4KBMB

Structure of the mtb card/rnap beta subunit b1-b2 domains complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
148
Chain Sequence
IFKVGDTVVYPHHGAALVEAIETREQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVVGQEGLDKVFQVLRAPWSRRYKANLEKLASGDVNKVAEVVRDLWRRDQERGLSAGEKRMLAKARQILVGELALAESTDDAKAETILDEVLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Mtb CarD/RNAP beta-Lobes Complex Reveals the Molecular Basis of Interaction and Presents a Distinct DNA-Binding Domain for Mtb CarD.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit beta
total genus 41
structure length 148
sequence length 159
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kbmB02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kbmB01
4MFRA 2LT3A 2LQKA 2LT4A 4KMCA 2LT1A 4KBMB 2EYQA 4L5GA 4XAXB 4ILUA
chains in the Genus database with same CATH superfamily
3AEBA 1MIWA 1VCTA 1ZBJA 4RTXA 3VYHB 5GAN2 3HFNA 1I94T 1H3HA 3G4SA 1P92A 1KQ2A 3C64A 4DV1T 3JCMW 4M75G 2KYMA 1JU5C 3N2KE 3OJAA 2HQXA 2E3IA 3H6ZA 3KDSE 2YHTA 4EV6A 4IDPA 3LW5E 3CMEQ 1KIKA 1IBKT 3FHNA 3SWNA 1QCFA 4M7DB 4KGVB 3JB9H 5J2TE 2NYSA 8AT1B 3HRTA 5CKHA 3G71Q 5JDHA 5HCJA 4L59A 2RH2A 2CREA 4E47A 2L3PA 3EG9B 4O8SA 4JJCA 3RKXA 3TCJA 1D3BB 5FU6C 1RACB 1PCXA 1KQSP 2PVOB 2MWPA 5LA6E 5IHNA 3LLRA 5DM7R 3RGLA 2P0PA 2HBPA 3I5SA 1OPKA 2L0AA 1WR6A 3RESA 2VV5A 4TX5A 2XUEA 3NRXA 1B34B 4JRIA 3HRUA 3MACA 3OYZA 1OX9A 4OMFB 3CMAT 2ZCFB 3CMAA 2LM2A 1Q81R 2BZXA 2DL1A 2NP9A 3EG1A 3RIUA 2XZEA 2D8HA 4ESRA 2VWAA 5A0LA 4LMJA 4OMLA 1MMAA 5ABFA 1M3CA 2LTOA 3TQ7P 3UU4A 1NYFA 1UHCA 3AXJA 2QQRA 4F7UF 1VOMA 3RMQA 2L89A 2H88A 4O4JE 2LZ6B 4F7UG 4AKGA 2H89A 4C0DB 4ZHQE 4A56A 1ABOA 2M16A 1DJ7B 3JSCA 1K8AC 2GQIA 4BE0A 4BACA 1M4ZA 4DO0A 1H641 2JMAA 1MMDA 3AA0B 2JN0A 4HFVA 4FU6A 3MXZA 1UURA 2RA2A 3Q5WA 5HK0A 3L2WA 2KSSA 1QKWA 3I56Q 3J7AF 2RI3A 2LT1A 4EAHA 1OX8A 4M78D 2BZYA 1JRIA 3RIAA 1KJWA 4ZS3A 2A37A 4M7DC 2K3XA 2YWWA 3T1HT 2V7IA 1D1AA 2WU5A 1WLPB 3QO3A 1XJWB 2WQYA 3CCRA 3MZKB 2X4JA 3FJPA 4CC3A 3JRZA 5EK4A 1IZ6A 4R0KA 1FEWA 3RIUC 3EG9A 3OYMA 5KE2A 5GAN4 3G7ZA 4PFOA 3ZYMA 1YJWQ 3O9XA 2BVMA 4N0AA 2EGEA 2DVEA 3OA6A 3TLSA 4KUDK 4MALA 5AQKB 3JB9I 4PJOC 3CC4T 4DR1T 1YITT 5ADXL 2BBJA 4LMKA 2KQWA 3VRYA 2W00A 2RHIA 4RTTA 5I11A 3T8OA 3KV5A 2MAWA 2RPNA 1ZLMA 3UT1A 2D1XA 2LMJA 1NJIR 1E6GA 3PNWC 4BE1A 5IN1A 4CXWA 3EG0A 1VIFA 1W2BP 2JQQA 4J2CA 4DV7T 1TUGB 1XDOA 3N9PA 2JS0A 1KC8U 2FJDA 4DNDA 1VQ6T 2UUAT 2Q9QB 3PT9A 4LUEA 1W9RA 1HF8A 3X26B 1OU8A 5F5WA 5ABFB 4BI8B 2JPFA 1PD1A 5CA1E 3ZEHA 1QMCA 1K1ZA 2GF7A 2BTTA 2HAXA 1FWZA 3EFOB 2MWOA 1U1SA 3G6ET 3FB2A 3UDCA 1KK7A 3CCRQ 3HI2A 3RIRA 3SD4A 2JMHA 4FT4A 1H3ZA 2IUBA 2LOPA 3QYGB 4LFCT 5GAMj 2LCCA 2VYTA 2NW9A 3JCMQ 3CCJQ 1WA7A 2WZHA 3CPWA 5LG4A 4M7AF 3ZMTB 1U5PA 1YI2Q 4QKNA 2E5VA 2VL8A 2XQ4A 3AXJB 2X9XA 4HGAA 1BI1A 5AQTB 3HA4A 4JZ4A 4M75D 4A4HA 1ZSZB 3TSZA 5IWAT 4NL2A 1JB0E 2FPDA 2O88A 4E6RA 4LF6T 2QRXA 2DA9A 2HD0A 4BJMA 3VS7A 3JCMb 2MF2A 2F1LA 2LRKA 1WZOA 2DZ9A 3BW1A 3EFRA 3OYHA 4Z90A 2X3XD 1UUEA 3E08A 3AEAA 3M0UA 1AZGB 3META 1IREB 3PDYA 3GBQA 4XTXA 3F70A 2VB6A 3G06A 4YXDA 1RLQC 5AQPB 2HL3A 2LHNA 1OWAA 1TXQA 3N9OA 2FZCB 1KHCA 5KCOA 2VXFA 2V7MA 4R56A 1E2AA 2XQ7A 2KR3A 2EQIA 4M77C 1SPKA 1KNZA 3DB4A 1HD3A 3HSBA 3HKCE 4VUBA 5LMNT 4AKLA 1HK9A 2VL0A 3HKSA 1OYXA 2BIVA 4X1KE 3O4XE 2LP5A 1QVFP 3CCST 3NWIA 3GNFB 4OMQA 2IG0A 4IURA 5KYXB 4YTMA 3JCFA 3VRAA 1M2VB 2QA7A 4X1VA 5D6XA 1XMOT 3C4ZA 2EGAA 2KINB 4RMOA 3L2QA 3QKJA 5L3FB 2PUKB 2EQKA 2SEMA 2FBWA 3I56A 3OPCA 4Z8XA 4BI4A 2Q9QC 4M75C 3M4GA 2CXFA 4H63H 5I22A 2VC8A 3E9GA 5LJ5j 4HT9A 4AT1B 4KMCA 1T0HA 1TUDA 3JCMJ 2LDMA 5CK9A 2PTFA 3ZC0A 5FVKA 4ZNXA 4BY6B 1N5ZA 5KYNA 5D6YA 2HSPA 4O5VA 2MTQA 3MK7C 4KUIA 3P4SA 3EFSA 4WBOA 1CHUA 3VRZA 2Y48B 2EBPA 1R8IA 3AE7A 3JADA 1G2BA 4DVDA 2DPPB 4ASKA 2DETA 3AE9A 2RQVA 1OOTA 2HEQA 4X5TA 3OW2P 3PV0F 3BDLA 4XU0A 5JR9A 2A36A 2QQ9A 3UU3A 3NMZC 2LSGA 4J5YA 2J6KA 5CAIA 2IAKA 4ZZBA 4XQ3A 3BQLA 4L9IA 3UUNA 4AG1C 5L23A 3CC7T 1AWOA 4Y92A 4MBQA 2EVRA 1GXIE 3AE8A 4CQIA 2HMAA 1KEYA 1MMGA 3P8DA 3AAAB 3OSVA 1PRLC 1U06A 1RLPC 2N9DA 3VRBA 4QX8B 1N8RR 5J39A 4KGZB 3REAB 3VR8A 3ONLC 4DMWA 1UEBA 2CP2A 3OW2A 1D3BA 2LEHA 4ATOA 2EYZA 1Q7YR 3CC2T 2DMOA 3Q9DA 3M0SA 2O4XB 3G71A 4M7DA 5EZYE 1LVFA 2BG9A 2ODVA 3IEEA 2PFVA 2DM1A 4C8QA 3CCVA 3UQ4A 2D9DA 4TWHA 5FRNA 1YJNQ 4I4TE 4MHCA 4JRPA 2V7LA 3M56A 1B34A 5LHGB 1WFDA 3RERA 4F17A 2LX9A 4K0UA 2BKDN 2ZLYA 3M0QA 1IHWA 3P4QA 4CRIA 4QQGA 4HFBA 3ZEFB 2ZM0A 1M1KR 4C0FA 2YLBA 4EMKA 1WCRA 1K9MU 1N33T 3GIBA 5AQJB 2MCNA 1TS9A 2RJCA 2X4XA 4HWCA 4XK8E 2BKPA 4QX7B 3RLFF 3MEVA 2XM1A 3QNUA 1WX6A 4CN4A 2DXCA 2R5MA 2V1DB 3ZJ2A 4WTOB 1KNRA 2RQRA 4KX6A 3OTOT 2KWHA 3E22E 2OLTA 4PJNA 1WHLA 3OS5A 2EKHA 5FROA 2EYXA 1K73C 5FRMA 5AFUL 5BMVE 2G3RA 5HXCA 1HYOA 3LH0A 1R0CB 1HX8A 4EDUA 1Y0MA 2J1DG 1T0JA 2PBIA 3AE6A 2PZ1A 2VKOA 4ISTA 1T7SA 3KVBA 5ABHA 3ER0A 2MOXA 4FSSA 1QLBA 1PRMC 2DZCA 1Q86R 3ZL7C 4H9NC 3EH1A 2BS3A 3GA8A 1HR0T 2YLCA 3JB9F 1AZEA 2XDPA 2RMOA 1JXMA 2RJDA 1QCNA 4M1PA 5IH2A 3AA6B 2XQ3A 3JC6C 5JDNA 2CSQA 3C51A 4JPBW 3PU3A 3D7SB 4NL3A 4AIUA 1YWPA 2UXDT 1KD1C 4AQFC 4YLHA 1QKXA 4JJDA 5DABA 5LJ5f 2QEXQ 3I9YA 2CEAA 4YHJA 3OB9A 2W61A 1ZQ1A 1VQMQ 1A0NB 2QA4Q 4I55E 4HVWA 1WHKA 4TWDA 1Q86U 2RHXA 5L3CB 2E1HA 1VQ9T 1S72T 2F4VT 3CPFA 1WJSA 2F2XA 4AFQC 1I8FA 2E4HA 4C5EA 3CD6T 5LJ5e 3CPWP 3VKHA 4GIWA 1VQ8Q 2DJQA 2X0YA 3OYBA 4QQ6A 3ONXA 1TUCA 4ZGEB 1J5WA 2J6FA 1UX5A 1ZA2B 4JS4A 2BG9B 2D2SA 2L8KA 1QP3A 1HS7A 2IPOB 4C92G 5A0GA 3K3QC 2RHZA 3UUBA 2CCQA 2YUNA 1NJIC 1M30A 1SSFA 3CCMT 1V9DA 4RCBA 1K8AU 3V8JA 5FU6B 2A3DA 2A9UA 2EHOB 2MBGA 2XTLA 3LK3B 4DUZT 3AECA 2Q9QA 3RUXA 5FWCA 3NZPA 3NGPA 2DXBA 4J9HA 1M1GA 3PUVF 5DY9A 3FBLA 2DX1A 1Q95G 1YIJA 1VQ8A 3G6EQ 3OSSC 1NBEB 2XQ8A 2EWNA 3A8GB 5GANg 2HPLA 4ILCA 3AA1B 2GNCA 3CKDA 1W0BA 2QA4A 5E0OA 1VQMT 4DV2T 4HCCA 1IGQA 3PVLA 2AZSA 3CX6B 3LYIA 4IREA 2IIMA 3KVAA 2CZ1B 4FJOA 2X9HA 2B8AA 4C5GA 5GAN7 1BR0A 4C5IA 4IE6A 3CEYA 1MNDA 2CBIA 2XJ7A 3N2OA 3QDFA 1M27C 3FJ5A 1T72A 4JLIA 3CCUT 4ISSA 3M58A 3G71T 2EKOA 3SB2A 3VHLA 2W2UA 2JTMA 4MMLA 2QXFA 4JEUB 4EEBA 1AVZC 4GKJT 2DL3A 2JS2A 1YQ4A 4RTZA 1TWBA 4UF0B 1X01A 4HVUA 2V6XA 1HG5A 4NUUA 2DCFA 1AWXA 4HFEA 2K5BB 3SWNB 1SHFA 5HY6A 2JMKA 1LRZA 5FXZA 5AQFB 4U7YA 1QP2A 2KZ7B 4I0UA 4OX9T 4E7HA 2O9VA 3OQ5A 1NPRA 5LJ5d 3GPLA 3OYFA 2X4WA 4DMVA 1MIVA 3SDZA 1D09B 3PTAA 5FKYA 3UUXB 2WAUA 1IBLT 2FJEA 4CN6A 1NE8A 5FXVA 3JCMX 1FMWA 1K73R 4PFZA 4PJOB 3RC3A 4QT7A 4C0ZA 3HFOA 2OTLT 2RHUA 1CSKA 1XWMA 1WYBA 2KY9A 5FU7B 5H6QB 1UJ0A 4X9CA 2X51A 4CC7A 1VYVA 3OKQA 5HWXA 3OS0A 3CCQA 3G6EA 3L2VA 3P8HA 2RPAA 1UGRB 3FLGA 1MUZA 2AT1B 2BDEA 2LNVA 2DI4A 3CC7A 5FY1A 1NEKA 6AT1B 3CXCS 2R5AA 4OYKA 2X0HA 4IUTA 2COYA 5FL0A 4CXXA 3GN5A 3JAEA 2OTLQ 3REBB 4C90A 2QGGA 3O1HA 1I0CA 4M78G 3TLWA 2CH4A 3S6WA 4JI8T 4WW0A 3RF1A 4YJ3E 2LJ0A 3PUWF 2VKDA 3C95A 2DLRA 3I1AA 1RAEB 2D8JA 3AT1B 2E41A 4IDNA 2P4TA 5JDMA 1Z0PA 1MV0B 1UGPB 1X2KA 2NR4A 3GP8A 4AMCA 1VCSA 2ESWA 2PTKA 1SHZC 1AWJA 2CZ6B 5CCAA 5JVDE 2E70A 4LDUA 4J8OA 2GQVA 4M7DG 3MJXA 4JZ3A 2BUDA 2FRYA 2W63A 1YJ9T 1LKXA 3N5BB 5FL1A 2IIUA 2XM2A 3SWNC 4E2FB 4A4GA 1M90R 3VU7H 4PLIA 3LGLA 1ZUYA 2YSQA 1JBMA 4CN1A 4A4FA 2KSRA 2COWA 3MCAB 4AFUC 1KG1A 4FYXB 3EGDA 2LKHA 4JI7T 5HEUA 4YTPA 4CI1B 1YJWA 5CVIA 3QSUA 5EG2A 2CT3A 4M7AD 3I9QA 1VQ4A 2DK3A 4TV8E 4M77G 1W2BA 5LBMA 5GAN6 1VQ7A 5FVLA 2DEQA 3RYFE 4UF0A 4D8KA 1Q7YC 3SS1A 1JXOA 2VKNA 2W0GA 1FIOA 2PVDB 2W10A 4ZS2A 3OBYA 5GJVB 4C92A 3CC2Q 4F6RC 3EG2A 1OEDE 5LJ3d 4EMGA 3LBXB 2SRCA 4MZPA 2CP0A 4ZZCA 1VYUA 3KV9A 2V8SV 1RI0A 3ZFJA 1US7B 2XU8A 1YIJT 4ZI2D 4YSZA 4CI0C 2C5IT 4LF5T 2VQET 2B1EA 1JNRA 1BYMA 1SG5A 2EYWA 2YUPA 4O2BE 4GLKA 2DXTA 5GONE 1V29B 3S3NA 4JI1T 1JQQA 1UDLA 4Z88A 1GRIA 4IL4A 3ZMVB 2EGCA 2QI2A 4LMLA 1X79A 3AVRA 5AT1B 3CVRA 4JV5T 5DQWA 2YT6A 2DNUA 2H3RA 5AQOB 1S35A 5DQVA 4ZI3C 1UJYA 2JW4A 2YDQA 5AQLB 3KUFA 1OPLA 1XTDA 5KXJA 2MPXC 2OI3A 2A3LA 5CGMA 2DL7A 2CP5A 5ABGA 3HKDE 2OV9A 2D0TA 4AKIA 5F8PA 3ZKRA 1PSFA 2RN8A 3UF4A 5LYJE 2YN6A 1S72A 3LG7A 3RRCA 3PUGA 2LX7A 3B57A 4DR4T 2UUCT 2QASA 2CS7A 3NHNA 2PQWA 5GMKi 3TLVA 2F5TX 3ZN1B 2XKOC 1OZ2A 1MV3A 1XOVA 4M77D 4M78B 4U2ZA 2JMCA 3A8OB 4ORZA 4UVAB 5LL6S 3C98B 3UQ7A 1CKAA 4IUQA 2QQAA 2RA1A 3EDUA 3X24B 3JV3A 1VQKA 4KHPT 4JEHB 1WI7A 4HEAA 1VYTA 2AE9A 1B7TA 4ZGJB 2E9XC 3OYJA 4FW2A 2KK4A 1M90U 5KYWB 3T9NA 4UV8B 3W15B 2MOZA 3NKZA 4U31A 5CKEA 2DERA 4LXCA 1UGQB 2FPEA 5LJ5h 2N2NA 3OVUA 4KULA 2C0TA 1PHTA 3L8RA 4GK5E 1YHQQ 2KT9A 3FZFB 4IIOA 1K73U 1WFWA 3PUQA 3PVQA 3Q5DA 4YFSA 2PJQA 4C8QD 4JI2T 2LHRA 3L3PA 4C92B 2C06A 4EYUA 1OQKA 5KYXA 2K9AA 3A7MA 1YFNA 5HXHA 2E3HA 3VKIA 3A8HB 2X68A 3PUAA 2LM9A 1TOVA 3RYHE 2SPCA 3R6OA 4IE5A 1AJ3A 4X20E 4B3MT 3AAIA 1D1CA 4X66T 4B3ST 2J47A 2H3JA 4MMKA 4TZ4C 4FM4B 4XU1A 4DBQA 5LHHB 2E9XA 1ZOYA 2WY2A 4BA9A 1YI2A 1OEDA 3ULRB 2JM8A 2DL5A 2RO0A 5FWBA 1B07A 3J81E 1N6AA 2R58A 2YRVA 4GLMA 4OP0A 5LJ3j 4PK4A 4AFSC 4O4HE 4JI0T 1VQOQ 3RQUA 5JR9B 5GAN3 3FZKB 2R6GF 4C8QC 1AEYA 1M90C 2KRNA 2CWYA 2E12A 2E6NA 5KYWA 4HCZA 2CXLA 2WDVA 1ZSZC 2VGNA 4PL6A 2K24A 2LSKA 2CGHA 2LSJA 4XZCA 3KBGA 3FXDB 3MP6A 3DLMA 3H37A 5AQVB 4C0DC 1T98A 5LHIB 3CCSA 2KBTA 5GANj 2L3QA 1BKBA 4O4LE 3F57A 5IYZE 5KX5E 3GWHA 2E64A 3A5XA 5KYYA 5GAOq 2PUOB 5L47A 3FZHB 2J6OA 3S3OA 1IBMT 1W6XA 4LD9K 8ATCB 3CC4Q 3VS6A 1K8AR 3P8CD 5FYMA 3NPFA 4A5XA 3RHWA 3CCEQ 3FXEB 4Z91A 4L0RA 2WDQA 2YUOA 3EG3A 2UXCT 2HCKA 3B5MA 2JTEA 4H63V 1WHJA 3I5RA 3O1IA 1KFYA 1ZKEA 4QKUA 2BS4A 4ANJA 3E19A 3VS5A 3HL6A 3R84B 3UU8A 4RUGA 1VQMA 4DV5T 3JCMe 2ACXA 3AE3A 3QIIA 4YTLA 3DLLA 1X6BA 2AZVA 4C92C 2CZ0B 2E9XD 2IHR1 1H7CA 5HWYA 1FXXA 4KGXB 1SE7A 5GMKl 4AKRB 1RAGB 2C5JA 2YXYA 2CM0A 3A8YC 4HFIA 3PMIA 4NOYA 5LMUT 3HKBE 1LJOA 4EPCA 4YHHT 2VXEA 3HP9A 2CP3A 3M5AA 5DLQE 3OYDA 2ABLA 1Q82R 1PKSA 4D8DA 2JIWA 3GN5B 3JCMV 1VQPQ 4M7AE 3CMET 4TNVA 4OK0A 2M6IA 5C2TA 1IO6A 2XI9A 4HCKA 2ZPIB 5LOVE 5JQGE 3QUJA 1C1AA 2IVWA 1M62A 4Z8AA 1FMVA 5IHYA 2L9QA 3UWNA 1YJNT 2HSEB 1YJNA 1VQ7T 4DR5T 3RBBB 2DBKA 4FYYB 4KI0F 1PC0A 2FHDA 2RHYA 4IDZA 4MZMA 4EEDA 1HNWT 2XAFB 1BI0A 5FY7A 4AFZC 4ZI7E 2KNDA 1NPPA 2ROTA 5JR9C 4ILBA 2J62A 5KYYB 3CCVT 1G3SA 1D0YA 1YNZA 1BR1A 5F3JA 3PUSA 1W2BS 2BG9E 2ODUA 3VS0A 2KEAA 4RKUE 2MIOA 1BI3A 5IUXA 4HWFA 5AQGB 2PU9B 1BR4A 5CO7A 4IUPA 4QXCB 4ZN3A 3U78A 4JYAT 3FDRA 1GQEA 1BIAA 2X4YA 2LKGA 2EQUA 5LP6E 4BJNA 5GMKe 5CQYA 1M1KU 4BDZA 2ZGWA 4YT0A 1OXZA 1YKHB 3RKGA 4EMKC 4P0AA 2CE7A 5J3BA 1Q81U 3X1DA 3PIPA 2GTOA 2WMOA 4J9CA 2VVSA 2ZAEA 2LSIA 4HWHA 4ILAA 2DTHA 1N34T 3I35A 4IDOA 3CCRT 3EUHA 3OMCA 2NWMA 2X35A 4JS5A 3T1YT 2G0UA 3BQIA 3OYIA 2M51A 5KYUB 3JB9D 2KLQA 4P09A 4QWNB 3FEOA 2EHOA 1NEBA 2HH7A 4IT4A 4LDVA 3VU3C 5L3BB 2DYIA 3WVEB 2OTJA 4LN2A 3EAEA 2XQ9A 3F31A 4KP3C 1E7PA 1QWEA 2CHNA 1UHFA 2GGRA 3P7IA 2YU2A 4M78A 2Y90A 3CK6A 2DRMA 5JREA 3HTRA 3UT5E 2KT8A 2QAZA 2FG0A 3KV4A 2C0OA 4Q5WA 3M0TA 3NZQA 4HCBA 4CC4B 3EI0A 4EZHA 5LNKA 3CWZB 3QB5A 2KMTA 3IQLA 2C0SA 2NWBA 3CC4A 4PFPA 2RK1A 1UB4A 3ZN0B 1TU0B 4R55A 2ACZA 2UXXB 2IW5B 2K6DA 4Z89A 2A28A 1J5ET 2JJ9A 3RH3A 2DHRA 5LJNA 5FW9A 3WAKA 1QVFA 4ILUA 1W70A 3CMEA 3CQTA 1QWFA 2RP4A 3CCET 3RYCE 2NW7A 3MO8A 1RABB 3KFVA 3Q2MA 3AEEA 3ZC1A 2H8HA 1JO8A 3N9QA 5M9OA 3OBWA 4HA8A 1WDXA 1NLOC 1X69A 2WACA 2CXDA 2NTYA 5CB4E 3FC3A 3I9WA 3RDVA 4AISA 1X6GA 3CCJT 5LJ3e 2X67A 3ZYKA 2WBLA 4EMKB 4H9RC 2NTXA 1IGUA 1SKUB 2AKKA 2RM4A 4A4KA 5AQSB 5DLOA 2XAJB 2WSFE 1VQOT 2FJBA 4QXBB 2ZMAA 3HPWA 3G4ST 1VQ5T 1VQLA 3K1SA 1Y7XA 2YINA 3EGUA 2QK0A 3TSWA 3JCMc 2V8IA 3ASKA 1M5Q1 4HT8A 2QDLA 3BE3A 4QW2A 4B6MA 3UFGA 3N9MA 2EQMA 1N9SA 1JJ2S 4LF4T 2BKOA 2KI7A 4N0AC 3PJAJ 2M9UA 1WYCA 3LSVA 3N9LA 2KRMA 1Z8UA 1WHMA 4YSYA 2X9WA 4N4IA 2RQTA 3TLTA 1G3YA 3S3MA 3I55A 1YITQ 4UR9A 4RCCA 1N27A 4OMMA 4DA4A 3CCLA 2EJFA 3QB5K 2JNGA 2OA5A 2C0IA 4IL9A 2OTJQ 2E5QA 5C8YE 2D6FA 4J9FA 3HRSA 4DR7T 1Y07A 5GAN5 1IZNB 4BD3A 2QTVA 4M75B 4J9GA 4MZTA 4H9PC 5KDMC 2FYKA 4DV4T 4HKEA 1K0SA 3SFEA 4C0GA 3V7CA 1OZ3A 1N36T 3L2UA 2MAMA 4V2SA 1IAPA 1DU2A 5FLXE 4ZI2C 1MGQA 3CBMA 1QLYA 2KNBB 3EGDB 4YSXA 3J7Yq 3VS4A 2D0QB 2O01E 4A4EA 2DL8A 4TV9E 5KH6A 2WWVA 5GAMe 1Q82U 5JDFA 2ZPFB 4NPPA 3TLUA 2K9GA 3GOXA 3ZLIA 3CCQQ 1NJIU 1MMNA 2OX7A 1GCQC 4KH1B 1ZBXA 1UGVA 1R0BG 4E7IA 2A08A 4RG2A 2K57A 3PE0A 2HL5C 5FY0A 1WXUA 1G3WA 3INZA 1HX1B 2V1RA 1UK5A 2FPFA 3RX6A 1Q7YU 4PW8A 1LVKA 3CPWS 3QHSA 1YKEB 3KV6A 2FO0A 3OY9A 3CMAQ 1SRMA 1WGSA 2H7OA 2VUBA 4DEYA 2CBJA 3OMGA 4ERRA 2JQ9A 1SF9A 2F69A 2LJLA 2MPKA 4G63A 3UU6A 3CCJA 2CUBA 2X3WD 4GYRA 2E5KA 4XTUA 4DV6T 2IMLA 1EFNA 2RJFA 2RQUA 4RTWA 2LCLA 4U3CA 3EGXA 1G8XA 3AEDA 4KUMB 1U3OA 3DB3A 1IB8A 1MNEA 3QXEB 4JI4T 2EW3A 2XAHB 2XAGB 1EX4A 1VQOA 2NOXA 3UTKA 5LXTE 1PG5B 3OYEA 1W1FA 3QZ9B 3Q5XA 2DEUA 2NUPB 3V7RA 3PTRB 3VUZA 2DL4A 1HCIA 5IHIA 4FT2A 2K2MA 4OGCA 1XNRT 5AQHB 1ZA1B 2EYYA 3AE4A 1VQKQ 3ME9A 4RTUA 4EOZB 3CMLA 3SEMA 4Q25A 1FMKA 3M55A 2DVJA 5M4YA 5IT9E 1M8VA 1K0XA 3SFMA 4KRTA 1IJ6A 4U72A 1SSHA 4CXYA 1AWWA 1Q82C 3UATA 4U7IA 4M7AB 2EJGA 3CQXC 4WCIA 1BCOA 3VKGA 1YP5A 2X66A 4J9EA 2BZBA 1M1KC 1LPLA 3RPUA 3RIFA 1RL2A 4JRKA 2I59A 3V8KA 3FZLB 2I2LA 3CCEA 1QVGS 2RK2A 2GBQA 4HFHA 3CCMQ 2DKGA 4MDXA 2LNHB 2QQSA 2QYZA 1TSFA 2ZPHB 4M78F 4PK5A 1H8KA 1NEGA 3IBPA 5LGNB 2YK0A 3CPZA 4KBMB 2YUQA 4MLKA 3A8LB 4GKKT 5GAN8 2J06A 2VVNA 4KHZF 2W66A 2DTIA 3SWHA 3MKDA 3J80E 3SFDA 1J1JA 4OMNA 1JJ2A 2IC9A 5CJ5A 4J6XA 5JTGA 3CD6A 4MFRA 4ADZA 1XMQT 3L1AA 4OB1B 1YWOA 2F2WA 3VJPA 2X9YA 3M0RA 3EAMA 2RD1A 3QYHB 4QVZA 2JTFA 1KFZA 1BR2A 2OAUA 3M65A 3V5SA 3QUIA 2WSCE 2QGFB 5H6RB 4F04B 5GANh 3K3OA 4FCYA 2CUDA 4PJMA 1BI2A 1CKBA 2LT3A 3NBXX 1VQ7Q 3PGGA 2CMRA 5FU7C 3AA7B 5LCYA 3CC7Q 1ZSZA 2HNIA 2A2FX 2N1GA 3QPHA 3VS1A 5CKFA 4M77B 4HXJA 3CCMA 2LT4A 4V1Av 3ZCJA 1MIYA 4PJLA 3P50A 2E6ZA 3LK2B 1TG0A 2HDAA 1GBRA 3I55Q 2CT4A 5C0MA 2VK9A 1SHGA 1QCOA 3GF5A 2XG8D 3CBPA 2FVUA 4ZN1A 2XICA 5JDGA 3KINB 3PU8A 4IGUA 3MPUB 2E5LT 2XK0A 4C8QF 4N4GA 5L4EA 4M75E 1FX7A 2K79A 4D6WA 3TEEA 3UFEA 4RTVA 2VWFA 4J9DA 3Q5EA 2JOYA 4K11A 4F7UA 1ARKA 4M7AC 2CA5A 2WZIA 4B3TT 1NG2A 4FW1A 4FYVB 1VQ5A 1VQLT 2YRDA 1OU9A 3P4WA 4DV0T 5HKCA 2XDDA 2VKJA 2DJZA 4UIGA 4BY6C 1Y64B 2WM9A 3ZMSB 4DQ2A 2WS3A 1VUBA 5ECAA 4QH1A 4LD6A 4U33A 3A1PA 4OVAA 3VV0A 5GAOr 4O6JA 3AAEB 2L3LA 5FXWA 1M3AA 3UPUA 3E9FA 5I2MA 2K2VA 4F8HA 2K3WA 5ETWA 2CPTA 1WQWA 3CX7B 3V5UA 3ZT7A 3NTHA 3FZMB 4LDWA 3LX7A 5C6SA 1UFFA 5D6WA 1HSQA 1W09A 4LE9A 1I5OB 1C0MA 1IJ5A 3LFMA 2I0MA 1WJQA 3CQCB 2FUPA 1QW1A 1SRLA 2JUFA 3C12A 4XTZA 4DBFA 5AQIB 4DEXA 4N4HA 2W67A 5I2SA 3VYGA 3M57A 4CC2A 5LGUB 3QWYA 3DTOA 2GFUA 4EB6E 4A98A 2EHOD 1PM3A 1PWTA 2UXBT 1BCMA 4BE2A 4M7DF 4QH4A 3P4RA 4XTVA 1I6ZA 3ZMUB 4F7UE 4A63B 1KC8R 3AHUA 5CQXA 5HXRA 2V7KA 4GOUA 1MHNA 2ED1A 4QQDA 2XD0A 4O2AE 3ZT6A 4E7ZA 1ZHIA 4M75A 4P1NA 2J4GA 1YQ3A 4C8QG 1WIEA 4IUUA 4H9OC 5GAOp 4ZTFA 2D0NA 4EXTA 2PG8A 2A7YA 2DILA 3DKMA 2FRWA 4GY5A 1T3SA 5HCKA 2K3BA 2AHJB 4C8QE 1UUSA 2OJ2A 4J83A 4M7DE 1KSWA 4UC4A 2WMNA 3URGA 1VQNA 3CQGB 1RADB 1IRXA 4H9QC 1GFCA 3OYAA 4GK0E 1QVGA 5GAOn 1ZUKA 4L6V5 5LJ5g 3BY7A 2KMFA 3ESLA 4CI3B 1AD5A 3RNJA 2F5KA 5HXEA 2K7AA 2WSEE 1YXRA 5HK3A 5LGTB 3M0PA 2QG9B 1NYGA 3BDUA 4M78C 1NAFA 4GYSA 3QWXX 4F7UB 3H8ZA 1S1NA 3MP8A 4IIMA 1WNLA 5J0ZA 1ABQA 1X27A 2WWUA 1VQNQ 4YY3T 3NFCA 1YHQT 4PNIA 4X64T 3C0CA 2QEXT 5CIUA 1HFAA 5FNVE 3OBVE 1HJDA 3GMIA 3RKYA 1M2VA 2JT4A 4PKCC 1NLPC 4ZTJA 4GBQA 4ME7A 4DBHA 4COFA 1ZV4X 1BB9A 1NM7A 5LJ3g 3QG1A 4A54A 2XDBA 3B13A 2HBWA 1QSDA 1E1HB 2L2PA 4TWFA 5GAOl 1VQ4T 2MI6A 2VURA 3I0OA 3QDRB 5L3DB 1VQ6A 4HE8A 4WZXA 4FL6A 1UX4A 2BKNA 2XHCA 3OYNA 1WXBA 3PMTA 3OS1A 3JC6D 5GANd 3E0ZA 1UECA 4ELYC 3L2ZA 1WXTA 3GNGA 2BG9C 4JUVA 1ZUUA 2M02A 3HHTB 4KT0E 4NXNT 1M2OA 1FJGT 3E1SA 3HR0A 2WCAA 2E10A 1S72Q 3CCLT 2ROLA 1WJRA 1YN8A 1EIFA 4K0KT 5KMGP 2KAFA 1N8RU 4DUYT 1V76A 3NTIA 2WDRA 1X9BA 1XQHA 3V7SA 3PJAA 1Y96A 4FI5A 4M7AA 1HG2A 4HTEA 3TKLB 1UG1A 3ZJ1A 5I21A 5CKBA 3ZSSA 2MMPA 2K5LA 2M6BA 3HKEE 2V8KA 3CCUQ 2KROA 3IF8B 2NUTB 2E2AA 1GBQA 2W4XA 1OI1A 2V7JA 3CCLQ 2PVGB 4JLGA 1I5LA 2XY8B 2LLYA 3SRZA 1AHJB 2ED0A 2P4RA 5AQQB 1VQ8T 1T3LA 5J2UE 4OB3B 3JCMg 1U8RA 3OYLA 2DD5A 5HCMA 4JRQA 5HEOA 2UUBT 1KHIA 3MEUA 2FZGB 2BBHA 3OS2A 3JB9J 2LQ8A 4M7DD 5HXSA 4C8QB 2QA4T 3M9QA 2ZPEB 2XQYA 1N32T 4PJOG 7AT1B 3AE5A 2LVMA 2HN2A 2O31A 1I1JA 2DYBA 4XAXB 4EMHA 4AG2C 3VUBA 3RKOA 3U23A 2MK5A 3C4SA 2CLYB 4NXMT 2BE7D 2XQ5A 2DWGA 2HZYA 3ZPOA 4PJOE 3IA3A 3NTKA 3LWIA 1LCKA 1N8RC 4B6XA 3O1JA 3CCUA 3A98A 3JCMh 1UGOA 4DR2T 2DO3A 1RUWA 1CUNA 4JUYA 4JLEA 2RQWA 1YJ9Q 1K76A 1QUUA 2GFAA 2QQBA 4M77A 4B9XA 1GFDA 4C91A 2PNIA 2Y6XA 4TN7B 1NZ9A 1ZSGA 1VQPA 5J26A 3X25B 4OFZA 3CD6Q 1M8MA 5A0DA 5GANe 4PAGA 2NLUA 2FZKB 3MHXA 4UV9B 5LJ3h 3EHRA 2V26A 1D0ZA 2NUTA 4Y91A 4F16A 4ZGDB 5L8RE 3F2EA 5A1LA 3M4YA 4AXPA 5JRCB 3LWHA 1M1FA 2KXCA 1ZX6A 4LFBT 2QDYB 3VS3A 4IE4A 1AT1B 3K8PC 3CBOA 4M4ZA 4WF2A 1PKTA 2M0OA 1RAAB 2L3RA 4J9BA 5GMKh 2XSBA 5GAMd 1QVFS 2YOEA 4XU2A 5IXBA 1WPYA 2K5IA 3KXTA 2FL7A 1TTHB 3S4UA 5GMKj 1B3QA 5IAYA 3UA7A 1VQNT 5GAOm 1U4QA 4U74A 2HHHT 3AE1A 4L5GA 4O4IE 4J7FA 3QBYA 2FB7A 3ZBDA 5LJMA 1JEGA 2V5DA 1T8BA 4LF9T 1RAIB 1M7KA 1NWMX 1Y57A 2K5FA 3GLXA 2V8JA 3C4WA 4DBRA 4UXNB 3OYCA 4PJOA 2CSIA 3LBXA 1WHGA 2BS2A 3FRNA 2P0QA 3CIRA 3BK9A 3PUXF 4II1A 3V8LA 4HN9A 1BBZA 3Q1JA 3QZ5B 5AQMB 1Q86C 1YHQA 1K9MR 1VA7A 3FB9A 3QC9A 5HEHA 2RF0A 4JBWF 2Q9QD 4ZEYA 4XTYA 2IDOB 3RC8A 5C3JA 5LJ3f 2UXNB 2LQNA 3UA6A 2KXPB 1C6VX 3LGFA 4EIKA 1XNQT 2CWOA 4DR3T 3ABVA 2AK5A 2CP7A 1KD1R 2KT1A 1VQLQ 1O3XA 1VQ5Q 3NVOA 3L09A 4JDSA 4YTNA 4M7AG 1UGSB 3K3NA 1ZHCA 4Y28E 1M3BA 5GJWB 1D0XA 2DAQA 2LC4A 3SHWA 2QVAA 3KBUA 4AQFA 5CFBA 4BDYA 4IDQA 2C5KT 1G3TA 3RYIE 5JH7E 3THKA 3H41A 4J6WA 4QVCA 2BE9B 2A0FB 2ENMA 2JM9A 3AE2A 2HQEA 3A8MB 4ZI3D 1G73A 3LK42 4TUYE 3ZMZB 1SUMB 1Z9ZA 3MEWA 1Y71A 4E7LA 3BQKA 1GCPA 3CXCP 2NW8A 2AKLA 2COZA 3CCSQ 1KQSS 5FP3A 3VR9A 1OEBA 1Y01A 4HWIB 4LFAT 2GTJA 2WP9A 2DNXA 2CDTA 3PURA 4LF8T 1M9SA 2CH4W 2O2OA 5EK3A 3ZYLA 4N78D 1RAFB 2K48A 2F2VA 2OTLA 3C4XA 1BK2A 3CCVQ 4DV3T 1L0VA 4EGWA 1BIBA 4UVCB 3CX8B 1WQ7A 3RKWA 4C92E 3QK6A 1E6HA 1BU1A 4ELZC 3D0TA 3DJBA 1I4K1 5HEGA 1R8OB 3I56T 5L3EB 2ZZDA 2EYQA 1HXDA 5HEJA 3M3ZB 2XMFA 4JI6T 1VQPT 3EDVA 5IXFA 4UVBB 2ES0A 3H3AA 2KWIB 2YDLA 1XDPA 1VQ4Q 5JDLA 4X62T 1O9SA 2H3EB 3KBTA 3WXMB 4BB7A 1EZ3A 2W0ZA 1HTJF 3R6NA 4EZ4A 2XAQB 5A2QE 3FBZA 2QYWA 3LH5A 2KVQG 2KE9A 2MYSA 4X9DA 1YCYA 1IHVA 4X65T 1NENA 1YW0A 5J1GA 4TVRA 4E7JA 2Z0WA 1UE9A 4OB0B 5KCHA 4WBNE 2JZ2A 1X75C 5LG3A 2ZPGB 3H3MA 2KYBA 3EGXB 4C5HA 2XPKA 5CA0E 2LE8A 2E8IA 3ONJA 4NIQA 1YBYA 3X20B 2DFUA 3UULA 2EPDA 4WYVA 4LNPA 3L39A 1Y96B 2OTJT 4BI3A 5EC7A 3L2RA 2E65A 1Q81C 2ZM2A 2DIQA 2XSAA 4C92F 3MA9A 4IE0A 4DIDB 3CC2A 5AQRB 2CP6A 3WVDB 4MDWA 2AXDS 3G1JA 1Z9QA 3OW2S 4NS5A 3PUYF 1F1BB 3QOFA 2VASA 5L3GB 3KFWX 4X1YE 2EHOC 2CKKA 2XASB 4A53A 2WU2A 2DRKA 4M77F 1QVGP 3N2GE 5KE3A 5HAXA 2K3YA 2YEVC 3EHZA 4WNKA 2I0NA 1YJ9A 1I81A 1YITA 1GCQA 5AQUB 2O9SA 1K9MC 2L5QA 4XBFB 3ZCIA 1QQJA 4FSXA 2HPJA 1VQ9Q 1WRDA 3DP7A 4M75F 2Z6EA 3RQWA 2J7IA 3QJYA 4DOWA 5GAMg 1KQ1A 2YRCA 1R77A 4X1IE 4ZXLA 2EQJA 5KYUA 2YKSA 1D1BA 4C92D 1VQ6Q 3MEAA 4OMOA 1H92A 1HNXT 1RAHB 3NRYA 2YDSA 4UEMA 4QHOA 4PLLA 5AQNB 1OULA 3ANWB 4RG8A 4OF1A 2L3SA 4HWDA 5BR8T 1UCUA 3UU5A 4E7KA 3ETVA 2HQHA 4M78E 4OMPA 3EABA 2D5UA 2L8DA 4JI3T 2DWKA 3AVSA 2DXUA 3JCMf 4E7SA 2VQFT 1G83A 1YJWT 2QGSA 3JCMd 1OEDC 2P0KA 4JI5T 2HKQB 4LDYA 1U1TA 2D9TA 2CYZB 4CI2B 1LOJA 5IHKA 2DBMA 2LQWA 2NUPA 5LBQB 4KH0B 1WHHA 4OGEA 5L4HA 1WYXA 1KNPA 2HN1A 2RI5A 2A72A 3G4SQ 4PJOF 3M53A 4QH5A 3RI5A 2LOSA 2YU1A 2LJ1A 2LQKA 2VGMA 3I0QA 4AI6A 3WAJA 5JRCA 4QVDA 2JRKA 2JVVA 2YDRA 3EVYA 4HVVA 1X2QA 4LDXA 4AKHA 3U3IA 3H0FA 3AB3B 1I07A 2LRQA 4YJ2E 5CR2A 2O4XA 1WLXA 3P8BB 3L42A 4CZZB 2IC6A 3AEFA 4M77E 5AYFA 3I55T 4H9SE 3SOLA 1SA0E 4PK6A 5JDQA 2DD4A 3OYGA 2ECZA 3EHQA 4IIJE 3LDQB 4I43B 3ZT5A 1SEMA 2JXBA 4FYWB 2V1QA 2ZPBB 2DE0X 2KXDA 2EFIA 4AQGA 2WB5A 4B9WA 3ZSTA 1JNZA 2CHOA 1IXDA 1V1CA 2M1HA 1ZP0A 1LNXA 2M0YA 1KF6A 2VKHA 2DIGA 1YCSB 3CXCA 4FIBA 1KD1U 4I50E 2EIFA 5GANf 2UU9T 3FIFA 2RNAA 4F14A 5GAMf 5ABEA 1KC8C 1J3TA 4OHFA 1W4SA 2V6YA 4P5NA 3BFMA 2XQ6A 1HNZT 3TVTA 3J9X1 4U2YA 1TH7A 2LJ3A 2E9XB 1X6OA 2BZ8A 1PSEA 4IKFA 2VVKA 3LJCA 3ANWA 4IUVA 4UELA 1OEDB 1OV3A 3RR6A 3C94A 3M54A 4XTWA 3EFOA 4P0BA 3N9NA 4OYJA 2EAYA 2HKNA 5D7UA 3VS2A 3JB9G 2WSSV 2XQAA 1YIJQ 5DJQC 3TREA 3JAME 3O5ZA 2X0LB 2DLPA 3IHRA 1RI9A 2GK9A 1G5VA 2V5CA 4HFCA 1KQSA 2P9BA 5GAMh 5HYAA 2ZM8A 3OYXA 1QVPA 3QJ6A 3X28B 4X34A 1VIEA 1FYNA 3WI3A 3M59A 4BUGA 2RI2A 2XIDA 2W62A 3PUZF 2JQHA 3RRWA 2G6FX 2RB6A 2P84A 1VQKT 2FEIA 3HL8A 1U5SA 2OAWA 4OB2B 3UUMA 3E2UA 2NUZA 3PFSA 4JJBA 5LB7B 2K4YA 2RJEA 4PNOA 1X43A 4EYYR 1S94A 1O75A 1EZZB 2EJ9A 3PIOA 3C50A 2LSYA 4Z02A 2D0UA 1WR0A 2M67A 2B76A 4J9IA 9ATCB 2KRSA 2JQKA 2ZM6T 4ZOLE 2GCXA 2H7VC 4A97A 4B3RT 5FXXA 5EK2A 1N9RA 4HFDA 2FJAA 2I6HA 4QXHB 2LCSA 2Y4YA 2QEXA 3H0HA 1K9AA 2CRBA 2Y8DA 3TU4K 4PJOD 1ZEEA 3MP1A 4NUVA 2QTXA 1W0AA 4IE7A 2B86A 2AIRB 3OYYA 4DOVA 1E7OA 1AOJA 1GL5A 2DF6A 3AEGA 4PJJA 2KGTA 2J05A 1ACMB 5L2LA 4BAYB 4G2AA 5CKDA 2BVLA 4JJNK 3EH2A 1PNJA 4DR6T 4J6YA 4LF7T 2R57A 3H0IA 4RTYA 1YD8G 1K4US 3RMSA 2V6YB 3ETUA 1XZYA 4HKAA 4IHJE 1PD0A 1VQ9A 3A5ZB 1XNIA 2CLYC 5FMNA 4J7IA 2ATCB 4LUDA 3CCQT 1JJ2P 1YI2T 2Y4XA 3H9NA 1UTIA 4EIWA 2DTOA 3N5LA 1VRBA 2LRLA 4TNWA 4AQYT 2CZ7B 4XU3A 3JCMP 3OYKA 2KDSA 5GMKm 2XHEB 3O8VA 3JAFA 5TAOA 3P4PA
chains in the Genus database with same CATH topology
1MIWA 3VYHB 5GAN2 3HFNA 3G4SA 1P92A 1KQ2A 3C64A 3JCMW 4M75G 3N2KE 3OJAA 2HQXA 3H6ZA 3KDSE 2YHTA 3LW5E 3FHNA 3SWNA 4M7DB 3JB9H 5J2TE 3HRTA 5CKHA 5JDHA 4L59A 2RH2A 4E47A 4O8SA 3RKXA 3TCJA 1D3BB 5FU6C 2PVOB 2MWPA 5LA6E 3LLRA 5DM7R 2P0PA 2HBPA 1WR6A 3RESA 2VV5A 4TX5A 2XUEA 3NRXA 1B34B 4JRIA 3HRUA 3MACA 3OYZA 4OMFB 3CMAT 2ZCFB 3CMAA 2NP9A 2VWAA 5A0LA 1MMAA 2LTOA 2QQRA 4F7UF 1VOMA 3RMQA 2L89A 4O4JE 4F7UG 4AKGA 4C0DB 4ZHQE 4A56A 2M16A 1DJ7B 3JSCA 1K8AC 4BE0A 4BACA 1M4ZA 4DO0A 1H641 1MMDA 3AA0B 2JN0A 4HFVA 4FU6A 3MXZA 2RA2A 3L2WA 3Q5WA 5HK0A 2KSSA 3J7AF 2RI3A 2LT1A 4EAHA 4M78D 1JRIA 4ZS3A 4M7DC 2K3XA 2V7IA 1D1AA 3QO3A 3CCRA 3MZKB 2X4JA 3FJPA 3JRZA 5EK4A 1IZ6A 1FEWA 3OYMA 5KE2A 5GAN4 3G7ZA 4PFOA 3ZYMA 3O9XA 2BVMA 4N0AA 3OA6A 2DVEA 4KUDK 4MALA 3JB9I 4PJOC 3CC4T 1YITT 5ADXL 2KQWA 2W00A 2RHIA 3T8OA 3KV5A 3UT1A 3PNWC 4BE1A 5IN1A 4CXWA 1VIFA 2JQQA 4J2CA 1KC8U 3N9PA 4DNDA 1VQ6T 2Q9QB 3PT9A 1HF8A 3X26B 4BI8B 2JPFA 3ZEHA 5CA1E 2HAXA 2GF7A 1FWZA 2MWOA 1U1SA 3G6ET 3FB2A 3UDCA 1KK7A 3HI2A 3RIRA 3SD4A 2JMHA 4FT4A 1H3ZA 2LOPA 3QYGB 5GAMj 2LCCA 2VYTA 2NW9A 3JCMQ 3CPWA 5LG4A 4M7AF 3ZMTB 1U5PA 4QKNA 2VL8A 2X9XA 4HGAA 1BI1A 3HA4A 4M75D 4A4HA 4NL2A 1JB0E 2HD0A 4BJMA 3JCMb 2MF2A 2DZ9A 3BW1A 3OYHA 3EFRA 3E08A 3META 1IREB 3PDYA 4XTXA 3F70A 2VB6A 2LHNA 1OWAA 3N9OA 1KHCA 5KCOA 2VXFA 2V7MA 4R56A 4M77C 1KNZA 3DB4A 3HSBA 3HKCE 4VUBA 4AKLA 1HK9A 3HKSA 1OYXA 2BIVA 4X1KE 3O4XE 3CCST 3GNFB 2IG0A 4IURA 2QA7A 5D6XA 3C4ZA 2KINB 4RMOA 3L2QA 3QKJA 5L3FB 2PUKB 2EQKA 3I56A 4Z8XA 4BI4A 2Q9QC 4M75C 3M4GA 2CXFA 4H63H 2VC8A 3E9GA 5LJ5j 4HT9A 4KMCA 3JCMJ 2LDMA 5CK9A 3ZC0A 4BY6B 5D6YA 4O5VA 2MTQA 3MK7C 4KUIA 3EFSA 4WBOA 2Y48B 2DPPB 4DVDA 4ASKA 3BDLA 4XU0A 5JR9A 2QQ9A 2LSGA 4J5YA 5CAIA 2IAKA 4XQ3A 3BQLA 4L9IA 3UUNA 3CC7T 4MBQA 1GXIE 4CQIA 1MMGA 3P8DA 3AAAB 3OSVA 2N9DA 4QX8B 5J39A 4DMWA 1UEBA 3OW2A 2LEHA 1D3BA 4ATOA 3CC2T 3Q9DA 2O4XB 3G71A 4M7DA 5EZYE 1LVFA 2ODVA 3IEEA 4C8QA 2PFVA 3CCVA 5FRNA 4I4TE 4MHCA 4JRPA 2V7LA 3M56A 5LHGB 1B34A 3RERA 2LX9A 4K0UA 2BKDN 2ZLYA 4CRIA 4QQGA 3ZEFB 2ZM0A 4C0FA 2YLBA 4EMKA 1K9MU 3GIBA 2RJCA 2X4XA 4XK8E 4QX7B 3MEVA 2DXCA 2R5MA 2V1DB 3ZJ2A 2KWHA 3E22E 4PJNA 1K73C 5FROA 3OS5A 5FRMA 5AFUL 5BMVE 2G3RA 5HXCA 3LH0A 1HX8A 4EDUA 2J1DG 2PBIA 3ER0A 2VKOA 4ISTA 3KVBA 2DZCA 4H9NC 3GA8A 3JB9F 2YLCA 2XDPA 2RJDA 4M1PA 3AA6B 3JC6C 5JDNA 3C51A 3PU3A 4NL3A 1KD1C 4AQFC 4YLHA 5LJ5f 5DABA 3I9YA 2CEAA 4YHJA 3OB9A 2W61A 1ZQ1A 4I55E 1Q86U 2RHXA 5L3CB 2E1HA 1VQ9T 1S72T 3CPFA 1WJSA 1I8FA 4C5EA 3CD6T 5LJ5e 3VKHA 4GIWA 3OYBA 4QQ6A 3ONXA 4ZGEB 1UX5A 4JS4A 2D2SA 2L8KA 1QP3A 1HS7A 4C92G 5A0GA 3K3QC 2RHZA 2CCQA 1NJIC 1SSFA 3CCMT 1V9DA 4RCBA 1K8AU 3V8JA 5FU6B 2A3DA 2EHOB 2MBGA 2XTLA 3LK3B 2Q9QA 3RUXA 3NZPA 2DXBA 1M1GA 5DY9A 3FBLA 1YIJA 1VQ8A 3OSSC 2EWNA 3A8GB 5GANg 2HPLA 3AA1B 3CKDA 2QA4A 5E0OA 1VQMT 4HCCA 3CX6B 3LYIA 3KVAA 2CZ1B 4FJOA 2X9HA 2B8AA 4C5GA 5GAN7 1BR0A 4C5IA 4IE6A 3CEYA 1MNDA 3N2OA 4JLIA 3CCUT 4ISSA 3M58A 3G71T 2EKOA 3SB2A 3VHLA 4MMLA 2JTMA 2QXFA 4JEUB 4UF0B 1X01A 1HG5A 4NUUA 2DCFA 2K5BB 3SWNB 5HY6A 2JMKA 1LRZA 5FXZA 1QP2A 2KZ7B 4E7HA 3GPLA 3OQ5A 1NPRA 5LJ5d 3OYFA 2X4WA 4DMVA 1MIVA 3SDZA 3PTAA 3UUXB 2WAUA 1NE8A 5FXVA 3JCMX 1FMWA 4PJOB 3RC3A 4C0ZA 3HFOA 2OTLT 2RHUA 2KY9A 1WYBA 5FU7B 5H6QB 4X9CA 2X51A 3OKQA 5HWXA 3OS0A 3CCQA 3G6EA 3L2VA 3P8HA 1UGRB 3FLGA 2LNVA 2BDEA 2DI4A 3CC7A 5FY1A 3CXCS 2R5AA 4OYKA 4IUTA 4CXXA 3GN5A 4C90A 4M78G 3O1HA 3S6WA 4WW0A 4YJ3E 3C95A 2VKDA 2DLRA 3I1AA 2E41A 2P4TA 5JDMA 1Z0PA 1UGPB 3GP8A 1SHZC 2CZ6B 5CCAA 5JVDE 2E70A 4LDUA 4J8OA 2GQVA 4M7DG 3MJXA 2BUDA 1YJ9T 2W63A 1LKXA 3N5BB 3SWNC 4A4GA 3VU7H 4PLIA 3LGLA 4A4FA 1VQMA 1JBMA 3MCAB 1KG1A 4CI1B 1YJWA 5CVIA 3QSUA 5EG2A 4M7AD 1VQ4A 2DK3A 4TV8E 4M77G 1W2BA 5LBMA 5GAN6 1VQ7A 2DEQA 3RYFE 4UF0A 1Q7YC 3SS1A 2W0GA 1FIOA 2PVDB 3OBYA 4ZS2A 4C92A 4F6RC 4EMGA 5LJ3d 3LBXB 4MZPA 3KV9A 1RI0A 3ZFJA 1US7B 2XU8A 1YIJT 4ZI2D 4CI0C 2C5IT 2B1EA 1BYMA 4GLKA 4O2BE 2DXTA 5GONE 1V29B 3S3NA 3ZMVB 2QI2A 1X79A 3AVRA 3CVRA 5DQWA 2H3RA 1S35A 5DQVA 4ZI3C 3KUFA 1XTDA 2A3LA 3HKDE 2D0TA 4AKIA 5F8PA 1PSFA 5LYJE 1S72A 3LG7A 3RRCA 3PUGA 3B57A 5GMKi 2CS7A 2PQWA 2F5TX 3ZN1B 2XKOC 1OZ2A 1XOVA 4M77D 4M78B 3A8OB 4UVAB 5LL6S 3C98B 4IUQA 2QQAA 2RA1A 3EDUA 3X24B 1VQKA 4JEHB 4HEAA 1B7TA 4ZGJB 2E9XC 3OYJA 2KK4A 1M90U 3T9NA 4UV8B 3W15B 2MOZA 5CKEA 1UGQB 5LJ5h 2N2NA 4KULA 4GK5E 2KT9A 1K73U 3PUQA 4YFSA 2PJQA 4C8QD 2LHRA 3L3PA 4C92B 2C06A 4EYUA 2K9AA 3VKIA 5HXHA 3A8HB 2X68A 3PUAA 2LM9A 3RYHE 2SPCA 3R6OA 4IE5A 4X20E 1AJ3A 3AAIA 1D1CA 4MMKA 2H3JA 4TZ4C 4FM4B 4XU1A 4DBQA 5LHHB 2E9XA 4BA9A 1YI2A 2RO0A 3J81E 1N6AA 2R58A 2YRVA 4OP0A 5LJ3j 4PK4A 4O4HE 5JR9B 5GAN3 4C8QC 1M90C 2CWYA 2E12A 2E6NA 4HCZA 2CXLA 2VGNA 4PL6A 2K24A 2LSKA 2CGHA 2LSJA 4XZCA 3KBGA 3FXDB 3MP6A 3DLMA 3H37A 4C0DC 1T98A 5LHIB 3CCSA 5GANj 1BKBA 4O4LE 3F57A 5IYZE 5KX5E 3GWHA 2E64A 3A5XA 5GAOq 2PUOB 3S3OA 4LD9K 3P8CD 5FYMA 3FXEB 4L0RA 4H63V 3O1IA 1ZKEA 4ANJA 3E19A 3HL6A 3R84B 3JCMe 2ACXA 3QIIA 4YTLA 3DLLA 4C92C 2CZ0B 2E9XD 5HWYA 1H7CA 1FXXA 5GMKl 4AKRB 2C5JA 2CM0A 3PMIA 4NOYA 3HKBE 1LJOA 4EPCA 2VXEA 3HP9A 3M5AA 5DLQE 3OYDA 3GN5B 3JCMV 4M7AE 3CMET 4OK0A 2XI9A 2ZPIB 5LOVE 5JQGE 3QUJA 2IVWA 3UWNA 4MDXA 1YJNT 1FMVA 5IHYA 2L9QA 1YJNA 1VQ7T 2FHDA 2RHYA 4IDZA 4MZMA 2XAFB 1BI0A 5FY7A 4ZI7E 2KNDA 1NPPA 5JR9C 3CCVT 1G3SA 1D0YA 1BR1A 5F3JA 3PUSA 1W2BS 2ODUA 4RKUE 1BI3A 2PU9B 1BR4A 5CO7A 4IUPA 4QXCB 4ZN3A 3U78A 3FDRA 1BIAA 2X4YA 2EQUA 5LP6E 4BJNA 5GMKe 5CQYA 1M1KU 4BDZA 2ZGWA 1OXZA 1YKHB 4EMKC 4P0AA 2CE7A 5J3BA 1Q81U 3PIPA 2WMOA 2LSIA 2DTHA 3CCRT 3EUHA 3OMCA 2X35A 4JS5A 2G0UA 3BQIA 3OYIA 3JB9D 2KLQA 4P09A 4QWNB 3FEOA 2EHOA 2HH7A 4LDVA 3VU3C 5L3BB 3WVEB 2OTJA 3EAEA 3F31A 4KP3C 3P7IA 2YU2A 4M78A 2Y90A 5JREA 3UT5E 3KV4A 4Q5WA 3NZQA 4HCBA 5LNKA 4EZHA 3CWZB 2KMTA 2C0SA 2NWBA 3CC4A 4PFPA 2RK1A 1UB4A 3ZN0B 4R55A 2UXXB 2IW5B 2JJ9A 3RH3A 2DHRA 5LJNA 1QVFA 3WAKA 4ILUA 3CMEA 2RP4A 3CCET 3RYCE 2NW7A 3MO8A 3Q2MA 3ZC1A 3N9QA 5M9OA 3OBWA 4HA8A 2WACA 2CXDA 2NTYA 5CB4E 3FC3A 3I9WA 3CCJT 5LJ3e 2X67A 3ZYKA 2WBLA 4EMKB 4H9RC 2NTXA 4A4KA 2RM4A 5DLOA 2XAJB 2WSFE 1VQOT 4QXBB 2ZMAA 3HPWA 3G4ST 1VQ5T 1VQLA 1Y7XA 2YINA 3JCMc 2V8IA 3ASKA 1M5Q1 4HT8A 4QW2A 2EQMA 3N9MA 1N9SA 1JJ2S 4N0AC 2M9UA 1WYCA 3N9LA 2X9WA 4N4IA 1G3YA 3S3MA 3I55A 4RCCA 1N27A 4DA4A 3CCLA 2EJFA 2JNGA 2OA5A 2E5QA 5C8YE 2D6FA 3HRSA 5GAN5 1Y07A 1IZNB 4BD3A 4M75B 4MZTA 4H9PC 5KDMC 2FYKA 4HKEA 4C0GA 3V7CA 1OZ3A 3L2UA 2MAMA 4V2SA 1IAPA 5FLXE 4ZI2C 1MGQA 3CBMA 3J7Yq 2D0QB 2O01E 4A4EA 4TV9E 5KH6A 1Q82U 5GAMe 5JDFA 2ZPFB 3GOXA 3ZLIA 1NJIU 1MMNA 1ZBXA 4E7IA 4RG2A 2K57A 3PE0A 5FY0A 1G3WA 3INZA 3RX6A 1Q7YU 4PW8A 1LVKA 3CPWS 3QHSA 1YKEB 3KV6A 3OY9A 1WGSA 2H7OA 2VUBA 3OMGA 4ERRA 2F69A 2LJLA 4G63A 3CCJA 4GYRA 4XTUA 2RJFA 2LCLA 1G8XA 4KUMB 3DB3A 1MNEA 3QXEB 2XAHB 2XAGB 1VQOA 2NOXA 3UTKA 5LXTE 3OYEA 3QZ9B 3Q5XA 3V7RA 3PTRB 3VUZA 1HCIA 4FT2A 4OGCA 3ME9A 4EOZB 3CMLA 3M55A 5IT9E 5M4YA 1M8VA 3SFMA 1IJ6A 4U72A 4CXYA 1Q82C 4M7AB 2EJGA 3CQXC 3VKGA 2X66A 2BZBA 1M1KC 3RPUA 1RL2A 4JRKA 2I59A 3V8KA 2I2LA 3CCEA 1QVGS 2RK2A 2DKGA 4M78F 2QQSA 2ZPHB 4PK5A 3IBPA 5LGNB 2YK0A 3CPZA 4KBMB 4MLKA 3A8LB 5GAN8 2DTIA 3SWHA 3MKDA 3J80E 1JJ2A 2IC9A 4J6XA 3CD6A 4MFRA 4ADZA 4OB1B 3L1AA 3VJPA 2X9YA 2RD1A 3QYHB 4QVZA 2JTFA 1BR2A 2OAUA 3M65A 3V5SA 3QUIA 2WSCE 5GANh 5H6RB 3K3OA 4PJMA 1BI2A 2LT3A 3NBXX 3PGGA 2CMRA 5FU7C 3AA7B 5LCYA 2HNIA 2A2FX 2N1GA 3QPHA 3CCMA 5CKFA 4M77B 2LT4A 4V1Av 3ZCJA 1MIYA 4PJLA 2E6ZA 3LK2B 5C0MA 2VK9A 3GF5A 2XG8D 3CBPA 2FVUA 4ZN1A 2XICA 5JDGA 3KINB 3PU8A 4IGUA 2XK0A 4C8QF 4N4GA 4M75E 1FX7A 4D6WA 3TEEA 3UFEA 4F7UA 2JOYA 4M7AC 2CA5A 1VQ5A 1VQLT 5HKCA 2XDDA 2VKJA 2DJZA 4UIGA 4BY6C 1Y64B 2WM9A 3ZMSB 4DQ2A 1VUBA 4LD6A 4OVAA 5GAOr 3VV0A 4O6JA 3AAEB 2L3LA 5FXWA 3UPUA 3E9FA 5I2MA 2K2VA 5ETWA 1WQWA 3CX7B 3V5UA 3NTHA 4LDWA 3LX7A 5C6SA 5D6WA 1IJ5A 3LFMA 1WJQA 3CQCB 2JUFA 1QW1A 3C12A 4XTZA 4N4HA 5I2SA 3VYGA 3M57A 5LGUB 3DTOA 2GFUA 4EB6E 2EHOD 4BE2A 4M7DF 4XTVA 3ZMUB 4F7UE 3AHUA 5CQXA 5HXRA 2V7KA 4GOUA 1MHNA 4QQDA 2XD0A 4O2AE 4E7ZA 1ZHIA 4M75A 4C8QG 4IUUA 5GAOp 4H9OC 4ZTFA 4EXTA 2PG8A 2A7YA 3DKMA 4GY5A 2AHJB 4C8QE 4J83A 4M7DE 4UC4A 2WMNA 3URGA 1VQNA 3CQGB 4H9QC 3OYAA 4GK0E 1QVGA 5GAOn 4L6V5 5LJ5g 3BY7A 2KMFA 3ESLA 4CI3B 2F5KA 5HXEA 2WSEE 5HK3A 5LGTB 3BDUA 4M78C 1NAFA 4GYSA 4F7UB 3H8ZA 3MP8A 1WNLA 2WWUA 3NFCA 1YHQT 4PNIA 2QEXT 5CIUA 1HFAA 5FNVE 3OBVE 3GMIA 3RKYA 4PKCC 4ZTJA 4ME7A 1ZV4X 5LJ3g 3QG1A 4A54A 2XDBA 3B13A 1QSDA 1E1HB 5GAOl 1VQ4T 2MI6A 3I0OA 3QDRB 5L3DB 1VQ6A 4HE8A 4FL6A 1UX4A 2XHCA 3OYNA 3PMTA 3OS1A 3JC6D 5GANd 3E0ZA 4ELYC 3L2ZA 4JUVA 3GNGA 3HHTB 4KT0E 3E1SA 3HR0A 2E10A 3CCLT 1WJRA 1EIFA 5KMGP 2KAFA 1N8RU 3NTIA 1XQHA 3V7SA 1Y96A 4FI5A 4M7AA 1HG2A 4HTEA 3TKLB 3ZJ1A 5I21A 5CKBA 2MMPA 2K5LA 3HKEE 2V8KA 3IF8B 1OI1A 2V7JA 2PVGB 4JLGA 1I5LA 3SRZA 1AHJB 1VQ8T 5J2UE 4OB3B 3JCMg 1U8RA 3OYLA 2DD5A 4JRQA 1KHIA 3JB9J 3MEUA 4M7DD 3OS2A 2LQ8A 5HXSA 4C8QB 2QA4T 3M9QA 2ZPEB 2XQYA 4PJOG 2LVMA 4XAXB 4EMHA 3VUBA 3RKOA 3C4SA 2CLYB 4PJOE 2DWGA 3ZPOA 3NTKA 3LWIA 1N8RC 4B6XA 3O1JA 3CCUA 3JCMh 2DO3A 1CUNA 4JUYA 4JLEA 1QUUA 2GFAA 2QQBA 4M77A 4B9XA 4C91A 2Y6XA 4TN7B 1NZ9A 1VQPA 5J26A 3X25B 4OFZA 5A0DA 5GANe 4PAGA 2NLUA 3MHXA 4UV9B 5LJ3h 2V26A 1D0ZA 4Y91A 4ZGDB 5L8RE 3F2EA 5A1LA 3M4YA 4AXPA 5JRCB 3LWHA 1M1FA 2QDYB 4IE4A 3K8PC 3CBOA 4WF2A 2M0OA 5GMKh 2L3RA 5GAMd 1QVFS 4XU2A 1WPYA 2K5IA 3KXTA 2FL7A 3S4UA 5GMKj 5IAYA 1VQNT 5GAOm 1U4QA 4U74A 4L5GA 4O4IE 4J7FA 3QBYA 2FB7A 3ZBDA 5LJMA 1NWMX 2K5FA 3GLXA 2V8JA 3C4WA 4DBRA 4UXNB 3OYCA 4PJOA 3LBXA 3FRNA 2P0QA 3BK9A 3V8LA 4II1A 4HN9A 3Q1JA 3QZ5B 1Q86C 1YHQA 3FB9A 3QC9A 2Q9QD 4XTYA 3RC8A 5LJ3f 2UXNB 2KXPB 3LGFA 2CWOA 1O3XA 3L09A 4JDSA 4M7AG 1UGSB 3K3NA 1ZHCA 4Y28E 1D0XA 2DAQA 2LC4A 3KBUA 4AQFA 4BDYA 2C5KT 1G3TA 3RYIE 5JH7E 4J6WA 4QVCA 2HQEA 3A8MB 4ZI3D 1G73A 3LK42 4TUYE 3ZMZB 3MEWA 1Y71A 4E7LA 3BQKA 2NW8A 1KQSS 5FP3A 2DNXA 3PURA 1M9SA 5EK3A 3ZYLA 4N78D 2K48A 2OTLA 3C4XA 1BIBA 4UVCB 3CX8B 1WQ7A 3RKWA 4C92E 3QK6A 4ELZC 3D0TA 3DJBA 1I4K1 1R8OB 3I56T 5L3EB 2ZZDA 2EYQA 1HXDA 1VQPT 3EDVA 2ES0A 3H3AA 2KWIB 4UVBB 5JDLA 1O9SA 3KBTA 3WXMB 4BB7A 1EZ3A 1HTJF 3R6NA 4EZ4A 2XAQB 5A2QE 3FBZA 2KVQG 2MYSA 4X9DA 1YCYA 5J1GA 1YW0A 4TVRA 4E7JA 4OB0B 5KCHA 4WBNE 2JZ2A 1X75C 2ZPGB 4C5HA 5CA0E 2LE8A 2E8IA 3X20B 1YBYA 3UULA 1Y96B 2OTJT 4BI3A 3L2RA 2E65A 1Q81C 2ZM2A 2DIQA 4C92F 3MA9A 4IE0A 3CC2A 3WVDB 4MDWA 3OW2S 4NS5A 5L3GB 2VASA 3KFWX 4X1YE 2EHOC 2CKKA 2XASB 4A53A 4M77F 3N2GE 5KE3A 5HAXA 2K3YA 2YEVC 4WNKA 1YJ9A 1I81A 1YITA 1K9MC 2L5QA 4XBFB 3ZCIA 4FSXA 2HPJA 1WRDA 3DP7A 4M75F 2Z6EA 3QJYA 4DOWA 5GAMg 1KQ1A 4X1IE 2EQJA 1D1BA 4C92D 3MEAA 3NRYA 4UEMA 4QHOA 4PLLA 3ANWB 4RG8A 4OF1A 1UCUA 4E7KA 3ETVA 4M78E 2D5UA 2L8DA 2DWKA 3AVSA 2DXUA 3JCMf 4E7SA 1YJWT 2QGSA 3JCMd 2P0KA 4LDYA 1U1TA 2D9TA 2CYZB 4CI2B 1LOJA 5LBQB 4OGEA 2RI5A 2A72A 4PJOF 3M53A 2LOSA 2YU1A 2LQKA 2VGMA 3I0QA 4AI6A 3WAJA 5JRCA 4QVDA 2JRKA 2JVVA 3EVYA 4LDXA 4AKHA 3U3IA 3AB3B 2LRQA 4YJ2E 5CR2A 2O4XA 1WLXA 3P8BB 3L42A 4CZZB 2IC6A 4M77E 5AYFA 3I55T 4H9SE 3SOLA 1SA0E 4PK6A 5JDQA 2DD4A 3OYGA 4IIJE 4I43B 2ZPBB 2EFIA 4AQGA 4B9WA 2M1HA 1LNXA 2VKHA 2DIGA 3CXCA 4FIBA 1KD1U 4I50E 2EIFA 5GANf 3FIFA 5GAMf 1KC8C 4OHFA 1W4SA 4P5NA 3BFMA 3J9X1 1TH7A 2E9XB 1X6OA 4IKFA 1PSEA 3LJCA 3ANWA 4IUVA 4UELA 3C94A 3M54A 4XTWA 4P0BA 3N9NA 4OYJA 2EAYA 3JB9G 2WSSV 5DJQC 3TREA 3JAME 2X0LB 3IHRA 2GK9A 1G5VA 1KQSA 2P9BA 5GAMh 5HYAA 2ZM8A 3OYXA 1QVPA 3QJ6A 3X28B 4X34A 1VIEA 3M59A 3WI3A 4BUGA 2RI2A 2XIDA 2W62A 3RRWA 2RB6A 1VQKT 3HL8A 4OB2B 3UUMA 3PFSA 2K4YA 2RJEA 4PNOA 4EYYR 1S94A 1O75A 3PIOA 2EJ9A 3C50A 2LSYA 4Z02A 2D0UA 2M67A 4ZOLE 2GCXA 2H7VC 5FXXA 1N9RA 5EK2A 4QXHB 2Y4YA 2QEXA 2Y8DA 3TU4K 4PJOD 1ZEEA 3MP1A 4NUVA 2QTXA 4IE7A 4DOVA 3OYYA 4PJJA 5L2LA 4BAYB 4G2AA 5CKDA 2BVLA 4JJNK 4J6YA 2R57A 1YD8G 3RMSA 3ETUA 4HKAA 4IHJE 1VQ9A 3A5ZB 1XNIA 2CLYC 5FMNA 4J7IA 3CCQT 1YI2T 2Y4XA 4EIWA 2DTOA 3N5LA 1VRBA 3JCMP 2CZ7B 4XU3A 3OYKA 2KDSA 5GMKm 2XHEB 3O8VA 5TAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFR A;  2LT3 A;  2LQK A;  2LT4 A;  4KMC A;  2LT1 A;  4KBM B;  2EYQ A;  4L5G A;  4XAX B;  4ILU A; 
#chains in the Genus database with same CATH topology
 3AEB A;  1MIW A;  1VCT A;  1ZBJ A;  4RTX A;  3VYH B;  5GAN 2;  3HFN A;  1I94 T;  1H3H A;  3G4S A;  1P92 A;  1KQ2 A;  3C64 A;  4DV1 T;  3JCM W;  4M75 G;  2KYM A;  1JU5 C;  3N2K E;  3OJA A;  2HQX A;  2E3I A;  3H6Z A;  3KDS E;  2YHT A;  4EV6 A;  4IDP A;  3LW5 E;  3CME Q;  1KIK A;  1IBK T;  3FHN A;  3SWN A;  1QCF A;  4M7D B;  4KGV B;  3JB9 H;  5J2T E;  2NYS A;  8AT1 B;  3HRT A;  5CKH A;  3G71 Q;  5JDH A;  5HCJ A;  4L59 A;  2RH2 A;  2CRE A;  4E47 A;  2L3P A;  3EG9 B;  4O8S A;  4JJC A;  3RKX A;  3TCJ A;  1D3B B;  5FU6 C;  1RAC B;  1PCX A;  1KQS P;  2PVO B;  2MWP A;  5LA6 E;  5IHN A;  3LLR A;  5DM7 R;  3RGL A;  2P0P A;  2HBP A;  3I5S A;  1OPK A;  2L0A A;  1WR6 A;  3RES A;  2VV5 A;  4TX5 A;  2XUE A;  3NRX A;  1B34 B;  4JRI A;  3HRU A;  3MAC A;  3OYZ A;  1OX9 A;  4OMF B;  3CMA T;  2ZCF B;  3CMA A;  2LM2 A;  1Q81 R;  2BZX A;  2DL1 A;  2NP9 A;  3EG1 A;  3RIU A;  2XZE A;  2D8H A;  4ESR A;  2VWA A;  5A0L A;  4LMJ A;  4OML A;  1MMA A;  5ABF A;  1M3C A;  2LTO A;  3TQ7 P;  3UU4 A;  1NYF A;  1UHC A;  3AXJ A;  2QQR A;  4F7U F;  1VOM A;  3RMQ A;  2L89 A;  2H88 A;  4O4J E;  2LZ6 B;  4F7U G;  4AKG A;  2H89 A;  4C0D B;  4ZHQ E;  4A56 A;  1ABO A;  2M16 A;  1DJ7 B;  3JSC A;  1K8A C;  2GQI A;  4BE0 A;  4BAC A;  1M4Z A;  4DO0 A;  1H64 1;  2JMA A;  1MMD A;  3AA0 B;  2JN0 A;  4HFV A;  4FU6 A;  3MXZ A;  1UUR A;  2RA2 A;  3Q5W A;  5HK0 A;  3L2W A;  2KSS A;  1QKW A;  3I56 Q;  3J7A F;  2RI3 A;  2LT1 A;  4EAH A;  1OX8 A;  4M78 D;  2BZY A;  1JRI A;  3RIA A;  1KJW A;  4ZS3 A;  2A37 A;  4M7D C;  2K3X A;  2YWW A;  3T1H T;  2V7I A;  1D1A A;  2WU5 A;  1WLP B;  3QO3 A;  1XJW B;  2WQY A;  3CCR A;  3MZK B;  2X4J A;  3FJP A;  4CC3 A;  3JRZ A;  5EK4 A;  1IZ6 A;  4R0K A;  1FEW A;  3RIU C;  3EG9 A;  3OYM A;  5KE2 A;  5GAN 4;  3G7Z A;  4PFO A;  3ZYM A;  1YJW Q;  3O9X A;  2BVM A;  4N0A A;  2EGE A;  2DVE A;  3OA6 A;  3TLS A;  4KUD K;  4MAL A;  5AQK B;  3JB9 I;  4PJO C;  3CC4 T;  4DR1 T;  1YIT T;  5ADX L;  2BBJ A;  4LMK A;  2KQW A;  3VRY A;  2W00 A;  2RHI A;  4RTT A;  5I11 A;  3T8O A;  3KV5 A;  2MAW A;  2RPN A;  1ZLM A;  3UT1 A;  2D1X A;  2LMJ A;  1NJI R;  1E6G A;  3PNW C;  4BE1 A;  5IN1 A;  4CXW A;  3EG0 A;  1VIF A;  1W2B P;  2JQQ A;  4J2C A;  4DV7 T;  1TUG B;  1XDO A;  3N9P A;  2JS0 A;  1KC8 U;  2FJD A;  4DND A;  1VQ6 T;  2UUA T;  2Q9Q B;  3PT9 A;  4LUE A;  1W9R A;  1HF8 A;  3X26 B;  1OU8 A;  5F5W A;  5ABF B;  4BI8 B;  2JPF A;  1PD1 A;  5CA1 E;  3ZEH A;  1QMC A;  1K1Z A;  2GF7 A;  2BTT A;  2HAX A;  1FWZ A;  3EFO B;  2MWO A;  1U1S A;  3G6E T;  3FB2 A;  3UDC A;  1KK7 A;  3CCR Q;  3HI2 A;  3RIR A;  3SD4 A;  2JMH A;  4FT4 A;  1H3Z A;  2IUB A;  2LOP A;  3QYG B;  4LFC T;  5GAM j;  2LCC A;  2VYT A;  2NW9 A;  3JCM Q;  3CCJ Q;  1WA7 A;  2WZH A;  3CPW A;  5LG4 A;  4M7A F;  3ZMT B;  1U5P A;  1YI2 Q;  4QKN A;  2E5V A;  2VL8 A;  2XQ4 A;  3AXJ B;  2X9X A;  4HGA A;  1BI1 A;  5AQT B;  3HA4 A;  4JZ4 A;  4M75 D;  4A4H A;  1ZSZ B;  3TSZ A;  5IWA T;  4NL2 A;  1JB0 E;  2FPD A;  2O88 A;  4E6R A;  4LF6 T;  2QRX A;  2DA9 A;  2HD0 A;  4BJM A;  3VS7 A;  3JCM b;  2MF2 A;  2F1L A;  2LRK A;  1WZO A;  2DZ9 A;  3BW1 A;  3EFR A;  3OYH A;  4Z90 A;  2X3X D;  1UUE A;  3E08 A;  3AEA A;  3M0U A;  1AZG B;  3MET A;  1IRE B;  3PDY A;  3GBQ A;  4XTX A;  3F70 A;  2VB6 A;  3G06 A;  4YXD A;  1RLQ C;  5AQP B;  2HL3 A;  2LHN A;  1OWA A;  1TXQ A;  3N9O A;  2FZC B;  1KHC A;  5KCO A;  2VXF A;  2V7M A;  4R56 A;  1E2A A;  2XQ7 A;  2KR3 A;  2EQI A;  4M77 C;  1SPK A;  1KNZ A;  3DB4 A;  1HD3 A;  3HSB A;  3HKC E;  4VUB A;  5LMN T;  4AKL A;  1HK9 A;  2VL0 A;  3HKS A;  1OYX A;  2BIV A;  4X1K E;  3O4X E;  2LP5 A;  1QVF P;  3CCS T;  3NWI A;  3GNF B;  4OMQ A;  2IG0 A;  4IUR A;  5KYX B;  4YTM A;  3JCF A;  3VRA A;  1M2V B;  2QA7 A;  4X1V A;  5D6X A;  1XMO T;  3C4Z A;  2EGA A;  2KIN B;  4RMO A;  3L2Q A;  3QKJ A;  5L3F B;  2PUK B;  2EQK A;  2SEM A;  2FBW A;  3I56 A;  3OPC A;  4Z8X A;  4BI4 A;  2Q9Q C;  4M75 C;  3M4G A;  2CXF A;  4H63 H;  5I22 A;  2VC8 A;  3E9G A;  5LJ5 j;  4HT9 A;  4AT1 B;  4KMC A;  1T0H A;  1TUD A;  3JCM J;  2LDM A;  5CK9 A;  2PTF A;  3ZC0 A;  5FVK A;  4ZNX A;  4BY6 B;  1N5Z A;  5KYN A;  5D6Y A;  2HSP A;  4O5V A;  2MTQ A;  3MK7 C;  4KUI A;  3P4S A;  3EFS A;  4WBO A;  1CHU A;  3VRZ A;  2Y48 B;  2EBP A;  1R8I A;  3AE7 A;  3JAD A;  1G2B A;  4DVD A;  2DPP B;  4ASK A;  2DET A;  3AE9 A;  2RQV A;  1OOT A;  2HEQ A;  4X5T A;  3OW2 P;  3PV0 F;  3BDL A;  4XU0 A;  5JR9 A;  2A36 A;  2QQ9 A;  3UU3 A;  3NMZ C;  2LSG A;  4J5Y A;  2J6K A;  5CAI A;  2IAK A;  4ZZB A;  4XQ3 A;  3BQL A;  4L9I A;  3UUN A;  4AG1 C;  5L23 A;  3CC7 T;  1AWO A;  4Y92 A;  4MBQ A;  2EVR A;  1GXI E;  3AE8 A;  4CQI A;  2HMA A;  1KEY A;  1MMG A;  3P8D A;  3AAA B;  3OSV A;  1PRL C;  1U06 A;  1RLP C;  2N9D A;  3VRB A;  4QX8 B;  1N8R R;  5J39 A;  4KGZ B;  3REA B;  3VR8 A;  3ONL C;  4DMW A;  1UEB A;  2CP2 A;  3OW2 A;  1D3B A;  2LEH A;  4ATO A;  2EYZ A;  1Q7Y R;  3CC2 T;  2DMO A;  3Q9D A;  3M0S A;  2O4X B;  3G71 A;  4M7D A;  5EZY E;  1LVF A;  2BG9 A;  2ODV A;  3IEE A;  2PFV A;  2DM1 A;  4C8Q A;  3CCV A;  3UQ4 A;  2D9D A;  4TWH A;  5FRN A;  1YJN Q;  4I4T E;  4MHC A;  4JRP A;  2V7L A;  3M56 A;  1B34 A;  5LHG B;  1WFD A;  3RER A;  4F17 A;  2LX9 A;  4K0U A;  2BKD N;  2ZLY A;  3M0Q A;  1IHW A;  3P4Q A;  4CRI A;  4QQG A;  4HFB A;  3ZEF B;  2ZM0 A;  1M1K R;  4C0F A;  2YLB A;  4EMK A;  1WCR A;  1K9M U;  1N33 T;  3GIB A;  5AQJ B;  2MCN A;  1TS9 A;  2RJC A;  2X4X A;  4HWC A;  4XK8 E;  2BKP A;  4QX7 B;  3RLF F;  3MEV A;  2XM1 A;  3QNU A;  1WX6 A;  4CN4 A;  2DXC A;  2R5M A;  2V1D B;  3ZJ2 A;  4WTO B;  1KNR A;  2RQR A;  4KX6 A;  3OTO T;  2KWH A;  3E22 E;  2OLT A;  4PJN A;  1WHL A;  3OS5 A;  2EKH A;  5FRO A;  2EYX A;  1K73 C;  5FRM A;  5AFU L;  5BMV E;  2G3R A;  5HXC A;  1HYO A;  3LH0 A;  1R0C B;  1HX8 A;  4EDU A;  1Y0M A;  2J1D G;  1T0J A;  2PBI A;  3AE6 A;  2PZ1 A;  2VKO A;  4IST A;  1T7S A;  3KVB A;  5ABH A;  3ER0 A;  2MOX A;  4FSS A;  1QLB A;  1PRM C;  2DZC A;  1Q86 R;  3ZL7 C;  4H9N C;  3EH1 A;  2BS3 A;  3GA8 A;  1HR0 T;  2YLC A;  3JB9 F;  1AZE A;  2XDP A;  2RMO A;  1JXM A;  2RJD A;  1QCN A;  4M1P A;  5IH2 A;  3AA6 B;  2XQ3 A;  3JC6 C;  5JDN A;  2CSQ A;  3C51 A;  4JPB W;  3PU3 A;  3D7S B;  4NL3 A;  4AIU A;  1YWP A;  2UXD T;  1KD1 C;  4AQF C;  4YLH A;  1QKX A;  4JJD A;  5DAB A;  5LJ5 f;  2QEX Q;  3I9Y A;  2CEA A;  4YHJ A;  3OB9 A;  2W61 A;  1ZQ1 A;  1VQM Q;  1A0N B;  2QA4 Q;  4I55 E;  4HVW A;  1WHK A;  4TWD A;  1Q86 U;  2RHX A;  5L3C B;  2E1H A;  1VQ9 T;  1S72 T;  2F4V T;  3CPF A;  1WJS A;  2F2X A;  4AFQ C;  1I8F A;  2E4H A;  4C5E A;  3CD6 T;  5LJ5 e;  3CPW P;  3VKH A;  4GIW A;  1VQ8 Q;  2DJQ A;  2X0Y A;  3OYB A;  4QQ6 A;  3ONX A;  1TUC A;  4ZGE B;  1J5W A;  2J6F A;  1UX5 A;  1ZA2 B;  4JS4 A;  2BG9 B;  2D2S A;  2L8K A;  1QP3 A;  1HS7 A;  2IPO B;  4C92 G;  5A0G A;  3K3Q C;  2RHZ A;  3UUB A;  2CCQ A;  2YUN A;  1NJI C;  1M30 A;  1SSF A;  3CCM T;  1V9D A;  4RCB A;  1K8A U;  3V8J A;  5FU6 B;  2A3D A;  2A9U A;  2EHO B;  2MBG A;  2XTL A;  3LK3 B;  4DUZ T;  3AEC A;  2Q9Q A;  3RUX A;  5FWC A;  3NZP A;  3NGP A;  2DXB A;  4J9H A;  1M1G A;  3PUV F;  5DY9 A;  3FBL A;  2DX1 A;  1Q95 G;  1YIJ A;  1VQ8 A;  3G6E Q;  3OSS C;  1NBE B;  2XQ8 A;  2EWN A;  3A8G B;  5GAN g;  2HPL A;  4ILC A;  3AA1 B;  2GNC A;  3CKD A;  1W0B A;  2QA4 A;  5E0O A;  1VQM T;  4DV2 T;  4HCC A;  1IGQ A;  3PVL A;  2AZS A;  3CX6 B;  3LYI A;  4IRE A;  2IIM A;  3KVA A;  2CZ1 B;  4FJO A;  2X9H A;  2B8A A;  4C5G A;  5GAN 7;  1BR0 A;  4C5I A;  4IE6 A;  3CEY A;  1MND A;  2CBI A;  2XJ7 A;  3N2O A;  3QDF A;  1M27 C;  3FJ5 A;  1T72 A;  4JLI A;  3CCU T;  4ISS A;  3M58 A;  3G71 T;  2EKO A;  3SB2 A;  3VHL A;  2W2U A;  2JTM A;  4MML A;  2QXF A;  4JEU B;  4EEB A;  1AVZ C;  4GKJ T;  2DL3 A;  2JS2 A;  1YQ4 A;  4RTZ A;  1TWB A;  4UF0 B;  1X01 A;  4HVU A;  2V6X A;  1HG5 A;  4NUU A;  2DCF A;  1AWX A;  4HFE A;  2K5B B;  3SWN B;  1SHF A;  5HY6 A;  2JMK A;  1LRZ A;  5FXZ A;  5AQF B;  4U7Y A;  1QP2 A;  2KZ7 B;  4I0U A;  4OX9 T;  4E7H A;  2O9V A;  3OQ5 A;  1NPR A;  5LJ5 d;  3GPL A;  3OYF A;  2X4W A;  4DMV A;  1MIV A;  3SDZ A;  1D09 B;  3PTA A;  5FKY A;  3UUX B;  2WAU A;  1IBL T;  2FJE A;  4CN6 A;  1NE8 A;  5FXV A;  3JCM X;  1FMW A;  1K73 R;  4PFZ A;  4PJO B;  3RC3 A;  4QT7 A;  4C0Z A;  3HFO A;  2OTL T;  2RHU A;  1CSK A;  1XWM A;  1WYB A;  2KY9 A;  5FU7 B;  5H6Q B;  1UJ0 A;  4X9C A;  2X51 A;  4CC7 A;  1VYV A;  3OKQ A;  5HWX A;  3OS0 A;  3CCQ A;  3G6E A;  3L2V A;  3P8H A;  2RPA A;  1UGR B;  3FLG A;  1MUZ A;  2AT1 B;  2BDE A;  2LNV A;  2DI4 A;  3CC7 A;  5FY1 A;  1NEK A;  6AT1 B;  3CXC S;  2R5A A;  4OYK A;  2X0H A;  4IUT A;  2COY A;  5FL0 A;  4CXX A;  3GN5 A;  3JAE A;  2OTL Q;  3REB B;  4C90 A;  2QGG A;  3O1H A;  1I0C A;  4M78 G;  3TLW A;  2CH4 A;  3S6W A;  4JI8 T;  4WW0 A;  3RF1 A;  4YJ3 E;  2LJ0 A;  3PUW F;  2VKD A;  3C95 A;  2DLR A;  3I1A A;  1RAE B;  2D8J A;  3AT1 B;  2E41 A;  4IDN A;  2P4T A;  5JDM A;  1Z0P A;  1MV0 B;  1UGP B;  1X2K A;  2NR4 A;  3GP8 A;  4AMC A;  1VCS A;  2ESW A;  2PTK A;  1SHZ C;  1AWJ A;  2CZ6 B;  5CCA A;  5JVD E;  2E70 A;  4LDU A;  4J8O A;  2GQV A;  4M7D G;  3MJX A;  4JZ3 A;  2BUD A;  2FRY A;  2W63 A;  1YJ9 T;  1LKX A;  3N5B B;  5FL1 A;  2IIU A;  2XM2 A;  3SWN C;  4E2F B;  4A4G A;  1M90 R;  3VU7 H;  4PLI A;  3LGL A;  1ZUY A;  2YSQ A;  1JBM A;  4CN1 A;  4A4F A;  2KSR A;  2COW A;  3MCA B;  4AFU C;  1KG1 A;  4FYX B;  3EGD A;  2LKH A;  4JI7 T;  5HEU A;  4YTP A;  4CI1 B;  1YJW A;  5CVI A;  3QSU A;  5EG2 A;  2CT3 A;  4M7A D;  3I9Q A;  1VQ4 A;  2DK3 A;  4TV8 E;  4M77 G;  1W2B A;  5LBM A;  5GAN 6;  1VQ7 A;  5FVL A;  2DEQ A;  3RYF E;  4UF0 A;  4D8K A;  1Q7Y C;  3SS1 A;  1JXO A;  2VKN A;  2W0G A;  1FIO A;  2PVD B;  2W10 A;  4ZS2 A;  3OBY A;  5GJV B;  4C92 A;  3CC2 Q;  4F6R C;  3EG2 A;  1OED E;  5LJ3 d;  4EMG A;  3LBX B;  2SRC A;  4MZP A;  2CP0 A;  4ZZC A;  1VYU A;  3KV9 A;  2V8S V;  1RI0 A;  3ZFJ A;  1US7 B;  2XU8 A;  1YIJ T;  4ZI2 D;  4YSZ A;  4CI0 C;  2C5I T;  4LF5 T;  2VQE T;  2B1E A;  1JNR A;  1BYM A;  1SG5 A;  2EYW A;  2YUP A;  4O2B E;  4GLK A;  2DXT A;  5GON E;  1V29 B;  3S3N A;  4JI1 T;  1JQQ A;  1UDL A;  4Z88 A;  1GRI A;  4IL4 A;  3ZMV B;  2EGC A;  2QI2 A;  4LML A;  1X79 A;  3AVR A;  5AT1 B;  3CVR A;  4JV5 T;  5DQW A;  2YT6 A;  2DNU A;  2H3R A;  5AQO B;  1S35 A;  5DQV A;  4ZI3 C;  1UJY A;  2JW4 A;  2YDQ A;  5AQL B;  3KUF A;  1OPL A;  1XTD A;  5KXJ A;  2MPX C;  2OI3 A;  2A3L A;  5CGM A;  2DL7 A;  2CP5 A;  5ABG A;  3HKD E;  2OV9 A;  2D0T A;  4AKI A;  5F8P A;  3ZKR A;  1PSF A;  2RN8 A;  3UF4 A;  5LYJ E;  2YN6 A;  1S72 A;  3LG7 A;  3RRC A;  3PUG A;  2LX7 A;  3B57 A;  4DR4 T;  2UUC T;  2QAS A;  2CS7 A;  3NHN A;  2PQW A;  5GMK i;  3TLV A;  2F5T X;  3ZN1 B;  2XKO C;  1OZ2 A;  1MV3 A;  1XOV A;  4M77 D;  4M78 B;  4U2Z A;  2JMC A;  3A8O B;  4ORZ A;  4UVA B;  5LL6 S;  3C98 B;  3UQ7 A;  1CKA A;  4IUQ A;  2QQA A;  2RA1 A;  3EDU A;  3X24 B;  3JV3 A;  1VQK A;  4KHP T;  4JEH B;  1WI7 A;  4HEA A;  1VYT A;  2AE9 A;  1B7T A;  4ZGJ B;  2E9X C;  3OYJ A;  4FW2 A;  2KK4 A;  1M90 U;  5KYW B;  3T9N A;  4UV8 B;  3W15 B;  2MOZ A;  3NKZ A;  4U31 A;  5CKE A;  2DER A;  4LXC A;  1UGQ B;  2FPE A;  5LJ5 h;  2N2N A;  3OVU A;  4KUL A;  2C0T A;  1PHT A;  3L8R A;  4GK5 E;  1YHQ Q;  2KT9 A;  3FZF B;  4IIO A;  1K73 U;  1WFW A;  3PUQ A;  3PVQ A;  3Q5D A;  4YFS A;  2PJQ A;  4C8Q D;  4JI2 T;  2LHR A;  3L3P A;  4C92 B;  2C06 A;  4EYU A;  1OQK A;  5KYX A;  2K9A A;  3A7M A;  1YFN A;  5HXH A;  2E3H A;  3VKI A;  3A8H B;  2X68 A;  3PUA A;  2LM9 A;  1TOV A;  3RYH E;  2SPC A;  3R6O A;  4IE5 A;  1AJ3 A;  4X20 E;  4B3M T;  3AAI A;  1D1C A;  4X66 T;  4B3S T;  2J47 A;  2H3J A;  4MMK A;  4TZ4 C;  4FM4 B;  4XU1 A;  4DBQ A;  5LHH B;  2E9X A;  1ZOY A;  2WY2 A;  4BA9 A;  1YI2 A;  1OED A;  3ULR B;  2JM8 A;  2DL5 A;  2RO0 A;  5FWB A;  1B07 A;  3J81 E;  1N6A A;  2R58 A;  2YRV A;  4GLM A;  4OP0 A;  5LJ3 j;  4PK4 A;  4AFS C;  4O4H E;  4JI0 T;  1VQO Q;  3RQU A;  5JR9 B;  5GAN 3;  3FZK B;  2R6G F;  4C8Q C;  1AEY A;  1M90 C;  2KRN A;  2CWY A;  2E12 A;  2E6N A;  5KYW A;  4HCZ A;  2CXL A;  2WDV A;  1ZSZ C;  2VGN A;  4PL6 A;  2K24 A;  2LSK A;  2CGH A;  2LSJ A;  4XZC A;  3KBG A;  3FXD B;  3MP6 A;  3DLM A;  3H37 A;  5AQV B;  4C0D C;  1T98 A;  5LHI B;  3CCS A;  2KBT A;  5GAN j;  2L3Q A;  1BKB A;  4O4L E;  3F57 A;  5IYZ E;  5KX5 E;  3GWH A;  2E64 A;  3A5X A;  5KYY A;  5GAO q;  2PUO B;  5L47 A;  3FZH B;  2J6O A;  3S3O A;  1IBM T;  1W6X A;  4LD9 K;  8ATC B;  3CC4 Q;  3VS6 A;  1K8A R;  3P8C D;  5FYM A;  3NPF A;  4A5X A;  3RHW A;  3CCE Q;  3FXE B;  4Z91 A;  4L0R A;  2WDQ A;  2YUO A;  3EG3 A;  2UXC T;  2HCK A;  3B5M A;  2JTE A;  4H63 V;  1WHJ A;  3I5R A;  3O1I A;  1KFY A;  1ZKE A;  4QKU A;  2BS4 A;  4ANJ A;  3E19 A;  3VS5 A;  3HL6 A;  3R84 B;  3UU8 A;  4RUG A;  1VQM A;  4DV5 T;  3JCM e;  2ACX A;  3AE3 A;  3QII A;  4YTL A;  3DLL A;  1X6B A;  2AZV A;  4C92 C;  2CZ0 B;  2E9X D;  2IHR 1;  1H7C A;  5HWY A;  1FXX A;  4KGX B;  1SE7 A;  5GMK l;  4AKR B;  1RAG B;  2C5J A;  2YXY A;  2CM0 A;  3A8Y C;  4HFI A;  3PMI A;  4NOY A;  5LMU T;  3HKB E;  1LJO A;  4EPC A;  4YHH T;  2VXE A;  3HP9 A;  2CP3 A;  3M5A A;  5DLQ E;  3OYD A;  2ABL A;  1Q82 R;  1PKS A;  4D8D A;  2JIW A;  3GN5 B;  3JCM V;  1VQP Q;  4M7A E;  3CME T;  4TNV A;  4OK0 A;  2M6I A;  5C2T A;  1IO6 A;  2XI9 A;  4HCK A;  2ZPI B;  5LOV E;  5JQG E;  3QUJ A;  1C1A A;  2IVW A;  1M62 A;  4Z8A A;  1FMV A;  5IHY A;  2L9Q A;  3UWN A;  1YJN T;  2HSE B;  1YJN A;  1VQ7 T;  4DR5 T;  3RBB B;  2DBK A;  4FYY B;  4KI0 F;  1PC0 A;  2FHD A;  2RHY A;  4IDZ A;  4MZM A;  4EED A;  1HNW T;  2XAF B;  1BI0 A;  5FY7 A;  4AFZ C;  4ZI7 E;  2KND A;  1NPP A;  2ROT A;  5JR9 C;  4ILB A;  2J62 A;  5KYY B;  3CCV T;  1G3S A;  1D0Y A;  1YNZ A;  1BR1 A;  5F3J A;  3PUS A;  1W2B S;  2BG9 E;  2ODU A;  3VS0 A;  2KEA A;  4RKU E;  2MIO A;  1BI3 A;  5IUX A;  4HWF A;  5AQG B;  2PU9 B;  1BR4 A;  5CO7 A;  4IUP A;  4QXC B;  4ZN3 A;  3U78 A;  4JYA T;  3FDR A;  1GQE A;  1BIA A;  2X4Y A;  2LKG A;  2EQU A;  5LP6 E;  4BJN A;  5GMK e;  5CQY A;  1M1K U;  4BDZ A;  2ZGW A;  4YT0 A;  1OXZ A;  1YKH B;  3RKG A;  4EMK C;  4P0A A;  2CE7 A;  5J3B A;  1Q81 U;  3X1D A;  3PIP A;  2GTO A;  2WMO A;  4J9C A;  2VVS A;  2ZAE A;  2LSI A;  4HWH A;  4ILA A;  2DTH A;  1N34 T;  3I35 A;  4IDO A;  3CCR T;  3EUH A;  3OMC A;  2NWM A;  2X35 A;  4JS5 A;  3T1Y T;  2G0U A;  3BQI A;  3OYI A;  2M51 A;  5KYU B;  3JB9 D;  2KLQ A;  4P09 A;  4QWN B;  3FEO A;  2EHO A;  1NEB A;  2HH7 A;  4IT4 A;  4LDV A;  3VU3 C;  5L3B B;  2DYI A;  3WVE B;  2OTJ A;  4LN2 A;  3EAE A;  2XQ9 A;  3F31 A;  4KP3 C;  1E7P A;  1QWE A;  2CHN A;  1UHF A;  2GGR A;  3P7I A;  2YU2 A;  4M78 A;  2Y90 A;  3CK6 A;  2DRM A;  5JRE A;  3HTR A;  3UT5 E;  2KT8 A;  2QAZ A;  2FG0 A;  3KV4 A;  2C0O A;  4Q5W A;  3M0T A;  3NZQ A;  4HCB A;  4CC4 B;  3EI0 A;  4EZH A;  5LNK A;  3CWZ B;  3QB5 A;  2KMT A;  3IQL A;  2C0S A;  2NWB A;  3CC4 A;  4PFP A;  2RK1 A;  1UB4 A;  3ZN0 B;  1TU0 B;  4R55 A;  2ACZ A;  2UXX B;  2IW5 B;  2K6D A;  4Z89 A;  2A28 A;  1J5E T;  2JJ9 A;  3RH3 A;  2DHR A;  5LJN A;  5FW9 A;  3WAK A;  1QVF A;  4ILU A;  1W70 A;  3CME A;  3CQT A;  1QWF A;  2RP4 A;  3CCE T;  3RYC E;  2NW7 A;  3MO8 A;  1RAB B;  3KFV A;  3Q2M A;  3AEE A;  3ZC1 A;  2H8H A;  1JO8 A;  3N9Q A;  5M9O A;  3OBW A;  4HA8 A;  1WDX A;  1NLO C;  1X69 A;  2WAC A;  2CXD A;  2NTY A;  5CB4 E;  3FC3 A;  3I9W A;  3RDV A;  4AIS A;  1X6G A;  3CCJ T;  5LJ3 e;  2X67 A;  3ZYK A;  2WBL A;  4EMK B;  4H9R C;  2NTX A;  1IGU A;  1SKU B;  2AKK A;  2RM4 A;  4A4K A;  5AQS B;  5DLO A;  2XAJ B;  2WSF E;  1VQO T;  2FJB A;  4QXB B;  2ZMA A;  3HPW A;  3G4S T;  1VQ5 T;  1VQL A;  3K1S A;  1Y7X A;  2YIN A;  3EGU A;  2QK0 A;  3TSW A;  3JCM c;  2V8I A;  3ASK A;  1M5Q 1;  4HT8 A;  2QDL A;  3BE3 A;  4QW2 A;  4B6M A;  3UFG A;  3N9M A;  2EQM A;  1N9S A;  1JJ2 S;  4LF4 T;  2BKO A;  2KI7 A;  4N0A C;  3PJA J;  2M9U A;  1WYC A;  3LSV A;  3N9L A;  2KRM A;  1Z8U A;  1WHM A;  4YSY A;  2X9W A;  4N4I A;  2RQT A;  3TLT A;  1G3Y A;  3S3M A;  3I55 A;  1YIT Q;  4UR9 A;  4RCC A;  1N27 A;  4OMM A;  4DA4 A;  3CCL A;  2EJF A;  3QB5 K;  2JNG A;  2OA5 A;  2C0I A;  4IL9 A;  2OTJ Q;  2E5Q A;  5C8Y E;  2D6F A;  4J9F A;  3HRS A;  4DR7 T;  1Y07 A;  5GAN 5;  1IZN B;  4BD3 A;  2QTV A;  4M75 B;  4J9G A;  4MZT A;  4H9P C;  5KDM C;  2FYK A;  4DV4 T;  4HKE A;  1K0S A;  3SFE A;  4C0G A;  3V7C A;  1OZ3 A;  1N36 T;  3L2U A;  2MAM A;  4V2S A;  1IAP A;  1DU2 A;  5FLX E;  4ZI2 C;  1MGQ A;  3CBM A;  1QLY A;  2KNB B;  3EGD B;  4YSX A;  3J7Y q;  3VS4 A;  2D0Q B;  2O01 E;  4A4E A;  2DL8 A;  4TV9 E;  5KH6 A;  2WWV A;  5GAM e;  1Q82 U;  5JDF A;  2ZPF B;  4NPP A;  3TLU A;  2K9G A;  3GOX A;  3ZLI A;  3CCQ Q;  1NJI U;  1MMN A;  2OX7 A;  1GCQ C;  4KH1 B;  1ZBX A;  1UGV A;  1R0B G;  4E7I A;  2A08 A;  4RG2 A;  2K57 A;  3PE0 A;  2HL5 C;  5FY0 A;  1WXU A;  1G3W A;  3INZ A;  1HX1 B;  2V1R A;  1UK5 A;  2FPF A;  3RX6 A;  1Q7Y U;  4PW8 A;  1LVK A;  3CPW S;  3QHS A;  1YKE B;  3KV6 A;  2FO0 A;  3OY9 A;  3CMA Q;  1SRM A;  1WGS A;  2H7O A;  2VUB A;  4DEY A;  2CBJ A;  3OMG A;  4ERR A;  2JQ9 A;  1SF9 A;  2F69 A;  2LJL A;  2MPK A;  4G63 A;  3UU6 A;  3CCJ A;  2CUB A;  2X3W D;  4GYR A;  2E5K A;  4XTU A;  4DV6 T;  2IML A;  1EFN A;  2RJF A;  2RQU A;  4RTW A;  2LCL A;  4U3C A;  3EGX A;  1G8X A;  3AED A;  4KUM B;  1U3O A;  3DB3 A;  1IB8 A;  1MNE A;  3QXE B;  4JI4 T;  2EW3 A;  2XAH B;  2XAG B;  1EX4 A;  1VQO A;  2NOX A;  3UTK A;  5LXT E;  1PG5 B;  3OYE A;  1W1F A;  3QZ9 B;  3Q5X A;  2DEU A;  2NUP B;  3V7R A;  3PTR B;  3VUZ A;  2DL4 A;  1HCI A;  5IHI A;  4FT2 A;  2K2M A;  4OGC A;  1XNR T;  5AQH B;  1ZA1 B;  2EYY A;  3AE4 A;  1VQK Q;  3ME9 A;  4RTU A;  4EOZ B;  3CML A;  3SEM A;  4Q25 A;  1FMK A;  3M55 A;  2DVJ A;  5M4Y A;  5IT9 E;  1M8V A;  1K0X A;  3SFM A;  4KRT A;  1IJ6 A;  4U72 A;  1SSH A;  4CXY A;  1AWW A;  1Q82 C;  3UAT A;  4U7I A;  4M7A B;  2EJG A;  3CQX C;  4WCI A;  1BCO A;  3VKG A;  1YP5 A;  2X66 A;  4J9E A;  2BZB A;  1M1K C;  1LPL A;  3RPU A;  3RIF A;  1RL2 A;  4JRK A;  2I59 A;  3V8K A;  3FZL B;  2I2L A;  3CCE A;  1QVG S;  2RK2 A;  2GBQ A;  4HFH A;  3CCM Q;  2DKG A;  4MDX A;  2LNH B;  2QQS A;  2QYZ A;  1TSF A;  2ZPH B;  4M78 F;  4PK5 A;  1H8K A;  1NEG A;  3IBP A;  5LGN B;  2YK0 A;  3CPZ A;  4KBM B;  2YUQ A;  4MLK A;  3A8L B;  4GKK T;  5GAN 8;  2J06 A;  2VVN A;  4KHZ F;  2W66 A;  2DTI A;  3SWH A;  3MKD A;  3J80 E;  3SFD A;  1J1J A;  4OMN A;  1JJ2 A;  2IC9 A;  5CJ5 A;  4J6X A;  5JTG A;  3CD6 A;  4MFR A;  4ADZ A;  1XMQ T;  3L1A A;  4OB1 B;  1YWO A;  2F2W A;  3VJP A;  2X9Y A;  3M0R A;  3EAM A;  2RD1 A;  3QYH B;  4QVZ A;  2JTF A;  1KFZ A;  1BR2 A;  2OAU A;  3M65 A;  3V5S A;  3QUI A;  2WSC E;  2QGF B;  5H6R B;  4F04 B;  5GAN h;  3K3O A;  4FCY A;  2CUD A;  4PJM A;  1BI2 A;  1CKB A;  2LT3 A;  3NBX X;  1VQ7 Q;  3PGG A;  2CMR A;  5FU7 C;  3AA7 B;  5LCY A;  3CC7 Q;  1ZSZ A;  2HNI A;  2A2F X;  2N1G A;  3QPH A;  3VS1 A;  5CKF A;  4M77 B;  4HXJ A;  3CCM A;  2LT4 A;  4V1A v;  3ZCJ A;  1MIY A;  4PJL A;  3P50 A;  2E6Z A;  3LK2 B;  1TG0 A;  2HDA A;  1GBR A;  3I55 Q;  2CT4 A;  5C0M A;  2VK9 A;  1SHG A;  1QCO A;  3GF5 A;  2XG8 D;  3CBP A;  2FVU A;  4ZN1 A;  2XIC A;  5JDG A;  3KIN B;  3PU8 A;  4IGU A;  3MPU B;  2E5L T;  2XK0 A;  4C8Q F;  4N4G A;  5L4E A;  4M75 E;  1FX7 A;  2K79 A;  4D6W A;  3TEE A;  3UFE A;  4RTV A;  2VWF A;  4J9D A;  3Q5E A;  2JOY A;  4K11 A;  4F7U A;  1ARK A;  4M7A C;  2CA5 A;  2WZI A;  4B3T T;  1NG2 A;  4FW1 A;  4FYV B;  1VQ5 A;  1VQL T;  2YRD A;  1OU9 A;  3P4W A;  4DV0 T;  5HKC A;  2XDD A;  2VKJ A;  2DJZ A;  4UIG A;  4BY6 C;  1Y64 B;  2WM9 A;  3ZMS B;  4DQ2 A;  2WS3 A;  1VUB A;  5ECA A;  4QH1 A;  4LD6 A;  4U33 A;  3A1P A;  4OVA A;  3VV0 A;  5GAO r;  4O6J A;  3AAE B;  2L3L A;  5FXW A;  1M3A A;  3UPU A;  3E9F A;  5I2M A;  2K2V A;  4F8H A;  2K3W A;  5ETW A;  2CPT A;  1WQW A;  3CX7 B;  3V5U A;  3ZT7 A;  3NTH A;  3FZM B;  4LDW A;  3LX7 A;  5C6S A;  1UFF A;  5D6W A;  1HSQ A;  1W09 A;  4LE9 A;  1I5O B;  1C0M A;  1IJ5 A;  3LFM A;  2I0M A;  1WJQ A;  3CQC B;  2FUP A;  1QW1 A;  1SRL A;  2JUF A;  3C12 A;  4XTZ A;  4DBF A;  5AQI B;  4DEX A;  4N4H A;  2W67 A;  5I2S A;  3VYG A;  3M57 A;  4CC2 A;  5LGU B;  3QWY A;  3DTO A;  2GFU A;  4EB6 E;  4A98 A;  2EHO D;  1PM3 A;  1PWT A;  2UXB T;  1BCM A;  4BE2 A;  4M7D F;  4QH4 A;  3P4R A;  4XTV A;  1I6Z A;  3ZMU B;  4F7U E;  4A63 B;  1KC8 R;  3AHU A;  5CQX A;  5HXR A;  2V7K A;  4GOU A;  1MHN A;  2ED1 A;  4QQD A;  2XD0 A;  4O2A E;  3ZT6 A;  4E7Z A;  1ZHI A;  4M75 A;  4P1N A;  2J4G A;  1YQ3 A;  4C8Q G;  1WIE A;  4IUU A;  4H9O C;  5GAO p;  4ZTF A;  2D0N A;  4EXT A;  2PG8 A;  2A7Y A;  2DIL A;  3DKM A;  2FRW A;  4GY5 A;  1T3S A;  5HCK A;  2K3B A;  2AHJ B;  4C8Q E;  1UUS A;  2OJ2 A;  4J83 A;  4M7D E;  1KSW A;  4UC4 A;  2WMN A;  3URG A;  1VQN A;  3CQG B;  1RAD B;  1IRX A;  4H9Q C;  1GFC A;  3OYA A;  4GK0 E;  1QVG A;  5GAO n;  1ZUK A;  4L6V 5;  5LJ5 g;  3BY7 A;  2KMF A;  3ESL A;  4CI3 B;  1AD5 A;  3RNJ A;  2F5K A;  5HXE A;  2K7A A;  2WSE E;  1YXR A;  5HK3 A;  5LGT B;  3M0P A;  2QG9 B;  1NYG A;  3BDU A;  4M78 C;  1NAF A;  4GYS A;  3QWX X;  4F7U B;  3H8Z A;  1S1N A;  3MP8 A;  4IIM A;  1WNL A;  5J0Z A;  1ABQ A;  1X27 A;  2WWU A;  1VQN Q;  4YY3 T;  3NFC A;  1YHQ T;  4PNI A;  4X64 T;  3C0C A;  2QEX T;  5CIU A;  1HFA A;  5FNV E;  3OBV E;  1HJD A;  3GMI A;  3RKY A;  1M2V A;  2JT4 A;  4PKC C;  1NLP C;  4ZTJ A;  4GBQ A;  4ME7 A;  4DBH A;  4COF A;  1ZV4 X;  1BB9 A;  1NM7 A;  5LJ3 g;  3QG1 A;  4A54 A;  2XDB A;  3B13 A;  2HBW A;  1QSD A;  1E1H B;  2L2P A;  4TWF A;  5GAO l;  1VQ4 T;  2MI6 A;  2VUR A;  3I0O A;  3QDR B;  5L3D B;  1VQ6 A;  4HE8 A;  4WZX A;  4FL6 A;  1UX4 A;  2BKN A;  2XHC A;  3OYN A;  1WXB A;  3PMT A;  3OS1 A;  3JC6 D;  5GAN d;  3E0Z A;  1UEC A;  4ELY C;  3L2Z A;  1WXT A;  3GNG A;  2BG9 C;  4JUV A;  1ZUU A;  2M02 A;  3HHT B;  4KT0 E;  4NXN T;  1M2O A;  1FJG T;  3E1S A;  3HR0 A;  2WCA A;  2E10 A;  1S72 Q;  3CCL T;  2ROL A;  1WJR A;  1YN8 A;  1EIF A;  4K0K T;  5KMG P;  2KAF A;  1N8R U;  4DUY T;  1V76 A;  3NTI A;  2WDR A;  1X9B A;  1XQH A;  3V7S A;  3PJA A;  1Y96 A;  4FI5 A;  4M7A A;  1HG2 A;  4HTE A;  3TKL B;  1UG1 A;  3ZJ1 A;  5I21 A;  5CKB A;  3ZSS A;  2MMP A;  2K5L A;  2M6B A;  3HKE E;  2V8K A;  3CCU Q;  2KRO A;  3IF8 B;  2NUT B;  2E2A A;  1GBQ A;  2W4X A;  1OI1 A;  2V7J A;  3CCL Q;  2PVG B;  4JLG A;  1I5L A;  2XY8 B;  2LLY A;  3SRZ A;  1AHJ B;  2ED0 A;  2P4R A;  5AQQ B;  1VQ8 T;  1T3L A;  5J2U E;  4OB3 B;  3JCM g;  1U8R A;  3OYL A;  2DD5 A;  5HCM A;  4JRQ A;  5HEO A;  2UUB T;  1KHI A;  3MEU A;  2FZG B;  2BBH A;  3OS2 A;  3JB9 J;  2LQ8 A;  4M7D D;  5HXS A;  4C8Q B;  2QA4 T;  3M9Q A;  2ZPE B;  2XQY A;  1N32 T;  4PJO G;  7AT1 B;  3AE5 A;  2LVM A;  2HN2 A;  2O31 A;  1I1J A;  2DYB A;  4XAX B;  4EMH A;  4AG2 C;  3VUB A;  3RKO A;  3U23 A;  2MK5 A;  3C4S A;  2CLY B;  4NXM T;  2BE7 D;  2XQ5 A;  2DWG A;  2HZY A;  3ZPO A;  4PJO E;  3IA3 A;  3NTK A;  3LWI A;  1LCK A;  1N8R C;  4B6X A;  3O1J A;  3CCU A;  3A98 A;  3JCM h;  1UGO A;  4DR2 T;  2DO3 A;  1RUW A;  1CUN A;  4JUY A;  4JLE A;  2RQW A;  1YJ9 Q;  1K76 A;  1QUU A;  2GFA A;  2QQB A;  4M77 A;  4B9X A;  1GFD A;  4C91 A;  2PNI A;  2Y6X A;  4TN7 B;  1NZ9 A;  1ZSG A;  1VQP A;  5J26 A;  3X25 B;  4OFZ A;  3CD6 Q;  1M8M A;  5A0D A;  5GAN e;  4PAG A;  2NLU A;  2FZK B;  3MHX A;  4UV9 B;  5LJ3 h;  3EHR A;  2V26 A;  1D0Z A;  2NUT A;  4Y91 A;  4F16 A;  4ZGD B;  5L8R E;  3F2E A;  5A1L A;  3M4Y A;  4AXP A;  5JRC B;  3LWH A;  1M1F A;  2KXC A;  1ZX6 A;  4LFB T;  2QDY B;  3VS3 A;  4IE4 A;  1AT1 B;  3K8P C;  3CBO A;  4M4Z A;  4WF2 A;  1PKT A;  2M0O A;  1RAA B;  2L3R A;  4J9B A;  5GMK h;  2XSB A;  5GAM d;  1QVF S;  2YOE A;  4XU2 A;  5IXB A;  1WPY A;  2K5I A;  3KXT A;  2FL7 A;  1TTH B;  3S4U A;  5GMK j;  1B3Q A;  5IAY A;  3UA7 A;  1VQN T;  5GAO m;  1U4Q A;  4U74 A;  2HHH T;  3AE1 A;  4L5G A;  4O4I E;  4J7F A;  3QBY A;  2FB7 A;  3ZBD A;  5LJM A;  1JEG A;  2V5D A;  1T8B A;  4LF9 T;  1RAI B;  1M7K A;  1NWM X;  1Y57 A;  2K5F A;  3GLX A;  2V8J A;  3C4W A;  4DBR A;  4UXN B;  3OYC A;  4PJO A;  2CSI A;  3LBX A;  1WHG A;  2BS2 A;  3FRN A;  2P0Q A;  3CIR A;  3BK9 A;  3PUX F;  4II1 A;  3V8L A;  4HN9 A;  1BBZ A;  3Q1J A;  3QZ5 B;  5AQM B;  1Q86 C;  1YHQ A;  1K9M R;  1VA7 A;  3FB9 A;  3QC9 A;  5HEH A;  2RF0 A;  4JBW F;  2Q9Q D;  4ZEY A;  4XTY A;  2IDO B;  3RC8 A;  5C3J A;  5LJ3 f;  2UXN B;  2LQN A;  3UA6 A;  2KXP B;  1C6V X;  3LGF A;  4EIK A;  1XNQ T;  2CWO A;  4DR3 T;  3ABV A;  2AK5 A;  2CP7 A;  1KD1 R;  2KT1 A;  1VQL Q;  1O3X A;  1VQ5 Q;  3NVO A;  3L09 A;  4JDS A;  4YTN A;  4M7A G;  1UGS B;  3K3N A;  1ZHC A;  4Y28 E;  1M3B A;  5GJW B;  1D0X A;  2DAQ A;  2LC4 A;  3SHW A;  2QVA A;  3KBU A;  4AQF A;  5CFB A;  4BDY A;  4IDQ A;  2C5K T;  1G3T A;  3RYI E;  5JH7 E;  3THK A;  3H41 A;  4J6W A;  4QVC A;  2BE9 B;  2A0F B;  2ENM A;  2JM9 A;  3AE2 A;  2HQE A;  3A8M B;  4ZI3 D;  1G73 A;  3LK4 2;  4TUY E;  3ZMZ B;  1SUM B;  1Z9Z A;  3MEW A;  1Y71 A;  4E7L A;  3BQK A;  1GCP A;  3CXC P;  2NW8 A;  2AKL A;  2COZ A;  3CCS Q;  1KQS S;  5FP3 A;  3VR9 A;  1OEB A;  1Y01 A;  4HWI B;  4LFA T;  2GTJ A;  2WP9 A;  2DNX A;  2CDT A;  3PUR A;  4LF8 T;  1M9S A;  2CH4 W;  2O2O A;  5EK3 A;  3ZYL A;  4N78 D;  1RAF B;  2K48 A;  2F2V A;  2OTL A;  3C4X A;  1BK2 A;  3CCV Q;  4DV3 T;  1L0V A;  4EGW A;  1BIB A;  4UVC B;  3CX8 B;  1WQ7 A;  3RKW A;  4C92 E;  3QK6 A;  1E6H A;  1BU1 A;  4ELZ C;  3D0T A;  3DJB A;  1I4K 1;  5HEG A;  1R8O B;  3I56 T;  5L3E B;  2ZZD A;  2EYQ A;  1HXD A;  5HEJ A;  3M3Z B;  2XMF A;  4JI6 T;  1VQP T;  3EDV A;  5IXF A;  4UVB B;  2ES0 A;  3H3A A;  2KWI B;  2YDL A;  1XDP A;  1VQ4 Q;  5JDL A;  4X62 T;  1O9S A;  2H3E B;  3KBT A;  3WXM B;  4BB7 A;  1EZ3 A;  2W0Z A;  1HTJ F;  3R6N A;  4EZ4 A;  2XAQ B;  5A2Q E;  3FBZ A;  2QYW A;  3LH5 A;  2KVQ G;  2KE9 A;  2MYS A;  4X9D A;  1YCY A;  1IHV A;  4X65 T;  1NEN A;  1YW0 A;  5J1G A;  4TVR A;  4E7J A;  2Z0W A;  1UE9 A;  4OB0 B;  5KCH A;  4WBN E;  2JZ2 A;  1X75 C;  5LG3 A;  2ZPG B;  3H3M A;  2KYB A;  3EGX B;  4C5H A;  2XPK A;  5CA0 E;  2LE8 A;  2E8I A;  3ONJ A;  4NIQ A;  1YBY A;  3X20 B;  2DFU A;  3UUL A;  2EPD A;  4WYV A;  4LNP A;  3L39 A;  1Y96 B;  2OTJ T;  4BI3 A;  5EC7 A;  3L2R A;  2E65 A;  1Q81 C;  2ZM2 A;  2DIQ A;  2XSA A;  4C92 F;  3MA9 A;  4IE0 A;  4DID B;  3CC2 A;  5AQR B;  2CP6 A;  3WVD B;  4MDW A;  2AXD S;  3G1J A;  1Z9Q A;  3OW2 S;  4NS5 A;  3PUY F;  1F1B B;  3QOF A;  2VAS A;  5L3G B;  3KFW X;  4X1Y E;  2EHO C;  2CKK A;  2XAS B;  4A53 A;  2WU2 A;  2DRK A;  4M77 F;  1QVG P;  3N2G E;  5KE3 A;  5HAX A;  2K3Y A;  2YEV C;  3EHZ A;  4WNK A;  2I0N A;  1YJ9 A;  1I81 A;  1YIT A;  1GCQ A;  5AQU B;  2O9S A;  1K9M C;  2L5Q A;  4XBF B;  3ZCI A;  1QQJ A;  4FSX A;  2HPJ A;  1VQ9 Q;  1WRD A;  3DP7 A;  4M75 F;  2Z6E A;  3RQW A;  2J7I A;  3QJY A;  4DOW A;  5GAM g;  1KQ1 A;  2YRC A;  1R77 A;  4X1I E;  4ZXL A;  2EQJ A;  5KYU A;  2YKS A;  1D1B A;  4C92 D;  1VQ6 Q;  3MEA A;  4OMO A;  1H92 A;  1HNX T;  1RAH B;  3NRY A;  2YDS A;  4UEM A;  4QHO A;  4PLL A;  5AQN B;  1OUL A;  3ANW B;  4RG8 A;  4OF1 A;  2L3S A;  4HWD A;  5BR8 T;  1UCU A;  3UU5 A;  4E7K A;  3ETV A;  2HQH A;  4M78 E;  4OMP A;  3EAB A;  2D5U A;  2L8D A;  4JI3 T;  2DWK A;  3AVS A;  2DXU A;  3JCM f;  4E7S A;  2VQF T;  1G83 A;  1YJW T;  2QGS A;  3JCM d;  1OED C;  2P0K A;  4JI5 T;  2HKQ B;  4LDY A;  1U1T A;  2D9T A;  2CYZ B;  4CI2 B;  1LOJ A;  5IHK A;  2DBM A;  2LQW A;  2NUP A;  5LBQ B;  4KH0 B;  1WHH A;  4OGE A;  5L4H A;  1WYX A;  1KNP A;  2HN1 A;  2RI5 A;  2A72 A;  3G4S Q;  4PJO F;  3M53 A;  4QH5 A;  3RI5 A;  2LOS A;  2YU1 A;  2LJ1 A;  2LQK A;  2VGM A;  3I0Q A;  4AI6 A;  3WAJ A;  5JRC A;  4QVD A;  2JRK A;  2JVV A;  2YDR A;  3EVY A;  4HVV A;  1X2Q A;  4LDX A;  4AKH A;  3U3I A;  3H0F A;  3AB3 B;  1I07 A;  2LRQ A;  4YJ2 E;  5CR2 A;  2O4X A;  1WLX A;  3P8B B;  3L42 A;  4CZZ B;  2IC6 A;  3AEF A;  4M77 E;  5AYF A;  3I55 T;  4H9S E;  3SOL A;  1SA0 E;  4PK6 A;  5JDQ A;  2DD4 A;  3OYG A;  2ECZ A;  3EHQ A;  4IIJ E;  3LDQ B;  4I43 B;  3ZT5 A;  1SEM A;  2JXB A;  4FYW B;  2V1Q A;  2ZPB B;  2DE0 X;  2KXD A;  2EFI A;  4AQG A;  2WB5 A;  4B9W A;  3ZST A;  1JNZ A;  2CHO A;  1IXD A;  1V1C A;  2M1H A;  1ZP0 A;  1LNX A;  2M0Y A;  1KF6 A;  2VKH A;  2DIG A;  1YCS B;  3CXC A;  4FIB A;  1KD1 U;  4I50 E;  2EIF A;  5GAN f;  2UU9 T;  3FIF A;  2RNA A;  4F14 A;  5GAM f;  5ABE A;  1KC8 C;  1J3T A;  4OHF A;  1W4S A;  2V6Y A;  4P5N A;  3BFM A;  2XQ6 A;  1HNZ T;  3TVT A;  3J9X 1;  4U2Y A;  1TH7 A;  2LJ3 A;  2E9X B;  1X6O A;  2BZ8 A;  1PSE A;  4IKF A;  2VVK A;  3LJC A;  3ANW A;  4IUV A;  4UEL A;  1OED B;  1OV3 A;  3RR6 A;  3C94 A;  3M54 A;  4XTW A;  3EFO A;  4P0B A;  3N9N A;  4OYJ A;  2EAY A;  2HKN A;  5D7U A;  3VS2 A;  3JB9 G;  2WSS V;  2XQA A;  1YIJ Q;  5DJQ C;  3TRE A;  3JAM E;  3O5Z A;  2X0L B;  2DLP A;  3IHR A;  1RI9 A;  2GK9 A;  1G5V A;  2V5C A;  4HFC A;  1KQS A;  2P9B A;  5GAM h;  5HYA A;  2ZM8 A;  3OYX A;  1QVP A;  3QJ6 A;  3X28 B;  4X34 A;  1VIE A;  1FYN A;  3WI3 A;  3M59 A;  4BUG A;  2RI2 A;  2XID A;  2W62 A;  3PUZ F;  2JQH A;  3RRW A;  2G6F X;  2RB6 A;  2P84 A;  1VQK T;  2FEI A;  3HL8 A;  1U5S A;  2OAW A;  4OB2 B;  3UUM A;  3E2U A;  2NUZ A;  3PFS A;  4JJB A;  5LB7 B;  2K4Y A;  2RJE A;  4PNO A;  1X43 A;  4EYY R;  1S94 A;  1O75 A;  1EZZ B;  2EJ9 A;  3PIO A;  3C50 A;  2LSY A;  4Z02 A;  2D0U A;  1WR0 A;  2M67 A;  2B76 A;  4J9I A;  9ATC B;  2KRS A;  2JQK A;  2ZM6 T;  4ZOL E;  2GCX A;  2H7V C;  4A97 A;  4B3R T;  5FXX A;  5EK2 A;  1N9R A;  4HFD A;  2FJA A;  2I6H A;  4QXH B;  2LCS A;  2Y4Y A;  2QEX A;  3H0H A;  1K9A A;  2CRB A;  2Y8D A;  3TU4 K;  4PJO D;  1ZEE A;  3MP1 A;  4NUV A;  2QTX A;  1W0A A;  4IE7 A;  2B86 A;  2AIR B;  3OYY A;  4DOV A;  1E7O A;  1AOJ A;  1GL5 A;  2DF6 A;  3AEG A;  4PJJ A;  2KGT A;  2J05 A;  1ACM B;  5L2L A;  4BAY B;  4G2A A;  5CKD A;  2BVL A;  4JJN K;  3EH2 A;  1PNJ A;  4DR6 T;  4J6Y A;  4LF7 T;  2R57 A;  3H0I A;  4RTY A;  1YD8 G;  1K4U S;  3RMS A;  2V6Y B;  3ETU A;  1XZY A;  4HKA A;  4IHJ E;  1PD0 A;  1VQ9 A;  3A5Z B;  1XNI A;  2CLY C;  5FMN A;  4J7I A;  2ATC B;  4LUD A;  3CCQ T;  1JJ2 P;  1YI2 T;  2Y4X A;  3H9N A;  1UTI A;  4EIW A;  2DTO A;  3N5L A;  1VRB A;  2LRL A;  4TNW A;  4AQY T;  2CZ7 B;  4XU3 A;  3JCM P;  3OYK A;  2KDS A;  5GMK m;  2XHE B;  3O8V A;  3JAF A;  5TAO A;  3P4P A; 
#chains in the Genus database with same CATH homology
 1MIW A;  3VYH B;  5GAN 2;  3HFN A;  3G4S A;  1P92 A;  1KQ2 A;  3C64 A;  3JCM W;  4M75 G;  3N2K E;  3OJA A;  2HQX A;  3H6Z A;  3KDS E;  2YHT A;  3LW5 E;  3FHN A;  3SWN A;  4M7D B;  3JB9 H;  5J2T E;  3HRT A;  5CKH A;  5JDH A;  4L59 A;  2RH2 A;  4E47 A;  4O8S A;  3RKX A;  3TCJ A;  1D3B B;  5FU6 C;  2PVO B;  2MWP A;  5LA6 E;  3LLR A;  5DM7 R;  2P0P A;  2HBP A;  1WR6 A;  3RES A;  2VV5 A;  4TX5 A;  2XUE A;  3NRX A;  1B34 B;  4JRI A;  3HRU A;  3MAC A;  3OYZ A;  4OMF B;  3CMA T;  2ZCF B;  3CMA A;  2NP9 A;  2VWA A;  5A0L A;  1MMA A;  2LTO A;  2QQR A;  4F7U F;  1VOM A;  3RMQ A;  2L89 A;  4O4J E;  4F7U G;  4AKG A;  4C0D B;  4ZHQ E;  4A56 A;  2M16 A;  1DJ7 B;  3JSC A;  1K8A C;  4BE0 A;  4BAC A;  1M4Z A;  4DO0 A;  1H64 1;  1MMD A;  3AA0 B;  2JN0 A;  4HFV A;  4FU6 A;  3MXZ A;  2RA2 A;  3L2W A;  3Q5W A;  5HK0 A;  2KSS A;  3J7A F;  2RI3 A;  2LT1 A;  4EAH A;  4M78 D;  1JRI A;  4ZS3 A;  4M7D C;  2K3X A;  2V7I A;  1D1A A;  3QO3 A;  3CCR A;  3MZK B;  2X4J A;  3FJP A;  3JRZ A;  5EK4 A;  1IZ6 A;  1FEW A;  3OYM A;  5KE2 A;  5GAN 4;  3G7Z A;  4PFO A;  3ZYM A;  3O9X A;  2BVM A;  4N0A A;  3OA6 A;  2DVE A;  4KUD K;  4MAL A;  3JB9 I;  4PJO C;  3CC4 T;  1YIT T;  5ADX L;  2KQW A;  2W00 A;  2RHI A;  3T8O A;  3KV5 A;  3UT1 A;  3PNW C;  4BE1 A;  5IN1 A;  4CXW A;  1VIF A;  2JQQ A;  4J2C A;  1KC8 U;  3N9P A;  4DND A;  1VQ6 T;  2Q9Q B;  3PT9 A;  1HF8 A;  3X26 B;  4BI8 B;  2JPF A;  3ZEH A;  5CA1 E;  2HAX A;  2GF7 A;  1FWZ A;  2MWO A;  1U1S A;  3G6E T;  3FB2 A;  3UDC A;  1KK7 A;  3HI2 A;  3RIR A;  3SD4 A;  2JMH A;  4FT4 A;  1H3Z A;  2LOP A;  3QYG B;  5GAM j;  2LCC A;  2VYT A;  2NW9 A;  3JCM Q;  3CPW A;  5LG4 A;  4M7A F;  3ZMT B;  1U5P A;  4QKN A;  2VL8 A;  2X9X A;  4HGA A;  1BI1 A;  3HA4 A;  4M75 D;  4A4H A;  4NL2 A;  1JB0 E;  2HD0 A;  4BJM A;  3JCM b;  2MF2 A;  2DZ9 A;  3BW1 A;  3OYH A;  3EFR A;  3E08 A;  3MET A;  1IRE B;  3PDY A;  4XTX A;  3F70 A;  2VB6 A;  2LHN A;  1OWA A;  3N9O A;  1KHC A;  5KCO A;  2VXF A;  2V7M A;  4R56 A;  4M77 C;  1KNZ A;  3DB4 A;  3HSB A;  3HKC E;  4VUB A;  4AKL A;  1HK9 A;  3HKS A;  1OYX A;  2BIV A;  4X1K E;  3O4X E;  3CCS T;  3GNF B;  2IG0 A;  4IUR A;  2QA7 A;  5D6X A;  3C4Z A;  2KIN B;  4RMO A;  3L2Q A;  3QKJ A;  5L3F B;  2PUK B;  2EQK A;  3I56 A;  4Z8X A;  4BI4 A;  2Q9Q C;  4M75 C;  3M4G A;  2CXF A;  4H63 H;  2VC8 A;  3E9G A;  5LJ5 j;  4HT9 A;  4KMC A;  3JCM J;  2LDM A;  5CK9 A;  3ZC0 A;  4BY6 B;  5D6Y A;  4O5V A;  2MTQ A;  3MK7 C;  4KUI A;  3EFS A;  4WBO A;  2Y48 B;  2DPP B;  4DVD A;  4ASK A;  3BDL A;  4XU0 A;  5JR9 A;  2QQ9 A;  2LSG A;  4J5Y A;  5CAI A;  2IAK A;  4XQ3 A;  3BQL A;  4L9I A;  3UUN A;  3CC7 T;  4MBQ A;  1GXI E;  4CQI A;  1MMG A;  3P8D A;  3AAA B;  3OSV A;  2N9D A;  4QX8 B;  5J39 A;  4DMW A;  1UEB A;  3OW2 A;  2LEH A;  1D3B A;  4ATO A;  3CC2 T;  3Q9D A;  2O4X B;  3G71 A;  4M7D A;  5EZY E;  1LVF A;  2ODV A;  3IEE A;  4C8Q A;  2PFV A;  3CCV A;  5FRN A;  4I4T E;  4MHC A;  4JRP A;  2V7L A;  3M56 A;  5LHG B;  1B34 A;  3RER A;  2LX9 A;  4K0U A;  2BKD N;  2ZLY A;  4CRI A;  4QQG A;  3ZEF B;  2ZM0 A;  4C0F A;  2YLB A;  4EMK A;  1K9M U;  3GIB A;  2RJC A;  2X4X A;  4XK8 E;  4QX7 B;  3MEV A;  2DXC A;  2R5M A;  2V1D B;  3ZJ2 A;  2KWH A;  3E22 E;  4PJN A;  1K73 C;  5FRO A;  3OS5 A;  5FRM A;  5AFU L;  5BMV E;  2G3R A;  5HXC A;  3LH0 A;  1HX8 A;  4EDU A;  2J1D G;  2PBI A;  3ER0 A;  2VKO A;  4IST A;  3KVB A;  2DZC A;  4H9N C;  3GA8 A;  3JB9 F;  2YLC A;  2XDP A;  2RJD A;  4M1P A;  3AA6 B;  3JC6 C;  5JDN A;  3C51 A;  3PU3 A;  4NL3 A;  1KD1 C;  4AQF C;  4YLH A;  5LJ5 f;  5DAB A;  3I9Y A;  2CEA A;  4YHJ A;  3OB9 A;  2W61 A;  1ZQ1 A;  4I55 E;  1Q86 U;  2RHX A;  5L3C B;  2E1H A;  1VQ9 T;  1S72 T;  3CPF A;  1WJS A;  1I8F A;  4C5E A;  3CD6 T;  5LJ5 e;  3VKH A;  4GIW A;  3OYB A;  4QQ6 A;  3ONX A;  4ZGE B;  1UX5 A;  4JS4 A;  2D2S A;  2L8K A;  1QP3 A;  1HS7 A;  4C92 G;  5A0G A;  3K3Q C;  2RHZ A;  2CCQ A;  1NJI C;  1SSF A;  3CCM T;  1V9D A;  4RCB A;  1K8A U;  3V8J A;  5FU6 B;  2A3D A;  2EHO B;  2MBG A;  2XTL A;  3LK3 B;  2Q9Q A;  3RUX A;  3NZP A;  2DXB A;  1M1G A;  5DY9 A;  3FBL A;  1YIJ A;  1VQ8 A;  3OSS C;  2EWN A;  3A8G B;  5GAN g;  2HPL A;  3AA1 B;  3CKD A;  2QA4 A;  5E0O A;  1VQM T;  4HCC A;  3CX6 B;  3LYI A;  3KVA A;  2CZ1 B;  4FJO A;  2X9H A;  2B8A A;  4C5G A;  5GAN 7;  1BR0 A;  4C5I A;  4IE6 A;  3CEY A;  1MND A;  3N2O A;  4JLI A;  3CCU T;  4ISS A;  3M58 A;  3G71 T;  2EKO A;  3SB2 A;  3VHL A;  4MML A;  2JTM A;  2QXF A;  4JEU B;  4UF0 B;  1X01 A;  1HG5 A;  4NUU A;  2DCF A;  2K5B B;  3SWN B;  5HY6 A;  2JMK A;  1LRZ A;  5FXZ A;  1QP2 A;  2KZ7 B;  4E7H A;  3GPL A;  3OQ5 A;  1NPR A;  5LJ5 d;  3OYF A;  2X4W A;  4DMV A;  1MIV A;  3SDZ A;  3PTA A;  3UUX B;  2WAU A;  1NE8 A;  5FXV A;  3JCM X;  1FMW A;  4PJO B;  3RC3 A;  4C0Z A;  3HFO A;  2OTL T;  2RHU A;  2KY9 A;  1WYB A;  5FU7 B;  5H6Q B;  4X9C A;  2X51 A;  3OKQ A;  5HWX A;  3OS0 A;  3CCQ A;  3G6E A;  3L2V A;  3P8H A;  1UGR B;  3FLG A;  2LNV A;  2BDE A;  2DI4 A;  3CC7 A;  5FY1 A;  3CXC S;  2R5A A;  4OYK A;  4IUT A;  4CXX A;  3GN5 A;  4C90 A;  4M78 G;  3O1H A;  3S6W A;  4WW0 A;  4YJ3 E;  3C95 A;  2VKD A;  2DLR A;  3I1A A;  2E41 A;  2P4T A;  5JDM A;  1Z0P A;  1UGP B;  3GP8 A;  1SHZ C;  2CZ6 B;  5CCA A;  5JVD E;  2E70 A;  4LDU A;  4J8O A;  2GQV A;  4M7D G;  3MJX A;  2BUD A;  1YJ9 T;  2W63 A;  1LKX A;  3N5B B;  3SWN C;  4A4G A;  3VU7 H;  4PLI A;  3LGL A;  4A4F A;  1VQM A;  1JBM A;  3MCA B;  1KG1 A;  4CI1 B;  1YJW A;  5CVI A;  3QSU A;  5EG2 A;  4M7A D;  1VQ4 A;  2DK3 A;  4TV8 E;  4M77 G;  1W2B A;  5LBM A;  5GAN 6;  1VQ7 A;  2DEQ A;  3RYF E;  4UF0 A;  1Q7Y C;  3SS1 A;  2W0G A;  1FIO A;  2PVD B;  3OBY A;  4ZS2 A;  4C92 A;  4F6R C;  4EMG A;  5LJ3 d;  3LBX B;  4MZP A;  3KV9 A;  1RI0 A;  3ZFJ A;  1US7 B;  2XU8 A;  1YIJ T;  4ZI2 D;  4CI0 C;  2C5I T;  2B1E A;  1BYM A;  4GLK A;  4O2B E;  2DXT A;  5GON E;  1V29 B;  3S3N A;  3ZMV B;  2QI2 A;  1X79 A;  3AVR A;  3CVR A;  5DQW A;  2H3R A;  1S35 A;  5DQV A;  4ZI3 C;  3KUF A;  1XTD A;  2A3L A;  3HKD E;  2D0T A;  4AKI A;  5F8P A;  1PSF A;  5LYJ E;  1S72 A;  3LG7 A;  3RRC A;  3PUG A;  3B57 A;  5GMK i;  2CS7 A;  2PQW A;  2F5T X;  3ZN1 B;  2XKO C;  1OZ2 A;  1XOV A;  4M77 D;  4M78 B;  3A8O B;  4UVA B;  5LL6 S;  3C98 B;  4IUQ A;  2QQA A;  2RA1 A;  3EDU A;  3X24 B;  1VQK A;  4JEH B;  4HEA A;  1B7T A;  4ZGJ B;  2E9X C;  3OYJ A;  2KK4 A;  1M90 U;  3T9N A;  4UV8 B;  3W15 B;  2MOZ A;  5CKE A;  1UGQ B;  5LJ5 h;  2N2N A;  4KUL A;  4GK5 E;  2KT9 A;  1K73 U;  3PUQ A;  4YFS A;  2PJQ A;  4C8Q D;  2LHR A;  3L3P A;  4C92 B;  2C06 A;  4EYU A;  2K9A A;  3VKI A;  5HXH A;  3A8H B;  2X68 A;  3PUA A;  2LM9 A;  3RYH E;  2SPC A;  3R6O A;  4IE5 A;  4X20 E;  1AJ3 A;  3AAI A;  1D1C A;  4MMK A;  2H3J A;  4TZ4 C;  4FM4 B;  4XU1 A;  4DBQ A;  5LHH B;  2E9X A;  4BA9 A;  1YI2 A;  2RO0 A;  3J81 E;  1N6A A;  2R58 A;  2YRV A;  4OP0 A;  5LJ3 j;  4PK4 A;  4O4H E;  5JR9 B;  5GAN 3;  4C8Q C;  1M90 C;  2CWY A;  2E12 A;  2E6N A;  4HCZ A;  2CXL A;  2VGN A;  4PL6 A;  2K24 A;  2LSK A;  2CGH A;  2LSJ A;  4XZC A;  3KBG A;  3FXD B;  3MP6 A;  3DLM A;  3H37 A;  4C0D C;  1T98 A;  5LHI B;  3CCS A;  5GAN j;  1BKB A;  4O4L E;  3F57 A;  5IYZ E;  5KX5 E;  3GWH A;  2E64 A;  3A5X A;  5GAO q;  2PUO B;  3S3O A;  4LD9 K;  3P8C D;  5FYM A;  3FXE B;  4L0R A;  4H63 V;  3O1I A;  1ZKE A;  4ANJ A;  3E19 A;  3HL6 A;  3R84 B;  3JCM e;  2ACX A;  3QII A;  4YTL A;  3DLL A;  4C92 C;  2CZ0 B;  2E9X D;  5HWY A;  1H7C A;  1FXX A;  5GMK l;  4AKR B;  2C5J A;  2CM0 A;  3PMI A;  4NOY A;  3HKB E;  1LJO A;  4EPC A;  2VXE A;  3HP9 A;  3M5A A;  5DLQ E;  3OYD A;  3GN5 B;  3JCM V;  4M7A E;  3CME T;  4OK0 A;  2XI9 A;  2ZPI B;  5LOV E;  5JQG E;  3QUJ A;  2IVW A;  3UWN A;  4MDX A;  1YJN T;  1FMV A;  5IHY A;  2L9Q A;  1YJN A;  1VQ7 T;  2FHD A;  2RHY A;  4IDZ A;  4MZM A;  2XAF B;  1BI0 A;  5FY7 A;  4ZI7 E;  2KND A;  1NPP A;  5JR9 C;  3CCV T;  1G3S A;  1D0Y A;  1BR1 A;  5F3J A;  3PUS A;  1W2B S;  2ODU A;  4RKU E;  1BI3 A;  2PU9 B;  1BR4 A;  5CO7 A;  4IUP A;  4QXC B;  4ZN3 A;  3U78 A;  3FDR A;  1BIA A;  2X4Y A;  2EQU A;  5LP6 E;  4BJN A;  5GMK e;  5CQY A;  1M1K U;  4BDZ A;  2ZGW A;  1OXZ A;  1YKH B;  4EMK C;  4P0A A;  2CE7 A;  5J3B A;  1Q81 U;  3PIP A;  2WMO A;  2LSI A;  2DTH A;  3CCR T;  3EUH A;  3OMC A;  2X35 A;  4JS5 A;  2G0U A;  3BQI A;  3OYI A;  3JB9 D;  2KLQ A;  4P09 A;  4QWN B;  3FEO A;  2EHO A;  2HH7 A;  4LDV A;  3VU3 C;  5L3B B;  3WVE B;  2OTJ A;  3EAE A;  3F31 A;  4KP3 C;  3P7I A;  2YU2 A;  4M78 A;  2Y90 A;  5JRE A;  3UT5 E;  3KV4 A;  4Q5W A;  3NZQ A;  4HCB A;  5LNK A;  4EZH A;  3CWZ B;  2KMT A;  2C0S A;  2NWB A;  3CC4 A;  4PFP A;  2RK1 A;  1UB4 A;  3ZN0 B;  4R55 A;  2UXX B;  2IW5 B;  2JJ9 A;  3RH3 A;  2DHR A;  5LJN A;  1QVF A;  3WAK A;  4ILU A;  3CME A;  2RP4 A;  3CCE T;  3RYC E;  2NW7 A;  3MO8 A;  3Q2M A;  3ZC1 A;  3N9Q A;  5M9O A;  3OBW A;  4HA8 A;  2WAC A;  2CXD A;  2NTY A;  5CB4 E;  3FC3 A;  3I9W A;  3CCJ T;  5LJ3 e;  2X67 A;  3ZYK A;  2WBL A;  4EMK B;  4H9R C;  2NTX A;  4A4K A;  2RM4 A;  5DLO A;  2XAJ B;  2WSF E;  1VQO T;  4QXB B;  2ZMA A;  3HPW A;  3G4S T;  1VQ5 T;  1VQL A;  1Y7X A;  2YIN A;  3JCM c;  2V8I A;  3ASK A;  1M5Q 1;  4HT8 A;  4QW2 A;  2EQM A;  3N9M A;  1N9S A;  1JJ2 S;  4N0A C;  2M9U A;  1WYC A;  3N9L A;  2X9W A;  4N4I A;  1G3Y A;  3S3M A;  3I55 A;  4RCC A;  1N27 A;  4DA4 A;  3CCL A;  2EJF A;  2JNG A;  2OA5 A;  2E5Q A;  5C8Y E;  2D6F A;  3HRS A;  5GAN 5;  1Y07 A;  1IZN B;  4BD3 A;  4M75 B;  4MZT A;  4H9P C;  5KDM C;  2FYK A;  4HKE A;  4C0G A;  3V7C A;  1OZ3 A;  3L2U A;  2MAM A;  4V2S A;  1IAP A;  5FLX E;  4ZI2 C;  1MGQ A;  3CBM A;  3J7Y q;  2D0Q B;  2O01 E;  4A4E A;  4TV9 E;  5KH6 A;  1Q82 U;  5GAM e;  5JDF A;  2ZPF B;  3GOX A;  3ZLI A;  1NJI U;  1MMN A;  1ZBX A;  4E7I A;  4RG2 A;  2K57 A;  3PE0 A;  5FY0 A;  1G3W A;  3INZ A;  3RX6 A;  1Q7Y U;  4PW8 A;  1LVK A;  3CPW S;  3QHS A;  1YKE B;  3KV6 A;  3OY9 A;  1WGS A;  2H7O A;  2VUB A;  3OMG A;  4ERR A;  2F69 A;  2LJL A;  4G63 A;  3CCJ A;  4GYR A;  4XTU A;  2RJF A;  2LCL A;  1G8X A;  4KUM B;  3DB3 A;  1MNE A;  3QXE B;  2XAH B;  2XAG B;  1VQO A;  2NOX A;  3UTK A;  5LXT E;  3OYE A;  3QZ9 B;  3Q5X A;  3V7R A;  3PTR B;  3VUZ A;  1HCI A;  4FT2 A;  4OGC A;  3ME9 A;  4EOZ B;  3CML A;  3M55 A;  5IT9 E;  5M4Y A;  1M8V A;  3SFM A;  1IJ6 A;  4U72 A;  4CXY A;  1Q82 C;  4M7A B;  2EJG A;  3CQX C;  3VKG A;  2X66 A;  2BZB A;  1M1K C;  3RPU A;  1RL2 A;  4JRK A;  2I59 A;  3V8K A;  2I2L A;  3CCE A;  1QVG S;  2RK2 A;  2DKG A;  4M78 F;  2QQS A;  2ZPH B;  4PK5 A;  3IBP A;  5LGN B;  2YK0 A;  3CPZ A;  4KBM B;  4MLK A;  3A8L B;  5GAN 8;  2DTI A;  3SWH A;  3MKD A;  3J80 E;  1JJ2 A;  2IC9 A;  4J6X A;  3CD6 A;  4MFR A;  4ADZ A;  4OB1 B;  3L1A A;  3VJP A;  2X9Y A;  2RD1 A;  3QYH B;  4QVZ A;  2JTF A;  1BR2 A;  2OAU A;  3M65 A;  3V5S A;  3QUI A;  2WSC E;  5GAN h;  5H6R B;  3K3O A;  4PJM A;  1BI2 A;  2LT3 A;  3NBX X;  3PGG A;  2CMR A;  5FU7 C;  3AA7 B;  5LCY A;  2HNI A;  2A2F X;  2N1G A;  3QPH A;  3CCM A;  5CKF A;  4M77 B;  2LT4 A;  4V1A v;  3ZCJ A;  1MIY A;  4PJL A;  2E6Z A;  3LK2 B;  5C0M A;  2VK9 A;  3GF5 A;  2XG8 D;  3CBP A;  2FVU A;  4ZN1 A;  2XIC A;  5JDG A;  3KIN B;  3PU8 A;  4IGU A;  2XK0 A;  4C8Q F;  4N4G A;  4M75 E;  1FX7 A;  4D6W A;  3TEE A;  3UFE A;  4F7U A;  2JOY A;  4M7A C;  2CA5 A;  1VQ5 A;  1VQL T;  5HKC A;  2XDD A;  2VKJ A;  2DJZ A;  4UIG A;  4BY6 C;  1Y64 B;  2WM9 A;  3ZMS B;  4DQ2 A;  1VUB A;  4LD6 A;  4OVA A;  5GAO r;  3VV0 A;  4O6J A;  3AAE B;  2L3L A;  5FXW A;  3UPU A;  3E9F A;  5I2M A;  2K2V A;  5ETW A;  1WQW A;  3CX7 B;  3V5U A;  3NTH A;  4LDW A;  3LX7 A;  5C6S A;  5D6W A;  1IJ5 A;  3LFM A;  1WJQ A;  3CQC B;  2JUF A;  1QW1 A;  3C12 A;  4XTZ A;  4N4H A;  5I2S A;  3VYG A;  3M57 A;  5LGU B;  3DTO A;  2GFU A;  4EB6 E;  2EHO D;  4BE2 A;  4M7D F;  4XTV A;  3ZMU B;  4F7U E;  3AHU A;  5CQX A;  5HXR A;  2V7K A;  4GOU A;  1MHN A;  4QQD A;  2XD0 A;  4O2A E;  4E7Z A;  1ZHI A;  4M75 A;  4C8Q G;  4IUU A;  5GAO p;  4H9O C;  4ZTF A;  4EXT A;  2PG8 A;  2A7Y A;  3DKM A;  4GY5 A;  2AHJ B;  4C8Q E;  4J83 A;  4M7D E;  4UC4 A;  2WMN A;  3URG A;  1VQN A;  3CQG B;  4H9Q C;  3OYA A;  4GK0 E;  1QVG A;  5GAO n;  4L6V 5;  5LJ5 g;  3BY7 A;  2KMF A;  3ESL A;  4CI3 B;  2F5K A;  5HXE A;  2WSE E;  5HK3 A;  5LGT B;  3BDU A;  4M78 C;  1NAF A;  4GYS A;  4F7U B;  3H8Z A;  3MP8 A;  1WNL A;  2WWU A;  3NFC A;  1YHQ T;  4PNI A;  2QEX T;  5CIU A;  1HFA A;  5FNV E;  3OBV E;  3GMI A;  3RKY A;  4PKC C;  4ZTJ A;  4ME7 A;  1ZV4 X;  5LJ3 g;  3QG1 A;  4A54 A;  2XDB A;  3B13 A;  1QSD A;  1E1H B;  5GAO l;  1VQ4 T;  2MI6 A;  3I0O A;  3QDR B;  5L3D B;  1VQ6 A;  4HE8 A;  4FL6 A;  1UX4 A;  2XHC A;  3OYN A;  3PMT A;  3OS1 A;  3JC6 D;  5GAN d;  3E0Z A;  4ELY C;  3L2Z A;  4JUV A;  3GNG A;  3HHT B;  4KT0 E;  3E1S A;  3HR0 A;  2E10 A;  3CCL T;  1WJR A;  1EIF A;  5KMG P;  2KAF A;  1N8R U;  3NTI A;  1XQH A;  3V7S A;  1Y96 A;  4FI5 A;  4M7A A;  1HG2 A;  4HTE A;  3TKL B;  3ZJ1 A;  5I21 A;  5CKB A;  2MMP A;  2K5L A;  3HKE E;  2V8K A;  3IF8 B;  1OI1 A;  2V7J A;  2PVG B;  4JLG A;  1I5L A;  3SRZ A;  1AHJ B;  1VQ8 T;  5J2U E;  4OB3 B;  3JCM g;  1U8R A;  3OYL A;  2DD5 A;  4JRQ A;  1KHI A;  3JB9 J;  3MEU A;  4M7D D;  3OS2 A;  2LQ8 A;  5HXS A;  4C8Q B;  2QA4 T;  3M9Q A;  2ZPE B;  2XQY A;  4PJO G;  2LVM A;  4XAX B;  4EMH A;  3VUB A;  3RKO A;  3C4S A;  2CLY B;  4PJO E;  2DWG A;  3ZPO A;  3NTK A;  3LWI A;  1N8R C;  4B6X A;  3O1J A;  3CCU A;  3JCM h;  2DO3 A;  1CUN A;  4JUY A;  4JLE A;  1QUU A;  2GFA A;  2QQB A;  4M77 A;  4B9X A;  4C91 A;  2Y6X A;  4TN7 B;  1NZ9 A;  1VQP A;  5J26 A;  3X25 B;  4OFZ A;  5A0D A;  5GAN e;  4PAG A;  2NLU A;  3MHX A;  4UV9 B;  5LJ3 h;  2V26 A;  1D0Z A;  4Y91 A;  4ZGD B;  5L8R E;  3F2E A;  5A1L A;  3M4Y A;  4AXP A;  5JRC B;  3LWH A;  1M1F A;  2QDY B;  4IE4 A;  3K8P C;  3CBO A;  4WF2 A;  2M0O A;  5GMK h;  2L3R A;  5GAM d;  1QVF S;  4XU2 A;  1WPY A;  2K5I A;  3KXT A;  2FL7 A;  3S4U A;  5GMK j;  5IAY A;  1VQN T;  5GAO m;  1U4Q A;  4U74 A;  4L5G A;  4O4I E;  4J7F A;  3QBY A;  2FB7 A;  3ZBD A;  5LJM A;  1NWM X;  2K5F A;  3GLX A;  2V8J A;  3C4W A;  4DBR A;  4UXN B;  3OYC A;  4PJO A;  3LBX A;  3FRN A;  2P0Q A;  3BK9 A;  3V8L A;  4II1 A;  4HN9 A;  3Q1J A;  3QZ5 B;  1Q86 C;  1YHQ A;  3FB9 A;  3QC9 A;  2Q9Q D;  4XTY A;  3RC8 A;  5LJ3 f;  2UXN B;  2KXP B;  3LGF A;  2CWO A;  1O3X A;  3L09 A;  4JDS A;  4M7A G;  1UGS B;  3K3N A;  1ZHC A;  4Y28 E;  1D0X A;  2DAQ A;  2LC4 A;  3KBU A;  4AQF A;  4BDY A;  2C5K T;  1G3T A;  3RYI E;  5JH7 E;  4J6W A;  4QVC A;  2HQE A;  3A8M B;  4ZI3 D;  1G73 A;  3LK4 2;  4TUY E;  3ZMZ B;  3MEW A;  1Y71 A;  4E7L A;  3BQK A;  2NW8 A;  1KQS S;  5FP3 A;  2DNX A;  3PUR A;  1M9S A;  5EK3 A;  3ZYL A;  4N78 D;  2K48 A;  2OTL A;  3C4X A;  1BIB A;  4UVC B;  3CX8 B;  1WQ7 A;  3RKW A;  4C92 E;  3QK6 A;  4ELZ C;  3D0T A;  3DJB A;  1I4K 1;  1R8O B;  3I56 T;  5L3E B;  2ZZD A;  2EYQ A;  1HXD A;  1VQP T;  3EDV A;  2ES0 A;  3H3A A;  2KWI B;  4UVB B;  5JDL A;  1O9S A;  3KBT A;  3WXM B;  4BB7 A;  1EZ3 A;  1HTJ F;  3R6N A;  4EZ4 A;  2XAQ B;  5A2Q E;  3FBZ A;  2KVQ G;  2MYS A;  4X9D A;  1YCY A;  5J1G A;  1YW0 A;  4TVR A;  4E7J A;  4OB0 B;  5KCH A;  4WBN E;  2JZ2 A;  1X75 C;  2ZPG B;  4C5H A;  5CA0 E;  2LE8 A;  2E8I A;  3X20 B;  1YBY A;  3UUL A;  1Y96 B;  2OTJ T;  4BI3 A;  3L2R A;  2E65 A;  1Q81 C;  2ZM2 A;  2DIQ A;  4C92 F;  3MA9 A;  4IE0 A;  3CC2 A;  3WVD B;  4MDW A;  3OW2 S;  4NS5 A;  5L3G B;  2VAS A;  3KFW X;  4X1Y E;  2EHO C;  2CKK A;  2XAS B;  4A53 A;  4M77 F;  3N2G E;  5KE3 A;  5HAX A;  2K3Y A;  2YEV C;  4WNK A;  1YJ9 A;  1I81 A;  1YIT A;  1K9M C;  2L5Q A;  4XBF B;  3ZCI A;  4FSX A;  2HPJ A;  1WRD A;  3DP7 A;  4M75 F;  2Z6E A;  3QJY A;  4DOW A;  5GAM g;  1KQ1 A;  4X1I E;  2EQJ A;  1D1B A;  4C92 D;  3MEA A;  3NRY A;  4UEM A;  4QHO A;  4PLL A;  3ANW B;  4RG8 A;  4OF1 A;  1UCU A;  4E7K A;  3ETV A;  4M78 E;  2D5U A;  2L8D A;  2DWK A;  3AVS A;  2DXU A;  3JCM f;  4E7S A;  1YJW T;  2QGS A;  3JCM d;  2P0K A;  4LDY A;  1U1T A;  2D9T A;  2CYZ B;  4CI2 B;  1LOJ A;  5LBQ B;  4OGE A;  2RI5 A;  2A72 A;  4PJO F;  3M53 A;  2LOS A;  2YU1 A;  2LQK A;  2VGM A;  3I0Q A;  4AI6 A;  3WAJ A;  5JRC A;  4QVD A;  2JRK A;  2JVV A;  3EVY A;  4LDX A;  4AKH A;  3U3I A;  3AB3 B;  2LRQ A;  4YJ2 E;  5CR2 A;  2O4X A;  1WLX A;  3P8B B;  3L42 A;  4CZZ B;  2IC6 A;  4M77 E;  5AYF A;  3I55 T;  4H9S E;  3SOL A;  1SA0 E;  4PK6 A;  5JDQ A;  2DD4 A;  3OYG A;  4IIJ E;  4I43 B;  2ZPB B;  2EFI A;  4AQG A;  4B9W A;  2M1H A;  1LNX A;  2VKH A;  2DIG A;  3CXC A;  4FIB A;  1KD1 U;  4I50 E;  2EIF A;  5GAN f;  3FIF A;  5GAM f;  1KC8 C;  4OHF A;  1W4S A;  4P5N A;  3BFM A;  3J9X 1;  1TH7 A;  2E9X B;  1X6O A;  4IKF A;  1PSE A;  3LJC A;  3ANW A;  4IUV A;  4UEL A;  3C94 A;  3M54 A;  4XTW A;  4P0B A;  3N9N A;  4OYJ A;  2EAY A;  3JB9 G;  2WSS V;  5DJQ C;  3TRE A;  3JAM E;  2X0L B;  3IHR A;  2GK9 A;  1G5V A;  1KQS A;  2P9B A;  5GAM h;  5HYA A;  2ZM8 A;  3OYX A;  1QVP A;  3QJ6 A;  3X28 B;  4X34 A;  1VIE A;  3M59 A;  3WI3 A;  4BUG A;  2RI2 A;  2XID A;  2W62 A;  3RRW A;  2RB6 A;  1VQK T;  3HL8 A;  4OB2 B;  3UUM A;  3PFS A;  2K4Y A;  2RJE A;  4PNO A;  4EYY R;  1S94 A;  1O75 A;  3PIO A;  2EJ9 A;  3C50 A;  2LSY A;  4Z02 A;  2D0U A;  2M67 A;  4ZOL E;  2GCX A;  2H7V C;  5FXX A;  1N9R A;  5EK2 A;  4QXH B;  2Y4Y A;  2QEX A;  2Y8D A;  3TU4 K;  4PJO D;  1ZEE A;  3MP1 A;  4NUV A;  2QTX A;  4IE7 A;  4DOV A;  3OYY A;  4PJJ A;  5L2L A;  4BAY B;  4G2A A;  5CKD A;  2BVL A;  4JJN K;  4J6Y A;  2R57 A;  1YD8 G;  3RMS A;  3ETU A;  4HKA A;  4IHJ E;  1VQ9 A;  3A5Z B;  1XNI A;  2CLY C;  5FMN A;  4J7I A;  3CCQ T;  1YI2 T;  2Y4X A;  4EIW A;  2DTO A;  3N5L A;  1VRB A;  3JCM P;  2CZ7 B;  4XU3 A;  3OYK A;  2KDS A;  5GMK m;  2XHE B;  3O8V A;  5TAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...