2V6YA

Structure of the mit domain from a s. solfataricus vps4-like atpase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
75
structure length
75
Chain Sequence
MSAQVMLEDMARKYAILAVKADKEGKVEDAITYYKKAIEVLSQIIVLYPESVARTAYEQMINEYKKRISYLEKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AAA FAMILY ATPASE, P60 KATANIN
publication title Structural Basis for Selective Recognition of Escrt-III by the Aaa ATPase Vps4
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 32
structure length 75
sequence length 75
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2v6yA00
2WWVA 4CN1A 2WY2A 5LB7B 4P1NA 3K1SA 4U31A 2XZEA 2W2UA 2A9UA 4U3CA 3ZT5A 5CGMA 2CRBA 2LRKA 5FVKA 2V6YA 1WFDA 2MPKA 2K3WA 2DL1A 4U7IA 4U7YA 4U2YA 4CN6A 4NIQA 4IT4A 1WR0A 2JQKA 4CN4A 5FVLA 4A5XA 3ZSSA 1YXRA 2JQHA 3EABA 3ZSTA 4U33A 4WZXA 2V6YB 2JQ9A 3ZT7A 4U2ZA 2LRLA 4ZEYA 3ZT6A 2CPTA 2RPAA 2V6XA 5CJ5A 1WCRA
chains in the Genus database with same CATH superfamily
5HYAA 2BVMA 3PU3A 4YHJA 3FXDB 1W09A 1JNRA 2NP9A 3JC6D 3ZYMA 3UQ7A 3I1AA 3RX6A 4DMWA 2C5JA 3K3OA 2D9DA 3AEGA 4X1IE 4MHCA 2BG9E 4QWNB 2W0GA 1WCRA 4UELA 2BG9B 2FBWA 3FZFB 3RKGA 3GN5A 4HWCA 5TAOA 4YTMA 3ZJ1A 2IHR1 4QH5A 3AE9A 3B5MA 3AECA 3FZHB 3N5LA 1QUUA 3KDSE 3KBTA 1HR0T 4EAHA 4B3RT 1HNXT 2V6XA 1I94T 3HKCE 2BS3A 5JDLA 5L2LA 1HCIA 3AE1A 5J2UE 3AEEA 3PURA 5ABHA 2DL1A 3UU8A 2JRKA 1MNDA 2B76A 3VR8A 4U33A 2KT9A 3QB5A 1H7CA 2WB5A 3AXJB 4X1KE 3N2OA 3Q5XA 4HE8A 2JIWA 4I43B 1KNZA 4B6XA 1T7SA 5DQWA 1G8XA 2XQ8A 4HWIB 3LK3B 4LMKA 1CUNA 2ZMAA 1QSDA 3P50A 5CJ5A 4JI3T 3RYHE 2H7VC 2M6BA 2Y6XA 2CXFA 2I59A 5JDHA 3SRZA 4DNDA 3AE5A 3UUBA 3H3MA 1J5WA 4Q25A 4BA9A 2RA1A 3Q9DA 1YW0A 4UIGA 2X66A 2NW9A 1IJ6A 3NRXA 1VCSA 3RIUA 2CHOA 3SFEA 4GKJT 5ETWA 4L9IA 3QUJA 4IE7A 3NRYA 2ZM0A 3Q2MA 1US7B 2X51A 5A1LA 2UUAT 2E9XC 3PUAA 3QNUA 4YY3T 2WY2A 2XQ7A 5HEGA 4ADZA 2Q9QC 4HEAA 3TLUA 3QOFA 1MMGA 1Z8UA 2CBJA 3LK2B 4PJLA 4GIWA 2BBHA 4NUUA 3T8OA 4DV4T 2Y8DA 3L8RA 4JEHB 4BAYB 1OWAA 3P8CD 5EK3A 2W4XA 4ZI3D 5HXEA 3JAEA 2HN2A 2BKOA 3MJXA 4PJJA 4JI8T 2C5KT 4DR1T 3PUWF 4AKGA 2JQ9A 4JBWF 3C4ZA 5ABFA 1UGOA 2AE9A 2QA7A 1UX4A 4ILBA 3LBXB 5EK2A 1EZ3A 1E2AA 2ZLYA 1YQ3A 2UU9T 4YTPA 3ANWB 3N9PA 1N33T 4CN4A 3HL6A 2AXDS 3T1YT 3PUZF 3P7IA 5IUXA 4CN1A 1T8BA 3P4WA 2ES0A 2E5VA 2EHOC 4X1YE 2LE8A 4LMJA 3RQUA 4CXWA 5JDGA 1DU2A 5HWYA 5E0OA 3V5UA 4A97A 4O4LE 4CXYA 4A56A 3B13A 3V5SA 3IEEA 1IBKT 2UXNB 4QX7B 2MBGA 3ZT7A 3NZPA 1S94A 2CLYC 5DQVA 3OTOT 2WWUA 3RIFA 3AVRA 4KP3C 1D1AA 4ZS3A 4IDQA 3UU3A 2LOPA 2XM1A 1HG2A 2BDEA 2PFVA 1HX8A 4IDZA 5LG4A 1V9DA 5AQFB 3LSVA 3CQGB 3J7Yq 1MIVA 2H89A 2VVNA 5LMUT 4X64T 3H37A 3ETUA 1N36T 2RPAA 2CEAA 2BG9C 4MBQA 1UURA 2XAJB 5JVDE 5CGMA 2JPFA 2LKHA 3IBPA 2FJEA 5IHYA 3SOLA 2CXDA 5HXHA 2CCQA 4O8SA 2WMOA 2CPTA 2QRXA 1MMNA 4JI4T 4B3TT 2K3WA 2WP9A 5JREA 1KF6A 3O1JA 1NEKA 3VR9A 2LT3A 2KMFA 2KNDA 3LJCA 2W62A 2XQ9A 5L4HA 4YFSA 1WFDA 4U2YA 2XHEB 4U72A 1YD8G 2V7JA 2BS4A 2KINB 1HNZT 4QH1A 5JDFA 3DJBA 5HEJA 5LBQB 4HWDA 4ZI7E 2WS3A 4O4JE 3LG7A 4HTEA 1B7TA 3NZQA 5LHHB 3AAEB 2KXPB 3N9MA 4KBMB 5CA1E 5LBMA 4PJNA 3AAAB 4PK4A 4PJMA 4ERRA 1HX1B 2XUEA 2CBIA 2WSSV 5LB7B 3HR0A 2XZEA 2P9BA 4YTNA 5AQTB 1U5PA 4IGUA 3BQLA 1UUSA 2WCAA 5DJQC 1S35A 3K3NA 5EZYE 3O4XE 1ZEEA 5HWXA 4P1NA 3AE6A 3GMIA 2VASA 3OPCA 5AQNB 1T98A 3RHWA 5F8PA 1LKXA 4H9SE 5AQPB 4TN7B 1VCTA 4KI0F 4UVBB 3ZN1B 2VKDA 3UQ4A 3N9OA 3FXEB 4DR4T 4YSXA 1FIOA 1N32T 2V7KA 3A8YC 4IIJE 4BJNA 4U7YA 4U7IA 3NVOA 4K0KT 4H9QC 2L3LA 5AQIB 2CMRA 4ISTA 2XAGB 2LRLA 3PJAA 3U78A 1FEWA 4OHFA 1D0XA 2MYSA 3C4XA 4HFHA 2A9UA 4DMVA 4JI1T 4NPPA 2CWYA 4H9RC 3EDVA 5L3DB 4WZXA 5FNVE 3I9YA 3X1DA 1AJ3A 2J1DG 3UU4A 4QXBB 2LSIA 4GK0E 1D0ZA 2V5DA 4DVDA 4ZOLE 3ZCIA 3MKDA 4EIWA 4EYYR 2C0SA 3C50A 5FVKA 4HFCA 4DR5T 2NOXA 2E9XA 2K5BB 2JQHA 4H63V 3HKBE 4DV6T 2Q9QA 4YJ3E 1KFYA 2MAWA 3M65A 2YK0A 2E8IA 3AB3B 1MMAA 4U31A 4TV8E 4E7ZA 2UXBT 2IIUA 4MALA 2V6YB 5HEOA 4HFBA 3UFEA 5F5WA 4LF7T 5JQGE 2CA5A 2N9DA 4JV5T 2HN1A 1MNEA 4KHZF 3KV5A 4UXNB 3Q5EA 5LJNA 1OEDE 2WZIA 4CI2B 3EAMA 1OEDB 4OYKA 2H3RA 4IDPA 2OV9A 4DR6T 4X65T 4UEMA 3ZYLA 4DV0T 1CHUA 2WZHA 3MK7C 3DTOA 2BBJA 3UUXB 2UUCT 2H88A 3OKQA 4ASKA 3PDYA 2D0TA 2ODUA 4GK5E 5LHGB 3KVAA 4LFBT 3NWIA 4ANJA 2EHOA 4YXDA 4O4IE 3FB2A 5LJMA 3I0OA 5FY1A 1HTJF 3CMLA 2G0UA 3L3PA 4IT4A 4GKKT 2LM2A 4TX5A 3O1IA 2WBLA 3CKDA 3PUQA 5BR8T 4I55E 1FJGT 2LSYA 2CRBA 2CHNA 3RRWA 5LG3A 2LKGA 3KFWX 1BR0A 3N9QA 1XWMA 5H6RB 2M67A 4JI5T 4LF4T 4L5GA 5HXSA 4O2BE 3N9LA 5L3FB 3UULA 4AQYT 2VQFT 2B1EA 4WNKA 3ZSTA 5C8YE 4LFCT 4OFZA 2XSAA 3P4QA 2DLRA 4EEBA 2YU1A 2E9XD 3UT5E 3KV6A 5AQHB 2KZ7B 5LGUB 4CN6A 4OX9T 5JTGA 2Q9QD 4A5XA 1OXZA 2A2FX 2MTQA 2BG9A 5AQSB 1HS7A 3ZC0A 4IDNA 3LDQB 4NXMT 3CX8B 2FJDA 3LFMA 4HFVA 2VURA 4UF0B 3QB5K 2PBIA 4QH4A 2WDVA 4P09A 4HN9A 3AA7B 2VKHA 5AQJB 4MFRA 2K9AA 2LHRA 4U2ZA 4Z91A 3MACA 3FBZA 2H7OA 4EV6A 3ZMSB 4WYVA 4ZHQE 4DV7T 5FXZA 2IDOB 1HFAA 1NENA 4TWFA 4HWHA 2RP4A 2YDSA 3HKEE 2DHRA 4G63A 1N34T 3AE4A 3RQWA 1SUMB 2XY8B 3AXJA 1HNWT 5JRCB 2J62A 2XQ5A 5HEHA 4CZZB 4V1Av 4ZI2C 3W15B 5HAXA 2LRKA 3A5XA 2MPKA 5JR9B 4MLKA 4QXHB 1O3XA 3EDUA 4Z8XA 2DCFA 3G06A 3F57A 4B3ST 5JDMA 2JQQA 2EHOD 1NWMX 2WU5A 1XZYA 3C4WA 1IJ5A 4AXPA 1IBMT 3AEBA 2X0LB 2YN6A 1HG5A 4JI6T 2KSRA 2IC6A 3LK42 3RYCE 2F4VT 4JI2T 4DUYT 4J2CA 2PTFA 3R6NA 2XQ3A 5HEUA 4OK0A 2YDRA 5J1GA 4HGAA 1YXRA 4YT0A 5L3GB 2X9WA 1I6ZA 2YOEA 5FXVA 3P4SA 1MMDA 2NTYA 3RH3A 1D1CA 4M1PA 1SA0E 4JLEA 1XNQT 3ZMZB 3KV4A 1XDPA 5J0ZA 3EI0A 3N2KE 4F8HA 4PAGA 3M3ZB 4CI3B 4AIUA 3CK6A 4WBNE 4YSYA 3LBXA 3MA9A 1OEDC 3AVSA 5AQLB 4EB6E 2X0HA 4HWFA 4DR2T 3ONLC 4IL4A 4AKRB 3ANWA 4JUYA 2LSGA 2W2UA 5F3JA 4H9OC 3L39A 2CWOA 3N2GE 2VKJA 3P4RA 5ADXL 1ZKEA 3SFDA 2UXDT 4IE0A 4JEUB 4KMCA 2X9HA 5LGTB 2WQYA 5ABEA 3RRCA 3ZJ2A 1W9RA 4LF6T 3ZMUB 4YLHA 2JMKA 5IWAT 4JI0T 4AQFC 2VB6A 4GYRA 1FMWA 4YHHT 4DV2T 1KNPA 1W0AA 4LF5T 3GN5B 4FI5A 4IL9A 2YU2A 3AE7A 3VU7H 4IREA 4CXXA 3IA3A 5L4EA 2D0UA 4EZHA 2V7MA 4O4HE 2OLTA 3FHNA 2BZBA 3KVBA 5LA6E 4N78D 2BKNA 4PK5A 4AISA 1WR0A 2R6GF 2VWAA 2QVAA 3WI3A 2BVLA 5CB4E 1Z0PA 1UK5A 1MIYA 1WRDA 5AQGB 3I9WA 3ZMVB 4X62T 3PU8A 3NKZA 3AA1B 5FY0A 2IUBA 3ABVA 3HA4A 1WYCA 2HHHT 5LXTE 3ETVA 4DV3T 4EZ4A 2VKOA 4UVAB 4DR3T 4PFOA 4I4TE 2V7IA 4Z90A 4EGWA 1L0VA 3CVRA 4IE5A 1LRZA 1BR2A 1ZOYA 2YINA 2XQ6A 2NR4A 4H63H 2I6HA 5FKYA 3OBVE 2QGSA 2W61A 2XPKA 4HFDA 2V5CA 3BK9A 3ZYKA 3OYZA 1IZNB 4YSZA 3ONJA 5KDMC 5IYZE 3JC6C 5HCJA 3PTRB 2HH7A 5FXXA 2DWKA 1XMQT 2YKSA 2V26A 4AQGA 2NW8A 1IBLT 2V1DB 4NIQA 3RF1A 4H9PC 5FL0A 5LNKA 2A72A 2VL8A 2IMLA 3C64A 2DNXA 3CPZA 2WMNA 1W0BA 2J4GA 4G2AA 5JR9C 3RPUA 1Y01A 4DUZT 2NW7A 1ZV4X 4XBFB 2L9QA 4GOUA 2D2SA 4JI7T 3ESLA 4H9NC 5C2TA 3VRBA 4QX8B 2XQAA 2XQYA 2XAFB 5FMNA 5ABFB 3OYXA 5KMGP 2LSKA 3ZEFB 1LVKA 2VK9A 3VKGA 2I0MA 4DO0A 1Y64B 1SE7A 3RI5A 4DIDB 3SS1A 4COFA 2N1GA 2KWHA 4QHOA 2ACZA 1E7PA 4U74A 4AKIA 1JNZA 1MIWA 4CI1B 1UX5A 2DI4A 3R84B 3P4PA 3ONXA 2XASB 3SWHA 3AA0B 3O9XA 2NTXA 3PUXF 1J1JA 1LVFA 4BJMA 2XTLA 2LHNA 2XAQB 2E5LT 1WR6A 1QLBA 2X0YA 3CX6B 4AI6A 2JMHA 3EUHA 3GWHA 4I50E 3UFGA 3JADA 4IE6A 5HXCA 1J5ET 3I0QA 3MZKB 4UVCB 2LM9A 2LLYA 2UXXB 2BKPA 3RC3A 3EHZA 5LOVE 4ILCA 3ZSSA 2D5UA 4NUVA 5J2TE 4KX6A 2LOSA 4HFEA 5H6QB 1YQ4A 3K1SA 3NBXX 2IC9A 5M4YA 3AAIA 3PJAJ 5GONE 2WDQA 3RLFF 1WLXA 4ZI3C 1M62A 3UU6A 4QXCB 3AA6B 5LP6E 2X9XA 5FYMA 5LMNT 5ABGA 1KEYA 3CQCB 2IW5B 3WAJA 3TLSA 4P0BA 3ZLIA 2NWBA 2J47A 4ZZCA 3GA8A 4IDOA 2XJ7A 5AQUB 5KXJA 5FVLA 2LJLA 3C51A 4C91A 2LEHA 4LMLA 5KX5E 3Q5DA 3CWZB 2FJBA 4KUMB 2V6YA 4WBOA 5EK4A 4ZS2A 1WYBA 4ISSA 3RIAA 2L8KA 3PUYF 2FUPA 4YJ2E 5L3CB 3E0ZA 4X66T 4B3MT 4I0UA 4P0AA 2KLQA 2V7LA 5FL1A 3KBUA 1HF8A 1VOMA 1OEDA 3ZMTB 3KINB 4LFAT 3TKLB 4EEDA 2N2NA 2V8SV 5CFBA 4EYUA 1BR1A 1KK7A 2WU2A 2XQ4A 3QC9A 2WWVA 2FJAA 3HKDE 4ILAA 4AKLA 2M6IA 3AE2A 3JCFA 4FJOA 4CQIA 2YEVC 5DABA 3S4UA 4TUYE 5LGNB 2ZM2A 2QYWA 3VRAA 3FZLB 5JH7E 4ZEYA 1E1HB 4L0RA 5LCYA 2XAHB 3TLVA 2PG8A 4AQFA 3UU5A 2Y48B 2W63A 5AQQB 4O2AE 4TWHA 4TNVA 3RYFE 4NXNT 1ZP0A 5AFUL 4X20E 5BMVE 3RIUC 5AQVB 4LF8T 4UR9A 2XM2A 1VRBA 3BQKA 4ZI2D 2DWGA 1XMOT 3RC8A 3OJAA 1YKEB 2X68A 5HXRA 4LF9T 2PJQA 2ODVA 3AEDA 3K8PC 2ZM6T 2HPLA 5JDNA 3HI2A 3CQXC 1XNRT 3PUGA 3QK6A 2LSJA 2VL0A 4X5TA 3CIRA 4ILUA 4EXTA 5FXWA 4DV5T 4PNIA 1BR4A 4TV9E 2E2AA 1X79A 2HPJA 3IHRA 2K24A 3PE0A 3UUMA 4UV9B 3IF8B 3AEAA 3ZT5A 4GYSA 3WAKA 4UV8B 3PV0F 4PFPA 4JYAT 5CA0E 3AEFA 1UCUA 3TLWA 3OVUA 5L47A 3PUVF 4WW0A 3F2EA 3FZMB 4DR7T 2W67A 1SHZC 2ZM8A 4UF0A 1NAFA 2WAUA 4TWDA 2ACXA 2CM0A 4EOZB 2JJ9A 3AE8A 3D0TA 4A98A 4XZCA 3RGLA 2WM9A 2X9YA 4AKHA 4PW8A 3FZKB 2A3DA 5AQOB 1T72A 3EABA 3ZKRA 4XAXB 3RKOA 3ZN0B 2E9XB 2XSBA 3AE3A 3TLTA 5AQRB 4TZ4C 3K3QC 5L3EB 2Q9QB 3O1HA 2C5IT 1XDOA 3UUNA 3ZCJA 2UUBT 2WDRA 5JRCA 1KNRA 5HCMA 3KV9A 5FY7A 5AQKB 2IAKA 5JR9A 5L3BB 4U3CA 2VVSA 1GQEA 4DV1T 3E22E 3J9X1 3Q5WA 4DBRA 1D0YA 2MOZA 4ZXLA 4PK6A 4HFIA 1IAPA 3ZPOA 2W00A 2UXCT 3VKHA 3C98B 4HKAA 1R8IA 2BS2A 3B57A 3H3AA 4KHPT 3PUSA 3EVYA 5LYJE 4E7SA 2GK9A 1FMVA 3N9NA 3E08A 3DP7A 1X9BA 2OA5A 2X67A 2K48A 5LHIB 2EHOB 1G73A 1ZHCA 4QKNA 3CX7B 3ZT6A 3F31A 2CXLA 3FBLA 1U4QA 3ZC1A 4IHJE 4C90A 3JAFA 3MXZA 2W66A 5JDQA 5AQMB 2KWIB 2SPCA 5C3JA 3UTKA 3A7MA 2YDQA 3VHLA 4K0UA 3BQIA 4ZZBA 2CLYB 3U3IA 3RYIE 2CE7A 1D1BA 2JQKA 4IE4A 4DBQA 2VQET 4F6RC 4TNWA 3L09A 1YKHB 1M7KA 5FP3A 2Z6EA 3T1HT 4OYJA
chains in the Genus database with same CATH topology
2WWVA 4CN1A 2WY2A 5LB7B 4P1NA 3K1SA 4U31A 2XZEA 2W2UA 2A9UA 4U3CA 3ZT5A 5CGMA 2CRBA 2LRKA 5FVKA 2V6YA 1WFDA 2MPKA 2K3WA 2DL1A 4U7IA 4U7YA 4U2YA 4CN6A 4NIQA 4IT4A 1WR0A 2JQKA 4CN4A 5FVLA 4A5XA 3ZSSA 1YXRA 2JQHA 3EABA 3ZSTA 4U33A 4WZXA 2V6YB 2JQ9A 3ZT7A 4U2ZA 2LRLA 4ZEYA 3ZT6A 2CPTA 2RPAA 2V6XA 5CJ5A 1WCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWV A;  4CN1 A;  2WY2 A;  5LB7 B;  4P1N A;  3K1S A;  4U31 A;  2XZE A;  2W2U A;  2A9U A;  4U3C A;  3ZT5 A;  5CGM A;  2CRB A;  2LRK A;  5FVK A;  2V6Y A;  1WFD A;  2MPK A;  2K3W A;  2DL1 A;  4U7I A;  4U7Y A;  4U2Y A;  4CN6 A;  4NIQ A;  4IT4 A;  1WR0 A;  2JQK A;  4CN4 A;  5FVL A;  4A5X A;  3ZSS A;  1YXR A;  2JQH A;  3EAB A;  3ZST A;  4U33 A;  4WZX A;  2V6Y B;  2JQ9 A;  3ZT7 A;  4U2Z A;  2LRL A;  4ZEY A;  3ZT6 A;  2CPT A;  2RPA A;  2V6X A;  5CJ5 A;  1WCR A; 
#chains in the Genus database with same CATH topology
 5HYA A;  2BVM A;  3PU3 A;  4YHJ A;  3FXD B;  1W09 A;  1JNR A;  2NP9 A;  3JC6 D;  3ZYM A;  3UQ7 A;  3I1A A;  3RX6 A;  4DMW A;  2C5J A;  3K3O A;  2D9D A;  3AEG A;  4X1I E;  4MHC A;  2BG9 E;  4QWN B;  2W0G A;  1WCR A;  4UEL A;  2BG9 B;  2FBW A;  3FZF B;  3RKG A;  3GN5 A;  4HWC A;  5TAO A;  4YTM A;  3ZJ1 A;  2IHR 1;  4QH5 A;  3AE9 A;  3B5M A;  3AEC A;  3FZH B;  3N5L A;  1QUU A;  3KDS E;  3KBT A;  1HR0 T;  4EAH A;  4B3R T;  1HNX T;  2V6X A;  1I94 T;  3HKC E;  2BS3 A;  5JDL A;  5L2L A;  1HCI A;  3AE1 A;  5J2U E;  3AEE A;  3PUR A;  5ABH A;  2DL1 A;  3UU8 A;  2JRK A;  1MND A;  2B76 A;  3VR8 A;  4U33 A;  2KT9 A;  3QB5 A;  1H7C A;  2WB5 A;  3AXJ B;  4X1K E;  3N2O A;  3Q5X A;  4HE8 A;  2JIW A;  4I43 B;  1KNZ A;  4B6X A;  1T7S A;  5DQW A;  1G8X A;  2XQ8 A;  4HWI B;  3LK3 B;  4LMK A;  1CUN A;  2ZMA A;  1QSD A;  3P50 A;  5CJ5 A;  4JI3 T;  3RYH E;  2H7V C;  2M6B A;  2Y6X A;  2CXF A;  2I59 A;  5JDH A;  3SRZ A;  4DND A;  3AE5 A;  3UUB A;  3H3M A;  1J5W A;  4Q25 A;  4BA9 A;  2RA1 A;  3Q9D A;  1YW0 A;  4UIG A;  2X66 A;  2NW9 A;  1IJ6 A;  3NRX A;  1VCS A;  3RIU A;  2CHO A;  3SFE A;  4GKJ T;  5ETW A;  4L9I A;  3QUJ A;  4IE7 A;  3NRY A;  2ZM0 A;  3Q2M A;  1US7 B;  2X51 A;  5A1L A;  2UUA T;  2E9X C;  3PUA A;  3QNU A;  4YY3 T;  2WY2 A;  2XQ7 A;  5HEG A;  4ADZ A;  2Q9Q C;  4HEA A;  3TLU A;  3QOF A;  1MMG A;  1Z8U A;  2CBJ A;  3LK2 B;  4PJL A;  4GIW A;  2BBH A;  4NUU A;  3T8O A;  4DV4 T;  2Y8D A;  3L8R A;  4JEH B;  4BAY B;  1OWA A;  3P8C D;  5EK3 A;  2W4X A;  4ZI3 D;  5HXE A;  3JAE A;  2HN2 A;  2BKO A;  3MJX A;  4PJJ A;  4JI8 T;  2C5K T;  4DR1 T;  3PUW F;  4AKG A;  2JQ9 A;  4JBW F;  3C4Z A;  5ABF A;  1UGO A;  2AE9 A;  2QA7 A;  1UX4 A;  4ILB A;  3LBX B;  5EK2 A;  1EZ3 A;  1E2A A;  2ZLY A;  1YQ3 A;  2UU9 T;  4YTP A;  3ANW B;  3N9P A;  1N33 T;  4CN4 A;  3HL6 A;  2AXD S;  3T1Y T;  3PUZ F;  3P7I A;  5IUX A;  4CN1 A;  1T8B A;  3P4W A;  2ES0 A;  2E5V A;  2EHO C;  4X1Y E;  2LE8 A;  4LMJ A;  3RQU A;  4CXW A;  5JDG A;  1DU2 A;  5HWY A;  5E0O A;  3V5U A;  4A97 A;  4O4L E;  4CXY A;  4A56 A;  3B13 A;  3V5S A;  3IEE A;  1IBK T;  2UXN B;  4QX7 B;  2MBG A;  3ZT7 A;  3NZP A;  1S94 A;  2CLY C;  5DQV A;  3OTO T;  2WWU A;  3RIF A;  3AVR A;  4KP3 C;  1D1A A;  4ZS3 A;  4IDQ A;  3UU3 A;  2LOP A;  2XM1 A;  1HG2 A;  2BDE A;  2PFV A;  1HX8 A;  4IDZ A;  5LG4 A;  1V9D A;  5AQF B;  3LSV A;  3CQG B;  3J7Y q;  1MIV A;  2H89 A;  2VVN A;  5LMU T;  4X64 T;  3H37 A;  3ETU A;  1N36 T;  2RPA A;  2CEA A;  2BG9 C;  4MBQ A;  1UUR A;  2XAJ B;  5JVD E;  5CGM A;  2JPF A;  2LKH A;  3IBP A;  2FJE A;  5IHY A;  3SOL A;  2CXD A;  5HXH A;  2CCQ A;  4O8S A;  2WMO A;  2CPT A;  2QRX A;  1MMN A;  4JI4 T;  4B3T T;  2K3W A;  2WP9 A;  5JRE A;  1KF6 A;  3O1J A;  1NEK A;  3VR9 A;  2LT3 A;  2KMF A;  2KND A;  3LJC A;  2W62 A;  2XQ9 A;  5L4H A;  4YFS A;  1WFD A;  4U2Y A;  2XHE B;  4U72 A;  1YD8 G;  2V7J A;  2BS4 A;  2KIN B;  1HNZ T;  4QH1 A;  5JDF A;  3DJB A;  5HEJ A;  5LBQ B;  4HWD A;  4ZI7 E;  2WS3 A;  4O4J E;  3LG7 A;  4HTE A;  1B7T A;  3NZQ A;  5LHH B;  3AAE B;  2KXP B;  3N9M A;  4KBM B;  5CA1 E;  5LBM A;  4PJN A;  3AAA B;  4PK4 A;  4PJM A;  4ERR A;  1HX1 B;  2XUE A;  2CBI A;  2WSS V;  5LB7 B;  3HR0 A;  2XZE A;  2P9B A;  4YTN A;  5AQT B;  1U5P A;  4IGU A;  3BQL A;  1UUS A;  2WCA A;  5DJQ C;  1S35 A;  3K3N A;  5EZY E;  3O4X E;  1ZEE A;  5HWX A;  4P1N A;  3AE6 A;  3GMI A;  2VAS A;  3OPC A;  5AQN B;  1T98 A;  3RHW A;  5F8P A;  1LKX A;  4H9S E;  5AQP B;  4TN7 B;  1VCT A;  4KI0 F;  4UVB B;  3ZN1 B;  2VKD A;  3UQ4 A;  3N9O A;  3FXE B;  4DR4 T;  4YSX A;  1FIO A;  1N32 T;  2V7K A;  3A8Y C;  4IIJ E;  4BJN A;  4U7Y A;  4U7I A;  3NVO A;  4K0K T;  4H9Q C;  2L3L A;  5AQI B;  2CMR A;  4IST A;  2XAG B;  2LRL A;  3PJA A;  3U78 A;  1FEW A;  4OHF A;  1D0X A;  2MYS A;  3C4X A;  4HFH A;  2A9U A;  4DMV A;  4JI1 T;  4NPP A;  2CWY A;  4H9R C;  3EDV A;  5L3D B;  4WZX A;  5FNV E;  3I9Y A;  3X1D A;  1AJ3 A;  2J1D G;  3UU4 A;  4QXB B;  2LSI A;  4GK0 E;  1D0Z A;  2V5D A;  4DVD A;  4ZOL E;  3ZCI A;  3MKD A;  4EIW A;  4EYY R;  2C0S A;  3C50 A;  5FVK A;  4HFC A;  4DR5 T;  2NOX A;  2E9X A;  2K5B B;  2JQH A;  4H63 V;  3HKB E;  4DV6 T;  2Q9Q A;  4YJ3 E;  1KFY A;  2MAW A;  3M65 A;  2YK0 A;  2E8I A;  3AB3 B;  1MMA A;  4U31 A;  4TV8 E;  4E7Z A;  2UXB T;  2IIU A;  4MAL A;  2V6Y B;  5HEO A;  4HFB A;  3UFE A;  5F5W A;  4LF7 T;  5JQG E;  2CA5 A;  2N9D A;  4JV5 T;  2HN1 A;  1MNE A;  4KHZ F;  3KV5 A;  4UXN B;  3Q5E A;  5LJN A;  1OED E;  2WZI A;  4CI2 B;  3EAM A;  1OED B;  4OYK A;  2H3R A;  4IDP A;  2OV9 A;  4DR6 T;  4X65 T;  4UEM A;  3ZYL A;  4DV0 T;  1CHU A;  2WZH A;  3MK7 C;  3DTO A;  2BBJ A;  3UUX B;  2UUC T;  2H88 A;  3OKQ A;  4ASK A;  3PDY A;  2D0T A;  2ODU A;  4GK5 E;  5LHG B;  3KVA A;  4LFB T;  3NWI A;  4ANJ A;  2EHO A;  4YXD A;  4O4I E;  3FB2 A;  5LJM A;  3I0O A;  5FY1 A;  1HTJ F;  3CML A;  2G0U A;  3L3P A;  4IT4 A;  4GKK T;  2LM2 A;  4TX5 A;  3O1I A;  2WBL A;  3CKD A;  3PUQ A;  5BR8 T;  4I55 E;  1FJG T;  2LSY A;  2CRB A;  2CHN A;  3RRW A;  5LG3 A;  2LKG A;  3KFW X;  1BR0 A;  3N9Q A;  1XWM A;  5H6R B;  2M67 A;  4JI5 T;  4LF4 T;  4L5G A;  5HXS A;  4O2B E;  3N9L A;  5L3F B;  3UUL A;  4AQY T;  2VQF T;  2B1E A;  4WNK A;  3ZST A;  5C8Y E;  4LFC T;  4OFZ A;  2XSA A;  3P4Q A;  2DLR A;  4EEB A;  2YU1 A;  2E9X D;  3UT5 E;  3KV6 A;  5AQH B;  2KZ7 B;  5LGU B;  4CN6 A;  4OX9 T;  5JTG A;  2Q9Q D;  4A5X A;  1OXZ A;  2A2F X;  2MTQ A;  2BG9 A;  5AQS B;  1HS7 A;  3ZC0 A;  4IDN A;  3LDQ B;  4NXM T;  3CX8 B;  2FJD A;  3LFM A;  4HFV A;  2VUR A;  4UF0 B;  3QB5 K;  2PBI A;  4QH4 A;  2WDV A;  4P09 A;  4HN9 A;  3AA7 B;  2VKH A;  5AQJ B;  4MFR A;  2K9A A;  2LHR A;  4U2Z A;  4Z91 A;  3MAC A;  3FBZ A;  2H7O A;  4EV6 A;  3ZMS B;  4WYV A;  4ZHQ E;  4DV7 T;  5FXZ A;  2IDO B;  1HFA A;  1NEN A;  4TWF A;  4HWH A;  2RP4 A;  2YDS A;  3HKE E;  2DHR A;  4G63 A;  1N34 T;  3AE4 A;  3RQW A;  1SUM B;  2XY8 B;  3AXJ A;  1HNW T;  5JRC B;  2J62 A;  2XQ5 A;  5HEH A;  4CZZ B;  4V1A v;  4ZI2 C;  3W15 B;  5HAX A;  2LRK A;  3A5X A;  2MPK A;  5JR9 B;  4MLK A;  4QXH B;  1O3X A;  3EDU A;  4Z8X A;  2DCF A;  3G06 A;  3F57 A;  4B3S T;  5JDM A;  2JQQ A;  2EHO D;  1NWM X;  2WU5 A;  1XZY A;  3C4W A;  1IJ5 A;  4AXP A;  1IBM T;  3AEB A;  2X0L B;  2YN6 A;  1HG5 A;  4JI6 T;  2KSR A;  2IC6 A;  3LK4 2;  3RYC E;  2F4V T;  4JI2 T;  4DUY T;  4J2C A;  2PTF A;  3R6N A;  2XQ3 A;  5HEU A;  4OK0 A;  2YDR A;  5J1G A;  4HGA A;  1YXR A;  4YT0 A;  5L3G B;  2X9W A;  1I6Z A;  2YOE A;  5FXV A;  3P4S A;  1MMD A;  2NTY A;  3RH3 A;  1D1C A;  4M1P A;  1SA0 E;  4JLE A;  1XNQ T;  3ZMZ B;  3KV4 A;  1XDP A;  5J0Z A;  3EI0 A;  3N2K E;  4F8H A;  4PAG A;  3M3Z B;  4CI3 B;  4AIU A;  3CK6 A;  4WBN E;  4YSY A;  3LBX A;  3MA9 A;  1OED C;  3AVS A;  5AQL B;  4EB6 E;  2X0H A;  4HWF A;  4DR2 T;  3ONL C;  4IL4 A;  4AKR B;  3ANW A;  4JUY A;  2LSG A;  2W2U A;  5F3J A;  4H9O C;  3L39 A;  2CWO A;  3N2G E;  2VKJ A;  3P4R A;  5ADX L;  1ZKE A;  3SFD A;  2UXD T;  4IE0 A;  4JEU B;  4KMC A;  2X9H A;  5LGT B;  2WQY A;  5ABE A;  3RRC A;  3ZJ2 A;  1W9R A;  4LF6 T;  3ZMU B;  4YLH A;  2JMK A;  5IWA T;  4JI0 T;  4AQF C;  2VB6 A;  4GYR A;  1FMW A;  4YHH T;  4DV2 T;  1KNP A;  1W0A A;  4LF5 T;  3GN5 B;  4FI5 A;  4IL9 A;  2YU2 A;  3AE7 A;  3VU7 H;  4IRE A;  4CXX A;  3IA3 A;  5L4E A;  2D0U A;  4EZH A;  2V7M A;  4O4H E;  2OLT A;  3FHN A;  2BZB A;  3KVB A;  5LA6 E;  4N78 D;  2BKN A;  4PK5 A;  4AIS A;  1WR0 A;  2R6G F;  2VWA A;  2QVA A;  3WI3 A;  2BVL A;  5CB4 E;  1Z0P A;  1UK5 A;  1MIY A;  1WRD A;  5AQG B;  3I9W A;  3ZMV B;  4X62 T;  3PU8 A;  3NKZ A;  3AA1 B;  5FY0 A;  2IUB A;  3ABV A;  3HA4 A;  1WYC A;  2HHH T;  5LXT E;  3ETV A;  4DV3 T;  4EZ4 A;  2VKO A;  4UVA B;  4DR3 T;  4PFO A;  4I4T E;  2V7I A;  4Z90 A;  4EGW A;  1L0V A;  3CVR A;  4IE5 A;  1LRZ A;  1BR2 A;  1ZOY A;  2YIN A;  2XQ6 A;  2NR4 A;  4H63 H;  2I6H A;  5FKY A;  3OBV E;  2QGS A;  2W61 A;  2XPK A;  4HFD A;  2V5C A;  3BK9 A;  3ZYK A;  3OYZ A;  1IZN B;  4YSZ A;  3ONJ A;  5KDM C;  5IYZ E;  3JC6 C;  5HCJ A;  3PTR B;  2HH7 A;  5FXX A;  2DWK A;  1XMQ T;  2YKS A;  2V26 A;  4AQG A;  2NW8 A;  1IBL T;  2V1D B;  4NIQ A;  3RF1 A;  4H9P C;  5FL0 A;  5LNK A;  2A72 A;  2VL8 A;  2IML A;  3C64 A;  2DNX A;  3CPZ A;  2WMN A;  1W0B A;  2J4G A;  4G2A A;  5JR9 C;  3RPU A;  1Y01 A;  4DUZ T;  2NW7 A;  1ZV4 X;  4XBF B;  2L9Q A;  4GOU A;  2D2S A;  4JI7 T;  3ESL A;  4H9N C;  5C2T A;  3VRB A;  4QX8 B;  2XQA A;  2XQY A;  2XAF B;  5FMN A;  5ABF B;  3OYX A;  5KMG P;  2LSK A;  3ZEF B;  1LVK A;  2VK9 A;  3VKG A;  2I0M A;  4DO0 A;  1Y64 B;  1SE7 A;  3RI5 A;  4DID B;  3SS1 A;  4COF A;  2N1G A;  2KWH A;  4QHO A;  2ACZ A;  1E7P A;  4U74 A;  4AKI A;  1JNZ A;  1MIW A;  4CI1 B;  1UX5 A;  2DI4 A;  3R84 B;  3P4P A;  3ONX A;  2XAS B;  3SWH A;  3AA0 B;  3O9X A;  2NTX A;  3PUX F;  1J1J A;  1LVF A;  4BJM A;  2XTL A;  2LHN A;  2XAQ B;  2E5L T;  1WR6 A;  1QLB A;  2X0Y A;  3CX6 B;  4AI6 A;  2JMH A;  3EUH A;  3GWH A;  4I50 E;  3UFG A;  3JAD A;  4IE6 A;  5HXC A;  1J5E T;  3I0Q A;  3MZK B;  4UVC B;  2LM9 A;  2LLY A;  2UXX B;  2BKP A;  3RC3 A;  3EHZ A;  5LOV E;  4ILC A;  3ZSS A;  2D5U A;  4NUV A;  5J2T E;  4KX6 A;  2LOS A;  4HFE A;  5H6Q B;  1YQ4 A;  3K1S A;  3NBX X;  2IC9 A;  5M4Y A;  3AAI A;  3PJA J;  5GON E;  2WDQ A;  3RLF F;  1WLX A;  4ZI3 C;  1M62 A;  3UU6 A;  4QXC B;  3AA6 B;  5LP6 E;  2X9X A;  5FYM A;  5LMN T;  5ABG A;  1KEY A;  3CQC B;  2IW5 B;  3WAJ A;  3TLS A;  4P0B A;  3ZLI A;  2NWB A;  2J47 A;  4ZZC A;  3GA8 A;  4IDO A;  2XJ7 A;  5AQU B;  5KXJ A;  5FVL A;  2LJL A;  3C51 A;  4C91 A;  2LEH A;  4LML A;  5KX5 E;  3Q5D A;  3CWZ B;  2FJB A;  4KUM B;  2V6Y A;  4WBO A;  5EK4 A;  4ZS2 A;  1WYB A;  4ISS A;  3RIA A;  2L8K A;  3PUY F;  2FUP A;  4YJ2 E;  5L3C B;  3E0Z A;  4X66 T;  4B3M T;  4I0U A;  4P0A A;  2KLQ A;  2V7L A;  5FL1 A;  3KBU A;  1HF8 A;  1VOM A;  1OED A;  3ZMT B;  3KIN B;  4LFA T;  3TKL B;  4EED A;  2N2N A;  2V8S V;  5CFB A;  4EYU A;  1BR1 A;  1KK7 A;  2WU2 A;  2XQ4 A;  3QC9 A;  2WWV A;  2FJA A;  3HKD E;  4ILA A;  4AKL A;  2M6I A;  3AE2 A;  3JCF A;  4FJO A;  4CQI A;  2YEV C;  5DAB A;  3S4U A;  4TUY E;  5LGN B;  2ZM2 A;  2QYW A;  3VRA A;  3FZL B;  5JH7 E;  4ZEY A;  1E1H B;  4L0R A;  5LCY A;  2XAH B;  3TLV A;  2PG8 A;  4AQF A;  3UU5 A;  2Y48 B;  2W63 A;  5AQQ B;  4O2A E;  4TWH A;  4TNV A;  3RYF E;  4NXN T;  1ZP0 A;  5AFU L;  4X20 E;  5BMV E;  3RIU C;  5AQV B;  4LF8 T;  4UR9 A;  2XM2 A;  1VRB A;  3BQK A;  4ZI2 D;  2DWG A;  1XMO T;  3RC8 A;  3OJA A;  1YKE B;  2X68 A;  5HXR A;  4LF9 T;  2PJQ A;  2ODV A;  3AED A;  3K8P C;  2ZM6 T;  2HPL A;  5JDN A;  3HI2 A;  3CQX C;  1XNR T;  3PUG A;  3QK6 A;  2LSJ A;  2VL0 A;  4X5T A;  3CIR A;  4ILU A;  4EXT A;  5FXW A;  4DV5 T;  4PNI A;  1BR4 A;  4TV9 E;  2E2A A;  1X79 A;  2HPJ A;  3IHR A;  2K24 A;  3PE0 A;  3UUM A;  4UV9 B;  3IF8 B;  3AEA A;  3ZT5 A;  4GYS A;  3WAK A;  4UV8 B;  3PV0 F;  4PFP A;  4JYA T;  5CA0 E;  3AEF A;  1UCU A;  3TLW A;  3OVU A;  5L47 A;  3PUV F;  4WW0 A;  3F2E A;  3FZM B;  4DR7 T;  2W67 A;  1SHZ C;  2ZM8 A;  4UF0 A;  1NAF A;  2WAU A;  4TWD A;  2ACX A;  2CM0 A;  4EOZ B;  2JJ9 A;  3AE8 A;  3D0T A;  4A98 A;  4XZC A;  3RGL A;  2WM9 A;  2X9Y A;  4AKH A;  4PW8 A;  3FZK B;  2A3D A;  5AQO B;  1T72 A;  3EAB A;  3ZKR A;  4XAX B;  3RKO A;  3ZN0 B;  2E9X B;  2XSB A;  3AE3 A;  3TLT A;  5AQR B;  4TZ4 C;  3K3Q C;  5L3E B;  2Q9Q B;  3O1H A;  2C5I T;  1XDO A;  3UUN A;  3ZCJ A;  2UUB T;  2WDR A;  5JRC A;  1KNR A;  5HCM A;  3KV9 A;  5FY7 A;  5AQK B;  2IAK A;  5JR9 A;  5L3B B;  4U3C A;  2VVS A;  1GQE A;  4DV1 T;  3E22 E;  3J9X 1;  3Q5W A;  4DBR A;  1D0Y A;  2MOZ A;  4ZXL A;  4PK6 A;  4HFI A;  1IAP A;  3ZPO A;  2W00 A;  2UXC T;  3VKH A;  3C98 B;  4HKA A;  1R8I A;  2BS2 A;  3B57 A;  3H3A A;  4KHP T;  3PUS A;  3EVY A;  5LYJ E;  4E7S A;  2GK9 A;  1FMV A;  3N9N A;  3E08 A;  3DP7 A;  1X9B A;  2OA5 A;  2X67 A;  2K48 A;  5LHI B;  2EHO B;  1G73 A;  1ZHC A;  4QKN A;  3CX7 B;  3ZT6 A;  3F31 A;  2CXL A;  3FBL A;  1U4Q A;  3ZC1 A;  4IHJ E;  4C90 A;  3JAF A;  3MXZ A;  2W66 A;  5JDQ A;  5AQM B;  2KWI B;  2SPC A;  5C3J A;  3UTK A;  3A7M A;  2YDQ A;  3VHL A;  4K0U A;  3BQI A;  4ZZB A;  2CLY B;  3U3I A;  3RYI E;  2CE7 A;  1D1B A;  2JQK A;  4IE4 A;  4DBQ A;  2VQE T;  4F6R C;  4TNW A;  3L09 A;  1YKH B;  1M7K A;  5FP3 A;  2Z6E A;  3T1H T;  4OYJ A; 
#chains in the Genus database with same CATH homology
 2WWV A;  4CN1 A;  2WY2 A;  5LB7 B;  4P1N A;  3K1S A;  4U31 A;  2XZE A;  2W2U A;  2A9U A;  4U3C A;  3ZT5 A;  5CGM A;  2CRB A;  2LRK A;  5FVK A;  2V6Y A;  1WFD A;  2MPK A;  2K3W A;  2DL1 A;  4U7I A;  4U7Y A;  4U2Y A;  4CN6 A;  4NIQ A;  4IT4 A;  1WR0 A;  2JQK A;  4CN4 A;  5FVL A;  4A5X A;  3ZSS A;  1YXR A;  2JQH A;  3EAB A;  3ZST A;  4U33 A;  4WZX A;  2V6Y B;  2JQ9 A;  3ZT7 A;  4U2Z A;  2LRL A;  4ZEY A;  3ZT6 A;  2CPT A;  2RPA A;  2V6X A;  5CJ5 A;  1WCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...