2QYWA

Crystal structure of mouse vti1b habc domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
MAASAASSEHFEKLHEIFRGLLEDLQGVPERLLGTAGTEEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle transport through interaction with t-SNAREs 1B homol
publication title A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport, endocytosis
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 2qywA00
2QYWA 3ONLC 3ONJA 1VCSA 2V8SV
chains in the Genus database with same CATH superfamily
1WR0A 4ISTA 4PFOA 4LF9T 2VB6A 4BAYB 2KSRA 1OEDB 4O8SA 2JPFA 5J2UE 1DU2A 3DP7A 4JUYA 3GMIA 2V8SV 5HWXA 5AQTB 4DMVA 4ILUA 2BVLA 1ZKEA 5LMNT 4AKIA 3PUZF 4JI7T 3BQLA 3PUVF 2NR4A 3A5XA 4GKKT 3FZFB 4DR2T 4HFDA 3I1AA 5L3FB 3QK6A 3AECA 4ZZBA 4GYSA 4L0RA 5JDMA 1FIOA 2LOSA 2K3WA 3UULA 1MMGA 3ZMTB 2W66A 4DV7T 4LF5T 1MMDA 3OYXA 2JIWA 2IW5B 5KMGP 1T98A 2CE7A 2XQ3A 4YT0A 2FJEA 3H3MA 3RRCA 3CX8B 3AEFA 3TKLB 4EZ4A 4YLHA 1N36T 5L4HA 1IBMT 2LHRA 2WZHA 4PJLA 4X66T 1HS7A 4H9PC 3ZYLA 5JR9C 2VKOA 4NXNT 4UXNB 2M6BA 5CB4E 1JNRA 4Z91A 2E2AA 2VASA 3PUWF 3AEGA 2LLYA 1E7PA 1KEYA 2H7OA 5J2TE 4LF8T 3AE1A 4JYAT 4YJ3E 4IDOA 5L2LA 2CA5A 2LM2A 3AAEB 2YU2A 5IWAT 4A56A 2FBWA 3PU3A 2Y6XA 4JBWF 2X0LB 4AKGA 2C5JA 1OEDC 4WNKA 3ZKRA 3RKOA 2CXFA 2J1DG 2PTFA 5AQKB 2CXDA 3C51A 2DL1A 5ABGA 5JDHA 2Z6EA 4ZOLE 1U5PA 3O1JA 3IEEA 4LMKA 4QWNB 3AE2A 4JEUB 3ZT5A 5JDNA 4FJOA 5AQNB 4AQFC 3AA7B 2J47A 2BZBA 2V6YB 2E5VA 4DUYT 4ADZA 2YN6A 5ETWA 4CQIA 2ODVA 4Z90A 5LJMA 4QHOA 3K1SA 2XQ6A 3EAMA 2XQYA 3C64A 3T1YT 4U3CA 2BS4A 4JEHB 4AKRB 2KXPB 2BS3A 3V5UA 2M67A 5EZYE 4HFBA 3RQUA 5H6QB 2WB5A 5CFBA 5HEOA 3ZN1B 4TWFA 2VKJA 2HPJA 2EHOC 1O3XA 5AFUL 4YTNA 2CLYB 2E8IA 2HH7A 2V5CA 4IL9A 2Q9QB 3AEEA 3O1IA 5DQWA 3RPUA 2E5LT 3IBPA 3ZC1A 3UU8A 2N9DA 1VOMA 2UUAT 5EK3A 2Q9QA 4C91A 1IJ5A 3AE8A 3ZSTA 3MJXA 3OBVE 4UV8B 2YDQA 2A72A 1VRBA 4F6RC 5IUXA 2XZEA 4HWCA 4C90A 4EYUA 4IDPA 2D0TA 4HTEA 3JC6D 1QSDA 4ZI2C 4O2AE 1MIWA 2XM1A 3BK9A 3BQIA 3I0OA 1MMNA 3BQKA 3KV6A 3TLWA 5ABEA 4UEMA 5AQHB 4TWDA 3HL6A 2KLQA 2Y48B 5HEUA 2OLTA 2W0GA 5TAOA 5ABHA 3CWZB 1HX1B 2YU1A 1M62A 4QX7B 5JVDE 3MACA 1IAPA 3WAKA 4HWIB 1G73A 3H3AA 2WZIA 4MALA 2VL8A 2VVNA 5FY1A 2MAWA 3C4ZA 2X67A 3W15B 4ZZCA 1NAFA 3GN5B 3D0TA 2LRLA 5F5WA 2IIUA 2YEVC 3F57A 3Q2MA 5C3JA 4LF6T 2LE8A 3FB2A 3GN5A 5AQLB 2CPTA 3ZJ1A 1D0ZA 5HCMA 3MKDA 2KZ7B 4JI0T 2LSGA 3NZQA 2DLRA 5IYZE 5JH7E 2N1GA 1HFAA 4TV9E 3UUNA 3EVYA 2IAKA 2LM9A 2DNXA 3P4RA 3AAAB 3AAIA 2CLYC 2H7VC 4PNIA 2NP9A 4G2AA 4ZS3A 5FL0A 2MBGA 4H63H 3RLFF 3AB3B 2X9YA 1HNXT 3PTRB 3AE6A 3X1DA 1D1BA 4P0BA 3RF1A 3IF8B 2KMFA 3UFEA 2JMHA 4QKNA 3ETVA 5AQIB 4QX8B 3ZPOA 4HWHA 2JRKA 3O1HA 3RHWA 4XAXB 1MIYA 3M65A 5AQQB 3EDVA 4DV4T 5HYAA 2BVMA 4DIDB 2JQ9A 4PK6A 3I9WA 3ZYMA 2BS2A 4YTMA 2XM2A 1Z0PA 4KBMB 5EK4A 5F8PA 1XMQT 3VKHA 3ZC0A 4JI8T 1D1CA 1X79A 2L3LA 2C5IT 2HPLA 2X66A 2JQQA 3P7IA 3CKDA 2PJQA 2PG8A 5FNVE 3VR8A 4ZI7E 2UUCT 4IDNA 5FVLA 4XBFB 2PFVA 2DWKA 3CVRA 2IC9A 2RP4A 3ZCIA 3HKCE 1Y01A 1UURA 4NPPA 2W67A 4DMWA 4OYJA 4Z8XA 4CN1A 3CQGB 4UF0B 2WY2A 2CCQA 4DBQA 2ACZA 2WU2A 2X0HA 3UQ7A 2I0MA 2BBJA 2BKNA 3TLVA 4UF0A 5C2TA 2K5BB 2NOXA 4P0AA 3F2EA 2DI4A 4B3TT 5HCJA 5JDQA 3Q5XA 1I6ZA 4AISA 4JV5T 2R6GF 2BBHA 3OPCA 3PE0A 1S94A 4DR3T 4ZEYA 2CBIA 4PK4A 5AQRB 3NBXX 2MOZA 3ZT7A 4YHHT 1LRZA 3PU8A 4OFZA 1D0XA 5CGMA 4WYVA 4X62T 3J7Yq 3FHNA 3A8YC 4A98A 2WMOA 5KDMC 4O4IE 3T8OA 3GA8A 2XSAA 2E9XD 3Q5EA 2VURA 1ZEEA 1VCTA 5HXSA 2ZMAA 5KXJA 3WAJA 3ETUA 4GKJT 2H88A 3Q5WA 5AQJB 1WLXA 4B6XA 3ZMVB 2M6IA 3VRBA 1YKEB 3CK6A 3LK2B 2IMLA 2YOEA 5JREA 3QC9A 2VQET 3WI3A 2X9HA 5FP3A 2UXCT 5LJNA 4NIQA 1QUUA 5LBQB 2KINB 3PURA 3UU6A 3AA0B 3FZKB 3HKBE 3EUHA 2CXLA 4H63V 4EB6E 4CXXA 3JCFA 5JQGE 4PK5A 2AE9A 5HXEA 1L0VA 5AQFB 3GWHA 2AXDS 4TUYE 4E7SA 5L3CB 2WCAA 5FYMA 4TN7B 3EI0A 3ANWA 4OX9T 3AXJB 4HFCA 2CM0A 2KWHA 2XAFB 3KV9A 4CN6A 1MIVA 3RYFE 1SE7A 3NZPA 3AXJA 2LSJA 2LKGA 3MK7C 1US7B 1J5WA 3T1HT 1BR1A 4CN4A 1HF8A 4MBQA 3EABA 3RX6A 3PV0F 5FY7A 2CHNA 2XQ5A 5LHIB 3Q9DA 3E22E 3UUBA 3U78A 5JRCA 1KK7A 2K48A 3CQXC 1E2AA 5LP6E 1KF6A 1EZ3A 3C4WA 2BKPA 5AQPB 4YSXA 2BG9A 3KFWX 3MZKB 4EAHA 2NTYA 1W0BA 3RGLA 3HI2A 3RYIE 3MA9A 3RRWA 1UX5A 5JTGA 1ZP0A 3L3PA 2V26A 2UU9T 5JDLA 3N5LA 1YD8G 4GIWA 4JI3T 2H89A 4ZS2A 3PUYF 5M4YA 2LSKA 4DR5T 1YKHB 2A9UA 2QA7A 4ERRA 1XWMA 4HEAA 5FXZA 3LG7A 4CXWA 5LGTB 4U7YA 2LOPA 1OWAA 3ZYKA 2XAQB 4JI1T 1HR0T 2LEHA 1WFDA 3R84B 4XZCA 2D0UA 2WS3A 2WM9A 1VCSA 4U72A 3LSVA 3SFDA 4H9SE 2FJAA 3RKGA 2V7KA 2XAGB 3JAEA 3RIFA 2DCFA 4H9QC 3IHRA 4DUZT 3I9YA 1T8BA 4HKAA 3ZJ2A 2D2SA 3SS1A 4F8HA 3CQCB 2XUEA 2XSBA 3QB5A 5J0ZA 5LGNB 3KVAA 4AI6A 2JMKA 2EHOD 5LOVE 3FZLB 1M7KA 1QLBA 3UQ4A 4YXDA 1HNWT 2IDOB 4LMJA 4DNDA 5AQGB 4K0KT 5JDGA 4AKHA 4UELA 1U4QA 3RC3A 4PFPA 2XPKA 3B5MA 1IZNB 4UIGA 4DR6T 1ZHCA 2JQKA 2I6HA 4A5XA 2XAHB 1W09A 3KV4A 4QXCB 5AQVB 3P4QA 4K0UA 3HR0A 4ZI2D 2NW8A 5HXCA 3O4XE 4I55E 2UXDT 4YSZA 3LK3B 3P4WA 3HKDE 5H6RB 3N9QA 3UUXB 4CI3B 1XNRT 5FL1A 1ZOYA 4QH4A 2X51A 5E0OA 3LBXA 4YFSA 3N9LA 2CRBA 1S35A 4AQYT 3SOLA 4I50E 2MYSA 2YKSA 2LKHA 4J2CA 3RIUA 3AA6B 1GQEA 2X9XA 3K3OA 3RYHE 3NKZA 3PJAJ 1XDPA 2FUPA 3LK42 4DBRA 4EZHA 2W61A 1OEDE 2Q9QC 4ISSA 4BA9A 4GK5E 3OYZA 1MMAA 4HWDA 4TV8E 2LJLA 1LVKA 2PBIA 3S4UA 5CJ5A 4P09A 1FJGT 2BDEA 3K8PC 5LG3A 2E9XB 5FXXA 3AVSA 4ILCA 3ZSSA 1UCUA 4U2YA 5DQVA 4LF4T 3AVRA 1XNQT 4IHJE 3UTKA 1FMVA 2E9XA 2CEAA 3KBTA 5HEHA 4O2BE 5F3JA 3FBLA 2BKOA 4ZXLA 3F31A 3FZHB 3N9NA 2WU5A 4AKLA 3G06A 2D9DA 2C5KT 3K3QC 3VKGA 4WZXA 3DTOA 5AQSB 3C98B 5LNKA 5LXTE 4IL4A 4YHJA 2ZM0A 3K3NA 2J4GA 3PUSA 2CHOA 1SUMB 2VQFT 3KINB 3HA4A 4ZI3C 2C0SA 3N9PA 4WW0A 5LCYA 3AEDA 1WYBA 4O4HE 1HG5A 2ZM6T 1KNRA 2K9AA 1CUNA 4QXBB 4TWHA 4L9IA 1HG2A 2XY8B 2VWAA 2X68A 2W2UA 2CBJA 1BR4A 4IE6A 1Z8UA 1T7SA 3UU5A 4AXPA 2BG9E 3JAFA 4IGUA 4JI2T 4IDQA 3FZMB 3N9MA 1SHZC 5DABA 4GOUA 5FY0A 5A1LA 2WSSV 1B7TA 1W9RA 1UX4A 2WMNA 4B3MT 1T72A 3RC8A 2OV9A 2XHEB 4LMLA 2P9BA 2V6XA 3NVOA 4OYKA 2ACXA 3KBUA 1LVFA 3AA1B 4E7ZA 2XASB 4UV9B 2VL0A 2QYWA 4KHZF 2CMRA 4V1Av 1AJ3A 1N32T 2X0YA 2XAJB 5FXWA 4YJ2E 5JR9B 3ZT6A 3OVUA 1KNPA 4CI2B 4H9NC 4DV2T 3PUXF 5JR9A 3ABVA 2QVAA 3JADA 5CA1E 4HE8A 2CWYA 4DR4T 1WCRA 3UU3A 5FMNA 1KFYA 1N34T 3N2GE 2VKDA 1HNZT 1V9DA 4DR7T 5HAXA 4PAGA 5J1GA 2B76A 3AEBA 3NRXA 1IJ6A 2GK9A 1CHUA 3P4SA 4QH5A 3E0ZA 2V7LA 3CX7B 3N9OA 2J62A 1OEDA 4EGWA 4X64T 1HTJF 5IHYA 4A97A 2D5UA 4JI4T 3EHZA 3VR9A 2V1DB 3QOFA 4EV6A 4UVCB 3U3IA 3ANWB 1KNZA 4TNWA 4AQFA 4HGAA 4HFEA 4AIUA 5FVKA 5C8YE 5LHGB 3LDQB 2WDVA 3A7MA 4HFVA 2XJ7A 3PUAA 4P1NA 2DWGA 4KUMB 1IBLT 3P4PA 3EDUA 3B57A 3PJAA 2ES0A 4TZ4C 4OK0A 5FXVA 1UGOA 4HFIA 2KNDA 1R8IA 4U74A 3AEAA 2EHOB 3I0QA 4LFAT 3IA3A 4KX6A 1Y64B 4IE7A 2XQ7A 4IIJE 5BMVE 4IREA 2EHOA 2ODUA 5JRCB 3FXEB 4YY3T 1IBKT 2RPAA 2V7JA 3ZEFB 2B1EA 1SA0E 1WYCA 1X9BA 3UUMA 1I94T 1XDOA 2BG9B 4YTPA 3LJCA 4FI5A 3L39A 4U2ZA 3C50A 3H37A 2YDRA 2LSYA 1D1AA 2Y8DA 2YINA 2NWBA 3AE3A 3PUGA 4X65T 3HKEE 1OXZA 5FKYA 3ESLA 1BR2A 5LHHB 4PJMA 4G63A 2W62A 4O4LE 2XQ9A 2KT9A 4EXTA 2NTXA 3SWHA 5HEJA 4L5GA 5HXRA 4BJNA 1YXRA 3OKQA 4OHFA 2UXNB 2IUBA 1XZYA 2WQYA 1E1HB 4TX5A 3RI5A 4PW8A 2CWOA 2YDSA 3KV5A 2QGSA 3ZMSB 3KVBA 2W63A 2V6YA 1MNDA 5LA6E 1NENA 5AQMB 3KDSE 3ONXA 2W4XA 3ONJA 3NRYA 4X1IE 4EIWA 2OA5A 4CZZB 4LF7T 4LFBT 4IT4A 5EK2A 4B3ST 1WRDA 4IE5A 5GONE 4ZHQE 4WBOA 4MLKA 4UVBB 4KMCA 4ILAA 3JC6C 2I59A 2VKHA 4X1YE 4B3RT 4DV3T 4DVDA 2SPCA 3PDYA 1YQ3A 4KHPT 5L3GB 1HX8A 2WDQA 5L47A 2BG9C 2LHNA 3RIAA 4U7IA 3FBZA 4X5TA 2N2NA 2WBLA 3RH3A 3NWIA 2ZM8A 4HFHA 4ILBA 3O9XA 5AQUB 2YK0A 4M1PA 1J5ET 2ZM2A 4U31A 1FEWA 4YSYA 2V7MA 2XQ4A 2JJ9A 1JNZA 2W00A 4BJMA 4DR1T 2L8KA 3N2OA 4X1KE 1FMWA 3AE4A 5L3EB 2A2FX 3M3ZB 1XMOT 3CMLA 3LBXB 2G0UA 4NUVA 2K24A 3Q5DA 4N78D 3AE5A 5L3DB 1UK5A 2HN1A 4DO0A 1NWMX 3FXDB 4CXYA 4IE4A 2X9WA 3ZN0B 5BR8T 2WAUA 2XQAA 3V5SA 4ASKA 4PJNA 2VVSA 3P8CD 1LKXA 2NW9A 2RA1A 5ABFB 3AE9A 3B13A 2MPKA 3ZMUB 3R6NA 4HN9A 1N33T 3TLUA 5ABFA 3CX6B 3J9X1 4AQGA 2FJBA 4O4JE 1WR6A 4JI5T 2UXXB 2IHR1 1NEKA 3MXZA 2JQHA 4DV6T 4Q25A 3QB5K 4EYYR 4TNVA 4UVAB 5HEGA 4UR9A 3QNUA 4MHCA 3VRAA 5CA0E 2Q9QD 5L4EA 2WP9A 1J1JA 4IDZA 2LSIA 5LB7B 3TLTA 1HCIA 3AE7A 2HHHT 4DV1T 3QUJA 4GK0E 5LG4A 3ONLC 3TLSA 5LGUB 3PUQA 1YQ4A 3ZMZB 1UUSA 4CI1B 4U33A 3UT5E 4I4TE 4QH1A 3SRZA 3ZCJA 3CIRA 5LMUT 3RQWA 4H9RC 2WWVA 4I43B 3RYCE 3SFEA 2QRXA 5KX5E 4X20E 2LRKA 5DJQC 3UFGA 5AQOB 2V5DA 5JDFA 4WBNE 4EEDA 3RIUC 4GYRA 5LYJE 5HXHA 4DV5T 3DJBA 3P50A 1G8XA 1D0YA 3LFMA 1H7CA 4ANJA 4EEBA 2A3DA 2VK9A 3E08A 4H9OC 4JLEA 2NW7A 2IC6A 4QXHB 4LFCT 4ZI3D 2ZLYA 3L09A 3OJAA 2L9QA 2KWIB 2UUBT 1W0AA 4DV0T 4IE0A 2H3RA 4HWFA 2XTLA 3C4XA 3L8RA 2UXBT 2DHRA 4NUUA 2XQ8A 2WWUA 2V7IA 2F4VT 3CPZA 4KI0F 1BR0A 4NXMT 2E9XC 3VU7H 4PJJA 3OTOT 4MFRA 2HN2A 5L3BB 2LT3A 1YW0A 1MNEA 3UU4A 4EOZB 5ADXL 4COFA 3VHLA 3ZLIA 5LBMA 4KP3C 1ZV4X 4JI6T 4I0UA 5HWYA 2MTQA 2FJDA 2WDRA 3N2KE
chains in the Genus database with same CATH topology
2QYWA 3ONLC 3ONJA 1VCSA 2V8SV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYW A;  3ONL C;  3ONJ A;  1VCS A;  2V8S V; 
#chains in the Genus database with same CATH topology
 1WR0 A;  4IST A;  4PFO A;  4LF9 T;  2VB6 A;  4BAY B;  2KSR A;  1OED B;  4O8S A;  2JPF A;  5J2U E;  1DU2 A;  3DP7 A;  4JUY A;  3GMI A;  2V8S V;  5HWX A;  5AQT B;  4DMV A;  4ILU A;  2BVL A;  1ZKE A;  5LMN T;  4AKI A;  3PUZ F;  4JI7 T;  3BQL A;  3PUV F;  2NR4 A;  3A5X A;  4GKK T;  3FZF B;  4DR2 T;  4HFD A;  3I1A A;  5L3F B;  3QK6 A;  3AEC A;  4ZZB A;  4GYS A;  4L0R A;  5JDM A;  1FIO A;  2LOS A;  2K3W A;  3UUL A;  1MMG A;  3ZMT B;  2W66 A;  4DV7 T;  4LF5 T;  1MMD A;  3OYX A;  2JIW A;  2IW5 B;  5KMG P;  1T98 A;  2CE7 A;  2XQ3 A;  4YT0 A;  2FJE A;  3H3M A;  3RRC A;  3CX8 B;  3AEF A;  3TKL B;  4EZ4 A;  4YLH A;  1N36 T;  5L4H A;  1IBM T;  2LHR A;  2WZH A;  4PJL A;  4X66 T;  1HS7 A;  4H9P C;  3ZYL A;  5JR9 C;  2VKO A;  4NXN T;  4UXN B;  2M6B A;  5CB4 E;  1JNR A;  4Z91 A;  2E2A A;  2VAS A;  3PUW F;  3AEG A;  2LLY A;  1E7P A;  1KEY A;  2H7O A;  5J2T E;  4LF8 T;  3AE1 A;  4JYA T;  4YJ3 E;  4IDO A;  5L2L A;  2CA5 A;  2LM2 A;  3AAE B;  2YU2 A;  5IWA T;  4A56 A;  2FBW A;  3PU3 A;  2Y6X A;  4JBW F;  2X0L B;  4AKG A;  2C5J A;  1OED C;  4WNK A;  3ZKR A;  3RKO A;  2CXF A;  2J1D G;  2PTF A;  5AQK B;  2CXD A;  3C51 A;  2DL1 A;  5ABG A;  5JDH A;  2Z6E A;  4ZOL E;  1U5P A;  3O1J A;  3IEE A;  4LMK A;  4QWN B;  3AE2 A;  4JEU B;  3ZT5 A;  5JDN A;  4FJO A;  5AQN B;  4AQF C;  3AA7 B;  2J47 A;  2BZB A;  2V6Y B;  2E5V A;  4DUY T;  4ADZ A;  2YN6 A;  5ETW A;  4CQI A;  2ODV A;  4Z90 A;  5LJM A;  4QHO A;  3K1S A;  2XQ6 A;  3EAM A;  2XQY A;  3C64 A;  3T1Y T;  4U3C A;  2BS4 A;  4JEH B;  4AKR B;  2KXP B;  2BS3 A;  3V5U A;  2M67 A;  5EZY E;  4HFB A;  3RQU A;  5H6Q B;  2WB5 A;  5CFB A;  5HEO A;  3ZN1 B;  4TWF A;  2VKJ A;  2HPJ A;  2EHO C;  1O3X A;  5AFU L;  4YTN A;  2CLY B;  2E8I A;  2HH7 A;  2V5C A;  4IL9 A;  2Q9Q B;  3AEE A;  3O1I A;  5DQW A;  3RPU A;  2E5L T;  3IBP A;  3ZC1 A;  3UU8 A;  2N9D A;  1VOM A;  2UUA T;  5EK3 A;  2Q9Q A;  4C91 A;  1IJ5 A;  3AE8 A;  3ZST A;  3MJX A;  3OBV E;  4UV8 B;  2YDQ A;  2A72 A;  1VRB A;  4F6R C;  5IUX A;  2XZE A;  4HWC A;  4C90 A;  4EYU A;  4IDP A;  2D0T A;  4HTE A;  3JC6 D;  1QSD A;  4ZI2 C;  4O2A E;  1MIW A;  2XM1 A;  3BK9 A;  3BQI A;  3I0O A;  1MMN A;  3BQK A;  3KV6 A;  3TLW A;  5ABE A;  4UEM A;  5AQH B;  4TWD A;  3HL6 A;  2KLQ A;  2Y48 B;  5HEU A;  2OLT A;  2W0G A;  5TAO A;  5ABH A;  3CWZ B;  1HX1 B;  2YU1 A;  1M62 A;  4QX7 B;  5JVD E;  3MAC A;  1IAP A;  3WAK A;  4HWI B;  1G73 A;  3H3A A;  2WZI A;  4MAL A;  2VL8 A;  2VVN A;  5FY1 A;  2MAW A;  3C4Z A;  2X67 A;  3W15 B;  4ZZC A;  1NAF A;  3GN5 B;  3D0T A;  2LRL A;  5F5W A;  2IIU A;  2YEV C;  3F57 A;  3Q2M A;  5C3J A;  4LF6 T;  2LE8 A;  3FB2 A;  3GN5 A;  5AQL B;  2CPT A;  3ZJ1 A;  1D0Z A;  5HCM A;  3MKD A;  2KZ7 B;  4JI0 T;  2LSG A;  3NZQ A;  2DLR A;  5IYZ E;  5JH7 E;  2N1G A;  1HFA A;  4TV9 E;  3UUN A;  3EVY A;  2IAK A;  2LM9 A;  2DNX A;  3P4R A;  3AAA B;  3AAI A;  2CLY C;  2H7V C;  4PNI A;  2NP9 A;  4G2A A;  4ZS3 A;  5FL0 A;  2MBG A;  4H63 H;  3RLF F;  3AB3 B;  2X9Y A;  1HNX T;  3PTR B;  3AE6 A;  3X1D A;  1D1B A;  4P0B A;  3RF1 A;  3IF8 B;  2KMF A;  3UFE A;  2JMH A;  4QKN A;  3ETV A;  5AQI B;  4QX8 B;  3ZPO A;  4HWH A;  2JRK A;  3O1H A;  3RHW A;  4XAX B;  1MIY A;  3M65 A;  5AQQ B;  3EDV A;  4DV4 T;  5HYA A;  2BVM A;  4DID B;  2JQ9 A;  4PK6 A;  3I9W A;  3ZYM A;  2BS2 A;  4YTM A;  2XM2 A;  1Z0P A;  4KBM B;  5EK4 A;  5F8P A;  1XMQ T;  3VKH A;  3ZC0 A;  4JI8 T;  1D1C A;  1X79 A;  2L3L A;  2C5I T;  2HPL A;  2X66 A;  2JQQ A;  3P7I A;  3CKD A;  2PJQ A;  2PG8 A;  5FNV E;  3VR8 A;  4ZI7 E;  2UUC T;  4IDN A;  5FVL A;  4XBF B;  2PFV A;  2DWK A;  3CVR A;  2IC9 A;  2RP4 A;  3ZCI A;  3HKC E;  1Y01 A;  1UUR A;  4NPP A;  2W67 A;  4DMW A;  4OYJ A;  4Z8X A;  4CN1 A;  3CQG B;  4UF0 B;  2WY2 A;  2CCQ A;  4DBQ A;  2ACZ A;  2WU2 A;  2X0H A;  3UQ7 A;  2I0M A;  2BBJ A;  2BKN A;  3TLV A;  4UF0 A;  5C2T A;  2K5B B;  2NOX A;  4P0A A;  3F2E A;  2DI4 A;  4B3T T;  5HCJ A;  5JDQ A;  3Q5X A;  1I6Z A;  4AIS A;  4JV5 T;  2R6G F;  2BBH A;  3OPC A;  3PE0 A;  1S94 A;  4DR3 T;  4ZEY A;  2CBI A;  4PK4 A;  5AQR B;  3NBX X;  2MOZ A;  3ZT7 A;  4YHH T;  1LRZ A;  3PU8 A;  4OFZ A;  1D0X A;  5CGM A;  4WYV A;  4X62 T;  3J7Y q;  3FHN A;  3A8Y C;  4A98 A;  2WMO A;  5KDM C;  4O4I E;  3T8O A;  3GA8 A;  2XSA A;  2E9X D;  3Q5E A;  2VUR A;  1ZEE A;  1VCT A;  5HXS A;  2ZMA A;  5KXJ A;  3WAJ A;  3ETU A;  4GKJ T;  2H88 A;  3Q5W A;  5AQJ B;  1WLX A;  4B6X A;  3ZMV B;  2M6I A;  3VRB A;  1YKE B;  3CK6 A;  3LK2 B;  2IML A;  2YOE A;  5JRE A;  3QC9 A;  2VQE T;  3WI3 A;  2X9H A;  5FP3 A;  2UXC T;  5LJN A;  4NIQ A;  1QUU A;  5LBQ B;  2KIN B;  3PUR A;  3UU6 A;  3AA0 B;  3FZK B;  3HKB E;  3EUH A;  2CXL A;  4H63 V;  4EB6 E;  4CXX A;  3JCF A;  5JQG E;  4PK5 A;  2AE9 A;  5HXE A;  1L0V A;  5AQF B;  3GWH A;  2AXD S;  4TUY E;  4E7S A;  5L3C B;  2WCA A;  5FYM A;  4TN7 B;  3EI0 A;  3ANW A;  4OX9 T;  3AXJ B;  4HFC A;  2CM0 A;  2KWH A;  2XAF B;  3KV9 A;  4CN6 A;  1MIV A;  3RYF E;  1SE7 A;  3NZP A;  3AXJ A;  2LSJ A;  2LKG A;  3MK7 C;  1US7 B;  1J5W A;  3T1H T;  1BR1 A;  4CN4 A;  1HF8 A;  4MBQ A;  3EAB A;  3RX6 A;  3PV0 F;  5FY7 A;  2CHN A;  2XQ5 A;  5LHI B;  3Q9D A;  3E22 E;  3UUB A;  3U78 A;  5JRC A;  1KK7 A;  2K48 A;  3CQX C;  1E2A A;  5LP6 E;  1KF6 A;  1EZ3 A;  3C4W A;  2BKP A;  5AQP B;  4YSX A;  2BG9 A;  3KFW X;  3MZK B;  4EAH A;  2NTY A;  1W0B A;  3RGL A;  3HI2 A;  3RYI E;  3MA9 A;  3RRW A;  1UX5 A;  5JTG A;  1ZP0 A;  3L3P A;  2V26 A;  2UU9 T;  5JDL A;  3N5L A;  1YD8 G;  4GIW A;  4JI3 T;  2H89 A;  4ZS2 A;  3PUY F;  5M4Y A;  2LSK A;  4DR5 T;  1YKH B;  2A9U A;  2QA7 A;  4ERR A;  1XWM A;  4HEA A;  5FXZ A;  3LG7 A;  4CXW A;  5LGT B;  4U7Y A;  2LOP A;  1OWA A;  3ZYK A;  2XAQ B;  4JI1 T;  1HR0 T;  2LEH A;  1WFD A;  3R84 B;  4XZC A;  2D0U A;  2WS3 A;  2WM9 A;  1VCS A;  4U72 A;  3LSV A;  3SFD A;  4H9S E;  2FJA A;  3RKG A;  2V7K A;  2XAG B;  3JAE A;  3RIF A;  2DCF A;  4H9Q C;  3IHR A;  4DUZ T;  3I9Y A;  1T8B A;  4HKA A;  3ZJ2 A;  2D2S A;  3SS1 A;  4F8H A;  3CQC B;  2XUE A;  2XSB A;  3QB5 A;  5J0Z A;  5LGN B;  3KVA A;  4AI6 A;  2JMK A;  2EHO D;  5LOV E;  3FZL B;  1M7K A;  1QLB A;  3UQ4 A;  4YXD A;  1HNW T;  2IDO B;  4LMJ A;  4DND A;  5AQG B;  4K0K T;  5JDG A;  4AKH A;  4UEL A;  1U4Q A;  3RC3 A;  4PFP A;  2XPK A;  3B5M A;  1IZN B;  4UIG A;  4DR6 T;  1ZHC A;  2JQK A;  2I6H A;  4A5X A;  2XAH B;  1W09 A;  3KV4 A;  4QXC B;  5AQV B;  3P4Q A;  4K0U A;  3HR0 A;  4ZI2 D;  2NW8 A;  5HXC A;  3O4X E;  4I55 E;  2UXD T;  4YSZ A;  3LK3 B;  3P4W A;  3HKD E;  5H6R B;  3N9Q A;  3UUX B;  4CI3 B;  1XNR T;  5FL1 A;  1ZOY A;  4QH4 A;  2X51 A;  5E0O A;  3LBX A;  4YFS A;  3N9L A;  2CRB A;  1S35 A;  4AQY T;  3SOL A;  4I50 E;  2MYS A;  2YKS A;  2LKH A;  4J2C A;  3RIU A;  3AA6 B;  1GQE A;  2X9X A;  3K3O A;  3RYH E;  3NKZ A;  3PJA J;  1XDP A;  2FUP A;  3LK4 2;  4DBR A;  4EZH A;  2W61 A;  1OED E;  2Q9Q C;  4ISS A;  4BA9 A;  4GK5 E;  3OYZ A;  1MMA A;  4HWD A;  4TV8 E;  2LJL A;  1LVK A;  2PBI A;  3S4U A;  5CJ5 A;  4P09 A;  1FJG T;  2BDE A;  3K8P C;  5LG3 A;  2E9X B;  5FXX A;  3AVS A;  4ILC A;  3ZSS A;  1UCU A;  4U2Y A;  5DQV A;  4LF4 T;  3AVR A;  1XNQ T;  4IHJ E;  3UTK A;  1FMV A;  2E9X A;  2CEA A;  3KBT A;  5HEH A;  4O2B E;  5F3J A;  3FBL A;  2BKO A;  4ZXL A;  3F31 A;  3FZH B;  3N9N A;  2WU5 A;  4AKL A;  3G06 A;  2D9D A;  2C5K T;  3K3Q C;  3VKG A;  4WZX A;  3DTO A;  5AQS B;  3C98 B;  5LNK A;  5LXT E;  4IL4 A;  4YHJ A;  2ZM0 A;  3K3N A;  2J4G A;  3PUS A;  2CHO A;  1SUM B;  2VQF T;  3KIN B;  3HA4 A;  4ZI3 C;  2C0S A;  3N9P A;  4WW0 A;  5LCY A;  3AED A;  1WYB A;  4O4H E;  1HG5 A;  2ZM6 T;  1KNR A;  2K9A A;  1CUN A;  4QXB B;  4TWH A;  4L9I A;  1HG2 A;  2XY8 B;  2VWA A;  2X68 A;  2W2U A;  2CBJ A;  1BR4 A;  4IE6 A;  1Z8U A;  1T7S A;  3UU5 A;  4AXP A;  2BG9 E;  3JAF A;  4IGU A;  4JI2 T;  4IDQ A;  3FZM B;  3N9M A;  1SHZ C;  5DAB A;  4GOU A;  5FY0 A;  5A1L A;  2WSS V;  1B7T A;  1W9R A;  1UX4 A;  2WMN A;  4B3M T;  1T72 A;  3RC8 A;  2OV9 A;  2XHE B;  4LML A;  2P9B A;  2V6X A;  3NVO A;  4OYK A;  2ACX A;  3KBU A;  1LVF A;  3AA1 B;  4E7Z A;  2XAS B;  4UV9 B;  2VL0 A;  2QYW A;  4KHZ F;  2CMR A;  4V1A v;  1AJ3 A;  1N32 T;  2X0Y A;  2XAJ B;  5FXW A;  4YJ2 E;  5JR9 B;  3ZT6 A;  3OVU A;  1KNP A;  4CI2 B;  4H9N C;  4DV2 T;  3PUX F;  5JR9 A;  3ABV A;  2QVA A;  3JAD A;  5CA1 E;  4HE8 A;  2CWY A;  4DR4 T;  1WCR A;  3UU3 A;  5FMN A;  1KFY A;  1N34 T;  3N2G E;  2VKD A;  1HNZ T;  1V9D A;  4DR7 T;  5HAX A;  4PAG A;  5J1G A;  2B76 A;  3AEB A;  3NRX A;  1IJ6 A;  2GK9 A;  1CHU A;  3P4S A;  4QH5 A;  3E0Z A;  2V7L A;  3CX7 B;  3N9O A;  2J62 A;  1OED A;  4EGW A;  4X64 T;  1HTJ F;  5IHY A;  4A97 A;  2D5U A;  4JI4 T;  3EHZ A;  3VR9 A;  2V1D B;  3QOF A;  4EV6 A;  4UVC B;  3U3I A;  3ANW B;  1KNZ A;  4TNW A;  4AQF A;  4HGA A;  4HFE A;  4AIU A;  5FVK A;  5C8Y E;  5LHG B;  3LDQ B;  2WDV A;  3A7M A;  4HFV A;  2XJ7 A;  3PUA A;  4P1N A;  2DWG A;  4KUM B;  1IBL T;  3P4P A;  3EDU A;  3B57 A;  3PJA A;  2ES0 A;  4TZ4 C;  4OK0 A;  5FXV A;  1UGO A;  4HFI A;  2KND A;  1R8I A;  4U74 A;  3AEA A;  2EHO B;  3I0Q A;  4LFA T;  3IA3 A;  4KX6 A;  1Y64 B;  4IE7 A;  2XQ7 A;  4IIJ E;  5BMV E;  4IRE A;  2EHO A;  2ODU A;  5JRC B;  3FXE B;  4YY3 T;  1IBK T;  2RPA A;  2V7J A;  3ZEF B;  2B1E A;  1SA0 E;  1WYC A;  1X9B A;  3UUM A;  1I94 T;  1XDO A;  2BG9 B;  4YTP A;  3LJC A;  4FI5 A;  3L39 A;  4U2Z A;  3C50 A;  3H37 A;  2YDR A;  2LSY A;  1D1A A;  2Y8D A;  2YIN A;  2NWB A;  3AE3 A;  3PUG A;  4X65 T;  3HKE E;  1OXZ A;  5FKY A;  3ESL A;  1BR2 A;  5LHH B;  4PJM A;  4G63 A;  2W62 A;  4O4L E;  2XQ9 A;  2KT9 A;  4EXT A;  2NTX A;  3SWH A;  5HEJ A;  4L5G A;  5HXR A;  4BJN A;  1YXR A;  3OKQ A;  4OHF A;  2UXN B;  2IUB A;  1XZY A;  2WQY A;  1E1H B;  4TX5 A;  3RI5 A;  4PW8 A;  2CWO A;  2YDS A;  3KV5 A;  2QGS A;  3ZMS B;  3KVB A;  2W63 A;  2V6Y A;  1MND A;  5LA6 E;  1NEN A;  5AQM B;  3KDS E;  3ONX A;  2W4X A;  3ONJ A;  3NRY A;  4X1I E;  4EIW A;  2OA5 A;  4CZZ B;  4LF7 T;  4LFB T;  4IT4 A;  5EK2 A;  4B3S T;  1WRD A;  4IE5 A;  5GON E;  4ZHQ E;  4WBO A;  4MLK A;  4UVB B;  4KMC A;  4ILA A;  3JC6 C;  2I59 A;  2VKH A;  4X1Y E;  4B3R T;  4DV3 T;  4DVD A;  2SPC A;  3PDY A;  1YQ3 A;  4KHP T;  5L3G B;  1HX8 A;  2WDQ A;  5L47 A;  2BG9 C;  2LHN A;  3RIA A;  4U7I A;  3FBZ A;  4X5T A;  2N2N A;  2WBL A;  3RH3 A;  3NWI A;  2ZM8 A;  4HFH A;  4ILB A;  3O9X A;  5AQU B;  2YK0 A;  4M1P A;  1J5E T;  2ZM2 A;  4U31 A;  1FEW A;  4YSY A;  2V7M A;  2XQ4 A;  2JJ9 A;  1JNZ A;  2W00 A;  4BJM A;  4DR1 T;  2L8K A;  3N2O A;  4X1K E;  1FMW A;  3AE4 A;  5L3E B;  2A2F X;  3M3Z B;  1XMO T;  3CML A;  3LBX B;  2G0U A;  4NUV A;  2K24 A;  3Q5D A;  4N78 D;  3AE5 A;  5L3D B;  1UK5 A;  2HN1 A;  4DO0 A;  1NWM X;  3FXD B;  4CXY A;  4IE4 A;  2X9W A;  3ZN0 B;  5BR8 T;  2WAU A;  2XQA A;  3V5S A;  4ASK A;  4PJN A;  2VVS A;  3P8C D;  1LKX A;  2NW9 A;  2RA1 A;  5ABF B;  3AE9 A;  3B13 A;  2MPK A;  3ZMU B;  3R6N A;  4HN9 A;  1N33 T;  3TLU A;  5ABF A;  3CX6 B;  3J9X 1;  4AQG A;  2FJB A;  4O4J E;  1WR6 A;  4JI5 T;  2UXX B;  2IHR 1;  1NEK A;  3MXZ A;  2JQH A;  4DV6 T;  4Q25 A;  3QB5 K;  4EYY R;  4TNV A;  4UVA B;  5HEG A;  4UR9 A;  3QNU A;  4MHC A;  3VRA A;  5CA0 E;  2Q9Q D;  5L4E A;  2WP9 A;  1J1J A;  4IDZ A;  2LSI A;  5LB7 B;  3TLT A;  1HCI A;  3AE7 A;  2HHH T;  4DV1 T;  3QUJ A;  4GK0 E;  5LG4 A;  3ONL C;  3TLS A;  5LGU B;  3PUQ A;  1YQ4 A;  3ZMZ B;  1UUS A;  4CI1 B;  4U33 A;  3UT5 E;  4I4T E;  4QH1 A;  3SRZ A;  3ZCJ A;  3CIR A;  5LMU T;  3RQW A;  4H9R C;  2WWV A;  4I43 B;  3RYC E;  3SFE A;  2QRX A;  5KX5 E;  4X20 E;  2LRK A;  5DJQ C;  3UFG A;  5AQO B;  2V5D A;  5JDF A;  4WBN E;  4EED A;  3RIU C;  4GYR A;  5LYJ E;  5HXH A;  4DV5 T;  3DJB A;  3P50 A;  1G8X A;  1D0Y A;  3LFM A;  1H7C A;  4ANJ A;  4EEB A;  2A3D A;  2VK9 A;  3E08 A;  4H9O C;  4JLE A;  2NW7 A;  2IC6 A;  4QXH B;  4LFC T;  4ZI3 D;  2ZLY A;  3L09 A;  3OJA A;  2L9Q A;  2KWI B;  2UUB T;  1W0A A;  4DV0 T;  4IE0 A;  2H3R A;  4HWF A;  2XTL A;  3C4X A;  3L8R A;  2UXB T;  2DHR A;  4NUU A;  2XQ8 A;  2WWU A;  2V7I A;  2F4V T;  3CPZ A;  4KI0 F;  1BR0 A;  4NXM T;  2E9X C;  3VU7 H;  4PJJ A;  3OTO T;  4MFR A;  2HN2 A;  5L3B B;  2LT3 A;  1YW0 A;  1MNE A;  3UU4 A;  4EOZ B;  5ADX L;  4COF A;  3VHL A;  3ZLI A;  5LBM A;  4KP3 C;  1ZV4 X;  4JI6 T;  4I0U A;  5HWY A;  2MTQ A;  2FJD A;  2WDR A;  3N2K E; 
#chains in the Genus database with same CATH homology
 2QYW A;  3ONL C;  3ONJ A;  1VCS A;  2V8S V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...