4DV1T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 38
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv1T00
2UXDT 2E5LT 4JYAT 4DV3T 1XNQT 4DR3T 4NXMT 4NXNT 4DV6T 4DUYT 1N36T 4X64T 2UUBT 4X65T 4LF5T 4JI4T 4JI1T 4K0KT 4B3RT 2UUAT 1XNRT 4JV5T 3T1HT 4JI8T 4KHPT 1HNWT 5LMNT 4JI2T 4X62T 4DR5T 4DR4T 4B3ST 4OX9T 4DV7T 1IBKT 4LF7T 2UXBT 4DR1T 4DR6T 4GKKT 4YHHT 1XMQT 4LFBT 1HR0T 1XMOT 1J5ET 1IBMT 4DR7T 1IBLT 5LMUT 4JI6T 4LFCT 2UXCT 3T1YT 4LF9T 4JI5T 1N34T 4DV0T 4GKJT 4DR2T 4AQYT 4LF6T 4JI3T 4B3MT 4DV2T 4JI0T 4DUZT 4YY3T 1HNXT 2VQFT 2UUCT 4DV4T 4B3TT 4DV5T 1N33T 4DV1T 4X66T 2UU9T 5BR8T 1I94T 5IWAT 1N32T 4LF4T 4JI7T 1FJGT 4LF8T 1HNZT 3OTOT 2F4VT 4LFAT 2HHHT 2ZM6T 2VQET
chains in the Genus database with same CATH superfamily
4IE7A 2XQ7A 4QH1A 4X64T 2DCFA 5EK4A 4HWFA 2LKGA 2ACZA 3T1HT 2IHR1 3MA9A 3I9WA 2W00A 5FL0A 2XQYA 2XSAA 3AE9A 4XAXB 1D1AA 4YJ3E 1FMWA 2VWAA 4PJMA 2MYSA 1XMQT 2HPJA 3P4SA 3F31A 1UX4A 5FNVE 5C8YE 5JR9B 3CMLA 2CLYC 3UUNA 4FJOA 4DV0T 2K48A 3Q9DA 1U5PA 4QXCB 2WSSV 5LBQB 3B13A 3FBZA 2A9UA 5LGTB 5ABEA 1N32T 3MACA 4G2AA 2YU1A 3VU7H 1CHUA 2KLQA 4H9SE 4UVCB 4IDQA 2W66A 3ZYMA 4DV3T 3N5LA 1KNRA 4DR3T 2DNXA 1NEKA 3LG7A 2NTXA 3AAIA 5LHGB 4HFIA 3F2EA 3RIAA 1HF8A 2H3RA 3WAJA 4X65T 3C4ZA 3JC6D 4KP3C 4EIWA 3EABA 1J5WA 3IEEA 3HR0A 4HWIB 4U3CA 2YKSA 4JLEA 3GWHA 4N78D 4JI2T 2H89A 5JRCB 2CWOA 3RIUC 4UEMA 1W0BA 1D1CA 2W63A 4GOUA 4QX7B 4YTPA 4JI6T 3ZN1B 3AXJA 3H3AA 3VKHA 4GKJT 2YEVC 4DNDA 5LHIB 3FZFB 3V5UA 2P9BA 4I43B 2LRKA 1HNXT 3ONJA 2JQ9A 4TNWA 3B5MA 1ZEEA 3AE8A 5HEHA 1QSDA 3RX6A 3ZKRA 4HFEA 1I94T 2XM1A 2MOZA 5IWAT 2CXDA 1Y01A 5L4HA 1KNZA 2B1EA 1S35A 2QA7A 3BQKA 5HXRA 1MNDA 2DI4A 2LKHA 4A98A 3PE0A 3UUMA 4NXMT 1Y64B 4DUYT 4PNIA 2X9XA 2MTQA 3BQLA 2UUBT 1W9RA 2OA5A 3X1DA 2XUEA 3CX7B 2BKNA 3WI3A 4KUMB 1IJ6A 1WCRA 2WMNA 2XQ3A 4YJ2E 1U4QA 1KFYA 4H9NC 4AKLA 4YSYA 3CVRA 3E0ZA 3EI0A 2YDRA 2C5JA 5AQKB 4YTMA 4HGAA 5HCMA 4E7SA 4IL4A 4ANJA 5FXXA 4NPPA 2EHOD 5AQVB 4H63H 1W09A 3C51A 2OLTA 3P4QA 2W61A 3CX6B 4IIJE 2A72A 4YT0A 2FJDA 3GN5A 4HTEA 2YU2A 4TNVA 3RF1A 3ZT7A 1XWMA 4WBOA 3RYHE 4DMVA 3MXZA 2E9XB 4I50E 2XY8B 3UU5A 4UF0A 1QUUA 4CXXA 2CHNA 4LMJA 2E5LT 3A8YC 3VR8A 1OEDA 4TWDA 3P50A 2KWIB 2WP9A 1MIYA 4U7IA 4P0AA 4YTNA 2PTFA 3FXEB 4EAHA 5FXZA 1Z0PA 3ZSTA 5AQHB 2X0HA 4Z91A 5JDNA 2K24A 3Q5XA 1KEYA 3NBXX 4PJLA 3O1JA 1AJ3A 5AQTB 2JMKA 3I1AA 2MPKA 4DBQA 4CN1A 5AQMB 1WYCA 1L0VA 2CWYA 5AQNB 3N9NA 4AQYT 4KX6A 4V1Av 5JTGA 4IL9A 3UUXB 3K1SA 2BVLA 1YW0A 2UUCT 5KDMC 4DV5T 4TV8E 3OJAA 2V7LA 3GMIA 5LXTE 4YLHA 3AA7B 3LK42 1MIWA 3OVUA 4CXWA 2LT3A 3E08A 4OYJA 2RPAA 3RYIE 3TLSA 5C3JA 2HHHT 5F3JA 4NUUA 1T72A 2VQET 2I59A 4UR9A 3K3OA 2UXDT 2OV9A 2KSRA 4AQGA 3CK6A 3HKCE 1XNQT 3LDQB 3ESLA 1SA0E 4IGUA 2LM9A 3FBLA 3FZHB 5ABFA 2XQ9A 3EDVA 2N2NA 3Q5EA 4X5TA 4IDNA 1YKEB 4EZHA 1BR0A 3LK2B 4ASKA 3EVYA 4U7YA 2H7VC 1WRDA 4AKGA 4OFZA 5HXSA 4IE6A 5LGUB 1HR0T 4TX5A 4ZI7E 4UELA 4UIGA 4DR7T 3KVBA 2RA1A 2XZEA 3NWIA 4LF9T 1T8BA 5FY7A 1WLXA 2ODVA 4DR2T 2YOEA 5LNKA 4JI0T 4DUZT 3I0QA 3Q5DA 2VKJA 4ZOLE 4MALA 4O2AE 4L5GA 3QK6A 5CGMA 3NZQA 2Y48B 4C90A 5FY0A 2XQ5A 2V7IA 1MMGA 2BG9A 3HL6A 4ZXLA 5JR9C 3DTOA 1HTJF 4PK4A 2VVNA 5AQLB 1SE7A 4CI3B 2FJBA 5FYMA 2NW8A 1MMAA 4IREA 3ZYKA 2W4XA 1D0ZA 1VCTA 5LHHB 3CIRA 3U78A 3M65A 1WFDA 2GK9A 2UUAT 1HX1B 5AQOB 4MHCA 3AAAB 5JDMA 3ZN0B 2CEAA 2IMLA 3FB2A 3AE5A 2LSKA 2YK0A 3KBUA 4X20E 1MMDA 4DIDB 3PUWF 5L47A 2LHNA 4HWCA 4QH5A 3ZT6A 5LG3A 3TLTA 1X9BA 3TLWA 4QKNA 1KF6A 3AEFA 1OXZA 4FI5A 4L0RA 5KXJA 3SRZA 3SFDA 4U74A 1US7B 1ZP0A 2IC9A 2D2SA 4YSXA 3AE4A 3KBTA 4ILBA 5E0OA 3O4XE 5JH7E 2CHOA 2LOPA 2WDVA 1FJGT 4LF8T 4BJNA 1NWMX 1G8XA 3CPZA 5HXHA 2CXLA 4EGWA 4O4JE 4BJMA 1OEDE 3ZPOA 1UCUA 2X9HA 4UV8B 3AECA 4U2ZA 3P4WA 2CRBA 5CJ5A 1WYBA 4TWHA 3AA0B 1N36T 4PFOA 2D0UA 3ZMVB 3FZLB 5JVDE 2VVSA 4EB6E 2BDEA 4JV5T 2X66A 4P1NA 4ILCA 3UULA 5LMNT 4MLKA 3RPUA 4TV9E 4ERRA 4CXYA 4QWNB 2X68A 2YDSA 5HAXA 4LF7T 1BR4A 2LM2A 3P7IA 3H37A 3I9YA 2BZBA 1IBMT 2QGSA 2BKOA 2EHOA 5FY1A 5FXWA 2M6BA 5AFUL 2XPKA 4JI5T 4TUYE 3G06A 1NAFA 4GIWA 3ZJ1A 4EOZB 4Z90A 2QRXA 2E2AA 2KINB 2IUBA 4QXHB 4HWDA 5L3CB 4IE5A 4B3MT 3GN5B 3K3QC 3IA3A 3ZMUB 5HEUA 2R6GF 5J2UE 4EEBA 3NVOA 4EXTA 4F6RC 2ES0A 4UF0B 5HWYA 4KBMB 2Y6XA 4O8SA 1W0AA 5LGNB 3OTOT 4ZI2C 3T8OA 3FZMB 2V7MA 1OEDB 2C5KT 3ZSSA 3UFEA 2H7OA 4WYVA 5FKYA 3S4UA 4AQFA 2CE7A 1JNZA 4JI4T 4CN4A 2AXDS 4IDZA 3ZC1A 3P8CD 4HFBA 2JQHA 4ISTA 1M62A 2E9XC 4X1YE 2LRLA 2MBGA 3VHLA 5DQVA 2LOSA 3PU8A 3N9QA 5LBMA 3TLUA 5ABHA 1DU2A 4I4TE 1SHZC 1ZOYA 2Q9QA 2UXXB 1YXRA 2VURA 2V7JA 1EZ3A 4IHJE 5AQPB 2PBIA 3AE7A 3D0TA 2XSBA 1YQ3A 4B3TT 2M67A 2XJ7A 2FBWA 5L3EB 1XDOA 3F57A 1NENA 2LLYA 3I0OA 4LMLA 4PJJA 4IE4A 4NIQA 4QHOA 3ZMZB 2V7KA 1FIOA 5HCJA 3PURA 5ABFB 2BVMA 4NXNT 2ZM8A 1FEWA 4BAYB 4CQIA 3PUSA 2ODUA 1E1HB 4TN7B 1MIVA 4K0KT 2CPTA 1MNEA 3AEBA 1MMNA 2QYWA 4ISSA 5EK2A 3LBXA 3RRCA 4HEAA 1KNPA 4B3ST 4HFVA 4PAGA 3AE1A 3DP7A 4DR6T 2M6IA 4AISA 1BR2A 2WY2A 2PFVA 3SS1A 1HS7A 4YSZA 3UQ7A 1N34T 2IC6A 5CA1E 3ETUA 3W15B 3Q5WA 5AQGB 4CI1B 5ABGA 4WBNE 3PUXF 4DV4T 2NWBA 4HFDA 2BG9B 3LJCA 2NP9A 1LVKA 2UU9T 3OPCA 3UQ4A 4LF4T 2Q9QD 1QLBA 4PK5A 2QVAA 2CMRA 3K8PC 2VL0A 3RIUA 3IHRA 1J1JA 3Q2MA 3UT5E 4XZCA 2YDQA 2LSJA 3GA8A 3RKGA 5L3GB 4ADZA 2X67A 5LA6E 2XAJB 3N9PA 2IAKA 5J2TE 4Z8XA 4WW0A 4K0UA 3BQIA 5DQWA 3A5XA 2WDQA 2WZIA 5A1LA 3UU8A 1KK7A 4M1PA 1VCSA 3ZMTB 5F8PA 5JQGE 4H9OC 3HKBE 3N9LA 2I0MA 1IBKT 5AQUB 5J0ZA 1XMOT 3PUZF 3KV6A 5HEJA 1IBLT 1YD8G 1UK5A 4O2BE 3T1YT 3EHZA 4QXBB 3L8RA 4WNKA 2E5VA 4UVBB 1LVFA 2LSIA 1HG2A 4ILAA 2YINA 4JI3T 4JEHB 4DV2T 2V6YA 4H9PC 1HX8A 4PFPA 3L39A 2E9XA 4YXDA 3ABVA 5L3FB 4IE0A 5ETWA 3IBPA 2KZ7B 3OBVE 3QNUA 1UX5A 1FMVA 3C4WA 2ZM6T 3QC9A 3PUAA 3UU4A 3K3NA 5AQIB 4H9QC 2A3DA 4U31A 1V9DA 5M4YA 4GYRA 4MBQA 4X1IE 4AIUA 4ILUA 4HWHA 2X9YA 4B6XA 4JI1T 5FXVA 2D9DA 4EZ4A 3PU3A 3CX8B 3HA4A 4I55E 5FVLA 3HKDE 3SWHA 5JDLA 4JUYA 3R84B 4E7ZA 3QUJA 4NUVA 3ONXA 1LKXA 2Z6EA 2EHOB 4YHHT 2IIUA 4LFBT 3ZYLA 3PUQA 4AKIA 2VK9A 2L8KA 3N2OA 5J1GA 2DHRA 5HEOA 2PJQA 2JRKA 4AKRB 4MFRA 4O4IE 2WB5A 4O4LE 2CA5A 5FP3A 3KV4A 2WQYA 3AA6B 3AXJB 4ZI2D 3B57A 3NRXA 2IW5B 2UXNB 3AEDA 2XAFB 5KMGP 4AKHA 3ZEFB 1WR6A 5L3BB 3LSVA 2ZLYA 5AQFB 3LFMA 3AE6A 2JQKA 4P09A 1IJ5A 2NW7A 2XQ4A 1GQEA 4HFCA 1T7SA 3AA1B 3JAEA 3R6NA 3NRYA 1XZYA 2V5DA 4DV6T 2E9XD 4GK0E 1CUNA 2XAHB 3ANWA 3RI5A 5KX5E 5HEGA 5AQRB 3MK7C 3MKDA 5L4EA 2DWGA 2XQ8A 2K5BB 4HFHA 5DABA 4UXNB 5FMNA 4GK5E 2DWKA 3RGLA 4KHPT 1HNWT 1VOMA 4ZZCA 1G73A 2WS3A 2D0TA 4X62T 3AEEA 4IDPA 4UV9B 3EAMA 2ZM2A 5CA0E 2L3LA 2LEHA 2Q9QB 3O1HA 1OEDC 5C2TA 5HWXA 4ZS2A 2W62A 2BBJA 1OWAA 2K3WA 5AQJB 4A56A 4HKAA 2IDOB 4U2YA 4LF6T 3L09A 4H63V 2KT9A 1SUMB 4YY3T 2JPFA 4A5XA 2N9DA 2Y8DA 2NTYA 3C50A 3ETVA 5LCYA 4ZS3A 2C0SA 4DMWA 4BA9A 3MJXA 3UTKA 2WAUA 4YFSA 4U72A 5LJNA 1LRZA 3OYXA 3MZKB 3PJAA 3KV9A 2KWHA 3RYFE 4LFAT 2XQ6A 3J7Yq 4G63A 5HXCA 3HKEE 4A97A 2WWVA 4KMCA 1UGOA 3PUGA 2V8SV 2XQAA 2WCAA 5AQSB 3PTRB 1E2AA 1M7KA 2JIWA 3ZCJA 4QX8B 4I0UA 2CLYB 5H6QB 2BS2A 2VKDA 5FL1A 5CB4E 4ZI3C 3PUYF 2VL8A 3KINB 2JMHA 1WR0A 2X0LB 1XNRT 3RYCE 3LBXB 4PK6A 4TWFA 4JBWF 5JDHA 2E8IA 4DR5T 4DR4T 1T98A 2W2UA 4OX9T 3N2GE 3FZKB 1ZV4X 4DR1T 3OKQA 3UUBA 1J5ET 1HCIA 3ZC0A 1YQ4A 3RC3A 1S94A 5LOVE 5JR9A 3RLFF 2XHEB 3RHWA 3A7MA 3WAKA 3QOFA 4OK0A 3UU3A 5H6RB 3ZT5A 5EK3A 2LE8A 4PJNA 4HE8A 1N33T 2BBHA 3SOLA 3BK9A 3C98B 5JREA 1X79A 3ONLC 2CBIA 2K9AA 1HNZT 2F4VT 4Q25A 2BG9E 3N2KE 3UU6A 4OHFA 5LYJE 2CBJA 2CXFA 3CQCB 3O1IA 2VASA 3UFGA 3VKGA 2BG9C 3JADA 2J4GA 3M3ZB 3O9XA 1JNRA 5L3DB 2D5UA 2MAWA 2FUPA 3E22E 4J2CA 3PUVF 2SPCA 3RC8A 1YKHB 4DV7T 3JC6C 4O4HE 1BR1A 2XM2A 3RQWA 5AQQB 2J47A 4P0BA 5JRCA 1HG5A 4ZZBA 5L2LA 2WWUA 5LB7B 5EZYE 4IT4A 3AEAA 2YN6A 3AEGA 3VRAA 3ZMSB 2KNDA 2V6YB 2WDRA 2VQFT 3JAFA 4WZXA 4KHZF 3EUHA 2BS3A 3LK3B 2NR4A 3NKZA 4X66T 1UURA 1VRBA 3PV0F 4CI2B 2G0UA 2JQQA 4HN9A 5JDQA 4XBFB 3RQUA 2J62A 2LHRA 1XDPA 3N9MA 4AXPA 4YHJA 3AE3A 4GYSA 3H3MA 2LJLA 5HYAA 4JYAT 1O3XA 3TLVA 3KVAA 3QB5K 3RIFA 3U3IA 2N1GA 5LP6E 4CZZB 1ZKEA 3CQXC 4LMKA 2HN1A 1H7CA 5JDFA 5GONE 4B3RT 4COFA 3CWZB 2W0GA 3AB3B 2VKHA 4IDOA 1B7TA 3OYZA 1I6ZA 3PDYA 1IAPA 1R8IA 3KV5A 4UVAB 2PG8A 3ZLIA 4KI0F 1Z8UA 5BMVE 2FJEA 5LMUT 3VR9A 5IHYA 4QH4A 5IUXA 2L9QA 4L9IA 2J1DG 2NW9A 2DLRA 3CKDA 3RH3A 3ZCIA 2V1DB 2KXPB 2KMFA 3NZPA 2LSYA 2W67A 2A2FX 4AI6A 3KFWX 4DV1T 3EDUA 2EHOC 5FVKA 4X1KE 2XAQB 2H88A 3V5SA 3KDSE 2ZMAA 3FHNA 4OYKA 3AVRA 2HH7A 2LSGA 2V5CA 3VRBA 2X9WA 1IZNB 5HXEA 2JJ9A 1D0XA 4PW8A 2HN2A 5F5WA 3IF8B 1E7PA 2RP4A 3ANWB 3AVSA 4EV6A 2XASB 3RRWA 1D1BA 2BKPA 4DBRA 3PJAJ 4C91A 2CCQA 3C64A 4LF5T 5IYZE 3QB5A 3SFEA 3CQGB 2X51A 3J9X1 2WM9A 4EEDA 3N9OA 3P4RA 1HFAA 4JI8T 1UUSA 4ZHQE 5TAOA 3ZJ2A 2ZM0A 2WU5A 3TKLB 2X0YA 2WZHA 4EYUA 5DJQC 5CFBA 2WU2A 2UXBT 4JEUB 4F8HA 4LFCT 2B76A 2UXCT 4CN6A 2V26A 2XTLA 3RKOA 4AQFC 3P4PA 2XAGB 5LJMA 2DL1A 2AE9A 4H9RC 2HPLA 4DO0A 2VKOA 3JCFA 5JDGA 2NOXA 2V6XA 4DVDA 5LG4A 2BS4A 3AAEB 1ZHCA 2C5IT 2WBLA 3DJBA 3FXDB 2VB6A 2CM0A 2FJAA 3HI2A 3AE2A 3C4XA 5BR8T 2Q9QC 4TZ4C 2ACXA 5ADXL 2I6HA 1D0YA 4JI7T 3L3PA 4ZEYA 4U33A 4ZI3D 4EYYR 4GKKT 2WMOA
chains in the Genus database with same CATH topology
2UXDT 2E5LT 4JYAT 4DV3T 1XNQT 4DR3T 4NXMT 4NXNT 4DV6T 4DUYT 1N36T 4X64T 2UUBT 4X65T 4LF5T 4JI4T 4JI1T 4K0KT 4B3RT 2UUAT 1XNRT 4JV5T 3T1HT 4JI8T 4KHPT 1HNWT 5LMNT 4JI2T 4X62T 4DR5T 4DR4T 4B3ST 4OX9T 4DV7T 1IBKT 4LF7T 2UXBT 4DR1T 4DR6T 4GKKT 4YHHT 1XMQT 4LFBT 1HR0T 1XMOT 1J5ET 1IBMT 4DR7T 1IBLT 5LMUT 4JI6T 4LFCT 2UXCT 3T1YT 4LF9T 4JI5T 1N34T 4DV0T 4GKJT 4DR2T 4AQYT 4LF6T 4JI3T 4B3MT 4DV2T 4JI0T 4DUZT 4YY3T 1HNXT 2VQFT 2UUCT 4DV4T 4B3TT 4DV5T 1N33T 4DV1T 4X66T 2UU9T 5BR8T 1I94T 5IWAT 1N32T 4LF4T 4JI7T 1FJGT 4LF8T 1HNZT 3OTOT 2F4VT 4LFAT 2HHHT 2ZM6T 2VQET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD T;  2E5L T;  4JYA T;  4DV3 T;  1XNQ T;  4DR3 T;  4NXM T;  4NXN T;  4DV6 T;  4DUY T;  1N36 T;  4X64 T;  2UUB T;  4X65 T;  4LF5 T;  4JI4 T;  4JI1 T;  4K0K T;  4B3R T;  2UUA T;  1XNR T;  4JV5 T;  3T1H T;  4JI8 T;  4KHP T;  1HNW T;  5LMN T;  4JI2 T;  4X62 T;  4DR5 T;  4DR4 T;  4B3S T;  4OX9 T;  4DV7 T;  1IBK T;  4LF7 T;  2UXB T;  4DR1 T;  4DR6 T;  4GKK T;  4YHH T;  1XMQ T;  4LFB T;  1HR0 T;  1XMO T;  1J5E T;  1IBM T;  4DR7 T;  1IBL T;  5LMU T;  4JI6 T;  4LFC T;  2UXC T;  3T1Y T;  4LF9 T;  4JI5 T;  1N34 T;  4DV0 T;  4GKJ T;  4DR2 T;  4AQY T;  4LF6 T;  4JI3 T;  4B3M T;  4DV2 T;  4JI0 T;  4DUZ T;  4YY3 T;  1HNX T;  2VQF T;  2UUC T;  4DV4 T;  4B3T T;  4DV5 T;  1N33 T;  4DV1 T;  4X66 T;  2UU9 T;  5BR8 T;  1I94 T;  5IWA T;  1N32 T;  4LF4 T;  4JI7 T;  1FJG T;  4LF8 T;  1HNZ T;  3OTO T;  2F4V T;  4LFA T;  2HHH T;  2ZM6 T;  2VQE T; 
#chains in the Genus database with same CATH topology
 4IE7 A;  2XQ7 A;  4QH1 A;  4X64 T;  2DCF A;  5EK4 A;  4HWF A;  2LKG A;  2ACZ A;  3T1H T;  2IHR 1;  3MA9 A;  3I9W A;  2W00 A;  5FL0 A;  2XQY A;  2XSA A;  3AE9 A;  4XAX B;  1D1A A;  4YJ3 E;  1FMW A;  2VWA A;  4PJM A;  2MYS A;  1XMQ T;  2HPJ A;  3P4S A;  3F31 A;  1UX4 A;  5FNV E;  5C8Y E;  5JR9 B;  3CML A;  2CLY C;  3UUN A;  4FJO A;  4DV0 T;  2K48 A;  3Q9D A;  1U5P A;  4QXC B;  2WSS V;  5LBQ B;  3B13 A;  3FBZ A;  2A9U A;  5LGT B;  5ABE A;  1N32 T;  3MAC A;  4G2A A;  2YU1 A;  3VU7 H;  1CHU A;  2KLQ A;  4H9S E;  4UVC B;  4IDQ A;  2W66 A;  3ZYM A;  4DV3 T;  3N5L A;  1KNR A;  4DR3 T;  2DNX A;  1NEK A;  3LG7 A;  2NTX A;  3AAI A;  5LHG B;  4HFI A;  3F2E A;  3RIA A;  1HF8 A;  2H3R A;  3WAJ A;  4X65 T;  3C4Z A;  3JC6 D;  4KP3 C;  4EIW A;  3EAB A;  1J5W A;  3IEE A;  3HR0 A;  4HWI B;  4U3C A;  2YKS A;  4JLE A;  3GWH A;  4N78 D;  4JI2 T;  2H89 A;  5JRC B;  2CWO A;  3RIU C;  4UEM A;  1W0B A;  1D1C A;  2W63 A;  4GOU A;  4QX7 B;  4YTP A;  4JI6 T;  3ZN1 B;  3AXJ A;  3H3A A;  3VKH A;  4GKJ T;  2YEV C;  4DND A;  5LHI B;  3FZF B;  3V5U A;  2P9B A;  4I43 B;  2LRK A;  1HNX T;  3ONJ A;  2JQ9 A;  4TNW A;  3B5M A;  1ZEE A;  3AE8 A;  5HEH A;  1QSD A;  3RX6 A;  3ZKR A;  4HFE A;  1I94 T;  2XM1 A;  2MOZ A;  5IWA T;  2CXD A;  1Y01 A;  5L4H A;  1KNZ A;  2B1E A;  1S35 A;  2QA7 A;  3BQK A;  5HXR A;  1MND A;  2DI4 A;  2LKH A;  4A98 A;  3PE0 A;  3UUM A;  4NXM T;  1Y64 B;  4DUY T;  4PNI A;  2X9X A;  2MTQ A;  3BQL A;  2UUB T;  1W9R A;  2OA5 A;  3X1D A;  2XUE A;  3CX7 B;  2BKN A;  3WI3 A;  4KUM B;  1IJ6 A;  1WCR A;  2WMN A;  2XQ3 A;  4YJ2 E;  1U4Q A;  1KFY A;  4H9N C;  4AKL A;  4YSY A;  3CVR A;  3E0Z A;  3EI0 A;  2YDR A;  2C5J A;  5AQK B;  4YTM A;  4HGA A;  5HCM A;  4E7S A;  4IL4 A;  4ANJ A;  5FXX A;  4NPP A;  2EHO D;  5AQV B;  4H63 H;  1W09 A;  3C51 A;  2OLT A;  3P4Q A;  2W61 A;  3CX6 B;  4IIJ E;  2A72 A;  4YT0 A;  2FJD A;  3GN5 A;  4HTE A;  2YU2 A;  4TNV A;  3RF1 A;  3ZT7 A;  1XWM A;  4WBO A;  3RYH E;  4DMV A;  3MXZ A;  2E9X B;  4I50 E;  2XY8 B;  3UU5 A;  4UF0 A;  1QUU A;  4CXX A;  2CHN A;  4LMJ A;  2E5L T;  3A8Y C;  3VR8 A;  1OED A;  4TWD A;  3P50 A;  2KWI B;  2WP9 A;  1MIY A;  4U7I A;  4P0A A;  4YTN A;  2PTF A;  3FXE B;  4EAH A;  5FXZ A;  1Z0P A;  3ZST A;  5AQH B;  2X0H A;  4Z91 A;  5JDN A;  2K24 A;  3Q5X A;  1KEY A;  3NBX X;  4PJL A;  3O1J A;  1AJ3 A;  5AQT B;  2JMK A;  3I1A A;  2MPK A;  4DBQ A;  4CN1 A;  5AQM B;  1WYC A;  1L0V A;  2CWY A;  5AQN B;  3N9N A;  4AQY T;  4KX6 A;  4V1A v;  5JTG A;  4IL9 A;  3UUX B;  3K1S A;  2BVL A;  1YW0 A;  2UUC T;  5KDM C;  4DV5 T;  4TV8 E;  3OJA A;  2V7L A;  3GMI A;  5LXT E;  4YLH A;  3AA7 B;  3LK4 2;  1MIW A;  3OVU A;  4CXW A;  2LT3 A;  3E08 A;  4OYJ A;  2RPA A;  3RYI E;  3TLS A;  5C3J A;  2HHH T;  5F3J A;  4NUU A;  1T72 A;  2VQE T;  2I59 A;  4UR9 A;  3K3O A;  2UXD T;  2OV9 A;  2KSR A;  4AQG A;  3CK6 A;  3HKC E;  1XNQ T;  3LDQ B;  3ESL A;  1SA0 E;  4IGU A;  2LM9 A;  3FBL A;  3FZH B;  5ABF A;  2XQ9 A;  3EDV A;  2N2N A;  3Q5E A;  4X5T A;  4IDN A;  1YKE B;  4EZH A;  1BR0 A;  3LK2 B;  4ASK A;  3EVY A;  4U7Y A;  2H7V C;  1WRD A;  4AKG A;  4OFZ A;  5HXS A;  4IE6 A;  5LGU B;  1HR0 T;  4TX5 A;  4ZI7 E;  4UEL A;  4UIG A;  4DR7 T;  3KVB A;  2RA1 A;  2XZE A;  3NWI A;  4LF9 T;  1T8B A;  5FY7 A;  1WLX A;  2ODV A;  4DR2 T;  2YOE A;  5LNK A;  4JI0 T;  4DUZ T;  3I0Q A;  3Q5D A;  2VKJ A;  4ZOL E;  4MAL A;  4O2A E;  4L5G A;  3QK6 A;  5CGM A;  3NZQ A;  2Y48 B;  4C90 A;  5FY0 A;  2XQ5 A;  2V7I A;  1MMG A;  2BG9 A;  3HL6 A;  4ZXL A;  5JR9 C;  3DTO A;  1HTJ F;  4PK4 A;  2VVN A;  5AQL B;  1SE7 A;  4CI3 B;  2FJB A;  5FYM A;  2NW8 A;  1MMA A;  4IRE A;  3ZYK A;  2W4X A;  1D0Z A;  1VCT A;  5LHH B;  3CIR A;  3U78 A;  3M65 A;  1WFD A;  2GK9 A;  2UUA T;  1HX1 B;  5AQO B;  4MHC A;  3AAA B;  5JDM A;  3ZN0 B;  2CEA A;  2IML A;  3FB2 A;  3AE5 A;  2LSK A;  2YK0 A;  3KBU A;  4X20 E;  1MMD A;  4DID B;  3PUW F;  5L47 A;  2LHN A;  4HWC A;  4QH5 A;  3ZT6 A;  5LG3 A;  3TLT A;  1X9B A;  3TLW A;  4QKN A;  1KF6 A;  3AEF A;  1OXZ A;  4FI5 A;  4L0R A;  5KXJ A;  3SRZ A;  3SFD A;  4U74 A;  1US7 B;  1ZP0 A;  2IC9 A;  2D2S A;  4YSX A;  3AE4 A;  3KBT A;  4ILB A;  5E0O A;  3O4X E;  5JH7 E;  2CHO A;  2LOP A;  2WDV A;  1FJG T;  4LF8 T;  4BJN A;  1NWM X;  1G8X A;  3CPZ A;  5HXH A;  2CXL A;  4EGW A;  4O4J E;  4BJM A;  1OED E;  3ZPO A;  1UCU A;  2X9H A;  4UV8 B;  3AEC A;  4U2Z A;  3P4W A;  2CRB A;  5CJ5 A;  1WYB A;  4TWH A;  3AA0 B;  1N36 T;  4PFO A;  2D0U A;  3ZMV B;  3FZL B;  5JVD E;  2VVS A;  4EB6 E;  2BDE A;  4JV5 T;  2X66 A;  4P1N A;  4ILC A;  3UUL A;  5LMN T;  4MLK A;  3RPU A;  4TV9 E;  4ERR A;  4CXY A;  4QWN B;  2X68 A;  2YDS A;  5HAX A;  4LF7 T;  1BR4 A;  2LM2 A;  3P7I A;  3H37 A;  3I9Y A;  2BZB A;  1IBM T;  2QGS A;  2BKO A;  2EHO A;  5FY1 A;  5FXW A;  2M6B A;  5AFU L;  2XPK A;  4JI5 T;  4TUY E;  3G06 A;  1NAF A;  4GIW A;  3ZJ1 A;  4EOZ B;  4Z90 A;  2QRX A;  2E2A A;  2KIN B;  2IUB A;  4QXH B;  4HWD A;  5L3C B;  4IE5 A;  4B3M T;  3GN5 B;  3K3Q C;  3IA3 A;  3ZMU B;  5HEU A;  2R6G F;  5J2U E;  4EEB A;  3NVO A;  4EXT A;  4F6R C;  2ES0 A;  4UF0 B;  5HWY A;  4KBM B;  2Y6X A;  4O8S A;  1W0A A;  5LGN B;  3OTO T;  4ZI2 C;  3T8O A;  3FZM B;  2V7M A;  1OED B;  2C5K T;  3ZSS A;  3UFE A;  2H7O A;  4WYV A;  5FKY A;  3S4U A;  4AQF A;  2CE7 A;  1JNZ A;  4JI4 T;  4CN4 A;  2AXD S;  4IDZ A;  3ZC1 A;  3P8C D;  4HFB A;  2JQH A;  4IST A;  1M62 A;  2E9X C;  4X1Y E;  2LRL A;  2MBG A;  3VHL A;  5DQV A;  2LOS A;  3PU8 A;  3N9Q A;  5LBM A;  3TLU A;  5ABH A;  1DU2 A;  4I4T E;  1SHZ C;  1ZOY A;  2Q9Q A;  2UXX B;  1YXR A;  2VUR A;  2V7J A;  1EZ3 A;  4IHJ E;  5AQP B;  2PBI A;  3AE7 A;  3D0T A;  2XSB A;  1YQ3 A;  4B3T T;  2M67 A;  2XJ7 A;  2FBW A;  5L3E B;  1XDO A;  3F57 A;  1NEN A;  2LLY A;  3I0O A;  4LML A;  4PJJ A;  4IE4 A;  4NIQ A;  4QHO A;  3ZMZ B;  2V7K A;  1FIO A;  5HCJ A;  3PUR A;  5ABF B;  2BVM A;  4NXN T;  2ZM8 A;  1FEW A;  4BAY B;  4CQI A;  3PUS A;  2ODU A;  1E1H B;  4TN7 B;  1MIV A;  4K0K T;  2CPT A;  1MNE A;  3AEB A;  1MMN A;  2QYW A;  4ISS A;  5EK2 A;  3LBX A;  3RRC A;  4HEA A;  1KNP A;  4B3S T;  4HFV A;  4PAG A;  3AE1 A;  3DP7 A;  4DR6 T;  2M6I A;  4AIS A;  1BR2 A;  2WY2 A;  2PFV A;  3SS1 A;  1HS7 A;  4YSZ A;  3UQ7 A;  1N34 T;  2IC6 A;  5CA1 E;  3ETU A;  3W15 B;  3Q5W A;  5AQG B;  4CI1 B;  5ABG A;  4WBN E;  3PUX F;  4DV4 T;  2NWB A;  4HFD A;  2BG9 B;  3LJC A;  2NP9 A;  1LVK A;  2UU9 T;  3OPC A;  3UQ4 A;  4LF4 T;  2Q9Q D;  1QLB A;  4PK5 A;  2QVA A;  2CMR A;  3K8P C;  2VL0 A;  3RIU A;  3IHR A;  1J1J A;  3Q2M A;  3UT5 E;  4XZC A;  2YDQ A;  2LSJ A;  3GA8 A;  3RKG A;  5L3G B;  4ADZ A;  2X67 A;  5LA6 E;  2XAJ B;  3N9P A;  2IAK A;  5J2T E;  4Z8X A;  4WW0 A;  4K0U A;  3BQI A;  5DQW A;  3A5X A;  2WDQ A;  2WZI A;  5A1L A;  3UU8 A;  1KK7 A;  4M1P A;  1VCS A;  3ZMT B;  5F8P A;  5JQG E;  4H9O C;  3HKB E;  3N9L A;  2I0M A;  1IBK T;  5AQU B;  5J0Z A;  1XMO T;  3PUZ F;  3KV6 A;  5HEJ A;  1IBL T;  1YD8 G;  1UK5 A;  4O2B E;  3T1Y T;  3EHZ A;  4QXB B;  3L8R A;  4WNK A;  2E5V A;  4UVB B;  1LVF A;  2LSI A;  1HG2 A;  4ILA A;  2YIN A;  4JI3 T;  4JEH B;  4DV2 T;  2V6Y A;  4H9P C;  1HX8 A;  4PFP A;  3L39 A;  2E9X A;  4YXD A;  3ABV A;  5L3F B;  4IE0 A;  5ETW A;  3IBP A;  2KZ7 B;  3OBV E;  3QNU A;  1UX5 A;  1FMV A;  3C4W A;  2ZM6 T;  3QC9 A;  3PUA A;  3UU4 A;  3K3N A;  5AQI B;  4H9Q C;  2A3D A;  4U31 A;  1V9D A;  5M4Y A;  4GYR A;  4MBQ A;  4X1I E;  4AIU A;  4ILU A;  4HWH A;  2X9Y A;  4B6X A;  4JI1 T;  5FXV A;  2D9D A;  4EZ4 A;  3PU3 A;  3CX8 B;  3HA4 A;  4I55 E;  5FVL A;  3HKD E;  3SWH A;  5JDL A;  4JUY A;  3R84 B;  4E7Z A;  3QUJ A;  4NUV A;  3ONX A;  1LKX A;  2Z6E A;  2EHO B;  4YHH T;  2IIU A;  4LFB T;  3ZYL A;  3PUQ A;  4AKI A;  2VK9 A;  2L8K A;  3N2O A;  5J1G A;  2DHR A;  5HEO A;  2PJQ A;  2JRK A;  4AKR B;  4MFR A;  4O4I E;  2WB5 A;  4O4L E;  2CA5 A;  5FP3 A;  3KV4 A;  2WQY A;  3AA6 B;  3AXJ B;  4ZI2 D;  3B57 A;  3NRX A;  2IW5 B;  2UXN B;  3AED A;  2XAF B;  5KMG P;  4AKH A;  3ZEF B;  1WR6 A;  5L3B B;  3LSV A;  2ZLY A;  5AQF B;  3LFM A;  3AE6 A;  2JQK A;  4P09 A;  1IJ5 A;  2NW7 A;  2XQ4 A;  1GQE A;  4HFC A;  1T7S A;  3AA1 B;  3JAE A;  3R6N A;  3NRY A;  1XZY A;  2V5D A;  4DV6 T;  2E9X D;  4GK0 E;  1CUN A;  2XAH B;  3ANW A;  3RI5 A;  5KX5 E;  5HEG A;  5AQR B;  3MK7 C;  3MKD A;  5L4E A;  2DWG A;  2XQ8 A;  2K5B B;  4HFH A;  5DAB A;  4UXN B;  5FMN A;  4GK5 E;  2DWK A;  3RGL A;  4KHP T;  1HNW T;  1VOM A;  4ZZC A;  1G73 A;  2WS3 A;  2D0T A;  4X62 T;  3AEE A;  4IDP A;  4UV9 B;  3EAM A;  2ZM2 A;  5CA0 E;  2L3L A;  2LEH A;  2Q9Q B;  3O1H A;  1OED C;  5C2T A;  5HWX A;  4ZS2 A;  2W62 A;  2BBJ A;  1OWA A;  2K3W A;  5AQJ B;  4A56 A;  4HKA A;  2IDO B;  4U2Y A;  4LF6 T;  3L09 A;  4H63 V;  2KT9 A;  1SUM B;  4YY3 T;  2JPF A;  4A5X A;  2N9D A;  2Y8D A;  2NTY A;  3C50 A;  3ETV A;  5LCY A;  4ZS3 A;  2C0S A;  4DMW A;  4BA9 A;  3MJX A;  3UTK A;  2WAU A;  4YFS A;  4U72 A;  5LJN A;  1LRZ A;  3OYX A;  3MZK B;  3PJA A;  3KV9 A;  2KWH A;  3RYF E;  4LFA T;  2XQ6 A;  3J7Y q;  4G63 A;  5HXC A;  3HKE E;  4A97 A;  2WWV A;  4KMC A;  1UGO A;  3PUG A;  2V8S V;  2XQA A;  2WCA A;  5AQS B;  3PTR B;  1E2A A;  1M7K A;  2JIW A;  3ZCJ A;  4QX8 B;  4I0U A;  2CLY B;  5H6Q B;  2BS2 A;  2VKD A;  5FL1 A;  5CB4 E;  4ZI3 C;  3PUY F;  2VL8 A;  3KIN B;  2JMH A;  1WR0 A;  2X0L B;  1XNR T;  3RYC E;  3LBX B;  4PK6 A;  4TWF A;  4JBW F;  5JDH A;  2E8I A;  4DR5 T;  4DR4 T;  1T98 A;  2W2U A;  4OX9 T;  3N2G E;  3FZK B;  1ZV4 X;  4DR1 T;  3OKQ A;  3UUB A;  1J5E T;  1HCI A;  3ZC0 A;  1YQ4 A;  3RC3 A;  1S94 A;  5LOV E;  5JR9 A;  3RLF F;  2XHE B;  3RHW A;  3A7M A;  3WAK A;  3QOF A;  4OK0 A;  3UU3 A;  5H6R B;  3ZT5 A;  5EK3 A;  2LE8 A;  4PJN A;  4HE8 A;  1N33 T;  2BBH A;  3SOL A;  3BK9 A;  3C98 B;  5JRE A;  1X79 A;  3ONL C;  2CBI A;  2K9A A;  1HNZ T;  2F4V T;  4Q25 A;  2BG9 E;  3N2K E;  3UU6 A;  4OHF A;  5LYJ E;  2CBJ A;  2CXF A;  3CQC B;  3O1I A;  2VAS A;  3UFG A;  3VKG A;  2BG9 C;  3JAD A;  2J4G A;  3M3Z B;  3O9X A;  1JNR A;  5L3D B;  2D5U A;  2MAW A;  2FUP A;  3E22 E;  4J2C A;  3PUV F;  2SPC A;  3RC8 A;  1YKH B;  4DV7 T;  3JC6 C;  4O4H E;  1BR1 A;  2XM2 A;  3RQW A;  5AQQ B;  2J47 A;  4P0B A;  5JRC A;  1HG5 A;  4ZZB A;  5L2L A;  2WWU A;  5LB7 B;  5EZY E;  4IT4 A;  3AEA A;  2YN6 A;  3AEG A;  3VRA A;  3ZMS B;  2KND A;  2V6Y B;  2WDR A;  2VQF T;  3JAF A;  4WZX A;  4KHZ F;  3EUH A;  2BS3 A;  3LK3 B;  2NR4 A;  3NKZ A;  4X66 T;  1UUR A;  1VRB A;  3PV0 F;  4CI2 B;  2G0U A;  2JQQ A;  4HN9 A;  5JDQ A;  4XBF B;  3RQU A;  2J62 A;  2LHR A;  1XDP A;  3N9M A;  4AXP A;  4YHJ A;  3AE3 A;  4GYS A;  3H3M A;  2LJL A;  5HYA A;  4JYA T;  1O3X A;  3TLV A;  3KVA A;  3QB5 K;  3RIF A;  3U3I A;  2N1G A;  5LP6 E;  4CZZ B;  1ZKE A;  3CQX C;  4LMK A;  2HN1 A;  1H7C A;  5JDF A;  5GON E;  4B3R T;  4COF A;  3CWZ B;  2W0G A;  3AB3 B;  2VKH A;  4IDO A;  1B7T A;  3OYZ A;  1I6Z A;  3PDY A;  1IAP A;  1R8I A;  3KV5 A;  4UVA B;  2PG8 A;  3ZLI A;  4KI0 F;  1Z8U A;  5BMV E;  2FJE A;  5LMU T;  3VR9 A;  5IHY A;  4QH4 A;  5IUX A;  2L9Q A;  4L9I A;  2J1D G;  2NW9 A;  2DLR A;  3CKD A;  3RH3 A;  3ZCI A;  2V1D B;  2KXP B;  2KMF A;  3NZP A;  2LSY A;  2W67 A;  2A2F X;  4AI6 A;  3KFW X;  4DV1 T;  3EDU A;  2EHO C;  5FVK A;  4X1K E;  2XAQ B;  2H88 A;  3V5S A;  3KDS E;  2ZMA A;  3FHN A;  4OYK A;  3AVR A;  2HH7 A;  2LSG A;  2V5C A;  3VRB A;  2X9W A;  1IZN B;  5HXE A;  2JJ9 A;  1D0X A;  4PW8 A;  2HN2 A;  5F5W A;  3IF8 B;  1E7P A;  2RP4 A;  3ANW B;  3AVS A;  4EV6 A;  2XAS B;  3RRW A;  1D1B A;  2BKP A;  4DBR A;  3PJA J;  4C91 A;  2CCQ A;  3C64 A;  4LF5 T;  5IYZ E;  3QB5 A;  3SFE A;  3CQG B;  2X51 A;  3J9X 1;  2WM9 A;  4EED A;  3N9O A;  3P4R A;  1HFA A;  4JI8 T;  1UUS A;  4ZHQ E;  5TAO A;  3ZJ2 A;  2ZM0 A;  2WU5 A;  3TKL B;  2X0Y A;  2WZH A;  4EYU A;  5DJQ C;  5CFB A;  2WU2 A;  2UXB T;  4JEU B;  4F8H A;  4LFC T;  2B76 A;  2UXC T;  4CN6 A;  2V26 A;  2XTL A;  3RKO A;  4AQF C;  3P4P A;  2XAG B;  5LJM A;  2DL1 A;  2AE9 A;  4H9R C;  2HPL A;  4DO0 A;  2VKO A;  3JCF A;  5JDG A;  2NOX A;  2V6X A;  4DVD A;  5LG4 A;  2BS4 A;  3AAE B;  1ZHC A;  2C5I T;  2WBL A;  3DJB A;  3FXD B;  2VB6 A;  2CM0 A;  2FJA A;  3HI2 A;  3AE2 A;  3C4X A;  5BR8 T;  2Q9Q C;  4TZ4 C;  2ACX A;  5ADX L;  2I6H A;  1D0Y A;  4JI7 T;  3L3P A;  4ZEY A;  4U33 A;  4ZI3 D;  4EYY R;  4GKK T;  2WMO A; 
#chains in the Genus database with same CATH homology
 2UXD T;  2E5L T;  4JYA T;  4DV3 T;  1XNQ T;  4DR3 T;  4NXM T;  4NXN T;  4DV6 T;  4DUY T;  1N36 T;  4X64 T;  2UUB T;  4X65 T;  4LF5 T;  4JI4 T;  4JI1 T;  4K0K T;  4B3R T;  2UUA T;  1XNR T;  4JV5 T;  3T1H T;  4JI8 T;  4KHP T;  1HNW T;  5LMN T;  4JI2 T;  4X62 T;  4DR5 T;  4DR4 T;  4B3S T;  4OX9 T;  4DV7 T;  1IBK T;  4LF7 T;  2UXB T;  4DR1 T;  4DR6 T;  4GKK T;  4YHH T;  1XMQ T;  4LFB T;  1HR0 T;  1XMO T;  1J5E T;  1IBM T;  4DR7 T;  1IBL T;  5LMU T;  4JI6 T;  4LFC T;  2UXC T;  3T1Y T;  4LF9 T;  4JI5 T;  1N34 T;  4DV0 T;  4GKJ T;  4DR2 T;  4AQY T;  4LF6 T;  4JI3 T;  4B3M T;  4DV2 T;  4JI0 T;  4DUZ T;  4YY3 T;  1HNX T;  2VQF T;  2UUC T;  4DV4 T;  4B3T T;  4DV5 T;  1N33 T;  4DV1 T;  4X66 T;  2UU9 T;  5BR8 T;  1I94 T;  5IWA T;  1N32 T;  4LF4 T;  4JI7 T;  1FJG T;  4LF8 T;  1HNZ T;  3OTO T;  2F4V T;  4LFA T;  2HHH T;  2ZM6 T;  2VQE T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...