2QYWA

Crystal structure of mouse vti1b habc domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport, endocytosis
molecule keywords Vesicle transport through interaction with t-SNAREs 1B homol
publication title A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles.
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2qywA00
1VCSA 3ONJA 3ONLC 2QYWA 2V8SV
chains in the Genus database with same CATH superfamily
1UX4A 1XDOA 4WBNE 5HAXA 4JUYA 3X1DA 4B3TT 2VKOA 2WBLA 1H7CA 4ZI2C 5FXXA 3CIRA 3WI3A 5BR8T 3RRWA 3P8CD 3KFWX 3Q5WA 5HEUA 1D1CA 4JI2T 3GWHA 2BKNA 2QRXA 2W00A 3JAFA 4NXNT 4OYKA 4GKKT 5L3EB 3LK2B 3PE0A 1BR2A 3AXJA 2V6YA 3NRXA 1T7SA 3ZYKA 1MMDA 1N33T 2XASB 4IL9A 5HCJA 2ZMAA 3KBUA 5JDMA 4QXBB 4LF5T 2V7KA 3C4XA 3GA8A 1YW0A 4OYJA 1Y01A 4NIQA 4C90A 1HTJF 2KT9A 3PUVF 3RPUA 2C5IT 4LF9T 2KMFA 5EK3A 1SHZC 2HPLA 1QSDA 2IC9A 3NZPA 3RYIE 1YQ4A 3JC6D 3FXDB 2IHR1 1HG2A 2CBIA 1BR1A 5F8PA 1UCUA 1S94A 2C0SA 3I0QA 3ZT6A 3AE5A 5FP3A 3VKGA 5FY7A 2C5KT 3AE4A 3UUNA 3CPZA 4DUZT 2WMNA 5HXHA 2V1DB 1BR0A 4I0UA 2IMLA 2EHOD 4J2CA 1JNZA 4L9IA 4QWNB 3ZYMA 4QH5A 2HHHT 4JI0T 1W0AA 3SOLA 3AAAB 5KXJA 3QUJA 2BS2A 5L2LA 2XAQB 1W9RA 3VU7H 1YKEB 3N5LA 2JQQA 2KZ7B 4H63H 4AKRB 3ZPOA 3RYCE 4CN4A 2A72A 4QX7B 1IBMT 4DO0A 2MPKA 4YSZA 3F57A 2DLRA 2HN2A 3EDVA 2V7MA 5LCYA 2XM1A 3LBXB 5LNKA 3OTOT 1OEDC 5AQFB 1XNQT 4HN9A 3FZKB 5JR9C 4A5XA 4EGWA 1M7KA 5EK4A 3CQGB 4IE0A 4AKLA 4TWFA 3AEDA 4QXCB 2WM9A 3UU8A 4COFA 4HFCA 3W15B 2X0LB 4OX9T 2VWAA 3J7Yq 1M62A 5IWAT 3OPCA 2I0MA 3N2OA 3PU3A 4AQYT 2H3RA 5DJQC 1UK5A 4LF6T 4KMCA 3PJAJ 1IZNB 4XAXB 4ILUA 4YSYA 2EHOB 2UUCT 3CQXC 4O2AE 2XSAA 4A56A 3PUXF 3N9NA 4AI6A 3B13A 2J1DG 1LKXA 3GN5B 5CJ5A 3LBXA 4JI4T 3N9QA 2K5BB 3V5SA 5FL0A 3EVYA 2XQ4A 3P4QA 2KSRA 5L47A 1WFDA 3UULA 1HF8A 2LRLA 1J1JA 2A3DA 3P4PA 5JDNA 3Q5XA 4HWIB 4ISSA 1YKHB 1E2AA 3A5XA 4U2YA 4EYUA 2NOXA 3ETUA 2DWGA 2JIWA 2I6HA 4O4IE 1WYBA 1KNZA 5HYAA 4G2AA 4TZ4C 2CE7A 4FJOA 4EZ4A 3VR9A 2EHOA 3N9PA 2FJAA 3TLWA 4ZZBA 5LHHB 1D0XA 2DWKA 2MTQA 3ZT7A 4LMKA 5J0ZA 4CXWA 5FKYA 1MNDA 5FXZA 3O1HA 3FZLB 1WR0A 3RIUA 3QB5K 4IL4A 2BVLA 4X1YE 2XQ5A 4IDNA 4U7YA 4H9QC 5FNVE 2UU9T 2NTXA 2E9XC 2V26A 4DVDA 2W4XA 3FZMB 4YFSA 5AFUL 1ZKEA 5AQGB 4DR3T 2CRBA 5LP6E 4M1PA 2K48A 2VL0A 2XQYA 3FBZA 3NRYA 2FJEA 2WB5A 4QKNA 3A8YC 2V5DA 5JDQA 5KMGP 4GIWA 1D1BA 3CK6A 2W62A 3C4ZA 3ZMUB 5JH7E 4AIUA 3LJCA 3SFDA 3FB2A 4DV7T 2KWIB 2LOSA 5FXVA 2BKOA 5M4YA 3E08A 4AQFA 5HEHA 4PJMA 3A7MA 2NW7A 3R84B 1HX1B 2XAFB 4IE4A 3DP7A 4UVAB 2PG8A 3EUHA 4KHPT 1OXZA 3R6NA 3VHLA 4X62T 1WR6A 2E2AA 5JQGE 2IIUA 3ABVA 2ODUA 4Z91A 3FZHB 5L4HA 4IT4A 3E0ZA 5ABGA 3JAEA 5LBQB 2DL1A 4AKIA 5LJMA 5LB7B 2V5CA 3TKLB 4V1Av 5HEOA 2KLQA 4ZS3A 1XMOT 3PJAA 4X5TA 3OBVE 5JDHA 4BJMA 1GQEA 1DU2A 3RH3A 3B5MA 4ANJA 4IE7A 3AXJB 5FVLA 2V6YB 2W0GA 2MAWA 3C98B 3QOFA 4EYYR 1VRBA 5IYZE 1YQ3A 2RPAA 5ABHA 2X68A 3O4XE 2YDRA 5FXWA 4YJ2E 2YINA 1MMAA 1G8XA 4PK5A 5C3JA 2NW9A 4QXHB 3H3AA 4NXMT 4DUYT 1MNEA 4K0UA 4O4JE 2PBIA 2DI4A 2OLTA 5LG3A 2NWBA 3QK6A 2JMKA 2YK0A 4AQGA 1MIYA 2H7OA 3NBXX 3I9YA 5AQHB 5F3JA 2AXDS 3O1JA 2OA5A 2B1EA 1I6ZA 1MMNA 2FJDA 2XHEB 1HNWT 3ZSSA 3CX8B 4Q25A 2JRKA 3Q2MA 4KX6A 3RQUA 2JJ9A 3ZMSB 2M6IA 2BVMA 1KFYA 3EDUA 3NKZA 4MLKA 4QX8B 5ADXL 3PU8A 4JYAT 2CLYB 3UFEA 1VCTA 2XTLA 4QH4A 2H88A 3ONJA 3RLFF 1HG5A 4TNVA 4PFPA 4ASKA 1R8IA 3PV0F 5L3FB 2VKHA 3IA3A 1XZYA 3AA7B 2W2UA 1MMGA 2WY2A 1HNZT 3AA6B 3VRAA 2DCFA 5J1GA 3OYXA 4YSXA 3CQCB 3L8RA 4DMWA 3N9MA 4FI5A 5HWXA 2L3LA 2Q9QD 1XMQT 2V7JA 2Z6EA 4PFOA 2WQYA 2XPKA 3RF1A 5AQOB 3ZMTB 2QA7A 4H9SE 3DJBA 4GOUA 2CA5A 2H89A 1Z0PA 4TWDA 4JEUB 3TLUA 2X9YA 5GONE 5AQNB 5IHYA 4LF4T 2KINB 3T1HT 3RHWA 1QLBA 1CHUA 3TLTA 3N9LA 2DNXA 2CXDA 2JMHA 4F6RC 4KUMB 2YU1A 5HWYA 4U74A 3N2GE 4XBFB 2JQHA 2VL8A 3LDQB 5HCMA 2E5LT 3Q9DA 2X0YA 2CPTA 2E9XD 3U3IA 3ZJ1A 3UTKA 4LFBT 5J2UE 2BS4A 4L0RA 1IJ6A 4LMLA 5KX5E 3O1IA 4LFCT 3SS1A 4DV6T 5LGTB 4ILBA 4TUYE 5HXRA 3GMIA 5CB4E 5LXTE 1OEDA 2D0UA 5IUXA 4EXTA 4OFZA 4HFVA 1SUMB 1XDPA 2ZM6T 3OVUA 4JLEA 1AJ3A 1LVKA 3FZFB 3PUWF 3ZN1B 4PK4A 4KI0F 2VURA 1D0ZA 2D5UA 3V5UA 5ETWA 3EAMA 1T72A 2ZM8A 3HKBE 3ZCIA 4IDZA 2XY8B 2CHNA 5A1LA 4ZI3D 5LHGB 2OV9A 3I0OA 2ZLYA 3HKEE 2UXDT 3ANWB 2ACXA 3PTRB 1ZP0A 2KWHA 3ZC1A 4WBOA 4CI3B 4GYRA 2MBGA 3QC9A 4JEHB 4AISA 4DBQA 4Z8XA 2QVAA 4ZS2A 2Y8DA 4YJ3E 1E7PA 3KV5A 3P4WA 3KINB 2K9AA 3FBLA 2FJBA 3LFMA 3MACA 1D1AA 2BG9A 2D2SA 2J62A 3AA1B 4HFBA 3H3MA 2FBWA 3FXEB 4HFEA 2XSBA 4MHCA 1O3XA 2X51A 2LSYA 4JI7T 4ADZA 5HEJA 3PUQA 5LYJE 4U3CA 3JC6C 5TAOA 4JI3T 4X20E 3RKOA 1VCSA 5FY0A 5FVKA 2WWUA 1XWMA 3L3PA 3I1AA 5CFBA 4WW0A 2VQFT 3C51A 4BAYB 1HS7A 4CXXA 4GYSA 2J4GA 2Q9QA 4H9NC 3SWHA 4PJJA 4AXPA 4N78D 4AKHA 2A2FX 3ANWA 2Y6XA 3FHNA 2V6XA 3BQLA 4ZZCA 3OYZA 2EHOC 2ACZA 2LE8A 3JCFA 4DR4T 2BBJA 5LHIB 2I59A 1MIVA 3AE8A 4OHFA 2XAHB 2D0TA 4UV9B 3N2KE 5FMNA 2MOZA 4ZI2D 3HI2A 3ZN0B 1D0YA 3RIUC 3CKDA 4X65T 2CCQA 2IUBA 4H63V 3P4SA 4LF8T 4EIWA 4A97A 2DHRA 2XQ3A 2BBHA 2QYWA 5L3CB 2E5VA 3MJXA 4CXYA 4HE8A 1NWMX 2NP9A 5JDGA 2LM9A 3MXZA 2X0HA 5LMNT 4PAGA 4UF0B 4NUVA 4HFIA 4PW8A 5AQSB 4K0KT 4UELA 5HXCA 3ONLC 4KHZF 5LGUB 5HXSA 3ZKRA 2A9UA 1IJ5A 4U31A 2UUAT 3QB5A 3AE3A 5CA1E 4X1KE 2FUPA 3WAKA 3PUSA 5F5WA 5L3DB 3PDYA 3ZT5A 2RP4A 2BKPA 4AQFC 5LJNA 4YHHT 4UIGA 1FEWA 2AE9A 3ZEFB 1FIOA 3CMLA 5LGNB 4B6XA 2WU5A 2XQ8A 3L09A 5LBMA 4X66T 2YKSA 1T8BA 4TN7B 3ZSTA 3HKCE 2CBJA 4IE5A 1U5PA 1ZEEA 3ONXA 4ZI7E 3LG7A 3O9XA 5AQQB 4O8SA 5L3GB 5H6RB 5AQJB 4YLHA 4IGUA 1XNRT 2WZHA 3P50A 1SE7A 4DR1T 3VR8A 4GK5E 2X66A 2M67A 4UF0A 2W67A 2P9BA 1KEYA 2KNDA 4ILCA 5JREA 4DR7T 2BS3A 3I9WA 4X1IE 2W61A 4YHJA 2XAGB 2G0UA 2NR4A 4DBRA 2WP9A 4CN1A 1KNPA 3M3ZB 4U72A 4ZXLA 3AE7A 3NZQA 2WMOA 3UUBA 5FL1A 1L0VA 4QHOA 3OKQA 2YDQA 4IDPA 3K3NA 4LFAT 4YTMA 5AQUB 4YXDA 3UUXB 2RA1A 2JQ9A 4I55E 3ZMZB 4U2ZA 1E1HB 1WCRA 1IBKT 4MFRA 2V7LA 5ABEA 2YN6A 3EHZA 3MKDA 4YT0A 4BJNA 2HN1A 1YXRA 1ZV4X 4KBMB 2X9XA 1UX5A 4DV4T 1ZOYA 4WNKA 3AEEA 2LKGA 1ZHCA 4NUUA 4DV0T 3KV9A 1U4QA 2WDQA 4DNDA 4H9OC 4JI5T 4CI1B 2K24A 1B7TA 4O4HE 4IDQA 2LHNA 1WYCA 3E22E 2LSIA 5KDMC 3L39A 3U78A 3KVBA 3ZCJA 2CHOA 3ZJ2A 3T8OA 3UQ4A 5HXEA 3PUZF 4U7IA 4EOZB 4AKGA 3BQKA 1KK7A 1N32T 1QUUA 5AQMB 3HR0A 1FJGT 4UVBB 4LMJA 5LMUT 3C50A 3ZLIA 2PJQA 2V7IA 3CX6B 1Y64B 5LOVE 3KV6A 4UR9A 5FYMA 5JRCA 4EV6A 4I50E 1UURA 2WDRA 3J9X1 1JNRA 1FMWA 1J5WA 2ODVA 3TLSA 3D0TA 1NENA 2M6BA 3LK42 1WRDA 2CWYA 3ETVA 2VQET 3UU4A 4E7SA 3AB3B 3AE6A 1LRZA 3RX6A 4NPPA 2GK9A 4JV5T 4X64T 4DR2T 4CZZB 3B57A 1US7B 4DR5T 2XQAA 2J47A 1OEDB 1BR4A 2LSKA 3SRZA 4ZOLE 2X9HA 2WCAA 5AQIB 2D9DA 5JR9B 4ISTA 3S4UA 3AECA 3QNUA 2LHRA 4I43B 2YU2A 2K3WA 3RGLA 3AE2A 3AEAA 4MALA 3UU6A 3SFEA 4DR6T 4UEMA 2MYSA 4A98A 2CLYC 3K3QC 3EI0A 4PNIA 3IEEA 5AQLB 4P1NA 4O4LE 3N9OA 1J5ET 4IIJE 2X9WA 4XZCA 3K1SA 3RI5A 2ZM2A 2VK9A 3KVAA 2XQ7A 2LLYA 4DV5T 2XUEA 1UGOA 3RQWA 4DV3T 2VKDA 4P0BA 3ZC0A 4HKAA 4EAHA 4EEBA 5DABA 1UUSA 2BG9B 3AEGA 2YOEA 4B3MT 4P09A 1EZ3A 4L5GA 2UXBT 2NW8A 5LA6E 3PUAA 2NTYA 4CI2B 3MA9A 2C5JA 4HTEA 2CM0A 2HH7A 2KXPB 5JR9A 1W0BA 4HWHA 4IE6A 2HPJA 3AA0B 3K8PC 3RKGA 3ZMVB 4HFDA 3UT5E 3M65A 2VB6A 2V8SV 3RRCA 5BMVE 4GK0E 3ZYLA 3LK3B 2JQKA 5ABFB 2WAUA 5L4EA 2YEVC 2Q9QB 3AEBA 2X67A 1X79A 2XAJB 4BA9A 4TX5A 1VOMA 4P0AA 3P4RA 4MBQA 4ZEYA 4ILAA 4HGAA 2LT3A 2UXXB 5C2TA 3JADA 5C8YE 4GKJT 4ERRA 4WZXA 3KBTA 4HWDA 3T1YT 2CXLA 2VASA 5EZYE 3AEFA 4DV2T 2XM2A 3KDSE 3HKDE 3RIAA 3VRBA 2BG9C 2VVNA 2R6GF 4TWHA 4CQIA 1SA0E 4QH1A 2LJLA 3C64A 1YD8G 2LM2A 5AQTB 1NAFA 2CXFA 2E9XB 4JI6T 2LEHA 5JVDE 3RYFE 3NWIA 4LF7T 1I94T 4YY3T 5JDFA 3AE9A 4B3RT 2PTFA 2IW5B 5ABFA 2BZBA 2UXNB 2LOPA 4ZHQE 3MK7C 2Q9QC 2YDSA 3BK9A 4IHJE 4HFHA 3WAJA 4Z90A 3EABA 5CA0E 5HEGA 5JTGA 4KP3C 3AAEB 2WS3A 2VVSA 2L8KA 3UQ7A 2LSJA 2WZIA 4IDOA 2XZEA 3K3OA 5LG4A 2XJ7A 5L3BB 3BQIA 1IAPA 4PJNA 2IAKA 2ZM0A 3AE1A 3RIFA 2W63A 3IHRA 3GN5A 3G06A 4OK0A 3KV4A 3TLVA 1HR0T 2UXCT 4EZHA 4H9RC 2B76A 2E9XA 1HX8A 1HNXT 1S35A 2LKHA 2ES0A 4WYVA 3VKHA 3PUGA 2Y48B 3CWZB 4TV9E 1V9DA 1IBLT 5FY1A 2N1GA 3RC3A 2IDOB 1FMVA 2LSGA 3F2EA 4YTPA 5J2TE 1OEDE 4I4TE 4IREA 1LVFA 3OJAA 4CN6A 5E0OA 3P7IA 3IBPA 4UV8B 2CEAA 3UU5A 2CWOA 2XQ9A 4JBWF 4C91A 2XQ6A 3H37A 4HWCA 5AQPB 3UU3A 2E8IA 2F4VT 4TV8E 4UVCB 5CGMA 5H6QB 3C4WA 1T98A 2N9DA 4PJLA 2PFVA 4EEDA 1HCIA 1CUNA 1X9BA 3IF8B 4DV1T 3RYHE 4HWFA 5DQWA 3DTOA 3HL6A 2VKJA 3CVRA 4ZI3C 2WDVA 5AQVB 3AAIA 3NVOA 4DMVA 2WSSV 1W09A 4U33A 3AVRA 2IC6A 5JDLA 4EB6E 1KNRA 2JPFA 4O2BE 1NEKA 4JI8T 2BG9E 5AQRB 3MZKB 3AVSA 2LRKA 4G63A 2BDEA 2QGSA 1N34T 4E7ZA 1HFAA 2W66A 3RC8A 3Q5EA 3UFGA 1G73A 3ESLA 4HEAA 3UUMA 4UXNB 1Z8UA 3PURA 5EK2A 3F31A 2H7VC 4JI1T 2WWVA 1N36T 1WLXA 3Q5DA 2UUBT 5AQKB 5DQVA 1KF6A 4DIDB 4F8HA 3PUYF 4TNWA 2CMRA 2L9QA 1MIWA 2SPCA 4H9PC 1OWAA 3LSVA 3CX7B 2N2NA 3HA4A 4YTNA 4PK6A 5JRCB 2WU2A 4B3ST
chains in the Genus database with same CATH topology
1VCSA 3ONJA 3ONLC 2QYWA 2V8SV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCS A;  3ONJ A;  3ONL C;  2QYW A;  2V8S V; 
#chains in the Genus database with same CATH topology
 1UX4 A;  1XDO A;  4WBN E;  5HAX A;  4JUY A;  3X1D A;  4B3T T;  2VKO A;  2WBL A;  1H7C A;  4ZI2 C;  5FXX A;  3CIR A;  3WI3 A;  5BR8 T;  3RRW A;  3P8C D;  3KFW X;  3Q5W A;  5HEU A;  1D1C A;  4JI2 T;  3GWH A;  2BKN A;  2QRX A;  2W00 A;  3JAF A;  4NXN T;  4OYK A;  4GKK T;  5L3E B;  3LK2 B;  3PE0 A;  1BR2 A;  3AXJ A;  2V6Y A;  3NRX A;  1T7S A;  3ZYK A;  1MMD A;  1N33 T;  2XAS B;  4IL9 A;  5HCJ A;  2ZMA A;  3KBU A;  5JDM A;  4QXB B;  4LF5 T;  2V7K A;  3C4X A;  3GA8 A;  1YW0 A;  4OYJ A;  1Y01 A;  4NIQ A;  4C90 A;  1HTJ F;  2KT9 A;  3PUV F;  3RPU A;  2C5I T;  4LF9 T;  2KMF A;  5EK3 A;  1SHZ C;  2HPL A;  1QSD A;  2IC9 A;  3NZP A;  3RYI E;  1YQ4 A;  3JC6 D;  3FXD B;  2IHR 1;  1HG2 A;  2CBI A;  1BR1 A;  5F8P A;  1UCU A;  1S94 A;  2C0S A;  3I0Q A;  3ZT6 A;  3AE5 A;  5FP3 A;  3VKG A;  5FY7 A;  2C5K T;  3AE4 A;  3UUN A;  3CPZ A;  4DUZ T;  2WMN A;  5HXH A;  2V1D B;  1BR0 A;  4I0U A;  2IML A;  2EHO D;  4J2C A;  1JNZ A;  4L9I A;  4QWN B;  3ZYM A;  4QH5 A;  2HHH T;  4JI0 T;  1W0A A;  3SOL A;  3AAA B;  5KXJ A;  3QUJ A;  2BS2 A;  5L2L A;  2XAQ B;  1W9R A;  3VU7 H;  1YKE B;  3N5L A;  2JQQ A;  2KZ7 B;  4H63 H;  4AKR B;  3ZPO A;  3RYC E;  4CN4 A;  2A72 A;  4QX7 B;  1IBM T;  4DO0 A;  2MPK A;  4YSZ A;  3F57 A;  2DLR A;  2HN2 A;  3EDV A;  2V7M A;  5LCY A;  2XM1 A;  3LBX B;  5LNK A;  3OTO T;  1OED C;  5AQF B;  1XNQ T;  4HN9 A;  3FZK B;  5JR9 C;  4A5X A;  4EGW A;  1M7K A;  5EK4 A;  3CQG B;  4IE0 A;  4AKL A;  4TWF A;  3AED A;  4QXC B;  2WM9 A;  3UU8 A;  4COF A;  4HFC A;  3W15 B;  2X0L B;  4OX9 T;  2VWA A;  3J7Y q;  1M62 A;  5IWA T;  3OPC A;  2I0M A;  3N2O A;  3PU3 A;  4AQY T;  2H3R A;  5DJQ C;  1UK5 A;  4LF6 T;  4KMC A;  3PJA J;  1IZN B;  4XAX B;  4ILU A;  4YSY A;  2EHO B;  2UUC T;  3CQX C;  4O2A E;  2XSA A;  4A56 A;  3PUX F;  3N9N A;  4AI6 A;  3B13 A;  2J1D G;  1LKX A;  3GN5 B;  5CJ5 A;  3LBX A;  4JI4 T;  3N9Q A;  2K5B B;  3V5S A;  5FL0 A;  3EVY A;  2XQ4 A;  3P4Q A;  2KSR A;  5L47 A;  1WFD A;  3UUL A;  1HF8 A;  2LRL A;  1J1J A;  2A3D A;  3P4P A;  5JDN A;  3Q5X A;  4HWI B;  4ISS A;  1YKH B;  1E2A A;  3A5X A;  4U2Y A;  4EYU A;  2NOX A;  3ETU A;  2DWG A;  2JIW A;  2I6H A;  4O4I E;  1WYB A;  1KNZ A;  5HYA A;  4G2A A;  4TZ4 C;  2CE7 A;  4FJO A;  4EZ4 A;  3VR9 A;  2EHO A;  3N9P A;  2FJA A;  3TLW A;  4ZZB A;  5LHH B;  1D0X A;  2DWK A;  2MTQ A;  3ZT7 A;  4LMK A;  5J0Z A;  4CXW A;  5FKY A;  1MND A;  5FXZ A;  3O1H A;  3FZL B;  1WR0 A;  3RIU A;  3QB5 K;  4IL4 A;  2BVL A;  4X1Y E;  2XQ5 A;  4IDN A;  4U7Y A;  4H9Q C;  5FNV E;  2UU9 T;  2NTX A;  2E9X C;  2V26 A;  4DVD A;  2W4X A;  3FZM B;  4YFS A;  5AFU L;  1ZKE A;  5AQG B;  4DR3 T;  2CRB A;  5LP6 E;  4M1P A;  2K48 A;  2VL0 A;  2XQY A;  3FBZ A;  3NRY A;  2FJE A;  2WB5 A;  4QKN A;  3A8Y C;  2V5D A;  5JDQ A;  5KMG P;  4GIW A;  1D1B A;  3CK6 A;  2W62 A;  3C4Z A;  3ZMU B;  5JH7 E;  4AIU A;  3LJC A;  3SFD A;  3FB2 A;  4DV7 T;  2KWI B;  2LOS A;  5FXV A;  2BKO A;  5M4Y A;  3E08 A;  4AQF A;  5HEH A;  4PJM A;  3A7M A;  2NW7 A;  3R84 B;  1HX1 B;  2XAF B;  4IE4 A;  3DP7 A;  4UVA B;  2PG8 A;  3EUH A;  4KHP T;  1OXZ A;  3R6N A;  3VHL A;  4X62 T;  1WR6 A;  2E2A A;  5JQG E;  2IIU A;  3ABV A;  2ODU A;  4Z91 A;  3FZH B;  5L4H A;  4IT4 A;  3E0Z A;  5ABG A;  3JAE A;  5LBQ B;  2DL1 A;  4AKI A;  5LJM A;  5LB7 B;  2V5C A;  3TKL B;  4V1A v;  5HEO A;  2KLQ A;  4ZS3 A;  1XMO T;  3PJA A;  4X5T A;  3OBV E;  5JDH A;  4BJM A;  1GQE A;  1DU2 A;  3RH3 A;  3B5M A;  4ANJ A;  4IE7 A;  3AXJ B;  5FVL A;  2V6Y B;  2W0G A;  2MAW A;  3C98 B;  3QOF A;  4EYY R;  1VRB A;  5IYZ E;  1YQ3 A;  2RPA A;  5ABH A;  2X68 A;  3O4X E;  2YDR A;  5FXW A;  4YJ2 E;  2YIN A;  1MMA A;  1G8X A;  4PK5 A;  5C3J A;  2NW9 A;  4QXH B;  3H3A A;  4NXM T;  4DUY T;  1MNE A;  4K0U A;  4O4J E;  2PBI A;  2DI4 A;  2OLT A;  5LG3 A;  2NWB A;  3QK6 A;  2JMK A;  2YK0 A;  4AQG A;  1MIY A;  2H7O A;  3NBX X;  3I9Y A;  5AQH B;  5F3J A;  2AXD S;  3O1J A;  2OA5 A;  2B1E A;  1I6Z A;  1MMN A;  2FJD A;  2XHE B;  1HNW T;  3ZSS A;  3CX8 B;  4Q25 A;  2JRK A;  3Q2M A;  4KX6 A;  3RQU A;  2JJ9 A;  3ZMS B;  2M6I A;  2BVM A;  1KFY A;  3EDU A;  3NKZ A;  4MLK A;  4QX8 B;  5ADX L;  3PU8 A;  4JYA T;  2CLY B;  3UFE A;  1VCT A;  2XTL A;  4QH4 A;  2H88 A;  3ONJ A;  3RLF F;  1HG5 A;  4TNV A;  4PFP A;  4ASK A;  1R8I A;  3PV0 F;  5L3F B;  2VKH A;  3IA3 A;  1XZY A;  3AA7 B;  2W2U A;  1MMG A;  2WY2 A;  1HNZ T;  3AA6 B;  3VRA A;  2DCF A;  5J1G A;  3OYX A;  4YSX A;  3CQC B;  3L8R A;  4DMW A;  3N9M A;  4FI5 A;  5HWX A;  2L3L A;  2Q9Q D;  1XMQ T;  2V7J A;  2Z6E A;  4PFO A;  2WQY A;  2XPK A;  3RF1 A;  5AQO B;  3ZMT B;  2QA7 A;  4H9S E;  3DJB A;  4GOU A;  2CA5 A;  2H89 A;  1Z0P A;  4TWD A;  4JEU B;  3TLU A;  2X9Y A;  5GON E;  5AQN B;  5IHY A;  4LF4 T;  2KIN B;  3T1H T;  3RHW A;  1QLB A;  1CHU A;  3TLT A;  3N9L A;  2DNX A;  2CXD A;  2JMH A;  4F6R C;  4KUM B;  2YU1 A;  5HWY A;  4U74 A;  3N2G E;  4XBF B;  2JQH A;  2VL8 A;  3LDQ B;  5HCM A;  2E5L T;  3Q9D A;  2X0Y A;  2CPT A;  2E9X D;  3U3I A;  3ZJ1 A;  3UTK A;  4LFB T;  5J2U E;  2BS4 A;  4L0R A;  1IJ6 A;  4LML A;  5KX5 E;  3O1I A;  4LFC T;  3SS1 A;  4DV6 T;  5LGT B;  4ILB A;  4TUY E;  5HXR A;  3GMI A;  5CB4 E;  5LXT E;  1OED A;  2D0U A;  5IUX A;  4EXT A;  4OFZ A;  4HFV A;  1SUM B;  1XDP A;  2ZM6 T;  3OVU A;  4JLE A;  1AJ3 A;  1LVK A;  3FZF B;  3PUW F;  3ZN1 B;  4PK4 A;  4KI0 F;  2VUR A;  1D0Z A;  2D5U A;  3V5U A;  5ETW A;  3EAM A;  1T72 A;  2ZM8 A;  3HKB E;  3ZCI A;  4IDZ A;  2XY8 B;  2CHN A;  5A1L A;  4ZI3 D;  5LHG B;  2OV9 A;  3I0O A;  2ZLY A;  3HKE E;  2UXD T;  3ANW B;  2ACX A;  3PTR B;  1ZP0 A;  2KWH A;  3ZC1 A;  4WBO A;  4CI3 B;  4GYR A;  2MBG A;  3QC9 A;  4JEH B;  4AIS A;  4DBQ A;  4Z8X A;  2QVA A;  4ZS2 A;  2Y8D A;  4YJ3 E;  1E7P A;  3KV5 A;  3P4W A;  3KIN B;  2K9A A;  3FBL A;  2FJB A;  3LFM A;  3MAC A;  1D1A A;  2BG9 A;  2D2S A;  2J62 A;  3AA1 B;  4HFB A;  3H3M A;  2FBW A;  3FXE B;  4HFE A;  2XSB A;  4MHC A;  1O3X A;  2X51 A;  2LSY A;  4JI7 T;  4ADZ A;  5HEJ A;  3PUQ A;  5LYJ E;  4U3C A;  3JC6 C;  5TAO A;  4JI3 T;  4X20 E;  3RKO A;  1VCS A;  5FY0 A;  5FVK A;  2WWU A;  1XWM A;  3L3P A;  3I1A A;  5CFB A;  4WW0 A;  2VQF T;  3C51 A;  4BAY B;  1HS7 A;  4CXX A;  4GYS A;  2J4G A;  2Q9Q A;  4H9N C;  3SWH A;  4PJJ A;  4AXP A;  4N78 D;  4AKH A;  2A2F X;  3ANW A;  2Y6X A;  3FHN A;  2V6X A;  3BQL A;  4ZZC A;  3OYZ A;  2EHO C;  2ACZ A;  2LE8 A;  3JCF A;  4DR4 T;  2BBJ A;  5LHI B;  2I59 A;  1MIV A;  3AE8 A;  4OHF A;  2XAH B;  2D0T A;  4UV9 B;  3N2K E;  5FMN A;  2MOZ A;  4ZI2 D;  3HI2 A;  3ZN0 B;  1D0Y A;  3RIU C;  3CKD A;  4X65 T;  2CCQ A;  2IUB A;  4H63 V;  3P4S A;  4LF8 T;  4EIW A;  4A97 A;  2DHR A;  2XQ3 A;  2BBH A;  2QYW A;  5L3C B;  2E5V A;  3MJX A;  4CXY A;  4HE8 A;  1NWM X;  2NP9 A;  5JDG A;  2LM9 A;  3MXZ A;  2X0H A;  5LMN T;  4PAG A;  4UF0 B;  4NUV A;  4HFI A;  4PW8 A;  5AQS B;  4K0K T;  4UEL A;  5HXC A;  3ONL C;  4KHZ F;  5LGU B;  5HXS A;  3ZKR A;  2A9U A;  1IJ5 A;  4U31 A;  2UUA T;  3QB5 A;  3AE3 A;  5CA1 E;  4X1K E;  2FUP A;  3WAK A;  3PUS A;  5F5W A;  5L3D B;  3PDY A;  3ZT5 A;  2RP4 A;  2BKP A;  4AQF C;  5LJN A;  4YHH T;  4UIG A;  1FEW A;  2AE9 A;  3ZEF B;  1FIO A;  3CML A;  5LGN B;  4B6X A;  2WU5 A;  2XQ8 A;  3L09 A;  5LBM A;  4X66 T;  2YKS A;  1T8B A;  4TN7 B;  3ZST A;  3HKC E;  2CBJ A;  4IE5 A;  1U5P A;  1ZEE A;  3ONX A;  4ZI7 E;  3LG7 A;  3O9X A;  5AQQ B;  4O8S A;  5L3G B;  5H6R B;  5AQJ B;  4YLH A;  4IGU A;  1XNR T;  2WZH A;  3P50 A;  1SE7 A;  4DR1 T;  3VR8 A;  4GK5 E;  2X66 A;  2M67 A;  4UF0 A;  2W67 A;  2P9B A;  1KEY A;  2KND A;  4ILC A;  5JRE A;  4DR7 T;  2BS3 A;  3I9W A;  4X1I E;  2W61 A;  4YHJ A;  2XAG B;  2G0U A;  2NR4 A;  4DBR A;  2WP9 A;  4CN1 A;  1KNP A;  3M3Z B;  4U72 A;  4ZXL A;  3AE7 A;  3NZQ A;  2WMO A;  3UUB A;  5FL1 A;  1L0V A;  4QHO A;  3OKQ A;  2YDQ A;  4IDP A;  3K3N A;  4LFA T;  4YTM A;  5AQU B;  4YXD A;  3UUX B;  2RA1 A;  2JQ9 A;  4I55 E;  3ZMZ B;  4U2Z A;  1E1H B;  1WCR A;  1IBK T;  4MFR A;  2V7L A;  5ABE A;  2YN6 A;  3EHZ A;  3MKD A;  4YT0 A;  4BJN A;  2HN1 A;  1YXR A;  1ZV4 X;  4KBM B;  2X9X A;  1UX5 A;  4DV4 T;  1ZOY A;  4WNK A;  3AEE A;  2LKG A;  1ZHC A;  4NUU A;  4DV0 T;  3KV9 A;  1U4Q A;  2WDQ A;  4DND A;  4H9O C;  4JI5 T;  4CI1 B;  2K24 A;  1B7T A;  4O4H E;  4IDQ A;  2LHN A;  1WYC A;  3E22 E;  2LSI A;  5KDM C;  3L39 A;  3U78 A;  3KVB A;  3ZCJ A;  2CHO A;  3ZJ2 A;  3T8O A;  3UQ4 A;  5HXE A;  3PUZ F;  4U7I A;  4EOZ B;  4AKG A;  3BQK A;  1KK7 A;  1N32 T;  1QUU A;  5AQM B;  3HR0 A;  1FJG T;  4UVB B;  4LMJ A;  5LMU T;  3C50 A;  3ZLI A;  2PJQ A;  2V7I A;  3CX6 B;  1Y64 B;  5LOV E;  3KV6 A;  4UR9 A;  5FYM A;  5JRC A;  4EV6 A;  4I50 E;  1UUR A;  2WDR A;  3J9X 1;  1JNR A;  1FMW A;  1J5W A;  2ODV A;  3TLS A;  3D0T A;  1NEN A;  2M6B A;  3LK4 2;  1WRD A;  2CWY A;  3ETV A;  2VQE T;  3UU4 A;  4E7S A;  3AB3 B;  3AE6 A;  1LRZ A;  3RX6 A;  4NPP A;  2GK9 A;  4JV5 T;  4X64 T;  4DR2 T;  4CZZ B;  3B57 A;  1US7 B;  4DR5 T;  2XQA A;  2J47 A;  1OED B;  1BR4 A;  2LSK A;  3SRZ A;  4ZOL E;  2X9H A;  2WCA A;  5AQI B;  2D9D A;  5JR9 B;  4IST A;  3S4U A;  3AEC A;  3QNU A;  2LHR A;  4I43 B;  2YU2 A;  2K3W A;  3RGL A;  3AE2 A;  3AEA A;  4MAL A;  3UU6 A;  3SFE A;  4DR6 T;  4UEM A;  2MYS A;  4A98 A;  2CLY C;  3K3Q C;  3EI0 A;  4PNI A;  3IEE A;  5AQL B;  4P1N A;  4O4L E;  3N9O A;  1J5E T;  4IIJ E;  2X9W A;  4XZC A;  3K1S A;  3RI5 A;  2ZM2 A;  2VK9 A;  3KVA A;  2XQ7 A;  2LLY A;  4DV5 T;  2XUE A;  1UGO A;  3RQW A;  4DV3 T;  2VKD A;  4P0B A;  3ZC0 A;  4HKA A;  4EAH A;  4EEB A;  5DAB A;  1UUS A;  2BG9 B;  3AEG A;  2YOE A;  4B3M T;  4P09 A;  1EZ3 A;  4L5G A;  2UXB T;  2NW8 A;  5LA6 E;  3PUA A;  2NTY A;  4CI2 B;  3MA9 A;  2C5J A;  4HTE A;  2CM0 A;  2HH7 A;  2KXP B;  5JR9 A;  1W0B A;  4HWH A;  4IE6 A;  2HPJ A;  3AA0 B;  3K8P C;  3RKG A;  3ZMV B;  4HFD A;  3UT5 E;  3M65 A;  2VB6 A;  2V8S V;  3RRC A;  5BMV E;  4GK0 E;  3ZYL A;  3LK3 B;  2JQK A;  5ABF B;  2WAU A;  5L4E A;  2YEV C;  2Q9Q B;  3AEB A;  2X67 A;  1X79 A;  2XAJ B;  4BA9 A;  4TX5 A;  1VOM A;  4P0A A;  3P4R A;  4MBQ A;  4ZEY A;  4ILA A;  4HGA A;  2LT3 A;  2UXX B;  5C2T A;  3JAD A;  5C8Y E;  4GKJ T;  4ERR A;  4WZX A;  3KBT A;  4HWD A;  3T1Y T;  2CXL A;  2VAS A;  5EZY E;  3AEF A;  4DV2 T;  2XM2 A;  3KDS E;  3HKD E;  3RIA A;  3VRB A;  2BG9 C;  2VVN A;  2R6G F;  4TWH A;  4CQI A;  1SA0 E;  4QH1 A;  2LJL A;  3C64 A;  1YD8 G;  2LM2 A;  5AQT B;  1NAF A;  2CXF A;  2E9X B;  4JI6 T;  2LEH A;  5JVD E;  3RYF E;  3NWI A;  4LF7 T;  1I94 T;  4YY3 T;  5JDF A;  3AE9 A;  4B3R T;  2PTF A;  2IW5 B;  5ABF A;  2BZB A;  2UXN B;  2LOP A;  4ZHQ E;  3MK7 C;  2Q9Q C;  2YDS A;  3BK9 A;  4IHJ E;  4HFH A;  3WAJ A;  4Z90 A;  3EAB A;  5CA0 E;  5HEG A;  5JTG A;  4KP3 C;  3AAE B;  2WS3 A;  2VVS A;  2L8K A;  3UQ7 A;  2LSJ A;  2WZI A;  4IDO A;  2XZE A;  3K3O A;  5LG4 A;  2XJ7 A;  5L3B B;  3BQI A;  1IAP A;  4PJN A;  2IAK A;  2ZM0 A;  3AE1 A;  3RIF A;  2W63 A;  3IHR A;  3GN5 A;  3G06 A;  4OK0 A;  3KV4 A;  3TLV A;  1HR0 T;  2UXC T;  4EZH A;  4H9R C;  2B76 A;  2E9X A;  1HX8 A;  1HNX T;  1S35 A;  2LKH A;  2ES0 A;  4WYV A;  3VKH A;  3PUG A;  2Y48 B;  3CWZ B;  4TV9 E;  1V9D A;  1IBL T;  5FY1 A;  2N1G A;  3RC3 A;  2IDO B;  1FMV A;  2LSG A;  3F2E A;  4YTP A;  5J2T E;  1OED E;  4I4T E;  4IRE A;  1LVF A;  3OJA A;  4CN6 A;  5E0O A;  3P7I A;  3IBP A;  4UV8 B;  2CEA A;  3UU5 A;  2CWO A;  2XQ9 A;  4JBW F;  4C91 A;  2XQ6 A;  3H37 A;  4HWC A;  5AQP B;  3UU3 A;  2E8I A;  2F4V T;  4TV8 E;  4UVC B;  5CGM A;  5H6Q B;  3C4W A;  1T98 A;  2N9D A;  4PJL A;  2PFV A;  4EED A;  1HCI A;  1CUN A;  1X9B A;  3IF8 B;  4DV1 T;  3RYH E;  4HWF A;  5DQW A;  3DTO A;  3HL6 A;  2VKJ A;  3CVR A;  4ZI3 C;  2WDV A;  5AQV B;  3AAI A;  3NVO A;  4DMV A;  2WSS V;  1W09 A;  4U33 A;  3AVR A;  2IC6 A;  5JDL A;  4EB6 E;  1KNR A;  2JPF A;  4O2B E;  1NEK A;  4JI8 T;  2BG9 E;  5AQR B;  3MZK B;  3AVS A;  2LRK A;  4G63 A;  2BDE A;  2QGS A;  1N34 T;  4E7Z A;  1HFA A;  2W66 A;  3RC8 A;  3Q5E A;  3UFG A;  1G73 A;  3ESL A;  4HEA A;  3UUM A;  4UXN B;  1Z8U A;  3PUR A;  5EK2 A;  3F31 A;  2H7V C;  4JI1 T;  2WWV A;  1N36 T;  1WLX A;  3Q5D A;  2UUB T;  5AQK B;  5DQV A;  1KF6 A;  4DID B;  4F8H A;  3PUY F;  4TNW A;  2CMR A;  2L9Q A;  1MIW A;  2SPC A;  4H9P C;  1OWA A;  3LSV A;  3CX7 B;  2N2N A;  3HA4 A;  4YTN A;  4PK6 A;  5JRC B;  2WU2 A;  4B3S T; 
#chains in the Genus database with same CATH homology
 1VCS A;  3ONJ A;  3ONL C;  2QYW A;  2V8S V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...