2NW8A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
266
structure length
266
Chain Sequence
EGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
total genus 105
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw8A00
2NW7A 4U72A 2V7MA 2NW8A 4HKAA 2NW9A 2V7LA 5EK4A 4PK5A 2X66A 2V7IA 4U74A 2X67A 2NOXA 4PK6A 2D0UA 3BK9A 2NWBA 4PW8A 2V7JA 3E08A 5ETWA 2D0TA 1YW0A 5EK3A 2V7KA 1ZEEA 5EK2A 2X68A
chains in the Genus database with same CATH superfamily
1OEDB 2IDOB 2KZ7B 1D0YA 2IC9A 2WZIA 1US7B 3VRAA 2YINA 2NW8A 3GA8A 4HKAA 4QXHB 3L3PA 4YJ3E 5FXXA 2CRBA 3RF1A 2PFVA 1HTJF 3AEDA 2KLQA 2WSSV 4JI2T 3RIUC 2I0MA 3H37A 4COFA 2JQKA 4L0RA 5ABGA 4M1PA 5AQUB 5KMGP 3NWIA 4X66T 4YSXA 2BG9C 3CX7B 3UT5E 2VWAA 4HFHA 4CI1B 3Q5WA 5LMUT 1UUSA 4YSYA 1BR0A 2K5BB 3VU7H 4BJMA 2B76A 4ILCA 3O1HA 2K9AA 2K24A 1YKHB 3PU3A 1N32T 1FEWA 4P1NA 2UUBT 3P4SA 2V7KA 4U7YA 3UUMA 1ZP0A 2JIWA 4ILAA 4X20E 3RI5A 4PNIA 2H3RA 3C4ZA 5FNVE 5M4YA 4GYSA 4X64T 5L47A 4AKGA 1VRBA 4I50E 4QXBB 4PK4A 1D1BA 3NRYA 1Y01A 3F2EA 3O4XE 2QA7A 4O4HE 3ZMVB 2NW9A 1I94T 1E7PA 4BAYB 2KXPB 3LDQB 2I6HA 3HI2A 2Z6EA 3CQGB 2V7IA 3QOFA 1W0AA 4GK5E 4KHZF 4HEAA 2NOXA 4PJNA 4QXCB 1ZHCA 4HWHA 4DR2T 4AI6A 2CXDA 2VL0A 3ETUA 1SUMB 3IF8B 3PV0F 3FZHB 3N9NA 4CN4A 1IBMT 5HEUA 3PUAA 4X1YE 2VL8A 2XAGB 3EVYA 3AEEA 1XNQT 4UR9A 2UXDT 4TWFA 1HG2A 3C64A 4WYVA 3F31A 4TNWA 2ZM0A 5HXCA 5BMVE 3B13A 2E9XA 2XJ7A 2KSRA 3N2OA 2LM2A 1S94A 2RA1A 4IT4A 5C3JA 5FY7A 1XMQT 3P7IA 2W62A 3G06A 3AEAA 2BKNA 3MA9A 1E2AA 3AVSA 3CK6A 3AE5A 1KK7A 3CQCB 1W9RA 1WFDA 4IHJE 4KMCA 4CN6A 5HXEA 2ES0A 3C4XA 4CXWA 4ZZCA 2L9QA 1ZV4X 2Y8DA 4IGUA 4MFRA 4EB6E 2BS4A 5AQGB 4UVBB 4NXNT 4EZ4A 4X1IE 4PAGA 3SFEA 3UU5A 4UIGA 2EHOB 2Q9QA 1FMWA 4ERRA 1YQ4A 3C51A 2E5LT 3T8OA 3B57A 4O2BE 2L3LA 3CWZB 2HPJA 2CWOA 2DL1A 3Q9DA 3KV5A 4L9IA 4OK0A 2VB6A 3KFWX 5HXRA 2IW5B 2ACZA 5L4EA 1MMAA 3K1SA 4B3RT 2RPAA 3C50A 4DV4T 1BR2A 3QB5K 4TV9E 4ZS2A 4ANJA 4IDPA 2AE9A 2V8SV 4LF9T 4JI6T 2ZM6T 2D2SA 2R6GF 2WU5A 1BR1A 4YFSA 2XQ4A 5EK3A 4ZEYA 5HXHA 2OLTA 3AB3B 5DQWA 4UV8B 1JNRA 1UK5A 2VASA 2VKDA 5AQSB 2BS2A 4PFPA 4P0AA 1WCRA 4UEMA 2V5CA 3ZMSB 2E8IA 2XM2A 3LSVA 5LBMA 3LFMA 2E5VA 2E2AA 4HWDA 3RIUA 2CEAA 4WW0A 1T98A 4JV5T 5H6QB 2QRXA 3I9YA 2X66A 4H63V 4U74A 4MLKA 4AQFC 3TLSA 4XAXB 4YT0A 2LOPA 5LMNT 1XNRT 1U4QA 2LHNA 3I9WA 3RQWA 2CHNA 5EZYE 3CVRA 1HNXT 3ANWB 2V6XA 1X79A 4GKKT 4JEHB 3PUXF 1J1JA 3UUNA 4DR1T 3T1YT 1I6ZA 4H9QC 4F6RC 2VVNA 1MNEA 2I59A 2FJBA 2PJQA 3HKDE 1XMOT 3PE0A 4GOUA 2MAWA 3SOLA 5ADXL 2P9BA 1HX1B 2XQ6A 4BJNA 3OTOT 5ABHA 2LSJA 2XSBA 3JC6C 3PJAA 4DMWA 1ZEEA 3A7MA 4LMKA 2X68A 4A97A 3ZT6A 3AXJB 2LSKA 3AE8A 3AXJA 2DLRA 3OYXA 1UURA 2LHRA 4IE5A 4PJMA 3RYCE 2WQYA 1NENA 3RLFF 5LGTB 2HH7A 2X0YA 3ZJ1A 1LRZA 2Y48B 1MMDA 5LGUB 3O9XA 2V26A 2DCFA 2QVAA 4DV6T 2M6BA 4GYRA 3LBXA 3AA0B 4YTNA 4CI3B 2C5KT 2LRKA 3OBVE 4IE7A 4O4LE 2BBJA 3SS1A 2XPKA 5JDHA 4QKNA 2W0GA 3BQKA 2KWHA 2LJLA 5HWXA 5AQIB 4ZOLE 5AQTB 2WAUA 3J9X1 4DV5T 3RC8A 4X65T 1E1HB 4YHHT 1O3XA 1R8IA 2WMOA 2VURA 4CI2B 3AEFA 3MKDA 1FJGT 5L3BB 5BR8T 2NP9A 4ILUA 1HCIA 4U31A 5J1GA 4LFAT 2CXLA 3E0ZA 1KNPA 2MBGA 1HNZT 2BBHA 2K48A 3EDVA 2VQFT 3P4RA 5LXTE 2PG8A 4QX8B 5JDGA 2W61A 3ZPOA 2F4VT 2W67A 1Z0PA 2C0SA 3FBLA 4HFIA 4ISTA 4LF4T 2G0UA 5LJMA 4DR3T 4HTEA 3ZCJA 4ISSA 5FXZA 3ONJA 3MJXA 4ZI2C 3ZYLA 3D0TA 3NZPA 3RIAA 4ADZA 2LLYA 2LSYA 4DV0T 4ZZBA 4B6XA 5LGNB 3ABVA 1H7CA 3C98B 4HGAA 4EOZB 1S35A 1LVFA 2KWIB 4KP3C 1YD8G 3Q2MA 4TWDA 3TLWA 3TLTA 3CX8B 2ODUA 2LE8A 2QGSA 2Y6XA 2FUPA 3CX6B 3IEEA 3NZQA 3V5SA 5JDNA 2LOSA 1KNZA 3IBPA 3FXEB 1GQEA 3CPZA 1NWMX 1M7KA 1LVKA 2N9DA 4TZ4C 4PFOA 4JI3T 2WZHA 3GMIA 4H9NC 4HFDA 2XHEB 1SA0E 3GN5B 1XDOA 3GN5A 3JC6D 3E22E 4JBWF 2WB5A 2J47A 4UF0B 2OV9A 3C4WA 1V9DA 5FXVA 3W15B 4AQYT 5KX5E 4DV7T 2LT3A 1N34T 3LG7A 1WYBA 4B3TT 1T7SA 5AQKB 5IYZE 3O1IA 5FL1A 2GK9A 3QNUA 1BR4A 1MIVA 2H88A 5CB4E 3TLVA 3SWHA 1B7TA 3A5XA 3BK9A 4KBMB 1W09A 3LK42 2YOEA 3SFDA 5AQLB 4DBRA 5LG4A 2VKJA 1D1AA 2A9UA 4ILBA 2ACXA 4O4IE 4TNVA 4IE4A 5FP3A 5LCYA 3UUBA 3QB5A 1MIYA 5ABFA 4QWNB 2OA5A 4UVAB 4AXPA 1SHZC 1FIOA 4K0KT 5J0ZA 2HN1A 3T1HT 3DP7A 2WWUA 2J1DG 4HN9A 4HWCA 4EIWA 5JREA 5HCJA 5AQHB 3H3AA 3IHRA 1D1CA 2LSIA 4TV8E 4YLHA 3L39A 2MOZA 4JEUB 4WBOA 4IIJE 4EEDA 2CMRA 4WNKA 2XQYA 2BKPA 1UCUA 3UQ4A 2EHOA 3OPCA 4LF8T 3FZLB 3AEBA 4ZI3D 2IC6A 5HEHA 3P4WA 1XDPA 3JAEA 3K8PC 3P50A 2UXCT 2V6YB 2YDQA 4AKRB 4JI0T 4IE0A 2BG9A 2DI4A 2BG9B 4PW8A 2LSGA 3PDYA 5FVLA 5JDFA 2CWYA 3ZC0A 3PUGA 5ETWA 3VHLA 2FJEA 2KINB 3ZEFB 4HFEA 5JH7E 4NUVA 4ZXLA 4A5XA 2UXBT 3CIRA 2EHOD 3PUSA 2HPLA 4U2ZA 1DU2A 3MZKB 2YU1A 3N9MA 4NUUA 1HS7A 2YN6A 3KDSE 3ONLC 1UX5A 5HCMA 2W63A 2CXFA 4HE8A 4FI5A 2IUBA 2WDRA 1KFYA 2A3DA 3EAMA 2YEVC 3EDUA 2CBJA 5L4HA 3ZSSA 5LHIB 4YY3T 4JYAT 2YU2A 4PJJA 2W4XA 4EGWA 3KV4A 3HR0A 4XZCA 2FBWA 2WS3A 4H9PC 5FVKA 4AIUA 5JTGA 1N36T 3X1DA 3BQIA 3J7Yq 3PUQA 4A56A 3MK7C 4DBQA 3H3MA 4OYKA 2X67A 2D5UA 3WI3A 3JCFA 3RIFA 3UFGA 2H7VC 2SPCA 3RPUA 4CZZB 4BA9A 5C2TA 5JQGE 4CXXA 5FYMA 4LF6T 2IIUA 1HX8A 1HG5A 3UFEA 2V6YA 4UXNB 5JDLA 2YKSA 5JR9B 5JR9A 3ZYKA 3ZC1A 2H7OA 5AFUL 4B3MT 5J2UE 2FJDA 4DR7T 2BG9E 4I0UA 5ABFB 2WMNA 4XBFB 2VQET 1L0VA 4OFZA 1MIWA 2A72A 3CMLA 1OXZA 3ONXA 3FZMB 3RRWA 4EV6A 5HXSA 1LKXA 4I55E 1YQ3A 4UVCB 1ZKEA 4KI0F 5LP6E 3FB2A 1M62A 1MMNA 1ZOYA 1OEDC 3PUWF 5L3FB 4OYJA 2FJAA 3RHWA 2ZLYA 2V7LA 2Q9QC 2XAFB 2UXXB 2JQ9A 1WRDA 5L3GB 3UU4A 3K3NA 4KHPT 3U3IA 4HWIB 1EZ3A 2XQ8A 3L8RA 3LK3B 4DV1T 2BVLA 4L5GA 3RYIE 3UU3A 4EZHA 2H89A 3I0QA 4DV3T 5CA1E 3RKOA 2XSAA 4IDZA 2VK9A 4F8HA 3UUXB 5KDMC 4OHFA 3R84B 4LF7T 2WU2A 2LM9A 4C90A 4Q25A 3LJCA 4O4JE 2IMLA 5AQOB 2VKOA 2W2UA 3VKHA 3PU8A 5C8YE 3ZMZB 2BS3A 1D0XA 1Z8UA 3RGLA 4DR4T 4P0BA 1HNWT 1MNDA 4AISA 1CUNA 2LEHA 1YXRA 4KX6A 2KNDA 2DWGA 3KVBA 2JRKA 3FXDB 3NBXX 4U72A 3VR8A 2XQ3A 5KXJA 2WY2A 3NVOA 1XZYA 4V1Av 3UU8A 4U3CA 4CXYA 2N2NA 2WDQA 3PUZF 1G8XA 1VCSA 3DTOA 3I1AA 4AQFA 5J2TE 4Z91A 1HF8A 2IAKA 2CHOA 3KBTA 4HFVA 1KF6A 5HYAA 3P4QA 2CCQA 4TUYE 5CJ5A 2NWBA 1QLBA 2X9HA 2JPFA 3AECA 3AA1B 4H9RC 4DO0A 4HFCA 4DR5T 4EAHA 4DNDA 3M65A 2KT9A 4EYUA 3ZCIA 5L3DB 2WCAA 4LFCT 3P8CD 1T8BA 3FBZA 2YDSA 2ZM8A 3R6NA 3UU6A 1VOMA 4DMVA 2NTYA 4UF0A 5DQVA 2J4GA 4I43B 4QH5A 1D0ZA 4HWFA 3KBUA 3GWHA 4ASKA 5ABEA 2JQQA 3AA6B 3AAEB 2XM1A 3JADA 4JI5T 2CPTA 4IL4A 3AAAB 4JLEA 4QX7B 2Q9QB 4ZS3A 4E7ZA 3N2GE 2DNXA 3PUYF 2C5JA 4YTMA 5TAOA 4CQIA 4QH4A 4OX9T 3FHNA 1QUUA 5AQFB 1IBLT 3QK6A 1U5PA 1UGOA 2CLYB 2JMHA 4E7SA 2NTXA 5LHHB 3OYZA 2DHRA 2IHR1 4QH1A 5AQPB 4IREA 5FMNA 2X51A 2NR4A 2VVSA 4PK5A 2LKHA 3HKEE 1IZNB 1SE7A 4GKJT 2A2FX 3B5MA 4IL9A 1HFAA 3PURA 2RP4A 2V7JA 4NIQA 3AEGA 5F5WA 3ZMTB 2JJ9A 3NKZA 3Q5EA 3K3OA 3RRCA 4TX5A 5DABA 4IE6A 4MHCA 3ZT5A 2AXDS 2CBIA 2XQAA 3N9QA 4ZI7E 5LB7B 3ZSTA 1KEYA 4GIWA 5A1LA 3FZKB 1IJ6A 4U33A 3M3ZB 2BDEA 2XZEA 5AQRB 4A98A 2BVMA 1NAFA 3N5LA 2Q9QD 3ZJ2A 3I0OA 1OEDE 4AKLA 3N9OA 5L3CB 4ZI2D 1KNRA 2XAQB 2XQ9A 1OEDA 1W0BA 4UELA 2WM9A 3Q5DA 2YK0A 5HAXA 3RYFE 3CKDA 4AQGA 1WLXA 2NW7A 4UV9B 4X5TA 2V7MA 2ZMAA 1T72A 2D9DA 2MYSA 2X9YA 4JI7T 3V5UA 4G63A 4O8SA 3MXZA 2W00A 5EK4A 4KUMB 5AQMB 3U78A 3ZMUB 3ETVA 4EEBA 4ZI3C 4H9SE 4WBNE 2PBIA 3EUHA 4J2CA 1IAPA 3AE3A 4IDOA 5GONE 2WWVA 4IDNA 4YJ2E 3PJAJ 4AKIA 3ANWA 4K0UA 4EYYR 4FJOA 3E08A 1YKEB 3S4UA 2BKOA 2VKHA 5LBQB 3RQUA 5LJNA 5FKYA 3AE2A 1X9BA 1VCTA 4DUYT 4YTPA 2JQHA 3QC9A 5HWYA 2X9XA 2YDRA 1QSDA 2LRLA 4YHJA 2JMKA 1OWAA 3K3QC 4B3ST 2MPKA 3ESLA 4H9OC 5FY1A 2CM0A 5LNKA 2DWKA 3RKGA 2M67A 5AQVB 2X0LB 2E9XB 3ZN1B 2LKGA 2W66A 5DJQC 4JI1T 3JAFA 2WDVA 3DJBA 3AE4A 2UU9T 3KVAA 5IWAT 1MMGA 3AE6A 3TLUA 5HEJA 5L2LA 4JI8T 3WAKA 4MALA 2K3WA 3HKCE 2E9XD 4X62T 5JRCB 4DIDB 5JRCA 4G2AA 3N9LA 3HA4A 4LMLA 2X0HA 3BQLA 4N78D 3N9PA 2XUEA 4GK0E 3RYHE 3ZN0B 4LFBT 2QYWA 3QUJA 2B1EA 3KV6A 3Q5XA 3PTRB 3KINB 3FZFB 3KV9A 3OJAA 4TN7B 3AE9A 5JVDE 4I4TE 4ZHQE 5F3JA 2XTLA 2UUAT 4NPPA 4X1KE 4P09A 5HEGA 3F57A 5F8PA 3TKLB 5LG3A 1IBKT 2XQ7A 1WR6A 2L8KA 3VR9A 4C91A 3HKBE 5AQNB 3AA7B 4DV2T 2ZM2A 2M6IA 2EHOC 2C5IT 2WP9A 3IA3A 5JDMA 1WYCA 2XY8B 3CQXC 4CN1A 4DUZT 2CLYC 2V1DB 5LOVE 3UTKA 4LF5T 4LMJA 4WZXA 3AAIA 4JUYA 1UX4A 1WR0A 4PJLA 5LYJE 5E0OA 3UQ7A 2D0UA 4U7IA 3EI0A 1AJ3A 4DR6T 4DVDA 5IUXA 5CA0E 3P4PA 5CGMA 2BZBA 3RH3A 2MTQA 2D0TA 3UULA 3ZYMA 1NEKA 4MBQA 2XAJB 3O1JA 3VKGA 5HEOA 2XAHB 2E9XC 3EHZA 1JNZA 2X9WA 3AE1A 5H6RB 2XQ5A 2ODVA 3RX6A 2CA5A 1Y64B 5FXWA 4O2AE 5LA6E 1XWMA 1J5WA 1HR0T 3AVRA 3PUVF 2HN2A 4H63H 4IDQA 4AKHA 4JI4T 2HHHT 4HFBA 5CFBA 3EABA 5LHGB 3A8YC 4TWHA 5JDQA 4U2YA 3WAJA 3MACA 5IHYA 4PK6A 2UXNB 3OKQA 1IJ5A 3RC3A 4YXDA 3ZT7A 1J5ET 4NXMT 3L09A 5FL0A 5FY0A 3SRZA 3N2KE 3HL6A 5AQQB 4QHOA 5AQJB 1G73A 3ZKRA 2PTFA 2N1GA 3VRBA 5JR9C 3LBXB 2UUCT 3LK2B 4Z8XA 5L3EB 1FMVA 2KMFA 4EXTA 3ZLIA 2XASB 3OVUA 1YW0A 2V5DA 2WBLA 4YSZA 3NRXA 1CHUA 1N33T 4Z90A 3AE7A 5EK2A 2CE7A 2J62A
chains in the Genus database with same CATH topology
2KZ7B 1D0YA 2IC9A 1US7B 2YINA 2NW8A 3GA8A 4HKAA 4QXHB 3L3PA 4YJ3E 5FXXA 2PFVA 1HTJF 2KLQA 2WSSV 3H37A 4L0RA 4M1PA 5KMGP 3UT5E 3CX7B 2VWAA 4CI1B 3Q5WA 1BR0A 2K5BB 3VU7H 4BJMA 3O1HA 2K9AA 2K24A 1YKHB 3PU3A 1FEWA 2V7KA 3UUMA 4X20E 4PNIA 2H3RA 3C4ZA 5FNVE 5M4YA 4GYSA 4AKGA 1VRBA 4I50E 4QXBB 4PK4A 1D1BA 3NRYA 3ZMVB 3F2EA 3O4XE 2QA7A 4O4HE 2NW9A 4BAYB 2KXPB 3HI2A 2Z6EA 3CQGB 2V7IA 4GK5E 4PJNA 4QXCB 4AI6A 4HEAA 2NOXA 1ZHCA 2CXDA 3IF8B 3ETUA 3N9NA 3PUAA 4X1YE 2VL8A 2XAGB 3EVYA 1HG2A 3C64A 3F31A 5HXCA 2ZM0A 5BMVE 3B13A 2E9XA 3N2OA 2RA1A 1S94A 5FY7A 3P7IA 2W62A 3MA9A 4IHJE 4UVCB 3AVSA 5LYJE 1KK7A 3CQCB 4KMCA 5HXEA 2ES0A 3C4XA 4CXWA 2L9QA 1ZV4X 2Y8DA 4IGUA 4MFRA 4EB6E 4UVBB 4EZ4A 4X1IE 4PAGA 4UIGA 2EHOB 2Q9QA 1FMWA 4ERRA 3C51A 3T8OA 3B57A 4O2BE 2L3LA 3CWZB 2HPJA 2CWOA 3Q9DA 4L9IA 3KV5A 4OK0A 5HXRA 2VB6A 3KFWX 2IW5B 1MMAA 3C50A 1BR2A 4TV9E 4ZS2A 4ANJA 2D2SA 1BR1A 4YFSA 5EK3A 3AB3B 5DQWA 4UV8B 2VASA 2VKDA 4PFPA 4P0AA 4UEMA 3ZMSB 2E8IA 5LBMA 3LFMA 2CEAA 4WW0A 1T98A 5H6QB 3I9YA 2X66A 4H63V 4U74A 4MLKA 4AQFC 4XAXB 2LOPA 1U4QA 2LHNA 3I9WA 5EZYE 3CVRA 3ANWB 1X79A 4JEHB 3UUNA 4H9QC 4F6RC 1MNEA 2I59A 2PJQA 3HKDE 3PE0A 4GOUA 3SOLA 5ADXL 2P9BA 4BJNA 2LSJA 3JC6C 4DMWA 1ZEEA 2X68A 2LSKA 3OYXA 2DLRA 2LHRA 4IE5A 4PJMA 3RYCE 5LGTB 2HH7A 3ZJ1A 1LRZA 2Y48B 1MMDA 5LGUB 3O9XA 2V26A 2DCFA 4GYRA 3LBXA 3AA0B 4CI3B 2C5KT 3OBVE 4IE7A 4O4LE 3SS1A 5JDHA 4QKNA 2W0GA 3BQKA 2KWHA 2LJLA 5HWXA 4ZOLE 2WAUA 3J9X1 3RC8A 1E1HB 1O3XA 2WMOA 4CI2B 3MKDA 5L3BB 2NP9A 4ILUA 1HCIA 5J1GA 2CXLA 3E0ZA 2MBGA 2K48A 3EDVA 5LXTE 2PG8A 4QX8B 5JDGA 2W61A 3ZPOA 1Z0PA 2C0SA 3FBLA 4ISTA 2G0UA 5LJMA 4HTEA 3ZCJA 4ISSA 5FXZA 4ZI2C 3MJXA 3ZYLA 3D0TA 3NZPA 4ADZA 2LSYA 4B6XA 5LGNB 1H7CA 3C98B 4HGAA 4EOZB 1S35A 1LVFA 2KWIB 4KP3C 1YD8G 3Q2MA 3CX8B 2ODUA 2LE8A 2QGSA 2Y6XA 3CX6B 3IEEA 3NZQA 3V5SA 5JDNA 2LOSA 1KNZA 3IBPA 3FXEB 3CPZA 1NWMX 1LVKA 2N9DA 4TZ4C 4PFOA 3GMIA 4H9NC 2XHEB 1SA0E 3GN5B 3GN5A 3JC6D 4UF0A 3E22E 4UF0B 5FXVA 3C4WA 1V9DA 3W15B 5KX5E 2LT3A 3LG7A 1WYBA 5IYZE 3O1IA 2GK9A 1BR4A 1MIVA 5CB4E 3SWHA 1B7TA 3A5XA 3BK9A 4KBMB 3LK42 4DBRA 5LG4A 2VKJA 1D1AA 5LCYA 2ACXA 4O4IE 4IE4A 5FP3A 1MIYA 4QWNB 2OA5A 4UVAB 4AXPA 1SHZC 1FIOA 3DP7A 2WWUA 2J1DG 4HN9A 4EIWA 5JREA 3H3AA 3IHRA 1D1CA 2LSIA 4TV8E 4YLHA 2MOZA 4JEUB 4WBOA 4IIJE 2CMRA 4WNKA 2XQYA 1UCUA 2EHOA 4ZI3D 2IC6A 3K8PC 4AKRB 4IE0A 2DI4A 4PW8A 2LSGA 3PDYA 3ZC0A 5JDFA 2CWYA 3PUGA 5ETWA 3VHLA 5JH7E 2KINB 3ZEFB 4NUVA 2EHOD 3PUSA 2HPLA 3MZKB 2YU1A 3N9MA 4NUUA 1HS7A 3KDSE 1UX5A 2W63A 2CXFA 4HE8A 4FI5A 3EDUA 2A3DA 2YEVC 5LHIB 2YU2A 4PJJA 3KV4A 3HR0A 4XZCA 4H9PC 3BQIA 3PUQA 4A56A 3MK7C 4DBQA 4OYKA 2X67A 2D5UA 3WI3A 2H7VC 2SPCA 3RPUA 4CZZB 4BA9A 5JQGE 4CXXA 5FYMA 1HX8A 1HG5A 3UFEA 4UXNB 5JDLA 5JR9B 5JR9A 3ZYKA 3ZC1A 2H7OA 5AFUL 5J2UE 4XBFB 2WMNA 4OFZA 1MIWA 2A72A 3CMLA 1OXZA 3ONXA 3RRWA 5HXSA 1LKXA 4I55E 1ZKEA 5LP6E 3FB2A 1MMNA 5L3FB 4OYJA 2ZLYA 2V7LA 2Q9QC 2XAFB 2UXXB 1WRDA 5L3GB 3K3NA 3U3IA 1EZ3A 3LK3B 2BVLA 4L5GA 3RYIE 4EZHA 3I0QA 5CA1E 3RKOA 4IDZA 2VK9A 3UUXB 5KDMC 4OHFA 3R84B 2LM9A 3LJCA 4O4JE 2VKOA 3VKHA 3PU8A 5C8YE 3ZMZB 1D0XA 4P0BA 1MNDA 1CUNA 2LEHA 2KNDA 2DWGA 3KVBA 2JRKA 3FXDB 3NBXX 4U72A 4V1Av 4CXYA 2N2NA 1G8XA 5J2TE 3DTOA 3I1AA 4AQFA 1HF8A 2IAKA 3KBTA 4HFVA 5HYAA 4TUYE 2CCQA 2NWBA 2X9HA 4DO0A 2JPFA 4H9RC 3AA1B 4EAHA 4DNDA 3M65A 2KT9A 4EYUA 3ZCIA 5L3DB 3P8CD 3FBZA 2ZM8A 3R6NA 1VOMA 4DMVA 2NTYA 5DQVA 4I43B 1D0ZA 3KBUA 3GWHA 4ASKA 2JQQA 3AA6B 3AAEB 4C90A 4ZS3A 3AAAB 4JLEA 4QX7B 2Q9QB 4E7ZA 3N2GE 2DNXA 5TAOA 2C5JA 4CQIA 3FHNA 1QUUA 3QK6A 1U5PA 2JMHA 2CLYB 4E7SA 5LHHB 2NTXA 3OYZA 2DHRA 5FMNA 2X51A 4PK5A 3HKEE 1IZNB 2A2FX 1HFAA 3PURA 2RP4A 2V7JA 3ZMTB 2JJ9A 3K3OA 3RRCA 4TX5A 5DABA 4IE6A 4MHCA 4ZI7E 5A1LA 5HXHA 3N9QA 4GIWA 1IJ6A 2BDEA 4ZI2D 2BVMA 1NAFA 3N5LA 2Q9QD 3ZJ2A 3I0OA 4AKLA 3N9OA 5L3CB 2XAQB 5HAXA 4UELA 2WM9A 4AQGA 2YK0A 3RYFE 3CKDA 1WLXA 2NW7A 4UV9B 2V7MA 2ZMAA 2MYSA 2X9YA 3V5UA 4G63A 4O8SA 3MXZA 5EK4A 3U78A 4KUMB 3ZMUB 3J7Yq 4WBNE 3ETVA 4ZI3C 4H9SE 2PBIA 3EUHA 4J2CA 1IAPA 4YJ2E 5GONE 4AKIA 3ANWA 4K0UA 4EYYR 4FJOA 3E08A 1YKEB 3S4UA 2VKHA 5LBQB 5LJNA 3QC9A 5HWYA 2X9XA 1QSDA 4YHJA 2JMKA 1OWAA 3K3QC 3ESLA 4H9OC 5FY1A 2CM0A 5LNKA 2DWKA 2M67A 2X0LB 2E9XB 3ZN1B 5DJQC 3DJBA 3KVAA 1MMGA 5L2LA 3WAKA 4MALA 3HKCE 2E9XD 5JRCB 5JRCA 4G2AA 3N9LA 3HA4A 3BQLA 4N78D 3RYHE 3N9PA 2XUEA 4GK0E 3ZN0B 3QUJA 2B1EA 3KV6A 3Q5XA 2CE7A 3PTRB 3KINB 5JVDE 3KV9A 3OJAA 4TN7B 4I4TE 4ZHQE 5F3JA 2XTLA 4X1KE 4P09A 3F57A 5F8PA 3TKLB 1WR6A 2L8KA 4C91A 3HKBE 3AA7B 2ZM2A 2EHOC 2C5IT 5JDMA 1WYCA 3CQXC 2CLYC 2V1DB 5LOVE 3UTKA 3AAIA 4JUYA 1UX4A 4PJLA 5E0OA 2D0UA 1AJ3A 4DVDA 5CA0E 2BZBA 3RH3A 2MTQA 2D0TA 3UULA 3ZYMA 4MBQA 2XAJB 3O1JA 3VKGA 2XAHB 2E9XC 2X9WA 5H6RB 2ODVA 3RX6A 2CA5A 1Y64B 5FXWA 4O2AE 5LA6E 3AVRA 4H63H 4AKHA 5LHGB 5JDQA 3WAJA 3MACA 5IHYA 4PK6A 2UXNB 3OKQA 1IJ5A 3RC3A 3L09A 5FY0A 3SRZA 3N2KE 3HL6A 4QHOA 1G73A 2N1GA 5JR9C 3LBXB 3LK2B 4Z8XA 5L3EB 1FMVA 2KMFA 4EXTA 3ZLIA 2XASB 1YW0A 2WBLA 3NRXA 5EK2A 2W00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW7 A;  4U72 A;  2V7M A;  2NW8 A;  4HKA A;  2NW9 A;  2V7L A;  5EK4 A;  4PK5 A;  2X66 A;  2V7I A;  4U74 A;  2X67 A;  2NOX A;  4PK6 A;  2D0U A;  3BK9 A;  2NWB A;  4PW8 A;  2V7J A;  3E08 A;  5ETW A;  2D0T A;  1YW0 A;  5EK3 A;  2V7K A;  1ZEE A;  5EK2 A;  2X68 A; 
#chains in the Genus database with same CATH topology
 1OED B;  2IDO B;  2KZ7 B;  1D0Y A;  2IC9 A;  2WZI A;  1US7 B;  3VRA A;  2YIN A;  2NW8 A;  3GA8 A;  4HKA A;  4QXH B;  3L3P A;  4YJ3 E;  5FXX A;  2CRB A;  3RF1 A;  2PFV A;  1HTJ F;  3AED A;  2KLQ A;  2WSS V;  4JI2 T;  3RIU C;  2I0M A;  3H37 A;  4COF A;  2JQK A;  4L0R A;  5ABG A;  4M1P A;  5AQU B;  5KMG P;  3NWI A;  4X66 T;  4YSX A;  2BG9 C;  3CX7 B;  3UT5 E;  2VWA A;  4HFH A;  4CI1 B;  3Q5W A;  5LMU T;  1UUS A;  4YSY A;  1BR0 A;  2K5B B;  3VU7 H;  4BJM A;  2B76 A;  4ILC A;  3O1H A;  2K9A A;  2K24 A;  1YKH B;  3PU3 A;  1N32 T;  1FEW A;  4P1N A;  2UUB T;  3P4S A;  2V7K A;  4U7Y A;  3UUM A;  1ZP0 A;  2JIW A;  4ILA A;  4X20 E;  3RI5 A;  4PNI A;  2H3R A;  3C4Z A;  5FNV E;  5M4Y A;  4GYS A;  4X64 T;  5L47 A;  4AKG A;  1VRB A;  4I50 E;  4QXB B;  4PK4 A;  1D1B A;  3NRY A;  1Y01 A;  3F2E A;  3O4X E;  2QA7 A;  4O4H E;  3ZMV B;  2NW9 A;  1I94 T;  1E7P A;  4BAY B;  2KXP B;  3LDQ B;  2I6H A;  3HI2 A;  2Z6E A;  3CQG B;  2V7I A;  3QOF A;  1W0A A;  4GK5 E;  4KHZ F;  4HEA A;  2NOX A;  4PJN A;  4QXC B;  1ZHC A;  4HWH A;  4DR2 T;  4AI6 A;  2CXD A;  2VL0 A;  3ETU A;  1SUM B;  3IF8 B;  3PV0 F;  3FZH B;  3N9N A;  4CN4 A;  1IBM T;  5HEU A;  3PUA A;  4X1Y E;  2VL8 A;  2XAG B;  3EVY A;  3AEE A;  1XNQ T;  4UR9 A;  2UXD T;  4TWF A;  1HG2 A;  3C64 A;  4WYV A;  3F31 A;  4TNW A;  2ZM0 A;  5HXC A;  5BMV E;  3B13 A;  2E9X A;  2XJ7 A;  2KSR A;  3N2O A;  2LM2 A;  1S94 A;  2RA1 A;  4IT4 A;  5C3J A;  5FY7 A;  1XMQ T;  3P7I A;  2W62 A;  3G06 A;  3AEA A;  2BKN A;  3MA9 A;  1E2A A;  3AVS A;  3CK6 A;  3AE5 A;  1KK7 A;  3CQC B;  1W9R A;  1WFD A;  4IHJ E;  4KMC A;  4CN6 A;  5HXE A;  2ES0 A;  3C4X A;  4CXW A;  4ZZC A;  2L9Q A;  1ZV4 X;  2Y8D A;  4IGU A;  4MFR A;  4EB6 E;  2BS4 A;  5AQG B;  4UVB B;  4NXN T;  4EZ4 A;  4X1I E;  4PAG A;  3SFE A;  3UU5 A;  4UIG A;  2EHO B;  2Q9Q A;  1FMW A;  4ERR A;  1YQ4 A;  3C51 A;  2E5L T;  3T8O A;  3B57 A;  4O2B E;  2L3L A;  3CWZ B;  2HPJ A;  2CWO A;  2DL1 A;  3Q9D A;  3KV5 A;  4L9I A;  4OK0 A;  2VB6 A;  3KFW X;  5HXR A;  2IW5 B;  2ACZ A;  5L4E A;  1MMA A;  3K1S A;  4B3R T;  2RPA A;  3C50 A;  4DV4 T;  1BR2 A;  3QB5 K;  4TV9 E;  4ZS2 A;  4ANJ A;  4IDP A;  2AE9 A;  2V8S V;  4LF9 T;  4JI6 T;  2ZM6 T;  2D2S A;  2R6G F;  2WU5 A;  1BR1 A;  4YFS A;  2XQ4 A;  5EK3 A;  4ZEY A;  5HXH A;  2OLT A;  3AB3 B;  5DQW A;  4UV8 B;  1JNR A;  1UK5 A;  2VAS A;  2VKD A;  5AQS B;  2BS2 A;  4PFP A;  4P0A A;  1WCR A;  4UEM A;  2V5C A;  3ZMS B;  2E8I A;  2XM2 A;  3LSV A;  5LBM A;  3LFM A;  2E5V A;  2E2A A;  4HWD A;  3RIU A;  2CEA A;  4WW0 A;  1T98 A;  4JV5 T;  5H6Q B;  2QRX A;  3I9Y A;  2X66 A;  4H63 V;  4U74 A;  4MLK A;  4AQF C;  3TLS A;  4XAX B;  4YT0 A;  2LOP A;  5LMN T;  1XNR T;  1U4Q A;  2LHN A;  3I9W A;  3RQW A;  2CHN A;  5EZY E;  3CVR A;  1HNX T;  3ANW B;  2V6X A;  1X79 A;  4GKK T;  4JEH B;  3PUX F;  1J1J A;  3UUN A;  4DR1 T;  3T1Y T;  1I6Z A;  4H9Q C;  4F6R C;  2VVN A;  1MNE A;  2I59 A;  2FJB A;  2PJQ A;  3HKD E;  1XMO T;  3PE0 A;  4GOU A;  2MAW A;  3SOL A;  5ADX L;  2P9B A;  1HX1 B;  2XQ6 A;  4BJN A;  3OTO T;  5ABH A;  2LSJ A;  2XSB A;  3JC6 C;  3PJA A;  4DMW A;  1ZEE A;  3A7M A;  4LMK A;  2X68 A;  4A97 A;  3ZT6 A;  3AXJ B;  2LSK A;  3AE8 A;  3AXJ A;  2DLR A;  3OYX A;  1UUR A;  2LHR A;  4IE5 A;  4PJM A;  3RYC E;  2WQY A;  1NEN A;  3RLF F;  5LGT B;  2HH7 A;  2X0Y A;  3ZJ1 A;  1LRZ A;  2Y48 B;  1MMD A;  5LGU B;  3O9X A;  2V26 A;  2DCF A;  2QVA A;  4DV6 T;  2M6B A;  4GYR A;  3LBX A;  3AA0 B;  4YTN A;  4CI3 B;  2C5K T;  2LRK A;  3OBV E;  4IE7 A;  4O4L E;  2BBJ A;  3SS1 A;  2XPK A;  5JDH A;  4QKN A;  2W0G A;  3BQK A;  2KWH A;  2LJL A;  5HWX A;  5AQI B;  4ZOL E;  5AQT B;  2WAU A;  3J9X 1;  4DV5 T;  3RC8 A;  4X65 T;  1E1H B;  4YHH T;  1O3X A;  1R8I A;  2WMO A;  2VUR A;  4CI2 B;  3AEF A;  3MKD A;  1FJG T;  5L3B B;  5BR8 T;  2NP9 A;  4ILU A;  1HCI A;  4U31 A;  5J1G A;  4LFA T;  2CXL A;  3E0Z A;  1KNP A;  2MBG A;  1HNZ T;  2BBH A;  2K48 A;  3EDV A;  2VQF T;  3P4R A;  5LXT E;  2PG8 A;  4QX8 B;  5JDG A;  2W61 A;  3ZPO A;  2F4V T;  2W67 A;  1Z0P A;  2C0S A;  3FBL A;  4HFI A;  4IST A;  4LF4 T;  2G0U A;  5LJM A;  4DR3 T;  4HTE A;  3ZCJ A;  4ISS A;  5FXZ A;  3ONJ A;  3MJX A;  4ZI2 C;  3ZYL A;  3D0T A;  3NZP A;  3RIA A;  4ADZ A;  2LLY A;  2LSY A;  4DV0 T;  4ZZB A;  4B6X A;  5LGN B;  3ABV A;  1H7C A;  3C98 B;  4HGA A;  4EOZ B;  1S35 A;  1LVF A;  2KWI B;  4KP3 C;  1YD8 G;  3Q2M A;  4TWD A;  3TLW A;  3TLT A;  3CX8 B;  2ODU A;  2LE8 A;  2QGS A;  2Y6X A;  2FUP A;  3CX6 B;  3IEE A;  3NZQ A;  3V5S A;  5JDN A;  2LOS A;  1KNZ A;  3IBP A;  3FXE B;  1GQE A;  3CPZ A;  1NWM X;  1M7K A;  1LVK A;  2N9D A;  4TZ4 C;  4PFO A;  4JI3 T;  2WZH A;  3GMI A;  4H9N C;  4HFD A;  2XHE B;  1SA0 E;  3GN5 B;  1XDO A;  3GN5 A;  3JC6 D;  3E22 E;  4JBW F;  2WB5 A;  2J47 A;  4UF0 B;  2OV9 A;  3C4W A;  1V9D A;  5FXV A;  3W15 B;  4AQY T;  5KX5 E;  4DV7 T;  2LT3 A;  1N34 T;  3LG7 A;  1WYB A;  4B3T T;  1T7S A;  5AQK B;  5IYZ E;  3O1I A;  5FL1 A;  2GK9 A;  3QNU A;  1BR4 A;  1MIV A;  2H88 A;  5CB4 E;  3TLV A;  3SWH A;  1B7T A;  3A5X A;  3BK9 A;  4KBM B;  1W09 A;  3LK4 2;  2YOE A;  3SFD A;  5AQL B;  4DBR A;  5LG4 A;  2VKJ A;  1D1A A;  2A9U A;  4ILB A;  2ACX A;  4O4I E;  4TNV A;  4IE4 A;  5FP3 A;  5LCY A;  3UUB A;  3QB5 A;  1MIY A;  5ABF A;  4QWN B;  2OA5 A;  4UVA B;  4AXP A;  1SHZ C;  1FIO A;  4K0K T;  5J0Z A;  2HN1 A;  3T1H T;  3DP7 A;  2WWU A;  2J1D G;  4HN9 A;  4HWC A;  4EIW A;  5JRE A;  5HCJ A;  5AQH B;  3H3A A;  3IHR A;  1D1C A;  2LSI A;  4TV8 E;  4YLH A;  3L39 A;  2MOZ A;  4JEU B;  4WBO A;  4IIJ E;  4EED A;  2CMR A;  4WNK A;  2XQY A;  2BKP A;  1UCU A;  3UQ4 A;  2EHO A;  3OPC A;  4LF8 T;  3FZL B;  3AEB A;  4ZI3 D;  2IC6 A;  5HEH A;  3P4W A;  1XDP A;  3JAE A;  3K8P C;  3P50 A;  2UXC T;  2V6Y B;  2YDQ A;  4AKR B;  4JI0 T;  4IE0 A;  2BG9 A;  2DI4 A;  2BG9 B;  4PW8 A;  2LSG A;  3PDY A;  5FVL A;  5JDF A;  2CWY A;  3ZC0 A;  3PUG A;  5ETW A;  3VHL A;  2FJE A;  2KIN B;  3ZEF B;  4HFE A;  5JH7 E;  4NUV A;  4ZXL A;  4A5X A;  2UXB T;  3CIR A;  2EHO D;  3PUS A;  2HPL A;  4U2Z A;  1DU2 A;  3MZK B;  2YU1 A;  3N9M A;  4NUU A;  1HS7 A;  2YN6 A;  3KDS E;  3ONL C;  1UX5 A;  5HCM A;  2W63 A;  2CXF A;  4HE8 A;  4FI5 A;  2IUB A;  2WDR A;  1KFY A;  2A3D A;  3EAM A;  2YEV C;  3EDU A;  2CBJ A;  5L4H A;  3ZSS A;  5LHI B;  4YY3 T;  4JYA T;  2YU2 A;  4PJJ A;  2W4X A;  4EGW A;  3KV4 A;  3HR0 A;  4XZC A;  2FBW A;  2WS3 A;  4H9P C;  5FVK A;  4AIU A;  5JTG A;  1N36 T;  3X1D A;  3BQI A;  3J7Y q;  3PUQ A;  4A56 A;  3MK7 C;  4DBQ A;  3H3M A;  4OYK A;  2X67 A;  2D5U A;  3WI3 A;  3JCF A;  3RIF A;  3UFG A;  2H7V C;  2SPC A;  3RPU A;  4CZZ B;  4BA9 A;  5C2T A;  5JQG E;  4CXX A;  5FYM A;  4LF6 T;  2IIU A;  1HX8 A;  1HG5 A;  3UFE A;  2V6Y A;  4UXN B;  5JDL A;  2YKS A;  5JR9 B;  5JR9 A;  3ZYK A;  3ZC1 A;  2H7O A;  5AFU L;  4B3M T;  5J2U E;  2FJD A;  4DR7 T;  2BG9 E;  4I0U A;  5ABF B;  2WMN A;  4XBF B;  2VQE T;  1L0V A;  4OFZ A;  1MIW A;  2A72 A;  3CML A;  1OXZ A;  3ONX A;  3FZM B;  3RRW A;  4EV6 A;  5HXS A;  1LKX A;  4I55 E;  1YQ3 A;  4UVC B;  1ZKE A;  4KI0 F;  5LP6 E;  3FB2 A;  1M62 A;  1MMN A;  1ZOY A;  1OED C;  3PUW F;  5L3F B;  4OYJ A;  2FJA A;  3RHW A;  2ZLY A;  2V7L A;  2Q9Q C;  2XAF B;  2UXX B;  2JQ9 A;  1WRD A;  5L3G B;  3UU4 A;  3K3N A;  4KHP T;  3U3I A;  4HWI B;  1EZ3 A;  2XQ8 A;  3L8R A;  3LK3 B;  4DV1 T;  2BVL A;  4L5G A;  3RYI E;  3UU3 A;  4EZH A;  2H89 A;  3I0Q A;  4DV3 T;  5CA1 E;  3RKO A;  2XSA A;  4IDZ A;  2VK9 A;  4F8H A;  3UUX B;  5KDM C;  4OHF A;  3R84 B;  4LF7 T;  2WU2 A;  2LM9 A;  4C90 A;  4Q25 A;  3LJC A;  4O4J E;  2IML A;  5AQO B;  2VKO A;  2W2U A;  3VKH A;  3PU8 A;  5C8Y E;  3ZMZ B;  2BS3 A;  1D0X A;  1Z8U A;  3RGL A;  4DR4 T;  4P0B A;  1HNW T;  1MND A;  4AIS A;  1CUN A;  2LEH A;  1YXR A;  4KX6 A;  2KND A;  2DWG A;  3KVB A;  2JRK A;  3FXD B;  3NBX X;  4U72 A;  3VR8 A;  2XQ3 A;  5KXJ A;  2WY2 A;  3NVO A;  1XZY A;  4V1A v;  3UU8 A;  4U3C A;  4CXY A;  2N2N A;  2WDQ A;  3PUZ F;  1G8X A;  1VCS A;  3DTO A;  3I1A A;  4AQF A;  5J2T E;  4Z91 A;  1HF8 A;  2IAK A;  2CHO A;  3KBT A;  4HFV A;  1KF6 A;  5HYA A;  3P4Q A;  2CCQ A;  4TUY E;  5CJ5 A;  2NWB A;  1QLB A;  2X9H A;  2JPF A;  3AEC A;  3AA1 B;  4H9R C;  4DO0 A;  4HFC A;  4DR5 T;  4EAH A;  4DND A;  3M65 A;  2KT9 A;  4EYU A;  3ZCI A;  5L3D B;  2WCA A;  4LFC T;  3P8C D;  1T8B A;  3FBZ A;  2YDS A;  2ZM8 A;  3R6N A;  3UU6 A;  1VOM A;  4DMV A;  2NTY A;  4UF0 A;  5DQV A;  2J4G A;  4I43 B;  4QH5 A;  1D0Z A;  4HWF A;  3KBU A;  3GWH A;  4ASK A;  5ABE A;  2JQQ A;  3AA6 B;  3AAE B;  2XM1 A;  3JAD A;  4JI5 T;  2CPT A;  4IL4 A;  3AAA B;  4JLE A;  4QX7 B;  2Q9Q B;  4ZS3 A;  4E7Z A;  3N2G E;  2DNX A;  3PUY F;  2C5J A;  4YTM A;  5TAO A;  4CQI A;  4QH4 A;  4OX9 T;  3FHN A;  1QUU A;  5AQF B;  1IBL T;  3QK6 A;  1U5P A;  1UGO A;  2CLY B;  2JMH A;  4E7S A;  2NTX A;  5LHH B;  3OYZ A;  2DHR A;  2IHR 1;  4QH1 A;  5AQP B;  4IRE A;  5FMN A;  2X51 A;  2NR4 A;  2VVS A;  4PK5 A;  2LKH A;  3HKE E;  1IZN B;  1SE7 A;  4GKJ T;  2A2F X;  3B5M A;  4IL9 A;  1HFA A;  3PUR A;  2RP4 A;  2V7J A;  4NIQ A;  3AEG A;  5F5W A;  3ZMT B;  2JJ9 A;  3NKZ A;  3Q5E A;  3K3O A;  3RRC A;  4TX5 A;  5DAB A;  4IE6 A;  4MHC A;  3ZT5 A;  2AXD S;  2CBI A;  2XQA A;  3N9Q A;  4ZI7 E;  5LB7 B;  3ZST A;  1KEY A;  4GIW A;  5A1L A;  3FZK B;  1IJ6 A;  4U33 A;  3M3Z B;  2BDE A;  2XZE A;  5AQR B;  4A98 A;  2BVM A;  1NAF A;  3N5L A;  2Q9Q D;  3ZJ2 A;  3I0O A;  1OED E;  4AKL A;  3N9O A;  5L3C B;  4ZI2 D;  1KNR A;  2XAQ B;  2XQ9 A;  1OED A;  1W0B A;  4UEL A;  2WM9 A;  3Q5D A;  2YK0 A;  5HAX A;  3RYF E;  3CKD A;  4AQG A;  1WLX A;  2NW7 A;  4UV9 B;  4X5T A;  2V7M A;  2ZMA A;  1T72 A;  2D9D A;  2MYS A;  2X9Y A;  4JI7 T;  3V5U A;  4G63 A;  4O8S A;  3MXZ A;  2W00 A;  5EK4 A;  4KUM B;  5AQM B;  3U78 A;  3ZMU B;  3ETV A;  4EEB A;  4ZI3 C;  4H9S E;  4WBN E;  2PBI A;  3EUH A;  4J2C A;  1IAP A;  3AE3 A;  4IDO A;  5GON E;  2WWV A;  4IDN A;  4YJ2 E;  3PJA J;  4AKI A;  3ANW A;  4K0U A;  4EYY R;  4FJO A;  3E08 A;  1YKE B;  3S4U A;  2BKO A;  2VKH A;  5LBQ B;  3RQU A;  5LJN A;  5FKY A;  3AE2 A;  1X9B A;  1VCT A;  4DUY T;  4YTP A;  2JQH A;  3QC9 A;  5HWY A;  2X9X A;  2YDR A;  1QSD A;  2LRL A;  4YHJ A;  2JMK A;  1OWA A;  3K3Q C;  4B3S T;  2MPK A;  3ESL A;  4H9O C;  5FY1 A;  2CM0 A;  5LNK A;  2DWK A;  3RKG A;  2M67 A;  5AQV B;  2X0L B;  2E9X B;  3ZN1 B;  2LKG A;  2W66 A;  5DJQ C;  4JI1 T;  3JAF A;  2WDV A;  3DJB A;  3AE4 A;  2UU9 T;  3KVA A;  5IWA T;  1MMG A;  3AE6 A;  3TLU A;  5HEJ A;  5L2L A;  4JI8 T;  3WAK A;  4MAL A;  2K3W A;  3HKC E;  2E9X D;  4X62 T;  5JRC B;  4DID B;  5JRC A;  4G2A A;  3N9L A;  3HA4 A;  4LML A;  2X0H A;  3BQL A;  4N78 D;  3N9P A;  2XUE A;  4GK0 E;  3RYH E;  3ZN0 B;  4LFB T;  2QYW A;  3QUJ A;  2B1E A;  3KV6 A;  3Q5X A;  3PTR B;  3KIN B;  3FZF B;  3KV9 A;  3OJA A;  4TN7 B;  3AE9 A;  5JVD E;  4I4T E;  4ZHQ E;  5F3J A;  2XTL A;  2UUA T;  4NPP A;  4X1K E;  4P09 A;  5HEG A;  3F57 A;  5F8P A;  3TKL B;  5LG3 A;  1IBK T;  2XQ7 A;  1WR6 A;  2L8K A;  3VR9 A;  4C91 A;  3HKB E;  5AQN B;  3AA7 B;  4DV2 T;  2ZM2 A;  2M6I A;  2EHO C;  2C5I T;  2WP9 A;  3IA3 A;  5JDM A;  1WYC A;  2XY8 B;  3CQX C;  4CN1 A;  4DUZ T;  2CLY C;  2V1D B;  5LOV E;  3UTK A;  4LF5 T;  4LMJ A;  4WZX A;  3AAI A;  4JUY A;  1UX4 A;  1WR0 A;  4PJL A;  5LYJ E;  5E0O A;  3UQ7 A;  2D0U A;  4U7I A;  3EI0 A;  1AJ3 A;  4DR6 T;  4DVD A;  5IUX A;  5CA0 E;  3P4P A;  5CGM A;  2BZB A;  3RH3 A;  2MTQ A;  2D0T A;  3UUL A;  3ZYM A;  1NEK A;  4MBQ A;  2XAJ B;  3O1J A;  3VKG A;  5HEO A;  2XAH B;  2E9X C;  3EHZ A;  1JNZ A;  2X9W A;  3AE1 A;  5H6R B;  2XQ5 A;  2ODV A;  3RX6 A;  2CA5 A;  1Y64 B;  5FXW A;  4O2A E;  5LA6 E;  1XWM A;  1J5W A;  1HR0 T;  3AVR A;  3PUV F;  2HN2 A;  4H63 H;  4IDQ A;  4AKH A;  4JI4 T;  2HHH T;  4HFB A;  5CFB A;  3EAB A;  5LHG B;  3A8Y C;  4TWH A;  5JDQ A;  4U2Y A;  3WAJ A;  3MAC A;  5IHY A;  4PK6 A;  2UXN B;  3OKQ A;  1IJ5 A;  3RC3 A;  4YXD A;  3ZT7 A;  1J5E T;  4NXM T;  3L09 A;  5FL0 A;  5FY0 A;  3SRZ A;  3N2K E;  3HL6 A;  5AQQ B;  4QHO A;  5AQJ B;  1G73 A;  3ZKR A;  2PTF A;  2N1G A;  3VRB A;  5JR9 C;  3LBX B;  2UUC T;  3LK2 B;  4Z8X A;  5L3E B;  1FMV A;  2KMF A;  4EXT A;  3ZLI A;  2XAS B;  3OVU A;  1YW0 A;  2V5D A;  2WBL A;  4YSZ A;  3NRX A;  1CHU A;  1N33 T;  4Z90 A;  3AE7 A;  5EK2 A;  2CE7 A;  2J62 A; 
#chains in the Genus database with same CATH homology
 2KZ7 B;  1D0Y A;  2IC9 A;  1US7 B;  2YIN A;  2NW8 A;  3GA8 A;  4HKA A;  4QXH B;  3L3P A;  4YJ3 E;  5FXX A;  2PFV A;  1HTJ F;  2KLQ A;  2WSS V;  3H37 A;  4L0R A;  4M1P A;  5KMG P;  3UT5 E;  3CX7 B;  2VWA A;  4CI1 B;  3Q5W A;  1BR0 A;  2K5B B;  3VU7 H;  4BJM A;  3O1H A;  2K9A A;  2K24 A;  1YKH B;  3PU3 A;  1FEW A;  2V7K A;  3UUM A;  4X20 E;  4PNI A;  2H3R A;  3C4Z A;  5FNV E;  5M4Y A;  4GYS A;  4AKG A;  1VRB A;  4I50 E;  4QXB B;  4PK4 A;  1D1B A;  3NRY A;  3ZMV B;  3F2E A;  3O4X E;  2QA7 A;  4O4H E;  2NW9 A;  4BAY B;  2KXP B;  3HI2 A;  2Z6E A;  3CQG B;  2V7I A;  4GK5 E;  4PJN A;  4QXC B;  4AI6 A;  4HEA A;  2NOX A;  1ZHC A;  2CXD A;  3IF8 B;  3ETU A;  3N9N A;  3PUA A;  4X1Y E;  2VL8 A;  2XAG B;  3EVY A;  1HG2 A;  3C64 A;  3F31 A;  5HXC A;  2ZM0 A;  5BMV E;  3B13 A;  2E9X A;  3N2O A;  2RA1 A;  1S94 A;  5FY7 A;  3P7I A;  2W62 A;  3MA9 A;  4IHJ E;  4UVC B;  3AVS A;  5LYJ E;  1KK7 A;  3CQC B;  4KMC A;  5HXE A;  2ES0 A;  3C4X A;  4CXW A;  2L9Q A;  1ZV4 X;  2Y8D A;  4IGU A;  4MFR A;  4EB6 E;  4UVB B;  4EZ4 A;  4X1I E;  4PAG A;  4UIG A;  2EHO B;  2Q9Q A;  1FMW A;  4ERR A;  3C51 A;  3T8O A;  3B57 A;  4O2B E;  2L3L A;  3CWZ B;  2HPJ A;  2CWO A;  3Q9D A;  4L9I A;  3KV5 A;  4OK0 A;  5HXR A;  2VB6 A;  3KFW X;  2IW5 B;  1MMA A;  3C50 A;  1BR2 A;  4TV9 E;  4ZS2 A;  4ANJ A;  2D2S A;  1BR1 A;  4YFS A;  5EK3 A;  3AB3 B;  5DQW A;  4UV8 B;  2VAS A;  2VKD A;  4PFP A;  4P0A A;  4UEM A;  3ZMS B;  2E8I A;  5LBM A;  3LFM A;  2CEA A;  4WW0 A;  1T98 A;  5H6Q B;  3I9Y A;  2X66 A;  4H63 V;  4U74 A;  4MLK A;  4AQF C;  4XAX B;  2LOP A;  1U4Q A;  2LHN A;  3I9W A;  5EZY E;  3CVR A;  3ANW B;  1X79 A;  4JEH B;  3UUN A;  4H9Q C;  4F6R C;  1MNE A;  2I59 A;  2PJQ A;  3HKD E;  3PE0 A;  4GOU A;  3SOL A;  5ADX L;  2P9B A;  4BJN A;  2LSJ A;  3JC6 C;  4DMW A;  1ZEE A;  2X68 A;  2LSK A;  3OYX A;  2DLR A;  2LHR A;  4IE5 A;  4PJM A;  3RYC E;  5LGT B;  2HH7 A;  3ZJ1 A;  1LRZ A;  2Y48 B;  1MMD A;  5LGU B;  3O9X A;  2V26 A;  2DCF A;  4GYR A;  3LBX A;  3AA0 B;  4CI3 B;  2C5K T;  3OBV E;  4IE7 A;  4O4L E;  3SS1 A;  5JDH A;  4QKN A;  2W0G A;  3BQK A;  2KWH A;  2LJL A;  5HWX A;  4ZOL E;  2WAU A;  3J9X 1;  3RC8 A;  1E1H B;  1O3X A;  2WMO A;  4CI2 B;  3MKD A;  5L3B B;  2NP9 A;  4ILU A;  1HCI A;  5J1G A;  2CXL A;  3E0Z A;  2MBG A;  2K48 A;  3EDV A;  5LXT E;  2PG8 A;  4QX8 B;  5JDG A;  2W61 A;  3ZPO A;  1Z0P A;  2C0S A;  3FBL A;  4IST A;  2G0U A;  5LJM A;  4HTE A;  3ZCJ A;  4ISS A;  5FXZ A;  4ZI2 C;  3MJX A;  3ZYL A;  3D0T A;  3NZP A;  4ADZ A;  2LSY A;  4B6X A;  5LGN B;  1H7C A;  3C98 B;  4HGA A;  4EOZ B;  1S35 A;  1LVF A;  2KWI B;  4KP3 C;  1YD8 G;  3Q2M A;  3CX8 B;  2ODU A;  2LE8 A;  2QGS A;  2Y6X A;  3CX6 B;  3IEE A;  3NZQ A;  3V5S A;  5JDN A;  2LOS A;  1KNZ A;  3IBP A;  3FXE B;  3CPZ A;  1NWM X;  1LVK A;  2N9D A;  4TZ4 C;  4PFO A;  3GMI A;  4H9N C;  2XHE B;  1SA0 E;  3GN5 B;  3GN5 A;  3JC6 D;  4UF0 A;  3E22 E;  4UF0 B;  5FXV A;  3C4W A;  1V9D A;  3W15 B;  5KX5 E;  2LT3 A;  3LG7 A;  1WYB A;  5IYZ E;  3O1I A;  2GK9 A;  1BR4 A;  1MIV A;  5CB4 E;  3SWH A;  1B7T A;  3A5X A;  3BK9 A;  4KBM B;  3LK4 2;  4DBR A;  5LG4 A;  2VKJ A;  1D1A A;  5LCY A;  2ACX A;  4O4I E;  4IE4 A;  5FP3 A;  1MIY A;  4QWN B;  2OA5 A;  4UVA B;  4AXP A;  1SHZ C;  1FIO A;  3DP7 A;  2WWU A;  2J1D G;  4HN9 A;  4EIW A;  5JRE A;  3H3A A;  3IHR A;  1D1C A;  2LSI A;  4TV8 E;  4YLH A;  2MOZ A;  4JEU B;  4WBO A;  4IIJ E;  2CMR A;  4WNK A;  2XQY A;  1UCU A;  2EHO A;  4ZI3 D;  2IC6 A;  3K8P C;  4AKR B;  4IE0 A;  2DI4 A;  4PW8 A;  2LSG A;  3PDY A;  3ZC0 A;  5JDF A;  2CWY A;  3PUG A;  5ETW A;  3VHL A;  5JH7 E;  2KIN B;  3ZEF B;  4NUV A;  2EHO D;  3PUS A;  2HPL A;  3MZK B;  2YU1 A;  3N9M A;  4NUU A;  1HS7 A;  3KDS E;  1UX5 A;  2W63 A;  2CXF A;  4HE8 A;  4FI5 A;  3EDU A;  2A3D A;  2YEV C;  5LHI B;  2YU2 A;  4PJJ A;  3KV4 A;  3HR0 A;  4XZC A;  4H9P C;  3BQI A;  3PUQ A;  4A56 A;  3MK7 C;  4DBQ A;  4OYK A;  2X67 A;  2D5U A;  3WI3 A;  2H7V C;  2SPC A;  3RPU A;  4CZZ B;  4BA9 A;  5JQG E;  4CXX A;  5FYM A;  1HX8 A;  1HG5 A;  3UFE A;  4UXN B;  5JDL A;  5JR9 B;  5JR9 A;  3ZYK A;  3ZC1 A;  2H7O A;  5AFU L;  5J2U E;  4XBF B;  2WMN A;  4OFZ A;  1MIW A;  2A72 A;  3CML A;  1OXZ A;  3ONX A;  3RRW A;  5HXS A;  1LKX A;  4I55 E;  1ZKE A;  5LP6 E;  3FB2 A;  1MMN A;  5L3F B;  4OYJ A;  2ZLY A;  2V7L A;  2Q9Q C;  2XAF B;  2UXX B;  1WRD A;  5L3G B;  3K3N A;  3U3I A;  1EZ3 A;  3LK3 B;  2BVL A;  4L5G A;  3RYI E;  4EZH A;  3I0Q A;  5CA1 E;  3RKO A;  4IDZ A;  2VK9 A;  3UUX B;  5KDM C;  4OHF A;  3R84 B;  2LM9 A;  3LJC A;  4O4J E;  2VKO A;  3VKH A;  3PU8 A;  5C8Y E;  3ZMZ B;  1D0X A;  4P0B A;  1MND A;  1CUN A;  2LEH A;  2KND A;  2DWG A;  3KVB A;  2JRK A;  3FXD B;  3NBX X;  4U72 A;  4V1A v;  4CXY A;  2N2N A;  1G8X A;  5J2T E;  3DTO A;  3I1A A;  4AQF A;  1HF8 A;  2IAK A;  3KBT A;  4HFV A;  5HYA A;  4TUY E;  2CCQ A;  2NWB A;  2X9H A;  4DO0 A;  2JPF A;  4H9R C;  3AA1 B;  4EAH A;  4DND A;  3M65 A;  2KT9 A;  4EYU A;  3ZCI A;  5L3D B;  3P8C D;  3FBZ A;  2ZM8 A;  3R6N A;  1VOM A;  4DMV A;  2NTY A;  5DQV A;  4I43 B;  1D0Z A;  3KBU A;  3GWH A;  4ASK A;  2JQQ A;  3AA6 B;  3AAE B;  4C90 A;  4ZS3 A;  3AAA B;  4JLE A;  4QX7 B;  2Q9Q B;  4E7Z A;  3N2G E;  2DNX A;  5TAO A;  2C5J A;  4CQI A;  3FHN A;  1QUU A;  3QK6 A;  1U5P A;  2JMH A;  2CLY B;  4E7S A;  5LHH B;  2NTX A;  3OYZ A;  2DHR A;  5FMN A;  2X51 A;  4PK5 A;  3HKE E;  1IZN B;  2A2F X;  1HFA A;  3PUR A;  2RP4 A;  2V7J A;  3ZMT B;  2JJ9 A;  3K3O A;  3RRC A;  4TX5 A;  5DAB A;  4IE6 A;  4MHC A;  4ZI7 E;  5A1L A;  5HXH A;  3N9Q A;  4GIW A;  1IJ6 A;  2BDE A;  4ZI2 D;  2BVM A;  1NAF A;  3N5L A;  2Q9Q D;  3ZJ2 A;  3I0O A;  4AKL A;  3N9O A;  5L3C B;  2XAQ B;  5HAX A;  4UEL A;  2WM9 A;  4AQG A;  2YK0 A;  3RYF E;  3CKD A;  1WLX A;  2NW7 A;  4UV9 B;  2V7M A;  2ZMA A;  2MYS A;  2X9Y A;  3V5U A;  4G63 A;  4O8S A;  3MXZ A;  5EK4 A;  3U78 A;  4KUM B;  3ZMU B;  3J7Y q;  4WBN E;  3ETV A;  4ZI3 C;  4H9S E;  2PBI A;  3EUH A;  4J2C A;  1IAP A;  4YJ2 E;  5GON E;  4AKI A;  3ANW A;  4K0U A;  4EYY R;  4FJO A;  3E08 A;  1YKE B;  3S4U A;  2VKH A;  5LBQ B;  5LJN A;  3QC9 A;  5HWY A;  2X9X A;  1QSD A;  4YHJ A;  2JMK A;  1OWA A;  3K3Q C;  3ESL A;  4H9O C;  5FY1 A;  2CM0 A;  5LNK A;  2DWK A;  2M67 A;  2X0L B;  2E9X B;  3ZN1 B;  5DJQ C;  3DJB A;  3KVA A;  1MMG A;  5L2L A;  3WAK A;  4MAL A;  3HKC E;  2E9X D;  5JRC B;  5JRC A;  4G2A A;  3N9L A;  3HA4 A;  3BQL A;  4N78 D;  3RYH E;  3N9P A;  2XUE A;  4GK0 E;  3ZN0 B;  3QUJ A;  2B1E A;  3KV6 A;  3Q5X A;  2CE7 A;  3PTR B;  3KIN B;  5JVD E;  3KV9 A;  3OJA A;  4TN7 B;  4I4T E;  4ZHQ E;  5F3J A;  2XTL A;  4X1K E;  4P09 A;  3F57 A;  5F8P A;  3TKL B;  1WR6 A;  2L8K A;  4C91 A;  3HKB E;  3AA7 B;  2ZM2 A;  2EHO C;  2C5I T;  5JDM A;  1WYC A;  3CQX C;  2CLY C;  2V1D B;  5LOV E;  3UTK A;  3AAI A;  4JUY A;  1UX4 A;  4PJL A;  5E0O A;  2D0U A;  1AJ3 A;  4DVD A;  5CA0 E;  2BZB A;  3RH3 A;  2MTQ A;  2D0T A;  3UUL A;  3ZYM A;  4MBQ A;  2XAJ B;  3O1J A;  3VKG A;  2XAH B;  2E9X C;  2X9W A;  5H6R B;  2ODV A;  3RX6 A;  2CA5 A;  1Y64 B;  5FXW A;  4O2A E;  5LA6 E;  3AVR A;  4H63 H;  4AKH A;  5LHG B;  5JDQ A;  3WAJ A;  3MAC A;  5IHY A;  4PK6 A;  2UXN B;  3OKQ A;  1IJ5 A;  3RC3 A;  3L09 A;  5FY0 A;  3SRZ A;  3N2K E;  3HL6 A;  4QHO A;  1G73 A;  2N1G A;  5JR9 C;  3LBX B;  3LK2 B;  4Z8X A;  5L3E B;  1FMV A;  2KMF A;  4EXT A;  3ZLI A;  2XAS B;  1YW0 A;  2WBL A;  3NRX A;  5EK2 A;  2W00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...