4KBMB

Structure of the mtb card/rnap beta subunit b1-b2 domains complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
148
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETREQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit beta
publication title Structure of the Mtb CarD/RNAP beta-Lobes Complex Reveals the Molecular Basis of Interaction and Presents a Distinct DNA-Binding Domain for Mtb CarD.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transcription
total genus 41
structure length 148
sequence length 159
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kbmB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kbmB01
4KMCA 4KBMB 4MFRA 2EYQA 2LT1A 2LQKA 4XAXB 2LT3A 4ILUA 4L5GA 2LT4A
chains in the Genus database with same CATH superfamily
2KXPB 4CC4B 4TWDA 3Q5XA 3JSCA 4RTVA 4H9OC 3JCMX 3L3PA 3KXTA 2HPLA 4M75A 2E6NA 2F1LA 3L2UA 2PU9B 4XTUA 1M8VA 1H3HA 3H8ZA 3P4RA 1SF9A 4X62T 2CREA 3VS4A 4PJNA 4OMNA 1BI1A 5CR2A 4QX8B 4IUPA 2IPOB 2LNVA 4EYUA 4IUVA 1PKTA 4ZGJB 2V6YA 1NLPC 2XPKA 1WFWA 3FZHB 5HAXA 5KYYB 4H9SE 3FHNA 2PUOB 1VQ7Q 3FZFB 4EDUA 3G6ET 3MACA 4TWFA 4A5XA 4YT0A 2WS3A 5L3EB 4B9XA 3QZ5B 3LFMA 3GF5A 3RYHE 4DUYT 3R84B 1KD1C 2VL0A 2KGTA 1KK7A 2RJCA 3FJPA 4ZNXA 1PNJA 4QT7A 2XDBA 2BTTA 2M16A 4V1Av 3GNFB 4EOZB 1QWFA 3M0TA 4ZZBA 3CVRA 5JR9C 2K5LA 3MEWA 5L4EA 2DJQA 2BVMA 3QNUA 5GAMf 5AQHB 2H88A 3CQXC 4P0BA 5KYXA 1VA7A 1MV3A 4PW8A 1VYUA 2M51A 1WZOA 2RI2A 4EV6A 2LHRA 1WYCA 2ENMA 2KT9A 2ZM8A 2RO0A 1GBRA 1Y64B 4GKKT 3Q2MA 2VK9A 5LYJE 3X26B 4OF1A 1OZ3A 2YDRA 1N9RA 3SDZA 3UUXB 4M75G 4GK5E 1VQOQ 2E8IA 1W9RA 3G4SA 2PVGB 4M75D 3FBZA 2JJ9A 1LOJA 2DMOA 2DHRA 3ULRB 1G8XA 3EFOA 4JLGA 3AEDA 3OYDA 1J5WA 1WQWA 3PJAJ 2RHIA 1TUGB 3CCRA 3EFSA 2WAUA 5EZYE 3AA6B 1WIEA 4PJOG 1R8IA 2CLYB 2QEXQ 4JI8T 2BE9B 2KT8A 4M77E 4PJOD 2ESWA 3CMLA 2RN8A 2QQBA 1KD1U 2H8HA 2CP6A 3ZL7C 4IDNA 2JZ2A 3P4SA 5GAMh 1G3YA 4OHFA 4M7AD 3A8MB 4OYJA 3OTOT 2W10A 1M27C 2KY9A 2BZYA 2VXFA 4AQYT 4BDYA 3CPZA 4BI8B 2CWYA 3OW2A 3RIUC 4PNOA 2NWBA 3TSWA 1U8RA 5C8YE 5E0OA 3OYEA 9ATCB 1S35A 3MHXA 2LT1A 3ZT6A 3GLXA 1G3WA 4C0DC 3EABA 2D8HA 1WHLA 2WY2A 1Q81R 2N2NA 3JCFA 4FYVB 2I59A 4O2AE 3PUVF 1C0MA 3ZFJA 2YKSA 2CZ0B 3EDVA 3N2KE 3NTHA 3OYMA 2P84A 5D6YA 4C8QB 4JDSA 1OI1A 2UXXB 1M2VB 2EQIA 3G6EQ 3CPWP 3N9QA 1UX5A 5L3DB 2FZCB 3AECA 3NBXX 2F69A 2CA5A 1Q95G 5ABFB 3UWNA 2QG9B 1OX8A 2LRKA 1M1FA 2QVAA 1XOVA 2E9XC 3FZMB 3C98B 3JRZA 5LJ3e 1QCOA 4FYXB 5IXBA 2V6XA 4J9EA 1IHVA 4QW2A 1M90C 1YKHB 3AEEA 4OX9T 3T9NA 4JEUB 3P8DA 4TN7B 4YTMA 4OK0A 3FB2A 2NW9A 2LSGA 1IGQA 2FHDA 4AFQC 4JJBA 3M3ZB 2DK3A 4IUQA 3NRYA 3LYIA 2LKGA 3C4WA 4GYSA 4XTXA 3CCQT 3DLMA 4LD9K 1Y96B 3UQ7A 4DV0T 2DRMA 4ZOLE 3AVSA 3AAIA 1M1KC 1VQ6A 4IE4A 2EJ9A 1VQ5A 2QDYB 3WVEB 4C0ZA 4QVDA 4YSZA 2KNBB 1OQKA 3PUXF 2YUQA 2VUBA 1S72A 3N5BB 3LJCA 3B5MA 3CPWA 4LMJA 1U06A 1OEBA 4DR2T 4RUGA 3P4QA 1TWBA 3PIPA 4TNVA 2VURA 3NKZA 4QXBB 2LRQA 3AEAA 1VQNT 1KQSP 3RKXA 5IN1A 3CC7T 4U33A 2GF7A 1K0XA 1K8AR 4AKRB 1I8FA 4WF2A 2XDPA 1IXDA 2BG9E 4HEAA 2A3DA 3FBLA 1WHHA 2DTHA 4RTZA 1TG0A 5FP3A 2GBQA 1WJRA 4O4JE 4U3CA 3BY7A 3ZT5A 2CS7A 4KUIA 5FRMA 2HSEB 3ZYMA 4OVAA 1VIFA 4O6JA 3KV5A 1F1BB 4L0RA 3RF1A 4CN4A 4FJOA 3S4UA 2KAFA 1K9MU 4Q5WA 3LSVA 4DR4T 5AQJB 3JCMc 3VV0A 2RQUA 2D1XA 2ROLA 5GMKe 1SSFA 3NZQA 4KHZF 2QTVA 2V1QA 4OB1B 5JTGA 3OMCA 3CCSA 1WYXA 1KC8C 2UXBT 1VUBA 2D0NA 1M1KU 2YU1A 2OTJA 5LB7B 2W0GA 2C06A 3GN5B 2X9XA 3ZYLA 2D9TA 3MEVA 1I5OB 3CX6B 3X25B 1W70A 4RKUE 2CBIA 1QVFP 3KV6A 1KQSA 4M75B 3ZN1B 2RHUA 4GOUA 1UEBA 1WX6A 1KQ1A 2RJFA 2EIFA 4OB2B 1JJ2S 3OYFA 4MLKA 1WQ7A 3PU8A 4LFCT 2ECZA 2A7YA 1Q82R 2LJ3A 4UVAB 5HXHA 3LWHA 4QQGA 5M9OA 2LSIA 2BUDA 2V6YB 4PJOB 4UV8B 2XM1A 6AT1B 5HEOA 1BCMA 2LE8A 2YWWA 4HXJA 3PUSA 2B8AA 3JV3A 2LCSA 5LGTB 4KUMB 4KI0F 5L3GB 1Y07A 3C94A 3O1HA 5HK3A 3CCQQ 3SRZA 4Y28E 4E7JA 2XM2A 1AJ3A 3M65A 4DV3T 1H8KA 2FO0A 4OMMA 3JCMe 3Q5EA 4NXMT 3D7SB 4MDXA 5CQXA 2XD0A 2BE7D 2GQVA 2EHOC 4CN6A 1QVFA 4YJ3E 1SEMA 2CE7A 1U3OA 5KYXB 4PJJA 5FNVE 4CXWA 4Z8AA 3FLGA 2ZM2A 2I6HA 4OMQA 4XU3A 1UGRB 1IJ5A 1O9SA 1G83A 1VQNQ 2UUAT 2QYWA 5H6RB 4B3TT 1BIAA 5HYAA 3WAJA 1GCQC 2YSQA 4B3ST 2DL4A 1U1SA 3S3MA 1SSHA 1QKXA 2IC6A 2O31A 4M77A 3GP8A 2O9VA 2EWNA 4LDWA 5AQQB 2ED0A 2RQTA 1WYBA 2NWMA 3M0UA 1SHZC 3EG0A 2NUTA 3RLFF 4C8QE 1D3BA 3IF8B 5LA6E 2LT3A 1B34B 3UDCA 5GANe 1FMVA 3ZC1A 4ZS3A 5JVDE 4OGCA 2LT4A 2IW5B 2D0QB 3OS2A 1MGQA 3UPUA 1YJ9A 3RRWA 4IUTA 2IHR1 5CB4E 1E6GA 1KQ2A 2DERA 1ZOYA 4WTOB 4AKLA 2IMLA 1YITA 4U74A 3VU3C 2EQMA 2YLCA 2VB6A 1WHMA 1HTJF 4ESRA 1VQ9T 2E12A 3SS1A 4LFBT 3RKYA 3QYGB 3AB3B 5F8PA 3RI5A 2A0FB 5FW9A 2BZXA 4MFRA 1IZNB 5LXTE 2I2LA 4PLIA 4M7DF 2WBLA 4PFPA 2XAJB 2RH2A 3M54A 5L47A 3M0SA 1VQ4A 5A1LA 3RNJA 2A2FX 3UU3A 5LCYA 5AQOB 5F5WA 1WJSA 4U7IA 5FVLA 1WR0A 2CXLA 3E9FA 4C5HA 2OTLA 1YWOA 3G7ZA 4J9FA 4N4GA 3OYLA 3QPHA 4YTNA 3I9QA 1IAPA 1UURA 1K4US 1G3SA 2BS3A 2W66A 5GANg 1SG5A 2QI2A 3OJAA 1VCTA 2QAZA 4KUDK 4XBFB 3CCMT 2QRXA 1ZHCA 3T8OA 2H89A 4ZEYA 2XKOC 1Q81U 4UC4A 2FYKA 2EGEA 1UDLA 4B3MT 3GBQA 3FEOA 2H3EB 3M0PA 4EMHA 5JDQA 3OBWA 4ZN3A 1G5VA 1WHKA 1D0ZA 3KINB 4J83A 1M5Q1 3H41A 2VGMA 5DLQE 2VYTA 4UV9B 4LF6T 4QH1A 4XTYA 2L5QA 1KHCA 2BS4A 2DILA 1CKBA 4OFZA 5HEGA 4U2ZA 1M3BA 3NFCA 1VQKT 2PUKB 5AQFB 3F57A 1B7TA 1BI3A 1GQEA 3L1AA 2VVNA 3M0QA 4DR1T 1T0HA 2BG9A 3EHRA 3P8BB 2ZAEA 5KXJA 2RPNA 3LGLA 3VUBA 4HVVA 2V8JA 2YINA 5FL0A 3CEYA 5HXEA 3JCMd 4FI5A 3MJXA 1NEKA 2W00A 5KYYA 2ZPGB 4II1A 2M6IA 3EH1A 4BE2A 4X1VA 1OULA 1RI0A 2FBWA 4EXTA 3HKSA 2Y8DA 1GXIE 2YK0A 3SEMA 2J06A 2Y48B 4LF8T 5J3BA 4F16A 4O4IE 4C92C 1N9SA 1HNWT 2F4VT 4PJOE 4BACA 1X6BA 1VQ9Q 4VUBA 3EAMA 3AVRA 5J1GA 3H0FA 2OV9A 2COYA 1I5LA 2LSYA 2NYSA 3CIRA 4FSSA 5CAIA 1IGUA 1HX1B 5L3CB 4M7AE 2FPDA 1X69A 2C0TA 1K8AU 2RNAA 4ZI2D 4JI1T 3GWHA 1ABQA 1XNQT 2BKDN 3T1HT 1S1NA 4ZTJA 5FY7A 4A97A 2JTMA 3M9QA 3R6NA 2A36A 3PIOA 3C4SA 3RC3A 5GANd 4HWHA 1VYTA 5J26A 3J80E 2I0NA 2VGNA 3TQ7P 4N0AA 1IREB 3ZBDA 4F17A 4BE1A 1N8RC 3J7AF 1KD1R 1YKEB 4A98A 2EYQA 3S6WA 3VS5A 2RM4A 3O9XA 2Q9QC 5J2UE 1LJOA 1OEDC 4YTLA 5IAYA 1E7OA 3MKDA 3PV0F 4RCBA 3G4ST 5L23A 4B6XA 3C0CA 1FEWA 1XZYA 3CCMQ 5C3JA 3CMAQ 1AWJA 5IH2A 3UQ4A 2L2PA 4C5IA 3OYZA 2KVQG 3MCAB 4QWNB 1UK5A 5H6QB 4DV2T 1Q86C 4EMKB 2GQIA 3OVUA 3HKCE 1N6AA 2VXEA 3VRZA 1AWOA 4XZCA 5GJVB 1MIVA 3CCRT 3TLVA 2XAQB 3Q5WA 3E9GA 3VUZA 2XQ9A 2FZGB 2D2SA 2CSIA 2RQWA 3ABVA 4CZZB 5KDMC 1PHTA 2DWKA 5KX5E 2HL3A 1BBZA 1VQKQ 4WBOA 2VWAA 1LPLA 2KWIB 4BUGA 2LOPA 4O4HE 2C0IA 4X9CA 3PDYA 4IE5A 4DBRA 1D0XA 3GMIA 3P7IA 2YRVA 3PVQA 1WXTA 4A53A 3HFOA 1UGOA 4CN1A 3C50A 4IHJE 5D6WA 3VR9A 2FG0A 4C8QA 3AE2A 3HP9A 4LDYA 2JQ9A 4CXYA 3X20B 1M2VA 3OS0A 2LQNA 2FJAA 1RADB 3OY9A 4UVCB 3RQUA 2J7IA 5TAOA 2E2AA 3UATA 5JDHA 2LJ1A 4IDPA 3QYHB 2VQET 2BIVA 1HS7A 4J9BA 1K1ZA 2E5KA 5FU7C 3OYYA 5L2LA 3GIBA 3HHTB 1D3BB 5CKBA 1I94T 3AE1A 3V5UA 4OB3B 4M7DG 3N9NA 3DP7A 3QOFA 2OI3A 2E65A 2ZPEB 3EDUA 3AE9A 2FJDA 5EC7A 3I55A 4H9QC 3CC4A 4M7DD 3A8HB 1UFFA 3E2UA 3VKIA 2EYZA 1M3AA 1Y96A 2DLRA 4FYWB 2WU2A 3LX7A 2R58A 3TKLB 2IIMA 2HL5C 3INZA 5DQWA 4NUVA 1SRMA 4H9PC 4H9RC 2CUDA 4ERRA 2XAHB 3N9LA 2ZPFB 3CXCP 5GAOm 3RX6A 3IBPA 2YXYA 2CZ1B 3QJ6A 4MBQA 3ZCJA 2VKHA 2JQHA 4CI2B 1NZ9A 1VQ6T 1NEGA 1HYOA 5GAN8 3G4SQ 1VQ5T 4LN2A 1M90R 2A3LA 2WACA 3K8PC 3ZJ2A 3P8HA 3RR6A 2XSAA 4DNDA 1QLYA 2Y4YA 3OB9A 1S72T 4C5GA 3EAEA 5C0MA 5AQSB 2V5DA 1AWWA 2XTLA 2QQSA 1E7PA 5GMKl 1YJWQ 1PRLC 4YJ2E 2KWHA 3RKWA 4PFOA 1FYNA 4JUYA 4DMWA 5IYZE 2MOXA 5ABHA 2K3WA 4J9CA 1M1KR 4JRIA 2X3WD 2V7IA 3ZMVB 2HQXA 3P8CD 1M1GA 1YHQT 2JVVA 3J81E 2KXCA 4HCZA 4LE9A 2BKOA 2XHEB 3CCEA 5GAOr 4TWHA 3ZC0A 5A0DA 1IJ6A 2XQ3A 2MI6A 4D8DA 3JCMW 2W2UA 1K9AA 3CXCA 3SWNC 4ASKA 1UECA 3RKGA 3SB2A 4O8SA 1VRBA 4DQ2A 3IEEA 4IGUA 2LP5A 3VRYA 3GN5A 3A8YC 4HE8A 5AQPB 1KNRA 3CMEA 4Z02A 1TOVA 2KMTA 3VS3A 5HXSA 3UU8A 3CCST 2CCQA 3I56Q 2NUZA 1BB9A 3BDLA 4P09A 5FMNA 2GCXA 5GAN3 1YJNT 2AXDS 4I0UA 1YN8A 3CCVA 5EK4A 1X6GA 2VQFT 2L3RA 4Q25A 3QDFA 3CX8B 3KV4A 3I35A 1QLBA 1ZUUA 1ZUKA 2BG9B 4HVUA 1VQ8A 4A4GA 1D09B 3EFRA 2JPFA 3UULA 2X35A 3PU3A 2RA1A 2HKQB 4PJOA 4LF4T 2FPFA 4BD3A 1WR6A 1KC8R 1WJQA 1ZBJA 4OMOA 5LJ3f 4HFCA 3CKDA 4HFHA 3N9OA 4GLMA 2QTXA 4X65T 4HKAA 4HT9A 4TX5A 4ZI3D 4M7AA 3PUWF 3RUXA 1OZ2A 1KNZA 2JMAA 1UTIA 2V8KA 3AEBA 1UGVA 4X9DA 2V5CA 4KRTA 2JOYA 2GFAA 1CSKA 3CK6A 4MHCA 4JZ3A 4ELYC 4QVZA 3L2WA 3JAFA 1WXUA 3PUGA 2V8SV 2K48A 2QK0A 1X9BA 4ORZA 1UB4A 1X43A 2DL3A 2DD4A 3KVAA 1VQ5Q 2YOEA 4JBWF 2R5MA 4XAXB 2ZPIB 4J9HA 4ILUA 2PVDB 2EYWA 2YRDA 3Q9DA 1S72Q 3OW2S 3RIAA 2DLPA 3PT9A 2LOSA 2MWPA 2M1HA 2ACXA 4BY6B 4Y92A 1YIJT 7AT1B 5LJ5e 4G2AA 1T7SA 3OYNA 1NENA 3EI0A 5HXRA 5FU6B 2MTQA 3B13A 3EGDB 3KBUA 2XK0A 2K5BB 1UE9A 5HCKA 4JS4A 1NJIC 5LJ3h 3HFNA 4M78C 1B34A 1YHQQ 4EEDA 4BI3A 4E6RA 2WDRA 3HL8A 5EK2A 1AD5A 3EH2A 5DM7R 3CC2A 3TLTA 3KBGA 2HAXA 1LCKA 4JYAT 3M58A 4WNKA 2EKHA 1U5PA 1Z0PA 4M7AG 3CCUA 1QP3A 1Y57A 4NIQA 4CRIA 3VKGA 4YHJA 4M7DB 2CPTA 1QUUA 1M30A 2E41A 3CD6T 2YUPA 3MEUA 3PTAA 1BK2A 3CWZB 4HFEA 2J47A 3DTOA 2WWVA 3W15B 2B86A 3CCSQ 4BAYB 2E9XD 4E7SA 1WXBA 1YJNQ 3VS1A 3NWIA 1YITT 5LJMA 1X79A 3H3MA 2MOZA 2O9SA 2PJQA 1PCXA 2WB5A 2MAWA 4DEYA 5CQYA 4L5GA 3J7Yq 3CCLT 2V1DB 4FT2A 3C4ZA 2EGAA 2KBTA 4MMKA 5LJ5g 1I07A 5FVKA 4NL3A 5LHGB 1OU9A 2DYBA 3A8GB 4YLHA 4QX7B 4M75C 2A37A 4XU1A 3OYAA 3HI2A 1XWMA 3ER0A 2EQKA 3UA7A 3PUYF 2IDOB 3OKQA 2OTLT 2AKKA 1D0YA 3TEEA 3N2GE 1W09A 3QKJA 3JCMQ 2XICA 4AT1B 2XAFB 2IG0A 3KBTA 5I11A 2E6ZA 2L0AA 4PK4A 4HFDA 4F04B 4Z89A 2YEVC 5ECAA 4QQDA 3PUAA 2DZCA 4P0AA 2W67A 1B07A 2XDDA 2ZPHB 3WI3A 1LRZA 3PUQA 3MP6A 3OS5A 1R77A 2CGHA 3RERA 2R57A 2PQWA 2B76A 1VQ7A 3OMGA 3UU4A 2HNIA 5GONE 2DIQA 1ZV4X 2VV5A 3QWXX 4QKNA 1YIJQ 4A63B 3EG3A 1HR0T 4YSXA 4M4ZA 5CKEA 2EQUA 2K9GA 2LQ8A 1FMWA 4JZ4A 3AE4A 5JDLA 2L89A 1OX9A 3FXDB 1RUWA 4C92F 4ATOA 1EZ3A 3LBXB 1UGSB 2AHJB 5GAMe 2K5FA 1W2BS 5I21A 2DYIA 1H641 1LKXA 5CKDA 4DBHA 4YY3T 3ANWB 1ZSZA 2VL8A 2AKLA 3HA4A 4JV5T 2DA9A 3RQWA 5CA0E 1Y71A 2DCFA 2KT1A 3CD6Q 2R5AA 3MPUB 2EJFA 5FYMA 4DR3T 1JO8A 3P50A 4MZMA 1M90U 4ZZCA 4E47A 2I0MA 2D9DA 1YITQ 1UG1A 3CQCB 5AQUB 2HZYA 3VS6A 5LJNA 1KFZA 2JMCA 5LJ5d 2BKNA 5JREA 4X64T 2CDTA 3AAAB 5DJQC 2BKPA 4QKUA 1I6ZA 2Y6XA 3AA0B 3AE5A 4KMCA 5FXVA 1T3SA 2ED1A 3UTKA 2EGCA 2QEXA 1AOJA 1MMGA 3LK3B 2H7VC 1RAGB 1QP2A 4JEHB 4LUDA 3NRXA 4IIMA 3C12A 2XIDA 4MALA 5KCOA 2JTFA 1W0BA 3VS7A 3H37A 2G3RA 5FWBA 1TU0B 2L3LA 2UXNB 3X28B 1GL5A 4EGWA 5DQVA 5LBQB 2M02A 5CJ5A 4JPBW 2MAMA 2XASB 5GAMg 2OTLQ 3V5SA 4KX6A 2EW3A 2EHOD 2SRCA 1MIWA 2KZ7B 2BDEA 5ADXL 2XHCA 4EMKA 3G71T 1OXZA 4C0DB 3ZEFB 2YUOA 3C4XA 4M1PA 5HEUA 3H6ZA 4U72A 5HCJA 1VYVA 3OYBA 4XTZA 1IZ6A 3QSUA 2EQJA 2JM8A 4BE0A 2NW7A 1O75A 1N8RR 3LGFA 1JJ2P 3QK6A 4M7AB 3RH3A 2RHYA 2L8DA 1FXXA 2DEUA 3G6EA 4E7IA 5FKYA 4DIDB 1VQPT 2E9XB 4M7DE 2KYMA 1VQLT 2RK1A 3I5SA 1KC8U 3RYCE 2ATCB 3EVYA 5IHKA 1Q86R 3M4GA 2HBPA 3OSSC 3TLUA 5LNKA 1PD0A 2RA2A 5KCHA 2YU2A 2BVLA 1EZZB 2XU8A 2BBHA 3I0OA 2BBJA 1C6VX 4OGEA 3VYGA 4IL4A 3CC7Q 3L2VA 5C2TA 1ZA1B 2KSSA 4J7FA 3QO3A 2UU9T 3AXJB 5AQKB 2ZCFB 2DF6A 4OP0A 4C5EA 4AG1C 2C5KT 4UR9A 1OOTA 5JRCA 3FRNA 1X75C 1YQ3A 2LJLA 5AQRB 1JJ2A 2E5LT 2RQRA 3UUMA 5GJWB 2K4YA 4IE6A 2VKNA 3GPLA 2X4YA 3HRTA 3PMIA 2MMPA 5J39A 1O3XA 2QA7A 4IL9A 3ZN0B 1KJWA 1XTDA 2CZ6B 5JDMA 4X20E 2ODUA 3DLLA 2NTXA 1JNRA 2W62A 4MMLA 3VS0A 3O5ZA 5GAMd 4ZI7E 2G6FX 3NZPA 1ZKEA 4EPCA 2CEAA 3JB9F 2UXCT 2XAGB 4DA4A 1HJDA 4Z91A 4ISTA 2X4JA 3REBB 2LLYA 4PAGA 4LMKA 1YI2T 2N1GA 2CBJA 5LG3A 2PVOB 1ZHIA 4I50E 3RGLA 4JLIA 2P0PA 5AQMB 4DV4T 2QQAA 1E6HA 4D8KA 4H63H 4AFUC 3G71Q 4ILBA 3PNWC 1RAFB 5FY1A 2JIWA 5FL1A 3DB4A 1KG1A 1U4QA 3OQ5A 5CCAA 2J4GA 1KHIA 3ESLA 1ABOA 1QWEA 2V7LA 1X01A 4DEXA 3UUBA 4AXPA 4EAHA 1W6XA 3URGA 5GAOn 2FVUA 5JH7E 2KRMA 1HF8A 4OMLA 1KF6A 2WMOA 3JB9I 1GCPA 1VCSA 4HA8A 4GY5A 4Z88A 1D1BA 3REAB 5AYFA 1VQPQ 4ZN1A 1BCOA 1VQLQ 3CQGB 3M53A 1PSEA 2RP4A 3EG9B 5BMVE 3TSZA 1IBLT 4BA9A 2DNXA 3CCET 5FXZA 1UCUA 2HHHT 4ME7A 4RG8A 3NTIA 5KYWA 3SFMA 5CKHA 4PFZA 4CC7A 2CHNA 2J1DG 4C92D 4DUZT 1GBQA 4FW2A 5GAN5 1JQQA 1H92A 1TH7A 3DJBA 4I4TE 4RTWA 2LJ0A 2K24A 3AEGA 1JEGA 3PTRB 2C0SA 3CCQA 4LF7T 3FC3A 4ANJA 4X34A 2EHOB 4J2CA 5LJ3j 4E7ZA 1QVGS 2X9WA 3EG1A 3VRAA 3PE0A 1BR0A 2V7MA 5GAOq 1HX8A 1YWPA 4X1YE 2DI4A 3VHLA 2OAUA 4DOVA 3D0TA 5CO7A 1VQ8T 1MIYA 4M77C 4AQFA 2FRYA 1NYGA 1ZSZB 5ETWA 3DKMA 5HK0A 1VQNA 2LCCA 1LNXA 2LTOA 1N32T 5CA1E 1FWZA 2Q9QD 3A8LB 1H3ZA 1QKWA 1HNXT 1DU2A 5JQGE 1NEBA 1SUMB 4GK0E 2VWFA 2OA5A 2F2WA 3B57A 3CQTA 5A2QE 4O5VA 2L3QA 4A4KA 1ZP0A 2PTFA 3WXMB 5J2TE 3K3NA 4H63V 2DKGA 2LNHB 1YI2Q 4X1IE 2L3PA 2Y90A 3CCLQ 3I5RA 3O1JA 5IHNA 4UELA 4F7UF 5M4YA 4YSYA 4IREA 3L39A 2K79A 4M78F 4MDWA 2R6GF 5A0LA 1TUDA 2VKOA 3HR0A 2LMJA 3QB5K 1UUSA 3OPCA 1NPRA 2XZEA 1M3CA 1G73A 4LDVA 4AMCA 3A8OB 3KFVA 4COFA 3EGDA 5HXCA 5DABA 1BYMA 3N9PA 4CI1B 1UJYA 4QH5A 3QWYA 1K76A 4UF0B 1QSDA 3H3AA 1OU8A 8ATCB 4E2FB 1ZEEA 1FIOA 1N5ZA 2PBIA 3MP1A 2CH4W 5GMKj 3RRCA 4XTVA 2BS2A 4J7IA 1NBEB 5I22A 4FU6A 2YN6A 2E3HA 4M7DA 4CQIA 2VVKA 3CC2T 2YDQA 3CCEQ 2J05A 3ZKRA 3CBMA 4GBQA 2KSRA 1RLPC 3A5XA 1Y0MA 4OMFB 3TCJA 1UHFA 2HN2A 1YP5A 4JJDA 3L42A 3ZLIA 2GNCA 2XSBA 3SFDA 4PK6A 1NJIR 2JW4A 3PFSA 4HGAA 2PZ1A 4WW0A 4J6XA 3A98A 5KYNA 2AZVA 1UGQB 4N78D 2WDVA 1XNRT 5AQIB 3RIFA 3AE6A 3SHWA 1N8RU 2QDLA 3TVTA 3TLWA 1E1HB 4LMLA 4JJCA 1B3QA 4JRPA 2OJ2A 4C0GA 4Z8XA 1VQ8Q 2EVRA 2PFVA 2YLBA 2HBWA 2LC4A 1UGPB 2WDQA 2O2OA 4NS5A 4YTPA 4EZ4A 2BG9C 2QQRA 3L09A 2JUFA 4DV6T 2ZMAA 5DY9A 3CCJA 1Q86U 1US7B 5JRCB 1X27A 1RAAB 2DBKA 2MYSA 2XQ5A 4L59A 3L2RA 1W4SA 3JB9D 2OAWA 3ME9A 3Q5DA 3SFEA 3NGPA 1RAHB 2HQEA 4B6MA 1I81A 4E7KA 1EIFA 3DB3A 2V7JA 1RABB 1V9DA 2DWGA 2DPPB 4O4LE 2D5UA 2CRBA 1FJGT 1YXRA 4UIGA 4CI3B 3EGUA 2LZ6B 5JR9A 2X67A 2RI3A 3E22E 3G06A 2K9AA 3CBOA 5HEJA 2QA4A 4ILCA 1A0NB 2NR4A 1BR4A 2O4XA 3V8LA 1VQ9A 1PRMC 1DJ7B 3S3NA 4DO0A 5GANj 2HEQA 3LBXA 2DO3A 3LW5E 2DVJA 5IHIA 4A4FA 1SHGA 4N0AC 3EUHA 2CSQA 5FROA 1R0CB 1JXMA 3ANWA 1TXQA 2ABLA 2AK5A 3CCRQ 3JAEA 3MK7C 2EKOA 3OYKA 3O1IA 3OS1A 3JCMV 2V26A 3JC6C 4C0FA 1XMQT 3CC2Q 2K2MA 3X24B 3KUFA 2D0UA 2X66A 4DBQA 1XNIA 3G1JA 1CHUA 2D0TA 1JRIA 2F5TX 3BW1A 4AG2C 2Q9QB 2CLYC 3ZSSA 4HCCA 4UXNB 3KDSE 4RTXA 1XDOA 3MXZA 1WDXA 3AT1B 3QC9A 4X66T 1AWXA 1MNEA 1Y01A 4NOYA 1Z8UA 2KR3A 2KE9A 2VVSA 1ZQ1A 3PGGA 3CMAA 3M4YA 2LKHA 2XQ8A 2K57A 2DZ9A 5CVIA 5JDGA 5LOVE 4CC3A 2YUNA 2IIUA 2OLTA 1RAIB 3OBVE 5KYWB 1I1JA 2CHOA 1HNZT 2KXDA 4CI0C 2DL5A 2NW8A 3JCMJ 3RIUA 1W1FA 4ADZA 2OTJT 2O01E 1IB8A 4HWFA 4FIBA 2J62A 3V7RA 5GAN2 3LK42 2HPJA 3AE3A 3RPUA 2JNGA 3LH0A 4KBMB 4KH1B 2DETA 2YRCA 1SKUB 1Q7YR 1VQKA 1N33T 2P4RA 4OB0B 4C8QC 1GFCA 1YW0A 2CUBA 4K0UA 1AT1B 2V8IA 4NXNT 1U5SA 4K11A 3TU4K 3V8KA 4AI6A 2MIOA 4F7UG 4PNIA 4P1NA 4U7YA 3NPFA 2HDAA 4DR5T 2QASA 4XU2A 4B3RT 2DJZA 2O88A 4M78G 2HQHA 2HD0A 2DRKA 2ZZDA 4AIUA 2D8JA 3T1YT 2E5QA 2E9XA 2M0OA 4M78D 5LL6S 5FU7B 4D6WA 1SA0E 2V7KA 1D1AA 1T0JA 3I0QA 3TLSA 5HKCA 1T98A 2E10A 1MNDA 1VQ6Q 4IDZA 2WZIA 3ZMUB 2WP9A 4KGVB 3HSBA 4FT4A 5I2SA 1TS9A 1IHWA 2CT4A 5LHIB 2HCKA 4U2YA 3OSVA 2WCAA 3AXJA 5AQNB 2XQ6A 1W0AA 2KLQA 2VKJA 4R55A 4B9WA 3F31A 2M6BA 3JB9H 3BFMA 3VKHA 1EFNA 2JMHA 2KQWA 2MCNA 2NUPA 1ZLMA 2CP3A 4KT0E 1WHJA 3OW2P 2K7AA 1IBKT 3BQIA 3P4WA 2FB7A 1PSFA 3LWIA 2LHNA 1TUCA 4ZI3C 3J9X1 1V29B 4IUUA 2KRNA 5F3JA 4JRKA 1NM7A 2RJEA 1WFDA 3A7MA 2RK2A 1EX4A 2CXFA 4XK8E 1YJ9T 1YJWA 4YHHT 4J8OA 1G3TA 2KEAA 1K73C 8AT1B 5FLXE 4X1KE 2V1RA 2CXDA 2OTJQ 3FB9A 1QVPA 4OYKA 5LGUB 1ARKA 1AHJB 1WCRA 3ZJ1A 4C92E 4JUVA 4Z90A 5FWCA 1NAFA 3UFEA 3LG7A 2EBPA 3SWNB 4J9IA 2Z0WA 1WGSA 4HWIB 3ZMZB 1UUEA 1VQMA 2X4XA 4BI4A 4DR6T 1VQ4T 1AVZC 5GMKm 1TSFA 3JAME 2VC8A 3HRSA 3RYIE 1BR1A 3CPWS 1JU5C 3V7CA 2XQAA 1NJIU 3HKDE 4QH4A 1WNLA 1MMNA 2FJEA 3I56A 3LDQB 4PJOC 1N27A 5GAN6 3PVLA 5GMKh 3QUJA 3EG9A 1IBMT 3OA6A 2L9QA 1I4K1 2CH4A 3RIRA 3UU6A 5FXXA 4FL6A 1OEDE 3ZYKA 1XJWB 4HFIA 2RF0A 3FDRA 3H0IA 3JCMf 2JRKA 2YT6A 1AZGB 4M7AC 5LP6E 3OYIA 4F14A 2ES0A 1HK9A 2AIRB 2GTOA 2NOXA 2Z6EA 3RBBB 1MMAA 3MA9A 4JI7T 2KROA 1K73U 5LG4A 4E7LA 2KRSA 4WYVA 1KSWA 5DLOA 4N4HA 5D6XA 2GFUA 2ZLYA 5CKFA 2ZM0A 4WZXA 4JI0T 2KI7A 1YQ4A 5JR9B 3LK2B 2EJGA 2EHOA 4IIOA 4M77F 4GKJT 2LDMA 2A9UA 1K9MC 3Q1JA 4C91A 2MK5A 3OYCA 2O4XB 3AA1B 5LGNB 2XMFA 4O2BE 1NLOC 2JQKA 2DAQA 1PM3A 2WSFE 3BE3A 4ZGEB 1KQSS 2CZ7B 3ONJA 2G0UA 2N9DA 1GCQA 3THKA 3FZLB 2DX1A 1HG5A 5GANf 4I43B 3CX7B 4JLEA 5LMUT 4OMPA 3V8JA 4G63A 1X6OA 2DXTA 4YFSA 2E64A 2X0LB 2VASA 2NTYA 1VQOA 1OWAA 2SPCA 2LM2A 3WVDB 4F7UB 2ROTA 3JCMh 4BJNA 4XQ3A 3JB9J 1YJ9Q 3HPWA 3M5AA 1M8MA 5EG2A 3ONXA 2DNUA 3C95A 5L4HA 4M78B 5CFBA 3AHUA 2AZSA 4N4IA 2LQWA 1W2BP 4L9IA 3OYGA 2W0ZA 1N34T 3FJ5A 5HEHA 3BQLA 2KDSA 1Q7YC 3FZKB 1YHQA 5FRNA 2W4XA 4QXHB 5LJ3g 3M0RA 4R56A 1WPYA 2WWUA 4PJLA 3EHZA 4KH0B 1ZX6A 1SPKA 2DEQA 3QIIA 2M67A 1V1CA 4GIWA 4EIKA 2XJ7A 3MZKB 1VQ4Q 1NYFA 2WZHA 2JXBA 3JCMP 3GOXA 1QVFS 4IE0A 1NE8A 1KIKA 4DV5T 3H9NA 4YXDA 3ZSTA 2FRWA 3QHSA 2CMRA 4H9NC 4UF0A 3I1AA 5KMGP 1GRIA 4DOWA 4HKEA 3SWHA 1WHGA 4IKFA 2YDSA 3FXEB 2GK9A 4AKHA 3U23A 5GANh 1YJNA 3AE8A 4LDUA 1M62A 3ZCIA 2JQQA 3QXEB 1OPLA 2C0OA 1IRXA 4J9DA 2MWOA 1W2BA 2LSJA 4KULA 1HFAA 3EG2A 3SD4A 1KNPA 2B1EA 1XDPA 4LXCA 2JS2A 3F2EA 5AT1B 2DL7A 4IIJE 2W63A 2VKDA 2X9HA 3OBYA 2XY8B 5L3BB 5JDNA 3VJPA 4ZS2A 2H3JA 4FM4B 1Q7YU 2JM9A 2X68A 4JI4T 2DBMA 3ZMTB 4F8HA 2KYBA 1PD1A 4TVRA 1WA7A 1X2QA 2BZ8A 4EEBA 2KINB 3I9WA 5BR8T 3ZPOA 1PKSA 4U31A 1RACB 2GTJA 3RDVA 4R0KA 4MZPA 5ABGA 2IUBA 2CWOA 2EPDA 3UT5E 5A0GA 2DL8A 2JTEA 5IXFA 5FY0A 5KE3A 3NMZC 3L2ZA 3UF4A 2JN0A 2MBGA 2L3SA 2FUPA 5JDFA 4HCBA 4P5NA 4J5YA 4Y91A 5GAN4 3C51A 4TZ4C 3QUIA 1UX4A 2X51A 4X5TA 1PG5B 4DV7T 3CBPA 3NTKA 2KK4A 3MP8A 3AE7A 2PNIA 3O8VA 3LH5A 5LJ3d 4XTWA 1YIJA 2NUPB 3PURA 5AQVB 1BKBA 1U1TA 3CCJT 3A1PA 3BK9A 3N9MA 1M4ZA 1ZSZC 1V76A 4J6WA 3VS2A 4TNWA 4HN9A 3L8RA 4WBNE 5EK3A 4EB6E 1IO6A 3C64A 2QQ9A 2L8KA 4C92A 3EFOB 4LNPA 4PJMA 2SEMA 3I55T 1XMOT 5KYUA 3VU7H 3CC4T 5LJ5j 2CM0A 4LF5T 2CT3A 3K1SA 1YFNA 3CD6A 2E4HA 1Q81C 4CXXA 1WLPB 2X4WA 3PUZF 2JMKA 4QQ6A 4EIWA 1SHFA 3JCMg 3U78A 5HY6A 4NL2A 2QA4T 2CKKA 4IE7A 1JXOA 3M59A 4PLLA 2ZGWA 4JI6T 4LUEA 5LMNT 1UHCA 4JRQA 3CCLA 1FX7A 4JS5A 4HFVA 4E7HA 4DMVA 1HD3A 4LDXA 1J5ET 2Q9QA 3RMQA 1OEDA 1GFDA 2DXBA 1BR2A 4FW1A 2FEIA 4V2SA 2LVMA 3V7SA 4EMKC 1QW1A 3ONLC 3PJAA 1KEYA 4AFSC 1R0BG 2RD1A 3AA7B 1HCIA 2QXFA 2K3BA 2UXDT 2JT4A 2WSEE 4M77G 2DE0X 4F7UE 4A54A 3BQKA 2P0KA 3L2QA 1JNZA 5HWYA 3QJYA 2IAKA 4M77D 4C92G 4M78E 4A4EA 4C90A 2A08A 2MF2A 3META 1I0CA 1OYXA 5J0ZA 2KNDA 2CP2A 3RC8A 2JS0A 2QYZA 2D6FA 3CMAT 2EYXA 3GA8A 2EAYA 2A72A 1SRLA 2ZPBB 4C8QF 3KFWX 3QDRB 1RI9A 1E2AA 2K3XA 5C6SA 3CMET 1M9SA 1MMDA 4LF9T 4JI2T 3MO8A 2FJBA 2FPEA 3EGXA 3ZT7A 4GLKA 2P0QA 4RMOA 1K8AC 3CCVT 1RLQC 2RJDA 3E0ZA 3O4XE 4A4HA 2K3YA 4XU0A 4RCCA 2J6OA 4ZTFA 2CYZB 5FXWA 2W61A 1QCNA 3QBYA 3CCJQ 1SE7A 4KP3C 5AQTB 2WSSV 3WAKA 5D7UA 5GAOl 2F5KA 1NWMX 2WM9A 2UUBT 2H3RA 4J6YA 2P4TA 2Y4XA 2DXCA 3F70A 2LEHA 1K0SA 3UA6A 1MUZA 1X2KA 3CC7A 2XUEA 1QVGP 4BJMA 4FCYA 1CUNA 2ODVA 3I55Q 4IDOA 1OPKA 2HMAA 3CC4Q 4M75E 5GAN7 1Z9ZA 3N5LA 1HG2A 5IUXA 1ACMB 4AISA 2LX9A 1BI0A 3H0HA 3JADA 4LD6A 3ZMSB 1T3LA 3KVBA 1QMCA 5CIUA 5KH6A 5GAOp 5I2MA 1ZA2B 3RESA 3X1DA 1JBMA 5GAMj 2F2XA 2QA4Q 2NP9A 3QG1A 3E19A 3KV9A 3M56A 4DBFA 2WMNA 4FYYB 3OYJA 2GGRA 3AEFA 2MPKA 2K2VA 1RAEB 2CP5A 1T72A 2OX7A 2LM9A 3MEAA 4RTTA 1J1JA 2IC9A 3ETUA 2COWA 3RMSA 1Q82C 4QHOA 4QVCA 4EYYR 1YNZA 3TREA 1UJ0A 3U3IA 2E3IA 2XG8D 2J6FA 4RG2A 3K3OA 4DR7T 3HL6A 1HXDA 2XI9A 3A5ZB 4FSXA 4PKCC 4KGXB 2YDLA 1QVGA 3FIFA 1J3TA 2HKNA 1YCYA 1WRDA 4AKIA 1T8BA 4TV8E 3I9YA 4JI5T 1AZEA 1MV0B 3M57A 3VRBA 3G71A 2ACZA 4KHPT 3GNGA 3RHWA 4DVDA 4L6V5 2YHTA 4RTYA 5IT9E 2HN1A 1VOMA 3CCUT 2CP7A 3IHRA 2DTOA 2DL1A 2LX7A 3ZEHA 3K3QC 2ZM6T 2A28A 3HKBE 1LVKA 4M75F 3ETVA 1NG2A 4UEMA 2FZKB 2LCLA 2X3XD 5HWXA 5L8RE 3CMEQ 4ZI2C 2QGGA 2M9UA 1YJWT 4HVWA 5AFUL 3SWNA 1ZUYA 1H7CA 2BZBA 2C5IT 1M2OA 2PG8A 1HSQA 2DTIA 1L0VA 1VQPA 3CCVQ 2XQ7A 3UFGA 1VQLA 3CPFA 2M0YA 4ZGDB 2HH7A 3HKEE 3QB5A 2WU5A 3S3OA 2WSCE 4PJOF 3NVOA 3HRUA 2E1HA 3R6OA 5AQGB 1LVFA 1Q82U 2PTKA 4F6RC 3RKOA 3IA3A 3BDUA 4ISSA 1K73R 3OYXA 1VQMT 1BIBA 4M7AF 4TUYE 1FMKA 4BDZA 2FL7A 3JB9G 1PWTA 2RB6A 1XQHA 1QCFA 1Y7XA 2LSKA 4ELZC 4ZHQE 1QQJA 3I56T 2WQYA 3UT1A 4AQFC 2IVWA 2MPXC 4I55E 3AAEB 4DV1T 3NHNA 5ABFA 5IWAT 1AEYA 4M77B 3JCMb 4BB7A 3JC6D 1S94A 2KMFA 4AFZC 4EMGA 3OYHA 3VR8A 1CKAA 2AT1B 4C92B 2EYYA 4IT4A 3E08A 2X9YA 2QGSA 4HWDA 4HWCA 2NUTB 4ILAA 4KGZB 5ABEA 1YD8G 4QXCB 2X0HA 5KYUB 1P92A 3CXCS 5AQLB 2AE9A 2UUCT 2CP0A 1BU1A 2DD5A 1OV3A 1Z9QA 2RQVA 4A56A 2K6DA 4HCKA 1VQ7T 4HT8A 3ASKA 5HCMA 2DFUA 2P9BA 1WI7A 5LHHB 3UUNA 2E70A 5LJ5f 5CK9A 4PL6A 4CC2A 2QGFB 1M7KA 4UVBB 1YBYA 1JB0E 3N2OA 4AKGA 3M55A 1YI2A 1TTHB 3E1SA 2H7OA 4AQGA 2RHZA 1PC0A 1KFYA 2DVEA 4BY6C 3VYHB 3HTRA 2J6KA 1NPPA 4IDQA 1ZBXA 1YCSB 4ZXLA 5FU6C 2RHXA 4J9GA 4LFAT 5L3FB 3PMTA 4HFBA 4F7UA 1N36T 1OEDB 4PK5A 2F2VA 3CCUQ 2RPAA 4JI3T 2X0YA 4M78A 1VIEA 2DIGA 4C8QG 1K9MR 3RYFE 1RL2A 4NUUA 4WCIA 5IHYA 1VQOT 1WLXA 5GMKi 2K5IA 2HSPA 4C8QD 3LLRA 3CCMA 4M7DC 3IQLA 4NPPA 3QZ9B 3EHQA 5CGMA 2DXUA 1ZSGA 4RTUA 1C1AA 3P4PA 5KE2A 4HTEA 1D1CA 1MHNA 1R8OB 2C5JA 1BI2A 2NLUA 4MZTA 3SOLA 2QEXT 2XQYA 4TV9E 2RI5A 5LJ5h 4K0KT 2DM1A 1G2BA 4IURA 2EFIA 2LQKA 2E5VA 2RMOA 2XQ4A 3UU5A 5LBMA 4JJNK 4EZHA 4GYRA 2LRLA 2COZA 1VQMQ 3EGXB
chains in the Genus database with same CATH topology
2KXPB 3Q5XA 3JSCA 4H9OC 3JCMX 3L3PA 3KXTA 2HPLA 4M75A 2E6NA 3L2UA 1M8VA 2PU9B 4XTUA 3H8ZA 4PJNA 1BI1A 5CR2A 4QX8B 4IUPA 2LNVA 4EYUA 4IUVA 4ZGJB 5HAXA 4H9SE 3FHNA 2PUOB 4EDUA 3G6ET 3MACA 4B9XA 5L3EB 3QZ5B 3LFMA 3GF5A 3RYHE 1KD1C 3R84B 1KK7A 2RJCA 3FJPA 2XDBA 2M16A 4V1Av 3GNFB 4EOZB 3MEWA 5JR9C 3CVRA 2K5LA 2BVMA 5GAMf 3CQXC 4P0BA 4PW8A 2RI2A 2LHRA 1WYCA 2KT9A 2ZM8A 2RO0A 1Y64B 3X26B 3Q2MA 2VK9A 5LYJE 4OF1A 1OZ3A 1N9RA 3SDZA 3UUXB 4M75G 4GK5E 2E8IA 3G4SA 2PVGB 4M75D 3FBZA 2JJ9A 1LOJA 2DHRA 1G8XA 4JLGA 3OYDA 1WQWA 2RHIA 3CCRA 3EFSA 2WAUA 5EZYE 3AA6B 4PJOG 2CLYB 4M77E 4PJOD 3CMLA 2QQBA 1KD1U 2JZ2A 5GAMh 1G3YA 4OHFA 4M7AD 3A8MB 4OYJA 2VXFA 2KY9A 4BDYA 3CPZA 4BI8B 2CWYA 3OW2A 4PNOA 2NWBA 1U8RA 5C8YE 5E0OA 3OYEA 1S35A 3MHXA 2LT1A 3GLXA 1G3WA 4C0DC 2N2NA 2I59A 4O2AE 3ZFJA 2CZ0B 3EDVA 3N2KE 3NTHA 3OYMA 5D6YA 4C8QB 4JDSA 1OI1A 2UXXB 3N9QA 1UX5A 5L3DB 3NBXX 2F69A 2CA5A 3UWNA 1M1FA 1XOVA 2E9XC 3C98B 3JRZA 5LJ3e 1M90C 4QW2A 1YKHB 3T9NA 4JEUB 3P8DA 4TN7B 4OK0A 3FB2A 2NW9A 2LSGA 2FHDA 4IUQA 2DK3A 3NRYA 3LYIA 3C4WA 4XTXA 4GYSA 3CCQT 3DLMA 4LD9K 1Y96B 4ZOLE 3AVSA 3AAIA 1M1KC 1VQ6A 4IE4A 2EJ9A 1VQ5A 2QDYB 3WVEB 4C0ZA 4QVDA 1S72A 2VUBA 3N5BB 3LJCA 3CPWA 3PIPA 2LRQA 4QXBB 1VQNT 3RKXA 5IN1A 3CC7T 2GF7A 4AKRB 1I8FA 4WF2A 2XDPA 4HEAA 2A3DA 3FBLA 2DTHA 5FP3A 1WJRA 4O4JE 3BY7A 2CS7A 4KUIA 5FRMA 3ZYMA 4OVAA 1VIFA 4O6JA 3KV5A 4L0RA 4FJOA 3S4UA 2KAFA 1K9MU 4Q5WA 3VV0A 3JCMc 5GMKe 1SSFA 3NZQA 4OB1B 3OMCA 3CCSA 1KC8C 1VUBA 1M1KU 2YU1A 2OTJA 2W0GA 2C06A 3GN5B 2X9XA 3ZYLA 2D9TA 3MEVA 3CX6B 3X25B 4RKUE 3KV6A 1KQSA 4M75B 3ZN1B 2RHUA 4GOUA 1UEBA 1KQ1A 2RJFA 2EIFA 4OB2B 1JJ2S 3OYFA 4MLKA 1WQ7A 3PU8A 2A7YA 4UVAB 5HXHA 3LWHA 4QQGA 5M9OA 2LSIA 2BUDA 4PJOB 4UV8B 2LE8A 3PUSA 2B8AA 5LGTB 4KUMB 5L3GB 1Y07A 3C94A 3O1HA 5HK3A 3SRZA 4Y28E 4E7JA 1AJ3A 3M65A 3JCMe 4MDXA 5CQXA 2XD0A 2GQVA 2EHOC 1QVFA 4YJ3E 2CE7A 4PJJA 5FNVE 4CXWA 3FLGA 2ZM2A 4XU3A 1UGRB 1IJ5A 1O9SA 5H6RB 1BIAA 5HYAA 3WAJA 1U1SA 3S3MA 2IC6A 4M77A 3GP8A 4LDWA 2EWNA 1WYBA 1SHZC 4C8QE 1D3BA 3IF8B 5LA6E 2LT3A 1B34B 3UDCA 5GANe 1FMVA 3ZC1A 4ZS3A 5JVDE 4OGCA 2LT4A 2IW5B 2D0QB 3OS2A 1MGQA 3UPUA 1YJ9A 3RRWA 4IUTA 5CB4E 1KQ2A 4AKLA 1YITA 4U74A 3VU3C 2EQMA 2YLCA 2VB6A 1HTJF 1VQ9T 2E12A 3SS1A 3RKYA 3QYGB 3AB3B 5F8PA 4MFRA 1IZNB 5LXTE 2I2LA 4PLIA 4M7DF 2WBLA 4PFPA 2XAJB 2RH2A 3M54A 1VQ4A 5A1LA 2A2FX 5LCYA 1WJSA 2OTLA 2CXLA 3E9FA 4C5HA 3G7ZA 4N4GA 3OYLA 3QPHA 1IAPA 1G3SA 5GANg 2QI2A 3OJAA 4KUDK 4XBFB 3CCMT 1ZHCA 3T8OA 2XKOC 1Q81U 4UC4A 2FYKA 3FEOA 4EMHA 5JDQA 3OBWA 4ZN3A 1G5VA 1D0ZA 3KINB 4J83A 1M5Q1 5DLQE 2VGMA 2VYTA 4UV9B 4XTYA 2L5QA 1KHCA 4OFZA 3NFCA 1VQKT 2PUKB 3F57A 1B7TA 1BI3A 3L1AA 3P8BB 3LGLA 3VUBA 2V8JA 2YINA 3CEYA 5HXEA 3JCMd 4FI5A 3MJXA 2W00A 2ZPGB 4II1A 4BE2A 1RI0A 4EXTA 3HKSA 2Y8DA 1GXIE 2YK0A 2Y48B 5J3BA 4O4IE 4C92C 1N9SA 4PJOE 4BACA 4VUBA 3AVRA 5J1GA 1I5LA 2LSYA 5CAIA 5L3CB 4M7AE 1K8AU 4ZI2D 3GWHA 2BKDN 4ZTJA 5FY7A 2JTMA 3M9QA 3R6NA 3PIOA 3C4SA 3RC3A 5GANd 5J26A 3J80E 2VGNA 4N0AA 1IREB 3ZBDA 3J7AF 4BE1A 1N8RC 1YKEB 2EYQA 3S6WA 2RM4A 3O9XA 2Q9QC 5J2UE 1LJOA 4YTLA 5IAYA 3MKDA 4RCBA 3G4ST 4B6XA 1FEWA 4C5IA 3OYZA 2KVQG 3MCAB 4QWNB 5H6QB 1Q86C 4EMKB 3HKCE 1N6AA 2VXEA 4XZCA 3CCRT 1MIVA 2XAQB 3Q5WA 3E9GA 3VUZA 2D2SA 4CZZB 5KDMC 2DWKA 5KX5E 4WBOA 2VWAA 2KWIB 4BUGA 2LOPA 4O4HE 4X9CA 3PDYA 4IE5A 4DBRA 1D0XA 3GMIA 3P7IA 2YRVA 4A53A 3HFOA 3C50A 4IHJE 5D6WA 4C8QA 3HP9A 4LDYA 3X20B 4CXYA 3OS0A 3OY9A 4UVCB 5TAOA 5JDHA 3QYHB 2BIVA 1HS7A 5FU7C 3OYYA 5L2LA 3GIBA 3HHTB 1D3BB 5CKBA 3V5UA 4OB3B 4M7DG 3N9NA 3DP7A 2E65A 2ZPEB 3EDUA 3I55A 4H9QC 3CC4A 4M7DD 3A8HB 3VKIA 1Y96A 2DLRA 3LX7A 2R58A 3TKLB 3INZA 5DQWA 4NUVA 4H9PC 4H9RC 4ERRA 2XAHB 3N9LA 2ZPFB 5GAOm 3RX6A 3IBPA 2CZ1B 3QJ6A 4MBQA 3ZCJA 2VKHA 4CI2B 1NZ9A 1VQ6T 5GAN8 1VQ5T 2A3LA 2WACA 3K8PC 3ZJ2A 3P8HA 4DNDA 2Y4YA 3OB9A 1S72T 4C5GA 3EAEA 5C0MA 2XTLA 2QQSA 5GMKl 4YJ2E 2KWHA 3RKWA 4PFOA 4JUYA 4DMWA 5IYZE 4JRIA 2V7IA 3ZMVB 2HQXA 3P8CD 1M1GA 1YHQT 2JVVA 3J81E 4HCZA 2XHEB 3CCEA 5GAOr 3ZC0A 5A0DA 1IJ6A 2MI6A 3JCMW 3CXCA 3SWNC 4ASKA 3SB2A 4O8SA 1VRBA 4DQ2A 3IEEA 4IGUA 3GN5A 4HE8A 3CMEA 4Z02A 2KMTA 5HXSA 3CCST 2CCQA 3BDLA 4P09A 5FMNA 2GCXA 5GAN3 1YJNT 3CCVA 5EK4A 2L3RA 3CX8B 3KV4A 1VQ8A 4A4GA 3EFRA 2JPFA 3UULA 2X35A 3PU3A 2RA1A 4PJOA 4BD3A 1WR6A 1WJQA 5LJ3f 3CKDA 3N9OA 2QTXA 4HKAA 4HT9A 4TX5A 4ZI3D 4M7AA 3RUXA 1OZ2A 1KNZA 2V8KA 4X9DA 2JOYA 2GFAA 4MHCA 4ELYC 4QVZA 3L2WA 3PUGA 2K48A 1UB4A 2DD4A 3KVAA 2R5MA 4XAXB 2ZPIB 4ILUA 2PVDB 3Q9DA 3OW2S 3PT9A 2LOSA 2MWPA 2M1HA 2ACXA 4BY6B 1YIJT 5LJ5e 4G2AA 3OYNA 5HXRA 5FU6B 3B13A 2MTQA 3KBUA 2XK0A 2K5BB 4JS4A 1NJIC 5LJ3h 3HFNA 4M78C 1B34A 4BI3A 3HL8A 5EK2A 5DM7R 3CC2A 3KBGA 2HAXA 3M58A 4WNKA 1U5PA 1Z0PA 4M7AG 3CCUA 1QP3A 4CRIA 3VKGA 4YHJA 4M7DB 1QUUA 2E41A 3CD6T 3PTAA 3MEUA 3CWZB 3DTOA 3W15B 4BAYB 2E9XD 4E7SA 1YITT 5LJMA 1X79A 2MOZA 2PJQA 5CQYA 4L5GA 3J7Yq 3CCLT 2V1DB 4FT2A 3C4ZA 4MMKA 5LJ5g 4NL3A 5LHGB 3A8GB 4M75C 4YLHA 4QX7B 4XU1A 3OYAA 3HI2A 3ER0A 2EQKA 3OKQA 2OTLT 1D0YA 3TEEA 3N2GE 3QKJA 3JCMQ 2XICA 2XAFB 2IG0A 3KBTA 2E6ZA 4PK4A 2YEVC 4QQDA 3PUAA 2DZCA 4P0AA 2XDDA 2ZPHB 3WI3A 1LRZA 3PUQA 3MP6A 3OS5A 2CGHA 3RERA 2R57A 2PQWA 1VQ7A 3OMGA 2HNIA 5GONE 2DIQA 1ZV4X 2VV5A 4QKNA 5CKEA 2EQUA 2LQ8A 1FMWA 5JDLA 2L89A 3FXDB 4C92F 4ATOA 1EZ3A 3LBXB 1UGSB 2AHJB 5GAMe 2K5FA 1W2BS 5I21A 1H641 1LKXA 5CKDA 3ANWB 2VL8A 3HA4A 5CA0E 1Y71A 2DCFA 2R5AA 2EJFA 5FYMA 4MZMA 1M90U 4E47A 3CQCB 5LJNA 5LJ5d 5JREA 3AAAB 5DJQC 2Y6XA 3AA0B 4KMCA 5FXVA 2QEXA 3UTKA 1MMGA 3LK3B 2H7VC 1QP2A 4JEHB 3NRXA 3C12A 2XIDA 4MALA 5KCOA 2JTFA 3H37A 2G3RA 2L3LA 2UXNB 3X28B 5DQVA 5LBQB 2MAMA 2XASB 5GAMg 3V5SA 2EHOD 1MIWA 2KZ7B 2BDEA 5ADXL 2XHCA 4EMKA 3G71T 1OXZA 4C0DB 3ZEFB 3C4XA 4M1PA 3H6ZA 4U72A 3OYBA 4XTZA 1IZ6A 3QSUA 2EQJA 4BE0A 2NW7A 1O75A 3LGFA 3QK6A 4M7AB 3RH3A 2RHYA 2L8DA 1FXXA 3G6EA 4E7IA 1VQPT 2E9XB 4M7DE 1VQLT 2RK1A 1KC8U 3RYCE 3EVYA 3M4GA 2HBPA 3OSSC 5LNKA 2RA2A 5KCHA 2YU2A 2BVLA 2XU8A 3I0OA 4OGEA 3VYGA 3L2VA 2KSSA 4J7FA 3QO3A 2ZCFB 4OP0A 4C5EA 2C5KT 5JRCA 3FRNA 1X75C 2LJLA 1JJ2A 3UUMA 2K4YA 4IE6A 3GPLA 2X4YA 3HRTA 3PMIA 2MMPA 5J39A 1O3XA 2QA7A 3ZN0B 1XTDA 2CZ6B 5JDMA 4X20E 2ODUA 3DLLA 2NTXA 4MMLA 2W62A 5GAMd 4ZI7E 3NZPA 1ZKEA 4EPCA 2CEAA 3JB9F 2XAGB 4DA4A 4ISTA 2X4JA 4PAGA 1YI2T 2N1GA 2PVOB 1ZHIA 4I50E 4JLIA 2P0PA 2QQAA 4H63H 3PNWC 5FY1A 3DB4A 1KG1A 1U4QA 3OQ5A 5CCAA 1KHIA 3ESLA 2V7LA 1X01A 4AXPA 4EAHA 3URGA 5GAOn 2FVUA 5JH7E 1HF8A 2WMOA 3JB9I 4HA8A 4GY5A 1D1BA 5AYFA 4ZN1A 3CQGB 3M53A 1PSEA 2RP4A 5BMVE 4BA9A 2DNXA 3CCET 5FXZA 1UCUA 4ME7A 4RG8A 3NTIA 3SFMA 5CKHA 2J1DG 4C92D 5GAN5 1TH7A 3DJBA 4I4TE 2K24A 3PTRB 2C0SA 3CCQA 3FC3A 4ANJA 4X34A 2EHOB 4J2CA 5LJ3j 4E7ZA 1QVGS 2X9WA 3PE0A 1BR0A 2V7MA 5GAOq 1HX8A 4X1YE 2DI4A 3VHLA 2OAUA 4DOVA 3D0TA 5CO7A 1VQ8T 1MIYA 4M77C 4AQFA 5ETWA 3DKMA 5HK0A 1VQNA 2LCCA 1LNXA 2LTOA 5CA1E 1FWZA 2Q9QD 3A8LB 1H3ZA 5JQGE 4GK0E 2OA5A 3B57A 5A2QE 4O5VA 4A4KA 3WXMB 5J2TE 3K3NA 4H63V 2DKGA 4X1IE 2Y90A 3O1JA 4UELA 4F7UF 5M4YA 4M78F 4MDWA 5A0LA 2VKOA 3HR0A 1NPRA 1G73A 4LDVA 3A8OB 5HXCA 5DABA 1BYMA 3N9PA 4CI1B 4UF0B 1QSDA 3H3AA 1ZEEA 1FIOA 2PBIA 3MP1A 5GMKj 3RRCA 4XTVA 4J7IA 4FU6A 4M7DA 4CQIA 3CC2T 3CBMA 3A5XA 4OMFB 3TCJA 3L42A 3ZLIA 4PK6A 3PFSA 4HGAA 4WW0A 4J6XA 1UGQB 4N78D 1N8RU 1E1HB 4JRPA 4C0GA 4Z8XA 2PFVA 2YLBA 2LC4A 1UGPB 4NS5A 4EZ4A 2QQRA 3L09A 2JUFA 3CCJA 2ZMAA 5DY9A 1Q86U 1US7B 5JRCB 2MYSA 4L59A 3L2RA 1W4SA 3JB9D 3ME9A 4E7KA 2HQEA 1I81A 1EIFA 3DB3A 2V7JA 1V9DA 2DWGA 2DPPB 4O4LE 2D5UA 4UIGA 4CI3B 5JR9A 2X67A 2RI3A 3E22E 3CBOA 2K9AA 2QA4A 1BR4A 2O4XA 3V8LA 1VQ9A 1DJ7B 3S3NA 4DO0A 5GANj 3LBXA 2DO3A 3LW5E 4A4FA 4N0AC 3EUHA 5FROA 3ANWA 3MK7C 2EKOA 3OYKA 3O1IA 3OS1A 3JCMV 2V26A 3JC6C 4C0FA 3X24B 3KUFA 2D0UA 2X66A 4DBQA 1XNIA 2D0TA 1JRIA 2F5TX 3BW1A 2Q9QB 2CLYC 4HCCA 4UXNB 3KDSE 3MXZA 3QC9A 1MNEA 4NOYA 1ZQ1A 3PGGA 3CMAA 3M4YA 2K57A 2DZ9A 5CVIA 5JDGA 5LOVE 3OBVE 4CI0C 2NW8A 3JCMJ 4ADZA 2OTJT 2O01E 4FIBA 3V7RA 5GAN2 3LK42 2HPJA 3RPUA 2JNGA 3LH0A 4KBMB 1VQKA 4OB0B 4C8QC 1YW0A 4K0UA 2V8IA 3TU4K 3V8KA 4AI6A 4F7UG 4PNIA 4XU2A 2DJZA 4M78G 2HD0A 2ZZDA 2E5QA 2E9XA 2M0OA 4M78D 5LL6S 5FU7B 4D6WA 1SA0E 2V7KA 1D1AA 3I0QA 5HKCA 1T98A 2E10A 1MNDA 4IDZA 3ZMUB 3HSBA 4FT4A 5I2SA 5LHIB 3OSVA 2KLQA 2VKJA 4R55A 4B9WA 3F31A 3JB9H 3BFMA 3VKHA 2JMHA 2KQWA 4KT0E 3BQIA 2FB7A 1PSFA 3LWIA 2LHNA 4ZI3C 3J9X1 1V29B 4IUUA 5F3JA 4JRKA 2RJEA 2RK2A 2CXFA 4XK8E 1YJ9T 1YJWA 4J8OA 1G3TA 1K73C 5FLXE 4X1KE 2CXDA 3FB9A 1QVPA 4OYKA 5LGUB 1AHJB 3ZJ1A 4C92E 4JUVA 1NAFA 3UFEA 3LG7A 3SWNB 1WGSA 3ZMZB 1VQMA 2X4XA 4BI4A 1VQ4T 5GMKm 3JAME 2VC8A 3HRSA 3RYIE 1BR1A 3CPWS 3V7CA 1NJIU 3HKDE 1WNLA 1MMNA 3I56A 4PJOC 1N27A 5GAN6 5GMKh 3QUJA 3OA6A 2L9QA 1I4K1 3RIRA 4FL6A 5FXXA 3ZYKA 3JCMf 3FDRA 2JRKA 4M7AC 5LP6E 3OYIA 2ES0A 1HK9A 2NOXA 2Z6EA 1MMAA 3MA9A 1K73U 5LG4A 4E7LA 5DLOA 4N4HA 5D6XA 2GFUA 2ZLYA 5CKFA 2ZM0A 5JR9B 3LK2B 2EJGA 2EHOA 4M77F 2LDMA 1K9MC 3Q1JA 4C91A 3OYCA 2O4XB 3AA1B 5LGNB 4O2BE 2DAQA 2WSFE 4ZGEB 1KQSS 2CZ7B 2G0UA 2N9DA 1HG5A 5GANf 4I43B 3CX7B 4JLEA 3V8JA 4G63A 1X6OA 2DXTA 4YFSA 2E64A 2X0LB 2VASA 2NTYA 1VQOA 1OWAA 2SPCA 3WVDB 4F7UB 3JCMh 4BJNA 4XQ3A 3JB9J 3HPWA 3M5AA 5EG2A 3ONXA 3C95A 3AHUA 4M78B 4N4IA 4L9IA 3OYGA 3BQLA 2KDSA 1Q7YC 1YHQA 5FRNA 4QXHB 5LJ3g 4R56A 1WPYA 2WWUA 4PJLA 2DEQA 3QIIA 2M67A 4GIWA 3MZKB 3JCMP 3GOXA 1QVFS 4IE0A 1NE8A 3QHSA 2CMRA 4H9NC 4UF0A 3I1AA 5KMGP 4DOWA 4HKEA 3SWHA 4IKFA 3FXEB 2GK9A 4AKHA 5GANh 1YJNA 4LDUA 3ZCIA 2JQQA 3QXEB 2MWOA 1W2BA 2LSJA 4KULA 1HFAA 3SD4A 2B1EA 3F2EA 4IIJE 2W63A 2VKDA 2X9HA 3OBYA 5L3BB 5JDNA 3VJPA 4ZS2A 2H3JA 4FM4B 1Q7YU 2X68A 3ZMTB 4TVRA 2KINB 3I9WA 3ZPOA 4MZPA 2CWOA 3UT5E 5A0GA 5FY0A 5KE3A 3L2ZA 2JN0A 2MBGA 5JDFA 4HCBA 4P5NA 4J5YA 4Y91A 5GAN4 3C51A 4TZ4C 3QUIA 1UX4A 2X51A 3CBPA 3NTKA 2KK4A 3MP8A 3O8VA 5LJ3d 4XTWA 1YIJA 3PURA 1BKBA 1U1TA 3CCJT 3BK9A 3N9MA 1M4ZA 4J6WA 4HN9A 4WBNE 5EK3A 4EB6E 3C64A 2QQ9A 2L8KA 4C92A 4PJMA 3I55T 3CC4T 3VU7H 5LJ5j 2CM0A 3CD6A 1Q81C 4CXXA 2X4WA 2JMKA 4QQ6A 4EIWA 3JCMg 3U78A 5HY6A 4NL2A 2QA4T 2CKKA 4IE7A 3M59A 4PLLA 2ZGWA 4JRQA 3CCLA 1FX7A 4JS5A 4HFVA 4E7HA 4DMVA 4LDXA 2Q9QA 3RMQA 2DXBA 1BR2A 4V2SA 2LVMA 3V7SA 4EMKC 1QW1A 2RD1A 3AA7B 1HCIA 2QXFA 2WSEE 4M77G 4F7UE 4A54A 3BQKA 2P0KA 3L2QA 5HWYA 3QJYA 2IAKA 4M77D 4C92G 4M78E 4A4EA 4C90A 2MF2A 3META 1OYXA 2KNDA 2D6FA 3RC8A 3CMAT 3GA8A 2EAYA 2A72A 2ZPBB 4C8QF 3KFWX 3QDRB 2K3XA 5C6SA 3CMET 1M9SA 1MMDA 3MO8A 4GLKA 2P0QA 4RMOA 1K8AC 3CCVT 2RJDA 3E0ZA 3O4XE 4A4HA 2K3YA 4XU0A 4RCCA 4ZTFA 2CYZB 5FXWA 2W61A 3QBYA 3WAKA 4KP3C 2WSSV 5GAOl 2F5KA 1NWMX 2WM9A 4J6YA 2H3RA 2P4TA 2Y4XA 2DXCA 3F70A 2LEHA 3CC7A 2XUEA 4BJMA 1CUNA 2ODVA 4M75E 5GAN7 3N5LA 1HG2A 2LX9A 1BI0A 4LD6A 3ZMSB 5CIUA 3KVBA 5KH6A 5GAOp 5I2MA 3RESA 1JBMA 5GAMj 2NP9A 3QG1A 3E19A 3KV9A 3M56A 2WMNA 3OYJA 2K2VA 2LM9A 3MEAA 2IC9A 3ETUA 1Q82C 3RMSA 4QHOA 4QVCA 4EYYR 3TREA 3U3IA 2XG8D 4RG2A 3K3OA 1HXDA 3HL6A 2XI9A 3A5ZB 4FSXA 4PKCC 1QVGA 3FIFA 1YCYA 1WRDA 4AKIA 4TV8E 3I9YA 3M57A 3G71A 3GNGA 4DVDA 4L6V5 2YHTA 5IT9E 1VOMA 3CCUT 3IHRA 2DTOA 3ZEHA 3K3QC 3HKBE 1LVKA 4M75F 3ETVA 2LCLA 4UEMA 5L8RE 5HWXA 4ZI2C 2M9UA 1YJWT 5AFUL 3SWNA 1H7CA 2BZBA 2C5IT 2PG8A 2DTIA 1VQPA 1VQLA 3CPFA 4ZGDB 2HH7A 3HKEE 3S3OA 2WSCE 4PJOF 3HRUA 2E1HA 3R6OA 1LVFA 1Q82U 4F6RC 3RKOA 3BDUA 4ISSA 3OYXA 1VQMT 1BIBA 4M7AF 4TUYE 4BDZA 2FL7A 3JB9G 2RB6A 1XQHA 1Y7XA 2LSKA 4ELZC 4ZHQE 3I56T 3UT1A 4AQFC 2IVWA 4I55E 3AAEB 4M77B 3JCMb 4BB7A 3JC6D 1S94A 2KMFA 4EMGA 3OYHA 4C92B 3E08A 2X9YA 2QGSA 1YD8G 4QXCB 3CXCS 1P92A 2DD5A 4HT8A 4A56A 1VQ7T 3ASKA 2P9BA 5LHHB 3UUNA 2E70A 5LJ5f 5CK9A 4PL6A 4UVBB 1YBYA 1JB0E 3N2OA 4AKGA 3M55A 1YI2A 3E1SA 2H7OA 4AQGA 2RHZA 4BY6C 2DVEA 3VYHB 1NPPA 1ZBXA 5FU6C 2RHXA 5L3FB 3PMTA 4F7UA 4PK5A 4M78A 1VIEA 2DIGA 4C8QG 3RYFE 1RL2A 4NUUA 5IHYA 1VQOT 1WLXA 5GMKi 2K5IA 4C8QD 3LLRA 3CCMA 4M7DC 3QZ9B 2DXUA 5KE2A 4HTEA 1D1CA 1MHNA 1R8OB 2C5JA 1BI2A 2NLUA 4MZTA 3SOLA 2QEXT 2XQYA 4TV9E 2RI5A 5LJ5h 4IURA 2EFIA 2LQKA 5LBMA 4JJNK 4EZHA 4GYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMC A;  4KBM B;  4MFR A;  2EYQ A;  2LT1 A;  2LQK A;  4XAX B;  2LT3 A;  4ILU A;  4L5G A;  2LT4 A; 
#chains in the Genus database with same CATH topology
 2KXP B;  4CC4 B;  4TWD A;  3Q5X A;  3JSC A;  4RTV A;  4H9O C;  3JCM X;  3L3P A;  3KXT A;  2HPL A;  4M75 A;  2E6N A;  2F1L A;  3L2U A;  2PU9 B;  4XTU A;  1M8V A;  1H3H A;  3H8Z A;  3P4R A;  1SF9 A;  4X62 T;  2CRE A;  3VS4 A;  4PJN A;  4OMN A;  1BI1 A;  5CR2 A;  4QX8 B;  4IUP A;  2IPO B;  2LNV A;  4EYU A;  4IUV A;  1PKT A;  4ZGJ B;  2V6Y A;  1NLP C;  2XPK A;  1WFW A;  3FZH B;  5HAX A;  5KYY B;  4H9S E;  3FHN A;  2PUO B;  1VQ7 Q;  3FZF B;  4EDU A;  3G6E T;  3MAC A;  4TWF A;  4A5X A;  4YT0 A;  2WS3 A;  5L3E B;  4B9X A;  3QZ5 B;  3LFM A;  3GF5 A;  3RYH E;  4DUY T;  3R84 B;  1KD1 C;  2VL0 A;  2KGT A;  1KK7 A;  2RJC A;  3FJP A;  4ZNX A;  1PNJ A;  4QT7 A;  2XDB A;  2BTT A;  2M16 A;  4V1A v;  3GNF B;  4EOZ B;  1QWF A;  3M0T A;  4ZZB A;  3CVR A;  5JR9 C;  2K5L A;  3MEW A;  5L4E A;  2DJQ A;  2BVM A;  3QNU A;  5GAM f;  5AQH B;  2H88 A;  3CQX C;  4P0B A;  5KYX A;  1VA7 A;  1MV3 A;  4PW8 A;  1VYU A;  2M51 A;  1WZO A;  2RI2 A;  4EV6 A;  2LHR A;  1WYC A;  2ENM A;  2KT9 A;  2ZM8 A;  2RO0 A;  1GBR A;  1Y64 B;  4GKK T;  3Q2M A;  2VK9 A;  5LYJ E;  3X26 B;  4OF1 A;  1OZ3 A;  2YDR A;  1N9R A;  3SDZ A;  3UUX B;  4M75 G;  4GK5 E;  1VQO Q;  2E8I A;  1W9R A;  3G4S A;  2PVG B;  4M75 D;  3FBZ A;  2JJ9 A;  1LOJ A;  2DMO A;  2DHR A;  3ULR B;  1G8X A;  3EFO A;  4JLG A;  3AED A;  3OYD A;  1J5W A;  1WQW A;  3PJA J;  2RHI A;  1TUG B;  3CCR A;  3EFS A;  2WAU A;  5EZY E;  3AA6 B;  1WIE A;  4PJO G;  1R8I A;  2CLY B;  2QEX Q;  4JI8 T;  2BE9 B;  2KT8 A;  4M77 E;  4PJO D;  2ESW A;  3CML A;  2RN8 A;  2QQB A;  1KD1 U;  2H8H A;  2CP6 A;  3ZL7 C;  4IDN A;  2JZ2 A;  3P4S A;  5GAM h;  1G3Y A;  4OHF A;  4M7A D;  3A8M B;  4OYJ A;  3OTO T;  2W10 A;  1M27 C;  2KY9 A;  2BZY A;  2VXF A;  4AQY T;  4BDY A;  3CPZ A;  4BI8 B;  2CWY A;  3OW2 A;  3RIU C;  4PNO A;  2NWB A;  3TSW A;  1U8R A;  5C8Y E;  5E0O A;  3OYE A;  9ATC B;  1S35 A;  3MHX A;  2LT1 A;  3ZT6 A;  3GLX A;  1G3W A;  4C0D C;  3EAB A;  2D8H A;  1WHL A;  2WY2 A;  1Q81 R;  2N2N A;  3JCF A;  4FYV B;  2I59 A;  4O2A E;  3PUV F;  1C0M A;  3ZFJ A;  2YKS A;  2CZ0 B;  3EDV A;  3N2K E;  3NTH A;  3OYM A;  2P84 A;  5D6Y A;  4C8Q B;  4JDS A;  1OI1 A;  2UXX B;  1M2V B;  2EQI A;  3G6E Q;  3CPW P;  3N9Q A;  1UX5 A;  5L3D B;  2FZC B;  3AEC A;  3NBX X;  2F69 A;  2CA5 A;  1Q95 G;  5ABF B;  3UWN A;  2QG9 B;  1OX8 A;  2LRK A;  1M1F A;  2QVA A;  1XOV A;  2E9X C;  3FZM B;  3C98 B;  3JRZ A;  5LJ3 e;  1QCO A;  4FYX B;  5IXB A;  2V6X A;  4J9E A;  1IHV A;  4QW2 A;  1M90 C;  1YKH B;  3AEE A;  4OX9 T;  3T9N A;  4JEU B;  3P8D A;  4TN7 B;  4YTM A;  4OK0 A;  3FB2 A;  2NW9 A;  2LSG A;  1IGQ A;  2FHD A;  4AFQ C;  4JJB A;  3M3Z B;  2DK3 A;  4IUQ A;  3NRY A;  3LYI A;  2LKG A;  3C4W A;  4GYS A;  4XTX A;  3CCQ T;  3DLM A;  4LD9 K;  1Y96 B;  3UQ7 A;  4DV0 T;  2DRM A;  4ZOL E;  3AVS A;  3AAI A;  1M1K C;  1VQ6 A;  4IE4 A;  2EJ9 A;  1VQ5 A;  2QDY B;  3WVE B;  4C0Z A;  4QVD A;  4YSZ A;  2KNB B;  1OQK A;  3PUX F;  2YUQ A;  2VUB A;  1S72 A;  3N5B B;  3LJC A;  3B5M A;  3CPW A;  4LMJ A;  1U06 A;  1OEB A;  4DR2 T;  4RUG A;  3P4Q A;  1TWB A;  3PIP A;  4TNV A;  2VUR A;  3NKZ A;  4QXB B;  2LRQ A;  3AEA A;  1VQN T;  1KQS P;  3RKX A;  5IN1 A;  3CC7 T;  4U33 A;  2GF7 A;  1K0X A;  1K8A R;  4AKR B;  1I8F A;  4WF2 A;  2XDP A;  1IXD A;  2BG9 E;  4HEA A;  2A3D A;  3FBL A;  1WHH A;  2DTH A;  4RTZ A;  1TG0 A;  5FP3 A;  2GBQ A;  1WJR A;  4O4J E;  4U3C A;  3BY7 A;  3ZT5 A;  2CS7 A;  4KUI A;  5FRM A;  2HSE B;  3ZYM A;  4OVA A;  1VIF A;  4O6J A;  3KV5 A;  1F1B B;  4L0R A;  3RF1 A;  4CN4 A;  4FJO A;  3S4U A;  2KAF A;  1K9M U;  4Q5W A;  3LSV A;  4DR4 T;  5AQJ B;  3JCM c;  3VV0 A;  2RQU A;  2D1X A;  2ROL A;  5GMK e;  1SSF A;  3NZQ A;  4KHZ F;  2QTV A;  2V1Q A;  4OB1 B;  5JTG A;  3OMC A;  3CCS A;  1WYX A;  1KC8 C;  2UXB T;  1VUB A;  2D0N A;  1M1K U;  2YU1 A;  2OTJ A;  5LB7 B;  2W0G A;  2C06 A;  3GN5 B;  2X9X A;  3ZYL A;  2D9T A;  3MEV A;  1I5O B;  3CX6 B;  3X25 B;  1W70 A;  4RKU E;  2CBI A;  1QVF P;  3KV6 A;  1KQS A;  4M75 B;  3ZN1 B;  2RHU A;  4GOU A;  1UEB A;  1WX6 A;  1KQ1 A;  2RJF A;  2EIF A;  4OB2 B;  1JJ2 S;  3OYF A;  4MLK A;  1WQ7 A;  3PU8 A;  4LFC T;  2ECZ A;  2A7Y A;  1Q82 R;  2LJ3 A;  4UVA B;  5HXH A;  3LWH A;  4QQG A;  5M9O A;  2LSI A;  2BUD A;  2V6Y B;  4PJO B;  4UV8 B;  2XM1 A;  6AT1 B;  5HEO A;  1BCM A;  2LE8 A;  2YWW A;  4HXJ A;  3PUS A;  2B8A A;  3JV3 A;  2LCS A;  5LGT B;  4KUM B;  4KI0 F;  5L3G B;  1Y07 A;  3C94 A;  3O1H A;  5HK3 A;  3CCQ Q;  3SRZ A;  4Y28 E;  4E7J A;  2XM2 A;  1AJ3 A;  3M65 A;  4DV3 T;  1H8K A;  2FO0 A;  4OMM A;  3JCM e;  3Q5E A;  4NXM T;  3D7S B;  4MDX A;  5CQX A;  2XD0 A;  2BE7 D;  2GQV A;  2EHO C;  4CN6 A;  1QVF A;  4YJ3 E;  1SEM A;  2CE7 A;  1U3O A;  5KYX B;  4PJJ A;  5FNV E;  4CXW A;  4Z8A A;  3FLG A;  2ZM2 A;  2I6H A;  4OMQ A;  4XU3 A;  1UGR B;  1IJ5 A;  1O9S A;  1G83 A;  1VQN Q;  2UUA T;  2QYW A;  5H6R B;  4B3T T;  1BIA A;  5HYA A;  3WAJ A;  1GCQ C;  2YSQ A;  4B3S T;  2DL4 A;  1U1S A;  3S3M A;  1SSH A;  1QKX A;  2IC6 A;  2O31 A;  4M77 A;  3GP8 A;  2O9V A;  2EWN A;  4LDW A;  5AQQ B;  2ED0 A;  2RQT A;  1WYB A;  2NWM A;  3M0U A;  1SHZ C;  3EG0 A;  2NUT A;  3RLF F;  4C8Q E;  1D3B A;  3IF8 B;  5LA6 E;  2LT3 A;  1B34 B;  3UDC A;  5GAN e;  1FMV A;  3ZC1 A;  4ZS3 A;  5JVD E;  4OGC A;  2LT4 A;  2IW5 B;  2D0Q B;  3OS2 A;  1MGQ A;  3UPU A;  1YJ9 A;  3RRW A;  4IUT A;  2IHR 1;  5CB4 E;  1E6G A;  1KQ2 A;  2DER A;  1ZOY A;  4WTO B;  4AKL A;  2IML A;  1YIT A;  4U74 A;  3VU3 C;  2EQM A;  2YLC A;  2VB6 A;  1WHM A;  1HTJ F;  4ESR A;  1VQ9 T;  2E12 A;  3SS1 A;  4LFB T;  3RKY A;  3QYG B;  3AB3 B;  5F8P A;  3RI5 A;  2A0F B;  5FW9 A;  2BZX A;  4MFR A;  1IZN B;  5LXT E;  2I2L A;  4PLI A;  4M7D F;  2WBL A;  4PFP A;  2XAJ B;  2RH2 A;  3M54 A;  5L47 A;  3M0S A;  1VQ4 A;  5A1L A;  3RNJ A;  2A2F X;  3UU3 A;  5LCY A;  5AQO B;  5F5W A;  1WJS A;  4U7I A;  5FVL A;  1WR0 A;  2CXL A;  3E9F A;  4C5H A;  2OTL A;  1YWO A;  3G7Z A;  4J9F A;  4N4G A;  3OYL A;  3QPH A;  4YTN A;  3I9Q A;  1IAP A;  1UUR A;  1K4U S;  1G3S A;  2BS3 A;  2W66 A;  5GAN g;  1SG5 A;  2QI2 A;  3OJA A;  1VCT A;  2QAZ A;  4KUD K;  4XBF B;  3CCM T;  2QRX A;  1ZHC A;  3T8O A;  2H89 A;  4ZEY A;  2XKO C;  1Q81 U;  4UC4 A;  2FYK A;  2EGE A;  1UDL A;  4B3M T;  3GBQ A;  3FEO A;  2H3E B;  3M0P A;  4EMH A;  5JDQ A;  3OBW A;  4ZN3 A;  1G5V A;  1WHK A;  1D0Z A;  3KIN B;  4J83 A;  1M5Q 1;  3H41 A;  2VGM A;  5DLQ E;  2VYT A;  4UV9 B;  4LF6 T;  4QH1 A;  4XTY A;  2L5Q A;  1KHC A;  2BS4 A;  2DIL A;  1CKB A;  4OFZ A;  5HEG A;  4U2Z A;  1M3B A;  3NFC A;  1VQK T;  2PUK B;  5AQF B;  3F57 A;  1B7T A;  1BI3 A;  1GQE A;  3L1A A;  2VVN A;  3M0Q A;  4DR1 T;  1T0H A;  2BG9 A;  3EHR A;  3P8B B;  2ZAE A;  5KXJ A;  2RPN A;  3LGL A;  3VUB A;  4HVV A;  2V8J A;  2YIN A;  5FL0 A;  3CEY A;  5HXE A;  3JCM d;  4FI5 A;  3MJX A;  1NEK A;  2W00 A;  5KYY A;  2ZPG B;  4II1 A;  2M6I A;  3EH1 A;  4BE2 A;  4X1V A;  1OUL A;  1RI0 A;  2FBW A;  4EXT A;  3HKS A;  2Y8D A;  1GXI E;  2YK0 A;  3SEM A;  2J06 A;  2Y48 B;  4LF8 T;  5J3B A;  4F16 A;  4O4I E;  4C92 C;  1N9S A;  1HNW T;  2F4V T;  4PJO E;  4BAC A;  1X6B A;  1VQ9 Q;  4VUB A;  3EAM A;  3AVR A;  5J1G A;  3H0F A;  2OV9 A;  2COY A;  1I5L A;  2LSY A;  2NYS A;  3CIR A;  4FSS A;  5CAI A;  1IGU A;  1HX1 B;  5L3C B;  4M7A E;  2FPD A;  1X69 A;  2C0T A;  1K8A U;  2RNA A;  4ZI2 D;  4JI1 T;  3GWH A;  1ABQ A;  1XNQ T;  2BKD N;  3T1H T;  1S1N A;  4ZTJ A;  5FY7 A;  4A97 A;  2JTM A;  3M9Q A;  3R6N A;  2A36 A;  3PIO A;  3C4S A;  3RC3 A;  5GAN d;  4HWH A;  1VYT A;  5J26 A;  3J80 E;  2I0N A;  2VGN A;  3TQ7 P;  4N0A A;  1IRE B;  3ZBD A;  4F17 A;  4BE1 A;  1N8R C;  3J7A F;  1KD1 R;  1YKE B;  4A98 A;  2EYQ A;  3S6W A;  3VS5 A;  2RM4 A;  3O9X A;  2Q9Q C;  5J2U E;  1LJO A;  1OED C;  4YTL A;  5IAY A;  1E7O A;  3MKD A;  3PV0 F;  4RCB A;  3G4S T;  5L23 A;  4B6X A;  3C0C A;  1FEW A;  1XZY A;  3CCM Q;  5C3J A;  3CMA Q;  1AWJ A;  5IH2 A;  3UQ4 A;  2L2P A;  4C5I A;  3OYZ A;  2KVQ G;  3MCA B;  4QWN B;  1UK5 A;  5H6Q B;  4DV2 T;  1Q86 C;  4EMK B;  2GQI A;  3OVU A;  3HKC E;  1N6A A;  2VXE A;  3VRZ A;  1AWO A;  4XZC A;  5GJV B;  1MIV A;  3CCR T;  3TLV A;  2XAQ B;  3Q5W A;  3E9G A;  3VUZ A;  2XQ9 A;  2FZG B;  2D2S A;  2CSI A;  2RQW A;  3ABV A;  4CZZ B;  5KDM C;  1PHT A;  2DWK A;  5KX5 E;  2HL3 A;  1BBZ A;  1VQK Q;  4WBO A;  2VWA A;  1LPL A;  2KWI B;  4BUG A;  2LOP A;  4O4H E;  2C0I A;  4X9C A;  3PDY A;  4IE5 A;  4DBR A;  1D0X A;  3GMI A;  3P7I A;  2YRV A;  3PVQ A;  1WXT A;  4A53 A;  3HFO A;  1UGO A;  4CN1 A;  3C50 A;  4IHJ E;  5D6W A;  3VR9 A;  2FG0 A;  4C8Q A;  3AE2 A;  3HP9 A;  4LDY A;  2JQ9 A;  4CXY A;  3X20 B;  1M2V A;  3OS0 A;  2LQN A;  2FJA A;  1RAD B;  3OY9 A;  4UVC B;  3RQU A;  2J7I A;  5TAO A;  2E2A A;  3UAT A;  5JDH A;  2LJ1 A;  4IDP A;  3QYH B;  2VQE T;  2BIV A;  1HS7 A;  4J9B A;  1K1Z A;  2E5K A;  5FU7 C;  3OYY A;  5L2L A;  3GIB A;  3HHT B;  1D3B B;  5CKB A;  1I94 T;  3AE1 A;  3V5U A;  4OB3 B;  4M7D G;  3N9N A;  3DP7 A;  3QOF A;  2OI3 A;  2E65 A;  2ZPE B;  3EDU A;  3AE9 A;  2FJD A;  5EC7 A;  3I55 A;  4H9Q C;  3CC4 A;  4M7D D;  3A8H B;  1UFF A;  3E2U A;  3VKI A;  2EYZ A;  1M3A A;  1Y96 A;  2DLR A;  4FYW B;  2WU2 A;  3LX7 A;  2R58 A;  3TKL B;  2IIM A;  2HL5 C;  3INZ A;  5DQW A;  4NUV A;  1SRM A;  4H9P C;  4H9R C;  2CUD A;  4ERR A;  2XAH B;  3N9L A;  2ZPF B;  3CXC P;  5GAO m;  3RX6 A;  3IBP A;  2YXY A;  2CZ1 B;  3QJ6 A;  4MBQ A;  3ZCJ A;  2VKH A;  2JQH A;  4CI2 B;  1NZ9 A;  1VQ6 T;  1NEG A;  1HYO A;  5GAN 8;  3G4S Q;  1VQ5 T;  4LN2 A;  1M90 R;  2A3L A;  2WAC A;  3K8P C;  3ZJ2 A;  3P8H A;  3RR6 A;  2XSA A;  4DND A;  1QLY A;  2Y4Y A;  3OB9 A;  1S72 T;  4C5G A;  3EAE A;  5C0M A;  5AQS B;  2V5D A;  1AWW A;  2XTL A;  2QQS A;  1E7P A;  5GMK l;  1YJW Q;  1PRL C;  4YJ2 E;  2KWH A;  3RKW A;  4PFO A;  1FYN A;  4JUY A;  4DMW A;  5IYZ E;  2MOX A;  5ABH A;  2K3W A;  4J9C A;  1M1K R;  4JRI A;  2X3W D;  2V7I A;  3ZMV B;  2HQX A;  3P8C D;  1M1G A;  1YHQ T;  2JVV A;  3J81 E;  2KXC A;  4HCZ A;  4LE9 A;  2BKO A;  2XHE B;  3CCE A;  5GAO r;  4TWH A;  3ZC0 A;  5A0D A;  1IJ6 A;  2XQ3 A;  2MI6 A;  4D8D A;  3JCM W;  2W2U A;  1K9A A;  3CXC A;  3SWN C;  4ASK A;  1UEC A;  3RKG A;  3SB2 A;  4O8S A;  1VRB A;  4DQ2 A;  3IEE A;  4IGU A;  2LP5 A;  3VRY A;  3GN5 A;  3A8Y C;  4HE8 A;  5AQP B;  1KNR A;  3CME A;  4Z02 A;  1TOV A;  2KMT A;  3VS3 A;  5HXS A;  3UU8 A;  3CCS T;  2CCQ A;  3I56 Q;  2NUZ A;  1BB9 A;  3BDL A;  4P09 A;  5FMN A;  2GCX A;  5GAN 3;  1YJN T;  2AXD S;  4I0U A;  1YN8 A;  3CCV A;  5EK4 A;  1X6G A;  2VQF T;  2L3R A;  4Q25 A;  3QDF A;  3CX8 B;  3KV4 A;  3I35 A;  1QLB A;  1ZUU A;  1ZUK A;  2BG9 B;  4HVU A;  1VQ8 A;  4A4G A;  1D09 B;  3EFR A;  2JPF A;  3UUL A;  2X35 A;  3PU3 A;  2RA1 A;  2HKQ B;  4PJO A;  4LF4 T;  2FPF A;  4BD3 A;  1WR6 A;  1KC8 R;  1WJQ A;  1ZBJ A;  4OMO A;  5LJ3 f;  4HFC A;  3CKD A;  4HFH A;  3N9O A;  4GLM A;  2QTX A;  4X65 T;  4HKA A;  4HT9 A;  4TX5 A;  4ZI3 D;  4M7A A;  3PUW F;  3RUX A;  1OZ2 A;  1KNZ A;  2JMA A;  1UTI A;  2V8K A;  3AEB A;  1UGV A;  4X9D A;  2V5C A;  4KRT A;  2JOY A;  2GFA A;  1CSK A;  3CK6 A;  4MHC A;  4JZ3 A;  4ELY C;  4QVZ A;  3L2W A;  3JAF A;  1WXU A;  3PUG A;  2V8S V;  2K48 A;  2QK0 A;  1X9B A;  4ORZ A;  1UB4 A;  1X43 A;  2DL3 A;  2DD4 A;  3KVA A;  1VQ5 Q;  2YOE A;  4JBW F;  2R5M A;  4XAX B;  2ZPI B;  4J9H A;  4ILU A;  2PVD B;  2EYW A;  2YRD A;  3Q9D A;  1S72 Q;  3OW2 S;  3RIA A;  2DLP A;  3PT9 A;  2LOS A;  2MWP A;  2M1H A;  2ACX A;  4BY6 B;  4Y92 A;  1YIJ T;  7AT1 B;  5LJ5 e;  4G2A A;  1T7S A;  3OYN A;  1NEN A;  3EI0 A;  5HXR A;  5FU6 B;  2MTQ A;  3B13 A;  3EGD B;  3KBU A;  2XK0 A;  2K5B B;  1UE9 A;  5HCK A;  4JS4 A;  1NJI C;  5LJ3 h;  3HFN A;  4M78 C;  1B34 A;  1YHQ Q;  4EED A;  4BI3 A;  4E6R A;  2WDR A;  3HL8 A;  5EK2 A;  1AD5 A;  3EH2 A;  5DM7 R;  3CC2 A;  3TLT A;  3KBG A;  2HAX A;  1LCK A;  4JYA T;  3M58 A;  4WNK A;  2EKH A;  1U5P A;  1Z0P A;  4M7A G;  3CCU A;  1QP3 A;  1Y57 A;  4NIQ A;  4CRI A;  3VKG A;  4YHJ A;  4M7D B;  2CPT A;  1QUU A;  1M30 A;  2E41 A;  3CD6 T;  2YUP A;  3MEU A;  3PTA A;  1BK2 A;  3CWZ B;  4HFE A;  2J47 A;  3DTO A;  2WWV A;  3W15 B;  2B86 A;  3CCS Q;  4BAY B;  2E9X D;  4E7S A;  1WXB A;  1YJN Q;  3VS1 A;  3NWI A;  1YIT T;  5LJM A;  1X79 A;  3H3M A;  2MOZ A;  2O9S A;  2PJQ A;  1PCX A;  2WB5 A;  2MAW A;  4DEY A;  5CQY A;  4L5G A;  3J7Y q;  3CCL T;  2V1D B;  4FT2 A;  3C4Z A;  2EGA A;  2KBT A;  4MMK A;  5LJ5 g;  1I07 A;  5FVK A;  4NL3 A;  5LHG B;  1OU9 A;  2DYB A;  3A8G B;  4YLH A;  4QX7 B;  4M75 C;  2A37 A;  4XU1 A;  3OYA A;  3HI2 A;  1XWM A;  3ER0 A;  2EQK A;  3UA7 A;  3PUY F;  2IDO B;  3OKQ A;  2OTL T;  2AKK A;  1D0Y A;  3TEE A;  3N2G E;  1W09 A;  3QKJ A;  3JCM Q;  2XIC A;  4AT1 B;  2XAF B;  2IG0 A;  3KBT A;  5I11 A;  2E6Z A;  2L0A A;  4PK4 A;  4HFD A;  4F04 B;  4Z89 A;  2YEV C;  5ECA A;  4QQD A;  3PUA A;  2DZC A;  4P0A A;  2W67 A;  1B07 A;  2XDD A;  2ZPH B;  3WI3 A;  1LRZ A;  3PUQ A;  3MP6 A;  3OS5 A;  1R77 A;  2CGH A;  3RER A;  2R57 A;  2PQW A;  2B76 A;  1VQ7 A;  3OMG A;  3UU4 A;  2HNI A;  5GON E;  2DIQ A;  1ZV4 X;  2VV5 A;  3QWX X;  4QKN A;  1YIJ Q;  4A63 B;  3EG3 A;  1HR0 T;  4YSX A;  4M4Z A;  5CKE A;  2EQU A;  2K9G A;  2LQ8 A;  1FMW A;  4JZ4 A;  3AE4 A;  5JDL A;  2L89 A;  1OX9 A;  3FXD B;  1RUW A;  4C92 F;  4ATO A;  1EZ3 A;  3LBX B;  1UGS B;  2AHJ B;  5GAM e;  2K5F A;  1W2B S;  5I21 A;  2DYI A;  1H64 1;  1LKX A;  5CKD A;  4DBH A;  4YY3 T;  3ANW B;  1ZSZ A;  2VL8 A;  2AKL A;  3HA4 A;  4JV5 T;  2DA9 A;  3RQW A;  5CA0 E;  1Y71 A;  2DCF A;  2KT1 A;  3CD6 Q;  2R5A A;  3MPU B;  2EJF A;  5FYM A;  4DR3 T;  1JO8 A;  3P50 A;  4MZM A;  1M90 U;  4ZZC A;  4E47 A;  2I0M A;  2D9D A;  1YIT Q;  1UG1 A;  3CQC B;  5AQU B;  2HZY A;  3VS6 A;  5LJN A;  1KFZ A;  2JMC A;  5LJ5 d;  2BKN A;  5JRE A;  4X64 T;  2CDT A;  3AAA B;  5DJQ C;  2BKP A;  4QKU A;  1I6Z A;  2Y6X A;  3AA0 B;  3AE5 A;  4KMC A;  5FXV A;  1T3S A;  2ED1 A;  3UTK A;  2EGC A;  2QEX A;  1AOJ A;  1MMG A;  3LK3 B;  2H7V C;  1RAG B;  1QP2 A;  4JEH B;  4LUD A;  3NRX A;  4IIM A;  3C12 A;  2XID A;  4MAL A;  5KCO A;  2JTF A;  1W0B A;  3VS7 A;  3H37 A;  2G3R A;  5FWB A;  1TU0 B;  2L3L A;  2UXN B;  3X28 B;  1GL5 A;  4EGW A;  5DQV A;  5LBQ B;  2M02 A;  5CJ5 A;  4JPB W;  2MAM A;  2XAS B;  5GAM g;  2OTL Q;  3V5S A;  4KX6 A;  2EW3 A;  2EHO D;  2SRC A;  1MIW A;  2KZ7 B;  2BDE A;  5ADX L;  2XHC A;  4EMK A;  3G71 T;  1OXZ A;  4C0D B;  3ZEF B;  2YUO A;  3C4X A;  4M1P A;  5HEU A;  3H6Z A;  4U72 A;  5HCJ A;  1VYV A;  3OYB A;  4XTZ A;  1IZ6 A;  3QSU A;  2EQJ A;  2JM8 A;  4BE0 A;  2NW7 A;  1O75 A;  1N8R R;  3LGF A;  1JJ2 P;  3QK6 A;  4M7A B;  3RH3 A;  2RHY A;  2L8D A;  1FXX A;  2DEU A;  3G6E A;  4E7I A;  5FKY A;  4DID B;  1VQP T;  2E9X B;  4M7D E;  2KYM A;  1VQL T;  2RK1 A;  3I5S A;  1KC8 U;  3RYC E;  2ATC B;  3EVY A;  5IHK A;  1Q86 R;  3M4G A;  2HBP A;  3OSS C;  3TLU A;  5LNK A;  1PD0 A;  2RA2 A;  5KCH A;  2YU2 A;  2BVL A;  1EZZ B;  2XU8 A;  2BBH A;  3I0O A;  2BBJ A;  1C6V X;  4OGE A;  3VYG A;  4IL4 A;  3CC7 Q;  3L2V A;  5C2T A;  1ZA1 B;  2KSS A;  4J7F A;  3QO3 A;  2UU9 T;  3AXJ B;  5AQK B;  2ZCF B;  2DF6 A;  4OP0 A;  4C5E A;  4AG1 C;  2C5K T;  4UR9 A;  1OOT A;  5JRC A;  3FRN A;  1X75 C;  1YQ3 A;  2LJL A;  5AQR B;  1JJ2 A;  2E5L T;  2RQR A;  3UUM A;  5GJW B;  2K4Y A;  4IE6 A;  2VKN A;  3GPL A;  2X4Y A;  3HRT A;  3PMI A;  2MMP A;  5J39 A;  1O3X A;  2QA7 A;  4IL9 A;  3ZN0 B;  1KJW A;  1XTD A;  2CZ6 B;  5JDM A;  4X20 E;  2ODU A;  3DLL A;  2NTX A;  1JNR A;  2W62 A;  4MML A;  3VS0 A;  3O5Z A;  5GAM d;  4ZI7 E;  2G6F X;  3NZP A;  1ZKE A;  4EPC A;  2CEA A;  3JB9 F;  2UXC T;  2XAG B;  4DA4 A;  1HJD A;  4Z91 A;  4IST A;  2X4J A;  3REB B;  2LLY A;  4PAG A;  4LMK A;  1YI2 T;  2N1G A;  2CBJ A;  5LG3 A;  2PVO B;  1ZHI A;  4I50 E;  3RGL A;  4JLI A;  2P0P A;  5AQM B;  4DV4 T;  2QQA A;  1E6H A;  4D8K A;  4H63 H;  4AFU C;  3G71 Q;  4ILB A;  3PNW C;  1RAF B;  5FY1 A;  2JIW A;  5FL1 A;  3DB4 A;  1KG1 A;  1U4Q A;  3OQ5 A;  5CCA A;  2J4G A;  1KHI A;  3ESL A;  1ABO A;  1QWE A;  2V7L A;  1X01 A;  4DEX A;  3UUB A;  4AXP A;  4EAH A;  1W6X A;  3URG A;  5GAO n;  2FVU A;  5JH7 E;  2KRM A;  1HF8 A;  4OML A;  1KF6 A;  2WMO A;  3JB9 I;  1GCP A;  1VCS A;  4HA8 A;  4GY5 A;  4Z88 A;  1D1B A;  3REA B;  5AYF A;  1VQP Q;  4ZN1 A;  1BCO A;  1VQL Q;  3CQG B;  3M53 A;  1PSE A;  2RP4 A;  3EG9 B;  5BMV E;  3TSZ A;  1IBL T;  4BA9 A;  2DNX A;  3CCE T;  5FXZ A;  1UCU A;  2HHH T;  4ME7 A;  4RG8 A;  3NTI A;  5KYW A;  3SFM A;  5CKH A;  4PFZ A;  4CC7 A;  2CHN A;  2J1D G;  4C92 D;  4DUZ T;  1GBQ A;  4FW2 A;  5GAN 5;  1JQQ A;  1H92 A;  1TH7 A;  3DJB A;  4I4T E;  4RTW A;  2LJ0 A;  2K24 A;  3AEG A;  1JEG A;  3PTR B;  2C0S A;  3CCQ A;  4LF7 T;  3FC3 A;  4ANJ A;  4X34 A;  2EHO B;  4J2C A;  5LJ3 j;  4E7Z A;  1QVG S;  2X9W A;  3EG1 A;  3VRA A;  3PE0 A;  1BR0 A;  2V7M A;  5GAO q;  1HX8 A;  1YWP A;  4X1Y E;  2DI4 A;  3VHL A;  2OAU A;  4DOV A;  3D0T A;  5CO7 A;  1VQ8 T;  1MIY A;  4M77 C;  4AQF A;  2FRY A;  1NYG A;  1ZSZ B;  5ETW A;  3DKM A;  5HK0 A;  1VQN A;  2LCC A;  1LNX A;  2LTO A;  1N32 T;  5CA1 E;  1FWZ A;  2Q9Q D;  3A8L B;  1H3Z A;  1QKW A;  1HNX T;  1DU2 A;  5JQG E;  1NEB A;  1SUM B;  4GK0 E;  2VWF A;  2OA5 A;  2F2W A;  3B57 A;  3CQT A;  5A2Q E;  4O5V A;  2L3Q A;  4A4K A;  1ZP0 A;  2PTF A;  3WXM B;  5J2T E;  3K3N A;  4H63 V;  2DKG A;  2LNH B;  1YI2 Q;  4X1I E;  2L3P A;  2Y90 A;  3CCL Q;  3I5R A;  3O1J A;  5IHN A;  4UEL A;  4F7U F;  5M4Y A;  4YSY A;  4IRE A;  3L39 A;  2K79 A;  4M78 F;  4MDW A;  2R6G F;  5A0L A;  1TUD A;  2VKO A;  3HR0 A;  2LMJ A;  3QB5 K;  1UUS A;  3OPC A;  1NPR A;  2XZE A;  1M3C A;  1G73 A;  4LDV A;  4AMC A;  3A8O B;  3KFV A;  4COF A;  3EGD A;  5HXC A;  5DAB A;  1BYM A;  3N9P A;  4CI1 B;  1UJY A;  4QH5 A;  3QWY A;  1K76 A;  4UF0 B;  1QSD A;  3H3A A;  1OU8 A;  8ATC B;  4E2F B;  1ZEE A;  1FIO A;  1N5Z A;  2PBI A;  3MP1 A;  2CH4 W;  5GMK j;  3RRC A;  4XTV A;  2BS2 A;  4J7I A;  1NBE B;  5I22 A;  4FU6 A;  2YN6 A;  2E3H A;  4M7D A;  4CQI A;  2VVK A;  3CC2 T;  2YDQ A;  3CCE Q;  2J05 A;  3ZKR A;  3CBM A;  4GBQ A;  2KSR A;  1RLP C;  3A5X A;  1Y0M A;  4OMF B;  3TCJ A;  1UHF A;  2HN2 A;  1YP5 A;  4JJD A;  3L42 A;  3ZLI A;  2GNC A;  2XSB A;  3SFD A;  4PK6 A;  1NJI R;  2JW4 A;  3PFS A;  4HGA A;  2PZ1 A;  4WW0 A;  4J6X A;  3A98 A;  5KYN A;  2AZV A;  1UGQ B;  4N78 D;  2WDV A;  1XNR T;  5AQI B;  3RIF A;  3AE6 A;  3SHW A;  1N8R U;  2QDL A;  3TVT A;  3TLW A;  1E1H B;  4LML A;  4JJC A;  1B3Q A;  4JRP A;  2OJ2 A;  4C0G A;  4Z8X A;  1VQ8 Q;  2EVR A;  2PFV A;  2YLB A;  2HBW A;  2LC4 A;  1UGP B;  2WDQ A;  2O2O A;  4NS5 A;  4YTP A;  4EZ4 A;  2BG9 C;  2QQR A;  3L09 A;  2JUF A;  4DV6 T;  2ZMA A;  5DY9 A;  3CCJ A;  1Q86 U;  1US7 B;  5JRC B;  1X27 A;  1RAA B;  2DBK A;  2MYS A;  2XQ5 A;  4L59 A;  3L2R A;  1W4S A;  3JB9 D;  2OAW A;  3ME9 A;  3Q5D A;  3SFE A;  3NGP A;  1RAH B;  2HQE A;  4B6M A;  1I81 A;  4E7K A;  1EIF A;  3DB3 A;  2V7J A;  1RAB B;  1V9D A;  2DWG A;  2DPP B;  4O4L E;  2D5U A;  2CRB A;  1FJG T;  1YXR A;  4UIG A;  4CI3 B;  3EGU A;  2LZ6 B;  5JR9 A;  2X67 A;  2RI3 A;  3E22 E;  3G06 A;  2K9A A;  3CBO A;  5HEJ A;  2QA4 A;  4ILC A;  1A0N B;  2NR4 A;  1BR4 A;  2O4X A;  3V8L A;  1VQ9 A;  1PRM C;  1DJ7 B;  3S3N A;  4DO0 A;  5GAN j;  2HEQ A;  3LBX A;  2DO3 A;  3LW5 E;  2DVJ A;  5IHI A;  4A4F A;  1SHG A;  4N0A C;  3EUH A;  2CSQ A;  5FRO A;  1R0C B;  1JXM A;  3ANW A;  1TXQ A;  2ABL A;  2AK5 A;  3CCR Q;  3JAE A;  3MK7 C;  2EKO A;  3OYK A;  3O1I A;  3OS1 A;  3JCM V;  2V26 A;  3JC6 C;  4C0F A;  1XMQ T;  3CC2 Q;  2K2M A;  3X24 B;  3KUF A;  2D0U A;  2X66 A;  4DBQ A;  1XNI A;  3G1J A;  1CHU A;  2D0T A;  1JRI A;  2F5T X;  3BW1 A;  4AG2 C;  2Q9Q B;  2CLY C;  3ZSS A;  4HCC A;  4UXN B;  3KDS E;  4RTX A;  1XDO A;  3MXZ A;  1WDX A;  3AT1 B;  3QC9 A;  4X66 T;  1AWX A;  1MNE A;  1Y01 A;  4NOY A;  1Z8U A;  2KR3 A;  2KE9 A;  2VVS A;  1ZQ1 A;  3PGG A;  3CMA A;  3M4Y A;  2LKH A;  2XQ8 A;  2K57 A;  2DZ9 A;  5CVI A;  5JDG A;  5LOV E;  4CC3 A;  2YUN A;  2IIU A;  2OLT A;  1RAI B;  3OBV E;  5KYW B;  1I1J A;  2CHO A;  1HNZ T;  2KXD A;  4CI0 C;  2DL5 A;  2NW8 A;  3JCM J;  3RIU A;  1W1F A;  4ADZ A;  2OTJ T;  2O01 E;  1IB8 A;  4HWF A;  4FIB A;  2J62 A;  3V7R A;  5GAN 2;  3LK4 2;  2HPJ A;  3AE3 A;  3RPU A;  2JNG A;  3LH0 A;  4KBM B;  4KH1 B;  2DET A;  2YRC A;  1SKU B;  1Q7Y R;  1VQK A;  1N33 T;  2P4R A;  4OB0 B;  4C8Q C;  1GFC A;  1YW0 A;  2CUB A;  4K0U A;  1AT1 B;  2V8I A;  4NXN T;  1U5S A;  4K11 A;  3TU4 K;  3V8K A;  4AI6 A;  2MIO A;  4F7U G;  4PNI A;  4P1N A;  4U7Y A;  3NPF A;  2HDA A;  4DR5 T;  2QAS A;  4XU2 A;  4B3R T;  2DJZ A;  2O88 A;  4M78 G;  2HQH A;  2HD0 A;  2DRK A;  2ZZD A;  4AIU A;  2D8J A;  3T1Y T;  2E5Q A;  2E9X A;  2M0O A;  4M78 D;  5LL6 S;  5FU7 B;  4D6W A;  1SA0 E;  2V7K A;  1D1A A;  1T0J A;  3I0Q A;  3TLS A;  5HKC A;  1T98 A;  2E10 A;  1MND A;  1VQ6 Q;  4IDZ A;  2WZI A;  3ZMU B;  2WP9 A;  4KGV B;  3HSB A;  4FT4 A;  5I2S A;  1TS9 A;  1IHW A;  2CT4 A;  5LHI B;  2HCK A;  4U2Y A;  3OSV A;  2WCA A;  3AXJ A;  5AQN B;  2XQ6 A;  1W0A A;  2KLQ A;  2VKJ A;  4R55 A;  4B9W A;  3F31 A;  2M6B A;  3JB9 H;  3BFM A;  3VKH A;  1EFN A;  2JMH A;  2KQW A;  2MCN A;  2NUP A;  1ZLM A;  2CP3 A;  4KT0 E;  1WHJ A;  3OW2 P;  2K7A A;  1IBK T;  3BQI A;  3P4W A;  2FB7 A;  1PSF A;  3LWI A;  2LHN A;  1TUC A;  4ZI3 C;  3J9X 1;  1V29 B;  4IUU A;  2KRN A;  5F3J A;  4JRK A;  1NM7 A;  2RJE A;  1WFD A;  3A7M A;  2RK2 A;  1EX4 A;  2CXF A;  4XK8 E;  1YJ9 T;  1YJW A;  4YHH T;  4J8O A;  1G3T A;  2KEA A;  1K73 C;  8AT1 B;  5FLX E;  4X1K E;  2V1R A;  2CXD A;  2OTJ Q;  3FB9 A;  1QVP A;  4OYK A;  5LGU B;  1ARK A;  1AHJ B;  1WCR A;  3ZJ1 A;  4C92 E;  4JUV A;  4Z90 A;  5FWC A;  1NAF A;  3UFE A;  3LG7 A;  2EBP A;  3SWN B;  4J9I A;  2Z0W A;  1WGS A;  4HWI B;  3ZMZ B;  1UUE A;  1VQM A;  2X4X A;  4BI4 A;  4DR6 T;  1VQ4 T;  1AVZ C;  5GMK m;  1TSF A;  3JAM E;  2VC8 A;  3HRS A;  3RYI E;  1BR1 A;  3CPW S;  1JU5 C;  3V7C A;  2XQA A;  1NJI U;  3HKD E;  4QH4 A;  1WNL A;  1MMN A;  2FJE A;  3I56 A;  3LDQ B;  4PJO C;  1N27 A;  5GAN 6;  3PVL A;  5GMK h;  3QUJ A;  3EG9 A;  1IBM T;  3OA6 A;  2L9Q A;  1I4K 1;  2CH4 A;  3RIR A;  3UU6 A;  5FXX A;  4FL6 A;  1OED E;  3ZYK A;  1XJW B;  4HFI A;  2RF0 A;  3FDR A;  3H0I A;  3JCM f;  2JRK A;  2YT6 A;  1AZG B;  4M7A C;  5LP6 E;  3OYI A;  4F14 A;  2ES0 A;  1HK9 A;  2AIR B;  2GTO A;  2NOX A;  2Z6E A;  3RBB B;  1MMA A;  3MA9 A;  4JI7 T;  2KRO A;  1K73 U;  5LG4 A;  4E7L A;  2KRS A;  4WYV A;  1KSW A;  5DLO A;  4N4H A;  5D6X A;  2GFU A;  2ZLY A;  5CKF A;  2ZM0 A;  4WZX A;  4JI0 T;  2KI7 A;  1YQ4 A;  5JR9 B;  3LK2 B;  2EJG A;  2EHO A;  4IIO A;  4M77 F;  4GKJ T;  2LDM A;  2A9U A;  1K9M C;  3Q1J A;  4C91 A;  2MK5 A;  3OYC A;  2O4X B;  3AA1 B;  5LGN B;  2XMF A;  4O2B E;  1NLO C;  2JQK A;  2DAQ A;  1PM3 A;  2WSF E;  3BE3 A;  4ZGE B;  1KQS S;  2CZ7 B;  3ONJ A;  2G0U A;  2N9D A;  1GCQ A;  3THK A;  3FZL B;  2DX1 A;  1HG5 A;  5GAN f;  4I43 B;  3CX7 B;  4JLE A;  5LMU T;  4OMP A;  3V8J A;  4G63 A;  1X6O A;  2DXT A;  4YFS A;  2E64 A;  2X0L B;  2VAS A;  2NTY A;  1VQO A;  1OWA A;  2SPC A;  2LM2 A;  3WVD B;  4F7U B;  2ROT A;  3JCM h;  4BJN A;  4XQ3 A;  3JB9 J;  1YJ9 Q;  3HPW A;  3M5A A;  1M8M A;  5EG2 A;  3ONX A;  2DNU A;  3C95 A;  5L4H A;  4M78 B;  5CFB A;  3AHU A;  2AZS A;  4N4I A;  2LQW A;  1W2B P;  4L9I A;  3OYG A;  2W0Z A;  1N34 T;  3FJ5 A;  5HEH A;  3BQL A;  2KDS A;  1Q7Y C;  3FZK B;  1YHQ A;  5FRN A;  2W4X A;  4QXH B;  5LJ3 g;  3M0R A;  4R56 A;  1WPY A;  2WWU A;  4PJL A;  3EHZ A;  4KH0 B;  1ZX6 A;  1SPK A;  2DEQ A;  3QII A;  2M67 A;  1V1C A;  4GIW A;  4EIK A;  2XJ7 A;  3MZK B;  1VQ4 Q;  1NYF A;  2WZH A;  2JXB A;  3JCM P;  3GOX A;  1QVF S;  4IE0 A;  1NE8 A;  1KIK A;  4DV5 T;  3H9N A;  4YXD A;  3ZST A;  2FRW A;  3QHS A;  2CMR A;  4H9N C;  4UF0 A;  3I1A A;  5KMG P;  1GRI A;  4DOW A;  4HKE A;  3SWH A;  1WHG A;  4IKF A;  2YDS A;  3FXE B;  2GK9 A;  4AKH A;  3U23 A;  5GAN h;  1YJN A;  3AE8 A;  4LDU A;  1M62 A;  3ZCI A;  2JQQ A;  3QXE B;  1OPL A;  2C0O A;  1IRX A;  4J9D A;  2MWO A;  1W2B A;  2LSJ A;  4KUL A;  1HFA A;  3EG2 A;  3SD4 A;  1KNP A;  2B1E A;  1XDP A;  4LXC A;  2JS2 A;  3F2E A;  5AT1 B;  2DL7 A;  4IIJ E;  2W63 A;  2VKD A;  2X9H A;  3OBY A;  2XY8 B;  5L3B B;  5JDN A;  3VJP A;  4ZS2 A;  2H3J A;  4FM4 B;  1Q7Y U;  2JM9 A;  2X68 A;  4JI4 T;  2DBM A;  3ZMT B;  4F8H A;  2KYB A;  1PD1 A;  4TVR A;  1WA7 A;  1X2Q A;  2BZ8 A;  4EEB A;  2KIN B;  3I9W A;  5BR8 T;  3ZPO A;  1PKS A;  4U31 A;  1RAC B;  2GTJ A;  3RDV A;  4R0K A;  4MZP A;  5ABG A;  2IUB A;  2CWO A;  2EPD A;  3UT5 E;  5A0G A;  2DL8 A;  2JTE A;  5IXF A;  5FY0 A;  5KE3 A;  3NMZ C;  3L2Z A;  3UF4 A;  2JN0 A;  2MBG A;  2L3S A;  2FUP A;  5JDF A;  4HCB A;  4P5N A;  4J5Y A;  4Y91 A;  5GAN 4;  3C51 A;  4TZ4 C;  3QUI A;  1UX4 A;  2X51 A;  4X5T A;  1PG5 B;  4DV7 T;  3CBP A;  3NTK A;  2KK4 A;  3MP8 A;  3AE7 A;  2PNI A;  3O8V A;  3LH5 A;  5LJ3 d;  4XTW A;  1YIJ A;  2NUP B;  3PUR A;  5AQV B;  1BKB A;  1U1T A;  3CCJ T;  3A1P A;  3BK9 A;  3N9M A;  1M4Z A;  1ZSZ C;  1V76 A;  4J6W A;  3VS2 A;  4TNW A;  4HN9 A;  3L8R A;  4WBN E;  5EK3 A;  4EB6 E;  1IO6 A;  3C64 A;  2QQ9 A;  2L8K A;  4C92 A;  3EFO B;  4LNP A;  4PJM A;  2SEM A;  3I55 T;  1XMO T;  5KYU A;  3VU7 H;  3CC4 T;  5LJ5 j;  2CM0 A;  4LF5 T;  2CT3 A;  3K1S A;  1YFN A;  3CD6 A;  2E4H A;  1Q81 C;  4CXX A;  1WLP B;  2X4W A;  3PUZ F;  2JMK A;  4QQ6 A;  4EIW A;  1SHF A;  3JCM g;  3U78 A;  5HY6 A;  4NL2 A;  2QA4 T;  2CKK A;  4IE7 A;  1JXO A;  3M59 A;  4PLL A;  2ZGW A;  4JI6 T;  4LUE A;  5LMN T;  1UHC A;  4JRQ A;  3CCL A;  1FX7 A;  4JS5 A;  4HFV A;  4E7H A;  4DMV A;  1HD3 A;  4LDX A;  1J5E T;  2Q9Q A;  3RMQ A;  1OED A;  1GFD A;  2DXB A;  1BR2 A;  4FW1 A;  2FEI A;  4V2S A;  2LVM A;  3V7S A;  4EMK C;  1QW1 A;  3ONL C;  3PJA A;  1KEY A;  4AFS C;  1R0B G;  2RD1 A;  3AA7 B;  1HCI A;  2QXF A;  2K3B A;  2UXD T;  2JT4 A;  2WSE E;  4M77 G;  2DE0 X;  4F7U E;  4A54 A;  3BQK A;  2P0K A;  3L2Q A;  1JNZ A;  5HWY A;  3QJY A;  2IAK A;  4M77 D;  4C92 G;  4M78 E;  4A4E A;  4C90 A;  2A08 A;  2MF2 A;  3MET A;  1I0C A;  1OYX A;  5J0Z A;  2KND A;  2CP2 A;  3RC8 A;  2JS0 A;  2QYZ A;  2D6F A;  3CMA T;  2EYX A;  3GA8 A;  2EAY A;  2A72 A;  1SRL A;  2ZPB B;  4C8Q F;  3KFW X;  3QDR B;  1RI9 A;  1E2A A;  2K3X A;  5C6S A;  3CME T;  1M9S A;  1MMD A;  4LF9 T;  4JI2 T;  3MO8 A;  2FJB A;  2FPE A;  3EGX A;  3ZT7 A;  4GLK A;  2P0Q A;  4RMO A;  1K8A C;  3CCV T;  1RLQ C;  2RJD A;  3E0Z A;  3O4X E;  4A4H A;  2K3Y A;  4XU0 A;  4RCC A;  2J6O A;  4ZTF A;  2CYZ B;  5FXW A;  2W61 A;  1QCN A;  3QBY A;  3CCJ Q;  1SE7 A;  4KP3 C;  5AQT B;  2WSS V;  3WAK A;  5D7U A;  5GAO l;  2F5K A;  1NWM X;  2WM9 A;  2UUB T;  2H3R A;  4J6Y A;  2P4T A;  2Y4X A;  2DXC A;  3F70 A;  2LEH A;  1K0S A;  3UA6 A;  1MUZ A;  1X2K A;  3CC7 A;  2XUE A;  1QVG P;  4BJM A;  4FCY A;  1CUN A;  2ODV A;  3I55 Q;  4IDO A;  1OPK A;  2HMA A;  3CC4 Q;  4M75 E;  5GAN 7;  1Z9Z A;  3N5L A;  1HG2 A;  5IUX A;  1ACM B;  4AIS A;  2LX9 A;  1BI0 A;  3H0H A;  3JAD A;  4LD6 A;  3ZMS B;  1T3L A;  3KVB A;  1QMC A;  5CIU A;  5KH6 A;  5GAO p;  5I2M A;  1ZA2 B;  3RES A;  3X1D A;  1JBM A;  5GAM j;  2F2X A;  2QA4 Q;  2NP9 A;  3QG1 A;  3E19 A;  3KV9 A;  3M56 A;  4DBF A;  2WMN A;  4FYY B;  3OYJ A;  2GGR A;  3AEF A;  2MPK A;  2K2V A;  1RAE B;  2CP5 A;  1T72 A;  2OX7 A;  2LM9 A;  3MEA A;  4RTT A;  1J1J A;  2IC9 A;  3ETU A;  2COW A;  3RMS A;  1Q82 C;  4QHO A;  4QVC A;  4EYY R;  1YNZ A;  3TRE A;  1UJ0 A;  3U3I A;  2E3I A;  2XG8 D;  2J6F A;  4RG2 A;  3K3O A;  4DR7 T;  3HL6 A;  1HXD A;  2XI9 A;  3A5Z B;  4FSX A;  4PKC C;  4KGX B;  2YDL A;  1QVG A;  3FIF A;  1J3T A;  2HKN A;  1YCY A;  1WRD A;  4AKI A;  1T8B A;  4TV8 E;  3I9Y A;  4JI5 T;  1AZE A;  1MV0 B;  3M57 A;  3VRB A;  3G71 A;  2ACZ A;  4KHP T;  3GNG A;  3RHW A;  4DVD A;  4L6V 5;  2YHT A;  4RTY A;  5IT9 E;  2HN1 A;  1VOM A;  3CCU T;  2CP7 A;  3IHR A;  2DTO A;  2DL1 A;  2LX7 A;  3ZEH A;  3K3Q C;  2ZM6 T;  2A28 A;  3HKB E;  1LVK A;  4M75 F;  3ETV A;  1NG2 A;  4UEM A;  2FZK B;  2LCL A;  2X3X D;  5HWX A;  5L8R E;  3CME Q;  4ZI2 C;  2QGG A;  2M9U A;  1YJW T;  4HVW A;  5AFU L;  3SWN A;  1ZUY A;  1H7C A;  2BZB A;  2C5I T;  1M2O A;  2PG8 A;  1HSQ A;  2DTI A;  1L0V A;  1VQP A;  3CCV Q;  2XQ7 A;  3UFG A;  1VQL A;  3CPF A;  2M0Y A;  4ZGD B;  2HH7 A;  3HKE E;  3QB5 A;  2WU5 A;  3S3O A;  2WSC E;  4PJO F;  3NVO A;  3HRU A;  2E1H A;  3R6O A;  5AQG B;  1LVF A;  1Q82 U;  2PTK A;  4F6R C;  3RKO A;  3IA3 A;  3BDU A;  4ISS A;  1K73 R;  3OYX A;  1VQM T;  1BIB A;  4M7A F;  4TUY E;  1FMK A;  4BDZ A;  2FL7 A;  3JB9 G;  1PWT A;  2RB6 A;  1XQH A;  1QCF A;  1Y7X A;  2LSK A;  4ELZ C;  4ZHQ E;  1QQJ A;  3I56 T;  2WQY A;  3UT1 A;  4AQF C;  2IVW A;  2MPX C;  4I55 E;  3AAE B;  4DV1 T;  3NHN A;  5ABF A;  5IWA T;  1AEY A;  4M77 B;  3JCM b;  4BB7 A;  3JC6 D;  1S94 A;  2KMF A;  4AFZ C;  4EMG A;  3OYH A;  3VR8 A;  1CKA A;  2AT1 B;  4C92 B;  2EYY A;  4IT4 A;  3E08 A;  2X9Y A;  2QGS A;  4HWD A;  4HWC A;  2NUT B;  4ILA A;  4KGZ B;  5ABE A;  1YD8 G;  4QXC B;  2X0H A;  5KYU B;  1P92 A;  3CXC S;  5AQL B;  2AE9 A;  2UUC T;  2CP0 A;  1BU1 A;  2DD5 A;  1OV3 A;  1Z9Q A;  2RQV A;  4A56 A;  2K6D A;  4HCK A;  1VQ7 T;  4HT8 A;  3ASK A;  5HCM A;  2DFU A;  2P9B A;  1WI7 A;  5LHH B;  3UUN A;  2E70 A;  5LJ5 f;  5CK9 A;  4PL6 A;  4CC2 A;  2QGF B;  1M7K A;  4UVB B;  1YBY A;  1JB0 E;  3N2O A;  4AKG A;  3M55 A;  1YI2 A;  1TTH B;  3E1S A;  2H7O A;  4AQG A;  2RHZ A;  1PC0 A;  1KFY A;  2DVE A;  4BY6 C;  3VYH B;  3HTR A;  2J6K A;  1NPP A;  4IDQ A;  1ZBX A;  1YCS B;  4ZXL A;  5FU6 C;  2RHX A;  4J9G A;  4LFA T;  5L3F B;  3PMT A;  4HFB A;  4F7U A;  1N36 T;  1OED B;  4PK5 A;  2F2V A;  3CCU Q;  2RPA A;  4JI3 T;  2X0Y A;  4M78 A;  1VIE A;  2DIG A;  4C8Q G;  1K9M R;  3RYF E;  1RL2 A;  4NUU A;  4WCI A;  5IHY A;  1VQO T;  1WLX A;  5GMK i;  2K5I A;  2HSP A;  4C8Q D;  3LLR A;  3CCM A;  4M7D C;  3IQL A;  4NPP A;  3QZ9 B;  3EHQ A;  5CGM A;  2DXU A;  1ZSG A;  4RTU A;  1C1A A;  3P4P A;  5KE2 A;  4HTE A;  1D1C A;  1MHN A;  1R8O B;  2C5J A;  1BI2 A;  2NLU A;  4MZT A;  3SOL A;  2QEX T;  2XQY A;  4TV9 E;  2RI5 A;  5LJ5 h;  4K0K T;  2DM1 A;  1G2B A;  4IUR A;  2EFI A;  2LQK A;  2E5V A;  2RMO A;  2XQ4 A;  3UU5 A;  5LBM A;  4JJN K;  4EZH A;  4GYR A;  2LRL A;  2COZ A;  1VQM Q;  3EGX B; 
#chains in the Genus database with same CATH homology
 2KXP B;  3Q5X A;  3JSC A;  4H9O C;  3JCM X;  3L3P A;  3KXT A;  2HPL A;  4M75 A;  2E6N A;  3L2U A;  1M8V A;  2PU9 B;  4XTU A;  3H8Z A;  4PJN A;  1BI1 A;  5CR2 A;  4QX8 B;  4IUP A;  2LNV A;  4EYU A;  4IUV A;  4ZGJ B;  5HAX A;  4H9S E;  3FHN A;  2PUO B;  4EDU A;  3G6E T;  3MAC A;  4B9X A;  5L3E B;  3QZ5 B;  3LFM A;  3GF5 A;  3RYH E;  1KD1 C;  3R84 B;  1KK7 A;  2RJC A;  3FJP A;  2XDB A;  2M16 A;  4V1A v;  3GNF B;  4EOZ B;  3MEW A;  5JR9 C;  3CVR A;  2K5L A;  2BVM A;  5GAM f;  3CQX C;  4P0B A;  4PW8 A;  2RI2 A;  2LHR A;  1WYC A;  2KT9 A;  2ZM8 A;  2RO0 A;  1Y64 B;  3X26 B;  3Q2M A;  2VK9 A;  5LYJ E;  4OF1 A;  1OZ3 A;  1N9R A;  3SDZ A;  3UUX B;  4M75 G;  4GK5 E;  2E8I A;  3G4S A;  2PVG B;  4M75 D;  3FBZ A;  2JJ9 A;  1LOJ A;  2DHR A;  1G8X A;  4JLG A;  3OYD A;  1WQW A;  2RHI A;  3CCR A;  3EFS A;  2WAU A;  5EZY E;  3AA6 B;  4PJO G;  2CLY B;  4M77 E;  4PJO D;  3CML A;  2QQB A;  1KD1 U;  2JZ2 A;  5GAM h;  1G3Y A;  4OHF A;  4M7A D;  3A8M B;  4OYJ A;  2VXF A;  2KY9 A;  4BDY A;  3CPZ A;  4BI8 B;  2CWY A;  3OW2 A;  4PNO A;  2NWB A;  1U8R A;  5C8Y E;  5E0O A;  3OYE A;  1S35 A;  3MHX A;  2LT1 A;  3GLX A;  1G3W A;  4C0D C;  2N2N A;  2I59 A;  4O2A E;  3ZFJ A;  2CZ0 B;  3EDV A;  3N2K E;  3NTH A;  3OYM A;  5D6Y A;  4C8Q B;  4JDS A;  1OI1 A;  2UXX B;  3N9Q A;  1UX5 A;  5L3D B;  3NBX X;  2F69 A;  2CA5 A;  3UWN A;  1M1F A;  1XOV A;  2E9X C;  3C98 B;  3JRZ A;  5LJ3 e;  1M90 C;  4QW2 A;  1YKH B;  3T9N A;  4JEU B;  3P8D A;  4TN7 B;  4OK0 A;  3FB2 A;  2NW9 A;  2LSG A;  2FHD A;  4IUQ A;  2DK3 A;  3NRY A;  3LYI A;  3C4W A;  4XTX A;  4GYS A;  3CCQ T;  3DLM A;  4LD9 K;  1Y96 B;  4ZOL E;  3AVS A;  3AAI A;  1M1K C;  1VQ6 A;  4IE4 A;  2EJ9 A;  1VQ5 A;  2QDY B;  3WVE B;  4C0Z A;  4QVD A;  1S72 A;  2VUB A;  3N5B B;  3LJC A;  3CPW A;  3PIP A;  2LRQ A;  4QXB B;  1VQN T;  3RKX A;  5IN1 A;  3CC7 T;  2GF7 A;  4AKR B;  1I8F A;  4WF2 A;  2XDP A;  4HEA A;  2A3D A;  3FBL A;  2DTH A;  5FP3 A;  1WJR A;  4O4J E;  3BY7 A;  2CS7 A;  4KUI A;  5FRM A;  3ZYM A;  4OVA A;  1VIF A;  4O6J A;  3KV5 A;  4L0R A;  4FJO A;  3S4U A;  2KAF A;  1K9M U;  4Q5W A;  3VV0 A;  3JCM c;  5GMK e;  1SSF A;  3NZQ A;  4OB1 B;  3OMC A;  3CCS A;  1KC8 C;  1VUB A;  1M1K U;  2YU1 A;  2OTJ A;  2W0G A;  2C06 A;  3GN5 B;  2X9X A;  3ZYL A;  2D9T A;  3MEV A;  3CX6 B;  3X25 B;  4RKU E;  3KV6 A;  1KQS A;  4M75 B;  3ZN1 B;  2RHU A;  4GOU A;  1UEB A;  1KQ1 A;  2RJF A;  2EIF A;  4OB2 B;  1JJ2 S;  3OYF A;  4MLK A;  1WQ7 A;  3PU8 A;  2A7Y A;  4UVA B;  5HXH A;  3LWH A;  4QQG A;  5M9O A;  2LSI A;  2BUD A;  4PJO B;  4UV8 B;  2LE8 A;  3PUS A;  2B8A A;  5LGT B;  4KUM B;  5L3G B;  1Y07 A;  3C94 A;  3O1H A;  5HK3 A;  3SRZ A;  4Y28 E;  4E7J A;  1AJ3 A;  3M65 A;  3JCM e;  4MDX A;  5CQX A;  2XD0 A;  2GQV A;  2EHO C;  1QVF A;  4YJ3 E;  2CE7 A;  4PJJ A;  5FNV E;  4CXW A;  3FLG A;  2ZM2 A;  4XU3 A;  1UGR B;  1IJ5 A;  1O9S A;  5H6R B;  1BIA A;  5HYA A;  3WAJ A;  1U1S A;  3S3M A;  2IC6 A;  4M77 A;  3GP8 A;  4LDW A;  2EWN A;  1WYB A;  1SHZ C;  4C8Q E;  1D3B A;  3IF8 B;  5LA6 E;  2LT3 A;  1B34 B;  3UDC A;  5GAN e;  1FMV A;  3ZC1 A;  4ZS3 A;  5JVD E;  4OGC A;  2LT4 A;  2IW5 B;  2D0Q B;  3OS2 A;  1MGQ A;  3UPU A;  1YJ9 A;  3RRW A;  4IUT A;  5CB4 E;  1KQ2 A;  4AKL A;  1YIT A;  4U74 A;  3VU3 C;  2EQM A;  2YLC A;  2VB6 A;  1HTJ F;  1VQ9 T;  2E12 A;  3SS1 A;  3RKY A;  3QYG B;  3AB3 B;  5F8P A;  4MFR A;  1IZN B;  5LXT E;  2I2L A;  4PLI A;  4M7D F;  2WBL A;  4PFP A;  2XAJ B;  2RH2 A;  3M54 A;  1VQ4 A;  5A1L A;  2A2F X;  5LCY A;  1WJS A;  2OTL A;  2CXL A;  3E9F A;  4C5H A;  3G7Z A;  4N4G A;  3OYL A;  3QPH A;  1IAP A;  1G3S A;  5GAN g;  2QI2 A;  3OJA A;  4KUD K;  4XBF B;  3CCM T;  1ZHC A;  3T8O A;  2XKO C;  1Q81 U;  4UC4 A;  2FYK A;  3FEO A;  4EMH A;  5JDQ A;  3OBW A;  4ZN3 A;  1G5V A;  1D0Z A;  3KIN B;  4J83 A;  1M5Q 1;  5DLQ E;  2VGM A;  2VYT A;  4UV9 B;  4XTY A;  2L5Q A;  1KHC A;  4OFZ A;  3NFC A;  1VQK T;  2PUK B;  3F57 A;  1B7T A;  1BI3 A;  3L1A A;  3P8B B;  3LGL A;  3VUB A;  2V8J A;  2YIN A;  3CEY A;  5HXE A;  3JCM d;  4FI5 A;  3MJX A;  2W00 A;  2ZPG B;  4II1 A;  4BE2 A;  1RI0 A;  4EXT A;  3HKS A;  2Y8D A;  1GXI E;  2YK0 A;  2Y48 B;  5J3B A;  4O4I E;  4C92 C;  1N9S A;  4PJO E;  4BAC A;  4VUB A;  3AVR A;  5J1G A;  1I5L A;  2LSY A;  5CAI A;  5L3C B;  4M7A E;  1K8A U;  4ZI2 D;  3GWH A;  2BKD N;  4ZTJ A;  5FY7 A;  2JTM A;  3M9Q A;  3R6N A;  3PIO A;  3C4S A;  3RC3 A;  5GAN d;  5J26 A;  3J80 E;  2VGN A;  4N0A A;  1IRE B;  3ZBD A;  3J7A F;  4BE1 A;  1N8R C;  1YKE B;  2EYQ A;  3S6W A;  2RM4 A;  3O9X A;  2Q9Q C;  5J2U E;  1LJO A;  4YTL A;  5IAY A;  3MKD A;  4RCB A;  3G4S T;  4B6X A;  1FEW A;  4C5I A;  3OYZ A;  2KVQ G;  3MCA B;  4QWN B;  5H6Q B;  1Q86 C;  4EMK B;  3HKC E;  1N6A A;  2VXE A;  4XZC A;  3CCR T;  1MIV A;  2XAQ B;  3Q5W A;  3E9G A;  3VUZ A;  2D2S A;  4CZZ B;  5KDM C;  2DWK A;  5KX5 E;  4WBO A;  2VWA A;  2KWI B;  4BUG A;  2LOP A;  4O4H E;  4X9C A;  3PDY A;  4IE5 A;  4DBR A;  1D0X A;  3GMI A;  3P7I A;  2YRV A;  4A53 A;  3HFO A;  3C50 A;  4IHJ E;  5D6W A;  4C8Q A;  3HP9 A;  4LDY A;  3X20 B;  4CXY A;  3OS0 A;  3OY9 A;  4UVC B;  5TAO A;  5JDH A;  3QYH B;  2BIV A;  1HS7 A;  5FU7 C;  3OYY A;  5L2L A;  3GIB A;  3HHT B;  1D3B B;  5CKB A;  3V5U A;  4OB3 B;  4M7D G;  3N9N A;  3DP7 A;  2E65 A;  2ZPE B;  3EDU A;  3I55 A;  4H9Q C;  3CC4 A;  4M7D D;  3A8H B;  3VKI A;  1Y96 A;  2DLR A;  3LX7 A;  2R58 A;  3TKL B;  3INZ A;  5DQW A;  4NUV A;  4H9P C;  4H9R C;  4ERR A;  2XAH B;  3N9L A;  2ZPF B;  5GAO m;  3RX6 A;  3IBP A;  2CZ1 B;  3QJ6 A;  4MBQ A;  3ZCJ A;  2VKH A;  4CI2 B;  1NZ9 A;  1VQ6 T;  5GAN 8;  1VQ5 T;  2A3L A;  2WAC A;  3K8P C;  3ZJ2 A;  3P8H A;  4DND A;  2Y4Y A;  3OB9 A;  1S72 T;  4C5G A;  3EAE A;  5C0M A;  2XTL A;  2QQS A;  5GMK l;  4YJ2 E;  2KWH A;  3RKW A;  4PFO A;  4JUY A;  4DMW A;  5IYZ E;  4JRI A;  2V7I A;  3ZMV B;  2HQX A;  3P8C D;  1M1G A;  1YHQ T;  2JVV A;  3J81 E;  4HCZ A;  2XHE B;  3CCE A;  5GAO r;  3ZC0 A;  5A0D A;  1IJ6 A;  2MI6 A;  3JCM W;  3CXC A;  3SWN C;  4ASK A;  3SB2 A;  4O8S A;  1VRB A;  4DQ2 A;  3IEE A;  4IGU A;  3GN5 A;  4HE8 A;  3CME A;  4Z02 A;  2KMT A;  5HXS A;  3CCS T;  2CCQ A;  3BDL A;  4P09 A;  5FMN A;  2GCX A;  5GAN 3;  1YJN T;  3CCV A;  5EK4 A;  2L3R A;  3CX8 B;  3KV4 A;  1VQ8 A;  4A4G A;  3EFR A;  2JPF A;  3UUL A;  2X35 A;  3PU3 A;  2RA1 A;  4PJO A;  4BD3 A;  1WR6 A;  1WJQ A;  5LJ3 f;  3CKD A;  3N9O A;  2QTX A;  4HKA A;  4HT9 A;  4TX5 A;  4ZI3 D;  4M7A A;  3RUX A;  1OZ2 A;  1KNZ A;  2V8K A;  4X9D A;  2JOY A;  2GFA A;  4MHC A;  4ELY C;  4QVZ A;  3L2W A;  3PUG A;  2K48 A;  1UB4 A;  2DD4 A;  3KVA A;  2R5M A;  4XAX B;  2ZPI B;  4ILU A;  2PVD B;  3Q9D A;  3OW2 S;  3PT9 A;  2LOS A;  2MWP A;  2M1H A;  2ACX A;  4BY6 B;  1YIJ T;  5LJ5 e;  4G2A A;  3OYN A;  5HXR A;  5FU6 B;  3B13 A;  2MTQ A;  3KBU A;  2XK0 A;  2K5B B;  4JS4 A;  1NJI C;  5LJ3 h;  3HFN A;  4M78 C;  1B34 A;  4BI3 A;  3HL8 A;  5EK2 A;  5DM7 R;  3CC2 A;  3KBG A;  2HAX A;  3M58 A;  4WNK A;  1U5P A;  1Z0P A;  4M7A G;  3CCU A;  1QP3 A;  4CRI A;  3VKG A;  4YHJ A;  4M7D B;  1QUU A;  2E41 A;  3CD6 T;  3PTA A;  3MEU A;  3CWZ B;  3DTO A;  3W15 B;  4BAY B;  2E9X D;  4E7S A;  1YIT T;  5LJM A;  1X79 A;  2MOZ A;  2PJQ A;  5CQY A;  4L5G A;  3J7Y q;  3CCL T;  2V1D B;  4FT2 A;  3C4Z A;  4MMK A;  5LJ5 g;  4NL3 A;  5LHG B;  3A8G B;  4M75 C;  4YLH A;  4QX7 B;  4XU1 A;  3OYA A;  3HI2 A;  3ER0 A;  2EQK A;  3OKQ A;  2OTL T;  1D0Y A;  3TEE A;  3N2G E;  3QKJ A;  3JCM Q;  2XIC A;  2XAF B;  2IG0 A;  3KBT A;  2E6Z A;  4PK4 A;  2YEV C;  4QQD A;  3PUA A;  2DZC A;  4P0A A;  2XDD A;  2ZPH B;  3WI3 A;  1LRZ A;  3PUQ A;  3MP6 A;  3OS5 A;  2CGH A;  3RER A;  2R57 A;  2PQW A;  1VQ7 A;  3OMG A;  2HNI A;  5GON E;  2DIQ A;  1ZV4 X;  2VV5 A;  4QKN A;  5CKE A;  2EQU A;  2LQ8 A;  1FMW A;  5JDL A;  2L89 A;  3FXD B;  4C92 F;  4ATO A;  1EZ3 A;  3LBX B;  1UGS B;  2AHJ B;  5GAM e;  2K5F A;  1W2B S;  5I21 A;  1H64 1;  1LKX A;  5CKD A;  3ANW B;  2VL8 A;  3HA4 A;  5CA0 E;  1Y71 A;  2DCF A;  2R5A A;  2EJF A;  5FYM A;  4MZM A;  1M90 U;  4E47 A;  3CQC B;  5LJN A;  5LJ5 d;  5JRE A;  3AAA B;  5DJQ C;  2Y6X A;  3AA0 B;  4KMC A;  5FXV A;  2QEX A;  3UTK A;  1MMG A;  3LK3 B;  2H7V C;  1QP2 A;  4JEH B;  3NRX A;  3C12 A;  2XID A;  4MAL A;  5KCO A;  2JTF A;  3H37 A;  2G3R A;  2L3L A;  2UXN B;  3X28 B;  5DQV A;  5LBQ B;  2MAM A;  2XAS B;  5GAM g;  3V5S A;  2EHO D;  1MIW A;  2KZ7 B;  2BDE A;  5ADX L;  2XHC A;  4EMK A;  3G71 T;  1OXZ A;  4C0D B;  3ZEF B;  3C4X A;  4M1P A;  3H6Z A;  4U72 A;  3OYB A;  4XTZ A;  1IZ6 A;  3QSU A;  2EQJ A;  4BE0 A;  2NW7 A;  1O75 A;  3LGF A;  3QK6 A;  4M7A B;  3RH3 A;  2RHY A;  2L8D A;  1FXX A;  3G6E A;  4E7I A;  1VQP T;  2E9X B;  4M7D E;  1VQL T;  2RK1 A;  1KC8 U;  3RYC E;  3EVY A;  3M4G A;  2HBP A;  3OSS C;  5LNK A;  2RA2 A;  5KCH A;  2YU2 A;  2BVL A;  2XU8 A;  3I0O A;  4OGE A;  3VYG A;  3L2V A;  2KSS A;  4J7F A;  3QO3 A;  2ZCF B;  4OP0 A;  4C5E A;  2C5K T;  5JRC A;  3FRN A;  1X75 C;  2LJL A;  1JJ2 A;  3UUM A;  2K4Y A;  4IE6 A;  3GPL A;  2X4Y A;  3HRT A;  3PMI A;  2MMP A;  5J39 A;  1O3X A;  2QA7 A;  3ZN0 B;  1XTD A;  2CZ6 B;  5JDM A;  4X20 E;  2ODU A;  3DLL A;  2NTX A;  4MML A;  2W62 A;  5GAM d;  4ZI7 E;  3NZP A;  1ZKE A;  4EPC A;  2CEA A;  3JB9 F;  2XAG B;  4DA4 A;  4IST A;  2X4J A;  4PAG A;  1YI2 T;  2N1G A;  2PVO B;  1ZHI A;  4I50 E;  4JLI A;  2P0P A;  2QQA A;  4H63 H;  3PNW C;  5FY1 A;  3DB4 A;  1KG1 A;  1U4Q A;  3OQ5 A;  5CCA A;  1KHI A;  3ESL A;  2V7L A;  1X01 A;  4AXP A;  4EAH A;  3URG A;  5GAO n;  2FVU A;  5JH7 E;  1HF8 A;  2WMO A;  3JB9 I;  4HA8 A;  4GY5 A;  1D1B A;  5AYF A;  4ZN1 A;  3CQG B;  3M53 A;  1PSE A;  2RP4 A;  5BMV E;  4BA9 A;  2DNX A;  3CCE T;  5FXZ A;  1UCU A;  4ME7 A;  4RG8 A;  3NTI A;  3SFM A;  5CKH A;  2J1D G;  4C92 D;  5GAN 5;  1TH7 A;  3DJB A;  4I4T E;  2K24 A;  3PTR B;  2C0S A;  3CCQ A;  3FC3 A;  4ANJ A;  4X34 A;  2EHO B;  4J2C A;  5LJ3 j;  4E7Z A;  1QVG S;  2X9W A;  3PE0 A;  1BR0 A;  2V7M A;  5GAO q;  1HX8 A;  4X1Y E;  2DI4 A;  3VHL A;  2OAU A;  4DOV A;  3D0T A;  5CO7 A;  1VQ8 T;  1MIY A;  4M77 C;  4AQF A;  5ETW A;  3DKM A;  5HK0 A;  1VQN A;  2LCC A;  1LNX A;  2LTO A;  5CA1 E;  1FWZ A;  2Q9Q D;  3A8L B;  1H3Z A;  5JQG E;  4GK0 E;  2OA5 A;  3B57 A;  5A2Q E;  4O5V A;  4A4K A;  3WXM B;  5J2T E;  3K3N A;  4H63 V;  2DKG A;  4X1I E;  2Y90 A;  3O1J A;  4UEL A;  4F7U F;  5M4Y A;  4M78 F;  4MDW A;  5A0L A;  2VKO A;  3HR0 A;  1NPR A;  1G73 A;  4LDV A;  3A8O B;  5HXC A;  5DAB A;  1BYM A;  3N9P A;  4CI1 B;  4UF0 B;  1QSD A;  3H3A A;  1ZEE A;  1FIO A;  2PBI A;  3MP1 A;  5GMK j;  3RRC A;  4XTV A;  4J7I A;  4FU6 A;  4M7D A;  4CQI A;  3CC2 T;  3CBM A;  3A5X A;  4OMF B;  3TCJ A;  3L42 A;  3ZLI A;  4PK6 A;  3PFS A;  4HGA A;  4WW0 A;  4J6X A;  1UGQ B;  4N78 D;  1N8R U;  1E1H B;  4JRP A;  4C0G A;  4Z8X A;  2PFV A;  2YLB A;  2LC4 A;  1UGP B;  4NS5 A;  4EZ4 A;  2QQR A;  3L09 A;  2JUF A;  3CCJ A;  2ZMA A;  5DY9 A;  1Q86 U;  1US7 B;  5JRC B;  2MYS A;  4L59 A;  3L2R A;  1W4S A;  3JB9 D;  3ME9 A;  4E7K A;  2HQE A;  1I81 A;  1EIF A;  3DB3 A;  2V7J A;  1V9D A;  2DWG A;  2DPP B;  4O4L E;  2D5U A;  4UIG A;  4CI3 B;  5JR9 A;  2X67 A;  2RI3 A;  3E22 E;  3CBO A;  2K9A A;  2QA4 A;  1BR4 A;  2O4X A;  3V8L A;  1VQ9 A;  1DJ7 B;  3S3N A;  4DO0 A;  5GAN j;  3LBX A;  2DO3 A;  3LW5 E;  4A4F A;  4N0A C;  3EUH A;  5FRO A;  3ANW A;  3MK7 C;  2EKO A;  3OYK A;  3O1I A;  3OS1 A;  3JCM V;  2V26 A;  3JC6 C;  4C0F A;  3X24 B;  3KUF A;  2D0U A;  2X66 A;  4DBQ A;  1XNI A;  2D0T A;  1JRI A;  2F5T X;  3BW1 A;  2Q9Q B;  2CLY C;  4HCC A;  4UXN B;  3KDS E;  3MXZ A;  3QC9 A;  1MNE A;  4NOY A;  1ZQ1 A;  3PGG A;  3CMA A;  3M4Y A;  2K57 A;  2DZ9 A;  5CVI A;  5JDG A;  5LOV E;  3OBV E;  4CI0 C;  2NW8 A;  3JCM J;  4ADZ A;  2OTJ T;  2O01 E;  4FIB A;  3V7R A;  5GAN 2;  3LK4 2;  2HPJ A;  3RPU A;  2JNG A;  3LH0 A;  4KBM B;  1VQK A;  4OB0 B;  4C8Q C;  1YW0 A;  4K0U A;  2V8I A;  3TU4 K;  3V8K A;  4AI6 A;  4F7U G;  4PNI A;  4XU2 A;  2DJZ A;  4M78 G;  2HD0 A;  2ZZD A;  2E5Q A;  2E9X A;  2M0O A;  4M78 D;  5LL6 S;  5FU7 B;  4D6W A;  1SA0 E;  2V7K A;  1D1A A;  3I0Q A;  5HKC A;  1T98 A;  2E10 A;  1MND A;  4IDZ A;  3ZMU B;  3HSB A;  4FT4 A;  5I2S A;  5LHI B;  3OSV A;  2KLQ A;  2VKJ A;  4R55 A;  4B9W A;  3F31 A;  3JB9 H;  3BFM A;  3VKH A;  2JMH A;  2KQW A;  4KT0 E;  3BQI A;  2FB7 A;  1PSF A;  3LWI A;  2LHN A;  4ZI3 C;  3J9X 1;  1V29 B;  4IUU A;  5F3J A;  4JRK A;  2RJE A;  2RK2 A;  2CXF A;  4XK8 E;  1YJ9 T;  1YJW A;  4J8O A;  1G3T A;  1K73 C;  5FLX E;  4X1K E;  2CXD A;  3FB9 A;  1QVP A;  4OYK A;  5LGU B;  1AHJ B;  3ZJ1 A;  4C92 E;  4JUV A;  1NAF A;  3UFE A;  3LG7 A;  3SWN B;  1WGS A;  3ZMZ B;  1VQM A;  2X4X A;  4BI4 A;  1VQ4 T;  5GMK m;  3JAM E;  2VC8 A;  3HRS A;  3RYI E;  1BR1 A;  3CPW S;  3V7C A;  1NJI U;  3HKD E;  1WNL A;  1MMN A;  3I56 A;  4PJO C;  1N27 A;  5GAN 6;  5GMK h;  3QUJ A;  3OA6 A;  2L9Q A;  1I4K 1;  3RIR A;  4FL6 A;  5FXX A;  3ZYK A;  3JCM f;  3FDR A;  2JRK A;  4M7A C;  5LP6 E;  3OYI A;  2ES0 A;  1HK9 A;  2NOX A;  2Z6E A;  1MMA A;  3MA9 A;  1K73 U;  5LG4 A;  4E7L A;  5DLO A;  4N4H A;  5D6X A;  2GFU A;  2ZLY A;  5CKF A;  2ZM0 A;  5JR9 B;  3LK2 B;  2EJG A;  2EHO A;  4M77 F;  2LDM A;  1K9M C;  3Q1J A;  4C91 A;  3OYC A;  2O4X B;  3AA1 B;  5LGN B;  4O2B E;  2DAQ A;  2WSF E;  4ZGE B;  1KQS S;  2CZ7 B;  2G0U A;  2N9D A;  1HG5 A;  5GAN f;  4I43 B;  3CX7 B;  4JLE A;  3V8J A;  4G63 A;  1X6O A;  2DXT A;  4YFS A;  2E64 A;  2X0L B;  2VAS A;  2NTY A;  1VQO A;  1OWA A;  2SPC A;  3WVD B;  4F7U B;  3JCM h;  4BJN A;  4XQ3 A;  3JB9 J;  3HPW A;  3M5A A;  5EG2 A;  3ONX A;  3C95 A;  3AHU A;  4M78 B;  4N4I A;  4L9I A;  3OYG A;  3BQL A;  2KDS A;  1Q7Y C;  1YHQ A;  5FRN A;  4QXH B;  5LJ3 g;  4R56 A;  1WPY A;  2WWU A;  4PJL A;  2DEQ A;  3QII A;  2M67 A;  4GIW A;  3MZK B;  3JCM P;  3GOX A;  1QVF S;  4IE0 A;  1NE8 A;  3QHS A;  2CMR A;  4H9N C;  4UF0 A;  3I1A A;  5KMG P;  4DOW A;  4HKE A;  3SWH A;  4IKF A;  3FXE B;  2GK9 A;  4AKH A;  5GAN h;  1YJN A;  4LDU A;  3ZCI A;  2JQQ A;  3QXE B;  2MWO A;  1W2B A;  2LSJ A;  4KUL A;  1HFA A;  3SD4 A;  2B1E A;  3F2E A;  4IIJ E;  2W63 A;  2VKD A;  2X9H A;  3OBY A;  5L3B B;  5JDN A;  3VJP A;  4ZS2 A;  2H3J A;  4FM4 B;  1Q7Y U;  2X68 A;  3ZMT B;  4TVR A;  2KIN B;  3I9W A;  3ZPO A;  4MZP A;  2CWO A;  3UT5 E;  5A0G A;  5FY0 A;  5KE3 A;  3L2Z A;  2JN0 A;  2MBG A;  5JDF A;  4HCB A;  4P5N A;  4J5Y A;  4Y91 A;  5GAN 4;  3C51 A;  4TZ4 C;  3QUI A;  1UX4 A;  2X51 A;  3CBP A;  3NTK A;  2KK4 A;  3MP8 A;  3O8V A;  5LJ3 d;  4XTW A;  1YIJ A;  3PUR A;  1BKB A;  1U1T A;  3CCJ T;  3BK9 A;  3N9M A;  1M4Z A;  4J6W A;  4HN9 A;  4WBN E;  5EK3 A;  4EB6 E;  3C64 A;  2QQ9 A;  2L8K A;  4C92 A;  4PJM A;  3I55 T;  3CC4 T;  3VU7 H;  5LJ5 j;  2CM0 A;  3CD6 A;  1Q81 C;  4CXX A;  2X4W A;  2JMK A;  4QQ6 A;  4EIW A;  3JCM g;  3U78 A;  5HY6 A;  4NL2 A;  2QA4 T;  2CKK A;  4IE7 A;  3M59 A;  4PLL A;  2ZGW A;  4JRQ A;  3CCL A;  1FX7 A;  4JS5 A;  4HFV A;  4E7H A;  4DMV A;  4LDX A;  2Q9Q A;  3RMQ A;  2DXB A;  1BR2 A;  4V2S A;  2LVM A;  3V7S A;  4EMK C;  1QW1 A;  2RD1 A;  3AA7 B;  1HCI A;  2QXF A;  2WSE E;  4M77 G;  4F7U E;  4A54 A;  3BQK A;  2P0K A;  3L2Q A;  5HWY A;  3QJY A;  2IAK A;  4M77 D;  4C92 G;  4M78 E;  4A4E A;  4C90 A;  2MF2 A;  3MET A;  1OYX A;  2KND A;  2D6F A;  3RC8 A;  3CMA T;  3GA8 A;  2EAY A;  2A72 A;  2ZPB B;  4C8Q F;  3KFW X;  3QDR B;  2K3X A;  5C6S A;  3CME T;  1M9S A;  1MMD A;  3MO8 A;  4GLK A;  2P0Q A;  4RMO A;  1K8A C;  3CCV T;  2RJD A;  3E0Z A;  3O4X E;  4A4H A;  2K3Y A;  4XU0 A;  4RCC A;  4ZTF A;  2CYZ B;  5FXW A;  2W61 A;  3QBY A;  3WAK A;  4KP3 C;  2WSS V;  5GAO l;  2F5K A;  1NWM X;  2WM9 A;  4J6Y A;  2H3R A;  2P4T A;  2Y4X A;  2DXC A;  3F70 A;  2LEH A;  3CC7 A;  2XUE A;  4BJM A;  1CUN A;  2ODV A;  4M75 E;  5GAN 7;  3N5L A;  1HG2 A;  2LX9 A;  1BI0 A;  4LD6 A;  3ZMS B;  5CIU A;  3KVB A;  5KH6 A;  5GAO p;  5I2M A;  3RES A;  1JBM A;  5GAM j;  2NP9 A;  3QG1 A;  3E19 A;  3KV9 A;  3M56 A;  2WMN A;  3OYJ A;  2K2V A;  2LM9 A;  3MEA A;  2IC9 A;  3ETU A;  1Q82 C;  3RMS A;  4QHO A;  4QVC A;  4EYY R;  3TRE A;  3U3I A;  2XG8 D;  4RG2 A;  3K3O A;  1HXD A;  3HL6 A;  2XI9 A;  3A5Z B;  4FSX A;  4PKC C;  1QVG A;  3FIF A;  1YCY A;  1WRD A;  4AKI A;  4TV8 E;  3I9Y A;  3M57 A;  3G71 A;  3GNG A;  4DVD A;  4L6V 5;  2YHT A;  5IT9 E;  1VOM A;  3CCU T;  3IHR A;  2DTO A;  3ZEH A;  3K3Q C;  3HKB E;  1LVK A;  4M75 F;  3ETV A;  2LCL A;  4UEM A;  5L8R E;  5HWX A;  4ZI2 C;  2M9U A;  1YJW T;  5AFU L;  3SWN A;  1H7C A;  2BZB A;  2C5I T;  2PG8 A;  2DTI A;  1VQP A;  1VQL A;  3CPF A;  4ZGD B;  2HH7 A;  3HKE E;  3S3O A;  2WSC E;  4PJO F;  3HRU A;  2E1H A;  3R6O A;  1LVF A;  1Q82 U;  4F6R C;  3RKO A;  3BDU A;  4ISS A;  3OYX A;  1VQM T;  1BIB A;  4M7A F;  4TUY E;  4BDZ A;  2FL7 A;  3JB9 G;  2RB6 A;  1XQH A;  1Y7X A;  2LSK A;  4ELZ C;  4ZHQ E;  3I56 T;  3UT1 A;  4AQF C;  2IVW A;  4I55 E;  3AAE B;  4M77 B;  3JCM b;  4BB7 A;  3JC6 D;  1S94 A;  2KMF A;  4EMG A;  3OYH A;  4C92 B;  3E08 A;  2X9Y A;  2QGS A;  1YD8 G;  4QXC B;  3CXC S;  1P92 A;  2DD5 A;  4HT8 A;  4A56 A;  1VQ7 T;  3ASK A;  2P9B A;  5LHH B;  3UUN A;  2E70 A;  5LJ5 f;  5CK9 A;  4PL6 A;  4UVB B;  1YBY A;  1JB0 E;  3N2O A;  4AKG A;  3M55 A;  1YI2 A;  3E1S A;  2H7O A;  4AQG A;  2RHZ A;  4BY6 C;  2DVE A;  3VYH B;  1NPP A;  1ZBX A;  5FU6 C;  2RHX A;  5L3F B;  3PMT A;  4F7U A;  4PK5 A;  4M78 A;  1VIE A;  2DIG A;  4C8Q G;  3RYF E;  1RL2 A;  4NUU A;  5IHY A;  1VQO T;  1WLX A;  5GMK i;  2K5I A;  4C8Q D;  3LLR A;  3CCM A;  4M7D C;  3QZ9 B;  2DXU A;  5KE2 A;  4HTE A;  1D1C A;  1MHN A;  1R8O B;  2C5J A;  1BI2 A;  2NLU A;  4MZT A;  3SOL A;  2QEX T;  2XQY A;  4TV9 E;  2RI5 A;  5LJ5 h;  4IUR A;  2EFI A;  2LQK A;  5LBM A;  4JJN K;  4EZH A;  4GYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...