2QYWA

Crystal structure of mouse vti1b habc domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle transport through interaction with t-SNAREs 1B homol
publication title A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport, endocytosis
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2qywA00
3ONJA 2V8SV 2QYWA 1VCSA 3ONLC
chains in the Genus database with same CATH superfamily
2VK9A 2B76A 4ISTA 2X66A 2FBWA 3VU7H 2W00A 1WR6A 2ACZA 3IBPA 2CWOA 5ADXL 5HEOA 3IEEA 4B3TT 3ZSSA 2XHEB 1W09A 3CQXC 3H3MA 2N9DA 5AQGB 2BBJA 4U74A 4UEMA 1XZYA 1XWMA 4PFOA 3R6NA 4HWDA 3PV0F 5LGUB 4DO0A 2VL8A 2L3LA 3CX6B 3GN5B 3MA9A 4IGUA 3P4QA 4EOZB 3E08A 2MAWA 4COFA 4ZI2D 4HFEA 2V7IA 3H37A 2ZM0A 5DQVA 3ZKRA 1XDPA 2ZMAA 4DR1T 2C5IT 2JPFA 5AQMB 5LHHB 3AE9A 4WW0A 1HG5A 4HN9A 1O3XA 1OEDA 2OV9A 2W4XA 3E0ZA 3GA8A 4E7ZA 5C3JA 3N9OA 4QHOA 5ABEA 4EYYR 2OA5A 3SFEA 2JQHA 4GYRA 4G2AA 4HWIB 2VVNA 1JNZA 5AQVB 4DV6T 4HFCA 3LDQB 4O4LE 2K48A 1E1HB 4A5XA 2NTXA 4YY3T 3C64A 4EB6E 2LOPA 3C98B 3OJAA 5JRCB 3TLTA 4ZEYA 3AAEB 3P8CD 2A2FX 4OYKA 4LFBT 3DTOA 2V26A 5CA1E 3LBXA 2KT9A 1Z0PA 4ZOLE 2WDQA 4LMKA 2CMRA 1QUUA 4U33A 4L5GA 2V6YB 4OK0A 4JI5T 3ZLIA 1XMOT 2UXDT 3KVAA 4ZI2C 3ONLC 2LSJA 5C2TA 2LE8A 3C4ZA 4H63H 4PK6A 2BG9E 2J4GA 3RPUA 4TWHA 3DJBA 3UU6A 1KK7A 4DV7T 2UXXB 1D0XA 3HKDE 4HFVA 3ZJ2A 3V5UA 2YN6A 2KWIB 5LBQB 3E22E 2WZIA 4LF5T 4JI8T 3N9NA 4YTNA 2W62A 5LG4A 4IE5A 4ZI7E 5LHGB 1IAPA 1MMGA 1KEYA 2JMHA 4PJJA 3ZCIA 4IL4A 2PG8A 4PAGA 5BR8T 4JI2T 2CLYB 1EZ3A 4YJ2E 5TAOA 4CN4A 1HX8A 3K3QC 2XQ6A 3PUQA 5LB7B 2LOSA 3OKQA 4Z90A 4KMCA 5HEHA 2ZM2A 3B13A 1U5PA 2XAGB 5FXZA 3NRYA 4AXPA 2K3WA 2JMKA 2H7VC 4AKIA 3QB5K 5JREA 5LOVE 2CLYC 4WZXA 1V9DA 4H9RC 1X79A 3SOLA 3PUXF 1XDOA 3TLSA 1N32T 3P50A 4J2CA 1WCRA 4ANJA 3EAMA 5FXWA 3CWZB 2PJQA 4I43B 3RKGA 3ZYKA 4AKHA 3Q9DA 4EEBA 2VKHA 3UU3A 2UXNB 4X66T 2W0GA 3N9MA 3ZT6A 1UX5A 5L3CB 3MKDA 2UUCT 3ZJ1A 3LSVA 4P0BA 4HTEA 5FYMA 2UXBT 4EEDA 3PUSA 4IREA 4UV8B 5L3BB 4TX5A 4DV1T 3NZPA 3T1YT 2FJDA 5EK2A 2IDOB 3RIUA 3K3NA 4EZ4A 4YLHA 2V7LA 3UFEA 4CI2B 1LVFA 5L2LA 4C90A 2X9YA 4QXHB 5EK4A 3JCFA 4H9PC 4IE4A 3N9LA 2EHOA 4Z91A 1R8IA 3CX8B 4X5TA 4EGWA 3LFMA 5LG3A 3AVRA 3ANWA 5JDQA 4TWDA 5HXCA 2KINB 5BMVE 4OFZA 2NP9A 2NW7A 2C5KT 3CVRA 2E2AA 4I55E 2V5CA 1KNPA 3RIAA 1SA0E 2J62A 4PJMA 3P4WA 4NUUA 3K3OA 5HXSA 4U7IA 4X1IE 1S35A 3FHNA 2MYSA 3C50A 1MIVA 4DV4T 2E5LT 2LKHA 2DCFA 1OEDB 2W66A 2LLYA 4OHFA 3AE6A 3N2OA 3FBZA 2XQ9A 4YXDA 1Y64B 2PFVA 3UUBA 2NTYA 2V8SV 3L8RA 4U2YA 3P4RA 3F57A 1VCSA 3F31A 3ONXA 1XMQT 2SPCA 1ZKEA 3MZKB 4AISA 2Y8DA 2NWBA 3FZMB 2BDEA 4JV5T 3WAJA 3MK7C 3SWHA 1YQ4A 4JI7T 3AE8A 2XQ4A 3KFWX 5HWYA 3NRXA 5AQHB 2BG9A 3A7MA 1SE7A 3AE3A 5LMNT 4KX6A 3C51A 4PW8A 2CXFA 3LBXB 4WNKA 3T8OA 1N33T 4ZXLA 2H88A 5CB4E 4AQGA 4QH4A 3PUYF 4LF8T 2WWVA 5J2TE 3L09A 4HFBA 4X64T 5KMGP 4B3MT 1HX1B 5HXRA 2KZ7B 5HWXA 4BA9A 1FMWA 3RYHE 2A3DA 5AQQB 4CXYA 4YSYA 3CKDA 1YD8G 4BJNA 3U78A 3GMIA 3DP7A 4YHHT 3F2EA 4HGAA 2XQ5A 3RQUA 4UVAB 3CQCB 3ZMUB 4HWCA 1MMDA 3AB3B 3AXJA 2XJ7A 2V5DA 1BR1A 2LSIA 4O4IE 5FNVE 2YU1A 3AEEA 2LSYA 4L0RA 4ILAA 2MPKA 1IBKT 5FY1A 3X1DA 3RIFA 5AQIB 3ZEFB 4DR5T 4UV9B 3JADA 3PU8A 4DVDA 3WI3A 1NWMX 3AVSA 3QB5A 3IHRA 3ZSTA 5C8YE 1VRBA 3LK2B 2XSBA 5LBMA 1LVKA 2BS4A 2MTQA 3UFGA 3P4SA 1J5WA 3JAEA 3QNUA 4OYJA 2FJBA 4PJLA 5LGNB 2H3RA 3PDYA 2YK0A 1IBLT 1IZNB 2ES0A 3QUJA 2DLRA 1YW0A 4QH1A 4MBQA 4LMLA 2EHOD 5L47A 2N2NA 3ZMZB 2W61A 4A56A 2NR4A 3Q5DA 2ZLYA 5FXXA 1B7TA 5L4EA 3G06A 4DMWA 2M6BA 2X67A 5IHYA 3HI2A 3N5LA 4IL9A 3KV4A 3P7IA 2LT3A 4AKGA 4I50E 3MACA 4PK5A 2YEVC 3ZPOA 1ZHCA 4DNDA 3W15B 2RP4A 2DI4A 2IAKA 4IDNA 2WZHA 2XZEA 4ASKA 2C0SA 1HR0T 4PFPA 1J1JA 1KNRA 2LM2A 2XQAA 4X1KE 1GQEA 2HPLA 3AEAA 1W0BA 2WWUA 3RIUC 2EHOB 5AFUL 5LJMA 2J47A 4L9IA 4B3ST 2XY8B 3ANWB 5JDNA 3AE7A 2WDVA 4CXXA 5ABGA 4CI3B 3AECA 1D0ZA 4HWFA 1E2AA 2WCAA 2GK9A 2YDQA 2E8IA 3VHLA 4JI6T 3NWIA 1HNXT 4DR2T 3PURA 5JDFA 1FEWA 3AAAB 1D0YA 3AEBA 2HN1A 3UU5A 2E9XA 4PNIA 2KSRA 1H7CA 4DR6T 1WLXA 2IC6A 4WBNE 4LFCT 4H9NC 4U31A 2LKGA 3PUWF 4CN1A 1YKHB 5FVKA 4NXMT 4YFSA 2VWAA 4UVCB 3VR9A 1ZOYA 3C4XA 4YSZA 3KV5A 2H89A 1WRDA 5ABHA 2VASA 3AE5A 1HS7A 5JDMA 1HFAA 2BKPA 1US7B 4U7YA 4AQFC 2BG9B 2Q9QA 2XASB 3BQIA 4CN6A 2G0UA 4KBMB 3L3PA 3OTOT 5LXTE 2B1EA 3IF8B 1D1AA 3ZYLA 4IIJE 2BS3A 4LMJA 3NKZA 3UQ7A 1UCUA 2BS2A 3UUMA 4O4HE 2XPKA 3HA4A 2CEAA 2CE7A 4M1PA 5AQPB 4H9SE 5ETWA 5AQFB 3S4UA 2Y48B 4EIWA 5JDLA 2MOZA 4HWHA 5EZYE 2ODVA 1ZEEA 2CXDA 3VRAA 5KXJA 4JI3T 4JI1T 2KMFA 5CFBA 4NXNT 4H63V 2HN2A 4GKJT 3VKHA 1WYBA 3CX7B 1ZV4X 2D0UA 2W2UA 2V7KA 1YXRA 4NUVA 4DV3T 2WMOA 1T8BA 3AXJB 2WP9A 5JDGA 3L39A 1OXZA 1E7PA 2CPTA 5J1GA 5HAXA 4ZS3A 4IDZA 2LHRA 1QSDA 2XAQB 4MLKA 3AEFA 4QH5A 2LSKA 4U72A 5ABFA 3R84B 1WYCA 5FXVA 2WB5A 2IW5B 1M7KA 2VQFT 3CQGB 1T7SA 4F8HA 2VL0A 3RX6A 1G8XA 3D0TA 3AEDA 4GK5E 2RPAA 1IJ6A 4UF0A 5DQWA 4EV6A 3FBLA 3K1SA 4TUYE 5HXEA 4IDOA 5HEJA 4LF6T 2CCQA 4F6RC 4K0KT 2V7JA 4TN7B 2NW9A 1OEDE 2IHR1 3SS1A 1MNDA 1I6ZA 3EVYA 5FP3A 5E0OA 4PJNA 1UGOA 2KXPB 2QA7A 3VRBA 4TZ4C 4IT4A 1IBMT 5LCYA 5HEGA 2LHNA 2K9AA 5AQLB 2FJEA 1LKXA 4TNWA 3UUXB 3Q5WA 4BAYB 3C4WA 4ISSA 3RYCE 3BQLA 4QKNA 4JYAT 5HEUA 2DHRA 2XQ8A 3N2GE 3I0OA 5FVLA 2A9UA 2HPJA 3UU8A 1D1CA 5LP6E 4JUYA 5CGMA 2ACXA 3ESLA 2W63A 2E9XD 4O2BE 2YDRA 3AE4A 3UQ4A 4ILBA 3EUHA 1OEDC 2P9BA 3BK9A 4UIGA 1FJGT 1XNRT 2CA5A 4X65T 5HCJA 2WU5A 5L3EB 3LK3B 5DABA 4UELA 3LJCA 2W67A 5FL1A 3U3IA 3RF1A 5AQTB 2ZM8A 3KDSE 4HFDA 2BKOA 2WDRA 1ZP0A 4CI1B 3KV6A 2Y6XA 4NPPA 2Q9QD 2XAJB 4YHJA 4O4JE 2LEHA 4BJMA 1HF8A 3ETUA 3P4PA 4EZHA 5AQUB 4ILCA 2DWKA 3Q5XA 4FI5A 4GIWA 2WAUA 5LYJE 1UK5A 3QC9A 2KWHA 2C5JA 2Z6EA 2E9XB 4CQIA 4X20E 1WR0A 2F4VT 3KV9A 4LFAT 3FXDB 2D9DA 5LHIB 4AKLA 2XAHB 3ABVA 1J5ET 3KBUA 4ZHQE 1FMVA 4GKKT 4IE0A 4DMVA 3PUAA 5LMUT 4JEHB 3AA0B 5LJNA 2JIWA 1HNZT 1SHZC 2E9XC 3ONJA 1AJ3A 1Z8UA 3IA3A 2Q9QB 2QRXA 4IE7A 4PK4A 2NOXA 3K8PC 4HFHA 2CRBA 2K5BB 4JEUB 3KINB 5AQRB 4DUYT 3QK6A 2XUEA 3JAFA 3ZMVB 2PTFA 3HKBE 1MMAA 5M4YA 2WBLA 3T1HT 5JVDE 2QYWA 5JH7E 5F5WA 2I0MA 3I1AA 2D2SA 4CZZB 4YTPA 2IC9A 3M65A 3KBTA 2DWGA 2FJAA 3EDUA 4I0UA 4ZZBA 2BKNA 5DJQC 5AQSB 3EDVA 3UT5E 3VKGA 1YKEB 5HYAA 4HFIA 2VKDA 4KP3C 2YOEA 4E7SA 1HCIA 4P09A 4DV5T 2V6XA 3PU3A 1KFYA 4DBQA 2DL1A 3RKOA 5JQGE 5JR9A 4LF7T 3OPCA 2XQ3A 4EXTA 4NIQA 4N78D 5FL0A 2J1DG 2YINA 5ABFB 4K0UA 3FB2A 1N36T 1HG2A 2H7OA 1Y01A 2WSSV 3NZQA 3ZN0B 2M67A 2X0HA 2IIUA 2JRKA 4XAXB 3UTKA 4IDQA 1MIWA 4MALA 3CPZA 2N1GA 4KUMB 2CWYA 2CBJA 4GK0E 3KVBA 2R6GF 5HCMA 4UF0B 4A97A 2VURA 5A1LA 4O8SA 3OBVE 3PUZF 4ERRA 2X0YA 3N9QA 2AE9A 2I6HA 2X68A 5L4HA 3J9X1 1CHUA 2YKSA 3CIRA 3ZCJA 3FZHB 3RQWA 3HL6A 5AQKB 3I9WA 3I0QA 1OWAA 1MNEA 3HKEE 4H9QC 4LF9T 3J7Yq 1D1BA 3EHZA 4OX9T 1KNZA 3LG7A 3O1IA 3WAKA 2E5VA 4X62T 3BQKA 4V1Av 4YTMA 2EHOC 4GOUA 2K24A 2HH7A 4ZZCA 5FY7A 5L3DB 1UX4A 2RA1A 1BR4A 4EAHA 3RLFF 4AQYT 5J2UE 4Z8XA 3RC8A 2XQYA 2JJ9A 4U2ZA 1HNWT 3N2KE 2X9XA 3ZYMA 4O2AE 2XM1A 4KHZF 2BVMA 4CXWA 4TWFA 4QX7B 3RI5A 2V7MA 1L0VA 1T72A 4JBWF 2XSAA 2XM2A 3Q5EA 3FZLB 2LRLA 4FJOA 2KLQA 4HEAA 4TNVA 5KX5E 5JDHA 2AXDS 3AAIA 4X1YE 2YDSA 4B3RT 3N9PA 4IE6A 4YSXA 4B6XA 1X9BA 2NW8A 5AQNB 5H6QB 2VQET 3VR8A 5LNKA 3NVOA 1YQ3A 3RRCA 2WMNA 1QLBA 3V5SA 4JI0T 2UUBT 4P0AA 3FZKB 1DU2A 2BG9C 1NEKA 3Q2MA 4UR9A 3AE1A 5EK3A 5KDMC 2JQKA 3UUNA 3I9YA 2VKJA 1CUNA 3SRZA 4A98A 3AEGA 3OYXA 1SUMB 3O1JA 1NENA 4ADZA 3TLVA 4UVBB 3TKLB 1UUSA 2I59A 3GN5A 4U3CA 5CJ5A 3M3ZB 3TLWA 1UURA 1HTJF 4WYVA 2HHHT 2UU9T 4YJ3E 2XQ7A 3PE0A 4DUZT 4AIUA 2A72A 3OVUA 3RHWA 2WQYA 4KI0F 1N34T 4IHJE 2D0TA 3LK42 4DBRA 3EABA 2BBHA 5FKYA 4ILUA 4DR4T 3QOFA 3ZC1A 1U4QA 3ZT7A 1M62A 2XTLA 3ZMSB 3O4XE 2LM9A 2CXLA 2JQ9A 5F8PA 2X0LB 1VOMA 3HKCE 1BR2A 3UU4A 4XBFB 3B5MA 1S94A 4AKRB 4DV0T 3JC6D 2L8KA 4ZI3D 4Q25A 3OYZA 3ZN1B 2UXCT 4DR3T 2KNDA 1MIYA 5JRCA 1MMNA 3O1HA 5L3FB 4QXBB 3ETVA 5JR9B 4TV9E 3PJAJ 3CMLA 4P1NA 4DV2T 5H6RB 2IUBA 1IJ5A 5AQJB 2FUPA 4IDPA 1NAFA 2V6YA 2IMLA 5LGTB 2QGSA 1VCTA 3RGLA 4GYSA 1I94T 3RYFE 5JR9C 4WBOA 4MFRA 5J0ZA 4YT0A 3ZC0A 5LA6E 3CK6A 5L3GB 4AQFA 1JNRA 1W0AA 1BR0A 2BZBA 2LJLA 2XAFB 3ZMTB 4JI4T 3UULA 3NBXX 2WS3A 3H3AA 4G63A 3RH3A 3GWHA 4DIDB 3PTRB 4DR7T 5JTGA 2PBIA 1LRZA 3MJXA 4QWNB 4HKAA 4QX8B 2WM9A 4XZCA 4EYUA 2ZM6T 2WU2A 3JC6C 3FXEB 4ZI3C 2DNXA 2D5UA 4ZS2A 3RYIE 2VVSA 2VB6A 1WFDA 3PUGA 5FMNA 4QXCB 2BVLA 2V1DB 5IYZE 1FIOA 3A8YC 4HE8A 4LF4T 2CM0A 3EI0A 3TLUA 3ZT5A 3AE2A 3SFDA 2CBIA 3HR0A 5GONE 3FZFB 4AI6A 4H9OC 5IWAT 3MXZA 1XNQT 2VKOA 5FY0A 2LSGA 4C91A 5IUXA 2UUAT 2WY2A 3A5XA 2CHNA 3AA1B 2X51A 3PJAA 2LRKA 5AQOB 5HXHA 2JQQA 2X9HA 2L9QA 2X9WA 4KHPT 3B57A 3O9XA 3AA7B 2QVAA 1W9RA 4MHCA 5CA0E 2YU2A 1G73A 4JLEA 2ODUA 1KF6A 3PUVF 1T98A 2OLTA 2CHOA 5F3JA 2MBGA 4TV8E 2M6IA 3AA6B 3RRWA 4I4TE 3RC3A 4UXNB 2Q9QC
chains in the Genus database with same CATH topology
3ONJA 2V8SV 2QYWA 1VCSA 3ONLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONJ A;  2V8S V;  2QYW A;  1VCS A;  3ONL C; 
#chains in the Genus database with same CATH topology
 2VK9 A;  2B76 A;  4IST A;  2X66 A;  2FBW A;  3VU7 H;  2W00 A;  1WR6 A;  2ACZ A;  3IBP A;  2CWO A;  5ADX L;  5HEO A;  3IEE A;  4B3T T;  3ZSS A;  2XHE B;  1W09 A;  3CQX C;  3H3M A;  2N9D A;  5AQG B;  2BBJ A;  4U74 A;  4UEM A;  1XZY A;  1XWM A;  4PFO A;  3R6N A;  4HWD A;  3PV0 F;  5LGU B;  4DO0 A;  2VL8 A;  2L3L A;  3CX6 B;  3GN5 B;  3MA9 A;  4IGU A;  3P4Q A;  4EOZ B;  3E08 A;  2MAW A;  4COF A;  4ZI2 D;  4HFE A;  2V7I A;  3H37 A;  2ZM0 A;  5DQV A;  3ZKR A;  1XDP A;  2ZMA A;  4DR1 T;  2C5I T;  2JPF A;  5AQM B;  5LHH B;  3AE9 A;  4WW0 A;  1HG5 A;  4HN9 A;  1O3X A;  1OED A;  2OV9 A;  2W4X A;  3E0Z A;  3GA8 A;  4E7Z A;  5C3J A;  3N9O A;  4QHO A;  5ABE A;  4EYY R;  2OA5 A;  3SFE A;  2JQH A;  4GYR A;  4G2A A;  4HWI B;  2VVN A;  1JNZ A;  5AQV B;  4DV6 T;  4HFC A;  3LDQ B;  4O4L E;  2K48 A;  1E1H B;  4A5X A;  2NTX A;  4YY3 T;  3C64 A;  4EB6 E;  2LOP A;  3C98 B;  3OJA A;  5JRC B;  3TLT A;  4ZEY A;  3AAE B;  3P8C D;  2A2F X;  4OYK A;  4LFB T;  3DTO A;  2V26 A;  5CA1 E;  3LBX A;  2KT9 A;  1Z0P A;  4ZOL E;  2WDQ A;  4LMK A;  2CMR A;  1QUU A;  4U33 A;  4L5G A;  2V6Y B;  4OK0 A;  4JI5 T;  3ZLI A;  1XMO T;  2UXD T;  3KVA A;  4ZI2 C;  3ONL C;  2LSJ A;  5C2T A;  2LE8 A;  3C4Z A;  4H63 H;  4PK6 A;  2BG9 E;  2J4G A;  3RPU A;  4TWH A;  3DJB A;  3UU6 A;  1KK7 A;  4DV7 T;  2UXX B;  1D0X A;  3HKD E;  4HFV A;  3ZJ2 A;  3V5U A;  2YN6 A;  2KWI B;  5LBQ B;  3E22 E;  2WZI A;  4LF5 T;  4JI8 T;  3N9N A;  4YTN A;  2W62 A;  5LG4 A;  4IE5 A;  4ZI7 E;  5LHG B;  1IAP A;  1MMG A;  1KEY A;  2JMH A;  4PJJ A;  3ZCI A;  4IL4 A;  2PG8 A;  4PAG A;  5BR8 T;  4JI2 T;  2CLY B;  1EZ3 A;  4YJ2 E;  5TAO A;  4CN4 A;  1HX8 A;  3K3Q C;  2XQ6 A;  3PUQ A;  5LB7 B;  2LOS A;  3OKQ A;  4Z90 A;  4KMC A;  5HEH A;  2ZM2 A;  3B13 A;  1U5P A;  2XAG B;  5FXZ A;  3NRY A;  4AXP A;  2K3W A;  2JMK A;  2H7V C;  4AKI A;  3QB5 K;  5JRE A;  5LOV E;  2CLY C;  4WZX A;  1V9D A;  4H9R C;  1X79 A;  3SOL A;  3PUX F;  1XDO A;  3TLS A;  1N32 T;  3P50 A;  4J2C A;  1WCR A;  4ANJ A;  3EAM A;  5FXW A;  3CWZ B;  2PJQ A;  4I43 B;  3RKG A;  3ZYK A;  4AKH A;  3Q9D A;  4EEB A;  2VKH A;  3UU3 A;  2UXN B;  4X66 T;  2W0G A;  3N9M A;  3ZT6 A;  1UX5 A;  5L3C B;  3MKD A;  2UUC T;  3ZJ1 A;  3LSV A;  4P0B A;  4HTE A;  5FYM A;  2UXB T;  4EED A;  3PUS A;  4IRE A;  4UV8 B;  5L3B B;  4TX5 A;  4DV1 T;  3NZP A;  3T1Y T;  2FJD A;  5EK2 A;  2IDO B;  3RIU A;  3K3N A;  4EZ4 A;  4YLH A;  2V7L A;  3UFE A;  4CI2 B;  1LVF A;  5L2L A;  4C90 A;  2X9Y A;  4QXH B;  5EK4 A;  3JCF A;  4H9P C;  4IE4 A;  3N9L A;  2EHO A;  4Z91 A;  1R8I A;  3CX8 B;  4X5T A;  4EGW A;  3LFM A;  5LG3 A;  3AVR A;  3ANW A;  5JDQ A;  4TWD A;  5HXC A;  2KIN B;  5BMV E;  4OFZ A;  2NP9 A;  2NW7 A;  2C5K T;  3CVR A;  2E2A A;  4I55 E;  2V5C A;  1KNP A;  3RIA A;  1SA0 E;  2J62 A;  4PJM A;  3P4W A;  4NUU A;  3K3O A;  5HXS A;  4U7I A;  4X1I E;  1S35 A;  3FHN A;  2MYS A;  3C50 A;  1MIV A;  4DV4 T;  2E5L T;  2LKH A;  2DCF A;  1OED B;  2W66 A;  2LLY A;  4OHF A;  3AE6 A;  3N2O A;  3FBZ A;  2XQ9 A;  4YXD A;  1Y64 B;  2PFV A;  3UUB A;  2NTY A;  2V8S V;  3L8R A;  4U2Y A;  3P4R A;  3F57 A;  1VCS A;  3F31 A;  3ONX A;  1XMQ T;  2SPC A;  1ZKE A;  3MZK B;  4AIS A;  2Y8D A;  2NWB A;  3FZM B;  2BDE A;  4JV5 T;  3WAJ A;  3MK7 C;  3SWH A;  1YQ4 A;  4JI7 T;  3AE8 A;  2XQ4 A;  3KFW X;  5HWY A;  3NRX A;  5AQH B;  2BG9 A;  3A7M A;  1SE7 A;  3AE3 A;  5LMN T;  4KX6 A;  3C51 A;  4PW8 A;  2CXF A;  3LBX B;  4WNK A;  3T8O A;  1N33 T;  4ZXL A;  2H88 A;  5CB4 E;  4AQG A;  4QH4 A;  3PUY F;  4LF8 T;  2WWV A;  5J2T E;  3L09 A;  4HFB A;  4X64 T;  5KMG P;  4B3M T;  1HX1 B;  5HXR A;  2KZ7 B;  5HWX A;  4BA9 A;  1FMW A;  3RYH E;  2A3D A;  5AQQ B;  4CXY A;  4YSY A;  3CKD A;  1YD8 G;  4BJN A;  3U78 A;  3GMI A;  3DP7 A;  4YHH T;  3F2E A;  4HGA A;  2XQ5 A;  3RQU A;  4UVA B;  3CQC B;  3ZMU B;  4HWC A;  1MMD A;  3AB3 B;  3AXJ A;  2XJ7 A;  2V5D A;  1BR1 A;  2LSI A;  4O4I E;  5FNV E;  2YU1 A;  3AEE A;  2LSY A;  4L0R A;  4ILA A;  2MPK A;  1IBK T;  5FY1 A;  3X1D A;  3RIF A;  5AQI B;  3ZEF B;  4DR5 T;  4UV9 B;  3JAD A;  3PU8 A;  4DVD A;  3WI3 A;  1NWM X;  3AVS A;  3QB5 A;  3IHR A;  3ZST A;  5C8Y E;  1VRB A;  3LK2 B;  2XSB A;  5LBM A;  1LVK A;  2BS4 A;  2MTQ A;  3UFG A;  3P4S A;  1J5W A;  3JAE A;  3QNU A;  4OYJ A;  2FJB A;  4PJL A;  5LGN B;  2H3R A;  3PDY A;  2YK0 A;  1IBL T;  1IZN B;  2ES0 A;  3QUJ A;  2DLR A;  1YW0 A;  4QH1 A;  4MBQ A;  4LML A;  2EHO D;  5L47 A;  2N2N A;  3ZMZ B;  2W61 A;  4A56 A;  2NR4 A;  3Q5D A;  2ZLY A;  5FXX A;  1B7T A;  5L4E A;  3G06 A;  4DMW A;  2M6B A;  2X67 A;  5IHY A;  3HI2 A;  3N5L A;  4IL9 A;  3KV4 A;  3P7I A;  2LT3 A;  4AKG A;  4I50 E;  3MAC A;  4PK5 A;  2YEV C;  3ZPO A;  1ZHC A;  4DND A;  3W15 B;  2RP4 A;  2DI4 A;  2IAK A;  4IDN A;  2WZH A;  2XZE A;  4ASK A;  2C0S A;  1HR0 T;  4PFP A;  1J1J A;  1KNR A;  2LM2 A;  2XQA A;  4X1K E;  1GQE A;  2HPL A;  3AEA A;  1W0B A;  2WWU A;  3RIU C;  2EHO B;  5AFU L;  5LJM A;  2J47 A;  4L9I A;  4B3S T;  2XY8 B;  3ANW B;  5JDN A;  3AE7 A;  2WDV A;  4CXX A;  5ABG A;  4CI3 B;  3AEC A;  1D0Z A;  4HWF A;  1E2A A;  2WCA A;  2GK9 A;  2YDQ A;  2E8I A;  3VHL A;  4JI6 T;  3NWI A;  1HNX T;  4DR2 T;  3PUR A;  5JDF A;  1FEW A;  3AAA B;  1D0Y A;  3AEB A;  2HN1 A;  3UU5 A;  2E9X A;  4PNI A;  2KSR A;  1H7C A;  4DR6 T;  1WLX A;  2IC6 A;  4WBN E;  4LFC T;  4H9N C;  4U31 A;  2LKG A;  3PUW F;  4CN1 A;  1YKH B;  5FVK A;  4NXM T;  4YFS A;  2VWA A;  4UVC B;  3VR9 A;  1ZOY A;  3C4X A;  4YSZ A;  3KV5 A;  2H89 A;  1WRD A;  5ABH A;  2VAS A;  3AE5 A;  1HS7 A;  5JDM A;  1HFA A;  2BKP A;  1US7 B;  4U7Y A;  4AQF C;  2BG9 B;  2Q9Q A;  2XAS B;  3BQI A;  4CN6 A;  2G0U A;  4KBM B;  3L3P A;  3OTO T;  5LXT E;  2B1E A;  3IF8 B;  1D1A A;  3ZYL A;  4IIJ E;  2BS3 A;  4LMJ A;  3NKZ A;  3UQ7 A;  1UCU A;  2BS2 A;  3UUM A;  4O4H E;  2XPK A;  3HA4 A;  2CEA A;  2CE7 A;  4M1P A;  5AQP B;  4H9S E;  5ETW A;  5AQF B;  3S4U A;  2Y48 B;  4EIW A;  5JDL A;  2MOZ A;  4HWH A;  5EZY E;  2ODV A;  1ZEE A;  2CXD A;  3VRA A;  5KXJ A;  4JI3 T;  4JI1 T;  2KMF A;  5CFB A;  4NXN T;  4H63 V;  2HN2 A;  4GKJ T;  3VKH A;  1WYB A;  3CX7 B;  1ZV4 X;  2D0U A;  2W2U A;  2V7K A;  1YXR A;  4NUV A;  4DV3 T;  2WMO A;  1T8B A;  3AXJ B;  2WP9 A;  5JDG A;  3L39 A;  1OXZ A;  1E7P A;  2CPT A;  5J1G A;  5HAX A;  4ZS3 A;  4IDZ A;  2LHR A;  1QSD A;  2XAQ B;  4MLK A;  3AEF A;  4QH5 A;  2LSK A;  4U72 A;  5ABF A;  3R84 B;  1WYC A;  5FXV A;  2WB5 A;  2IW5 B;  1M7K A;  2VQF T;  3CQG B;  1T7S A;  4F8H A;  2VL0 A;  3RX6 A;  1G8X A;  3D0T A;  3AED A;  4GK5 E;  2RPA A;  1IJ6 A;  4UF0 A;  5DQW A;  4EV6 A;  3FBL A;  3K1S A;  4TUY E;  5HXE A;  4IDO A;  5HEJ A;  4LF6 T;  2CCQ A;  4F6R C;  4K0K T;  2V7J A;  4TN7 B;  2NW9 A;  1OED E;  2IHR 1;  3SS1 A;  1MND A;  1I6Z A;  3EVY A;  5FP3 A;  5E0O A;  4PJN A;  1UGO A;  2KXP B;  2QA7 A;  3VRB A;  4TZ4 C;  4IT4 A;  1IBM T;  5LCY A;  5HEG A;  2LHN A;  2K9A A;  5AQL B;  2FJE A;  1LKX A;  4TNW A;  3UUX B;  3Q5W A;  4BAY B;  3C4W A;  4ISS A;  3RYC E;  3BQL A;  4QKN A;  4JYA T;  5HEU A;  2DHR A;  2XQ8 A;  3N2G E;  3I0O A;  5FVL A;  2A9U A;  2HPJ A;  3UU8 A;  1D1C A;  5LP6 E;  4JUY A;  5CGM A;  2ACX A;  3ESL A;  2W63 A;  2E9X D;  4O2B E;  2YDR A;  3AE4 A;  3UQ4 A;  4ILB A;  3EUH A;  1OED C;  2P9B A;  3BK9 A;  4UIG A;  1FJG T;  1XNR T;  2CA5 A;  4X65 T;  5HCJ A;  2WU5 A;  5L3E B;  3LK3 B;  5DAB A;  4UEL A;  3LJC A;  2W67 A;  5FL1 A;  3U3I A;  3RF1 A;  5AQT B;  2ZM8 A;  3KDS E;  4HFD A;  2BKO A;  2WDR A;  1ZP0 A;  4CI1 B;  3KV6 A;  2Y6X A;  4NPP A;  2Q9Q D;  2XAJ B;  4YHJ A;  4O4J E;  2LEH A;  4BJM A;  1HF8 A;  3ETU A;  3P4P A;  4EZH A;  5AQU B;  4ILC A;  2DWK A;  3Q5X A;  4FI5 A;  4GIW A;  2WAU A;  5LYJ E;  1UK5 A;  3QC9 A;  2KWH A;  2C5J A;  2Z6E A;  2E9X B;  4CQI A;  4X20 E;  1WR0 A;  2F4V T;  3KV9 A;  4LFA T;  3FXD B;  2D9D A;  5LHI B;  4AKL A;  2XAH B;  3ABV A;  1J5E T;  3KBU A;  4ZHQ E;  1FMV A;  4GKK T;  4IE0 A;  4DMV A;  3PUA A;  5LMU T;  4JEH B;  3AA0 B;  5LJN A;  2JIW A;  1HNZ T;  1SHZ C;  2E9X C;  3ONJ A;  1AJ3 A;  1Z8U A;  3IA3 A;  2Q9Q B;  2QRX A;  4IE7 A;  4PK4 A;  2NOX A;  3K8P C;  4HFH A;  2CRB A;  2K5B B;  4JEU B;  3KIN B;  5AQR B;  4DUY T;  3QK6 A;  2XUE A;  3JAF A;  3ZMV B;  2PTF A;  3HKB E;  1MMA A;  5M4Y A;  2WBL A;  3T1H T;  5JVD E;  2QYW A;  5JH7 E;  5F5W A;  2I0M A;  3I1A A;  2D2S A;  4CZZ B;  4YTP A;  2IC9 A;  3M65 A;  3KBT A;  2DWG A;  2FJA A;  3EDU A;  4I0U A;  4ZZB A;  2BKN A;  5DJQ C;  5AQS B;  3EDV A;  3UT5 E;  3VKG A;  1YKE B;  5HYA A;  4HFI A;  2VKD A;  4KP3 C;  2YOE A;  4E7S A;  1HCI A;  4P09 A;  4DV5 T;  2V6X A;  3PU3 A;  1KFY A;  4DBQ A;  2DL1 A;  3RKO A;  5JQG E;  5JR9 A;  4LF7 T;  3OPC A;  2XQ3 A;  4EXT A;  4NIQ A;  4N78 D;  5FL0 A;  2J1D G;  2YIN A;  5ABF B;  4K0U A;  3FB2 A;  1N36 T;  1HG2 A;  2H7O A;  1Y01 A;  2WSS V;  3NZQ A;  3ZN0 B;  2M67 A;  2X0H A;  2IIU A;  2JRK A;  4XAX B;  3UTK A;  4IDQ A;  1MIW A;  4MAL A;  3CPZ A;  2N1G A;  4KUM B;  2CWY A;  2CBJ A;  4GK0 E;  3KVB A;  2R6G F;  5HCM A;  4UF0 B;  4A97 A;  2VUR A;  5A1L A;  4O8S A;  3OBV E;  3PUZ F;  4ERR A;  2X0Y A;  3N9Q A;  2AE9 A;  2I6H A;  2X68 A;  5L4H A;  3J9X 1;  1CHU A;  2YKS A;  3CIR A;  3ZCJ A;  3FZH B;  3RQW A;  3HL6 A;  5AQK B;  3I9W A;  3I0Q A;  1OWA A;  1MNE A;  3HKE E;  4H9Q C;  4LF9 T;  3J7Y q;  1D1B A;  3EHZ A;  4OX9 T;  1KNZ A;  3LG7 A;  3O1I A;  3WAK A;  2E5V A;  4X62 T;  3BQK A;  4V1A v;  4YTM A;  2EHO C;  4GOU A;  2K24 A;  2HH7 A;  4ZZC A;  5FY7 A;  5L3D B;  1UX4 A;  2RA1 A;  1BR4 A;  4EAH A;  3RLF F;  4AQY T;  5J2U E;  4Z8X A;  3RC8 A;  2XQY A;  2JJ9 A;  4U2Z A;  1HNW T;  3N2K E;  2X9X A;  3ZYM A;  4O2A E;  2XM1 A;  4KHZ F;  2BVM A;  4CXW A;  4TWF A;  4QX7 B;  3RI5 A;  2V7M A;  1L0V A;  1T72 A;  4JBW F;  2XSA A;  2XM2 A;  3Q5E A;  3FZL B;  2LRL A;  4FJO A;  2KLQ A;  4HEA A;  4TNV A;  5KX5 E;  5JDH A;  2AXD S;  3AAI A;  4X1Y E;  2YDS A;  4B3R T;  3N9P A;  4IE6 A;  4YSX A;  4B6X A;  1X9B A;  2NW8 A;  5AQN B;  5H6Q B;  2VQE T;  3VR8 A;  5LNK A;  3NVO A;  1YQ3 A;  3RRC A;  2WMN A;  1QLB A;  3V5S A;  4JI0 T;  2UUB T;  4P0A A;  3FZK B;  1DU2 A;  2BG9 C;  1NEK A;  3Q2M A;  4UR9 A;  3AE1 A;  5EK3 A;  5KDM C;  2JQK A;  3UUN A;  3I9Y A;  2VKJ A;  1CUN A;  3SRZ A;  4A98 A;  3AEG A;  3OYX A;  1SUM B;  3O1J A;  1NEN A;  4ADZ A;  3TLV A;  4UVB B;  3TKL B;  1UUS A;  2I59 A;  3GN5 A;  4U3C A;  5CJ5 A;  3M3Z B;  3TLW A;  1UUR A;  1HTJ F;  4WYV A;  2HHH T;  2UU9 T;  4YJ3 E;  2XQ7 A;  3PE0 A;  4DUZ T;  4AIU A;  2A72 A;  3OVU A;  3RHW A;  2WQY A;  4KI0 F;  1N34 T;  4IHJ E;  2D0T A;  3LK4 2;  4DBR A;  3EAB A;  2BBH A;  5FKY A;  4ILU A;  4DR4 T;  3QOF A;  3ZC1 A;  1U4Q A;  3ZT7 A;  1M62 A;  2XTL A;  3ZMS B;  3O4X E;  2LM9 A;  2CXL A;  2JQ9 A;  5F8P A;  2X0L B;  1VOM A;  3HKC E;  1BR2 A;  3UU4 A;  4XBF B;  3B5M A;  1S94 A;  4AKR B;  4DV0 T;  3JC6 D;  2L8K A;  4ZI3 D;  4Q25 A;  3OYZ A;  3ZN1 B;  2UXC T;  4DR3 T;  2KND A;  1MIY A;  5JRC A;  1MMN A;  3O1H A;  5L3F B;  4QXB B;  3ETV A;  5JR9 B;  4TV9 E;  3PJA J;  3CML A;  4P1N A;  4DV2 T;  5H6R B;  2IUB A;  1IJ5 A;  5AQJ B;  2FUP A;  4IDP A;  1NAF A;  2V6Y A;  2IML A;  5LGT B;  2QGS A;  1VCT A;  3RGL A;  4GYS A;  1I94 T;  3RYF E;  5JR9 C;  4WBO A;  4MFR A;  5J0Z A;  4YT0 A;  3ZC0 A;  5LA6 E;  3CK6 A;  5L3G B;  4AQF A;  1JNR A;  1W0A A;  1BR0 A;  2BZB A;  2LJL A;  2XAF B;  3ZMT B;  4JI4 T;  3UUL A;  3NBX X;  2WS3 A;  3H3A A;  4G63 A;  3RH3 A;  3GWH A;  4DID B;  3PTR B;  4DR7 T;  5JTG A;  2PBI A;  1LRZ A;  3MJX A;  4QWN B;  4HKA A;  4QX8 B;  2WM9 A;  4XZC A;  4EYU A;  2ZM6 T;  2WU2 A;  3JC6 C;  3FXE B;  4ZI3 C;  2DNX A;  2D5U A;  4ZS2 A;  3RYI E;  2VVS A;  2VB6 A;  1WFD A;  3PUG A;  5FMN A;  4QXC B;  2BVL A;  2V1D B;  5IYZ E;  1FIO A;  3A8Y C;  4HE8 A;  4LF4 T;  2CM0 A;  3EI0 A;  3TLU A;  3ZT5 A;  3AE2 A;  3SFD A;  2CBI A;  3HR0 A;  5GON E;  3FZF B;  4AI6 A;  4H9O C;  5IWA T;  3MXZ A;  1XNQ T;  2VKO A;  5FY0 A;  2LSG A;  4C91 A;  5IUX A;  2UUA T;  2WY2 A;  3A5X A;  2CHN A;  3AA1 B;  2X51 A;  3PJA A;  2LRK A;  5AQO B;  5HXH A;  2JQQ A;  2X9H A;  2L9Q A;  2X9W A;  4KHP T;  3B57 A;  3O9X A;  3AA7 B;  2QVA A;  1W9R A;  4MHC A;  5CA0 E;  2YU2 A;  1G73 A;  4JLE A;  2ODU A;  1KF6 A;  3PUV F;  1T98 A;  2OLT A;  2CHO A;  5F3J A;  2MBG A;  4TV8 E;  2M6I A;  3AA6 B;  3RRW A;  4I4T E;  3RC3 A;  4UXN B;  2Q9Q C; 
#chains in the Genus database with same CATH homology
 3ONJ A;  2V8S V;  2QYW A;  1VCS A;  3ONL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...