2V6YA

Structure of the mit domain from a s. solfataricus vps4-like atpase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
75
structure length
75
Chain Sequence
MSAQVMLEDMARKYAILAVKADKEGKVEDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAA FAMILY ATPASE, P60 KATANIN
publication title Structural Basis for Selective Recognition of Escrt-III by the Aaa ATPase Vps4
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 32
structure length 75
sequence length 75
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2v6yA00
4CN1A 2V6XA 1YXRA 2A9UA 5FVKA 2W2UA 2WWVA 4U7IA 1WR0A 5LB7B 4WZXA 2RPAA 2JQHA 4U2ZA 4ZEYA 2LRLA 4IT4A 1WCRA 4CN6A 2V6YB 3ZT7A 4CN4A 4U7YA 2JQKA 5CJ5A 1WFDA 2WY2A 2CPTA 2K3WA 3K1SA 4U3CA 3ZSSA 3ZSTA 2JQ9A 4NIQA 4A5XA 5FVLA 4U31A 4U33A 4U2YA 3ZT6A 3EABA 4P1NA 5CGMA 2XZEA 2LRKA 2V6YA 2MPKA 3ZT5A 2CRBA 2DL1A
chains in the Genus database with same CATH superfamily
2KWHA 2XQ3A 4OFZA 4AISA 3PTRB 5AQTB 5CB4E 1HX1B 2KXPB 2Q9QB 2PG8A 4WYVA 5KXJA 5J0ZA 5DQWA 4Z91A 4P09A 3ZSTA 4PK4A 3JC6D 2VASA 4OYJA 4ZI3D 3WI3A 4IL9A 3SWHA 2UUAT 3RKGA 3C4WA 2I6HA 4DR7T 3AE8A 5LXTE 4PNIA 2K24A 2BDEA 4A97A 3L39A 4JI8T 2LOPA 1D0XA 4C90A 2LSYA 1HR0T 3EDUA 4F6RC 5L2LA 4YTMA 4MLKA 3UFGA 4JUYA 3IF8B 2LT3A 2V26A 3P4PA 3AE3A 2C5IT 3FXDB 3PJAJ 3RIAA 4X1KE 3NVOA 2XZEA 3FZKB 4HWDA 4PJJA 5LHIB 3IHRA 1W9RA 1ZOYA 3TLVA 3SOLA 2VB6A 1MNEA 5EZYE 5ABFB 2EHOD 5DQVA 2N1GA 3NKZA 2J1DG 3RGLA 3U78A 3RLFF 3ZT5A 4O4LE 2E9XD 3F57A 2CLYC 2XAHB 1KK7A 4B3MT 3I0QA 3Q5EA 3P4RA 2YN6A 2WWUA 1B7TA 2WU2A 4WW0A 2UUBT 1SA0E 4UELA 3W15B 4DBQA 2VVSA 4AKGA 3N5LA 2NTXA 3UUNA 4GIWA 3P50A 4K0UA 4JI5T 4DR3T 5HEUA 3CVRA 2V7KA 2WDRA 4KHZF 2UXXB 3PJAA 5AQUB 1VOMA 2JQ9A 4DV5T 2RA1A 3C50A 3UU4A 5ABFA 3HI2A 4CXYA 1IBLT 4L5GA 2W0GA 1US7B 3F31A 1SE7A 3ZEFB 4UV9B 3RIUA 3PUZF 2CMRA 3N9QA 2YINA 4GK0E 4TNVA 3A8YC 1FJGT 2L8KA 2W62A 2V7LA 3ZMZB 5LBMA 4F8HA 2BS3A 3OKQA 2CM0A 3P4QA 3QB5K 3UT5E 4EEDA 5M4YA 1ZHCA 5JDGA 2FJDA 4ILAA 1BR4A 2H3RA 3LK3B 3T1HT 1Z8UA 2CHOA 2CWYA 1KEYA 5CA0E 2BG9B 4BJMA 3C98B 3KVBA 2BG9E 2A9UA 3HKCE 4B3RT 3ETUA 3LJCA 5EK2A 3E08A 4ZI2D 4DR4T 2ZMAA 3Q5WA 3ZCIA 4QXHB 2OA5A 1SHZC 4YXDA 5AQHB 4U7IA 4LFCT 4JI3T 3BQIA 3LDQB 4C91A 2I59A 2HN2A 3ZJ2A 4HEAA 4ZHQE 4DV0T 3PUQA 2DWGA 2N9DA 2LHRA 4EEBA 4YSZA 1CUNA 3ANWB 3O1HA 5LJMA 3RC8A 3T8OA 5FY1A 2BG9A 3R6NA 2DLRA 3MKDA 1G73A 3BQKA 1M7KA 4BJNA 4H63V 2Q9QC 5L47A 1M62A 2KINB 4AIUA 3ZLIA 1UX5A 5L3BB 2J47A 3FZFB 4AKIA 1HF8A 3J9X1 3I1AA 5CJ5A 1BR2A 4QHOA 1HG2A 2UXBT 2XTLA 3OJAA 2VKDA 5TAOA 1WR6A 3RHWA 4YTPA 3VR9A 2V7MA 5IYZE 1CHUA 1J5WA 4O8SA 2IW5B 2CXFA 4LF4T 3RPUA 3ZMTB 4PFOA 3JAEA 3LSVA 2X51A 4HE8A 2PBIA 5AQKB 2XM2A 4X5TA 4TN7B 3PUYF 1XMOT 2E5VA 2IC9A 2BZBA 5HYAA 2QA7A 4TZ4C 3AE7A 1MIYA 4QX8B 4EYYR 3AB3B 2D5UA 2X9HA 3ZPOA 2Z6EA 5EK4A 4WZXA 3O4XE 1N34T 2IHR1 2H7VC 4ZI7E 3M65A 2CE7A 4LMJA 4IDNA 3FZMB 3K1SA 4HFHA 5L3FB 5L3GB 4H9QC 4DO0A 2JMHA 1YXRA 2UXCT 3H3AA 4HN9A 2LM9A 4G63A 4OYKA 1WCRA 1S35A 2D2SA 1UX4A 1O3XA 3RI5A 3RIFA 5JREA 1VRBA 2LLYA 3DP7A 2X0LB 2EHOB 5F8PA 2LRKA 4TV8E 1BR1A 2YU2A 1MNDA 1QLBA 2MTQA 2RP4A 5ABEA 1DU2A 4E7SA 2LSKA 4DV2T 3AVSA 2YDSA 4U72A 4GKJT 5LMNT 5HXSA 4DV6T 3PUSA 1IJ6A 3CKDA 2WS3A 3N2OA 4PW8A 2CWOA 3PUWF 3AEGA 3UUXB 2CA5A 4JLEA 4A5XA 2V1DB 3PUVF 1QUUA 4X66T 1WRDA 3AA1B 3CWZB 4QH5A 4IDOA 4EIWA 5FY7A 2D0UA 5C2TA 2EHOA 1KFYA 3RX6A 2XAJB 2BKNA 4E7ZA 3DTOA 4ZZCA 2E9XA 4MFRA 2WDVA 2BS2A 4JEHB 2V5DA 3Q5DA 2DHRA 5JRCA 4DUZT 4JI6T 2NP9A 2XY8B 5HEOA 2XAGB 4WBOA 4UR9A 4DR6T 2VKHA 4P0AA 2IC6A 3OBVE 3Q2MA 2ACXA 4TWHA 1E2AA 2Y48B 2LRLA 2ODUA 4KX6A 2H88A 3AAEB 2W00A 4MALA 4H9NC 3ETVA 5FVLA 3KINB 2CBIA 2BVMA 4NPPA 3V5SA 3NWIA 4CN1A 2AXDS 2OV9A 5JDLA 4IDZA 4AQFA 4CI3B 4CZZB 3QNUA 1UGOA 2M67A 3VKHA 4QXCB 1EZ3A 2LSGA 1HX8A 2JIWA 2VL8A 3KBUA 2X66A 1FMWA 2XQ5A 5FYMA 3P7IA 3QK6A 2QYWA 5HXHA 2CCQA 4EAHA 3RYHE 5C3JA 2A72A 3AE9A 3AE4A 2VKJA 2KNDA 2I0MA 1D0YA 3IBPA 4UEMA 2VK9A 4PK5A 3UU3A 3CX6B 1YKEB 4I43B 4UXNB 5AQVB 3AA7B 4I0UA 3AA0B 4UVAB 5AQNB 4X65T 4KHPT 2MBGA 5J2TE 2B1EA 3MACA 2XQ9A 1YKHB 1YW0A 4YSXA 2LEHA 2WZHA 2BVLA 2XQ7A 2XQYA 2X68A 1KNPA 4LMLA 3JC6C 3MZKB 3MJXA 2XASB 3M3ZB 2XHEB 3AE5A 4O4HE 5KX5E 4FI5A 3LBXB 3F2EA 2FUPA 2VWAA 1HFAA 4AI6A 2IIUA 4NXMT 3N2GE 2BKPA 4QH1A 1MMAA 1MMNA 2E5LT 2XQAA 4PFPA 4QH4A 5AFUL 5JTGA 4X1IE 5JDMA 4L0RA 3ZMSB 4P1NA 3HKEE 3RQWA 4LF6T 4GKKT 3RQUA 2K48A 3RRCA 4OHFA 4GYRA 1XNQT 1OXZA 4ZS2A 2LSJA 3NRXA 5FL1A 2YDQA 2DWKA 3RRWA 3P4WA 3AXJA 3HA4A 1N36T 1ZV4X 3FHNA 2WWVA 4U74A 5L4HA 3GWHA 2IUBA 2V7JA 4WBNE 5F3JA 3LBXA 5LMUT 1FEWA 3JAFA 3KV9A 3O1IA 1G8XA 2WM9A 3PUXF 3CX8B 5AQIB 2YKSA 1LVFA 4AXPA 2IDOB 3WAKA 2LOSA 4DUYT 3MA9A 2AE9A 1MIVA 2LE8A 1E7PA 2MPKA 3BQLA 5HAXA 4O4IE 5LNKA 4DMWA 3TLUA 1XMQT 5LP6E 3N9LA 4I4TE 2CHNA 1OWAA 2P9BA 1MMDA 2VKOA 5AQLB 3OYZA 2X67A 3KBTA 1J1JA 4XBFB 3AEAA 2PFVA 2LKHA 2NW8A 2RPAA 2XQ6A 2ZLYA 5AQGB 4HFVA 3GN5B 4EZHA 3FB2A 3WAJA 5IWAT 2ZM6T 5ABHA 4PJNA 3NRYA 5AQSB 3OTOT 5JR9A 4YLHA 5DJQC 4X64T 2UUCT 2MYSA 3NZQA 4CI1B 3RF1A 3VRBA 1IZNB 2WU5A 3GMIA 4Q25A 1NEKA 3X1DA 5FKYA 1X9BA 2ZM8A 4JI0T 3QC9A 3O9XA 2CXLA 2X0HA 2V5CA 4QKNA 4CXWA 2FJBA 5H6QB 2YK0A 4CXXA 5JVDE 4HKAA 5JDNA 3QB5A 5FMNA 3GN5A 4ILBA 2FBWA 3JADA 1D1AA 4EZ4A 2C5KT 3LG7A 2E8IA 3SS1A 1HS7A 1D1BA 4P0BA 4IT4A 1W0AA 3AAAB 2MOZA 5LGUB 3UU6A 2X9WA 4IE5A 2SPCA 5AQQB 4OX9T 4B3ST 3AVRA 5J1GA 3UULA 3HR0A 3V5UA 3H3MA 5HXRA 3JCFA 3AAIA 2JQHA 3H37A 4B3TT 4I55E 4CN6A 1J5ET 3TLTA 2L3LA 4YT0A 1I94T 5BMVE 3DJBA 2QGSA 5AQFB 2R6GF 4AKHA 1W0BA 2QRXA 4QXBB 5HCMA 5HEHA 4IIJE 5LBQB 4NUUA 4JI4T 2J62A 3B13A 4O2BE 4DR5T 2HN1A 3Q9DA 3ZN1B 3E22E 1AJ3A 2VL0A 5CGMA 3RIUC 4ADZA 1NAFA 3IEEA 3HKDE 2JRKA 3R84B 3MK7C 2LSIA 2B76A 2IAKA 4DV1T 3T1YT 2ES0A 5AQOB 2CXDA 5H6RB 2XM1A 2J4GA 1XDOA 2CBJA 3CQGB 3C4XA 5LGTB 4H9PC 2E9XB 3EAMA 4UVBB 3EHZA 3UFEA 1NWMX 5LA6E 2LJLA 5JRCB 4CI2B 2WZIA 3ZMVB 2C5JA 4EB6E 4J2CA 3KDSE 5IHYA 4YJ3E 1ZKEA 3P4SA 3FBLA 5L3EB 3A5XA 5LG4A 3TKLB 4YSYA 5L4EA 3TLWA 2W61A 1L0VA 4LF5T 2L9QA 5ABGA 3NZPA 2CRBA 5JDQA 2CEAA 3RKOA 3PDYA 2KLQA 4YHJA 1LVKA 4TNWA 4LF9T 2XSBA 3D0TA 5LGNB 5LJNA 3VKGA 1HG5A 2W67A 3AEEA 5FY0A 3ZJ1A 3VHLA 2PTFA 3KV4A 3FBZA 2BG9C 3K3NA 2DNXA 4BA9A 3UQ7A 3EUHA 4IREA 4PJMA 3MXZA 1YQ4A 4ILUA 1U4QA 3P8CD 3ZN0B 3L8RA 3CPZA 3PUGA 2WSSV 4JEUB 4DVDA 4NIQA 3UUBA 2DCFA 2DL1A 5JDFA 3I9WA 4IDPA 3I9YA 4PK6A 5JDHA 3TLSA 2K5BB 1FMVA 2XSAA 3LK2B 5JQGE 1T98A 4AQYT 1Z0PA 2ZM0A 1YQ3A 2HPLA 3AEDA 3IA3A 4LMKA 3ONXA 1I6ZA 3AE2A 4X1YE 4UIGA 2W2UA 3AEFA 3ESLA 2W4XA 4LFAT 4A98A 2X9YA 3KV6A 4B6XA 2E2AA 2KSRA 3L09A 2CPTA 1UUSA 3ZC1A 5HWXA 5L3DB 4IL4A 3HL6A 2V7IA 4DR2T 2QVAA 4U2ZA 4JV5T 4EOZB 1WR0A 1YD8G 2OLTA 3KFWX 4HWFA 1OEDB 4IDQA 3UTKA 4U31A 3PE0A 4GOUA 1OEDE 4KBMB 2Q9QA 2YEVC 2JQQA 2LM2A 3AXJB 1KNZA 1BR0A 3PURA 2M6IA 4ZI3C 4DV3T 2M6BA 2YOEA 5HXEA 4QX7B 5LCYA 2VQFT 2VURA 4YJ2E 1N33T 1D1CA 4JI2T 2KT9A 3ZCJA 4V1Av 1HNWT 4H9OC 4ZZBA 3FXEB 3ZYKA 4GK5E 4TWDA 1XZYA 4IHJE 5FXWA 2HPJA 2Y8DA 1ZP0A 5AQRB 2VQET 4FJOA 3N9MA 4WNKA 2D0TA 2UXNB 1SUMB 2X9XA 2XPKA 4IE4A 3K8PC 5ADXL 4ZEYA 3BK9A 1OEDA 3SFEA 3ZT7A 4QWNB 2YDRA 4DV7T 4LF8T 4YY3T 4EV6A 4HFBA 1JNZA 3N9PA 2WCAA 2X0YA 3C64A 3RYCE 1HTJF 2WBLA 3VR8A 3OVUA 5KDMC 2NWBA 5AQJB 4CN4A 4Z8XA 2JQKA 4NXNT 2EHOC 1WFDA 2XJ7A 4DMVA 2E9XC 3B5MA 3NBXX 3N9OA 3RYIE 3ZYMA 3EVYA 1KF6A 3B57A 2UXDT 3AE1A 4H9RC 4EYUA 5LG3A 4PAGA 4ANJA 4KI0F 1Y64B 5JR9B 1XWMA 3J7Yq 5HXCA 3SRZA 4O4JE 3E0ZA 1KNRA 3SFDA 2WMOA 1W09A 5J2UE 1XDPA 2BBHA 2Q9QD 3N2KE 4DV4T 4COFA 5FNVE 2VVNA 1HNXT 3RH3A 3CK6A 2H7OA 3LK42 2FJEA 3OPCA 2W66A 3S4UA 3ZYLA 4M1PA 2A2FX 3PU3A 4AQFC 1WYCA 3K3QC 4ASKA 5GONE 1JNRA 2H89A 1MIWA 4K0KT 2ODVA 1IJ5A 5CFBA 4MBQA 1H7CA 3G06A 2WMNA 3ONJA 5ETWA 3VU7H 2BBJA 5L3CB 4AKRB 3UUMA 4XZCA 4N78D 3GA8A 5HCJA 4CQIA 4O2AE 3ZC0A 1QSDA 3QUJA 4ISTA 3CIRA 4YHHT 5LHGB 3Q5XA 4AQGA 4U7YA 4IE7A 1NENA 2WP9A 2WY2A 2K9AA 4HTEA 3U3IA 2JMKA 3ZKRA 2V8SV 2XAQB 4A56A 1HNZT 3RYFE 4GYSA 3CQCB 3PU8A 5JH7E 3KVAA 4UF0B 5IUXA 2XUEA 3PUAA 4PJLA 2D9DA 1D0ZA 5AQPB 3KV5A 4KMCA 2DI4A 4U3CA 3ZSSA 3UU5A 4DIDB 1MMGA 3VRAA 3FZLB 2PJQA 1VCTA 4JI1T 4LF7T 4MHCA 4ZI2C 2XQ8A 2GK9A 2WQYA 3FZHB 4AKLA 2ACZA 4HWHA 4G2AA 4DNDA 4ISSA 4DBRA 3A7MA 4U33A 2LKGA 4KP3C 3AECA 1X79A 5HWYA 3C51A 5HEJA 5LYJE 2V6YB 2MAWA 5EK3A 2A3DA 5FXZA 3OYXA 5E0OA 3L3PA 5LHHB 2CLYB 4X62T 3ANWA 1VCSA 3QOFA 4XAXB 4UF0A 5DABA 2FJAA 3ONLC 4X20E 1U5PA 4DR1T 2NR4A 2N2NA 1V9DA 1OEDC 2HHHT 1IBKT 1LRZA 4IE0A 2LHNA 4BAYB 2NW7A 4EGWA 4H63H 3AEBA 3AA6B 3ZMUB 1Y01A 4HWIB 3K3OA 4ZS3A 3I0OA 4HFIA 2NTYA 5A1LA 1WYBA 3UQ4A 1ZEEA 5C8YE 3AE6A 3EABA 2KZ7B 2V6YA 3ABVA 4HFDA 5KMGP 4TUYE 3EI0A 5LOVE 4EXTA 3RC3A 1N32T 4I50E 4L9IA 4UV8B 1IBMT 2IMLA 4UVCB 4YTNA 5CA1E 2KMFA 2BS4A 2KWIB 1T8BA 3CQXC 4KUMB 4OK0A 1GQEA 3CX7B 4H9SE 4IE6A 2WDQA 5BR8T 4NUVA 3N9NA 2XAFB 2F4VT 1T72A 1E1HB 2K3WA 4IGUA 2NOXA 2C0SA 4U2YA 3ZT6A 2G0UA 1IAPA 4ZXLA 2V6XA 3UU8A 5FVKA 4TX5A 2Y6XA 5FXXA 2YU1A 4HGAA 4HFEA 4ERRA 1UURA 3PV0F 4Z90A 1UCUA 1HCIA 1WLXA 5HEGA 1LKXA 2XQ4A 4TV9E 3LFMA 5FXVA 5AQMB 3O1JA 4ZOLE 4ILCA 2WB5A 4HFCA 5FP3A 5JR9C 5FL0A 3HKBE 2ZM2A 4YFSA 2NW9A 4JYAT 2UU9T 1UK5A 2JJ9A 4TWFA 2W63A 5F5WA 4JBWF 2WAUA 4JI7T 2JPFA 1XNRT 1T7SA 5LB7B 2BKOA 3C4ZA 4LFBT 1S94A 2HH7A 4HWCA 3CMLA 1R8IA 1FIOA 3EDVA
chains in the Genus database with same CATH topology
4CN1A 2V6XA 1YXRA 2A9UA 5FVKA 2W2UA 2WWVA 4U7IA 1WR0A 5LB7B 4WZXA 2RPAA 2JQHA 4U2ZA 4ZEYA 2LRLA 4IT4A 1WCRA 4CN6A 2V6YB 3ZT7A 4CN4A 4U7YA 2JQKA 5CJ5A 1WFDA 2WY2A 2CPTA 2K3WA 3K1SA 4U3CA 3ZSSA 3ZSTA 2JQ9A 4NIQA 4A5XA 5FVLA 4U31A 4U33A 4U2YA 3ZT6A 3EABA 4P1NA 5CGMA 2XZEA 2LRKA 2V6YA 2MPKA 3ZT5A 2CRBA 2DL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CN1 A;  2V6X A;  1YXR A;  2A9U A;  5FVK A;  2W2U A;  2WWV A;  4U7I A;  1WR0 A;  5LB7 B;  4WZX A;  2RPA A;  2JQH A;  4U2Z A;  4ZEY A;  2LRL A;  4IT4 A;  1WCR A;  4CN6 A;  2V6Y B;  3ZT7 A;  4CN4 A;  4U7Y A;  2JQK A;  5CJ5 A;  1WFD A;  2WY2 A;  2CPT A;  2K3W A;  3K1S A;  4U3C A;  3ZSS A;  3ZST A;  2JQ9 A;  4NIQ A;  4A5X A;  5FVL A;  4U31 A;  4U33 A;  4U2Y A;  3ZT6 A;  3EAB A;  4P1N A;  5CGM A;  2XZE A;  2LRK A;  2V6Y A;  2MPK A;  3ZT5 A;  2CRB A;  2DL1 A; 
#chains in the Genus database with same CATH topology
 2KWH A;  2XQ3 A;  4OFZ A;  4AIS A;  3PTR B;  5AQT B;  5CB4 E;  1HX1 B;  2KXP B;  2Q9Q B;  2PG8 A;  4WYV A;  5KXJ A;  5J0Z A;  5DQW A;  4Z91 A;  4P09 A;  3ZST A;  4PK4 A;  3JC6 D;  2VAS A;  4OYJ A;  4ZI3 D;  3WI3 A;  4IL9 A;  3SWH A;  2UUA T;  3RKG A;  3C4W A;  2I6H A;  4DR7 T;  3AE8 A;  5LXT E;  4PNI A;  2K24 A;  2BDE A;  4A97 A;  3L39 A;  4JI8 T;  2LOP A;  1D0X A;  4C90 A;  2LSY A;  1HR0 T;  3EDU A;  4F6R C;  5L2L A;  4YTM A;  4MLK A;  3UFG A;  4JUY A;  3IF8 B;  2LT3 A;  2V26 A;  3P4P A;  3AE3 A;  2C5I T;  3FXD B;  3PJA J;  3RIA A;  4X1K E;  3NVO A;  2XZE A;  3FZK B;  4HWD A;  4PJJ A;  5LHI B;  3IHR A;  1W9R A;  1ZOY A;  3TLV A;  3SOL A;  2VB6 A;  1MNE A;  5EZY E;  5ABF B;  2EHO D;  5DQV A;  2N1G A;  3NKZ A;  2J1D G;  3RGL A;  3U78 A;  3RLF F;  3ZT5 A;  4O4L E;  2E9X D;  3F57 A;  2CLY C;  2XAH B;  1KK7 A;  4B3M T;  3I0Q A;  3Q5E A;  3P4R A;  2YN6 A;  2WWU A;  1B7T A;  2WU2 A;  4WW0 A;  2UUB T;  1SA0 E;  4UEL A;  3W15 B;  4DBQ A;  2VVS A;  4AKG A;  3N5L A;  2NTX A;  3UUN A;  4GIW A;  3P50 A;  4K0U A;  4JI5 T;  4DR3 T;  5HEU A;  3CVR A;  2V7K A;  2WDR A;  4KHZ F;  2UXX B;  3PJA A;  5AQU B;  1VOM A;  2JQ9 A;  4DV5 T;  2RA1 A;  3C50 A;  3UU4 A;  5ABF A;  3HI2 A;  4CXY A;  1IBL T;  4L5G A;  2W0G A;  1US7 B;  3F31 A;  1SE7 A;  3ZEF B;  4UV9 B;  3RIU A;  3PUZ F;  2CMR A;  3N9Q A;  2YIN A;  4GK0 E;  4TNV A;  3A8Y C;  1FJG T;  2L8K A;  2W62 A;  2V7L A;  3ZMZ B;  5LBM A;  4F8H A;  2BS3 A;  3OKQ A;  2CM0 A;  3P4Q A;  3QB5 K;  3UT5 E;  4EED A;  5M4Y A;  1ZHC A;  5JDG A;  2FJD A;  4ILA A;  1BR4 A;  2H3R A;  3LK3 B;  3T1H T;  1Z8U A;  2CHO A;  2CWY A;  1KEY A;  5CA0 E;  2BG9 B;  4BJM A;  3C98 B;  3KVB A;  2BG9 E;  2A9U A;  3HKC E;  4B3R T;  3ETU A;  3LJC A;  5EK2 A;  3E08 A;  4ZI2 D;  4DR4 T;  2ZMA A;  3Q5W A;  3ZCI A;  4QXH B;  2OA5 A;  1SHZ C;  4YXD A;  5AQH B;  4U7I A;  4LFC T;  4JI3 T;  3BQI A;  3LDQ B;  4C91 A;  2I59 A;  2HN2 A;  3ZJ2 A;  4HEA A;  4ZHQ E;  4DV0 T;  3PUQ A;  2DWG A;  2N9D A;  2LHR A;  4EEB A;  4YSZ A;  1CUN A;  3ANW B;  3O1H A;  5LJM A;  3RC8 A;  3T8O A;  5FY1 A;  2BG9 A;  3R6N A;  2DLR A;  3MKD A;  1G73 A;  3BQK A;  1M7K A;  4BJN A;  4H63 V;  2Q9Q C;  5L47 A;  1M62 A;  2KIN B;  4AIU A;  3ZLI A;  1UX5 A;  5L3B B;  2J47 A;  3FZF B;  4AKI A;  1HF8 A;  3J9X 1;  3I1A A;  5CJ5 A;  1BR2 A;  4QHO A;  1HG2 A;  2UXB T;  2XTL A;  3OJA A;  2VKD A;  5TAO A;  1WR6 A;  3RHW A;  4YTP A;  3VR9 A;  2V7M A;  5IYZ E;  1CHU A;  1J5W A;  4O8S A;  2IW5 B;  2CXF A;  4LF4 T;  3RPU A;  3ZMT B;  4PFO A;  3JAE A;  3LSV A;  2X51 A;  4HE8 A;  2PBI A;  5AQK B;  2XM2 A;  4X5T A;  4TN7 B;  3PUY F;  1XMO T;  2E5V A;  2IC9 A;  2BZB A;  5HYA A;  2QA7 A;  4TZ4 C;  3AE7 A;  1MIY A;  4QX8 B;  4EYY R;  3AB3 B;  2D5U A;  2X9H A;  3ZPO A;  2Z6E A;  5EK4 A;  4WZX A;  3O4X E;  1N34 T;  2IHR 1;  2H7V C;  4ZI7 E;  3M65 A;  2CE7 A;  4LMJ A;  4IDN A;  3FZM B;  3K1S A;  4HFH A;  5L3F B;  5L3G B;  4H9Q C;  4DO0 A;  2JMH A;  1YXR A;  2UXC T;  3H3A A;  4HN9 A;  2LM9 A;  4G63 A;  4OYK A;  1WCR A;  1S35 A;  2D2S A;  1UX4 A;  1O3X A;  3RI5 A;  3RIF A;  5JRE A;  1VRB A;  2LLY A;  3DP7 A;  2X0L B;  2EHO B;  5F8P A;  2LRK A;  4TV8 E;  1BR1 A;  2YU2 A;  1MND A;  1QLB A;  2MTQ A;  2RP4 A;  5ABE A;  1DU2 A;  4E7S A;  2LSK A;  4DV2 T;  3AVS A;  2YDS A;  4U72 A;  4GKJ T;  5LMN T;  5HXS A;  4DV6 T;  3PUS A;  1IJ6 A;  3CKD A;  2WS3 A;  3N2O A;  4PW8 A;  2CWO A;  3PUW F;  3AEG A;  3UUX B;  2CA5 A;  4JLE A;  4A5X A;  2V1D B;  3PUV F;  1QUU A;  4X66 T;  1WRD A;  3AA1 B;  3CWZ B;  4QH5 A;  4IDO A;  4EIW A;  5FY7 A;  2D0U A;  5C2T A;  2EHO A;  1KFY A;  3RX6 A;  2XAJ B;  2BKN A;  4E7Z A;  3DTO A;  4ZZC A;  2E9X A;  4MFR A;  2WDV A;  2BS2 A;  4JEH B;  2V5D A;  3Q5D A;  2DHR A;  5JRC A;  4DUZ T;  4JI6 T;  2NP9 A;  2XY8 B;  5HEO A;  2XAG B;  4WBO A;  4UR9 A;  4DR6 T;  2VKH A;  4P0A A;  2IC6 A;  3OBV E;  3Q2M A;  2ACX A;  4TWH A;  1E2A A;  2Y48 B;  2LRL A;  2ODU A;  4KX6 A;  2H88 A;  3AAE B;  2W00 A;  4MAL A;  4H9N C;  3ETV A;  5FVL A;  3KIN B;  2CBI A;  2BVM A;  4NPP A;  3V5S A;  3NWI A;  4CN1 A;  2AXD S;  2OV9 A;  5JDL A;  4IDZ A;  4AQF A;  4CI3 B;  4CZZ B;  3QNU A;  1UGO A;  2M67 A;  3VKH A;  4QXC B;  1EZ3 A;  2LSG A;  1HX8 A;  2JIW A;  2VL8 A;  3KBU A;  2X66 A;  1FMW A;  2XQ5 A;  5FYM A;  3P7I A;  3QK6 A;  2QYW A;  5HXH A;  2CCQ A;  4EAH A;  3RYH E;  5C3J A;  2A72 A;  3AE9 A;  3AE4 A;  2VKJ A;  2KND A;  2I0M A;  1D0Y A;  3IBP A;  4UEM A;  2VK9 A;  4PK5 A;  3UU3 A;  3CX6 B;  1YKE B;  4I43 B;  4UXN B;  5AQV B;  3AA7 B;  4I0U A;  3AA0 B;  4UVA B;  5AQN B;  4X65 T;  4KHP T;  2MBG A;  5J2T E;  2B1E A;  3MAC A;  2XQ9 A;  1YKH B;  1YW0 A;  4YSX A;  2LEH A;  2WZH A;  2BVL A;  2XQ7 A;  2XQY A;  2X68 A;  1KNP A;  4LML A;  3JC6 C;  3MZK B;  3MJX A;  2XAS B;  3M3Z B;  2XHE B;  3AE5 A;  4O4H E;  5KX5 E;  4FI5 A;  3LBX B;  3F2E A;  2FUP A;  2VWA A;  1HFA A;  4AI6 A;  2IIU A;  4NXM T;  3N2G E;  2BKP A;  4QH1 A;  1MMA A;  1MMN A;  2E5L T;  2XQA A;  4PFP A;  4QH4 A;  5AFU L;  5JTG A;  4X1I E;  5JDM A;  4L0R A;  3ZMS B;  4P1N A;  3HKE E;  3RQW A;  4LF6 T;  4GKK T;  3RQU A;  2K48 A;  3RRC A;  4OHF A;  4GYR A;  1XNQ T;  1OXZ A;  4ZS2 A;  2LSJ A;  3NRX A;  5FL1 A;  2YDQ A;  2DWK A;  3RRW A;  3P4W A;  3AXJ A;  3HA4 A;  1N36 T;  1ZV4 X;  3FHN A;  2WWV A;  4U74 A;  5L4H A;  3GWH A;  2IUB A;  2V7J A;  4WBN E;  5F3J A;  3LBX A;  5LMU T;  1FEW A;  3JAF A;  3KV9 A;  3O1I A;  1G8X A;  2WM9 A;  3PUX F;  3CX8 B;  5AQI B;  2YKS A;  1LVF A;  4AXP A;  2IDO B;  3WAK A;  2LOS A;  4DUY T;  3MA9 A;  2AE9 A;  1MIV A;  2LE8 A;  1E7P A;  2MPK A;  3BQL A;  5HAX A;  4O4I E;  5LNK A;  4DMW A;  3TLU A;  1XMQ T;  5LP6 E;  3N9L A;  4I4T E;  2CHN A;  1OWA A;  2P9B A;  1MMD A;  2VKO A;  5AQL B;  3OYZ A;  2X67 A;  3KBT A;  1J1J A;  4XBF B;  3AEA A;  2PFV A;  2LKH A;  2NW8 A;  2RPA A;  2XQ6 A;  2ZLY A;  5AQG B;  4HFV A;  3GN5 B;  4EZH A;  3FB2 A;  3WAJ A;  5IWA T;  2ZM6 T;  5ABH A;  4PJN A;  3NRY A;  5AQS B;  3OTO T;  5JR9 A;  4YLH A;  5DJQ C;  4X64 T;  2UUC T;  2MYS A;  3NZQ A;  4CI1 B;  3RF1 A;  3VRB A;  1IZN B;  2WU5 A;  3GMI A;  4Q25 A;  1NEK A;  3X1D A;  5FKY A;  1X9B A;  2ZM8 A;  4JI0 T;  3QC9 A;  3O9X A;  2CXL A;  2X0H A;  2V5C A;  4QKN A;  4CXW A;  2FJB A;  5H6Q B;  2YK0 A;  4CXX A;  5JVD E;  4HKA A;  5JDN A;  3QB5 A;  5FMN A;  3GN5 A;  4ILB A;  2FBW A;  3JAD A;  1D1A A;  4EZ4 A;  2C5K T;  3LG7 A;  2E8I A;  3SS1 A;  1HS7 A;  1D1B A;  4P0B A;  4IT4 A;  1W0A A;  3AAA B;  2MOZ A;  5LGU B;  3UU6 A;  2X9W A;  4IE5 A;  2SPC A;  5AQQ B;  4OX9 T;  4B3S T;  3AVR A;  5J1G A;  3UUL A;  3HR0 A;  3V5U A;  3H3M A;  5HXR A;  3JCF A;  3AAI A;  2JQH A;  3H37 A;  4B3T T;  4I55 E;  4CN6 A;  1J5E T;  3TLT A;  2L3L A;  4YT0 A;  1I94 T;  5BMV E;  3DJB A;  2QGS A;  5AQF B;  2R6G F;  4AKH A;  1W0B A;  2QRX A;  4QXB B;  5HCM A;  5HEH A;  4IIJ E;  5LBQ B;  4NUU A;  4JI4 T;  2J62 A;  3B13 A;  4O2B E;  4DR5 T;  2HN1 A;  3Q9D A;  3ZN1 B;  3E22 E;  1AJ3 A;  2VL0 A;  5CGM A;  3RIU C;  4ADZ A;  1NAF A;  3IEE A;  3HKD E;  2JRK A;  3R84 B;  3MK7 C;  2LSI A;  2B76 A;  2IAK A;  4DV1 T;  3T1Y T;  2ES0 A;  5AQO B;  2CXD A;  5H6R B;  2XM1 A;  2J4G A;  1XDO A;  2CBJ A;  3CQG B;  3C4X A;  5LGT B;  4H9P C;  2E9X B;  3EAM A;  4UVB B;  3EHZ A;  3UFE A;  1NWM X;  5LA6 E;  2LJL A;  5JRC B;  4CI2 B;  2WZI A;  3ZMV B;  2C5J A;  4EB6 E;  4J2C A;  3KDS E;  5IHY A;  4YJ3 E;  1ZKE A;  3P4S A;  3FBL A;  5L3E B;  3A5X A;  5LG4 A;  3TKL B;  4YSY A;  5L4E A;  3TLW A;  2W61 A;  1L0V A;  4LF5 T;  2L9Q A;  5ABG A;  3NZP A;  2CRB A;  5JDQ A;  2CEA A;  3RKO A;  3PDY A;  2KLQ A;  4YHJ A;  1LVK A;  4TNW A;  4LF9 T;  2XSB A;  3D0T A;  5LGN B;  5LJN A;  3VKG A;  1HG5 A;  2W67 A;  3AEE A;  5FY0 A;  3ZJ1 A;  3VHL A;  2PTF A;  3KV4 A;  3FBZ A;  2BG9 C;  3K3N A;  2DNX A;  4BA9 A;  3UQ7 A;  3EUH A;  4IRE A;  4PJM A;  3MXZ A;  1YQ4 A;  4ILU A;  1U4Q A;  3P8C D;  3ZN0 B;  3L8R A;  3CPZ A;  3PUG A;  2WSS V;  4JEU B;  4DVD A;  4NIQ A;  3UUB A;  2DCF A;  2DL1 A;  5JDF A;  3I9W A;  4IDP A;  3I9Y A;  4PK6 A;  5JDH A;  3TLS A;  2K5B B;  1FMV A;  2XSA A;  3LK2 B;  5JQG E;  1T98 A;  4AQY T;  1Z0P A;  2ZM0 A;  1YQ3 A;  2HPL A;  3AED A;  3IA3 A;  4LMK A;  3ONX A;  1I6Z A;  3AE2 A;  4X1Y E;  4UIG A;  2W2U A;  3AEF A;  3ESL A;  2W4X A;  4LFA T;  4A98 A;  2X9Y A;  3KV6 A;  4B6X A;  2E2A A;  2KSR A;  3L09 A;  2CPT A;  1UUS A;  3ZC1 A;  5HWX A;  5L3D B;  4IL4 A;  3HL6 A;  2V7I A;  4DR2 T;  2QVA A;  4U2Z A;  4JV5 T;  4EOZ B;  1WR0 A;  1YD8 G;  2OLT A;  3KFW X;  4HWF A;  1OED B;  4IDQ A;  3UTK A;  4U31 A;  3PE0 A;  4GOU A;  1OED E;  4KBM B;  2Q9Q A;  2YEV C;  2JQQ A;  2LM2 A;  3AXJ B;  1KNZ A;  1BR0 A;  3PUR A;  2M6I A;  4ZI3 C;  4DV3 T;  2M6B A;  2YOE A;  5HXE A;  4QX7 B;  5LCY A;  2VQF T;  2VUR A;  4YJ2 E;  1N33 T;  1D1C A;  4JI2 T;  2KT9 A;  3ZCJ A;  4V1A v;  1HNW T;  4H9O C;  4ZZB A;  3FXE B;  3ZYK A;  4GK5 E;  4TWD A;  1XZY A;  4IHJ E;  5FXW A;  2HPJ A;  2Y8D A;  1ZP0 A;  5AQR B;  2VQE T;  4FJO A;  3N9M A;  4WNK A;  2D0T A;  2UXN B;  1SUM B;  2X9X A;  2XPK A;  4IE4 A;  3K8P C;  5ADX L;  4ZEY A;  3BK9 A;  1OED A;  3SFE A;  3ZT7 A;  4QWN B;  2YDR A;  4DV7 T;  4LF8 T;  4YY3 T;  4EV6 A;  4HFB A;  1JNZ A;  3N9P A;  2WCA A;  2X0Y A;  3C64 A;  3RYC E;  1HTJ F;  2WBL A;  3VR8 A;  3OVU A;  5KDM C;  2NWB A;  5AQJ B;  4CN4 A;  4Z8X A;  2JQK A;  4NXN T;  2EHO C;  1WFD A;  2XJ7 A;  4DMV A;  2E9X C;  3B5M A;  3NBX X;  3N9O A;  3RYI E;  3ZYM A;  3EVY A;  1KF6 A;  3B57 A;  2UXD T;  3AE1 A;  4H9R C;  4EYU A;  5LG3 A;  4PAG A;  4ANJ A;  4KI0 F;  1Y64 B;  5JR9 B;  1XWM A;  3J7Y q;  5HXC A;  3SRZ A;  4O4J E;  3E0Z A;  1KNR A;  3SFD A;  2WMO A;  1W09 A;  5J2U E;  1XDP A;  2BBH A;  2Q9Q D;  3N2K E;  4DV4 T;  4COF A;  5FNV E;  2VVN A;  1HNX T;  3RH3 A;  3CK6 A;  2H7O A;  3LK4 2;  2FJE A;  3OPC A;  2W66 A;  3S4U A;  3ZYL A;  4M1P A;  2A2F X;  3PU3 A;  4AQF C;  1WYC A;  3K3Q C;  4ASK A;  5GON E;  1JNR A;  2H89 A;  1MIW A;  4K0K T;  2ODV A;  1IJ5 A;  5CFB A;  4MBQ A;  1H7C A;  3G06 A;  2WMN A;  3ONJ A;  5ETW A;  3VU7 H;  2BBJ A;  5L3C B;  4AKR B;  3UUM A;  4XZC A;  4N78 D;  3GA8 A;  5HCJ A;  4CQI A;  4O2A E;  3ZC0 A;  1QSD A;  3QUJ A;  4IST A;  3CIR A;  4YHH T;  5LHG B;  3Q5X A;  4AQG A;  4U7Y A;  4IE7 A;  1NEN A;  2WP9 A;  2WY2 A;  2K9A A;  4HTE A;  3U3I A;  2JMK A;  3ZKR A;  2V8S V;  2XAQ B;  4A56 A;  1HNZ T;  3RYF E;  4GYS A;  3CQC B;  3PU8 A;  5JH7 E;  3KVA A;  4UF0 B;  5IUX A;  2XUE A;  3PUA A;  4PJL A;  2D9D A;  1D0Z A;  5AQP B;  3KV5 A;  4KMC A;  2DI4 A;  4U3C A;  3ZSS A;  3UU5 A;  4DID B;  1MMG A;  3VRA A;  3FZL B;  2PJQ A;  1VCT A;  4JI1 T;  4LF7 T;  4MHC A;  4ZI2 C;  2XQ8 A;  2GK9 A;  2WQY A;  3FZH B;  4AKL A;  2ACZ A;  4HWH A;  4G2A A;  4DND A;  4ISS A;  4DBR A;  3A7M A;  4U33 A;  2LKG A;  4KP3 C;  3AEC A;  1X79 A;  5HWY A;  3C51 A;  5HEJ A;  5LYJ E;  2V6Y B;  2MAW A;  5EK3 A;  2A3D A;  5FXZ A;  3OYX A;  5E0O A;  3L3P A;  5LHH B;  2CLY B;  4X62 T;  3ANW A;  1VCS A;  3QOF A;  4XAX B;  4UF0 A;  5DAB A;  2FJA A;  3ONL C;  4X20 E;  1U5P A;  4DR1 T;  2NR4 A;  2N2N A;  1V9D A;  1OED C;  2HHH T;  1IBK T;  1LRZ A;  4IE0 A;  2LHN A;  4BAY B;  2NW7 A;  4EGW A;  4H63 H;  3AEB A;  3AA6 B;  3ZMU B;  1Y01 A;  4HWI B;  3K3O A;  4ZS3 A;  3I0O A;  4HFI A;  2NTY A;  5A1L A;  1WYB A;  3UQ4 A;  1ZEE A;  5C8Y E;  3AE6 A;  3EAB A;  2KZ7 B;  2V6Y A;  3ABV A;  4HFD A;  5KMG P;  4TUY E;  3EI0 A;  5LOV E;  4EXT A;  3RC3 A;  1N32 T;  4I50 E;  4L9I A;  4UV8 B;  1IBM T;  2IML A;  4UVC B;  4YTN A;  5CA1 E;  2KMF A;  2BS4 A;  2KWI B;  1T8B A;  3CQX C;  4KUM B;  4OK0 A;  1GQE A;  3CX7 B;  4H9S E;  4IE6 A;  2WDQ A;  5BR8 T;  4NUV A;  3N9N A;  2XAF B;  2F4V T;  1T72 A;  1E1H B;  2K3W A;  4IGU A;  2NOX A;  2C0S A;  4U2Y A;  3ZT6 A;  2G0U A;  1IAP A;  4ZXL A;  2V6X A;  3UU8 A;  5FVK A;  4TX5 A;  2Y6X A;  5FXX A;  2YU1 A;  4HGA A;  4HFE A;  4ERR A;  1UUR A;  3PV0 F;  4Z90 A;  1UCU A;  1HCI A;  1WLX A;  5HEG A;  1LKX A;  2XQ4 A;  4TV9 E;  3LFM A;  5FXV A;  5AQM B;  3O1J A;  4ZOL E;  4ILC A;  2WB5 A;  4HFC A;  5FP3 A;  5JR9 C;  5FL0 A;  3HKB E;  2ZM2 A;  4YFS A;  2NW9 A;  4JYA T;  2UU9 T;  1UK5 A;  2JJ9 A;  4TWF A;  2W63 A;  5F5W A;  4JBW F;  2WAU A;  4JI7 T;  2JPF A;  1XNR T;  1T7S A;  5LB7 B;  2BKO A;  3C4Z A;  4LFB T;  1S94 A;  2HH7 A;  4HWC A;  3CML A;  1R8I A;  1FIO A;  3EDV A; 
#chains in the Genus database with same CATH homology
 4CN1 A;  2V6X A;  1YXR A;  2A9U A;  5FVK A;  2W2U A;  2WWV A;  4U7I A;  1WR0 A;  5LB7 B;  4WZX A;  2RPA A;  2JQH A;  4U2Z A;  4ZEY A;  2LRL A;  4IT4 A;  1WCR A;  4CN6 A;  2V6Y B;  3ZT7 A;  4CN4 A;  4U7Y A;  2JQK A;  5CJ5 A;  1WFD A;  2WY2 A;  2CPT A;  2K3W A;  3K1S A;  4U3C A;  3ZSS A;  3ZST A;  2JQ9 A;  4NIQ A;  4A5X A;  5FVL A;  4U31 A;  4U33 A;  4U2Y A;  3ZT6 A;  3EAB A;  4P1N A;  5CGM A;  2XZE A;  2LRK A;  2V6Y A;  2MPK A;  3ZT5 A;  2CRB A;  2DL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...