2QYWA

Crystal structure of mouse vti1b habc domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport, endocytosis
molecule keywords Vesicle transport through interaction with t-SNAREs 1B homol
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2qywA00
3ONJA 2QYWA 3ONLC 2V8SV 1VCSA
chains in the Genus database with same CATH superfamily
2X9XA 4ZXLA 2HH7A 4NXNT 4HWCA 1D0ZA 3PUVF 2CHOA 2DLRA 3OPCA 1HCIA 1MNDA 1LKXA 1VCSA 2CE7A 2DCFA 1SA0E 2UXXB 2SPCA 3B57A 3AE7A 2K9AA 3BK9A 5JH7E 2CWYA 4K0UA 4NUUA 2CA5A 3ZMUB 5LG3A 3G06A 4YJ3E 2YDQA 2V7MA 4TN7B 4JLEA 3Q9DA 1UX5A 4PFPA 2A9UA 2VL8A 4ILCA 4AXPA 2LM2A 4E7ZA 5AQOB 1SHZC 5LG4A 5HXSA 4UIGA 2V26A 1YD8G 3HA4A 5DQWA 4O4JE 2NR4A 3WAJA 3U78A 5JRCA 2LT3A 2KNDA 5HEJA 4QH5A 2XQ4A 3HKDE 5HYAA 1HFAA 1BR4A 2Q9QC 4PK5A 5IYZE 4YTNA 2G0UA 1UK5A 2NWBA 4H9OC 5C3JA 5JDMA 2VQET 4DUZT 2UUBT 3R84B 3PTRB 4DV4T 4GKJT 3OJAA 2XQ3A 3S4UA 2NOXA 2C5JA 1NAFA 2JPFA 2R6GF 1UGOA 2W63A 3F2EA 3RI5A 5BR8T 3I1AA 1S94A 3QK6A 1OEDC 1KNPA 3K3QC 1YW0A 5FY0A 4DV7T 4JI1T 3LBXB 3MK7C 5LGTB 2X9WA 1I94T 3ZMTB 4P1NA 1ZEEA 4YHHT 4ZI3D 2LJLA 2I59A 2BBHA 3ONXA 3LJCA 3PUXF 2HN1A 1WFDA 2Y8DA 4KUMB 3RIUC 5AQIB 5L3FB 3ZPOA 1IBKT 3JCFA 2JRKA 3AEBA 2BS4A 3UUMA 5JDLA 3PU3A 4JYAT 4DBQA 2XQAA 4IL9A 1VCTA 3AXJA 3L8RA 3QOFA 5JR9A 4ZS2A 4GIWA 3O1IA 5HEHA 3EABA 3RX6A 5KDMC 4LF9T 4MHCA 1E7PA 2IMLA 4U72A 2W67A 3RH3A 4F6RC 4YJ2E 5L2LA 2AXDS 3A5XA 3AE4A 4HWDA 2UU9T 1ZV4X 3AEDA 2CXFA 1W09A 1HF8A 3NRXA 2V5CA 3VR9A 5AQRB 4HWIB 2ZLYA 2A2FX 3N9PA 2KT9A 3AA1B 4IL4A 2LLYA 3KBTA 5AQPB 1U5PA 2WS3A 2VKHA 1WYCA 4U3CA 4X1KE 1HTJF 2VQFT 5J0ZA 5IHYA 1IBMT 2BKNA 1CHUA 4OYKA 1FJGT 3AA7B 1XDOA 3C64A 3C4WA 4YTPA 2K3WA 5HWXA 4DO0A 4KX6A 3JADA 3ONJA 2N2NA 4UF0A 4M1PA 3FZHB 3E08A 4PAGA 3AE9A 2IC9A 4UVAB 3L3PA 3MJXA 3RF1A 4OYJA 4TV9E 2WWUA 3DP7A 3P4QA 2VASA 4BJMA 2X9YA 5AQKB 1ZP0A 3CKDA 4XBFB 3Q5EA 4ZS3A 3UULA 4FI5A 2F4VT 2C5KT 1XDPA 2VWAA 4H9RC 3P50A 2W62A 3KINB 1Y01A 5FP3A 3V5SA 1MIYA 2HN2A 5C8YE 2BKOA 5ABEA 4H9SE 1IJ5A 4LF8T 2LSJA 2LOSA 3Q5WA 4YY3T 4AKHA 3NZQA 3PUGA 1QLBA 2QVAA 2FJBA 3KVBA 3I0OA 3IEEA 3JC6D 3N9NA 3QC9A 3C51A 4IDOA 5JREA 2Q9QD 2E9XC 3KDSE 3RYCE 3UU4A 4PFOA 4B3MT 4KHPT 1Y64B 3CWZB 5AQNB 4ZI2C 5LMNT 2BDEA 3ZYMA 2CPTA 1Z8UA 2DWGA 4UV9B 2IHR1 2XAGB 5HCJA 4BA9A 4ERRA 4EZHA 3KV4A 4CXWA 4DR2T 4HKAA 2WU2A 3SFDA 3ZLIA 5FNVE 4A98A 1US7B 3F57A 3A8YC 3ZT6A 1HG5A 4DMWA 3CPZA 4OK0A 2MOZA 3ZN1B 3P4RA 4MLKA 3PU8A 3IF8B 4ZI2D 3ANWB 3RHWA 2KXPB 1HX1B 4HFHA 2HPJA 5AQMB 3HKCE 3RLFF 3CMLA 3PUZF 2MTQA 2V1DB 2WMOA 2YOEA 2XASB 2WMNA 3AE3A 3K3OA 4DR5T 4KI0F 2WU5A 2EHOD 2X66A 3P8CD 3UUBA 5LBMA 3C4ZA 1CUNA 4GKKT 4EZ4A 3PE0A 4OX9T 3FZLB 2X0HA 3PUWF 2W00A 1E1HB 3FB2A 4ISSA 4O8SA 1T8BA 2JMHA 5AQTB 5CA0E 3FHNA 4IDPA 5DJQC 2WWVA 3UUXB 4DV5T 4QH4A 5FVKA 2EHOB 5ABFA 2XAJB 4H9QC 5KMGP 4UR9A 4JI2T 3OYZA 5CGMA 1J1JA 1E2AA 3K8PC 5H6QB 4I50E 4NIQA 1WR6A 2LRLA 3SWHA 2X51A 4N78D 4WNKA 3UU3A 3ZKRA 1NENA 3N2GE 3PUAA 4UEMA 3NKZA 4UF0B 3Q2MA 4AQFA 4EYUA 2L9QA 1XNRT 3ZSTA 1AJ3A 4TV8E 5AQFB 3AECA 2VKDA 3N5LA 3MXZA 1MNEA 4B3ST 4LMJA 3PUQA 2XUEA 4Z8XA 3JAEA 3AE6A 4YSYA 2X68A 4O2AE 1HNWT 3ZT5A 3ZJ2A 2CRBA 1XNQT 4YTMA 3EDUA 4AI6A 4MBQA 3EHZA 3ABVA 4CI2B 3TLUA 4TWDA 5FY1A 3T8OA 4YSZA 3N9MA 1FMWA 5ADXL 4JI6T 5L3BB 3NWIA 2D5UA 1XMOT 2WSSV 1JNRA 2Q9QA 3ZMSB 4AKLA 2UUAT 5C2TA 2BG9E 3LK2B 2J4GA 4L9IA 2JQKA 1IZNB 3X1DA 2FJDA 3NZPA 5FXXA 5HCMA 4AIUA 2JQHA 5HXRA 4ILAA 1HNXT 3LDQB 2FJEA 3IA3A 3LSVA 1L0VA 4CQIA 5JDQA 4IDZA 5FL0A 1YQ3A 3ANWA 2K24A 2JIWA 2D0UA 2ES0A 3FZMB 4HWHA 4KMCA 1OEDE 5DABA 3D0TA 3TLSA 2XZEA 5FY7A 3ZCJA 3FZFB 2UXCT 1FMVA 2I0MA 2XQ9A 2YK0A 2Y6XA 3BQIA 4YT0A 2D0TA 2LKGA 3QNUA 2I6HA 3GWHA 2OLTA 4UELA 4ILUA 2CHNA 2W4XA 1T7SA 5CFBA 4GOUA 2DNXA 4HFBA 5L3DB 3RC3A 1MMDA 4X62T 3VKHA 3Q5XA 3SOLA 4HFEA 2XY8B 2XM1A 4AQFC 3ESLA 2ODUA 4I55E 2XQ7A 4TX5A 3OTOT 4QXHB 2W66A 4CXXA 3RQUA 3AE5A 5AQLB 3VU7H 3E0ZA 4Z90A 4HWFA 3A7MA 5JDHA 1OEDA 3ZMVB 3FXEB 2E5VA 5J2UE 2UXBT 1IAPA 3N2OA 3K3NA 2WAUA 1MMGA 1WRDA 3QB5K 4J2CA 5EK4A 2DL1A 2XQ5A 5F8PA 4LF5T 1ZOYA 2WBLA 5LYJE 1S35A 5IUXA 2V8SV 2XQ6A 1R8IA 2CWOA 1ZHCA 5M4YA 4BJNA 2DWKA 2KZ7B 1UURA 2XTLA 1ZKEA 2CLYC 2PTFA 3CIRA 4ILBA 4PK4A 4QX8B 4C90A 4CXYA 3AVRA 4QXBB 5AQUB 3AB3B 4QH1A 3M65A 4PK6A 1GQEA 5JTGA 1HG2A 1YQ4A 4EB6E 3RRCA 3H3MA 3AVSA 3UTKA 1N33T 2K5BB 3AA6B 2V7JA 4JI5T 3CX8B 4IREA 3ZT7A 4TWHA 2H7OA 5J2TE 3P4PA 3RPUA 3VRBA 2VVSA 4YFSA 4EEBA 4JI8T 1UCUA 4G2AA 5LOVE 3L09A 4V1Av 2NW9A 4KBMB 2BS2A 4LF7T 2C5IT 1KEYA 2PFVA 2A3DA 3JAFA 4JBWF 2GK9A 5L3EB 2J47A 1D0YA 3OBVE 2JJ9A 4UXNB 4E7SA 1M7KA 5L47A 2BKPA 2X9HA 3O1HA 3KFWX 3CX7B 3UU6A 2YN6A 3P7IA 5AQGB 2BBJA 2FUPA 2OV9A 2UXDT 1QUUA 2ZM8A 4DVDA 2QA7A 2XQ8A 2M6IA 4AQYT 1OXZA 3MKDA 1J5ET 2V6XA 3F31A 4EGWA 4WBNE 3AE8A 2UUCT 5CB4E 2J62A 2V5DA 2KINB 1BR1A 2PG8A 4B3TT 2OA5A 5JDGA 1EZ3A 4U2ZA 2NW8A 1KK7A 5JDNA 2CBIA 3ZYKA 4EYYR 4NXMT 3O1JA 3FBLA 4YSXA 5HXEA 3CK6A 3ONLC 1NEKA 2IAKA 2X0YA 5HEUA 4COFA 2ACXA 3J9X1 1NWMX 1YKHB 3T1YT 4LF6T 3PDYA 3NRYA 4DUYT 5FXVA 3VKGA 4TNWA 5E0OA 3RIFA 2IDOB 2CXDA 5FXZA 3GN5A 3MA9A 4U31A 2KSRA 4JI0T 2XPKA 3QUJA 1D1BA 5L4HA 2BVMA 2DHRA 3LG7A 4X66T 3AA0B 4TZ4C 5LB7B 2LE8A 2E8IA 3O9XA 4IHJE 1DU2A 5CA1E 4AKIA 4TNVA 1WYBA 5AQQB 3TLWA 1JNZA 4QHOA 2C0SA 3OVUA 3IBPA 4WYVA 3N9LA 5AQHB 5LHHB 2JQ9A 3N9QA 2HHHT 5LA6E 1BR0A 1KNRA 1M62A 1WR0A 2BG9C 2Z6EA 4I43B 4JEHB 3ZC1A 2FBWA 2XSAA 3DTOA 3E22E 3UFEA 3UFGA 2ZM2A 4DR6T 3RIAA 3UQ7A 4HFCA 5FVLA 3ZYLA 4CZZB 1D1AA 3LBXA 5GONE 3U3IA 2B76A 5JQGE 3R6NA 2LHRA 2D9DA 2Y48B 4ASKA 2XAHB 3EUHA 4PW8A 4F8HA 2EHOC 5L3GB 2CM0A 2VK9A 3AEFA 4XAXB 3C4XA 3WAKA 4DMVA 1HNZT 2NTXA 2MAWA 4TUYE 3RYIE 3ZSSA 2AE9A 1W0AA 1SUMB 3LK3B 3OKQA 1N36T 4ISTA 3TLVA 2LHNA 3HR0A 4HFDA 4KHZF 2XM2A 3EDVA 4X20E 3RC8A 4CN1A 2LEHA 3PV0F 4MFRA 2P9BA 2IW5B 3B5MA 1UX4A 3KVAA 4PJMA 3RRWA 4HE8A 4UVCB 4IE4A 2H7VC 3I9WA 4ZZBA 4QXCB 3O4XE 4Q25A 4JI3T 2YINA 5ABGA 2PBIA 2KWIB 3FXDB 1X9BA 4GYRA 3AAIA 3ZEFB 4DV2T 3P4SA 2PJQA 4IDNA 4X5TA 5LCYA 4A97A 5ABHA 4JI4T 4H63H 1Z0PA 4U74A 3RYFE 4YHJA 5A1LA 5HXHA 4HFIA 3C98B 2XQYA 3ETUA 4H9NC 4DIDB 4IE6A 3AEEA 4I0UA 3J7Yq 2CCQA 2H3RA 1G8XA 3VR8A 2IUBA 3PURA 1LVKA 3TKLB 5F3JA 5ETWA 3V5UA 3M3ZB 1LVFA 4IE5A 3K1SA 1J5WA 4TWFA 5FXWA 5LMUT 1W9RA 4PJJA 2BZBA 2YKSA 3KBUA 2V7IA 4AISA 3GMIA 2E5LT 4CN6A 3UU5A 4NUVA 5KX5E 5H6RB 1KFYA 4U2YA 5DQVA 1D1CA 2CEAA 2V6YB 4OFZA 5JVDE 4ZI7E 3GN5B 4DBRA 5AQVB 4IE7A 2XAFB 5LNKA 4DR7T 1KNZA 1YKEB 1QSDA 2H88A 2A72A 2WDRA 3B13A 3H37A 3HI2A 5HXCA 2WDVA 4CI3B 2B1EA 2VB6A 3EVYA 1SE7A 4U33A 2VKJA 4NPPA 4WW0A 4GYSA 3VHLA 4DV0T 4ZHQE 1OEDB 1FIOA 4P0AA 2CLYB 1WLXA 2RP4A 1H7CA 2WCAA 3CQXC 3DJBA 4P09A 4WBOA 4QX7B 2ZM6T 5LGNB 2WZIA 2KLQA 1U4QA 2WP9A 3EAMA 3GA8A 4HFVA 4X1IE 1VOMA 2JMKA 3MACA 4X1YE 2BG9B 2MYSA 5FYMA 3UT5E 3ZMZB 5LP6E 3T1HT 4CI1B 2MBGA 3I9YA 3HKBE 2RPAA 3ZCIA 4A5XA 1HX8A 4IE0A 2K48A 2M6BA 2VKOA 3AEGA 3AEAA 3KV9A 3PJAA 5JR9C 3C50A 2IIUA 2JQQA 4EOZB 1O3XA 4JV5T 1FEWA 4O2BE 3AAAB 4XZCA 4DV1T 1T72A 2W61A 4MALA 2V6YA 2DI4A 3PUSA 4LFCT 4X65T 2MPKA 4JUYA 4P0BA 5AQJB 5L4EA 1XWMA 1OWAA 3PJAJ 5LGUB 3AXJB 4O4IE 5JR9B 3N9OA 4FJOA 3CX6B 4LFBT 3NBXX 4KP3C 2VURA 2X0LB 4LFAT 5HEOA 2BS3A 3EI0A 5ABFB 4C91A 5IWAT 4YLHA 4HEAA 5EZYE 1LRZA 1V9DA 4HN9A 4IDQA 4LMKA 5BMVE 2XHEB 3ZJ1A 4O4LE 2N9DA 2QYWA 2Q9QB 5F5WA 3RQWA 3ZN0B 5FKYA 4ANJA 1T98A 3WI3A 3CQCB 4IT4A 5L3CB 3L39A 2LRKA 4DR3T 4AQGA 2IC6A 2V7LA 4H63V 2NW7A 2LSYA 2QGSA 2WZHA 2YDRA 2H89A 4O4HE 5HAXA 2E9XA 3RYHE 4QWNB 4GK5E 4EV6A 2LSGA 4X64T 2E9XD 3NVOA 3P4WA 4HGAA 2VL0A 2WDQA 4PJLA 3JC6C 3AE2A 4IGUA 3RKGA 4ZOLE 2M67A 4LMLA 5FMNA 4H9PC 1VRBA 2YU2A 1D0XA 2CMRA 2KMFA 3OYXA 4L0RA 1W0BA 2ACZA 4DNDA 1B7TA 3HKEE 3N2KE 4IIJE 4EAHA 4ZZCA 1IBLT 2N1GA 4U7YA 1MIWA 3ZC0A 2D2SA 4GK0E 3VRAA 4WZXA 2LOPA 4JEUB 4DV6T 5AQSB 4JI7T 3SFEA 4EIWA 5EK3A 3RGLA 3FBZA 5LBQB 1YXRA 2ZMAA 2BVLA 3AE1A 2W0GA 3Q5DA 5HEGA 2RA1A 2XSBA 3UU8A 2J1DG 3SRZA 2L3LA 2X67A 1N32T 3HL6A 4A56A 2L8KA 5JRCB 3QB5A 4EEDA 1MMNA 3RKOA 2BG9A 2CXLA 3KV6A 4BAYB 2YDSA 2LKHA 2W2UA 3LK42 4LF4T 2ZM0A 5JDFA 2UXNB 3CVRA 3H3AA 3I0QA 2QRXA 2NP9A 1X79A 2FJAA 4DV3T 3UQ4A 2LM9A 2XJ7A 2YU1A 1MMAA 4CN4A 4I4TE 2LSKA 1IJ6A 2E9XB 4YXDA 2KWHA 4ZEYA 3BQLA 3CQGB 4UV8B 5LJNA 2E2AA 2WB5A 4B6XA 4EXTA 4UVBB 3MZKB 4PJNA 3AAEB 5LHIB 4U7IA 4DR1T 1HS7A 5AFUL 4HTEA 3W15B 4B3RT 1HR0T 1XMQT 1G73A 2YEVC 4L5GA 5KXJA 4Z91A 1WCRA 5FL1A 2LSIA 4G63A 5LJMA 4ADZA 5LHGB 5LXTE 3TLTA 1MIVA 1BR2A 1N34T 2WQYA 4K0KT 3RIUA 4OHFA 2VVNA 2V7KA 4AKGA 4PNIA 5J1GA 5TAOA 2EHOA 4ZI3C 5CJ5A 1UUSA 4QKNA 1KF6A 2WY2A 3ETVA 4AKRB 3BQKA 2NTYA 1XZYA 2CBJA 2ODVA 3IHRA 3PUYF 3KV5A 3SS1A 3UUNA 2WM9A 3LFMA 5EK2A 2XAQB 4DR4T 1I6ZA 2HPLA 5HWYA 3FZKB
chains in the Genus database with same CATH topology
3ONJA 2QYWA 3ONLC 2V8SV 1VCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONJ A;  2QYW A;  3ONL C;  2V8S V;  1VCS A; 
#chains in the Genus database with same CATH topology
 2X9X A;  4ZXL A;  2HH7 A;  4NXN T;  4HWC A;  1D0Z A;  3PUV F;  2CHO A;  2DLR A;  3OPC A;  1HCI A;  1MND A;  1LKX A;  1VCS A;  2CE7 A;  2DCF A;  1SA0 E;  2UXX B;  2SPC A;  3B57 A;  3AE7 A;  2K9A A;  3BK9 A;  5JH7 E;  2CWY A;  4K0U A;  4NUU A;  2CA5 A;  3ZMU B;  5LG3 A;  3G06 A;  4YJ3 E;  2YDQ A;  2V7M A;  4TN7 B;  4JLE A;  3Q9D A;  1UX5 A;  4PFP A;  2A9U A;  2VL8 A;  4ILC A;  4AXP A;  2LM2 A;  4E7Z A;  5AQO B;  1SHZ C;  5LG4 A;  5HXS A;  4UIG A;  2V26 A;  1YD8 G;  3HA4 A;  5DQW A;  4O4J E;  2NR4 A;  3WAJ A;  3U78 A;  5JRC A;  2LT3 A;  2KND A;  5HEJ A;  4QH5 A;  2XQ4 A;  3HKD E;  5HYA A;  1HFA A;  1BR4 A;  2Q9Q C;  4PK5 A;  5IYZ E;  4YTN A;  2G0U A;  1UK5 A;  2NWB A;  4H9O C;  5C3J A;  5JDM A;  2VQE T;  4DUZ T;  2UUB T;  3R84 B;  3PTR B;  4DV4 T;  4GKJ T;  3OJA A;  2XQ3 A;  3S4U A;  2NOX A;  2C5J A;  1NAF A;  2JPF A;  2R6G F;  1UGO A;  2W63 A;  3F2E A;  3RI5 A;  5BR8 T;  3I1A A;  1S94 A;  3QK6 A;  1OED C;  1KNP A;  3K3Q C;  1YW0 A;  5FY0 A;  4DV7 T;  4JI1 T;  3LBX B;  3MK7 C;  5LGT B;  2X9W A;  1I94 T;  3ZMT B;  4P1N A;  1ZEE A;  4YHH T;  4ZI3 D;  2LJL A;  2I59 A;  2BBH A;  3ONX A;  3LJC A;  3PUX F;  2HN1 A;  1WFD A;  2Y8D A;  4KUM B;  3RIU C;  5AQI B;  5L3F B;  3ZPO A;  1IBK T;  3JCF A;  2JRK A;  3AEB A;  2BS4 A;  3UUM A;  5JDL A;  3PU3 A;  4JYA T;  4DBQ A;  2XQA A;  4IL9 A;  1VCT A;  3AXJ A;  3L8R A;  3QOF A;  5JR9 A;  4ZS2 A;  4GIW A;  3O1I A;  5HEH A;  3EAB A;  3RX6 A;  5KDM C;  4LF9 T;  4MHC A;  1E7P A;  2IML A;  4U72 A;  2W67 A;  3RH3 A;  4F6R C;  4YJ2 E;  5L2L A;  2AXD S;  3A5X A;  3AE4 A;  4HWD A;  2UU9 T;  1ZV4 X;  3AED A;  2CXF A;  1W09 A;  1HF8 A;  3NRX A;  2V5C A;  3VR9 A;  5AQR B;  4HWI B;  2ZLY A;  2A2F X;  3N9P A;  2KT9 A;  3AA1 B;  4IL4 A;  2LLY A;  3KBT A;  5AQP B;  1U5P A;  2WS3 A;  2VKH A;  1WYC A;  4U3C A;  4X1K E;  1HTJ F;  2VQF T;  5J0Z A;  5IHY A;  1IBM T;  2BKN A;  1CHU A;  4OYK A;  1FJG T;  3AA7 B;  1XDO A;  3C64 A;  3C4W A;  4YTP A;  2K3W A;  5HWX A;  4DO0 A;  4KX6 A;  3JAD A;  3ONJ A;  2N2N A;  4UF0 A;  4M1P A;  3FZH B;  3E08 A;  4PAG A;  3AE9 A;  2IC9 A;  4UVA B;  3L3P A;  3MJX A;  3RF1 A;  4OYJ A;  4TV9 E;  2WWU A;  3DP7 A;  3P4Q A;  2VAS A;  4BJM A;  2X9Y A;  5AQK B;  1ZP0 A;  3CKD A;  4XBF B;  3Q5E A;  4ZS3 A;  3UUL A;  4FI5 A;  2F4V T;  2C5K T;  1XDP A;  2VWA A;  4H9R C;  3P50 A;  2W62 A;  3KIN B;  1Y01 A;  5FP3 A;  3V5S A;  1MIY A;  2HN2 A;  5C8Y E;  2BKO A;  5ABE A;  4H9S E;  1IJ5 A;  4LF8 T;  2LSJ A;  2LOS A;  3Q5W A;  4YY3 T;  4AKH A;  3NZQ A;  3PUG A;  1QLB A;  2QVA A;  2FJB A;  3KVB A;  3I0O A;  3IEE A;  3JC6 D;  3N9N A;  3QC9 A;  3C51 A;  4IDO A;  5JRE A;  2Q9Q D;  2E9X C;  3KDS E;  3RYC E;  3UU4 A;  4PFO A;  4B3M T;  4KHP T;  1Y64 B;  3CWZ B;  5AQN B;  4ZI2 C;  5LMN T;  2BDE A;  3ZYM A;  2CPT A;  1Z8U A;  2DWG A;  4UV9 B;  2IHR 1;  2XAG B;  5HCJ A;  4BA9 A;  4ERR A;  4EZH A;  3KV4 A;  4CXW A;  4DR2 T;  4HKA A;  2WU2 A;  3SFD A;  3ZLI A;  5FNV E;  4A98 A;  1US7 B;  3F57 A;  3A8Y C;  3ZT6 A;  1HG5 A;  4DMW A;  3CPZ A;  4OK0 A;  2MOZ A;  3ZN1 B;  3P4R A;  4MLK A;  3PU8 A;  3IF8 B;  4ZI2 D;  3ANW B;  3RHW A;  2KXP B;  1HX1 B;  4HFH A;  2HPJ A;  5AQM B;  3HKC E;  3RLF F;  3CML A;  3PUZ F;  2MTQ A;  2V1D B;  2WMO A;  2YOE A;  2XAS B;  2WMN A;  3AE3 A;  3K3O A;  4DR5 T;  4KI0 F;  2WU5 A;  2EHO D;  2X66 A;  3P8C D;  3UUB A;  5LBM A;  3C4Z A;  1CUN A;  4GKK T;  4EZ4 A;  3PE0 A;  4OX9 T;  3FZL B;  2X0H A;  3PUW F;  2W00 A;  1E1H B;  3FB2 A;  4ISS A;  4O8S A;  1T8B A;  2JMH A;  5AQT B;  5CA0 E;  3FHN A;  4IDP A;  5DJQ C;  2WWV A;  3UUX B;  4DV5 T;  4QH4 A;  5FVK A;  2EHO B;  5ABF A;  2XAJ B;  4H9Q C;  5KMG P;  4UR9 A;  4JI2 T;  3OYZ A;  5CGM A;  1J1J A;  1E2A A;  3K8P C;  5H6Q B;  4I50 E;  4NIQ A;  1WR6 A;  2LRL A;  3SWH A;  2X51 A;  4N78 D;  4WNK A;  3UU3 A;  3ZKR A;  1NEN A;  3N2G E;  3PUA A;  4UEM A;  3NKZ A;  4UF0 B;  3Q2M A;  4AQF A;  4EYU A;  2L9Q A;  1XNR T;  3ZST A;  1AJ3 A;  4TV8 E;  5AQF B;  3AEC A;  2VKD A;  3N5L A;  3MXZ A;  1MNE A;  4B3S T;  4LMJ A;  3PUQ A;  2XUE A;  4Z8X A;  3JAE A;  3AE6 A;  4YSY A;  2X68 A;  4O2A E;  1HNW T;  3ZT5 A;  3ZJ2 A;  2CRB A;  1XNQ T;  4YTM A;  3EDU A;  4AI6 A;  4MBQ A;  3EHZ A;  3ABV A;  4CI2 B;  3TLU A;  4TWD A;  5FY1 A;  3T8O A;  4YSZ A;  3N9M A;  1FMW A;  5ADX L;  4JI6 T;  5L3B B;  3NWI A;  2D5U A;  1XMO T;  2WSS V;  1JNR A;  2Q9Q A;  3ZMS B;  4AKL A;  2UUA T;  5C2T A;  2BG9 E;  3LK2 B;  2J4G A;  4L9I A;  2JQK A;  1IZN B;  3X1D A;  2FJD A;  3NZP A;  5FXX A;  5HCM A;  4AIU A;  2JQH A;  5HXR A;  4ILA A;  1HNX T;  3LDQ B;  2FJE A;  3IA3 A;  3LSV A;  1L0V A;  4CQI A;  5JDQ A;  4IDZ A;  5FL0 A;  1YQ3 A;  3ANW A;  2K24 A;  2JIW A;  2D0U A;  2ES0 A;  3FZM B;  4HWH A;  4KMC A;  1OED E;  5DAB A;  3D0T A;  3TLS A;  2XZE A;  5FY7 A;  3ZCJ A;  3FZF B;  2UXC T;  1FMV A;  2I0M A;  2XQ9 A;  2YK0 A;  2Y6X A;  3BQI A;  4YT0 A;  2D0T A;  2LKG A;  3QNU A;  2I6H A;  3GWH A;  2OLT A;  4UEL A;  4ILU A;  2CHN A;  2W4X A;  1T7S A;  5CFB A;  4GOU A;  2DNX A;  4HFB A;  5L3D B;  3RC3 A;  1MMD A;  4X62 T;  3VKH A;  3Q5X A;  3SOL A;  4HFE A;  2XY8 B;  2XM1 A;  4AQF C;  3ESL A;  2ODU A;  4I55 E;  2XQ7 A;  4TX5 A;  3OTO T;  4QXH B;  2W66 A;  4CXX A;  3RQU A;  3AE5 A;  5AQL B;  3VU7 H;  3E0Z A;  4Z90 A;  4HWF A;  3A7M A;  5JDH A;  1OED A;  3ZMV B;  3FXE B;  2E5V A;  5J2U E;  2UXB T;  1IAP A;  3N2O A;  3K3N A;  2WAU A;  1MMG A;  1WRD A;  3QB5 K;  4J2C A;  5EK4 A;  2DL1 A;  2XQ5 A;  5F8P A;  4LF5 T;  1ZOY A;  2WBL A;  5LYJ E;  1S35 A;  5IUX A;  2V8S V;  2XQ6 A;  1R8I A;  2CWO A;  1ZHC A;  5M4Y A;  4BJN A;  2DWK A;  2KZ7 B;  1UUR A;  2XTL A;  1ZKE A;  2CLY C;  2PTF A;  3CIR A;  4ILB A;  4PK4 A;  4QX8 B;  4C90 A;  4CXY A;  3AVR A;  4QXB B;  5AQU B;  3AB3 B;  4QH1 A;  3M65 A;  4PK6 A;  1GQE A;  5JTG A;  1HG2 A;  1YQ4 A;  4EB6 E;  3RRC A;  3H3M A;  3AVS A;  3UTK A;  1N33 T;  2K5B B;  3AA6 B;  2V7J A;  4JI5 T;  3CX8 B;  4IRE A;  3ZT7 A;  4TWH A;  2H7O A;  5J2T E;  3P4P A;  3RPU A;  3VRB A;  2VVS A;  4YFS A;  4EEB A;  4JI8 T;  1UCU A;  4G2A A;  5LOV E;  3L09 A;  4V1A v;  2NW9 A;  4KBM B;  2BS2 A;  4LF7 T;  2C5I T;  1KEY A;  2PFV A;  2A3D A;  3JAF A;  4JBW F;  2GK9 A;  5L3E B;  2J47 A;  1D0Y A;  3OBV E;  2JJ9 A;  4UXN B;  4E7S A;  1M7K A;  5L47 A;  2BKP A;  2X9H A;  3O1H A;  3KFW X;  3CX7 B;  3UU6 A;  2YN6 A;  3P7I A;  5AQG B;  2BBJ A;  2FUP A;  2OV9 A;  2UXD T;  1QUU A;  2ZM8 A;  4DVD A;  2QA7 A;  2XQ8 A;  2M6I A;  4AQY T;  1OXZ A;  3MKD A;  1J5E T;  2V6X A;  3F31 A;  4EGW A;  4WBN E;  3AE8 A;  2UUC T;  5CB4 E;  2J62 A;  2V5D A;  2KIN B;  1BR1 A;  2PG8 A;  4B3T T;  2OA5 A;  5JDG A;  1EZ3 A;  4U2Z A;  2NW8 A;  1KK7 A;  5JDN A;  2CBI A;  3ZYK A;  4EYY R;  4NXM T;  3O1J A;  3FBL A;  4YSX A;  5HXE A;  3CK6 A;  3ONL C;  1NEK A;  2IAK A;  2X0Y A;  5HEU A;  4COF A;  2ACX A;  3J9X 1;  1NWM X;  1YKH B;  3T1Y T;  4LF6 T;  3PDY A;  3NRY A;  4DUY T;  5FXV A;  3VKG A;  4TNW A;  5E0O A;  3RIF A;  2IDO B;  2CXD A;  5FXZ A;  3GN5 A;  3MA9 A;  4U31 A;  2KSR A;  4JI0 T;  2XPK A;  3QUJ A;  1D1B A;  5L4H A;  2BVM A;  2DHR A;  3LG7 A;  4X66 T;  3AA0 B;  4TZ4 C;  5LB7 B;  2LE8 A;  2E8I A;  3O9X A;  4IHJ E;  1DU2 A;  5CA1 E;  4AKI A;  4TNV A;  1WYB A;  5AQQ B;  3TLW A;  1JNZ A;  4QHO A;  2C0S A;  3OVU A;  3IBP A;  4WYV A;  3N9L A;  5AQH B;  5LHH B;  2JQ9 A;  3N9Q A;  2HHH T;  5LA6 E;  1BR0 A;  1KNR A;  1M62 A;  1WR0 A;  2BG9 C;  2Z6E A;  4I43 B;  4JEH B;  3ZC1 A;  2FBW A;  2XSA A;  3DTO A;  3E22 E;  3UFE A;  3UFG A;  2ZM2 A;  4DR6 T;  3RIA A;  3UQ7 A;  4HFC A;  5FVL A;  3ZYL A;  4CZZ B;  1D1A A;  3LBX A;  5GON E;  3U3I A;  2B76 A;  5JQG E;  3R6N A;  2LHR A;  2D9D A;  2Y48 B;  4ASK A;  2XAH B;  3EUH A;  4PW8 A;  4F8H A;  2EHO C;  5L3G B;  2CM0 A;  2VK9 A;  3AEF A;  4XAX B;  3C4X A;  3WAK A;  4DMV A;  1HNZ T;  2NTX A;  2MAW A;  4TUY E;  3RYI E;  3ZSS A;  2AE9 A;  1W0A A;  1SUM B;  3LK3 B;  3OKQ A;  1N36 T;  4IST A;  3TLV A;  2LHN A;  3HR0 A;  4HFD A;  4KHZ F;  2XM2 A;  3EDV A;  4X20 E;  3RC8 A;  4CN1 A;  2LEH A;  3PV0 F;  4MFR A;  2P9B A;  2IW5 B;  3B5M A;  1UX4 A;  3KVA A;  4PJM A;  3RRW A;  4HE8 A;  4UVC B;  4IE4 A;  2H7V C;  3I9W A;  4ZZB A;  4QXC B;  3O4X E;  4Q25 A;  4JI3 T;  2YIN A;  5ABG A;  2PBI A;  2KWI B;  3FXD B;  1X9B A;  4GYR A;  3AAI A;  3ZEF B;  4DV2 T;  3P4S A;  2PJQ A;  4IDN A;  4X5T A;  5LCY A;  4A97 A;  5ABH A;  4JI4 T;  4H63 H;  1Z0P A;  4U74 A;  3RYF E;  4YHJ A;  5A1L A;  5HXH A;  4HFI A;  3C98 B;  2XQY A;  3ETU A;  4H9N C;  4DID B;  4IE6 A;  3AEE A;  4I0U A;  3J7Y q;  2CCQ A;  2H3R A;  1G8X A;  3VR8 A;  2IUB A;  3PUR A;  1LVK A;  3TKL B;  5F3J A;  5ETW A;  3V5U A;  3M3Z B;  1LVF A;  4IE5 A;  3K1S A;  1J5W A;  4TWF A;  5FXW A;  5LMU T;  1W9R A;  4PJJ A;  2BZB A;  2YKS A;  3KBU A;  2V7I A;  4AIS A;  3GMI A;  2E5L T;  4CN6 A;  3UU5 A;  4NUV A;  5KX5 E;  5H6R B;  1KFY A;  4U2Y A;  5DQV A;  1D1C A;  2CEA A;  2V6Y B;  4OFZ A;  5JVD E;  4ZI7 E;  3GN5 B;  4DBR A;  5AQV B;  4IE7 A;  2XAF B;  5LNK A;  4DR7 T;  1KNZ A;  1YKE B;  1QSD A;  2H88 A;  2A72 A;  2WDR A;  3B13 A;  3H37 A;  3HI2 A;  5HXC A;  2WDV A;  4CI3 B;  2B1E A;  2VB6 A;  3EVY A;  1SE7 A;  4U33 A;  2VKJ A;  4NPP A;  4WW0 A;  4GYS A;  3VHL A;  4DV0 T;  4ZHQ E;  1OED B;  1FIO A;  4P0A A;  2CLY B;  1WLX A;  2RP4 A;  1H7C A;  2WCA A;  3CQX C;  3DJB A;  4P09 A;  4WBO A;  4QX7 B;  2ZM6 T;  5LGN B;  2WZI A;  2KLQ A;  1U4Q A;  2WP9 A;  3EAM A;  3GA8 A;  4HFV A;  4X1I E;  1VOM A;  2JMK A;  3MAC A;  4X1Y E;  2BG9 B;  2MYS A;  5FYM A;  3UT5 E;  3ZMZ B;  5LP6 E;  3T1H T;  4CI1 B;  2MBG A;  3I9Y A;  3HKB E;  2RPA A;  3ZCI A;  4A5X A;  1HX8 A;  4IE0 A;  2K48 A;  2M6B A;  2VKO A;  3AEG A;  3AEA A;  3KV9 A;  3PJA A;  5JR9 C;  3C50 A;  2IIU A;  2JQQ A;  4EOZ B;  1O3X A;  4JV5 T;  1FEW A;  4O2B E;  3AAA B;  4XZC A;  4DV1 T;  1T72 A;  2W61 A;  4MAL A;  2V6Y A;  2DI4 A;  3PUS A;  4LFC T;  4X65 T;  2MPK A;  4JUY A;  4P0B A;  5AQJ B;  5L4E A;  1XWM A;  1OWA A;  3PJA J;  5LGU B;  3AXJ B;  4O4I E;  5JR9 B;  3N9O A;  4FJO A;  3CX6 B;  4LFB T;  3NBX X;  4KP3 C;  2VUR A;  2X0L B;  4LFA T;  5HEO A;  2BS3 A;  3EI0 A;  5ABF B;  4C91 A;  5IWA T;  4YLH A;  4HEA A;  5EZY E;  1LRZ A;  1V9D A;  4HN9 A;  4IDQ A;  4LMK A;  5BMV E;  2XHE B;  3ZJ1 A;  4O4L E;  2N9D A;  2QYW A;  2Q9Q B;  5F5W A;  3RQW A;  3ZN0 B;  5FKY A;  4ANJ A;  1T98 A;  3WI3 A;  3CQC B;  4IT4 A;  5L3C B;  3L39 A;  2LRK A;  4DR3 T;  4AQG A;  2IC6 A;  2V7L A;  4H63 V;  2NW7 A;  2LSY A;  2QGS A;  2WZH A;  2YDR A;  2H89 A;  4O4H E;  5HAX A;  2E9X A;  3RYH E;  4QWN B;  4GK5 E;  4EV6 A;  2LSG A;  4X64 T;  2E9X D;  3NVO A;  3P4W A;  4HGA A;  2VL0 A;  2WDQ A;  4PJL A;  3JC6 C;  3AE2 A;  4IGU A;  3RKG A;  4ZOL E;  2M67 A;  4LML A;  5FMN A;  4H9P C;  1VRB A;  2YU2 A;  1D0X A;  2CMR A;  2KMF A;  3OYX A;  4L0R A;  1W0B A;  2ACZ A;  4DND A;  1B7T A;  3HKE E;  3N2K E;  4IIJ E;  4EAH A;  4ZZC A;  1IBL T;  2N1G A;  4U7Y A;  1MIW A;  3ZC0 A;  2D2S A;  4GK0 E;  3VRA A;  4WZX A;  2LOP A;  4JEU B;  4DV6 T;  5AQS B;  4JI7 T;  3SFE A;  4EIW A;  5EK3 A;  3RGL A;  3FBZ A;  5LBQ B;  1YXR A;  2ZMA A;  2BVL A;  3AE1 A;  2W0G A;  3Q5D A;  5HEG A;  2RA1 A;  2XSB A;  3UU8 A;  2J1D G;  3SRZ A;  2L3L A;  2X67 A;  1N32 T;  3HL6 A;  4A56 A;  2L8K A;  5JRC B;  3QB5 A;  4EED A;  1MMN A;  3RKO A;  2BG9 A;  2CXL A;  3KV6 A;  4BAY B;  2YDS A;  2LKH A;  2W2U A;  3LK4 2;  4LF4 T;  2ZM0 A;  5JDF A;  2UXN B;  3CVR A;  3H3A A;  3I0Q A;  2QRX A;  2NP9 A;  1X79 A;  2FJA A;  4DV3 T;  3UQ4 A;  2LM9 A;  2XJ7 A;  2YU1 A;  1MMA A;  4CN4 A;  4I4T E;  2LSK A;  1IJ6 A;  2E9X B;  4YXD A;  2KWH A;  4ZEY A;  3BQL A;  3CQG B;  4UV8 B;  5LJN A;  2E2A A;  2WB5 A;  4B6X A;  4EXT A;  4UVB B;  3MZK B;  4PJN A;  3AAE B;  5LHI B;  4U7I A;  4DR1 T;  1HS7 A;  5AFU L;  4HTE A;  3W15 B;  4B3R T;  1HR0 T;  1XMQ T;  1G73 A;  2YEV C;  4L5G A;  5KXJ A;  4Z91 A;  1WCR A;  5FL1 A;  2LSI A;  4G63 A;  5LJM A;  4ADZ A;  5LHG B;  5LXT E;  3TLT A;  1MIV A;  1BR2 A;  1N34 T;  2WQY A;  4K0K T;  3RIU A;  4OHF A;  2VVN A;  2V7K A;  4AKG A;  4PNI A;  5J1G A;  5TAO A;  2EHO A;  4ZI3 C;  5CJ5 A;  1UUS A;  4QKN A;  1KF6 A;  2WY2 A;  3ETV A;  4AKR B;  3BQK A;  2NTY A;  1XZY A;  2CBJ A;  2ODV A;  3IHR A;  3PUY F;  3KV5 A;  3SS1 A;  3UUN A;  2WM9 A;  3LFM A;  5EK2 A;  2XAQ B;  4DR4 T;  1I6Z A;  2HPL A;  5HWY A;  3FZK B; 
#chains in the Genus database with same CATH homology
 3ONJ A;  2QYW A;  3ONL C;  2V8S V;  1VCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...