2NW8A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
266
structure length
266
Chain Sequence
b'EGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
total genus 105
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw8A00
2NW8A 4U74A 2V7MA 4HKAA 3E08A 2X68A 5ETWA 5EK3A 4PW8A 5EK4A 4PK6A 4U72A 2X67A 2X66A 4PK5A 5EK2A 2NWBA 1ZEEA 2V7LA 2D0UA 1YW0A 2NW9A 2V7JA 2V7KA 3BK9A 2NW7A 2D0TA 2V7IA 2NOXA
chains in the Genus database with same CATH superfamily
3K1SA 2KWHA 4X64T 2QA7A 3TLVA 4KI0F 5C3JA 4QXBB 3DJBA 4ZI2C 4GYRA 2A2FX 3CWZB 1U4QA 2LSIA 4EIWA 5FY7A 2NW7A 4TV9E 2RA1A 3FZKB 4B3ST 4MLKA 4U33A 2DWKA 3KBUA 2WU5A 1N32T 3TKLB 5ABHA 3SRZA 3RKOA 2VURA 5FXZA 4AQGA 3NVOA 2IUBA 4DMVA 2N2NA 3N9NA 5HEUA 5AQIB 4WW0A 4TV8E 4PFPA 4PK6A 3M3ZB 4QXHB 3ZN0B 3RIUC 5EK2A 3AEEA 5IWAT 5LGUB 5CA0E 2JQQA 3L39A 2V6YA 2E9XB 4JI2T 3ETVA 3RIUA 1KEYA 3F57A 2W4XA 3ZLIA 2DI4A 1QUUA 5HEJA 3CQXC 4NXMT 4F8HA 1NAFA 5AFUL 2K48A 2BVLA 4HWHA 2MBGA 2V5DA 2VASA 2OA5A 2XQ7A 3AE2A 4PK4A 4AXPA 3C4WA 4I55E 2H89A 2BVMA 5HWYA 4I43B 4DUYT 3AXJB 3JC6D 3A5XA 5J2TE 5L47A 4AKIA 1WFDA 2I6HA 5FY1A 1YQ3A 3F2EA 2JJ9A 2N1GA 3P4PA 4YTMA 4DO0A 2WCAA 2X9XA 1IZNB 4ILAA 3PUGA 2WM9A 3E0ZA 3AE4A 1HS7A 4J2CA 3UUNA 4LF4T 1J5WA 3OJAA 2QRXA 2J62A 5LMUT 3ZYMA 5JDGA 5IYZE 2XM1A 2MAWA 4A5XA 2UXXB 2WS3A 5FY0A 4YJ2E 2ES0A 1T8BA 3UFGA 3MACA 4GKKT 4H9OC 4QX7B 1MMGA 3V5SA 1YD8G 4WZXA 1XNQT 5ABGA 3N9QA 5FYMA 1W09A 4X1KE 3I0QA 1MMDA 4K0KT 2XUEA 1FMWA 3H3AA 2A3DA 3UU4A 5DABA 5JDFA 4LFAT 2VKOA 1OEDA 5M4YA 1MNDA 1MIYA 2XAGB 4HE8A 2QYWA 3HKEE 3SWHA 5LHGB 2NTXA 2W66A 4ZXLA 2BDEA 4PJNA 4B3MT 2B1EA 3PU8A 3RC8A 3NZQA 5AQQB 1OXZA 4HWCA 2UUBT 4F6RC 2ODUA 3CPZA 2VKDA 5AQMB 2KNDA 2LLYA 3K8PC 4TX5A 3S4UA 3CQCB 2VVSA 5AQSB 5JTGA 2IHR1 2JQKA 3RRWA 3LJCA 3TLTA 4KX6A 1OEDE 2OLTA 4DV0T 1HNZT 2Y8DA 4EZ4A 4EXTA 5AQUB 4JV5T 4EV6A 5FL1A 3AE7A 3UUMA 1OWAA 4JYAT 1YKEB 2XQ5A 4AQYT 4TUYE 4U2YA 4H9PC 5JDQA 1ZEEA 2XY8B 3ZT6A 4A56A 2WZHA 3CX6B 3UU6A 2E8IA 1IBMT 4ZEYA 3OVUA 2LOSA 3J9X1 2CWOA 2ZMAA 4HFEA 4QXCB 4PFOA 4TWHA 1S94A 3RIAA 4ZS3A 2WWUA 2DLRA 4LF6T 3PJAJ 3AA1B 4P09A 3N9LA 4GK5E 5FVKA 3FZLB 2I59A 5CA1E 2HN2A 3VR8A 4UF0B 2C0SA 5LHIB 5AQRB 3JCFA 3UTKA 3HKDE 3MK7C 3LDQB 5EK3A 1ZP0A 4IDZA 3KFWX 4OHFA 2A72A 2QVAA 2F4VT 2PTFA 2W67A 2L8KA 3EI0A 3AEGA 3ZMZB 4COFA 1HG5A 4EZHA 2K9AA 2EHOD 5FNVE 3L8RA 3EABA 1CUNA 4EB6E 2M6IA 2FJDA 4HGAA 5FKYA 1D0ZA 1HG2A 4YLHA 2BZBA 5F5WA 1V9DA 5LYJE 2E9XC 1UCUA 4CI1B 5JDMA 4XAXB 5LGNB 2E5VA 2E9XA 2XSAA 3AE5A 2G0UA 2UXNB 4H63V 2WU2A 5HWXA 4PNIA 4E7ZA 4YFSA 3RYHE 2YDRA 4DV6T 2K5BB 2DHRA 4EYUA 2KINB 3UQ7A 1YQ4A 2XTLA 2C5IT 4NUVA 1NENA 4YTNA 3GWHA 4V1Av 2ZM0A 4E7SA 4AIUA 3IBPA 1S35A 4A97A 2L9QA 4EYYR 3AXJA 2WB5A 3CQGB 1J1JA 2A9UA 4BAYB 5HYAA 4AKHA 2CWYA 4ASKA 3O4XE 2CEAA 2KLQA 2KZ7B 4HTEA 1E7PA 4CN1A 2CHNA 2BS3A 3P4SA 4I0UA 1FMVA 3N2OA 5CB4E 1HF8A 2Y48B 3RYCE 3RLFF 3SS1A 1E1HB 3FHNA 3PV0F 2CCQA 4HEAA 5J2UE 2V5CA 5FVLA 2YU2A 1MIVA 3MA9A 4CZZB 3AE3A 1Y01A 5L4EA 3PUXF 3ESLA 3GN5B 2CLYB 1BR2A 3NRYA 5CJ5A 3EDUA 3ZJ1A 3CX7B 2BG9E 5DJQC 4DR2T 3PUZF 4CN6A 4GKJT 1UK5A 2UXCT 1LRZA 3KBTA 3AEBA 2WP9A 3QNUA 1D1CA 3OPCA 1KK7A 5AQKB 4XBFB 2RP4A 3B13A 3P4WA 3SFEA 3N2KE 2LM9A 5HCJA 2IAKA 3UT5E 3A8YC 3Q5EA 4DR6T 2V7LA 1T72A 2ZM2A 2UXDT 4ZI2D 1J5ET 2NW9A 1KNZA 5JRCB 3KVAA 4NUUA 3CKDA 3ZN1B 3QK6A 2LOPA 2KMFA 2WMNA 2XQYA 4HFCA 4YSYA 3C64A 4X66T 1H7CA 2UXBT 4ISSA 4C90A 4U74A 4ZI3C 5HXHA 4PW8A 4DMWA 4B3TT 5J0ZA 2H3RA 4HN9A 2XAFB 3EUHA 1CHUA 4XZCA 2XQ8A 2R6GF 3C51A 2EHOB 1WCRA 3LG7A 3C4XA 3AAAB 4HWFA 4H9NC 5LOVE 1KFYA 1LVKA 3ZMVB 3M65A 4JLEA 3ONJA 3ZT7A 4TNVA 1XDPA 2LSJA 2W63A 1UX4A 3L09A 2WY2A 5AQOB 5LJNA 1E2AA 2V7IA 5F3JA 5HEHA 5LMNT 4QX8B 4M1PA 5L2LA 5AQLB 3HKCE 1SA0E 2VKHA 1KF6A 2X66A 4UELA 5ADXL 4HWIB 2WDQA 4ILBA 2BKNA 1UGOA 4IL9A 5E0OA 2CMRA 3N9OA 4UF0A 2YDSA 5LB7B 4FJOA 3KINB 4CI3B 3VRAA 4DBQA 2BG9B 3AE9A 3I9YA 2YK0A 3EAMA 2NWBA 2ZM6T 1WLXA 2WAUA 3NBXX 4BJMA 3ANWB 4IE5A 3LSVA 4UVAB 4QH5A 1BR0A 4WBOA 2FJEA 2DWGA 3QB5A 2E5LT 1FJGT 3HR0A 4Z91A 4IE7A 3L3PA 4ZZCA 2X0YA 4EOZB 4A98A 4O4IE 3OBVE 5A1LA 4UVBB 2DNXA 5C8YE 2KSRA 5AQTB 5LP6E 2Y6XA 2M67A 3PJAA 2J47A 2V7KA 2LJLA 3ABVA 2LSYA 2JRKA 1Z0PA 2LEHA 1OEDC 2BBHA 3FB2A 4TZ4C 3IA3A 2X9YA 3RIFA 4DVDA 5FL0A 4PK5A 4X5TA 2X9WA 3CVRA 3QUJA 4DR3T 2YOEA 2JQHA 2HH7A 3JAFA 3AECA 4O4LE 3ZT5A 5AQJB 4YXDA 3T8OA 3CK6A 4DV1T 2HHHT 1ZV4X 3RGLA 2YU1A 2BBJA 5DQWA 4CXYA 1YW0A 3GA8A 1D1BA 5LNKA 1XDOA 2CBIA 1NEKA 1LKXA 3HA4A 4KHPT 3EHZA 3PUVF 3SFDA 3AAIA 5HXSA 4B6XA 3VHLA 4PJJA 3N5LA 4U2ZA 4DR7T 2MPKA 4HFIA 2E2AA 5AQVB 2YKSA 3PUYF 4MHCA 4BA9A 3C4ZA 3NRXA 2CE7A 3LBXB 3PTRB 2CLYC 4DV2T 4CXXA 5LGTB 4TWFA 4CN4A 3NKZA 4LF8T 2ACXA 1T7SA 3GN5A 4MBQA 4AQFA 4OYJA 4ILUA 3ZYLA 1VCSA 3MKDA 3PURA 5JREA 3C50A 5ABFB 2MYSA 2V7JA 3T1HT 5AQHB 3Q9DA 3FBLA 2LM2A 4YT0A 5H6QB 2FUPA 2LT3A 4G63A 3KDSE 4YY3T 2VL8A 3F31A 3RI5A 4L0RA 3LK2B 3P8CD 5AQGB 3FXDB 3GMIA 4O4JE 4NIQA 3EVYA 5JRCA 2DL1A 1ZHCA 2NTYA 4KUMB 4HFHA 4DV7T 4X20E 4TN7B 2FBWA 1D1AA 4DR5T 1XNRT 2V7MA 4CQIA 4QHOA 4KBMB 2FJAA 3ZC1A 5LHHB 3VKHA 3ZSSA 4JI0T 4LFCT 4ZZBA 1D0XA 5JR9B 1W0AA 3U3IA 3IHRA 2GK9A 2X51A 3RKGA 4IREA 2XQ6A 1BR4A 2IC6A 5IHYA 2XHEB 2CXFA 3BQKA 1QSDA 2EHOC 4AKGA 2C5JA 3AE6A 2K3WA 2D5UA 2EHOA 3AEAA 3WAJA 2QGSA 2D0TA 3ZEFB 2XAJB 1WYBA 4O4HE 1U5PA 3KV9A 5JVDE 3ZCIA 4P1NA 3E22E 2OV9A 5HEOA 3KV4A 4YSZA 4NPPA 1WRDA 3AVSA 4EEBA 4U3CA 3T1YT 1HR0T 2UUAT 2PG8A 2BKPA 4UEMA 4JI6T 2MOZA 3BK9A 4AI6A 2HN1A 3TLSA 4HKAA 1ZOYA 2BG9A 4TNWA 4DV5T 3P4QA 4JI5T 2IDOB 4KMCA 2XSBA 4AISA 2M6BA 3ANWA 2C5KT 1UUSA 3UU5A 1HX1B 5CFBA 5HAXA 3UULA 4C91A 2XZEA 1W0BA 4YHJA 2W62A 4OFZA 2PFVA 2CHOA 5JDHA 1YXRA 1XMQT 5L3GB 2WDVA 3B5MA 5BR8T 4IGUA 1O3XA 5LG3A 5L3FB 3PUAA 1X9BA 1MMNA 4MALA 1N33T 1DU2A 1X79A 1M62A 3WAKA 2Q9QD 4UXNB 2NP9A 3AE8A 2CM0A 5L4HA 3ETUA 1D0YA 4O2AE 2LE8A 3A7MA 3QC9A 2LRKA 4I50E 2IC9A 1FIOA 2NR4A 2VQET 4ZI7E 1AJ3A 3ZMUB 4BJNA 5JQGE 3D0TA 3RC3A 1HNWT 4G2AA 4H9SE 3SOLA 5L3DB 1G8XA 4IDNA 1HNXT 4X62T 3NWIA 3MXZA 4NXNT 3RQUA 5HEGA 5AQPB 5EZYE 5FXVA 1IAPA 3RRCA 1ZKEA 3ZSTA 4U7IA 4PJMA 4I4TE 5KXJA 3RYFE 2ACZA 3ZKRA 5LCYA 4ZI3D 2XJ7A 2HPLA 3I9WA 3W15B 3JADA 3VKGA 4JI8T 2VL0A 1N34T 4WBNE 4EEDA 4QH4A 4OX9T 3OKQA 4ZHQE 4CXWA 2FJBA 3BQIA 2V26A 3E08A 3R84B 1US7B 3LBXA 4IIJE 3AA6B 2KXPB 5AQFB 2W0GA 3P7IA 1BR1A 4DV3T 2XQ4A 3Q5DA 4UIGA 3Q5WA 4GK0E 4OK0A 4IL4A 2IMLA 3ZJ2A 1W9RA 2WBLA 3TLUA 2BS2A 4JEUB 5ABFA 1HFAA 4ADZA 2XAQB 3IEEA 2WMOA 1WYCA 2IW5B 2XQ9A 3TLWA 1MIWA 3JC6C 2LRLA 3OYZA 2JMHA 2SPCA 2LHNA 4ILCA 2D0UA 5IUXA 5HXEA 4LMKA 2WQYA 1VCTA 4IT4A 4LMJA 3VR9A 3CMLA 5TAOA 2YN6A 3AE1A 2MTQA 3AB3B 3ZMTB 2WWVA 1M7KA 4EAHA 2UUCT 3LK42 3AVRA 3KV6A 5BMVE 5EK4A 3FZMB 5JR9C 5FXXA 4LF7T 3AA0B 1SUMB 2XAHB 5JR9A 2WZIA 2V6XA 1VOMA 3QB5K 1XMOT 2NW8A 4Z90A 2LSGA 3UUXB 5FP3A 1MNEA 5HXRA 1WR6A 2XASB 1I94T 4IDPA 1B7TA 1IBKT 4UV8B 4JI3T 4YJ3E 2PJQA 4Z8XA 2BKOA 5AQNB 4CI2B 4YHHT 4FI5A 4DIDB 3ONXA 4HFVA 4DV4T 3Q2MA 2LKHA 2H7VC 4JI4T 4U31A 1HCIA 2VB6A 3CX8B 3HKBE 5KMGP 2Q9QB 2D9DA 4JBWF 4DBRA 4KHZF 1LVFA 5DQVA 1GQEA 5LBQB 3RQWA 5L3CB 2CXDA 2AXDS 3B57A 5CGMA 2D2SA 4X65T 3O1HA 3N2GE 3UUBA 3K3OA 3ZCJA 3HI2A 3PE0A 4GOUA 4IDOA 3FBZA 2XQAA 3UFEA 2KT9A 1N36T 3MZKB 4IDQA 2VWAA 4EGWA 1WR0A 2LKGA 3I1AA 1VRBA 1XZYA 1T98A 3OYXA 2CBJA 2CPTA 4YTPA 2I0MA 1EZ3A 2JIWA 4P0AA 3RYIE 3DTOA 1L0VA 5LA6E 3AEDA 4JI7T 2NOXA 4IE0A 3G06A 2VK9A 4N78D 2J4GA 3RPUA 1YKHB 3ONLC 2IIUA 5LJMA 3Q5XA 1G73A 1IBLT 4HFDA 4YSXA 4LF9T 4AKLA 4AQFC 2LHRA 2V6YB 3EDVA 2WDRA 2X0LB 2YEVC 4DNDA 2BS4A 1R8IA 4OYKA 4H9QC 2X67A 2AE9A 3UQ4A 5ABEA 2Z6EA 1I6ZA 3X1DA 4JUYA 3KV5A 4AKRB 4GIWA 4Q25A 1QLBA 1IJ6A 2H88A 2KWIB 3WI3A 4WNKA 3BQLA 1Z8UA 4ISTA 3N9PA 4X1YE 4IE6A 3O9XA 5GONE 4LMLA 5KDMC 4QKNA 3H37A 2XM2A 3FZFB 4KP3C 3IF8B 5ETWA 4X1IE 3FXEB 2K24A 3LK3B 3UU8A 3QOFA 2JQ9A 2JMKA 3AEFA 4UVCB 1Y64B 2JPFA 1JNRA 3MJXA 4ZOLE 4JEHB 5LG4A 3C98B 4LFBT 5LBMA 1MMAA 3JAEA 3RF1A 1UX5A 2E9XD 2V8SV 2UU9T 4WYVA 3RX6A 5C2TA 4GYSA 3LFMA 3R6NA 5FXWA 4IHJE 4JI1T 5L3EB 3ZPOA 2W61A 4K0UA 3RHWA 5FMNA 4UV9B 3PUSA 1HTJF 3AAEB 4LF5T 3AA7B 1JNZA 2XQ3A 3DP7A 4DR4T 1SHZC 3J7Yq 4PAGA 5LXTE 4MFRA 4L9IA 3H3MA 2ZM8A 5H6RB 3V5UA 1OEDB 5HCMA 2H7OA 2X9HA 4B3RT 5KX5E 2CXLA 5JDNA 3ZMSB 2W2UA 4DUZT 2BG9C 4H63H 2W00A 1XWMA 2PBIA 2V1DB 2CA5A 3RH3A 4ZS2A 2N9DA 3PUQA 2ZLYA 3U78A 3K3NA 3OTOT 2HPJA 4P0BA 4H9RC 2B76A 2ODVA 4ANJA 3I0OA 3KVBA 4DR1T 1UURA 4UR9A 3ZC0A 3CIRA 2DCFA 3FZHB 2YDQA 3PUWF 2LSKA 2J1DG 5F8PA 3K3QC 3P50A 3VRBA 3PU3A 4ERRA 4HFBA 2VQFT 2L3LA 4L5GA 3ZYKA 2YINA 1IJ5A 5L3BB 1NWMX 4QWNB 3O1IA 1KNPA 5HXCA 1SE7A 3UU3A 3HL6A 1KNRA 3PDYA 4O2BE 4PJLA 2X0HA 5J1GA 4QH1A 3N9MA 2VKJA 4HWDA 1HX8A 2WSSV 2RPAA 3VU7H 2X68A 2VVNA 2CRBA 3P4RA 4U72A 2Q9QC 2P9BA 1FEWA 3O1JA 3NZPA 4TWDA 2Q9QA 4O8SA 5JH7E 4IE4A 2XPKA 4U7YA 5JDLA
chains in the Genus database with same CATH topology
5TAOA 2G0UA 2UXNB 4H63V 2KWHA 5HWXA 2MTQA 3AB3B 4MHCA 4PNIA 2QA7A 3C4ZA 3ZMTB 4BA9A 3NRXA 4E7ZA 4YFSA 3RYHE 2CE7A 4EAHA 3LK42 3AVRA 3KV6A 5BMVE 2K5BB 4QXBB 5EK4A 3DJBA 3LBXB 2DHRA 4EYUA 4ZI2C 2KINB 3PTRB 5JR9C 5FXXA 2XTLA 2CLYC 4GYRA 2C5IT 4NUVA 2A2FX 3AA0B 3CWZB 4CXXA 5LGTB 1U4QA 2LSIA 3GWHA 4EIWA 2ACXA 2XAHB 5JR9A 3GN5A 4V1Av 5FY7A 2NW7A 2ZM0A 4E7SA 4TV9E 2RA1A 1VOMA 3IBPA 4MBQA 4AQFA 1S35A 4OYJA 4ILUA 3ZYLA 2NW8A 4MLKA 2L9QA 2LSGA 3MKDA 3PURA 5JREA 3UUXB 4EYYR 5FP3A 1MNEA 5HXRA 1WR6A 2DWKA 2XASB 3C50A 3KBUA 1B7TA 3TKLB 2MYSA 3CQGB 3SRZA 4UV8B 3RKOA 4YJ3E 2PJQA 4Z8XA 2V7JA 5FXZA 4BAYB 4AQGA 5HYAA 3Q9DA 4AKHA 3FBLA 5H6QB 4DMVA 4CI2B 2N2NA 2LT3A 3N9NA 2CWYA 4FI5A 4G63A 3KDSE 4ASKA 3ONXA 4HFVA 3Q2MA 3O4XE 2H7VC 2CEAA 2KLQA 2KZ7B 4WW0A 2VL8A 4HTEA 4TV8E 4PFPA 3F31A 4L0RA 3LK2B 3P8CD 4PK6A 3ZN0B 4QXHB 1HCIA 2VB6A 3CX8B 5EK2A 3FXDB 3HKBE 3GMIA 5KMGP 5LGUB 1FMVA 4O4JE 2JQQA 5CA0E 3EVYA 3N2OA 2Q9QB 2E9XB 3ETVA 5CB4E 1HF8A 2Y48B 5JRCA 3RYCE 4DBRA 1ZHCA 3SS1A 1E1HB 1LVFA 3F57A 3ZLIA 2NTYA 4KUMB 5DQVA 3FHNA 4X20E 2CCQA 2DI4A 4HEAA 1QUUA 3CQXC 4TN7B 5J2UE 5LBQB 1D1AA 5L3CB 2CXDA 2V7MA 4CQIA 1NAFA 3B57A 2YU2A 4QHOA 4KBMB 2D2SA 3O1HA 1MIVA 2K48A 3MA9A 3K3OA 3N2GE 3ZC1A 2BVLA 4CZZB 5AFUL 3ZCJA 3HI2A 2MBGA 5LHHB 3PE0A 3VKHA 4GOUA 2VASA 2OA5A 3FBZA 4PK4A 1D0XA 3ESLA 3UFEA 5JR9B 2KT9A 3U3IA 3GN5B 2CLYB 3IHRA 3MZKB 4AXPA 1BR2A 2VWAA 2GK9A 3C4WA 3NRYA 2X51A 3I1AA 4I55E 1VRBA 5HWYA 2BVMA 3EDUA 4I43B 3ZJ1A 1T98A 1BR4A 3CX7B 3OYXA 5DJQC 3JC6D 2IC6A 5IHYA 2XHEB 2CXFA 3A5XA 3BQKA 5J2TE 1EZ3A 1QSDA 2EHOC 4AKGA 2C5JA 4P0AA 4AKIA 1LRZA 3RYIE 3KBTA 1D1CA 3DTOA 2D5UA 5LA6E 1KK7A 2EHOA 3WAJA 5FY1A 2QGSA 2D0TA 3ZEFB 2NOXA 4IE0A 3F2EA 2JJ9A 2N1GA 2XAJB 2VK9A 4XBFB 2RP4A 4N78D 1WYBA 3B13A 4DO0A 4O4HE 3N2KE 2LM9A 1U5PA 2IAKA 1YKHB 3KV9A 2X9XA 5JVDE 3RPUA 5LJMA 3UT5E 1IZNB 3Q5XA 3ZCIA 1G73A 3E22E 2V7LA 3PUGA 2WM9A 3E0ZA 4AKLA 3KV4A 2ZM2A 4AQFC 4ZI2D 2LHRA 2NW9A 1KNZA 1HS7A 5JRCB 3EDVA 1WRDA 4J2CA 3UUNA 3KVAA 4NUUA 3AVSA 2X0LB 3CKDA 2YEVC 4DNDA 3ZN1B 3OJAA 3QK6A 2LOPA 2KMFA 4OYKA 3ZYMA 5JDGA 4H9QC 5IYZE 2WMNA 2XQYA 2PG8A 2X67A 4UEMA 2UXXB 3C64A 2MOZA 2Z6EA 5FY0A 4YJ2E 2ES0A 4JUYA 3BK9A 3KV5A 3MACA 4AKRB 4AI6A 1H7CA 4H9OC 4QX7B 1MMGA 3V5SA 4GIWA 4ISSA 4C90A 4U74A 1IJ6A 1YD8G 2KWIB 4ZI3C 5HXHA 4HKAA 4PW8A 3WI3A 4WNKA 3BQLA 4DMWA 3N9QA 5FYMA 4ISTA 3N9PA 4X1KE 3I0QA 2H3RA 4HN9A 1MMDA 2XAFB 3EUHA 4KMCA 2XUEA 4X1YE 4XZCA 1FMWA 3H3AA 4IE6A 3O9XA 3ANWA 5GONE 3C51A 2EHOB 2A3DA 3LG7A 3C4XA 5KDMC 4QKNA 3H37A 2C5KT 3AAAB 5DABA 4H9NC 5LOVE 5JDFA 5HAXA 2VKOA 1LVKA 3ZMVB 3UULA 4C91A 4KP3C 3IF8B 5ETWA 3M65A 1MNDA 5M4YA 1MIYA 2XAGB 4JLEA 4X1IE 3FXEB 4HE8A 4YHJA 2K24A 3LK3B 3HKEE 3SWHA 2W62A 4OFZA 2PFVA 2LSJA 2JMKA 2W63A 5JDHA 5LHGB 2NTXA 4UVCB 1UX4A 3L09A 2BDEA 4PJNA 1Y64B 2B1EA 5L3GB 5LJNA 3PU8A 2V7IA 3RC8A 5F3JA 4IGUA 1O3XA 2JPFA 3MJXA 4QX8B 4M1PA 4ZOLE 5L3FB 5L2LA 3NZQA 3HKCE 1OXZA 4JEHB 3PUAA 1SA0E 5LG4A 3C98B 2VKHA 4F6RC 2ODUA 3CPZA 5LBMA 1MMNA 2VKDA 4MALA 2X66A 1MMAA 4UELA 2KNDA 5ADXL 3K8PC 1X79A 4TX5A 3WAKA 2Q9QD 1UX5A 2E9XD 2NP9A 4UXNB 3S4UA 3CQCB 5E0OA 2CMRA 3N9OA 3RX6A 4UF0A 2CM0A 4GYSA 3LFMA 3ETUA 3R6NA 1D0YA 4O2AE 4FJOA 2LE8A 3KINB 4CI3B 5FXWA 3RRWA 4IHJE 3LJCA 5L3EB 3ZPOA 4DBQA 2W61A 4K0UA 5FMNA 3QC9A 4UV9B 3I9YA 3PUSA 2YK0A 4I50E 2NWBA 1HTJF 1WLXA 3AAEB 2IC9A 2Y8DA 2WAUA 3AA7B 1FIOA 4EZ4A 3NBXX 4EXTA 3DP7A 4BJMA 4ZI7E 3ANWB 4IE5A 1SHZC 1AJ3A 4UVAB 3ZMUB 4BJNA 5JQGE 3UUMA 1OWAA 3J7Yq 4PAGA 5LXTE 1BR0A 1YKEB 4MFRA 4WBOA 3D0TA 4L9IA 3RC3A 2ZM8A 5H6RB 4G2AA 4TUYE 2DWGA 3V5UA 4H9SE 3SOLA 5L3DB 1G8XA 4H9PC 5JDQA 3HR0A 1ZEEA 3MXZA 2H7OA 4IE7A 4A56A 3CX6B 3L3PA 2X9HA 2E8IA 5KX5E 2CXLA 5EZYE 5FXVA 5JDNA 4EOZB 2LOSA 3J9X1 1IAPA 2CWOA 2ZMAA 4QXCB 4PFOA 3RRCA 3ZMSB 1ZKEA 1S94A 4ZS3A 4O4IE 2WWUA 4H63H 2DLRA 2W00A 4PJMA 3OBVE 4I4TE 5A1LA 2PBIA 2V1DB 2CA5A 4UVBB 2DNXA 3RH3A 5C8YE 4ZS2A 2N9DA 3RYFE 3AA1B 4P09A 3N9LA 3PUQA 2ZLYA 4GK5E 5LCYA 4ZI3D 2HPLA 3U78A 3I9WA 3W15B 3K3NA 5LP6E 2I59A 2Y6XA 2M67A 3VKGA 2HPJA 4P0BA 4WBNE 4H9RC 2ODVA 2V7KA 4ANJA 5CA1E 2LJLA 3I0OA 3OKQA 2LSYA 4UF0B 2C0SA 1Z0PA 2JRKA 4ZHQE 5LHIB 2LEHA 3KVBA 4CXWA 3UTKA 3FB2A 4TZ4C 3ZC0A 3HKDE 2X9YA 2DCFA 3BQIA 4DVDA 2LSKA 2V26A 3MK7C 3E08A 2J1DG 5EK3A 1US7B 3K3QC 4IDZA 5F8PA 3R84B 3LBXA 3PU3A 4IIJE 4ERRA 3AA6B 4PK5A 3KFWX 2X9WA 2KXPB 4OHFA 3CVRA 2W0GA 3QUJA 2L3LA 3P7IA 4L5GA 1BR1A 2HH7A 3ZYKA 2A72A 2YINA 1IJ5A 5L3BB 1NWMX 4QWNB 3O1IA 4O4LE 4UIGA 3Q5WA 4GK0E 2L8KA 4OK0A 5HXCA 3ZMZB 3HL6A 3ZJ2A 3PDYA 3T8OA 2WBLA 4O2BE 4PJLA 1ZV4X 4JEUB 2YU1A 5J1GA 5DQWA 4CXYA 1HFAA 1YW0A 1HG5A 4ADZA 4EZHA 3GA8A 2K9AA 1D1BA 2EHOD 2XAQB 5FNVE 5LNKA 3N9MA 3IEEA 2WMOA 1WYCA 1CUNA 1LKXA 2IW5B 4EB6E 2VKJA 4HGAA 1HX8A 1MIWA 2WSSV 1D0ZA 3JC6C 3VU7H 1HG2A 2JMHA 3OYZA 4YLHA 2BZBA 2SPCA 3HA4A 2LHNA 2X68A 1V9DA 5LYJE 4U72A 2Q9QC 2E9XC 3AAIA 2P9BA 1UCUA 1FEWA 3O1JA 4CI1B 5HXSA 5JDMA 4B6XA 4XAXB 2D0UA 3NZPA 5LGNB 3VHLA 4PJJA 5HXEA 2Q9QA 2E9XA 3N5LA 4O8SA 5JH7E 4IE4A 3CMLA 5JDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW8 A;  4U74 A;  2V7M A;  4HKA A;  3E08 A;  2X68 A;  5ETW A;  5EK3 A;  4PW8 A;  5EK4 A;  4PK6 A;  4U72 A;  2X67 A;  2X66 A;  4PK5 A;  5EK2 A;  2NWB A;  1ZEE A;  2V7L A;  2D0U A;  1YW0 A;  2NW9 A;  2V7J A;  2V7K A;  3BK9 A;  2NW7 A;  2D0T A;  2V7I A;  2NOX A; 
#chains in the Genus database with same CATH topology
 3K1S A;  2KWH A;  4X64 T;  2QA7 A;  3TLV A;  4KI0 F;  5C3J A;  4QXB B;  3DJB A;  4ZI2 C;  4GYR A;  2A2F X;  3CWZ B;  1U4Q A;  2LSI A;  4EIW A;  5FY7 A;  2NW7 A;  4TV9 E;  2RA1 A;  3FZK B;  4B3S T;  4MLK A;  4U33 A;  2DWK A;  3KBU A;  2WU5 A;  1N32 T;  3TKL B;  5ABH A;  3SRZ A;  3RKO A;  2VUR A;  5FXZ A;  4AQG A;  3NVO A;  2IUB A;  4DMV A;  2N2N A;  3N9N A;  5HEU A;  5AQI B;  4WW0 A;  4TV8 E;  4PFP A;  4PK6 A;  3M3Z B;  4QXH B;  3ZN0 B;  3RIU C;  5EK2 A;  3AEE A;  5IWA T;  5LGU B;  5CA0 E;  2JQQ A;  3L39 A;  2V6Y A;  2E9X B;  4JI2 T;  3ETV A;  3RIU A;  1KEY A;  3F57 A;  2W4X A;  3ZLI A;  2DI4 A;  1QUU A;  5HEJ A;  3CQX C;  4NXM T;  4F8H A;  1NAF A;  5AFU L;  2K48 A;  2BVL A;  4HWH A;  2MBG A;  2V5D A;  2VAS A;  2OA5 A;  2XQ7 A;  3AE2 A;  4PK4 A;  4AXP A;  3C4W A;  4I55 E;  2H89 A;  2BVM A;  5HWY A;  4I43 B;  4DUY T;  3AXJ B;  3JC6 D;  3A5X A;  5J2T E;  5L47 A;  4AKI A;  1WFD A;  2I6H A;  5FY1 A;  1YQ3 A;  3F2E A;  2JJ9 A;  2N1G A;  3P4P A;  4YTM A;  4DO0 A;  2WCA A;  2X9X A;  1IZN B;  4ILA A;  3PUG A;  2WM9 A;  3E0Z A;  3AE4 A;  1HS7 A;  4J2C A;  3UUN A;  4LF4 T;  1J5W A;  3OJA A;  2QRX A;  2J62 A;  5LMU T;  3ZYM A;  5JDG A;  5IYZ E;  2XM1 A;  2MAW A;  4A5X A;  2UXX B;  2WS3 A;  5FY0 A;  4YJ2 E;  2ES0 A;  1T8B A;  3UFG A;  3MAC A;  4GKK T;  4H9O C;  4QX7 B;  1MMG A;  3V5S A;  1YD8 G;  4WZX A;  1XNQ T;  5ABG A;  3N9Q A;  5FYM A;  1W09 A;  4X1K E;  3I0Q A;  1MMD A;  4K0K T;  2XUE A;  1FMW A;  3H3A A;  2A3D A;  3UU4 A;  5DAB A;  5JDF A;  4LFA T;  2VKO A;  1OED A;  5M4Y A;  1MND A;  1MIY A;  2XAG B;  4HE8 A;  2QYW A;  3HKE E;  3SWH A;  5LHG B;  2NTX A;  2W66 A;  4ZXL A;  2BDE A;  4PJN A;  4B3M T;  2B1E A;  3PU8 A;  3RC8 A;  3NZQ A;  5AQQ B;  1OXZ A;  4HWC A;  2UUB T;  4F6R C;  2ODU A;  3CPZ A;  2VKD A;  5AQM B;  2KND A;  2LLY A;  3K8P C;  4TX5 A;  3S4U A;  3CQC B;  2VVS A;  5AQS B;  5JTG A;  2IHR 1;  2JQK A;  3RRW A;  3LJC A;  3TLT A;  4KX6 A;  1OED E;  2OLT A;  4DV0 T;  1HNZ T;  2Y8D A;  4EZ4 A;  4EXT A;  5AQU B;  4JV5 T;  4EV6 A;  5FL1 A;  3AE7 A;  3UUM A;  1OWA A;  4JYA T;  1YKE B;  2XQ5 A;  4AQY T;  4TUY E;  4U2Y A;  4H9P C;  5JDQ A;  1ZEE A;  2XY8 B;  3ZT6 A;  4A56 A;  2WZH A;  3CX6 B;  3UU6 A;  2E8I A;  1IBM T;  4ZEY A;  3OVU A;  2LOS A;  3J9X 1;  2CWO A;  2ZMA A;  4HFE A;  4QXC B;  4PFO A;  4TWH A;  1S94 A;  3RIA A;  4ZS3 A;  2WWU A;  2DLR A;  4LF6 T;  3PJA J;  3AA1 B;  4P09 A;  3N9L A;  4GK5 E;  5FVK A;  3FZL B;  2I59 A;  5CA1 E;  2HN2 A;  3VR8 A;  4UF0 B;  2C0S A;  5LHI B;  5AQR B;  3JCF A;  3UTK A;  3HKD E;  3MK7 C;  3LDQ B;  5EK3 A;  1ZP0 A;  4IDZ A;  3KFW X;  4OHF A;  2A72 A;  2QVA A;  2F4V T;  2PTF A;  2W67 A;  2L8K A;  3EI0 A;  3AEG A;  3ZMZ B;  4COF A;  1HG5 A;  4EZH A;  2K9A A;  2EHO D;  5FNV E;  3L8R A;  3EAB A;  1CUN A;  4EB6 E;  2M6I A;  2FJD A;  4HGA A;  5FKY A;  1D0Z A;  1HG2 A;  4YLH A;  2BZB A;  5F5W A;  1V9D A;  5LYJ E;  2E9X C;  1UCU A;  4CI1 B;  5JDM A;  4XAX B;  5LGN B;  2E5V A;  2E9X A;  2XSA A;  3AE5 A;  2G0U A;  2UXN B;  4H63 V;  2WU2 A;  5HWX A;  4PNI A;  4E7Z A;  4YFS A;  3RYH E;  2YDR A;  4DV6 T;  2K5B B;  2DHR A;  4EYU A;  2KIN B;  3UQ7 A;  1YQ4 A;  2XTL A;  2C5I T;  4NUV A;  1NEN A;  4YTN A;  3GWH A;  4V1A v;  2ZM0 A;  4E7S A;  4AIU A;  3IBP A;  1S35 A;  4A97 A;  2L9Q A;  4EYY R;  3AXJ A;  2WB5 A;  3CQG B;  1J1J A;  2A9U A;  4BAY B;  5HYA A;  4AKH A;  2CWY A;  4ASK A;  3O4X E;  2CEA A;  2KLQ A;  2KZ7 B;  4HTE A;  1E7P A;  4CN1 A;  2CHN A;  2BS3 A;  3P4S A;  4I0U A;  1FMV A;  3N2O A;  5CB4 E;  1HF8 A;  2Y48 B;  3RYC E;  3RLF F;  3SS1 A;  1E1H B;  3FHN A;  3PV0 F;  2CCQ A;  4HEA A;  5J2U E;  2V5C A;  5FVL A;  2YU2 A;  1MIV A;  3MA9 A;  4CZZ B;  3AE3 A;  1Y01 A;  5L4E A;  3PUX F;  3ESL A;  3GN5 B;  2CLY B;  1BR2 A;  3NRY A;  5CJ5 A;  3EDU A;  3ZJ1 A;  3CX7 B;  2BG9 E;  5DJQ C;  4DR2 T;  3PUZ F;  4CN6 A;  4GKJ T;  1UK5 A;  2UXC T;  1LRZ A;  3KBT A;  3AEB A;  2WP9 A;  3QNU A;  1D1C A;  3OPC A;  1KK7 A;  5AQK B;  4XBF B;  2RP4 A;  3B13 A;  3P4W A;  3SFE A;  3N2K E;  2LM9 A;  5HCJ A;  2IAK A;  3UT5 E;  3A8Y C;  3Q5E A;  4DR6 T;  2V7L A;  1T72 A;  2ZM2 A;  2UXD T;  4ZI2 D;  1J5E T;  2NW9 A;  1KNZ A;  5JRC B;  3KVA A;  4NUU A;  3CKD A;  3ZN1 B;  3QK6 A;  2LOP A;  2KMF A;  2WMN A;  2XQY A;  4HFC A;  4YSY A;  3C64 A;  4X66 T;  1H7C A;  2UXB T;  4ISS A;  4C90 A;  4U74 A;  4ZI3 C;  5HXH A;  4PW8 A;  4DMW A;  4B3T T;  5J0Z A;  2H3R A;  4HN9 A;  2XAF B;  3EUH A;  1CHU A;  4XZC A;  2XQ8 A;  2R6G F;  3C51 A;  2EHO B;  1WCR A;  3LG7 A;  3C4X A;  3AAA B;  4HWF A;  4H9N C;  5LOV E;  1KFY A;  1LVK A;  3ZMV B;  3M65 A;  4JLE A;  3ONJ A;  3ZT7 A;  4TNV A;  1XDP A;  2LSJ A;  2W63 A;  1UX4 A;  3L09 A;  2WY2 A;  5AQO B;  5LJN A;  1E2A A;  2V7I A;  5F3J A;  5HEH A;  5LMN T;  4QX8 B;  4M1P A;  5L2L A;  5AQL B;  3HKC E;  1SA0 E;  2VKH A;  1KF6 A;  2X66 A;  4UEL A;  5ADX L;  4HWI B;  2WDQ A;  4ILB A;  2BKN A;  1UGO A;  4IL9 A;  5E0O A;  2CMR A;  3N9O A;  4UF0 A;  2YDS A;  5LB7 B;  4FJO A;  3KIN B;  4CI3 B;  3VRA A;  4DBQ A;  2BG9 B;  3AE9 A;  3I9Y A;  2YK0 A;  3EAM A;  2NWB A;  2ZM6 T;  1WLX A;  2WAU A;  3NBX X;  4BJM A;  3ANW B;  4IE5 A;  3LSV A;  4UVA B;  4QH5 A;  1BR0 A;  4WBO A;  2FJE A;  2DWG A;  3QB5 A;  2E5L T;  1FJG T;  3HR0 A;  4Z91 A;  4IE7 A;  3L3P A;  4ZZC A;  2X0Y A;  4EOZ B;  4A98 A;  4O4I E;  3OBV E;  5A1L A;  4UVB B;  2DNX A;  5C8Y E;  2KSR A;  5AQT B;  5LP6 E;  2Y6X A;  2M67 A;  3PJA A;  2J47 A;  2V7K A;  2LJL A;  3ABV A;  2LSY A;  2JRK A;  1Z0P A;  2LEH A;  1OED C;  2BBH A;  3FB2 A;  4TZ4 C;  3IA3 A;  2X9Y A;  3RIF A;  4DVD A;  5FL0 A;  4PK5 A;  4X5T A;  2X9W A;  3CVR A;  3QUJ A;  4DR3 T;  2YOE A;  2JQH A;  2HH7 A;  3JAF A;  3AEC A;  4O4L E;  3ZT5 A;  5AQJ B;  4YXD A;  3T8O A;  3CK6 A;  4DV1 T;  2HHH T;  1ZV4 X;  3RGL A;  2YU1 A;  2BBJ A;  5DQW A;  4CXY A;  1YW0 A;  3GA8 A;  1D1B A;  5LNK A;  1XDO A;  2CBI A;  1NEK A;  1LKX A;  3HA4 A;  4KHP T;  3EHZ A;  3PUV F;  3SFD A;  3AAI A;  5HXS A;  4B6X A;  3VHL A;  4PJJ A;  3N5L A;  4U2Z A;  4DR7 T;  2MPK A;  4HFI A;  2E2A A;  5AQV B;  2YKS A;  3PUY F;  4MHC A;  4BA9 A;  3C4Z A;  3NRX A;  2CE7 A;  3LBX B;  3PTR B;  2CLY C;  4DV2 T;  4CXX A;  5LGT B;  4TWF A;  4CN4 A;  3NKZ A;  4LF8 T;  2ACX A;  1T7S A;  3GN5 A;  4MBQ A;  4AQF A;  4OYJ A;  4ILU A;  3ZYL A;  1VCS A;  3MKD A;  3PUR A;  5JRE A;  3C50 A;  5ABF B;  2MYS A;  2V7J A;  3T1H T;  5AQH B;  3Q9D A;  3FBL A;  2LM2 A;  4YT0 A;  5H6Q B;  2FUP A;  2LT3 A;  4G63 A;  3KDS E;  4YY3 T;  2VL8 A;  3F31 A;  3RI5 A;  4L0R A;  3LK2 B;  3P8C D;  5AQG B;  3FXD B;  3GMI A;  4O4J E;  4NIQ A;  3EVY A;  5JRC A;  2DL1 A;  1ZHC A;  2NTY A;  4KUM B;  4HFH A;  4DV7 T;  4X20 E;  4TN7 B;  2FBW A;  1D1A A;  4DR5 T;  1XNR T;  2V7M A;  4CQI A;  4QHO A;  4KBM B;  2FJA A;  3ZC1 A;  5LHH B;  3VKH A;  3ZSS A;  4JI0 T;  4LFC T;  4ZZB A;  1D0X A;  5JR9 B;  1W0A A;  3U3I A;  3IHR A;  2GK9 A;  2X51 A;  3RKG A;  4IRE A;  2XQ6 A;  1BR4 A;  2IC6 A;  5IHY A;  2XHE B;  2CXF A;  3BQK A;  1QSD A;  2EHO C;  4AKG A;  2C5J A;  3AE6 A;  2K3W A;  2D5U A;  2EHO A;  3AEA A;  3WAJ A;  2QGS A;  2D0T A;  3ZEF B;  2XAJ B;  1WYB A;  4O4H E;  1U5P A;  3KV9 A;  5JVD E;  3ZCI A;  4P1N A;  3E22 E;  2OV9 A;  5HEO A;  3KV4 A;  4YSZ A;  4NPP A;  1WRD A;  3AVS A;  4EEB A;  4U3C A;  3T1Y T;  1HR0 T;  2UUA T;  2PG8 A;  2BKP A;  4UEM A;  4JI6 T;  2MOZ A;  3BK9 A;  4AI6 A;  2HN1 A;  3TLS A;  4HKA A;  1ZOY A;  2BG9 A;  4TNW A;  4DV5 T;  3P4Q A;  4JI5 T;  2IDO B;  4KMC A;  2XSB A;  4AIS A;  2M6B A;  3ANW A;  2C5K T;  1UUS A;  3UU5 A;  1HX1 B;  5CFB A;  5HAX A;  3UUL A;  4C91 A;  2XZE A;  1W0B A;  4YHJ A;  2W62 A;  4OFZ A;  2PFV A;  2CHO A;  5JDH A;  1YXR A;  1XMQ T;  5L3G B;  2WDV A;  3B5M A;  5BR8 T;  4IGU A;  1O3X A;  5LG3 A;  5L3F B;  3PUA A;  1X9B A;  1MMN A;  4MAL A;  1N33 T;  1DU2 A;  1X79 A;  1M62 A;  3WAK A;  2Q9Q D;  4UXN B;  2NP9 A;  3AE8 A;  2CM0 A;  5L4H A;  3ETU A;  1D0Y A;  4O2A E;  2LE8 A;  3A7M A;  3QC9 A;  2LRK A;  4I50 E;  2IC9 A;  1FIO A;  2NR4 A;  2VQE T;  4ZI7 E;  1AJ3 A;  3ZMU B;  4BJN A;  5JQG E;  3D0T A;  3RC3 A;  1HNW T;  4G2A A;  4H9S E;  3SOL A;  5L3D B;  1G8X A;  4IDN A;  1HNX T;  4X62 T;  3NWI A;  3MXZ A;  4NXN T;  3RQU A;  5HEG A;  5AQP B;  5EZY E;  5FXV A;  1IAP A;  3RRC A;  1ZKE A;  3ZST A;  4U7I A;  4PJM A;  4I4T E;  5KXJ A;  3RYF E;  2ACZ A;  3ZKR A;  5LCY A;  4ZI3 D;  2XJ7 A;  2HPL A;  3I9W A;  3W15 B;  3JAD A;  3VKG A;  4JI8 T;  2VL0 A;  1N34 T;  4WBN E;  4EED A;  4QH4 A;  4OX9 T;  3OKQ A;  4ZHQ E;  4CXW A;  2FJB A;  3BQI A;  2V26 A;  3E08 A;  3R84 B;  1US7 B;  3LBX A;  4IIJ E;  3AA6 B;  2KXP B;  5AQF B;  2W0G A;  3P7I A;  1BR1 A;  4DV3 T;  2XQ4 A;  3Q5D A;  4UIG A;  3Q5W A;  4GK0 E;  4OK0 A;  4IL4 A;  2IML A;  3ZJ2 A;  1W9R A;  2WBL A;  3TLU A;  2BS2 A;  4JEU B;  5ABF A;  1HFA A;  4ADZ A;  2XAQ B;  3IEE A;  2WMO A;  1WYC A;  2IW5 B;  2XQ9 A;  3TLW A;  1MIW A;  3JC6 C;  2LRL A;  3OYZ A;  2JMH A;  2SPC A;  2LHN A;  4ILC A;  2D0U A;  5IUX A;  5HXE A;  4LMK A;  2WQY A;  1VCT A;  4IT4 A;  4LMJ A;  3VR9 A;  3CML A;  5TAO A;  2YN6 A;  3AE1 A;  2MTQ A;  3AB3 B;  3ZMT B;  2WWV A;  1M7K A;  4EAH A;  2UUC T;  3LK4 2;  3AVR A;  3KV6 A;  5BMV E;  5EK4 A;  3FZM B;  5JR9 C;  5FXX A;  4LF7 T;  3AA0 B;  1SUM B;  2XAH B;  5JR9 A;  2WZI A;  2V6X A;  1VOM A;  3QB5 K;  1XMO T;  2NW8 A;  4Z90 A;  2LSG A;  3UUX B;  5FP3 A;  1MNE A;  5HXR A;  1WR6 A;  2XAS B;  1I94 T;  4IDP A;  1B7T A;  1IBK T;  4UV8 B;  4JI3 T;  4YJ3 E;  2PJQ A;  4Z8X A;  2BKO A;  5AQN B;  4CI2 B;  4YHH T;  4FI5 A;  4DID B;  3ONX A;  4HFV A;  4DV4 T;  3Q2M A;  2LKH A;  2H7V C;  4JI4 T;  4U31 A;  1HCI A;  2VB6 A;  3CX8 B;  3HKB E;  5KMG P;  2Q9Q B;  2D9D A;  4JBW F;  4DBR A;  4KHZ F;  1LVF A;  5DQV A;  1GQE A;  5LBQ B;  3RQW A;  5L3C B;  2CXD A;  2AXD S;  3B57 A;  5CGM A;  2D2S A;  4X65 T;  3O1H A;  3N2G E;  3UUB A;  3K3O A;  3ZCJ A;  3HI2 A;  3PE0 A;  4GOU A;  4IDO A;  3FBZ A;  2XQA A;  3UFE A;  2KT9 A;  1N36 T;  3MZK B;  4IDQ A;  2VWA A;  4EGW A;  1WR0 A;  2LKG A;  3I1A A;  1VRB A;  1XZY A;  1T98 A;  3OYX A;  2CBJ A;  2CPT A;  4YTP A;  2I0M A;  1EZ3 A;  2JIW A;  4P0A A;  3RYI E;  3DTO A;  1L0V A;  5LA6 E;  3AED A;  4JI7 T;  2NOX A;  4IE0 A;  3G06 A;  2VK9 A;  4N78 D;  2J4G A;  3RPU A;  1YKH B;  3ONL C;  2IIU A;  5LJM A;  3Q5X A;  1G73 A;  1IBL T;  4HFD A;  4YSX A;  4LF9 T;  4AKL A;  4AQF C;  2LHR A;  2V6Y B;  3EDV A;  2WDR A;  2X0L B;  2YEV C;  4DND A;  2BS4 A;  1R8I A;  4OYK A;  4H9Q C;  2X67 A;  2AE9 A;  3UQ4 A;  5ABE A;  2Z6E A;  1I6Z A;  3X1D A;  4JUY A;  3KV5 A;  4AKR B;  4GIW A;  4Q25 A;  1QLB A;  1IJ6 A;  2H88 A;  2KWI B;  3WI3 A;  4WNK A;  3BQL A;  1Z8U A;  4IST A;  3N9P A;  4X1Y E;  4IE6 A;  3O9X A;  5GON E;  4LML A;  5KDM C;  4QKN A;  3H37 A;  2XM2 A;  3FZF B;  4KP3 C;  3IF8 B;  5ETW A;  4X1I E;  3FXE B;  2K24 A;  3LK3 B;  3UU8 A;  3QOF A;  2JQ9 A;  2JMK A;  3AEF A;  4UVC B;  1Y64 B;  2JPF A;  1JNR A;  3MJX A;  4ZOL E;  4JEH B;  5LG4 A;  3C98 B;  4LFB T;  5LBM A;  1MMA A;  3JAE A;  3RF1 A;  1UX5 A;  2E9X D;  2V8S V;  2UU9 T;  4WYV A;  3RX6 A;  5C2T A;  4GYS A;  3LFM A;  3R6N A;  5FXW A;  4IHJ E;  4JI1 T;  5L3E B;  3ZPO A;  2W61 A;  4K0U A;  3RHW A;  5FMN A;  4UV9 B;  3PUS A;  1HTJ F;  3AAE B;  4LF5 T;  3AA7 B;  1JNZ A;  2XQ3 A;  3DP7 A;  4DR4 T;  1SHZ C;  3J7Y q;  4PAG A;  5LXT E;  4MFR A;  4L9I A;  3H3M A;  2ZM8 A;  5H6R B;  3V5U A;  1OED B;  5HCM A;  2H7O A;  2X9H A;  4B3R T;  5KX5 E;  2CXL A;  5JDN A;  3ZMS B;  2W2U A;  4DUZ T;  2BG9 C;  4H63 H;  2W00 A;  1XWM A;  2PBI A;  2V1D B;  2CA5 A;  3RH3 A;  4ZS2 A;  2N9D A;  3PUQ A;  2ZLY A;  3U78 A;  3K3N A;  3OTO T;  2HPJ A;  4P0B A;  4H9R C;  2B76 A;  2ODV A;  4ANJ A;  3I0O A;  3KVB A;  4DR1 T;  1UUR A;  4UR9 A;  3ZC0 A;  3CIR A;  2DCF A;  3FZH B;  2YDQ A;  3PUW F;  2LSK A;  2J1D G;  5F8P A;  3K3Q C;  3P50 A;  3VRB A;  3PU3 A;  4ERR A;  4HFB A;  2VQF T;  2L3L A;  4L5G A;  3ZYK A;  2YIN A;  1IJ5 A;  5L3B B;  1NWM X;  4QWN B;  3O1I A;  1KNP A;  5HXC A;  1SE7 A;  3UU3 A;  3HL6 A;  1KNR A;  3PDY A;  4O2B E;  4PJL A;  2X0H A;  5J1G A;  4QH1 A;  3N9M A;  2VKJ A;  4HWD A;  1HX8 A;  2WSS V;  2RPA A;  3VU7 H;  2X68 A;  2VVN A;  2CRB A;  3P4R A;  4U72 A;  2Q9Q C;  2P9B A;  1FEW A;  3O1J A;  3NZP A;  4TWD A;  2Q9Q A;  4O8S A;  5JH7 E;  4IE4 A;  2XPK A;  4U7Y A;  5JDL A; 
#chains in the Genus database with same CATH homology
 5TAO A;  2G0U A;  2UXN B;  4H63 V;  2KWH A;  5HWX A;  2MTQ A;  3AB3 B;  4MHC A;  4PNI A;  2QA7 A;  3C4Z A;  3ZMT B;  4BA9 A;  3NRX A;  4E7Z A;  4YFS A;  3RYH E;  2CE7 A;  4EAH A;  3LK4 2;  3AVR A;  3KV6 A;  5BMV E;  2K5B B;  4QXB B;  5EK4 A;  3DJB A;  3LBX B;  2DHR A;  4EYU A;  4ZI2 C;  2KIN B;  3PTR B;  5JR9 C;  5FXX A;  2XTL A;  2CLY C;  4GYR A;  2C5I T;  4NUV A;  2A2F X;  3AA0 B;  3CWZ B;  4CXX A;  5LGT B;  1U4Q A;  2LSI A;  3GWH A;  4EIW A;  2ACX A;  2XAH B;  5JR9 A;  3GN5 A;  4V1A v;  5FY7 A;  2NW7 A;  2ZM0 A;  4E7S A;  4TV9 E;  2RA1 A;  1VOM A;  3IBP A;  4MBQ A;  4AQF A;  1S35 A;  4OYJ A;  4ILU A;  3ZYL A;  2NW8 A;  4MLK A;  2L9Q A;  2LSG A;  3MKD A;  3PUR A;  5JRE A;  3UUX B;  4EYY R;  5FP3 A;  1MNE A;  5HXR A;  1WR6 A;  2DWK A;  2XAS B;  3C50 A;  3KBU A;  1B7T A;  3TKL B;  2MYS A;  3CQG B;  3SRZ A;  4UV8 B;  3RKO A;  4YJ3 E;  2PJQ A;  4Z8X A;  2V7J A;  5FXZ A;  4BAY B;  4AQG A;  5HYA A;  3Q9D A;  4AKH A;  3FBL A;  5H6Q B;  4DMV A;  4CI2 B;  2N2N A;  2LT3 A;  3N9N A;  2CWY A;  4FI5 A;  4G63 A;  3KDS E;  4ASK A;  3ONX A;  4HFV A;  3Q2M A;  3O4X E;  2H7V C;  2CEA A;  2KLQ A;  2KZ7 B;  4WW0 A;  2VL8 A;  4HTE A;  4TV8 E;  4PFP A;  3F31 A;  4L0R A;  3LK2 B;  3P8C D;  4PK6 A;  3ZN0 B;  4QXH B;  1HCI A;  2VB6 A;  3CX8 B;  5EK2 A;  3FXD B;  3HKB E;  3GMI A;  5KMG P;  5LGU B;  1FMV A;  4O4J E;  2JQQ A;  5CA0 E;  3EVY A;  3N2O A;  2Q9Q B;  2E9X B;  3ETV A;  5CB4 E;  1HF8 A;  2Y48 B;  5JRC A;  3RYC E;  4DBR A;  1ZHC A;  3SS1 A;  1E1H B;  1LVF A;  3F57 A;  3ZLI A;  2NTY A;  4KUM B;  5DQV A;  3FHN A;  4X20 E;  2CCQ A;  2DI4 A;  4HEA A;  1QUU A;  3CQX C;  4TN7 B;  5J2U E;  5LBQ B;  1D1A A;  5L3C B;  2CXD A;  2V7M A;  4CQI A;  1NAF A;  3B57 A;  2YU2 A;  4QHO A;  4KBM B;  2D2S A;  3O1H A;  1MIV A;  2K48 A;  3MA9 A;  3K3O A;  3N2G E;  3ZC1 A;  2BVL A;  4CZZ B;  5AFU L;  3ZCJ A;  3HI2 A;  2MBG A;  5LHH B;  3PE0 A;  3VKH A;  4GOU A;  2VAS A;  2OA5 A;  3FBZ A;  4PK4 A;  1D0X A;  3ESL A;  3UFE A;  5JR9 B;  2KT9 A;  3U3I A;  3GN5 B;  2CLY B;  3IHR A;  3MZK B;  4AXP A;  1BR2 A;  2VWA A;  2GK9 A;  3C4W A;  3NRY A;  2X51 A;  3I1A A;  4I55 E;  1VRB A;  5HWY A;  2BVM A;  3EDU A;  4I43 B;  3ZJ1 A;  1T98 A;  1BR4 A;  3CX7 B;  3OYX A;  5DJQ C;  3JC6 D;  2IC6 A;  5IHY A;  2XHE B;  2CXF A;  3A5X A;  3BQK A;  5J2T E;  1EZ3 A;  1QSD A;  2EHO C;  4AKG A;  2C5J A;  4P0A A;  4AKI A;  1LRZ A;  3RYI E;  3KBT A;  1D1C A;  3DTO A;  2D5U A;  5LA6 E;  1KK7 A;  2EHO A;  3WAJ A;  5FY1 A;  2QGS A;  2D0T A;  3ZEF B;  2NOX A;  4IE0 A;  3F2E A;  2JJ9 A;  2N1G A;  2XAJ B;  2VK9 A;  4XBF B;  2RP4 A;  4N78 D;  1WYB A;  3B13 A;  4DO0 A;  4O4H E;  3N2K E;  2LM9 A;  1U5P A;  2IAK A;  1YKH B;  3KV9 A;  2X9X A;  5JVD E;  3RPU A;  5LJM A;  3UT5 E;  1IZN B;  3Q5X A;  3ZCI A;  1G73 A;  3E22 E;  2V7L A;  3PUG A;  2WM9 A;  3E0Z A;  4AKL A;  3KV4 A;  2ZM2 A;  4AQF C;  4ZI2 D;  2LHR A;  2NW9 A;  1KNZ A;  1HS7 A;  5JRC B;  3EDV A;  1WRD A;  4J2C A;  3UUN A;  3KVA A;  4NUU A;  3AVS A;  2X0L B;  3CKD A;  2YEV C;  4DND A;  3ZN1 B;  3OJA A;  3QK6 A;  2LOP A;  2KMF A;  4OYK A;  3ZYM A;  5JDG A;  4H9Q C;  5IYZ E;  2WMN A;  2XQY A;  2PG8 A;  2X67 A;  4UEM A;  2UXX B;  3C64 A;  2MOZ A;  2Z6E A;  5FY0 A;  4YJ2 E;  2ES0 A;  4JUY A;  3BK9 A;  3KV5 A;  3MAC A;  4AKR B;  4AI6 A;  1H7C A;  4H9O C;  4QX7 B;  1MMG A;  3V5S A;  4GIW A;  4ISS A;  4C90 A;  4U74 A;  1IJ6 A;  1YD8 G;  2KWI B;  4ZI3 C;  5HXH A;  4HKA A;  4PW8 A;  3WI3 A;  4WNK A;  3BQL A;  4DMW A;  3N9Q A;  5FYM A;  4IST A;  3N9P A;  4X1K E;  3I0Q A;  2H3R A;  4HN9 A;  1MMD A;  2XAF B;  3EUH A;  4KMC A;  2XUE A;  4X1Y E;  4XZC A;  1FMW A;  3H3A A;  4IE6 A;  3O9X A;  3ANW A;  5GON E;  3C51 A;  2EHO B;  2A3D A;  3LG7 A;  3C4X A;  5KDM C;  4QKN A;  3H37 A;  2C5K T;  3AAA B;  5DAB A;  4H9N C;  5LOV E;  5JDF A;  5HAX A;  2VKO A;  1LVK A;  3ZMV B;  3UUL A;  4C91 A;  4KP3 C;  3IF8 B;  5ETW A;  3M65 A;  1MND A;  5M4Y A;  1MIY A;  2XAG B;  4JLE A;  4X1I E;  3FXE B;  4HE8 A;  4YHJ A;  2K24 A;  3LK3 B;  3HKE E;  3SWH A;  2W62 A;  4OFZ A;  2PFV A;  2LSJ A;  2JMK A;  2W63 A;  5JDH A;  5LHG B;  2NTX A;  4UVC B;  1UX4 A;  3L09 A;  2BDE A;  4PJN A;  1Y64 B;  2B1E A;  5L3G B;  5LJN A;  3PU8 A;  2V7I A;  3RC8 A;  5F3J A;  4IGU A;  1O3X A;  2JPF A;  3MJX A;  4QX8 B;  4M1P A;  4ZOL E;  5L3F B;  5L2L A;  3NZQ A;  3HKC E;  1OXZ A;  4JEH B;  3PUA A;  1SA0 E;  5LG4 A;  3C98 B;  2VKH A;  4F6R C;  2ODU A;  3CPZ A;  5LBM A;  1MMN A;  2VKD A;  4MAL A;  2X66 A;  1MMA A;  4UEL A;  2KND A;  5ADX L;  3K8P C;  1X79 A;  4TX5 A;  3WAK A;  2Q9Q D;  1UX5 A;  2E9X D;  2NP9 A;  4UXN B;  3S4U A;  3CQC B;  5E0O A;  2CMR A;  3N9O A;  3RX6 A;  4UF0 A;  2CM0 A;  4GYS A;  3LFM A;  3ETU A;  3R6N A;  1D0Y A;  4O2A E;  4FJO A;  2LE8 A;  3KIN B;  4CI3 B;  5FXW A;  3RRW A;  4IHJ E;  3LJC A;  5L3E B;  3ZPO A;  4DBQ A;  2W61 A;  4K0U A;  5FMN A;  3QC9 A;  4UV9 B;  3I9Y A;  3PUS A;  2YK0 A;  4I50 E;  2NWB A;  1HTJ F;  1WLX A;  3AAE B;  2IC9 A;  2Y8D A;  2WAU A;  3AA7 B;  1FIO A;  4EZ4 A;  3NBX X;  4EXT A;  3DP7 A;  4BJM A;  4ZI7 E;  3ANW B;  4IE5 A;  1SHZ C;  1AJ3 A;  4UVA B;  3ZMU B;  4BJN A;  5JQG E;  3UUM A;  1OWA A;  3J7Y q;  4PAG A;  5LXT E;  1BR0 A;  1YKE B;  4MFR A;  4WBO A;  3D0T A;  4L9I A;  3RC3 A;  2ZM8 A;  5H6R B;  4G2A A;  4TUY E;  2DWG A;  3V5U A;  4H9S E;  3SOL A;  5L3D B;  1G8X A;  4H9P C;  5JDQ A;  3HR0 A;  1ZEE A;  3MXZ A;  2H7O A;  4IE7 A;  4A56 A;  3CX6 B;  3L3P A;  2X9H A;  2E8I A;  5KX5 E;  2CXL A;  5EZY E;  5FXV A;  5JDN A;  4EOZ B;  2LOS A;  3J9X 1;  1IAP A;  2CWO A;  2ZMA A;  4QXC B;  4PFO A;  3RRC A;  3ZMS B;  1ZKE A;  1S94 A;  4ZS3 A;  4O4I E;  2WWU A;  4H63 H;  2DLR A;  2W00 A;  4PJM A;  3OBV E;  4I4T E;  5A1L A;  2PBI A;  2V1D B;  2CA5 A;  4UVB B;  2DNX A;  3RH3 A;  5C8Y E;  4ZS2 A;  2N9D A;  3RYF E;  3AA1 B;  4P09 A;  3N9L A;  3PUQ A;  2ZLY A;  4GK5 E;  5LCY A;  4ZI3 D;  2HPL A;  3U78 A;  3I9W A;  3W15 B;  3K3N A;  5LP6 E;  2I59 A;  2Y6X A;  2M67 A;  3VKG A;  2HPJ A;  4P0B A;  4WBN E;  4H9R C;  2ODV A;  2V7K A;  4ANJ A;  5CA1 E;  2LJL A;  3I0O A;  3OKQ A;  2LSY A;  4UF0 B;  2C0S A;  1Z0P A;  2JRK A;  4ZHQ E;  5LHI B;  2LEH A;  3KVB A;  4CXW A;  3UTK A;  3FB2 A;  4TZ4 C;  3ZC0 A;  3HKD E;  2X9Y A;  2DCF A;  3BQI A;  4DVD A;  2LSK A;  2V26 A;  3MK7 C;  3E08 A;  2J1D G;  5EK3 A;  1US7 B;  3K3Q C;  4IDZ A;  5F8P A;  3R84 B;  3LBX A;  3PU3 A;  4IIJ E;  4ERR A;  3AA6 B;  4PK5 A;  3KFW X;  2X9W A;  2KXP B;  4OHF A;  3CVR A;  2W0G A;  3QUJ A;  2L3L A;  3P7I A;  4L5G A;  1BR1 A;  2HH7 A;  3ZYK A;  2A72 A;  2YIN A;  1IJ5 A;  5L3B B;  1NWM X;  4QWN B;  3O1I A;  4O4L E;  4UIG A;  3Q5W A;  4GK0 E;  2L8K A;  4OK0 A;  5HXC A;  3ZMZ B;  3HL6 A;  3ZJ2 A;  3PDY A;  3T8O A;  2WBL A;  4O2B E;  4PJL A;  1ZV4 X;  4JEU B;  2YU1 A;  5J1G A;  5DQW A;  4CXY A;  1HFA A;  1YW0 A;  1HG5 A;  4ADZ A;  4EZH A;  3GA8 A;  2K9A A;  1D1B A;  2EHO D;  2XAQ B;  5FNV E;  5LNK A;  3N9M A;  3IEE A;  2WMO A;  1WYC A;  1CUN A;  1LKX A;  2IW5 B;  4EB6 E;  2VKJ A;  4HGA A;  1HX8 A;  1MIW A;  2WSS V;  1D0Z A;  3JC6 C;  3VU7 H;  1HG2 A;  2JMH A;  3OYZ A;  4YLH A;  2BZB A;  2SPC A;  3HA4 A;  2LHN A;  2X68 A;  1V9D A;  5LYJ E;  4U72 A;  2Q9Q C;  2E9X C;  3AAI A;  2P9B A;  1UCU A;  1FEW A;  3O1J A;  4CI1 B;  5HXS A;  5JDM A;  4B6X A;  4XAX B;  2D0U A;  3NZP A;  5LGN B;  3VHL A;  4PJJ A;  5HXE A;  2Q9Q A;  2E9X A;  3N5L A;  4O8S A;  5JH7 E;  4IE4 A;  3CML A;  5JDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...