4KBMB

Structure of the mtb card/rnap beta subunit b1-b2 domains complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
148
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETREQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit beta
publication title Structure of the Mtb CarD/RNAP beta-Lobes Complex Reveals the Molecular Basis of Interaction and Presents a Distinct DNA-Binding Domain for Mtb CarD.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transcription
total genus 41
structure length 148
sequence length 159
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kbmB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kbmB01
2LT1A 2LT3A 4MFRA 2LT4A 4L5GA 2LQKA 4KMCA 4XAXB 4KBMB 4ILUA 2EYQA
chains in the Genus database with same CATH superfamily
5GANd 1YI2T 1AOJA 4KP3C 1YHQT 2PQWA 2XAJB 4EIWA 3CMAQ 1XWMA 1YIJA 2E6ZA 4X34A 1UX4A 2V7JA 4J5YA 2M02A 4LN2A 2HH7A 2RP4A 1W9RA 4BA9A 3L2UA 5GAMg 3JB9H 4QKNA 1X75C 4JYAT 3OS2A 4WTOB 1SSHA 1BIAA 3L2ZA 2JMKA 1BK2A 2EJ9A 5LMNT 2VWAA 3SEMA 3CCLQ 2DX1A 4E7IA 1K0SA 2YXYA 4QXBB 4J9GA 4M78C 4QW2A 4M7AF 2C0SA 3KBTA 1UX5A 2XAFB 2A3LA 5KE2A 4DVDA 3S3OA 2OA5A 4X9CA 3REBB 2JN0A 5GAOl 3ANWB 1WXBA 5GAOr 2AZSA 1YXRA 2QA4Q 2YRDA 1U3OA 1T0HA 3CBPA 1KG1A 2CMRA 4ZZCA 2BIVA 4I0UA 2ZAEA 3VRAA 2CDTA 3ZT6A 3DB4A 2XDDA 4F7UE 1YJWA 4OHFA 1Y7XA 1UGOA 4IUPA 1VQ6T 2MWPA 2M67A 5J3BA 4WYVA 3VHLA 2YEVC 4C91A 4UF0B 4J9BA 2KYMA 1UEBA 1TH7A 1AWXA 3CMEQ 4PJOD 1M7KA 2KRSA 3CD6A 2EJFA 2FZCB 2ACXA 4F6RC 3G6EQ 5FVLA 1RL2A 4NPPA 4KGZB 2XY8B 4IDOA 1QWFA 3I35A 2X9YA 2MIOA 2KQWA 4TV8E 4ESRA 1OEDC 2KVQG 1BR1A 5IHKA 2W61A 1SHGA 4YXDA 2DD5A 2MI6A 2UXBT 2GGRA 1X2KA 5FY1A 5FXXA 3BW1A 4C92C 3VU3C 3CC2Q 1OOTA 5J2TE 3AE9A 1UJYA 5LJ3h 3MP6A 5GANj 1W4SA 4QXHB 3C51A 2VURA 1XNIA 4O5VA 3OS0A 2DFUA 5LJ3e 1OU9A 3CBMA 4M7AA 5L2LA 4O4HE 3I55A 3VS5A 2BE7D 1K76A 2JQHA 2DL8A 2BG9B 1FEWA 4EB6E 2XDPA 3LW5E 1M30A 4QQDA 3F2EA 3KV4A 2HMAA 3HL8A 4IE7A 1LCKA 1KEYA 1KFZA 4A53A 2Y8DA 4HWDA 1O75A 2RA2A 4E6RA 1RAGB 4HWIB 1FX7A 1PHTA 5HY6A 3I56T 1X79A 3EGDA 1M27C 2XKOC 5I22A 3UUXB 2X9XA 2K79A 3OTOT 2P4TA 2A72A 1NJIR 1LNXA 4LFAT 4ATOA 2V7LA 4IE6A 3IF8B 1UGSB 4JDSA 4ELZC 2V8JA 3GPLA 2E9XD 4DMVA 3CK6A 3TVTA 2HHHT 3G71Q 4N4IA 2JJ9A 1HJDA 3K3NA 3EH2A 4ZZBA 2EJGA 1EZ3A 4C0ZA 4O2AE 5GMKl 2J4GA 3I0QA 5L3BB 1KJWA 3TSZA 1AWJA 2O31A 1MIVA 4QKUA 2WSEE 1WXUA 3RYCE 4J83A 2BS4A 3MCAB 3O1HA 2CH4A 3PTRB 3NRXA 2K7AA 2JMHA 3JCMh 5GAN8 4A56A 2CUDA 4QH1A 3V7SA 4X1IE 1VQOA 4A54A 5C6SA 1YJ9A 1Q86U 3AEEA 3O8VA 3X26B 2LJ1A 5LJ5f 3JCMe 5KYUA 5JR9C 2VWFA 3EGXA 4C8QG 2NW7A 1U5PA 5CO7A 3UA7A 3FB2A 5GAMd 4BJNA 4JJCA 3Q5EA 1UGVA 2RK2A 5A0GA 1QP2A 3KDSE 3V5UA 1M2VB 1QMCA 3VS3A 4U74A 4P09A 4UXNB 2JTFA 4JI0T 3CX8B 2PVOB 1YIJQ 2ES0A 2HKNA 2KRMA 3B5MA 2VQET 3QSUA 2EBPA 3VKIA 4JLGA 2PG8A 3EFRA 2DL5A 3GN5B 1OI1A 1YHQQ 3QC9A 2RHYA 5LL6S 1Q7YC 4OFZA 4KMCA 1SRLA 3RMQA 4JZ4A 3JAEA 2VKJA 2W0ZA 4HN9A 1I0CA 5JRCA 2J7IA 1WR6A 5CKDA 4G2AA 3ZMVB 2NTXA 3ZN1B 1IGUA 1NLOC 3HPWA 4GYSA 4RKUE 4XTZA 4IDZA 1Q81C 2FHDA 4A4EA 2CZ7B 1Q82C 3C4WA 3CBOA 3TSWA 4Z8XA 1QW1A 3S4UA 3CQGB 1HTJF 2JQKA 2CSQA 4BUGA 2E12A 2BKPA 4KH1B 2XM1A 1VRBA 4EYYR 2LLYA 5LHGB 3ZMSB 1HFAA 1KNZA 3C4XA 5AQRB 2DWGA 1SKUB 4ZHQE 1YJWQ 3HKCE 3ZMUB 1WHMA 1YQ3A 2DERA 2RHZA 1US7B 1JXOA 2DILA 2QG9B 5L8RE 2L5QA 1I81A 1JEGA 2PNIA 5FXWA 5AQLB 5IXBA 3CD6Q 4QH5A 4GKJT 5ABHA 2ED0A 3OYGA 2OAUA 1G5VA 3RDVA 2OLTA 3EDVA 2RH2A 5GAOm 1IGQA 3O4XE 3KV9A 3TLSA 1JJ2A 3KUFA 4JLIA 4C8QE 1MNDA 3V7RA 1YJNQ 1WYBA 2UUAT 5F5WA 4J2CA 1BBZA 1IB8A 2NW8A 1B7TA 4B3MT 2NWMA 5GAMj 1E6GA 2RI5A 4R55A 4M77G 4X20E 1EX4A 2CCQA 3AVSA 3UT5E 2AE9A 2CGHA 3LGLA 1B07A 4JS4A 1VQNA 2LSGA 4ILAA 2IHR1 1VQ8T 3EH1A 1WHKA 3N5BB 4L6V5 3JCMb 3ASKA 4L0RA 2XHEB 1R8OB 3LG7A 3U78A 2K6DA 2XQ8A 3I55Q 2X67A 2KDSA 3LBXA 1OX9A 3P8BB 4PL6A 3LK42 3E9FA 5HXCA 2CXDA 3AECA 4DBRA 2YKSA 2V7KA 3LH0A 5AQHB 4JBWF 1JB0E 2XQ4A 4O2BE 1D3BA 4J8OA 1XZYA 2ZPIB 2N9DA 1RABB 4M78B 2G3RA 4C8QC 4MZPA 3AE7A 2VXFA 4C5GA 1BI1A 2Y4YA 5EK4A 2O4XA 3ZYMA 2L3PA 1ABQA 4KGVB 3L39A 2FJEA 2J6OA 2X0HA 4GKKT 5FY0A 2VVNA 4MDWA 2DKGA 2HQHA 2D1XA 4JI3T 1QCOA 2O9VA 3I56Q 4BACA 4NUVA 3OYDA 5GMKe 1VQLT 1ZUKA 3REAB 1HK9A 4N0AC 1QSDA 5DJQC 3OYXA 4HCCA 3FZKB 2K3YA 1QVGA 1U4QA 2W0GA 2ZLYA 1QLYA 2E41A 4YHHT 4F04B 5CQXA 3JADA 1WLPB 4DR2T 3H6ZA 2CUBA 3LJCA 2E1HA 4C92D 3AEAA 1TWBA 3M59A 1PM3A 4RTZA 2XASB 3WAJA 1YJ9Q 1VQOQ 1W70A 2YDLA 1JJ2S 3OKQA 2WDRA 3H8ZA 4LUEA 1ZV4X 8AT1B 1SE7A 2CRBA 5CA0E 1VQMQ 5I21A 1J1JA 4M77E 3H41A 1UJ0A 4LMLA 1QKXA 3AA0B 1VQKT 3OYNA 4ZGJB 5GMKm 1ZA1B 5CQYA 2LSKA 2IAKA 2YDQA 2RHXA 2Q9QB 2EYZA 4M75D 1FJGT 4JI8T 2KBTA 1G3SA 4GLKA 3UDCA 4AKIA 1X6BA 4AQFC 2KSSA 2LQWA 5AQVB 5FXZA 2I2LA 3JCMc 3NMZC 2DVJA 2KRNA 2XSAA 5AQKB 4PFPA 4E7ZA 2CLYC 1VYTA 1T72A 2Z0WA 5C8YE 4DA4A 3UU5A 1TU0B 3JCMQ 1HX1B 2J62A 2E10A 2NWBA 1AWWA 3PT9A 2HD0A 5H6RB 2EYXA 3QZ5B 1GCPA 1M1KC 2VK9A 2G6FX 3AHUA 1YBYA 1K8AU 2YUPA 3E2UA 1YKEB 3A7MA 5AQNB 3NWIA 4LDUA 3CCVT 4M77C 3JV3A 4RMOA 2D0NA 1JNRA 1G3WA 4DUZT 2M9UA 4RTVA 2K3WA 3NTIA 2V7MA 1IBKT 4PJNA 1N34T 5LOVE 2HPJA 3E1SA 5CAIA 4RTWA 2LTOA 2LM2A 4MALA 2CYZB 3PGGA 3CCRA 1ZSZB 2QK0A 3A98A 2KYBA 3PUGA 1ZHCA 4HKEA 2F69A 3OBWA 3UFGA 5FU7C 3MEVA 2VQFT 1QVGS 3U23A 4E7JA 2PBIA 4PJOE 5KYWB 1WDXA 4O4IE 3RHWA 2M6BA 4I55E 9ATCB 3J81E 5AT1B 2I6HA 5JR9B 1VQ7T 3ME9A 3P8DA 2QQ9A 3EHZA 4AKGA 2YUQA 2LE8A 4M7DC 3AAIA 3ZMZB 5M4YA 1M8MA 3O1IA 1VQNQ 3HTRA 1YWPA 4XTXA 4CN4A 3CCSQ 3FBZA 2OTJA 2A37A 2RQUA 2O88A 4CN6A 2BKDN 1QVFP 2H3EB 4OYJA 4B9XA 2RJCA 1UDLA 2E2AA 4UV8B 2XU8A 4ME7A 2GQIA 3PVLA 4PJOC 5LCYA 3VR8A 3CMAT 3B57A 3P4PA 4ZS3A 4LMJA 1VIFA 3RGLA 1NENA 3I9QA 3MP1A 3T9NA 5FRNA 3URGA 1AJ3A 1HF8A 3AVRA 5DQWA 1MNEA 1U1TA 2WQYA 4WZXA 2WY2A 2FZKB 3C4SA 4F14A 3RRCA 2I0NA 2BZXA 3IBPA 5AQMB 1N33T 1V1CA 3EHRA 1VUBA 1VCSA 3ZCIA 1E7OA 5JDGA 2DLRA 4TNVA 1OZ2A 3KV5A 1GFCA 3CCLT 1Q86R 2AK5A 2EHOA 2KINB 2DE0X 3CEYA 2QGSA 4IL9A 1X43A 4F16A 4DO0A 4ZI3D 3TEEA 2MBGA 4FT2A 2J05A 2X66A 3HI2A 2ENMA 3EG9A 1KF6A 3RIFA 1AHJB 2GTOA 3N9QA 5L4EA 2QGFB 5JDMA 4LFBT 2BZ8A 4JUVA 4A97A 3A5ZB 2XHCA 3CVRA 3M65A 4XTUA 1BI3A 2QA4T 1WYCA 3CQXC 1K73C 4PK4A 2CH4W 1PRMC 3PUSA 4CI0C 1OU8A 2EQJA 2LC4A 5AQIB 3PIOA 2XPKA 4YY3T 1UGQB 4HFVA 4OGEA 3CMET 2QXFA 3QYHB 3MPUB 3PDYA 2LDMA 5D6WA 3L2VA 3JB9D 2D8JA 2GTJA 4LD9K 5LA6E 2CP5A 2HPLA 2VKDA 5ECAA 2EQUA 3RKYA 5L4HA 4EPCA 3LDQB 1PWTA 2CPTA 3JAFA 2VVKA 2L3LA 3CC2T 1I6ZA 1IBLT 4Z02A 2L9QA 5CKHA 1MMGA 4CXWA 1WGSA 3RESA 2JUFA 2KROA 4JRQA 1RAHB 2OTLA 2FUPA 1BR0A 1RAAB 1YFNA 3TLTA 4DV1T 4U72A 3AT1B 1NPRA 4IE5A 4AG2C 2K3BA 5LJ3f 4XAXB 4IUVA 3CXCP 1Y96B 1B34B 2VL8A 4U31A 2ZPFB 3CCMQ 3M0RA 2X68A 3MO8A 4X9DA 2G0UA 3T1HT 3A8MB 4C5IA 4H63H 2IDOB 5HXRA 8ATCB 3UU4A 3LLRA 2QA7A 2R5AA 5LGUB 2QGGA 2X0YA 3O5ZA 2EHOD 3CCEA 3CCRQ 2D6FA 1GFDA 3OW2P 2FRWA 2W66A 3D0TA 4YTLA 3IHRA 2HQXA 3G7ZA 3RBBB 3ZL7C 3R6NA 5HWXA 2MAMA 3BDLA 3QUIA 5D7UA 5IUXA 4YFSA 3UT1A 4HFEA 4WCIA 1H3ZA 2V8SV 4GIWA 4DUYT 4X1YE 2W00A 1Z8UA 4AIUA 2ZCFB 3P8CD 4EEDA 5KCOA 3G71T 1TS9A 2DXUA 2YOEA 4TN7B 1WPYA 4J9IA 4KI0F 3SFMA 1I07A 3ANWA 3L2WA 3M0QA 1O3XA 2COWA 4N4HA 3MXZA 4C92G 2CHOA 4EOZB 4U2ZA 1NAFA 3SRZA 2KMFA 3CCJT 4J9DA 1MMDA 3PUQA 4XQ3A 4F7UG 2C0OA 1HNWT 4ZN3A 4CI2B 3LSVA 2K2VA 5GMKi 2A36A 5LG4A 5GANh 5J39A 2ZM0A 3NFCA 4U2YA 3M0TA 1NPPA 2X9HA 4AFSC 2LP5A 4UF0A 1SEMA 1JNZA 3K8PC 5GANe 3JAME 2OTJQ 3JCMf 2V6YB 3A1PA 1L0VA 2ACZA 4M75G 1VCTA 2DPPB 4OMQA 2YHTA 1YIJT 5LHIB 1U06A 4RG8A 3FDRA 5L47A 1TUDA 4CC2A 4NOYA 4NXNT 3C0CA 5AQFB 1D09B 2H7VC 1KIKA 1NJIC 3FZMB 2BVMA 5J2UE 1NLPC 1R0CB 4M77B 1LKXA 3NRYA 1UHCA 1M4ZA 2BS2A 2FG0A 2EKOA 5J26A 1QKWA 5FWCA 3RX6A 1W1FA 2D0QB 5I2MA 2EQMA 1WFDA 2O01E 5HXSA 2P4RA 1PD0A 1E7PA 3VKGA 2LRQA 2BG9A 3RIUA 2DXBA 2JQQA 3AA6B 1WHJA 5CKBA 3JB9I 2HL5C 3ZC1A 2LVMA 1QLBA 3EVYA 4OP0A 1MMAA 1R8IA 3VYGA 1OEDE 3QNUA 1TXQA 3AA7B 2P84A 2EFIA 3INZA 1R77A 3RKXA 4DR6T 1YJWT 2BZBA 3ETVA 4IDQA 4OB3B 5HCKA 4AFUC 1XTDA 4NS5A 4C92E 1O9SA 4DR7T 1WZOA 4OMFB 3JC6D 1HX8A 4M7DD 3A8OB 4ELYC 1FYNA 2VB6A 3NKZA 5LBQB 5GAN7 3CD6T 3OYHA 4XU0A 1K8AR 1E6HA 3WVEB 1T7SA 5FXVA 1IREB 1WHLA 4KGXB 2DL1A 3ZSTA 5FRMA 4CC3A 2K2MA 3CX7B 1YJNT 5LB7B 3VRZA 2UXDT 4DBHA 4O8SA 3TLVA 3M5AA 4M75E 1VQPQ 5DM7R 2V7IA 3CX6B 2IMLA 1D1AA 3CQTA 2EWNA 3DP7A 1E2AA 4L59A 3AE8A 1X6OA 2LNHB 3EG0A 2OTLQ 1EZZB 1W09A 2QTXA 3LK2B 2YUNA 4WW0A 1LOJA 3S6WA 3I55T 1ABOA 2FBWA 1M2VA 2WM9A 4JI2T 1P92A 4GY5A 1IJ6A 2DA9A 3JCMV 5LHHB 4V2SA 1VQ6A 4DV4T 5FROA 2RM4A 4OMNA 3H9NA 1UB4A 2HEQA 2X0LB 2HCKA 2PVGB 3P8HA 4XTVA 5EG2A 4EZHA 1Y07A 2JMCA 4ZTFA 1KQSP 3E19A 3GN5A 1E1HB 3CCEQ 1G8XA 4M75C 2ODUA 3GMIA 1LRZA 3CCQA 1S94A 2C5IT 2JXBA 4OF1A 4H9RC 2RHUA 4V1Av 3SWNB 3ONXA 1D1CA 3RUXA 3ONLC 4M1PA 4ASKA 4IL4A 3U3IA 3IQLA 3HKEE 3UQ7A 2KGTA 2WMOA 1WQWA 2RHIA 1ACMB 5FVKA 2WU5A 1RAFB 5GAOn 5BMVE 3H3MA 1OX8A 3JB9J 4HEAA 4M78F 2CA5A 3THKA 4UVBB 4BY6C 2QQSA 4TX5A 3V8KA 3SWHA 1WIEA 3BDUA 1M9SA 2MTQA 1UFFA 5GAMh 2DM1A 4NXMT 3MKDA 1VQOT 1YJ9T 2E4HA 5GAMe 3JB9G 4RUGA 1Z0PA 1N8RU 2E9XB 4DIDB 5GAOp 1VQ4A 1VQMT 1HG5A 3SD4A 4JZ3A 3CCJQ 1HNXT 4ZEYA 3VS4A 3EUHA 2FEIA 3OVUA 4Y91A 1M3AA 3M53A 1NYFA 2Y4XA 5C0MA 4OGCA 4VUBA 1WCRA 2K24A 2RJDA 1Y0MA 2W4XA 4LF7T 1BKBA 2EYQA 2L89A 4MMLA 3BQLA 2QQAA 4DOVA 4XK8E 5IAYA 5IHNA 2QI2A 2WWVA 4P0AA 3M0UA 5ETWA 2EGCA 1OQKA 3DKMA 3M58A 2IC9A 1WLXA 2C06A 4U3CA 1XOVA 2JVVA 1C1AA 1N27A 2KK4A 3OBVE 2JMAA 3ZSSA 4Z8AA 2RQRA 4HVUA 2RA1A 1UUSA 2X3WD 1ZUYA 4XBFB 3HKDE 1WHGA 3GNGA 1G73A 2CEAA 2VV5A 4M7AD 4FU6A 2BZYA 3UA6A 2DD4A 4F7UF 3HSBA 2HN2A 2YWWA 4CZZB 4FM4B 4WNKA 3QIIA 3X28B 2DEQA 4LDWA 3VRYA 2DETA 2YK0A 2XSBA 3CIRA 4LF5T 4M78A 4LDYA 2IVWA 2KY9A 2VVSA 2QYZA 3RI5A 1SRMA 2D0UA 4JUYA 2NW9A 1NEBA 2LRLA 4FI5A 4JJBA 1JRIA 2HSEB 2IW5B 2YRCA 4M4ZA 2MOZA 4PFZA 4Y92A 5AFUL 3SOLA 4NIQA 3ONJA 5JDLA 5ABFB 2CP6A 1H3HA 3RKWA 2WB5A 4H63V 1EIFA 2CXLA 2CT3A 2DNUA 1XDPA 1WI7A 3HA4A 2AHJB 4PLLA 4ZI3C 1QUUA 3PJAJ 4HFCA 2F1LA 3HFOA 3J7AF 2RMOA 3LH5A 2CP3A 5LJ5g 4N4GA 4TNWA 1M90U 3PIPA 2LHNA 5KE3A 1SHFA 4ORZA 1K0XA 2LQKA 3G4SA 1CSKA 3JCMX 4LDXA 4B9WA 1VQNT 1YWOA 2DRKA 4H9NC 4JJDA 2QEXA 5CKFA 3CCST 3ZLIA 2C5KT 2F4VT 1K9MU 2JM9A 3ABVA 3UUMA 3I0OA 4JV5T 2KT9A 4FIBA 1OYXA 1KC8U 4DBQA 4Q25A 1HG2A 1WX6A 2A08A 3CC4A 2D9TA 2C0TA 2LM9A 4EMKC 2Q9QA 1JXMA 2MOXA 2E8IA 4DV3T 2WZIA 4GOUA 5JREA 3Q1JA 5IXFA 1HNZT 4QX7B 2MAWA 5JDFA 4D8DA 3OA6A 2LMJA 5AQSB 2DRMA 5L3DB 2MK5A 1MIWA 3E08A 4YHJA 1I1JA 4BI3A 2IIUA 1PRLC 5L3FB 1QCFA 2LSJA 2K9GA 3M55A 3NVOA 3VYHB 2PFVA 4GK0E 1IJ5A 5KH6A 5FMNA 2K3XA 4HVWA 2A0FB 4QQGA 1LJOA 5GAN6 1OWAA 4DR4T 2WP9A 1T8BA 3L8RA 3QUJA 2E5LT 5H6QB 4M7DG 4UEMA 1IAPA 2V5DA 3QYGB 5HYAA 1ZEEA 4UV9B 4JPBW 1ZSZA 1PD1A 3RLFF 5A2QE 2D9DA 3OYEA 4TZ4C 3UUNA 3ZC0A 2XIDA 5F3JA 3UU6A 1N32T 4TV9E 4LF4T 2EHOC 1VQ4Q 1C6VX 2XQ3A 4FYXB 3MEUA 2R5MA 4DV0T 4X64T 4PJOG 2CBIA 1AWOA 4EEBA 3IEEA 4KH0B 4HFBA 5KYWA 1OEDB 1VOMA 2V1QA 4U7YA 2BBHA 2DMOA 1UK5A 2EYYA 2V6XA 3RYIE 4ILBA 2N1GA 2CREA 1VYVA 5JR9A 2XQ7A 3AEBA 4C92B 2ZMAA 2LRKA 2ECZA 2DEUA 2AT1B 1RUWA 1ZUUA 2H89A 1Q86C 2VXEA 3RH3A 4MBQA 4A4FA 4YSXA 4F7UB 4XU3A 4HCKA 4QQ6A 3QG1A 4JRIA 2AZVA 4CRIA 1RLPC 4H9SE 3Q5XA 3VV0A 4BAYB 4DV6T 2W63A 3PUVF 3N2OA 2JPFA 3EABA 2LT4A 3M0PA 5FU6C 2Q9QD 4KHZF 3P7IA 4RTYA 2X4JA 4M75B 2RD1A 3CCMT 2CS7A 4X1VA 5BR8T 4AI6A 1IRXA 4ZTJA 4PNOA 2FJBA 2FJDA 1U8RA 3KBUA 2X3XD 3FZFB 1W2BP 4C0DC 1QVFA 5M9OA 2HN1A 4YTPA 4JI6T 3EHQA 5DQVA 4DR3T 2J6FA 3RPUA 2OV9A 3CCRT 3RYFE 4ZOLE 5FY7A 3WI3A 2OAWA 5DY9A 3X24B 4IIMA 3CPWP 2OJ2A 1FMWA 3HL6A 3V8LA 5KYYB 3QXEB 1Q95G 5LJ5d 1BR2A 4GYRA 4M7DE 5HEGA 1G2BA 2DLPA 4C8QF 1KD1R 4DV5T 2CWOA 2JOYA 5L3EB 2ZPEB 4O4JE 4BD3A 1BCOA 1GCQA 2CXFA 5LYJE 3NGPA 1DU2A 5EC7A 1BB9A 4FYYB 3F57A 4FCYA 2M0OA 3ZEFB 4TWFA 2WS3A 2X35A 5HCMA 4Z90A 2LHRA 5EK2A 4QHOA 2QTVA 2LOPA 3VR9A 3VS2A 4ZGDB 3G4SQ 4YSZA 3MJXA 1BYMA 3OYYA 4BJMA 5ABEA 2JIWA 2XZEA 3HKBE 3ESLA 3OPCA 4IREA 1YNZA 2V5CA 2DXCA 3M56A 5KYXB 2Y6XA 2YN6A 1MIYA 5FYMA 3ZKRA 3KFWX 2GNCA 4KBMB 5ADXL 4ZI2C 5HWYA 2RF0A 2GFAA 5FWBA 2OTJT 2HQEA 3SB2A 2L8KA 2W62A 1WJQA 2F5KA 2PUKB 5AQOB 3GIBA 3JC6C 3LGFA 5GANf 2EYWA 3Q5WA 4A4HA 4FT4A 2LSIA 4UC4A 5LJNA 2XJ7A 3HKSA 3CC4Q 2KXDA 2FB7A 5LGTB 1NBEB 4FW2A 2BUDA 1KC8C 3UUBA 5KCHA 1YP5A 2NUPB 2WACA 2ZGWA 3GP8A 1OPLA 2CZ1B 3CPZA 3ZN0B 1HR0T 5JDQA 2EVRA 1N8RR 3JRZA 3OB9A 4M7AG 3H0FA 2NUTB 2LX7A 2E6NA 2VC8A 1QVFS 3AA1B 2HSPA 4AFQC 2LT3A 4DV2T 2BG9E 2BS3A 1U5SA 1Y96A 1XNRT 1B34A 1M3CA 1BIBA 2RPAA 4LF8T 1KFYA 2N2NA 2H88A 2IC6A 1OPKA 3LYIA 1YW0A 4EMHA 4PAGA 5LJ5j 3FJPA 1BU1A 2P0QA 3CXCA 1ZOYA 2WSSV 2XM2A 3RYHE 3BE3A 5L23A 1JQQA 2NP9A 2WSCE 1SA0E 2XK0A 5KMGP 1KK7A 2KLQA 4M77F 5JDNA 3TLUA 2KWIB 2ROLA 2UUCT 4LD6A 3VS7A 4KRTA 2QRXA 5E0OA 3CMAA 2JRKA 2M6IA 4JS5A 3N2KE 4HTEA 2RQWA 3OW2A 2XG8D 3L2RA 2LNVA 2PTKA 1S72A 1OZ3A 3I9YA 1YCYA 2K5BB 1UTIA 3CC7A 1VQ5A 2B76A 3ZFJA 1G83A 2BG9C 3PU3A 3RIUC 5CB4E 3RNJA 4BDYA 2XD0A 1WQ7A 3OYFA 2L8DA 4CC4B 4HWFA 2BE9B 4OYKA 4BE1A 2ZM8A 5GJVB 4UVCB 1VQPT 4UVAB 3RIAA 2WSFE 2ODVA 4H9PC 1M3BA 2HDAA 2CKKA 3MEAA 4DR5T 1PNJA 3UATA 1NM7A 3CKDA 2X4YA 2GBQA 5FL1A 2OTLT 3JCFA 4EMKB 2J06A 2ROTA 3IA3A 5HEOA 2DIGA 2V6YA 2XICA 3CCUA 2XAHB 2DYBA 5LBMA 3P50A 4TWDA 4YLHA 4EV6A 1BI0A 4IDPA 4C90A 4M7AE 3JCMJ 4JLEA 2WU2A 3GWHA 3PJAA 1W0AA 4J6WA 3V8JA 3H37A 3N2GE 3L1AA 4C8QB 1M90R 2SEMA 2VKHA 1YQ4A 1PC0A 2XDBA 3CCET 2DYIA 1QWEA 1X69A 3G6EA 3SFDA 4M77A 4PJOF 1YITA 5D6YA 3NTHA 4DEXA 3PUYF 1K8AC 1M1FA 1K9MR 1RAIB 2R58A 2YSQA 3CXCS 4U7IA 4PK5A 5AQQB 3PVQA 5IHYA 3RQWA 2DJQA 2E5QA 1KC8R 5HEHA 4MMKA 4J7IA 4JI1T 3DB3A 2WDVA 2BKOA 3ETUA 3VKHA 1CHUA 3FZHB 1IZ6A 4Z89A 4HVVA 2COYA 3OYMA 4JEUB 1T3SA 4M7AC 1WXTA 3FLGA 3NZPA 3VJPA 4KX6A 3OW2S 1PG5B 1X27A 4BE0A 4P1NA 4IUQA 2CBJA 3HFNA 4PLIA 2JS0A 1M5Q1 4OMOA 4UIGA 2P9BA 4COFA 1N9RA 1N6AA 1XDOA 3EI0A 5LG3A 2DTIA 1NE8A 2KZ7B 2IUBA 5GAMf 1D0ZA 4QX8B 2RI3A 3NTKA 1FMKA 4IKFA 3OMCA 3PV0F 4XU2A 2A9UA 2MPKA 3UULA 2YDRA 2DBKA 5IYZE 1I4K1 3Q9DA 2E5VA 4H9OC 2ATCB 2NUZA 1AT1B 2DTHA 1WNLA 5KX5E 4O6JA 3QOFA 4HWCA 1UGRB 1GBRA 4IGUA 3J7Yq 2ESWA 5HXEA 2V1RA 4DBFA 5CJ5A 3RRWA 5LJ3g 1VQ9A 3UU8A 5CFBA 4O4LE 3G71A 3CPFA 2CLYB 4LF9T 3RQUA 4A63B 3MA9A 2HBWA 4A4GA 1UCUA 2RJFA 2P0PA 2QQRA 4C0DB 2EPDA 2HBPA 3WAKA 3J80E 5CCAA 2YINA 2Y48B 2K5LA 5HAXA 2DWKA 2M16A 2A2FX 3EDUA 2EW3A 1CUNA 3AE5A 2LJ3A 4JI5T 3LWIA 4YTNA 2DZ9A 2CZ6B 1I5LA 3AAEB 3NZQA 2DI4A 1XNQT 2MMPA 5I2SA 3GOXA 3N9MA 3AXJB 2V26A 2WZHA 2FPEA 3RC8A 1LPLA 2ZM6T 4HFDA 2QAZA 4CI3B 4C5EA 1T3LA 1GXIE 4X62T 4RTXA 5F8PA 3ZBDA 5FU7B 3SWNA 4QVDA 5DABA 1Q7YU 1KQSA 4P5NA 5HKCA 5A1LA 4B6MA 3WVDB 4FJOA 3TU4K 1KQ1A 2RJEA 2X51A 4KHPT 4ZI2D 1S72Q 1Y71A 3ZJ1A 1YI2A 1YHQA 1VQ5Q 2IG0A 3CC7Q 2R57A 1ZBJA 5HK3A 3AEGA 2KI7A 1Q81U 4FYWB 3T1YT 2RB6A 5GAN5 3FZLB 1Q82U 1D1BA 3HR0A 1OV3A 3P4SA 1UE9A 3OSVA 1KSWA 1HXDA 2YRVA 3O1JA 1KHIA 4JJNK 4M7DB 4ISTA 2Y90A 2H8HA 3JCMg 3DTOA 1RACB 1WYXA 4CXXA 2UXCT 4JRKA 4AFZC 1HCIA 1XMOT 2QQBA 3FHNA 1TUCA 3R84B 3EFOB 3UU3A 2ED1A 4TVRA 2LCSA 4I4TE 2QASA 2GQVA 1WJRA 3HRUA 2E9XA 3TREA 2XQYA 4K0UA 4EMGA 1AEYA 2PU9B 1W0BA 2NLUA 3PMTA 3CCUQ 4IT4A 1RLQC 1S1NA 3EGUA 5LMUT 4PJOB 4AG1C 4Z91A 3S3MA 3AE1A 5IWAT 1ZHIA 2KAFA 1CKAA 2XQAA 2JW4A 2DHRA 3EG3A 2BVLA 2MF2A 2RI2A 1KD1U 3TKLB 2LOSA 4ILUA 1SSFA 4EIKA 4B3RT 2RQTA 5AQGB 5L3CB 2MYSA 3META 3VRBA 3CCQT 2ZM2A 3A8HB 4RTTA 1YITQ 2OI3A 1D0XA 1GRIA 3RKOA 3EAMA 2DL4A 4B3ST 3FXDB 4C0GA 1XMQT 2EGAA 2K57A 2YLCA 1YJNA 3OQ5A 3GBQA 2CHNA 3K1SA 5CGMA 3TLWA 3QK6A 2JT4A 2L3SA 3NPFA 2DK3A 2PVDB 2XAQB 2OX7A 2DXTA 2Q9QC 4OMPA 1JU5C 3S3NA 2BKNA 1KQSS 3N9LA 4X1KE 2LKHA 5JDHA 3MZKB 2JM8A 2H3RA 3MHXA 1PCXA 4OVAA 4DNDA 2FVUA 2QYWA 1Y01A 1LVKA 5AQUB 5ABFA 4F17A 1VQ4T 3PUAA 2ABLA 1VYUA 3G1JA 3I5SA 5LJ3d 2VASA 2NYSA 4AT1B 5HXHA 3ZJ2A 4E2FB 1MUZA 3KVBA 1TUGB 2SPCA 3QZ9B 2KR3A 2V8IA 2LKGA 1B3QA 2KXCA 3GNFB 4AXPA 4EXTA 2HKQB 4QVCA 1K4US 3GA8A 2JQ9A 4AKLA 4RTUA 4BDZA 5FL0A 2VKOA 3QO3A 3I56A 2O9SA 1T98A 1VQ9Q 1ZSZC 3HHTB 3QKJA 1Z9ZA 5CKEA 4ILCA 1QCNA 4HGAA 2K4YA 4DR1T 4OX9T 2K5FA 3BQIA 4OB2B 2E3IA 3PE0A 1S35A 2LEHA 1I5OB 5FKYA 3UTKA 5ABGA 1ZP0A 2UXNB 4N78D 1IHVA 1UHFA 3RERA 4XTYA 3N9NA 4C92F 1MV3A 3FB9A 2YT6A 3MK7C 3VUZA 3M57A 1V76A 1G3TA 1ZX6A 3PMIA 1VQMA 3LWHA 5CK9A 3KVAA 1EFNA 2PTFA 4LDVA 1N36T 3V5SA 5AYFA 4CXYA 4JI7T 2W2UA 4Y28E 3OYIA 2DIQA 1RI0A 2NTYA 5DLOA 5CIUA 3OYKA 5GONE 1VA7A 4M7AB 3OY9A 4RCCA 4UELA 4ANJA 2NR4A 3JCMd 3ZYLA 2DBMA 4TUYE 4M75F 4X5TA 1YI2Q 5IN1A 2E5KA 1M1KU 5GAN2 1NG2A 5LGNB 4E47A 3QWXX 2EGEA 4LUDA 4E7LA 3OYJA 4J9EA 5AQJB 1JBMA 4CC7A 1YKHB 5LJ3j 2CP0A 2DNXA 4IURA 5I11A 2HNIA 3G4ST 3AE3A 3QDRB 3EGDB 3V7CA 1NZ9A 2CP7A 2EQKA 4IIOA 3ZPOA 4KT0E 2QEXT 1N5ZA 1RADB 4AKHA 2LQ8A 2VKNA 2CT4A 2F5TX 2VGNA 3GLXA 2UU9T 2E3HA 5FNVE 3G06A 3FC3A 2Z6EA 4HA8A 4DMWA 2CE7A 2VUBA 3AB3B 4B3TT 1OEDA 3KINB 1GCQC 2B1EA 4LMKA 4ZN1A 3CC4T 2ZZDA 4E7KA 2JTEA 1NEKA 1V29B 4C92A 4LF6T 2HL3A 3ULRB 5JTGA 2AKLA 3MP8A 1K1ZA 1I8FA 2W10A 3UPUA 4YTMA 2CSIA 3A8LB 4FW1A 5L3GB 3TCJA 4XU1A 4F7UA 5KXJA 1X01A 2EQIA 2KE9A 1VQ6Q 3SDZA 1KD1C 2LJ0A 5KYUB 2DO3A 3LX7A 3EGXB 4YSYA 4HFHA 3A8GB 3NBXX 2EKHA 1ZBXA 4AMCA 5J1GA 3DLMA 2QVAA 1YCSB 3CCQQ 3TQ7P 3M54A 4M75A 4RG2A 1MGQA 3MACA 5GAOq 2LCCA 1AZGB 1QQJA 2O2OA 4KUDK 4IE0A 1NWMX 1HSQA 4OB1B 1VIEA 2CP2A 4A98A 3CCSA 2EAYA 4PJLA 4KUMB 3JCMP 1RAEB 1M62A 1PKSA 1AZEA 2RN8A 4HFIA 4M78D 3M9QA 5HCJA 4PW8A 1PSFA 2D0TA 4CQIA 3GF5A 3SHWA 5FW9A 4MZTA 1M8VA 3HRSA 3PUXF 1W2BA 2A3DA 2F2VA 2YDSA 5FP3A 2ZPBB 4ZS2A 5KYYA 4YJ3E 2J6KA 1VQ8A 3PUWF 2DL7A 3P4WA 1SUMB 5JRCB 2CZ0B 2AIRB 3A8YC 4MLKA 1DJ7B 3BY7A 3ZEHA 1G3YA 2W67A 3QPHA 1Y64B 3CPWA 3FRNA 2ZPHB 4HXJA 4BB7A 2L3RA 3C98B 3AE4A 3ZT7A 4HT8A 2IIMA 1D0YA 1KNRA 4DOWA 3P4RA 1QVPA 2CWYA 3JSCA 2L3QA 3PFSA 3OSSC 5GMKh 2V8KA 1NEGA 4FYVB 2WBLA 1HD3A 1N8RC 1T0JA 4H9QC 4QT7A 4QVZA 1K73U 5AQPB 3CMLA 3UF4A 4G63A 5KYXA 4GLMA 3B13A 1X6GA 2M51A 5IT9E 1Q7YR 3OYAA 2RK1A 4DEYA 1JJ2P 2JZ2A 4LE9A 4OK0A 4LXCA 4I50E 2X4WA 3OS5A 2KNBB 1A0NB 4XZCA 3HP9A 2XMFA 2GCXA 1VQLA 3I9WA 4KULA 3QBYA 3ER0A 1Q81R 3CWZB 2KEAA 1OXZA 1V9DA 5CR2A 1JO8A 1Q82R 2LSYA 1WHHA 3RMSA 4QXCB 4K0KT 5LJ5h 5CA1E 3OYZA 5C2TA 3VS1A 2M0YA 3PU8A 2I59A 2NUPA 5IH2A 2WAUA 2UXXB 4GK5E 2X4XA 5LJ5e 1ZQ1A 3L42A 1KHCA 5J0ZA 1UGPB 4DV7T 2DZCA 5HEUA 1IO6A 3M0SA 3JB9F 1IHWA 2NUTA 3PURA 3AE2A 4EZ4A 4AQGA 4OMLA 3A5XA 2AXDS 3LBXB 2IPOB 2QDLA 4E7HA 2WCAA 1VQKA 4EYUA 2I0MA 4IDNA 2KMTA 3QJYA 2PZ1A 1W2BS 4J9HA 2GFUA 3RR6A 1D3BB 4BY6B 2BBJA 3DJBA 2YUOA 4MZMA 3HRTA 4L9IA 3K3QC 2AKKA 2D2SA 4PJMA 3UQ4A 3D7SB 4EDUA 3CPWS 3LFMA 3P4QA 2JNGA 1TSFA 2O4XB 3CCMA 3OYBA 3X1DA 1W6XA 4AISA 1ZA2B 5TAOA 2DAQA 2HAXA 5KYNA 5GAN3 1QVGP 1H92A 4ZNXA 2A28A 1H641 3CCVA 3VUBA 1NYGA 4IE4A 4MHCA 1M90C 2QEXQ 5D6XA 3KFVA 4Z88A 4UR9A 2DTOA 1GBQA 3EG1A 3I5RA 5JH7E 3M4GA 4HT9A 4BI8B 2WDQA 2FRYA 4AKRB 3FBLA 3MEWA 4C0FA 1J3TA 4MFRA 1WFWA 2XTLA 2E64A 3OYLA 3RIRA 1K9MC 3BQKA 1H8KA 1FIOA 2FPFA 2LT1A 3C50A 4J9FA 4D8KA 4EMKA 5GMKj 2B86A 3J9X1 3X25B 2LCLA 1XQHA 4WBNE 1GL5A 3ZCJA 4ERRA 1SF9A 5LXTE 4FSSA 3UFEA 2JS2A 3AE6A 4ZGEB 4J6XA 4A5XA 2J1DG 1HS7A 4IIJE 3N5LA 2DVEA 1UURA 3C94A 3H0HA 3C12A 3QDFA 2R6GF 2EIFA 2VGMA 4P0BA 7AT1B 2LZ6B 1IXDA 2C5JA 4C8QA 1ZSGA 2E65A 1VQ7A 1F1BB 5LJMA 5GJWB 3EAEA 2FL7A 1SHZC 4OMMA 3OYCA 2D5UA 3C4ZA 5FLXE 3UWNA 1I94T 4QWNB 3W15B 2P0KA 2VL0A 4HKAA 5C3JA 4GBQA 1MMNA 1H7CA 1IZNB 3L2QA 5AQTB 3VS6A 3R6OA 4JI4T 5IHIA 1J5ET 1NJIU 1VQ8Q 1CKBA 5A0DA 2F2XA 5JVDE 4QH4A 4AQYT 2LQNA 3SS1A 1S72T 4WBOA 5LNKA 1FXXA 4FSXA 5EK3A 4N0AA 3C95A 4II1A 1VQ5T 3CC7T 3X20B 4FL6A 3FJ5A 1J5WA 4DQ2A 4NL3A 4ISSA 3N9PA 2HZYA 1FWZA 4PKCC 4PNIA 5DLQE 3VS0A 3QHSA 2LJLA 1MHNA 3L09A 2D8HA 4NL2A 2YU2A 4OB0B 2FJAA 2V1DB 2DL3A 4WF2A 2F2WA 3PNWC 5A0LA 3SFEA 2C0IA 1UUEA 2NOXA 5GANg 2MWOA 1FMVA 2DF6A 1OEBA 3CCLA 2J47A 4R0KA 3SWNC 3FIFA 1YD8G 1MV0B 5HK0A 1PSEA 5EZYE 5HEJA 3CCUT 1X2QA 3K3OA 2UUBT 1VQLQ 1M1KR 1BR4A 4MDXA 1UG1A 2MCNA 4ZXLA 2VYTA 5LP6E 4Q5WA 2QA4A 4LFCT 4AQFA 2L0AA 2FO0A 4F8HA 4BE2A 1LVFA 3F70A 3OMGA 4M7DF 3NHNA 4IHJE 1ZLMA 3G6ET 1WR0A 2FZGB 2M1HA 2B8AA 1YITT 1M1GA 4YT0A 3CQCB 1IBMT 1OULA 2DCFA 2YLBA 1K9AA 2XQ6A 2E9XC 2XQ5A 3CMEA 3AEDA 4U33A 4X65T 3BFMA 3RC3A 2XQ9A 3E9GA 1BCMA 3ZMTB 1UECA 3H3AA 1VQPA 4ADZA 4J6YA 3OS1A 2E70A 3PUZF 2RQVA 4J7FA 2COZA 4C8QD 1VQKQ 1ARKA 2KXPB 3Q2MA 2KWHA 4HCBA 4TWHA 2SRCA 2A7YA 3EFSA 4M78G 3E0ZA 3OBYA 4LNPA 2RO0A 4XTWA 3FEOA 2BDEA 1PKTA 3Q5DA 3CC2A 3JCMW 2MPXC 2YU1A 3AXJA 1Z9QA 3E22E 4IUTA 1WRDA 4RCBA 1N9SA 2XUEA 2PUOB 3AAAB 1M2OA 3KBGA 4A4KA 2EHOB 5KDMC 2FYKA 2KT1A 2H7OA 3I1AA 2XI9A 4CI1B 3VU7H 3EG9B 4NUUA 3CCVQ 1AVZC 2L2PA 1RI9A 3L3PA 1R0BG 4C5HA 4HCZA 1AD5A 3H0IA 3ZYKA 4K11A 4E7SA 2RPNA 4I43B 2QDYB 2KNDA 2XAGB 4HWHA 2KT8A 2WWUA 4M7DA 3LK3B 3KV6A 3EG2A 2FPDA 1VQ9T 4X66T 6AT1B 3KXTA 3T8OA 3EFOA 4PK6A 4PJJA 3DLLA 1TG0A 3PTAA 4PFOA 1WJSA 1C0MA 2BTTA 4JRPA 3ZT5A 1SG5A 2ZPGB 4IUUA 3F31A 5FU6B 4EAHA 4CN1A 4B6XA 1BI2A 4PJOA 3N9OA 3BK9A 4HE8A 1YN8A 3OJAA 4ZI7E 1HYOA 1Y57A 2LX9A 1KQ2A 3QJ6A 2GF7A 1XJWB 4BI4A 2K9AA 3M3ZB 5JQGE 3O9XA 4KUIA 3QB5A 1VQ7Q 3CCJA 1TTHB 2K5IA 3QB5K 2DJZA 2K48A 2WMNA 3QWYA 2X9WA 1KNPA 1TOVA 1U1SA 2CM0A 4D6WA 4YJ2E 4R56A 1K73R 1ZKEA 1GQEA 3RF1A 4EGWA 4M78E 3FXEB 4L5GA 3RKGA 2RNAA 1WA7A 4J9CA 5GAN4 4M77D 1QP3A 4JEHB 2H3JA 2KSRA 3AEFA 1X9BA 2JTMA 3M4YA 1SPKA 2PJQA 2GK9A 3WXMB 3C64A 5CVIA
chains in the Genus database with same CATH topology
5GANd 1YI2T 4KP3C 1YHQT 2PQWA 2XAJB 4EIWA 1YIJA 2E6ZA 4X34A 1UX4A 2V7JA 4J5YA 2HH7A 2RP4A 4BA9A 3L2UA 5GAMg 3JB9H 4QKNA 1X75C 3OS2A 1BIAA 3L2ZA 2JMKA 2EJ9A 2VWAA 4E7IA 4QXBB 4M78C 4QW2A 4M7AF 2C0SA 3KBTA 1UX5A 2XAFB 2A3LA 5KE2A 4DVDA 3S3OA 2OA5A 4X9CA 5GAOl 2JN0A 3ANWB 5GAOr 3CBPA 1KG1A 2CMRA 2BIVA 2XDDA 3DB4A 4F7UE 1YJWA 4OHFA 1Y7XA 4IUPA 1VQ6T 2MWPA 2M67A 5J3BA 3VHLA 2YEVC 4C91A 4UF0B 1UEBA 1TH7A 4PJOD 3CD6A 2EJFA 2ACXA 4F6RC 1RL2A 2X9YA 2KQWA 4TV8E 2KVQG 1BR1A 2W61A 2DD5A 2MI6A 5FY1A 5FXXA 3BW1A 4C92C 3VU3C 5J2TE 5LJ3h 3MP6A 5GANj 1W4SA 4QXHB 3C51A 1XNIA 4O5VA 3OS0A 5LJ3e 3CBMA 4M7AA 5L2LA 4O4HE 3I55A 1FEWA 4EB6E 2XDPA 3LW5E 4QQDA 3F2EA 3KV4A 3HL8A 4IE7A 4A53A 2Y8DA 1O75A 2RA2A 1FX7A 5HY6A 3I56T 1X79A 2XKOC 3UUXB 2X9XA 2P4TA 2A72A 1LNXA 4ATOA 2V7LA 4IE6A 3IF8B 1UGSB 4JDSA 4ELZC 2V8JA 3GPLA 2E9XD 4DMVA 4N4IA 2JJ9A 3K3NA 2EJGA 1EZ3A 4C0ZA 4O2AE 5GMKl 3I0QA 5L3BB 1MIVA 2WSEE 3RYCE 4J83A 3MCAB 3O1HA 3PTRB 3NRXA 2JMHA 3JCMh 5GAN8 4A56A 3V7SA 4X1IE 1VQOA 4A54A 5C6SA 1YJ9A 1Q86U 3O8VA 3X26B 5LJ5f 3JCMe 5JR9C 4C8QG 2NW7A 1U5PA 5CO7A 3FB2A 5GAMd 4BJNA 5A0GA 2RK2A 1QP2A 3KDSE 3V5UA 4U74A 4P09A 4UXNB 2JTFA 3CX8B 2PVOB 2ES0A 3QSUA 3VKIA 4JLGA 2PG8A 3EFRA 3GN5B 1OI1A 3QC9A 2RHYA 5LL6S 1Q7YC 4OFZA 4KMCA 3RMQA 2VKJA 4HN9A 5JRCA 1WR6A 5CKDA 4G2AA 3ZMVB 2NTXA 3ZN1B 3HPWA 4RKUE 4XTZA 4GYSA 4IDZA 1Q81C 2FHDA 4A4EA 2CZ7B 1Q82C 3C4WA 3CBOA 4Z8XA 1QW1A 3S4UA 3CQGB 1HTJF 4BUGA 2E12A 1VRBA 4EYYR 5LHGB 3ZMSB 1HFAA 1KNZA 3C4XA 2DWGA 4ZHQE 3HKCE 3ZMUB 2RHZA 1US7B 5L8RE 2L5QA 1I81A 5FXWA 3OYGA 2OAUA 1G5VA 3EDVA 2RH2A 5GAOm 3O4XE 3KV9A 1JJ2A 3KUFA 4JLIA 4C8QE 1MNDA 3V7RA 1WYBA 4J2CA 2NW8A 1B7TA 5GAMj 2RI5A 4R55A 4M77G 4X20E 2CCQA 3AVSA 3UT5E 2CGHA 3LGLA 1VQNA 4JS4A 2LSGA 1VQ8T 3N5BB 4L6V5 3JCMb 3ASKA 4L0RA 2XHEB 1R8OB 3LG7A 3U78A 2X67A 2KDSA 3LBXA 3P8BB 4PL6A 3LK42 3E9FA 5HXCA 2CXDA 4DBRA 2V7KA 3LH0A 1JB0E 4O2BE 1D3BA 4J8OA 2ZPIB 2N9DA 4M78B 2G3RA 4C8QC 4MZPA 2VXFA 4C5GA 1BI1A 2Y4YA 5EK4A 2O4XA 3ZYMA 5FY0A 4MDWA 2DKGA 4BACA 4NUVA 3OYDA 5GMKe 1VQLT 1HK9A 4N0AC 1QSDA 5DJQC 3OYXA 4HCCA 2K3YA 1QVGA 1U4QA 2W0GA 2ZLYA 2E41A 5CQXA 3H6ZA 3LJCA 2E1HA 4C92D 3M59A 2XASB 3WAJA 1JJ2S 3OKQA 3H8ZA 1ZV4X 5CA0E 5I21A 4M77E 3AA0B 1VQKT 3OYNA 4ZGJB 5GMKm 5CQYA 2LSKA 2IAKA 2RHXA 2Q9QB 4M75D 4GLKA 1G3SA 3UDCA 4AKIA 4AQFC 2KSSA 5FXZA 2I2LA 3JCMc 4PFPA 4E7ZA 2CLYC 5C8YE 4DA4A 3JCMQ 2E10A 2NWBA 3PT9A 2HD0A 5H6RB 3QZ5B 1M1KC 2VK9A 3AHUA 1YBYA 1K8AU 1YKEB 4LDUA 3CCVT 4M77C 4RMOA 1G3WA 2M9UA 3NTIA 2V7MA 4PJNA 5LOVE 2HPJA 3E1SA 5CAIA 2LTOA 4MALA 2CYZB 3PGGA 3CCRA 3PUGA 1ZHCA 4HKEA 2F69A 3OBWA 5FU7C 3MEVA 1QVGS 4E7JA 2PBIA 4PJOE 4O4IE 4I55E 3J81E 5JR9B 1VQ7T 3ME9A 3P8DA 2QQ9A 4AKGA 2LE8A 4M7DC 3AAIA 3ZMZB 5M4YA 3O1IA 4XTXA 3FBZA 2OTJA 2BKDN 4B9XA 4OYJA 2RJCA 4UV8B 4ME7A 2XU8A 4PJOC 5LCYA 3CMAT 3B57A 4ZS3A 1VIFA 3MP1A 5FRNA 3T9NA 3URGA 1AJ3A 1HF8A 3AVRA 5DQWA 1MNEA 1U1TA 3C4SA 3RRCA 3IBPA 1VUBA 3ZCIA 1OZ2A 5JDGA 2DLRA 3CCLT 3KV5A 2EHOA 2KINB 3CEYA 2QGSA 4DO0A 4ZI3D 3TEEA 2MBGA 4FT2A 2X66A 3HI2A 1AHJB 3N9QA 5JDMA 4JUVA 3A5ZB 2XHCA 3CVRA 3M65A 4XTUA 1BI3A 2QA4T 1WYCA 3CQXC 1K73C 4PK4A 3PUSA 4CI0C 2EQJA 2LC4A 3PIOA 1UGQB 4HFVA 4OGEA 3CMET 2QXFA 3QYHB 3PDYA 2LDMA 5D6WA 3L2VA 3JB9D 4LD9K 5LA6E 2HPLA 2VKDA 2EQUA 3RKYA 4EPCA 2L3LA 3CC2T 4Z02A 2L9QA 5CKHA 1MMGA 4CXWA 1WGSA 3RESA 2JUFA 4JRQA 2OTLA 1BR0A 4U72A 1NPRA 4IE5A 5LJ3f 4XAXB 4IUVA 1Y96B 1B34B 2VL8A 2ZPFB 2X68A 3MO8A 4X9DA 2G0UA 3A8MB 4C5IA 4H63H 5HXRA 3LLRA 2QA7A 2R5AA 5LGUB 2D6FA 2EHOD 3CCEA 3D0TA 4YTLA 3IHRA 2HQXA 3G7ZA 3R6NA 5HWXA 2MAMA 3BDLA 3QUIA 3UT1A 4YFSA 1H3ZA 4GIWA 4X1YE 2W00A 2ZCFB 3P8CD 5KCOA 3G71T 2DXUA 4TN7B 1WPYA 3SFMA 3ANWA 3L2WA 1O3XA 4N4HA 4C92G 3MXZA 4EOZB 1NAFA 3SRZA 2KMFA 3CCJT 1MMDA 3PUQA 4XQ3A 4F7UG 4ZN3A 4CI2B 2K2VA 5GMKi 5LG4A 5GANh 5J39A 2ZM0A 3NFCA 1NPPA 2X9HA 4UF0A 3K8PC 5GANe 3JAME 3JCMf 4M75G 2DPPB 2YHTA 1YIJT 5LHIB 4RG8A 3FDRA 4NOYA 2H7VC 1NJIC 2BVMA 5J2UE 4M77B 1LKXA 3NRYA 1M4ZA 2EKOA 5J26A 3RX6A 5I2MA 2D0QB 2EQMA 2O01E 5HXSA 3VKGA 2LRQA 2DXBA 2JQQA 3AA6B 5CKBA 3JB9I 3ZC1A 2LVMA 3EVYA 4OP0A 1MMAA 3VYGA 3AA7B 2EFIA 3INZA 3RKXA 1YJWT 2BZBA 3ETVA 4OB3B 1XTDA 4NS5A 4C92E 1O9SA 4OMFB 4M7DD 3JC6D 1HX8A 3A8OB 4ELYC 2VB6A 5LBQB 5GAN7 3CD6T 3OYHA 4XU0A 3WVEB 5FXVA 1IREB 5FRMA 3CX7B 1YJNT 4O8SA 3M5AA 4M75E 5DM7R 2V7IA 3CX6B 1D1AA 2EWNA 3DP7A 4L59A 1X6OA 2QTXA 3LK2B 4WW0A 1LOJA 3S6WA 3I55T 2WM9A 1P92A 4GY5A 1IJ6A 3JCMV 5LHHB 4V2SA 1VQ6A 5FROA 2RM4A 1UB4A 2X0LB 2PVGB 3P8HA 4XTVA 5EG2A 4EZHA 1Y07A 4ZTFA 3E19A 3GN5A 1E1HB 1G8XA 4M75C 2ODUA 3GMIA 1LRZA 3CCQA 1S94A 2C5IT 4OF1A 4H9RC 2RHUA 4V1Av 3SWNB 3ONXA 1D1CA 3RUXA 4M1PA 4ASKA 3U3IA 3HKEE 2WMOA 1WQWA 2RHIA 5GAOn 5BMVE 3JB9J 4HEAA 4M78F 2CA5A 4UVBB 4BY6C 2QQSA 4TX5A 3V8KA 3SWHA 3BDUA 1M9SA 2MTQA 5GAMh 3MKDA 1VQOT 1YJ9T 5GAMe 3JB9G 1Z0PA 1N8RU 2E9XB 5GAOp 1VQ4A 1VQMT 1HG5A 3SD4A 3EUHA 4Y91A 3M53A 2Y4XA 5C0MA 4OGCA 4VUBA 2K24A 2RJDA 2EYQA 1BKBA 2L89A 4MMLA 3BQLA 2QQAA 4DOVA 4XK8E 5IAYA 2QI2A 4P0AA 5ETWA 3DKMA 3M58A 2IC9A 1WLXA 2C06A 1XOVA 2JVVA 1N27A 2KK4A 3OBVE 2RA1A 4XBFB 3HKDE 3GNGA 1G73A 2CEAA 2VV5A 4M7AD 4FU6A 2DD4A 4F7UF 3HSBA 4FM4B 4CZZB 4WNKA 3QIIA 3X28B 2DEQA 4LDWA 2YK0A 4M78A 4LDYA 2IVWA 2KY9A 2D0UA 4JUYA 2NW9A 4FI5A 1JRIA 2IW5B 2MOZA 5AFUL 3SOLA 5JDLA 3RKWA 4H63V 1EIFA 2CXLA 3HA4A 2AHJB 4PLLA 4ZI3C 1QUUA 3HFOA 3J7AF 5LJ5g 4N4GA 1M90U 3PIPA 2LHNA 5KE3A 2LQKA 3G4SA 3JCMX 4LDXA 4B9WA 1VQNT 4H9NC 2QEXA 5CKFA 3CCST 3ZLIA 2C5KT 1K9MU 3UUMA 3I0OA 2KT9A 4FIBA 1OYXA 1KC8U 4DBQA 1HG2A 3CC4A 2D9TA 2LM9A 4EMKC 2Q9QA 2E8IA 4GOUA 5JREA 3Q1JA 4QX7B 3OA6A 5JDFA 5L3DB 1MIWA 3E08A 4YHJA 4BI3A 5L3FB 2LSJA 3M55A 3VYHB 2PFVA 4GK0E 1IJ5A 5KH6A 5FMNA 2K3XA 4QQGA 1LJOA 5GAN6 1OWAA 3QUJA 5H6QB 4M7DG 4UEMA 1IAPA 3QYGB 5HYAA 1ZEEA 4UV9B 5A2QE 3OYEA 4TZ4C 3UUNA 3ZC0A 2XIDA 5F3JA 4TV9E 2EHOC 3MEUA 2R5MA 4PJOG 3IEEA 1VOMA 3RYIE 2N1GA 5JR9A 4C92B 2ZMAA 1Q86C 2VXEA 3RH3A 4MBQA 4A4FA 4F7UB 4XU3A 4QQ6A 3QG1A 4JRIA 4CRIA 4H9SE 3Q5XA 3VV0A 4BAYB 2W63A 3N2OA 2JPFA 2LT4A 5FU6C 2Q9QD 3P7IA 2X4JA 4M75B 2RD1A 3CCMT 2CS7A 4AI6A 4ZTJA 4PNOA 1U8RA 3KBUA 4C0DC 1QVFA 5M9OA 5DQVA 3RPUA 3CCRT 3RYFE 4ZOLE 5FY7A 3WI3A 5DY9A 3X24B 1FMWA 3HL6A 3V8LA 3QXEB 5LJ5d 1BR2A 4GYRA 4M7DE 4C8QF 2CWOA 2JOYA 5L3EB 2ZPEB 4O4JE 4BD3A 2CXFA 5LYJE 3F57A 2M0OA 3ZEFB 2X35A 2LHRA 5EK2A 4QHOA 2LOPA 4ZGDB 3MJXA 1BYMA 3OYYA 4BJMA 3HKBE 3M56A 3ESLA 2DXCA 2Y6XA 1MIYA 5FYMA 3KFWX 4KBMB 5ADXL 4ZI2C 5HWYA 2OTJT 2GFAA 2HQEA 3SB2A 2L8KA 2W62A 1WJQA 2F5KA 2PUKB 3GIBA 3JC6C 3LGFA 5GANf 3Q5WA 4A4HA 4FT4A 2LSIA 4UC4A 5LJNA 3HKSA 2FB7A 5LGTB 2BUDA 1KC8C 5KCHA 2WACA 2ZGWA 3GP8A 2CZ1B 3CPZA 3ZN0B 5JDQA 3JRZA 3OB9A 4M7AG 2E6NA 2VC8A 1QVFS 3AA1B 2LT3A 1Y96A 1B34A 1BIBA 2N2NA 2IC6A 3LYIA 4EMHA 1YW0A 4PAGA 5LJ5j 3FJPA 2P0QA 3CXCA 2WSSV 3RYHE 2NP9A 2WSCE 1SA0E 2XK0A 5KMGP 1KK7A 2KLQA 4M77F 5JDNA 2KWIB 4LD6A 5E0OA 3CMAA 2JRKA 4JS5A 3N2KE 4HTEA 3OW2A 2XG8D 3L2RA 2LNVA 1S72A 1OZ3A 3I9YA 1YCYA 2K5BB 3CC7A 1VQ5A 3ZFJA 3PU3A 5CB4E 4BDYA 2XD0A 1WQ7A 3OYFA 2L8DA 4BE1A 4OYKA 2ZM8A 4UVCB 1VQPT 4UVAB 2WSFE 2ODVA 4H9PC 2CKKA 3MEAA 3CKDA 2X4YA 2OTLT 4EMKB 2DIGA 2XICA 3CCUA 2XAHB 5LBMA 4YLHA 1BI0A 4C90A 4M7AE 3JCMJ 4JLEA 4J6WA 3GWHA 3V8JA 3H37A 3N2GE 3L1AA 4C8QB 2VKHA 2XDBA 3CCET 3G6EA 4M77A 4PJOF 1YITA 5D6YA 3NTHA 1K8AC 1M1FA 2R58A 3CXCS 4PK5A 5IHYA 2E5QA 4MMKA 4J7IA 3DB3A 3ETUA 3VKHA 1IZ6A 3OYMA 4JEUB 4M7AC 3FLGA 3NZPA 3VJPA 3OW2S 4BE0A 4IUQA 3HFNA 4PLIA 1M5Q1 4UIGA 2P9BA 1N9RA 1N6AA 2DTIA 1NE8A 2KZ7B 5GAMf 1D0ZA 4QX8B 2RI3A 3NTKA 4IKFA 3OMCA 4XU2A 3UULA 5IYZE 1I4K1 3Q9DA 4H9OC 2DTHA 1WNLA 5KX5E 4O6JA 1UGRB 4IGUA 3J7Yq 5HXEA 3RRWA 5LJ3g 1VQ9A 4O4LE 3G71A 3CPFA 2CLYB 3MA9A 4A4GA 1UCUA 2RJFA 2P0PA 2QQRA 4C0DB 2HBPA 3WAKA 3J80E 5CCAA 2YINA 2Y48B 2K5LA 5HAXA 2DWKA 2M16A 2A2FX 3EDUA 1CUNA 3LWIA 2DZ9A 2CZ6B 1I5LA 3AAEB 3NZQA 2DI4A 2MMPA 5I2SA 3GOXA 3N9MA 2V26A 3RC8A 4CI3B 4C5EA 1GXIE 5F8PA 3ZBDA 5FU7B 3SWNA 4QVDA 5DABA 1Q7YU 1KQSA 4P5NA 5HKCA 5A1LA 3WVDB 4FJOA 3TU4K 1KQ1A 2RJEA 2X51A 4ZI2D 1Y71A 3ZJ1A 1YI2A 1YHQA 2IG0A 2R57A 5HK3A 1Q81U 5GAN5 2RB6A 1Q82U 1D1BA 3HR0A 3OSVA 1HXDA 2YRVA 3O1JA 1KHIA 4JJNK 4M7DB 4ISTA 2Y90A 3JCMg 3DTOA 4JRKA 4CXXA 1HCIA 2QQBA 3FHNA 3R84B 4TVRA 4I4TE 2GQVA 1WJRA 3HRUA 2E9XA 3TREA 2XQYA 4K0UA 4EMGA 2PU9B 2NLUA 3PMTA 4PJOB 3S3MA 1ZHIA 2KAFA 2DHRA 2BVLA 2MF2A 2RI2A 1KD1U 3TKLB 2LOSA 4ILUA 1SSFA 5L3CB 3META 2MYSA 3CCQT 2ZM2A 3A8HB 1D0XA 3RKOA 3FXDB 4C0GA 2K57A 1YJNA 2YLCA 3OQ5A 3QK6A 2DK3A 2PVDB 2XAQB 2DXTA 2Q9QC 3S3NA 1KQSS 3N9LA 4X1KE 5JDHA 3MZKB 2H3RA 3MHXA 4OVAA 4DNDA 2FVUA 1LVKA 1VQ4T 3PUAA 5LJ3d 2VASA 5HXHA 3ZJ2A 3KVBA 3QZ9B 2SPCA 2V8IA 3GNFB 4AXPA 4EXTA 4QVCA 3GA8A 4AKLA 4BDZA 2VKOA 3QO3A 3I56A 1T98A 3HHTB 3QKJA 5CKEA 4HGAA 2K4YA 2K5FA 3BQIA 4OB2B 3PE0A 1S35A 2LEHA 3UTKA 2UXNB 4N78D 3RERA 4XTYA 3N9NA 4C92F 3FB9A 3MK7C 3VUZA 3M57A 1G3TA 3PMIA 1VQMA 3LWHA 5CK9A 3KVAA 4LDVA 3V5SA 5AYFA 4CXYA 4Y28E 3OYIA 2DIQA 1RI0A 2NTYA 5DLOA 5CIUA 3OYKA 5GONE 4M7AB 3OY9A 4RCCA 4UELA 4ANJA 3JCMd 3ZYLA 4TUYE 4M75F 5IN1A 1M1KU 5GAN2 5LGNB 4E47A 4E7LA 3OYJA 1JBMA 1YKHB 5LJ3j 2DNXA 4IURA 3G4ST 2HNIA 3QDRB 3V7CA 1NZ9A 2EQKA 3ZPOA 4KT0E 2QEXT 4AKHA 2LQ8A 2VGNA 2F5TX 3GLXA 5FNVE 3FC3A 2Z6EA 4HA8A 4DMWA 2CE7A 2VUBA 3AB3B 3KINB 3CC4T 2B1EA 4ZN1A 2ZZDA 4E7KA 1V29B 4C92A 3MP8A 1I8FA 3UPUA 3A8LB 5L3GB 3TCJA 4XU1A 4F7UA 1X01A 3SDZA 1KD1C 2DO3A 3LX7A 3A8GB 3NBXX 1ZBXA 5J1GA 3DLMA 3M54A 4M75A 4RG2A 1MGQA 3MACA 5GAOq 2LCCA 4KUDK 4IE0A 1NWMX 4OB1B 1VIEA 3CCSA 2EAYA 4PJLA 4KUMB 3JCMP 4M78D 3M9QA 4PW8A 1PSFA 2D0TA 4CQIA 3GF5A 1M8VA 4MZTA 3HRSA 1W2BA 2A3DA 5FP3A 2ZPBB 4ZS2A 4YJ3E 1VQ8A 5JRCB 2CZ0B 4MLKA 1DJ7B 3BY7A 3ZEHA 1G3YA 3QPHA 3CPWA 1Y64B 3FRNA 2ZPHB 4BB7A 2L3RA 3C98B 4HT8A 1D0YA 4DOWA 1QVPA 2CWYA 3JSCA 3PFSA 3OSSC 5GMKh 2V8KA 2WBLA 1N8RC 4H9QC 4QVZA 1K73U 3CMLA 4G63A 3B13A 5IT9E 3OYAA 2RK1A 2JZ2A 4OK0A 4I50E 2X4WA 3OS5A 4XZCA 3HP9A 2GCXA 1VQLA 3I9WA 4KULA 3QBYA 3ER0A 3CWZB 1OXZA 1V9DA 5CR2A 2LSYA 3RMSA 4QXCB 5LJ5h 5CA1E 3OYZA 3PU8A 2I59A 2WAUA 2UXXB 4GK5E 2X4XA 5LJ5e 1ZQ1A 3L42A 1KHCA 1UGPB 2DZCA 3JB9F 3PURA 4EZ4A 4AQGA 3A5XA 3LBXB 4E7HA 1VQKA 4EYUA 2KMTA 3QJYA 1W2BS 2GFUA 1D3BB 4BY6B 3DJBA 4MZMA 3HRTA 4L9IA 3K3QC 2D2SA 4PJMA 4EDUA 3CPWS 3LFMA 2JNGA 2O4XB 3CCMA 3OYBA 5TAOA 2DAQA 2HAXA 5GAN3 1H641 3CCVA 3VUBA 4IE4A 4MHCA 1M90C 5D6XA 2DTOA 5JH7E 3M4GA 4HT9A 4BI8B 4AKRB 3FBLA 3MEWA 4C0FA 4MFRA 2XTLA 2E64A 3OYLA 3RIRA 1K9MC 3BQKA 1FIOA 2LT1A 3C50A 4EMKA 5GMKj 3J9X1 3X25B 2LCLA 1XQHA 4WBNE 3ZCJA 4ERRA 5LXTE 3UFEA 4ZGEB 4J6XA 2J1DG 1HS7A 4IIJE 3N5LA 3C94A 2DVEA 3C12A 2EIFA 2VGMA 4P0BA 2C5JA 4C8QA 2E65A 1VQ7A 5LJMA 3EAEA 2FL7A 1SHZC 3OYCA 2D5UA 3C4ZA 5FLXE 3UWNA 4QWNB 3W15B 2P0KA 3L2QA 4HKAA 1MMNA 1H7CA 1IZNB 3R6OA 1NJIU 5A0DA 5JVDE 3SS1A 1S72T 4WBOA 5LNKA 1FXXA 4FSXA 5EK3A 4N0AA 3C95A 4II1A 1VQ5T 3CC7T 3X20B 4FL6A 4DQ2A 4NL3A 4ISSA 3N9PA 5DLQE 1FWZA 4PKCC 4PNIA 3QHSA 2LJLA 1MHNA 3L09A 4NL2A 2YU2A 4OB0B 4WF2A 2V1DB 3PNWC 5A0LA 2NOXA 5GANg 2MWOA 1FMVA 3CCLA 3SWNC 3FIFA 1YD8G 5HK0A 1PSEA 5EZYE 3CCUT 3K3OA 1BR4A 4MDXA 2VYTA 5LP6E 4Q5WA 2QA4A 4AQFA 4BE2A 1LVFA 3F70A 3OMGA 4M7DF 4IHJE 3G6ET 2M1HA 2B8AA 1YITT 1M1GA 3CQCB 2DCFA 2YLBA 3CMEA 2E9XC 3BFMA 3RC3A 3E9GA 3ZMTB 1VQPA 3H3AA 4ADZA 4J6YA 3OS1A 2E70A 4J7FA 4C8QD 2KXPB 3Q2MA 2KWHA 4HCBA 3EFSA 2A7YA 4M78G 3E0ZA 3OBYA 2RO0A 4XTWA 3FEOA 2BDEA 3CC2A 3JCMW 2YU1A 3E22E 4IUTA 1WRDA 4RCBA 1N9SA 2XUEA 2PUOB 3AAAB 3KBGA 4A4KA 2EHOB 5KDMC 2FYKA 2H7OA 3I1AA 2XI9A 4CI1B 3VU7H 4NUUA 3L3PA 4C5HA 4HCZA 3ZYKA 4E7SA 4I43B 2QDYB 2KNDA 2XAGB 2WWUA 4M7DA 3LK3B 3KV6A 1VQ9T 3KXTA 3T8OA 4PK6A 4PJJA 3DLLA 3PTAA 4PFOA 1WJSA 4JRPA 2ZPGB 4IUUA 3F31A 5FU6B 4EAHA 4B6XA 1BI2A 4PJOA 3N9OA 3BK9A 4HE8A 3OJAA 4ZI7E 1KQ2A 2LX9A 3QJ6A 2GF7A 4BI4A 2K9AA 5JQGE 3O9XA 4KUIA 3CCJA 2K5IA 2DJZA 2K48A 2WMNA 2X9WA 1U1SA 2CM0A 4D6WA 4YJ2E 4R56A 1ZKEA 4M78E 3FXEB 4L5GA 5GAN4 4M77D 1QP3A 4JEHB 2H3JA 2JTMA 3M4YA 2PJQA 2GK9A 3WXMB 3C64A 5CVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT1 A;  2LT3 A;  4MFR A;  2LT4 A;  4L5G A;  2LQK A;  4KMC A;  4XAX B;  4KBM B;  4ILU A;  2EYQ A; 
#chains in the Genus database with same CATH topology
 5GAN d;  1YI2 T;  1AOJ A;  4KP3 C;  1YHQ T;  2PQW A;  2XAJ B;  4EIW A;  3CMA Q;  1XWM A;  1YIJ A;  2E6Z A;  4X34 A;  1UX4 A;  2V7J A;  4J5Y A;  2M02 A;  4LN2 A;  2HH7 A;  2RP4 A;  1W9R A;  4BA9 A;  3L2U A;  5GAM g;  3JB9 H;  4QKN A;  1X75 C;  4JYA T;  3OS2 A;  4WTO B;  1SSH A;  1BIA A;  3L2Z A;  2JMK A;  1BK2 A;  2EJ9 A;  5LMN T;  2VWA A;  3SEM A;  3CCL Q;  2DX1 A;  4E7I A;  1K0S A;  2YXY A;  4QXB B;  4J9G A;  4M78 C;  4QW2 A;  4M7A F;  2C0S A;  3KBT A;  1UX5 A;  2XAF B;  2A3L A;  5KE2 A;  4DVD A;  3S3O A;  2OA5 A;  4X9C A;  3REB B;  2JN0 A;  5GAO l;  3ANW B;  1WXB A;  5GAO r;  2AZS A;  1YXR A;  2QA4 Q;  2YRD A;  1U3O A;  1T0H A;  3CBP A;  1KG1 A;  2CMR A;  4ZZC A;  2BIV A;  4I0U A;  2ZAE A;  3VRA A;  2CDT A;  3ZT6 A;  3DB4 A;  2XDD A;  4F7U E;  1YJW A;  4OHF A;  1Y7X A;  1UGO A;  4IUP A;  1VQ6 T;  2MWP A;  2M67 A;  5J3B A;  4WYV A;  3VHL A;  2YEV C;  4C91 A;  4UF0 B;  4J9B A;  2KYM A;  1UEB A;  1TH7 A;  1AWX A;  3CME Q;  4PJO D;  1M7K A;  2KRS A;  3CD6 A;  2EJF A;  2FZC B;  2ACX A;  4F6R C;  3G6E Q;  5FVL A;  1RL2 A;  4NPP A;  4KGZ B;  2XY8 B;  4IDO A;  1QWF A;  3I35 A;  2X9Y A;  2MIO A;  2KQW A;  4TV8 E;  4ESR A;  1OED C;  2KVQ G;  1BR1 A;  5IHK A;  2W61 A;  1SHG A;  4YXD A;  2DD5 A;  2MI6 A;  2UXB T;  2GGR A;  1X2K A;  5FY1 A;  5FXX A;  3BW1 A;  4C92 C;  3VU3 C;  3CC2 Q;  1OOT A;  5J2T E;  3AE9 A;  1UJY A;  5LJ3 h;  3MP6 A;  5GAN j;  1W4S A;  4QXH B;  3C51 A;  2VUR A;  1XNI A;  4O5V A;  3OS0 A;  2DFU A;  5LJ3 e;  1OU9 A;  3CBM A;  4M7A A;  5L2L A;  4O4H E;  3I55 A;  3VS5 A;  2BE7 D;  1K76 A;  2JQH A;  2DL8 A;  2BG9 B;  1FEW A;  4EB6 E;  2XDP A;  3LW5 E;  1M30 A;  4QQD A;  3F2E A;  3KV4 A;  2HMA A;  3HL8 A;  4IE7 A;  1LCK A;  1KEY A;  1KFZ A;  4A53 A;  2Y8D A;  4HWD A;  1O75 A;  2RA2 A;  4E6R A;  1RAG B;  4HWI B;  1FX7 A;  1PHT A;  5HY6 A;  3I56 T;  1X79 A;  3EGD A;  1M27 C;  2XKO C;  5I22 A;  3UUX B;  2X9X A;  2K79 A;  3OTO T;  2P4T A;  2A72 A;  1NJI R;  1LNX A;  4LFA T;  4ATO A;  2V7L A;  4IE6 A;  3IF8 B;  1UGS B;  4JDS A;  4ELZ C;  2V8J A;  3GPL A;  2E9X D;  4DMV A;  3CK6 A;  3TVT A;  2HHH T;  3G71 Q;  4N4I A;  2JJ9 A;  1HJD A;  3K3N A;  3EH2 A;  4ZZB A;  2EJG A;  1EZ3 A;  4C0Z A;  4O2A E;  5GMK l;  2J4G A;  3I0Q A;  5L3B B;  1KJW A;  3TSZ A;  1AWJ A;  2O31 A;  1MIV A;  4QKU A;  2WSE E;  1WXU A;  3RYC E;  4J83 A;  2BS4 A;  3MCA B;  3O1H A;  2CH4 A;  3PTR B;  3NRX A;  2K7A A;  2JMH A;  3JCM h;  5GAN 8;  4A56 A;  2CUD A;  4QH1 A;  3V7S A;  4X1I E;  1VQO A;  4A54 A;  5C6S A;  1YJ9 A;  1Q86 U;  3AEE A;  3O8V A;  3X26 B;  2LJ1 A;  5LJ5 f;  3JCM e;  5KYU A;  5JR9 C;  2VWF A;  3EGX A;  4C8Q G;  2NW7 A;  1U5P A;  5CO7 A;  3UA7 A;  3FB2 A;  5GAM d;  4BJN A;  4JJC A;  3Q5E A;  1UGV A;  2RK2 A;  5A0G A;  1QP2 A;  3KDS E;  3V5U A;  1M2V B;  1QMC A;  3VS3 A;  4U74 A;  4P09 A;  4UXN B;  2JTF A;  4JI0 T;  3CX8 B;  2PVO B;  1YIJ Q;  2ES0 A;  2HKN A;  2KRM A;  3B5M A;  2VQE T;  3QSU A;  2EBP A;  3VKI A;  4JLG A;  2PG8 A;  3EFR A;  2DL5 A;  3GN5 B;  1OI1 A;  1YHQ Q;  3QC9 A;  2RHY A;  5LL6 S;  1Q7Y C;  4OFZ A;  4KMC A;  1SRL A;  3RMQ A;  4JZ4 A;  3JAE A;  2VKJ A;  2W0Z A;  4HN9 A;  1I0C A;  5JRC A;  2J7I A;  1WR6 A;  5CKD A;  4G2A A;  3ZMV B;  2NTX A;  3ZN1 B;  1IGU A;  1NLO C;  3HPW A;  4GYS A;  4RKU E;  4XTZ A;  4IDZ A;  1Q81 C;  2FHD A;  4A4E A;  2CZ7 B;  1Q82 C;  3C4W A;  3CBO A;  3TSW A;  4Z8X A;  1QW1 A;  3S4U A;  3CQG B;  1HTJ F;  2JQK A;  2CSQ A;  4BUG A;  2E12 A;  2BKP A;  4KH1 B;  2XM1 A;  1VRB A;  4EYY R;  2LLY A;  5LHG B;  3ZMS B;  1HFA A;  1KNZ A;  3C4X A;  5AQR B;  2DWG A;  1SKU B;  4ZHQ E;  1YJW Q;  3HKC E;  3ZMU B;  1WHM A;  1YQ3 A;  2DER A;  2RHZ A;  1US7 B;  1JXO A;  2DIL A;  2QG9 B;  5L8R E;  2L5Q A;  1I81 A;  1JEG A;  2PNI A;  5FXW A;  5AQL B;  5IXB A;  3CD6 Q;  4QH5 A;  4GKJ T;  5ABH A;  2ED0 A;  3OYG A;  2OAU A;  1G5V A;  3RDV A;  2OLT A;  3EDV A;  2RH2 A;  5GAO m;  1IGQ A;  3O4X E;  3KV9 A;  3TLS A;  1JJ2 A;  3KUF A;  4JLI A;  4C8Q E;  1MND A;  3V7R A;  1YJN Q;  1WYB A;  2UUA T;  5F5W A;  4J2C A;  1BBZ A;  1IB8 A;  2NW8 A;  1B7T A;  4B3M T;  2NWM A;  5GAM j;  1E6G A;  2RI5 A;  4R55 A;  4M77 G;  4X20 E;  1EX4 A;  2CCQ A;  3AVS A;  3UT5 E;  2AE9 A;  2CGH A;  3LGL A;  1B07 A;  4JS4 A;  1VQN A;  2LSG A;  4ILA A;  2IHR 1;  1VQ8 T;  3EH1 A;  1WHK A;  3N5B B;  4L6V 5;  3JCM b;  3ASK A;  4L0R A;  2XHE B;  1R8O B;  3LG7 A;  3U78 A;  2K6D A;  2XQ8 A;  3I55 Q;  2X67 A;  2KDS A;  3LBX A;  1OX9 A;  3P8B B;  4PL6 A;  3LK4 2;  3E9F A;  5HXC A;  2CXD A;  3AEC A;  4DBR A;  2YKS A;  2V7K A;  3LH0 A;  5AQH B;  4JBW F;  1JB0 E;  2XQ4 A;  4O2B E;  1D3B A;  4J8O A;  1XZY A;  2ZPI B;  2N9D A;  1RAB B;  4M78 B;  2G3R A;  4C8Q C;  4MZP A;  3AE7 A;  2VXF A;  4C5G A;  1BI1 A;  2Y4Y A;  5EK4 A;  2O4X A;  3ZYM A;  2L3P A;  1ABQ A;  4KGV B;  3L39 A;  2FJE A;  2J6O A;  2X0H A;  4GKK T;  5FY0 A;  2VVN A;  4MDW A;  2DKG A;  2HQH A;  2D1X A;  4JI3 T;  1QCO A;  2O9V A;  3I56 Q;  4BAC A;  4NUV A;  3OYD A;  5GMK e;  1VQL T;  1ZUK A;  3REA B;  1HK9 A;  4N0A C;  1QSD A;  5DJQ C;  3OYX A;  4HCC A;  3FZK B;  2K3Y A;  1QVG A;  1U4Q A;  2W0G A;  2ZLY A;  1QLY A;  2E41 A;  4YHH T;  4F04 B;  5CQX A;  3JAD A;  1WLP B;  4DR2 T;  3H6Z A;  2CUB A;  3LJC A;  2E1H A;  4C92 D;  3AEA A;  1TWB A;  3M59 A;  1PM3 A;  4RTZ A;  2XAS B;  3WAJ A;  1YJ9 Q;  1VQO Q;  1W70 A;  2YDL A;  1JJ2 S;  3OKQ A;  2WDR A;  3H8Z A;  4LUE A;  1ZV4 X;  8AT1 B;  1SE7 A;  2CRB A;  5CA0 E;  1VQM Q;  5I21 A;  1J1J A;  4M77 E;  3H41 A;  1UJ0 A;  4LML A;  1QKX A;  3AA0 B;  1VQK T;  3OYN A;  4ZGJ B;  5GMK m;  1ZA1 B;  5CQY A;  2LSK A;  2IAK A;  2YDQ A;  2RHX A;  2Q9Q B;  2EYZ A;  4M75 D;  1FJG T;  4JI8 T;  2KBT A;  1G3S A;  4GLK A;  3UDC A;  4AKI A;  1X6B A;  4AQF C;  2KSS A;  2LQW A;  5AQV B;  5FXZ A;  2I2L A;  3JCM c;  3NMZ C;  2DVJ A;  2KRN A;  2XSA A;  5AQK B;  4PFP A;  4E7Z A;  2CLY C;  1VYT A;  1T72 A;  2Z0W A;  5C8Y E;  4DA4 A;  3UU5 A;  1TU0 B;  3JCM Q;  1HX1 B;  2J62 A;  2E10 A;  2NWB A;  1AWW A;  3PT9 A;  2HD0 A;  5H6R B;  2EYX A;  3QZ5 B;  1GCP A;  1M1K C;  2VK9 A;  2G6F X;  3AHU A;  1YBY A;  1K8A U;  2YUP A;  3E2U A;  1YKE B;  3A7M A;  5AQN B;  3NWI A;  4LDU A;  3CCV T;  4M77 C;  3JV3 A;  4RMO A;  2D0N A;  1JNR A;  1G3W A;  4DUZ T;  2M9U A;  4RTV A;  2K3W A;  3NTI A;  2V7M A;  1IBK T;  4PJN A;  1N34 T;  5LOV E;  2HPJ A;  3E1S A;  5CAI A;  4RTW A;  2LTO A;  2LM2 A;  4MAL A;  2CYZ B;  3PGG A;  3CCR A;  1ZSZ B;  2QK0 A;  3A98 A;  2KYB A;  3PUG A;  1ZHC A;  4HKE A;  2F69 A;  3OBW A;  3UFG A;  5FU7 C;  3MEV A;  2VQF T;  1QVG S;  3U23 A;  4E7J A;  2PBI A;  4PJO E;  5KYW B;  1WDX A;  4O4I E;  3RHW A;  2M6B A;  4I55 E;  9ATC B;  3J81 E;  5AT1 B;  2I6H A;  5JR9 B;  1VQ7 T;  3ME9 A;  3P8D A;  2QQ9 A;  3EHZ A;  4AKG A;  2YUQ A;  2LE8 A;  4M7D C;  3AAI A;  3ZMZ B;  5M4Y A;  1M8M A;  3O1I A;  1VQN Q;  3HTR A;  1YWP A;  4XTX A;  4CN4 A;  3CCS Q;  3FBZ A;  2OTJ A;  2A37 A;  2RQU A;  2O88 A;  4CN6 A;  2BKD N;  1QVF P;  2H3E B;  4OYJ A;  4B9X A;  2RJC A;  1UDL A;  2E2A A;  4UV8 B;  2XU8 A;  4ME7 A;  2GQI A;  3PVL A;  4PJO C;  5LCY A;  3VR8 A;  3CMA T;  3B57 A;  3P4P A;  4ZS3 A;  4LMJ A;  1VIF A;  3RGL A;  1NEN A;  3I9Q A;  3MP1 A;  3T9N A;  5FRN A;  3URG A;  1AJ3 A;  1HF8 A;  3AVR A;  5DQW A;  1MNE A;  1U1T A;  2WQY A;  4WZX A;  2WY2 A;  2FZK B;  3C4S A;  4F14 A;  3RRC A;  2I0N A;  2BZX A;  3IBP A;  5AQM B;  1N33 T;  1V1C A;  3EHR A;  1VUB A;  1VCS A;  3ZCI A;  1E7O A;  5JDG A;  2DLR A;  4TNV A;  1OZ2 A;  3KV5 A;  1GFC A;  3CCL T;  1Q86 R;  2AK5 A;  2EHO A;  2KIN B;  2DE0 X;  3CEY A;  2QGS A;  4IL9 A;  1X43 A;  4F16 A;  4DO0 A;  4ZI3 D;  3TEE A;  2MBG A;  4FT2 A;  2J05 A;  2X66 A;  3HI2 A;  2ENM A;  3EG9 A;  1KF6 A;  3RIF A;  1AHJ B;  2GTO A;  3N9Q A;  5L4E A;  2QGF B;  5JDM A;  4LFB T;  2BZ8 A;  4JUV A;  4A97 A;  3A5Z B;  2XHC A;  3CVR A;  3M65 A;  4XTU A;  1BI3 A;  2QA4 T;  1WYC A;  3CQX C;  1K73 C;  4PK4 A;  2CH4 W;  1PRM C;  3PUS A;  4CI0 C;  1OU8 A;  2EQJ A;  2LC4 A;  5AQI B;  3PIO A;  2XPK A;  4YY3 T;  1UGQ B;  4HFV A;  4OGE A;  3CME T;  2QXF A;  3QYH B;  3MPU B;  3PDY A;  2LDM A;  5D6W A;  3L2V A;  3JB9 D;  2D8J A;  2GTJ A;  4LD9 K;  5LA6 E;  2CP5 A;  2HPL A;  2VKD A;  5ECA A;  2EQU A;  3RKY A;  5L4H A;  4EPC A;  3LDQ B;  1PWT A;  2CPT A;  3JAF A;  2VVK A;  2L3L A;  3CC2 T;  1I6Z A;  1IBL T;  4Z02 A;  2L9Q A;  5CKH A;  1MMG A;  4CXW A;  1WGS A;  3RES A;  2JUF A;  2KRO A;  4JRQ A;  1RAH B;  2OTL A;  2FUP A;  1BR0 A;  1RAA B;  1YFN A;  3TLT A;  4DV1 T;  4U72 A;  3AT1 B;  1NPR A;  4IE5 A;  4AG2 C;  2K3B A;  5LJ3 f;  4XAX B;  4IUV A;  3CXC P;  1Y96 B;  1B34 B;  2VL8 A;  4U31 A;  2ZPF B;  3CCM Q;  3M0R A;  2X68 A;  3MO8 A;  4X9D A;  2G0U A;  3T1H T;  3A8M B;  4C5I A;  4H63 H;  2IDO B;  5HXR A;  8ATC B;  3UU4 A;  3LLR A;  2QA7 A;  2R5A A;  5LGU B;  2QGG A;  2X0Y A;  3O5Z A;  2EHO D;  3CCE A;  3CCR Q;  2D6F A;  1GFD A;  3OW2 P;  2FRW A;  2W66 A;  3D0T A;  4YTL A;  3IHR A;  2HQX A;  3G7Z A;  3RBB B;  3ZL7 C;  3R6N A;  5HWX A;  2MAM A;  3BDL A;  3QUI A;  5D7U A;  5IUX A;  4YFS A;  3UT1 A;  4HFE A;  4WCI A;  1H3Z A;  2V8S V;  4GIW A;  4DUY T;  4X1Y E;  2W00 A;  1Z8U A;  4AIU A;  2ZCF B;  3P8C D;  4EED A;  5KCO A;  3G71 T;  1TS9 A;  2DXU A;  2YOE A;  4TN7 B;  1WPY A;  4J9I A;  4KI0 F;  3SFM A;  1I07 A;  3ANW A;  3L2W A;  3M0Q A;  1O3X A;  2COW A;  4N4H A;  3MXZ A;  4C92 G;  2CHO A;  4EOZ B;  4U2Z A;  1NAF A;  3SRZ A;  2KMF A;  3CCJ T;  4J9D A;  1MMD A;  3PUQ A;  4XQ3 A;  4F7U G;  2C0O A;  1HNW T;  4ZN3 A;  4CI2 B;  3LSV A;  2K2V A;  5GMK i;  2A36 A;  5LG4 A;  5GAN h;  5J39 A;  2ZM0 A;  3NFC A;  4U2Y A;  3M0T A;  1NPP A;  2X9H A;  4AFS C;  2LP5 A;  4UF0 A;  1SEM A;  1JNZ A;  3K8P C;  5GAN e;  3JAM E;  2OTJ Q;  3JCM f;  2V6Y B;  3A1P A;  1L0V A;  2ACZ A;  4M75 G;  1VCT A;  2DPP B;  4OMQ A;  2YHT A;  1YIJ T;  5LHI B;  1U06 A;  4RG8 A;  3FDR A;  5L47 A;  1TUD A;  4CC2 A;  4NOY A;  4NXN T;  3C0C A;  5AQF B;  1D09 B;  2H7V C;  1KIK A;  1NJI C;  3FZM B;  2BVM A;  5J2U E;  1NLP C;  1R0C B;  4M77 B;  1LKX A;  3NRY A;  1UHC A;  1M4Z A;  2BS2 A;  2FG0 A;  2EKO A;  5J26 A;  1QKW A;  5FWC A;  3RX6 A;  1W1F A;  2D0Q B;  5I2M A;  2EQM A;  1WFD A;  2O01 E;  5HXS A;  2P4R A;  1PD0 A;  1E7P A;  3VKG A;  2LRQ A;  2BG9 A;  3RIU A;  2DXB A;  2JQQ A;  3AA6 B;  1WHJ A;  5CKB A;  3JB9 I;  2HL5 C;  3ZC1 A;  2LVM A;  1QLB A;  3EVY A;  4OP0 A;  1MMA A;  1R8I A;  3VYG A;  1OED E;  3QNU A;  1TXQ A;  3AA7 B;  2P84 A;  2EFI A;  3INZ A;  1R77 A;  3RKX A;  4DR6 T;  1YJW T;  2BZB A;  3ETV A;  4IDQ A;  4OB3 B;  5HCK A;  4AFU C;  1XTD A;  4NS5 A;  4C92 E;  1O9S A;  4DR7 T;  1WZO A;  4OMF B;  3JC6 D;  1HX8 A;  4M7D D;  3A8O B;  4ELY C;  1FYN A;  2VB6 A;  3NKZ A;  5LBQ B;  5GAN 7;  3CD6 T;  3OYH A;  4XU0 A;  1K8A R;  1E6H A;  3WVE B;  1T7S A;  5FXV A;  1IRE B;  1WHL A;  4KGX B;  2DL1 A;  3ZST A;  5FRM A;  4CC3 A;  2K2M A;  3CX7 B;  1YJN T;  5LB7 B;  3VRZ A;  2UXD T;  4DBH A;  4O8S A;  3TLV A;  3M5A A;  4M75 E;  1VQP Q;  5DM7 R;  2V7I A;  3CX6 B;  2IML A;  1D1A A;  3CQT A;  2EWN A;  3DP7 A;  1E2A A;  4L59 A;  3AE8 A;  1X6O A;  2LNH B;  3EG0 A;  2OTL Q;  1EZZ B;  1W09 A;  2QTX A;  3LK2 B;  2YUN A;  4WW0 A;  1LOJ A;  3S6W A;  3I55 T;  1ABO A;  2FBW A;  1M2V A;  2WM9 A;  4JI2 T;  1P92 A;  4GY5 A;  1IJ6 A;  2DA9 A;  3JCM V;  5LHH B;  4V2S A;  1VQ6 A;  4DV4 T;  5FRO A;  2RM4 A;  4OMN A;  3H9N A;  1UB4 A;  2HEQ A;  2X0L B;  2HCK A;  2PVG B;  3P8H A;  4XTV A;  5EG2 A;  4EZH A;  1Y07 A;  2JMC A;  4ZTF A;  1KQS P;  3E19 A;  3GN5 A;  1E1H B;  3CCE Q;  1G8X A;  4M75 C;  2ODU A;  3GMI A;  1LRZ A;  3CCQ A;  1S94 A;  2C5I T;  2JXB A;  4OF1 A;  4H9R C;  2RHU A;  4V1A v;  3SWN B;  3ONX A;  1D1C A;  3RUX A;  3ONL C;  4M1P A;  4ASK A;  4IL4 A;  3U3I A;  3IQL A;  3HKE E;  3UQ7 A;  2KGT A;  2WMO A;  1WQW A;  2RHI A;  1ACM B;  5FVK A;  2WU5 A;  1RAF B;  5GAO n;  5BMV E;  3H3M A;  1OX8 A;  3JB9 J;  4HEA A;  4M78 F;  2CA5 A;  3THK A;  4UVB B;  4BY6 C;  2QQS A;  4TX5 A;  3V8K A;  3SWH A;  1WIE A;  3BDU A;  1M9S A;  2MTQ A;  1UFF A;  5GAM h;  2DM1 A;  4NXM T;  3MKD A;  1VQO T;  1YJ9 T;  2E4H A;  5GAM e;  3JB9 G;  4RUG A;  1Z0P A;  1N8R U;  2E9X B;  4DID B;  5GAO p;  1VQ4 A;  1VQM T;  1HG5 A;  3SD4 A;  4JZ3 A;  3CCJ Q;  1HNX T;  4ZEY A;  3VS4 A;  3EUH A;  2FEI A;  3OVU A;  4Y91 A;  1M3A A;  3M53 A;  1NYF A;  2Y4X A;  5C0M A;  4OGC A;  4VUB A;  1WCR A;  2K24 A;  2RJD A;  1Y0M A;  2W4X A;  4LF7 T;  1BKB A;  2EYQ A;  2L89 A;  4MML A;  3BQL A;  2QQA A;  4DOV A;  4XK8 E;  5IAY A;  5IHN A;  2QI2 A;  2WWV A;  4P0A A;  3M0U A;  5ETW A;  2EGC A;  1OQK A;  3DKM A;  3M58 A;  2IC9 A;  1WLX A;  2C06 A;  4U3C A;  1XOV A;  2JVV A;  1C1A A;  1N27 A;  2KK4 A;  3OBV E;  2JMA A;  3ZSS A;  4Z8A A;  2RQR A;  4HVU A;  2RA1 A;  1UUS A;  2X3W D;  1ZUY A;  4XBF B;  3HKD E;  1WHG A;  3GNG A;  1G73 A;  2CEA A;  2VV5 A;  4M7A D;  4FU6 A;  2BZY A;  3UA6 A;  2DD4 A;  4F7U F;  3HSB A;  2HN2 A;  2YWW A;  4CZZ B;  4FM4 B;  4WNK A;  3QII A;  3X28 B;  2DEQ A;  4LDW A;  3VRY A;  2DET A;  2YK0 A;  2XSB A;  3CIR A;  4LF5 T;  4M78 A;  4LDY A;  2IVW A;  2KY9 A;  2VVS A;  2QYZ A;  3RI5 A;  1SRM A;  2D0U A;  4JUY A;  2NW9 A;  1NEB A;  2LRL A;  4FI5 A;  4JJB A;  1JRI A;  2HSE B;  2IW5 B;  2YRC A;  4M4Z A;  2MOZ A;  4PFZ A;  4Y92 A;  5AFU L;  3SOL A;  4NIQ A;  3ONJ A;  5JDL A;  5ABF B;  2CP6 A;  1H3H A;  3RKW A;  2WB5 A;  4H63 V;  1EIF A;  2CXL A;  2CT3 A;  2DNU A;  1XDP A;  1WI7 A;  3HA4 A;  2AHJ B;  4PLL A;  4ZI3 C;  1QUU A;  3PJA J;  4HFC A;  2F1L A;  3HFO A;  3J7A F;  2RMO A;  3LH5 A;  2CP3 A;  5LJ5 g;  4N4G A;  4TNW A;  1M90 U;  3PIP A;  2LHN A;  5KE3 A;  1SHF A;  4ORZ A;  1K0X A;  2LQK A;  3G4S A;  1CSK A;  3JCM X;  4LDX A;  4B9W A;  1VQN T;  1YWO A;  2DRK A;  4H9N C;  4JJD A;  2QEX A;  5CKF A;  3CCS T;  3ZLI A;  2C5K T;  2F4V T;  1K9M U;  2JM9 A;  3ABV A;  3UUM A;  3I0O A;  4JV5 T;  2KT9 A;  4FIB A;  1OYX A;  1KC8 U;  4DBQ A;  4Q25 A;  1HG2 A;  1WX6 A;  2A08 A;  3CC4 A;  2D9T A;  2C0T A;  2LM9 A;  4EMK C;  2Q9Q A;  1JXM A;  2MOX A;  2E8I A;  4DV3 T;  2WZI A;  4GOU A;  5JRE A;  3Q1J A;  5IXF A;  1HNZ T;  4QX7 B;  2MAW A;  5JDF A;  4D8D A;  3OA6 A;  2LMJ A;  5AQS B;  2DRM A;  5L3D B;  2MK5 A;  1MIW A;  3E08 A;  4YHJ A;  1I1J A;  4BI3 A;  2IIU A;  1PRL C;  5L3F B;  1QCF A;  2LSJ A;  2K9G A;  3M55 A;  3NVO A;  3VYH B;  2PFV A;  4GK0 E;  1IJ5 A;  5KH6 A;  5FMN A;  2K3X A;  4HVW A;  2A0F B;  4QQG A;  1LJO A;  5GAN 6;  1OWA A;  4DR4 T;  2WP9 A;  1T8B A;  3L8R A;  3QUJ A;  2E5L T;  5H6Q B;  4M7D G;  4UEM A;  1IAP A;  2V5D A;  3QYG B;  5HYA A;  1ZEE A;  4UV9 B;  4JPB W;  1ZSZ A;  1PD1 A;  3RLF F;  5A2Q E;  2D9D A;  3OYE A;  4TZ4 C;  3UUN A;  3ZC0 A;  2XID A;  5F3J A;  3UU6 A;  1N32 T;  4TV9 E;  4LF4 T;  2EHO C;  1VQ4 Q;  1C6V X;  2XQ3 A;  4FYX B;  3MEU A;  2R5M A;  4DV0 T;  4X64 T;  4PJO G;  2CBI A;  1AWO A;  4EEB A;  3IEE A;  4KH0 B;  4HFB A;  5KYW A;  1OED B;  1VOM A;  2V1Q A;  4U7Y A;  2BBH A;  2DMO A;  1UK5 A;  2EYY A;  2V6X A;  3RYI E;  4ILB A;  2N1G A;  2CRE A;  1VYV A;  5JR9 A;  2XQ7 A;  3AEB A;  4C92 B;  2ZMA A;  2LRK A;  2ECZ A;  2DEU A;  2AT1 B;  1RUW A;  1ZUU A;  2H89 A;  1Q86 C;  2VXE A;  3RH3 A;  4MBQ A;  4A4F A;  4YSX A;  4F7U B;  4XU3 A;  4HCK A;  4QQ6 A;  3QG1 A;  4JRI A;  2AZV A;  4CRI A;  1RLP C;  4H9S E;  3Q5X A;  3VV0 A;  4BAY B;  4DV6 T;  2W63 A;  3PUV F;  3N2O A;  2JPF A;  3EAB A;  2LT4 A;  3M0P A;  5FU6 C;  2Q9Q D;  4KHZ F;  3P7I A;  4RTY A;  2X4J A;  4M75 B;  2RD1 A;  3CCM T;  2CS7 A;  4X1V A;  5BR8 T;  4AI6 A;  1IRX A;  4ZTJ A;  4PNO A;  2FJB A;  2FJD A;  1U8R A;  3KBU A;  2X3X D;  3FZF B;  1W2B P;  4C0D C;  1QVF A;  5M9O A;  2HN1 A;  4YTP A;  4JI6 T;  3EHQ A;  5DQV A;  4DR3 T;  2J6F A;  3RPU A;  2OV9 A;  3CCR T;  3RYF E;  4ZOL E;  5FY7 A;  3WI3 A;  2OAW A;  5DY9 A;  3X24 B;  4IIM A;  3CPW P;  2OJ2 A;  1FMW A;  3HL6 A;  3V8L A;  5KYY B;  3QXE B;  1Q95 G;  5LJ5 d;  1BR2 A;  4GYR A;  4M7D E;  5HEG A;  1G2B A;  2DLP A;  4C8Q F;  1KD1 R;  4DV5 T;  2CWO A;  2JOY A;  5L3E B;  2ZPE B;  4O4J E;  4BD3 A;  1BCO A;  1GCQ A;  2CXF A;  5LYJ E;  3NGP A;  1DU2 A;  5EC7 A;  1BB9 A;  4FYY B;  3F57 A;  4FCY A;  2M0O A;  3ZEF B;  4TWF A;  2WS3 A;  2X35 A;  5HCM A;  4Z90 A;  2LHR A;  5EK2 A;  4QHO A;  2QTV A;  2LOP A;  3VR9 A;  3VS2 A;  4ZGD B;  3G4S Q;  4YSZ A;  3MJX A;  1BYM A;  3OYY A;  4BJM A;  5ABE A;  2JIW A;  2XZE A;  3HKB E;  3ESL A;  3OPC A;  4IRE A;  1YNZ A;  2V5C A;  2DXC A;  3M56 A;  5KYX B;  2Y6X A;  2YN6 A;  1MIY A;  5FYM A;  3ZKR A;  3KFW X;  2GNC A;  4KBM B;  5ADX L;  4ZI2 C;  5HWY A;  2RF0 A;  2GFA A;  5FWB A;  2OTJ T;  2HQE A;  3SB2 A;  2L8K A;  2W62 A;  1WJQ A;  2F5K A;  2PUK B;  5AQO B;  3GIB A;  3JC6 C;  3LGF A;  5GAN f;  2EYW A;  3Q5W A;  4A4H A;  4FT4 A;  2LSI A;  4UC4 A;  5LJN A;  2XJ7 A;  3HKS A;  3CC4 Q;  2KXD A;  2FB7 A;  5LGT B;  1NBE B;  4FW2 A;  2BUD A;  1KC8 C;  3UUB A;  5KCH A;  1YP5 A;  2NUP B;  2WAC A;  2ZGW A;  3GP8 A;  1OPL A;  2CZ1 B;  3CPZ A;  3ZN0 B;  1HR0 T;  5JDQ A;  2EVR A;  1N8R R;  3JRZ A;  3OB9 A;  4M7A G;  3H0F A;  2NUT B;  2LX7 A;  2E6N A;  2VC8 A;  1QVF S;  3AA1 B;  2HSP A;  4AFQ C;  2LT3 A;  4DV2 T;  2BG9 E;  2BS3 A;  1U5S A;  1Y96 A;  1XNR T;  1B34 A;  1M3C A;  1BIB A;  2RPA A;  4LF8 T;  1KFY A;  2N2N A;  2H88 A;  2IC6 A;  1OPK A;  3LYI A;  1YW0 A;  4EMH A;  4PAG A;  5LJ5 j;  3FJP A;  1BU1 A;  2P0Q A;  3CXC A;  1ZOY A;  2WSS V;  2XM2 A;  3RYH E;  3BE3 A;  5L23 A;  1JQQ A;  2NP9 A;  2WSC E;  1SA0 E;  2XK0 A;  5KMG P;  1KK7 A;  2KLQ A;  4M77 F;  5JDN A;  3TLU A;  2KWI B;  2ROL A;  2UUC T;  4LD6 A;  3VS7 A;  4KRT A;  2QRX A;  5E0O A;  3CMA A;  2JRK A;  2M6I A;  4JS5 A;  3N2K E;  4HTE A;  2RQW A;  3OW2 A;  2XG8 D;  3L2R A;  2LNV A;  2PTK A;  1S72 A;  1OZ3 A;  3I9Y A;  1YCY A;  2K5B B;  1UTI A;  3CC7 A;  1VQ5 A;  2B76 A;  3ZFJ A;  1G83 A;  2BG9 C;  3PU3 A;  3RIU C;  5CB4 E;  3RNJ A;  4BDY A;  2XD0 A;  1WQ7 A;  3OYF A;  2L8D A;  4CC4 B;  4HWF A;  2BE9 B;  4OYK A;  4BE1 A;  2ZM8 A;  5GJV B;  4UVC B;  1VQP T;  4UVA B;  3RIA A;  2WSF E;  2ODV A;  4H9P C;  1M3B A;  2HDA A;  2CKK A;  3MEA A;  4DR5 T;  1PNJ A;  3UAT A;  1NM7 A;  3CKD A;  2X4Y A;  2GBQ A;  5FL1 A;  2OTL T;  3JCF A;  4EMK B;  2J06 A;  2ROT A;  3IA3 A;  5HEO A;  2DIG A;  2V6Y A;  2XIC A;  3CCU A;  2XAH B;  2DYB A;  5LBM A;  3P50 A;  4TWD A;  4YLH A;  4EV6 A;  1BI0 A;  4IDP A;  4C90 A;  4M7A E;  3JCM J;  4JLE A;  2WU2 A;  3GWH A;  3PJA A;  1W0A A;  4J6W A;  3V8J A;  3H37 A;  3N2G E;  3L1A A;  4C8Q B;  1M90 R;  2SEM A;  2VKH A;  1YQ4 A;  1PC0 A;  2XDB A;  3CCE T;  2DYI A;  1QWE A;  1X69 A;  3G6E A;  3SFD A;  4M77 A;  4PJO F;  1YIT A;  5D6Y A;  3NTH A;  4DEX A;  3PUY F;  1K8A C;  1M1F A;  1K9M R;  1RAI B;  2R58 A;  2YSQ A;  3CXC S;  4U7I A;  4PK5 A;  5AQQ B;  3PVQ A;  5IHY A;  3RQW A;  2DJQ A;  2E5Q A;  1KC8 R;  5HEH A;  4MMK A;  4J7I A;  4JI1 T;  3DB3 A;  2WDV A;  2BKO A;  3ETU A;  3VKH A;  1CHU A;  3FZH B;  1IZ6 A;  4Z89 A;  4HVV A;  2COY A;  3OYM A;  4JEU B;  1T3S A;  4M7A C;  1WXT A;  3FLG A;  3NZP A;  3VJP A;  4KX6 A;  3OW2 S;  1PG5 B;  1X27 A;  4BE0 A;  4P1N A;  4IUQ A;  2CBJ A;  3HFN A;  4PLI A;  2JS0 A;  1M5Q 1;  4OMO A;  4UIG A;  2P9B A;  4COF A;  1N9R A;  1N6A A;  1XDO A;  3EI0 A;  5LG3 A;  2DTI A;  1NE8 A;  2KZ7 B;  2IUB A;  5GAM f;  1D0Z A;  4QX8 B;  2RI3 A;  3NTK A;  1FMK A;  4IKF A;  3OMC A;  3PV0 F;  4XU2 A;  2A9U A;  2MPK A;  3UUL A;  2YDR A;  2DBK A;  5IYZ E;  1I4K 1;  3Q9D A;  2E5V A;  4H9O C;  2ATC B;  2NUZ A;  1AT1 B;  2DTH A;  1WNL A;  5KX5 E;  4O6J A;  3QOF A;  4HWC A;  1UGR B;  1GBR A;  4IGU A;  3J7Y q;  2ESW A;  5HXE A;  2V1R A;  4DBF A;  5CJ5 A;  3RRW A;  5LJ3 g;  1VQ9 A;  3UU8 A;  5CFB A;  4O4L E;  3G71 A;  3CPF A;  2CLY B;  4LF9 T;  3RQU A;  4A63 B;  3MA9 A;  2HBW A;  4A4G A;  1UCU A;  2RJF A;  2P0P A;  2QQR A;  4C0D B;  2EPD A;  2HBP A;  3WAK A;  3J80 E;  5CCA A;  2YIN A;  2Y48 B;  2K5L A;  5HAX A;  2DWK A;  2M16 A;  2A2F X;  3EDU A;  2EW3 A;  1CUN A;  3AE5 A;  2LJ3 A;  4JI5 T;  3LWI A;  4YTN A;  2DZ9 A;  2CZ6 B;  1I5L A;  3AAE B;  3NZQ A;  2DI4 A;  1XNQ T;  2MMP A;  5I2S A;  3GOX A;  3N9M A;  3AXJ B;  2V26 A;  2WZH A;  2FPE A;  3RC8 A;  1LPL A;  2ZM6 T;  4HFD A;  2QAZ A;  4CI3 B;  4C5E A;  1T3L A;  1GXI E;  4X62 T;  4RTX A;  5F8P A;  3ZBD A;  5FU7 B;  3SWN A;  4QVD A;  5DAB A;  1Q7Y U;  1KQS A;  4P5N A;  5HKC A;  5A1L A;  4B6M A;  3WVD B;  4FJO A;  3TU4 K;  1KQ1 A;  2RJE A;  2X51 A;  4KHP T;  4ZI2 D;  1S72 Q;  1Y71 A;  3ZJ1 A;  1YI2 A;  1YHQ A;  1VQ5 Q;  2IG0 A;  3CC7 Q;  2R57 A;  1ZBJ A;  5HK3 A;  3AEG A;  2KI7 A;  1Q81 U;  4FYW B;  3T1Y T;  2RB6 A;  5GAN 5;  3FZL B;  1Q82 U;  1D1B A;  3HR0 A;  1OV3 A;  3P4S A;  1UE9 A;  3OSV A;  1KSW A;  1HXD A;  2YRV A;  3O1J A;  1KHI A;  4JJN K;  4M7D B;  4IST A;  2Y90 A;  2H8H A;  3JCM g;  3DTO A;  1RAC B;  1WYX A;  4CXX A;  2UXC T;  4JRK A;  4AFZ C;  1HCI A;  1XMO T;  2QQB A;  3FHN A;  1TUC A;  3R84 B;  3EFO B;  3UU3 A;  2ED1 A;  4TVR A;  2LCS A;  4I4T E;  2QAS A;  2GQV A;  1WJR A;  3HRU A;  2E9X A;  3TRE A;  2XQY A;  4K0U A;  4EMG A;  1AEY A;  2PU9 B;  1W0B A;  2NLU A;  3PMT A;  3CCU Q;  4IT4 A;  1RLQ C;  1S1N A;  3EGU A;  5LMU T;  4PJO B;  4AG1 C;  4Z91 A;  3S3M A;  3AE1 A;  5IWA T;  1ZHI A;  2KAF A;  1CKA A;  2XQA A;  2JW4 A;  2DHR A;  3EG3 A;  2BVL A;  2MF2 A;  2RI2 A;  1KD1 U;  3TKL B;  2LOS A;  4ILU A;  1SSF A;  4EIK A;  4B3R T;  2RQT A;  5AQG B;  5L3C B;  2MYS A;  3MET A;  3VRB A;  3CCQ T;  2ZM2 A;  3A8H B;  4RTT A;  1YIT Q;  2OI3 A;  1D0X A;  1GRI A;  3RKO A;  3EAM A;  2DL4 A;  4B3S T;  3FXD B;  4C0G A;  1XMQ T;  2EGA A;  2K57 A;  2YLC A;  1YJN A;  3OQ5 A;  3GBQ A;  2CHN A;  3K1S A;  5CGM A;  3TLW A;  3QK6 A;  2JT4 A;  2L3S A;  3NPF A;  2DK3 A;  2PVD B;  2XAQ B;  2OX7 A;  2DXT A;  2Q9Q C;  4OMP A;  1JU5 C;  3S3N A;  2BKN A;  1KQS S;  3N9L A;  4X1K E;  2LKH A;  5JDH A;  3MZK B;  2JM8 A;  2H3R A;  3MHX A;  1PCX A;  4OVA A;  4DND A;  2FVU A;  2QYW A;  1Y01 A;  1LVK A;  5AQU B;  5ABF A;  4F17 A;  1VQ4 T;  3PUA A;  2ABL A;  1VYU A;  3G1J A;  3I5S A;  5LJ3 d;  2VAS A;  2NYS A;  4AT1 B;  5HXH A;  3ZJ2 A;  4E2F B;  1MUZ A;  3KVB A;  1TUG B;  2SPC A;  3QZ9 B;  2KR3 A;  2V8I A;  2LKG A;  1B3Q A;  2KXC A;  3GNF B;  4AXP A;  4EXT A;  2HKQ B;  4QVC A;  1K4U S;  3GA8 A;  2JQ9 A;  4AKL A;  4RTU A;  4BDZ A;  5FL0 A;  2VKO A;  3QO3 A;  3I56 A;  2O9S A;  1T98 A;  1VQ9 Q;  1ZSZ C;  3HHT B;  3QKJ A;  1Z9Z A;  5CKE A;  4ILC A;  1QCN A;  4HGA A;  2K4Y A;  4DR1 T;  4OX9 T;  2K5F A;  3BQI A;  4OB2 B;  2E3I A;  3PE0 A;  1S35 A;  2LEH A;  1I5O B;  5FKY A;  3UTK A;  5ABG A;  1ZP0 A;  2UXN B;  4N78 D;  1IHV A;  1UHF A;  3RER A;  4XTY A;  3N9N A;  4C92 F;  1MV3 A;  3FB9 A;  2YT6 A;  3MK7 C;  3VUZ A;  3M57 A;  1V76 A;  1G3T A;  1ZX6 A;  3PMI A;  1VQM A;  3LWH A;  5CK9 A;  3KVA A;  1EFN A;  2PTF A;  4LDV A;  1N36 T;  3V5S A;  5AYF A;  4CXY A;  4JI7 T;  2W2U A;  4Y28 E;  3OYI A;  2DIQ A;  1RI0 A;  2NTY A;  5DLO A;  5CIU A;  3OYK A;  5GON E;  1VA7 A;  4M7A B;  3OY9 A;  4RCC A;  4UEL A;  4ANJ A;  2NR4 A;  3JCM d;  3ZYL A;  2DBM A;  4TUY E;  4M75 F;  4X5T A;  1YI2 Q;  5IN1 A;  2E5K A;  1M1K U;  5GAN 2;  1NG2 A;  5LGN B;  4E47 A;  3QWX X;  2EGE A;  4LUD A;  4E7L A;  3OYJ A;  4J9E A;  5AQJ B;  1JBM A;  4CC7 A;  1YKH B;  5LJ3 j;  2CP0 A;  2DNX A;  4IUR A;  5I11 A;  2HNI A;  3G4S T;  3AE3 A;  3QDR B;  3EGD B;  3V7C A;  1NZ9 A;  2CP7 A;  2EQK A;  4IIO A;  3ZPO A;  4KT0 E;  2QEX T;  1N5Z A;  1RAD B;  4AKH A;  2LQ8 A;  2VKN A;  2CT4 A;  2F5T X;  2VGN A;  3GLX A;  2UU9 T;  2E3H A;  5FNV E;  3G06 A;  3FC3 A;  2Z6E A;  4HA8 A;  4DMW A;  2CE7 A;  2VUB A;  3AB3 B;  4B3T T;  1OED A;  3KIN B;  1GCQ C;  2B1E A;  4LMK A;  4ZN1 A;  3CC4 T;  2ZZD A;  4E7K A;  2JTE A;  1NEK A;  1V29 B;  4C92 A;  4LF6 T;  2HL3 A;  3ULR B;  5JTG A;  2AKL A;  3MP8 A;  1K1Z A;  1I8F A;  2W10 A;  3UPU A;  4YTM A;  2CSI A;  3A8L B;  4FW1 A;  5L3G B;  3TCJ A;  4XU1 A;  4F7U A;  5KXJ A;  1X01 A;  2EQI A;  2KE9 A;  1VQ6 Q;  3SDZ A;  1KD1 C;  2LJ0 A;  5KYU B;  2DO3 A;  3LX7 A;  3EGX B;  4YSY A;  4HFH A;  3A8G B;  3NBX X;  2EKH A;  1ZBX A;  4AMC A;  5J1G A;  3DLM A;  2QVA A;  1YCS B;  3CCQ Q;  3TQ7 P;  3M54 A;  4M75 A;  4RG2 A;  1MGQ A;  3MAC A;  5GAO q;  2LCC A;  1AZG B;  1QQJ A;  2O2O A;  4KUD K;  4IE0 A;  1NWM X;  1HSQ A;  4OB1 B;  1VIE A;  2CP2 A;  4A98 A;  3CCS A;  2EAY A;  4PJL A;  4KUM B;  3JCM P;  1RAE B;  1M62 A;  1PKS A;  1AZE A;  2RN8 A;  4HFI A;  4M78 D;  3M9Q A;  5HCJ A;  4PW8 A;  1PSF A;  2D0T A;  4CQI A;  3GF5 A;  3SHW A;  5FW9 A;  4MZT A;  1M8V A;  3HRS A;  3PUX F;  1W2B A;  2A3D A;  2F2V A;  2YDS A;  5FP3 A;  2ZPB B;  4ZS2 A;  5KYY A;  4YJ3 E;  2J6K A;  1VQ8 A;  3PUW F;  2DL7 A;  3P4W A;  1SUM B;  5JRC B;  2CZ0 B;  2AIR B;  3A8Y C;  4MLK A;  1DJ7 B;  3BY7 A;  3ZEH A;  1G3Y A;  2W67 A;  3QPH A;  1Y64 B;  3CPW A;  3FRN A;  2ZPH B;  4HXJ A;  4BB7 A;  2L3R A;  3C98 B;  3AE4 A;  3ZT7 A;  4HT8 A;  2IIM A;  1D0Y A;  1KNR A;  4DOW A;  3P4R A;  1QVP A;  2CWY A;  3JSC A;  2L3Q A;  3PFS A;  3OSS C;  5GMK h;  2V8K A;  1NEG A;  4FYV B;  2WBL A;  1HD3 A;  1N8R C;  1T0J A;  4H9Q C;  4QT7 A;  4QVZ A;  1K73 U;  5AQP B;  3CML A;  3UF4 A;  4G63 A;  5KYX A;  4GLM A;  3B13 A;  1X6G A;  2M51 A;  5IT9 E;  1Q7Y R;  3OYA A;  2RK1 A;  4DEY A;  1JJ2 P;  2JZ2 A;  4LE9 A;  4OK0 A;  4LXC A;  4I50 E;  2X4W A;  3OS5 A;  2KNB B;  1A0N B;  4XZC A;  3HP9 A;  2XMF A;  2GCX A;  1VQL A;  3I9W A;  4KUL A;  3QBY A;  3ER0 A;  1Q81 R;  3CWZ B;  2KEA A;  1OXZ A;  1V9D A;  5CR2 A;  1JO8 A;  1Q82 R;  2LSY A;  1WHH A;  3RMS A;  4QXC B;  4K0K T;  5LJ5 h;  5CA1 E;  3OYZ A;  5C2T A;  3VS1 A;  2M0Y A;  3PU8 A;  2I59 A;  2NUP A;  5IH2 A;  2WAU A;  2UXX B;  4GK5 E;  2X4X A;  5LJ5 e;  1ZQ1 A;  3L42 A;  1KHC A;  5J0Z A;  1UGP B;  4DV7 T;  2DZC A;  5HEU A;  1IO6 A;  3M0S A;  3JB9 F;  1IHW A;  2NUT A;  3PUR A;  3AE2 A;  4EZ4 A;  4AQG A;  4OML A;  3A5X A;  2AXD S;  3LBX B;  2IPO B;  2QDL A;  4E7H A;  2WCA A;  1VQK A;  4EYU A;  2I0M A;  4IDN A;  2KMT A;  3QJY A;  2PZ1 A;  1W2B S;  4J9H A;  2GFU A;  3RR6 A;  1D3B B;  4BY6 B;  2BBJ A;  3DJB A;  2YUO A;  4MZM A;  3HRT A;  4L9I A;  3K3Q C;  2AKK A;  2D2S A;  4PJM A;  3UQ4 A;  3D7S B;  4EDU A;  3CPW S;  3LFM A;  3P4Q A;  2JNG A;  1TSF A;  2O4X B;  3CCM A;  3OYB A;  3X1D A;  1W6X A;  4AIS A;  1ZA2 B;  5TAO A;  2DAQ A;  2HAX A;  5KYN A;  5GAN 3;  1QVG P;  1H92 A;  4ZNX A;  2A28 A;  1H64 1;  3CCV A;  3VUB A;  1NYG A;  4IE4 A;  4MHC A;  1M90 C;  2QEX Q;  5D6X A;  3KFV A;  4Z88 A;  4UR9 A;  2DTO A;  1GBQ A;  3EG1 A;  3I5R A;  5JH7 E;  3M4G A;  4HT9 A;  4BI8 B;  2WDQ A;  2FRY A;  4AKR B;  3FBL A;  3MEW A;  4C0F A;  1J3T A;  4MFR A;  1WFW A;  2XTL A;  2E64 A;  3OYL A;  3RIR A;  1K9M C;  3BQK A;  1H8K A;  1FIO A;  2FPF A;  2LT1 A;  3C50 A;  4J9F A;  4D8K A;  4EMK A;  5GMK j;  2B86 A;  3J9X 1;  3X25 B;  2LCL A;  1XQH A;  4WBN E;  1GL5 A;  3ZCJ A;  4ERR A;  1SF9 A;  5LXT E;  4FSS A;  3UFE A;  2JS2 A;  3AE6 A;  4ZGE B;  4J6X A;  4A5X A;  2J1D G;  1HS7 A;  4IIJ E;  3N5L A;  2DVE A;  1UUR A;  3C94 A;  3H0H A;  3C12 A;  3QDF A;  2R6G F;  2EIF A;  2VGM A;  4P0B A;  7AT1 B;  2LZ6 B;  1IXD A;  2C5J A;  4C8Q A;  1ZSG A;  2E65 A;  1VQ7 A;  1F1B B;  5LJM A;  5GJW B;  3EAE A;  2FL7 A;  1SHZ C;  4OMM A;  3OYC A;  2D5U A;  3C4Z A;  5FLX E;  3UWN A;  1I94 T;  4QWN B;  3W15 B;  2P0K A;  2VL0 A;  4HKA A;  5C3J A;  4GBQ A;  1MMN A;  1H7C A;  1IZN B;  3L2Q A;  5AQT B;  3VS6 A;  3R6O A;  4JI4 T;  5IHI A;  1J5E T;  1NJI U;  1VQ8 Q;  1CKB A;  5A0D A;  2F2X A;  5JVD E;  4QH4 A;  4AQY T;  2LQN A;  3SS1 A;  1S72 T;  4WBO A;  5LNK A;  1FXX A;  4FSX A;  5EK3 A;  4N0A A;  3C95 A;  4II1 A;  1VQ5 T;  3CC7 T;  3X20 B;  4FL6 A;  3FJ5 A;  1J5W A;  4DQ2 A;  4NL3 A;  4ISS A;  3N9P A;  2HZY A;  1FWZ A;  4PKC C;  4PNI A;  5DLQ E;  3VS0 A;  3QHS A;  2LJL A;  1MHN A;  3L09 A;  2D8H A;  4NL2 A;  2YU2 A;  4OB0 B;  2FJA A;  2V1D B;  2DL3 A;  4WF2 A;  2F2W A;  3PNW C;  5A0L A;  3SFE A;  2C0I A;  1UUE A;  2NOX A;  5GAN g;  2MWO A;  1FMV A;  2DF6 A;  1OEB A;  3CCL A;  2J47 A;  4R0K A;  3SWN C;  3FIF A;  1YD8 G;  1MV0 B;  5HK0 A;  1PSE A;  5EZY E;  5HEJ A;  3CCU T;  1X2Q A;  3K3O A;  2UUB T;  1VQL Q;  1M1K R;  1BR4 A;  4MDX A;  1UG1 A;  2MCN A;  4ZXL A;  2VYT A;  5LP6 E;  4Q5W A;  2QA4 A;  4LFC T;  4AQF A;  2L0A A;  2FO0 A;  4F8H A;  4BE2 A;  1LVF A;  3F70 A;  3OMG A;  4M7D F;  3NHN A;  4IHJ E;  1ZLM A;  3G6E T;  1WR0 A;  2FZG B;  2M1H A;  2B8A A;  1YIT T;  1M1G A;  4YT0 A;  3CQC B;  1IBM T;  1OUL A;  2DCF A;  2YLB A;  1K9A A;  2XQ6 A;  2E9X C;  2XQ5 A;  3CME A;  3AED A;  4U33 A;  4X65 T;  3BFM A;  3RC3 A;  2XQ9 A;  3E9G A;  1BCM A;  3ZMT B;  1UEC A;  3H3A A;  1VQP A;  4ADZ A;  4J6Y A;  3OS1 A;  2E70 A;  3PUZ F;  2RQV A;  4J7F A;  2COZ A;  4C8Q D;  1VQK Q;  1ARK A;  2KXP B;  3Q2M A;  2KWH A;  4HCB A;  4TWH A;  2SRC A;  2A7Y A;  3EFS A;  4M78 G;  3E0Z A;  3OBY A;  4LNP A;  2RO0 A;  4XTW A;  3FEO A;  2BDE A;  1PKT A;  3Q5D A;  3CC2 A;  3JCM W;  2MPX C;  2YU1 A;  3AXJ A;  1Z9Q A;  3E22 E;  4IUT A;  1WRD A;  4RCB A;  1N9S A;  2XUE A;  2PUO B;  3AAA B;  1M2O A;  3KBG A;  4A4K A;  2EHO B;  5KDM C;  2FYK A;  2KT1 A;  2H7O A;  3I1A A;  2XI9 A;  4CI1 B;  3VU7 H;  3EG9 B;  4NUU A;  3CCV Q;  1AVZ C;  2L2P A;  1RI9 A;  3L3P A;  1R0B G;  4C5H A;  4HCZ A;  1AD5 A;  3H0I A;  3ZYK A;  4K11 A;  4E7S A;  2RPN A;  4I43 B;  2QDY B;  2KND A;  2XAG B;  4HWH A;  2KT8 A;  2WWU A;  4M7D A;  3LK3 B;  3KV6 A;  3EG2 A;  2FPD A;  1VQ9 T;  4X66 T;  6AT1 B;  3KXT A;  3T8O A;  3EFO A;  4PK6 A;  4PJJ A;  3DLL A;  1TG0 A;  3PTA A;  4PFO A;  1WJS A;  1C0M A;  2BTT A;  4JRP A;  3ZT5 A;  1SG5 A;  2ZPG B;  4IUU A;  3F31 A;  5FU6 B;  4EAH A;  4CN1 A;  4B6X A;  1BI2 A;  4PJO A;  3N9O A;  3BK9 A;  4HE8 A;  1YN8 A;  3OJA A;  4ZI7 E;  1HYO A;  1Y57 A;  2LX9 A;  1KQ2 A;  3QJ6 A;  2GF7 A;  1XJW B;  4BI4 A;  2K9A A;  3M3Z B;  5JQG E;  3O9X A;  4KUI A;  3QB5 A;  1VQ7 Q;  3CCJ A;  1TTH B;  2K5I A;  3QB5 K;  2DJZ A;  2K48 A;  2WMN A;  3QWY A;  2X9W A;  1KNP A;  1TOV A;  1U1S A;  2CM0 A;  4D6W A;  4YJ2 E;  4R56 A;  1K73 R;  1ZKE A;  1GQE A;  3RF1 A;  4EGW A;  4M78 E;  3FXE B;  4L5G A;  3RKG A;  2RNA A;  1WA7 A;  4J9C A;  5GAN 4;  4M77 D;  1QP3 A;  4JEH B;  2H3J A;  2KSR A;  3AEF A;  1X9B A;  2JTM A;  3M4Y A;  1SPK A;  2PJQ A;  2GK9 A;  3WXM B;  3C64 A;  5CVI A; 
#chains in the Genus database with same CATH homology
 5GAN d;  1YI2 T;  4KP3 C;  1YHQ T;  2PQW A;  2XAJ B;  4EIW A;  1YIJ A;  2E6Z A;  4X34 A;  1UX4 A;  2V7J A;  4J5Y A;  2HH7 A;  2RP4 A;  4BA9 A;  3L2U A;  5GAM g;  3JB9 H;  4QKN A;  1X75 C;  3OS2 A;  1BIA A;  3L2Z A;  2JMK A;  2EJ9 A;  2VWA A;  4E7I A;  4QXB B;  4M78 C;  4QW2 A;  4M7A F;  2C0S A;  3KBT A;  1UX5 A;  2XAF B;  2A3L A;  5KE2 A;  4DVD A;  3S3O A;  2OA5 A;  4X9C A;  5GAO l;  2JN0 A;  3ANW B;  5GAO r;  3CBP A;  1KG1 A;  2CMR A;  2BIV A;  2XDD A;  3DB4 A;  4F7U E;  1YJW A;  4OHF A;  1Y7X A;  4IUP A;  1VQ6 T;  2MWP A;  2M67 A;  5J3B A;  3VHL A;  2YEV C;  4C91 A;  4UF0 B;  1UEB A;  1TH7 A;  4PJO D;  3CD6 A;  2EJF A;  2ACX A;  4F6R C;  1RL2 A;  2X9Y A;  2KQW A;  4TV8 E;  2KVQ G;  1BR1 A;  2W61 A;  2DD5 A;  2MI6 A;  5FY1 A;  5FXX A;  3BW1 A;  4C92 C;  3VU3 C;  5J2T E;  5LJ3 h;  3MP6 A;  5GAN j;  1W4S A;  4QXH B;  3C51 A;  1XNI A;  4O5V A;  3OS0 A;  5LJ3 e;  3CBM A;  4M7A A;  5L2L A;  4O4H E;  3I55 A;  1FEW A;  4EB6 E;  2XDP A;  3LW5 E;  4QQD A;  3F2E A;  3KV4 A;  3HL8 A;  4IE7 A;  4A53 A;  2Y8D A;  1O75 A;  2RA2 A;  1FX7 A;  5HY6 A;  3I56 T;  1X79 A;  2XKO C;  3UUX B;  2X9X A;  2P4T A;  2A72 A;  1LNX A;  4ATO A;  2V7L A;  4IE6 A;  3IF8 B;  1UGS B;  4JDS A;  4ELZ C;  2V8J A;  3GPL A;  2E9X D;  4DMV A;  4N4I A;  2JJ9 A;  3K3N A;  2EJG A;  1EZ3 A;  4C0Z A;  4O2A E;  5GMK l;  3I0Q A;  5L3B B;  1MIV A;  2WSE E;  3RYC E;  4J83 A;  3MCA B;  3O1H A;  3PTR B;  3NRX A;  2JMH A;  3JCM h;  5GAN 8;  4A56 A;  3V7S A;  4X1I E;  1VQO A;  4A54 A;  5C6S A;  1YJ9 A;  1Q86 U;  3O8V A;  3X26 B;  5LJ5 f;  3JCM e;  5JR9 C;  4C8Q G;  2NW7 A;  1U5P A;  5CO7 A;  3FB2 A;  5GAM d;  4BJN A;  5A0G A;  2RK2 A;  1QP2 A;  3KDS E;  3V5U A;  4U74 A;  4P09 A;  4UXN B;  2JTF A;  3CX8 B;  2PVO B;  2ES0 A;  3QSU A;  3VKI A;  4JLG A;  2PG8 A;  3EFR A;  3GN5 B;  1OI1 A;  3QC9 A;  2RHY A;  5LL6 S;  1Q7Y C;  4OFZ A;  4KMC A;  3RMQ A;  2VKJ A;  4HN9 A;  5JRC A;  1WR6 A;  5CKD A;  4G2A A;  3ZMV B;  2NTX A;  3ZN1 B;  3HPW A;  4RKU E;  4XTZ A;  4GYS A;  4IDZ A;  1Q81 C;  2FHD A;  4A4E A;  2CZ7 B;  1Q82 C;  3C4W A;  3CBO A;  4Z8X A;  1QW1 A;  3S4U A;  3CQG B;  1HTJ F;  4BUG A;  2E12 A;  1VRB A;  4EYY R;  5LHG B;  3ZMS B;  1HFA A;  1KNZ A;  3C4X A;  2DWG A;  4ZHQ E;  3HKC E;  3ZMU B;  2RHZ A;  1US7 B;  5L8R E;  2L5Q A;  1I81 A;  5FXW A;  3OYG A;  2OAU A;  1G5V A;  3EDV A;  2RH2 A;  5GAO m;  3O4X E;  3KV9 A;  1JJ2 A;  3KUF A;  4JLI A;  4C8Q E;  1MND A;  3V7R A;  1WYB A;  4J2C A;  2NW8 A;  1B7T A;  5GAM j;  2RI5 A;  4R55 A;  4M77 G;  4X20 E;  2CCQ A;  3AVS A;  3UT5 E;  2CGH A;  3LGL A;  1VQN A;  4JS4 A;  2LSG A;  1VQ8 T;  3N5B B;  4L6V 5;  3JCM b;  3ASK A;  4L0R A;  2XHE B;  1R8O B;  3LG7 A;  3U78 A;  2X67 A;  2KDS A;  3LBX A;  3P8B B;  4PL6 A;  3LK4 2;  3E9F A;  5HXC A;  2CXD A;  4DBR A;  2V7K A;  3LH0 A;  1JB0 E;  4O2B E;  1D3B A;  4J8O A;  2ZPI B;  2N9D A;  4M78 B;  2G3R A;  4C8Q C;  4MZP A;  2VXF A;  4C5G A;  1BI1 A;  2Y4Y A;  5EK4 A;  2O4X A;  3ZYM A;  5FY0 A;  4MDW A;  2DKG A;  4BAC A;  4NUV A;  3OYD A;  5GMK e;  1VQL T;  1HK9 A;  4N0A C;  1QSD A;  5DJQ C;  3OYX A;  4HCC A;  2K3Y A;  1QVG A;  1U4Q A;  2W0G A;  2ZLY A;  2E41 A;  5CQX A;  3H6Z A;  3LJC A;  2E1H A;  4C92 D;  3M59 A;  2XAS B;  3WAJ A;  1JJ2 S;  3OKQ A;  3H8Z A;  1ZV4 X;  5CA0 E;  5I21 A;  4M77 E;  3AA0 B;  1VQK T;  3OYN A;  4ZGJ B;  5GMK m;  5CQY A;  2LSK A;  2IAK A;  2RHX A;  2Q9Q B;  4M75 D;  4GLK A;  1G3S A;  3UDC A;  4AKI A;  4AQF C;  2KSS A;  5FXZ A;  2I2L A;  3JCM c;  4PFP A;  4E7Z A;  2CLY C;  5C8Y E;  4DA4 A;  3JCM Q;  2E10 A;  2NWB A;  3PT9 A;  2HD0 A;  5H6R B;  3QZ5 B;  1M1K C;  2VK9 A;  3AHU A;  1YBY A;  1K8A U;  1YKE B;  4LDU A;  3CCV T;  4M77 C;  4RMO A;  1G3W A;  2M9U A;  3NTI A;  2V7M A;  4PJN A;  5LOV E;  2HPJ A;  3E1S A;  5CAI A;  2LTO A;  4MAL A;  2CYZ B;  3PGG A;  3CCR A;  3PUG A;  1ZHC A;  4HKE A;  2F69 A;  3OBW A;  5FU7 C;  3MEV A;  1QVG S;  4E7J A;  2PBI A;  4PJO E;  4O4I E;  4I55 E;  3J81 E;  5JR9 B;  1VQ7 T;  3ME9 A;  3P8D A;  2QQ9 A;  4AKG A;  2LE8 A;  4M7D C;  3AAI A;  3ZMZ B;  5M4Y A;  3O1I A;  4XTX A;  3FBZ A;  2OTJ A;  2BKD N;  4B9X A;  4OYJ A;  2RJC A;  4UV8 B;  4ME7 A;  2XU8 A;  4PJO C;  5LCY A;  3CMA T;  3B57 A;  4ZS3 A;  1VIF A;  3MP1 A;  5FRN A;  3T9N A;  3URG A;  1AJ3 A;  1HF8 A;  3AVR A;  5DQW A;  1MNE A;  1U1T A;  3C4S A;  3RRC A;  3IBP A;  1VUB A;  3ZCI A;  1OZ2 A;  5JDG A;  2DLR A;  3CCL T;  3KV5 A;  2EHO A;  2KIN B;  3CEY A;  2QGS A;  4DO0 A;  4ZI3 D;  3TEE A;  2MBG A;  4FT2 A;  2X66 A;  3HI2 A;  1AHJ B;  3N9Q A;  5JDM A;  4JUV A;  3A5Z B;  2XHC A;  3CVR A;  3M65 A;  4XTU A;  1BI3 A;  2QA4 T;  1WYC A;  3CQX C;  1K73 C;  4PK4 A;  3PUS A;  4CI0 C;  2EQJ A;  2LC4 A;  3PIO A;  1UGQ B;  4HFV A;  4OGE A;  3CME T;  2QXF A;  3QYH B;  3PDY A;  2LDM A;  5D6W A;  3L2V A;  3JB9 D;  4LD9 K;  5LA6 E;  2HPL A;  2VKD A;  2EQU A;  3RKY A;  4EPC A;  2L3L A;  3CC2 T;  4Z02 A;  2L9Q A;  5CKH A;  1MMG A;  4CXW A;  1WGS A;  3RES A;  2JUF A;  4JRQ A;  2OTL A;  1BR0 A;  4U72 A;  1NPR A;  4IE5 A;  5LJ3 f;  4XAX B;  4IUV A;  1Y96 B;  1B34 B;  2VL8 A;  2ZPF B;  2X68 A;  3MO8 A;  4X9D A;  2G0U A;  3A8M B;  4C5I A;  4H63 H;  5HXR A;  3LLR A;  2QA7 A;  2R5A A;  5LGU B;  2D6F A;  2EHO D;  3CCE A;  3D0T A;  4YTL A;  3IHR A;  2HQX A;  3G7Z A;  3R6N A;  5HWX A;  2MAM A;  3BDL A;  3QUI A;  3UT1 A;  4YFS A;  1H3Z A;  4GIW A;  4X1Y E;  2W00 A;  2ZCF B;  3P8C D;  5KCO A;  3G71 T;  2DXU A;  4TN7 B;  1WPY A;  3SFM A;  3ANW A;  3L2W A;  1O3X A;  4N4H A;  4C92 G;  3MXZ A;  4EOZ B;  1NAF A;  3SRZ A;  2KMF A;  3CCJ T;  1MMD A;  3PUQ A;  4XQ3 A;  4F7U G;  4ZN3 A;  4CI2 B;  2K2V A;  5GMK i;  5LG4 A;  5GAN h;  5J39 A;  2ZM0 A;  3NFC A;  1NPP A;  2X9H A;  4UF0 A;  3K8P C;  5GAN e;  3JAM E;  3JCM f;  4M75 G;  2DPP B;  2YHT A;  1YIJ T;  5LHI B;  4RG8 A;  3FDR A;  4NOY A;  2H7V C;  1NJI C;  2BVM A;  5J2U E;  4M77 B;  1LKX A;  3NRY A;  1M4Z A;  2EKO A;  5J26 A;  3RX6 A;  5I2M A;  2D0Q B;  2EQM A;  2O01 E;  5HXS A;  3VKG A;  2LRQ A;  2DXB A;  2JQQ A;  3AA6 B;  5CKB A;  3JB9 I;  3ZC1 A;  2LVM A;  3EVY A;  4OP0 A;  1MMA A;  3VYG A;  3AA7 B;  2EFI A;  3INZ A;  3RKX A;  1YJW T;  2BZB A;  3ETV A;  4OB3 B;  1XTD A;  4NS5 A;  4C92 E;  1O9S A;  4OMF B;  4M7D D;  3JC6 D;  1HX8 A;  3A8O B;  4ELY C;  2VB6 A;  5LBQ B;  5GAN 7;  3CD6 T;  3OYH A;  4XU0 A;  3WVE B;  5FXV A;  1IRE B;  5FRM A;  3CX7 B;  1YJN T;  4O8S A;  3M5A A;  4M75 E;  5DM7 R;  2V7I A;  3CX6 B;  1D1A A;  2EWN A;  3DP7 A;  4L59 A;  1X6O A;  2QTX A;  3LK2 B;  4WW0 A;  1LOJ A;  3S6W A;  3I55 T;  2WM9 A;  1P92 A;  4GY5 A;  1IJ6 A;  3JCM V;  5LHH B;  4V2S A;  1VQ6 A;  5FRO A;  2RM4 A;  1UB4 A;  2X0L B;  2PVG B;  3P8H A;  4XTV A;  5EG2 A;  4EZH A;  1Y07 A;  4ZTF A;  3E19 A;  3GN5 A;  1E1H B;  1G8X A;  4M75 C;  2ODU A;  3GMI A;  1LRZ A;  3CCQ A;  1S94 A;  2C5I T;  4OF1 A;  4H9R C;  2RHU A;  4V1A v;  3SWN B;  3ONX A;  1D1C A;  3RUX A;  4M1P A;  4ASK A;  3U3I A;  3HKE E;  2WMO A;  1WQW A;  2RHI A;  5GAO n;  5BMV E;  3JB9 J;  4HEA A;  4M78 F;  2CA5 A;  4UVB B;  4BY6 C;  2QQS A;  4TX5 A;  3V8K A;  3SWH A;  3BDU A;  1M9S A;  2MTQ A;  5GAM h;  3MKD A;  1VQO T;  1YJ9 T;  5GAM e;  3JB9 G;  1Z0P A;  1N8R U;  2E9X B;  5GAO p;  1VQ4 A;  1VQM T;  1HG5 A;  3SD4 A;  3EUH A;  4Y91 A;  3M53 A;  2Y4X A;  5C0M A;  4OGC A;  4VUB A;  2K24 A;  2RJD A;  2EYQ A;  1BKB A;  2L89 A;  4MML A;  3BQL A;  2QQA A;  4DOV A;  4XK8 E;  5IAY A;  2QI2 A;  4P0A A;  5ETW A;  3DKM A;  3M58 A;  2IC9 A;  1WLX A;  2C06 A;  1XOV A;  2JVV A;  1N27 A;  2KK4 A;  3OBV E;  2RA1 A;  4XBF B;  3HKD E;  3GNG A;  1G73 A;  2CEA A;  2VV5 A;  4M7A D;  4FU6 A;  2DD4 A;  4F7U F;  3HSB A;  4FM4 B;  4CZZ B;  4WNK A;  3QII A;  3X28 B;  2DEQ A;  4LDW A;  2YK0 A;  4M78 A;  4LDY A;  2IVW A;  2KY9 A;  2D0U A;  4JUY A;  2NW9 A;  4FI5 A;  1JRI A;  2IW5 B;  2MOZ A;  5AFU L;  3SOL A;  5JDL A;  3RKW A;  4H63 V;  1EIF A;  2CXL A;  3HA4 A;  2AHJ B;  4PLL A;  4ZI3 C;  1QUU A;  3HFO A;  3J7A F;  5LJ5 g;  4N4G A;  1M90 U;  3PIP A;  2LHN A;  5KE3 A;  2LQK A;  3G4S A;  3JCM X;  4LDX A;  4B9W A;  1VQN T;  4H9N C;  2QEX A;  5CKF A;  3CCS T;  3ZLI A;  2C5K T;  1K9M U;  3UUM A;  3I0O A;  2KT9 A;  4FIB A;  1OYX A;  1KC8 U;  4DBQ A;  1HG2 A;  3CC4 A;  2D9T A;  2LM9 A;  4EMK C;  2Q9Q A;  2E8I A;  4GOU A;  5JRE A;  3Q1J A;  4QX7 B;  3OA6 A;  5JDF A;  5L3D B;  1MIW A;  3E08 A;  4YHJ A;  4BI3 A;  5L3F B;  2LSJ A;  3M55 A;  3VYH B;  2PFV A;  4GK0 E;  1IJ5 A;  5KH6 A;  5FMN A;  2K3X A;  4QQG A;  1LJO A;  5GAN 6;  1OWA A;  3QUJ A;  5H6Q B;  4M7D G;  4UEM A;  1IAP A;  3QYG B;  5HYA A;  1ZEE A;  4UV9 B;  5A2Q E;  3OYE A;  4TZ4 C;  3UUN A;  3ZC0 A;  2XID A;  5F3J A;  4TV9 E;  2EHO C;  3MEU A;  2R5M A;  4PJO G;  3IEE A;  1VOM A;  3RYI E;  2N1G A;  5JR9 A;  4C92 B;  2ZMA A;  1Q86 C;  2VXE A;  3RH3 A;  4MBQ A;  4A4F A;  4F7U B;  4XU3 A;  4QQ6 A;  3QG1 A;  4JRI A;  4CRI A;  4H9S E;  3Q5X A;  3VV0 A;  4BAY B;  2W63 A;  3N2O A;  2JPF A;  2LT4 A;  5FU6 C;  2Q9Q D;  3P7I A;  2X4J A;  4M75 B;  2RD1 A;  3CCM T;  2CS7 A;  4AI6 A;  4ZTJ A;  4PNO A;  1U8R A;  3KBU A;  4C0D C;  1QVF A;  5M9O A;  5DQV A;  3RPU A;  3CCR T;  3RYF E;  4ZOL E;  5FY7 A;  3WI3 A;  5DY9 A;  3X24 B;  1FMW A;  3HL6 A;  3V8L A;  3QXE B;  5LJ5 d;  1BR2 A;  4GYR A;  4M7D E;  4C8Q F;  2CWO A;  2JOY A;  5L3E B;  2ZPE B;  4O4J E;  4BD3 A;  2CXF A;  5LYJ E;  3F57 A;  2M0O A;  3ZEF B;  2X35 A;  2LHR A;  5EK2 A;  4QHO A;  2LOP A;  4ZGD B;  3MJX A;  1BYM A;  3OYY A;  4BJM A;  3HKB E;  3M56 A;  3ESL A;  2DXC A;  2Y6X A;  1MIY A;  5FYM A;  3KFW X;  4KBM B;  5ADX L;  4ZI2 C;  5HWY A;  2OTJ T;  2GFA A;  2HQE A;  3SB2 A;  2L8K A;  2W62 A;  1WJQ A;  2F5K A;  2PUK B;  3GIB A;  3JC6 C;  3LGF A;  5GAN f;  3Q5W A;  4A4H A;  4FT4 A;  2LSI A;  4UC4 A;  5LJN A;  3HKS A;  2FB7 A;  5LGT B;  2BUD A;  1KC8 C;  5KCH A;  2WAC A;  2ZGW A;  3GP8 A;  2CZ1 B;  3CPZ A;  3ZN0 B;  5JDQ A;  3JRZ A;  3OB9 A;  4M7A G;  2E6N A;  2VC8 A;  1QVF S;  3AA1 B;  2LT3 A;  1Y96 A;  1B34 A;  1BIB A;  2N2N A;  2IC6 A;  3LYI A;  4EMH A;  1YW0 A;  4PAG A;  5LJ5 j;  3FJP A;  2P0Q A;  3CXC A;  2WSS V;  3RYH E;  2NP9 A;  2WSC E;  1SA0 E;  2XK0 A;  5KMG P;  1KK7 A;  2KLQ A;  4M77 F;  5JDN A;  2KWI B;  4LD6 A;  5E0O A;  3CMA A;  2JRK A;  4JS5 A;  3N2K E;  4HTE A;  3OW2 A;  2XG8 D;  3L2R A;  2LNV A;  1S72 A;  1OZ3 A;  3I9Y A;  1YCY A;  2K5B B;  3CC7 A;  1VQ5 A;  3ZFJ A;  3PU3 A;  5CB4 E;  4BDY A;  2XD0 A;  1WQ7 A;  3OYF A;  2L8D A;  4BE1 A;  4OYK A;  2ZM8 A;  4UVC B;  1VQP T;  4UVA B;  2WSF E;  2ODV A;  4H9P C;  2CKK A;  3MEA A;  3CKD A;  2X4Y A;  2OTL T;  4EMK B;  2DIG A;  2XIC A;  3CCU A;  2XAH B;  5LBM A;  4YLH A;  1BI0 A;  4C90 A;  4M7A E;  3JCM J;  4JLE A;  4J6W A;  3GWH A;  3V8J A;  3H37 A;  3N2G E;  3L1A A;  4C8Q B;  2VKH A;  2XDB A;  3CCE T;  3G6E A;  4M77 A;  4PJO F;  1YIT A;  5D6Y A;  3NTH A;  1K8A C;  1M1F A;  2R58 A;  3CXC S;  4PK5 A;  5IHY A;  2E5Q A;  4MMK A;  4J7I A;  3DB3 A;  3ETU A;  3VKH A;  1IZ6 A;  3OYM A;  4JEU B;  4M7A C;  3FLG A;  3NZP A;  3VJP A;  3OW2 S;  4BE0 A;  4IUQ A;  3HFN A;  4PLI A;  1M5Q 1;  4UIG A;  2P9B A;  1N9R A;  1N6A A;  2DTI A;  1NE8 A;  2KZ7 B;  5GAM f;  1D0Z A;  4QX8 B;  2RI3 A;  3NTK A;  4IKF A;  3OMC A;  4XU2 A;  3UUL A;  5IYZ E;  1I4K 1;  3Q9D A;  4H9O C;  2DTH A;  1WNL A;  5KX5 E;  4O6J A;  1UGR B;  4IGU A;  3J7Y q;  5HXE A;  3RRW A;  5LJ3 g;  1VQ9 A;  4O4L E;  3G71 A;  3CPF A;  2CLY B;  3MA9 A;  4A4G A;  1UCU A;  2RJF A;  2P0P A;  2QQR A;  4C0D B;  2HBP A;  3WAK A;  3J80 E;  5CCA A;  2YIN A;  2Y48 B;  2K5L A;  5HAX A;  2DWK A;  2M16 A;  2A2F X;  3EDU A;  1CUN A;  3LWI A;  2DZ9 A;  2CZ6 B;  1I5L A;  3AAE B;  3NZQ A;  2DI4 A;  2MMP A;  5I2S A;  3GOX A;  3N9M A;  2V26 A;  3RC8 A;  4CI3 B;  4C5E A;  1GXI E;  5F8P A;  3ZBD A;  5FU7 B;  3SWN A;  4QVD A;  5DAB A;  1Q7Y U;  1KQS A;  4P5N A;  5HKC A;  5A1L A;  3WVD B;  4FJO A;  3TU4 K;  1KQ1 A;  2RJE A;  2X51 A;  4ZI2 D;  1Y71 A;  3ZJ1 A;  1YI2 A;  1YHQ A;  2IG0 A;  2R57 A;  5HK3 A;  1Q81 U;  5GAN 5;  2RB6 A;  1Q82 U;  1D1B A;  3HR0 A;  3OSV A;  1HXD A;  2YRV A;  3O1J A;  1KHI A;  4JJN K;  4M7D B;  4IST A;  2Y90 A;  3JCM g;  3DTO A;  4JRK A;  4CXX A;  1HCI A;  2QQB A;  3FHN A;  3R84 B;  4TVR A;  4I4T E;  2GQV A;  1WJR A;  3HRU A;  2E9X A;  3TRE A;  2XQY A;  4K0U A;  4EMG A;  2PU9 B;  2NLU A;  3PMT A;  4PJO B;  3S3M A;  1ZHI A;  2KAF A;  2DHR A;  2BVL A;  2MF2 A;  2RI2 A;  1KD1 U;  3TKL B;  2LOS A;  4ILU A;  1SSF A;  5L3C B;  3MET A;  2MYS A;  3CCQ T;  2ZM2 A;  3A8H B;  1D0X A;  3RKO A;  3FXD B;  4C0G A;  2K57 A;  1YJN A;  2YLC A;  3OQ5 A;  3QK6 A;  2DK3 A;  2PVD B;  2XAQ B;  2DXT A;  2Q9Q C;  3S3N A;  1KQS S;  3N9L A;  4X1K E;  5JDH A;  3MZK B;  2H3R A;  3MHX A;  4OVA A;  4DND A;  2FVU A;  1LVK A;  1VQ4 T;  3PUA A;  5LJ3 d;  2VAS A;  5HXH A;  3ZJ2 A;  3KVB A;  3QZ9 B;  2SPC A;  2V8I A;  3GNF B;  4AXP A;  4EXT A;  4QVC A;  3GA8 A;  4AKL A;  4BDZ A;  2VKO A;  3QO3 A;  3I56 A;  1T98 A;  3HHT B;  3QKJ A;  5CKE A;  4HGA A;  2K4Y A;  2K5F A;  3BQI A;  4OB2 B;  3PE0 A;  1S35 A;  2LEH A;  3UTK A;  2UXN B;  4N78 D;  3RER A;  4XTY A;  3N9N A;  4C92 F;  3FB9 A;  3MK7 C;  3VUZ A;  3M57 A;  1G3T A;  3PMI A;  1VQM A;  3LWH A;  5CK9 A;  3KVA A;  4LDV A;  3V5S A;  5AYF A;  4CXY A;  4Y28 E;  3OYI A;  2DIQ A;  1RI0 A;  2NTY A;  5DLO A;  5CIU A;  3OYK A;  5GON E;  4M7A B;  3OY9 A;  4RCC A;  4UEL A;  4ANJ A;  3JCM d;  3ZYL A;  4TUY E;  4M75 F;  5IN1 A;  1M1K U;  5GAN 2;  5LGN B;  4E47 A;  4E7L A;  3OYJ A;  1JBM A;  1YKH B;  5LJ3 j;  2DNX A;  4IUR A;  3G4S T;  2HNI A;  3QDR B;  3V7C A;  1NZ9 A;  2EQK A;  3ZPO A;  4KT0 E;  2QEX T;  4AKH A;  2LQ8 A;  2VGN A;  2F5T X;  3GLX A;  5FNV E;  3FC3 A;  2Z6E A;  4HA8 A;  4DMW A;  2CE7 A;  2VUB A;  3AB3 B;  3KIN B;  3CC4 T;  2B1E A;  4ZN1 A;  2ZZD A;  4E7K A;  1V29 B;  4C92 A;  3MP8 A;  1I8F A;  3UPU A;  3A8L B;  5L3G B;  3TCJ A;  4XU1 A;  4F7U A;  1X01 A;  3SDZ A;  1KD1 C;  2DO3 A;  3LX7 A;  3A8G B;  3NBX X;  1ZBX A;  5J1G A;  3DLM A;  3M54 A;  4M75 A;  4RG2 A;  1MGQ A;  3MAC A;  5GAO q;  2LCC A;  4KUD K;  4IE0 A;  1NWM X;  4OB1 B;  1VIE A;  3CCS A;  2EAY A;  4PJL A;  4KUM B;  3JCM P;  4M78 D;  3M9Q A;  4PW8 A;  1PSF A;  2D0T A;  4CQI A;  3GF5 A;  1M8V A;  4MZT A;  3HRS A;  1W2B A;  2A3D A;  5FP3 A;  2ZPB B;  4ZS2 A;  4YJ3 E;  1VQ8 A;  5JRC B;  2CZ0 B;  4MLK A;  1DJ7 B;  3BY7 A;  3ZEH A;  1G3Y A;  3QPH A;  3CPW A;  1Y64 B;  3FRN A;  2ZPH B;  4BB7 A;  2L3R A;  3C98 B;  4HT8 A;  1D0Y A;  4DOW A;  1QVP A;  2CWY A;  3JSC A;  3PFS A;  3OSS C;  5GMK h;  2V8K A;  2WBL A;  1N8R C;  4H9Q C;  4QVZ A;  1K73 U;  3CML A;  4G63 A;  3B13 A;  5IT9 E;  3OYA A;  2RK1 A;  2JZ2 A;  4OK0 A;  4I50 E;  2X4W A;  3OS5 A;  4XZC A;  3HP9 A;  2GCX A;  1VQL A;  3I9W A;  4KUL A;  3QBY A;  3ER0 A;  3CWZ B;  1OXZ A;  1V9D A;  5CR2 A;  2LSY A;  3RMS A;  4QXC B;  5LJ5 h;  5CA1 E;  3OYZ A;  3PU8 A;  2I59 A;  2WAU A;  2UXX B;  4GK5 E;  2X4X A;  5LJ5 e;  1ZQ1 A;  3L42 A;  1KHC A;  1UGP B;  2DZC A;  3JB9 F;  3PUR A;  4EZ4 A;  4AQG A;  3A5X A;  3LBX B;  4E7H A;  1VQK A;  4EYU A;  2KMT A;  3QJY A;  1W2B S;  2GFU A;  1D3B B;  4BY6 B;  3DJB A;  4MZM A;  3HRT A;  4L9I A;  3K3Q C;  2D2S A;  4PJM A;  4EDU A;  3CPW S;  3LFM A;  2JNG A;  2O4X B;  3CCM A;  3OYB A;  5TAO A;  2DAQ A;  2HAX A;  5GAN 3;  1H64 1;  3CCV A;  3VUB A;  4IE4 A;  4MHC A;  1M90 C;  5D6X A;  2DTO A;  5JH7 E;  3M4G A;  4HT9 A;  4BI8 B;  4AKR B;  3FBL A;  3MEW A;  4C0F A;  4MFR A;  2XTL A;  2E64 A;  3OYL A;  3RIR A;  1K9M C;  3BQK A;  1FIO A;  2LT1 A;  3C50 A;  4EMK A;  5GMK j;  3J9X 1;  3X25 B;  2LCL A;  1XQH A;  4WBN E;  3ZCJ A;  4ERR A;  5LXT E;  3UFE A;  4ZGE B;  4J6X A;  2J1D G;  1HS7 A;  4IIJ E;  3N5L A;  3C94 A;  2DVE A;  3C12 A;  2EIF A;  2VGM A;  4P0B A;  2C5J A;  4C8Q A;  2E65 A;  1VQ7 A;  5LJM A;  3EAE A;  2FL7 A;  1SHZ C;  3OYC A;  2D5U A;  3C4Z A;  5FLX E;  3UWN A;  4QWN B;  3W15 B;  2P0K A;  3L2Q A;  4HKA A;  1MMN A;  1H7C A;  1IZN B;  3R6O A;  1NJI U;  5A0D A;  5JVD E;  3SS1 A;  1S72 T;  4WBO A;  5LNK A;  1FXX A;  4FSX A;  5EK3 A;  4N0A A;  3C95 A;  4II1 A;  1VQ5 T;  3CC7 T;  3X20 B;  4FL6 A;  4DQ2 A;  4NL3 A;  4ISS A;  3N9P A;  5DLQ E;  1FWZ A;  4PKC C;  4PNI A;  3QHS A;  2LJL A;  1MHN A;  3L09 A;  4NL2 A;  2YU2 A;  4OB0 B;  4WF2 A;  2V1D B;  3PNW C;  5A0L A;  2NOX A;  5GAN g;  2MWO A;  1FMV A;  3CCL A;  3SWN C;  3FIF A;  1YD8 G;  5HK0 A;  1PSE A;  5EZY E;  3CCU T;  3K3O A;  1BR4 A;  4MDX A;  2VYT A;  5LP6 E;  4Q5W A;  2QA4 A;  4AQF A;  4BE2 A;  1LVF A;  3F70 A;  3OMG A;  4M7D F;  4IHJ E;  3G6E T;  2M1H A;  2B8A A;  1YIT T;  1M1G A;  3CQC B;  2DCF A;  2YLB A;  3CME A;  2E9X C;  3BFM A;  3RC3 A;  3E9G A;  3ZMT B;  1VQP A;  3H3A A;  4ADZ A;  4J6Y A;  3OS1 A;  2E70 A;  4J7F A;  4C8Q D;  2KXP B;  3Q2M A;  2KWH A;  4HCB A;  3EFS A;  2A7Y A;  4M78 G;  3E0Z A;  3OBY A;  2RO0 A;  4XTW A;  3FEO A;  2BDE A;  3CC2 A;  3JCM W;  2YU1 A;  3E22 E;  4IUT A;  1WRD A;  4RCB A;  1N9S A;  2XUE A;  2PUO B;  3AAA B;  3KBG A;  4A4K A;  2EHO B;  5KDM C;  2FYK A;  2H7O A;  3I1A A;  2XI9 A;  4CI1 B;  3VU7 H;  4NUU A;  3L3P A;  4C5H A;  4HCZ A;  3ZYK A;  4E7S A;  4I43 B;  2QDY B;  2KND A;  2XAG B;  2WWU A;  4M7D A;  3LK3 B;  3KV6 A;  1VQ9 T;  3KXT A;  3T8O A;  4PK6 A;  4PJJ A;  3DLL A;  3PTA A;  4PFO A;  1WJS A;  4JRP A;  2ZPG B;  4IUU A;  3F31 A;  5FU6 B;  4EAH A;  4B6X A;  1BI2 A;  4PJO A;  3N9O A;  3BK9 A;  4HE8 A;  3OJA A;  4ZI7 E;  1KQ2 A;  2LX9 A;  3QJ6 A;  2GF7 A;  4BI4 A;  2K9A A;  5JQG E;  3O9X A;  4KUI A;  3CCJ A;  2K5I A;  2DJZ A;  2K48 A;  2WMN A;  2X9W A;  1U1S A;  2CM0 A;  4D6W A;  4YJ2 E;  4R56 A;  1ZKE A;  4M78 E;  3FXE B;  4L5G A;  5GAN 4;  4M77 D;  1QP3 A;  4JEH B;  2H3J A;  2JTM A;  3M4Y A;  2PJQ A;  2GK9 A;  3WXM B;  3C64 A;  5CVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...