4KBMB

Structure of the mtb card/rnap beta subunit b1-b2 domains complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
148
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETREQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit beta
publication title Structure of the Mtb CarD/RNAP beta-Lobes Complex Reveals the Molecular Basis of Interaction and Presents a Distinct DNA-Binding Domain for Mtb CarD.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 41
structure length 148
sequence length 159
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kbmB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kbmB01
4L5GA 2EYQA 4XAXB 4ILUA 4KMCA 4MFRA 4KBMB 2LT1A 2LT3A 2LT4A 2LQKA
chains in the Genus database with same CATH superfamily
4OFZA 1OZ3A 3QO3A 4MZPA 1I94T 4H9SE 1KJWA 2R57A 1YJWQ 5F8PA 3MEWA 4ZI3D 4O4HE 2KI7A 1HG5A 1C0MA 4Z89A 1ZSZB 3H3MA 2PNIA 4F14A 1WXTA 5LHIB 3B13A 3OYEA 2LC4A 2VQFT 2H8HA 8AT1B 1VQKQ 3P4SA 2I0NA 2Z0WA 4HKAA 3WAKA 3BY7A 5JR9A 1R8OB 2XHCA 1GXIE 2MMPA 1Q7YU 3JCMc 3HHTB 2DNUA 3CK6A 2AZVA 2CWOA 1UUEA 2XQ3A 5JRCA 2EKOA 5LJ5e 1WHGA 2XJ7A 5EK3A 2GF7A 4M75F 5KYYA 1VQNT 1WCRA 4YJ2E 5FL1A 3FHNA 1X6BA 4TNVA 4C5GA 2E6ZA 2WZIA 5KXJA 2K48A 1WHKA 4CC3A 3N9NA 3PTRB 2ZPGB 1FIOA 2K5BB 3FBLA 4M75B 4ZZCA 1S72Q 2DX1A 1SSHA 1JJ2A 4X9DA 4HWFA 2JM9A 5CAIA 3UU6A 2PTFA 3PUXF 3RGLA 2O9VA 2J62A 3KFWX 4QVZA 3HSBA 4UELA 2I59A 2W67A 1ABOA 2V1RA 4OVAA 2EHOD 1Q7YR 4M1PA 3S4UA 3CPFA 4DBFA 3JCMJ 3CCUQ 3ZL7C 2FJDA 2EJGA 4QQGA 3Q9DA 1LVKA 2V5CA 4QX8B 2DD5A 1QVGP 4U2ZA 3ONLC 3CMEA 3C4SA 4HE8A 3M0QA 1YCSB 2YRCA 5HXCA 4C8QF 2XG8D 3HL6A 2DCFA 1PM3A 3SEMA 2X9HA 2P4RA 3C4ZA 2Q9QA 4K0KT 2HQEA 2UU9T 4QH1A 3TLVA 3ZEHA 4A4GA 5GANf 2VK9A 5DY9A 1I5OB 2LEHA 4ATOA 4H9PC 3EGUA 2M6IA 2VWFA 1M4ZA 3OYZA 1BCOA 4EMHA 1SA0E 5GAOq 2VKOA 2XY8B 4C0GA 2AT1B 3EAEA 2DL5A 3H6ZA 3QBYA 2P0QA 2YRVA 2XAHB 4J7IA 4AFSC 2CXFA 1U5PA 2RK2A 5CFBA 2P9BA 4MMLA 3AE6A 1N27A 2HD0A 2DYBA 4RTYA 4B9WA 3QWYA 3AT1B 4EZ4A 2ZPBB 2Z6EA 3MCAB 2VL8A 1ZLMA 3UA7A 3SWHA 2RB6A 4J7FA 2DKGA 3QZ5B 1KIKA 2E70A 2XTLA 4LDVA 3QJYA 5IYZE 5GAN2 1WX6A 4LFAT 3M0UA 4E47A 2L8KA 1PSFA 4BI3A 2JS2A 4PL6A 1OXZA 3BE3A 2CHOA 4XTVA 5GAMf 3J80E 3HFNA 3IEEA 3QXEB 3RKOA 3H3AA 4IL4A 3UU4A 3ASKA 4UV8B 1YW0A 3CC2T 3RQUA 3MEUA 5GMKi 2F5KA 4CN4A 1RI9A 2I2LA 3HKSA 2BG9A 4O4LE 2BZBA 4U74A 1IBMT 2PVDB 1RAHB 3HPWA 3OYGA 2QAZA 2JW4A 3CWZB 1WJQA 5FWBA 1Y96B 4LMKA 2RQUA 3UUBA 2NWMA 4PK6A 5HY6A 3PUGA 3LK42 2BS4A 3N5LA 1KEYA 3EDUA 1XNQT 2NUPB 4M4ZA 4XTUA 2ZZDA 3JV3A 1S94A 3SD4A 2D9TA 4KHPT 3ZN0B 1YJ9T 2BKNA 1US7B 1WQWA 2E65A 5GAMd 3EG0A 2OTJA 2RHXA 3CMEQ 5IH2A 1MGQA 4H9QC 2UXNB 2EVRA 4IE4A 2HBPA 1GCQC 2R5AA 2MOZA 2UUBT 3RH3A 1UGVA 1PC0A 2ZCFB 3KBTA 5JR9B 5GANe 2CPTA 1X01A 2AIRB 1BR1A 3CC4A 4P09A 1H7CA 1PD1A 3JRZA 1O3XA 5JRCB 3CCVA 2C0TA 4PJOA 4OK0A 1NPPA 5KYYB 3SHWA 1XDPA 3UFGA 4B3TT 3A98A 2V7LA 5CJ5A 2C0OA 1LPLA 2JXBA 2QA4A 1D1BA 4NIQA 4M7AG 3A5ZB 5HWYA 3LYIA 1GFDA 2YK0A 2E5LT 1LKXA 2DMOA 2NW9A 4JV5T 3R6OA 3EG3A 2CP5A 3UWNA 3E19A 3C94A 3AA6B 5J39A 4I0UA 1N9SA 3CXCS 2YN6A 3I9WA 2K5IA 1BYMA 1AZGB 1VQPQ 2KT9A 3RR6A 1NJIC 4E7SA 2PZ1A 2LHNA 2OX7A 3EG1A 1BR0A 2EYXA 3PUSA 4DR5T 2KRSA 3ZT7A 4IUVA 4KH0B 5GAMe 4OMMA 2X68A 1UK5A 3JC6C 2LZ6B 3EGXA 4B3ST 3F31A 1KNRA 4N4GA 1N33T 3UUNA 3RQWA 4F7UG 3ZEFB 2ATCB 1CSKA 1EFNA 3H0FA 5EZYE 2KNBB 3G71A 4HWCA 3OS1A 1NEKA 5JVDE 1JEGA 5AQVB 2J05A 3VUZA 3QUJA 2KSSA 4M78D 1OWAA 5HXSA 2FPDA 5CO7A 3UT5E 1ABQA 4GLKA 2OTLT 2AHJB 4JPBW 1SPKA 2E10A 1JO8A 2W63A 2EGAA 3JCFA 3Q5WA 3LDQB 3PUAA 3Q5XA 4OYKA 1SEMA 2SEMA 2ZPHB 4M75E 4C92A 4OB3B 2Q9QB 5AQMB 3OTOT 3AA1B 1IAPA 4X62T 3RDVA 5AQIB 1YIJA 3JCMQ 2DNXA 1E7PA 3NGPA 1TWBA 2KWIB 4DQ2A 2N9DA 2NP9A 2LT1A 4C0ZA 4ZGDB 1VQKT 2OTJQ 2ECZA 4G2AA 2LP5A 4OMNA 1YD8G 5LJ3g 2ZM0A 4QVDA 2K3XA 4TWHA 3JB9J 3G4SA 2QYWA 2JIWA 2XHEB 2G0UA 4QKNA 2PVGB 2LMJA 1K73C 4JYAT 2BBHA 1BK2A 3CC4Q 2F69A 2XQ7A 3P4PA 5IUXA 3N9LA 1GFCA 2W2UA 5ABFA 2ZAEA 2ZM8A 3GNGA 2H7OA 5KYXA 3CCVQ 5GAN7 4FCYA 3LW5E 4D8DA 2D9DA 2WWVA 3ZYKA 5HEOA 4XQ3A 2V8IA 2O9SA 3P4QA 2SPCA 4EAHA 2QA4Q 4ME7A 5FU7B 5A0GA 2CWYA 1IHVA 3FXDB 2RQTA 3CCJT 1S72T 3CCEA 2MWPA 2WP9A 1RACB 2QQRA 2VWAA 1G8XA 3MACA 3I35A 4C8QE 5LG4A 3AAIA 2N1GA 2F4VT 3V5SA 4TNWA 2V6YA 1ZSZC 2AZSA 2LJ1A 1NJIR 1AZEA 2IUBA 4DV7T 2VV5A 4XTZA 1E2AA 3GBQA 3RYCE 4ZTFA 1W0BA 3N2KE 2XK0A 5ADXL 4Z8AA 3FZKB 5CKHA 3FJPA 3CCUT 3AE1A 3ANWB 1K73U 3MPUB 5HXHA 4JJDA 1SHZC 3C64A 3M55A 3PJAA 5AQTB 4RCCA 4QVCA 2E8IA 2ZM2A 4RTXA 1AOJA 2RQWA 3G71Q 3F70A 1Z8UA 5IWAT 2G6FX 4BB7A 3AVSA 1UUSA 1ZQ1A 3WAJA 5GAN8 4B6XA 2X35A 5GJWB 3HR0A 2M0OA 1IRXA 3UQ7A 3TKLB 1YJNT 3E08A 2XSAA 1MIVA 2DL3A 5CKFA 1QWFA 5LGNB 4M75C 2LDMA 4CI2B 4AMCA 5J2TE 4OP0A 1Q86R 4XU1A 3ZJ1A 3AECA 2DD4A 5FRNA 2VXFA 1ZBXA 4OGCA 3A8OB 3VS1A 3VRBA 2LKHA 3PURA 4AKRB 3EFRA 4OMLA 4IDZA 4ZS3A 2RA1A 4F6RC 3ZCJA 4DBHA 3LH5A 4B9XA 4PJOB 2KQWA 1K8AC 2Y48B 1VQNQ 4AIUA 2DERA 4FSSA 2OJ2A 2VYTA 2ZPFB 5M9OA 4AQFA 3U23A 3RRCA 4IDOA 1AWOA 3OBWA 3ZMUB 1HXDA 4QH5A 2FJEA 3OYMA 1K73R 2YUQA 3G1JA 4DR2T 2YLBA 4ZI7E 1QVFA 1VQ6A 2RD1A 3EHRA 2LQ8A 4GYRA 2CDTA 4N4IA 1YKHB 4HFDA 2Y4YA 4M77A 1VCSA 3LBXB 5D7UA 2D5UA 3NKZA 3QPHA 1LOJA 1VUBA 4RCBA 5AYFA 1KQSA 2JMCA 4AISA 4HCKA 3UT1A 5FY1A 2M9UA 5DQWA 2VB6A 4IL9A 1ZKEA 3EI0A 1JJ2S 5CA1E 2HBWA 4L9IA 1O9SA 4NS5A 5HCMA 3SOLA 4WNKA 4ZEYA 2E3IA 3EGXB 4JZ3A 4ILCA 4LDXA 3OMGA 4JJNK 2C0IA 4C92F 2DEQA 3OY9A 4ILBA 1KK7A 3N2GE 2B86A 5J26A 2CREA 3FB2A 2ODVA 1H3HA 4ZZBA 1K8AU 1FMWA 2JQKA 4RG8A 3N9MA 1XMQT 5ABHA 4Z90A 1OX9A 3BQKA 2I6HA 2K7AA 3J7AF 2LRQA 2FJBA 2B8AA 1KNZA 4RTWA 2RA2A 4L0RA 2V7KA 2OLTA 3AE7A 4C92B 5A0LA 3CMET 1VCTA 4MLKA 3WVDB 5AT1B 1IO6A 2WDQA 5LGUB 2K57A 2CZ6B 3D0TA 5LGTB 2IG0A 5HK3A 5IXFA 3L2RA 1H92A 3AE4A 4HFBA 4CI0C 4QXHB 4HFVA 4TUYE 2X4JA 2HPJA 1KD1C 5GAOr 2ZPEB 5ETWA 3PDYA 2BKOA 3AVRA 2HHHT 3ZLIA 4U7IA 3CCMA 3N9QA 3OYAA 1BCMA 1J5ET 3CKDA 1WIEA 1M27C 1XNIA 5CQXA 3I9YA 3FZFB 5HWXA 3OSVA 2ROLA 3OJAA 2LNHB 1LJOA 3VJPA 4OMOA 2DTOA 1X27A 2DILA 2A37A 5DM7R 2X4XA 2P4TA 2QQBA 3LLRA 3G06A 4HWIB 3T8OA 4QH4A 3RLFF 4PNOA 1M90C 4HT9A 3GPLA 3CMAA 1QMCA 1VQ6Q 2WB5A 3JCMW 4O4JE 2CS7A 5JREA 2DL8A 4NPPA 4IUUA 3T9NA 1B7TA 2LSIA 5GANg 2DXCA 1ZUUA 5LJNA 3PTAA 3PVQA 4AXPA 1MV3A 2YU1A 2YEVC 5F5WA 2V6YB 2QDYB 1XZYA 4L6V5 2P0PA 1QCFA 2RI2A 1KD1U 4FM4B 1D3BA 2FRYA 2UXCT 2IAKA 4Z91A 5JR9C 1R77A 3ME9A 2A72A 5CB4E 2HSPA 4DUZT 2PUKB 2FEIA 2HKQB 2RHUA 4KP3C 2ESWA 4JLGA 2A0FB 4JJCA 3CBMA 1M1FA 4DR6T 4J9IA 3MP1A 2DHRA 3RPUA 2AK5A 2HMAA 1WPYA 2KGTA 2NTYA 3CXCP 5CVIA 3EDVA 4JRQA 3I0QA 5FL0A 1IGQA 1NBEB 3V8LA 2WU5A 3RC3A 1UFFA 3JCMb 3EUHA 5LBQB 4FYVB 4YSYA 2OA5A 2RM4A 3QIIA 3RESA 2M6BA 3M0PA 2XMFA 1WHLA 4G63A 4DUYT 1M90U 4LMLA 1ZP0A 2K24A 2I0MA 3JC6D 4JI7T 4EIWA 4PKCC 5KYUA 3A8MB 2OV9A 4Y91A 2DVJA 2OTJT 1QWEA 3OKQA 3JADA 1OPLA 4C8QA 3JB9F 1X43A 3UA6A 4HCZA 4MFRA 1MNDA 2RNAA 2BG9E 4EIKA 3O1IA 3V8JA 4Z88A 2K5LA 4JI2T 3AE9A 3AAEB 2HQHA 4M77F 3OYNA 3OW2A 2E64A 1AVZC 3UDCA 2XDDA 1NAFA 3CC4T 2RQVA 2VVSA 2F2WA 2XAFB 1VQ9T 4LD9K 3ZC1A 4EYYR 1VA7A 3CCVT 3HKEE 2VASA 5AQJB 4ERRA 2PTKA 2YDLA 4QQDA 4YT0A 3RIFA 1Y0MA 4NUVA 4UVCB 2LJ0A 3OMCA 3CCMQ 2H89A 1VQ7A 2QA4T 3URGA 3FLGA 4M77B 4X20E 4DA4A 2KY9A 2DETA 2IW5B 1SRMA 4H9OC 2N2NA 4DNDA 2EYWA 2RHYA 2RJCA 5CGMA 1UB4A 3MHXA 3GA8A 1SKUB 2YKSA 2COZA 3CEYA 1UCUA 1UX5A 1ZEEA 1X6GA 3VS7A 5LJ3j 2Q9QC 4BDYA 2JM8A 5FY0A 3SFDA 5JDGA 3QDRB 4N4HA 2V8JA 1BB9A 1SRLA 1TUCA 3AXJA 3CMAQ 3SRZA 4PJOE 4LUEA 4M7DG 5JDLA 4C5HA 5GMKh 2FHDA 2XASB 1V76A 4J9HA 4KGZB 5A2QE 4JS4A 2CHNA 3N2OA 3H8ZA 4J6YA 5HEGA 4RG2A 4BI4A 1NENA 4DV1T 2HQXA 3ABVA 4GK0E 2XPKA 2K9GA 3V7RA 3G71T 4M7AA 2E5KA 1YJNA 3SDZA 5FROA 4DR3T 1RAEB 4IE5A 2MIOA 1HX8A 4UC4A 2CGHA 3CX7B 3M0RA 2C06A 4AQGA 4AKIA 3S3OA 2HNIA 3C4XA 2KSRA 5LJ5j 5FU7C 3V8KA 3E9FA 1G5VA 2V6XA 4U3CA 3BFMA 3UATA 1GL5A 4WBNE 4U2YA 2LRKA 2YOEA 1OPKA 5D6WA 1YIJT 2WSCE 3EG9B 3QYGB 2HL3A 3CBPA 2CSQA 1W4SA 2BG9C 3G4ST 2NTXA 2DIQA 4F7UA 5KDMC 3VRZA 1RAIB 1JU5C 2BBJA 4YSZA 4FU6A 2C0SA 4C92E 1W0AA 3RHWA 2X4WA 4E6RA 3HA4A 5HEHA 5JQGE 5IHYA 3AEEA 3CPZA 4HFEA 3TLTA 2WSEE 3KBGA 4HA8A 5A0DA 1VQLA 5GAN5 4JRPA 3ER0A 3CCJQ 1IZNB 4M75D 4OF1A 3H0IA 2XQYA 5GMKm 3VKHA 1VQ7Q 2V26A 2LCSA 5BMVE 4JI1T 4LXCA 3V7SA 1XWMA 1EZ3A 4JBWF 3OQ5A 3CCET 1M3CA 2DYIA 3MO8A 3PUVF 4AI6A 5HK0A 4KX6A 3DTOA 4IDNA 4OYJA 1D3BB 1B07A 1VRBA 1Z0PA 3V5UA 1P92A 2CH4W 3HI2A 2NW7A 2WQYA 2E6NA 5L3DB 4DOVA 1NWMX 2K5FA 2QGFB 2EIFA 1U1TA 2CZ0B 3OYDA 5EK2A 1IBLT 3FBZA 3CD6A 4A53A 1YBYA 4PJOC 2WAUA 2YINA 3OVUA 5JH7E 4UXNB 3NHNA 5H6RB 2VUBA 2QDLA 1MNEA 1T0JA 4QXCB 4YY3T 4NXMT 2YDRA 1WJRA 1EIFA 1VYVA 4GK5E 3VRAA 9ATCB 3OYHA 3LWIA 3RBBB 3CQGB 1QW1A 2JRKA 4P0AA 2YDQA 1YNZA 4KUDK 1N8RC 1JJ2P 2DJQA 3ULRB 1YJNQ 5KYUB 2DVEA 4FYXB 3AEFA 1DU2A 2FG0A 4C8QB 3KBUA 2GBQA 2BVMA 4C8QD 1W09A 5HXEA 4HXJA 2IPOB 3JCMd 2KR3A 4DO0A 1HCIA 3G7ZA 5C0MA 2XDPA 1D0ZA 3TREA 2WWUA 2H7VC 4BJMA 4ZOLE 3ZT5A 4QT7A 4A63B 3M0TA 4IDPA 2DK3A 4C5IA 5CR2A 4X65T 3KV9A 4YSXA 2YUNA 2SRCA 2O88A 4C91A 3RF1A 3P7IA 2L0AA 2RJDA 2DBMA 1QVFS 1R0BG 2RQRA 2ACXA 5LNKA 1PG5B 1F1BB 1VQ6T 3TEEA 3M0SA 5CCAA 1IGUA 3ONXA 4DBRA 3HTRA 2RHZA 4C92C 4OB0B 1N8RU 1KQSS 1I5LA 1TOVA 4U31A 2E1HA 2RK1A 4LF5T 2XUEA 1IB8A 3V7CA 1XNRT 3CPWA 1FYNA 2ACZA 2QVAA 4M7AF 1HNWT 3NBXX 2O4XB 3REBB 2M02A 2DL1A 1I1JA 3QDFA 1WRDA 4BY6B 1M8MA 3C12A 1O75A 3ZCIA 2PFVA 4I43B 1N32T 1OEDE 4PJMA 1U5SA 2VXEA 4LDUA 4RTTA 1ZSGA 3I1AA 3KV6A 3P8BB 1WFDA 2MPXC 4A4FA 4YLHA 4JZ4A 5FU6C 1HR0T 1BKBA 1YIJQ 3ZSTA 3LGLA 2J6FA 4C90A 2V7IA 4ZTJA 2V7MA 4IUQA 4U33A 3PT9A 1ZOYA 4M77E 4M7AB 1K0SA 2L3QA 4HT8A 4KUMB 2BE7D 3CD6Q 2W66A 3REAB 2XQ5A 5FXXA 3C95A 4ILUA 2A08A 3LWHA 1KC8C 3PMIA 5GANj 3EGDA 2EGEA 3PUQA 3KXTA 3B57A 4F7UF 2Y6XA 1IJ6A 3OPCA 3CX6B 1N8RR 3O1HA 2KZ7B 2V1QA 5KX5E 1BU1A 1VQ9A 4OHFA 1M1GA 4KT0E 3BK9A 3EVYA 1BIAA 3AA0B 2QGGA 1MUZA 1G73A 2XZEA 1VOMA 7AT1B 2BTTA 2KDSA 3EH1A 1GBQA 1QP2A 3NPFA 4BDZA 2LQNA 4YHJA 1DJ7B 1PKTA 2WSSV 2R5MA 3CCQA 1U06A 1X75C 4F7UB 1VQ8A 1K9MR 1RABB 5DLQE 2E12A 4L59A 1NPRA 2MF2A 2MYSA 3CCMT 1NM7A 2M51A 3JCMP 2EQIA 2XD0A 2XAGB 3B5MA 1LCKA 1BBZA 1M62A 5GAMj 2J4GA 2VVNA 3QC9A 1N5ZA 1KC8U 2CP0A 4KRTA 3JCMX 2L9QA 3RIAA 4EOZB 2YUOA 5GMKe 2CP6A 2ED0A 3CMAT 3AE5A 2KYBA 4R56A 1AWWA 3TVTA 3ONJA 4LFCT 4KULA 2J7IA 2MOXA 4AFUC 2XIDA 2CMRA 1M5Q1 4NOYA 1OQKA 2DTHA 4OB1B 2DBKA 4E7IA 4HVUA 2XI9A 2MPKA 3T1YT 4A4KA 3M4GA 2AE9A 4F8HA 2CP2A 1M2OA 4J9GA 3LK3B 5CKEA 2BZXA 4NL3A 3PU3A 3M65A 1N34T 4X9CA 2XSBA 4AQFC 2OI3A 3OSSC 1W2BA 1TXQA 3VYHB 5L4EA 4CRIA 2Q9QD 1Y57A 1I8FA 4JRKA 4ADZA 4OGEA 4IKFA 1KG1A 2QQ9A 4K11A 4LDYA 4YFSA 2QGSA 4P0BA 4UF0A 1QP3A 1WNLA 2BIVA 1Q86C 4M77C 2YU2A 4O6JA 1KC8R 4YJ3E 2CSIA 1QUUA 4FW2A 4TVRA 1Q81R 4HCBA 5CIUA 3LG7A 3AA7B 3S3NA 1V9DA 4P1NA 1U1SA 3DB4A 3QB5K 1NLOC 1KFZA 2FL7A 3VR8A 2DXUA 1FWZA 1AHJB 3RMQA 3PV0F 3OW2S 3L42A 1VQ9Q 3N5BB 3JAFA 2DO3A 3A8GB 3FB9A 1VQOA 1AWJA 2JTMA 3VKGA 2LSYA 3EFOA 2K6DA 3FXEB 3L8RA 4LF9T 2F2VA 1HF8A 1QQJA 2KINB 1XMOT 3TSWA 3UULA 2A3DA 3UFEA 4PLLA 4A98A 1K76A 5GAN4 3CCQQ 2EQMA 4X1YE 1ZBJA 1VQ8Q 4V1Av 2GQVA 2DPPB 3IHRA 2GQIA 2QQAA 4M78G 2X66A 1G3SA 5A1LA 4HFIA 2O01E 4X5TA 4IUPA 1WYCA 3ETUA 1I4K1 2JN0A 4XK8E 1VQ7T 2EYYA 4ILAA 3X28B 4NXNT 1Q86U 1HSQA 1RAFB 2E9XA 3QUIA 1M30A 1RI0A 5LJ5g 4RKUE 1PHTA 4LF6T 2V8SV 2EJFA 4B6MA 2C5JA 2BG9B 2P0KA 2PUOB 2DA9A 4O2AE 1SE7A 4IIOA 1JB0E 4QW2A 5HEJA 1X79A 4ZHQE 1PNJA 3TLSA 3HL8A 2IIUA 2X3WD 2H88A 1OULA 4FJOA 2XM2A 3ZC0A 3RKWA 1ZX6A 4H9RC 4ZI2C 3I55A 1BI0A 3OYKA 3M3ZB 4R0KA 2QTXA 3I56A 3DLLA 3OYXA 1HS7A 2JT4A 2NYSA 1EX4A 2X9YA 4UV9B 1UDLA 2KRMA 3OB9A 2HH7A 4JRIA 1Y71A 2K9AA 3CMLA 2RF0A 2YXYA 2FZGB 3KINB 4PK5A 1QKWA 2CUDA 1YCYA 4Z02A 2EQJA 4P5NA 2CH4A 2RJFA 3UF4A 3UU3A 2KVQG 3A1PA 2Y8DA 2JS0A 3NZQA 4PNIA 1GQEA 3AEDA 2K2MA 4PJOD 2JMHA 5L3BB 2EBPA 2L89A 5CKBA 2CUBA 1M1KC 4M7DA 1JRIA 3ZFJA 3G4SQ 4O8SA 2J6OA 1OEDA 4M7AE 1YI2A 3I5RA 1E6GA 1A0NB 4AFZC 4LNPA 4ZN3A 1MV0B 4ZGEB 5FRMA 1RL2A 2MI6A 1VIEA 3R6NA 1WXUA 2A3LA 2JMAA 5LMUT 1ZHCA 1VQOQ 3A8HB 3HKDE 1YXRA 4CI3B 3P4RA 5FWCA 2RMOA 4RTVA 1YKEB 4EEBA 2YDSA 2QTVA 1OYXA 3UQ4A 1RLQC 3RI5A 4DIDB 4UVBB 1VQLT 2KT8A 3L2ZA 4IHJE 5C3JA 2JZ2A 3CVRA 3CCEQ 2D0UA 4RTUA 4LFBT 3EG2A 2DM1A 1QCOA 2LJLA 4TZ4C 4C8QC 1CKAA 3TU4K 3WXMB 5KYWA 3ZSSA 2BVLA 3PVLA 4F7UE 2KXCA 2KYMA 3K3QC 4DR1T 1M1KU 3Q5DA 1OEBA 1KHIA 1PSEA 1WR0A 2CLYB 2RI3A 4HTEA 4HGAA 5EK4A 4XU0A 1QVFP 3AE8A 3OYBA 5AQGB 2VGNA 4XTWA 3PUZF 4HWDA 1B34A 3CD6T 2HN2A 4II1A 4C92D 3AB3B 2JVVA 3ZYMA 1LRZA 5BR8T 1PWTA 1R8IA 2JMKA 4N0AA 4DOWA 1KQSP 4UF0B 1D1AA 2YT6A 2YHTA 5J2UE 2XKOC 4HFCA 1WI7A 2EWNA 1T8BA 2DFUA 4J5YA 1KQ1A 2LVMA 3VS5A 3E2UA 5EG2A 2VKHA 1WYBA 2X0YA 1BR2A 2C5IT 3GWHA 5FXVA 1YHQA 1ZUYA 5FU6B 1YFNA 4IIMA 3PFSA 2VURA 2LSKA 3UPUA 3CCRT 4UIGA 2X9WA 4CI1B 2KNDA 5I2MA 5ABFB 3O8VA 4F04B 4H63H 4FL6A 1I07A 6AT1B 5KYXB 3EFOB 5I2SA 3C51A 1NYFA 1U8RA 5AQOB 4KGVB 4BY6C 3N9PA 1TU0B 1M1KR 4YHHT 3A8YC 4DV6T 2A2FX 4EB6E 1CKBA 2RJEA 2HL5C 2WSFE 4A54A 4A4HA 2RPAA 5GMKl 5LCYA 4B3RT 1YI2Q 4X34A 2CXLA 3QB5A 5AQUB 4M7AC 1VQMA 4WZXA 4LN2A 3M53A 1HFAA 5IXBA 1FMVA 3A8LB 1GBRA 1D1CA 1YITA 2V8KA 3Q1JA 2EYQA 1LVFA 3UUMA 2GGRA 1WJSA 4JJBA 3UU8A 4MDWA 3CPWS 3CQCB 4FI5A 3ZYLA 3DB3A 4FYYB 4XAXB 3JB9I 2KROA 1J3TA 2V5DA 2DJZA 2CZ7B 2EW3A 2WM9A 2IC9A 5AQRB 3K3OA 2LCLA 5FLXE 1B3QA 2AKLA 2A28A 4EXTA 3P8DA 2XQ9A 3OS0A 3FZHB 5KCOA 4ISTA 2KK4A 4YTLA 5IHNA 3RERA 2W00A 3K3NA 4JI0T 3JCMh 2EHOA 3EHZA 5IN1A 2DXBA 1W70A 3CCSA 4ZN1A 2DI4A 4LMJA 3M59A 4IE7A 2JTEA 5AQNB 3X26B 1BI3A 1Y64B 2DZ9A 4JEHB 2JOYA 1PCXA 3G6EA 5KH6A 5GAMg 5FKYA 4M7DF 1WHJA 2FZCB 1MIWA 2DRMA 4EPCA 1TSFA 4TX5A 1HNZT 4JLIA 1UGOA 3BDUA 4X1VA 3C4WA 2LCCA 1ACMB 3Q2MA 4Q25A 4CC7A 2CKKA 2CZ1B 4DEXA 3M56A 3RYIE 3MA9A 1WXBA 4PJJA 3F57A 4A97A 1OV3A 2QI2A 4FIBA 5ABEA 4CC2A 5LJ3d 1WHHA 4YTMA 5HYAA 3SWNA 5IT9E 3O4XE 2HPLA 3ZKRA 1OEDB 2CA5A 4E7LA 2XQ6A 2NW8A 4IUTA 4EGWA 1G3TA 3JB9D 2LOPA 4PLIA 4E7ZA 3FEOA 4D6WA 5J3BA 3CX8B 4GY5A 4ASKA 2L2PA 2FBWA 4TV9E 3CCQT 1VQ8T 4DVDA 4M77D 1UTIA 3EHQA 1ZV4X 2H3EB 1WZOA 2VKJA 4C0FA 2H3RA 3LX7A 4EDUA 1L0VA 1VYUA 5HEUA 2MCNA 1UG1A 3E1SA 2J06A 4IE6A 5KCHA 3OYCA 2LX7A 1VQ5A 1T72A 1VQMQ 2X0HA 4E7HA 4QHOA 3NTIA 3QZ9B 5AQQB 1UJ0A 3ZT6A 4JI6T 3OYIA 3OW2P 2WACA 4BA9A 1PRMC 1HYOA 5KYWB 4HN9A 4JI4T 1Z9ZA 1BR4A 1OI1A 1YITQ 1G2BA 1SF9A 2LT3A 3JSCA 3SFEA 2FB7A 2PBIA 4OMQA 1D09B 4HWHA 5LMNT 1U4QA 4LF4T 1MIYA 4MBQA 3PU8A 2Y90A 5GAN3 2LM9A 1NLPC 4E7KA 1B34B 2K79A 2HSEB 2DWGA 1NJIU 2NWBA 3KV5A 2UXBT 2XQAA 4NUUA 3J9X1 1W2BS 4YTPA 1Y96A 5HCKA 1UHCA 4LD6A 3NZPA 2O31A 5LHGB 3CCSQ 1X2QA 4ELYC 5L3FB 2XDBA 2VQET 2QEXA 4TN7B 1ZUKA 2W62A 2PQWA 3ZJ2A 2AKKA 4GYSA 5C6SA 3PIPA 3L2WA 3G6EQ 2HAXA 4CN1A 1VIFA 1X69A 2CEAA 2GFAA 3MEAA 1FEWA 1FXXA 5I22A 3FZLB 1WQ7A 4HKEA 2W4XA 2K2VA 4ZI2D 3HKCE 1AT1B 2DTIA 2JQQA 3RKXA 2JQ9A 3M54A 2WBLA 4FSXA 2CP7A 2MBGA 1Z9QA 4EMKA 2XQ4A 3A5XA 3AEAA 4K0UA 2RP4A 1G3WA 4LF8T 1YWOA 1HNXT 3EABA 1VQOT 2D0NA 4Y28E 4ZXLA 3RX6A 1NE8A 3H0HA 3K1SA 3RKYA 4H63V 3NVOA 2ENMA 2QG9B 3D7SB 1VQ4A 3OYFA 3OBYA 2FPEA 1T3LA 3AEGA 2R6GF 4KI0F 2RI5A 3PGGA 1QVGA 1K0XA 3KVAA 2J6KA 2LQKA 2KBTA 4LE9A 3VU7H 5LHHB 2P84A 3DLMA 5AQHB 2W61A 3OA6A 2OAUA 5LP6E 5FW9A 3OS2A 5LG3A 3JCMf 3NFCA 3RIUA 2KEAA 1VQ5Q 3UTKA 3T1HT 1JNZA 2WMNA 2O2OA 2FO0A 3RYFE 2ZGWA 1M7KA 3PNWC 5L8RE 3O5ZA 2KWHA 1Q95G 1WGSA 1WYXA 3KUFA 1SUMB 4J6WA 2JPFA 4MZTA 2WZHA 3M58A 2DRKA 1U3OA 1VYTA 5FP3A 2EHOB 4EV6A 3BW1A 3JAEA 3KVBA 3EAMA 3I55T 4LF7T 1IREB 4X64T 2D1XA 2A7YA 4TWDA 4MMKA 3HRSA 2RHIA 4EMGA 3I56T 5LB7B 1ZHIA 4LUDA 4M78A 3ETVA 5J0ZA 5IHKA 3I0OA 1H3ZA 3X24B 1WLPB 2DIGA 4XBFB 4KHZF 3MXZA 4GIWA 5HAXA 2LSGA 1SG5A 2LRLA 1UGRB 4M75G 3CCRA 2EFIA 4L5GA 3AAAB 2QYZA 1G83A 4DV3T 2QEXQ 4KBMB 1K9MC 1HX1B 2BKDN 2WCAA 3AE3A 4TV8E 3SWNB 2ABLA 3OYJA 2W0ZA 5AQLB 3SFMA 1CUNA 4J9FA 3A7MA 3S3MA 2BS3A 2V1DB 2CLYC 4J2CA 5AQPB 1JXOA 3VS3A 1YN8A 1YI2T 2FUPA 2CT3A 3QSUA 5JDNA 1UX4A 2NUTA 2JTFA 5E0OA 3ZPOA 3PMTA 1VQLQ 3KDSE 4PJLA 4BD3A 3AXJB 1VQ4Q 1HK9A 1VQPA 2PU9B 2WMOA 4YXDA 2DWKA 1BIBA 5GANd 2CCQA 2HZYA 4M7DE 1OU8A 3RIRA 4AG2C 2GTJA 2FJAA 5FMNA 1K9MU 4Z8XA 4C8QG 3CCLA 3JCMV 3TCJA 2FVUA 4EEDA 2X0LB 3JCMe 1NYGA 2D6FA 4JLEA 3RMSA 1WR6A 5FY7A 2GCXA 2L5QA 4ANJA 2L3RA 2GFUA 3QHSA 3CC7A 4M7AD 3C98B 3MJXA 5J1GA 2LX9A 4ZGJB 3LSVA 2GTOA 4MDXA 1FMKA 4VUBA 1Q81C 2YUPA 2DL4A 3ANWA 5DABA 5DLOA 3JB9H 2IVWA 1E6HA 2X3XD 4AKHA 1TH7A 4BE1A 1QCNA 3CPWP 4CN6A 2X67A 5L3CB 3FJ5A 2K3BA 2E9XC 3Q5EA 4PFPA 2VL0A 5JDFA 1FJGT 1NEBA 4WTOB 4DV0T 4HVWA 3CCRQ 4IIJE 3OBVE 1MHNA 2DXTA 2B1EA 5ECAA 3MP8A 4ORZA 4UVAB 4FT2A 1E7OA 5L2LA 2HN1A 1YHQT 1TTHB 4QWNB 4KGXB 2RN8A 4EMKB 4YTNA 2ODUA 5DQVA 1WLXA 4OMPA 4ESRA 4DV2T 4BAYB 3CC7Q 5GMKj 2EYZA 5LBMA 2UUAT 4XTYA 3GLXA 1Q81U 1K4US 2M67A 3H41A 2NR4A 4O2BE 1QKXA 4O5VA 4MALA 3QK6A 2BZ8A 2HEQA 1KF6A 3L09A 3LK2B 1OU9A 3AHUA 2E3HA 1X6OA 2DAQA 3NTKA 1VQMT 3PE0A 2DE0X 4HEAA 3IQLA 4GLMA 4E7JA 3VV0A 4DEYA 2XM1A 2WS3A 3LBXA 4AKLA 3FC3A 5GONE 1YQ3A 2MTQA 3JAME 1SHFA 2MK5A 3RYHE 2K3WA 1QVPA 4J83A 3TQ7P 1YITT 2L8DA 2CBIA 3ZMZB 3I5SA 3MK7C 3FRNA 5M4YA 4KUIA 4M78F 2IC6A 4RMOA 4FT4A 3CCLQ 2RH2A 1KSWA 4M7DC 1YQ4A 4KH1B 4Q5WA 3PJAJ 1N6AA 5JDMA 1OEDC 2OAWA 3PUWF 5GAOn 3GP8A 1Y7XA 2LT4A 2K4YA 1RAGB 2MAWA 3HRTA 2BDEA 3LFMA 3META 1E1HB 4A56A 5LL6S 1K9AA 2KMFA 2DF6A 4I4TE 3U3IA 4CC4B 2L3PA 4BACA 2IHR1 2LJ3A 4C0DB 1H8KA 3CCST 2QK0A 3RKGA 4M78B 2WDRA 2KAFA 1NEGA 2QQSA 3L2VA 4PAGA 4J9BA 4J9CA 2LKGA 4AG1C 5D6YA 3NMZC 1QSDA 1ZA1B 3MZKB 4UR9A 1S35A 5L3EB 3G6ET 2NLUA 1XJWB 3NTHA 3DP7A 8ATCB 1YJWT 4IT4A 3MKDA 4JI5T 4DMWA 1T0HA 1I0CA 2JQHA 4DR4T 2XAQB 3ESLA 4BE0A 1C1AA 5CQYA 5L47A 2B76A 4JI3T 3VS4A 2VVKA 1PRLC 4WW0A 1HD3A 1XQHA 1WA7A 4J6XA 4EZHA 2ROTA 4QX7B 5CK9A 3J81E 5CKDA 3O9XA 1VQNA 2ZPIB 4O4IE 2BE9B 3J7Yq 5LOVE 1W2BP 1MMNA 5IHIA 4N78D 1JXMA 1YP5A 2BUDA 2VKNA 3VU3C 1HJDA 2BS2A 3QYHB 4GKJT 4BJNA 2Y4XA 2NUTB 2LLYA 1D0YA 3PIOA 2KT1A 5TAOA 5L23A 4EYUA 2PG8A 2EKHA 4N0AC 2CYZB 1GCPA 2M1HA 1T7SA 2WU2A 3BQLA 2ED1A 4GKKT 1AWXA 5I21A 2UXXB 4COFA 4V2SA 1G3YA 2VC8A 1GCQA 4BE2A 1T3SA 3DJBA 3UUXB 2BZYA 4DV5T 3H37A 4F17A 3ZBDA 2XQ8A 4H9NC 5FVLA 3RC8A 1UGQB 1VQ5T 3GOXA 1D0XA 4ZI3C 3X20B 2XAJB 1Y01A 3UU5A 3VR9A 4J9DA 4IE0A 3FZMB 1J5WA 4IREA 2CM0A 5H6QB 2WDVA 4PFOA 3NRXA 1YWPA 2FZKB 3VYGA 1KHCA 4IGUA 2JUFA 2VGMA 2ZLYA 5GJVB 4FW1A 5GAN6 2HCKA 2C5KT 1BI2A 3EGDB 3L2UA 2DLPA 1I81A 2J1DG 4ZNXA 1J1JA 5LJ3h 3E22E 1N36T 3OYLA 3E9GA 4X1IE 4JS5A 2ZM6T 3QWXX 1SHGA 4AFQC 5GAOl 3M9QA 2CBJA 3U78A 1ARKA 3QNUA 2M16A 3M4YA 3SS1A 3VHLA 1V1CA 2QEXT 4ISSA 3H9NA 3MP6A 3VS6A 3O1JA 4PJOF 2E4HA 1I6ZA 1AD5A 4A5XA 4CQIA 4FYWB 1M9SA 3X25B 1V29B 2EQKA 2L3LA 2KRNA 2LNVA 4AQYT 4ZS2A 5KMGP 3IF8B 4JUVA 3C50A 4QKUA 4I50E 2DZCA 2WY2A 2X9XA 1CHUA 3GN5A 3GMIA 4X66T 1M2VA 2LHRA 4MHCA 1RLPC 3AE2A 1UE9A 4DMVA 2HDAA 5LXTE 4CXXA 5EC7A 2K3YA 2DLRA 1Y07A 2EHOC 3TLUA 5LJ5h 3BQIA 4Y92A 3E0ZA 5AFUL 1EZZB 4PK4A 1UHFA 4J9EA 3OS5A 3CBOA 4OX9T 1PKSA 5L3GB 1Q82C 2LOSA 4TWFA 1QVGS 3C0CA 1VQ4T 3AEBA 2KXDA 3TLWA 4HCCA 3EH2A 3QOFA 4IDQA 1SSFA 2DEUA 2IIMA 2QASA 2MAMA 4RTZA 1NZ9A 3F2EA 2COYA 2D8JA 5JDQA 3CC2A 2E5QA 1RUWA 2QRXA 4HFHA 3QG1A 3NRYA 2KLQA 3FDRA 5LJMA 4HVVA 4B3MT 3HKBE 3KFVA 5D6XA 2CT4A 3WVEB 2A36A 1C6VX 1IZ6A 4PJOG 1HG2A 1TUDA 3RUXA 1PD0A 2E5VA 2F1LA 3SWNC 3SB2A 3P50A 2GK9A 1R0CB 2YLCA 5HCJA 2LSJA 2GNCA 4OMFB 2FYKA 2MWOA 3I55Q 5KE3A 2CXDA 3M57A 1YJ9A 1IXDA 3THKA 3I56Q 1JQQA 4AKGA 2IDOB 2ES0A 5JTGA 5FYMA 2F5TX 3LH0A 1W6XA 1Q82U 4NL2A 3RRWA 3X1DA 1AEYA 4PJNA 4XZCA 2EJ9A 3ZMTB 3VUBA 1OX8A 4X1KE 5ABGA 1M8VA 5LA6E 1ZSZA 2X4YA 3JCMg 1BI1A 3GIBA 1WDXA 3NWIA 5IAYA 2KE9A 5AQFB 1M3AA 1XDOA 1MMDA 3QJ6A 3P4WA 5CA0E 1KQ2A 4QXBB 3PUYF 4DBQA 5AQKB 2XICA 4XTXA 4GBQA 3EG9A 2DL7A 2PVOB 3CQTA 2LE8A 4M78E 3HP9A 5KYNA 1GRIA 2E9XB 1WHMA 1K8AR 1IHWA 4DR7T 2E9XD 1HTJF 2UUCT 3S6WA 4C92G 5JDHA 1KNPA 2BKPA 2RPNA 2JNGA 5HXRA 3CXCA 4R55A 1WFWA 1FX7A 1KFYA 1Q82R 4AT1B 2COWA 4WCIA 4M75A 1X2KA 4JEUB 1OZ2A 4CXYA 4WF2A 5LYJE 3IA3A 1UECA 1VQPT 2KMTA 3L3PA 2D0TA 3ZMVB 2D0QB 2V7JA 1QLYA 3HRUA 5KE2A 5F3JA 1UURA 2EGCA 3VS2A 5FNVE 2D8HA 5LJ3f 2HKNA 3CC2Q 3CCLT 2FPFA 2W0GA 1X9BA 3WI3A 3GF5A 4A4EA 5FVKA 4F16A 1UGSB 1UJYA 4EMKC 4I55E 2LM2A 1XTDA 2OTLA 3TSZA 2QA7A 3IBPA 4BUGA 1H641 3LGFA 3CC7T 4C5EA 4CZZB 2XU8A 1YJWA 3N9OA 2E2AA 5FXWA 4WBOA 4U72A 5HKCA 3CIRA 2LTOA 2EQUA 3VS0A 1M3BA 2D2SA 1MMGA 2H3JA 1JNRA 3LJCA 3HFOA 5GAOm 1YJ9Q 2LQWA 1S1NA 2W10A 3P8HA 1T98A 1VQKA 1K1ZA 4UEMA 2F2XA 3CQXC 1UEBA 1LNXA 2EPDA 4XU3A 3W15B 4M7DB 5AQSB 3INZA 3M5AA 5L4HA 4IURA 2JJ9A 4M7DD 5C8YE 5FXZA 2NOXA 2UXDT 1YHQQ 4JUYA 3L1AA 1W9RA 1OOTA 5LJ5f 1XOVA 3RIUC 2X51A 3I9QA 1N9RA 3FIFA 1IJ5A 2IMLA 4WYVA 1W1FA 3GN5B 3EFSA 1M2VB 1QLBA 5GANh 4BI8B 1KD1R 4QQ6A 1TG0A 2CE7A 1RAAB 4GOUA 2YWWA 4CXWA 1UGPB 3RNJA 2J47A 1JBMA 1RADB 5DJQC 1IBKT 3VKIA 2L3SA 3KV4A 4LDWA 3CCJA 1S72A 2QXFA 2R58A 4PFZA 1ZA2B 2CRBA 4JDSA 2YRDA 5I11A 3DKMA 4C0DC 2ZMAA 3QKJA 5GAOp 2KXPB 4U7YA 4JI8T 4M78C 2M0YA 3P8CD 4XU2A 4DV4T 4D8KA 4KMCA 2NUZA 5LJ5d 4OB2B 4E2FB 2AXDS 3ZMSB 2EAYA 3L39A 2CP3A 4J8OA 4MZMA 2PJQA 2RO0A 4PW8A 2YSQA 1M90R 1TUGB 1Q7YC 3BDLA 3MEVA 3CCUA 4ELZC 3K8PC 4RUGA 2A9UA 2FRWA 5GAMh 3R84B 2O4XA 5LJ3e 5C2TA 3GNFB 1NG2A 3JB9G 1MMAA 3VRYA 1AJ3A 1TS9A 3ZN1B 3L2QA 3OYYA 2G3RA 2NUPA 4M77G 2E41A 2VKDA 2OTLQ
chains in the Genus database with same CATH topology
4OFZA 1OZ3A 3QO3A 4MZPA 4H9SE 2R57A 5F8PA 3MEWA 4ZI3D 4O4HE 1HG5A 5LHIB 3B13A 3OYEA 2LC4A 4HKAA 3WAKA 3BY7A 5JR9A 1R8OB 2XHCA 1GXIE 2MMPA 1Q7YU 3JCMc 3HHTB 2CWOA 5JRCA 2EKOA 5LJ5e 5EK3A 2GF7A 4M75F 1VQNT 4YJ2E 3FHNA 4C5GA 2E6ZA 2K48A 3N9NA 3PTRB 2ZPGB 1FIOA 2K5BB 3FBLA 4M75B 1JJ2A 4X9DA 5CAIA 3KFWX 4QVZA 3HSBA 4UELA 2I59A 4OVAA 2EHOD 4M1PA 3S4UA 3CPFA 3JCMJ 2EJGA 4QQGA 3Q9DA 1LVKA 4QX8B 2DD5A 3CMEA 3C4SA 4HE8A 5HXCA 4C8QF 2XG8D 3HL6A 2DCFA 2X9HA 3C4ZA 2Q9QA 2HQEA 3ZEHA 4A4GA 5GANf 2VK9A 5DY9A 2LEHA 4ATOA 4H9PC 1M4ZA 3OYZA 4EMHA 1SA0E 5GAOq 2VKOA 4C0GA 3EAEA 3H6ZA 3QBYA 2P0QA 2YRVA 2XAHB 4J7IA 2CXFA 1U5PA 2RK2A 2P9BA 4MMLA 1N27A 2HD0A 4B9WA 4EZ4A 2ZPBB 2Z6EA 3MCAB 2VL8A 3SWHA 2RB6A 4J7FA 2DKGA 3QZ5B 2E70A 2XTLA 4LDVA 3QJYA 5IYZE 5GAN2 4E47A 2L8KA 1PSFA 4BI3A 4PL6A 1OXZA 4XTVA 5GAMf 3J80E 3HFNA 3IEEA 3QXEB 3RKOA 3H3AA 3ASKA 4UV8B 1YW0A 3CC2T 3MEUA 5GMKi 2F5KA 2I2LA 3HKSA 4O4LE 2BZBA 4U74A 2PVDB 3HPWA 3OYGA 3CWZB 1WJQA 1Y96B 4PK6A 5HY6A 3PUGA 3LK42 3N5LA 4XTUA 3EDUA 2ZZDA 1S94A 3SD4A 2D9TA 1YJ9T 3ZN0B 1US7B 1WQWA 2E65A 5GAMd 2OTJA 2RHXA 1MGQA 4H9QC 2UXNB 4IE4A 2HBPA 2R5AA 2MOZA 3RH3A 2ZCFB 3KBTA 5JR9B 5GANe 1X01A 1BR1A 3CC4A 4P09A 1H7CA 3JRZA 1O3XA 5JRCB 3CCVA 4PJOA 4OK0A 1NPPA 2V7LA 2QA4A 1D1BA 4M7AG 3A5ZB 5HWYA 3LYIA 2YK0A 1LKXA 2NW9A 3R6OA 3UWNA 3E19A 3C94A 3AA6B 5J39A 1N9SA 3CXCS 3I9WA 2K5IA 1BYMA 2KT9A 1NJIC 4E7SA 2LHNA 1BR0A 3PUSA 4IUVA 5GAMe 2X68A 3JC6C 3F31A 4N4GA 3UUNA 4F7UG 3ZEFB 5EZYE 3G71A 3OS1A 5JVDE 3VUZA 3QUJA 2KSSA 4M78D 1OWAA 5HXSA 5CO7A 3UT5E 4GLKA 2OTLT 2AHJB 2E10A 2W63A 3Q5WA 3PUAA 3Q5XA 4M75E 4OYKA 2ZPHB 4C92A 4OB3B 2Q9QB 3AA1B 1IAPA 1YIJA 3JCMQ 2DNXA 1NJIU 4DQ2A 4ZGDB 2KWIB 1VQKT 2N9DA 2NP9A 2LT1A 4C0ZA 4G2AA 1YD8G 5LJ3g 2ZM0A 4QVDA 2K3XA 3JB9J 3G4SA 2XHEB 2G0UA 4QKNA 2PVGB 1K73C 2F69A 3N9LA 2ZM8A 3GNGA 2H7OA 5GAN7 3LW5E 3ZYKA 4XQ3A 2V8IA 2SPCA 4EAHA 4ME7A 5FU7B 5A0GA 2CWYA 3FXDB 3CCJT 1S72T 3CCEA 2MWPA 2QQRA 2VWAA 1G8XA 3MACA 4C8QE 5LG4A 3AAIA 2N1GA 3V5SA 2VV5A 4XTZA 3RYCE 4ZTFA 3N2KE 2XK0A 5ADXL 5CKHA 3FJPA 3CCUT 3ANWB 1K73U 5HXHA 1SHZC 3C64A 3M55A 4RCCA 4QVCA 2E8IA 2ZM2A 3F70A 4BB7A 3AVSA 1ZQ1A 3WAJA 5GAN8 4B6XA 2X35A 3HR0A 2M0OA 1YJNT 3TKLB 3E08A 1MIVA 5CKFA 5LGNB 4M75C 2LDMA 4CI2B 5J2TE 4OP0A 4XU1A 3ZJ1A 2DD4A 5FRNA 2VXFA 1ZBXA 4OGCA 3A8OB 3PURA 4AKRB 3EFRA 4IDZA 4ZS3A 2RA1A 4F6RC 3ZCJA 4B9XA 4PJOB 2KQWA 1K8AC 2Y48B 2VYTA 5M9OA 2ZPFB 4AQFA 3RRCA 3OBWA 3ZMUB 1HXDA 3OYMA 2YLBA 4ZI7E 1QVFA 1VQ6A 2RD1A 2LQ8A 4GYRA 4N4IA 1YKHB 2Y4YA 4M77A 3LBXB 2D5UA 3QPHA 1LOJA 1VUBA 4RCBA 5AYFA 1KQSA 3UT1A 5FY1A 2M9UA 5DQWA 2VB6A 1ZKEA 1JJ2S 5CA1E 4L9IA 1O9SA 4NS5A 3SOLA 4WNKA 4LDXA 3OMGA 4JJNK 4C92F 2DEQA 3OY9A 1KK7A 3N2GE 5J26A 3FB2A 2ODVA 1K8AU 1FMWA 4RG8A 3N9MA 3BQKA 3J7AF 2LRQA 2B8AA 1KNZA 2RA2A 4L0RA 2V7KA 4C92B 5A0LA 3CMET 4MLKA 3WVDB 5LGUB 2K57A 2CZ6B 3D0TA 5LGTB 2IG0A 5HK3A 3L2RA 4CI0C 4QXHB 4HFVA 4TUYE 2X4JA 2HPJA 1KD1C 5GAOr 2ZPEB 5ETWA 3PDYA 3AVRA 3ZLIA 3CCMA 3N9QA 3OYAA 3CKDA 1XNIA 5CQXA 3I9YA 3OSVA 5HWXA 3OJAA 1LJOA 3VJPA 2DTOA 5DM7R 2X4XA 2P4TA 2QQBA 3LLRA 3T8OA 4PNOA 1M90C 4HT9A 3GPLA 3CMAA 3JCMW 4O4JE 2CS7A 5JREA 4IUUA 3T9NA 1B7TA 2LSIA 5GANg 2DXCA 5LJNA 3PTAA 4AXPA 2YU1A 2YEVC 2QDYB 4L6V5 2P0PA 2RI2A 1KD1U 4FM4B 1D3BA 2IAKA 5JR9C 3ME9A 2A72A 5CB4E 2PUKB 2RHUA 4KP3C 4JLGA 3CBMA 1M1FA 3MP1A 2DHRA 3RPUA 1WPYA 2NTYA 5CVIA 3EDVA 4JRQA 3I0QA 3V8LA 3RC3A 3JCMb 3EUHA 5LBQB 3QIIA 2OA5A 2RM4A 3RESA 4G63A 1M90U 4PKCC 2K24A 3JC6D 4EIWA 3A8MB 4Y91A 2OTJT 3OKQA 4C8QA 3JB9F 4HCZA 4MFRA 1MNDA 3O1IA 3V8JA 2K5LA 3AAEB 3OYNA 4M77F 3OW2A 2E64A 3UDCA 2XDDA 1NAFA 3CC4T 2XAFB 1VQ9T 4LD9K 3ZC1A 4EYYR 3CCVT 3HKEE 2VASA 4ERRA 4QQDA 4NUVA 4UVCB 3OMCA 1VQ7A 2QA4T 3URGA 3FLGA 4M77B 4X20E 4DA4A 2KY9A 2IW5B 4H9OC 2N2NA 4DNDA 2RHYA 2RJCA 1UB4A 3MHXA 3GA8A 3CEYA 1UCUA 1UX5A 1ZEEA 5LJ3j 2Q9QC 4BDYA 5FY0A 5JDGA 3QDRB 4N4HA 2V8JA 3SRZA 4PJOE 4M7DG 5JDLA 4C5HA 5GMKh 2FHDA 2XASB 5A2QE 4JS4A 3N2OA 3H8ZA 4J6YA 4RG2A 4BI4A 2HQXA 4GK0E 3V7RA 3G71T 4M7AA 1YJNA 3SDZA 5FROA 4IE5A 1HX8A 4UC4A 2CGHA 3CX7B 2C06A 4AQGA 4AKIA 3S3OA 2HNIA 3C4XA 5LJ5j 1G5VA 5FU7C 3V8KA 3E9FA 3BFMA 4WBNE 5D6WA 1YIJT 2WSCE 3QYGB 3CBPA 1W4SA 3G4ST 2NTXA 2DIQA 4F7UA 5KDMC 4FU6A 2C0SA 4C92E 2X4WA 2WSEE 3HA4A 5IHYA 5JQGE 3CPZA 3KBGA 4HA8A 1VQLA 5A0DA 5GAN5 4JRPA 3ER0A 1IZNB 4M75D 4OF1A 2XQYA 5GMKm 3VKHA 2V26A 5BMVE 3V7SA 1EZ3A 3OQ5A 3CCET 3MO8A 4AI6A 5HK0A 3DTOA 4OYJA 1D3BB 1VRBA 1Z0PA 3V5UA 1P92A 3HI2A 2NW7A 2E6NA 5L3DB 4DOVA 1NWMX 2K5FA 2EIFA 1U1TA 2CZ0B 3OYDA 5EK2A 3FBZA 3CD6A 4A53A 1YBYA 4PJOC 2WAUA 2YINA 5JH7E 4UXNB 5H6RB 2VUBA 1MNEA 1WJRA 4QXCB 1EIFA 4GK5E 3OYHA 3LWIA 3CQGB 1QW1A 2JRKA 4P0AA 4KUDK 1N8RC 2DVEA 4C8QB 3KBUA 2BVMA 4C8QD 5HXEA 3JCMd 4DO0A 1HCIA 3G7ZA 5C0MA 2XDPA 1D0ZA 3TREA 2WWUA 2H7VC 4BJMA 4ZOLE 2DK3A 4C5IA 5CR2A 3KV9A 4C91A 3P7IA 2RJDA 1QVFS 2ACXA 5LNKA 1VQ6T 3TEEA 5CCAA 3ONXA 4DBRA 2RHZA 4C92C 4OB0B 1N8RU 1KQSS 1I5LA 2E1HA 2RK1A 2XUEA 3V7CA 3CPWA 4M7AF 3NBXX 2O4XB 1WRDA 4BY6B 3C12A 1O75A 3ZCIA 2PFVA 4I43B 4PJMA 2VXEA 4LDUA 3I1AA 3KV6A 3P8BB 4A4FA 4YLHA 5FU6C 1BKBA 3LGLA 4C90A 2V7IA 4ZTJA 2V7MA 4IUQA 3PT9A 4M77E 4M7AB 4HT8A 4KUMB 5FXXA 3C95A 4ILUA 3LWHA 1KC8C 3PMIA 5GANj 3PUQA 3KXTA 3B57A 4F7UF 2Y6XA 1IJ6A 3CX6B 3O1HA 2KZ7B 5KX5E 1VQ9A 4OHFA 1M1GA 4KT0E 3BK9A 3EVYA 1BIAA 3AA0B 1G73A 1VOMA 2KDSA 1QP2A 4BDZA 4YHJA 1DJ7B 2WSSV 2R5MA 3CCQA 4F7UB 1X75C 1VQ8A 5DLQE 2E12A 4L59A 1NPRA 2MF2A 2MYSA 3CCMT 3JCMP 2XD0A 2XAGB 5GAMj 3QC9A 1KC8U 3JCMX 2L9QA 4EOZB 5GMKe 3CMAT 4R56A 4KULA 2XIDA 2CMRA 1M5Q1 4NOYA 2DTHA 4OB1B 4E7IA 2XI9A 4A4KA 3M4GA 3LK3B 5CKEA 4NL3A 3PU3A 3M65A 4X9CA 4AQFC 3OSSC 1W2BA 3VYHB 4CRIA 2Q9QD 1I8FA 4JRKA 4ADZA 4OGEA 4IKFA 1KG1A 2QQ9A 4LDYA 4YFSA 2QGSA 4P0BA 4UF0A 1QP3A 1WNLA 2BIVA 1Q86C 4M77C 2YU2A 4O6JA 4YJ3E 1QUUA 4TVRA 4HCBA 5CIUA 3LG7A 3AA7B 3S3NA 1V9DA 3DB4A 1U1SA 2FL7A 2DXUA 1FWZA 1AHJB 3RMQA 3OW2S 3L42A 3N5BB 2DO3A 3A8GB 3FB9A 1VQOA 2JTMA 3VKGA 2LSYA 3FXEB 1HF8A 2KINB 3UULA 2A3DA 3UFEA 4PLLA 5GAN4 2EQMA 4X1YE 4V1Av 2GQVA 2DPPB 3IHRA 2QQAA 4M78G 1G3SA 2X66A 2O01E 5A1LA 4IUPA 1WYCA 3ETUA 1I4K1 2JN0A 4XK8E 1VQ7T 3X28B 1Q86U 2E9XA 3QUIA 1RI0A 5LJ5g 4RKUE 2EJFA 2C5JA 2P0KA 2PUOB 4O2AE 1JB0E 4QW2A 1X79A 4ZHQE 3HL8A 4FJOA 3ZC0A 3RKWA 4H9RC 4ZI2C 3I55A 1BI0A 3OYKA 2QTXA 3I56A 3DLLA 3OYXA 1HS7A 2X9YA 4UV9B 3OB9A 2HH7A 4JRIA 1Y71A 2K9AA 3CMLA 3KINB 4PK5A 4Z02A 1YCYA 2EQJA 4P5NA 2RJFA 2KVQG 2Y8DA 3NZQA 4PNIA 4PJOD 2JMHA 5L3BB 2L89A 5CKBA 1M1KC 4M7DA 1JRIA 3ZFJA 4O8SA 4M7AE 1YI2A 4ZN3A 4ZGEB 5FRMA 1RL2A 2MI6A 1VIEA 3R6NA 2A3LA 1ZHCA 3A8HB 3HKDE 4CI3B 1YKEB 1OYXA 4UVBB 1VQLT 3L2ZA 4IHJE 2JZ2A 3CVRA 2D0UA 2LJLA 4TZ4C 4C8QC 3TU4K 3WXMB 2BVLA 4F7UE 3K3QC 1M1KU 1KHIA 1PSEA 2CLYB 2RI3A 4HTEA 4HGAA 5EK4A 4XU0A 3OYBA 2VGNA 4XTWA 1B34A 3CD6T 4II1A 4C92D 3AB3B 2JVVA 3ZYMA 1LRZA 4DOWA 2JMKA 4N0AA 4UF0B 1D1AA 2YHTA 5J2UE 2XKOC 2EWNA 4J5YA 1KQ1A 2LVMA 5EG2A 2VKHA 1WYBA 1BR2A 2C5IT 3GWHA 5FXVA 1YHQA 5FU6B 3PFSA 2LSKA 3UPUA 3CCRT 4UIGA 2X9WA 4CI1B 2KNDA 5I2MA 3O8VA 4H63H 4FL6A 5I2SA 3C51A 1U8RA 4BY6C 3N9PA 2A2FX 4EB6E 2RJEA 4A54A 2WSFE 4A4HA 5GMKl 5LCYA 4X34A 2CXLA 4M7AC 1VQMA 3M53A 1HFAA 1FMVA 3A8LB 1D1CA 1YITA 2V8KA 3Q1JA 2EYQA 1LVFA 3UUMA 1WJSA 4MDWA 3CPWS 3CQCB 4FI5A 3ZYLA 3DB3A 4XAXB 3JB9I 2DJZA 2CZ7B 2WM9A 2IC9A 2LCLA 3K3OA 5FLXE 3P8DA 4EXTA 3OS0A 5KCOA 4ISTA 2KK4A 4YTLA 3RERA 2W00A 3K3NA 3JCMh 2EHOA 5IN1A 2DXBA 3CCSA 4ZN1A 2DI4A 3M59A 4IE7A 3X26B 1BI3A 1Y64B 2DZ9A 4JEHB 2JOYA 3G6EA 5KH6A 5GAMg 4M7DF 1MIWA 4EPCA 4TX5A 4JLIA 3BDUA 3C4WA 2LCCA 3Q2MA 2CKKA 2CZ1B 3M56A 3RYIE 3MA9A 4PJJA 3F57A 2QI2A 4FIBA 5LJ3d 5HYAA 5IT9E 3SWNA 3O4XE 2HPLA 2CA5A 4E7LA 4IUTA 2NW8A 1G3TA 3JB9D 2LOPA 4PLIA 4E7ZA 3FEOA 4D6WA 5J3BA 3CX8B 4GY5A 4ASKA 4TV9E 3CCQT 1VQ8T 4DVDA 4M77D 1ZV4X 2VKJA 4C0FA 2H3RA 3LX7A 4EDUA 3E1SA 4IE6A 5KCHA 3OYCA 1VQ5A 4E7HA 4QHOA 3NTIA 3QZ9B 3OYIA 2WACA 4BA9A 4HN9A 1BR4A 1OI1A 2LT3A 3JSCA 2FB7A 2PBIA 1U4QA 1MIYA 4MBQA 3PU8A 2Y90A 5GAN3 2LM9A 4E7KA 1B34B 2DWGA 2NWBA 3KV5A 4NUUA 3J9X1 1W2BS 1Y96A 4LD6A 3NZPA 5LHGB 2XDBA 4ELYC 5L3FB 2QEXA 4TN7B 2W62A 2PQWA 3ZJ2A 4GYSA 5C6SA 3PIPA 3L2WA 2HAXA 1VIFA 2CEAA 2GFAA 3MEAA 1FEWA 1FXXA 1WQ7A 4HKEA 2K2VA 4ZI2D 3HKCE 2DTIA 2JQQA 3RKXA 3M54A 2WBLA 4FSXA 2MBGA 4EMKA 3A5XA 4K0UA 2RP4A 1G3WA 1VQOT 4Y28E 3RX6A 1NE8A 3RKYA 4H63V 1VQ4A 3OYFA 3OBYA 2RI5A 3PGGA 1QVGA 3KVAA 2LQKA 3VU7H 5LHHB 3DLMA 2W61A 3OA6A 2OAUA 5LP6E 3OS2A 3JCMf 3NFCA 3UTKA 2WMNA 3RYFE 2ZGWA 3PNWC 5L8RE 2KWHA 3KUFA 1WGSA 4MZTA 4J6WA 2JPFA 3M58A 5FP3A 2EHOB 3BW1A 3KVBA 3I55T 1IREB 2A7YA 4MMKA 3HRSA 2RHIA 4EMGA 3I56T 1ZHIA 4M78A 3ETVA 1H3ZA 3I0OA 3X24B 2DIGA 4XBFB 3MXZA 4GIWA 5HAXA 2LSGA 1UGRB 3CCRA 4M75G 2EFIA 4L5GA 3AAAB 4KBMB 1K9MC 2BKDN 4TV8E 3SWNB 3OYJA 3SFMA 1CUNA 3S3MA 2V1DB 2CLYC 4J2CA 1YI2T 3QSUA 5JDNA 1UX4A 2JTFA 5E0OA 3ZPOA 3PMTA 3KDSE 4PJLA 4BD3A 1HK9A 1VQPA 2PU9B 2WMOA 2DWKA 1BIBA 5GANd 2CCQA 4M7DE 3RIRA 5FMNA 1K9MU 4Z8XA 4C8QG 3CCLA 3JCMV 3TCJA 2FVUA 2X0LB 3JCMe 2D6FA 4JLEA 3RMSA 1WR6A 5FY7A 2GCXA 2L5QA 4ANJA 2L3RA 2GFUA 3QHSA 3CC7A 4M7AD 3C98B 3MJXA 5J1GA 2LX9A 4ZGJB 4MDXA 4VUBA 1Q81C 3ANWA 5DABA 5DLOA 3JB9H 2IVWA 4AKHA 1TH7A 4BE1A 2X67A 5L3CB 2E9XC 4PFPA 5JDFA 4IIJE 3OBVE 1MHNA 2DXTA 2B1EA 3MP8A 4UVAB 4FT2A 5L2LA 1YHQT 4QWNB 4EMKB 2ODUA 5DQVA 1WLXA 4BAYB 5GMKj 5LBMA 4XTYA 3GLXA 1Q81U 2M67A 4O2BE 4O5VA 4MALA 3QK6A 3L09A 3LK2B 3AHUA 1X6OA 2DAQA 3NTKA 1VQMT 3PE0A 4HEAA 4E7JA 3VV0A 3LBXA 4AKLA 3FC3A 5GONE 2MTQA 3JAME 3RYHE 4J83A 1QVPA 1YITT 2L8DA 3ZMZB 3MK7C 3FRNA 5M4YA 4KUIA 4M78F 2IC6A 4RMOA 4FT4A 4M7DC 2RH2A 4Q5WA 1N6AA 5JDMA 5GAOn 3GP8A 1Y7XA 2LT4A 2K4YA 3HRTA 2BDEA 3LFMA 3META 1E1HB 4A56A 5LL6S 2KMFA 4I4TE 3U3IA 4BACA 4C0DB 3CCST 4M78B 2KAFA 2QQSA 3L2VA 4PAGA 5D6YA 1QSDA 3MZKB 5L3EB 1S35A 3G6ET 2NLUA 3NTHA 3DP7A 1YJWT 3MKDA 4DMWA 2XAQB 3ESLA 4BE0A 5CQYA 4WW0A 1XQHA 4J6XA 4EZHA 4QX7B 5CK9A 3J81E 5CKDA 3O9XA 1VQNA 2ZPIB 4O4IE 3J7Yq 5LOVE 1MMNA 4N78D 2BUDA 3VU3C 3QYHB 4BJNA 2Y4XA 3PIOA 1D0YA 5TAOA 4EYUA 2PG8A 4N0AC 2CYZB 2M1HA 3BQLA 5I21A 4V2SA 2UXXB 1G3YA 2VC8A 4BE2A 3DJBA 3UUXB 3H37A 3ZBDA 4H9NC 3RC8A 1UGQB 1VQ5T 3GOXA 1D0XA 4ZI3C 3X20B 2XAJB 4IE0A 2CM0A 5H6QB 4PFOA 3NRXA 3VYGA 1KHCA 4IGUA 2JUFA 2VGMA 2ZLYA 5GAN6 2C5KT 1BI2A 3L2UA 1I81A 2J1DG 5LJ3h 3E22E 3OYLA 3E9GA 4X1IE 4JS5A 5GAOl 3M9QA 3U78A 2M16A 3M4YA 3SS1A 3VHLA 2QEXT 4ISSA 3MP6A 3O1JA 4PJOF 4CQIA 3X25B 1M9SA 1V29B 2EQKA 2L3LA 2LNVA 4ZS2A 5KMGP 3IF8B 4JUVA 3C50A 4I50E 2DZCA 2X9XA 3GN5A 3GMIA 2LHRA 4MHCA 4DMVA 5LXTE 4CXXA 2K3YA 2DLRA 1Y07A 2EHOC 5LJ5h 3BQIA 3E0ZA 5AFUL 4PK4A 3OS5A 3CBOA 5L3GB 1Q82C 2LOSA 1QVGS 1VQ4T 4HCCA 1SSFA 2MAMA 1NZ9A 3F2EA 5JDQA 3CC2A 2E5QA 3QG1A 3NRYA 2KLQA 3FDRA 5LJMA 3HKBE 5D6XA 3WVEB 4PJOG 1IZ6A 1HG2A 3RUXA 3SWNC 3SB2A 2GK9A 2YLCA 2LSJA 4OMFB 2FYKA 2MWOA 5KE3A 2CXDA 3M57A 1YJ9A 4AKGA 2ES0A 5FYMA 2F5TX 3LH0A 1Q82U 4NL2A 3RRWA 4PJNA 4XZCA 2EJ9A 3ZMTB 3VUBA 4X1KE 1M8VA 5LA6E 2X4YA 3JCMg 1BI1A 3GIBA 5IAYA 1MMDA 3QJ6A 5CA0E 1KQ2A 4QXBB 4DBQA 2XICA 4XTXA 2PVOB 2LE8A 4M78E 3HP9A 2E9XB 2E9XD 1HTJF 4C92G 3S6WA 5JDHA 2JNGA 5HXRA 3CXCA 4R55A 1FX7A 4M75A 4JEUB 1OZ2A 4CXYA 4WF2A 5LYJE 1VQPT 2KMTA 3L3PA 2D0TA 3ZMVB 2D0QB 2V7JA 3HRUA 5KE2A 5F3JA 5FNVE 5LJ3f 3CCLT 2W0GA 3WI3A 3GF5A 4A4EA 1UGSB 4EMKC 4I55E 1XTDA 2OTLA 2QA7A 3IBPA 4BUGA 1H641 3LGFA 3CC7T 4C5EA 4CZZB 2XU8A 1YJWA 3N9OA 5FXWA 4WBOA 4U72A 5HKCA 2LTOA 2EQUA 2D2SA 1MMGA 2H3JA 3HFOA 3LJCA 5GAOm 3P8HA 1T98A 1VQKA 4UEMA 3CQXC 1UEBA 1LNXA 4XU3A 3W15B 4M7DB 3INZA 3M5AA 4IURA 2JJ9A 4M7DD 5C8YE 5FXZA 2NOXA 4JUYA 3L1AA 5LJ5f 1XOVA 2X51A 1N9RA 3FIFA 1IJ5A 3EFSA 3GN5B 5GANh 4BI8B 4QQ6A 2CE7A 4GOUA 4CXWA 1UGPB 1JBMA 5DJQC 3VKIA 3KV4A 4LDWA 3CCJA 1S72A 2QXFA 2R58A 4JDSA 3DKMA 4C0DC 2ZMAA 3QKJA 5GAOp 2KXPB 4M78C 3P8CD 4XU2A 4KMCA 5LJ5d 4OB2B 3ZMSB 2EAYA 4J8OA 4MZMA 2PJQA 2RO0A 4PW8A 1Q7YC 3BDLA 3MEVA 3CCUA 4ELZC 3K8PC 5GAMh 3R84B 2O4XA 5LJ3e 3GNFB 3JB9G 1MMAA 1AJ3A 3ZN1B 3L2QA 3OYYA 2G3RA 4M77G 2E41A 2VKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5G A;  2EYQ A;  4XAX B;  4ILU A;  4KMC A;  4MFR A;  4KBM B;  2LT1 A;  2LT3 A;  2LT4 A;  2LQK A; 
#chains in the Genus database with same CATH topology
 4OFZ A;  1OZ3 A;  3QO3 A;  4MZP A;  1I94 T;  4H9S E;  1KJW A;  2R57 A;  1YJW Q;  5F8P A;  3MEW A;  4ZI3 D;  4O4H E;  2KI7 A;  1HG5 A;  1C0M A;  4Z89 A;  1ZSZ B;  3H3M A;  2PNI A;  4F14 A;  1WXT A;  5LHI B;  3B13 A;  3OYE A;  2LC4 A;  2VQF T;  2H8H A;  8AT1 B;  1VQK Q;  3P4S A;  2I0N A;  2Z0W A;  4HKA A;  3WAK A;  3BY7 A;  5JR9 A;  1R8O B;  2XHC A;  1GXI E;  2MMP A;  1Q7Y U;  3JCM c;  3HHT B;  2DNU A;  3CK6 A;  2AZV A;  2CWO A;  1UUE A;  2XQ3 A;  5JRC A;  2EKO A;  5LJ5 e;  1WHG A;  2XJ7 A;  5EK3 A;  2GF7 A;  4M75 F;  5KYY A;  1VQN T;  1WCR A;  4YJ2 E;  5FL1 A;  3FHN A;  1X6B A;  4TNV A;  4C5G A;  2E6Z A;  2WZI A;  5KXJ A;  2K48 A;  1WHK A;  4CC3 A;  3N9N A;  3PTR B;  2ZPG B;  1FIO A;  2K5B B;  3FBL A;  4M75 B;  4ZZC A;  1S72 Q;  2DX1 A;  1SSH A;  1JJ2 A;  4X9D A;  4HWF A;  2JM9 A;  5CAI A;  3UU6 A;  2PTF A;  3PUX F;  3RGL A;  2O9V A;  2J62 A;  3KFW X;  4QVZ A;  3HSB A;  4UEL A;  2I59 A;  2W67 A;  1ABO A;  2V1R A;  4OVA A;  2EHO D;  1Q7Y R;  4M1P A;  3S4U A;  3CPF A;  4DBF A;  3JCM J;  3CCU Q;  3ZL7 C;  2FJD A;  2EJG A;  4QQG A;  3Q9D A;  1LVK A;  2V5C A;  4QX8 B;  2DD5 A;  1QVG P;  4U2Z A;  3ONL C;  3CME A;  3C4S A;  4HE8 A;  3M0Q A;  1YCS B;  2YRC A;  5HXC A;  4C8Q F;  2XG8 D;  3HL6 A;  2DCF A;  1PM3 A;  3SEM A;  2X9H A;  2P4R A;  3C4Z A;  2Q9Q A;  4K0K T;  2HQE A;  2UU9 T;  4QH1 A;  3TLV A;  3ZEH A;  4A4G A;  5GAN f;  2VK9 A;  5DY9 A;  1I5O B;  2LEH A;  4ATO A;  4H9P C;  3EGU A;  2M6I A;  2VWF A;  1M4Z A;  3OYZ A;  1BCO A;  4EMH A;  1SA0 E;  5GAO q;  2VKO A;  2XY8 B;  4C0G A;  2AT1 B;  3EAE A;  2DL5 A;  3H6Z A;  3QBY A;  2P0Q A;  2YRV A;  2XAH B;  4J7I A;  4AFS C;  2CXF A;  1U5P A;  2RK2 A;  5CFB A;  2P9B A;  4MML A;  3AE6 A;  1N27 A;  2HD0 A;  2DYB A;  4RTY A;  4B9W A;  3QWY A;  3AT1 B;  4EZ4 A;  2ZPB B;  2Z6E A;  3MCA B;  2VL8 A;  1ZLM A;  3UA7 A;  3SWH A;  2RB6 A;  4J7F A;  2DKG A;  3QZ5 B;  1KIK A;  2E70 A;  2XTL A;  4LDV A;  3QJY A;  5IYZ E;  5GAN 2;  1WX6 A;  4LFA T;  3M0U A;  4E47 A;  2L8K A;  1PSF A;  4BI3 A;  2JS2 A;  4PL6 A;  1OXZ A;  3BE3 A;  2CHO A;  4XTV A;  5GAM f;  3J80 E;  3HFN A;  3IEE A;  3QXE B;  3RKO A;  3H3A A;  4IL4 A;  3UU4 A;  3ASK A;  4UV8 B;  1YW0 A;  3CC2 T;  3RQU A;  3MEU A;  5GMK i;  2F5K A;  4CN4 A;  1RI9 A;  2I2L A;  3HKS A;  2BG9 A;  4O4L E;  2BZB A;  4U74 A;  1IBM T;  2PVD B;  1RAH B;  3HPW A;  3OYG A;  2QAZ A;  2JW4 A;  3CWZ B;  1WJQ A;  5FWB A;  1Y96 B;  4LMK A;  2RQU A;  3UUB A;  2NWM A;  4PK6 A;  5HY6 A;  3PUG A;  3LK4 2;  2BS4 A;  3N5L A;  1KEY A;  3EDU A;  1XNQ T;  2NUP B;  4M4Z A;  4XTU A;  2ZZD A;  3JV3 A;  1S94 A;  3SD4 A;  2D9T A;  4KHP T;  3ZN0 B;  1YJ9 T;  2BKN A;  1US7 B;  1WQW A;  2E65 A;  5GAM d;  3EG0 A;  2OTJ A;  2RHX A;  3CME Q;  5IH2 A;  1MGQ A;  4H9Q C;  2UXN B;  2EVR A;  4IE4 A;  2HBP A;  1GCQ C;  2R5A A;  2MOZ A;  2UUB T;  3RH3 A;  1UGV A;  1PC0 A;  2ZCF B;  3KBT A;  5JR9 B;  5GAN e;  2CPT A;  1X01 A;  2AIR B;  1BR1 A;  3CC4 A;  4P09 A;  1H7C A;  1PD1 A;  3JRZ A;  1O3X A;  5JRC B;  3CCV A;  2C0T A;  4PJO A;  4OK0 A;  1NPP A;  5KYY B;  3SHW A;  1XDP A;  3UFG A;  4B3T T;  3A98 A;  2V7L A;  5CJ5 A;  2C0O A;  1LPL A;  2JXB A;  2QA4 A;  1D1B A;  4NIQ A;  4M7A G;  3A5Z B;  5HWY A;  3LYI A;  1GFD A;  2YK0 A;  2E5L T;  1LKX A;  2DMO A;  2NW9 A;  4JV5 T;  3R6O A;  3EG3 A;  2CP5 A;  3UWN A;  3E19 A;  3C94 A;  3AA6 B;  5J39 A;  4I0U A;  1N9S A;  3CXC S;  2YN6 A;  3I9W A;  2K5I A;  1BYM A;  1AZG B;  1VQP Q;  2KT9 A;  3RR6 A;  1NJI C;  4E7S A;  2PZ1 A;  2LHN A;  2OX7 A;  3EG1 A;  1BR0 A;  2EYX A;  3PUS A;  4DR5 T;  2KRS A;  3ZT7 A;  4IUV A;  4KH0 B;  5GAM e;  4OMM A;  2X68 A;  1UK5 A;  3JC6 C;  2LZ6 B;  3EGX A;  4B3S T;  3F31 A;  1KNR A;  4N4G A;  1N33 T;  3UUN A;  3RQW A;  4F7U G;  3ZEF B;  2ATC B;  1CSK A;  1EFN A;  3H0F A;  5EZY E;  2KNB B;  3G71 A;  4HWC A;  3OS1 A;  1NEK A;  5JVD E;  1JEG A;  5AQV B;  2J05 A;  3VUZ A;  3QUJ A;  2KSS A;  4M78 D;  1OWA A;  5HXS A;  2FPD A;  5CO7 A;  3UT5 E;  1ABQ A;  4GLK A;  2OTL T;  2AHJ B;  4JPB W;  1SPK A;  2E10 A;  1JO8 A;  2W63 A;  2EGA A;  3JCF A;  3Q5W A;  3LDQ B;  3PUA A;  3Q5X A;  4OYK A;  1SEM A;  2SEM A;  2ZPH B;  4M75 E;  4C92 A;  4OB3 B;  2Q9Q B;  5AQM B;  3OTO T;  3AA1 B;  1IAP A;  4X62 T;  3RDV A;  5AQI B;  1YIJ A;  3JCM Q;  2DNX A;  1E7P A;  3NGP A;  1TWB A;  2KWI B;  4DQ2 A;  2N9D A;  2NP9 A;  2LT1 A;  4C0Z A;  4ZGD B;  1VQK T;  2OTJ Q;  2ECZ A;  4G2A A;  2LP5 A;  4OMN A;  1YD8 G;  5LJ3 g;  2ZM0 A;  4QVD A;  2K3X A;  4TWH A;  3JB9 J;  3G4S A;  2QYW A;  2JIW A;  2XHE B;  2G0U A;  4QKN A;  2PVG B;  2LMJ A;  1K73 C;  4JYA T;  2BBH A;  1BK2 A;  3CC4 Q;  2F69 A;  2XQ7 A;  3P4P A;  5IUX A;  3N9L A;  1GFC A;  2W2U A;  5ABF A;  2ZAE A;  2ZM8 A;  3GNG A;  2H7O A;  5KYX A;  3CCV Q;  5GAN 7;  4FCY A;  3LW5 E;  4D8D A;  2D9D A;  2WWV A;  3ZYK A;  5HEO A;  4XQ3 A;  2V8I A;  2O9S A;  3P4Q A;  2SPC A;  4EAH A;  2QA4 Q;  4ME7 A;  5FU7 B;  5A0G A;  2CWY A;  1IHV A;  3FXD B;  2RQT A;  3CCJ T;  1S72 T;  3CCE A;  2MWP A;  2WP9 A;  1RAC B;  2QQR A;  2VWA A;  1G8X A;  3MAC A;  3I35 A;  4C8Q E;  5LG4 A;  3AAI A;  2N1G A;  2F4V T;  3V5S A;  4TNW A;  2V6Y A;  1ZSZ C;  2AZS A;  2LJ1 A;  1NJI R;  1AZE A;  2IUB A;  4DV7 T;  2VV5 A;  4XTZ A;  1E2A A;  3GBQ A;  3RYC E;  4ZTF A;  1W0B A;  3N2K E;  2XK0 A;  5ADX L;  4Z8A A;  3FZK B;  5CKH A;  3FJP A;  3CCU T;  3AE1 A;  3ANW B;  1K73 U;  3MPU B;  5HXH A;  4JJD A;  1SHZ C;  3C64 A;  3M55 A;  3PJA A;  5AQT B;  4RCC A;  4QVC A;  2E8I A;  2ZM2 A;  4RTX A;  1AOJ A;  2RQW A;  3G71 Q;  3F70 A;  1Z8U A;  5IWA T;  2G6F X;  4BB7 A;  3AVS A;  1UUS A;  1ZQ1 A;  3WAJ A;  5GAN 8;  4B6X A;  2X35 A;  5GJW B;  3HR0 A;  2M0O A;  1IRX A;  3UQ7 A;  3TKL B;  1YJN T;  3E08 A;  2XSA A;  1MIV A;  2DL3 A;  5CKF A;  1QWF A;  5LGN B;  4M75 C;  2LDM A;  4CI2 B;  4AMC A;  5J2T E;  4OP0 A;  1Q86 R;  4XU1 A;  3ZJ1 A;  3AEC A;  2DD4 A;  5FRN A;  2VXF A;  1ZBX A;  4OGC A;  3A8O B;  3VS1 A;  3VRB A;  2LKH A;  3PUR A;  4AKR B;  3EFR A;  4OML A;  4IDZ A;  4ZS3 A;  2RA1 A;  4F6R C;  3ZCJ A;  4DBH A;  3LH5 A;  4B9X A;  4PJO B;  2KQW A;  1K8A C;  2Y48 B;  1VQN Q;  4AIU A;  2DER A;  4FSS A;  2OJ2 A;  2VYT A;  2ZPF B;  5M9O A;  4AQF A;  3U23 A;  3RRC A;  4IDO A;  1AWO A;  3OBW A;  3ZMU B;  1HXD A;  4QH5 A;  2FJE A;  3OYM A;  1K73 R;  2YUQ A;  3G1J A;  4DR2 T;  2YLB A;  4ZI7 E;  1QVF A;  1VQ6 A;  2RD1 A;  3EHR A;  2LQ8 A;  4GYR A;  2CDT A;  4N4I A;  1YKH B;  4HFD A;  2Y4Y A;  4M77 A;  1VCS A;  3LBX B;  5D7U A;  2D5U A;  3NKZ A;  3QPH A;  1LOJ A;  1VUB A;  4RCB A;  5AYF A;  1KQS A;  2JMC A;  4AIS A;  4HCK A;  3UT1 A;  5FY1 A;  2M9U A;  5DQW A;  2VB6 A;  4IL9 A;  1ZKE A;  3EI0 A;  1JJ2 S;  5CA1 E;  2HBW A;  4L9I A;  1O9S A;  4NS5 A;  5HCM A;  3SOL A;  4WNK A;  4ZEY A;  2E3I A;  3EGX B;  4JZ3 A;  4ILC A;  4LDX A;  3OMG A;  4JJN K;  2C0I A;  4C92 F;  2DEQ A;  3OY9 A;  4ILB A;  1KK7 A;  3N2G E;  2B86 A;  5J26 A;  2CRE A;  3FB2 A;  2ODV A;  1H3H A;  4ZZB A;  1K8A U;  1FMW A;  2JQK A;  4RG8 A;  3N9M A;  1XMQ T;  5ABH A;  4Z90 A;  1OX9 A;  3BQK A;  2I6H A;  2K7A A;  3J7A F;  2LRQ A;  2FJB A;  2B8A A;  1KNZ A;  4RTW A;  2RA2 A;  4L0R A;  2V7K A;  2OLT A;  3AE7 A;  4C92 B;  5A0L A;  3CME T;  1VCT A;  4MLK A;  3WVD B;  5AT1 B;  1IO6 A;  2WDQ A;  5LGU B;  2K57 A;  2CZ6 B;  3D0T A;  5LGT B;  2IG0 A;  5HK3 A;  5IXF A;  3L2R A;  1H92 A;  3AE4 A;  4HFB A;  4CI0 C;  4QXH B;  4HFV A;  4TUY E;  2X4J A;  2HPJ A;  1KD1 C;  5GAO r;  2ZPE B;  5ETW A;  3PDY A;  2BKO A;  3AVR A;  2HHH T;  3ZLI A;  4U7I A;  3CCM A;  3N9Q A;  3OYA A;  1BCM A;  1J5E T;  3CKD A;  1WIE A;  1M27 C;  1XNI A;  5CQX A;  3I9Y A;  3FZF B;  5HWX A;  3OSV A;  2ROL A;  3OJA A;  2LNH B;  1LJO A;  3VJP A;  4OMO A;  2DTO A;  1X27 A;  2DIL A;  2A37 A;  5DM7 R;  2X4X A;  2P4T A;  2QQB A;  3LLR A;  3G06 A;  4HWI B;  3T8O A;  4QH4 A;  3RLF F;  4PNO A;  1M90 C;  4HT9 A;  3GPL A;  3CMA A;  1QMC A;  1VQ6 Q;  2WB5 A;  3JCM W;  4O4J E;  2CS7 A;  5JRE A;  2DL8 A;  4NPP A;  4IUU A;  3T9N A;  1B7T A;  2LSI A;  5GAN g;  2DXC A;  1ZUU A;  5LJN A;  3PTA A;  3PVQ A;  4AXP A;  1MV3 A;  2YU1 A;  2YEV C;  5F5W A;  2V6Y B;  2QDY B;  1XZY A;  4L6V 5;  2P0P A;  1QCF A;  2RI2 A;  1KD1 U;  4FM4 B;  1D3B A;  2FRY A;  2UXC T;  2IAK A;  4Z91 A;  5JR9 C;  1R77 A;  3ME9 A;  2A72 A;  5CB4 E;  2HSP A;  4DUZ T;  2PUK B;  2FEI A;  2HKQ B;  2RHU A;  4KP3 C;  2ESW A;  4JLG A;  2A0F B;  4JJC A;  3CBM A;  1M1F A;  4DR6 T;  4J9I A;  3MP1 A;  2DHR A;  3RPU A;  2AK5 A;  2HMA A;  1WPY A;  2KGT A;  2NTY A;  3CXC P;  5CVI A;  3EDV A;  4JRQ A;  3I0Q A;  5FL0 A;  1IGQ A;  1NBE B;  3V8L A;  2WU5 A;  3RC3 A;  1UFF A;  3JCM b;  3EUH A;  5LBQ B;  4FYV B;  4YSY A;  2OA5 A;  2RM4 A;  3QII A;  3RES A;  2M6B A;  3M0P A;  2XMF A;  1WHL A;  4G63 A;  4DUY T;  1M90 U;  4LML A;  1ZP0 A;  2K24 A;  2I0M A;  3JC6 D;  4JI7 T;  4EIW A;  4PKC C;  5KYU A;  3A8M B;  2OV9 A;  4Y91 A;  2DVJ A;  2OTJ T;  1QWE A;  3OKQ A;  3JAD A;  1OPL A;  4C8Q A;  3JB9 F;  1X43 A;  3UA6 A;  4HCZ A;  4MFR A;  1MND A;  2RNA A;  2BG9 E;  4EIK A;  3O1I A;  3V8J A;  4Z88 A;  2K5L A;  4JI2 T;  3AE9 A;  3AAE B;  2HQH A;  4M77 F;  3OYN A;  3OW2 A;  2E64 A;  1AVZ C;  3UDC A;  2XDD A;  1NAF A;  3CC4 T;  2RQV A;  2VVS A;  2F2W A;  2XAF B;  1VQ9 T;  4LD9 K;  3ZC1 A;  4EYY R;  1VA7 A;  3CCV T;  3HKE E;  2VAS A;  5AQJ B;  4ERR A;  2PTK A;  2YDL A;  4QQD A;  4YT0 A;  3RIF A;  1Y0M A;  4NUV A;  4UVC B;  2LJ0 A;  3OMC A;  3CCM Q;  2H89 A;  1VQ7 A;  2QA4 T;  3URG A;  3FLG A;  4M77 B;  4X20 E;  4DA4 A;  2KY9 A;  2DET A;  2IW5 B;  1SRM A;  4H9O C;  2N2N A;  4DND A;  2EYW A;  2RHY A;  2RJC A;  5CGM A;  1UB4 A;  3MHX A;  3GA8 A;  1SKU B;  2YKS A;  2COZ A;  3CEY A;  1UCU A;  1UX5 A;  1ZEE A;  1X6G A;  3VS7 A;  5LJ3 j;  2Q9Q C;  4BDY A;  2JM8 A;  5FY0 A;  3SFD A;  5JDG A;  3QDR B;  4N4H A;  2V8J A;  1BB9 A;  1SRL A;  1TUC A;  3AXJ A;  3CMA Q;  3SRZ A;  4PJO E;  4LUE A;  4M7D G;  5JDL A;  4C5H A;  5GMK h;  2FHD A;  2XAS B;  1V76 A;  4J9H A;  4KGZ B;  5A2Q E;  4JS4 A;  2CHN A;  3N2O A;  3H8Z A;  4J6Y A;  5HEG A;  4RG2 A;  4BI4 A;  1NEN A;  4DV1 T;  2HQX A;  3ABV A;  4GK0 E;  2XPK A;  2K9G A;  3V7R A;  3G71 T;  4M7A A;  2E5K A;  1YJN A;  3SDZ A;  5FRO A;  4DR3 T;  1RAE B;  4IE5 A;  2MIO A;  1HX8 A;  4UC4 A;  2CGH A;  3CX7 B;  3M0R A;  2C06 A;  4AQG A;  4AKI A;  3S3O A;  2HNI A;  3C4X A;  2KSR A;  5LJ5 j;  5FU7 C;  3V8K A;  3E9F A;  1G5V A;  2V6X A;  4U3C A;  3BFM A;  3UAT A;  1GL5 A;  4WBN E;  4U2Y A;  2LRK A;  2YOE A;  1OPK A;  5D6W A;  1YIJ T;  2WSC E;  3EG9 B;  3QYG B;  2HL3 A;  3CBP A;  2CSQ A;  1W4S A;  2BG9 C;  3G4S T;  2NTX A;  2DIQ A;  4F7U A;  5KDM C;  3VRZ A;  1RAI B;  1JU5 C;  2BBJ A;  4YSZ A;  4FU6 A;  2C0S A;  4C92 E;  1W0A A;  3RHW A;  2X4W A;  4E6R A;  3HA4 A;  5HEH A;  5JQG E;  5IHY A;  3AEE A;  3CPZ A;  4HFE A;  3TLT A;  2WSE E;  3KBG A;  4HA8 A;  5A0D A;  1VQL A;  5GAN 5;  4JRP A;  3ER0 A;  3CCJ Q;  1IZN B;  4M75 D;  4OF1 A;  3H0I A;  2XQY A;  5GMK m;  3VKH A;  1VQ7 Q;  2V26 A;  2LCS A;  5BMV E;  4JI1 T;  4LXC A;  3V7S A;  1XWM A;  1EZ3 A;  4JBW F;  3OQ5 A;  3CCE T;  1M3C A;  2DYI A;  3MO8 A;  3PUV F;  4AI6 A;  5HK0 A;  4KX6 A;  3DTO A;  4IDN A;  4OYJ A;  1D3B B;  1B07 A;  1VRB A;  1Z0P A;  3V5U A;  1P92 A;  2CH4 W;  3HI2 A;  2NW7 A;  2WQY A;  2E6N A;  5L3D B;  4DOV A;  1NWM X;  2K5F A;  2QGF B;  2EIF A;  1U1T A;  2CZ0 B;  3OYD A;  5EK2 A;  1IBL T;  3FBZ A;  3CD6 A;  4A53 A;  1YBY A;  4PJO C;  2WAU A;  2YIN A;  3OVU A;  5JH7 E;  4UXN B;  3NHN A;  5H6R B;  2VUB A;  2QDL A;  1MNE A;  1T0J A;  4QXC B;  4YY3 T;  4NXM T;  2YDR A;  1WJR A;  1EIF A;  1VYV A;  4GK5 E;  3VRA A;  9ATC B;  3OYH A;  3LWI A;  3RBB B;  3CQG B;  1QW1 A;  2JRK A;  4P0A A;  2YDQ A;  1YNZ A;  4KUD K;  1N8R C;  1JJ2 P;  2DJQ A;  3ULR B;  1YJN Q;  5KYU B;  2DVE A;  4FYX B;  3AEF A;  1DU2 A;  2FG0 A;  4C8Q B;  3KBU A;  2GBQ A;  2BVM A;  4C8Q D;  1W09 A;  5HXE A;  4HXJ A;  2IPO B;  3JCM d;  2KR3 A;  4DO0 A;  1HCI A;  3G7Z A;  5C0M A;  2XDP A;  1D0Z A;  3TRE A;  2WWU A;  2H7V C;  4BJM A;  4ZOL E;  3ZT5 A;  4QT7 A;  4A63 B;  3M0T A;  4IDP A;  2DK3 A;  4C5I A;  5CR2 A;  4X65 T;  3KV9 A;  4YSX A;  2YUN A;  2SRC A;  2O88 A;  4C91 A;  3RF1 A;  3P7I A;  2L0A A;  2RJD A;  2DBM A;  1QVF S;  1R0B G;  2RQR A;  2ACX A;  5LNK A;  1PG5 B;  1F1B B;  1VQ6 T;  3TEE A;  3M0S A;  5CCA A;  1IGU A;  3ONX A;  4DBR A;  3HTR A;  2RHZ A;  4C92 C;  4OB0 B;  1N8R U;  1KQS S;  1I5L A;  1TOV A;  4U31 A;  2E1H A;  2RK1 A;  4LF5 T;  2XUE A;  1IB8 A;  3V7C A;  1XNR T;  3CPW A;  1FYN A;  2ACZ A;  2QVA A;  4M7A F;  1HNW T;  3NBX X;  2O4X B;  3REB B;  2M02 A;  2DL1 A;  1I1J A;  3QDF A;  1WRD A;  4BY6 B;  1M8M A;  3C12 A;  1O75 A;  3ZCI A;  2PFV A;  4I43 B;  1N32 T;  1OED E;  4PJM A;  1U5S A;  2VXE A;  4LDU A;  4RTT A;  1ZSG A;  3I1A A;  3KV6 A;  3P8B B;  1WFD A;  2MPX C;  4A4F A;  4YLH A;  4JZ4 A;  5FU6 C;  1HR0 T;  1BKB A;  1YIJ Q;  3ZST A;  3LGL A;  2J6F A;  4C90 A;  2V7I A;  4ZTJ A;  2V7M A;  4IUQ A;  4U33 A;  3PT9 A;  1ZOY A;  4M77 E;  4M7A B;  1K0S A;  2L3Q A;  4HT8 A;  4KUM B;  2BE7 D;  3CD6 Q;  2W66 A;  3REA B;  2XQ5 A;  5FXX A;  3C95 A;  4ILU A;  2A08 A;  3LWH A;  1KC8 C;  3PMI A;  5GAN j;  3EGD A;  2EGE A;  3PUQ A;  3KXT A;  3B57 A;  4F7U F;  2Y6X A;  1IJ6 A;  3OPC A;  3CX6 B;  1N8R R;  3O1H A;  2KZ7 B;  2V1Q A;  5KX5 E;  1BU1 A;  1VQ9 A;  4OHF A;  1M1G A;  4KT0 E;  3BK9 A;  3EVY A;  1BIA A;  3AA0 B;  2QGG A;  1MUZ A;  1G73 A;  2XZE A;  1VOM A;  7AT1 B;  2BTT A;  2KDS A;  3EH1 A;  1GBQ A;  1QP2 A;  3NPF A;  4BDZ A;  2LQN A;  4YHJ A;  1DJ7 B;  1PKT A;  2WSS V;  2R5M A;  3CCQ A;  1U06 A;  1X75 C;  4F7U B;  1VQ8 A;  1K9M R;  1RAB B;  5DLQ E;  2E12 A;  4L59 A;  1NPR A;  2MF2 A;  2MYS A;  3CCM T;  1NM7 A;  2M51 A;  3JCM P;  2EQI A;  2XD0 A;  2XAG B;  3B5M A;  1LCK A;  1BBZ A;  1M62 A;  5GAM j;  2J4G A;  2VVN A;  3QC9 A;  1N5Z A;  1KC8 U;  2CP0 A;  4KRT A;  3JCM X;  2L9Q A;  3RIA A;  4EOZ B;  2YUO A;  5GMK e;  2CP6 A;  2ED0 A;  3CMA T;  3AE5 A;  2KYB A;  4R56 A;  1AWW A;  3TVT A;  3ONJ A;  4LFC T;  4KUL A;  2J7I A;  2MOX A;  4AFU C;  2XID A;  2CMR A;  1M5Q 1;  4NOY A;  1OQK A;  2DTH A;  4OB1 B;  2DBK A;  4E7I A;  4HVU A;  2XI9 A;  2MPK A;  3T1Y T;  4A4K A;  3M4G A;  2AE9 A;  4F8H A;  2CP2 A;  1M2O A;  4J9G A;  3LK3 B;  5CKE A;  2BZX A;  4NL3 A;  3PU3 A;  3M65 A;  1N34 T;  4X9C A;  2XSB A;  4AQF C;  2OI3 A;  3OSS C;  1W2B A;  1TXQ A;  3VYH B;  5L4E A;  4CRI A;  2Q9Q D;  1Y57 A;  1I8F A;  4JRK A;  4ADZ A;  4OGE A;  4IKF A;  1KG1 A;  2QQ9 A;  4K11 A;  4LDY A;  4YFS A;  2QGS A;  4P0B A;  4UF0 A;  1QP3 A;  1WNL A;  2BIV A;  1Q86 C;  4M77 C;  2YU2 A;  4O6J A;  1KC8 R;  4YJ3 E;  2CSI A;  1QUU A;  4FW2 A;  4TVR A;  1Q81 R;  4HCB A;  5CIU A;  3LG7 A;  3AA7 B;  3S3N A;  1V9D A;  4P1N A;  1U1S A;  3DB4 A;  3QB5 K;  1NLO C;  1KFZ A;  2FL7 A;  3VR8 A;  2DXU A;  1FWZ A;  1AHJ B;  3RMQ A;  3PV0 F;  3OW2 S;  3L42 A;  1VQ9 Q;  3N5B B;  3JAF A;  2DO3 A;  3A8G B;  3FB9 A;  1VQO A;  1AWJ A;  2JTM A;  3VKG A;  2LSY A;  3EFO A;  2K6D A;  3FXE B;  3L8R A;  4LF9 T;  2F2V A;  1HF8 A;  1QQJ A;  2KIN B;  1XMO T;  3TSW A;  3UUL A;  2A3D A;  3UFE A;  4PLL A;  4A98 A;  1K76 A;  5GAN 4;  3CCQ Q;  2EQM A;  4X1Y E;  1ZBJ A;  1VQ8 Q;  4V1A v;  2GQV A;  2DPP B;  3IHR A;  2GQI A;  2QQA A;  4M78 G;  2X66 A;  1G3S A;  5A1L A;  4HFI A;  2O01 E;  4X5T A;  4IUP A;  1WYC A;  3ETU A;  1I4K 1;  2JN0 A;  4XK8 E;  1VQ7 T;  2EYY A;  4ILA A;  3X28 B;  4NXN T;  1Q86 U;  1HSQ A;  1RAF B;  2E9X A;  3QUI A;  1M30 A;  1RI0 A;  5LJ5 g;  4RKU E;  1PHT A;  4LF6 T;  2V8S V;  2EJF A;  4B6M A;  2C5J A;  2BG9 B;  2P0K A;  2PUO B;  2DA9 A;  4O2A E;  1SE7 A;  4IIO A;  1JB0 E;  4QW2 A;  5HEJ A;  1X79 A;  4ZHQ E;  1PNJ A;  3TLS A;  3HL8 A;  2IIU A;  2X3W D;  2H88 A;  1OUL A;  4FJO A;  2XM2 A;  3ZC0 A;  3RKW A;  1ZX6 A;  4H9R C;  4ZI2 C;  3I55 A;  1BI0 A;  3OYK A;  3M3Z B;  4R0K A;  2QTX A;  3I56 A;  3DLL A;  3OYX A;  1HS7 A;  2JT4 A;  2NYS A;  1EX4 A;  2X9Y A;  4UV9 B;  1UDL A;  2KRM A;  3OB9 A;  2HH7 A;  4JRI A;  1Y71 A;  2K9A A;  3CML A;  2RF0 A;  2YXY A;  2FZG B;  3KIN B;  4PK5 A;  1QKW A;  2CUD A;  1YCY A;  4Z02 A;  2EQJ A;  4P5N A;  2CH4 A;  2RJF A;  3UF4 A;  3UU3 A;  2KVQ G;  3A1P A;  2Y8D A;  2JS0 A;  3NZQ A;  4PNI A;  1GQE A;  3AED A;  2K2M A;  4PJO D;  2JMH A;  5L3B B;  2EBP A;  2L89 A;  5CKB A;  2CUB A;  1M1K C;  4M7D A;  1JRI A;  3ZFJ A;  3G4S Q;  4O8S A;  2J6O A;  1OED A;  4M7A E;  1YI2 A;  3I5R A;  1E6G A;  1A0N B;  4AFZ C;  4LNP A;  4ZN3 A;  1MV0 B;  4ZGE B;  5FRM A;  1RL2 A;  2MI6 A;  1VIE A;  3R6N A;  1WXU A;  2A3L A;  2JMA A;  5LMU T;  1ZHC A;  1VQO Q;  3A8H B;  3HKD E;  1YXR A;  4CI3 B;  3P4R A;  5FWC A;  2RMO A;  4RTV A;  1YKE B;  4EEB A;  2YDS A;  2QTV A;  1OYX A;  3UQ4 A;  1RLQ C;  3RI5 A;  4DID B;  4UVB B;  1VQL T;  2KT8 A;  3L2Z A;  4IHJ E;  5C3J A;  2JZ2 A;  3CVR A;  3CCE Q;  2D0U A;  4RTU A;  4LFB T;  3EG2 A;  2DM1 A;  1QCO A;  2LJL A;  4TZ4 C;  4C8Q C;  1CKA A;  3TU4 K;  3WXM B;  5KYW A;  3ZSS A;  2BVL A;  3PVL A;  4F7U E;  2KXC A;  2KYM A;  3K3Q C;  4DR1 T;  1M1K U;  3Q5D A;  1OEB A;  1KHI A;  1PSE A;  1WR0 A;  2CLY B;  2RI3 A;  4HTE A;  4HGA A;  5EK4 A;  4XU0 A;  1QVF P;  3AE8 A;  3OYB A;  5AQG B;  2VGN A;  4XTW A;  3PUZ F;  4HWD A;  1B34 A;  3CD6 T;  2HN2 A;  4II1 A;  4C92 D;  3AB3 B;  2JVV A;  3ZYM A;  1LRZ A;  5BR8 T;  1PWT A;  1R8I A;  2JMK A;  4N0A A;  4DOW A;  1KQS P;  4UF0 B;  1D1A A;  2YT6 A;  2YHT A;  5J2U E;  2XKO C;  4HFC A;  1WI7 A;  2EWN A;  1T8B A;  2DFU A;  4J5Y A;  1KQ1 A;  2LVM A;  3VS5 A;  3E2U A;  5EG2 A;  2VKH A;  1WYB A;  2X0Y A;  1BR2 A;  2C5I T;  3GWH A;  5FXV A;  1YHQ A;  1ZUY A;  5FU6 B;  1YFN A;  4IIM A;  3PFS A;  2VUR A;  2LSK A;  3UPU A;  3CCR T;  4UIG A;  2X9W A;  4CI1 B;  2KND A;  5I2M A;  5ABF B;  3O8V A;  4F04 B;  4H63 H;  4FL6 A;  1I07 A;  6AT1 B;  5KYX B;  3EFO B;  5I2S A;  3C51 A;  1NYF A;  1U8R A;  5AQO B;  4KGV B;  4BY6 C;  3N9P A;  1TU0 B;  1M1K R;  4YHH T;  3A8Y C;  4DV6 T;  2A2F X;  4EB6 E;  1CKB A;  2RJE A;  2HL5 C;  2WSF E;  4A54 A;  4A4H A;  2RPA A;  5GMK l;  5LCY A;  4B3R T;  1YI2 Q;  4X34 A;  2CXL A;  3QB5 A;  5AQU B;  4M7A C;  1VQM A;  4WZX A;  4LN2 A;  3M53 A;  1HFA A;  5IXB A;  1FMV A;  3A8L B;  1GBR A;  1D1C A;  1YIT A;  2V8K A;  3Q1J A;  2EYQ A;  1LVF A;  3UUM A;  2GGR A;  1WJS A;  4JJB A;  3UU8 A;  4MDW A;  3CPW S;  3CQC B;  4FI5 A;  3ZYL A;  3DB3 A;  4FYY B;  4XAX B;  3JB9 I;  2KRO A;  1J3T A;  2V5D A;  2DJZ A;  2CZ7 B;  2EW3 A;  2WM9 A;  2IC9 A;  5AQR B;  3K3O A;  2LCL A;  5FLX E;  1B3Q A;  2AKL A;  2A28 A;  4EXT A;  3P8D A;  2XQ9 A;  3OS0 A;  3FZH B;  5KCO A;  4IST A;  2KK4 A;  4YTL A;  5IHN A;  3RER A;  2W00 A;  3K3N A;  4JI0 T;  3JCM h;  2EHO A;  3EHZ A;  5IN1 A;  2DXB A;  1W70 A;  3CCS A;  4ZN1 A;  2DI4 A;  4LMJ A;  3M59 A;  4IE7 A;  2JTE A;  5AQN B;  3X26 B;  1BI3 A;  1Y64 B;  2DZ9 A;  4JEH B;  2JOY A;  1PCX A;  3G6E A;  5KH6 A;  5GAM g;  5FKY A;  4M7D F;  1WHJ A;  2FZC B;  1MIW A;  2DRM A;  4EPC A;  1TSF A;  4TX5 A;  1HNZ T;  4JLI A;  1UGO A;  3BDU A;  4X1V A;  3C4W A;  2LCC A;  1ACM B;  3Q2M A;  4Q25 A;  4CC7 A;  2CKK A;  2CZ1 B;  4DEX A;  3M56 A;  3RYI E;  3MA9 A;  1WXB A;  4PJJ A;  3F57 A;  4A97 A;  1OV3 A;  2QI2 A;  4FIB A;  5ABE A;  4CC2 A;  5LJ3 d;  1WHH A;  4YTM A;  5HYA A;  3SWN A;  5IT9 E;  3O4X E;  2HPL A;  3ZKR A;  1OED B;  2CA5 A;  4E7L A;  2XQ6 A;  2NW8 A;  4IUT A;  4EGW A;  1G3T A;  3JB9 D;  2LOP A;  4PLI A;  4E7Z A;  3FEO A;  4D6W A;  5J3B A;  3CX8 B;  4GY5 A;  4ASK A;  2L2P A;  2FBW A;  4TV9 E;  3CCQ T;  1VQ8 T;  4DVD A;  4M77 D;  1UTI A;  3EHQ A;  1ZV4 X;  2H3E B;  1WZO A;  2VKJ A;  4C0F A;  2H3R A;  3LX7 A;  4EDU A;  1L0V A;  1VYU A;  5HEU A;  2MCN A;  1UG1 A;  3E1S A;  2J06 A;  4IE6 A;  5KCH A;  3OYC A;  2LX7 A;  1VQ5 A;  1T72 A;  1VQM Q;  2X0H A;  4E7H A;  4QHO A;  3NTI A;  3QZ9 B;  5AQQ B;  1UJ0 A;  3ZT6 A;  4JI6 T;  3OYI A;  3OW2 P;  2WAC A;  4BA9 A;  1PRM C;  1HYO A;  5KYW B;  4HN9 A;  4JI4 T;  1Z9Z A;  1BR4 A;  1OI1 A;  1YIT Q;  1G2B A;  1SF9 A;  2LT3 A;  3JSC A;  3SFE A;  2FB7 A;  2PBI A;  4OMQ A;  1D09 B;  4HWH A;  5LMN T;  1U4Q A;  4LF4 T;  1MIY A;  4MBQ A;  3PU8 A;  2Y90 A;  5GAN 3;  2LM9 A;  1NLP C;  4E7K A;  1B34 B;  2K79 A;  2HSE B;  2DWG A;  1NJI U;  2NWB A;  3KV5 A;  2UXB T;  2XQA A;  4NUU A;  3J9X 1;  1W2B S;  4YTP A;  1Y96 A;  5HCK A;  1UHC A;  4LD6 A;  3NZP A;  2O31 A;  5LHG B;  3CCS Q;  1X2Q A;  4ELY C;  5L3F B;  2XDB A;  2VQE T;  2QEX A;  4TN7 B;  1ZUK A;  2W62 A;  2PQW A;  3ZJ2 A;  2AKK A;  4GYS A;  5C6S A;  3PIP A;  3L2W A;  3G6E Q;  2HAX A;  4CN1 A;  1VIF A;  1X69 A;  2CEA A;  2GFA A;  3MEA A;  1FEW A;  1FXX A;  5I22 A;  3FZL B;  1WQ7 A;  4HKE A;  2W4X A;  2K2V A;  4ZI2 D;  3HKC E;  1AT1 B;  2DTI A;  2JQQ A;  3RKX A;  2JQ9 A;  3M54 A;  2WBL A;  4FSX A;  2CP7 A;  2MBG A;  1Z9Q A;  4EMK A;  2XQ4 A;  3A5X A;  3AEA A;  4K0U A;  2RP4 A;  1G3W A;  4LF8 T;  1YWO A;  1HNX T;  3EAB A;  1VQO T;  2D0N A;  4Y28 E;  4ZXL A;  3RX6 A;  1NE8 A;  3H0H A;  3K1S A;  3RKY A;  4H63 V;  3NVO A;  2ENM A;  2QG9 B;  3D7S B;  1VQ4 A;  3OYF A;  3OBY A;  2FPE A;  1T3L A;  3AEG A;  2R6G F;  4KI0 F;  2RI5 A;  3PGG A;  1QVG A;  1K0X A;  3KVA A;  2J6K A;  2LQK A;  2KBT A;  4LE9 A;  3VU7 H;  5LHH B;  2P84 A;  3DLM A;  5AQH B;  2W61 A;  3OA6 A;  2OAU A;  5LP6 E;  5FW9 A;  3OS2 A;  5LG3 A;  3JCM f;  3NFC A;  3RIU A;  2KEA A;  1VQ5 Q;  3UTK A;  3T1H T;  1JNZ A;  2WMN A;  2O2O A;  2FO0 A;  3RYF E;  2ZGW A;  1M7K A;  3PNW C;  5L8R E;  3O5Z A;  2KWH A;  1Q95 G;  1WGS A;  1WYX A;  3KUF A;  1SUM B;  4J6W A;  2JPF A;  4MZT A;  2WZH A;  3M58 A;  2DRK A;  1U3O A;  1VYT A;  5FP3 A;  2EHO B;  4EV6 A;  3BW1 A;  3JAE A;  3KVB A;  3EAM A;  3I55 T;  4LF7 T;  1IRE B;  4X64 T;  2D1X A;  2A7Y A;  4TWD A;  4MMK A;  3HRS A;  2RHI A;  4EMG A;  3I56 T;  5LB7 B;  1ZHI A;  4LUD A;  4M78 A;  3ETV A;  5J0Z A;  5IHK A;  3I0O A;  1H3Z A;  3X24 B;  1WLP B;  2DIG A;  4XBF B;  4KHZ F;  3MXZ A;  4GIW A;  5HAX A;  2LSG A;  1SG5 A;  2LRL A;  1UGR B;  4M75 G;  3CCR A;  2EFI A;  4L5G A;  3AAA B;  2QYZ A;  1G83 A;  4DV3 T;  2QEX Q;  4KBM B;  1K9M C;  1HX1 B;  2BKD N;  2WCA A;  3AE3 A;  4TV8 E;  3SWN B;  2ABL A;  3OYJ A;  2W0Z A;  5AQL B;  3SFM A;  1CUN A;  4J9F A;  3A7M A;  3S3M A;  2BS3 A;  2V1D B;  2CLY C;  4J2C A;  5AQP B;  1JXO A;  3VS3 A;  1YN8 A;  1YI2 T;  2FUP A;  2CT3 A;  3QSU A;  5JDN A;  1UX4 A;  2NUT A;  2JTF A;  5E0O A;  3ZPO A;  3PMT A;  1VQL Q;  3KDS E;  4PJL A;  4BD3 A;  3AXJ B;  1VQ4 Q;  1HK9 A;  1VQP A;  2PU9 B;  2WMO A;  4YXD A;  2DWK A;  1BIB A;  5GAN d;  2CCQ A;  2HZY A;  4M7D E;  1OU8 A;  3RIR A;  4AG2 C;  2GTJ A;  2FJA A;  5FMN A;  1K9M U;  4Z8X A;  4C8Q G;  3CCL A;  3JCM V;  3TCJ A;  2FVU A;  4EED A;  2X0L B;  3JCM e;  1NYG A;  2D6F A;  4JLE A;  3RMS A;  1WR6 A;  5FY7 A;  2GCX A;  2L5Q A;  4ANJ A;  2L3R A;  2GFU A;  3QHS A;  3CC7 A;  4M7A D;  3C98 B;  3MJX A;  5J1G A;  2LX9 A;  4ZGJ B;  3LSV A;  2GTO A;  4MDX A;  1FMK A;  4VUB A;  1Q81 C;  2YUP A;  2DL4 A;  3ANW A;  5DAB A;  5DLO A;  3JB9 H;  2IVW A;  1E6H A;  2X3X D;  4AKH A;  1TH7 A;  4BE1 A;  1QCN A;  3CPW P;  4CN6 A;  2X67 A;  5L3C B;  3FJ5 A;  2K3B A;  2E9X C;  3Q5E A;  4PFP A;  2VL0 A;  5JDF A;  1FJG T;  1NEB A;  4WTO B;  4DV0 T;  4HVW A;  3CCR Q;  4IIJ E;  3OBV E;  1MHN A;  2DXT A;  2B1E A;  5ECA A;  3MP8 A;  4ORZ A;  4UVA B;  4FT2 A;  1E7O A;  5L2L A;  2HN1 A;  1YHQ T;  1TTH B;  4QWN B;  4KGX B;  2RN8 A;  4EMK B;  4YTN A;  2ODU A;  5DQV A;  1WLX A;  4OMP A;  4ESR A;  4DV2 T;  4BAY B;  3CC7 Q;  5GMK j;  2EYZ A;  5LBM A;  2UUA T;  4XTY A;  3GLX A;  1Q81 U;  1K4U S;  2M67 A;  3H41 A;  2NR4 A;  4O2B E;  1QKX A;  4O5V A;  4MAL A;  3QK6 A;  2BZ8 A;  2HEQ A;  1KF6 A;  3L09 A;  3LK2 B;  1OU9 A;  3AHU A;  2E3H A;  1X6O A;  2DAQ A;  3NTK A;  1VQM T;  3PE0 A;  2DE0 X;  4HEA A;  3IQL A;  4GLM A;  4E7J A;  3VV0 A;  4DEY A;  2XM1 A;  2WS3 A;  3LBX A;  4AKL A;  3FC3 A;  5GON E;  1YQ3 A;  2MTQ A;  3JAM E;  1SHF A;  2MK5 A;  3RYH E;  2K3W A;  1QVP A;  4J83 A;  3TQ7 P;  1YIT T;  2L8D A;  2CBI A;  3ZMZ B;  3I5S A;  3MK7 C;  3FRN A;  5M4Y A;  4KUI A;  4M78 F;  2IC6 A;  4RMO A;  4FT4 A;  3CCL Q;  2RH2 A;  1KSW A;  4M7D C;  1YQ4 A;  4KH1 B;  4Q5W A;  3PJA J;  1N6A A;  5JDM A;  1OED C;  2OAW A;  3PUW F;  5GAO n;  3GP8 A;  1Y7X A;  2LT4 A;  2K4Y A;  1RAG B;  2MAW A;  3HRT A;  2BDE A;  3LFM A;  3MET A;  1E1H B;  4A56 A;  5LL6 S;  1K9A A;  2KMF A;  2DF6 A;  4I4T E;  3U3I A;  4CC4 B;  2L3P A;  4BAC A;  2IHR 1;  2LJ3 A;  4C0D B;  1H8K A;  3CCS T;  2QK0 A;  3RKG A;  4M78 B;  2WDR A;  2KAF A;  1NEG A;  2QQS A;  3L2V A;  4PAG A;  4J9B A;  4J9C A;  2LKG A;  4AG1 C;  5D6Y A;  3NMZ C;  1QSD A;  1ZA1 B;  3MZK B;  4UR9 A;  1S35 A;  5L3E B;  3G6E T;  2NLU A;  1XJW B;  3NTH A;  3DP7 A;  8ATC B;  1YJW T;  4IT4 A;  3MKD A;  4JI5 T;  4DMW A;  1T0H A;  1I0C A;  2JQH A;  4DR4 T;  2XAQ B;  3ESL A;  4BE0 A;  1C1A A;  5CQY A;  5L47 A;  2B76 A;  4JI3 T;  3VS4 A;  2VVK A;  1PRL C;  4WW0 A;  1HD3 A;  1XQH A;  1WA7 A;  4J6X A;  4EZH A;  2ROT A;  4QX7 B;  5CK9 A;  3J81 E;  5CKD A;  3O9X A;  1VQN A;  2ZPI B;  4O4I E;  2BE9 B;  3J7Y q;  5LOV E;  1W2B P;  1MMN A;  5IHI A;  4N78 D;  1JXM A;  1YP5 A;  2BUD A;  2VKN A;  3VU3 C;  1HJD A;  2BS2 A;  3QYH B;  4GKJ T;  4BJN A;  2Y4X A;  2NUT B;  2LLY A;  1D0Y A;  3PIO A;  2KT1 A;  5TAO A;  5L23 A;  4EYU A;  2PG8 A;  2EKH A;  4N0A C;  2CYZ B;  1GCP A;  2M1H A;  1T7S A;  2WU2 A;  3BQL A;  2ED1 A;  4GKK T;  1AWX A;  5I21 A;  2UXX B;  4COF A;  4V2S A;  1G3Y A;  2VC8 A;  1GCQ A;  4BE2 A;  1T3S A;  3DJB A;  3UUX B;  2BZY A;  4DV5 T;  3H37 A;  4F17 A;  3ZBD A;  2XQ8 A;  4H9N C;  5FVL A;  3RC8 A;  1UGQ B;  1VQ5 T;  3GOX A;  1D0X A;  4ZI3 C;  3X20 B;  2XAJ B;  1Y01 A;  3UU5 A;  3VR9 A;  4J9D A;  4IE0 A;  3FZM B;  1J5W A;  4IRE A;  2CM0 A;  5H6Q B;  2WDV A;  4PFO A;  3NRX A;  1YWP A;  2FZK B;  3VYG A;  1KHC A;  4IGU A;  2JUF A;  2VGM A;  2ZLY A;  5GJV B;  4FW1 A;  5GAN 6;  2HCK A;  2C5K T;  1BI2 A;  3EGD B;  3L2U A;  2DLP A;  1I81 A;  2J1D G;  4ZNX A;  1J1J A;  5LJ3 h;  3E22 E;  1N36 T;  3OYL A;  3E9G A;  4X1I E;  4JS5 A;  2ZM6 T;  3QWX X;  1SHG A;  4AFQ C;  5GAO l;  3M9Q A;  2CBJ A;  3U78 A;  1ARK A;  3QNU A;  2M16 A;  3M4Y A;  3SS1 A;  3VHL A;  1V1C A;  2QEX T;  4ISS A;  3H9N A;  3MP6 A;  3VS6 A;  3O1J A;  4PJO F;  2E4H A;  1I6Z A;  1AD5 A;  4A5X A;  4CQI A;  4FYW B;  1M9S A;  3X25 B;  1V29 B;  2EQK A;  2L3L A;  2KRN A;  2LNV A;  4AQY T;  4ZS2 A;  5KMG P;  3IF8 B;  4JUV A;  3C50 A;  4QKU A;  4I50 E;  2DZC A;  2WY2 A;  2X9X A;  1CHU A;  3GN5 A;  3GMI A;  4X66 T;  1M2V A;  2LHR A;  4MHC A;  1RLP C;  3AE2 A;  1UE9 A;  4DMV A;  2HDA A;  5LXT E;  4CXX A;  5EC7 A;  2K3Y A;  2DLR A;  1Y07 A;  2EHO C;  3TLU A;  5LJ5 h;  3BQI A;  4Y92 A;  3E0Z A;  5AFU L;  1EZZ B;  4PK4 A;  1UHF A;  4J9E A;  3OS5 A;  3CBO A;  4OX9 T;  1PKS A;  5L3G B;  1Q82 C;  2LOS A;  4TWF A;  1QVG S;  3C0C A;  1VQ4 T;  3AEB A;  2KXD A;  3TLW A;  4HCC A;  3EH2 A;  3QOF A;  4IDQ A;  1SSF A;  2DEU A;  2IIM A;  2QAS A;  2MAM A;  4RTZ A;  1NZ9 A;  3F2E A;  2COY A;  2D8J A;  5JDQ A;  3CC2 A;  2E5Q A;  1RUW A;  2QRX A;  4HFH A;  3QG1 A;  3NRY A;  2KLQ A;  3FDR A;  5LJM A;  4HVV A;  4B3M T;  3HKB E;  3KFV A;  5D6X A;  2CT4 A;  3WVE B;  2A36 A;  1C6V X;  1IZ6 A;  4PJO G;  1HG2 A;  1TUD A;  3RUX A;  1PD0 A;  2E5V A;  2F1L A;  3SWN C;  3SB2 A;  3P50 A;  2GK9 A;  1R0C B;  2YLC A;  5HCJ A;  2LSJ A;  2GNC A;  4OMF B;  2FYK A;  2MWO A;  3I55 Q;  5KE3 A;  2CXD A;  3M57 A;  1YJ9 A;  1IXD A;  3THK A;  3I56 Q;  1JQQ A;  4AKG A;  2IDO B;  2ES0 A;  5JTG A;  5FYM A;  2F5T X;  3LH0 A;  1W6X A;  1Q82 U;  4NL2 A;  3RRW A;  3X1D A;  1AEY A;  4PJN A;  4XZC A;  2EJ9 A;  3ZMT B;  3VUB A;  1OX8 A;  4X1K E;  5ABG A;  1M8V A;  5LA6 E;  1ZSZ A;  2X4Y A;  3JCM g;  1BI1 A;  3GIB A;  1WDX A;  3NWI A;  5IAY A;  2KE9 A;  5AQF B;  1M3A A;  1XDO A;  1MMD A;  3QJ6 A;  3P4W A;  5CA0 E;  1KQ2 A;  4QXB B;  3PUY F;  4DBQ A;  5AQK B;  2XIC A;  4XTX A;  4GBQ A;  3EG9 A;  2DL7 A;  2PVO B;  3CQT A;  2LE8 A;  4M78 E;  3HP9 A;  5KYN A;  1GRI A;  2E9X B;  1WHM A;  1K8A R;  1IHW A;  4DR7 T;  2E9X D;  1HTJ F;  2UUC T;  3S6W A;  4C92 G;  5JDH A;  1KNP A;  2BKP A;  2RPN A;  2JNG A;  5HXR A;  3CXC A;  4R55 A;  1WFW A;  1FX7 A;  1KFY A;  1Q82 R;  4AT1 B;  2COW A;  4WCI A;  4M75 A;  1X2K A;  4JEU B;  1OZ2 A;  4CXY A;  4WF2 A;  5LYJ E;  3IA3 A;  1UEC A;  1VQP T;  2KMT A;  3L3P A;  2D0T A;  3ZMV B;  2D0Q B;  2V7J A;  1QLY A;  3HRU A;  5KE2 A;  5F3J A;  1UUR A;  2EGC A;  3VS2 A;  5FNV E;  2D8H A;  5LJ3 f;  2HKN A;  3CC2 Q;  3CCL T;  2FPF A;  2W0G A;  1X9B A;  3WI3 A;  3GF5 A;  4A4E A;  5FVK A;  4F16 A;  1UGS B;  1UJY A;  4EMK C;  4I55 E;  2LM2 A;  1XTD A;  2OTL A;  3TSZ A;  2QA7 A;  3IBP A;  4BUG A;  1H64 1;  3LGF A;  3CC7 T;  4C5E A;  4CZZ B;  2XU8 A;  1YJW A;  3N9O A;  2E2A A;  5FXW A;  4WBO A;  4U72 A;  5HKC A;  3CIR A;  2LTO A;  2EQU A;  3VS0 A;  1M3B A;  2D2S A;  1MMG A;  2H3J A;  1JNR A;  3LJC A;  3HFO A;  5GAO m;  1YJ9 Q;  2LQW A;  1S1N A;  2W10 A;  3P8H A;  1T98 A;  1VQK A;  1K1Z A;  4UEM A;  2F2X A;  3CQX C;  1UEB A;  1LNX A;  2EPD A;  4XU3 A;  3W15 B;  4M7D B;  5AQS B;  3INZ A;  3M5A A;  5L4H A;  4IUR A;  2JJ9 A;  4M7D D;  5C8Y E;  5FXZ A;  2NOX A;  2UXD T;  1YHQ Q;  4JUY A;  3L1A A;  1W9R A;  1OOT A;  5LJ5 f;  1XOV A;  3RIU C;  2X51 A;  3I9Q A;  1N9R A;  3FIF A;  1IJ5 A;  2IML A;  4WYV A;  1W1F A;  3GN5 B;  3EFS A;  1M2V B;  1QLB A;  5GAN h;  4BI8 B;  1KD1 R;  4QQ6 A;  1TG0 A;  2CE7 A;  1RAA B;  4GOU A;  2YWW A;  4CXW A;  1UGP B;  3RNJ A;  2J47 A;  1JBM A;  1RAD B;  5DJQ C;  1IBK T;  3VKI A;  2L3S A;  3KV4 A;  4LDW A;  3CCJ A;  1S72 A;  2QXF A;  2R58 A;  4PFZ A;  1ZA2 B;  2CRB A;  4JDS A;  2YRD A;  5I11 A;  3DKM A;  4C0D C;  2ZMA A;  3QKJ A;  5GAO p;  2KXP B;  4U7Y A;  4JI8 T;  4M78 C;  2M0Y A;  3P8C D;  4XU2 A;  4DV4 T;  4D8K A;  4KMC A;  2NUZ A;  5LJ5 d;  4OB2 B;  4E2F B;  2AXD S;  3ZMS B;  2EAY A;  3L39 A;  2CP3 A;  4J8O A;  4MZM A;  2PJQ A;  2RO0 A;  4PW8 A;  2YSQ A;  1M90 R;  1TUG B;  1Q7Y C;  3BDL A;  3MEV A;  3CCU A;  4ELZ C;  3K8P C;  4RUG A;  2A9U A;  2FRW A;  5GAM h;  3R84 B;  2O4X A;  5LJ3 e;  5C2T A;  3GNF B;  1NG2 A;  3JB9 G;  1MMA A;  3VRY A;  1AJ3 A;  1TS9 A;  3ZN1 B;  3L2Q A;  3OYY A;  2G3R A;  2NUP A;  4M77 G;  2E41 A;  2VKD A;  2OTL Q; 
#chains in the Genus database with same CATH homology
 4OFZ A;  1OZ3 A;  3QO3 A;  4MZP A;  4H9S E;  2R57 A;  5F8P A;  3MEW A;  4ZI3 D;  4O4H E;  1HG5 A;  5LHI B;  3B13 A;  3OYE A;  2LC4 A;  4HKA A;  3WAK A;  3BY7 A;  5JR9 A;  1R8O B;  2XHC A;  1GXI E;  2MMP A;  1Q7Y U;  3JCM c;  3HHT B;  2CWO A;  5JRC A;  2EKO A;  5LJ5 e;  5EK3 A;  2GF7 A;  4M75 F;  1VQN T;  4YJ2 E;  3FHN A;  4C5G A;  2E6Z A;  2K48 A;  3N9N A;  3PTR B;  2ZPG B;  1FIO A;  2K5B B;  3FBL A;  4M75 B;  1JJ2 A;  4X9D A;  5CAI A;  3KFW X;  4QVZ A;  3HSB A;  4UEL A;  2I59 A;  4OVA A;  2EHO D;  4M1P A;  3S4U A;  3CPF A;  3JCM J;  2EJG A;  4QQG A;  3Q9D A;  1LVK A;  4QX8 B;  2DD5 A;  3CME A;  3C4S A;  4HE8 A;  5HXC A;  4C8Q F;  2XG8 D;  3HL6 A;  2DCF A;  2X9H A;  3C4Z A;  2Q9Q A;  2HQE A;  3ZEH A;  4A4G A;  5GAN f;  2VK9 A;  5DY9 A;  2LEH A;  4ATO A;  4H9P C;  1M4Z A;  3OYZ A;  4EMH A;  1SA0 E;  5GAO q;  2VKO A;  4C0G A;  3EAE A;  3H6Z A;  3QBY A;  2P0Q A;  2YRV A;  2XAH B;  4J7I A;  2CXF A;  1U5P A;  2RK2 A;  2P9B A;  4MML A;  1N27 A;  2HD0 A;  4B9W A;  4EZ4 A;  2ZPB B;  2Z6E A;  3MCA B;  2VL8 A;  3SWH A;  2RB6 A;  4J7F A;  2DKG A;  3QZ5 B;  2E70 A;  2XTL A;  4LDV A;  3QJY A;  5IYZ E;  5GAN 2;  4E47 A;  2L8K A;  1PSF A;  4BI3 A;  4PL6 A;  1OXZ A;  4XTV A;  5GAM f;  3J80 E;  3HFN A;  3IEE A;  3QXE B;  3RKO A;  3H3A A;  3ASK A;  4UV8 B;  1YW0 A;  3CC2 T;  3MEU A;  5GMK i;  2F5K A;  2I2L A;  3HKS A;  4O4L E;  2BZB A;  4U74 A;  2PVD B;  3HPW A;  3OYG A;  3CWZ B;  1WJQ A;  1Y96 B;  4PK6 A;  5HY6 A;  3PUG A;  3LK4 2;  3N5L A;  4XTU A;  3EDU A;  2ZZD A;  1S94 A;  3SD4 A;  2D9T A;  1YJ9 T;  3ZN0 B;  1US7 B;  1WQW A;  2E65 A;  5GAM d;  2OTJ A;  2RHX A;  1MGQ A;  4H9Q C;  2UXN B;  4IE4 A;  2HBP A;  2R5A A;  2MOZ A;  3RH3 A;  2ZCF B;  3KBT A;  5JR9 B;  5GAN e;  1X01 A;  1BR1 A;  3CC4 A;  4P09 A;  1H7C A;  3JRZ A;  1O3X A;  5JRC B;  3CCV A;  4PJO A;  4OK0 A;  1NPP A;  2V7L A;  2QA4 A;  1D1B A;  4M7A G;  3A5Z B;  5HWY A;  3LYI A;  2YK0 A;  1LKX A;  2NW9 A;  3R6O A;  3UWN A;  3E19 A;  3C94 A;  3AA6 B;  5J39 A;  1N9S A;  3CXC S;  3I9W A;  2K5I A;  1BYM A;  2KT9 A;  1NJI C;  4E7S A;  2LHN A;  1BR0 A;  3PUS A;  4IUV A;  5GAM e;  2X68 A;  3JC6 C;  3F31 A;  4N4G A;  3UUN A;  4F7U G;  3ZEF B;  5EZY E;  3G71 A;  3OS1 A;  5JVD E;  3VUZ A;  3QUJ A;  2KSS A;  4M78 D;  1OWA A;  5HXS A;  5CO7 A;  3UT5 E;  4GLK A;  2OTL T;  2AHJ B;  2E10 A;  2W63 A;  3Q5W A;  3PUA A;  3Q5X A;  4M75 E;  4OYK A;  2ZPH B;  4C92 A;  4OB3 B;  2Q9Q B;  3AA1 B;  1IAP A;  1YIJ A;  3JCM Q;  2DNX A;  1NJI U;  4DQ2 A;  4ZGD B;  2KWI B;  1VQK T;  2N9D A;  2NP9 A;  2LT1 A;  4C0Z A;  4G2A A;  1YD8 G;  5LJ3 g;  2ZM0 A;  4QVD A;  2K3X A;  3JB9 J;  3G4S A;  2XHE B;  2G0U A;  4QKN A;  2PVG B;  1K73 C;  2F69 A;  3N9L A;  2ZM8 A;  3GNG A;  2H7O A;  5GAN 7;  3LW5 E;  3ZYK A;  4XQ3 A;  2V8I A;  2SPC A;  4EAH A;  4ME7 A;  5FU7 B;  5A0G A;  2CWY A;  3FXD B;  3CCJ T;  1S72 T;  3CCE A;  2MWP A;  2QQR A;  2VWA A;  1G8X A;  3MAC A;  4C8Q E;  5LG4 A;  3AAI A;  2N1G A;  3V5S A;  2VV5 A;  4XTZ A;  3RYC E;  4ZTF A;  3N2K E;  2XK0 A;  5ADX L;  5CKH A;  3FJP A;  3CCU T;  3ANW B;  1K73 U;  5HXH A;  1SHZ C;  3C64 A;  3M55 A;  4RCC A;  4QVC A;  2E8I A;  2ZM2 A;  3F70 A;  4BB7 A;  3AVS A;  1ZQ1 A;  3WAJ A;  5GAN 8;  4B6X A;  2X35 A;  3HR0 A;  2M0O A;  1YJN T;  3TKL B;  3E08 A;  1MIV A;  5CKF A;  5LGN B;  4M75 C;  2LDM A;  4CI2 B;  5J2T E;  4OP0 A;  4XU1 A;  3ZJ1 A;  2DD4 A;  5FRN A;  2VXF A;  1ZBX A;  4OGC A;  3A8O B;  3PUR A;  4AKR B;  3EFR A;  4IDZ A;  4ZS3 A;  2RA1 A;  4F6R C;  3ZCJ A;  4B9X A;  4PJO B;  2KQW A;  1K8A C;  2Y48 B;  2VYT A;  5M9O A;  2ZPF B;  4AQF A;  3RRC A;  3OBW A;  3ZMU B;  1HXD A;  3OYM A;  2YLB A;  4ZI7 E;  1QVF A;  1VQ6 A;  2RD1 A;  2LQ8 A;  4GYR A;  4N4I A;  1YKH B;  2Y4Y A;  4M77 A;  3LBX B;  2D5U A;  3QPH A;  1LOJ A;  1VUB A;  4RCB A;  5AYF A;  1KQS A;  3UT1 A;  5FY1 A;  2M9U A;  5DQW A;  2VB6 A;  1ZKE A;  1JJ2 S;  5CA1 E;  4L9I A;  1O9S A;  4NS5 A;  3SOL A;  4WNK A;  4LDX A;  3OMG A;  4JJN K;  4C92 F;  2DEQ A;  3OY9 A;  1KK7 A;  3N2G E;  5J26 A;  3FB2 A;  2ODV A;  1K8A U;  1FMW A;  4RG8 A;  3N9M A;  3BQK A;  3J7A F;  2LRQ A;  2B8A A;  1KNZ A;  2RA2 A;  4L0R A;  2V7K A;  4C92 B;  5A0L A;  3CME T;  4MLK A;  3WVD B;  5LGU B;  2K57 A;  2CZ6 B;  3D0T A;  5LGT B;  2IG0 A;  5HK3 A;  3L2R A;  4CI0 C;  4QXH B;  4HFV A;  4TUY E;  2X4J A;  2HPJ A;  1KD1 C;  5GAO r;  2ZPE B;  5ETW A;  3PDY A;  3AVR A;  3ZLI A;  3CCM A;  3N9Q A;  3OYA A;  3CKD A;  1XNI A;  5CQX A;  3I9Y A;  3OSV A;  5HWX A;  3OJA A;  1LJO A;  3VJP A;  2DTO A;  5DM7 R;  2X4X A;  2P4T A;  2QQB A;  3LLR A;  3T8O A;  4PNO A;  1M90 C;  4HT9 A;  3GPL A;  3CMA A;  3JCM W;  4O4J E;  2CS7 A;  5JRE A;  4IUU A;  3T9N A;  1B7T A;  2LSI A;  5GAN g;  2DXC A;  5LJN A;  3PTA A;  4AXP A;  2YU1 A;  2YEV C;  2QDY B;  4L6V 5;  2P0P A;  2RI2 A;  1KD1 U;  4FM4 B;  1D3B A;  2IAK A;  5JR9 C;  3ME9 A;  2A72 A;  5CB4 E;  2PUK B;  2RHU A;  4KP3 C;  4JLG A;  3CBM A;  1M1F A;  3MP1 A;  2DHR A;  3RPU A;  1WPY A;  2NTY A;  5CVI A;  3EDV A;  4JRQ A;  3I0Q A;  3V8L A;  3RC3 A;  3JCM b;  3EUH A;  5LBQ B;  3QII A;  2OA5 A;  2RM4 A;  3RES A;  4G63 A;  1M90 U;  4PKC C;  2K24 A;  3JC6 D;  4EIW A;  3A8M B;  4Y91 A;  2OTJ T;  3OKQ A;  4C8Q A;  3JB9 F;  4HCZ A;  4MFR A;  1MND A;  3O1I A;  3V8J A;  2K5L A;  3AAE B;  3OYN A;  4M77 F;  3OW2 A;  2E64 A;  3UDC A;  2XDD A;  1NAF A;  3CC4 T;  2XAF B;  1VQ9 T;  4LD9 K;  3ZC1 A;  4EYY R;  3CCV T;  3HKE E;  2VAS A;  4ERR A;  4QQD A;  4NUV A;  4UVC B;  3OMC A;  1VQ7 A;  2QA4 T;  3URG A;  3FLG A;  4M77 B;  4X20 E;  4DA4 A;  2KY9 A;  2IW5 B;  4H9O C;  2N2N A;  4DND A;  2RHY A;  2RJC A;  1UB4 A;  3MHX A;  3GA8 A;  3CEY A;  1UCU A;  1UX5 A;  1ZEE A;  5LJ3 j;  2Q9Q C;  4BDY A;  5FY0 A;  5JDG A;  3QDR B;  4N4H A;  2V8J A;  3SRZ A;  4PJO E;  4M7D G;  5JDL A;  4C5H A;  5GMK h;  2FHD A;  2XAS B;  5A2Q E;  4JS4 A;  3N2O A;  3H8Z A;  4J6Y A;  4RG2 A;  4BI4 A;  2HQX A;  4GK0 E;  3V7R A;  3G71 T;  4M7A A;  1YJN A;  3SDZ A;  5FRO A;  4IE5 A;  1HX8 A;  4UC4 A;  2CGH A;  3CX7 B;  2C06 A;  4AQG A;  4AKI A;  3S3O A;  2HNI A;  3C4X A;  5LJ5 j;  1G5V A;  5FU7 C;  3V8K A;  3E9F A;  3BFM A;  4WBN E;  5D6W A;  1YIJ T;  2WSC E;  3QYG B;  3CBP A;  1W4S A;  3G4S T;  2NTX A;  2DIQ A;  4F7U A;  5KDM C;  4FU6 A;  2C0S A;  4C92 E;  2X4W A;  2WSE E;  3HA4 A;  5IHY A;  5JQG E;  3CPZ A;  3KBG A;  4HA8 A;  1VQL A;  5A0D A;  5GAN 5;  4JRP A;  3ER0 A;  1IZN B;  4M75 D;  4OF1 A;  2XQY A;  5GMK m;  3VKH A;  2V26 A;  5BMV E;  3V7S A;  1EZ3 A;  3OQ5 A;  3CCE T;  3MO8 A;  4AI6 A;  5HK0 A;  3DTO A;  4OYJ A;  1D3B B;  1VRB A;  1Z0P A;  3V5U A;  1P92 A;  3HI2 A;  2NW7 A;  2E6N A;  5L3D B;  4DOV A;  1NWM X;  2K5F A;  2EIF A;  1U1T A;  2CZ0 B;  3OYD A;  5EK2 A;  3FBZ A;  3CD6 A;  4A53 A;  1YBY A;  4PJO C;  2WAU A;  2YIN A;  5JH7 E;  4UXN B;  5H6R B;  2VUB A;  1MNE A;  1WJR A;  4QXC B;  1EIF A;  4GK5 E;  3OYH A;  3LWI A;  3CQG B;  1QW1 A;  2JRK A;  4P0A A;  4KUD K;  1N8R C;  2DVE A;  4C8Q B;  3KBU A;  2BVM A;  4C8Q D;  5HXE A;  3JCM d;  4DO0 A;  1HCI A;  3G7Z A;  5C0M A;  2XDP A;  1D0Z A;  3TRE A;  2WWU A;  2H7V C;  4BJM A;  4ZOL E;  2DK3 A;  4C5I A;  5CR2 A;  3KV9 A;  4C91 A;  3P7I A;  2RJD A;  1QVF S;  2ACX A;  5LNK A;  1VQ6 T;  3TEE A;  5CCA A;  3ONX A;  4DBR A;  2RHZ A;  4C92 C;  4OB0 B;  1N8R U;  1KQS S;  1I5L A;  2E1H A;  2RK1 A;  2XUE A;  3V7C A;  3CPW A;  4M7A F;  3NBX X;  2O4X B;  1WRD A;  4BY6 B;  3C12 A;  1O75 A;  3ZCI A;  2PFV A;  4I43 B;  4PJM A;  2VXE A;  4LDU A;  3I1A A;  3KV6 A;  3P8B B;  4A4F A;  4YLH A;  5FU6 C;  1BKB A;  3LGL A;  4C90 A;  2V7I A;  4ZTJ A;  2V7M A;  4IUQ A;  3PT9 A;  4M77 E;  4M7A B;  4HT8 A;  4KUM B;  5FXX A;  3C95 A;  4ILU A;  3LWH A;  1KC8 C;  3PMI A;  5GAN j;  3PUQ A;  3KXT A;  3B57 A;  4F7U F;  2Y6X A;  1IJ6 A;  3CX6 B;  3O1H A;  2KZ7 B;  5KX5 E;  1VQ9 A;  4OHF A;  1M1G A;  4KT0 E;  3BK9 A;  3EVY A;  1BIA A;  3AA0 B;  1G73 A;  1VOM A;  2KDS A;  1QP2 A;  4BDZ A;  4YHJ A;  1DJ7 B;  2WSS V;  2R5M A;  3CCQ A;  4F7U B;  1X75 C;  1VQ8 A;  5DLQ E;  2E12 A;  4L59 A;  1NPR A;  2MF2 A;  2MYS A;  3CCM T;  3JCM P;  2XD0 A;  2XAG B;  5GAM j;  3QC9 A;  1KC8 U;  3JCM X;  2L9Q A;  4EOZ B;  5GMK e;  3CMA T;  4R56 A;  4KUL A;  2XID A;  2CMR A;  1M5Q 1;  4NOY A;  2DTH A;  4OB1 B;  4E7I A;  2XI9 A;  4A4K A;  3M4G A;  3LK3 B;  5CKE A;  4NL3 A;  3PU3 A;  3M65 A;  4X9C A;  4AQF C;  3OSS C;  1W2B A;  3VYH B;  4CRI A;  2Q9Q D;  1I8F A;  4JRK A;  4ADZ A;  4OGE A;  4IKF A;  1KG1 A;  2QQ9 A;  4LDY A;  4YFS A;  2QGS A;  4P0B A;  4UF0 A;  1QP3 A;  1WNL A;  2BIV A;  1Q86 C;  4M77 C;  2YU2 A;  4O6J A;  4YJ3 E;  1QUU A;  4TVR A;  4HCB A;  5CIU A;  3LG7 A;  3AA7 B;  3S3N A;  1V9D A;  3DB4 A;  1U1S A;  2FL7 A;  2DXU A;  1FWZ A;  1AHJ B;  3RMQ A;  3OW2 S;  3L42 A;  3N5B B;  2DO3 A;  3A8G B;  3FB9 A;  1VQO A;  2JTM A;  3VKG A;  2LSY A;  3FXE B;  1HF8 A;  2KIN B;  3UUL A;  2A3D A;  3UFE A;  4PLL A;  5GAN 4;  2EQM A;  4X1Y E;  4V1A v;  2GQV A;  2DPP B;  3IHR A;  2QQA A;  4M78 G;  1G3S A;  2X66 A;  2O01 E;  5A1L A;  4IUP A;  1WYC A;  3ETU A;  1I4K 1;  2JN0 A;  4XK8 E;  1VQ7 T;  3X28 B;  1Q86 U;  2E9X A;  3QUI A;  1RI0 A;  5LJ5 g;  4RKU E;  2EJF A;  2C5J A;  2P0K A;  2PUO B;  4O2A E;  1JB0 E;  4QW2 A;  1X79 A;  4ZHQ E;  3HL8 A;  4FJO A;  3ZC0 A;  3RKW A;  4H9R C;  4ZI2 C;  3I55 A;  1BI0 A;  3OYK A;  2QTX A;  3I56 A;  3DLL A;  3OYX A;  1HS7 A;  2X9Y A;  4UV9 B;  3OB9 A;  2HH7 A;  4JRI A;  1Y71 A;  2K9A A;  3CML A;  3KIN B;  4PK5 A;  4Z02 A;  1YCY A;  2EQJ A;  4P5N A;  2RJF A;  2KVQ G;  2Y8D A;  3NZQ A;  4PNI A;  4PJO D;  2JMH A;  5L3B B;  2L89 A;  5CKB A;  1M1K C;  4M7D A;  1JRI A;  3ZFJ A;  4O8S A;  4M7A E;  1YI2 A;  4ZN3 A;  4ZGE B;  5FRM A;  1RL2 A;  2MI6 A;  1VIE A;  3R6N A;  2A3L A;  1ZHC A;  3A8H B;  3HKD E;  4CI3 B;  1YKE B;  1OYX A;  4UVB B;  1VQL T;  3L2Z A;  4IHJ E;  2JZ2 A;  3CVR A;  2D0U A;  2LJL A;  4TZ4 C;  4C8Q C;  3TU4 K;  3WXM B;  2BVL A;  4F7U E;  3K3Q C;  1M1K U;  1KHI A;  1PSE A;  2CLY B;  2RI3 A;  4HTE A;  4HGA A;  5EK4 A;  4XU0 A;  3OYB A;  2VGN A;  4XTW A;  1B34 A;  3CD6 T;  4II1 A;  4C92 D;  3AB3 B;  2JVV A;  3ZYM A;  1LRZ A;  4DOW A;  2JMK A;  4N0A A;  4UF0 B;  1D1A A;  2YHT A;  5J2U E;  2XKO C;  2EWN A;  4J5Y A;  1KQ1 A;  2LVM A;  5EG2 A;  2VKH A;  1WYB A;  1BR2 A;  2C5I T;  3GWH A;  5FXV A;  1YHQ A;  5FU6 B;  3PFS A;  2LSK A;  3UPU A;  3CCR T;  4UIG A;  2X9W A;  4CI1 B;  2KND A;  5I2M A;  3O8V A;  4H63 H;  4FL6 A;  5I2S A;  3C51 A;  1U8R A;  4BY6 C;  3N9P A;  2A2F X;  4EB6 E;  2RJE A;  4A54 A;  2WSF E;  4A4H A;  5GMK l;  5LCY A;  4X34 A;  2CXL A;  4M7A C;  1VQM A;  3M53 A;  1HFA A;  1FMV A;  3A8L B;  1D1C A;  1YIT A;  2V8K A;  3Q1J A;  2EYQ A;  1LVF A;  3UUM A;  1WJS A;  4MDW A;  3CPW S;  3CQC B;  4FI5 A;  3ZYL A;  3DB3 A;  4XAX B;  3JB9 I;  2DJZ A;  2CZ7 B;  2WM9 A;  2IC9 A;  2LCL A;  3K3O A;  5FLX E;  3P8D A;  4EXT A;  3OS0 A;  5KCO A;  4IST A;  2KK4 A;  4YTL A;  3RER A;  2W00 A;  3K3N A;  3JCM h;  2EHO A;  5IN1 A;  2DXB A;  3CCS A;  4ZN1 A;  2DI4 A;  3M59 A;  4IE7 A;  3X26 B;  1BI3 A;  1Y64 B;  2DZ9 A;  4JEH B;  2JOY A;  3G6E A;  5KH6 A;  5GAM g;  4M7D F;  1MIW A;  4EPC A;  4TX5 A;  4JLI A;  3BDU A;  3C4W A;  2LCC A;  3Q2M A;  2CKK A;  2CZ1 B;  3M56 A;  3RYI E;  3MA9 A;  4PJJ A;  3F57 A;  2QI2 A;  4FIB A;  5LJ3 d;  5HYA A;  5IT9 E;  3SWN A;  3O4X E;  2HPL A;  2CA5 A;  4E7L A;  4IUT A;  2NW8 A;  1G3T A;  3JB9 D;  2LOP A;  4PLI A;  4E7Z A;  3FEO A;  4D6W A;  5J3B A;  3CX8 B;  4GY5 A;  4ASK A;  4TV9 E;  3CCQ T;  1VQ8 T;  4DVD A;  4M77 D;  1ZV4 X;  2VKJ A;  4C0F A;  2H3R A;  3LX7 A;  4EDU A;  3E1S A;  4IE6 A;  5KCH A;  3OYC A;  1VQ5 A;  4E7H A;  4QHO A;  3NTI A;  3QZ9 B;  3OYI A;  2WAC A;  4BA9 A;  4HN9 A;  1BR4 A;  1OI1 A;  2LT3 A;  3JSC A;  2FB7 A;  2PBI A;  1U4Q A;  1MIY A;  4MBQ A;  3PU8 A;  2Y90 A;  5GAN 3;  2LM9 A;  4E7K A;  1B34 B;  2DWG A;  2NWB A;  3KV5 A;  4NUU A;  3J9X 1;  1W2B S;  1Y96 A;  4LD6 A;  3NZP A;  5LHG B;  2XDB A;  4ELY C;  5L3F B;  2QEX A;  4TN7 B;  2W62 A;  2PQW A;  3ZJ2 A;  4GYS A;  5C6S A;  3PIP A;  3L2W A;  2HAX A;  1VIF A;  2CEA A;  2GFA A;  3MEA A;  1FEW A;  1FXX A;  1WQ7 A;  4HKE A;  2K2V A;  4ZI2 D;  3HKC E;  2DTI A;  2JQQ A;  3RKX A;  3M54 A;  2WBL A;  4FSX A;  2MBG A;  4EMK A;  3A5X A;  4K0U A;  2RP4 A;  1G3W A;  1VQO T;  4Y28 E;  3RX6 A;  1NE8 A;  3RKY A;  4H63 V;  1VQ4 A;  3OYF A;  3OBY A;  2RI5 A;  3PGG A;  1QVG A;  3KVA A;  2LQK A;  3VU7 H;  5LHH B;  3DLM A;  2W61 A;  3OA6 A;  2OAU A;  5LP6 E;  3OS2 A;  3JCM f;  3NFC A;  3UTK A;  2WMN A;  3RYF E;  2ZGW A;  3PNW C;  5L8R E;  2KWH A;  3KUF A;  1WGS A;  4MZT A;  4J6W A;  2JPF A;  3M58 A;  5FP3 A;  2EHO B;  3BW1 A;  3KVB A;  3I55 T;  1IRE B;  2A7Y A;  4MMK A;  3HRS A;  2RHI A;  4EMG A;  3I56 T;  1ZHI A;  4M78 A;  3ETV A;  1H3Z A;  3I0O A;  3X24 B;  2DIG A;  4XBF B;  3MXZ A;  4GIW A;  5HAX A;  2LSG A;  1UGR B;  3CCR A;  4M75 G;  2EFI A;  4L5G A;  3AAA B;  4KBM B;  1K9M C;  2BKD N;  4TV8 E;  3SWN B;  3OYJ A;  3SFM A;  1CUN A;  3S3M A;  2V1D B;  2CLY C;  4J2C A;  1YI2 T;  3QSU A;  5JDN A;  1UX4 A;  2JTF A;  5E0O A;  3ZPO A;  3PMT A;  3KDS E;  4PJL A;  4BD3 A;  1HK9 A;  1VQP A;  2PU9 B;  2WMO A;  2DWK A;  1BIB A;  5GAN d;  2CCQ A;  4M7D E;  3RIR A;  5FMN A;  1K9M U;  4Z8X A;  4C8Q G;  3CCL A;  3JCM V;  3TCJ A;  2FVU A;  2X0L B;  3JCM e;  2D6F A;  4JLE A;  3RMS A;  1WR6 A;  5FY7 A;  2GCX A;  2L5Q A;  4ANJ A;  2L3R A;  2GFU A;  3QHS A;  3CC7 A;  4M7A D;  3C98 B;  3MJX A;  5J1G A;  2LX9 A;  4ZGJ B;  4MDX A;  4VUB A;  1Q81 C;  3ANW A;  5DAB A;  5DLO A;  3JB9 H;  2IVW A;  4AKH A;  1TH7 A;  4BE1 A;  2X67 A;  5L3C B;  2E9X C;  4PFP A;  5JDF A;  4IIJ E;  3OBV E;  1MHN A;  2DXT A;  2B1E A;  3MP8 A;  4UVA B;  4FT2 A;  5L2L A;  1YHQ T;  4QWN B;  4EMK B;  2ODU A;  5DQV A;  1WLX A;  4BAY B;  5GMK j;  5LBM A;  4XTY A;  3GLX A;  1Q81 U;  2M67 A;  4O2B E;  4O5V A;  4MAL A;  3QK6 A;  3L09 A;  3LK2 B;  3AHU A;  1X6O A;  2DAQ A;  3NTK A;  1VQM T;  3PE0 A;  4HEA A;  4E7J A;  3VV0 A;  3LBX A;  4AKL A;  3FC3 A;  5GON E;  2MTQ A;  3JAM E;  3RYH E;  4J83 A;  1QVP A;  1YIT T;  2L8D A;  3ZMZ B;  3MK7 C;  3FRN A;  5M4Y A;  4KUI A;  4M78 F;  2IC6 A;  4RMO A;  4FT4 A;  4M7D C;  2RH2 A;  4Q5W A;  1N6A A;  5JDM A;  5GAO n;  3GP8 A;  1Y7X A;  2LT4 A;  2K4Y A;  3HRT A;  2BDE A;  3LFM A;  3MET A;  1E1H B;  4A56 A;  5LL6 S;  2KMF A;  4I4T E;  3U3I A;  4BAC A;  4C0D B;  3CCS T;  4M78 B;  2KAF A;  2QQS A;  3L2V A;  4PAG A;  5D6Y A;  1QSD A;  3MZK B;  5L3E B;  1S35 A;  3G6E T;  2NLU A;  3NTH A;  3DP7 A;  1YJW T;  3MKD A;  4DMW A;  2XAQ B;  3ESL A;  4BE0 A;  5CQY A;  4WW0 A;  1XQH A;  4J6X A;  4EZH A;  4QX7 B;  5CK9 A;  3J81 E;  5CKD A;  3O9X A;  1VQN A;  2ZPI B;  4O4I E;  3J7Y q;  5LOV E;  1MMN A;  4N78 D;  2BUD A;  3VU3 C;  3QYH B;  4BJN A;  2Y4X A;  3PIO A;  1D0Y A;  5TAO A;  4EYU A;  2PG8 A;  4N0A C;  2CYZ B;  2M1H A;  3BQL A;  5I21 A;  4V2S A;  2UXX B;  1G3Y A;  2VC8 A;  4BE2 A;  3DJB A;  3UUX B;  3H37 A;  3ZBD A;  4H9N C;  3RC8 A;  1UGQ B;  1VQ5 T;  3GOX A;  1D0X A;  4ZI3 C;  3X20 B;  2XAJ B;  4IE0 A;  2CM0 A;  5H6Q B;  4PFO A;  3NRX A;  3VYG A;  1KHC A;  4IGU A;  2JUF A;  2VGM A;  2ZLY A;  5GAN 6;  2C5K T;  1BI2 A;  3L2U A;  1I81 A;  2J1D G;  5LJ3 h;  3E22 E;  3OYL A;  3E9G A;  4X1I E;  4JS5 A;  5GAO l;  3M9Q A;  3U78 A;  2M16 A;  3M4Y A;  3SS1 A;  3VHL A;  2QEX T;  4ISS A;  3MP6 A;  3O1J A;  4PJO F;  4CQI A;  3X25 B;  1M9S A;  1V29 B;  2EQK A;  2L3L A;  2LNV A;  4ZS2 A;  5KMG P;  3IF8 B;  4JUV A;  3C50 A;  4I50 E;  2DZC A;  2X9X A;  3GN5 A;  3GMI A;  2LHR A;  4MHC A;  4DMV A;  5LXT E;  4CXX A;  2K3Y A;  2DLR A;  1Y07 A;  2EHO C;  5LJ5 h;  3BQI A;  3E0Z A;  5AFU L;  4PK4 A;  3OS5 A;  3CBO A;  5L3G B;  1Q82 C;  2LOS A;  1QVG S;  1VQ4 T;  4HCC A;  1SSF A;  2MAM A;  1NZ9 A;  3F2E A;  5JDQ A;  3CC2 A;  2E5Q A;  3QG1 A;  3NRY A;  2KLQ A;  3FDR A;  5LJM A;  3HKB E;  5D6X A;  3WVE B;  4PJO G;  1IZ6 A;  1HG2 A;  3RUX A;  3SWN C;  3SB2 A;  2GK9 A;  2YLC A;  2LSJ A;  4OMF B;  2FYK A;  2MWO A;  5KE3 A;  2CXD A;  3M57 A;  1YJ9 A;  4AKG A;  2ES0 A;  5FYM A;  2F5T X;  3LH0 A;  1Q82 U;  4NL2 A;  3RRW A;  4PJN A;  4XZC A;  2EJ9 A;  3ZMT B;  3VUB A;  4X1K E;  1M8V A;  5LA6 E;  2X4Y A;  3JCM g;  1BI1 A;  3GIB A;  5IAY A;  1MMD A;  3QJ6 A;  5CA0 E;  1KQ2 A;  4QXB B;  4DBQ A;  2XIC A;  4XTX A;  2PVO B;  2LE8 A;  4M78 E;  3HP9 A;  2E9X B;  2E9X D;  1HTJ F;  4C92 G;  3S6W A;  5JDH A;  2JNG A;  5HXR A;  3CXC A;  4R55 A;  1FX7 A;  4M75 A;  4JEU B;  1OZ2 A;  4CXY A;  4WF2 A;  5LYJ E;  1VQP T;  2KMT A;  3L3P A;  2D0T A;  3ZMV B;  2D0Q B;  2V7J A;  3HRU A;  5KE2 A;  5F3J A;  5FNV E;  5LJ3 f;  3CCL T;  2W0G A;  3WI3 A;  3GF5 A;  4A4E A;  1UGS B;  4EMK C;  4I55 E;  1XTD A;  2OTL A;  2QA7 A;  3IBP A;  4BUG A;  1H64 1;  3LGF A;  3CC7 T;  4C5E A;  4CZZ B;  2XU8 A;  1YJW A;  3N9O A;  5FXW A;  4WBO A;  4U72 A;  5HKC A;  2LTO A;  2EQU A;  2D2S A;  1MMG A;  2H3J A;  3HFO A;  3LJC A;  5GAO m;  3P8H A;  1T98 A;  1VQK A;  4UEM A;  3CQX C;  1UEB A;  1LNX A;  4XU3 A;  3W15 B;  4M7D B;  3INZ A;  3M5A A;  4IUR A;  2JJ9 A;  4M7D D;  5C8Y E;  5FXZ A;  2NOX A;  4JUY A;  3L1A A;  5LJ5 f;  1XOV A;  2X51 A;  1N9R A;  3FIF A;  1IJ5 A;  3EFS A;  3GN5 B;  5GAN h;  4BI8 B;  4QQ6 A;  2CE7 A;  4GOU A;  4CXW A;  1UGP B;  1JBM A;  5DJQ C;  3VKI A;  3KV4 A;  4LDW A;  3CCJ A;  1S72 A;  2QXF A;  2R58 A;  4JDS A;  3DKM A;  4C0D C;  2ZMA A;  3QKJ A;  5GAO p;  2KXP B;  4M78 C;  3P8C D;  4XU2 A;  4KMC A;  5LJ5 d;  4OB2 B;  3ZMS B;  2EAY A;  4J8O A;  4MZM A;  2PJQ A;  2RO0 A;  4PW8 A;  1Q7Y C;  3BDL A;  3MEV A;  3CCU A;  4ELZ C;  3K8P C;  5GAM h;  3R84 B;  2O4X A;  5LJ3 e;  3GNF B;  3JB9 G;  1MMA A;  1AJ3 A;  3ZN1 B;  3L2Q A;  3OYY A;  2G3R A;  4M77 G;  2E41 A;  2VKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...