2NW8A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
266
structure length
266
Chain Sequence
EGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
total genus 105
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw8A00
2NOXA 2X67A 2V7KA 2NW9A 2X68A 4PK5A 2D0TA 2V7LA 5ETWA 5EK4A 3BK9A 2X66A 2V7MA 2D0UA 5EK3A 2NWBA 1YW0A 4U74A 4PK6A 1ZEEA 5EK2A 2V7IA 3E08A 4PW8A 2NW8A 4HKAA 2V7JA 2NW7A 4U72A
chains in the Genus database with same CATH superfamily
4LF9T 2IAKA 4L9IA 2K24A 4ZS2A 3KDSE 3RQUA 4HWIB 4BJMA 1O3XA 2K3WA 1FIOA 4TNVA 4WW0A 4I55E 1BR1A 3E08A 4OK0A 2W63A 1UX5A 4X64T 4DBQA 4ZZBA 5AQHB 5LB7B 2K5BB 2WZHA 2X0HA 1SHZC 3EDUA 2NW9A 3RIAA 3LDQB 1GQEA 2WDQA 3LSVA 4YLHA 1IJ6A 4HWCA 1D0YA 2CBIA 2XQ7A 3HA4A 3Q5EA 2OA5A 4J2CA 4YSYA 4ZS3A 3N9LA 4E7SA 5AQFB 4ILCA 4U2YA 4FJOA 3LG7A 2LJLA 5DABA 4F8HA 4MFRA 4KHPT 1WRDA 3ZMTB 2VKOA 2YKSA 3CQCB 4LMKA 4AKGA 4EXTA 2M6IA 2DLRA 2DHRA 2HH7A 2BKOA 3J7Yq 5CGMA 1Y64B 2J62A 1VCSA 4Z90A 4DV4T 4DR6T 5DQWA 4EV6A 1XMOT 2W67A 3PUXF 1D0XA 4GKJT 1NWMX 3PUVF 2IW5B 3RI5A 4MALA 4L5GA 3AVSA 3N2OA 2MPKA 1HX1B 4X1IE 4UVCB 4UVAB 5JDNA 2QVAA 1HR0T 4HWHA 4JV5T 3PUYF 3SFDA 4HEAA 5HWXA 3NRYA 2W62A 4PNIA 4H63H 2ZM6T 3ZSTA 4XBFB 1IBMT 3BQLA 3UU8A 3PUAA 1T7SA 3ANWA 3AEFA 2CXLA 3PV0F 3ZSSA 2YK0A 2XSBA 2CLYB 2RA1A 4A97A 3ETUA 2V6XA 5HCJA 3OYXA 3FZLB 3KV5A 3JADA 2Y6XA 3HR0A 3EI0A 4DR5T 4HWFA 4NIQA 1EZ3A 3WAKA 5JDGA 3C51A 1UGOA 5FY7A 4HFEA 3UT5E 4AKRB 4AKIA 2F4VT 3HKCE 2LSGA 1N33T 4X62T 3K1SA 4ZHQE 2KWIB 4HFCA 2C0SA 5L47A 1I6ZA 4O8SA 3CWZB 3CQGB 4GK5E 3JAEA 5FL0A 3NVOA 5L2LA 2CBJA 3PURA 2X51A 1HG2A 3RQWA 1LVFA 4PW8A 2KNDA 1QSDA 1XZYA 2CEAA 4LMJA 1WYBA 4PJNA 5HAXA 2VB6A 3KV6A 4Z91A 2XQAA 3BQIA 3ZMSB 1ZP0A 2A2FX 5IHYA 4DV7T 4DV6T 3CK6A 3H3AA 4HKAA 4P0BA 3AE5A 3TLUA 4IL9A 2EHOD 4JI3T 3FXDB 4U7YA 5J2TE 2Y8DA 5JDQA 3AAIA 2M6BA 2XM2A 3RYIE 4GKKT 1WFDA 4IDQA 3ZYLA 2DWKA 4I43B 5KXJA 3F2EA 1YXRA 5AQLB 2UUBT 5FXZA 4NUVA 4X1KE 4YT0A 4U72A 2YDQA 4U7IA 2EHOC 4JI1T 4KBMB 5J2UE 2WB5A 5AQJB 4H9PC 3HKBE 2CRBA 4JI4T 2WBLA 5FY0A 3LK42 2XAGB 4WZXA 2IC6A 4LF7T 3K3NA 3FXEB 4UIGA 1MIWA 2KMFA 5JR9B 4DR4T 5HYAA 4UELA 2Z6EA 5LBQB 4IDPA 4Q25A 2UXBT 3ZYKA 3RKGA 3ANWB 3NBXX 5AQTB 4IE4A 4IL4A 4IHJE 2CLYC 3GMIA 5J0ZA 4H9QC 1XNQT 3D0TA 4MBQA 3R6NA 1OWAA 3JAFA 3M65A 4U2ZA 4GYRA 1HF8A 4UV9B 2XQ6A 5L3BB 1LVKA 2X68A 2NTYA 3AA7B 4DIDB 2FJBA 3GN5A 2WM9A 5CB4E 3BK9A 5AQSB 3MACA 2N2NA 2XQ9A 3ZT6A 4QH5A 4UV8B 3TLWA 4ZI3D 4V1Av 4AISA 2V7KA 4LFBT 4B3TT 1IAPA 3RF1A 3ZCIA 5AQNB 2AXDS 1YKEB 5L3CB 1ZEEA 3ZT7A 3AEGA 5AQIB 4WBOA 1LRZA 4ZI3C 4QHOA 4KMCA 1KEYA 2KZ7B 3ONJA 1N34T 4TUYE 4ERRA 5L3GB 2FJAA 3ZCJA 5M4YA 2VVNA 4TWHA 5L4EA 4COFA 3ZMZB 4EB6E 3MKDA 4O2BE 4EEDA 3MXZA 2MAWA 1T98A 2BBJA 2ODUA 5JQGE 2VL8A 3CX6B 1HG5A 2XQ4A 4ADZA 2DCFA 4CXXA 1QLBA 2E9XD 2D9DA 2VKJA 4F6RC 1MMDA 2XASB 1XMQT 3SS1A 5AQMB 4JI5T 2QA7A 3IA3A 1HNZT 2D0UA 1M7KA 2PFVA 2XJ7A 2YINA 1MMAA 3ZC1A 1L0VA 2E9XC 2PTFA 5H6QB 2X0LB 1X9BA 4CXYA 4I0UA 4UVBB 4HFHA 2J47A 5C3JA 4X20E 4QXBB 3IHRA 1HNWT 4JLEA 4YHHT 2UXCT 3C50A 1FMWA 5F5WA 5HXRA 5IYZE 3ZPOA 4L0RA 5GONE 2IMLA 4OX9T 4B3ST 4IDOA 5KX5E 2VVSA 1N32T 4A56A 2X9XA 5LG3A 3ZMVB 1HNXT 3ONLC 4EYUA 3UUBA 4A5XA 3VRBA 2WU2A 4HWDA 2HPJA 2I59A 5FP3A 2N1GA 1Z0PA 1FMVA 3A5XA 5CA1E 5ABHA 4PK4A 4PAGA 5FYMA 1W0BA 3CMLA 2W0GA 3GN5B 2KSRA 4DMVA 5BR8T 4OYJA 3RRCA 4EZHA 2DNXA 1BR0A 2LOSA 4DV5T 2LSKA 1ZOYA 3KBUA 2Q9QD 1E2AA 3PJAJ 1BR2A 4DO0A 1XWMA 5E0OA 2RP4A 3ZC0A 1NAFA 5FMNA 2LM9A 2PBIA 2V5CA 3P4QA 5ABGA 1HTJF 5FKYA 2VURA 4KI0F 1U5PA 2BVLA 4NUUA 2WY2A 3K3QC 2Q9QC 2DL1A 4IDNA 3OKQA 2LLYA 4QX8B 2H3RA 2OV9A 3SRZA 3KFWX 3HI2A 3J9X1 2NOXA 4DR7T 2BVMA 4AQFA 3BQKA 3ZJ1A 1DU2A 1D1AA 1FJGT 3P7IA 3AE7A 2LSYA 3T8OA 1G73A 2V7IA 2XAJB 4EOZB 3RPUA 3E0ZA 2VQET 5FXXA 1M62A 3UU5A 5AQOB 2L8KA 3UQ7A 1W09A 3X1DA 3OTOT 3VR9A 4OHFA 4ZI2D 4KP3C 3FZKB 1WR6A 1HS7A 3ESLA 3HKDE 2XPKA 4DUYT 5JR9A 5JH7E 3KBTA 1SUMB 3U78A 4P09A 4YTMA 4DR2T 3PUGA 4CN1A 5IUXA 4U33A 2VASA 2L9QA 2A9UA 3C4WA 2DI4A 2JQ9A 4DVDA 1CUNA 4ZI2C 4C90A 4YFSA 1YQ4A 4U31A 2YU2A 3C4XA 1LKXA 3HL6A 5JDHA 3AA6B 5HEGA 1IBKT 2V7MA 3OJAA 4YTNA 1OEDB 4YSXA 4TX5A 2V6YA 5L3FB 4H9OC 3CIRA 4JI7T 2IUBA 3AECA 2JQKA 4AXPA 4UR9A 4KX6A 1HFAA 1W0AA 3F57A 2WP9A 3VKHA 3RX6A 3KINB 3UFGA 5LXTE 5EK4A 2C5JA 2ACZA 4BAYB 2CWOA 3N9QA 4TWFA 5HEJA 3MA9A 1Z8UA 4OYKA 3F31A 5JDLA 4B3RT 3UU6A 3PUQA 5F3JA 2VKDA 3GWHA 2BS2A 2GK9A 4U74A 3B5MA 3NRXA 2LT3A 4YSZA 3K3OA 5L4HA 4LF4T 3RH3A 2XM1A 2V1DB 4HFBA 2WZIA 2VWAA 2E5VA 3AE9A 2BBHA 3L8RA 1UUSA 1FEWA 2XAFB 3EHZA 5ABFA 3UFEA 3PU8A 2FJDA 3AE8A 1WYCA 3UULA 1UURA 3ZT5A 5LGUB 4MHCA 3OYZA 5TAOA 3Q5XA 2SPCA 5FXVA 4CXWA 3AEBA 4GOUA 5LG4A 4XAXB 2LOPA 3QNUA 3ONXA 3TLSA 5HXSA 2W4XA 4PK6A 1S35A 5EK2A 2CHNA 2LSJA 2XQ3A 3L3PA 3S4UA 4CI2B 2V26A 2JQQA 1YQ3A 4TNWA 2XY8B 2D0TA 4H9NC 2JIWA 2YN6A 2JMHA 5ETWA 1N36T 3AEAA 3KVAA 3P4RA 2DWGA 4AQGA 4HGAA 3CVRA 5LYJE 4X66T 1NEKA 5AQUB 3AXJA 2CM0A 3C98B 2KXPB 3AE4A 5JVDE 2K9AA 2UXNB 5C8YE 2CWYA 4XZCA 4K0KT 1IBLT 5LBMA 2HN1A 3N9NA 5L3EB 4LF6T 3RIUA 3QOFA 2XTLA 2LHNA 2QRXA 3V5SA 4EIWA 2V6YB 3AEEA 3PUWF 5AQQB 5LMUT 4QXHB 1IJ5A 4JI8T 5H6RB 2XUEA 4PJJA 3RYCE 3RC3A 4YHJA 1T72A 4DV3T 2BG9B 4IE0A 4LF5T 4JUYA 5KDMC 4IGUA 3T1HT 1J5ET 3K8PC 5LOVE 3Q5WA 5JRCB 5LGTB 3PUZF 3RKOA 4AKHA 4G2AA 3RYFE 1XNRT 3GA8A 4JBWF 4CI3B 2LE8A 2WQYA 2NR4A 2HPLA 1G8XA 3EVYA 3P4WA 2XAHB 3IBPA 5ABFB 4KUMB 4GYSA 4JI2T 3AE2A 2CXFA 4ISSA 4B6XA 3KV9A 4PK5A 2LKHA 2WAUA 2YU1A 4QX7B 4DMWA 1OXZA 5FNVE 1VCTA 3RGLA 4B3MT 4DBRA 2M67A 4WYVA 4P1NA 3ZEFB 1UK5A 2RPAA 1KNZA 1XDPA 3QUJA 3AAEB 4QH1A 4AQFC 3JCFA 5LNKA 3VU7H 2EHOA 3I9YA 1YW0A 4ZI7E 2X9WA 3LK2B 4I50E 1ZV4X 3CX8B 4LFCT 2CHOA 5AQRB 3Q5DA 2JQHA 4P0AA 3TKLB 3ZMUB 2NTXA 2CA5A 3AXJB 2YDSA 3P50A 4EYYR 3DJBA 3LBXA 5JR9C 4JI0T 3OPCA 2QGSA 3RRWA 4JEUB 3ABVA 4LFAT 4NXMT 2KWHA 2CE7A 2G0UA 1OEDA 4YXDA 5EK3A 4HN9A 1YKHB 4IDZA 2MTQA 3KV4A 5FVKA 4QWNB 1US7B 3ZN1B 4NPPA 3IEEA 4HFDA 3FBLA 3VHLA 2XHEB 3LFMA 3AE3A 5LJNA 4MLKA 2ZLYA 2W00A 5LP6E 1D1BA 3SOLA 2BDEA 2X0YA 2J4GA 3QB5A 3ZJ2A 2CPTA 3Q2MA 5HEHA 4KHZF 4X5TA 1MMNA 2HN2A 3LK3B 2VL0A 5JREA 3N9OA 4UEMA 2UU9T 4PFOA 4CI1B 1SA0E 2XAQB 5HCMA 4DUZT 5CA0E 3QB5K 2CCQA 3I0QA 4ILAA 3FBZA 2LEHA 3PJAA 3FB2A 3UUNA 1MNDA 5FVLA 3UTKA 2W61A 4FI5A 3Q9DA 4ILUA 4O4IE 2VQFT 3AEDA 4Z8XA 2H7OA 1SE7A 3MJXA 3AA1B 2NP9A 4PJLA 4YJ2E 5CFBA 4ZEYA 4AKLA 1JNRA 4JEHB 2X66A 3W15B 3H37A 3SFEA 2J1DG 4GK0E 5BMVE 3QK6A 2FBWA 2C5IT 4G63A 2BZBA 2A3DA 3VR8A 5HXHA 2W66A 5FL1A 4IREA 3ZN0B 4O4JE 2I0MA 3JC6D 2I6HA 2WWUA 3FHNA 3TLVA 2EHOB 2BS4A 5J1GA 4IE6A 3A8YC 2E9XA 3IF8B 1V9DA 2BKNA 5HEUA 2JMKA 5HXEA 4H63V 3NZPA 3JC6C 3OBVE 4ANJA 1KNRA 4CN6A 2OLTA 4IIJE 2AE9A 2UUCT 2VK9A 3LBXB 2KLQA 4ILBA 3MZKB 2ACXA 3O1IA 3M3ZB 4ZOLE 2E2AA 3NKZA 4O4LE 3RHWA 1WR0A 2BKPA 4DV2T 2NWBA 2B76A 4M1PA 3FZHB 1B7TA 5HWYA 2A72A 2CXDA 3G06A 1VRBA 5ABEA 1MMGA 1Y01A 1CHUA 3RIUC 3TLTA 5LHGB 2BG9A 3O9XA 3AB3B 3MK7C 3DP7A 3L09A 4IE7A 4CZZB 4CQIA 5JTGA 1H7CA 4AI6A 5ADXL 3P4SA 2V7JA 5JRCA 3N9PA 2H7VC 2XZEA 1OEDE 3P4PA 5AQPB 4TV8E 2V7LA 2IHR1 3I0OA 2WU5A 4TV9E 4IE5A 2W2UA 2WSSV 2D2SA 3PUSA 2WMOA 3RC8A 1E7PA 5C2TA 2V5DA 1JNZA 3EAMA 1ZKEA 3PDYA 3DTOA 3AE1A 1BR4A 4X1YE 1U4QA 4YY3T 2MYSA 1MNEA 3WI3A 2Q9QA 2KINB 2MOZA 3UQ4A 5LJMA 2ODVA 1I94T 4ISTA 1YD8G 2UXDT 3H3MA 5HXCA 4HE8A 2LM2A 1J1JA 2ZMAA 4QXCB 2ZM8A 1R8IA 3UU4A 3O1JA 4O4HE 2XSAA 4OFZA 3O4XE 1HCIA 4HFIA 2E5LT 5LMNT 3KVBA 2JPFA 3AAAB 3NWIA 1XDOA 2XQ8A 2WDVA 3P8CD 3ZYMA 2X67A 1QUUA 5DJQC 5EZYE 2Y48B 3AA0B 4LF8T 3PE0A 2E9XB 4IT4A 3RIFA 4EAHA 5JDFA 1KF6A 3SWHA 2C5KT 4YJ3E 4UF0A 2WDRA 2HHHT 3EUHA 5LA6E 3C64A 2YEVC 4EEBA 2WMNA 4NXNT 4LMLA 4QH4A 3RLFF 4A98A 1VOMA 2X9YA 2LSIA 2LRLA 5LHIB 4EGWA 2NW8A 4DV0T 2JRKA 1NENA 2IIUA 1OEDC 3ETVA 3B13A 1X79A 2IDOB 2R6GF 2V8SV 3ZLIA 2E8IA 2UUAT 1HX8A 5IWAT 3UUXB 4X65T 3I9WA 3CQXC 3WAJA 3N5LA 5FY1A 1UX4A 2ZM2A 5AQGB 3CX7B 4PFPA 4CN4A 2FUPA 2LKGA 4I4TE 2ES0A 2D5UA 2WCAA 3AE6A 2NW7A 2BG9E 2UXXB 5LCYA 2IC9A 5KMGP 2XQYA 4ZXLA 4WBNE 2BS3A 4DR3T 1E1HB 3A7MA 3R84B 3FZFB 2YDRA 3RYHE 3VKGA 3UUMA 4N78D 4BJNA 2QYWA 3PTRB 4AIUA 3AVRA 4DV1T 4E7ZA 3HKEE 2Q9QB 1IZNB 3QC9A 3T1YT 4TZ4C 1J5WA 2P9BA 2H89A 3U3IA 3N2KE 4H9RC 3B57A 4YTPA 3NZQA 3EABA 4JI6T 2KT9A 2B1EA 5AFUL 3FZMB 4ZZCA 4TWDA 2YOEA 4U3CA 3UU3A 3N2GE 5AQVB 5LHHB 5JDMA 2K48A 4H9SE 4JYAT 2LHRA 1KK7A 1S94A 2WWVA 3CKDA 1WLXA 5HEOA 1W9RA 2PG8A 2X9HA 2CMRA 3EDVA 3LJCA 2MBGA 4TN7B 3VRAA 3C4ZA 3E22E 4PJMA 4HTEA 5F8PA 1T8BA 1UCUA 5FXWA 4AQYT 4UXNB 4DNDA 5L3DB 5A1LA 4UF0B 1ZHCA 3N9MA 1AJ3A 4QKNA 2PJQA 2H88A 2VKHA 5DQVA 2XQ5A 2WS3A 2LRKA 1D0ZA 4HFVA 4ASKA 1WCRA 1KNPA 4EZ4A 3O1HA 2N9DA 1KFYA 4K0UA 4DR1T 3PU3A 3OVUA 5AQKB 3V5UA 4BA9A 2L3LA 1MIYA 5CJ5A 2FJEA 2ZM0A 4O2AE 2BG9C 3ZKRA 5LGNB 3I1AA 4WNKA 3CPZA 4C91A 4GIWA 1D1CA 3L39A 1MIVA 2JJ9A
chains in the Genus database with same CATH topology
2CM0A 5JQGE 1MMGA 2VL8A 3C98B 2KXPB 3CX6B 2IAKA 4L9IA 2K24A 5JVDE 2K9AA 5LHGB 4ZS2A 3KDSE 2UXNB 4BJMA 5C8YE 1O3XA 3O9XA 3AB3B 1FIOA 3MK7C 4WW0A 2CWYA 1HG5A 3DP7A 4I55E 4XZCA 3L09A 4IE7A 4CZZB 1BR1A 4CQIA 3E08A 4ADZA 5LBMA 2DCFA 4OK0A 4CXXA 2W63A 1H7CA 3N9NA 4AI6A 5ADXL 1UX5A 4DBQA 2E9XD 2VKJA 4F6RC 1MMDA 2V7JA 2XASB 3SS1A 2K5BB 5JRCA 3N9PA 2H7VC 1SHZC 3EDUA 2NW9A 5L3EB 4TV8E 2V7LA 4YLHA 1IJ6A 3I0OA 2QA7A 1D0YA 4TV9E 2D0UA 3HA4A 4IE5A 2XTLA 2LHNA 2OA5A 4J2CA 2PFVA 2WSSV 2D2SA 2YINA 1MMAA 3N9LA 4ZS3A 3ZC1A 4E7SA 4FJOA 3LG7A 2LJLA 3PUSA 5DABA 4MFRA 2E9XC 1WRDA 5H6QB 2WMOA 3V5SA 3RC8A 4EIWA 2X0LB 3ZMTB 4CXYA 2VKOA 4UVBB 3CQCB 4X20E 4AKGA 4EXTA 4QXBB 2DLRA 4QXHB 1ZKEA 2DHRA 3IHRA 3PDYA 1IJ5A 2HH7A 2XUEA 4JLEA 4PJJA 5H6RB 3RC3A 3RYCE 4YHJA 3J7Yq 3DTOA 3C50A 1Y64B 1BR4A 4X1YE 1FMWA 5HXRA 5IYZE 3ZPOA 4L0RA 1U4QA 5GONE 4IE0A 5DQWA 2MYSA 1MNEA 3WI3A 2Q9QA 4JUYA 5KDMC 4IGUA 2KINB 2MOZA 5KX5E 5LJMA 1D0XA 3K8PC 2ODVA 5LOVE 4ISTA 1NWMX 1YD8G 3Q5WA 2IW5B 5JRCB 4A56A 5LGTB 5HXCA 2X9XA 4HE8A 3RKOA 4AKHA 3ZMVB 2ZMAA 4G2AA 4MALA 4L5GA 4EYUA 3AVSA 3RYFE 4QXCB 2ZM8A 3GA8A 3N2OA 4X1IE 3O1JA 4O4HE 4CI3B 4UVCB 4OFZA 2HPJA 2I59A 5FP3A 4UVAB 2LE8A 2N1GA 5JDNA 1Z0PA 3O4XE 1FMVA 1HCIA 3A5XA 4HEAA 5HWXA 3NRYA 2W62A 5CA1E 4PNIA 3KVBA 4H63H 4XBFB 4PK4A 3BQLA 2JPFA 2HPLA 1G8XA 4PAGA 5FYMA 3AAAB 3CMLA 2W0GA 3EVYA 3GN5B 3PUAA 4DMVA 2XAHB 3IBPA 3ANWA 4OYJA 4KUMB 3RRCA 4GYSA 4EZHA 2CXLA 2YK0A 2CXFA 2DNXA 4ISSA 3P8CD 2CLYB 3ZYMA 2RA1A 2X67A 1BR0A 1QUUA 5DJQC 2LOSA 4B6XA 3KV9A 4PK5A 3ETUA 2WAUA 5EZYE 2YU1A 2Y48B 4QX7B 4DMWA 1OXZA 5FNVE 3AA0B 3OYXA 3KV5A 3PE0A 2E9XB 2LSKA 4DBRA 4EAHA 2Y6XA 5JDFA 3HR0A 2M67A 3KBUA 2Q9QD 1BR2A 4DO0A 3ZEFB 3SWHA 2C5KT 1KNZA 5E0OA 2RP4A 4YJ3E 3QUJA 1EZ3A 4UF0A 3AAEB 4AQFC 3ZC0A 1NAFA 5FMNA 2LM9A 2PBIA 1HTJF 3EUHA 5LA6E 3WAKA 3C64A 5LNKA 3VU7H 2YEVC 5JDGA 1U5PA 2BVLA 2WMNA 4NUUA 2EHOA 3C51A 5FY7A 3I9YA 3UT5E 1VOMA 2X9YA 1YW0A 3K3QC 2LSIA 4AKRB 2Q9QC 4ZI7E 2X9WA 5LHIB 4AKIA 3OKQA 3LK2B 4I50E 3HKCE 1ZV4X 4QX8B 2LSGA 2H3RA 3CX8B 2NW8A 3SRZA 3KFWX 2JRKA 4ZHQE 2KWIB 3HI2A 3J9X1 2NOXA 3ETVA 3B13A 2C0SA 2BVMA 1X79A 4O8SA 4P0AA 3TKLB 3CWZB 3BQKA 3ZJ1A 3ZMUB 4AQFA 3CQGB 4GK5E 1D1AA 2NTXA 3P7IA 2CA5A 2LSYA 5L2LA 4EYYR 3T8OA 3ZLIA 3PURA 2E8IA 2X51A 1G73A 1HG2A 2V7IA 3DJBA 2XAJB 3LBXA 5JR9C 1HX8A 1LVFA 4EOZB 4PW8A 3RPUA 2QGSA 2KNDA 1QSDA 3RRWA 3E0ZA 5FXXA 4JEUB 3UUXB 3I9WA 3CQXC 3WAJA 3N5LA 5FY1A 1UX4A 2CEAA 2KWHA 2CE7A 2ZM2A 2G0UA 3CX7B 1WYBA 2L8KA 4PFPA 4PJNA 5HAXA 2VB6A 3KV6A 5EK3A 4HN9A 4OHFA 1YKHB 4ZI2D 3BQIA 4KP3C 4IDZA 3ZMSB 4I4TE 2A2FX 2ES0A 1WR6A 5IHYA 2D5UA 2MTQA 1HS7A 3KV4A 3ESLA 3H3AA 3HKDE 4HKAA 5JR9A 5JH7E 2NW7A 4QWNB 1US7B 3ZN1B 3KBTA 3IEEA 4P0BA 2EHOD 3FBLA 2UXXB 3VHLA 5LCYA 3U78A 4P09A 2XHEB 3FXDB 3LFMA 2IC9A 5KMGP 5LJNA 5J2TE 2XQYA 2Y8DA 4WBNE 5JDQA 3PUGA 3AAIA 1E1HB 3RYIE 4MLKA 2ZLYA 3R84B 2VASA 2W00A 3ZYLA 2L9QA 5LP6E 3C4WA 3RYHE 3VKGA 2DI4A 1D1BA 4DVDA 1CUNA 4ZI2C 2DWKA 3SOLA 4I43B 3UUMA 2BDEA 4N78D 3F2EA 4BJNA 4C90A 5FXZA 4NUVA 4X1KE 3ZJ2A 3PTRB 4YFSA 4U72A 2YU2A 3C4XA 1LKXA 3HL6A 3Q2MA 3AVRA 5JDHA 2EHOC 4E7ZA 3HKEE 2Q9QB 4KBMB 1MMNA 3LK3B 5JREA 1IZNB 3QC9A 5J2UE 3AA6B 4TZ4C 4H9PC 2P9BA 3N9OA 3HKBE 2V7MA 3OJAA 4UEMA 2WBLA 5FY0A 3LK42 3U3IA 4TX5A 2XAGB 4PFOA 3N2KE 5L3FB 4CI1B 4H9OC 1SA0E 2XAQB 2IC6A 5CA0E 2CCQA 4H9RC 3I0QA 3K3NA 4AXPA 3FXEB 3B57A 3FBZA 1HFAA 2LEHA 4UIGA 3F57A 1MIWA 3NZQA 3VKHA 3FB2A 2KMFA 1MNDA 3UUNA 5JR9B 2KT9A 2B1EA 3RX6A 5HYAA 3KINB 5LXTE 5EK4A 5AFUL 2C5JA 4UELA 3UTKA 2Z6EA 5LBQB 2W61A 4BAYB 4FI5A 2CWOA 3N9QA 3Q9DA 4ILUA 4O4IE 3N2GE 5LHHB 3ZYKA 4Z8XA 5JDMA 2H7OA 2K48A 4H9SE 2LHRA 1KK7A 1S94A 3MA9A 3MJXA 3AA1B 4OYKA 3ANWB 3F31A 3CKDA 1WLXA 5JDLA 3NBXX 2NP9A 4PJLA 4IE4A 3PUQA 5F3JA 4IHJE 2VKDA 2CLYC 3GMIA 4YJ2E 4AKLA 4H9QC 4JEHB 3D0TA 2PG8A 2X66A 3GWHA 3W15B 2X9HA 4MBQA 2GK9A 4U74A 3H37A 3R6NA 2CMRA 3EDVA 3LJCA 3NRXA 2LT3A 2MBGA 4TN7B 2J1DG 3C4ZA 4GK0E 1OWAA 5BMVE 3M65A 3K3OA 3QK6A 3E22E 2C5IT 4PJMA 3RH3A 4G63A 4HTEA 4GYRA 5F8PA 2BZBA 2V1DB 1UCUA 1HF8A 2VWAA 4UV9B 5FXWA 4UXNB 5L3BB 2A3DA 4DNDA 1LVKA 5L3DB 2X68A 5HXHA 5A1LA 1FEWA 2NTYA 3AA7B 3GN5A 2WM9A 2XAFB 4UF0B 1ZHCA 3N9MA 5CB4E 3ZN0B 4O4JE 1AJ3A 4QKNA 3BK9A 3UFEA 2PJQA 2VKHA 3JC6D 5DQVA 2WWUA 3MACA 3PU8A 2N2NA 3FHNA 2EHOB 1WYCA 5J1GA 3UULA 5LGUB 4MHCA 1D0ZA 3OYZA 4IE6A 3Q5XA 5TAOA 2SPCA 4UV8B 4HFVA 5FXVA 4ZI3D 4V1Av 4ASKA 2E9XA 4CXWA 3IF8B 2V7KA 4GOUA 4EZ4A 5LG4A 1V9DA 3O1HA 4XAXB 1IAPA 2N9DA 4K0UA 2LOPA 3ZCIA 2JMKA 5HXEA 4H63V 3PU3A 3NZPA 3ONXA 1YKEB 3JC6C 5HXSA 5L3CB 4PK6A 1ZEEA 1S35A 3OBVE 3V5UA 4ANJA 5EK2A 4BA9A 2L3LA 2LSJA 4IIJE 1MIYA 4WBOA 3L3PA 3S4UA 4CI2B 2V26A 1LRZA 2ZM0A 2VK9A 4O2AE 4QHOA 3LBXB 2JQQA 2KLQA 4ZI3C 4KMCA 2KZ7B 3MZKB 2ACXA 5LGNB 2D0TA 3O1IA 3I1AA 4H9NC 4WNKA 4TUYE 4ZOLE 4ERRA 2JMHA 5L3GB 5ETWA 3ZCJA 5M4YA 4O4LE 3CPZA 2NWBA 4M1PA 4C91A 3KVAA 4GIWA 2DWGA 1D1CA 3ZMZB 4AQGA 4HGAA 1B7TA 5HWYA 1MIVA 3CVRA 4EB6E 3MKDA 4O2BE 2A72A 3MXZA 5LYJE 1T98A 2JJ9A 2CXDA 2ODUA 1VRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOX A;  2X67 A;  2V7K A;  2NW9 A;  2X68 A;  4PK5 A;  2D0T A;  2V7L A;  5ETW A;  5EK4 A;  3BK9 A;  2X66 A;  2V7M A;  2D0U A;  5EK3 A;  2NWB A;  1YW0 A;  4U74 A;  4PK6 A;  1ZEE A;  5EK2 A;  2V7I A;  3E08 A;  4PW8 A;  2NW8 A;  4HKA A;  2V7J A;  2NW7 A;  4U72 A; 
#chains in the Genus database with same CATH topology
 4LF9 T;  2IAK A;  4L9I A;  2K24 A;  4ZS2 A;  3KDS E;  3RQU A;  4HWI B;  4BJM A;  1O3X A;  2K3W A;  1FIO A;  4TNV A;  4WW0 A;  4I55 E;  1BR1 A;  3E08 A;  4OK0 A;  2W63 A;  1UX5 A;  4X64 T;  4DBQ A;  4ZZB A;  5AQH B;  5LB7 B;  2K5B B;  2WZH A;  2X0H A;  1SHZ C;  3EDU A;  2NW9 A;  3RIA A;  3LDQ B;  1GQE A;  2WDQ A;  3LSV A;  4YLH A;  1IJ6 A;  4HWC A;  1D0Y A;  2CBI A;  2XQ7 A;  3HA4 A;  3Q5E A;  2OA5 A;  4J2C A;  4YSY A;  4ZS3 A;  3N9L A;  4E7S A;  5AQF B;  4ILC A;  4U2Y A;  4FJO A;  3LG7 A;  2LJL A;  5DAB A;  4F8H A;  4MFR A;  4KHP T;  1WRD A;  3ZMT B;  2VKO A;  2YKS A;  3CQC B;  4LMK A;  4AKG A;  4EXT A;  2M6I A;  2DLR A;  2DHR A;  2HH7 A;  2BKO A;  3J7Y q;  5CGM A;  1Y64 B;  2J62 A;  1VCS A;  4Z90 A;  4DV4 T;  4DR6 T;  5DQW A;  4EV6 A;  1XMO T;  2W67 A;  3PUX F;  1D0X A;  4GKJ T;  1NWM X;  3PUV F;  2IW5 B;  3RI5 A;  4MAL A;  4L5G A;  3AVS A;  3N2O A;  2MPK A;  1HX1 B;  4X1I E;  4UVC B;  4UVA B;  5JDN A;  2QVA A;  1HR0 T;  4HWH A;  4JV5 T;  3PUY F;  3SFD A;  4HEA A;  5HWX A;  3NRY A;  2W62 A;  4PNI A;  4H63 H;  2ZM6 T;  3ZST A;  4XBF B;  1IBM T;  3BQL A;  3UU8 A;  3PUA A;  1T7S A;  3ANW A;  3AEF A;  2CXL A;  3PV0 F;  3ZSS A;  2YK0 A;  2XSB A;  2CLY B;  2RA1 A;  4A97 A;  3ETU A;  2V6X A;  5HCJ A;  3OYX A;  3FZL B;  3KV5 A;  3JAD A;  2Y6X A;  3HR0 A;  3EI0 A;  4DR5 T;  4HWF A;  4NIQ A;  1EZ3 A;  3WAK A;  5JDG A;  3C51 A;  1UGO A;  5FY7 A;  4HFE A;  3UT5 E;  4AKR B;  4AKI A;  2F4V T;  3HKC E;  2LSG A;  1N33 T;  4X62 T;  3K1S A;  4ZHQ E;  2KWI B;  4HFC A;  2C0S A;  5L47 A;  1I6Z A;  4O8S A;  3CWZ B;  3CQG B;  4GK5 E;  3JAE A;  5FL0 A;  3NVO A;  5L2L A;  2CBJ A;  3PUR A;  2X51 A;  1HG2 A;  3RQW A;  1LVF A;  4PW8 A;  2KND A;  1QSD A;  1XZY A;  2CEA A;  4LMJ A;  1WYB A;  4PJN A;  5HAX A;  2VB6 A;  3KV6 A;  4Z91 A;  2XQA A;  3BQI A;  3ZMS B;  1ZP0 A;  2A2F X;  5IHY A;  4DV7 T;  4DV6 T;  3CK6 A;  3H3A A;  4HKA A;  4P0B A;  3AE5 A;  3TLU A;  4IL9 A;  2EHO D;  4JI3 T;  3FXD B;  4U7Y A;  5J2T E;  2Y8D A;  5JDQ A;  3AAI A;  2M6B A;  2XM2 A;  3RYI E;  4GKK T;  1WFD A;  4IDQ A;  3ZYL A;  2DWK A;  4I43 B;  5KXJ A;  3F2E A;  1YXR A;  5AQL B;  2UUB T;  5FXZ A;  4NUV A;  4X1K E;  4YT0 A;  4U72 A;  2YDQ A;  4U7I A;  2EHO C;  4JI1 T;  4KBM B;  5J2U E;  2WB5 A;  5AQJ B;  4H9P C;  3HKB E;  2CRB A;  4JI4 T;  2WBL A;  5FY0 A;  3LK4 2;  2XAG B;  4WZX A;  2IC6 A;  4LF7 T;  3K3N A;  3FXE B;  4UIG A;  1MIW A;  2KMF A;  5JR9 B;  4DR4 T;  5HYA A;  4UEL A;  2Z6E A;  5LBQ B;  4IDP A;  4Q25 A;  2UXB T;  3ZYK A;  3RKG A;  3ANW B;  3NBX X;  5AQT B;  4IE4 A;  4IL4 A;  4IHJ E;  2CLY C;  3GMI A;  5J0Z A;  4H9Q C;  1XNQ T;  3D0T A;  4MBQ A;  3R6N A;  1OWA A;  3JAF A;  3M65 A;  4U2Z A;  4GYR A;  1HF8 A;  4UV9 B;  2XQ6 A;  5L3B B;  1LVK A;  2X68 A;  2NTY A;  3AA7 B;  4DID B;  2FJB A;  3GN5 A;  2WM9 A;  5CB4 E;  3BK9 A;  5AQS B;  3MAC A;  2N2N A;  2XQ9 A;  3ZT6 A;  4QH5 A;  4UV8 B;  3TLW A;  4ZI3 D;  4V1A v;  4AIS A;  2V7K A;  4LFB T;  4B3T T;  1IAP A;  3RF1 A;  3ZCI A;  5AQN B;  2AXD S;  1YKE B;  5L3C B;  1ZEE A;  3ZT7 A;  3AEG A;  5AQI B;  4WBO A;  1LRZ A;  4ZI3 C;  4QHO A;  4KMC A;  1KEY A;  2KZ7 B;  3ONJ A;  1N34 T;  4TUY E;  4ERR A;  5L3G B;  2FJA A;  3ZCJ A;  5M4Y A;  2VVN A;  4TWH A;  5L4E A;  4COF A;  3ZMZ B;  4EB6 E;  3MKD A;  4O2B E;  4EED A;  3MXZ A;  2MAW A;  1T98 A;  2BBJ A;  2ODU A;  5JQG E;  2VL8 A;  3CX6 B;  1HG5 A;  2XQ4 A;  4ADZ A;  2DCF A;  4CXX A;  1QLB A;  2E9X D;  2D9D A;  2VKJ A;  4F6R C;  1MMD A;  2XAS B;  1XMQ T;  3SS1 A;  5AQM B;  4JI5 T;  2QA7 A;  3IA3 A;  1HNZ T;  2D0U A;  1M7K A;  2PFV A;  2XJ7 A;  2YIN A;  1MMA A;  3ZC1 A;  1L0V A;  2E9X C;  2PTF A;  5H6Q B;  2X0L B;  1X9B A;  4CXY A;  4I0U A;  4UVB B;  4HFH A;  2J47 A;  5C3J A;  4X20 E;  4QXB B;  3IHR A;  1HNW T;  4JLE A;  4YHH T;  2UXC T;  3C50 A;  1FMW A;  5F5W A;  5HXR A;  5IYZ E;  3ZPO A;  4L0R A;  5GON E;  2IML A;  4OX9 T;  4B3S T;  4IDO A;  5KX5 E;  2VVS A;  1N32 T;  4A56 A;  2X9X A;  5LG3 A;  3ZMV B;  1HNX T;  3ONL C;  4EYU A;  3UUB A;  4A5X A;  3VRB A;  2WU2 A;  4HWD A;  2HPJ A;  2I59 A;  5FP3 A;  2N1G A;  1Z0P A;  1FMV A;  3A5X A;  5CA1 E;  5ABH A;  4PK4 A;  4PAG A;  5FYM A;  1W0B A;  3CML A;  2W0G A;  3GN5 B;  2KSR A;  4DMV A;  5BR8 T;  4OYJ A;  3RRC A;  4EZH A;  2DNX A;  1BR0 A;  2LOS A;  4DV5 T;  2LSK A;  1ZOY A;  3KBU A;  2Q9Q D;  1E2A A;  3PJA J;  1BR2 A;  4DO0 A;  1XWM A;  5E0O A;  2RP4 A;  3ZC0 A;  1NAF A;  5FMN A;  2LM9 A;  2PBI A;  2V5C A;  3P4Q A;  5ABG A;  1HTJ F;  5FKY A;  2VUR A;  4KI0 F;  1U5P A;  2BVL A;  4NUU A;  2WY2 A;  3K3Q C;  2Q9Q C;  2DL1 A;  4IDN A;  3OKQ A;  2LLY A;  4QX8 B;  2H3R A;  2OV9 A;  3SRZ A;  3KFW X;  3HI2 A;  3J9X 1;  2NOX A;  4DR7 T;  2BVM A;  4AQF A;  3BQK A;  3ZJ1 A;  1DU2 A;  1D1A A;  1FJG T;  3P7I A;  3AE7 A;  2LSY A;  3T8O A;  1G73 A;  2V7I A;  2XAJ B;  4EOZ B;  3RPU A;  3E0Z A;  2VQE T;  5FXX A;  1M62 A;  3UU5 A;  5AQO B;  2L8K A;  3UQ7 A;  1W09 A;  3X1D A;  3OTO T;  3VR9 A;  4OHF A;  4ZI2 D;  4KP3 C;  3FZK B;  1WR6 A;  1HS7 A;  3ESL A;  3HKD E;  2XPK A;  4DUY T;  5JR9 A;  5JH7 E;  3KBT A;  1SUM B;  3U78 A;  4P09 A;  4YTM A;  4DR2 T;  3PUG A;  4CN1 A;  5IUX A;  4U33 A;  2VAS A;  2L9Q A;  2A9U A;  3C4W A;  2DI4 A;  2JQ9 A;  4DVD A;  1CUN A;  4ZI2 C;  4C90 A;  4YFS A;  1YQ4 A;  4U31 A;  2YU2 A;  3C4X A;  1LKX A;  3HL6 A;  5JDH A;  3AA6 B;  5HEG A;  1IBK T;  2V7M A;  3OJA A;  4YTN A;  1OED B;  4YSX A;  4TX5 A;  2V6Y A;  5L3F B;  4H9O C;  3CIR A;  4JI7 T;  2IUB A;  3AEC A;  2JQK A;  4AXP A;  4UR9 A;  4KX6 A;  1HFA A;  1W0A A;  3F57 A;  2WP9 A;  3VKH A;  3RX6 A;  3KIN B;  3UFG A;  5LXT E;  5EK4 A;  2C5J A;  2ACZ A;  4BAY B;  2CWO A;  3N9Q A;  4TWF A;  5HEJ A;  3MA9 A;  1Z8U A;  4OYK A;  3F31 A;  5JDL A;  4B3R T;  3UU6 A;  3PUQ A;  5F3J A;  2VKD A;  3GWH A;  2BS2 A;  2GK9 A;  4U74 A;  3B5M A;  3NRX A;  2LT3 A;  4YSZ A;  3K3O A;  5L4H A;  4LF4 T;  3RH3 A;  2XM1 A;  2V1D B;  4HFB A;  2WZI A;  2VWA A;  2E5V A;  3AE9 A;  2BBH A;  3L8R A;  1UUS A;  1FEW A;  2XAF B;  3EHZ A;  5ABF A;  3UFE A;  3PU8 A;  2FJD A;  3AE8 A;  1WYC A;  3UUL A;  1UUR A;  3ZT5 A;  5LGU B;  4MHC A;  3OYZ A;  5TAO A;  3Q5X A;  2SPC A;  5FXV A;  4CXW A;  3AEB A;  4GOU A;  5LG4 A;  4XAX B;  2LOP A;  3QNU A;  3ONX A;  3TLS A;  5HXS A;  2W4X A;  4PK6 A;  1S35 A;  5EK2 A;  2CHN A;  2LSJ A;  2XQ3 A;  3L3P A;  3S4U A;  4CI2 B;  2V26 A;  2JQQ A;  1YQ3 A;  4TNW A;  2XY8 B;  2D0T A;  4H9N C;  2JIW A;  2YN6 A;  2JMH A;  5ETW A;  1N36 T;  3AEA A;  3KVA A;  3P4R A;  2DWG A;  4AQG A;  4HGA A;  3CVR A;  5LYJ E;  4X66 T;  1NEK A;  5AQU B;  3AXJ A;  2CM0 A;  3C98 B;  2KXP B;  3AE4 A;  5JVD E;  2K9A A;  2UXN B;  5C8Y E;  2CWY A;  4XZC A;  4K0K T;  1IBL T;  5LBM A;  2HN1 A;  3N9N A;  5L3E B;  4LF6 T;  3RIU A;  3QOF A;  2XTL A;  2LHN A;  2QRX A;  3V5S A;  4EIW A;  2V6Y B;  3AEE A;  3PUW F;  5AQQ B;  5LMU T;  4QXH B;  1IJ5 A;  4JI8 T;  5H6R B;  2XUE A;  4PJJ A;  3RYC E;  3RC3 A;  4YHJ A;  1T72 A;  4DV3 T;  2BG9 B;  4IE0 A;  4LF5 T;  4JUY A;  5KDM C;  4IGU A;  3T1H T;  1J5E T;  3K8P C;  5LOV E;  3Q5W A;  5JRC B;  5LGT B;  3PUZ F;  3RKO A;  4AKH A;  4G2A A;  3RYF E;  1XNR T;  3GA8 A;  4JBW F;  4CI3 B;  2LE8 A;  2WQY A;  2NR4 A;  2HPL A;  1G8X A;  3EVY A;  3P4W A;  2XAH B;  3IBP A;  5ABF B;  4KUM B;  4GYS A;  4JI2 T;  3AE2 A;  2CXF A;  4ISS A;  4B6X A;  3KV9 A;  4PK5 A;  2LKH A;  2WAU A;  2YU1 A;  4QX7 B;  4DMW A;  1OXZ A;  5FNV E;  1VCT A;  3RGL A;  4B3M T;  4DBR A;  2M67 A;  4WYV A;  4P1N A;  3ZEF B;  1UK5 A;  2RPA A;  1KNZ A;  1XDP A;  3QUJ A;  3AAE B;  4QH1 A;  4AQF C;  3JCF A;  5LNK A;  3VU7 H;  2EHO A;  3I9Y A;  1YW0 A;  4ZI7 E;  2X9W A;  3LK2 B;  4I50 E;  1ZV4 X;  3CX8 B;  4LFC T;  2CHO A;  5AQR B;  3Q5D A;  2JQH A;  4P0A A;  3TKL B;  3ZMU B;  2NTX A;  2CA5 A;  3AXJ B;  2YDS A;  3P50 A;  4EYY R;  3DJB A;  3LBX A;  5JR9 C;  4JI0 T;  3OPC A;  2QGS A;  3RRW A;  4JEU B;  3ABV A;  4LFA T;  4NXM T;  2KWH A;  2CE7 A;  2G0U A;  1OED A;  4YXD A;  5EK3 A;  4HN9 A;  1YKH B;  4IDZ A;  2MTQ A;  3KV4 A;  5FVK A;  4QWN B;  1US7 B;  3ZN1 B;  4NPP A;  3IEE A;  4HFD A;  3FBL A;  3VHL A;  2XHE B;  3LFM A;  3AE3 A;  5LJN A;  4MLK A;  2ZLY A;  2W00 A;  5LP6 E;  1D1B A;  3SOL A;  2BDE A;  2X0Y A;  2J4G A;  3QB5 A;  3ZJ2 A;  2CPT A;  3Q2M A;  5HEH A;  4KHZ F;  4X5T A;  1MMN A;  2HN2 A;  3LK3 B;  2VL0 A;  5JRE A;  3N9O A;  4UEM A;  2UU9 T;  4PFO A;  4CI1 B;  1SA0 E;  2XAQ B;  5HCM A;  4DUZ T;  5CA0 E;  3QB5 K;  2CCQ A;  3I0Q A;  4ILA A;  3FBZ A;  2LEH A;  3PJA A;  3FB2 A;  3UUN A;  1MND A;  5FVL A;  3UTK A;  2W61 A;  4FI5 A;  3Q9D A;  4ILU A;  4O4I E;  2VQF T;  3AED A;  4Z8X A;  2H7O A;  1SE7 A;  3MJX A;  3AA1 B;  2NP9 A;  4PJL A;  4YJ2 E;  5CFB A;  4ZEY A;  4AKL A;  1JNR A;  4JEH B;  2X66 A;  3W15 B;  3H37 A;  3SFE A;  2J1D G;  4GK0 E;  5BMV E;  3QK6 A;  2FBW A;  2C5I T;  4G63 A;  2BZB A;  2A3D A;  3VR8 A;  5HXH A;  2W66 A;  5FL1 A;  4IRE A;  3ZN0 B;  4O4J E;  2I0M A;  3JC6 D;  2I6H A;  2WWU A;  3FHN A;  3TLV A;  2EHO B;  2BS4 A;  5J1G A;  4IE6 A;  3A8Y C;  2E9X A;  3IF8 B;  1V9D A;  2BKN A;  5HEU A;  2JMK A;  5HXE A;  4H63 V;  3NZP A;  3JC6 C;  3OBV E;  4ANJ A;  1KNR A;  4CN6 A;  2OLT A;  4IIJ E;  2AE9 A;  2UUC T;  2VK9 A;  3LBX B;  2KLQ A;  4ILB A;  3MZK B;  2ACX A;  3O1I A;  3M3Z B;  4ZOL E;  2E2A A;  3NKZ A;  4O4L E;  3RHW A;  1WR0 A;  2BKP A;  4DV2 T;  2NWB A;  2B76 A;  4M1P A;  3FZH B;  1B7T A;  5HWY A;  2A72 A;  2CXD A;  3G06 A;  1VRB A;  5ABE A;  1MMG A;  1Y01 A;  1CHU A;  3RIU C;  3TLT A;  5LHG B;  2BG9 A;  3O9X A;  3AB3 B;  3MK7 C;  3DP7 A;  3L09 A;  4IE7 A;  4CZZ B;  4CQI A;  5JTG A;  1H7C A;  4AI6 A;  5ADX L;  3P4S A;  2V7J A;  5JRC A;  3N9P A;  2H7V C;  2XZE A;  1OED E;  3P4P A;  5AQP B;  4TV8 E;  2V7L A;  2IHR 1;  3I0O A;  2WU5 A;  4TV9 E;  4IE5 A;  2W2U A;  2WSS V;  2D2S A;  3PUS A;  2WMO A;  3RC8 A;  1E7P A;  5C2T A;  2V5D A;  1JNZ A;  3EAM A;  1ZKE A;  3PDY A;  3DTO A;  3AE1 A;  1BR4 A;  4X1Y E;  1U4Q A;  4YY3 T;  2MYS A;  1MNE A;  3WI3 A;  2Q9Q A;  2KIN B;  2MOZ A;  3UQ4 A;  5LJM A;  2ODV A;  1I94 T;  4IST A;  1YD8 G;  2UXD T;  3H3M A;  5HXC A;  4HE8 A;  2LM2 A;  1J1J A;  2ZMA A;  4QXC B;  2ZM8 A;  1R8I A;  3UU4 A;  3O1J A;  4O4H E;  2XSA A;  4OFZ A;  3O4X E;  1HCI A;  4HFI A;  2E5L T;  5LMN T;  3KVB A;  2JPF A;  3AAA B;  3NWI A;  1XDO A;  2XQ8 A;  2WDV A;  3P8C D;  3ZYM A;  2X67 A;  1QUU A;  5DJQ C;  5EZY E;  2Y48 B;  3AA0 B;  4LF8 T;  3PE0 A;  2E9X B;  4IT4 A;  3RIF A;  4EAH A;  5JDF A;  1KF6 A;  3SWH A;  2C5K T;  4YJ3 E;  4UF0 A;  2WDR A;  2HHH T;  3EUH A;  5LA6 E;  3C64 A;  2YEV C;  4EEB A;  2WMN A;  4NXN T;  4LML A;  4QH4 A;  3RLF F;  4A98 A;  1VOM A;  2X9Y A;  2LSI A;  2LRL A;  5LHI B;  4EGW A;  2NW8 A;  4DV0 T;  2JRK A;  1NEN A;  2IIU A;  1OED C;  3ETV A;  3B13 A;  1X79 A;  2IDO B;  2R6G F;  2V8S V;  3ZLI A;  2E8I A;  2UUA T;  1HX8 A;  5IWA T;  3UUX B;  4X65 T;  3I9W A;  3CQX C;  3WAJ A;  3N5L A;  5FY1 A;  1UX4 A;  2ZM2 A;  5AQG B;  3CX7 B;  4PFP A;  4CN4 A;  2FUP A;  2LKG A;  4I4T E;  2ES0 A;  2D5U A;  2WCA A;  3AE6 A;  2NW7 A;  2BG9 E;  2UXX B;  5LCY A;  2IC9 A;  5KMG P;  2XQY A;  4ZXL A;  4WBN E;  2BS3 A;  4DR3 T;  1E1H B;  3A7M A;  3R84 B;  3FZF B;  2YDR A;  3RYH E;  3VKG A;  3UUM A;  4N78 D;  4BJN A;  2QYW A;  3PTR B;  4AIU A;  3AVR A;  4DV1 T;  4E7Z A;  3HKE E;  2Q9Q B;  1IZN B;  3QC9 A;  3T1Y T;  4TZ4 C;  1J5W A;  2P9B A;  2H89 A;  3U3I A;  3N2K E;  4H9R C;  3B57 A;  4YTP A;  3NZQ A;  3EAB A;  4JI6 T;  2KT9 A;  2B1E A;  5AFU L;  3FZM B;  4ZZC A;  4TWD A;  2YOE A;  4U3C A;  3UU3 A;  3N2G E;  5AQV B;  5LHH B;  5JDM A;  2K48 A;  4H9S E;  4JYA T;  2LHR A;  1KK7 A;  1S94 A;  2WWV A;  3CKD A;  1WLX A;  5HEO A;  1W9R A;  2PG8 A;  2X9H A;  2CMR A;  3EDV A;  3LJC A;  2MBG A;  4TN7 B;  3VRA A;  3C4Z A;  3E22 E;  4PJM A;  4HTE A;  5F8P A;  1T8B A;  1UCU A;  5FXW A;  4AQY T;  4UXN B;  4DND A;  5L3D B;  5A1L A;  4UF0 B;  1ZHC A;  3N9M A;  1AJ3 A;  4QKN A;  2PJQ A;  2H88 A;  2VKH A;  5DQV A;  2XQ5 A;  2WS3 A;  2LRK A;  1D0Z A;  4HFV A;  4ASK A;  1WCR A;  1KNP A;  4EZ4 A;  3O1H A;  2N9D A;  1KFY A;  4K0U A;  4DR1 T;  3PU3 A;  3OVU A;  5AQK B;  3V5U A;  4BA9 A;  2L3L A;  1MIY A;  5CJ5 A;  2FJE A;  2ZM0 A;  4O2A E;  2BG9 C;  3ZKR A;  5LGN B;  3I1A A;  4WNK A;  3CPZ A;  4C91 A;  4GIW A;  1D1C A;  3L39 A;  1MIV A;  2JJ9 A; 
#chains in the Genus database with same CATH homology
 2CM0 A;  5JQG E;  1MMG A;  2VL8 A;  3C98 B;  2KXP B;  3CX6 B;  2IAK A;  4L9I A;  2K24 A;  5JVD E;  2K9A A;  5LHG B;  4ZS2 A;  3KDS E;  2UXN B;  4BJM A;  5C8Y E;  1O3X A;  3O9X A;  3AB3 B;  1FIO A;  3MK7 C;  4WW0 A;  2CWY A;  1HG5 A;  3DP7 A;  4I55 E;  4XZC A;  3L09 A;  4IE7 A;  4CZZ B;  1BR1 A;  4CQI A;  3E08 A;  4ADZ A;  5LBM A;  2DCF A;  4OK0 A;  4CXX A;  2W63 A;  1H7C A;  3N9N A;  4AI6 A;  5ADX L;  1UX5 A;  4DBQ A;  2E9X D;  2VKJ A;  4F6R C;  1MMD A;  2V7J A;  2XAS B;  3SS1 A;  2K5B B;  5JRC A;  3N9P A;  2H7V C;  1SHZ C;  3EDU A;  2NW9 A;  5L3E B;  4TV8 E;  2V7L A;  4YLH A;  1IJ6 A;  3I0O A;  2QA7 A;  1D0Y A;  4TV9 E;  2D0U A;  3HA4 A;  4IE5 A;  2XTL A;  2LHN A;  2OA5 A;  4J2C A;  2PFV A;  2WSS V;  2D2S A;  2YIN A;  1MMA A;  3N9L A;  4ZS3 A;  3ZC1 A;  4E7S A;  4FJO A;  3LG7 A;  2LJL A;  3PUS A;  5DAB A;  4MFR A;  2E9X C;  1WRD A;  5H6Q B;  2WMO A;  3V5S A;  3RC8 A;  4EIW A;  2X0L B;  3ZMT B;  4CXY A;  2VKO A;  4UVB B;  3CQC B;  4X20 E;  4AKG A;  4EXT A;  4QXB B;  2DLR A;  4QXH B;  1ZKE A;  2DHR A;  3IHR A;  3PDY A;  1IJ5 A;  2HH7 A;  2XUE A;  4JLE A;  4PJJ A;  5H6R B;  3RC3 A;  3RYC E;  4YHJ A;  3J7Y q;  3DTO A;  3C50 A;  1Y64 B;  1BR4 A;  4X1Y E;  1FMW A;  5HXR A;  5IYZ E;  3ZPO A;  4L0R A;  1U4Q A;  5GON E;  4IE0 A;  5DQW A;  2MYS A;  1MNE A;  3WI3 A;  2Q9Q A;  4JUY A;  5KDM C;  4IGU A;  2KIN B;  2MOZ A;  5KX5 E;  5LJM A;  1D0X A;  3K8P C;  2ODV A;  5LOV E;  4IST A;  1NWM X;  1YD8 G;  3Q5W A;  2IW5 B;  5JRC B;  4A56 A;  5LGT B;  5HXC A;  2X9X A;  4HE8 A;  3RKO A;  4AKH A;  3ZMV B;  2ZMA A;  4G2A A;  4MAL A;  4L5G A;  4EYU A;  3AVS A;  3RYF E;  4QXC B;  2ZM8 A;  3GA8 A;  3N2O A;  4X1I E;  3O1J A;  4O4H E;  4CI3 B;  4UVC B;  4OFZ A;  2HPJ A;  2I59 A;  5FP3 A;  4UVA B;  2LE8 A;  2N1G A;  5JDN A;  1Z0P A;  3O4X E;  1FMV A;  1HCI A;  3A5X A;  4HEA A;  5HWX A;  3NRY A;  2W62 A;  5CA1 E;  4PNI A;  3KVB A;  4H63 H;  4XBF B;  4PK4 A;  3BQL A;  2JPF A;  2HPL A;  1G8X A;  4PAG A;  5FYM A;  3AAA B;  3CML A;  2W0G A;  3EVY A;  3GN5 B;  3PUA A;  4DMV A;  2XAH B;  3IBP A;  3ANW A;  4OYJ A;  4KUM B;  3RRC A;  4GYS A;  4EZH A;  2CXL A;  2YK0 A;  2CXF A;  2DNX A;  4ISS A;  3P8C D;  2CLY B;  3ZYM A;  2RA1 A;  2X67 A;  1BR0 A;  1QUU A;  5DJQ C;  2LOS A;  4B6X A;  3KV9 A;  4PK5 A;  3ETU A;  2WAU A;  5EZY E;  2YU1 A;  2Y48 B;  4QX7 B;  4DMW A;  1OXZ A;  5FNV E;  3AA0 B;  3OYX A;  3KV5 A;  3PE0 A;  2E9X B;  2LSK A;  4DBR A;  4EAH A;  2Y6X A;  5JDF A;  3HR0 A;  2M67 A;  3KBU A;  2Q9Q D;  1BR2 A;  4DO0 A;  3ZEF B;  3SWH A;  2C5K T;  1KNZ A;  5E0O A;  2RP4 A;  4YJ3 E;  3QUJ A;  1EZ3 A;  4UF0 A;  3AAE B;  4AQF C;  3ZC0 A;  1NAF A;  5FMN A;  2LM9 A;  2PBI A;  1HTJ F;  3EUH A;  5LA6 E;  3WAK A;  3C64 A;  5LNK A;  3VU7 H;  2YEV C;  5JDG A;  1U5P A;  2BVL A;  2WMN A;  4NUU A;  2EHO A;  3C51 A;  5FY7 A;  3I9Y A;  3UT5 E;  1VOM A;  2X9Y A;  1YW0 A;  3K3Q C;  2LSI A;  4AKR B;  2Q9Q C;  4ZI7 E;  2X9W A;  5LHI B;  4AKI A;  3OKQ A;  3LK2 B;  4I50 E;  3HKC E;  1ZV4 X;  4QX8 B;  2LSG A;  2H3R A;  3CX8 B;  2NW8 A;  3SRZ A;  3KFW X;  2JRK A;  4ZHQ E;  2KWI B;  3HI2 A;  3J9X 1;  2NOX A;  3ETV A;  3B13 A;  2C0S A;  2BVM A;  1X79 A;  4O8S A;  4P0A A;  3TKL B;  3CWZ B;  3BQK A;  3ZJ1 A;  3ZMU B;  4AQF A;  3CQG B;  4GK5 E;  1D1A A;  2NTX A;  3P7I A;  2CA5 A;  2LSY A;  5L2L A;  4EYY R;  3T8O A;  3ZLI A;  3PUR A;  2E8I A;  2X51 A;  1G73 A;  1HG2 A;  2V7I A;  3DJB A;  2XAJ B;  3LBX A;  5JR9 C;  1HX8 A;  1LVF A;  4EOZ B;  4PW8 A;  3RPU A;  2QGS A;  2KND A;  1QSD A;  3RRW A;  3E0Z A;  5FXX A;  4JEU B;  3UUX B;  3I9W A;  3CQX C;  3WAJ A;  3N5L A;  5FY1 A;  1UX4 A;  2CEA A;  2KWH A;  2CE7 A;  2ZM2 A;  2G0U A;  3CX7 B;  1WYB A;  2L8K A;  4PFP A;  4PJN A;  5HAX A;  2VB6 A;  3KV6 A;  5EK3 A;  4HN9 A;  4OHF A;  1YKH B;  4ZI2 D;  3BQI A;  4KP3 C;  4IDZ A;  3ZMS B;  4I4T E;  2A2F X;  2ES0 A;  1WR6 A;  5IHY A;  2D5U A;  2MTQ A;  1HS7 A;  3KV4 A;  3ESL A;  3H3A A;  3HKD E;  4HKA A;  5JR9 A;  5JH7 E;  2NW7 A;  4QWN B;  1US7 B;  3ZN1 B;  3KBT A;  3IEE A;  4P0B A;  2EHO D;  3FBL A;  2UXX B;  3VHL A;  5LCY A;  3U78 A;  4P09 A;  2XHE B;  3FXD B;  3LFM A;  2IC9 A;  5KMG P;  5LJN A;  5J2T E;  2XQY A;  2Y8D A;  4WBN E;  5JDQ A;  3PUG A;  3AAI A;  1E1H B;  3RYI E;  4MLK A;  2ZLY A;  3R84 B;  2VAS A;  2W00 A;  3ZYL A;  2L9Q A;  5LP6 E;  3C4W A;  3RYH E;  3VKG A;  2DI4 A;  1D1B A;  4DVD A;  1CUN A;  4ZI2 C;  2DWK A;  3SOL A;  4I43 B;  3UUM A;  2BDE A;  4N78 D;  3F2E A;  4BJN A;  4C90 A;  5FXZ A;  4NUV A;  4X1K E;  3ZJ2 A;  3PTR B;  4YFS A;  4U72 A;  2YU2 A;  3C4X A;  1LKX A;  3HL6 A;  3Q2M A;  3AVR A;  5JDH A;  2EHO C;  4E7Z A;  3HKE E;  2Q9Q B;  4KBM B;  1MMN A;  3LK3 B;  5JRE A;  1IZN B;  3QC9 A;  5J2U E;  3AA6 B;  4TZ4 C;  4H9P C;  2P9B A;  3N9O A;  3HKB E;  2V7M A;  3OJA A;  4UEM A;  2WBL A;  5FY0 A;  3LK4 2;  3U3I A;  4TX5 A;  2XAG B;  4PFO A;  3N2K E;  5L3F B;  4CI1 B;  4H9O C;  1SA0 E;  2XAQ B;  2IC6 A;  5CA0 E;  2CCQ A;  4H9R C;  3I0Q A;  3K3N A;  4AXP A;  3FXE B;  3B57 A;  3FBZ A;  1HFA A;  2LEH A;  4UIG A;  3F57 A;  1MIW A;  3NZQ A;  3VKH A;  3FB2 A;  2KMF A;  1MND A;  3UUN A;  5JR9 B;  2KT9 A;  2B1E A;  3RX6 A;  5HYA A;  3KIN B;  5LXT E;  5EK4 A;  5AFU L;  2C5J A;  4UEL A;  3UTK A;  2Z6E A;  5LBQ B;  2W61 A;  4BAY B;  4FI5 A;  2CWO A;  3N9Q A;  3Q9D A;  4ILU A;  4O4I E;  3N2G E;  5LHH B;  3ZYK A;  4Z8X A;  5JDM A;  2H7O A;  2K48 A;  4H9S E;  2LHR A;  1KK7 A;  1S94 A;  3MA9 A;  3MJX A;  3AA1 B;  4OYK A;  3ANW B;  3F31 A;  3CKD A;  1WLX A;  5JDL A;  3NBX X;  2NP9 A;  4PJL A;  4IE4 A;  3PUQ A;  5F3J A;  4IHJ E;  2VKD A;  2CLY C;  3GMI A;  4YJ2 E;  4AKL A;  4H9Q C;  4JEH B;  3D0T A;  2PG8 A;  2X66 A;  3GWH A;  3W15 B;  2X9H A;  4MBQ A;  2GK9 A;  4U74 A;  3H37 A;  3R6N A;  2CMR A;  3EDV A;  3LJC A;  3NRX A;  2LT3 A;  2MBG A;  4TN7 B;  2J1D G;  3C4Z A;  4GK0 E;  1OWA A;  5BMV E;  3M65 A;  3K3O A;  3QK6 A;  3E22 E;  2C5I T;  4PJM A;  3RH3 A;  4G63 A;  4HTE A;  4GYR A;  5F8P A;  2BZB A;  2V1D B;  1UCU A;  1HF8 A;  2VWA A;  4UV9 B;  5FXW A;  4UXN B;  5L3B B;  2A3D A;  4DND A;  1LVK A;  5L3D B;  2X68 A;  5HXH A;  5A1L A;  1FEW A;  2NTY A;  3AA7 B;  3GN5 A;  2WM9 A;  2XAF B;  4UF0 B;  1ZHC A;  3N9M A;  5CB4 E;  3ZN0 B;  4O4J E;  1AJ3 A;  4QKN A;  3BK9 A;  3UFE A;  2PJQ A;  2VKH A;  3JC6 D;  5DQV A;  2WWU A;  3MAC A;  3PU8 A;  2N2N A;  3FHN A;  2EHO B;  1WYC A;  5J1G A;  3UUL A;  5LGU B;  4MHC A;  1D0Z A;  3OYZ A;  4IE6 A;  3Q5X A;  5TAO A;  2SPC A;  4UV8 B;  4HFV A;  5FXV A;  4ZI3 D;  4V1A v;  4ASK A;  2E9X A;  4CXW A;  3IF8 B;  2V7K A;  4GOU A;  4EZ4 A;  5LG4 A;  1V9D A;  3O1H A;  4XAX B;  1IAP A;  2N9D A;  4K0U A;  2LOP A;  3ZCI A;  2JMK A;  5HXE A;  4H63 V;  3PU3 A;  3NZP A;  3ONX A;  1YKE B;  3JC6 C;  5HXS A;  5L3C B;  4PK6 A;  1ZEE A;  1S35 A;  3OBV E;  3V5U A;  4ANJ A;  5EK2 A;  4BA9 A;  2L3L A;  2LSJ A;  4IIJ E;  1MIY A;  4WBO A;  3L3P A;  3S4U A;  4CI2 B;  2V26 A;  1LRZ A;  2ZM0 A;  2VK9 A;  4O2A E;  4QHO A;  3LBX B;  2JQQ A;  2KLQ A;  4ZI3 C;  4KMC A;  2KZ7 B;  3MZK B;  2ACX A;  5LGN B;  2D0T A;  3O1I A;  3I1A A;  4H9N C;  4WNK A;  4TUY E;  4ZOL E;  4ERR A;  2JMH A;  5L3G B;  5ETW A;  3ZCJ A;  5M4Y A;  4O4L E;  3CPZ A;  2NWB A;  4M1P A;  4C91 A;  3KVA A;  4GIW A;  2DWG A;  1D1C A;  3ZMZ B;  4AQG A;  4HGA A;  1B7T A;  5HWY A;  1MIV A;  3CVR A;  4EB6 E;  3MKD A;  4O2B E;  2A72 A;  3MXZ A;  5LYJ E;  1T98 A;  2JJ9 A;  2CXD A;  2ODU A;  1VRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...