2QYWA

Crystal structure of mouse vti1b habc domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport, endocytosis
molecule keywords Vesicle transport through interaction with t-SNAREs 1B homol
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2qywA00
1VCSA 3ONLC 2QYWA 3ONJA 2V8SV
chains in the Genus database with same CATH superfamily
4CI1B 3B5MA 2WZIA 3T1YT 1FEWA 1KNPA 2CBJA 2DHRA 2WAUA 3AA7B 3EUHA 5FY7A 4CZZB 4DR1T 4HN9A 2LSIA 4PJLA 3ZPOA 4EAHA 3CQCB 3CX8B 3C50A 2WBLA 1S94A 4LMLA 4U2ZA 2XQ4A 1FJGT 4AKLA 4F8HA 2BKNA 2JQQA 2YEVC 3EVYA 5EZYE 3RGLA 1VCTA 2BS3A 2H7VC 3FZHB 3TLWA 3MA9A 2CHOA 4ZI7E 2KMFA 4B6XA 1NEKA 2BG9B 3JAEA 3KV5A 4YHJA 5E0OA 4EGWA 2X51A 4NIQA 2B1EA 4O2AE 1ZV4X 4X5TA 3AE6A 1LVKA 2V1DB 4Z90A 5IHYA 3P4RA 2F4VT 4QHOA 2QA7A 4DV3T 4K0KT 4U7IA 3K3QC 1OEDB 3ZMSB 4TNWA 2FJBA 3NRXA 2WSSV 4TWDA 3SS1A 5AQIB 4CI2B 3EABA 3TKLB 2RP4A 3CK6A 4EIWA 4WBNE 3LBXB 1JNZA 5JDMA 2LKGA 3IA3A 2ES0A 2XQAA 2CRBA 3R6NA 2E5VA 4X20E 5L47A 4F6RC 2R6GF 2WDQA 2ZLYA 4NUUA 5JDQA 4IE7A 2XHEB 2IC9A 3LK42 1HNXT 4LFCT 2CXDA 2NTXA 4YLHA 3RYCE 3ONXA 4HE8A 2I0MA 4ILUA 3O9XA 2ZM0A 1IZNB 3LFMA 1GQEA 2WM9A 2W62A 4O2BE 1HNZT 4ERRA 5AQQB 2X66A 1N33T 3PU3A 5HEJA 4MHCA 4DV7T 4WYVA 2L8KA 3AAIA 2PTFA 3SFDA 2E8IA 2IIUA 4DV6T 2YINA 3IBPA 3GWHA 1NWMX 2XSAA 3ZCJA 3VR9A 5BMVE 4ADZA 5FYMA 4BA9A 3WAKA 5ETWA 4EYYR 2UXBT 4IDQA 4TNVA 4AQGA 4GOUA 3L3PA 2BKPA 2FBWA 3FZKB 4YTMA 4A5XA 4YHHT 1H7CA 3LDQB 5LMNT 2VWAA 4IDOA 4A98A 5KX5E 3M3ZB 2LOPA 1UX4A 2UUBT 1G8XA 2H89A 2HPJA 3HKDE 3QOFA 5HXRA 2W61A 3RYFE 4DO0A 2VL0A 5L3BB 2VKHA 1B7TA 2V7MA 2P9BA 1W9RA 2X9XA 2OV9A 2X9YA 2J62A 3C64A 4J2CA 1XWMA 4OFZA 4OYJA 4U72A 2XQYA 2J1DG 4HWFA 5LXTE 5CJ5A 1XDOA 4HFEA 1HR0T 4QX7B 3UT5E 3AE3A 4PNIA 4C90A 1M7KA 3RKOA 3I9YA 3QNUA 4IDPA 2CM0A 5TAOA 4E7SA 4B3MT 4PK6A 5HEUA 5AFUL 2BG9E 1Z0PA 2CWOA 2V7KA 2YU1A 4PFPA 1SE7A 4I55E 4WBOA 4CXWA 4IL4A 3AE2A 3ZJ1A 1ZP0A 2DCFA 2HN1A 4UVBB 3N9QA 3ZMZB 5EK4A 1N32T 2XAHB 2LRLA 3QUJA 4EZHA 4B3RT 1IJ5A 5FY1A 2LRKA 1WYBA 2LE8A 2K9AA 4PK4A 3SRZA 4COFA 4DIDB 3EAMA 5L3EB 5FXXA 4UF0B 5A1LA 2Q9QC 2K24A 2LSYA 3AAEB 4ANJA 3UFEA 4XAXB 1OWAA 4UR9A 4EV6A 5F3JA 4H9QC 4H9SE 4GKJT 1T98A 3PJAA 4H63H 2BKOA 1QLBA 3FBLA 2W00A 3P50A 5LB7B 1KEYA 4X1KE 3I0QA 2DLRA 2M6BA 1CUNA 4H9RC 5FNVE 3ZYLA 2C5IT 2X68A 3AA6B 2I59A 4TX5A 5DQVA 2KZ7B 2ODUA 3HKBE 3N9PA 1WCRA 3P4SA 2EHOD 3QC9A 4QX8B 3SOLA 4AQFC 2W2UA 4BJNA 1KNZA 5LGUB 3LJCA 2WDRA 2BDEA 4HFHA 5JRCA 3KV9A 1WYCA 4EB6E 2NTYA 3M65A 2XQ3A 2LM2A 4ZOLE 5HXHA 4UIGA 1YQ4A 4QH5A 3AE5A 2YK0A 2XQ7A 3PUAA 2M67A 5JR9C 1FMVA 2DWKA 3UU8A 5KMGP 1NENA 2FUPA 3I0OA 4G2AA 2I6HA 3S4UA 4AKRB 1ZKEA 1Y01A 2N1GA 2D0TA 2ZMAA 3KBTA 1MMNA 2LHRA 3DTOA 5LJNA 5LP6E 5J2TE 4B3ST 3FZFB 4QXHB 5CA1E 2UUAT 5DJQC 4HTEA 3RQWA 2A9UA 3IEEA 3MXZA 4UVAB 5HEOA 1KFYA 3OBVE 4HWDA 2A72A 5HXSA 3PUXF 4ISTA 4TWFA 3UU3A 2KWHA 2J4GA 3BQIA 2JMHA 3AEGA 5CFBA 1XNRT 3AA0B 3RIFA 2WDVA 5IUXA 2W4XA 3FHNA 4YSZA 3ONJA 3PJAJ 3U78A 1SA0E 2JJ9A 4CQIA 4LF9T 3ZLIA 3IHRA 4ILBA 3L39A 4KUMB 5AQRB 4A56A 3WAJA 3FZMB 4DBRA 2LEHA 4YXDA 5JH7E 3RF1A 4X1IE 2XAFB 2C5JA 5FXWA 4XBFB 2ZM2A 3PU8A 5AQHB 5LCYA 2JPFA 3RHWA 4PFOA 4O4LE 2IUBA 2NP9A 4P09A 1T7SA 5LBMA 2KSRA 4U7YA 3AEAA 5JDHA 2V6YA 3N9OA 3UU4A 2XM1A 2IC6A 5CGMA 4GK5E 2XY8B 3TLTA 1HX1B 3DJBA 4KMCA 3AA1B 3VU7H 3ZT6A 4OX9T 1US7B 3OYXA 4XZCA 3H37A 4U31A 4YJ3E 4KHPT 2LHNA 4IREA 4X65T 3Q5WA 4DR7T 3RC3A 5HEGA 2WCAA 3P7IA 3IF8B 1VOMA 3PUQA 4JEHB 3PUWF 4LFAT 3QK6A 2V5DA 2WWVA 4X1YE 3K3OA 3PUVF 4ILCA 4WZXA 1OEDA 3NZQA 3MZKB 4EXTA 5CA0E 1E1HB 4QXBB 4YTPA 2VQET 4OK0A 3H3MA 2Z6EA 3FXDB 2JQKA 1WLXA 5AQLB 2LSJA 2MOZA 4AKIA 2WMOA 2XQ6A 2PFVA 4AQYT 2A3DA 2BG9A 4YSYA 1XMQT 1YD8G 2AE9A 4IT4A 2X9WA 5BR8T 3P8CD 3ZCIA 3UTKA 4JI8T 2WS3A 3L09A 4IDNA 2XASB 3E22E 1J1JA 3PURA 4MALA 4JI0T 2K3WA 1D0ZA 3OKQA 2V7IA 1AJ3A 4AI6A 2A2FX 2CLYC 2X0LB 3DP7A 4LFBT 2G0UA 4GKKT 2JQ9A 4MLKA 2M6IA 3RIAA 4DNDA 3JAFA 5AQSB 4DR3T 4WNKA 4JI1T 1I6ZA 3KV4A 2DWGA 1BR1A 5EK3A 3AE8A 3MKDA 4P0AA 3AEEA 4KBMB 2MAWA 2YN6A 3HKEE 2J47A 1YXRA 4IE6A 2DL1A 1X9BA 3Q5DA 4DV4T 5AQPB 3KVAA 3LG7A 1FMWA 2K5BB 1LVFA 1EZ3A 2X0YA 2XQ8A 3O1HA 3ZMTB 4EEDA 2V26A 1MIWA 5JDNA 4GYSA 1KF6A 2V7LA 3JC6C 2VASA 4GYRA 3PE0A 3Q2MA 4IHJE 4IDZA 4Z8XA 1IBMT 2WB5A 3ZSTA 3BQKA 2VK9A 3EDVA 4KI0F 5AQKB 4DR6T 4HEAA 2YKSA 5LG3A 2LKHA 3RYHE 2VKJA 1UGOA 3KFWX 3NKZA 4IGUA 5LGNB 2CPTA 4QH1A 4YT0A 4JYAT 3KDSE 3JC6D 4HFVA 4JLEA 2LOSA 4FI5A 4PJMA 2DI4A 1W09A 4ZXLA 4JI5T 2W63A 4MBQA 4DBQA 4ZI2C 3FXEB 1MIVA 2BVLA 3ZMUB 3ONLC 4EZ4A 2D5UA 2EHOA 3P4WA 4U74A 3ZN0B 3C4XA 5HEHA 3ZC1A 2VKOA 4ZS2A 2V6XA 2CCQA 4IE4A 2NWBA 2PG8A 4UELA 3EI0A 2MTQA 2CHNA 2VB6A 3D0TA 3JADA 3N2KE 2CEAA 5JQGE 1N36T 3VKGA 5L3FB 4L9IA 3SWHA 4M1PA 5JTGA 3V5SA 4DR5T 4UXNB 1I94T 4B3TT 3UU5A 5HAXA 2IW5B 5JR9B 1U5PA 4OHFA 4TWHA 4ZI2D 3UUMA 5ABFB 2CE7A 2LLYA 1MIYA 3MJXA 1VCSA 3B13A 3L8RA 4K0UA 4PJNA 3UQ4A 4EYUA 2QYWA 2V5CA 4LF8T 4EOZB 2NW7A 2PBIA 3KINB 5LA6E 2D0UA 1UURA 2WP9A 3F57A 2YDSA 3HL6A 4DVDA 1MMAA 1UX5A 1SUMB 2V6YB 3C4WA 4AXPA 3WI3A 2KNDA 1ZOYA 5L2LA 1OXZA 2JIWA 2LT3A 3CQXC 2KWIB 2RPAA 2XQ5A 3OVUA 4IE5A 4PAGA 5AQOB 5H6RB 4AKHA 5KXJA 3PDYA 2ZM8A 3A5XA 1QUUA 2VQFT 3ZC0A 2NR4A 1XZYA 2MBGA 3ZSSA 4AKGA 3AEBA 3MK7C 2XZEA 4KX6A 3AB3B 3J7Yq 5AQFB 2CA5A 1D1AA 1HG2A 4U3CA 3RKGA 3ANWA 4PJJA 3HA4A 4NUVA 3OYZA 2Y48B 5FY0A 4LF4T 3AXJA 3A7MA 4NXMT 2BS4A 2JQHA 4CN1A 3PUYF 2FJAA 3PUGA 3ZEFB 1HCIA 5LOVE 5AQUB 3LK3B 5JDGA 5LNKA 2WQYA 3U3IA 2LSGA 2BS2A 5JREA 3T1HT 4TN7B 4ZHQE 4KP3C 3TLUA 2ZM6T 5LHHB 2VVSA 2YU2A 3C4ZA 3FBZA 3F31A 3I9WA 1T8BA 2E9XA 3CQGB 3P4QA 3G06A 4X62T 2DNXA 5AQNB 2E5LT 3AVRA 5AQMB 4UV9B 3ZKRA 4CN4A 4CN6A 4AIUA 4E7ZA 2UU9T 1MMDA 4P0BA 5L4EA 2EHOC 3BQLA 5HCMA 4QWNB 3O1JA 1MMGA 4JEUB 5KDMC 2RA1A 3OJAA 2QGSA 4IIJE 2CWYA 3AE1A 4MFRA 2XQ9A 1D0XA 1XDPA 2VURA 3NVOA 3OPCA 4TV8E 4ZS3A 3RI5A 3I1AA 1M62A 2WU5A 3RH3A 4A97A 4YTNA 2HN2A 5J2UE 3PV0F 3PUZF 5JRCB 5HWYA 4HWCA 2L9QA 1UUSA 3Q5XA 4QXCB 3RIUA 4YSXA 4DV1T 5LJMA 4DR4T 5L3CB 3EHZA 5ADXL 3CMLA 2HH7A 3ZJ2A 2PJQA 5C3JA 4X66T 3RC8A 3BK9A 1BR2A 4U2YA 4DMVA 4U33A 3CX7B 1KK7A 1IAPA 4TZ4C 4BJMA 2JMKA 2ACXA 1VRBA 3K3NA 3K8PC 2N2NA 3CKDA 2XAQB 3CVRA 4JBWF 2X9HA 3ZN1B 4H63V 2K48A 2JRKA 4YJ2E 1XMOT 2XJ7A 2XAJB 2H7OA 3GMIA 5FXZA 5J1GA 5FP3A 2WU2A 2IHR1 2KXPB 3C98B 3NZPA 4UF0A 3TLVA 4YY3T 2CXFA 4I4TE 2CMRA 3CIRA 2XUEA 1L0VA 4CI3B 2IAKA 1LKXA 1JNRA 5L3DB 3HI2A 5DABA 4JI2T 3N5LA 4AISA 4DV2T 5JDLA 4I0UA 1SHZC 2V8SV 1BR4A 1NAFA 5J0ZA 1IBLT 4HWIB 2HPLA 2E2AA 2E9XD 3PTRB 4HWHA 3N9MA 4GIWA 4HFDA 4LMJA 4NPPA 5F5WA 5CB4E 3VRAA 5LG4A 4CXYA 4JI6T 4JUYA 5GONE 2QRXA 4H9NC 5HXEA 1HTJF 1D1BA 3N2OA 4DR2T 1KNRA 3VR8A 1YQ3A 4P1NA 2XAGB 2BZBA 1HF8A 4ZZBA 3K1SA 4UEMA 5FL1A 3LBXA 2Q9QD 1FIOA 2C0SA 3UUBA 4DUYT 4LF6T 2FJEA 1WRDA 2V7JA 4UV8B 3O1IA 3AE7A 3QB5K 2XM2A 3RIUC 1T72A 2GK9A 2B76A 4OYKA 2KT9A 5ABHA 3AEDA 3T8OA 4G63A 2ACZA 1OEDC 2L3LA 3FZLB 5JDFA 2LM9A 5ABGA 3RRWA 3ZT5A 5LGTB 3AE9A 4ZI3C 5LHIB 2VL8A 1S35A 1D1CA 3NBXX 3RPUA 4JI7T 4Z91A 5FKYA 1D0YA 1E2AA 2NW8A 1E7PA 4HFBA 4L0RA 4L5GA 2XSBA 2NW9A 5LHGB 5L4HA 4X64T 4HGAA 2N9DA 2D9DA 1LRZA 3AE4A 2WZHA 4JI4T 5AQGB 3ZT7A 4NXNT 1QSDA 3ABVA 3AEFA 2E9XC 1CHUA 1WR0A 3P4PA 4O4HE 1V9DA 3Q9DA 4WW0A 4CXXA 3V5UA 2W66A 2AXDS 3VKHA 4EEBA 1YW0A 4DUZT 2WY2A 3N9LA 5FL0A 1N34T 3RYIE 1G73A 1UCUA 1WFDA 1Y64B 3AXJB 4HFCA 2HHHT 3ZMVB 2LJLA 2BBJA 2QVAA 4H9PC 3ANWB 4V1Av 3RQUA 3UUXB 2H88A 2ODVA 3EDUA 1HS7A 3NWIA 3H3AA 1XNQT 5AQVB 5AQTB 2UXCT 2OLTA 1WR6A 3ESLA 5C2TA 2Y8DA 1OEDE 1IJ6A 1ZHCA 3QB5A 5FMNA 4JV5T 2WWUA 3B57A 1U4QA 3N2GE 3UUNA 2X0HA 1IBKT 5C8YE 2X67A 4GK0E 4O4IE 2W67A 2BVMA 3MACA 2VKDA 2C5KT 4O8SA 3X1DA 5M4YA 3CWZB 3PUSA 1W0BA 3NRYA 3CPZA 1O3XA 3RLFF 4UVCB 3UQ7A 1R8IA 3JCFA 5HXCA 3VRBA 4ZEYA 5FVLA 1W0AA 3A8YC 2YDRA 4HFIA 2E9XB 2UXXB 5ABFA 4ILAA 2CLYB 5JR9A 5LBQB 4ISSA 2NOXA 5H6QB 4Q25A 5DQWA 3R84B 2XPKA 3J9X1 4KHZF 2OA5A 4PK5A 4DV5T 2YOEA 3KBUA 3ZYMA 5IWAT 4BAYB 3KV6A 2UXDT 3C51A 3E0ZA 1HG5A 1HX8A 2YDQA 4YFSA 4AQFA 4ZZCA 1BR0A 3GN5B 2CBIA 2FJDA 3N9NA 4HKAA 2UXNB 1UK5A 2EHOB 2SPCA 4O4JE 2Q9QB 4TUYE 3VHLA 2UUCT 1MNEA 5L3GB 2IMLA 3FB2A 1YKHB 1MNDA 4FJOA 3Q5EA 4PW8A 3AVSA 2LSKA 4QH4A 4JI3T 2H3RA 3AAAB 4QKNA 3W15B 4H9OC 1YKEB 3HR0A 1HFAA 1ZEEA 2MPKA 5F8PA 2MYSA 3TLSA 2BG9C 2KLQA 4LMKA 4N78D 3KVBA 5JVDE 3SFEA 4ASKA 5IYZE 3OTOT 2WMNA 3UFGA 3ETVA 2KINB 4C91A 3CX6B 2Y6XA 3UULA 1Z8UA 1J5ET 2VVNA 3ETUA 3HKCE 3RX6A 3ZYKA 4TV9E 4LF5T 5HCJA 5LMUT 3E08A 3O4XE 4IL9A 2BBHA 4IE0A 4I43B 3AECA 5FXVA 5AQJB 4ZI3D 2CXLA 4I50E 4LF7T 2IDOB 2Q9QA 2XTLA 3RRCA 4DV0T 1DU2A 3LK2B 1X79A 2W0GA 5EK2A 3GN5A 5ABEA 3UU6A 4DMWA 5HWXA 5LYJE 1HNWT 3F2EA 3LSVA 5HYAA 2D2SA 1J5WA 3GA8A 5FVKA
chains in the Genus database with same CATH topology
1VCSA 3ONLC 2QYWA 3ONJA 2V8SV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCS A;  3ONL C;  2QYW A;  3ONJ A;  2V8S V; 
#chains in the Genus database with same CATH topology
 4CI1 B;  3B5M A;  2WZI A;  3T1Y T;  1FEW A;  1KNP A;  2CBJ A;  2DHR A;  2WAU A;  3AA7 B;  3EUH A;  5FY7 A;  4CZZ B;  4DR1 T;  4HN9 A;  2LSI A;  4PJL A;  3ZPO A;  4EAH A;  3CQC B;  3CX8 B;  3C50 A;  2WBL A;  1S94 A;  4LML A;  4U2Z A;  2XQ4 A;  1FJG T;  4AKL A;  4F8H A;  2BKN A;  2JQQ A;  2YEV C;  3EVY A;  5EZY E;  3RGL A;  1VCT A;  2BS3 A;  2H7V C;  3FZH B;  3TLW A;  3MA9 A;  2CHO A;  4ZI7 E;  2KMF A;  4B6X A;  1NEK A;  2BG9 B;  3JAE A;  3KV5 A;  4YHJ A;  5E0O A;  4EGW A;  2X51 A;  4NIQ A;  2B1E A;  4O2A E;  1ZV4 X;  4X5T A;  3AE6 A;  1LVK A;  2V1D B;  4Z90 A;  5IHY A;  3P4R A;  2F4V T;  4QHO A;  2QA7 A;  4DV3 T;  4K0K T;  4U7I A;  3K3Q C;  1OED B;  3ZMS B;  4TNW A;  2FJB A;  3NRX A;  2WSS V;  4TWD A;  3SS1 A;  5AQI B;  4CI2 B;  3EAB A;  3TKL B;  2RP4 A;  3CK6 A;  4EIW A;  4WBN E;  3LBX B;  1JNZ A;  5JDM A;  2LKG A;  3IA3 A;  2ES0 A;  2XQA A;  2CRB A;  3R6N A;  2E5V A;  4X20 E;  5L47 A;  4F6R C;  2R6G F;  2WDQ A;  2ZLY A;  4NUU A;  5JDQ A;  4IE7 A;  2XHE B;  2IC9 A;  3LK4 2;  1HNX T;  4LFC T;  2CXD A;  2NTX A;  4YLH A;  3RYC E;  3ONX A;  4HE8 A;  2I0M A;  4ILU A;  3O9X A;  2ZM0 A;  1IZN B;  3LFM A;  1GQE A;  2WM9 A;  2W62 A;  4O2B E;  1HNZ T;  4ERR A;  5AQQ B;  2X66 A;  1N33 T;  3PU3 A;  5HEJ A;  4MHC A;  4DV7 T;  4WYV A;  2L8K A;  3AAI A;  2PTF A;  3SFD A;  2E8I A;  2IIU A;  4DV6 T;  2YIN A;  3IBP A;  3GWH A;  1NWM X;  2XSA A;  3ZCJ A;  3VR9 A;  5BMV E;  4ADZ A;  5FYM A;  4BA9 A;  3WAK A;  5ETW A;  4EYY R;  2UXB T;  4IDQ A;  4TNV A;  4AQG A;  4GOU A;  3L3P A;  2BKP A;  2FBW A;  3FZK B;  4YTM A;  4A5X A;  4YHH T;  1H7C A;  3LDQ B;  5LMN T;  2VWA A;  4IDO A;  4A98 A;  5KX5 E;  3M3Z B;  2LOP A;  1UX4 A;  2UUB T;  1G8X A;  2H89 A;  2HPJ A;  3HKD E;  3QOF A;  5HXR A;  2W61 A;  3RYF E;  4DO0 A;  2VL0 A;  5L3B B;  2VKH A;  1B7T A;  2V7M A;  2P9B A;  1W9R A;  2X9X A;  2OV9 A;  2X9Y A;  2J62 A;  3C64 A;  4J2C A;  1XWM A;  4OFZ A;  4OYJ A;  4U72 A;  2XQY A;  2J1D G;  4HWF A;  5LXT E;  5CJ5 A;  1XDO A;  4HFE A;  1HR0 T;  4QX7 B;  3UT5 E;  3AE3 A;  4PNI A;  4C90 A;  1M7K A;  3RKO A;  3I9Y A;  3QNU A;  4IDP A;  2CM0 A;  5TAO A;  4E7S A;  4B3M T;  4PK6 A;  5HEU A;  5AFU L;  2BG9 E;  1Z0P A;  2CWO A;  2V7K A;  2YU1 A;  4PFP A;  1SE7 A;  4I55 E;  4WBO A;  4CXW A;  4IL4 A;  3AE2 A;  3ZJ1 A;  1ZP0 A;  2DCF A;  2HN1 A;  4UVB B;  3N9Q A;  3ZMZ B;  5EK4 A;  1N32 T;  2XAH B;  2LRL A;  3QUJ A;  4EZH A;  4B3R T;  1IJ5 A;  5FY1 A;  2LRK A;  1WYB A;  2LE8 A;  2K9A A;  4PK4 A;  3SRZ A;  4COF A;  4DID B;  3EAM A;  5L3E B;  5FXX A;  4UF0 B;  5A1L A;  2Q9Q C;  2K24 A;  2LSY A;  3AAE B;  4ANJ A;  3UFE A;  4XAX B;  1OWA A;  4UR9 A;  4EV6 A;  5F3J A;  4H9Q C;  4H9S E;  4GKJ T;  1T98 A;  3PJA A;  4H63 H;  2BKO A;  1QLB A;  3FBL A;  2W00 A;  3P50 A;  5LB7 B;  1KEY A;  4X1K E;  3I0Q A;  2DLR A;  2M6B A;  1CUN A;  4H9R C;  5FNV E;  3ZYL A;  2C5I T;  2X68 A;  3AA6 B;  2I59 A;  4TX5 A;  5DQV A;  2KZ7 B;  2ODU A;  3HKB E;  3N9P A;  1WCR A;  3P4S A;  2EHO D;  3QC9 A;  4QX8 B;  3SOL A;  4AQF C;  2W2U A;  4BJN A;  1KNZ A;  5LGU B;  3LJC A;  2WDR A;  2BDE A;  4HFH A;  5JRC A;  3KV9 A;  1WYC A;  4EB6 E;  2NTY A;  3M65 A;  2XQ3 A;  2LM2 A;  4ZOL E;  5HXH A;  4UIG A;  1YQ4 A;  4QH5 A;  3AE5 A;  2YK0 A;  2XQ7 A;  3PUA A;  2M67 A;  5JR9 C;  1FMV A;  2DWK A;  3UU8 A;  5KMG P;  1NEN A;  2FUP A;  3I0O A;  4G2A A;  2I6H A;  3S4U A;  4AKR B;  1ZKE A;  1Y01 A;  2N1G A;  2D0T A;  2ZMA A;  3KBT A;  1MMN A;  2LHR A;  3DTO A;  5LJN A;  5LP6 E;  5J2T E;  4B3S T;  3FZF B;  4QXH B;  5CA1 E;  2UUA T;  5DJQ C;  4HTE A;  3RQW A;  2A9U A;  3IEE A;  3MXZ A;  4UVA B;  5HEO A;  1KFY A;  3OBV E;  4HWD A;  2A72 A;  5HXS A;  3PUX F;  4IST A;  4TWF A;  3UU3 A;  2KWH A;  2J4G A;  3BQI A;  2JMH A;  3AEG A;  5CFB A;  1XNR T;  3AA0 B;  3RIF A;  2WDV A;  5IUX A;  2W4X A;  3FHN A;  4YSZ A;  3ONJ A;  3PJA J;  3U78 A;  1SA0 E;  2JJ9 A;  4CQI A;  4LF9 T;  3ZLI A;  3IHR A;  4ILB A;  3L39 A;  4KUM B;  5AQR B;  4A56 A;  3WAJ A;  3FZM B;  4DBR A;  2LEH A;  4YXD A;  5JH7 E;  3RF1 A;  4X1I E;  2XAF B;  2C5J A;  5FXW A;  4XBF B;  2ZM2 A;  3PU8 A;  5AQH B;  5LCY A;  2JPF A;  3RHW A;  4PFO A;  4O4L E;  2IUB A;  2NP9 A;  4P09 A;  1T7S A;  5LBM A;  2KSR A;  4U7Y A;  3AEA A;  5JDH A;  2V6Y A;  3N9O A;  3UU4 A;  2XM1 A;  2IC6 A;  5CGM A;  4GK5 E;  2XY8 B;  3TLT A;  1HX1 B;  3DJB A;  4KMC A;  3AA1 B;  3VU7 H;  3ZT6 A;  4OX9 T;  1US7 B;  3OYX A;  4XZC A;  3H37 A;  4U31 A;  4YJ3 E;  4KHP T;  2LHN A;  4IRE A;  4X65 T;  3Q5W A;  4DR7 T;  3RC3 A;  5HEG A;  2WCA A;  3P7I A;  3IF8 B;  1VOM A;  3PUQ A;  4JEH B;  3PUW F;  4LFA T;  3QK6 A;  2V5D A;  2WWV A;  4X1Y E;  3K3O A;  3PUV F;  4ILC A;  4WZX A;  1OED A;  3NZQ A;  3MZK B;  4EXT A;  5CA0 E;  1E1H B;  4QXB B;  4YTP A;  2VQE T;  4OK0 A;  3H3M A;  2Z6E A;  3FXD B;  2JQK A;  1WLX A;  5AQL B;  2LSJ A;  2MOZ A;  4AKI A;  2WMO A;  2XQ6 A;  2PFV A;  4AQY T;  2A3D A;  2BG9 A;  4YSY A;  1XMQ T;  1YD8 G;  2AE9 A;  4IT4 A;  2X9W A;  5BR8 T;  3P8C D;  3ZCI A;  3UTK A;  4JI8 T;  2WS3 A;  3L09 A;  4IDN A;  2XAS B;  3E22 E;  1J1J A;  3PUR A;  4MAL A;  4JI0 T;  2K3W A;  1D0Z A;  3OKQ A;  2V7I A;  1AJ3 A;  4AI6 A;  2A2F X;  2CLY C;  2X0L B;  3DP7 A;  4LFB T;  2G0U A;  4GKK T;  2JQ9 A;  4MLK A;  2M6I A;  3RIA A;  4DND A;  3JAF A;  5AQS B;  4DR3 T;  4WNK A;  4JI1 T;  1I6Z A;  3KV4 A;  2DWG A;  1BR1 A;  5EK3 A;  3AE8 A;  3MKD A;  4P0A A;  3AEE A;  4KBM B;  2MAW A;  2YN6 A;  3HKE E;  2J47 A;  1YXR A;  4IE6 A;  2DL1 A;  1X9B A;  3Q5D A;  4DV4 T;  5AQP B;  3KVA A;  3LG7 A;  1FMW A;  2K5B B;  1LVF A;  1EZ3 A;  2X0Y A;  2XQ8 A;  3O1H A;  3ZMT B;  4EED A;  2V26 A;  1MIW A;  5JDN A;  4GYS A;  1KF6 A;  2V7L A;  3JC6 C;  2VAS A;  4GYR A;  3PE0 A;  3Q2M A;  4IHJ E;  4IDZ A;  4Z8X A;  1IBM T;  2WB5 A;  3ZST A;  3BQK A;  2VK9 A;  3EDV A;  4KI0 F;  5AQK B;  4DR6 T;  4HEA A;  2YKS A;  5LG3 A;  2LKH A;  3RYH E;  2VKJ A;  1UGO A;  3KFW X;  3NKZ A;  4IGU A;  5LGN B;  2CPT A;  4QH1 A;  4YT0 A;  4JYA T;  3KDS E;  3JC6 D;  4HFV A;  4JLE A;  2LOS A;  4FI5 A;  4PJM A;  2DI4 A;  1W09 A;  4ZXL A;  4JI5 T;  2W63 A;  4MBQ A;  4DBQ A;  4ZI2 C;  3FXE B;  1MIV A;  2BVL A;  3ZMU B;  3ONL C;  4EZ4 A;  2D5U A;  2EHO A;  3P4W A;  4U74 A;  3ZN0 B;  3C4X A;  5HEH A;  3ZC1 A;  2VKO A;  4ZS2 A;  2V6X A;  2CCQ A;  4IE4 A;  2NWB A;  2PG8 A;  4UEL A;  3EI0 A;  2MTQ A;  2CHN A;  2VB6 A;  3D0T A;  3JAD A;  3N2K E;  2CEA A;  5JQG E;  1N36 T;  3VKG A;  5L3F B;  4L9I A;  3SWH A;  4M1P A;  5JTG A;  3V5S A;  4DR5 T;  4UXN B;  1I94 T;  4B3T T;  3UU5 A;  5HAX A;  2IW5 B;  5JR9 B;  1U5P A;  4OHF A;  4TWH A;  4ZI2 D;  3UUM A;  5ABF B;  2CE7 A;  2LLY A;  1MIY A;  3MJX A;  1VCS A;  3B13 A;  3L8R A;  4K0U A;  4PJN A;  3UQ4 A;  4EYU A;  2QYW A;  2V5C A;  4LF8 T;  4EOZ B;  2NW7 A;  2PBI A;  3KIN B;  5LA6 E;  2D0U A;  1UUR A;  2WP9 A;  3F57 A;  2YDS A;  3HL6 A;  4DVD A;  1MMA A;  1UX5 A;  1SUM B;  2V6Y B;  3C4W A;  4AXP A;  3WI3 A;  2KND A;  1ZOY A;  5L2L A;  1OXZ A;  2JIW A;  2LT3 A;  3CQX C;  2KWI B;  2RPA A;  2XQ5 A;  3OVU A;  4IE5 A;  4PAG A;  5AQO B;  5H6R B;  4AKH A;  5KXJ A;  3PDY A;  2ZM8 A;  3A5X A;  1QUU A;  2VQF T;  3ZC0 A;  2NR4 A;  1XZY A;  2MBG A;  3ZSS A;  4AKG A;  3AEB A;  3MK7 C;  2XZE A;  4KX6 A;  3AB3 B;  3J7Y q;  5AQF B;  2CA5 A;  1D1A A;  1HG2 A;  4U3C A;  3RKG A;  3ANW A;  4PJJ A;  3HA4 A;  4NUV A;  3OYZ A;  2Y48 B;  5FY0 A;  4LF4 T;  3AXJ A;  3A7M A;  4NXM T;  2BS4 A;  2JQH A;  4CN1 A;  3PUY F;  2FJA A;  3PUG A;  3ZEF B;  1HCI A;  5LOV E;  5AQU B;  3LK3 B;  5JDG A;  5LNK A;  2WQY A;  3U3I A;  2LSG A;  2BS2 A;  5JRE A;  3T1H T;  4TN7 B;  4ZHQ E;  4KP3 C;  3TLU A;  2ZM6 T;  5LHH B;  2VVS A;  2YU2 A;  3C4Z A;  3FBZ A;  3F31 A;  3I9W A;  1T8B A;  2E9X A;  3CQG B;  3P4Q A;  3G06 A;  4X62 T;  2DNX A;  5AQN B;  2E5L T;  3AVR A;  5AQM B;  4UV9 B;  3ZKR A;  4CN4 A;  4CN6 A;  4AIU A;  4E7Z A;  2UU9 T;  1MMD A;  4P0B A;  5L4E A;  2EHO C;  3BQL A;  5HCM A;  4QWN B;  3O1J A;  1MMG A;  4JEU B;  5KDM C;  2RA1 A;  3OJA A;  2QGS A;  4IIJ E;  2CWY A;  3AE1 A;  4MFR A;  2XQ9 A;  1D0X A;  1XDP A;  2VUR A;  3NVO A;  3OPC A;  4TV8 E;  4ZS3 A;  3RI5 A;  3I1A A;  1M62 A;  2WU5 A;  3RH3 A;  4A97 A;  4YTN A;  2HN2 A;  5J2U E;  3PV0 F;  3PUZ F;  5JRC B;  5HWY A;  4HWC A;  2L9Q A;  1UUS A;  3Q5X A;  4QXC B;  3RIU A;  4YSX A;  4DV1 T;  5LJM A;  4DR4 T;  5L3C B;  3EHZ A;  5ADX L;  3CML A;  2HH7 A;  3ZJ2 A;  2PJQ A;  5C3J A;  4X66 T;  3RC8 A;  3BK9 A;  1BR2 A;  4U2Y A;  4DMV A;  4U33 A;  3CX7 B;  1KK7 A;  1IAP A;  4TZ4 C;  4BJM A;  2JMK A;  2ACX A;  1VRB A;  3K3N A;  3K8P C;  2N2N A;  3CKD A;  2XAQ B;  3CVR A;  4JBW F;  2X9H A;  3ZN1 B;  4H63 V;  2K48 A;  2JRK A;  4YJ2 E;  1XMO T;  2XJ7 A;  2XAJ B;  2H7O A;  3GMI A;  5FXZ A;  5J1G A;  5FP3 A;  2WU2 A;  2IHR 1;  2KXP B;  3C98 B;  3NZP A;  4UF0 A;  3TLV A;  4YY3 T;  2CXF A;  4I4T E;  2CMR A;  3CIR A;  2XUE A;  1L0V A;  4CI3 B;  2IAK A;  1LKX A;  1JNR A;  5L3D B;  3HI2 A;  5DAB A;  4JI2 T;  3N5L A;  4AIS A;  4DV2 T;  5JDL A;  4I0U A;  1SHZ C;  2V8S V;  1BR4 A;  1NAF A;  5J0Z A;  1IBL T;  4HWI B;  2HPL A;  2E2A A;  2E9X D;  3PTR B;  4HWH A;  3N9M A;  4GIW A;  4HFD A;  4LMJ A;  4NPP A;  5F5W A;  5CB4 E;  3VRA A;  5LG4 A;  4CXY A;  4JI6 T;  4JUY A;  5GON E;  2QRX A;  4H9N C;  5HXE A;  1HTJ F;  1D1B A;  3N2O A;  4DR2 T;  1KNR A;  3VR8 A;  1YQ3 A;  4P1N A;  2XAG B;  2BZB A;  1HF8 A;  4ZZB A;  3K1S A;  4UEM A;  5FL1 A;  3LBX A;  2Q9Q D;  1FIO A;  2C0S A;  3UUB A;  4DUY T;  4LF6 T;  2FJE A;  1WRD A;  2V7J A;  4UV8 B;  3O1I A;  3AE7 A;  3QB5 K;  2XM2 A;  3RIU C;  1T72 A;  2GK9 A;  2B76 A;  4OYK A;  2KT9 A;  5ABH A;  3AED A;  3T8O A;  4G63 A;  2ACZ A;  1OED C;  2L3L A;  3FZL B;  5JDF A;  2LM9 A;  5ABG A;  3RRW A;  3ZT5 A;  5LGT B;  3AE9 A;  4ZI3 C;  5LHI B;  2VL8 A;  1S35 A;  1D1C A;  3NBX X;  3RPU A;  4JI7 T;  4Z91 A;  5FKY A;  1D0Y A;  1E2A A;  2NW8 A;  1E7P A;  4HFB A;  4L0R A;  4L5G A;  2XSB A;  2NW9 A;  5LHG B;  5L4H A;  4X64 T;  4HGA A;  2N9D A;  2D9D A;  1LRZ A;  3AE4 A;  2WZH A;  4JI4 T;  5AQG B;  3ZT7 A;  4NXN T;  1QSD A;  3ABV A;  3AEF A;  2E9X C;  1CHU A;  1WR0 A;  3P4P A;  4O4H E;  1V9D A;  3Q9D A;  4WW0 A;  4CXX A;  3V5U A;  2W66 A;  2AXD S;  3VKH A;  4EEB A;  1YW0 A;  4DUZ T;  2WY2 A;  3N9L A;  5FL0 A;  1N34 T;  3RYI E;  1G73 A;  1UCU A;  1WFD A;  1Y64 B;  3AXJ B;  4HFC A;  2HHH T;  3ZMV B;  2LJL A;  2BBJ A;  2QVA A;  4H9P C;  3ANW B;  4V1A v;  3RQU A;  3UUX B;  2H88 A;  2ODV A;  3EDU A;  1HS7 A;  3NWI A;  3H3A A;  1XNQ T;  5AQV B;  5AQT B;  2UXC T;  2OLT A;  1WR6 A;  3ESL A;  5C2T A;  2Y8D A;  1OED E;  1IJ6 A;  1ZHC A;  3QB5 A;  5FMN A;  4JV5 T;  2WWU A;  3B57 A;  1U4Q A;  3N2G E;  3UUN A;  2X0H A;  1IBK T;  5C8Y E;  2X67 A;  4GK0 E;  4O4I E;  2W67 A;  2BVM A;  3MAC A;  2VKD A;  2C5K T;  4O8S A;  3X1D A;  5M4Y A;  3CWZ B;  3PUS A;  1W0B A;  3NRY A;  3CPZ A;  1O3X A;  3RLF F;  4UVC B;  3UQ7 A;  1R8I A;  3JCF A;  5HXC A;  3VRB A;  4ZEY A;  5FVL A;  1W0A A;  3A8Y C;  2YDR A;  4HFI A;  2E9X B;  2UXX B;  5ABF A;  4ILA A;  2CLY B;  5JR9 A;  5LBQ B;  4ISS A;  2NOX A;  5H6Q B;  4Q25 A;  5DQW A;  3R84 B;  2XPK A;  3J9X 1;  4KHZ F;  2OA5 A;  4PK5 A;  4DV5 T;  2YOE A;  3KBU A;  3ZYM A;  5IWA T;  4BAY B;  3KV6 A;  2UXD T;  3C51 A;  3E0Z A;  1HG5 A;  1HX8 A;  2YDQ A;  4YFS A;  4AQF A;  4ZZC A;  1BR0 A;  3GN5 B;  2CBI A;  2FJD A;  3N9N A;  4HKA A;  2UXN B;  1UK5 A;  2EHO B;  2SPC A;  4O4J E;  2Q9Q B;  4TUY E;  3VHL A;  2UUC T;  1MNE A;  5L3G B;  2IML A;  3FB2 A;  1YKH B;  1MND A;  4FJO A;  3Q5E A;  4PW8 A;  3AVS A;  2LSK A;  4QH4 A;  4JI3 T;  2H3R A;  3AAA B;  4QKN A;  3W15 B;  4H9O C;  1YKE B;  3HR0 A;  1HFA A;  1ZEE A;  2MPK A;  5F8P A;  2MYS A;  3TLS A;  2BG9 C;  2KLQ A;  4LMK A;  4N78 D;  3KVB A;  5JVD E;  3SFE A;  4ASK A;  5IYZ E;  3OTO T;  2WMN A;  3UFG A;  3ETV A;  2KIN B;  4C91 A;  3CX6 B;  2Y6X A;  3UUL A;  1Z8U A;  1J5E T;  2VVN A;  3ETU A;  3HKC E;  3RX6 A;  3ZYK A;  4TV9 E;  4LF5 T;  5HCJ A;  5LMU T;  3E08 A;  3O4X E;  4IL9 A;  2BBH A;  4IE0 A;  4I43 B;  3AEC A;  5FXV A;  5AQJ B;  4ZI3 D;  2CXL A;  4I50 E;  4LF7 T;  2IDO B;  2Q9Q A;  2XTL A;  3RRC A;  4DV0 T;  1DU2 A;  3LK2 B;  1X79 A;  2W0G A;  5EK2 A;  3GN5 A;  5ABE A;  3UU6 A;  4DMW A;  5HWX A;  5LYJ E;  1HNW T;  3F2E A;  3LSV A;  5HYA A;  2D2S A;  1J5W A;  3GA8 A;  5FVK A; 
#chains in the Genus database with same CATH homology
 1VCS A;  3ONL C;  2QYW A;  3ONJ A;  2V8S V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...