4KBMB

Structure of the mtb card/rnap beta subunit b1-b2 domains complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
148
Chain Sequence
b'IFKVGDTVVYPHHGAALVEAIETREQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit beta
publication title Structure of the Mtb CarD/RNAP beta-Lobes Complex Reveals the Molecular Basis of Interaction and Presents a Distinct DNA-Binding Domain for Mtb CarD.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transcription
total genus 41
structure length 148
sequence length 159
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kbmB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kbmB01
4XAXB 4ILUA 2LQKA 4MFRA 2LT1A 4KBMB 4KMCA 2LT4A 4L5GA 2LT3A 2EYQA
chains in the Genus database with same CATH superfamily
2B86A 1N5ZA 3G71Q 3ZBDA 2PNIA 3CPZA 1N6AA 3EGXA 1TUCA 1ZSGA 3TKLB 4OK0A 3HL6A 2C0IA 2CZ1B 2DE0X 3UF4A 1HYOA 1XTDA 2CWYA 3TLTA 4J9CA 4B9WA 2EYXA 4JI4T 4FYVB 4PJLA 3X26B 4IE5A 3VUBA 4JLEA 2O2OA 4MDXA 1MIWA 4DMVA 5AQKB 4KGVB 3TU4K 5ABFB 2VUBA 3BW1A 2XPKA 4AMCA 5JR9A 3RUXA 3ZFJA 2W62A 2XQ9A 2KLQA 1I6ZA 1IGQA 2C5IT 3QJ6A 1ZHCA 4F7UB 2OAWA 5HY6A 5ETWA 2E9XB 3EAMA 2BS3A 3VR9A 4U7YA 2DTOA 5J2TE 2HMAA 1OULA 2X51A 3ZCJA 5JDQA 1NYGA 4LMLA 5GMKi 2MOZA 2DFUA 2JW4A 1YBYA 2BBHA 3H3MA 4ZN1A 4Z88A 3ZYMA 1RAEB 4HE8A 4C5GA 2CKKA 2X9WA 3TEEA 3P8BB 5LBQB 4TN7B 1VQ5T 2X9HA 3QG1A 4EZHA 4Y92A 3OYYA 2QEXT 2LT3A 3JB9D 1TG0A 2DBMA 4DV7T 3G06A 2IAKA 4WNKA 4JZ3A 4NS5A 5CB4E 4DUZT 5F5WA 1IHVA 4JRPA 5L3FB 2K3YA 4JI1T 3C4XA 3PMTA 2LSIA 3UU5A 4IUPA 1E6HA 4QH5A 5EK2A 2ROTA 1BU1A 1TUDA 2J6OA 4J8OA 1HG2A 2RMOA 2VV5A 5FL0A 2DL1A 1UGPB 2VXFA 4RTYA 2QA4Q 2CA5A 5HXRA 2X35A 2A0FB 3ETVA 2EQIA 2FVUA 4O5VA 5LOVE 4IDOA 2ODUA 3CPWA 4F6RC 3UUBA 1NM7A 5AQUB 1OZ3A 3I56A 2CP0A 2J6KA 2V7IA 2ACXA 1SKUB 1ZA1B 2FO0A 1YHQT 1KQSS 1N9RA 5FXVA 4X1YE 4KGXB 3QK6A 1WXTA 3JB9F 3ZYLA 3CCRT 3MA9A 4B3RT 4HTEA 2GFAA 3I55A 5DM7R 2YDSA 3RHWA 1BK2A 2M0YA 3OTOT 5KYYB 2IDOB 3KBTA 4MZTA 5AFUL 3JC6D 1Z0PA 4YXDA 4X20E 4DR7T 1B34A 3EG1A 2A72A 1VUBA 2D8JA 2F69A 4OB0B 2LP5A 1IJ5A 1YJ9T 2JMHA 4MZMA 5JTGA 2VWFA 4ILAA 2DK3A 1MMNA 4EB6E 2FJEA 2LM9A 2SPCA 2GF7A 3EFOB 4OMFB 1V29B 3C50A 2X0LB 3EHZA 1CSKA 4E47A 4N4HA 2VVNA 3EAEA 3CK6A 2PUOB 2V6YB 4Q5WA 1I81A 1VQ8Q 4C8QA 3PUWF 3P4QA 2EYZA 1JNZA 3ZT6A 2XQ6A 1IO6A 4TWFA 4BA9A 1S72Q 3AE5A 3NVOA 2Q9QC 5AQVB 2DLRA 3ONJA 4WF2A 2Y8DA 3CCVT 4KUDK 3RC8A 1RUWA 3V8LA 3CCJA 3EH2A 3OW2A 2DEQA 4UV9B 5DQVA 2PUKB 3A8GB 5A1LA 2FBWA 3I9YA 1WZOA 3ANWB 2I2LA 3GA8A 1ZSZC 2DMOA 4DV4T 2WP9A 2FB7A 4ZGJB 5LGNB 1WQ7A 1HXDA 3SDZA 4U33A 1U5SA 4WBOA 5ABHA 1W70A 3UFEA 2CBIA 1G83A 1G3WA 1ZA2B 3WVDB 2JPFA 4IGUA 4EDUA 5LJ5g 4O4LE 3BK9A 2VVKA 2KT8A 4MFRA 1Q95G 1R0CB 3ZMUB 3SHWA 3CCSA 4NIQA 2K3WA 2EQKA 4C0DB 4UELA 1PSFA 3GNGA 3L1AA 2CH4W 2V26A 4R0KA 1SE7A 4JPBW 1PD0A 2K2MA 5C6SA 1VQLA 3RYIE 2UXDT 3EHRA 2ZM6T 3LDQB 2BKDN 1M3BA 4RG2A 1YITT 2O4XA 3AE3A 3B13A 2EYQA 1WFDA 5KYXA 4EGWA 3E1SA 2L8DA 4YLHA 2W63A 3VS0A 3HSBA 3C4SA 3PJAA 4MHCA 4LXCA 2CLYB 5FW9A 4I55E 3GBQA 2IHR1 4N78D 2KR3A 4GBQA 5J3BA 2E8IA 4E7SA 3VUZA 4C8QE 4PKCC 2VKJA 3E22E 1W4SA 4FYXB 4GKJT 4F17A 3JAME 3MEWA 3PFSA 2W00A 1ZQ1A 4EYUA 5FL1A 3JCMd 4JJCA 3O9XA 1SG5A 3SB2A 1T0HA 4GK0E 3M56A 4DBFA 3QHSA 3LW5E 3P4WA 1Q7YR 1D1CA 3OYAA 3LH5A 3QNUA 4FI5A 3ZMTB 2VL0A 4CI3B 1UE9A 3DJBA 3VS7A 1WR0A 3L42A 2VYTA 5IUXA 4C92C 3VKHA 3BFMA 3VRAA 4ZI3D 4OGEA 3WI3A 4M7DA 2CT4A 3M0RA 2JXBA 1EFNA 1YWOA 1KFYA 3ONXA 4N0AC 3MZKB 4DEYA 1K9MU 5H6RB 4JS4A 1TXQA 4M77A 4M75D 5AQRB 3UT1A 2MWPA 1UG1A 2RQTA 2RHIA 1XZYA 4FT4A 4XTXA 2QEXQ 2ZM8A 4OX9T 2D0UA 3L09A 3HKEE 3AE1A 1X79A 2BZYA 4X1VA 5LMNT 3RIAA 3ESLA 5ABGA 3CX6B 1QMCA 2HQHA 3E9GA 2CGHA 3L2UA 2JQQA 4QHOA 3T1HT 2HBPA 3LK2B 4ERRA 1AOJA 4X1KE 2RB6A 3UATA 1OV3A 2COYA 2P4RA 3GNFB 1PRLC 5LJ3j 1K9MC 4JI7T 1CKAA 5HEUA 3AEBA 2WAUA 4JI0T 3FXDB 2JOYA 3CC7A 1PKSA 4M75F 4J5YA 4CXWA 2XG8D 3X1DA 4QVCA 1YHQQ 4M78D 3ZL7C 4V1Av 2RQWA 4M7DE 2V5DA 1G2BA 4NUUA 1WA7A 2KRNA 2YRCA 3CCRQ 1BIAA 2M1HA 4GIWA 4HWIB 4QW2A 3EUHA 2WSFE 2J06A 3REBB 5ABFA 3KXTA 2F5TX 4N4IA 3KV6A 3AE4A 4M77E 3AAIA 5FXXA 1X69A 2QGFB 1HJDA 1N33T 2FL7A 1LCKA 4JRQA 3OS2A 1VQ9T 1WJRA 2JM8A 1G8XA 3PIOA 2HZYA 4XTVA 1XQHA 4F7UA 2YKSA 2KYMA 4C5HA 1QVGA 3UDCA 3PIPA 5CK9A 1YJ9Q 4J6XA 2Q9QD 2R5AA 5GANe 2XU8A 1U8RA 3PUAA 3VKGA 2EYWA 3FJPA 2XKOC 2A28A 2B1EA 1RAFB 5HYAA 4UV8B 2K24A 2CH4A 3JCMX 1JU5C 3FC3A 2MPKA 4JJBA 2DWGA 2HQXA 2SRCA 5C2TA 5JDHA 4M78F 1UEBA 2A3LA 3HPWA 2C0TA 3V5SA 1AT1B 1C6VX 4NXMT 2IC9A 4CZZB 2XASB 2BE9B 4K11A 5CKHA 1VQOA 3CCVQ 2KXDA 2BKNA 5IHNA 2JVVA 2DTIA 1J3TA 1KF6A 3BQLA 1H8KA 2K5LA 3JAFA 2B8AA 2KAFA 1RLQC 3B5MA 4PFPA 4J9FA 1Y57A 1BI0A 5HAXA 2YLCA 1YCSB 2LM2A 1SHGA 2GBQA 2V1RA 1YI2A 3M0PA 2LCCA 4HCZA 3A8HB 1MIYA 1VQMA 5LJ5h 4F8HA 2J6FA 4NOYA 3AXJB 3MHXA 5JH7E 5HEHA 4DV2T 4JYAT 2Q9QB 2K3BA 3QXEB 1BI3A 3EG0A 4MMKA 4CI1B 4FT2A 5GAMe 5LP6E 4AKLA 2QTXA 1UCUA 3HFOA 5EK4A 4X9CA 1ZSZB 3M0SA 4F7UE 1YITQ 2C0SA 2IIUA 4KHZF 2O88A 1OPKA 4RTWA 1X2QA 2F2WA 2ZM0A 2XAHB 3RRWA 4UC4A 1FMWA 2GNCA 5GONE 2OAUA 3OB9A 1P92A 3I9QA 3QPHA 4OP0A 5KYYA 4GYSA 1V1CA 1MIVA 4TUYE 1RAHB 1FMKA 2LNVA 4OMLA 1ARKA 1WYBA 3EDVA 1VQ4T 2KSSA 1YJNT 4C92D 4ANJA 2X4YA 3ZMZB 4XU0A 4COFA 1S35A 1IHWA 4CQIA 3EFOA 3AECA 5AQOB 3I0QA 4QH4A 1NZ9A 1YWPA 1YJWA 4UIGA 2V6YA 2J7IA 2FEIA 4J7FA 4ZGDB 1DJ7B 3ETUA 2QGGA 4X9DA 3PU3A 2DHRA 4YTLA 3JSCA 5FRNA 4ME7A 4FL6A 1IB8A 3JB9I 4JI3T 3Q2MA 2UU9T 5LJ5f 2WWUA 5HXHA 2L3RA 1NE8A 2MOXA 1VQPA 5BR8T 1JJ2P 5HCMA 2JT4A 1QP2A 3PVLA 5CJ5A 3ANWA 2QQBA 3G1JA 4RCCA 3JV3A 4JRKA 1KQSA 3CC4A 2YINA 4AISA 5JRCB 3RYFE 1LOJA 3QBYA 3E9FA 2JQ9A 2CPTA 3H0HA 1M7KA 5A0LA 4KRTA 2FPEA 2L2PA 1E2AA 4QKNA 4C92B 4MALA 4XTWA 1C0MA 3O8VA 2BZBA 1YKHB 2E5QA 4ZXLA 1VYTA 4IDQA 2ZCFB 4HVWA 4QQ6A 5AYFA 4CC4B 2EHOD 1Q86R 4JI2T 2DX1A 4BI8B 2VVSA 3JCMb 2DL4A 2EGCA 4DR1T 3HTRA 3OMCA 3QB5K 4II1A 3Q5WA 3REAB 3O5ZA 2XICA 4FJOA 4IDZA 4Q25A 4UF0B 3OPCA 3IA3A 1OU8A 2KMTA 1WHLA 3SFMA 2JQHA 3PUQA 3QDFA 4GLMA 4JLIA 1VIEA 4TVRA 3N2KE 1KD1R 2EKHA 2M51A 4DBHA 1S94A 1Q82C 3KFVA 5D7UA 2CHOA 5GAOq 1NWMX 1RADB 4LF7T 3HHTB 4LE9A 2OI3A 1OX8A 2LOPA 1OEDC 5CA1E 5GAOr 2LKHA 1O9SA 3K8PC 1U4QA 5A0GA 9ATCB 2GQVA 4B3MT 3N2GE 2C06A 3OS1A 4QX7B 4FIBA 2MYSA 1VQ9Q 2BIVA 1Q81R 5FP3A 2Y48B 2LSYA 2RHYA 4EV6A 4B9XA 3N9MA 3T8OA 5L3DB 3VRBA 2MI6A 2PVDB 2X4XA 2CYZB 2MIOA 2K3XA 1FYNA 5CA0E 1BCMA 2KMFA 3CMEA 2DWKA 3M65A 1SRLA 2V7JA 1V76A 1WYXA 2HNIA 1QVFP 1R0BG 2P9BA 4CI0C 8AT1B 5FMNA 2IMLA 2G0UA 3M58A 3OYIA 2XSBA 3I56T 4LUEA 2QYZA 1HD3A 1X9BA 2LT4A 3J81E 1SSFA 2E6NA 2JN0A 2EKOA 3KVBA 2AZSA 2DXUA 3P4PA 4AQFC 3ER0A 3CC2A 5FLXE 3I55T 2CP7A 1LNXA 2KT1A 4ZI7E 5CGMA 4PLIA 2HKNA 1VIFA 4KBMB 1FEWA 1NENA 2L8KA 3J7Yq 3V8KA 4ZZCA 1HFAA 4BI4A 2DNXA 2V8KA 1H641 4AG2C 4X5TA 2EGAA 3AA1B 2FZKB 3EG9B 5GJVB 5L3CB 3N2OA 3CD6Q 3CVRA 2LJLA 2RN8A 3VS6A 3GMIA 5IT9E 1AWOA 4RG8A 2BG9C 4YJ2E 1AEYA 3J9X1 3FB9A 3S6WA 5HK3A 1YFNA 1K73U 2KNDA 1XDPA 4HN9A 2LSKA 3A98A 3CCJT 2PTFA 3EDUA 3PUVF 4GK5E 4IUQA 4IE0A 3PUZF 5ADXL 4PLLA 2GTOA 4QXHB 1VQ6A 2X0HA 3QC9A 2WDVA 1VYUA 2DKGA 2LHNA 4KH0B 3LLRA 1VQ4Q 1M4ZA 2N2NA 1YJNQ 2HPLA 3CCMA 1Y0MA 4XQ3A 3GP8A 1K8AU 2EIFA 4OHFA 4PK4A 2CXDA 4IE4A 5CO7A 4QH1A 1UURA 4EEBA 1X6GA 2JZ2A 2EQJA 2E5VA 3CCST 1ZV4X 2H3JA 4ZZBA 3A8MB 2LRQA 1LVKA 4H63H 3NTKA 4JBWF 2LKGA 1VQLT 3OA6A 3Q1JA 4RMOA 2ZPFB 4IE7A 4C5EA 4XU3A 1VQKA 5FU7B 4EOZB 3AE7A 2KROA 4M77F 2ROLA 2DPPB 5KYWA 5GAN2 3K3OA 2BTTA 3VHLA 4AXPA 3M0QA 5KYUB 2IUBA 4H9NC 4ZNXA 5DLQE 3JB9J 1MGQA 1QKXA 1K8AC 2ATCB 2CUDA 4L5GA 2XQ4A 2YOEA 1VA7A 4PNOA 2X9YA 1G3TA 2DD5A 5LJNA 3JB9G 2PG8A 4FW2A 3A5XA 4AQGA 2D8HA 2LCLA 2LJ0A 1T8BA 3FBZA 3E08A 3EVYA 4CI2B 3N5BB 2I59A 1KHCA 5AQSB 1VCSA 5LGUB 5EZYE 4XAXB 2DIQA 2OJ2A 1WX6A 1ZSZA 2OLTA 3ZN0B 5FY1A 2DL3A 4CC7A 4CXXA 3VYGA 2IVWA 2DLPA 4RUGA 3OSSC 2A36A 3HKDE 2KINB 4B3ST 4IURA 3UU4A 1BKBA 5FNVE 5LMUT 2LQNA 2E10A 3UT5E 2DETA 2WZIA 1WHKA 4BI3A 5L2LA 1FX7A 3C12A 2R6GF 4U7IA 2MBGA 2RI3A 1RI9A 2QAZA 2WSCE 3UA6A 3AE9A 3MPUB 1W1FA 3V7RA 5KDMC 1IGUA 5LJ3e 4ZGEB 1GBRA 2EBPA 1JJ2S 2R5MA 1M8VA 2MMPA 3IEEA 4ZI3C 2VC8A 4FW1A 1KNPA 1JNRA 3EG3A 3OYNA 3RIFA 1M90R 2CWOA 1JEGA 3AA0B 3QB5A 4U2ZA 2E2AA 4QQGA 4P0BA 1ABQA 1ABOA 5D6WA 1WXUA 2P0PA 1OI1A 5J2UE 4LDUA 4M75C 4X34A 3I5RA 3N9LA 3RKGA 1UTIA 4IIMA 2DI4A 3C4ZA 3SWNC 1ZBJA 4HEAA 5FROA 5JRCA 5C0MA 3CC7T 1TU0B 3I56Q 3UU6A 4B6XA 4UVCB 2E5LT 3W15B 2EAYA 2D0NA 3PNWC 3BDUA 2RJEA 3PV0F 3Q5XA 5HWYA 2W0GA 2QYWA 1BR1A 3NZQA 5J0ZA 5IWAT 2V7MA 2FYKA 4N0AA 3I55Q 4YTNA 2VASA 2O01E 3RQUA 2E5KA 2LQ8A 3FB2A 1MNDA 4JEHB 5LCYA 3LX7A 2MK5A 4YJ3E 1SRMA 1E6GA 3ZMSB 4KT0E 4QT7A 1B7TA 1SHZC 3C98B 2XDDA 3KDSE 3UUXB 4M78C 3G4SA 3KBUA 2QVAA 1ACMB 2YHTA 4LDWA 8ATCB 2L3LA 5GAOp 4HWCA 4P09A 3FDRA 4U72A 2F2VA 2RA1A 2JS2A 1UDLA 2W2UA 3D0TA 5JQGE 2DJQA 3TLVA 2KK4A 4J2CA 3DTOA 1T98A 5LA6E 3SRZA 2CUBA 4BE2A 2E41A 2LMJA 2PJQA 2Y90A 3U78A 2JMKA 3PUYF 4J83A 3ZLIA 3RH3A 3GN5A 1VQOT 1WYCA 1QVFS 3CCJQ 1BI1A 3RBBB 2WACA 2Z6EA 2CP3A 2QQSA 3OYXA 4XZCA 4XBFB 2KZ7B 1Y07A 4JEUB 2RF0A 2MF2A 1M3CA 2LTOA 3UTKA 2BG9B 1YI2T 4QXBB 1TH7A 1VQMT 3P8HA 4DV6T 3TQ7P 1M2VB 4HT8A 1AHJB 3N9QA 2LDMA 2FRWA 2MAMA 4OMQA 1YIJA 3LFMA 1XOVA 3CCSQ 3RYCE 5GAN8 3QO3A 4BJMA 4KP3C 2CXLA 4EAHA 1VYVA 1VQLQ 1IZNB 1X2KA 1IBKT 4C91A 1UHCA 2EVRA 4NL2A 2BDEA 3Q5DA 4A98A 3QIIA 2XQ5A 3HR0A 2AE9A 3RERA 3AEAA 3CCLA 4LF4T 3OBWA 3BQIA 3TVTA 2XM2A 3M9QA 2VWAA 3ONLC 4KMCA 4GKKT 7AT1B 2QI2A 1JQQA 5FVLA 4BACA 4FCYA 2YUQA 2XQ7A 4CN4A 4M75G 3S3OA 1L0VA 2LQWA 4PJOD 2QDLA 4X62T 2XQAA 3CEYA 1W09A 4F04B 1O3XA 4R55A 3CMLA 1IXDA 3AB3B 1I1JA 3TCJA 3LWHA 2P84A 1WGSA 5L3GB 4AIUA 2PQWA 3EG9A 4E7LA 2NOXA 2XY8B 1YJWT 1Q7YU 3LG7A 3OW2P 2HPJA 1LRZA 2AXDS 2UUCT 1WLXA 5F3JA 4BDYA 3UUNA 4PFOA 3UU3A 4DO0A 5GANd 2XJ7A 4LF8T 3N9PA 1G3SA 1VOMA 2KNBB 3JB9H 2XAFB 3OKQA 1WRDA 1OX9A 2E3HA 1VQPT 1VQ7A 1RLPC 4PJNA 1J1JA 2ESWA 5LHGB 1IRXA 1HK9A 3LWIA 2I0NA 3P8CD 2CZ7B 4HKEA 5LJ5j 3X20B 3CC4T 3HKCE 1HTJF 1FJGT 3NHNA 2HH7A 3EGDB 3PMIA 3CPFA 1G5VA 3AEGA 2XAJB 2KBTA 4PJOF 1T72A 2PVOB 1IBLT 4TZ4C 3FJ5A 3LBXA 2EQMA 3QDRB 3G6EA 2CS7A 1XMOT 5CFBA 4OYJA 1PRMC 2YDLA 5EK3A 1VQ5Q 5FU6C 5CKBA 1Q7YC 4OVAA 4M7AD 3C4WA 4ZOLE 4O2BE 3JRZA 5CQYA 3RDVA 4HFHA 4EIWA 3ULRB 3A8YC 2DXCA 4J9BA 1PCXA 4J6WA 2VKHA 4J9EA 4K0KT 1XNQT 4Y91A 4DBQA 3EHQA 4BJNA 1GCQC 3NTIA 3FZFB 5IYZE 1N27A 4IUVA 5GAMd 1W2BP 1K9MR 1I8FA 2YDRA 3P4RA 5KYUA 3X24B 2PBIA 3H3AA 2V8SV 1PC0A 2WSEE 1MMGA 2GQIA 1K0XA 5AQHB 2H7OA 3SEMA 3RIUC 2FRYA 4ILBA 3FLGA 1R8IA 2EHOC 4PJJA 3M57A 3CC7Q 1M5Q1 2IPOB 2LQKA 6AT1B 1M62A 3VU7H 3VRYA 1UGRB 4A97A 4B3TT 2RK1A 2QK0A 4M75B 4P1NA 3IQLA 4UEMA 2WY2A 2KVQG 2ODVA 1N36T 3FRNA 4M7AF 4ZN3A 2KWIB 4C8QC 3QWYA 1VRBA 2W10A 3HRUA 2NLUA 4DNDA 5IHKA 1PG5B 2K48A 3P50A 5DABA 2WU5A 1QUUA 4EMKC 4BB7A 4JI5T 5GMKm 3OYHA 1SUMB 2COWA 2HN1A 2DL7A 4L0RA 2E9XA 2FJAA 4IL4A 3CMET 2RH2A 4U31A 1BIBA 4N4GA 3E0ZA 4Z90A 2XIDA 2FZGB 2DILA 1WHJA 2F1LA 1NPRA 3KINB 3EFRA 2M67A 4ESRA 1BBZA 1I0CA 4HKAA 4JUVA 5LG3A 2LE8A 4M78B 1VQOQ 4KULA 5GAN3 1RABB 3CC2T 2K7AA 5M9OA 1WIEA 5JDNA 2LZ6B 1W0AA 4C92G 2PTKA 1YI2Q 4EZ4A 1KFZA 4JI6T 3GWHA 1VQMQ 2YU2A 2DYIA 1NEGA 1X6BA 2RQUA 2BBJA 3KV5A 1ZOYA 2VL8A 4AI6A 2IW5B 2H3EB 2Z0WA 2D1XA 2IC6A 1AZGB 3SFEA 2BS4A 3FEOA 2VXEA 1YP5A 4C0FA 4JJNK 4HXJA 1XNIA 1I4K1 2B76A 1NYFA 2L3QA 1M30A 2CREA 1T3LA 5JREA 4U3CA 3RLFF 2V7LA 5CR2A 5FKYA 2DD4A 4FYWB 3UWNA 3WVEB 3OMGA 5KCOA 3CXCP 1WHHA 3CBMA 4PFZA 1OWAA 4Y28E 3KVAA 4LD6A 1I07A 2CEAA 1VQ6T 3PVQA 2CDTA 1H92A 2LVMA 1RI0A 1QLYA 2VK9A 2IG0A 4HWHA 2HSPA 1GL5A 2WS3A 1OOTA 4BUGA 2O31A 1JJ2A 3CCMT 2YUOA 2M0OA 2HL5C 3VV0A 3MEUA 2QRXA 4M77C 1BR4A 3UULA 1OU9A 5IH2A 1QKWA 1D1BA 1YJWQ 4HT9A 1BYMA 3UU8A 3NGPA 3RF1A 4NUVA 3IBPA 3S3MA 3OYFA 2PFVA 3IHRA 2KY9A 5DQWA 3QOFA 4DR4T 3GPLA 2MPXC 3GLXA 2H3RA 1VQKT 2CP2A 2AK5A 1VQPQ 2FG0A 2K2VA 1GXIE 2V5CA 3L8RA 4WW0A 2HN2A 2LSGA 2OA5A 1UGSB 2LRKA 3CC4Q 1D0YA 3FZHB 5KCHA 2QQRA 2RNAA 3A1PA 1UX4A 1XNRT 2O9SA 2X4JA 2LX7A 2QXFA 4Z8AA 3V7SA 4JI8T 2BVLA 3L2RA 2MWOA 1VQNA 5AQPB 5IAYA 1AVZC 2E6ZA 2XTLA 3RESA 1HR0T 1NJIR 3V5UA 2OTLA 2K9GA 1KNRA 1Q86U 4BE1A 3OYEA 4UR9A 4HFEA 3I9WA 3VYHB 3CX7B 2CP6A 2XQ3A 4DV0T 3N9NA 1NLPC 2ECZA 2RHXA 1QVPA 5GJWB 3PU8A 2CCQA 4E6RA 1QWFA 4KUIA 4ZEYA 3TSWA 2LJ3A 4QWNB 4DUYT 2E12A 1ZX6A 2H7VC 2JMCA 1YKEB 3PJAJ 3ZYKA 3CQXC 1OZ2A 1WFWA 3TLSA 4MMLA 4OMMA 4ORZA 4M1PA 2E70A 3RRCA 4C0GA 4H9SE 4C8QD 1KD1U 4UVAB 5DJQC 1Q82R 5FWCA 1HNXT 1VCTA 2EPDA 4O4HE 3DP7A 3CCUA 2ZZDA 1HNZT 2BS2A 2A3DA 4JUYA 4B6MA 2OX7A 3VKIA 2UXBT 1US7B 2ZPBB 3CMAA 2W4XA 3JCMQ 3RPUA 2ZMAA 4I4TE 5HCJA 3VRZA 2RO0A 4LD9K 3JCMg 2NUPB 5KXJA 4U74A 4CC3A 2NR4A 2JTFA 4YSYA 2NUTB 1B34B 2BG9E 2EHOB 2L89A 4KX6A 5GANg 2DEUA 1Q81U 5C3JA 1OYXA 3AVRA 4H9PC 5I2SA 5CQXA 5CCAA 2KEAA 3BQKA 1K76A 5AQNB 5LJMA 3CMEQ 3OYZA 2HSEB 2CSQA 3UA7A 4C8QF 2DJZA 2A37A 3MEAA 4J9IA 4ILUA 1Z9QA 3F2EA 4YFSA 4AFUC 2J05A 1ZP0A 2KDSA 5D6XA 1OEBA 2D0TA 4EMKB 1JRIA 2RJFA 3QJYA 2P4TA 1UB4A 5FY0A 1W2BS 3KBGA 2JM9A 3RKOA 1YCYA 1WJSA 3CC2Q 1HF8A 3RGLA 1TSFA 4JJDA 2A9UA 2FJDA 5GAN4 4YSZA 3JCMV 3EABA 1Q81C 2LHRA 2HKQB 3SS1A 2CRBA 4KHPT 3FXEB 1UX5A 4YY3T 1SF9A 2W66A 3E19A 1WNLA 3OBVE 3TLUA 3VS2A 2YLBA 2RHZA 2AKKA 1MNEA 3J7AF 1U1TA 5GAMg 4MDWA 3G4ST 4IL9A 2K57A 4I50E 3VS1A 4F14A 1W9RA 1Y7XA 1FIOA 3I1AA 3MXZA 2O4XB 4JLGA 2DO3A 3MACA 1KC8R 4DR5T 4WZXA 1XJWB 3H8ZA 4M7DD 3NRYA 2KWHA 4M75A 3MKDA 1RAIB 2XQ8A 4M77D 3INZA 4HFIA 1D3BB 3N9OA 1JBMA 2X67A 4PW8A 2Y4YA 3G7ZA 1VQ6Q 2A7YA 2OTJA 5LB7B 5JDGA 3M3ZB 3KUFA 5GAN6 1X6OA 5LJ3d 4QVDA 1WXBA 1HNWT 3AE6A 5FXWA 5HKCA 1UJ0A 3L3PA 1Y71A 2NWMA 5F8PA 4DR6T 2JMAA 2FJBA 1IREB 2ZM2A 1WPYA 2CSIA 3EI0A 3CD6A 3FZMB 1M8MA 1UHFA 3BDLA 1YIJT 2DAQA 2RJDA 5H6QB 4IHJE 5LHIB 2FHDA 2I6HA 1M1KR 1U1SA 1M9SA 2W61A 5LBMA 4UXNB 3NBXX 4NL3A 1EZ3A 3N5LA 2DRKA 2FZCB 1N8RU 4M7DF 1QWEA 2JNGA 1TTHB 3O1HA 2KQWA 1K73C 1T0JA 2K5FA 1YQ4A 3CCLT 2EQUA 2LEHA 3JCMc 5TAOA 4M77B 2DXBA 4J7IA 3OYBA 5HXSA 1O75A 1U06A 1XDOA 4X66T 4M75E 2V7KA 1GBQA 4EMHA 3OS5A 3O1JA 1KNZA 1PNJA 4HWFA 3MO8A 1KSWA 5I2MA 4EEDA 2MTQA 1TS9A 4PK6A 3ZN1B 1MHNA 1UUEA 2XK0A 4EIKA 4IT4A 2ENMA 4WYVA 3CCQA 3CXCS 2R57A 3AXJA 3SFDA 2AHJB 3QYHB 3RI5A 2Q9QA 5LJ5e 2CM0A 2LLYA 3PDYA 2ZPEB 2K79A 4D8DA 3CCEA 1N8RC 1DU2A 3MP6A 2NUZA 2E64A 1I94T 1MMAA 4KH1B 3DKMA 5CKDA 5GMKh 2AIRB 3S3NA 1M1FA 1FMVA 4PJOC 1VQ7T 1E7PA 2HHHT 5HK0A 4G63A 3OYKA 4LDYA 1YQ3A 2DL5A 2CXFA 1Y96B 2JUFA 2XSAA 1AD5A 1HG5A 5GAOm 3H9NA 4RTZA 3I0OA 1QW1A 3QYGB 3G71A 5L47A 3M54A 4JRIA 1KK7A 3QUJA 2XHCA 4MBQA 2YEVC 3G6ET 5FYMA 4M78E 5IN1A 2K4YA 2K6DA 3VJPA 3F31A 1ZUUA 2ES0A 2CE7A 2V8JA 4ASKA 3JCMh 2KRMA 4ATOA 5E0OA 2GK9A 2WZHA 5J1GA 4L59A 4F7UF 2NTYA 5DY9A 5LXTE 2NYSA 2WU2A 4K0UA 1M90U 3CQCB 2BKPA 1UK5A 2EYYA 4GY5A 2DA9A 5GANh 1U5PA 2IIMA 3ZSTA 3ZT5A 4DVDA 4G2AA 3ZEFB 5KMGP 1QCOA 1M3AA 2CP5A 2EW3A 1QQJA 1WLPB 1OEDB 5I21A 5CAIA 4DQ2A 5J39A 2V6XA 1X01A 1FWZA 5LHHB 1S1NA 4M7AC 5DLOA 2LT1A 4RKUE 2ABLA 2HD0A 1I5OB 1QCFA 4IIOA 3M53A 4D8KA 1TUGB 3RC3A 3OYDA 3QZ9B 4JDSA 4BY6C 4C92A 2DRMA 3FZKB 2VGNA 5IXBA 1M90C 2H89A 1WR6A 3DB3A 2CBJA 2LOSA 3O4XE 4E7JA 1T3SA 2VKNA 2YRVA 1AJ3A 4YHJA 1I5LA 1PSEA 2WB5A 4H9QC 2NP9A 5GAN7 2DERA 4OMNA 1YD8G 4LMJA 4C5IA 4M4ZA 3L2WA 3GIBA 3UQ7A 2QA4A 3L2QA 4UF0A 5GAMh 4ZS3A 3KFWX 3CQTA 3G4SQ 1YW0A 3UFGA 2RI5A 3UUMA 3JCMf 2C5JA 2J47A 3CKDA 4A4EA 2C0OA 2F2XA 4IDPA 1K1ZA 3ZJ2A 1XMQT 3QKJA 2CMRA 4KGZB 2L9QA 5GANf 2K5BB 2KGTA 2PU9B 2DXTA 3JCMJ 2ZPGB 1D0XA 1GCQA 3VU3C 3UQ4A 5GAOl 3MP1A 1BI2A 3ASKA 3ZJ1A 2W0ZA 2XQYA 2DNUA 1KQ2A 3RQWA 2NUPA 3ABVA 4YTPA 5L23A 2G6FX 2NW9A 3RIUA 4WBNE 4EYYR 2NUTA 2Y6XA 2RJCA 1YXRA 5JDFA 2EHOA 3HKBE 2QDYB 4P5NA 3OS0A 1A0NB 1KJWA 4PJOG 1JB0E 5LNKA 2JTMA 1TOVA 4A53A 3CPWP 3C51A 4Z89A 2HCKA 4C92E 2WMOA 3C94A 1GCPA 2DTHA 5LG4A 1EX4A 2AT1B 2LNHB 3EG2A 3P8DA 2KSRA 4CXYA 4TWHA 1F1BB 2V1DB 4ADZA 1WHMA 1YIJQ 3K3NA 3F70A 3LSVA 1BB9A 3R6OA 3EFSA 2DCFA 4LFCT 4I43B 1UGVA 4V2SA 2C5KT 3MEVA 4L9IA 1VQ8A 1KHIA 3H37A 3OVUA 4U2YA 3THKA 4EMKA 4E7HA 2QTVA 3QWXX 1J5ET 2EJFA 1S72A 3I5SA 4WTOB 5GAMf 4RTTA 3CCLQ 2ED0A 3AT1B 1JXMA 1M2OA 3OYCA 3RMSA 2XDBA 2A2FX 3VS3A 4H63V 1LJOA 4C0ZA 1J5WA 3B57A 5JR9C 3BE3A 3HRTA 4YSXA 2ED1A 5JVDE 3WAJA 1SSHA 2EFIA 1RAAB 4ISTA 4HCCA 3Q5EA 3R84B 1T7SA 4TNVA 2AZVA 2ZLYA 4TWDA 4DV3T 4LDXA 4EXTA 4HVVA 4HWDA 2DZ9A 3M5AA 2UUBT 4BD3A 2M9UA 4M7AG 3LGFA 2D0QB 1M27C 3META 3NZPA 2UXNB 4YTMA 1TWBA 3H0IA 4OMPA 2YUPA 2D9TA 3TSZA 4PNIA 5ABEA 4LF9T 5AT1B 3I35A 2QASA 5AQQB 5AQJB 1KG1A 1D0ZA 2BVMA 1KIKA 1VQ7Q 4DOWA 1AWJA 4AFQC 2WDQA 2KXCA 2XMFA 2BZ8A 3PUXF 2K9AA 3NTHA 1D3BA 2DM1A 3T1YT 3RMQA 4ZTFA 3HKSA 2E1HA 3TREA 2FPFA 4E7KA 1IBMT 1W2BA 5LJ3g 1SPKA 2V1QA 4LUDA 1VQNT 3G6EQ 2F5KA 3SOLA 4QKUA 3ME9A 2X68A 4M78G 5JDMA 2DIGA 2LSJA 3CBPA 4EPCA 4PJOB 3DLLA 2OTLT 2MCNA 3OBYA 3FBLA 3SD4A 5LL6S 3FHNA 5HCKA 3P4SA 1WQWA 4DR2T 2XAQB 5I11A 3A8OB 3QSUA 2RA2A 4QX8B 1ZUYA 3EH1A 1YNZA 4HVUA 1M1GA 4P0AA 4HCKA 1ZKEA 2ACZA 2YUNA 1JXOA 3WAKA 1UGQB 2E65A 4F16A 3LJCA 2YK0A 1CUNA 5FY7A 3H6ZA 1Z9ZA 5GAN5 3LK3B 3X25B 3CCUT 3GF5A 1UGOA 1R8OB 2UXXB 4BE0A 1VQ5A 3F57A 3CX8B 4DIDB 4EMGA 3CMAT 4FSXA 2QEXA 2KT9A 5AQIB 1NEBA 2CHNA 5KYNA 2WM9A 1MV0B 3AEEA 2JS0A 3OYLA 3J80E 1CHUA 4MZPA 2M6IA 5D6YA 3E2UA 1HX1B 3AHUA 3KV4A 1MUZA 2XHEB 2X3XD 4E7IA 3SWNB 1HX8A 4M7AB 4IE6A 3OYMA 1U3OA 4HGAA 4J9DA 4X1IE 2COZA 2WCAA 3TLWA 2EJ9A 4PJMA 5GMKe 3L2VA 4RTVA 4L6V5 2A08A 2JQKA 2L5QA 1PHTA 4LNPA 4BY6B 5L4HA 4LN2A 4Z8XA 1Y96A 3K1SA 4KI0F 3U23A 3CWZB 4A4HA 2XD0A 2EJGA 4O6JA 4AKGA 1RL2A 5I22A 4BDZA 2RK2A 2GGRA 3HFNA 2RI2A 2YSQA 2QA7A 1R77A 5AQLB 1X75C 3NKZA 1NBEB 1YHQA 4ISSA 4RTUA 1PKTA 3LYIA 1PWTA 3MJXA 2WSSV 1RACB 1FXXA 3CCRA 4JV5T 1AWWA 4PAGA 4QQDA 1SA0E 1WI7A 2DF6A 3JCMe 3AA6B 1B3QA 4DEXA 3AE8A 4OB1B 2QG9B 1PD1A 2J4GA 2SEMA 4TX5A 4ZS2A 4HFBA 2HAXA 1ZLMA 3AA7B 3CXCA 4LFBT 1N34T 1K4US 3VR8A 5JDLA 1IZ6A 2LRLA 3X28B 1YJ9A 2FUPA 4AQYT 2F4VT 3ZT7A 3AVSA 2P0KA 2BUDA 4DA4A 3BY7A 4NXNT 1OEDA 5IXFA 1UUSA 1MV3A 4DV5T 2KYBA 1EIFA 2KE9A 2XI9A 5A0DA 1QSDA 3KV9A 1NLOC 5FWBA 3JCMW 3RX6A 2YU1A 3QZ5B 4RTXA 1CKBA 5KYWB 2MAWA 5GAOn 4XU1A 3ZCIA 4MLKA 1QLBA 4X65T 3NPFA 5LGTB 1YN8A 2QQ9A 4RCBA 3CCVA 3PE0A 4J9HA 3H0FA 1QVGP 3HI2A 4FU6A 4OB2B 5L3EB 1B07A 2XDPA 4OGCA 2OTJT 5AQGB 2X9XA 3QUIA 3UPUA 4TV8E 2RQVA 4E7ZA 3EGXB 1ZEEA 3RKXA 3ZEHA 2M6BA 4HFVA 4XTZA 4M7DC 1WCRA 3CD6T 3AEDA 4AKHA 2NW8A 4ZHQE 3ZSSA 2QGSA 4A4GA 5KH6A 4AQFA 5JR9B 4D6WA 2NWBA 2DVJA 2K5IA 3OY9A 3P7IA 2D6FA 3K3QC 5GMKl 1YITA 3ZPOA 3CPWS 1GQEA 2N9DA 4IKFA 2FPDA 4O2AE 3DLMA 5AQTB 4A56A 2YWWA 1AZEA 3HL8A 2X0YA 1OEDE 3S4UA 4E2FB 2HEQA 2WQYA 2RHUA 4XTUA 4A63B 4C8QG 2M02A 4TV9E 3JCFA 3V8JA 2QQAA 1KQ1A 4IUTA 5FU7C 5LJ3h 3L39A 1X43A 3JAEA 5L4EA 1VQNQ 5LYJE 2BG9A 4OFZA 3RYHE 2VURA 3CCQT 2OTLQ 3MP8A 1NJIU 1M2VA 5KE2A 2W67A 2L3PA 2D2SA 1GRIA 4XU2A 4DMWA 1NAFA 4AT1B 3O1IA 2O9VA 2PZ1A 4J6YA 3CCET 2DVEA 4XK8E 5A2QE 3U3IA 4HFDA 3C0CA 2J1DG 4CRIA 5HWXA 1NEKA 2EWNA 3ZKRA 3RKYA 1XWMA 1JO8A 2H8HA 2XZEA 2JTEA 2YDQA 2RQRA 1Y64B 2YRDA 4OYKA 4QVZA 3NFCA 4OF1A 4WCIA 5ECAA 2CZ0B 3ZMVB 5FU6B 3VS5A 1H7CA 5C8YE 4R56A 1Q82U 4IREA 1V9DA 4A5XA 3HA4A 3CCUQ 2M16A 4C92F 5HXCA 4ZI2C 2RD1A 3G71T 2VB6A 4YHHT 4LFAT 3OW2S 4C90A 3CMAQ 4PK5A 2WDRA 3C95A 2E9XC 4O4IE 1NJIC 1X27A 2EGEA 1QVFA 3MCAB 4JZ4A 1G3YA 1Q86C 5IHIA 5BMVE 1WJQA 2VKOA 1WDXA 1GFCA 4A54A 1BCOA 2VQET 3A5ZB 4LDVA 2G3RA 2J62A 3PUSA 2JJ9A 5LJ3f 4PL6A 3IF8B 2ZPIB 4VUBA 1KQSP 1LKXA 4JS5A 4CC2A 1C1AA 4XTYA 5HEGA 2KXPB 3EGUA 3M55A 4CN6A 2JRKA 5CKEA 2RPAA 1KD1C 1D1AA 2WMNA 4J9GA 1GFDA 1K0SA 5J26A 2E4HA 3RIRA 1QP3A 2BZXA 4GLKA 2DBKA 1N32T 3A8LB 2BE7D 3HP9A 1KEYA 4C8QB 4AKIA 1AWXA 4M7DG 3LGLA 3EGDA 2PVGB 4IUUA 3VS4A 1BR0A 3GN5B 1K9AA 4IIJE 1RAGB 2YT6A 1N9SA 4ELZC 4PJOA 2D5UA 2ZAEA 4OB3B 2LC4A 2DL8A 4M77G 5GMKj 2KRSA 1NG2A 3M0TA 5AQMB 1HS7A 1OXZA 2X4WA 4DOVA 4FSSA 2V8IA 1LVFA 2HL3A 1H3ZA 1VQ9A 5L8RE 3OYJA 3WXMB 3RKWA 5L3BB 1PM3A 5LJ5d 1W0BA 2HQEA 2KI7A 3V7CA 3A7MA 4DBRA 2QA4T 3RR6A 2LCSA 3JADA 5HEJA 4AFSC 5CIUA 4ELYC 4UVBB 4HA8A 4AFZC 3AE2A 3PURA 3PGGA 2RP4A 1LPLA 3JCMP 3D7SB 3PT9A 2E3IA 1NPPA 3RNJA 3FIFA 1OQKA 3M0UA 4CN1A 2DYBA 4DV1T 1KC8U 1MMDA 3CQGB 2UUAT 1SEMA 1E1HB 1UECA 2X66A 2R58A 5KYXB 4AG1C 1BR2A 2NW7A 2CT3A 4Z02A 3CBOA 1ZHIA 5KE3A 5GANj 2L3SA 3CIRA 2Y4XA 2UXCT 3SWNA 4M7AA 2BKOA 4YT0A 4FM4B 1IAPA 3ZC1A 2OTJQ 3H41A 2AKLA 3R6NA 2XUEA 3OQ5A 4PJOE 4Z91A 3NWIA 1H3HA 5EC7A 1HSQA 3MK7C 2ZGWA 5CKFA 1G73A 2WBLA 4TNWA 4O4JE 1Z8UA 3CCMQ 3M59A 1E7OA 2D9DA 2DZCA 3NMZC 4FYYB 1D09B 1KC8C 3PTRB 1UFFA 4F7UG 4IDNA 3AEFA 1VQ8T 2ZPHB 1UJYA 2GFUA 2HBWA 5EG2A 1M1KU 3JC6C 5HEOA 3M4YA 5M4YA 1W6XA 4BAYB 4GYRA 4A4FA 3AAEB 4NPPA 2H88A 2CZ6B 2LX9A 1S72T 1K73R 2XAGB 2WWVA 2RPNA 3OYGA 4AKRB 1QCNA 4M7DB 1HCIA 1VQKQ 3OJAA 4LMKA 3HRSA 2XM1A 4C0DC 4M78A 1OPLA 3PUGA 2YXYA 3L2ZA 5GAMj 2HDAA 3LBXB 2VGMA 2X3WD 2N1GA 3OSVA 2YN6A 1VQ4A 1YJNA 3SWHA 5FRMA 1K8AR 2LJ1A 1WHGA 1EZZB 1IJ6A 5AQFB 5CVIA 3GOXA 3PTAA 1ZBXA 2P0QA 4GOUA 5HXEA 2CLYC 4H9RC 3CCQQ 1SHFA 4HFCA 2RM4A 3ZC0A 3LH0A 1QVGS 1M1KC 4M7AE 2GTJA 4I0UA 2VQFT 2JIWA 3M4GA 3LK42 1ZUKA 1N8RR 4DR3T 4ZI2D 3AAAB 3C64A 3CCEQ 4O8SA 4KUMB 2NTXA 4A4KA 2L0AA 3URGA 2OV9A 2VKDA 4LF5T 2E9XD 5KX5E 4ZTJA 4OMOA 3DB4A 1Y01A 2GCXA 3NRXA 4QXCB 4LF6T 4HCBA 4ILCA 3T9NA 5FVKA 5FXZA 5IHYA 4X64T 2I0MA 3Q9DA 3FZLB 4H9OC
chains in the Genus database with same CATH topology
3ZBDA 3CPZA 1N6AA 3TKLB 4OK0A 3HL6A 2CZ1B 1XTDA 2CWYA 4B9WA 3X26B 4PJLA 4IE5A 3VUBA 4JLEA 4MDXA 1MIWA 4DMVA 3TU4K 3BW1A 2VUBA 5JR9A 3RUXA 3ZFJA 2W62A 2KLQA 2C5IT 3QJ6A 1ZHCA 4F7UB 5HY6A 5ETWA 2E9XB 2DTOA 5J2TE 5GMKi 2X51A 3ZCJA 5JDQA 2MOZA 1YBYA 4ZN1A 3ZYMA 4HE8A 4C5GA 2CKKA 2X9WA 3TEEA 3P8BB 5LBQB 4TN7B 1VQ5T 2X9HA 3QG1A 4EZHA 3OYYA 2QEXT 2LT3A 3JB9D 2IAKA 4WNKA 4NS5A 5CB4E 4JRPA 5L3FB 2K3YA 3PMTA 3C4XA 2LSIA 4IUPA 5EK2A 4J8OA 1HG2A 2VV5A 1UGPB 2VXFA 2CA5A 5HXRA 2X35A 3ETVA 2FVUA 4O5VA 5LOVE 2ODUA 3CPWA 4F6RC 1OZ3A 3I56A 2V7IA 2ACXA 1YHQT 1KQSS 1N9RA 5FXVA 4X1YE 3JB9F 3QK6A 3ZYLA 3CCRT 3MA9A 4HTEA 2GFAA 3I55A 5DM7R 3KBTA 4MZTA 5AFUL 3JC6D 1Z0PA 1B34A 4X20E 2A72A 1VUBA 2F69A 4OB0B 1IJ5A 1YJ9T 2JMHA 4MZMA 2DK3A 1MMNA 4EB6E 2LM9A 2SPCA 2GF7A 4OMFB 1V29B 3C50A 2X0LB 4E47A 4N4HA 3EAEA 2PUOB 4Q5WA 1I81A 4C8QA 4BA9A 2Q9QC 2DLRA 4WF2A 2Y8DA 3CCVT 4KUDK 3RC8A 3CCJA 3V8LA 3OW2A 2DEQA 4UV9B 5DQVA 2PUKB 3A8GB 5A1LA 3I9YA 3ANWB 2I2LA 3GA8A 4ZGJB 2FB7A 5LGNB 1WQ7A 1HXDA 3SDZA 4WBOA 3UFEA 1G3WA 3WVDB 4EDUA 2JPFA 4IGUA 5LJ5g 4O4LE 3BK9A 4MFRA 3ZMUB 3CCSA 2EQKA 4C0DB 4UELA 1PSFA 3GNGA 3L1AA 2V26A 5C6SA 1VQLA 3RYIE 2BKDN 1YITT 4RG2A 2O4XA 3B13A 2EYQA 3E1SA 2L8DA 4YLHA 2W63A 3HSBA 3C4SA 4MHCA 2CLYB 4I55E 4N78D 5J3BA 2E8IA 4E7SA 3VUZA 4C8QE 4PKCC 2VKJA 3E22E 1W4SA 3JAME 3MEWA 3PFSA 2W00A 1ZQ1A 4EYUA 3JCMd 3O9XA 3SB2A 4GK0E 3M56A 3QHSA 3LW5E 1D1CA 3OYAA 4FI5A 3ZMTB 4CI3B 3DJBA 3L42A 2VYTA 4C92C 3VKHA 3BFMA 4ZI3D 4OGEA 3WI3A 4M7DA 4N0AC 3ONXA 3MZKB 1K9MU 5H6RB 4JS4A 4M77A 4M75D 3UT1A 2MWPA 2RHIA 4FT4A 4XTXA 2ZM8A 2D0UA 3L09A 3HKEE 1X79A 3ESLA 3CX6B 3E9GA 2CGHA 3L2UA 2JQQA 4QHOA 2HBPA 3LK2B 4ERRA 4X1KE 2RB6A 3GNFB 5LJ3j 1K9MC 2WAUA 3FXDB 2JOYA 3CC7A 4M75F 4J5YA 4CXWA 2XG8D 4QVCA 4M78D 4V1Av 4M7DE 4NUUA 1BIAA 2M1HA 4GIWA 4QW2A 3EUHA 2WSFE 3KXTA 2F5TX 4N4IA 3KV6A 4M77E 3AAIA 5FXXA 2FL7A 4JRQA 3OS2A 1VQ9T 1WJRA 1G8XA 3PIOA 4XTVA 4F7UA 1XQHA 4C5HA 1QVGA 3UDCA 3PIPA 5CK9A 4J6XA 2Q9QD 2R5AA 5GANe 2XU8A 1U8RA 3PUAA 3VKGA 3FJPA 2XKOC 2B1EA 5HYAA 4UV8B 2K24A 3JCMX 3FC3A 2DWGA 2HQXA 5JDHA 4M78F 1UEBA 2A3LA 3HPWA 3V5SA 2IC9A 4CZZB 2XASB 5CKHA 1VQOA 2JVVA 2DTIA 3BQLA 2K5LA 2KAFA 2B8AA 4PFPA 1BI0A 5HAXA 2YLCA 1YI2A 2LCCA 4HCZA 3A8HB 1MIYA 1VQMA 5LJ5h 4NOYA 3MHXA 5JH7E 2Q9QB 3QXEB 1BI3A 4MMKA 4CI1B 4FT2A 5GAMe 5LP6E 4AKLA 2QTXA 1UCUA 3HFOA 5EK4A 4X9CA 4F7UE 2C0SA 2ZM0A 2XAHB 3RRWA 4UC4A 1FMWA 5GONE 2OAUA 3OB9A 1P92A 4OP0A 3QPHA 4GYSA 1MIVA 4TUYE 2LNVA 1WYBA 3EDVA 1VQ4T 2KSSA 1YJNT 4C92D 4ANJA 2X4YA 3ZMZB 4XU0A 1S35A 4CQIA 3I0QA 1NZ9A 1YJWA 4UIGA 4J7FA 4ZGDB 1DJ7B 3ETUA 4X9DA 3PU3A 2DHRA 4YTLA 3JSCA 5FRNA 4ME7A 4FL6A 3JB9I 3Q2MA 5LJ5f 2WWUA 5HXHA 2L3RA 1NE8A 1VQPA 1QP2A 2QQBA 3ANWA 4RCCA 1KQSA 3CC4A 4JRKA 2YINA 5JRCB 3RYFE 1LOJA 3QBYA 3E9FA 5A0LA 4QKNA 4C92B 4MALA 4XTWA 3O8VA 2BZBA 1YKHB 2E5QA 2ZCFB 4RMOA 5AYFA 4QQ6A 2EHOD 4BI8B 3JCMb 3OMCA 4II1A 3Q5WA 2XICA 4FJOA 4IDZA 4UF0B 2KMTA 3SFMA 3PUQA 4JLIA 1VIEA 4TVRA 3N2KE 1S94A 1Q82C 5GAOq 1NWMX 3HHTB 2LOPA 5CA1E 5GAOr 1O9SA 3K8PC 1U4QA 5A0GA 2GQVA 3N2GE 2C06A 3OS1A 4QX7B 4FIBA 2MYSA 2BIVA 5FP3A 2Y48B 2LSYA 2RHYA 4B9XA 3N9MA 3T8OA 5L3DB 2MI6A 2PVDB 2X4XA 2CYZB 2K3XA 5CA0E 2KMFA 3CMEA 2DWKA 3M65A 2V7JA 2HNIA 2P9BA 4CI0C 5FMNA 3M58A 2G0UA 3OYIA 3I56T 2LT4A 3J81E 1SSFA 2E6NA 2JN0A 2EKOA 3KVBA 2DXUA 4AQFC 3ER0A 3CC2A 5FLXE 3I55T 1LNXA 4ZI7E 4PLIA 1VIFA 4KBMB 1FEWA 2L8KA 3J7Yq 3V8KA 1HFAA 4BI4A 2DNXA 2V8KA 1H641 3AA1B 5L3CB 3N2OA 3CVRA 2LJLA 3GMIA 5IT9E 4RG8A 4YJ2E 3J9X1 3FB9A 3S6WA 5HK3A 1K73U 2KNDA 4HN9A 2LSKA 3CCJT 3EDUA 4GK5E 4IUQA 4IE0A 4PLLA 5ADXL 1VQ6A 4QXHB 3QC9A 2DKGA 2LHNA 3LLRA 1M4ZA 2N2NA 2HPLA 3CCMA 4XQ3A 1K8AU 3GP8A 2EIFA 4OHFA 4PK4A 2CXDA 4IE4A 5CO7A 2JZ2A 2EQJA 3CCST 1ZV4X 2H3JA 3A8MB 2LRQA 1LVKA 4H63H 3NTKA 1VQLT 3OA6A 3Q1JA 2ZPFB 4IE7A 4C5EA 4XU3A 1VQKA 5FU7B 4EOZB 4M77F 2DPPB 5GAN2 3K3OA 3VHLA 4AXPA 4H9NC 3JB9J 5DLQE 1MGQA 1K8AC 4L5GA 4PNOA 2X9YA 1G3TA 2DD5A 5LJNA 3JB9G 2PG8A 3A5XA 4AQGA 2LCLA 3FBZA 3E08A 3EVYA 4CI2B 3N5BB 2I59A 1KHCA 5LGUB 5EZYE 4XAXB 2DIQA 3ZN0B 5FY1A 4CXXA 3VYGA 2IVWA 3OSSC 3HKDE 2KINB 4IURA 1BKBA 5FNVE 2E10A 3UT5E 4BI3A 5L2LA 1FX7A 3C12A 2MBGA 2RI3A 2WSCE 3V7RA 5KDMC 5LJ3e 4ZGEB 1JJ2S 2R5MA 1M8VA 2MMPA 3IEEA 4ZI3C 2VC8A 3OYNA 2CWOA 3AA0B 4QQGA 4P0BA 5D6WA 2P0PA 1OI1A 5J2UE 4LDUA 4M75C 4X34A 3N9LA 2DI4A 3C4ZA 3SWNC 4HEAA 5FROA 5JRCA 5C0MA 3CC7T 4B6XA 4UVCB 2EAYA 3W15B 3PNWC 3BDUA 2RJEA 3Q5XA 5HWYA 2W0GA 2FYKA 1BR1A 3NZQA 2V7MA 4N0AA 2O01E 2VASA 2LQ8A 3FB2A 1MNDA 4JEHB 5LCYA 3LX7A 4YJ3E 3ZMSB 4KT0E 1B7TA 1SHZC 3C98B 2XDDA 3KDSE 3UUXB 4M78C 3G4SA 3KBUA 2YHTA 4LDWA 2L3LA 5GAOp 4P09A 3FDRA 4U72A 2RA1A 3D0TA 5JQGE 2KK4A 4J2CA 3DTOA 1T98A 5LA6E 3SRZA 4BE2A 2E41A 2PJQA 2Y90A 3U78A 2JMKA 4J83A 3ZLIA 3RH3A 3GN5A 1VQOT 1WYCA 1QVFS 1BI1A 2WACA 2Z6EA 2QQSA 3OYXA 4XZCA 4XBFB 2KZ7B 1Y07A 4JEUB 2MF2A 2LTOA 3UTKA 1YI2T 4QXBB 1TH7A 1VQMT 3P8HA 4HT8A 1AHJB 3N9QA 2LDMA 2MAMA 1YIJA 3LFMA 1XOVA 3RYCE 5GAN8 3QO3A 4BJMA 4KP3C 2CXLA 4EAHA 1IZNB 4C91A 4NL2A 2BDEA 3QIIA 3HR0A 3RERA 3CCLA 3OBWA 3BQIA 3M9QA 2VWAA 4KMCA 2QI2A 4BACA 4M75G 3S3OA 4PJOD 3CEYA 4R55A 1O3XA 3CMLA 3AB3B 3TCJA 3LWHA 1WGSA 5L3GB 2PQWA 4E7LA 2NOXA 1YJWT 1Q7YU 3LG7A 2HPJA 1LRZA 1WLXA 5F3JA 4BDYA 3UUNA 4PFOA 4DO0A 5GANd 3N9PA 1G3SA 1VOMA 3JB9H 2XAFB 3OKQA 1WRDA 1VQ7A 1VQPT 4PJNA 5LHGB 1HK9A 3LWIA 3P8CD 2CZ7B 4HKEA 5LJ5j 3X20B 3CC4T 3HKCE 1HTJF 2HH7A 3PMIA 3CPFA 1G5VA 2XAJB 4PJOF 2PVOB 4TZ4C 3LBXA 2EQMA 3QDRB 3G6EA 2CS7A 4OYJA 5EK3A 5FU6C 5CKBA 1Q7YC 4OVAA 4M7AD 3C4WA 4ZOLE 4O2BE 3JRZA 5CQYA 4EIWA 2DXCA 4J6WA 2VKHA 4Y91A 4DBQA 4BJNA 3NTIA 5IYZE 1N27A 4IUVA 5GAMd 1I8FA 3X24B 2PBIA 3H3AA 2WSEE 1MMGA 2H7OA 3FLGA 2EHOC 4PJJA 3M57A 1M5Q1 2LQKA 3VU7H 1UGRB 2RK1A 4M75B 4UEMA 2KVQG 2ODVA 3FRNA 4M7AF 4ZN3A 2KWIB 4C8QC 1VRBA 3HRUA 2NLUA 4DNDA 2K48A 5DABA 4EMKC 1QUUA 4BB7A 5GMKm 3OYHA 4L0RA 2E9XA 3CMET 2RH2A 1BIBA 4N4GA 3E0ZA 2XIDA 1NPRA 3KINB 3EFRA 2M67A 4HKAA 4JUVA 2LE8A 4M78B 4KULA 5GAN3 3CC2T 5M9OA 5JDNA 4C92G 4EZ4A 3GWHA 2YU2A 3KV5A 2VL8A 4AI6A 2IW5B 2IC6A 3FEOA 2VXEA 4C0FA 4JJNK 1XNIA 1I4K1 5JREA 2V7LA 5CR2A 2DD4A 3UWNA 3WVEB 3OMGA 5KCOA 3CBMA 1OWAA 4Y28E 3KVAA 4LD6A 2CEAA 1VQ6T 2LVMA 1RI0A 2VK9A 2IG0A 4BUGA 1JJ2A 3CCMT 2M0OA 3VV0A 3MEUA 4M77C 1BR4A 3UULA 1D1BA 1BYMA 4HT9A 4NUVA 3IBPA 3S3MA 3OYFA 2PFVA 3IHRA 2KY9A 5DQWA 3GPLA 1VQKT 3GLXA 2H3RA 2K2VA 1GXIE 4WW0A 2LSGA 2OA5A 1UGSB 1D0YA 5KCHA 2QQRA 1UX4A 2X4JA 3V7SA 2QXFA 2BVLA 3L2RA 2MWOA 1VQNA 5IAYA 2E6ZA 2XTLA 3RESA 2OTLA 3V5UA 1Q86U 4BE1A 3OYEA 3I9WA 3VYHB 3CX7B 3N9NA 2RHXA 1QVPA 3PU8A 2CCQA 4KUIA 4QWNB 2E12A 2H7VC 1YKEB 3ZYKA 1OZ2A 3CQXC 4MMLA 4M1PA 2E70A 3RRCA 4C0GA 4H9SE 4C8QD 1KD1U 4UVAB 5DJQC 4O4HE 3DP7A 3CCUA 2ZZDA 2A3DA 4JUYA 3VKIA 1US7B 2ZPBB 3CMAA 3JCMQ 3RPUA 2ZMAA 4I4TE 2RO0A 4LD9K 3JCMg 4U74A 2JTFA 1B34B 2EHOB 2L89A 5GANg 1Q81U 1OYXA 3AVRA 4H9PC 5I2SA 5CQXA 5CCAA 3BQKA 5LJMA 3OYZA 4C8QF 2DJZA 3MEAA 4ILUA 3F2EA 4YFSA 2KDSA 5D6XA 2D0TA 4EMKB 1JRIA 2RJFA 3QJYA 2P4TA 1UB4A 5FY0A 1W2BS 3KBGA 3RKOA 1YCYA 1WJSA 1HF8A 5GAN4 3JCMV 1Q81C 2LHRA 3SS1A 3FXEB 1UX5A 3E19A 1WNLA 3OBVE 2YLBA 2RHZA 3J7AF 1MNEA 1U1TA 5GAMg 4MDWA 3G4ST 2K57A 4I50E 1Y7XA 1FIOA 3I1AA 3MXZA 2O4XB 4JLGA 2DO3A 3MACA 3H8ZA 4M7DD 3NRYA 2KWHA 4M75A 3MKDA 4M77D 3INZA 1D3BB 3N9OA 1JBMA 2X67A 4PW8A 2Y4YA 3G7ZA 2A7YA 2OTJA 3KUFA 5JDGA 5GAN6 4QVDA 1X6OA 5LJ3d 5HKCA 5FXWA 3L3PA 1Y71A 5F8PA 1IREB 2ZM2A 1WPYA 3CD6A 3BDLA 1YIJT 2DAQA 2RJDA 5H6QB 4IHJE 5LHIB 2FHDA 1U1SA 1M9SA 2W61A 5LBMA 4UXNB 3NBXX 4NL3A 1EZ3A 3N5LA 4M7DF 1N8RU 2JNGA 3O1HA 2KQWA 1K73C 2K5FA 3CCLT 2EQUA 2LEHA 3JCMc 5TAOA 4M77B 2DXBA 4J7IA 3OYBA 5HXSA 1O75A 4M75E 2V7KA 4EMHA 3OS5A 3O1JA 1KNZA 3MO8A 5I2MA 2MTQA 4PK6A 3ZN1B 1MHNA 2XK0A 3CCQA 3CXCS 2R57A 3QYHB 2AHJB 2Q9QA 5LJ5e 2CM0A 3PDYA 2ZPEB 3CCEA 1N8RC 3MP6A 2E64A 1MMAA 5GMKh 3DKMA 5CKDA 3S3NA 1M1FA 1FMVA 4PJOC 1VQ7T 5HK0A 4G63A 3OYKA 4LDYA 2CXFA 1Y96B 2JUFA 1HG5A 5GAOm 3I0OA 1QW1A 3QYGB 3G71A 3M54A 4JRIA 1KK7A 3QUJA 2XHCA 4MBQA 2YEVC 3G6ET 5FYMA 4M78E 5IN1A 2K4YA 3VJPA 3F31A 2ES0A 2CE7A 2V8JA 4ASKA 3JCMh 4ATOA 5E0OA 2GK9A 5J1GA 4L59A 4F7UF 2NTYA 5DY9A 5LXTE 4K0UA 1M90U 3CQCB 4GY5A 5GANh 1U5PA 4DVDA 4G2AA 3ZEFB 5KMGP 5I21A 5CAIA 4DQ2A 5J39A 1X01A 1FWZA 5LHHB 4M7AC 5DLOA 2LT1A 4RKUE 2HD0A 3M53A 3RC3A 3OYDA 3QZ9B 4JDSA 4BY6C 4C92A 2VGNA 1M90C 1WR6A 3DB3A 2LOSA 3O4XE 4E7JA 2YRVA 1AJ3A 4YHJA 1I5LA 1PSEA 4H9QC 2NP9A 5GAN7 1YD8G 4C5IA 3L2WA 3GIBA 2QA4A 3L2QA 4UF0A 5GAMh 4ZS3A 3KFWX 1YW0A 2RI5A 3UUMA 3JCMf 2C5JA 3CKDA 4A4EA 3ZJ2A 3QKJA 2CMRA 2L9QA 5GANf 2K5BB 2PU9B 2DXTA 3JCMJ 2ZPGB 1D0XA 3VU3C 5GAOl 3MP1A 1BI2A 3ASKA 3ZJ1A 2XQYA 1KQ2A 2NW9A 4WBNE 4EYYR 2Y6XA 2RJCA 5JDFA 2EHOA 3HKBE 2QDYB 4P5NA 3OS0A 4PJOG 1JB0E 5LNKA 2JTMA 4A53A 3C51A 4C92E 2WMOA 3C94A 2DTHA 5LG4A 3P8DA 4CXYA 2V1DB 4ADZA 3K3NA 3F70A 3R6OA 3EFSA 2DCFA 4I43B 4V2SA 2C5KT 3MEVA 4L9IA 1VQ8A 1KHIA 3H37A 4EMKA 4E7HA 2EJFA 1S72A 5GAMf 3OYCA 3RMSA 2XDBA 2A2FX 4H63V 1LJOA 4C0ZA 3B57A 5JR9C 3HRTA 5JVDE 3WAJA 2EFIA 4ISTA 4HCCA 3R84B 2ZLYA 4LDXA 4EXTA 2DZ9A 3M5AA 4BD3A 2M9UA 4M7AG 3LGFA 2D0QB 3META 3NZPA 2UXNB 2D9TA 4PNIA 1KG1A 1D0ZA 2BVMA 4DOWA 2K9AA 3NTHA 1D3BA 3RMQA 4ZTFA 3HKSA 2E1HA 3TREA 4E7KA 1W2BA 5LJ3g 1VQNT 2F5KA 3SOLA 3ME9A 2X68A 4M78G 5JDMA 2DIGA 2LSJA 3CBPA 4EPCA 4PJOB 3DLLA 2OTLT 3OBYA 3FBLA 3SD4A 5LL6S 3FHNA 1WQWA 2XAQB 3A8OB 3QSUA 2RA2A 4QX8B 1M1GA 4P0AA 1ZKEA 3WAKA 1UGQB 2E65A 3LJCA 2YK0A 1CUNA 5FY7A 3H6ZA 5GAN5 3LK3B 3X25B 3CCUT 3GF5A 1R8OB 2UXXB 4BE0A 1VQ5A 3F57A 3CX8B 4EMGA 3CMAT 4FSXA 2QEXA 2KT9A 2WM9A 3OYLA 3J80E 4MZPA 5D6YA 3AHUA 3KV4A 2XHEB 4E7IA 3SWNB 1HX8A 4M7AB 4IE6A 3OYMA 4HGAA 4X1IE 2EJ9A 4PJMA 5GMKe 3L2VA 4L6V5 2L5QA 4BY6B 4Z8XA 1Y96A 3CWZB 4A4HA 2XD0A 2EJGA 4O6JA 4AKGA 1RL2A 4BDZA 2RK2A 3HFNA 2RI2A 2QA7A 1X75C 1YHQA 4ISSA 3LYIA 3MJXA 2WSSV 1FXXA 3CCRA 4PAGA 4QQDA 1SA0E 3JCMe 3AA6B 4OB1B 4TX5A 4ZS2A 2HAXA 3AA7B 3CXCA 5JDLA 1IZ6A 3X28B 1YJ9A 3AVSA 2P0KA 2BUDA 4DA4A 3BY7A 1EIFA 5A0DA 2XI9A 1QSDA 3KV9A 3JCMW 3RX6A 2YU1A 3QZ5B 5GAOn 4XU1A 3ZCIA 4MLKA 5LGTB 2QQ9A 4RCBA 3CCVA 3PE0A 3HI2A 4FU6A 4OB2B 5L3EB 2XDPA 4OGCA 2OTJT 2X9XA 3QUIA 3UPUA 4TV8E 4E7ZA 1ZEEA 3RKXA 3ZEHA 4XTZA 4HFVA 4M7DC 3CD6T 4AKHA 2NW8A 4ZHQE 2QGSA 4A4GA 5KH6A 4AQFA 5JR9B 4D6WA 2NWBA 2K5IA 3OY9A 3P7IA 2D6FA 3K3QC 5GMKl 1YITA 3ZPOA 3CPWS 2N9DA 4IKFA 4O2AE 3DLMA 4A56A 3HL8A 3S4UA 2RHUA 4XTUA 4C8QG 4TV9E 3V8JA 2QQAA 1KQ1A 4IUTA 5FU7C 5LJ3h 5LYJE 4OFZA 3RYHE 3CCQT 3MP8A 1NJIU 5KE2A 2D2SA 4XU2A 4DMWA 1NAFA 3O1IA 4J6YA 3CCET 2DVEA 4XK8E 5A2QE 3U3IA 4CRIA 2J1DG 5HWXA 2EWNA 3RKYA 1Y64B 4OYKA 4QVZA 3NFCA 4OF1A 2CZ0B 3ZMVB 5FU6B 1H7CA 5C8YE 4R56A 1Q82U 1V9DA 3HA4A 2M16A 4C92F 5HXCA 4ZI2C 2RD1A 3G71T 2VB6A 3OW2S 4C90A 4PK5A 3C95A 2E9XC 4O4IE 1NJIC 1QVFA 3MCAB 1G3YA 1Q86C 5BMVE 1WJQA 2VKOA 4A54A 3A5ZB 4LDVA 2G3RA 3PUSA 2JJ9A 5LJ3f 4PL6A 3IF8B 2ZPIB 4VUBA 1LKXA 4JS5A 4XTYA 2KXPB 3M55A 2JRKA 5CKEA 1KD1C 1D1AA 2WMNA 5J26A 3RIRA 1QP3A 4GLKA 3A8LB 3HP9A 4C8QB 4AKIA 4M7DG 3LGLA 2PVGB 4IUUA 1BR0A 3GN5B 4IIJE 4ELZC 4PJOA 1N9SA 2D5UA 4OB3B 2LC4A 4M77G 5GMKj 1HS7A 1OXZA 2X4WA 4DOVA 2V8IA 1LVFA 1H3ZA 1VQ9A 5L8RE 3OYJA 3WXMB 3RKWA 5L3BB 5LJ5d 2HQEA 3V7CA 4DBRA 2QA4T 5CIUA 4ELYC 4UVBB 4HA8A 3PURA 3PGGA 2RP4A 3JCMP 3PT9A 1NPPA 3FIFA 1KC8U 1MMDA 3CQGB 1E1HB 2X66A 2R58A 1BR2A 2NW7A 4Z02A 3CBOA 1ZHIA 5KE3A 5GANj 2Y4XA 3SWNA 4M7AA 4FM4B 1IAPA 3ZC1A 3R6NA 2XUEA 3OQ5A 4PJOE 3MK7C 2ZGWA 5CKFA 1G73A 2WBLA 4O4JE 3M59A 2DZCA 1KC8C 3PTRB 4F7UG 1VQ8T 2ZPHB 2GFUA 1M1KU 5EG2A 3JC6C 3M4YA 5M4YA 4BAYB 4GYRA 4A4FA 3AAEB 2CZ6B 1S72T 2LX9A 2XAGB 3OYGA 4AKRB 4M7DB 1HCIA 3OJAA 3HRSA 4C0DC 4M78A 3PUGA 3L2ZA 5GAMj 3LBXB 2VGMA 2N1GA 3OSVA 1VQ4A 1YJNA 3SWHA 5FRMA 1IJ6A 5CVIA 3GOXA 3PTAA 1ZBXA 2P0QA 4GOUA 5HXEA 2CLYC 4H9RC 2RM4A 3LH0A 3ZC0A 4M7AE 1QVGS 1M1KC 3M4GA 3LK42 3AAAB 4ZI2D 3C64A 4O8SA 4KUMB 2NTXA 4A4KA 3URGA 2VKDA 2E9XD 5KX5E 4ZTJA 3DB4A 2GCXA 3NRXA 4QXCB 3T9NA 5FXZA 5IHYA 3Q9DA 4HCBA 4H9OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAX B;  4ILU A;  2LQK A;  4MFR A;  2LT1 A;  4KBM B;  4KMC A;  2LT4 A;  4L5G A;  2LT3 A;  2EYQ A; 
#chains in the Genus database with same CATH topology
 2B86 A;  1N5Z A;  3G71 Q;  3ZBD A;  2PNI A;  3CPZ A;  1N6A A;  3EGX A;  1TUC A;  1ZSG A;  3TKL B;  4OK0 A;  3HL6 A;  2C0I A;  2CZ1 B;  2DE0 X;  3UF4 A;  1HYO A;  1XTD A;  2CWY A;  3TLT A;  4J9C A;  4B9W A;  2EYX A;  4JI4 T;  4FYV B;  4PJL A;  3X26 B;  4IE5 A;  3VUB A;  4JLE A;  2O2O A;  4MDX A;  1MIW A;  4DMV A;  5AQK B;  4KGV B;  3TU4 K;  5ABF B;  2VUB A;  3BW1 A;  2XPK A;  4AMC A;  5JR9 A;  3RUX A;  3ZFJ A;  2W62 A;  2XQ9 A;  2KLQ A;  1I6Z A;  1IGQ A;  2C5I T;  3QJ6 A;  1ZHC A;  4F7U B;  2OAW A;  5HY6 A;  5ETW A;  2E9X B;  3EAM A;  2BS3 A;  3VR9 A;  4U7Y A;  2DTO A;  5J2T E;  2HMA A;  1OUL A;  2X51 A;  3ZCJ A;  5JDQ A;  1NYG A;  4LML A;  5GMK i;  2MOZ A;  2DFU A;  2JW4 A;  1YBY A;  2BBH A;  3H3M A;  4ZN1 A;  4Z88 A;  3ZYM A;  1RAE B;  4HE8 A;  4C5G A;  2CKK A;  2X9W A;  3TEE A;  3P8B B;  5LBQ B;  4TN7 B;  1VQ5 T;  2X9H A;  3QG1 A;  4EZH A;  4Y92 A;  3OYY A;  2QEX T;  2LT3 A;  3JB9 D;  1TG0 A;  2DBM A;  4DV7 T;  3G06 A;  2IAK A;  4WNK A;  4JZ3 A;  4NS5 A;  5CB4 E;  4DUZ T;  5F5W A;  1IHV A;  4JRP A;  5L3F B;  2K3Y A;  4JI1 T;  3C4X A;  3PMT A;  2LSI A;  3UU5 A;  4IUP A;  1E6H A;  4QH5 A;  5EK2 A;  2ROT A;  1BU1 A;  1TUD A;  2J6O A;  4J8O A;  1HG2 A;  2RMO A;  2VV5 A;  5FL0 A;  2DL1 A;  1UGP B;  2VXF A;  4RTY A;  2QA4 Q;  2CA5 A;  5HXR A;  2X35 A;  2A0F B;  3ETV A;  2EQI A;  2FVU A;  4O5V A;  5LOV E;  4IDO A;  2ODU A;  3CPW A;  4F6R C;  3UUB A;  1NM7 A;  5AQU B;  1OZ3 A;  3I56 A;  2CP0 A;  2J6K A;  2V7I A;  2ACX A;  1SKU B;  1ZA1 B;  2FO0 A;  1YHQ T;  1KQS S;  1N9R A;  5FXV A;  4X1Y E;  4KGX B;  3QK6 A;  1WXT A;  3JB9 F;  3ZYL A;  3CCR T;  3MA9 A;  4B3R T;  4HTE A;  2GFA A;  3I55 A;  5DM7 R;  2YDS A;  3RHW A;  1BK2 A;  2M0Y A;  3OTO T;  5KYY B;  2IDO B;  3KBT A;  4MZT A;  5AFU L;  3JC6 D;  1Z0P A;  4YXD A;  4X20 E;  4DR7 T;  1B34 A;  3EG1 A;  2A72 A;  1VUB A;  2D8J A;  2F69 A;  4OB0 B;  2LP5 A;  1IJ5 A;  1YJ9 T;  2JMH A;  4MZM A;  5JTG A;  2VWF A;  4ILA A;  2DK3 A;  1MMN A;  4EB6 E;  2FJE A;  2LM9 A;  2SPC A;  2GF7 A;  3EFO B;  4OMF B;  1V29 B;  3C50 A;  2X0L B;  3EHZ A;  1CSK A;  4E47 A;  4N4H A;  2VVN A;  3EAE A;  3CK6 A;  2PUO B;  2V6Y B;  4Q5W A;  1I81 A;  1VQ8 Q;  4C8Q A;  3PUW F;  3P4Q A;  2EYZ A;  1JNZ A;  3ZT6 A;  2XQ6 A;  1IO6 A;  4TWF A;  4BA9 A;  1S72 Q;  3AE5 A;  3NVO A;  2Q9Q C;  5AQV B;  2DLR A;  3ONJ A;  4WF2 A;  2Y8D A;  3CCV T;  4KUD K;  3RC8 A;  1RUW A;  3V8L A;  3CCJ A;  3EH2 A;  3OW2 A;  2DEQ A;  4UV9 B;  5DQV A;  2PUK B;  3A8G B;  5A1L A;  2FBW A;  3I9Y A;  1WZO A;  3ANW B;  2I2L A;  3GA8 A;  1ZSZ C;  2DMO A;  4DV4 T;  2WP9 A;  2FB7 A;  4ZGJ B;  5LGN B;  1WQ7 A;  1HXD A;  3SDZ A;  4U33 A;  1U5S A;  4WBO A;  5ABH A;  1W70 A;  3UFE A;  2CBI A;  1G83 A;  1G3W A;  1ZA2 B;  3WVD B;  2JPF A;  4IGU A;  4EDU A;  5LJ5 g;  4O4L E;  3BK9 A;  2VVK A;  2KT8 A;  4MFR A;  1Q95 G;  1R0C B;  3ZMU B;  3SHW A;  3CCS A;  4NIQ A;  2K3W A;  2EQK A;  4C0D B;  4UEL A;  1PSF A;  3GNG A;  3L1A A;  2CH4 W;  2V26 A;  4R0K A;  1SE7 A;  4JPB W;  1PD0 A;  2K2M A;  5C6S A;  1VQL A;  3RYI E;  2UXD T;  3EHR A;  2ZM6 T;  3LDQ B;  2BKD N;  1M3B A;  4RG2 A;  1YIT T;  2O4X A;  3AE3 A;  3B13 A;  2EYQ A;  1WFD A;  5KYX A;  4EGW A;  3E1S A;  2L8D A;  4YLH A;  2W63 A;  3VS0 A;  3HSB A;  3C4S A;  3PJA A;  4MHC A;  4LXC A;  2CLY B;  5FW9 A;  4I55 E;  3GBQ A;  2IHR 1;  4N78 D;  2KR3 A;  4GBQ A;  5J3B A;  2E8I A;  4E7S A;  3VUZ A;  4C8Q E;  4PKC C;  2VKJ A;  3E22 E;  1W4S A;  4FYX B;  4GKJ T;  4F17 A;  3JAM E;  3MEW A;  3PFS A;  2W00 A;  1ZQ1 A;  4EYU A;  5FL1 A;  3JCM d;  4JJC A;  3O9X A;  1SG5 A;  3SB2 A;  1T0H A;  4GK0 E;  3M56 A;  4DBF A;  3QHS A;  3LW5 E;  3P4W A;  1Q7Y R;  1D1C A;  3OYA A;  3LH5 A;  3QNU A;  4FI5 A;  3ZMT B;  2VL0 A;  4CI3 B;  1UE9 A;  3DJB A;  3VS7 A;  1WR0 A;  3L42 A;  2VYT A;  5IUX A;  4C92 C;  3VKH A;  3BFM A;  3VRA A;  4ZI3 D;  4OGE A;  3WI3 A;  4M7D A;  2CT4 A;  3M0R A;  2JXB A;  1EFN A;  1YWO A;  1KFY A;  3ONX A;  4N0A C;  3MZK B;  4DEY A;  1K9M U;  5H6R B;  4JS4 A;  1TXQ A;  4M77 A;  4M75 D;  5AQR B;  3UT1 A;  2MWP A;  1UG1 A;  2RQT A;  2RHI A;  1XZY A;  4FT4 A;  4XTX A;  2QEX Q;  2ZM8 A;  4OX9 T;  2D0U A;  3L09 A;  3HKE E;  3AE1 A;  1X79 A;  2BZY A;  4X1V A;  5LMN T;  3RIA A;  3ESL A;  5ABG A;  3CX6 B;  1QMC A;  2HQH A;  3E9G A;  2CGH A;  3L2U A;  2JQQ A;  4QHO A;  3T1H T;  2HBP A;  3LK2 B;  4ERR A;  1AOJ A;  4X1K E;  2RB6 A;  3UAT A;  1OV3 A;  2COY A;  2P4R A;  3GNF B;  1PRL C;  5LJ3 j;  1K9M C;  4JI7 T;  1CKA A;  5HEU A;  3AEB A;  2WAU A;  4JI0 T;  3FXD B;  2JOY A;  3CC7 A;  1PKS A;  4M75 F;  4J5Y A;  4CXW A;  2XG8 D;  3X1D A;  4QVC A;  1YHQ Q;  4M78 D;  3ZL7 C;  4V1A v;  2RQW A;  4M7D E;  2V5D A;  1G2B A;  4NUU A;  1WA7 A;  2KRN A;  2YRC A;  3CCR Q;  1BIA A;  2M1H A;  4GIW A;  4HWI B;  4QW2 A;  3EUH A;  2WSF E;  2J06 A;  3REB B;  5ABF A;  3KXT A;  2F5T X;  4N4I A;  3KV6 A;  3AE4 A;  4M77 E;  3AAI A;  5FXX A;  1X69 A;  2QGF B;  1HJD A;  1N33 T;  2FL7 A;  1LCK A;  4JRQ A;  3OS2 A;  1VQ9 T;  1WJR A;  2JM8 A;  1G8X A;  3PIO A;  2HZY A;  4XTV A;  1XQH A;  4F7U A;  2YKS A;  2KYM A;  4C5H A;  1QVG A;  3UDC A;  3PIP A;  5CK9 A;  1YJ9 Q;  4J6X A;  2Q9Q D;  2R5A A;  5GAN e;  2XU8 A;  1U8R A;  3PUA A;  3VKG A;  2EYW A;  3FJP A;  2XKO C;  2A28 A;  2B1E A;  1RAF B;  5HYA A;  4UV8 B;  2K24 A;  2CH4 A;  3JCM X;  1JU5 C;  3FC3 A;  2MPK A;  4JJB A;  2DWG A;  2HQX A;  2SRC A;  5C2T A;  5JDH A;  4M78 F;  1UEB A;  2A3L A;  3HPW A;  2C0T A;  3V5S A;  1AT1 B;  1C6V X;  4NXM T;  2IC9 A;  4CZZ B;  2XAS B;  2BE9 B;  4K11 A;  5CKH A;  1VQO A;  3CCV Q;  2KXD A;  2BKN A;  5IHN A;  2JVV A;  2DTI A;  1J3T A;  1KF6 A;  3BQL A;  1H8K A;  2K5L A;  3JAF A;  2B8A A;  2KAF A;  1RLQ C;  3B5M A;  4PFP A;  4J9F A;  1Y57 A;  1BI0 A;  5HAX A;  2YLC A;  1YCS B;  2LM2 A;  1SHG A;  2GBQ A;  2V1R A;  1YI2 A;  3M0P A;  2LCC A;  4HCZ A;  3A8H B;  1MIY A;  1VQM A;  5LJ5 h;  4F8H A;  2J6F A;  4NOY A;  3AXJ B;  3MHX A;  5JH7 E;  5HEH A;  4DV2 T;  4JYA T;  2Q9Q B;  2K3B A;  3QXE B;  1BI3 A;  3EG0 A;  4MMK A;  4CI1 B;  4FT2 A;  5GAM e;  5LP6 E;  4AKL A;  2QTX A;  1UCU A;  3HFO A;  5EK4 A;  4X9C A;  1ZSZ B;  3M0S A;  4F7U E;  1YIT Q;  2C0S A;  2IIU A;  4KHZ F;  2O88 A;  1OPK A;  4RTW A;  1X2Q A;  2F2W A;  2ZM0 A;  2XAH B;  3RRW A;  4UC4 A;  1FMW A;  2GNC A;  5GON E;  2OAU A;  3OB9 A;  1P92 A;  3I9Q A;  3QPH A;  4OP0 A;  5KYY A;  4GYS A;  1V1C A;  1MIV A;  4TUY E;  1RAH B;  1FMK A;  2LNV A;  4OML A;  1ARK A;  1WYB A;  3EDV A;  1VQ4 T;  2KSS A;  1YJN T;  4C92 D;  4ANJ A;  2X4Y A;  3ZMZ B;  4XU0 A;  4COF A;  1S35 A;  1IHW A;  4CQI A;  3EFO A;  3AEC A;  5AQO B;  3I0Q A;  4QH4 A;  1NZ9 A;  1YWP A;  1YJW A;  4UIG A;  2V6Y A;  2J7I A;  2FEI A;  4J7F A;  4ZGD B;  1DJ7 B;  3ETU A;  2QGG A;  4X9D A;  3PU3 A;  2DHR A;  4YTL A;  3JSC A;  5FRN A;  4ME7 A;  4FL6 A;  1IB8 A;  3JB9 I;  4JI3 T;  3Q2M A;  2UU9 T;  5LJ5 f;  2WWU A;  5HXH A;  2L3R A;  1NE8 A;  2MOX A;  1VQP A;  5BR8 T;  1JJ2 P;  5HCM A;  2JT4 A;  1QP2 A;  3PVL A;  5CJ5 A;  3ANW A;  2QQB A;  3G1J A;  4RCC A;  3JV3 A;  4JRK A;  1KQS A;  3CC4 A;  2YIN A;  4AIS A;  5JRC B;  3RYF E;  1LOJ A;  3QBY A;  3E9F A;  2JQ9 A;  2CPT A;  3H0H A;  1M7K A;  5A0L A;  4KRT A;  2FPE A;  2L2P A;  1E2A A;  4QKN A;  4C92 B;  4MAL A;  4XTW A;  1C0M A;  3O8V A;  2BZB A;  1YKH B;  2E5Q A;  4ZXL A;  1VYT A;  4IDQ A;  2ZCF B;  4HVW A;  4QQ6 A;  5AYF A;  4CC4 B;  2EHO D;  1Q86 R;  4JI2 T;  2DX1 A;  4BI8 B;  2VVS A;  3JCM b;  2DL4 A;  2EGC A;  4DR1 T;  3HTR A;  3OMC A;  3QB5 K;  4II1 A;  3Q5W A;  3REA B;  3O5Z A;  2XIC A;  4FJO A;  4IDZ A;  4Q25 A;  4UF0 B;  3OPC A;  3IA3 A;  1OU8 A;  2KMT A;  1WHL A;  3SFM A;  2JQH A;  3PUQ A;  3QDF A;  4GLM A;  4JLI A;  1VIE A;  4TVR A;  3N2K E;  1KD1 R;  2EKH A;  2M51 A;  4DBH A;  1S94 A;  1Q82 C;  3KFV A;  5D7U A;  2CHO A;  5GAO q;  1NWM X;  1RAD B;  4LF7 T;  3HHT B;  4LE9 A;  2OI3 A;  1OX8 A;  2LOP A;  1OED C;  5CA1 E;  5GAO r;  2LKH A;  1O9S A;  3K8P C;  1U4Q A;  5A0G A;  9ATC B;  2GQV A;  4B3M T;  3N2G E;  2C06 A;  3OS1 A;  4QX7 B;  4FIB A;  2MYS A;  1VQ9 Q;  2BIV A;  1Q81 R;  5FP3 A;  2Y48 B;  2LSY A;  2RHY A;  4EV6 A;  4B9X A;  3N9M A;  3T8O A;  5L3D B;  3VRB A;  2MI6 A;  2PVD B;  2X4X A;  2CYZ B;  2MIO A;  2K3X A;  1FYN A;  5CA0 E;  1BCM A;  2KMF A;  3CME A;  2DWK A;  3M65 A;  1SRL A;  2V7J A;  1V76 A;  1WYX A;  2HNI A;  1QVF P;  1R0B G;  2P9B A;  4CI0 C;  8AT1 B;  5FMN A;  2IML A;  2G0U A;  3M58 A;  3OYI A;  2XSB A;  3I56 T;  4LUE A;  2QYZ A;  1HD3 A;  1X9B A;  2LT4 A;  3J81 E;  1SSF A;  2E6N A;  2JN0 A;  2EKO A;  3KVB A;  2AZS A;  2DXU A;  3P4P A;  4AQF C;  3ER0 A;  3CC2 A;  5FLX E;  3I55 T;  2CP7 A;  1LNX A;  2KT1 A;  4ZI7 E;  5CGM A;  4PLI A;  2HKN A;  1VIF A;  4KBM B;  1FEW A;  1NEN A;  2L8K A;  3J7Y q;  3V8K A;  4ZZC A;  1HFA A;  4BI4 A;  2DNX A;  2V8K A;  1H64 1;  4AG2 C;  4X5T A;  2EGA A;  3AA1 B;  2FZK B;  3EG9 B;  5GJV B;  5L3C B;  3N2O A;  3CD6 Q;  3CVR A;  2LJL A;  2RN8 A;  3VS6 A;  3GMI A;  5IT9 E;  1AWO A;  4RG8 A;  2BG9 C;  4YJ2 E;  1AEY A;  3J9X 1;  3FB9 A;  3S6W A;  5HK3 A;  1YFN A;  1K73 U;  2KND A;  1XDP A;  4HN9 A;  2LSK A;  3A98 A;  3CCJ T;  2PTF A;  3EDU A;  3PUV F;  4GK5 E;  4IUQ A;  4IE0 A;  3PUZ F;  5ADX L;  4PLL A;  2GTO A;  4QXH B;  1VQ6 A;  2X0H A;  3QC9 A;  2WDV A;  1VYU A;  2DKG A;  2LHN A;  4KH0 B;  3LLR A;  1VQ4 Q;  1M4Z A;  2N2N A;  1YJN Q;  2HPL A;  3CCM A;  1Y0M A;  4XQ3 A;  3GP8 A;  1K8A U;  2EIF A;  4OHF A;  4PK4 A;  2CXD A;  4IE4 A;  5CO7 A;  4QH1 A;  1UUR A;  4EEB A;  1X6G A;  2JZ2 A;  2EQJ A;  2E5V A;  3CCS T;  1ZV4 X;  2H3J A;  4ZZB A;  3A8M B;  2LRQ A;  1LVK A;  4H63 H;  3NTK A;  4JBW F;  2LKG A;  1VQL T;  3OA6 A;  3Q1J A;  4RMO A;  2ZPF B;  4IE7 A;  4C5E A;  4XU3 A;  1VQK A;  5FU7 B;  4EOZ B;  3AE7 A;  2KRO A;  4M77 F;  2ROL A;  2DPP B;  5KYW A;  5GAN 2;  3K3O A;  2BTT A;  3VHL A;  4AXP A;  3M0Q A;  5KYU B;  2IUB A;  4H9N C;  4ZNX A;  5DLQ E;  3JB9 J;  1MGQ A;  1QKX A;  1K8A C;  2ATC B;  2CUD A;  4L5G A;  2XQ4 A;  2YOE A;  1VA7 A;  4PNO A;  2X9Y A;  1G3T A;  2DD5 A;  5LJN A;  3JB9 G;  2PG8 A;  4FW2 A;  3A5X A;  4AQG A;  2D8H A;  2LCL A;  2LJ0 A;  1T8B A;  3FBZ A;  3E08 A;  3EVY A;  4CI2 B;  3N5B B;  2I59 A;  1KHC A;  5AQS B;  1VCS A;  5LGU B;  5EZY E;  4XAX B;  2DIQ A;  2OJ2 A;  1WX6 A;  1ZSZ A;  2OLT A;  3ZN0 B;  5FY1 A;  2DL3 A;  4CC7 A;  4CXX A;  3VYG A;  2IVW A;  2DLP A;  4RUG A;  3OSS C;  2A36 A;  3HKD E;  2KIN B;  4B3S T;  4IUR A;  3UU4 A;  1BKB A;  5FNV E;  5LMU T;  2LQN A;  2E10 A;  3UT5 E;  2DET A;  2WZI A;  1WHK A;  4BI3 A;  5L2L A;  1FX7 A;  3C12 A;  2R6G F;  4U7I A;  2MBG A;  2RI3 A;  1RI9 A;  2QAZ A;  2WSC E;  3UA6 A;  3AE9 A;  3MPU B;  1W1F A;  3V7R A;  5KDM C;  1IGU A;  5LJ3 e;  4ZGE B;  1GBR A;  2EBP A;  1JJ2 S;  2R5M A;  1M8V A;  2MMP A;  3IEE A;  4ZI3 C;  2VC8 A;  4FW1 A;  1KNP A;  1JNR A;  3EG3 A;  3OYN A;  3RIF A;  1M90 R;  2CWO A;  1JEG A;  3AA0 B;  3QB5 A;  4U2Z A;  2E2A A;  4QQG A;  4P0B A;  1ABQ A;  1ABO A;  5D6W A;  1WXU A;  2P0P A;  1OI1 A;  5J2U E;  4LDU A;  4M75 C;  4X34 A;  3I5R A;  3N9L A;  3RKG A;  1UTI A;  4IIM A;  2DI4 A;  3C4Z A;  3SWN C;  1ZBJ A;  4HEA A;  5FRO A;  5JRC A;  5C0M A;  3CC7 T;  1TU0 B;  3I56 Q;  3UU6 A;  4B6X A;  4UVC B;  2E5L T;  3W15 B;  2EAY A;  2D0N A;  3PNW C;  3BDU A;  2RJE A;  3PV0 F;  3Q5X A;  5HWY A;  2W0G A;  2QYW A;  1BR1 A;  3NZQ A;  5J0Z A;  5IWA T;  2V7M A;  2FYK A;  4N0A A;  3I55 Q;  4YTN A;  2VAS A;  2O01 E;  3RQU A;  2E5K A;  2LQ8 A;  3FB2 A;  1MND A;  4JEH B;  5LCY A;  3LX7 A;  2MK5 A;  4YJ3 E;  1SRM A;  1E6G A;  3ZMS B;  4KT0 E;  4QT7 A;  1B7T A;  1SHZ C;  3C98 B;  2XDD A;  3KDS E;  3UUX B;  4M78 C;  3G4S A;  3KBU A;  2QVA A;  1ACM B;  2YHT A;  4LDW A;  8ATC B;  2L3L A;  5GAO p;  4HWC A;  4P09 A;  3FDR A;  4U72 A;  2F2V A;  2RA1 A;  2JS2 A;  1UDL A;  2W2U A;  3D0T A;  5JQG E;  2DJQ A;  3TLV A;  2KK4 A;  4J2C A;  3DTO A;  1T98 A;  5LA6 E;  3SRZ A;  2CUB A;  4BE2 A;  2E41 A;  2LMJ A;  2PJQ A;  2Y90 A;  3U78 A;  2JMK A;  3PUY F;  4J83 A;  3ZLI A;  3RH3 A;  3GN5 A;  1VQO T;  1WYC A;  1QVF S;  3CCJ Q;  1BI1 A;  3RBB B;  2WAC A;  2Z6E A;  2CP3 A;  2QQS A;  3OYX A;  4XZC A;  4XBF B;  2KZ7 B;  1Y07 A;  4JEU B;  2RF0 A;  2MF2 A;  1M3C A;  2LTO A;  3UTK A;  2BG9 B;  1YI2 T;  4QXB B;  1TH7 A;  1VQM T;  3P8H A;  4DV6 T;  3TQ7 P;  1M2V B;  4HT8 A;  1AHJ B;  3N9Q A;  2LDM A;  2FRW A;  2MAM A;  4OMQ A;  1YIJ A;  3LFM A;  1XOV A;  3CCS Q;  3RYC E;  5GAN 8;  3QO3 A;  4BJM A;  4KP3 C;  2CXL A;  4EAH A;  1VYV A;  1VQL Q;  1IZN B;  1X2K A;  1IBK T;  4C91 A;  1UHC A;  2EVR A;  4NL2 A;  2BDE A;  3Q5D A;  4A98 A;  3QII A;  2XQ5 A;  3HR0 A;  2AE9 A;  3RER A;  3AEA A;  3CCL A;  4LF4 T;  3OBW A;  3BQI A;  3TVT A;  2XM2 A;  3M9Q A;  2VWA A;  3ONL C;  4KMC A;  4GKK T;  7AT1 B;  2QI2 A;  1JQQ A;  5FVL A;  4BAC A;  4FCY A;  2YUQ A;  2XQ7 A;  4CN4 A;  4M75 G;  3S3O A;  1L0V A;  2LQW A;  4PJO D;  2QDL A;  4X62 T;  2XQA A;  3CEY A;  1W09 A;  4F04 B;  1O3X A;  4R55 A;  3CML A;  1IXD A;  3AB3 B;  1I1J A;  3TCJ A;  3LWH A;  2P84 A;  1WGS A;  5L3G B;  4AIU A;  2PQW A;  3EG9 A;  4E7L A;  2NOX A;  2XY8 B;  1YJW T;  1Q7Y U;  3LG7 A;  3OW2 P;  2HPJ A;  1LRZ A;  2AXD S;  2UUC T;  1WLX A;  5F3J A;  4BDY A;  3UUN A;  4PFO A;  3UU3 A;  4DO0 A;  5GAN d;  2XJ7 A;  4LF8 T;  3N9P A;  1G3S A;  1VOM A;  2KNB B;  3JB9 H;  2XAF B;  3OKQ A;  1WRD A;  1OX9 A;  2E3H A;  1VQP T;  1VQ7 A;  1RLP C;  4PJN A;  1J1J A;  2ESW A;  5LHG B;  1IRX A;  1HK9 A;  3LWI A;  2I0N A;  3P8C D;  2CZ7 B;  4HKE A;  5LJ5 j;  3X20 B;  3CC4 T;  3HKC E;  1HTJ F;  1FJG T;  3NHN A;  2HH7 A;  3EGD B;  3PMI A;  3CPF A;  1G5V A;  3AEG A;  2XAJ B;  2KBT A;  4PJO F;  1T72 A;  2PVO B;  1IBL T;  4TZ4 C;  3FJ5 A;  3LBX A;  2EQM A;  3QDR B;  3G6E A;  2CS7 A;  1XMO T;  5CFB A;  4OYJ A;  1PRM C;  2YDL A;  5EK3 A;  1VQ5 Q;  5FU6 C;  5CKB A;  1Q7Y C;  4OVA A;  4M7A D;  3C4W A;  4ZOL E;  4O2B E;  3JRZ A;  5CQY A;  3RDV A;  4HFH A;  4EIW A;  3ULR B;  3A8Y C;  2DXC A;  4J9B A;  1PCX A;  4J6W A;  2VKH A;  4J9E A;  4K0K T;  1XNQ T;  4Y91 A;  4DBQ A;  3EHQ A;  4BJN A;  1GCQ C;  3NTI A;  3FZF B;  5IYZ E;  1N27 A;  4IUV A;  5GAM d;  1W2B P;  1K9M R;  1I8F A;  2YDR A;  3P4R A;  5KYU A;  3X24 B;  2PBI A;  3H3A A;  2V8S V;  1PC0 A;  2WSE E;  1MMG A;  2GQI A;  1K0X A;  5AQH B;  2H7O A;  3SEM A;  3RIU C;  2FRY A;  4ILB A;  3FLG A;  1R8I A;  2EHO C;  4PJJ A;  3M57 A;  3CC7 Q;  1M5Q 1;  2IPO B;  2LQK A;  6AT1 B;  1M62 A;  3VU7 H;  3VRY A;  1UGR B;  4A97 A;  4B3T T;  2RK1 A;  2QK0 A;  4M75 B;  4P1N A;  3IQL A;  4UEM A;  2WY2 A;  2KVQ G;  2ODV A;  1N36 T;  3FRN A;  4M7A F;  4ZN3 A;  2KWI B;  4C8Q C;  3QWY A;  1VRB A;  2W10 A;  3HRU A;  2NLU A;  4DND A;  5IHK A;  1PG5 B;  2K48 A;  3P50 A;  5DAB A;  2WU5 A;  1QUU A;  4EMK C;  4BB7 A;  4JI5 T;  5GMK m;  3OYH A;  1SUM B;  2COW A;  2HN1 A;  2DL7 A;  4L0R A;  2E9X A;  2FJA A;  4IL4 A;  3CME T;  2RH2 A;  4U31 A;  1BIB A;  4N4G A;  3E0Z A;  4Z90 A;  2XID A;  2FZG B;  2DIL A;  1WHJ A;  2F1L A;  1NPR A;  3KIN B;  3EFR A;  2M67 A;  4ESR A;  1BBZ A;  1I0C A;  4HKA A;  4JUV A;  5LG3 A;  2LE8 A;  4M78 B;  1VQO Q;  4KUL A;  5GAN 3;  1RAB B;  3CC2 T;  2K7A A;  5M9O A;  1WIE A;  5JDN A;  2LZ6 B;  1W0A A;  4C92 G;  2PTK A;  1YI2 Q;  4EZ4 A;  1KFZ A;  4JI6 T;  3GWH A;  1VQM Q;  2YU2 A;  2DYI A;  1NEG A;  1X6B A;  2RQU A;  2BBJ A;  3KV5 A;  1ZOY A;  2VL8 A;  4AI6 A;  2IW5 B;  2H3E B;  2Z0W A;  2D1X A;  2IC6 A;  1AZG B;  3SFE A;  2BS4 A;  3FEO A;  2VXE A;  1YP5 A;  4C0F A;  4JJN K;  4HXJ A;  1XNI A;  1I4K 1;  2B76 A;  1NYF A;  2L3Q A;  1M30 A;  2CRE A;  1T3L A;  5JRE A;  4U3C A;  3RLF F;  2V7L A;  5CR2 A;  5FKY A;  2DD4 A;  4FYW B;  3UWN A;  3WVE B;  3OMG A;  5KCO A;  3CXC P;  1WHH A;  3CBM A;  4PFZ A;  1OWA A;  4Y28 E;  3KVA A;  4LD6 A;  1I07 A;  2CEA A;  1VQ6 T;  3PVQ A;  2CDT A;  1H92 A;  2LVM A;  1RI0 A;  1QLY A;  2VK9 A;  2IG0 A;  4HWH A;  2HSP A;  1GL5 A;  2WS3 A;  1OOT A;  4BUG A;  2O31 A;  1JJ2 A;  3CCM T;  2YUO A;  2M0O A;  2HL5 C;  3VV0 A;  3MEU A;  2QRX A;  4M77 C;  1BR4 A;  3UUL A;  1OU9 A;  5IH2 A;  1QKW A;  1D1B A;  1YJW Q;  4HT9 A;  1BYM A;  3UU8 A;  3NGP A;  3RF1 A;  4NUV A;  3IBP A;  3S3M A;  3OYF A;  2PFV A;  3IHR A;  2KY9 A;  5DQW A;  3QOF A;  4DR4 T;  3GPL A;  2MPX C;  3GLX A;  2H3R A;  1VQK T;  2CP2 A;  2AK5 A;  1VQP Q;  2FG0 A;  2K2V A;  1GXI E;  2V5C A;  3L8R A;  4WW0 A;  2HN2 A;  2LSG A;  2OA5 A;  1UGS B;  2LRK A;  3CC4 Q;  1D0Y A;  3FZH B;  5KCH A;  2QQR A;  2RNA A;  3A1P A;  1UX4 A;  1XNR T;  2O9S A;  2X4J A;  2LX7 A;  2QXF A;  4Z8A A;  3V7S A;  4JI8 T;  2BVL A;  3L2R A;  2MWO A;  1VQN A;  5AQP B;  5IAY A;  1AVZ C;  2E6Z A;  2XTL A;  3RES A;  1HR0 T;  1NJI R;  3V5U A;  2OTL A;  2K9G A;  1KNR A;  1Q86 U;  4BE1 A;  3OYE A;  4UR9 A;  4HFE A;  3I9W A;  3VYH B;  3CX7 B;  2CP6 A;  2XQ3 A;  4DV0 T;  3N9N A;  1NLP C;  2ECZ A;  2RHX A;  1QVP A;  5GJW B;  3PU8 A;  2CCQ A;  4E6R A;  1QWF A;  4KUI A;  4ZEY A;  3TSW A;  2LJ3 A;  4QWN B;  4DUY T;  2E12 A;  1ZX6 A;  2H7V C;  2JMC A;  1YKE B;  3PJA J;  3ZYK A;  3CQX C;  1OZ2 A;  1WFW A;  3TLS A;  4MML A;  4OMM A;  4ORZ A;  4M1P A;  2E70 A;  3RRC A;  4C0G A;  4H9S E;  4C8Q D;  1KD1 U;  4UVA B;  5DJQ C;  1Q82 R;  5FWC A;  1HNX T;  1VCT A;  2EPD A;  4O4H E;  3DP7 A;  3CCU A;  2ZZD A;  1HNZ T;  2BS2 A;  2A3D A;  4JUY A;  4B6M A;  2OX7 A;  3VKI A;  2UXB T;  1US7 B;  2ZPB B;  3CMA A;  2W4X A;  3JCM Q;  3RPU A;  2ZMA A;  4I4T E;  5HCJ A;  3VRZ A;  2RO0 A;  4LD9 K;  3JCM g;  2NUP B;  5KXJ A;  4U74 A;  4CC3 A;  2NR4 A;  2JTF A;  4YSY A;  2NUT B;  1B34 B;  2BG9 E;  2EHO B;  2L89 A;  4KX6 A;  5GAN g;  2DEU A;  1Q81 U;  5C3J A;  1OYX A;  3AVR A;  4H9P C;  5I2S A;  5CQX A;  5CCA A;  2KEA A;  3BQK A;  1K76 A;  5AQN B;  5LJM A;  3CME Q;  3OYZ A;  2HSE B;  2CSQ A;  3UA7 A;  4C8Q F;  2DJZ A;  2A37 A;  3MEA A;  4J9I A;  4ILU A;  1Z9Q A;  3F2E A;  4YFS A;  4AFU C;  2J05 A;  1ZP0 A;  2KDS A;  5D6X A;  1OEB A;  2D0T A;  4EMK B;  1JRI A;  2RJF A;  3QJY A;  2P4T A;  1UB4 A;  5FY0 A;  1W2B S;  3KBG A;  2JM9 A;  3RKO A;  1YCY A;  1WJS A;  3CC2 Q;  1HF8 A;  3RGL A;  1TSF A;  4JJD A;  2A9U A;  2FJD A;  5GAN 4;  4YSZ A;  3JCM V;  3EAB A;  1Q81 C;  2LHR A;  2HKQ B;  3SS1 A;  2CRB A;  4KHP T;  3FXE B;  1UX5 A;  4YY3 T;  1SF9 A;  2W66 A;  3E19 A;  1WNL A;  3OBV E;  3TLU A;  3VS2 A;  2YLB A;  2RHZ A;  2AKK A;  1MNE A;  3J7A F;  1U1T A;  5GAM g;  4MDW A;  3G4S T;  4IL9 A;  2K57 A;  4I50 E;  3VS1 A;  4F14 A;  1W9R A;  1Y7X A;  1FIO A;  3I1A A;  3MXZ A;  2O4X B;  4JLG A;  2DO3 A;  3MAC A;  1KC8 R;  4DR5 T;  4WZX A;  1XJW B;  3H8Z A;  4M7D D;  3NRY A;  2KWH A;  4M75 A;  3MKD A;  1RAI B;  2XQ8 A;  4M77 D;  3INZ A;  4HFI A;  1D3B B;  3N9O A;  1JBM A;  2X67 A;  4PW8 A;  2Y4Y A;  3G7Z A;  1VQ6 Q;  2A7Y A;  2OTJ A;  5LB7 B;  5JDG A;  3M3Z B;  3KUF A;  5GAN 6;  1X6O A;  5LJ3 d;  4QVD A;  1WXB A;  1HNW T;  3AE6 A;  5FXW A;  5HKC A;  1UJ0 A;  3L3P A;  1Y71 A;  2NWM A;  5F8P A;  4DR6 T;  2JMA A;  2FJB A;  1IRE B;  2ZM2 A;  1WPY A;  2CSI A;  3EI0 A;  3CD6 A;  3FZM B;  1M8M A;  1UHF A;  3BDL A;  1YIJ T;  2DAQ A;  2RJD A;  5H6Q B;  4IHJ E;  5LHI B;  2FHD A;  2I6H A;  1M1K R;  1U1S A;  1M9S A;  2W61 A;  5LBM A;  4UXN B;  3NBX X;  4NL3 A;  1EZ3 A;  3N5L A;  2DRK A;  2FZC B;  1N8R U;  4M7D F;  1QWE A;  2JNG A;  1TTH B;  3O1H A;  2KQW A;  1K73 C;  1T0J A;  2K5F A;  1YQ4 A;  3CCL T;  2EQU A;  2LEH A;  3JCM c;  5TAO A;  4M77 B;  2DXB A;  4J7I A;  3OYB A;  5HXS A;  1O75 A;  1U06 A;  1XDO A;  4X66 T;  4M75 E;  2V7K A;  1GBQ A;  4EMH A;  3OS5 A;  3O1J A;  1KNZ A;  1PNJ A;  4HWF A;  3MO8 A;  1KSW A;  5I2M A;  4EED A;  2MTQ A;  1TS9 A;  4PK6 A;  3ZN1 B;  1MHN A;  1UUE A;  2XK0 A;  4EIK A;  4IT4 A;  2ENM A;  4WYV A;  3CCQ A;  3CXC S;  2R57 A;  3AXJ A;  3SFD A;  2AHJ B;  3QYH B;  3RI5 A;  2Q9Q A;  5LJ5 e;  2CM0 A;  2LLY A;  3PDY A;  2ZPE B;  2K79 A;  4D8D A;  3CCE A;  1N8R C;  1DU2 A;  3MP6 A;  2NUZ A;  2E64 A;  1I94 T;  1MMA A;  4KH1 B;  3DKM A;  5CKD A;  5GMK h;  2AIR B;  3S3N A;  1M1F A;  1FMV A;  4PJO C;  1VQ7 T;  1E7P A;  2HHH T;  5HK0 A;  4G63 A;  3OYK A;  4LDY A;  1YQ3 A;  2DL5 A;  2CXF A;  1Y96 B;  2JUF A;  2XSA A;  1AD5 A;  1HG5 A;  5GAO m;  3H9N A;  4RTZ A;  3I0O A;  1QW1 A;  3QYG B;  3G71 A;  5L47 A;  3M54 A;  4JRI A;  1KK7 A;  3QUJ A;  2XHC A;  4MBQ A;  2YEV C;  3G6E T;  5FYM A;  4M78 E;  5IN1 A;  2K4Y A;  2K6D A;  3VJP A;  3F31 A;  1ZUU A;  2ES0 A;  2CE7 A;  2V8J A;  4ASK A;  3JCM h;  2KRM A;  4ATO A;  5E0O A;  2GK9 A;  2WZH A;  5J1G A;  4L59 A;  4F7U F;  2NTY A;  5DY9 A;  5LXT E;  2NYS A;  2WU2 A;  4K0U A;  1M90 U;  3CQC B;  2BKP A;  1UK5 A;  2EYY A;  4GY5 A;  2DA9 A;  5GAN h;  1U5P A;  2IIM A;  3ZST A;  3ZT5 A;  4DVD A;  4G2A A;  3ZEF B;  5KMG P;  1QCO A;  1M3A A;  2CP5 A;  2EW3 A;  1QQJ A;  1WLP B;  1OED B;  5I21 A;  5CAI A;  4DQ2 A;  5J39 A;  2V6X A;  1X01 A;  1FWZ A;  5LHH B;  1S1N A;  4M7A C;  5DLO A;  2LT1 A;  4RKU E;  2ABL A;  2HD0 A;  1I5O B;  1QCF A;  4IIO A;  3M53 A;  4D8K A;  1TUG B;  3RC3 A;  3OYD A;  3QZ9 B;  4JDS A;  4BY6 C;  4C92 A;  2DRM A;  3FZK B;  2VGN A;  5IXB A;  1M90 C;  2H89 A;  1WR6 A;  3DB3 A;  2CBJ A;  2LOS A;  3O4X E;  4E7J A;  1T3S A;  2VKN A;  2YRV A;  1AJ3 A;  4YHJ A;  1I5L A;  1PSE A;  2WB5 A;  4H9Q C;  2NP9 A;  5GAN 7;  2DER A;  4OMN A;  1YD8 G;  4LMJ A;  4C5I A;  4M4Z A;  3L2W A;  3GIB A;  3UQ7 A;  2QA4 A;  3L2Q A;  4UF0 A;  5GAM h;  4ZS3 A;  3KFW X;  3CQT A;  3G4S Q;  1YW0 A;  3UFG A;  2RI5 A;  3UUM A;  3JCM f;  2C5J A;  2J47 A;  3CKD A;  4A4E A;  2C0O A;  2F2X A;  4IDP A;  1K1Z A;  3ZJ2 A;  1XMQ T;  3QKJ A;  2CMR A;  4KGZ B;  2L9Q A;  5GAN f;  2K5B B;  2KGT A;  2PU9 B;  2DXT A;  3JCM J;  2ZPG B;  1D0X A;  1GCQ A;  3VU3 C;  3UQ4 A;  5GAO l;  3MP1 A;  1BI2 A;  3ASK A;  3ZJ1 A;  2W0Z A;  2XQY A;  2DNU A;  1KQ2 A;  3RQW A;  2NUP A;  3ABV A;  4YTP A;  5L23 A;  2G6F X;  2NW9 A;  3RIU A;  4WBN E;  4EYY R;  2NUT A;  2Y6X A;  2RJC A;  1YXR A;  5JDF A;  2EHO A;  3HKB E;  2QDY B;  4P5N A;  3OS0 A;  1A0N B;  1KJW A;  4PJO G;  1JB0 E;  5LNK A;  2JTM A;  1TOV A;  4A53 A;  3CPW P;  3C51 A;  4Z89 A;  2HCK A;  4C92 E;  2WMO A;  3C94 A;  1GCP A;  2DTH A;  5LG4 A;  1EX4 A;  2AT1 B;  2LNH B;  3EG2 A;  3P8D A;  2KSR A;  4CXY A;  4TWH A;  1F1B B;  2V1D B;  4ADZ A;  1WHM A;  1YIJ Q;  3K3N A;  3F70 A;  3LSV A;  1BB9 A;  3R6O A;  3EFS A;  2DCF A;  4LFC T;  4I43 B;  1UGV A;  4V2S A;  2C5K T;  3MEV A;  4L9I A;  1VQ8 A;  1KHI A;  3H37 A;  3OVU A;  4U2Y A;  3THK A;  4EMK A;  4E7H A;  2QTV A;  3QWX X;  1J5E T;  2EJF A;  1S72 A;  3I5S A;  4WTO B;  5GAM f;  4RTT A;  3CCL Q;  2ED0 A;  3AT1 B;  1JXM A;  1M2O A;  3OYC A;  3RMS A;  2XDB A;  2A2F X;  3VS3 A;  4H63 V;  1LJO A;  4C0Z A;  1J5W A;  3B57 A;  5JR9 C;  3BE3 A;  3HRT A;  4YSX A;  2ED1 A;  5JVD E;  3WAJ A;  1SSH A;  2EFI A;  1RAA B;  4IST A;  4HCC A;  3Q5E A;  3R84 B;  1T7S A;  4TNV A;  2AZV A;  2ZLY A;  4TWD A;  4DV3 T;  4LDX A;  4EXT A;  4HVV A;  4HWD A;  2DZ9 A;  3M5A A;  2UUB T;  4BD3 A;  2M9U A;  4M7A G;  3LGF A;  2D0Q B;  1M27 C;  3MET A;  3NZP A;  2UXN B;  4YTM A;  1TWB A;  3H0I A;  4OMP A;  2YUP A;  2D9T A;  3TSZ A;  4PNI A;  5ABE A;  4LF9 T;  5AT1 B;  3I35 A;  2QAS A;  5AQQ B;  5AQJ B;  1KG1 A;  1D0Z A;  2BVM A;  1KIK A;  1VQ7 Q;  4DOW A;  1AWJ A;  4AFQ C;  2WDQ A;  2KXC A;  2XMF A;  2BZ8 A;  3PUX F;  2K9A A;  3NTH A;  1D3B A;  2DM1 A;  3T1Y T;  3RMQ A;  4ZTF A;  3HKS A;  2E1H A;  3TRE A;  2FPF A;  4E7K A;  1IBM T;  1W2B A;  5LJ3 g;  1SPK A;  2V1Q A;  4LUD A;  1VQN T;  3G6E Q;  2F5K A;  3SOL A;  4QKU A;  3ME9 A;  2X68 A;  4M78 G;  5JDM A;  2DIG A;  2LSJ A;  3CBP A;  4EPC A;  4PJO B;  3DLL A;  2OTL T;  2MCN A;  3OBY A;  3FBL A;  3SD4 A;  5LL6 S;  3FHN A;  5HCK A;  3P4S A;  1WQW A;  4DR2 T;  2XAQ B;  5I11 A;  3A8O B;  3QSU A;  2RA2 A;  4QX8 B;  1ZUY A;  3EH1 A;  1YNZ A;  4HVU A;  1M1G A;  4P0A A;  4HCK A;  1ZKE A;  2ACZ A;  2YUN A;  1JXO A;  3WAK A;  1UGQ B;  2E65 A;  4F16 A;  3LJC A;  2YK0 A;  1CUN A;  5FY7 A;  3H6Z A;  1Z9Z A;  5GAN 5;  3LK3 B;  3X25 B;  3CCU T;  3GF5 A;  1UGO A;  1R8O B;  2UXX B;  4BE0 A;  1VQ5 A;  3F57 A;  3CX8 B;  4DID B;  4EMG A;  3CMA T;  4FSX A;  2QEX A;  2KT9 A;  5AQI B;  1NEB A;  2CHN A;  5KYN A;  2WM9 A;  1MV0 B;  3AEE A;  2JS0 A;  3OYL A;  3J80 E;  1CHU A;  4MZP A;  2M6I A;  5D6Y A;  3E2U A;  1HX1 B;  3AHU A;  3KV4 A;  1MUZ A;  2XHE B;  2X3X D;  4E7I A;  3SWN B;  1HX8 A;  4M7A B;  4IE6 A;  3OYM A;  1U3O A;  4HGA A;  4J9D A;  4X1I E;  2COZ A;  2WCA A;  3TLW A;  2EJ9 A;  4PJM A;  5GMK e;  3L2V A;  4RTV A;  4L6V 5;  2A08 A;  2JQK A;  2L5Q A;  1PHT A;  4LNP A;  4BY6 B;  5L4H A;  4LN2 A;  4Z8X A;  1Y96 A;  3K1S A;  4KI0 F;  3U23 A;  3CWZ B;  4A4H A;  2XD0 A;  2EJG A;  4O6J A;  4AKG A;  1RL2 A;  5I22 A;  4BDZ A;  2RK2 A;  2GGR A;  3HFN A;  2RI2 A;  2YSQ A;  2QA7 A;  1R77 A;  5AQL B;  1X75 C;  3NKZ A;  1NBE B;  1YHQ A;  4ISS A;  4RTU A;  1PKT A;  3LYI A;  1PWT A;  3MJX A;  2WSS V;  1RAC B;  1FXX A;  3CCR A;  4JV5 T;  1AWW A;  4PAG A;  4QQD A;  1SA0 E;  1WI7 A;  2DF6 A;  3JCM e;  3AA6 B;  1B3Q A;  4DEX A;  3AE8 A;  4OB1 B;  2QG9 B;  1PD1 A;  2J4G A;  2SEM A;  4TX5 A;  4ZS2 A;  4HFB A;  2HAX A;  1ZLM A;  3AA7 B;  3CXC A;  4LFB T;  1N34 T;  1K4U S;  3VR8 A;  5JDL A;  1IZ6 A;  2LRL A;  3X28 B;  1YJ9 A;  2FUP A;  4AQY T;  2F4V T;  3ZT7 A;  3AVS A;  2P0K A;  2BUD A;  4DA4 A;  3BY7 A;  4NXN T;  1OED A;  5IXF A;  1UUS A;  1MV3 A;  4DV5 T;  2KYB A;  1EIF A;  2KE9 A;  2XI9 A;  5A0D A;  1QSD A;  3KV9 A;  1NLO C;  5FWB A;  3JCM W;  3RX6 A;  2YU1 A;  3QZ5 B;  4RTX A;  1CKB A;  5KYW B;  2MAW A;  5GAO n;  4XU1 A;  3ZCI A;  4MLK A;  1QLB A;  4X65 T;  3NPF A;  5LGT B;  1YN8 A;  2QQ9 A;  4RCB A;  3CCV A;  3PE0 A;  4J9H A;  3H0F A;  1QVG P;  3HI2 A;  4FU6 A;  4OB2 B;  5L3E B;  1B07 A;  2XDP A;  4OGC A;  2OTJ T;  5AQG B;  2X9X A;  3QUI A;  3UPU A;  4TV8 E;  2RQV A;  4E7Z A;  3EGX B;  1ZEE A;  3RKX A;  3ZEH A;  2M6B A;  4HFV A;  4XTZ A;  4M7D C;  1WCR A;  3CD6 T;  3AED A;  4AKH A;  2NW8 A;  4ZHQ E;  3ZSS A;  2QGS A;  4A4G A;  5KH6 A;  4AQF A;  5JR9 B;  4D6W A;  2NWB A;  2DVJ A;  2K5I A;  3OY9 A;  3P7I A;  2D6F A;  3K3Q C;  5GMK l;  1YIT A;  3ZPO A;  3CPW S;  1GQE A;  2N9D A;  4IKF A;  2FPD A;  4O2A E;  3DLM A;  5AQT B;  4A56 A;  2YWW A;  1AZE A;  3HL8 A;  2X0Y A;  1OED E;  3S4U A;  4E2F B;  2HEQ A;  2WQY A;  2RHU A;  4XTU A;  4A63 B;  4C8Q G;  2M02 A;  4TV9 E;  3JCF A;  3V8J A;  2QQA A;  1KQ1 A;  4IUT A;  5FU7 C;  5LJ3 h;  3L39 A;  1X43 A;  3JAE A;  5L4E A;  1VQN Q;  5LYJ E;  2BG9 A;  4OFZ A;  3RYH E;  2VUR A;  3CCQ T;  2OTL Q;  3MP8 A;  1NJI U;  1M2V A;  5KE2 A;  2W67 A;  2L3P A;  2D2S A;  1GRI A;  4XU2 A;  4DMW A;  1NAF A;  4AT1 B;  3O1I A;  2O9V A;  2PZ1 A;  4J6Y A;  3CCE T;  2DVE A;  4XK8 E;  5A2Q E;  3U3I A;  4HFD A;  3C0C A;  2J1D G;  4CRI A;  5HWX A;  1NEK A;  2EWN A;  3ZKR A;  3RKY A;  1XWM A;  1JO8 A;  2H8H A;  2XZE A;  2JTE A;  2YDQ A;  2RQR A;  1Y64 B;  2YRD A;  4OYK A;  4QVZ A;  3NFC A;  4OF1 A;  4WCI A;  5ECA A;  2CZ0 B;  3ZMV B;  5FU6 B;  3VS5 A;  1H7C A;  5C8Y E;  4R56 A;  1Q82 U;  4IRE A;  1V9D A;  4A5X A;  3HA4 A;  3CCU Q;  2M16 A;  4C92 F;  5HXC A;  4ZI2 C;  2RD1 A;  3G71 T;  2VB6 A;  4YHH T;  4LFA T;  3OW2 S;  4C90 A;  3CMA Q;  4PK5 A;  2WDR A;  3C95 A;  2E9X C;  4O4I E;  1NJI C;  1X27 A;  2EGE A;  1QVF A;  3MCA B;  4JZ4 A;  1G3Y A;  1Q86 C;  5IHI A;  5BMV E;  1WJQ A;  2VKO A;  1WDX A;  1GFC A;  4A54 A;  1BCO A;  2VQE T;  3A5Z B;  4LDV A;  2G3R A;  2J62 A;  3PUS A;  2JJ9 A;  5LJ3 f;  4PL6 A;  3IF8 B;  2ZPI B;  4VUB A;  1KQS P;  1LKX A;  4JS5 A;  4CC2 A;  1C1A A;  4XTY A;  5HEG A;  2KXP B;  3EGU A;  3M55 A;  4CN6 A;  2JRK A;  5CKE A;  2RPA A;  1KD1 C;  1D1A A;  2WMN A;  4J9G A;  1GFD A;  1K0S A;  5J26 A;  2E4H A;  3RIR A;  1QP3 A;  2BZX A;  4GLK A;  2DBK A;  1N32 T;  3A8L B;  2BE7 D;  3HP9 A;  1KEY A;  4C8Q B;  4AKI A;  1AWX A;  4M7D G;  3LGL A;  3EGD A;  2PVG B;  4IUU A;  3VS4 A;  1BR0 A;  3GN5 B;  1K9A A;  4IIJ E;  1RAG B;  2YT6 A;  1N9S A;  4ELZ C;  4PJO A;  2D5U A;  2ZAE A;  4OB3 B;  2LC4 A;  2DL8 A;  4M77 G;  5GMK j;  2KRS A;  1NG2 A;  3M0T A;  5AQM B;  1HS7 A;  1OXZ A;  2X4W A;  4DOV A;  4FSS A;  2V8I A;  1LVF A;  2HL3 A;  1H3Z A;  1VQ9 A;  5L8R E;  3OYJ A;  3WXM B;  3RKW A;  5L3B B;  1PM3 A;  5LJ5 d;  1W0B A;  2HQE A;  2KI7 A;  3V7C A;  3A7M A;  4DBR A;  2QA4 T;  3RR6 A;  2LCS A;  3JAD A;  5HEJ A;  4AFS C;  5CIU A;  4ELY C;  4UVB B;  4HA8 A;  4AFZ C;  3AE2 A;  3PUR A;  3PGG A;  2RP4 A;  1LPL A;  3JCM P;  3D7S B;  3PT9 A;  2E3I A;  1NPP A;  3RNJ A;  3FIF A;  1OQK A;  3M0U A;  4CN1 A;  2DYB A;  4DV1 T;  1KC8 U;  1MMD A;  3CQG B;  2UUA T;  1SEM A;  1E1H B;  1UEC A;  2X66 A;  2R58 A;  5KYX B;  4AG1 C;  1BR2 A;  2NW7 A;  2CT3 A;  4Z02 A;  3CBO A;  1ZHI A;  5KE3 A;  5GAN j;  2L3S A;  3CIR A;  2Y4X A;  2UXC T;  3SWN A;  4M7A A;  2BKO A;  4YT0 A;  4FM4 B;  1IAP A;  3ZC1 A;  2OTJ Q;  3H41 A;  2AKL A;  3R6N A;  2XUE A;  3OQ5 A;  4PJO E;  4Z91 A;  3NWI A;  1H3H A;  5EC7 A;  1HSQ A;  3MK7 C;  2ZGW A;  5CKF A;  1G73 A;  2WBL A;  4TNW A;  4O4J E;  1Z8U A;  3CCM Q;  3M59 A;  1E7O A;  2D9D A;  2DZC A;  3NMZ C;  4FYY B;  1D09 B;  1KC8 C;  3PTR B;  1UFF A;  4F7U G;  4IDN A;  3AEF A;  1VQ8 T;  2ZPH B;  1UJY A;  2GFU A;  2HBW A;  5EG2 A;  1M1K U;  3JC6 C;  5HEO A;  3M4Y A;  5M4Y A;  1W6X A;  4BAY B;  4GYR A;  4A4F A;  3AAE B;  4NPP A;  2H88 A;  2CZ6 B;  2LX9 A;  1S72 T;  1K73 R;  2XAG B;  2WWV A;  2RPN A;  3OYG A;  4AKR B;  1QCN A;  4M7D B;  1HCI A;  1VQK Q;  3OJA A;  4LMK A;  3HRS A;  2XM1 A;  4C0D C;  4M78 A;  1OPL A;  3PUG A;  2YXY A;  3L2Z A;  5GAM j;  2HDA A;  3LBX B;  2VGM A;  2X3W D;  2N1G A;  3OSV A;  2YN6 A;  1VQ4 A;  1YJN A;  3SWH A;  5FRM A;  1K8A R;  2LJ1 A;  1WHG A;  1EZZ B;  1IJ6 A;  5AQF B;  5CVI A;  3GOX A;  3PTA A;  1ZBX A;  2P0Q A;  4GOU A;  5HXE A;  2CLY C;  4H9R C;  3CCQ Q;  1SHF A;  4HFC A;  2RM4 A;  3ZC0 A;  3LH0 A;  1QVG S;  1M1K C;  4M7A E;  2GTJ A;  4I0U A;  2VQF T;  2JIW A;  3M4G A;  3LK4 2;  1ZUK A;  1N8R R;  4DR3 T;  4ZI2 D;  3AAA B;  3C64 A;  3CCE Q;  4O8S A;  4KUM B;  2NTX A;  4A4K A;  2L0A A;  3URG A;  2OV9 A;  2VKD A;  4LF5 T;  2E9X D;  5KX5 E;  4ZTJ A;  4OMO A;  3DB4 A;  1Y01 A;  2GCX A;  3NRX A;  4QXC B;  4LF6 T;  4HCB A;  4ILC A;  3T9N A;  5FVK A;  5FXZ A;  5IHY A;  4X64 T;  2I0M A;  3Q9D A;  3FZL B;  4H9O C; 
#chains in the Genus database with same CATH homology
 3ZBD A;  3CPZ A;  1N6A A;  3TKL B;  4OK0 A;  3HL6 A;  2CZ1 B;  1XTD A;  2CWY A;  4B9W A;  3X26 B;  4PJL A;  4IE5 A;  3VUB A;  4JLE A;  4MDX A;  1MIW A;  4DMV A;  3TU4 K;  3BW1 A;  2VUB A;  5JR9 A;  3RUX A;  3ZFJ A;  2W62 A;  2KLQ A;  2C5I T;  3QJ6 A;  1ZHC A;  4F7U B;  5HY6 A;  5ETW A;  2E9X B;  2DTO A;  5J2T E;  5GMK i;  2X51 A;  3ZCJ A;  5JDQ A;  2MOZ A;  1YBY A;  4ZN1 A;  3ZYM A;  4HE8 A;  4C5G A;  2CKK A;  2X9W A;  3TEE A;  3P8B B;  5LBQ B;  4TN7 B;  1VQ5 T;  2X9H A;  3QG1 A;  4EZH A;  3OYY A;  2QEX T;  2LT3 A;  3JB9 D;  2IAK A;  4WNK A;  4NS5 A;  5CB4 E;  4JRP A;  5L3F B;  2K3Y A;  3PMT A;  3C4X A;  2LSI A;  4IUP A;  5EK2 A;  4J8O A;  1HG2 A;  2VV5 A;  1UGP B;  2VXF A;  2CA5 A;  5HXR A;  2X35 A;  3ETV A;  2FVU A;  4O5V A;  5LOV E;  2ODU A;  3CPW A;  4F6R C;  1OZ3 A;  3I56 A;  2V7I A;  2ACX A;  1YHQ T;  1KQS S;  1N9R A;  5FXV A;  4X1Y E;  3JB9 F;  3QK6 A;  3ZYL A;  3CCR T;  3MA9 A;  4HTE A;  2GFA A;  3I55 A;  5DM7 R;  3KBT A;  4MZT A;  5AFU L;  3JC6 D;  1Z0P A;  1B34 A;  4X20 E;  2A72 A;  1VUB A;  2F69 A;  4OB0 B;  1IJ5 A;  1YJ9 T;  2JMH A;  4MZM A;  2DK3 A;  1MMN A;  4EB6 E;  2LM9 A;  2SPC A;  2GF7 A;  4OMF B;  1V29 B;  3C50 A;  2X0L B;  4E47 A;  4N4H A;  3EAE A;  2PUO B;  4Q5W A;  1I81 A;  4C8Q A;  4BA9 A;  2Q9Q C;  2DLR A;  4WF2 A;  2Y8D A;  3CCV T;  4KUD K;  3RC8 A;  3CCJ A;  3V8L A;  3OW2 A;  2DEQ A;  4UV9 B;  5DQV A;  2PUK B;  3A8G B;  5A1L A;  3I9Y A;  3ANW B;  2I2L A;  3GA8 A;  4ZGJ B;  2FB7 A;  5LGN B;  1WQ7 A;  1HXD A;  3SDZ A;  4WBO A;  3UFE A;  1G3W A;  3WVD B;  4EDU A;  2JPF A;  4IGU A;  5LJ5 g;  4O4L E;  3BK9 A;  4MFR A;  3ZMU B;  3CCS A;  2EQK A;  4C0D B;  4UEL A;  1PSF A;  3GNG A;  3L1A A;  2V26 A;  5C6S A;  1VQL A;  3RYI E;  2BKD N;  1YIT T;  4RG2 A;  2O4X A;  3B13 A;  2EYQ A;  3E1S A;  2L8D A;  4YLH A;  2W63 A;  3HSB A;  3C4S A;  4MHC A;  2CLY B;  4I55 E;  4N78 D;  5J3B A;  2E8I A;  4E7S A;  3VUZ A;  4C8Q E;  4PKC C;  2VKJ A;  3E22 E;  1W4S A;  3JAM E;  3MEW A;  3PFS A;  2W00 A;  1ZQ1 A;  4EYU A;  3JCM d;  3O9X A;  3SB2 A;  4GK0 E;  3M56 A;  3QHS A;  3LW5 E;  1D1C A;  3OYA A;  4FI5 A;  3ZMT B;  4CI3 B;  3DJB A;  3L42 A;  2VYT A;  4C92 C;  3VKH A;  3BFM A;  4ZI3 D;  4OGE A;  3WI3 A;  4M7D A;  4N0A C;  3ONX A;  3MZK B;  1K9M U;  5H6R B;  4JS4 A;  4M77 A;  4M75 D;  3UT1 A;  2MWP A;  2RHI A;  4FT4 A;  4XTX A;  2ZM8 A;  2D0U A;  3L09 A;  3HKE E;  1X79 A;  3ESL A;  3CX6 B;  3E9G A;  2CGH A;  3L2U A;  2JQQ A;  4QHO A;  2HBP A;  3LK2 B;  4ERR A;  4X1K E;  2RB6 A;  3GNF B;  5LJ3 j;  1K9M C;  2WAU A;  3FXD B;  2JOY A;  3CC7 A;  4M75 F;  4J5Y A;  4CXW A;  2XG8 D;  4QVC A;  4M78 D;  4V1A v;  4M7D E;  4NUU A;  1BIA A;  2M1H A;  4GIW A;  4QW2 A;  3EUH A;  2WSF E;  3KXT A;  2F5T X;  4N4I A;  3KV6 A;  4M77 E;  3AAI A;  5FXX A;  2FL7 A;  4JRQ A;  3OS2 A;  1VQ9 T;  1WJR A;  1G8X A;  3PIO A;  4XTV A;  4F7U A;  1XQH A;  4C5H A;  1QVG A;  3UDC A;  3PIP A;  5CK9 A;  4J6X A;  2Q9Q D;  2R5A A;  5GAN e;  2XU8 A;  1U8R A;  3PUA A;  3VKG A;  3FJP A;  2XKO C;  2B1E A;  5HYA A;  4UV8 B;  2K24 A;  3JCM X;  3FC3 A;  2DWG A;  2HQX A;  5JDH A;  4M78 F;  1UEB A;  2A3L A;  3HPW A;  3V5S A;  2IC9 A;  4CZZ B;  2XAS B;  5CKH A;  1VQO A;  2JVV A;  2DTI A;  3BQL A;  2K5L A;  2KAF A;  2B8A A;  4PFP A;  1BI0 A;  5HAX A;  2YLC A;  1YI2 A;  2LCC A;  4HCZ A;  3A8H B;  1MIY A;  1VQM A;  5LJ5 h;  4NOY A;  3MHX A;  5JH7 E;  2Q9Q B;  3QXE B;  1BI3 A;  4MMK A;  4CI1 B;  4FT2 A;  5GAM e;  5LP6 E;  4AKL A;  2QTX A;  1UCU A;  3HFO A;  5EK4 A;  4X9C A;  4F7U E;  2C0S A;  2ZM0 A;  2XAH B;  3RRW A;  4UC4 A;  1FMW A;  5GON E;  2OAU A;  3OB9 A;  1P92 A;  4OP0 A;  3QPH A;  4GYS A;  1MIV A;  4TUY E;  2LNV A;  1WYB A;  3EDV A;  1VQ4 T;  2KSS A;  1YJN T;  4C92 D;  4ANJ A;  2X4Y A;  3ZMZ B;  4XU0 A;  1S35 A;  4CQI A;  3I0Q A;  1NZ9 A;  1YJW A;  4UIG A;  4J7F A;  4ZGD B;  1DJ7 B;  3ETU A;  4X9D A;  3PU3 A;  2DHR A;  4YTL A;  3JSC A;  5FRN A;  4ME7 A;  4FL6 A;  3JB9 I;  3Q2M A;  5LJ5 f;  2WWU A;  5HXH A;  2L3R A;  1NE8 A;  1VQP A;  1QP2 A;  2QQB A;  3ANW A;  4RCC A;  1KQS A;  3CC4 A;  4JRK A;  2YIN A;  5JRC B;  3RYF E;  1LOJ A;  3QBY A;  3E9F A;  5A0L A;  4QKN A;  4C92 B;  4MAL A;  4XTW A;  3O8V A;  2BZB A;  1YKH B;  2E5Q A;  2ZCF B;  4RMO A;  5AYF A;  4QQ6 A;  2EHO D;  4BI8 B;  3JCM b;  3OMC A;  4II1 A;  3Q5W A;  2XIC A;  4FJO A;  4IDZ A;  4UF0 B;  2KMT A;  3SFM A;  3PUQ A;  4JLI A;  1VIE A;  4TVR A;  3N2K E;  1S94 A;  1Q82 C;  5GAO q;  1NWM X;  3HHT B;  2LOP A;  5CA1 E;  5GAO r;  1O9S A;  3K8P C;  1U4Q A;  5A0G A;  2GQV A;  3N2G E;  2C06 A;  3OS1 A;  4QX7 B;  4FIB A;  2MYS A;  2BIV A;  5FP3 A;  2Y48 B;  2LSY A;  2RHY A;  4B9X A;  3N9M A;  3T8O A;  5L3D B;  2MI6 A;  2PVD B;  2X4X A;  2CYZ B;  2K3X A;  5CA0 E;  2KMF A;  3CME A;  2DWK A;  3M65 A;  2V7J A;  2HNI A;  2P9B A;  4CI0 C;  5FMN A;  3M58 A;  2G0U A;  3OYI A;  3I56 T;  2LT4 A;  3J81 E;  1SSF A;  2E6N A;  2JN0 A;  2EKO A;  3KVB A;  2DXU A;  4AQF C;  3ER0 A;  3CC2 A;  5FLX E;  3I55 T;  1LNX A;  4ZI7 E;  4PLI A;  1VIF A;  4KBM B;  1FEW A;  2L8K A;  3J7Y q;  3V8K A;  1HFA A;  4BI4 A;  2DNX A;  2V8K A;  1H64 1;  3AA1 B;  5L3C B;  3N2O A;  3CVR A;  2LJL A;  3GMI A;  5IT9 E;  4RG8 A;  4YJ2 E;  3J9X 1;  3FB9 A;  3S6W A;  5HK3 A;  1K73 U;  2KND A;  4HN9 A;  2LSK A;  3CCJ T;  3EDU A;  4GK5 E;  4IUQ A;  4IE0 A;  4PLL A;  5ADX L;  1VQ6 A;  4QXH B;  3QC9 A;  2DKG A;  2LHN A;  3LLR A;  1M4Z A;  2N2N A;  2HPL A;  3CCM A;  4XQ3 A;  1K8A U;  3GP8 A;  2EIF A;  4OHF A;  4PK4 A;  2CXD A;  4IE4 A;  5CO7 A;  2JZ2 A;  2EQJ A;  3CCS T;  1ZV4 X;  2H3J A;  3A8M B;  2LRQ A;  1LVK A;  4H63 H;  3NTK A;  1VQL T;  3OA6 A;  3Q1J A;  2ZPF B;  4IE7 A;  4C5E A;  4XU3 A;  1VQK A;  5FU7 B;  4EOZ B;  4M77 F;  2DPP B;  5GAN 2;  3K3O A;  3VHL A;  4AXP A;  4H9N C;  3JB9 J;  5DLQ E;  1MGQ A;  1K8A C;  4L5G A;  4PNO A;  2X9Y A;  1G3T A;  2DD5 A;  5LJN A;  3JB9 G;  2PG8 A;  3A5X A;  4AQG A;  2LCL A;  3FBZ A;  3E08 A;  3EVY A;  4CI2 B;  3N5B B;  2I59 A;  1KHC A;  5LGU B;  5EZY E;  4XAX B;  2DIQ A;  3ZN0 B;  5FY1 A;  4CXX A;  3VYG A;  2IVW A;  3OSS C;  3HKD E;  2KIN B;  4IUR A;  1BKB A;  5FNV E;  2E10 A;  3UT5 E;  4BI3 A;  5L2L A;  1FX7 A;  3C12 A;  2MBG A;  2RI3 A;  2WSC E;  3V7R A;  5KDM C;  5LJ3 e;  4ZGE B;  1JJ2 S;  2R5M A;  1M8V A;  2MMP A;  3IEE A;  4ZI3 C;  2VC8 A;  3OYN A;  2CWO A;  3AA0 B;  4QQG A;  4P0B A;  5D6W A;  2P0P A;  1OI1 A;  5J2U E;  4LDU A;  4M75 C;  4X34 A;  3N9L A;  2DI4 A;  3C4Z A;  3SWN C;  4HEA A;  5FRO A;  5JRC A;  5C0M A;  3CC7 T;  4B6X A;  4UVC B;  2EAY A;  3W15 B;  3PNW C;  3BDU A;  2RJE A;  3Q5X A;  5HWY A;  2W0G A;  2FYK A;  1BR1 A;  3NZQ A;  2V7M A;  4N0A A;  2O01 E;  2VAS A;  2LQ8 A;  3FB2 A;  1MND A;  4JEH B;  5LCY A;  3LX7 A;  4YJ3 E;  3ZMS B;  4KT0 E;  1B7T A;  1SHZ C;  3C98 B;  2XDD A;  3KDS E;  3UUX B;  4M78 C;  3G4S A;  3KBU A;  2YHT A;  4LDW A;  2L3L A;  5GAO p;  4P09 A;  3FDR A;  4U72 A;  2RA1 A;  3D0T A;  5JQG E;  2KK4 A;  4J2C A;  3DTO A;  1T98 A;  5LA6 E;  3SRZ A;  4BE2 A;  2E41 A;  2PJQ A;  2Y90 A;  3U78 A;  2JMK A;  4J83 A;  3ZLI A;  3RH3 A;  3GN5 A;  1VQO T;  1WYC A;  1QVF S;  1BI1 A;  2WAC A;  2Z6E A;  2QQS A;  3OYX A;  4XZC A;  4XBF B;  2KZ7 B;  1Y07 A;  4JEU B;  2MF2 A;  2LTO A;  3UTK A;  1YI2 T;  4QXB B;  1TH7 A;  1VQM T;  3P8H A;  4HT8 A;  1AHJ B;  3N9Q A;  2LDM A;  2MAM A;  1YIJ A;  3LFM A;  1XOV A;  3RYC E;  5GAN 8;  3QO3 A;  4BJM A;  4KP3 C;  2CXL A;  4EAH A;  1IZN B;  4C91 A;  4NL2 A;  2BDE A;  3QII A;  3HR0 A;  3RER A;  3CCL A;  3OBW A;  3BQI A;  3M9Q A;  2VWA A;  4KMC A;  2QI2 A;  4BAC A;  4M75 G;  3S3O A;  4PJO D;  3CEY A;  4R55 A;  1O3X A;  3CML A;  3AB3 B;  3TCJ A;  3LWH A;  1WGS A;  5L3G B;  2PQW A;  4E7L A;  2NOX A;  1YJW T;  1Q7Y U;  3LG7 A;  2HPJ A;  1LRZ A;  1WLX A;  5F3J A;  4BDY A;  3UUN A;  4PFO A;  4DO0 A;  5GAN d;  3N9P A;  1G3S A;  1VOM A;  3JB9 H;  2XAF B;  3OKQ A;  1WRD A;  1VQ7 A;  1VQP T;  4PJN A;  5LHG B;  1HK9 A;  3LWI A;  3P8C D;  2CZ7 B;  4HKE A;  5LJ5 j;  3X20 B;  3CC4 T;  3HKC E;  1HTJ F;  2HH7 A;  3PMI A;  3CPF A;  1G5V A;  2XAJ B;  4PJO F;  2PVO B;  4TZ4 C;  3LBX A;  2EQM A;  3QDR B;  3G6E A;  2CS7 A;  4OYJ A;  5EK3 A;  5FU6 C;  5CKB A;  1Q7Y C;  4OVA A;  4M7A D;  3C4W A;  4ZOL E;  4O2B E;  3JRZ A;  5CQY A;  4EIW A;  2DXC A;  4J6W A;  2VKH A;  4Y91 A;  4DBQ A;  4BJN A;  3NTI A;  5IYZ E;  1N27 A;  4IUV A;  5GAM d;  1I8F A;  3X24 B;  2PBI A;  3H3A A;  2WSE E;  1MMG A;  2H7O A;  3FLG A;  2EHO C;  4PJJ A;  3M57 A;  1M5Q 1;  2LQK A;  3VU7 H;  1UGR B;  2RK1 A;  4M75 B;  4UEM A;  2KVQ G;  2ODV A;  3FRN A;  4M7A F;  4ZN3 A;  2KWI B;  4C8Q C;  1VRB A;  3HRU A;  2NLU A;  4DND A;  2K48 A;  5DAB A;  4EMK C;  1QUU A;  4BB7 A;  5GMK m;  3OYH A;  4L0R A;  2E9X A;  3CME T;  2RH2 A;  1BIB A;  4N4G A;  3E0Z A;  2XID A;  1NPR A;  3KIN B;  3EFR A;  2M67 A;  4HKA A;  4JUV A;  2LE8 A;  4M78 B;  4KUL A;  5GAN 3;  3CC2 T;  5M9O A;  5JDN A;  4C92 G;  4EZ4 A;  3GWH A;  2YU2 A;  3KV5 A;  2VL8 A;  4AI6 A;  2IW5 B;  2IC6 A;  3FEO A;  2VXE A;  4C0F A;  4JJN K;  1XNI A;  1I4K 1;  5JRE A;  2V7L A;  5CR2 A;  2DD4 A;  3UWN A;  3WVE B;  3OMG A;  5KCO A;  3CBM A;  1OWA A;  4Y28 E;  3KVA A;  4LD6 A;  2CEA A;  1VQ6 T;  2LVM A;  1RI0 A;  2VK9 A;  2IG0 A;  4BUG A;  1JJ2 A;  3CCM T;  2M0O A;  3VV0 A;  3MEU A;  4M77 C;  1BR4 A;  3UUL A;  1D1B A;  1BYM A;  4HT9 A;  4NUV A;  3IBP A;  3S3M A;  3OYF A;  2PFV A;  3IHR A;  2KY9 A;  5DQW A;  3GPL A;  1VQK T;  3GLX A;  2H3R A;  2K2V A;  1GXI E;  4WW0 A;  2LSG A;  2OA5 A;  1UGS B;  1D0Y A;  5KCH A;  2QQR A;  1UX4 A;  2X4J A;  3V7S A;  2QXF A;  2BVL A;  3L2R A;  2MWO A;  1VQN A;  5IAY A;  2E6Z A;  2XTL A;  3RES A;  2OTL A;  3V5U A;  1Q86 U;  4BE1 A;  3OYE A;  3I9W A;  3VYH B;  3CX7 B;  3N9N A;  2RHX A;  1QVP A;  3PU8 A;  2CCQ A;  4KUI A;  4QWN B;  2E12 A;  2H7V C;  1YKE B;  3ZYK A;  1OZ2 A;  3CQX C;  4MML A;  4M1P A;  2E70 A;  3RRC A;  4C0G A;  4H9S E;  4C8Q D;  1KD1 U;  4UVA B;  5DJQ C;  4O4H E;  3DP7 A;  3CCU A;  2ZZD A;  2A3D A;  4JUY A;  3VKI A;  1US7 B;  2ZPB B;  3CMA A;  3JCM Q;  3RPU A;  2ZMA A;  4I4T E;  2RO0 A;  4LD9 K;  3JCM g;  4U74 A;  2JTF A;  1B34 B;  2EHO B;  2L89 A;  5GAN g;  1Q81 U;  1OYX A;  3AVR A;  4H9P C;  5I2S A;  5CQX A;  5CCA A;  3BQK A;  5LJM A;  3OYZ A;  4C8Q F;  2DJZ A;  3MEA A;  4ILU A;  3F2E A;  4YFS A;  2KDS A;  5D6X A;  2D0T A;  4EMK B;  1JRI A;  2RJF A;  3QJY A;  2P4T A;  1UB4 A;  5FY0 A;  1W2B S;  3KBG A;  3RKO A;  1YCY A;  1WJS A;  1HF8 A;  5GAN 4;  3JCM V;  1Q81 C;  2LHR A;  3SS1 A;  3FXE B;  1UX5 A;  3E19 A;  1WNL A;  3OBV E;  2YLB A;  2RHZ A;  3J7A F;  1MNE A;  1U1T A;  5GAM g;  4MDW A;  3G4S T;  2K57 A;  4I50 E;  1Y7X A;  1FIO A;  3I1A A;  3MXZ A;  2O4X B;  4JLG A;  2DO3 A;  3MAC A;  3H8Z A;  4M7D D;  3NRY A;  2KWH A;  4M75 A;  3MKD A;  4M77 D;  3INZ A;  1D3B B;  3N9O A;  1JBM A;  2X67 A;  4PW8 A;  2Y4Y A;  3G7Z A;  2A7Y A;  2OTJ A;  3KUF A;  5JDG A;  5GAN 6;  4QVD A;  1X6O A;  5LJ3 d;  5HKC A;  5FXW A;  3L3P A;  1Y71 A;  5F8P A;  1IRE B;  2ZM2 A;  1WPY A;  3CD6 A;  3BDL A;  1YIJ T;  2DAQ A;  2RJD A;  5H6Q B;  4IHJ E;  5LHI B;  2FHD A;  1U1S A;  1M9S A;  2W61 A;  5LBM A;  4UXN B;  3NBX X;  4NL3 A;  1EZ3 A;  3N5L A;  4M7D F;  1N8R U;  2JNG A;  3O1H A;  2KQW A;  1K73 C;  2K5F A;  3CCL T;  2EQU A;  2LEH A;  3JCM c;  5TAO A;  4M77 B;  2DXB A;  4J7I A;  3OYB A;  5HXS A;  1O75 A;  4M75 E;  2V7K A;  4EMH A;  3OS5 A;  3O1J A;  1KNZ A;  3MO8 A;  5I2M A;  2MTQ A;  4PK6 A;  3ZN1 B;  1MHN A;  2XK0 A;  3CCQ A;  3CXC S;  2R57 A;  3QYH B;  2AHJ B;  2Q9Q A;  5LJ5 e;  2CM0 A;  3PDY A;  2ZPE B;  3CCE A;  1N8R C;  3MP6 A;  2E64 A;  1MMA A;  5GMK h;  3DKM A;  5CKD A;  3S3N A;  1M1F A;  1FMV A;  4PJO C;  1VQ7 T;  5HK0 A;  4G63 A;  3OYK A;  4LDY A;  2CXF A;  1Y96 B;  2JUF A;  1HG5 A;  5GAO m;  3I0O A;  1QW1 A;  3QYG B;  3G71 A;  3M54 A;  4JRI A;  1KK7 A;  3QUJ A;  2XHC A;  4MBQ A;  2YEV C;  3G6E T;  5FYM A;  4M78 E;  5IN1 A;  2K4Y A;  3VJP A;  3F31 A;  2ES0 A;  2CE7 A;  2V8J A;  4ASK A;  3JCM h;  4ATO A;  5E0O A;  2GK9 A;  5J1G A;  4L59 A;  4F7U F;  2NTY A;  5DY9 A;  5LXT E;  4K0U A;  1M90 U;  3CQC B;  4GY5 A;  5GAN h;  1U5P A;  4DVD A;  4G2A A;  3ZEF B;  5KMG P;  5I21 A;  5CAI A;  4DQ2 A;  5J39 A;  1X01 A;  1FWZ A;  5LHH B;  4M7A C;  5DLO A;  2LT1 A;  4RKU E;  2HD0 A;  3M53 A;  3RC3 A;  3OYD A;  3QZ9 B;  4JDS A;  4BY6 C;  4C92 A;  2VGN A;  1M90 C;  1WR6 A;  3DB3 A;  2LOS A;  3O4X E;  4E7J A;  2YRV A;  1AJ3 A;  4YHJ A;  1I5L A;  1PSE A;  4H9Q C;  2NP9 A;  5GAN 7;  1YD8 G;  4C5I A;  3L2W A;  3GIB A;  2QA4 A;  3L2Q A;  4UF0 A;  5GAM h;  4ZS3 A;  3KFW X;  1YW0 A;  2RI5 A;  3UUM A;  3JCM f;  2C5J A;  3CKD A;  4A4E A;  3ZJ2 A;  3QKJ A;  2CMR A;  2L9Q A;  5GAN f;  2K5B B;  2PU9 B;  2DXT A;  3JCM J;  2ZPG B;  1D0X A;  3VU3 C;  5GAO l;  3MP1 A;  1BI2 A;  3ASK A;  3ZJ1 A;  2XQY A;  1KQ2 A;  2NW9 A;  4WBN E;  4EYY R;  2Y6X A;  2RJC A;  5JDF A;  2EHO A;  3HKB E;  2QDY B;  4P5N A;  3OS0 A;  4PJO G;  1JB0 E;  5LNK A;  2JTM A;  4A53 A;  3C51 A;  4C92 E;  2WMO A;  3C94 A;  2DTH A;  5LG4 A;  3P8D A;  4CXY A;  2V1D B;  4ADZ A;  3K3N A;  3F70 A;  3R6O A;  3EFS A;  2DCF A;  4I43 B;  4V2S A;  2C5K T;  3MEV A;  4L9I A;  1VQ8 A;  1KHI A;  3H37 A;  4EMK A;  4E7H A;  2EJF A;  1S72 A;  5GAM f;  3OYC A;  3RMS A;  2XDB A;  2A2F X;  4H63 V;  1LJO A;  4C0Z A;  3B57 A;  5JR9 C;  3HRT A;  5JVD E;  3WAJ A;  2EFI A;  4IST A;  4HCC A;  3R84 B;  2ZLY A;  4LDX A;  4EXT A;  2DZ9 A;  3M5A A;  4BD3 A;  2M9U A;  4M7A G;  3LGF A;  2D0Q B;  3MET A;  3NZP A;  2UXN B;  2D9T A;  4PNI A;  1KG1 A;  1D0Z A;  2BVM A;  4DOW A;  2K9A A;  3NTH A;  1D3B A;  3RMQ A;  4ZTF A;  3HKS A;  2E1H A;  3TRE A;  4E7K A;  1W2B A;  5LJ3 g;  1VQN T;  2F5K A;  3SOL A;  3ME9 A;  2X68 A;  4M78 G;  5JDM A;  2DIG A;  2LSJ A;  3CBP A;  4EPC A;  4PJO B;  3DLL A;  2OTL T;  3OBY A;  3FBL A;  3SD4 A;  5LL6 S;  3FHN A;  1WQW A;  2XAQ B;  3A8O B;  3QSU A;  2RA2 A;  4QX8 B;  1M1G A;  4P0A A;  1ZKE A;  3WAK A;  1UGQ B;  2E65 A;  3LJC A;  2YK0 A;  1CUN A;  5FY7 A;  3H6Z A;  5GAN 5;  3LK3 B;  3X25 B;  3CCU T;  3GF5 A;  1R8O B;  2UXX B;  4BE0 A;  1VQ5 A;  3F57 A;  3CX8 B;  4EMG A;  3CMA T;  4FSX A;  2QEX A;  2KT9 A;  2WM9 A;  3OYL A;  3J80 E;  4MZP A;  5D6Y A;  3AHU A;  3KV4 A;  2XHE B;  4E7I A;  3SWN B;  1HX8 A;  4M7A B;  4IE6 A;  3OYM A;  4HGA A;  4X1I E;  2EJ9 A;  4PJM A;  5GMK e;  3L2V A;  4L6V 5;  2L5Q A;  4BY6 B;  4Z8X A;  1Y96 A;  3CWZ B;  4A4H A;  2XD0 A;  2EJG A;  4O6J A;  4AKG A;  1RL2 A;  4BDZ A;  2RK2 A;  3HFN A;  2RI2 A;  2QA7 A;  1X75 C;  1YHQ A;  4ISS A;  3LYI A;  3MJX A;  2WSS V;  1FXX A;  3CCR A;  4PAG A;  4QQD A;  1SA0 E;  3JCM e;  3AA6 B;  4OB1 B;  4TX5 A;  4ZS2 A;  2HAX A;  3AA7 B;  3CXC A;  5JDL A;  1IZ6 A;  3X28 B;  1YJ9 A;  3AVS A;  2P0K A;  2BUD A;  4DA4 A;  3BY7 A;  1EIF A;  5A0D A;  2XI9 A;  1QSD A;  3KV9 A;  3JCM W;  3RX6 A;  2YU1 A;  3QZ5 B;  5GAO n;  4XU1 A;  3ZCI A;  4MLK A;  5LGT B;  2QQ9 A;  4RCB A;  3CCV A;  3PE0 A;  3HI2 A;  4FU6 A;  4OB2 B;  5L3E B;  2XDP A;  4OGC A;  2OTJ T;  2X9X A;  3QUI A;  3UPU A;  4TV8 E;  4E7Z A;  1ZEE A;  3RKX A;  3ZEH A;  4XTZ A;  4HFV A;  4M7D C;  3CD6 T;  4AKH A;  2NW8 A;  4ZHQ E;  2QGS A;  4A4G A;  5KH6 A;  4AQF A;  5JR9 B;  4D6W A;  2NWB A;  2K5I A;  3OY9 A;  3P7I A;  2D6F A;  3K3Q C;  5GMK l;  1YIT A;  3ZPO A;  3CPW S;  2N9D A;  4IKF A;  4O2A E;  3DLM A;  4A56 A;  3HL8 A;  3S4U A;  2RHU A;  4XTU A;  4C8Q G;  4TV9 E;  3V8J A;  2QQA A;  1KQ1 A;  4IUT A;  5FU7 C;  5LJ3 h;  5LYJ E;  4OFZ A;  3RYH E;  3CCQ T;  3MP8 A;  1NJI U;  5KE2 A;  2D2S A;  4XU2 A;  4DMW A;  1NAF A;  3O1I A;  4J6Y A;  3CCE T;  2DVE A;  4XK8 E;  5A2Q E;  3U3I A;  4CRI A;  2J1D G;  5HWX A;  2EWN A;  3RKY A;  1Y64 B;  4OYK A;  4QVZ A;  3NFC A;  4OF1 A;  2CZ0 B;  3ZMV B;  5FU6 B;  1H7C A;  5C8Y E;  4R56 A;  1Q82 U;  1V9D A;  3HA4 A;  2M16 A;  4C92 F;  5HXC A;  4ZI2 C;  2RD1 A;  3G71 T;  2VB6 A;  3OW2 S;  4C90 A;  4PK5 A;  3C95 A;  2E9X C;  4O4I E;  1NJI C;  1QVF A;  3MCA B;  1G3Y A;  1Q86 C;  5BMV E;  1WJQ A;  2VKO A;  4A54 A;  3A5Z B;  4LDV A;  2G3R A;  3PUS A;  2JJ9 A;  5LJ3 f;  4PL6 A;  3IF8 B;  2ZPI B;  4VUB A;  1LKX A;  4JS5 A;  4XTY A;  2KXP B;  3M55 A;  2JRK A;  5CKE A;  1KD1 C;  1D1A A;  2WMN A;  5J26 A;  3RIR A;  1QP3 A;  4GLK A;  3A8L B;  3HP9 A;  4C8Q B;  4AKI A;  4M7D G;  3LGL A;  2PVG B;  4IUU A;  1BR0 A;  3GN5 B;  4IIJ E;  4ELZ C;  4PJO A;  1N9S A;  2D5U A;  4OB3 B;  2LC4 A;  4M77 G;  5GMK j;  1HS7 A;  1OXZ A;  2X4W A;  4DOV A;  2V8I A;  1LVF A;  1H3Z A;  1VQ9 A;  5L8R E;  3OYJ A;  3WXM B;  3RKW A;  5L3B B;  5LJ5 d;  2HQE A;  3V7C A;  4DBR A;  2QA4 T;  5CIU A;  4ELY C;  4UVB B;  4HA8 A;  3PUR A;  3PGG A;  2RP4 A;  3JCM P;  3PT9 A;  1NPP A;  3FIF A;  1KC8 U;  1MMD A;  3CQG B;  1E1H B;  2X66 A;  2R58 A;  1BR2 A;  2NW7 A;  4Z02 A;  3CBO A;  1ZHI A;  5KE3 A;  5GAN j;  2Y4X A;  3SWN A;  4M7A A;  4FM4 B;  1IAP A;  3ZC1 A;  3R6N A;  2XUE A;  3OQ5 A;  4PJO E;  3MK7 C;  2ZGW A;  5CKF A;  1G73 A;  2WBL A;  4O4J E;  3M59 A;  2DZC A;  1KC8 C;  3PTR B;  4F7U G;  1VQ8 T;  2ZPH B;  2GFU A;  1M1K U;  5EG2 A;  3JC6 C;  3M4Y A;  5M4Y A;  4BAY B;  4GYR A;  4A4F A;  3AAE B;  2CZ6 B;  1S72 T;  2LX9 A;  2XAG B;  3OYG A;  4AKR B;  4M7D B;  1HCI A;  3OJA A;  3HRS A;  4C0D C;  4M78 A;  3PUG A;  3L2Z A;  5GAM j;  3LBX B;  2VGM A;  2N1G A;  3OSV A;  1VQ4 A;  1YJN A;  3SWH A;  5FRM A;  1IJ6 A;  5CVI A;  3GOX A;  3PTA A;  1ZBX A;  2P0Q A;  4GOU A;  5HXE A;  2CLY C;  4H9R C;  2RM4 A;  3LH0 A;  3ZC0 A;  4M7A E;  1QVG S;  1M1K C;  3M4G A;  3LK4 2;  3AAA B;  4ZI2 D;  3C64 A;  4O8S A;  4KUM B;  2NTX A;  4A4K A;  3URG A;  2VKD A;  2E9X D;  5KX5 E;  4ZTJ A;  3DB4 A;  2GCX A;  3NRX A;  4QXC B;  3T9N A;  5FXZ A;  5IHY A;  3Q9D A;  4HCB A;  4H9O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...