4DV1T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 38
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv1T00
4DUYT 4JI3T 4GKJT 4JI4T 1IBKT 4DV3T 1IBLT 2VQFT 4LF9T 1I94T 4AQYT 2VQET 2UUBT 4JI6T 4LF7T 4DR7T 2HHHT 4LF8T 1HR0T 4KHPT 4DV0T 4DR2T 5IWAT 4X62T 4B3RT 4JYAT 4DUZT 4LFAT 2UXBT 4DR4T 4YY3T 1HNWT 2UXDT 1IBMT 4LF5T 2UUAT 1XMOT 4B3ST 5LMUT 4X65T 4DV1T 4OX9T 4B3MT 4JI2T 4DV6T 5BR8T 4JI7T 4DV2T 3T1YT 4DV4T 1N34T 4DR1T 2UXCT 3OTOT 1HNZT 4NXMT 4DR5T 1N33T 4LF4T 4DR6T 4LF6T 4YHHT 4JI1T 1FJGT 3T1HT 4JI0T 2F4VT 5LMNT 4X66T 4DR3T 4K0KT 4X64T 4DV5T 2E5LT 4NXNT 1XNRT 1J5ET 2ZM6T 4LFBT 1XNQT 2UUCT 4JI8T 4GKKT 4LFCT 4B3TT 1N36T 1XMQT 2UU9T 4JI5T 4JV5T 1N32T 1HNXT 4DV7T
chains in the Genus database with same CATH superfamily
1UURA 4TWHA 5LNKA 2W4XA 3DP7A 4DV3T 4EYYR 4YJ2E 3L8RA 2D2SA 5LOVE 3ZEFB 1WR6A 3UTKA 4N78D 2XQ3A 1VCSA 2VQET 3C98B 3RC8A 3UU6A 2E5VA 3NZQA 4QXHB 4IREA 4TV9E 3SWHA 5DABA 4A5XA 1EZ3A 1US7B 2JQHA 3RPUA 3N2OA 2QRXA 1NWMX 2X0HA 3WAKA 3ZSTA 2Y8DA 1QUUA 3OTOT 4ILUA 4MLKA 3CK6A 2RA1A 3PUXF 4O8SA 2XHEB 3KBUA 3NRYA 2K9AA 1W09A 4L0RA 3PV0F 5AQUB 3CWZB 3FXDB 5IUXA 2E9XC 2E9XD 1BR2A 2BS2A 2PJQA 1NAFA 2UUCT 4HTEA 3ZN0B 5FXZA 4QH4A 3W15B 4F6RC 2CA5A 2BKPA 3ESLA 2YDSA 2XUEA 4EIWA 3N9OA 2N1GA 3ZN1B 3CQGB 3Q2MA 3AA0B 5F3JA 3O1IA 4JI6T 3ETUA 4E7ZA 3PTRB 3N9QA 3IEEA 4LFAT 2KMFA 4AKGA 4YY3T 4EZHA 4DIDB 4YTNA 3DTOA 5HEOA 5L3CB 2MYSA 2WQYA 5C2TA 3UUXB 4B3MT 1XDPA 3OVUA 4XZCA 3RKOA 2CXLA 4CN6A 3AB3B 3D0TA 2K48A 4DV4T 1CUNA 5L47A 2LM9A 2MPKA 4AISA 4DR5T 2LSIA 3KFWX 3MXZA 4OYJA 3FZMB 3FXEB 4OYKA 1ZKEA 4H9QC 2X0LB 2WB5A 3PUVF 3ETVA 2E8IA 2DI4A 2W67A 3GMIA 3PUQA 2J62A 5JR9B 4P0BA 4H63V 1UX4A 4MFRA 4NPPA 4U33A 1N36T 3MACA 5IHYA 2HN1A 1XMQT 4A98A 5ABEA 5AQLB 3F57A 1HNXT 2XJ7A 4NIQA 2J1DG 3AE1A 1T8BA 4U3CA 3SFDA 1IBLT 2VQFT 3LK3B 4UVBB 2LRLA 1VRBA 5JDNA 3RYIE 5AQVB 4B3RT 4ZI7E 5LYJE 2UXDT 1VCTA 4X65T 4U2YA 5L3GB 4X1YE 5AQFB 2CHOA 4DV2T 2OLTA 3PUWF 2V7JA 2Q9QA 3OYZA 2IC6A 1W0AA 2LM2A 3EI0A 2IMLA 1OEDA 4HE8A 5FP3A 5F8PA 3K3OA 3RI5A 2KINB 3T1HT 2LE8A 4FI5A 5AQJB 2JMHA 5HEHA 5JDHA 4O4HE 5E0OA 2WCAA 3PUGA 3UU4A 4LFBT 1YKEB 3JAFA 5KMGP 2QYWA 5HEUA 5FMNA 1KNRA 1W0BA 2NTYA 4KP3C 3ZC0A 2VVNA 5EK4A 5HCMA 2WDQA 2XQ7A 2A3DA 1T98A 3RH3A 4KI0F 4BJNA 5JR9C 1JNZA 4X5TA 2UUBT 4DR7T 5FL1A 2W62A 5LHGB 4CI3B 4EB6E 2NP9A 3M65A 2PFVA 3V5SA 4YTPA 2IIUA 1XMOT 4TX5A 2WMNA 5FXXA 1AJ3A 1D1AA 5L3DB 3PDYA 3ZLIA 4EXTA 2BS3A 4WZXA 5TAOA 1D1BA 3ONLC 1T7SA 5DQVA 2D0TA 3CX7B 2HPLA 2JRKA 2J47A 2EHOA 4ZI2D 3PURA 3R84B 4YSXA 3IF8B 3SOLA 5AQRB 3OPCA 3ZPOA 2X67A 5JRCA 3MA9A 5AFUL 3GA8A 1Z8UA 4I55E 4LMLA 3AEDA 2YK0A 4IDZA 3C4XA 3DJBA 4KX6A 1YKHB 5LA6E 1FIOA 4UF0A 4F8HA 2WBLA 4UV9B 3CX8B 3VKGA 4AKIA 2VL0A 3HA4A 3UFGA 3UFEA 4JV5T 3A5XA 1N32T 3H3AA 1UX5A 3JC6C 2X66A 3ZC1A 2WWVA 2L8KA 3RIFA 2H3RA 5JDQA 2V8SV 4HFDA 3QOFA 4HWIB 3VKHA 2XTLA 1WRDA 1HR0T 4O4JE 5LXTE 2LKHA 3N9MA 3KV6A 2UUAT 3FBZA 3LBXA 2G0UA 1WYBA 4JEUB 3JCFA 1GQEA 2XAQB 2PTFA 2NW8A 3PUYF 4MBQA 3IA3A 3O4XE 1N34T 1O3XA 4H9SE 2E9XA 5AQIB 3I0OA 4MALA 5CA0E 4ILBA 5HCJA 3P50A 2YU1A 2M6BA 2BKNA 5LBQB 4KMCA 2R6GF 2A9UA 2DCFA 1MMAA 2VURA 3GN5B 4UXNB 4JUYA 2E5LT 3ZT6A 3FHNA 3RYHE 5J1GA 3P8CD 2ZLYA 4AQFC 1E1HB 3CMLA 2UU9T 2ZM0A 3AE6A 4BAYB 5AQGB 5JH7E 4QH1A 3BQIA 4AXPA 4GOUA 2J4GA 4WYVA 3ZT5A 3GWHA 4AQYT 5JDMA 1D0YA 4LF8T 3M3ZB 4PAGA 1YQ3A 4EZ4A 4X62T 3C51A 4GIWA 4QHOA 4PW8A 2L9QA 3JADA 2CHNA 3CQXC 4JEHB 1Y64B 4ZHQE 3Q5EA 4L5GA 3B5MA 5BR8T 2WU5A 5LB7B 2V7KA 4NXMT 2X0YA 2DLRA 4LF4T 2XQ4A 3AE7A 1FJGT 4PJLA 2AXDS 4IE4A 3BQLA 3Q5XA 1M7KA 4HWDA 4HFCA 5LGNB 1S35A 3C4WA 3HKCE 4YHJA 3AEAA 5LHHB 1XNRT 5FY0A 3TLVA 3SFEA 2HPJA 2HN2A 3N9PA 4Q25A 2XPKA 4NUVA 4V1Av 2UXNB 5JDLA 3P4SA 4JI3T 1WCRA 4JI4T 2V26A 4AI6A 4X20E 3HKBE 3Q9DA 1W9RA 3WI3A 4TN7B 4H9PC 2C5IT 3ZYMA 2V7LA 3AEEA 2YEVC 2WZIA 4JLEA 1DU2A 3IHRA 4LF7T 2JQQA 1MMNA 2WY2A 1MNDA 3CKDA 3MKDA 2UXBT 1HG5A 3TKLB 1NENA 2DL1A 2LSKA 4B3ST 4PK6A 4BJMA 3PE0A 4E7SA 4OX9T 2IC9A 4H63H 2V5DA 4ZI3D 3AVSA 5AQHB 3T1YT 4QWNB 4DNDA 2Y6XA 2LSYA 5HYAA 1FEWA 5CFBA 3QNUA 5LBMA 3UQ4A 3FB2A 3RYFE 3TLTA 4AKHA 4PJMA 2V6XA 5HWYA 2FJAA 2QVAA 2LSGA 2VKJA 3ONJA 1FMVA 2CMRA 4GKKT 4B3TT 4TZ4C 1BR1A 2ZM2A 3L09A 3AE9A 5JR9A 4IGUA 5LHIB 1ZP0A 1IBKT 3QC9A 4I0UA 5HWXA 1JNRA 4EV6A 3U3IA 2WP9A 2PG8A 1U4QA 3RC3A 5LCYA 2HHHT 1WYCA 4DV0T 5FNVE 2NOXA 3RX6A 3KDSE 3K3NA 3J7Yq 3SS1A 3OJAA 2V5CA 3IBPA 2N2NA 3NRXA 1KEYA 3NKZA 3WAJA 4DO0A 1HF8A 2IHR1 5FVLA 4TNWA 3ZSSA 3E22E 1E2AA 3KINB 4IDPA 5HXRA 3C4ZA 1D0XA 5AQPB 4IL9A 5HEJA 2C5JA 5KXJA 3EHZA 2YOEA 5LGTB 5J0ZA 4PFOA 3EVYA 4DV5T 1LKXA 2CXDA 3K1SA 4ILCA 2WS3A 4XAXB 5C8YE 2BG9B 3ZCJA 3LJCA 2JQKA 2XQYA 2W63A 4IDOA 2VB6A 1ZEEA 4JI5T 3B57A 5F5WA 2XQ8A 4GKJT 4IE6A 4CI1B 2VVSA 5BMVE 1X79A 3VRBA 4CXYA 4GYSA 3OYXA 1D0ZA 2XQAA 4PK5A 3G06A 2NW9A 4PJJA 4LF9T 5L4EA 2ES0A 4ERRA 2X9HA 4HFVA 1YXRA 4DR2T 3UULA 5IWAT 4JYAT 4CN4A 3O1HA 1IBMT 3LK42 4DMVA 1OXZA 3RQWA 3QUJA 4ANJA 1HX1B 5FVKA 3PUAA 3E08A 3FBLA 4QXBB 5KX5E 4IIJE 4EAHA 3JAEA 2YU2A 3CVRA 2YINA 2UXCT 2FUPA 2L3LA 2X68A 3TLWA 2B76A 3VU7H 3ZJ1A 4ZS3A 4YHHT 4GK0E 3AA7B 4AQGA 3LSVA 2H7VC 5JVDE 3AEGA 5CA1E 4UR9A 4AQFA 4WW0A 2CM0A 4WBOA 5JDGA 3AVRA 5CGMA 4NXNT 1G8XA 4ZI2C 5HXEA 2FBWA 3N9NA 1SA0E 2BDEA 3ZYLA 1KNPA 4FJOA 5KDMC 4K0UA 5ABFB 2CRBA 3RGLA 3ZCIA 4PNIA 2DWGA 4U2ZA 3E0ZA 3ZMVB 1UK5A 1IJ6A 3ANWB 3Q5WA 4BA9A 3KV4A 2SPCA 3P4PA 2ZMAA 2LSJA 5C3JA 3HKEE 2JPFA 2K3WA 2BG9C 3B13A 3ZJ2A 2XAGB 2VKOA 4CXXA 2E2AA 2V1DB 2MBGA 4OHFA 2FJBA 3FZKB 4ASKA 4EEBA 3LK2B 1ZV4X 2YDQA 5LMUT 5H6QB 4EOZB 2MOZA 5AQKB 1XWMA 3P7IA 2BG9E 4JI2T 5FL0A 3H37A 2Q9QD 4I4TE 2Z6EA 3OBVE 2KZ7B 4UV8B 3VRAA 1B7TA 4HGAA 3ZKRA 3ZT7A 1R8IA 4P1NA 2XAFB 4IE5A 4I43B 1V9DA 2KWHA 4O4LE 3LFMA 1HS7A 5AQQB 2W61A 2QGSA 5L2LA 4G63A 4H9OC 5J2UE 3O1JA 4YSYA 2WDVA 1QLBA 3C50A 3PU8A 5FY1A 5AQTB 4LFCT 2H89A 3GN5A 4WBNE 4TV8E 5L4HA 3UUMA 3A8YC 5LP6E 2CPTA 4DV7T 1WFDA 1LVFA 3AXJB 2CCQA 2RP4A 2AE9A 3N2KE 4QKNA 3RLFF 3KV5A 4ZZBA 3PJAA 3N2GE 2WAUA 2LOSA 1NEKA 4U7YA 5HXHA 2LOPA 3MK7C 4MHCA 1HNWT 3CPZA 4LF5T 2XQ5A 1YW0A 4I50E 4DBRA 4CN1A 3ZMSB 3N5LA 2V7IA 1ZHCA 3N9LA 4JI7T 3RQUA 2K24A 2WMOA 1HG2A 1SE7A 2DNXA 1XDOA 4ZEYA 3VR9A 4GYRA 3I9WA 4DR3T 4K0KT 2W00A 1MNEA 2CBJA 3HR0A 1XZYA 3I9YA 1G73A 1BR0A 3OKQA 1J5WA 1XNQT 1Z0PA 4COFA 2I59A 1LRZA 4TWDA 3AE3A 3QK6A 5A1LA 3PUSA 5AQOB 4CI2B 3ABVA 2CBIA 3RIUC 3K3QC 4M1PA 3VHLA 2YN6A 4JBWF 2X9XA 2D9DA 4UEMA 2UXXB 4LMKA 5DQWA 4ZXLA 4YTMA 2DHRA 5FYMA 4QXCB 4YXDA 3BK9A 4DR4T 2LLYA 3CQCB 3A7MA 5LGUB 4P0AA 4U31A 2RPAA 3CX6B 2QA7A 3R6NA 3H3MA 4DV6T 3BQKA 5HXCA 4DMWA 2BVLA 2XSBA 2BBHA 1HCIA 3TLUA 4YJ3E 4EYUA 5M4YA 4L9IA 3I0QA 2LJLA 4JI1T 4HFBA 3C64A 2KT9A 2M6IA 4ZI3C 1UCUA 2WSSV 4AIUA 2NTXA 1FMWA 3AE4A 2WM9A 4GK5E 1S94A 2MTQA 3L39A 5ABHA 4HN9A 3UT5E 3RYCE 4ZZCA 5ABGA 5L3FB 4X1KE 4U72A 4YSZA 5J2TE 5EZYE 4DUYT 3FZHB 1WLXA 2NR4A 2KWIB 2C0SA 2X51A 5CB4E 4U7IA 2FJEA 1YD8G 3ZMTB 3K8PC 4HFIA 2BS4A 2XQ6A 3T8OA 3EUHA 2X9WA 5EK3A 3LG7A 4IE7A 4DUZT 3PJAJ 2BZBA 3P4RA 3AA6B 4OFZA 3EDUA 3MZKB 3X1DA 5CJ5A 3MJXA 1BR4A 4WNKA 2X9YA 4Z91A 4OK0A 4DVDA 4J2CA 1U5PA 4P09A 4HFHA 4PFPA 4QH5A 3AEBA 5LG4A 4ZS2A 2PBIA 2XY8B 4DR6T 2BKOA 1L0VA 2WWUA 3VR8A 2ODUA 2VK9A 2VWAA 1HX8A 3RIAA 2XSAA 4Z90A 3EABA 4Z8XA 5LMNT 4UELA 2H7OA 4IHJE 4X64T 3HL6A 1KNZA 1M62A 1J5ET 2ZM6T 5HXSA 2C5KT 4TWFA 5JDFA 3AA1B 4HEAA 1T72A 5AQSB 3SRZA 1QSDA 4QX8B 1VOMA 3L3PA 3RF1A 2BG9A 4C90A 1MMDA 3NBXX 3HI2A 3AE8A 3AE2A 4LMJA 4X1IE 1MIVA 4HWCA 4UVAB 1IZNB 4KHPT 1UGOA 3QB5K 2WDRA 4KBMB 4B6XA 2I6HA 2Y48B 1IJ5A 4CXWA 3F2EA 4YFSA 2JQ9A 5IYZE 2XASB 1MMGA 2Q9QB 4H9RC 4IT4A 2W66A 1E7PA 2VASA 1LVKA 1OEDB 1H7CA 2N9DA 2XM2A 4O2BE 4QX7B 4A97A 3UU8A 3AAIA 3ZYKA 5EK2A 1HNZT 5FXWA 2FJDA 4UVCB 2CLYB 2YDRA 2JIWA 2B1EA 3PUZF 4ILAA 3J9X1 2D5UA 5AQMB 2A72A 2K5BB 2V6YA 3UU5A 1UUSA 4ZOLE 4PJNA 3UUNA 4HFEA 2I0MA 4KUMB 2IDOB 2KLQA 2V6YB 3RHWA 2ACXA 3AECA 1HFAA 1Y01A 4IDNA 4ADZA 1CHUA 5LG3A 2HH7A 5JREA 4YT0A 3FZFB 3NZPA 5ABFA 2ACZA 2LHRA 3RRCA 3EAMA 3AE5A 2LRKA 3UU3A 3V5UA 1KF6A 4XBFB 3ANWA 2W2UA 2LT3A 2XZEA 4CQIA 4CZZB 1KFYA 2KSRA 2XQ9A 2VL8A 2GK9A 4TUYE 2MAWA 2XAJB 4AKLA 3UQ7A 4IE0A 2D0UA 2WU2A 1SHZC 3UUBA 4A56A 4O4IE 3CIRA 3P4QA 2KXPB 2LHNA 4DV1T 3TLSA 1IAPA 2VKHA 5JQGE 2EHOB 5L3BB 4ISSA 2XAHB 3QB5A 2M67A 3S4UA 2BBJA 4TNVA 5JRCB 1SUMB 5HEGA 4DR1T 3PU3A 4AKRB 1N33T 5GONE 4U74A 4UF0B 3RKGA 2ODVA 2P9BA 3RRWA 1HTJF 2IAKA 2JMKA 2A2FX 2CXFA 4DBQA 2Q9QC 3U78A 2JJ9A 3JC6D 5ADXL 5ETWA 4HWFA 2H88A 1OEDC 1X9BA 1D1CA 5FY7A 4KHZF 1MIWA 3EDVA 2XM1A 2DWKA 3RIUA 3NVOA 3KBTA 3P4WA 1J1JA 3KVAA 4YLHA 2CLYC 3KVBA 3Q5DA 2WZHA 3LDQB 3AAAB 2NWBA 1OEDE 5H6RB 4UIGA 3I1AA 3AXJA 1I94T 5LJMA 5LJNA 3LBXB 4NUUA 2NW7A 5HAXA 1MIYA 3FZLB 3AAEB 2OV9A 5FXVA 1I6ZA 2LEHA 2YKSA 2CWOA 3ZMZB 2CWYA 5AQNB 2E9XB 2IUBA 2ZM8A 4HKAA 3F31A 2VKDA 5L3EB 3HKDE 4O2AE 4IDQA 3ZMUB 4LF6T 4EGWA 4IL4A 2LKGA 2V7MA 4HWHA 5JTGA 1YQ4A 5FKYA 3O9XA 3KV9A 2W0GA 2OA5A 4JI0T 4ISTA 4G2AA 4H9NC 4X66T 2F4VT 2EHOC 2EHOD 2KNDA 1OWAA 3NWIA 4EEDA 2CE7A 1ZOYA 4C91A 5DJQC 4JI8T 3AEFA 2BVMA 1WR0A 1KK7A 3ONXA 2IW5B 2CEAA 4PK4A
chains in the Genus database with same CATH topology
4DUYT 4JI3T 4GKJT 4JI4T 1IBKT 4DV3T 1IBLT 2VQFT 4LF9T 1I94T 4AQYT 2VQET 2UUBT 4JI6T 4LF7T 4DR7T 2HHHT 4LF8T 1HR0T 4KHPT 4DV0T 4DR2T 5IWAT 4X62T 4B3RT 4JYAT 4DUZT 4LFAT 2UXBT 4DR4T 4YY3T 1HNWT 2UXDT 1IBMT 4LF5T 2UUAT 1XMOT 4B3ST 5LMUT 4X65T 4DV1T 4OX9T 4B3MT 4JI2T 4DV6T 5BR8T 4JI7T 4DV2T 3T1YT 4DV4T 1N34T 4DR1T 2UXCT 3OTOT 1HNZT 4NXMT 4DR5T 1N33T 4LF4T 4DR6T 4LF6T 4YHHT 4JI1T 1FJGT 3T1HT 4JI0T 2F4VT 5LMNT 4X66T 4DR3T 4K0KT 4X64T 4DV5T 2E5LT 4NXNT 1XNRT 1J5ET 2ZM6T 4LFBT 1XNQT 2UUCT 4JI8T 4GKKT 4LFCT 4B3TT 1N36T 1XMQT 2UU9T 4JI5T 4JV5T 1N32T 1HNXT 4DV7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY T;  4JI3 T;  4GKJ T;  4JI4 T;  1IBK T;  4DV3 T;  1IBL T;  2VQF T;  4LF9 T;  1I94 T;  4AQY T;  2VQE T;  2UUB T;  4JI6 T;  4LF7 T;  4DR7 T;  2HHH T;  4LF8 T;  1HR0 T;  4KHP T;  4DV0 T;  4DR2 T;  5IWA T;  4X62 T;  4B3R T;  4JYA T;  4DUZ T;  4LFA T;  2UXB T;  4DR4 T;  4YY3 T;  1HNW T;  2UXD T;  1IBM T;  4LF5 T;  2UUA T;  1XMO T;  4B3S T;  5LMU T;  4X65 T;  4DV1 T;  4OX9 T;  4B3M T;  4JI2 T;  4DV6 T;  5BR8 T;  4JI7 T;  4DV2 T;  3T1Y T;  4DV4 T;  1N34 T;  4DR1 T;  2UXC T;  3OTO T;  1HNZ T;  4NXM T;  4DR5 T;  1N33 T;  4LF4 T;  4DR6 T;  4LF6 T;  4YHH T;  4JI1 T;  1FJG T;  3T1H T;  4JI0 T;  2F4V T;  5LMN T;  4X66 T;  4DR3 T;  4K0K T;  4X64 T;  4DV5 T;  2E5L T;  4NXN T;  1XNR T;  1J5E T;  2ZM6 T;  4LFB T;  1XNQ T;  2UUC T;  4JI8 T;  4GKK T;  4LFC T;  4B3T T;  1N36 T;  1XMQ T;  2UU9 T;  4JI5 T;  4JV5 T;  1N32 T;  1HNX T;  4DV7 T; 
#chains in the Genus database with same CATH topology
 1UUR A;  4TWH A;  5LNK A;  2W4X A;  3DP7 A;  4DV3 T;  4EYY R;  4YJ2 E;  3L8R A;  2D2S A;  5LOV E;  3ZEF B;  1WR6 A;  3UTK A;  4N78 D;  2XQ3 A;  1VCS A;  2VQE T;  3C98 B;  3RC8 A;  3UU6 A;  2E5V A;  3NZQ A;  4QXH B;  4IRE A;  4TV9 E;  3SWH A;  5DAB A;  4A5X A;  1EZ3 A;  1US7 B;  2JQH A;  3RPU A;  3N2O A;  2QRX A;  1NWM X;  2X0H A;  3WAK A;  3ZST A;  2Y8D A;  1QUU A;  3OTO T;  4ILU A;  4MLK A;  3CK6 A;  2RA1 A;  3PUX F;  4O8S A;  2XHE B;  3KBU A;  3NRY A;  2K9A A;  1W09 A;  4L0R A;  3PV0 F;  5AQU B;  3CWZ B;  3FXD B;  5IUX A;  2E9X C;  2E9X D;  1BR2 A;  2BS2 A;  2PJQ A;  1NAF A;  2UUC T;  4HTE A;  3ZN0 B;  5FXZ A;  4QH4 A;  3W15 B;  4F6R C;  2CA5 A;  2BKP A;  3ESL A;  2YDS A;  2XUE A;  4EIW A;  3N9O A;  2N1G A;  3ZN1 B;  3CQG B;  3Q2M A;  3AA0 B;  5F3J A;  3O1I A;  4JI6 T;  3ETU A;  4E7Z A;  3PTR B;  3N9Q A;  3IEE A;  4LFA T;  2KMF A;  4AKG A;  4YY3 T;  4EZH A;  4DID B;  4YTN A;  3DTO A;  5HEO A;  5L3C B;  2MYS A;  2WQY A;  5C2T A;  3UUX B;  4B3M T;  1XDP A;  3OVU A;  4XZC A;  3RKO A;  2CXL A;  4CN6 A;  3AB3 B;  3D0T A;  2K48 A;  4DV4 T;  1CUN A;  5L47 A;  2LM9 A;  2MPK A;  4AIS A;  4DR5 T;  2LSI A;  3KFW X;  3MXZ A;  4OYJ A;  3FZM B;  3FXE B;  4OYK A;  1ZKE A;  4H9Q C;  2X0L B;  2WB5 A;  3PUV F;  3ETV A;  2E8I A;  2DI4 A;  2W67 A;  3GMI A;  3PUQ A;  2J62 A;  5JR9 B;  4P0B A;  4H63 V;  1UX4 A;  4MFR A;  4NPP A;  4U33 A;  1N36 T;  3MAC A;  5IHY A;  2HN1 A;  1XMQ T;  4A98 A;  5ABE A;  5AQL B;  3F57 A;  1HNX T;  2XJ7 A;  4NIQ A;  2J1D G;  3AE1 A;  1T8B A;  4U3C A;  3SFD A;  1IBL T;  2VQF T;  3LK3 B;  4UVB B;  2LRL A;  1VRB A;  5JDN A;  3RYI E;  5AQV B;  4B3R T;  4ZI7 E;  5LYJ E;  2UXD T;  1VCT A;  4X65 T;  4U2Y A;  5L3G B;  4X1Y E;  5AQF B;  2CHO A;  4DV2 T;  2OLT A;  3PUW F;  2V7J A;  2Q9Q A;  3OYZ A;  2IC6 A;  1W0A A;  2LM2 A;  3EI0 A;  2IML A;  1OED A;  4HE8 A;  5FP3 A;  5F8P A;  3K3O A;  3RI5 A;  2KIN B;  3T1H T;  2LE8 A;  4FI5 A;  5AQJ B;  2JMH A;  5HEH A;  5JDH A;  4O4H E;  5E0O A;  2WCA A;  3PUG A;  3UU4 A;  4LFB T;  1YKE B;  3JAF A;  5KMG P;  2QYW A;  5HEU A;  5FMN A;  1KNR A;  1W0B A;  2NTY A;  4KP3 C;  3ZC0 A;  2VVN A;  5EK4 A;  5HCM A;  2WDQ A;  2XQ7 A;  2A3D A;  1T98 A;  3RH3 A;  4KI0 F;  4BJN A;  5JR9 C;  1JNZ A;  4X5T A;  2UUB T;  4DR7 T;  5FL1 A;  2W62 A;  5LHG B;  4CI3 B;  4EB6 E;  2NP9 A;  3M65 A;  2PFV A;  3V5S A;  4YTP A;  2IIU A;  1XMO T;  4TX5 A;  2WMN A;  5FXX A;  1AJ3 A;  1D1A A;  5L3D B;  3PDY A;  3ZLI A;  4EXT A;  2BS3 A;  4WZX A;  5TAO A;  1D1B A;  3ONL C;  1T7S A;  5DQV A;  2D0T A;  3CX7 B;  2HPL A;  2JRK A;  2J47 A;  2EHO A;  4ZI2 D;  3PUR A;  3R84 B;  4YSX A;  3IF8 B;  3SOL A;  5AQR B;  3OPC A;  3ZPO A;  2X67 A;  5JRC A;  3MA9 A;  5AFU L;  3GA8 A;  1Z8U A;  4I55 E;  4LML A;  3AED A;  2YK0 A;  4IDZ A;  3C4X A;  3DJB A;  4KX6 A;  1YKH B;  5LA6 E;  1FIO A;  4UF0 A;  4F8H A;  2WBL A;  4UV9 B;  3CX8 B;  3VKG A;  4AKI A;  2VL0 A;  3HA4 A;  3UFG A;  3UFE A;  4JV5 T;  3A5X A;  1N32 T;  3H3A A;  1UX5 A;  3JC6 C;  2X66 A;  3ZC1 A;  2WWV A;  2L8K A;  3RIF A;  2H3R A;  5JDQ A;  2V8S V;  4HFD A;  3QOF A;  4HWI B;  3VKH A;  2XTL A;  1WRD A;  1HR0 T;  4O4J E;  5LXT E;  2LKH A;  3N9M A;  3KV6 A;  2UUA T;  3FBZ A;  3LBX A;  2G0U A;  1WYB A;  4JEU B;  3JCF A;  1GQE A;  2XAQ B;  2PTF A;  2NW8 A;  3PUY F;  4MBQ A;  3IA3 A;  3O4X E;  1N34 T;  1O3X A;  4H9S E;  2E9X A;  5AQI B;  3I0O A;  4MAL A;  5CA0 E;  4ILB A;  5HCJ A;  3P50 A;  2YU1 A;  2M6B A;  2BKN A;  5LBQ B;  4KMC A;  2R6G F;  2A9U A;  2DCF A;  1MMA A;  2VUR A;  3GN5 B;  4UXN B;  4JUY A;  2E5L T;  3ZT6 A;  3FHN A;  3RYH E;  5J1G A;  3P8C D;  2ZLY A;  4AQF C;  1E1H B;  3CML A;  2UU9 T;  2ZM0 A;  3AE6 A;  4BAY B;  5AQG B;  5JH7 E;  4QH1 A;  3BQI A;  4AXP A;  4GOU A;  2J4G A;  4WYV A;  3ZT5 A;  3GWH A;  4AQY T;  5JDM A;  1D0Y A;  4LF8 T;  3M3Z B;  4PAG A;  1YQ3 A;  4EZ4 A;  4X62 T;  3C51 A;  4GIW A;  4QHO A;  4PW8 A;  2L9Q A;  3JAD A;  2CHN A;  3CQX C;  4JEH B;  1Y64 B;  4ZHQ E;  3Q5E A;  4L5G A;  3B5M A;  5BR8 T;  2WU5 A;  5LB7 B;  2V7K A;  4NXM T;  2X0Y A;  2DLR A;  4LF4 T;  2XQ4 A;  3AE7 A;  1FJG T;  4PJL A;  2AXD S;  4IE4 A;  3BQL A;  3Q5X A;  1M7K A;  4HWD A;  4HFC A;  5LGN B;  1S35 A;  3C4W A;  3HKC E;  4YHJ A;  3AEA A;  5LHH B;  1XNR T;  5FY0 A;  3TLV A;  3SFE A;  2HPJ A;  2HN2 A;  3N9P A;  4Q25 A;  2XPK A;  4NUV A;  4V1A v;  2UXN B;  5JDL A;  3P4S A;  4JI3 T;  1WCR A;  4JI4 T;  2V26 A;  4AI6 A;  4X20 E;  3HKB E;  3Q9D A;  1W9R A;  3WI3 A;  4TN7 B;  4H9P C;  2C5I T;  3ZYM A;  2V7L A;  3AEE A;  2YEV C;  2WZI A;  4JLE A;  1DU2 A;  3IHR A;  4LF7 T;  2JQQ A;  1MMN A;  2WY2 A;  1MND A;  3CKD A;  3MKD A;  2UXB T;  1HG5 A;  3TKL B;  1NEN A;  2DL1 A;  2LSK A;  4B3S T;  4PK6 A;  4BJM A;  3PE0 A;  4E7S A;  4OX9 T;  2IC9 A;  4H63 H;  2V5D A;  4ZI3 D;  3AVS A;  5AQH B;  3T1Y T;  4QWN B;  4DND A;  2Y6X A;  2LSY A;  5HYA A;  1FEW A;  5CFB A;  3QNU A;  5LBM A;  3UQ4 A;  3FB2 A;  3RYF E;  3TLT A;  4AKH A;  4PJM A;  2V6X A;  5HWY A;  2FJA A;  2QVA A;  2LSG A;  2VKJ A;  3ONJ A;  1FMV A;  2CMR A;  4GKK T;  4B3T T;  4TZ4 C;  1BR1 A;  2ZM2 A;  3L09 A;  3AE9 A;  5JR9 A;  4IGU A;  5LHI B;  1ZP0 A;  1IBK T;  3QC9 A;  4I0U A;  5HWX A;  1JNR A;  4EV6 A;  3U3I A;  2WP9 A;  2PG8 A;  1U4Q A;  3RC3 A;  5LCY A;  2HHH T;  1WYC A;  4DV0 T;  5FNV E;  2NOX A;  3RX6 A;  3KDS E;  3K3N A;  3J7Y q;  3SS1 A;  3OJA A;  2V5C A;  3IBP A;  2N2N A;  3NRX A;  1KEY A;  3NKZ A;  3WAJ A;  4DO0 A;  1HF8 A;  2IHR 1;  5FVL A;  4TNW A;  3ZSS A;  3E22 E;  1E2A A;  3KIN B;  4IDP A;  5HXR A;  3C4Z A;  1D0X A;  5AQP B;  4IL9 A;  5HEJ A;  2C5J A;  5KXJ A;  3EHZ A;  2YOE A;  5LGT B;  5J0Z A;  4PFO A;  3EVY A;  4DV5 T;  1LKX A;  2CXD A;  3K1S A;  4ILC A;  2WS3 A;  4XAX B;  5C8Y E;  2BG9 B;  3ZCJ A;  3LJC A;  2JQK A;  2XQY A;  2W63 A;  4IDO A;  2VB6 A;  1ZEE A;  4JI5 T;  3B57 A;  5F5W A;  2XQ8 A;  4GKJ T;  4IE6 A;  4CI1 B;  2VVS A;  5BMV E;  1X79 A;  3VRB A;  4CXY A;  4GYS A;  3OYX A;  1D0Z A;  2XQA A;  4PK5 A;  3G06 A;  2NW9 A;  4PJJ A;  4LF9 T;  5L4E A;  2ES0 A;  4ERR A;  2X9H A;  4HFV A;  1YXR A;  4DR2 T;  3UUL A;  5IWA T;  4JYA T;  4CN4 A;  3O1H A;  1IBM T;  3LK4 2;  4DMV A;  1OXZ A;  3RQW A;  3QUJ A;  4ANJ A;  1HX1 B;  5FVK A;  3PUA A;  3E08 A;  3FBL A;  4QXB B;  5KX5 E;  4IIJ E;  4EAH A;  3JAE A;  2YU2 A;  3CVR A;  2YIN A;  2UXC T;  2FUP A;  2L3L A;  2X68 A;  3TLW A;  2B76 A;  3VU7 H;  3ZJ1 A;  4ZS3 A;  4YHH T;  4GK0 E;  3AA7 B;  4AQG A;  3LSV A;  2H7V C;  5JVD E;  3AEG A;  5CA1 E;  4UR9 A;  4AQF A;  4WW0 A;  2CM0 A;  4WBO A;  5JDG A;  3AVR A;  5CGM A;  4NXN T;  1G8X A;  4ZI2 C;  5HXE A;  2FBW A;  3N9N A;  1SA0 E;  2BDE A;  3ZYL A;  1KNP A;  4FJO A;  5KDM C;  4K0U A;  5ABF B;  2CRB A;  3RGL A;  3ZCI A;  4PNI A;  2DWG A;  4U2Z A;  3E0Z A;  3ZMV B;  1UK5 A;  1IJ6 A;  3ANW B;  3Q5W A;  4BA9 A;  3KV4 A;  2SPC A;  3P4P A;  2ZMA A;  2LSJ A;  5C3J A;  3HKE E;  2JPF A;  2K3W A;  2BG9 C;  3B13 A;  3ZJ2 A;  2XAG B;  2VKO A;  4CXX A;  2E2A A;  2V1D B;  2MBG A;  4OHF A;  2FJB A;  3FZK B;  4ASK A;  4EEB A;  3LK2 B;  1ZV4 X;  2YDQ A;  5LMU T;  5H6Q B;  4EOZ B;  2MOZ A;  5AQK B;  1XWM A;  3P7I A;  2BG9 E;  4JI2 T;  5FL0 A;  3H37 A;  2Q9Q D;  4I4T E;  2Z6E A;  3OBV E;  2KZ7 B;  4UV8 B;  3VRA A;  1B7T A;  4HGA A;  3ZKR A;  3ZT7 A;  1R8I A;  4P1N A;  2XAF B;  4IE5 A;  4I43 B;  1V9D A;  2KWH A;  4O4L E;  3LFM A;  1HS7 A;  5AQQ B;  2W61 A;  2QGS A;  5L2L A;  4G63 A;  4H9O C;  5J2U E;  3O1J A;  4YSY A;  2WDV A;  1QLB A;  3C50 A;  3PU8 A;  5FY1 A;  5AQT B;  4LFC T;  2H89 A;  3GN5 A;  4WBN E;  4TV8 E;  5L4H A;  3UUM A;  3A8Y C;  5LP6 E;  2CPT A;  4DV7 T;  1WFD A;  1LVF A;  3AXJ B;  2CCQ A;  2RP4 A;  2AE9 A;  3N2K E;  4QKN A;  3RLF F;  3KV5 A;  4ZZB A;  3PJA A;  3N2G E;  2WAU A;  2LOS A;  1NEK A;  4U7Y A;  5HXH A;  2LOP A;  3MK7 C;  4MHC A;  1HNW T;  3CPZ A;  4LF5 T;  2XQ5 A;  1YW0 A;  4I50 E;  4DBR A;  4CN1 A;  3ZMS B;  3N5L A;  2V7I A;  1ZHC A;  3N9L A;  4JI7 T;  3RQU A;  2K24 A;  2WMO A;  1HG2 A;  1SE7 A;  2DNX A;  1XDO A;  4ZEY A;  3VR9 A;  4GYR A;  3I9W A;  4DR3 T;  4K0K T;  2W00 A;  1MNE A;  2CBJ A;  3HR0 A;  1XZY A;  3I9Y A;  1G73 A;  1BR0 A;  3OKQ A;  1J5W A;  1XNQ T;  1Z0P A;  4COF A;  2I59 A;  1LRZ A;  4TWD A;  3AE3 A;  3QK6 A;  5A1L A;  3PUS A;  5AQO B;  4CI2 B;  3ABV A;  2CBI A;  3RIU C;  3K3Q C;  4M1P A;  3VHL A;  2YN6 A;  4JBW F;  2X9X A;  2D9D A;  4UEM A;  2UXX B;  4LMK A;  5DQW A;  4ZXL A;  4YTM A;  2DHR A;  5FYM A;  4QXC B;  4YXD A;  3BK9 A;  4DR4 T;  2LLY A;  3CQC B;  3A7M A;  5LGU B;  4P0A A;  4U31 A;  2RPA A;  3CX6 B;  2QA7 A;  3R6N A;  3H3M A;  4DV6 T;  3BQK A;  5HXC A;  4DMW A;  2BVL A;  2XSB A;  2BBH A;  1HCI A;  3TLU A;  4YJ3 E;  4EYU A;  5M4Y A;  4L9I A;  3I0Q A;  2LJL A;  4JI1 T;  4HFB A;  3C64 A;  2KT9 A;  2M6I A;  4ZI3 C;  1UCU A;  2WSS V;  4AIU A;  2NTX A;  1FMW A;  3AE4 A;  2WM9 A;  4GK5 E;  1S94 A;  2MTQ A;  3L39 A;  5ABH A;  4HN9 A;  3UT5 E;  3RYC E;  4ZZC A;  5ABG A;  5L3F B;  4X1K E;  4U72 A;  4YSZ A;  5J2T E;  5EZY E;  4DUY T;  3FZH B;  1WLX A;  2NR4 A;  2KWI B;  2C0S A;  2X51 A;  5CB4 E;  4U7I A;  2FJE A;  1YD8 G;  3ZMT B;  3K8P C;  4HFI A;  2BS4 A;  2XQ6 A;  3T8O A;  3EUH A;  2X9W A;  5EK3 A;  3LG7 A;  4IE7 A;  4DUZ T;  3PJA J;  2BZB A;  3P4R A;  3AA6 B;  4OFZ A;  3EDU A;  3MZK B;  3X1D A;  5CJ5 A;  3MJX A;  1BR4 A;  4WNK A;  2X9Y A;  4Z91 A;  4OK0 A;  4DVD A;  4J2C A;  1U5P A;  4P09 A;  4HFH A;  4PFP A;  4QH5 A;  3AEB A;  5LG4 A;  4ZS2 A;  2PBI A;  2XY8 B;  4DR6 T;  2BKO A;  1L0V A;  2WWU A;  3VR8 A;  2ODU A;  2VK9 A;  2VWA A;  1HX8 A;  3RIA A;  2XSA A;  4Z90 A;  3EAB A;  4Z8X A;  5LMN T;  4UEL A;  2H7O A;  4IHJ E;  4X64 T;  3HL6 A;  1KNZ A;  1M62 A;  1J5E T;  2ZM6 T;  5HXS A;  2C5K T;  4TWF A;  5JDF A;  3AA1 B;  4HEA A;  1T72 A;  5AQS B;  3SRZ A;  1QSD A;  4QX8 B;  1VOM A;  3L3P A;  3RF1 A;  2BG9 A;  4C90 A;  1MMD A;  3NBX X;  3HI2 A;  3AE8 A;  3AE2 A;  4LMJ A;  4X1I E;  1MIV A;  4HWC A;  4UVA B;  1IZN B;  4KHP T;  1UGO A;  3QB5 K;  2WDR A;  4KBM B;  4B6X A;  2I6H A;  2Y48 B;  1IJ5 A;  4CXW A;  3F2E A;  4YFS A;  2JQ9 A;  5IYZ E;  2XAS B;  1MMG A;  2Q9Q B;  4H9R C;  4IT4 A;  2W66 A;  1E7P A;  2VAS A;  1LVK A;  1OED B;  1H7C A;  2N9D A;  2XM2 A;  4O2B E;  4QX7 B;  4A97 A;  3UU8 A;  3AAI A;  3ZYK A;  5EK2 A;  1HNZ T;  5FXW A;  2FJD A;  4UVC B;  2CLY B;  2YDR A;  2JIW A;  2B1E A;  3PUZ F;  4ILA A;  3J9X 1;  2D5U A;  5AQM B;  2A72 A;  2K5B B;  2V6Y A;  3UU5 A;  1UUS A;  4ZOL E;  4PJN A;  3UUN A;  4HFE A;  2I0M A;  4KUM B;  2IDO B;  2KLQ A;  2V6Y B;  3RHW A;  2ACX A;  3AEC A;  1HFA A;  1Y01 A;  4IDN A;  4ADZ A;  1CHU A;  5LG3 A;  2HH7 A;  5JRE A;  4YT0 A;  3FZF B;  3NZP A;  5ABF A;  2ACZ A;  2LHR A;  3RRC A;  3EAM A;  3AE5 A;  2LRK A;  3UU3 A;  3V5U A;  1KF6 A;  4XBF B;  3ANW A;  2W2U A;  2LT3 A;  2XZE A;  4CQI A;  4CZZ B;  1KFY A;  2KSR A;  2XQ9 A;  2VL8 A;  2GK9 A;  4TUY E;  2MAW A;  2XAJ B;  4AKL A;  3UQ7 A;  4IE0 A;  2D0U A;  2WU2 A;  1SHZ C;  3UUB A;  4A56 A;  4O4I E;  3CIR A;  3P4Q A;  2KXP B;  2LHN A;  4DV1 T;  3TLS A;  1IAP A;  2VKH A;  5JQG E;  2EHO B;  5L3B B;  4ISS A;  2XAH B;  3QB5 A;  2M67 A;  3S4U A;  2BBJ A;  4TNV A;  5JRC B;  1SUM B;  5HEG A;  4DR1 T;  3PU3 A;  4AKR B;  1N33 T;  5GON E;  4U74 A;  4UF0 B;  3RKG A;  2ODV A;  2P9B A;  3RRW A;  1HTJ F;  2IAK A;  2JMK A;  2A2F X;  2CXF A;  4DBQ A;  2Q9Q C;  3U78 A;  2JJ9 A;  3JC6 D;  5ADX L;  5ETW A;  4HWF A;  2H88 A;  1OED C;  1X9B A;  1D1C A;  5FY7 A;  4KHZ F;  1MIW A;  3EDV A;  2XM1 A;  2DWK A;  3RIU A;  3NVO A;  3KBT A;  3P4W A;  1J1J A;  3KVA A;  4YLH A;  2CLY C;  3KVB A;  3Q5D A;  2WZH A;  3LDQ B;  3AAA B;  2NWB A;  1OED E;  5H6R B;  4UIG A;  3I1A A;  3AXJ A;  1I94 T;  5LJM A;  5LJN A;  3LBX B;  4NUU A;  2NW7 A;  5HAX A;  1MIY A;  3FZL B;  3AAE B;  2OV9 A;  5FXV A;  1I6Z A;  2LEH A;  2YKS A;  2CWO A;  3ZMZ B;  2CWY A;  5AQN B;  2E9X B;  2IUB A;  2ZM8 A;  4HKA A;  3F31 A;  2VKD A;  5L3E B;  3HKD E;  4O2A E;  4IDQ A;  3ZMU B;  4LF6 T;  4EGW A;  4IL4 A;  2LKG A;  2V7M A;  4HWH A;  5JTG A;  1YQ4 A;  5FKY A;  3O9X A;  3KV9 A;  2W0G A;  2OA5 A;  4JI0 T;  4IST A;  4G2A A;  4H9N C;  4X66 T;  2F4V T;  2EHO C;  2EHO D;  2KND A;  1OWA A;  3NWI A;  4EED A;  2CE7 A;  1ZOY A;  4C91 A;  5DJQ C;  4JI8 T;  3AEF A;  2BVM A;  1WR0 A;  1KK7 A;  3ONX A;  2IW5 B;  2CEA A;  4PK4 A; 
#chains in the Genus database with same CATH homology
 4DUY T;  4JI3 T;  4GKJ T;  4JI4 T;  1IBK T;  4DV3 T;  1IBL T;  2VQF T;  4LF9 T;  1I94 T;  4AQY T;  2VQE T;  2UUB T;  4JI6 T;  4LF7 T;  4DR7 T;  2HHH T;  4LF8 T;  1HR0 T;  4KHP T;  4DV0 T;  4DR2 T;  5IWA T;  4X62 T;  4B3R T;  4JYA T;  4DUZ T;  4LFA T;  2UXB T;  4DR4 T;  4YY3 T;  1HNW T;  2UXD T;  1IBM T;  4LF5 T;  2UUA T;  1XMO T;  4B3S T;  5LMU T;  4X65 T;  4DV1 T;  4OX9 T;  4B3M T;  4JI2 T;  4DV6 T;  5BR8 T;  4JI7 T;  4DV2 T;  3T1Y T;  4DV4 T;  1N34 T;  4DR1 T;  2UXC T;  3OTO T;  1HNZ T;  4NXM T;  4DR5 T;  1N33 T;  4LF4 T;  4DR6 T;  4LF6 T;  4YHH T;  4JI1 T;  1FJG T;  3T1H T;  4JI0 T;  2F4V T;  5LMN T;  4X66 T;  4DR3 T;  4K0K T;  4X64 T;  4DV5 T;  2E5L T;  4NXN T;  1XNR T;  1J5E T;  2ZM6 T;  4LFB T;  1XNQ T;  2UUC T;  4JI8 T;  4GKK T;  4LFC T;  4B3T T;  1N36 T;  1XMQ T;  2UU9 T;  4JI5 T;  4JV5 T;  1N32 T;  1HNX T;  4DV7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...