2NW8A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
266
structure length
266
Chain Sequence
EGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 105
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw8A00
2NW8A 4PW8A 2V7MA 2NW7A 2V7IA 2V7JA 2NW9A 3E08A 5ETWA 2X67A 2NOXA 5EK4A 3BK9A 2V7LA 2D0UA 2V7KA 2NWBA 4U72A 5EK2A 1YW0A 4PK5A 4PK6A 4HKAA 4U74A 5EK3A 2X68A 1ZEEA 2X66A 2D0TA
chains in the Genus database with same CATH superfamily
4HN9A 2C0SA 2NTXA 1MNDA 4UF0B 1Y64B 1J5ET 2WAUA 3N9OA 4AQYT 4IE4A 5IHYA 2LOSA 3CX8B 4YY3T 3PUQA 2C5JA 1YW0A 2BG9C 4QXHB 2NR4A 1B7TA 5EZYE 2VURA 5CGMA 4UVCB 2E9XB 1D1AA 2BG9E 1D0YA 4XBFB 2UU9T 2IAKA 2AE9A 1XMOT 2UUBT 3KV4A 3C50A 5CB4E 2X66A 3CIRA 2PJQA 3RQWA 2LJLA 2Q9QD 4X66T 5JR9C 2H88A 1M62A 2XTLA 3FBZA 1VOMA 4YTNA 4YXDA 5AQMB 2LSGA 2H7VC 5KDMC 5LHHB 1IBLT 4LFBT 3FZFB 5BMVE 4UXNB 4PFOA 3JC6D 4OFZA 3I0OA 3L3PA 1HX1B 3JCFA 5LBMA 2ACZA 2UUCT 4HFVA 2YDRA 2UXXB 4LF9T 3V5UA 3ONXA 2VKJA 5J2TE 5HEGA 2NTYA 5JREA 4QXCB 4IL9A 3ZYLA 3HKEE 5LMUT 2F4VT 2WDRA 2LSYA 3HKDE 4JI4T 2OA5A 3BQLA 2H89A 4H9NC 1XMQT 1CHUA 1N33T 4NIQA 3ZSTA 2WCAA 4B3MT 4BJMA 1IZNB 3RIUA 4DBRA 3TLTA 3KV5A 3LDQB 2VK9A 1MIYA 2ZM6T 4IL4A 1HNXT 5FKYA 2LSIA 4ZI3C 3MZKB 2BVMA 4AXPA 3Q5XA 1WFDA 2WZIA 2HN2A 5AQOB 5JDLA 4CXXA 4H9OC 4CXWA 2K9AA 1HCIA 3MK7C 1D0ZA 5ABFB 4IE7A 3T1HT 5HWXA 2C5KT 3HKBE 1FMWA 4IGUA 3UU3A 2E9XC 3AA7B 4DR4T 2LHNA 2XQAA 2CHNA 4CI1B 4BAYB 1UURA 1Z0PA 4YTMA 4I4TE 3AE8A 1BR2A 5L3CB 2XAJB 3KBUA 3AEBA 1ZKEA 4DMWA 3ZT6A 2R6GF 4JI3T 4LF5T 5HEJA 3UFGA 3QB5K 5FY1A 2N9DA 3RRWA 5FY7A 4EZHA 1MMDA 2VKDA 5J2UE 5AQIB 4YJ2E 3C98B 3PUXF 2LRLA 2CCQA 1MNEA 4HFCA 3ESLA 2W61A 1ZHCA 5CA0E 4U7YA 4WZXA 4HFBA 2LT3A 3AE4A 3PJAA 2M6BA 3ETUA 3ZMSB 4DV7T 2D2SA 5LJMA 4JUYA 4Z91A 5LJNA 2XAQB 4QX8B 2WQYA 1AJ3A 1OWAA 4O4LE 2ZM8A 4O8SA 2LM9A 2Q9QB 2W63A 3HL6A 3QUJA 4HWFA 4KHPT 2WY2A 4JI1T 2I6HA 3KVAA 3GMIA 4MBQA 4YFSA 3ZJ2A 1JNZA 2SPCA 4P0AA 3E0ZA 5LP6E 3PV0F 2BKPA 4QXBB 5C2TA 2X9YA 4EYYR 2X9XA 3PUVF 4ZI3D 4IDQA 1ZV4X 5FXVA 2V5DA 2V7IA 4MHCA 5LGUB 3QB5A 3K3OA 1WR6A 1KK7A 2LLYA 5AQRB 2JJ9A 2E5LT 2N2NA 4QH4A 4LF7T 4B3ST 4ZS2A 3ZMUB 2X51A 5HXCA 3KFWX 4OHFA 4JEUB 2DWGA 1UGOA 1IBKT 4HGAA 1YD8G 5AQUB 5L3BB 2X0YA 4EEDA 4EV6A 3AB3B 4PK5A 3RYIE 3RIAA 1MMNA 3OVUA 3PUGA 4B3TT 5J0ZA 3Q5WA 4PJMA 4Q25A 1IAPA 4PAGA 2W00A 3JAEA 5ETWA 2OLTA 4HFDA 1MIVA 2WP9A 2ZLYA 2CA5A 2JIWA 3GN5A 3RX6A 4IDNA 4PW8A 3ZMTB 4A97A 4MALA 2K48A 4U7IA 2V26A 4PJNA 3P4RA 3FZKB 5HEOA 1QUUA 2K24A 2V7KA 4O4IE 3P4PA 3L8RA 1UCUA 3ZPOA 4AKIA 4CZZB 3FHNA 4EZ4A 2ODVA 4PK4A 5AQLB 2XUEA 2NWBA 3EHZA 2Q9QC 2EHOA 1YKHB 4DIDB 4TN7B 2PFVA 5FNVE 3TKLB 3OYXA 3K3QC 3LFMA 4NUUA 3UQ4A 4QX7B 3N2OA 3TLVA 1SHZC 1KNRA 1UX4A 1HFAA 2XM1A 2V6XA 3FB2A 2D0TA 1W0BA 3JC6C 3AE2A 1OXZA 1N32T 3AEDA 5FXXA 4EIWA 3VHLA 5FYMA 2FJAA 2KLQA 3O1JA 3KVBA 1XWMA 2BVLA 4ILBA 1WCRA 4QKNA 4NUVA 5FY0A 2UXCT 4IE6A 4FJOA 3LK2B 4NPPA 5LNKA 2XSBA 2YEVC 3RQUA 3WI3A 5IUXA 3W15B 1FJGT 4P09A 1HF8A 2LSJA 4EXTA 4GIWA 3AECA 5FVLA 1E7PA 4BA9A 3UQ7A 1S94A 5IYZE 2RP4A 4NXMT 4ZZCA 4ZEYA 4DUZT 2XQ3A 2CWYA 3O4XE 5AQGB 4AKRB 4EEBA 4U2YA 5JDGA 2DHRA 1U4QA 4LF6T 4DR3T 4KMCA 2K5BB 3O1IA 3E08A 1D0XA 3JAFA 3RC3A 5IWAT 4N78D 1T98A 2VB6A 4PJJA 4KHZF 2QGSA 4IE0A 5CA1E 2ES0A 1T8BA 3OJAA 4KUMB 1HTJF 2KWIB 2ZM2A 4IHJE 4MLKA 3N9PA 3ABVA 5EK4A 2PG8A 2CXFA 2D9DA 4HEAA 5LHIB 2KINB 4O4JE 5AQPB 1H7CA 2ZMAA 5LA6E 2PBIA 4P0BA 2JQ9A 2I59A 2JRKA 2XHEB 2HH7A 2LSKA 2VL0A 3CPZA 4JLEA 4X1KE 4JI0T 5ABEA 2UXDT 2J4GA 2LKHA 5DJQC 3ZMVB 5DABA 3CX7B 2QRXA 2VKHA 3P4WA 3TLSA 1N36T 5HWYA 4FI5A 3I9YA 2V7JA 1KNPA 3M3ZB 5FP3A 4X65T 4XZCA 3ZN1B 2IDOB 2XSAA 2X9WA 3OBVE 1G73A 2WB5A 4LF4T 2X68A 2MBGA 5HYAA 3AE9A 4EGWA 4L9IA 3NRYA 1VCTA 4DR2T 2WZHA 4PJLA 4OX9T 4U3CA 1US7B 4U33A 4LFAT 3RIUC 3UU6A 5FXWA 2B76A 5EK3A 2BBHA 3VRBA 2LKGA 3PU3A 4DV6T 2DI4A 4LF8T 5C8YE 2IIUA 4AKHA 4UVBB 3ZT7A 3PUSA 2LRKA 4BJNA 5LOVE 3IHRA 2K3WA 1QSDA 2XASB 2CMRA 4CXYA 4HFIA 3KDSE 2WSSV 3PUYF 3U78A 4CN6A 2V7MA 2YDSA 4UEMA 2NW9A 2CBJA 3H3AA 4IE5A 1IJ5A 2LE8A 2P9BA 3FZMB 3UULA 4PK6A 2BKOA 1FMVA 3NRXA 1LVFA 4GKKT 3UUBA 4O2BE 2CXDA 3LBXA 1U5PA 4KP3C 4YHJA 3NVOA 3Q2MA 2W66A 4LMJA 3BK9A 3RKOA 2IC9A 2G0UA 2W67A 1IBMT 2OV9A 3GN5B 3CVRA 4DV5T 1DU2A 3AEGA 3F57A 5L3EB 3SRZA 2NOXA 2UXNB 2CEAA 3V5SA 4TWFA 4AQFA 4EB6E 3VKGA 3CQCB 3A5XA 4PFPA 2WWUA 2MPKA 1FEWA 2J47A 2RPAA 3RYCE 2A2FX 1XZYA 1D1BA 1HS7A 3U3IA 3NBXX 4H9QC 4AISA 4I43B 2XPKA 3NWIA 4U31A 2VVSA 4TUYE 2N1GA 2XZEA 2HHHT 5H6QB 3SFDA 3RHWA 3CK6A 2MTQA 4YSYA 3DTOA 5BR8T 2I0MA 3UU8A 1J1JA 2JMKA 3LK42 3TLWA 4AQGA 3CQXC 4KX6A 3RRCA 3ZKRA 5H6RB 1UUSA 3QK6A 4I0UA 4EYUA 3ZSSA 4NXNT 5JDMA 1SUMB 4COFA 4TNWA 4DR6T 4HFEA 5HAXA 1MIWA 2YK0A 4WBNE 5ABHA 4CN4A 2V6YA 5AQKB 2XY8B 2BZBA 4ISSA 2FJEA 2YN6A 2YU2A 3M65A 5AFUL 2JQQA 1YKEB 2XQ7A 2GK9A 4WBOA 4UR9A 3B5MA 5HEHA 2L8KA 4P1NA 3ZJ1A 1GQEA 3MXZA 4ZHQE 5LCYA 2XAFB 4WYVA 5CFBA 1YXRA 4B6XA 3JADA 1KF6A 2YKSA 1WYBA 2XQ8A 3TLUA 4YSZA 3AXJA 4X20E 3N2GE 5FVKA 4HFHA 1UK5A 3SS1A 2BKNA 4O2AE 5JDFA 1X79A 4H9PC 5KXJA 2IC6A 2V7LA 4U74A 3VR8A 1WYCA 3FXEB 3RIFA 4DV1T 5AQQB 4DVDA 1W09A 3LK3B 4H9SE 3ZC0A 1OEDA 2A3DA 2ODUA 1YQ4A 4ZOLE 2XQ5A 2ZM0A 5L47A 3KBTA 2EHOC 3B13A 4LFCT 4C91A 2CWOA 4YTPA 4EOZB 2X67A 5J1GA 5FMNA 5JRCA 4X5TA 4TNVA 3A8YC 2M67A 2X9HA 4AIUA 5L3DB 2V1DB 4G63A 3UTKA 1MMAA 2XQ6A 3AA0B 4ZI2C 3AE3A 4EAHA 3J9X1 3ZMZB 2Z6EA 3ANWA 5LXTE 2FJBA 3CMLA 1LVKA 1JNRA 3OTOT 2WBLA 3LSVA 3N2KE 2JPFA 3AEAA 2CPTA 2WM9A 2WMOA 4KBMB 2XM2A 2XQ4A 4QWNB 2X0HA 4B3RT 2J62A 5DQVA 2LM2A 4HWIB 3WAKA 3FBLA 3GA8A 2HPJA 3AAEB 3ZCJA 3NZPA 1EZ3A 3LJCA 2M6IA 3O9XA 3IBPA 2QVAA 4ILUA 3T1YT 5L3GB 4DV4T 3OYZA 1NENA 3C4XA 3F2EA 3C4ZA 3PDYA 4H9RC 3PURA 3OPCA 3BQIA 3P8CD 2LOPA 1WR0A 2BS2A 3ETVA 5M4YA 1BR4A 4A5XA 2CHOA 2W62A 2MOZA 5LB7B 5CJ5A 2UXBT 1T7SA 2PTFA 3VRAA 2QYWA 3ZYKA 4Z8XA 2VKOA 2Y48B 4LMLA 5JQGE 2RA1A 3Q5EA 4GK5E 3UUXB 3PUWF 4QH5A 5LMNT 4I55E 3N9NA 5HCMA 3LBXB 5JDQA 5E0OA 3AVRA 4A56A 2B1EA 4CQIA 4I50E 2IW5B 3VR9A 1ZP0A 2CBIA 2VL8A 4WNKA 2X0LB 4L5GA 2EHOD 2D0UA 3RKGA 2J1DG 3RC8A 3IA3A 4XAXB 4QH1A 5A1LA 4DV3T 4DNDA 1NEKA 3KV6A 5L4HA 2WS3A 1SA0E 2NW7A 3PUZF 4E7ZA 2KT9A 5AQJB 2BG9A 4L0RA 4JI5T 4K0KT 3SFEA 4ZI2D 4JV5T 1XDOA 4UIGA 4IIJE 3QOFA 1IJ6A 4HKAA 3R6NA 3ZEFB 5LHGB 5KX5E 4X1IE 4IDOA 2NW8A 5HXRA 2E8IA 2VQFT 1KEYA 2IHR1 2WWVA 1LKXA 4ZXLA 2CM0A 3C64A 3PE0A 5AQTB 4TV9E 2XAGB 5ADXL 1M7KA 5JR9A 4IDPA 5LGNB 3EI0A 4HE8A 2CE7A 2BS3A 4TZ4C 4OYKA 4YLHA 3R84B 5JTGA 2BS4A 4TV8E 1KFYA 5KMGP 4DUYT 4ISTA 5LG3A 4YSXA 4ASKA 3E22E 3AEEA 5LGTB 4GK0E 4AI6A 3MJXA 3DP7A 3J7Yq 2V6YB 1E2AA 4JEHB 3UFEA 3AVSA 4OK0A 5LYJE 4X62T 2L9QA 2W0GA 2Y6XA 1W0AA 1XNRT 4J2CA 1S35A 4GYRA 2JQKA 2FBWA 3OKQA 3O1HA 1ZEEA 4GOUA 5JDNA 2DWKA 3PTRB 3CX6B 5FXZA 2CRBA 3H37A 4E7SA 5JDHA 3P7IA 4TWDA 5C3JA 3PUAA 4QHOA 4JI7T 2JQHA 1HNZT 3QNUA 2C5IT 2DCFA 1W9RA 5FL1A 3ZCIA 3PU8A 1WLXA 3VU7H 2H7OA 3AXJB 3ZN0B 4DO0A 3ONLC 1L0VA 4X1YE 4WW0A 5L2LA 5F5WA 2WMNA 4DMVA 3WAJA 3Q5DA 3AE7A 2V8SV 2VWAA 4UELA 2AXDS 2KXPB 3F31A 3AE6A 4UF0A 3DJBA 4AQFC 2A9UA 4YHHT 3CWZB 3C4WA 1QLBA 2UUAT 1O3XA 3EABA 2JMHA 2XAHB 2E2AA 1OEDB 2L3LA 4UV8B 2E9XA 3EAMA 3GWHA 5HEUA 5F3JA 2WU2A 2YU1A 4ANJA 1BR0A 1SE7A 2KWHA 4U2ZA 4C90A 4YT0A 5JRCB 3RYHE 3EDUA 4IT4A 2H3RA 3RI5A 2EHOB 3A7MA 4UVAB 4H63V 3UT5E 3Q9DA 4JI6T 2HN1A 3X1DA 3ANWB 5DQWA 2VVNA 2LEHA 4TWHA 3AAAB 3L09A 3PJAJ 3K3NA 1XNQT 1HR0T 2XJ7A 4OYJA 5TAOA 1ZOYA 2CLYB 2A72A 3L39A 3G06A 4M1PA 1X9BA 2QA7A 1KNZA 1VRBA 4X64T 4DV2T 1Z8UA 2HPLA 2Y8DA 4V1Av 4JBWF 3KINB 2XQ9A 1VCSA 4O4HE 2MAWA 4JI8T 3N9QA 4ADZA 5AQHB 4DV0T 2XQYA 3N9LA 3ONJA 5AQNB 4K0UA 3K1SA 3RH3A 3VKHA 1YQ3A 1NWMX 3HKCE 1T72A 4Z90A 3ZT5A 5ABFA 2E5VA 2E9XD 2VASA 4DBQA 2KNDA 3RF1A 3UUMA 5EK2A 1OEDC 3I9WA 2LHRA 1XDPA 2BDEA 4AKLA 5JH7E 5AQFB 4JYAT 2CXLA 3ZC1A 4ZS3A 1OEDE 4ILCA 3QC9A 3ZLIA 4ERRA 3T8OA 4HWHA 2YDQA 1Y01A 2WDQA 4IREA 4PNIA 5LBQB 2BBJA 3AE5A 2D5UA 1FIOA 4YJ3E 2KSRA 1J5WA 3AA1B 1HNWT 4ZI7E 3HR0A 5HXEA 4GKJT 5F8PA 3RLFF 2BG9B 3MA9A 5HXSA 4JI2T 2IMLA 2DLRA 2W2UA 3FXDB 5AQVB 4ILAA 3RPUA 1HG2A 4F8HA 3AE1A 4A98A 1BR1A 3UUNA 2CLYC 3HA4A 3B57A 4F6RC 4UV9B 4G2AA 4DR7T 2V5CA 1G8XA 5L3FB 2DL1A 3NZQA 3AEFA 3K8PC 4U72A 2MYSA 2FUPA 4IDZA 4CN1A 5FL0A 5L4EA 4TX5A 3EUHA 5JR9B 4HTEA 3P4SA 3CQGB 4HWCA 5AQSB 3IF8B 4AKGA 4CI2B 3RGLA 1I94T 2DNXA 1HG5A 2NP9A 1UX5A 2WDVA 2Q9QA 1R8IA 3N5LA 5ABGA 1N34T 5HXHA 3CKDA 3MACA 1WRDA 1D1CA 2YINA 3UU4A 3I1AA 2ACXA 1V9DA 1E1HB 2FJDA 2WU5A 3EVYA 5LG4A 3BQKA 3RYFE 2W4XA 4ZZBA 3FZLB 3SWHA 4CI3B 5HCJA 3N9MA 4LMKA 2KZ7B 5JVDE 2YOEA 1I6ZA 3NKZA 3AAIA 3KV9A 3SOLA 3P50A 4H63H 4DR5T 3IEEA 3AA6B 3C51A 2KMFA 3S4UA 4KI0F 3H3MA 3I0QA 2IUBA 3HI2A 1NAFA 3UU5A 5GONE 1HX8A 1CUNA 3P4QA 2VQET 4DR1T 3EDVA 3FZHB 4GYSA 4MFRA 3LG7A 1LRZA 3D0TA 4HWDA 1MMGA 3ZYMA 3MKDA
chains in the Genus database with same CATH topology
3PTRB 4HN9A 2C0SA 5JDMA 2ODVA 2NTXA 3CX6B 5FXZA 1MNDA 4UF0B 1Y64B 2WAUA 3N9OA 3H37A 4E7SA 5JDHA 3P7IA 5HAXA 4PK4A 1MIWA 2YK0A 3PUAA 4IE4A 5IHYA 4WBNE 2LOSA 4QHOA 2XUEA 3CX8B 3PUQA 2NWBA 2C5JA 1YW0A 2C5IT 2DCFA 4QXHB 1B7TA 2Q9QC 5EZYE 2EHOA 1YKHB 3ZCIA 3PU8A 2BZBA 1WLXA 4ISSA 4UVCB 4TN7B 3VU7H 2H7OA 2PFVA 2E9XB 5FNVE 3TKLB 3OYXA 3K3QC 1D1AA 2YU2A 3LFMA 3M65A 3ZN0B 4DO0A 5AFUL 2JQQA 1D0YA 4NUUA 1YKEB 4X1YE 4WW0A 2GK9A 5L2LA 4XBFB 2WMNA 2IAKA 4QX7B 3N2OA 4DMVA 3WAJA 1SHZC 4WBOA 1UX4A 2VWAA 1HFAA 4UELA 2L8KA 2KXPB 3FB2A 3F31A 3KV4A 3C50A 3ZJ1A 4UF0A 5CB4E 2X66A 3DJBA 4AQFC 2D0TA 3MXZA 2PJQA 4ZHQE 5LCYA 2LJLA 2XAFB 2Q9QD 3JC6C 5JR9C 1OXZA 2XTLA 5FXXA 4EIWA 3FBZA 3CWZB 4B6XA 3VHLA 3C4WA 1O3XA 1WYBA 5FYMA 2JMHA 2KLQA 2XAHB 3KVBA 1VOMA 3O1JA 2BVLA 4QKNA 2L3LA 4UV8B 4NUVA 5FY0A 2E9XA 4X20E 3N2GE 4IE6A 4FJOA 3LK2B 5LNKA 2YEVC 2LSGA 2H7VC 5KDMC 5LHHB 3GWHA 3WI3A 3SS1A 5F3JA 5BMVE 3W15B 4O2AE 2YU1A 5JDFA 4P09A 1HF8A 4UXNB 2LSJA 4PFOA 1X79A 4H9PC 3JC6D 4OFZA 4EXTA 3I0OA 3L3PA 2IC6A 4GIWA 2KWHA 2V7LA 5LBMA 4C90A 4HFVA 4BA9A 4U74A 5JRCB 2UXXB 1S94A 3RYHE 5IYZE 1WYCA 3EDUA 2VKJA 3ONXA 3V5UA 5J2TE 2H3RA 2NTYA 5JREA 3FXEB 4QXCB 2RP4A 3ZYLA 2EHOB 3HKEE 4UVAB 4DVDA 4H63V 3LK3B 2LSYA 4H9SE 3ZC0A 2CWYA 3HKDE 3O4XE 3UT5E 3Q9DA 2A3DA 2OA5A 2ODUA 3BQLA 4AKRB 4H9NC 3ANWB 5DQWA 2LEHA 5JDGA 3AAAB 3L09A 4ZOLE 2DHRA 2ZM0A 1U4QA 3K3NA 3KBTA 4KMCA 2EHOC 3B13A 4C91A 4OYJA 4BJMA 2K5BB 5TAOA 2CLYB 3O1IA 2CWOA 1IZNB 2A72A 4DBRA 3E08A 3KV5A 4EOZB 2X67A 5J1GA 2VK9A 1D0XA 5FMNA 5JRCA 1MIYA 3RC3A 2M67A 2LSIA 4ZI3C 3MZKB 2BVMA 4M1PA 4N78D 2X9HA 4AXPA 2QA7A 1KNZA 5L3DB 1T98A 1VRBA 2VB6A 4PJJA 2V1DB 3Q5XA 4G63A 3UTKA 1MMAA 2QGSA 4IE0A 5CA1E 2ES0A 2HPLA 5JDLA 4CXXA 3OJAA 3AA0B 4H9OC 2Y8DA 4V1Av 4ZI2C 4CXWA 2K9AA 4EAHA 3J9X1 3ZMZB 2Z6EA 4KUMB 1HTJF 1HCIA 2KWIB 3MK7C 4ANJA 2ZM2A 4IHJE 3ANWA 5LXTE 3KINB 4MLKA 3N9PA 1D0ZA 5EK4A 2PG8A 3CMLA 4IE7A 1LVKA 2CXFA 4HEAA 5LHIB 2KINB 5HWXA 4O4JE 2WBLA 3N2KE 2C5KT 2JPFA 3HKBE 1H7CA 2ZMAA 4O4HE 5LA6E 1FMWA 2PBIA 4P0BA 2WM9A 2WMOA 4IGUA 4KBMB 2I59A 2E9XC 2JRKA 2XHEB 3AA7B 3N9QA 2HH7A 2LSKA 4QWNB 2LHNA 3CPZA 4ADZA 5DQVA 4JLEA 4X1KE 4CI1B 3WAKA 4BAYB 2XQYA 3FBLA 1Z0PA 3GA8A 2HPJA 4I4TE 3AAEB 3ZCJA 5DJQC 3ZMVB 3N9LA 5DABA 3CX7B 1BR2A 4K0UA 3RH3A 2VKHA 3VKHA 5L3CB 2XAJB 3NZPA 3KBUA 5HWYA 1EZ3A 1NWMX 1ZKEA 3LJCA 3HKCE 4DMWA 4FI5A 3O9XA 3IBPA 3I9YA 2V7JA 2E9XD 5FP3A 4ILUA 4XZCA 2VASA 5FY1A 3ZN1B 4DBQA 2N9DA 5L3GB 3OYZA 2X9WA 2KNDA 3UUMA 5EK2A 3I9WA 2LHRA 3C4XA 5FY7A 3RRWA 4EZHA 2BDEA 1MMDA 2VKDA 3F2EA 3C4ZA 4AKLA 3OBVE 5JH7E 1G73A 3PDYA 4H9RC 2X68A 2MBGA 2CXLA 5HYAA 5J2UE 3PURA 4L9IA 3BQIA 3P8CD 2LOPA 3ZC1A 4YJ2E 3NRYA 4ZS3A 3C98B 3QC9A 3ETVA 2CCQA 5M4YA 1BR4A 1MNEA 4PJLA 3ZLIA 4ERRA 3T8OA 3ESLA 2W62A 1US7B 2MOZA 2W61A 4PNIA 1ZHCA 5LBQB 5CA0E 5FXWA 2LT3A 5EK3A 2D5UA 1FIOA 3ZYKA 3ETUA 4YJ3E 3PU3A 2DI4A 3ZMSB 4Z8XA 5C8YE 2VKOA 2D2SA 5LJMA 4UVBB 4AKHA 4JUYA 2Y48B 3PUSA 3AA1B 5JQGE 2RA1A 4GK5E 3UUXB 5LJNA 4BJNA 4ZI7E 2XAQB 4QX8B 5LOVE 1BR0A 3IHRA 1AJ3A 1OWAA 4I55E 4O4LE 3N9NA 1QSDA 2XASB 3LBXB 2ZM8A 5JDQA 5E0OA 3HR0A 5HXEA 2CMRA 3AVRA 5F8PA 4O8SA 3MA9A 4A56A 5HXSA 2LM9A 4CXYA 2DLRA 2Q9QB 2W63A 3FXDB 3HL6A 2B1EA 3KDSE 2WSSV 3RPUA 1HG2A 3QUJA 4CQIA 4I50E 2IW5B 3U78A 2V7MA 1BR1A 3UUNA 2CLYC 3HA4A 2VL8A 3B57A 3KVAA 3GMIA 4MBQA 4UV9B 4UEMA 4G2AA 4WNKA 4YFSA 3ZJ2A 4F6RC 2X0LB 2NW9A 4L5GA 2EHOD 1G8XA 3H3AA 5L3FB 2SPCA 3NZQA 4IE5A 3K8PC 2D0UA 4U72A 1IJ5A 2J1DG 2LE8A 2P9BA 3E0ZA 4P0AA 3RC8A 3UULA 5LP6E 4PK6A 2MYSA 4XAXB 4IDZA 5A1LA 1FMVA 4QXBB 3NRXA 1LVFA 2X9YA 4EYYR 2X9XA 4DNDA 4TX5A 4ZI3D 3EUHA 3KV6A 1ZV4X 5JR9B 1SA0E 4HTEA 5FXVA 3CQGB 4O2BE 2CXDA 3IF8B 2NW7A 3LBXA 4AKGA 1U5PA 2V7IA 4KP3C 4YHJA 4CI2B 4MHCA 4E7ZA 5LGUB 2KT9A 3K3OA 3Q2MA 1WR6A 2DNXA 1KK7A 4L0RA 1HG5A 2NP9A 1UX5A 3BK9A 3RKOA 4ZI2D 2Q9QA 3N5LA 2JJ9A 2IC9A 4UIGA 4IIJE 2N2NA 3R6NA 1IJ6A 4HKAA 3ZEFB 2G0UA 4ZS2A 3ZMUB 2X51A 5HXCA 5LHGB 3KFWX 5HXHA 3GN5B 4X1IE 5KX5E 4OHFA 3CKDA 4JEUB 2DWGA 2NW8A 5HXRA 2E8IA 3CVRA 3MACA 4HGAA 1WRDA 1YD8G 1D1CA 2YINA 3F57A 1LKXA 5L3EB 3I1AA 2ACXA 3SRZA 5L3BB 2NOXA 1V9DA 2CM0A 3C64A 3PE0A 3AB3B 2UXNB 1E1HB 2CEAA 3V5SA 3EVYA 4PK5A 5LG4A 3RYIE 3BQKA 4TV9E 3RYFE 4AQFA 4EB6E 2XAGB 5ADXL 3VKGA 3CQCB 5JR9A 3A5XA 3SWHA 4CI3B 4PFPA 5LGNB 1MMNA 2WWUA 3PUGA 1FEWA 4HE8A 2CE7A 4TZ4C 4YLHA 4OYKA 3R84B 3Q5WA 4PJMA 3RYCE 1IAPA 4PAGA 4TV8E 2A2FX 3N9MA 5KMGP 4ISTA 2W00A 4ASKA 2KZ7B 3E22E 1D1BA 5ETWA 5JVDE 1HS7A 1MIVA 3AAIA 2ZLYA 3KV9A 5LGTB 4GK0E 3SOLA 4AI6A 3U3IA 2CA5A 3NBXX 4H9QC 4I43B 4H63H 3MJXA 3DP7A 3J7Yq 3GN5A 4JEHB 3UFEA 3AVSA 3IEEA 4TUYE 3RX6A 2N1GA 3AA6B 3C51A 2KMFA 4OK0A 5H6QB 5LYJE 4PW8A 3S4UA 3I0QA 3ZMTB 3HI2A 2MTQA 3DTOA 1NAFA 4MALA 2K48A 5GONE 2L9QA 2V26A 1HX8A 1CUNA 4PJNA 2JMKA 2W0GA 3LK42 2Y6XA 4AQGA 3CQXC 3EDVA 3RRCA 1QUUA 2K24A 2V7KA 4GYSA 4J2CA 1S35A 4O4IE 4GYRA 4MFRA 3LG7A 1LRZA 3D0TA 1UCUA 5H6RB 3ZPOA 1MMGA 3ZYMA 3MKDA 3OKQA 3QK6A 3O1HA 1ZEEA 4CZZB 3FHNA 4GOUA 4AKIA 5JDNA 2DWKA 4EZ4A 4EYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW8 A;  4PW8 A;  2V7M A;  2NW7 A;  2V7I A;  2V7J A;  2NW9 A;  3E08 A;  5ETW A;  2X67 A;  2NOX A;  5EK4 A;  3BK9 A;  2V7L A;  2D0U A;  2V7K A;  2NWB A;  4U72 A;  5EK2 A;  1YW0 A;  4PK5 A;  4PK6 A;  4HKA A;  4U74 A;  5EK3 A;  2X68 A;  1ZEE A;  2X66 A;  2D0T A; 
#chains in the Genus database with same CATH topology
 4HN9 A;  2C0S A;  2NTX A;  1MND A;  4UF0 B;  1Y64 B;  1J5E T;  2WAU A;  3N9O A;  4AQY T;  4IE4 A;  5IHY A;  2LOS A;  3CX8 B;  4YY3 T;  3PUQ A;  2C5J A;  1YW0 A;  2BG9 C;  4QXH B;  2NR4 A;  1B7T A;  5EZY E;  2VUR A;  5CGM A;  4UVC B;  2E9X B;  1D1A A;  2BG9 E;  1D0Y A;  4XBF B;  2UU9 T;  2IAK A;  2AE9 A;  1XMO T;  2UUB T;  3KV4 A;  3C50 A;  5CB4 E;  2X66 A;  3CIR A;  2PJQ A;  3RQW A;  2LJL A;  2Q9Q D;  4X66 T;  5JR9 C;  2H88 A;  1M62 A;  2XTL A;  3FBZ A;  1VOM A;  4YTN A;  4YXD A;  5AQM B;  2LSG A;  2H7V C;  5KDM C;  5LHH B;  1IBL T;  4LFB T;  3FZF B;  5BMV E;  4UXN B;  4PFO A;  3JC6 D;  4OFZ A;  3I0O A;  3L3P A;  1HX1 B;  3JCF A;  5LBM A;  2ACZ A;  2UUC T;  4HFV A;  2YDR A;  2UXX B;  4LF9 T;  3V5U A;  3ONX A;  2VKJ A;  5J2T E;  5HEG A;  2NTY A;  5JRE A;  4QXC B;  4IL9 A;  3ZYL A;  3HKE E;  5LMU T;  2F4V T;  2WDR A;  2LSY A;  3HKD E;  4JI4 T;  2OA5 A;  3BQL A;  2H89 A;  4H9N C;  1XMQ T;  1CHU A;  1N33 T;  4NIQ A;  3ZST A;  2WCA A;  4B3M T;  4BJM A;  1IZN B;  3RIU A;  4DBR A;  3TLT A;  3KV5 A;  3LDQ B;  2VK9 A;  1MIY A;  2ZM6 T;  4IL4 A;  1HNX T;  5FKY A;  2LSI A;  4ZI3 C;  3MZK B;  2BVM A;  4AXP A;  3Q5X A;  1WFD A;  2WZI A;  2HN2 A;  5AQO B;  5JDL A;  4CXX A;  4H9O C;  4CXW A;  2K9A A;  1HCI A;  3MK7 C;  1D0Z A;  5ABF B;  4IE7 A;  3T1H T;  5HWX A;  2C5K T;  3HKB E;  1FMW A;  4IGU A;  3UU3 A;  2E9X C;  3AA7 B;  4DR4 T;  2LHN A;  2XQA A;  2CHN A;  4CI1 B;  4BAY B;  1UUR A;  1Z0P A;  4YTM A;  4I4T E;  3AE8 A;  1BR2 A;  5L3C B;  2XAJ B;  3KBU A;  3AEB A;  1ZKE A;  4DMW A;  3ZT6 A;  2R6G F;  4JI3 T;  4LF5 T;  5HEJ A;  3UFG A;  3QB5 K;  5FY1 A;  2N9D A;  3RRW A;  5FY7 A;  4EZH A;  1MMD A;  2VKD A;  5J2U E;  5AQI B;  4YJ2 E;  3C98 B;  3PUX F;  2LRL A;  2CCQ A;  1MNE A;  4HFC A;  3ESL A;  2W61 A;  1ZHC A;  5CA0 E;  4U7Y A;  4WZX A;  4HFB A;  2LT3 A;  3AE4 A;  3PJA A;  2M6B A;  3ETU A;  3ZMS B;  4DV7 T;  2D2S A;  5LJM A;  4JUY A;  4Z91 A;  5LJN A;  2XAQ B;  4QX8 B;  2WQY A;  1AJ3 A;  1OWA A;  4O4L E;  2ZM8 A;  4O8S A;  2LM9 A;  2Q9Q B;  2W63 A;  3HL6 A;  3QUJ A;  4HWF A;  4KHP T;  2WY2 A;  4JI1 T;  2I6H A;  3KVA A;  3GMI A;  4MBQ A;  4YFS A;  3ZJ2 A;  1JNZ A;  2SPC A;  4P0A A;  3E0Z A;  5LP6 E;  3PV0 F;  2BKP A;  4QXB B;  5C2T A;  2X9Y A;  4EYY R;  2X9X A;  3PUV F;  4ZI3 D;  4IDQ A;  1ZV4 X;  5FXV A;  2V5D A;  2V7I A;  4MHC A;  5LGU B;  3QB5 A;  3K3O A;  1WR6 A;  1KK7 A;  2LLY A;  5AQR B;  2JJ9 A;  2E5L T;  2N2N A;  4QH4 A;  4LF7 T;  4B3S T;  4ZS2 A;  3ZMU B;  2X51 A;  5HXC A;  3KFW X;  4OHF A;  4JEU B;  2DWG A;  1UGO A;  1IBK T;  4HGA A;  1YD8 G;  5AQU B;  5L3B B;  2X0Y A;  4EED A;  4EV6 A;  3AB3 B;  4PK5 A;  3RYI E;  3RIA A;  1MMN A;  3OVU A;  3PUG A;  4B3T T;  5J0Z A;  3Q5W A;  4PJM A;  4Q25 A;  1IAP A;  4PAG A;  2W00 A;  3JAE A;  5ETW A;  2OLT A;  4HFD A;  1MIV A;  2WP9 A;  2ZLY A;  2CA5 A;  2JIW A;  3GN5 A;  3RX6 A;  4IDN A;  4PW8 A;  3ZMT B;  4A97 A;  4MAL A;  2K48 A;  4U7I A;  2V26 A;  4PJN A;  3P4R A;  3FZK B;  5HEO A;  1QUU A;  2K24 A;  2V7K A;  4O4I E;  3P4P A;  3L8R A;  1UCU A;  3ZPO A;  4AKI A;  4CZZ B;  3FHN A;  4EZ4 A;  2ODV A;  4PK4 A;  5AQL B;  2XUE A;  2NWB A;  3EHZ A;  2Q9Q C;  2EHO A;  1YKH B;  4DID B;  4TN7 B;  2PFV A;  5FNV E;  3TKL B;  3OYX A;  3K3Q C;  3LFM A;  4NUU A;  3UQ4 A;  4QX7 B;  3N2O A;  3TLV A;  1SHZ C;  1KNR A;  1UX4 A;  1HFA A;  2XM1 A;  2V6X A;  3FB2 A;  2D0T A;  1W0B A;  3JC6 C;  3AE2 A;  1OXZ A;  1N32 T;  3AED A;  5FXX A;  4EIW A;  3VHL A;  5FYM A;  2FJA A;  2KLQ A;  3O1J A;  3KVB A;  1XWM A;  2BVL A;  4ILB A;  1WCR A;  4QKN A;  4NUV A;  5FY0 A;  2UXC T;  4IE6 A;  4FJO A;  3LK2 B;  4NPP A;  5LNK A;  2XSB A;  2YEV C;  3RQU A;  3WI3 A;  5IUX A;  3W15 B;  1FJG T;  4P09 A;  1HF8 A;  2LSJ A;  4EXT A;  4GIW A;  3AEC A;  5FVL A;  1E7P A;  4BA9 A;  3UQ7 A;  1S94 A;  5IYZ E;  2RP4 A;  4NXM T;  4ZZC A;  4ZEY A;  4DUZ T;  2XQ3 A;  2CWY A;  3O4X E;  5AQG B;  4AKR B;  4EEB A;  4U2Y A;  5JDG A;  2DHR A;  1U4Q A;  4LF6 T;  4DR3 T;  4KMC A;  2K5B B;  3O1I A;  3E08 A;  1D0X A;  3JAF A;  3RC3 A;  5IWA T;  4N78 D;  1T98 A;  2VB6 A;  4PJJ A;  4KHZ F;  2QGS A;  4IE0 A;  5CA1 E;  2ES0 A;  1T8B A;  3OJA A;  4KUM B;  1HTJ F;  2KWI B;  2ZM2 A;  4IHJ E;  4MLK A;  3N9P A;  3ABV A;  5EK4 A;  2PG8 A;  2CXF A;  2D9D A;  4HEA A;  5LHI B;  2KIN B;  4O4J E;  5AQP B;  1H7C A;  2ZMA A;  5LA6 E;  2PBI A;  4P0B A;  2JQ9 A;  2I59 A;  2JRK A;  2XHE B;  2HH7 A;  2LSK A;  2VL0 A;  3CPZ A;  4JLE A;  4X1K E;  4JI0 T;  5ABE A;  2UXD T;  2J4G A;  2LKH A;  5DJQ C;  3ZMV B;  5DAB A;  3CX7 B;  2QRX A;  2VKH A;  3P4W A;  3TLS A;  1N36 T;  5HWY A;  4FI5 A;  3I9Y A;  2V7J A;  1KNP A;  3M3Z B;  5FP3 A;  4X65 T;  4XZC A;  3ZN1 B;  2IDO B;  2XSA A;  2X9W A;  3OBV E;  1G73 A;  2WB5 A;  4LF4 T;  2X68 A;  2MBG A;  5HYA A;  3AE9 A;  4EGW A;  4L9I A;  3NRY A;  1VCT A;  4DR2 T;  2WZH A;  4PJL A;  4OX9 T;  4U3C A;  1US7 B;  4U33 A;  4LFA T;  3RIU C;  3UU6 A;  5FXW A;  2B76 A;  5EK3 A;  2BBH A;  3VRB A;  2LKG A;  3PU3 A;  4DV6 T;  2DI4 A;  4LF8 T;  5C8Y E;  2IIU A;  4AKH A;  4UVB B;  3ZT7 A;  3PUS A;  2LRK A;  4BJN A;  5LOV E;  3IHR A;  2K3W A;  1QSD A;  2XAS B;  2CMR A;  4CXY A;  4HFI A;  3KDS E;  2WSS V;  3PUY F;  3U78 A;  4CN6 A;  2V7M A;  2YDS A;  4UEM A;  2NW9 A;  2CBJ A;  3H3A A;  4IE5 A;  1IJ5 A;  2LE8 A;  2P9B A;  3FZM B;  3UUL A;  4PK6 A;  2BKO A;  1FMV A;  3NRX A;  1LVF A;  4GKK T;  3UUB A;  4O2B E;  2CXD A;  3LBX A;  1U5P A;  4KP3 C;  4YHJ A;  3NVO A;  3Q2M A;  2W66 A;  4LMJ A;  3BK9 A;  3RKO A;  2IC9 A;  2G0U A;  2W67 A;  1IBM T;  2OV9 A;  3GN5 B;  3CVR A;  4DV5 T;  1DU2 A;  3AEG A;  3F57 A;  5L3E B;  3SRZ A;  2NOX A;  2UXN B;  2CEA A;  3V5S A;  4TWF A;  4AQF A;  4EB6 E;  3VKG A;  3CQC B;  3A5X A;  4PFP A;  2WWU A;  2MPK A;  1FEW A;  2J47 A;  2RPA A;  3RYC E;  2A2F X;  1XZY A;  1D1B A;  1HS7 A;  3U3I A;  3NBX X;  4H9Q C;  4AIS A;  4I43 B;  2XPK A;  3NWI A;  4U31 A;  2VVS A;  4TUY E;  2N1G A;  2XZE A;  2HHH T;  5H6Q B;  3SFD A;  3RHW A;  3CK6 A;  2MTQ A;  4YSY A;  3DTO A;  5BR8 T;  2I0M A;  3UU8 A;  1J1J A;  2JMK A;  3LK4 2;  3TLW A;  4AQG A;  3CQX C;  4KX6 A;  3RRC A;  3ZKR A;  5H6R B;  1UUS A;  3QK6 A;  4I0U A;  4EYU A;  3ZSS A;  4NXN T;  5JDM A;  1SUM B;  4COF A;  4TNW A;  4DR6 T;  4HFE A;  5HAX A;  1MIW A;  2YK0 A;  4WBN E;  5ABH A;  4CN4 A;  2V6Y A;  5AQK B;  2XY8 B;  2BZB A;  4ISS A;  2FJE A;  2YN6 A;  2YU2 A;  3M65 A;  5AFU L;  2JQQ A;  1YKE B;  2XQ7 A;  2GK9 A;  4WBO A;  4UR9 A;  3B5M A;  5HEH A;  2L8K A;  4P1N A;  3ZJ1 A;  1GQE A;  3MXZ A;  4ZHQ E;  5LCY A;  2XAF B;  4WYV A;  5CFB A;  1YXR A;  4B6X A;  3JAD A;  1KF6 A;  2YKS A;  1WYB A;  2XQ8 A;  3TLU A;  4YSZ A;  3AXJ A;  4X20 E;  3N2G E;  5FVK A;  4HFH A;  1UK5 A;  3SS1 A;  2BKN A;  4O2A E;  5JDF A;  1X79 A;  4H9P C;  5KXJ A;  2IC6 A;  2V7L A;  4U74 A;  3VR8 A;  1WYC A;  3FXE B;  3RIF A;  4DV1 T;  5AQQ B;  4DVD A;  1W09 A;  3LK3 B;  4H9S E;  3ZC0 A;  1OED A;  2A3D A;  2ODU A;  1YQ4 A;  4ZOL E;  2XQ5 A;  2ZM0 A;  5L47 A;  3KBT A;  2EHO C;  3B13 A;  4LFC T;  4C91 A;  2CWO A;  4YTP A;  4EOZ B;  2X67 A;  5J1G A;  5FMN A;  5JRC A;  4X5T A;  4TNV A;  3A8Y C;  2M67 A;  2X9H A;  4AIU A;  5L3D B;  2V1D B;  4G63 A;  3UTK A;  1MMA A;  2XQ6 A;  3AA0 B;  4ZI2 C;  3AE3 A;  4EAH A;  3J9X 1;  3ZMZ B;  2Z6E A;  3ANW A;  5LXT E;  2FJB A;  3CML A;  1LVK A;  1JNR A;  3OTO T;  2WBL A;  3LSV A;  3N2K E;  2JPF A;  3AEA A;  2CPT A;  2WM9 A;  2WMO A;  4KBM B;  2XM2 A;  2XQ4 A;  4QWN B;  2X0H A;  4B3R T;  2J62 A;  5DQV A;  2LM2 A;  4HWI B;  3WAK A;  3FBL A;  3GA8 A;  2HPJ A;  3AAE B;  3ZCJ A;  3NZP A;  1EZ3 A;  3LJC A;  2M6I A;  3O9X A;  3IBP A;  2QVA A;  4ILU A;  3T1Y T;  5L3G B;  4DV4 T;  3OYZ A;  1NEN A;  3C4X A;  3F2E A;  3C4Z A;  3PDY A;  4H9R C;  3PUR A;  3OPC A;  3BQI A;  3P8C D;  2LOP A;  1WR0 A;  2BS2 A;  3ETV A;  5M4Y A;  1BR4 A;  4A5X A;  2CHO A;  2W62 A;  2MOZ A;  5LB7 B;  5CJ5 A;  2UXB T;  1T7S A;  2PTF A;  3VRA A;  2QYW A;  3ZYK A;  4Z8X A;  2VKO A;  2Y48 B;  4LML A;  5JQG E;  2RA1 A;  3Q5E A;  4GK5 E;  3UUX B;  3PUW F;  4QH5 A;  5LMN T;  4I55 E;  3N9N A;  5HCM A;  3LBX B;  5JDQ A;  5E0O A;  3AVR A;  4A56 A;  2B1E A;  4CQI A;  4I50 E;  2IW5 B;  3VR9 A;  1ZP0 A;  2CBI A;  2VL8 A;  4WNK A;  2X0L B;  4L5G A;  2EHO D;  2D0U A;  3RKG A;  2J1D G;  3RC8 A;  3IA3 A;  4XAX B;  4QH1 A;  5A1L A;  4DV3 T;  4DND A;  1NEK A;  3KV6 A;  5L4H A;  2WS3 A;  1SA0 E;  2NW7 A;  3PUZ F;  4E7Z A;  2KT9 A;  5AQJ B;  2BG9 A;  4L0R A;  4JI5 T;  4K0K T;  3SFE A;  4ZI2 D;  4JV5 T;  1XDO A;  4UIG A;  4IIJ E;  3QOF A;  1IJ6 A;  4HKA A;  3R6N A;  3ZEF B;  5LHG B;  5KX5 E;  4X1I E;  4IDO A;  2NW8 A;  5HXR A;  2E8I A;  2VQF T;  1KEY A;  2IHR 1;  2WWV A;  1LKX A;  4ZXL A;  2CM0 A;  3C64 A;  3PE0 A;  5AQT B;  4TV9 E;  2XAG B;  5ADX L;  1M7K A;  5JR9 A;  4IDP A;  5LGN B;  3EI0 A;  4HE8 A;  2CE7 A;  2BS3 A;  4TZ4 C;  4OYK A;  4YLH A;  3R84 B;  5JTG A;  2BS4 A;  4TV8 E;  1KFY A;  5KMG P;  4DUY T;  4IST A;  5LG3 A;  4YSX A;  4ASK A;  3E22 E;  3AEE A;  5LGT B;  4GK0 E;  4AI6 A;  3MJX A;  3DP7 A;  3J7Y q;  2V6Y B;  1E2A A;  4JEH B;  3UFE A;  3AVS A;  4OK0 A;  5LYJ E;  4X62 T;  2L9Q A;  2W0G A;  2Y6X A;  1W0A A;  1XNR T;  4J2C A;  1S35 A;  4GYR A;  2JQK A;  2FBW A;  3OKQ A;  3O1H A;  1ZEE A;  4GOU A;  5JDN A;  2DWK A;  3PTR B;  3CX6 B;  5FXZ A;  2CRB A;  3H37 A;  4E7S A;  5JDH A;  3P7I A;  4TWD A;  5C3J A;  3PUA A;  4QHO A;  4JI7 T;  2JQH A;  1HNZ T;  3QNU A;  2C5I T;  2DCF A;  1W9R A;  5FL1 A;  3ZCI A;  3PU8 A;  1WLX A;  3VU7 H;  2H7O A;  3AXJ B;  3ZN0 B;  4DO0 A;  3ONL C;  1L0V A;  4X1Y E;  4WW0 A;  5L2L A;  5F5W A;  2WMN A;  4DMV A;  3WAJ A;  3Q5D A;  3AE7 A;  2V8S V;  2VWA A;  4UEL A;  2AXD S;  2KXP B;  3F31 A;  3AE6 A;  4UF0 A;  3DJB A;  4AQF C;  2A9U A;  4YHH T;  3CWZ B;  3C4W A;  1QLB A;  2UUA T;  1O3X A;  3EAB A;  2JMH A;  2XAH B;  2E2A A;  1OED B;  2L3L A;  4UV8 B;  2E9X A;  3EAM A;  3GWH A;  5HEU A;  5F3J A;  2WU2 A;  2YU1 A;  4ANJ A;  1BR0 A;  1SE7 A;  2KWH A;  4U2Z A;  4C90 A;  4YT0 A;  5JRC B;  3RYH E;  3EDU A;  4IT4 A;  2H3R A;  3RI5 A;  2EHO B;  3A7M A;  4UVA B;  4H63 V;  3UT5 E;  3Q9D A;  4JI6 T;  2HN1 A;  3X1D A;  3ANW B;  5DQW A;  2VVN A;  2LEH A;  4TWH A;  3AAA B;  3L09 A;  3PJA J;  3K3N A;  1XNQ T;  1HR0 T;  2XJ7 A;  4OYJ A;  5TAO A;  1ZOY A;  2CLY B;  2A72 A;  3L39 A;  3G06 A;  4M1P A;  1X9B A;  2QA7 A;  1KNZ A;  1VRB A;  4X64 T;  4DV2 T;  1Z8U A;  2HPL A;  2Y8D A;  4V1A v;  4JBW F;  3KIN B;  2XQ9 A;  1VCS A;  4O4H E;  2MAW A;  4JI8 T;  3N9Q A;  4ADZ A;  5AQH B;  4DV0 T;  2XQY A;  3N9L A;  3ONJ A;  5AQN B;  4K0U A;  3K1S A;  3RH3 A;  3VKH A;  1YQ3 A;  1NWM X;  3HKC E;  1T72 A;  4Z90 A;  3ZT5 A;  5ABF A;  2E5V A;  2E9X D;  2VAS A;  4DBQ A;  2KND A;  3RF1 A;  3UUM A;  5EK2 A;  1OED C;  3I9W A;  2LHR A;  1XDP A;  2BDE A;  4AKL A;  5JH7 E;  5AQF B;  4JYA T;  2CXL A;  3ZC1 A;  4ZS3 A;  1OED E;  4ILC A;  3QC9 A;  3ZLI A;  4ERR A;  3T8O A;  4HWH A;  2YDQ A;  1Y01 A;  2WDQ A;  4IRE A;  4PNI A;  5LBQ B;  2BBJ A;  3AE5 A;  2D5U A;  1FIO A;  4YJ3 E;  2KSR A;  1J5W A;  3AA1 B;  1HNW T;  4ZI7 E;  3HR0 A;  5HXE A;  4GKJ T;  5F8P A;  3RLF F;  2BG9 B;  3MA9 A;  5HXS A;  4JI2 T;  2IML A;  2DLR A;  2W2U A;  3FXD B;  5AQV B;  4ILA A;  3RPU A;  1HG2 A;  4F8H A;  3AE1 A;  4A98 A;  1BR1 A;  3UUN A;  2CLY C;  3HA4 A;  3B57 A;  4F6R C;  4UV9 B;  4G2A A;  4DR7 T;  2V5C A;  1G8X A;  5L3F B;  2DL1 A;  3NZQ A;  3AEF A;  3K8P C;  4U72 A;  2MYS A;  2FUP A;  4IDZ A;  4CN1 A;  5FL0 A;  5L4E A;  4TX5 A;  3EUH A;  5JR9 B;  4HTE A;  3P4S A;  3CQG B;  4HWC A;  5AQS B;  3IF8 B;  4AKG A;  4CI2 B;  3RGL A;  1I94 T;  2DNX A;  1HG5 A;  2NP9 A;  1UX5 A;  2WDV A;  2Q9Q A;  1R8I A;  3N5L A;  5ABG A;  1N34 T;  5HXH A;  3CKD A;  3MAC A;  1WRD A;  1D1C A;  2YIN A;  3UU4 A;  3I1A A;  2ACX A;  1V9D A;  1E1H B;  2FJD A;  2WU5 A;  3EVY A;  5LG4 A;  3BQK A;  3RYF E;  2W4X A;  4ZZB A;  3FZL B;  3SWH A;  4CI3 B;  5HCJ A;  3N9M A;  4LMK A;  2KZ7 B;  5JVD E;  2YOE A;  1I6Z A;  3NKZ A;  3AAI A;  3KV9 A;  3SOL A;  3P50 A;  4H63 H;  4DR5 T;  3IEE A;  3AA6 B;  3C51 A;  2KMF A;  3S4U A;  4KI0 F;  3H3M A;  3I0Q A;  2IUB A;  3HI2 A;  1NAF A;  3UU5 A;  5GON E;  1HX8 A;  1CUN A;  3P4Q A;  2VQE T;  4DR1 T;  3EDV A;  3FZH B;  4GYS A;  4MFR A;  3LG7 A;  1LRZ A;  3D0T A;  4HWD A;  1MMG A;  3ZYM A;  3MKD A; 
#chains in the Genus database with same CATH homology
 3PTR B;  4HN9 A;  2C0S A;  5JDM A;  2ODV A;  2NTX A;  3CX6 B;  5FXZ A;  1MND A;  4UF0 B;  1Y64 B;  2WAU A;  3N9O A;  3H37 A;  4E7S A;  5JDH A;  3P7I A;  5HAX A;  4PK4 A;  1MIW A;  2YK0 A;  3PUA A;  4IE4 A;  5IHY A;  4WBN E;  2LOS A;  4QHO A;  2XUE A;  3CX8 B;  3PUQ A;  2NWB A;  2C5J A;  1YW0 A;  2C5I T;  2DCF A;  4QXH B;  1B7T A;  2Q9Q C;  5EZY E;  2EHO A;  1YKH B;  3ZCI A;  3PU8 A;  2BZB A;  1WLX A;  4ISS A;  4UVC B;  4TN7 B;  3VU7 H;  2H7O A;  2PFV A;  2E9X B;  5FNV E;  3TKL B;  3OYX A;  3K3Q C;  1D1A A;  2YU2 A;  3LFM A;  3M65 A;  3ZN0 B;  4DO0 A;  5AFU L;  2JQQ A;  1D0Y A;  4NUU A;  1YKE B;  4X1Y E;  4WW0 A;  2GK9 A;  5L2L A;  4XBF B;  2WMN A;  2IAK A;  4QX7 B;  3N2O A;  4DMV A;  3WAJ A;  1SHZ C;  4WBO A;  1UX4 A;  2VWA A;  1HFA A;  4UEL A;  2L8K A;  2KXP B;  3FB2 A;  3F31 A;  3KV4 A;  3C50 A;  3ZJ1 A;  4UF0 A;  5CB4 E;  2X66 A;  3DJB A;  4AQF C;  2D0T A;  3MXZ A;  2PJQ A;  4ZHQ E;  5LCY A;  2LJL A;  2XAF B;  2Q9Q D;  3JC6 C;  5JR9 C;  1OXZ A;  2XTL A;  5FXX A;  4EIW A;  3FBZ A;  3CWZ B;  4B6X A;  3VHL A;  3C4W A;  1O3X A;  1WYB A;  5FYM A;  2JMH A;  2KLQ A;  2XAH B;  3KVB A;  1VOM A;  3O1J A;  2BVL A;  4QKN A;  2L3L A;  4UV8 B;  4NUV A;  5FY0 A;  2E9X A;  4X20 E;  3N2G E;  4IE6 A;  4FJO A;  3LK2 B;  5LNK A;  2YEV C;  2LSG A;  2H7V C;  5KDM C;  5LHH B;  3GWH A;  3WI3 A;  3SS1 A;  5F3J A;  5BMV E;  3W15 B;  4O2A E;  2YU1 A;  5JDF A;  4P09 A;  1HF8 A;  4UXN B;  2LSJ A;  4PFO A;  1X79 A;  4H9P C;  3JC6 D;  4OFZ A;  4EXT A;  3I0O A;  3L3P A;  2IC6 A;  4GIW A;  2KWH A;  2V7L A;  5LBM A;  4C90 A;  4HFV A;  4BA9 A;  4U74 A;  5JRC B;  2UXX B;  1S94 A;  3RYH E;  5IYZ E;  1WYC A;  3EDU A;  2VKJ A;  3ONX A;  3V5U A;  5J2T E;  2H3R A;  2NTY A;  5JRE A;  3FXE B;  4QXC B;  2RP4 A;  3ZYL A;  2EHO B;  3HKE E;  4UVA B;  4DVD A;  4H63 V;  3LK3 B;  2LSY A;  4H9S E;  3ZC0 A;  2CWY A;  3HKD E;  3O4X E;  3UT5 E;  3Q9D A;  2A3D A;  2OA5 A;  2ODU A;  3BQL A;  4AKR B;  4H9N C;  3ANW B;  5DQW A;  2LEH A;  5JDG A;  3AAA B;  3L09 A;  4ZOL E;  2DHR A;  2ZM0 A;  1U4Q A;  3K3N A;  3KBT A;  4KMC A;  2EHO C;  3B13 A;  4C91 A;  4OYJ A;  4BJM A;  2K5B B;  5TAO A;  2CLY B;  3O1I A;  2CWO A;  1IZN B;  2A72 A;  4DBR A;  3E08 A;  3KV5 A;  4EOZ B;  2X67 A;  5J1G A;  2VK9 A;  1D0X A;  5FMN A;  5JRC A;  1MIY A;  3RC3 A;  2M67 A;  2LSI A;  4ZI3 C;  3MZK B;  2BVM A;  4M1P A;  4N78 D;  2X9H A;  4AXP A;  2QA7 A;  1KNZ A;  5L3D B;  1T98 A;  1VRB A;  2VB6 A;  4PJJ A;  2V1D B;  3Q5X A;  4G63 A;  3UTK A;  1MMA A;  2QGS A;  4IE0 A;  5CA1 E;  2ES0 A;  2HPL A;  5JDL A;  4CXX A;  3OJA A;  3AA0 B;  4H9O C;  2Y8D A;  4V1A v;  4ZI2 C;  4CXW A;  2K9A A;  4EAH A;  3J9X 1;  3ZMZ B;  2Z6E A;  4KUM B;  1HTJ F;  1HCI A;  2KWI B;  3MK7 C;  4ANJ A;  2ZM2 A;  4IHJ E;  3ANW A;  5LXT E;  3KIN B;  4MLK A;  3N9P A;  1D0Z A;  5EK4 A;  2PG8 A;  3CML A;  4IE7 A;  1LVK A;  2CXF A;  4HEA A;  5LHI B;  2KIN B;  5HWX A;  4O4J E;  2WBL A;  3N2K E;  2C5K T;  2JPF A;  3HKB E;  1H7C A;  2ZMA A;  4O4H E;  5LA6 E;  1FMW A;  2PBI A;  4P0B A;  2WM9 A;  2WMO A;  4IGU A;  4KBM B;  2I59 A;  2E9X C;  2JRK A;  2XHE B;  3AA7 B;  3N9Q A;  2HH7 A;  2LSK A;  4QWN B;  2LHN A;  3CPZ A;  4ADZ A;  5DQV A;  4JLE A;  4X1K E;  4CI1 B;  3WAK A;  4BAY B;  2XQY A;  3FBL A;  1Z0P A;  3GA8 A;  2HPJ A;  4I4T E;  3AAE B;  3ZCJ A;  5DJQ C;  3ZMV B;  3N9L A;  5DAB A;  3CX7 B;  1BR2 A;  4K0U A;  3RH3 A;  2VKH A;  3VKH A;  5L3C B;  2XAJ B;  3NZP A;  3KBU A;  5HWY A;  1EZ3 A;  1NWM X;  1ZKE A;  3LJC A;  3HKC E;  4DMW A;  4FI5 A;  3O9X A;  3IBP A;  3I9Y A;  2V7J A;  2E9X D;  5FP3 A;  4ILU A;  4XZC A;  2VAS A;  5FY1 A;  3ZN1 B;  4DBQ A;  2N9D A;  5L3G B;  3OYZ A;  2X9W A;  2KND A;  3UUM A;  5EK2 A;  3I9W A;  2LHR A;  3C4X A;  5FY7 A;  3RRW A;  4EZH A;  2BDE A;  1MMD A;  2VKD A;  3F2E A;  3C4Z A;  4AKL A;  3OBV E;  5JH7 E;  1G73 A;  3PDY A;  4H9R C;  2X68 A;  2MBG A;  2CXL A;  5HYA A;  5J2U E;  3PUR A;  4L9I A;  3BQI A;  3P8C D;  2LOP A;  3ZC1 A;  4YJ2 E;  3NRY A;  4ZS3 A;  3C98 B;  3QC9 A;  3ETV A;  2CCQ A;  5M4Y A;  1BR4 A;  1MNE A;  4PJL A;  3ZLI A;  4ERR A;  3T8O A;  3ESL A;  2W62 A;  1US7 B;  2MOZ A;  2W61 A;  4PNI A;  1ZHC A;  5LBQ B;  5CA0 E;  5FXW A;  2LT3 A;  5EK3 A;  2D5U A;  1FIO A;  3ZYK A;  3ETU A;  4YJ3 E;  3PU3 A;  2DI4 A;  3ZMS B;  4Z8X A;  5C8Y E;  2VKO A;  2D2S A;  5LJM A;  4UVB B;  4AKH A;  4JUY A;  2Y48 B;  3PUS A;  3AA1 B;  5JQG E;  2RA1 A;  4GK5 E;  3UUX B;  5LJN A;  4BJN A;  4ZI7 E;  2XAQ B;  4QX8 B;  5LOV E;  1BR0 A;  3IHR A;  1AJ3 A;  1OWA A;  4I55 E;  4O4L E;  3N9N A;  1QSD A;  2XAS B;  3LBX B;  2ZM8 A;  5JDQ A;  5E0O A;  3HR0 A;  5HXE A;  2CMR A;  3AVR A;  5F8P A;  4O8S A;  3MA9 A;  4A56 A;  5HXS A;  2LM9 A;  4CXY A;  2DLR A;  2Q9Q B;  2W63 A;  3FXD B;  3HL6 A;  2B1E A;  3KDS E;  2WSS V;  3RPU A;  1HG2 A;  3QUJ A;  4CQI A;  4I50 E;  2IW5 B;  3U78 A;  2V7M A;  1BR1 A;  3UUN A;  2CLY C;  3HA4 A;  2VL8 A;  3B57 A;  3KVA A;  3GMI A;  4MBQ A;  4UV9 B;  4UEM A;  4G2A A;  4WNK A;  4YFS A;  3ZJ2 A;  4F6R C;  2X0L B;  2NW9 A;  4L5G A;  2EHO D;  1G8X A;  3H3A A;  5L3F B;  2SPC A;  3NZQ A;  4IE5 A;  3K8P C;  2D0U A;  4U72 A;  1IJ5 A;  2J1D G;  2LE8 A;  2P9B A;  3E0Z A;  4P0A A;  3RC8 A;  3UUL A;  5LP6 E;  4PK6 A;  2MYS A;  4XAX B;  4IDZ A;  5A1L A;  1FMV A;  4QXB B;  3NRX A;  1LVF A;  2X9Y A;  4EYY R;  2X9X A;  4DND A;  4TX5 A;  4ZI3 D;  3EUH A;  3KV6 A;  1ZV4 X;  5JR9 B;  1SA0 E;  4HTE A;  5FXV A;  3CQG B;  4O2B E;  2CXD A;  3IF8 B;  2NW7 A;  3LBX A;  4AKG A;  1U5P A;  2V7I A;  4KP3 C;  4YHJ A;  4CI2 B;  4MHC A;  4E7Z A;  5LGU B;  2KT9 A;  3K3O A;  3Q2M A;  1WR6 A;  2DNX A;  1KK7 A;  4L0R A;  1HG5 A;  2NP9 A;  1UX5 A;  3BK9 A;  3RKO A;  4ZI2 D;  2Q9Q A;  3N5L A;  2JJ9 A;  2IC9 A;  4UIG A;  4IIJ E;  2N2N A;  3R6N A;  1IJ6 A;  4HKA A;  3ZEF B;  2G0U A;  4ZS2 A;  3ZMU B;  2X51 A;  5HXC A;  5LHG B;  3KFW X;  5HXH A;  3GN5 B;  4X1I E;  5KX5 E;  4OHF A;  3CKD A;  4JEU B;  2DWG A;  2NW8 A;  5HXR A;  2E8I A;  3CVR A;  3MAC A;  4HGA A;  1WRD A;  1YD8 G;  1D1C A;  2YIN A;  3F57 A;  1LKX A;  5L3E B;  3I1A A;  2ACX A;  3SRZ A;  5L3B B;  2NOX A;  1V9D A;  2CM0 A;  3C64 A;  3PE0 A;  3AB3 B;  2UXN B;  1E1H B;  2CEA A;  3V5S A;  3EVY A;  4PK5 A;  5LG4 A;  3RYI E;  3BQK A;  4TV9 E;  3RYF E;  4AQF A;  4EB6 E;  2XAG B;  5ADX L;  3VKG A;  3CQC B;  5JR9 A;  3A5X A;  3SWH A;  4CI3 B;  4PFP A;  5LGN B;  1MMN A;  2WWU A;  3PUG A;  1FEW A;  4HE8 A;  2CE7 A;  4TZ4 C;  4YLH A;  4OYK A;  3R84 B;  3Q5W A;  4PJM A;  3RYC E;  1IAP A;  4PAG A;  4TV8 E;  2A2F X;  3N9M A;  5KMG P;  4IST A;  2W00 A;  4ASK A;  2KZ7 B;  3E22 E;  1D1B A;  5ETW A;  5JVD E;  1HS7 A;  1MIV A;  3AAI A;  2ZLY A;  3KV9 A;  5LGT B;  4GK0 E;  3SOL A;  4AI6 A;  3U3I A;  2CA5 A;  3NBX X;  4H9Q C;  4I43 B;  4H63 H;  3MJX A;  3DP7 A;  3J7Y q;  3GN5 A;  4JEH B;  3UFE A;  3AVS A;  3IEE A;  4TUY E;  3RX6 A;  2N1G A;  3AA6 B;  3C51 A;  2KMF A;  4OK0 A;  5H6Q B;  5LYJ E;  4PW8 A;  3S4U A;  3I0Q A;  3ZMT B;  3HI2 A;  2MTQ A;  3DTO A;  1NAF A;  4MAL A;  2K48 A;  5GON E;  2L9Q A;  2V26 A;  1HX8 A;  1CUN A;  4PJN A;  2JMK A;  2W0G A;  3LK4 2;  2Y6X A;  4AQG A;  3CQX C;  3EDV A;  3RRC A;  1QUU A;  2K24 A;  2V7K A;  4GYS A;  4J2C A;  1S35 A;  4O4I E;  4GYR A;  4MFR A;  3LG7 A;  1LRZ A;  3D0T A;  1UCU A;  5H6R B;  3ZPO A;  1MMG A;  3ZYM A;  3MKD A;  3OKQ A;  3QK6 A;  3O1H A;  1ZEE A;  4CZZ B;  3FHN A;  4GOU A;  4AKI A;  5JDN A;  2DWK A;  4EZ4 A;  4EYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...