2NW8A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
266
structure length
266
Chain Sequence
EGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
total genus 105
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw8A00
5ETWA 2X66A 1ZEEA 2V7MA 2NWBA 2X68A 2NW9A 2D0TA 5EK3A 2NW7A 5EK2A 4U74A 2D0UA 2NW8A 2NOXA 4U72A 1YW0A 2V7KA 2X67A 3BK9A 2V7JA 5EK4A 4PK6A 4PK5A 2V7IA 2V7LA 3E08A 4PW8A 4HKAA
chains in the Genus database with same CATH superfamily
5ETWA 3UU5A 4DMVA 3AAIA 2YKSA 3MACA 1M62A 2VASA 1HS7A 1NEKA 3ZSSA 1VCSA 2LJLA 1EZ3A 1MNEA 1NWMX 1ZEEA 2BKNA 2IC6A 2K48A 3JC6D 3ZJ1A 4YTPA 5LXTE 2X0LB 3H37A 4F8HA 4G63A 4DBRA 3RYIE 3JAFA 4I43B 2HN1A 4GK0E 4O4JE 1MIWA 1IJ6A 3PE0A 4TWHA 4C91A 2CLYB 2Q9QC 2JQKA 2JPFA 2N1GA 2XQ5A 4IE5A 5FY0A 5LG4A 4MLKA 5IHYA 2W66A 3BK9A 5L47A 2LEHA 2CXLA 4L0RA 4ANJA 3EDUA 4IDPA 4ZI2C 3RC3A 5AQFB 2YEVC 2CHNA 1XDPA 3EHZA 3QB5K 4UVBB 1V9DA 4EGWA 2MPKA 1BR4A 2QA7A 3BQKA 3CQCB 3RYFE 5AQHB 2CWOA 4O2BE 1LVKA 5CGMA 1FIOA 3GA8A 3UU4A 1KNZA 4H9SE 4CXWA 4AKRB 4DBQA 4LF6T 2HPJA 2K5BB 1JNRA 3LBXA 3KV5A 3BQLA 5CFBA 4JI3T 3JCFA 5ADXL 3H3AA 4QX7B 2QVAA 5AQMB 3RHWA 2XM1A 5L3CB 2PJQA 3EI0A 5HCJA 3PJAA 1KFYA 4JI0T 1HTJF 4TWDA 4ZZBA 4P1NA 4N78D 2ES0A 2XSBA 5JH7E 1VRBA 2M67A 3KBUA 3KV9A 4UELA 3H3MA 2L3LA 3U78A 3CWZB 5AQOB 1JNZA 4DO0A 4YTNA 2WAUA 5L3FB 2ZM0A 3I0OA 3AE5A 5ABGA 3K3OA 2DCFA 2KSRA 2CEAA 5EZYE 5JR9B 4HFCA 4JI6T 2P9BA 2XJ7A 4QHOA 5LB7B 2FJBA 2BS3A 2I6HA 5E0OA 5AQPB 1LVFA 4U31A 4IIJE 1D0XA 3AAEB 5IYZE 5AQSB 4GKKT 4AI6A 3PUVF 3QUJA 5JREA 2LHRA 4ILUA 3AA1B 5FL1A 4UF0B 3ONXA 5LBQB 1XNQT 3C51A 2V7MA 4FJOA 3FHNA 4HFEA 5J1GA 2IC9A 1WFDA 3B5MA 4JBWF 5AQJB 4K0KT 2DWKA 5HXHA 2ZLYA 3MK7C 3RGLA 3G06A 3P50A 4YLHA 2IW5B 5L3EB 3AE4A 3L8RA 3PUWF 3AVSA 4Z91A 3ZSTA 2C5IT 4IE6A 4EYYR 2E5LT 3D0TA 2LRLA 3RX6A 3ZKRA 2KLQA 1HNZT 1MNDA 5FMNA 1MMGA 2LSKA 2RPAA 3ZJ2A 2B1EA 3FZMB 2CCQA 1KF6A 2KT9A 4MFRA 5F3JA 2WS3A 5LJNA 4X66T 4DV3T 2XAJB 5LHIB 4OYJA 1W0BA 3ONLC 3UU8A 4HE8A 2WM9A 3LBXB 4TNVA 4JI1T 4H9NC 4KHPT 2LSYA 4H63H 1QSDA 1J1JA 3AEGA 3KINB 4OK0A 4UVAB 1Y01A 5AQIB 2BG9E 3I1AA 1IAPA 5FYMA 2Y8DA 4YJ3E 3Q2MA 1T72A 5F5WA 3NKZA 4OX9T 1B7TA 2G0UA 2NW7A 3RF1A 3VR8A 2CA5A 3NZPA 4AQFA 2LOSA 2H7OA 4KX6A 2JQQA 3RYCE 1D0YA 2X9WA 2X0YA 3C4XA 3NRYA 1O3XA 1S35A 5HXEA 2J1DG 4ZS3A 3UUXB 4EV6A 3P4WA 3N2KE 4IGUA 4IDNA 3K3NA 2W4XA 2XQ8A 3C4ZA 4B6XA 2ZM8A 3VRAA 2ZMAA 2VKOA 4DV4T 2V6YB 3A8YC 4DMWA 5HEUA 3AA7B 3I0QA 4EEBA 4EZHA 4B3ST 3AE2A 3E08A 4BJNA 2V5CA 4ISSA 2JIWA 3HR0A 3TLUA 3TKLB 2XAFB 3AE6A 2BBJA 3P4SA 2LE8A 4WYVA 3RRCA 3AEDA 3B57A 4IE7A 4I4TE 2LSJA 3OTOT 3NVOA 4QH5A 1SHZC 5FXXA 3VR9A 4K0UA 4EAHA 5ABEA 4YT0A 4A97A 4KBMB 2E9XC 5EK2A 4LF9T 2WB5A 1W0AA 1WYBA 5LNKA 4GYSA 3LJCA 5DJQC 5AQRB 2JQ9A 2Q9QA 2A3DA 2V7KA 2EHOA 4DVDA 3EUHA 3ETVA 2LHNA 4DUYT 3TLSA 5BMVE 4KUMB 2R6GF 1FEWA 2IMLA 5L3BB 4UF0A 2V7LA 2Q9QB 4Z90A 4JEUB 1ZV4X 4DR6T 3UQ4A 3UULA 3KVBA 3Q9DA 4EXTA 2NP9A 4HWHA 3L09A 4P0AA 3E22E 1UX4A 1ZOYA 3CPZA 4I55E 4ILCA 3M3ZB 5HXRA 1YQ3A 4EIWA 4DV6T 4JYAT 4IDQA 4U7YA 2WU5A 4TUYE 2X9HA 4H9RC 4U2ZA 3IBPA 5DABA 5AQVB 5FXZA 3ZEFB 2C0SA 2HN2A 2NWBA 2VL0A 3PUZF 1D0ZA 1YQ4A 4U2YA 3RI5A 3X1DA 5LHGB 4DV2T 2UXDT 4IL9A 4QXCB 4H63V 4CN4A 1HX8A 2H7VC 3OJAA 4MBQA 4U74A 4DUZT 3LK2B 3RYHE 1UURA 1YW0A 3LK3B 4NIQA 3CQXC 3F31A 3P4QA 1IJ5A 4HWFA 3C4WA 3VU7H 5LGUB 2BBHA 3RC8A 2LM9A 4HFDA 3DJBA 4IE4A 3RKOA 2XAGB 3PUSA 2V1DB 2FBWA 5FKYA 5TAOA 3SFDA 3AE8A 4PFOA 5JDGA 4B3TT 3V5SA 4GKJT 1XMOT 2KWIB 4PJMA 1YKEB 3RQWA 4BA9A 1IBLT 3AB3B 1T7SA 1HF8A 2PBIA 4ISTA 4UXNB 4F6RC 5LG3A 2E5VA 3FZHB 3PUXF 2VQFT 1XNRT 2VVNA 2XM2A 3CMLA 3N9OA 2XPKA 1E2AA 2AE9A 3AE9A 4YXDA 1HCIA 2Q9QD 4PJNA 3RRWA 2LOPA 3B13A 5LOVE 3RIFA 3T1HT 1WRDA 2QRXA 1MMDA 1G8XA 3CX6B 1UX5A 4ZXLA 3F2EA 4DR1T 1BR1A 5LGTB 2XAQB 4ZOLE 3CK6A 5JVDE 4EB6E 2B76A 4QH1A 2XAHB 2L8KA 4EYUA 4JEHB 1BR2A 2OA5A 2BS2A 2MTQA 2WCAA 3AXJB 2MYSA 2IIUA 3GN5A 3OKQA 4YFSA 1LKXA 3Q5DA 5CB4E 4B3MT 4PJLA 3WAKA 3EAMA 4PAGA 1X9BA 4DR3T 4AQGA 2Z6EA 4TWFA 4HWDA 5C2TA 4DV7T 4ILBA 3I9YA 2JMKA 3Q5XA 4DR5T 4CQIA 2WU2A 3VHLA 3AE1A 2LKGA 4LMKA 2JMHA 4G2AA 2UXNB 4KMCA 5AQUB 1Y64B 2JJ9A 3S4UA 2WDRA 2KMFA 5HXCA 1ZHCA 4U3CA 3UU6A 3ZMVB 1HR0T 5HEGA 5KX5E 2UUBT 5CA0E 3FXEB 1X79A 3VKHA 4X65T 4IE0A 3MKDA 4CXYA 1OEDC 1HX1B 2ZM2A 1J5ET 3ZC0A 2WMNA 1QLBA 2ZM6T 2XY8B 2SPCA 2NR4A 2BKPA 2IUBA 2EHOB 3N5LA 4ZI3C 1N34T 2X67A 4LFAT 5JDHA 2YN6A 4NXNT 2IHR1 4CXXA 3ZT5A 2PTFA 4YTMA 4HFIA 3BQIA 5LBMA 4OFZA 2WDVA 2V7JA 2YU2A 5JDLA 2YDRA 5HEJA 3IEEA 2WZIA 4LMJA 2D5UA 4PK6A 2KXPB 3P4PA 4ZEYA 3W15B 3UQ7A 1UGOA 1WCRA 4MALA 5HWYA 4C90A 3EDVA 3IF8B 3T1YT 1E1HB 3HKDE 3LSVA 5LP6E 3CQGB 4GYRA 2WY2A 3PV0F 1HG2A 2CXFA 3P4RA 4AXPA 5ABFA 3ZC1A 4A98A 1VCTA 2XQ9A 1Z8UA 5HYAA 5HWXA 3E0ZA 5JTGA 2E8IA 4AKHA 5KMGP 3TLTA 2DL1A 2C5KT 3KBTA 5CA1E 3RIUC 5LJMA 3ZYMA 5BR8T 2CWYA 3DP7A 2V26A 4BJMA 3T8OA 1DU2A 4V1Av 3AXJA 2FJDA 2HH7A 1SUMB 4PFPA 2MOZA 2UU9T 2BG9B 5H6RB 5IWAT 3M65A 2Y6XA 4PJJA 5LCYA 3KV6A 3AECA 3OYXA 4TN7B 1S94A 3Q5WA 2MAWA 1M7KA 2MBGA 5J0ZA 2YINA 4KI0F 2XHEB 3PDYA 4DR4T 3O1HA 3AE7A 1Z0PA 1LRZA 3ZCJA 2BG9C 2X66A 3PU8A 5C3JA 4GOUA 5GONE 3QK6A 2H3RA 3P8CD 2OV9A 3A5XA 2J4GA 2XQ7A 3HKCE 4HN9A 4DIDB 2NTXA 4O8SA 5KDMC 3LK42 3UUBA 5L3GB 3SS1A 3C64A 2DNXA 3ANWA 4ZI2D 1WLXA 1XMQT 2K24A 4JI4T 3VKGA 4L5GA 2W63A 1W09A 3R6NA 1SE7A 2WBLA 1U4QA 2CHOA 2VK9A 4NUVA 5M4YA 4YHHT 1IBMT 3UT5E 4NUUA 4O4HE 3UFGA 5CJ5A 4DV1T 3PUYF 5L4HA 3PJAJ 1T98A 2IAKA 3K3QC 1D1AA 2UXCT 4CI2B 3JAEA 3R84B 2BDEA 2W00A 3EABA 4U7IA 1HNWT 4OYKA 3K8PC 4IT4A 2VQET 2LKHA 5C8YE 5AQQB 5LHHB 3O1IA 4HGAA 1UCUA 1D1CA 4NXMT 5FVKA 2OLTA 4HKAA 5HEOA 5H6QB 3HI2A 4QX8B 2YOEA 3L3PA 1US7B 4O4LE 5FY1A 3UFEA 5AQLB 4YSXA 2N9DA 2W61A 2W67A 3ZMSB 4IDZA 3U3IA 3ZN0B 3ZYLA 5HCMA 4X64T 2FJAA 2UXBT 1ZP0A 2GK9A 2EHOD 2XQAA 3PUAA 4QH4A 3KVAA 2NW9A 1L0VA 4QKNA 2IDOB 5EK3A 2YDSA 3OPCA 2J62A 3J9X1 4LF7T 5FP3A 2X51A 1IBKT 3N9MA 2D9DA 2H88A 4AKGA 2X0HA 2YU1A 3QNUA 2W0GA 2V6YA 3ESLA 5FXVA 3ZLIA 1KK7A 4KHZF 3FXDB 2V8SV 2XSAA 2HHHT 4GK5E 1AJ3A 4HFVA 1NAFA 3NWIA 4P09A 2CXDA 4LF8T 4ILAA 1HNXT 3RPUA 2J47A 4O2AE 3GN5B 1J5WA 2D2SA 1QUUA 2XASB 2CRBA 1G73A 4KP3C 3VRBA 2XUEA 2VVSA 1WYCA 2CM0A 2EHOC 4Q25A 2AXDS 3C98B 4X5TA 4HWCA 3PUGA 3EVYA 5ABHA 4X62T 3IHRA 4CI1B 2X9YA 3RIAA 5FVLA 1FMWA 4A5XA 1YKHB 2LM2A 2DHRA 2HPLA 2NOXA 2WDQA 3QB5A 4MHCA 2LRKA 2CBIA 2I59A 2ACZA 2VKDA 2WSSV 2BZBA 1MIYA 2E9XA 2QYWA 3HA4A 3ONJA 4U33A 3AA6B 5JDNA 3KFWX 3MXZA 3JADA 3PTRB 1IZNB 2ACXA 4WBNE 3V5UA 2WP9A 5LMNT 3GMIA 4JI7T 3CKDA 3HKEE 4JV5T 3UTKA 4PK5A 4CI3B 2CPTA 5JDQA 4H9PC 1XWMA 2CBJA 2XZEA 4QXBB 2A9UA 2YDQA 3OBVE 4JLEA 4COFA 5JQGE 4PW8A 5DQWA 4P0BA 5J2TE 3ETUA 2KNDA 4DR7T 1CHUA 1WR0A 5L3DB 4LF4T 2DI4A 1U5PA 4I50E 4EZ4A 4CZZB 3AEAA 5JRCB 3LDQB 2LT3A 2X68A 3AVRA 3UUMA 4YHJA 4CN1A 4UVCB 2BVMA 2H89A 4DNDA 3MA9A 3N9QA 4UV9B 3SWHA 1T8BA 2RP4A 4AISA 2XQ4A 4H9OC 3UUNA 3I9WA 4YJ2E 5A1LA 2X9XA 4XAXB 4AQYT 4XBFB 1MMNA 5FNVE 4ZI7E 3AA0B 4L9IA 5IUXA 4NPPA 4DR2T 4IHJE 4WW0A 3NZQA 5F8PA 2VWAA 2WQYA 3RLFF 4ASKA 5HAXA 4LF5T 3IA3A 1UUSA 4HTEA 3AEEA 4ZS2A 4O4IE 4DV5T 2UUAT 3HL6A 2V7IA 4BAYB 2JQHA 2ODVA 2CLYC 2VL8A 1NENA 4WNKA 3ZMZB 3C50A 4TV8E 5JDFA 3TLVA 2NTYA 2E9XD 1WR6A 1OEDA 3NRXA 4IREA 3HKBE 4TNWA 3FZKB 4UEMA 3AEBA 3SRZA 4YSYA 5JDMA 3CVRA 3N2GE 4AKLA 4X1YE 5JR9C 4ADZA 3ZCIA 2FUPA 3ZN1B 4X20E 2CE7A 4ZZCA 4AIUA 5LA6E 3RH3A 1OXZA 3CX8B 2LLYA 2NW8A 4U72A 3WI3A 2VB6A 4DV0T 1KEYA 2C5JA 5HXSA 5AQKB 2K9AA 3CIRA 4IL4A 1MIVA 2A2FX 1SA0E 3L39A 3J7Yq 2V6XA 4LFCT 2XQYA 3SFEA 3KDSE 3UU3A 3ANWB 5EK4A 1HFAA 4FI5A 3MJXA 5LGNB 2JRKA 3P7IA 1ZKEA 4EEDA 4AKIA 2K3WA 3JC6C 2I0MA 4QXHB 3O9XA 1I94T 1YD8G 3RKGA 1FJGT 2W2UA 2VURA 3N9PA 4HWIB 2CMRA 2VKJA 2WWUA 4TZ4C 4XZCA 3ZT7A 5AFUL 3GWHA 4TV9E 1N36T 1CUNA 4IDOA 3AAAB 3FZFB 1GQEA 2YK0A 4PK4A 2M6IA 3OYZA 2VKHA 2W62A 5DQVA 3FB2A 3RIUA 3ZYKA 3OVUA 1OEDE 5LYJE 2WWVA 4UR9A 3ZPOA 4QWNB 1H7CA 4J2CA 2DLRA 3O4XE 3CX7B 2BG9A 4M1PA 2BKOA 1R8IA 2KINB 3SOLA 3ZMUB 1OWAA 5L2LA 3N9NA 5FXWA 3N2OA 2KZ7B 3PURA 4WZXA 2XTLA 1MMAA 4HFHA 3FBZA 4AQFC 5J2UE 4ZI3D 5JR9A 1HG5A 3K1SA 2XQ3A 2UUCT 2WMOA 3KV4A 3FBLA 4H9QC 5L4EA 1BR0A 2M6BA 2PG8A 2DWGA 4GIWA 4UV8B 1YXRA 4E7ZA 1OEDB 3NBXX 4JI5T 4E7SA 5ABFB 3ABVA 2WZHA 2Y48B 2L9QA 3LFMA 2BVLA 4I0UA 1W9RA 4TX5A 5FY7A 1XZYA 4WBOA 4LMLA 4JI2T 4ZHQE 3AE3A 4JUYA 3WAJA 3DTOA 1N32T 2N2NA 4HEAA 4EOZB 1UK5A 4PNIA 2V5DA 4UIGA 2XQ6A 3ZT6A 4YSZA 1D1BA 5LMUT 5JRCA 3FZLB 2KWHA 4OHFA 1VOMA 2D0TA 4X1IE 5AQTB 4LFBT 3PUQA 4A56A 2ODUA 5HEHA 2E2AA 1N33T 3TLWA 3O1JA 2D0UA 2UXXB 3QOFA 5FL0A 2BS4A 3RQUA 4YY3T 1KNPA 2RA1A 1FMVA 2A72A 5AQNB 3LG7A 4ERRA 3ZMTB 4X1KE 3QC9A 2F4VT 2FJEA 4Z8XA 1E7PA 3PU3A 1I6ZA 2PFVA 2QGSA 2E9XB 3F57A 4JI8T 3A7MA 4HFBA 2LSGA 3N9LA 5KXJA 3MZKB 3Q5EA 5AQGB 2LSIA 3AEFA 4B3RT 4CN6A 1KNRA 1XDOA
chains in the Genus database with same CATH topology
5ETWA 4DMVA 3AAIA 3MACA 2VASA 1HS7A 2LJLA 1EZ3A 1MNEA 1NWMX 1ZEEA 2IC6A 2K48A 3JC6D 3ZJ1A 5LHGB 2X0LB 3H37A 4G63A 4DBRA 3RYIE 4I43B 4GK0E 4O4JE 1MIWA 1IJ6A 3PE0A 4C91A 2CLYB 2Q9QC 2JPFA 2N1GA 4IE5A 5FY0A 5LG4A 4MLKA 5IHYA 3BK9A 2LEHA 2CXLA 4L0RA 4ANJA 3EDUA 4ZI2C 3RC3A 2YEVC 4UVBB 1V9DA 1BR4A 2QA7A 3BQKA 3CQCB 3RYFE 2CWOA 4O2BE 1LVKA 1FIOA 3GA8A 1KNZA 4AKHA 4H9SE 4CXWA 4AKRB 4DBQA 2HPJA 2K5BB 3LBXA 3KV5A 3BQLA 5ADXL 3H3AA 4QX7B 5L3CB 2PJQA 1HTJF 4N78D 2ES0A 1VRBA 2M67A 3KBUA 3KV9A 4UELA 3U78A 2L3LA 4DO0A 3CWZB 2WAUA 5L3FB 2ZM0A 3I0OA 3K3OA 2DCFA 5EZYE 2CEAA 5JR9B 2P9BA 4QHOA 5E0OA 1LVFA 4IIJE 1D0XA 3AAEB 5IYZE 4AI6A 3QUJA 5JREA 2LHRA 4ILUA 3AA1B 4UF0B 3ONXA 5LBQB 3C51A 2V7MA 4FJOA 3FHNA 2IC9A 2DWKA 5HXHA 2ZLYA 3MK7C 5L3EB 4YLHA 2IW5B 3AVSA 2C5IT 4IE6A 4EYYR 3D0TA 3RX6A 2KLQA 1MNDA 5FMNA 1MMGA 2LSKA 3ZJ2A 2B1EA 2CCQA 2KT9A 4MFRA 5F3JA 5LJNA 2XAJB 5LHIB 4OYJA 4HE8A 2WM9A 3LBXB 4H9NC 2LSYA 4H63H 1QSDA 3KINB 4OK0A 4UVAB 3I1AA 1IAPA 5FYMA 2Y8DA 4YJ3E 3Q2MA 1B7TA 2G0UA 2NW7A 4AQFA 2CA5A 3NZPA 2LOSA 2H7OA 2JQQA 3RYCE 1D0YA 2X9WA 3C4XA 3NRYA 1O3XA 1S35A 5HXEA 2J1DG 4ZS3A 3UUXB 3N2KE 4IGUA 3K3NA 3C4ZA 4B6XA 2ZM8A 2ZMAA 2VKOA 4DMWA 4EZHA 3AA7B 3I0QA 3E08A 4BJNA 4ISSA 3HR0A 3TKLB 2XAFB 2LE8A 3RRCA 3B57A 4IE7A 4I4TE 2LSJA 1SHZC 5FXXA 4K0UA 4EAHA 4KBMB 2E9XC 5EK2A 1WYBA 5LNKA 4GYSA 3LJCA 5DJQC 2Q9QA 2A3DA 2V7KA 2EHOA 4DVDA 3EUHA 3ETVA 2LHNA 5BMVE 4KUMB 1FEWA 5L3BB 4UF0A 2V7LA 2Q9QB 4JEUB 1ZV4X 3UULA 4EXTA 3KVBA 3Q9DA 2NP9A 4P0AA 3L09A 3E22E 1UX4A 3CPZA 4I55E 5HXRA 4EIWA 5DABA 5LXTE 4TUYE 2X9HA 4H9RC 3IBPA 5FXZA 3ZEFB 2C0SA 2NWBA 1D0ZA 4QXCB 4H63V 1HX8A 2H7VC 3OJAA 4MBQA 4U74A 3LK2B 3RYHE 1YW0A 3LK3B 3CQXC 3F31A 1IJ5A 5LGUB 3C4WA 3VU7H 3RC8A 2LM9A 3DJBA 4IE4A 3RKOA 2XAGB 3PUSA 2V1DB 5TAOA 5JDGA 4PFOA 3V5SA 2KWIB 4PJMA 1YKEB 4BA9A 3AB3B 1HF8A 2PBIA 4ISTA 4UXNB 4F6RC 3CMLA 3N9OA 1HCIA 2Q9QD 4PJNA 3RRWA 2LOPA 3B13A 5LOVE 1WRDA 1MMDA 1G8XA 3CX6B 1UX5A 3F2EA 1BR1A 5LGTB 2XAQB 4ZOLE 5JVDE 4EB6E 4EYUA 2XAHB 2L8KA 4JEHB 1BR2A 2MTQA 2OA5A 2MYSA 3GN5A 3OKQA 4YFSA 5CB4E 1LKXA 4PJLA 3WAKA 4PAGA 2Z6EA 3I9YA 2JMKA 3Q5XA 4CQIA 3VHLA 2JMHA 4G2AA 2UXNB 4KMCA 1Y64B 2JJ9A 3S4UA 2KMFA 5HXCA 1ZHCA 3ZMVB 5KX5E 5CA0E 3FXEB 1X79A 3VKHA 4IE0A 3MKDA 4CXYA 2ZM2A 3ZC0A 2WMNA 2SPCA 2EHOB 3N5LA 4ZI3C 2X67A 5JDHA 4CXXA 3BQIA 5LBMA 4OFZA 2V7JA 2YU2A 5JDLA 3IEEA 4PK6A 2D5UA 2KXPB 3W15B 5HWYA 4MALA 4C90A 3EDVA 3IF8B 1E1HB 3HKDE 5LP6E 3CQGB 4GYRA 1HG2A 2CXFA 4AXPA 3ZC1A 5HWXA 5HYAA 3E0ZA 2E8IA 5KMGP 5CA1E 2C5KT 3KBTA 5LJMA 3ZYMA 2CWYA 3DP7A 2V26A 4BJMA 3T8OA 4V1Av 2HH7A 4PFPA 2MOZA 5H6RB 3M65A 2Y6XA 4PJJA 5LCYA 3KV6A 3OYXA 4TN7B 1S94A 3Q5WA 2MBGA 2YINA 2XHEB 3PDYA 3O1HA 1Z0PA 1LRZA 3ZCJA 2X66A 3PU8A 4GOUA 5GONE 3QK6A 2H3RA 3P8CD 3A5XA 3HKCE 4HN9A 2NTXA 4O8SA 5KDMC 3LK42 5L3GB 3SS1A 3C64A 2DNXA 3ANWA 4ZI2D 1WLXA 3VKGA 2K24A 4L5GA 2W63A 3R6NA 2WBLA 1U4QA 4NUVA 2VK9A 5M4YA 3UT5E 4NUUA 4O4HE 1T98A 2IAKA 3K3QC 1D1AA 4CI2B 3R84B 2BDEA 2W00A 4OYKA 3K8PC 5C8YE 5LHHB 3O1IA 4HGAA 1UCUA 1D1CA 4HKAA 5H6QB 3HI2A 4QX8B 3L3PA 1US7B 4O4LE 5FY1A 3UFEA 2N9DA 2W61A 3ZYLA 3ZMSB 4IDZA 3ZN0B 2GK9A 2NW9A 2EHOD 3PUAA 3KVAA 4QKNA 5EK3A 3J9X1 5FP3A 2X51A 3N9MA 4AKGA 2YU1A 2W0GA 3ESLA 5FXVA 3ZLIA 1KK7A 3FXDB 4GK5E 1AJ3A 4HFVA 1NAFA 4P09A 2CXDA 3RPUA 4O2AE 3GN5B 2D2SA 1QUUA 2XASB 1G73A 4KP3C 2XUEA 1WYCA 2CM0A 2EHOC 3C98B 3PUGA 3EVYA 3IHRA 4CI1B 2X9YA 1FMWA 1YKHB 2NOXA 2DHRA 2HPLA 4MHCA 5A1LA 4AQGA 2VKDA 2I59A 2WSSV 5LYJE 2BZBA 1MIYA 2E9XA 3HA4A 3AA6B 5JDNA 3KFWX 3MXZA 3PTRB 1IZNB 2ACXA 4WBNE 3V5UA 3GMIA 3CKDA 3HKEE 3UTKA 4PK5A 4CI3B 5JDQA 4H9PC 4QXBB 3OBVE 5JQGE 4JLEA 5J2TE 4PW8A 5DQWA 4P0BA 3ETUA 2KNDA 5L3DB 2DI4A 1U5PA 4I50E 4EZ4A 4CZZB 5JRCB 2LT3A 2X68A 3AVRA 3UUMA 4YHJA 4UVCB 2BVMA 4DNDA 3MA9A 3N9QA 4UV9B 3SWHA 2RP4A 4H9OC 3UUNA 3I9WA 4YJ2E 4XBFB 2X9XA 4XAXB 1MMNA 5FNVE 4ZI7E 3AA0B 4L9IA 4IHJE 4WW0A 3NZQA 5F8PA 2VWAA 4ASKA 5HAXA 4HTEA 4ZS2A 4O4IE 3HL6A 2V7IA 4BAYB 2ODVA 2CLYC 2VL8A 4WNKA 3ZMZB 3C50A 4TV8E 5JDFA 2NTYA 2E9XD 1WR6A 3NRXA 5JH7E 3HKBE 3SRZA 4UEMA 5JDMA 3CVRA 3N2GE 4AKLA 4X1YE 5JR9C 4ADZA 3ZCIA 3ZN1B 4X20E 2CE7A 5LA6E 3RH3A 1OXZA 3CX8B 2NW8A 4U72A 3WI3A 2VB6A 2C5JA 5HXSA 2K9AA 1MIVA 2A2FX 1SA0E 3J7Yq 2XQYA 3KDSE 3ANWB 5EK4A 1HFAA 4FI5A 3MJXA 5LGNB 2JRKA 3P7IA 1ZKEA 4AKIA 3JC6C 4QXHB 1YD8G 3N9PA 4TZ4C 2CMRA 2VKJA 2WWUA 4XZCA 5AFUL 3GWHA 4TV9E 1CUNA 3AAAB 4PK4A 2YK0A 3OYZA 2VKHA 2W62A 5DQVA 3FB2A 3ZYKA 3ZPOA 4QWNB 1H7CA 4J2CA 2DLRA 3O4XE 3CX7B 4M1PA 2KINB 3SOLA 3ZMUB 1OWAA 5L2LA 3N9NA 5FXWA 3N2OA 2KZ7B 3PURA 4AQFC 2XTLA 1MMAA 5J2UE 3FBZA 4ZI3D 5JR9A 1HG5A 2WMOA 3KV4A 3FBLA 4H9QC 1BR0A 2PG8A 4GIWA 2DWGA 4UV8B 4E7ZA 3NBXX 4E7SA 3U3IA 3LFMA 2Y48B 2L9QA 5J1GA 2BVLA 4TX5A 4ZHQE 5FY7A 4WBOA 3WAJA 4JUYA 3DTOA 2N2NA 4HEAA 4EOZB 4PNIA 4UIGA 1D1BA 5JRCA 2KWHA 4OHFA 1VOMA 2D0TA 4X1IE 3PUQA 4A56A 2ODUA 3O1JA 2D0UA 2UXXB 1FMVA 2RA1A 2A72A 3LG7A 4ERRA 3ZMTB 4X1KE 3QC9A 4Z8XA 3PU3A 2PFVA 2QGSA 2E9XB 3F57A 2LSGA 3N9LA 3MZKB 2LSIA 3O9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETW A;  2X66 A;  1ZEE A;  2V7M A;  2NWB A;  2X68 A;  2NW9 A;  2D0T A;  5EK3 A;  2NW7 A;  5EK2 A;  4U74 A;  2D0U A;  2NW8 A;  2NOX A;  4U72 A;  1YW0 A;  2V7K A;  2X67 A;  3BK9 A;  2V7J A;  5EK4 A;  4PK6 A;  4PK5 A;  2V7I A;  2V7L A;  3E08 A;  4PW8 A;  4HKA A; 
#chains in the Genus database with same CATH topology
 5ETW A;  3UU5 A;  4DMV A;  3AAI A;  2YKS A;  3MAC A;  1M62 A;  2VAS A;  1HS7 A;  1NEK A;  3ZSS A;  1VCS A;  2LJL A;  1EZ3 A;  1MNE A;  1NWM X;  1ZEE A;  2BKN A;  2IC6 A;  2K48 A;  3JC6 D;  3ZJ1 A;  4YTP A;  5LXT E;  2X0L B;  3H37 A;  4F8H A;  4G63 A;  4DBR A;  3RYI E;  3JAF A;  4I43 B;  2HN1 A;  4GK0 E;  4O4J E;  1MIW A;  1IJ6 A;  3PE0 A;  4TWH A;  4C91 A;  2CLY B;  2Q9Q C;  2JQK A;  2JPF A;  2N1G A;  2XQ5 A;  4IE5 A;  5FY0 A;  5LG4 A;  4MLK A;  5IHY A;  2W66 A;  3BK9 A;  5L47 A;  2LEH A;  2CXL A;  4L0R A;  4ANJ A;  3EDU A;  4IDP A;  4ZI2 C;  3RC3 A;  5AQF B;  2YEV C;  2CHN A;  1XDP A;  3EHZ A;  3QB5 K;  4UVB B;  1V9D A;  4EGW A;  2MPK A;  1BR4 A;  2QA7 A;  3BQK A;  3CQC B;  3RYF E;  5AQH B;  2CWO A;  4O2B E;  1LVK A;  5CGM A;  1FIO A;  3GA8 A;  3UU4 A;  1KNZ A;  4H9S E;  4CXW A;  4AKR B;  4DBQ A;  4LF6 T;  2HPJ A;  2K5B B;  1JNR A;  3LBX A;  3KV5 A;  3BQL A;  5CFB A;  4JI3 T;  3JCF A;  5ADX L;  3H3A A;  4QX7 B;  2QVA A;  5AQM B;  3RHW A;  2XM1 A;  5L3C B;  2PJQ A;  3EI0 A;  5HCJ A;  3PJA A;  1KFY A;  4JI0 T;  1HTJ F;  4TWD A;  4ZZB A;  4P1N A;  4N78 D;  2ES0 A;  2XSB A;  5JH7 E;  1VRB A;  2M67 A;  3KBU A;  3KV9 A;  4UEL A;  3H3M A;  2L3L A;  3U78 A;  3CWZ B;  5AQO B;  1JNZ A;  4DO0 A;  4YTN A;  2WAU A;  5L3F B;  2ZM0 A;  3I0O A;  3AE5 A;  5ABG A;  3K3O A;  2DCF A;  2KSR A;  2CEA A;  5EZY E;  5JR9 B;  4HFC A;  4JI6 T;  2P9B A;  2XJ7 A;  4QHO A;  5LB7 B;  2FJB A;  2BS3 A;  2I6H A;  5E0O A;  5AQP B;  1LVF A;  4U31 A;  4IIJ E;  1D0X A;  3AAE B;  5IYZ E;  5AQS B;  4GKK T;  4AI6 A;  3PUV F;  3QUJ A;  5JRE A;  2LHR A;  4ILU A;  3AA1 B;  5FL1 A;  4UF0 B;  3ONX A;  5LBQ B;  1XNQ T;  3C51 A;  2V7M A;  4FJO A;  3FHN A;  4HFE A;  5J1G A;  2IC9 A;  1WFD A;  3B5M A;  4JBW F;  5AQJ B;  4K0K T;  2DWK A;  5HXH A;  2ZLY A;  3MK7 C;  3RGL A;  3G06 A;  3P50 A;  4YLH A;  2IW5 B;  5L3E B;  3AE4 A;  3L8R A;  3PUW F;  3AVS A;  4Z91 A;  3ZST A;  2C5I T;  4IE6 A;  4EYY R;  2E5L T;  3D0T A;  2LRL A;  3RX6 A;  3ZKR A;  2KLQ A;  1HNZ T;  1MND A;  5FMN A;  1MMG A;  2LSK A;  2RPA A;  3ZJ2 A;  2B1E A;  3FZM B;  2CCQ A;  1KF6 A;  2KT9 A;  4MFR A;  5F3J A;  2WS3 A;  5LJN A;  4X66 T;  4DV3 T;  2XAJ B;  5LHI B;  4OYJ A;  1W0B A;  3ONL C;  3UU8 A;  4HE8 A;  2WM9 A;  3LBX B;  4TNV A;  4JI1 T;  4H9N C;  4KHP T;  2LSY A;  4H63 H;  1QSD A;  1J1J A;  3AEG A;  3KIN B;  4OK0 A;  4UVA B;  1Y01 A;  5AQI B;  2BG9 E;  3I1A A;  1IAP A;  5FYM A;  2Y8D A;  4YJ3 E;  3Q2M A;  1T72 A;  5F5W A;  3NKZ A;  4OX9 T;  1B7T A;  2G0U A;  2NW7 A;  3RF1 A;  3VR8 A;  2CA5 A;  3NZP A;  4AQF A;  2LOS A;  2H7O A;  4KX6 A;  2JQQ A;  3RYC E;  1D0Y A;  2X9W A;  2X0Y A;  3C4X A;  3NRY A;  1O3X A;  1S35 A;  5HXE A;  2J1D G;  4ZS3 A;  3UUX B;  4EV6 A;  3P4W A;  3N2K E;  4IGU A;  4IDN A;  3K3N A;  2W4X A;  2XQ8 A;  3C4Z A;  4B6X A;  2ZM8 A;  3VRA A;  2ZMA A;  2VKO A;  4DV4 T;  2V6Y B;  3A8Y C;  4DMW A;  5HEU A;  3AA7 B;  3I0Q A;  4EEB A;  4EZH A;  4B3S T;  3AE2 A;  3E08 A;  4BJN A;  2V5C A;  4ISS A;  2JIW A;  3HR0 A;  3TLU A;  3TKL B;  2XAF B;  3AE6 A;  2BBJ A;  3P4S A;  2LE8 A;  4WYV A;  3RRC A;  3AED A;  3B57 A;  4IE7 A;  4I4T E;  2LSJ A;  3OTO T;  3NVO A;  4QH5 A;  1SHZ C;  5FXX A;  3VR9 A;  4K0U A;  4EAH A;  5ABE A;  4YT0 A;  4A97 A;  4KBM B;  2E9X C;  5EK2 A;  4LF9 T;  2WB5 A;  1W0A A;  1WYB A;  5LNK A;  4GYS A;  3LJC A;  5DJQ C;  5AQR B;  2JQ9 A;  2Q9Q A;  2A3D A;  2V7K A;  2EHO A;  4DVD A;  3EUH A;  3ETV A;  2LHN A;  4DUY T;  3TLS A;  5BMV E;  4KUM B;  2R6G F;  1FEW A;  2IML A;  5L3B B;  4UF0 A;  2V7L A;  2Q9Q B;  4Z90 A;  4JEU B;  1ZV4 X;  4DR6 T;  3UQ4 A;  3UUL A;  3KVB A;  3Q9D A;  4EXT A;  2NP9 A;  4HWH A;  3L09 A;  4P0A A;  3E22 E;  1UX4 A;  1ZOY A;  3CPZ A;  4I55 E;  4ILC A;  3M3Z B;  5HXR A;  1YQ3 A;  4EIW A;  4DV6 T;  4JYA T;  4IDQ A;  4U7Y A;  2WU5 A;  4TUY E;  2X9H A;  4H9R C;  4U2Z A;  3IBP A;  5DAB A;  5AQV B;  5FXZ A;  3ZEF B;  2C0S A;  2HN2 A;  2NWB A;  2VL0 A;  3PUZ F;  1D0Z A;  1YQ4 A;  4U2Y A;  3RI5 A;  3X1D A;  5LHG B;  4DV2 T;  2UXD T;  4IL9 A;  4QXC B;  4H63 V;  4CN4 A;  1HX8 A;  2H7V C;  3OJA A;  4MBQ A;  4U74 A;  4DUZ T;  3LK2 B;  3RYH E;  1UUR A;  1YW0 A;  3LK3 B;  4NIQ A;  3CQX C;  3F31 A;  3P4Q A;  1IJ5 A;  4HWF A;  3C4W A;  3VU7 H;  5LGU B;  2BBH A;  3RC8 A;  2LM9 A;  4HFD A;  3DJB A;  4IE4 A;  3RKO A;  2XAG B;  3PUS A;  2V1D B;  2FBW A;  5FKY A;  5TAO A;  3SFD A;  3AE8 A;  4PFO A;  5JDG A;  4B3T T;  3V5S A;  4GKJ T;  1XMO T;  2KWI B;  4PJM A;  1YKE B;  3RQW A;  4BA9 A;  1IBL T;  3AB3 B;  1T7S A;  1HF8 A;  2PBI A;  4IST A;  4UXN B;  4F6R C;  5LG3 A;  2E5V A;  3FZH B;  3PUX F;  2VQF T;  1XNR T;  2VVN A;  2XM2 A;  3CML A;  3N9O A;  2XPK A;  1E2A A;  2AE9 A;  3AE9 A;  4YXD A;  1HCI A;  2Q9Q D;  4PJN A;  3RRW A;  2LOP A;  3B13 A;  5LOV E;  3RIF A;  3T1H T;  1WRD A;  2QRX A;  1MMD A;  1G8X A;  3CX6 B;  1UX5 A;  4ZXL A;  3F2E A;  4DR1 T;  1BR1 A;  5LGT B;  2XAQ B;  4ZOL E;  3CK6 A;  5JVD E;  4EB6 E;  2B76 A;  4QH1 A;  2XAH B;  2L8K A;  4EYU A;  4JEH B;  1BR2 A;  2OA5 A;  2BS2 A;  2MTQ A;  2WCA A;  3AXJ B;  2MYS A;  2IIU A;  3GN5 A;  3OKQ A;  4YFS A;  1LKX A;  3Q5D A;  5CB4 E;  4B3M T;  4PJL A;  3WAK A;  3EAM A;  4PAG A;  1X9B A;  4DR3 T;  4AQG A;  2Z6E A;  4TWF A;  4HWD A;  5C2T A;  4DV7 T;  4ILB A;  3I9Y A;  2JMK A;  3Q5X A;  4DR5 T;  4CQI A;  2WU2 A;  3VHL A;  3AE1 A;  2LKG A;  4LMK A;  2JMH A;  4G2A A;  2UXN B;  4KMC A;  5AQU B;  1Y64 B;  2JJ9 A;  3S4U A;  2WDR A;  2KMF A;  5HXC A;  1ZHC A;  4U3C A;  3UU6 A;  3ZMV B;  1HR0 T;  5HEG A;  5KX5 E;  2UUB T;  5CA0 E;  3FXE B;  1X79 A;  3VKH A;  4X65 T;  4IE0 A;  3MKD A;  4CXY A;  1OED C;  1HX1 B;  2ZM2 A;  1J5E T;  3ZC0 A;  2WMN A;  1QLB A;  2ZM6 T;  2XY8 B;  2SPC A;  2NR4 A;  2BKP A;  2IUB A;  2EHO B;  3N5L A;  4ZI3 C;  1N34 T;  2X67 A;  4LFA T;  5JDH A;  2YN6 A;  4NXN T;  2IHR 1;  4CXX A;  3ZT5 A;  2PTF A;  4YTM A;  4HFI A;  3BQI A;  5LBM A;  4OFZ A;  2WDV A;  2V7J A;  2YU2 A;  5JDL A;  2YDR A;  5HEJ A;  3IEE A;  2WZI A;  4LMJ A;  2D5U A;  4PK6 A;  2KXP B;  3P4P A;  4ZEY A;  3W15 B;  3UQ7 A;  1UGO A;  1WCR A;  4MAL A;  5HWY A;  4C90 A;  3EDV A;  3IF8 B;  3T1Y T;  1E1H B;  3HKD E;  3LSV A;  5LP6 E;  3CQG B;  4GYR A;  2WY2 A;  3PV0 F;  1HG2 A;  2CXF A;  3P4R A;  4AXP A;  5ABF A;  3ZC1 A;  4A98 A;  1VCT A;  2XQ9 A;  1Z8U A;  5HYA A;  5HWX A;  3E0Z A;  5JTG A;  2E8I A;  4AKH A;  5KMG P;  3TLT A;  2DL1 A;  2C5K T;  3KBT A;  5CA1 E;  3RIU C;  5LJM A;  3ZYM A;  5BR8 T;  2CWY A;  3DP7 A;  2V26 A;  4BJM A;  3T8O A;  1DU2 A;  4V1A v;  3AXJ A;  2FJD A;  2HH7 A;  1SUM B;  4PFP A;  2MOZ A;  2UU9 T;  2BG9 B;  5H6R B;  5IWA T;  3M65 A;  2Y6X A;  4PJJ A;  5LCY A;  3KV6 A;  3AEC A;  3OYX A;  4TN7 B;  1S94 A;  3Q5W A;  2MAW A;  1M7K A;  2MBG A;  5J0Z A;  2YIN A;  4KI0 F;  2XHE B;  3PDY A;  4DR4 T;  3O1H A;  3AE7 A;  1Z0P A;  1LRZ A;  3ZCJ A;  2BG9 C;  2X66 A;  3PU8 A;  5C3J A;  4GOU A;  5GON E;  3QK6 A;  2H3R A;  3P8C D;  2OV9 A;  3A5X A;  2J4G A;  2XQ7 A;  3HKC E;  4HN9 A;  4DID B;  2NTX A;  4O8S A;  5KDM C;  3LK4 2;  3UUB A;  5L3G B;  3SS1 A;  3C64 A;  2DNX A;  3ANW A;  4ZI2 D;  1WLX A;  1XMQ T;  2K24 A;  4JI4 T;  3VKG A;  4L5G A;  2W63 A;  1W09 A;  3R6N A;  1SE7 A;  2WBL A;  1U4Q A;  2CHO A;  2VK9 A;  4NUV A;  5M4Y A;  4YHH T;  1IBM T;  3UT5 E;  4NUU A;  4O4H E;  3UFG A;  5CJ5 A;  4DV1 T;  3PUY F;  5L4H A;  3PJA J;  1T98 A;  2IAK A;  3K3Q C;  1D1A A;  2UXC T;  4CI2 B;  3JAE A;  3R84 B;  2BDE A;  2W00 A;  3EAB A;  4U7I A;  1HNW T;  4OYK A;  3K8P C;  4IT4 A;  2VQE T;  2LKH A;  5C8Y E;  5AQQ B;  5LHH B;  3O1I A;  4HGA A;  1UCU A;  1D1C A;  4NXM T;  5FVK A;  2OLT A;  4HKA A;  5HEO A;  5H6Q B;  3HI2 A;  4QX8 B;  2YOE A;  3L3P A;  1US7 B;  4O4L E;  5FY1 A;  3UFE A;  5AQL B;  4YSX A;  2N9D A;  2W61 A;  2W67 A;  3ZMS B;  4IDZ A;  3U3I A;  3ZN0 B;  3ZYL A;  5HCM A;  4X64 T;  2FJA A;  2UXB T;  1ZP0 A;  2GK9 A;  2EHO D;  2XQA A;  3PUA A;  4QH4 A;  3KVA A;  2NW9 A;  1L0V A;  4QKN A;  2IDO B;  5EK3 A;  2YDS A;  3OPC A;  2J62 A;  3J9X 1;  4LF7 T;  5FP3 A;  2X51 A;  1IBK T;  3N9M A;  2D9D A;  2H88 A;  4AKG A;  2X0H A;  2YU1 A;  3QNU A;  2W0G A;  2V6Y A;  3ESL A;  5FXV A;  3ZLI A;  1KK7 A;  4KHZ F;  3FXD B;  2V8S V;  2XSA A;  2HHH T;  4GK5 E;  1AJ3 A;  4HFV A;  1NAF A;  3NWI A;  4P09 A;  2CXD A;  4LF8 T;  4ILA A;  1HNX T;  3RPU A;  2J47 A;  4O2A E;  3GN5 B;  1J5W A;  2D2S A;  1QUU A;  2XAS B;  2CRB A;  1G73 A;  4KP3 C;  3VRB A;  2XUE A;  2VVS A;  1WYC A;  2CM0 A;  2EHO C;  4Q25 A;  2AXD S;  3C98 B;  4X5T A;  4HWC A;  3PUG A;  3EVY A;  5ABH A;  4X62 T;  3IHR A;  4CI1 B;  2X9Y A;  3RIA A;  5FVL A;  1FMW A;  4A5X A;  1YKH B;  2LM2 A;  2DHR A;  2HPL A;  2NOX A;  2WDQ A;  3QB5 A;  4MHC A;  2LRK A;  2CBI A;  2I59 A;  2ACZ A;  2VKD A;  2WSS V;  2BZB A;  1MIY A;  2E9X A;  2QYW A;  3HA4 A;  3ONJ A;  4U33 A;  3AA6 B;  5JDN A;  3KFW X;  3MXZ A;  3JAD A;  3PTR B;  1IZN B;  2ACX A;  4WBN E;  3V5U A;  2WP9 A;  5LMN T;  3GMI A;  4JI7 T;  3CKD A;  3HKE E;  4JV5 T;  3UTK A;  4PK5 A;  4CI3 B;  2CPT A;  5JDQ A;  4H9P C;  1XWM A;  2CBJ A;  2XZE A;  4QXB B;  2A9U A;  2YDQ A;  3OBV E;  4JLE A;  4COF A;  5JQG E;  4PW8 A;  5DQW A;  4P0B A;  5J2T E;  3ETU A;  2KND A;  4DR7 T;  1CHU A;  1WR0 A;  5L3D B;  4LF4 T;  2DI4 A;  1U5P A;  4I50 E;  4EZ4 A;  4CZZ B;  3AEA A;  5JRC B;  3LDQ B;  2LT3 A;  2X68 A;  3AVR A;  3UUM A;  4YHJ A;  4CN1 A;  4UVC B;  2BVM A;  2H89 A;  4DND A;  3MA9 A;  3N9Q A;  4UV9 B;  3SWH A;  1T8B A;  2RP4 A;  4AIS A;  2XQ4 A;  4H9O C;  3UUN A;  3I9W A;  4YJ2 E;  5A1L A;  2X9X A;  4XAX B;  4AQY T;  4XBF B;  1MMN A;  5FNV E;  4ZI7 E;  3AA0 B;  4L9I A;  5IUX A;  4NPP A;  4DR2 T;  4IHJ E;  4WW0 A;  3NZQ A;  5F8P A;  2VWA A;  2WQY A;  3RLF F;  4ASK A;  5HAX A;  4LF5 T;  3IA3 A;  1UUS A;  4HTE A;  3AEE A;  4ZS2 A;  4O4I E;  4DV5 T;  2UUA T;  3HL6 A;  2V7I A;  4BAY B;  2JQH A;  2ODV A;  2CLY C;  2VL8 A;  1NEN A;  4WNK A;  3ZMZ B;  3C50 A;  4TV8 E;  5JDF A;  3TLV A;  2NTY A;  2E9X D;  1WR6 A;  1OED A;  3NRX A;  4IRE A;  3HKB E;  4TNW A;  3FZK B;  4UEM A;  3AEB A;  3SRZ A;  4YSY A;  5JDM A;  3CVR A;  3N2G E;  4AKL A;  4X1Y E;  5JR9 C;  4ADZ A;  3ZCI A;  2FUP A;  3ZN1 B;  4X20 E;  2CE7 A;  4ZZC A;  4AIU A;  5LA6 E;  3RH3 A;  1OXZ A;  3CX8 B;  2LLY A;  2NW8 A;  4U72 A;  3WI3 A;  2VB6 A;  4DV0 T;  1KEY A;  2C5J A;  5HXS A;  5AQK B;  2K9A A;  3CIR A;  4IL4 A;  1MIV A;  2A2F X;  1SA0 E;  3L39 A;  3J7Y q;  2V6X A;  4LFC T;  2XQY A;  3SFE A;  3KDS E;  3UU3 A;  3ANW B;  5EK4 A;  1HFA A;  4FI5 A;  3MJX A;  5LGN B;  2JRK A;  3P7I A;  1ZKE A;  4EED A;  4AKI A;  2K3W A;  3JC6 C;  2I0M A;  4QXH B;  3O9X A;  1I94 T;  1YD8 G;  3RKG A;  1FJG T;  2W2U A;  2VUR A;  3N9P A;  4HWI B;  2CMR A;  2VKJ A;  2WWU A;  4TZ4 C;  4XZC A;  3ZT7 A;  5AFU L;  3GWH A;  4TV9 E;  1N36 T;  1CUN A;  4IDO A;  3AAA B;  3FZF B;  1GQE A;  2YK0 A;  4PK4 A;  2M6I A;  3OYZ A;  2VKH A;  2W62 A;  5DQV A;  3FB2 A;  3RIU A;  3ZYK A;  3OVU A;  1OED E;  5LYJ E;  2WWV A;  4UR9 A;  3ZPO A;  4QWN B;  1H7C A;  4J2C A;  2DLR A;  3O4X E;  3CX7 B;  2BG9 A;  4M1P A;  2BKO A;  1R8I A;  2KIN B;  3SOL A;  3ZMU B;  1OWA A;  5L2L A;  3N9N A;  5FXW A;  3N2O A;  2KZ7 B;  3PUR A;  4WZX A;  2XTL A;  1MMA A;  4HFH A;  3FBZ A;  4AQF C;  5J2U E;  4ZI3 D;  5JR9 A;  1HG5 A;  3K1S A;  2XQ3 A;  2UUC T;  2WMO A;  3KV4 A;  3FBL A;  4H9Q C;  5L4E A;  1BR0 A;  2M6B A;  2PG8 A;  2DWG A;  4GIW A;  4UV8 B;  1YXR A;  4E7Z A;  1OED B;  3NBX X;  4JI5 T;  4E7S A;  5ABF B;  3ABV A;  2WZH A;  2Y48 B;  2L9Q A;  3LFM A;  2BVL A;  4I0U A;  1W9R A;  4TX5 A;  5FY7 A;  1XZY A;  4WBO A;  4LML A;  4JI2 T;  4ZHQ E;  3AE3 A;  4JUY A;  3WAJ A;  3DTO A;  1N32 T;  2N2N A;  4HEA A;  4EOZ B;  1UK5 A;  4PNI A;  2V5D A;  4UIG A;  2XQ6 A;  3ZT6 A;  4YSZ A;  1D1B A;  5LMU T;  5JRC A;  3FZL B;  2KWH A;  4OHF A;  1VOM A;  2D0T A;  4X1I E;  5AQT B;  4LFB T;  3PUQ A;  4A56 A;  2ODU A;  5HEH A;  2E2A A;  1N33 T;  3TLW A;  3O1J A;  2D0U A;  2UXX B;  3QOF A;  5FL0 A;  2BS4 A;  3RQU A;  4YY3 T;  1KNP A;  2RA1 A;  1FMV A;  2A72 A;  5AQN B;  3LG7 A;  4ERR A;  3ZMT B;  4X1K E;  3QC9 A;  2F4V T;  2FJE A;  4Z8X A;  1E7P A;  3PU3 A;  1I6Z A;  2PFV A;  2QGS A;  2E9X B;  3F57 A;  4JI8 T;  3A7M A;  4HFB A;  2LSG A;  3N9L A;  5KXJ A;  3MZK B;  3Q5E A;  5AQG B;  2LSI A;  3AEF A;  4B3R T;  4CN6 A;  1KNR A;  1XDO A; 
#chains in the Genus database with same CATH homology
 5ETW A;  4DMV A;  3AAI A;  3MAC A;  2VAS A;  1HS7 A;  2LJL A;  1EZ3 A;  1MNE A;  1NWM X;  1ZEE A;  2IC6 A;  2K48 A;  3JC6 D;  3ZJ1 A;  5LHG B;  2X0L B;  3H37 A;  4G63 A;  4DBR A;  3RYI E;  4I43 B;  4GK0 E;  4O4J E;  1MIW A;  1IJ6 A;  3PE0 A;  4C91 A;  2CLY B;  2Q9Q C;  2JPF A;  2N1G A;  4IE5 A;  5FY0 A;  5LG4 A;  4MLK A;  5IHY A;  3BK9 A;  2LEH A;  2CXL A;  4L0R A;  4ANJ A;  3EDU A;  4ZI2 C;  3RC3 A;  2YEV C;  4UVB B;  1V9D A;  1BR4 A;  2QA7 A;  3BQK A;  3CQC B;  3RYF E;  2CWO A;  4O2B E;  1LVK A;  1FIO A;  3GA8 A;  1KNZ A;  4AKH A;  4H9S E;  4CXW A;  4AKR B;  4DBQ A;  2HPJ A;  2K5B B;  3LBX A;  3KV5 A;  3BQL A;  5ADX L;  3H3A A;  4QX7 B;  5L3C B;  2PJQ A;  1HTJ F;  4N78 D;  2ES0 A;  1VRB A;  2M67 A;  3KBU A;  3KV9 A;  4UEL A;  3U78 A;  2L3L A;  4DO0 A;  3CWZ B;  2WAU A;  5L3F B;  2ZM0 A;  3I0O A;  3K3O A;  2DCF A;  5EZY E;  2CEA A;  5JR9 B;  2P9B A;  4QHO A;  5E0O A;  1LVF A;  4IIJ E;  1D0X A;  3AAE B;  5IYZ E;  4AI6 A;  3QUJ A;  5JRE A;  2LHR A;  4ILU A;  3AA1 B;  4UF0 B;  3ONX A;  5LBQ B;  3C51 A;  2V7M A;  4FJO A;  3FHN A;  2IC9 A;  2DWK A;  5HXH A;  2ZLY A;  3MK7 C;  5L3E B;  4YLH A;  2IW5 B;  3AVS A;  2C5I T;  4IE6 A;  4EYY R;  3D0T A;  3RX6 A;  2KLQ A;  1MND A;  5FMN A;  1MMG A;  2LSK A;  3ZJ2 A;  2B1E A;  2CCQ A;  2KT9 A;  4MFR A;  5F3J A;  5LJN A;  2XAJ B;  5LHI B;  4OYJ A;  4HE8 A;  2WM9 A;  3LBX B;  4H9N C;  2LSY A;  4H63 H;  1QSD A;  3KIN B;  4OK0 A;  4UVA B;  3I1A A;  1IAP A;  5FYM A;  2Y8D A;  4YJ3 E;  3Q2M A;  1B7T A;  2G0U A;  2NW7 A;  4AQF A;  2CA5 A;  3NZP A;  2LOS A;  2H7O A;  2JQQ A;  3RYC E;  1D0Y A;  2X9W A;  3C4X A;  3NRY A;  1O3X A;  1S35 A;  5HXE A;  2J1D G;  4ZS3 A;  3UUX B;  3N2K E;  4IGU A;  3K3N A;  3C4Z A;  4B6X A;  2ZM8 A;  2ZMA A;  2VKO A;  4DMW A;  4EZH A;  3AA7 B;  3I0Q A;  3E08 A;  4BJN A;  4ISS A;  3HR0 A;  3TKL B;  2XAF B;  2LE8 A;  3RRC A;  3B57 A;  4IE7 A;  4I4T E;  2LSJ A;  1SHZ C;  5FXX A;  4K0U A;  4EAH A;  4KBM B;  2E9X C;  5EK2 A;  1WYB A;  5LNK A;  4GYS A;  3LJC A;  5DJQ C;  2Q9Q A;  2A3D A;  2V7K A;  2EHO A;  4DVD A;  3EUH A;  3ETV A;  2LHN A;  5BMV E;  4KUM B;  1FEW A;  5L3B B;  4UF0 A;  2V7L A;  2Q9Q B;  4JEU B;  1ZV4 X;  3UUL A;  4EXT A;  3KVB A;  3Q9D A;  2NP9 A;  4P0A A;  3L09 A;  3E22 E;  1UX4 A;  3CPZ A;  4I55 E;  5HXR A;  4EIW A;  5DAB A;  5LXT E;  4TUY E;  2X9H A;  4H9R C;  3IBP A;  5FXZ A;  3ZEF B;  2C0S A;  2NWB A;  1D0Z A;  4QXC B;  4H63 V;  1HX8 A;  2H7V C;  3OJA A;  4MBQ A;  4U74 A;  3LK2 B;  3RYH E;  1YW0 A;  3LK3 B;  3CQX C;  3F31 A;  1IJ5 A;  5LGU B;  3C4W A;  3VU7 H;  3RC8 A;  2LM9 A;  3DJB A;  4IE4 A;  3RKO A;  2XAG B;  3PUS A;  2V1D B;  5TAO A;  5JDG A;  4PFO A;  3V5S A;  2KWI B;  4PJM A;  1YKE B;  4BA9 A;  3AB3 B;  1HF8 A;  2PBI A;  4IST A;  4UXN B;  4F6R C;  3CML A;  3N9O A;  1HCI A;  2Q9Q D;  4PJN A;  3RRW A;  2LOP A;  3B13 A;  5LOV E;  1WRD A;  1MMD A;  1G8X A;  3CX6 B;  1UX5 A;  3F2E A;  1BR1 A;  5LGT B;  2XAQ B;  4ZOL E;  5JVD E;  4EB6 E;  4EYU A;  2XAH B;  2L8K A;  4JEH B;  1BR2 A;  2MTQ A;  2OA5 A;  2MYS A;  3GN5 A;  3OKQ A;  4YFS A;  5CB4 E;  1LKX A;  4PJL A;  3WAK A;  4PAG A;  2Z6E A;  3I9Y A;  2JMK A;  3Q5X A;  4CQI A;  3VHL A;  2JMH A;  4G2A A;  2UXN B;  4KMC A;  1Y64 B;  2JJ9 A;  3S4U A;  2KMF A;  5HXC A;  1ZHC A;  3ZMV B;  5KX5 E;  5CA0 E;  3FXE B;  1X79 A;  3VKH A;  4IE0 A;  3MKD A;  4CXY A;  2ZM2 A;  3ZC0 A;  2WMN A;  2SPC A;  2EHO B;  3N5L A;  4ZI3 C;  2X67 A;  5JDH A;  4CXX A;  3BQI A;  5LBM A;  4OFZ A;  2V7J A;  2YU2 A;  5JDL A;  3IEE A;  4PK6 A;  2D5U A;  2KXP B;  3W15 B;  5HWY A;  4MAL A;  4C90 A;  3EDV A;  3IF8 B;  1E1H B;  3HKD E;  5LP6 E;  3CQG B;  4GYR A;  1HG2 A;  2CXF A;  4AXP A;  3ZC1 A;  5HWX A;  5HYA A;  3E0Z A;  2E8I A;  5KMG P;  5CA1 E;  2C5K T;  3KBT A;  5LJM A;  3ZYM A;  2CWY A;  3DP7 A;  2V26 A;  4BJM A;  3T8O A;  4V1A v;  2HH7 A;  4PFP A;  2MOZ A;  5H6R B;  3M65 A;  2Y6X A;  4PJJ A;  5LCY A;  3KV6 A;  3OYX A;  4TN7 B;  1S94 A;  3Q5W A;  2MBG A;  2YIN A;  2XHE B;  3PDY A;  3O1H A;  1Z0P A;  1LRZ A;  3ZCJ A;  2X66 A;  3PU8 A;  4GOU A;  5GON E;  3QK6 A;  2H3R A;  3P8C D;  3A5X A;  3HKC E;  4HN9 A;  2NTX A;  4O8S A;  5KDM C;  3LK4 2;  5L3G B;  3SS1 A;  3C64 A;  2DNX A;  3ANW A;  4ZI2 D;  1WLX A;  3VKG A;  2K24 A;  4L5G A;  2W63 A;  3R6N A;  2WBL A;  1U4Q A;  4NUV A;  2VK9 A;  5M4Y A;  3UT5 E;  4NUU A;  4O4H E;  1T98 A;  2IAK A;  3K3Q C;  1D1A A;  4CI2 B;  3R84 B;  2BDE A;  2W00 A;  4OYK A;  3K8P C;  5C8Y E;  5LHH B;  3O1I A;  4HGA A;  1UCU A;  1D1C A;  4HKA A;  5H6Q B;  3HI2 A;  4QX8 B;  3L3P A;  1US7 B;  4O4L E;  5FY1 A;  3UFE A;  2N9D A;  2W61 A;  3ZYL A;  3ZMS B;  4IDZ A;  3ZN0 B;  2GK9 A;  2NW9 A;  2EHO D;  3PUA A;  3KVA A;  4QKN A;  5EK3 A;  3J9X 1;  5FP3 A;  2X51 A;  3N9M A;  4AKG A;  2YU1 A;  2W0G A;  3ESL A;  5FXV A;  3ZLI A;  1KK7 A;  3FXD B;  4GK5 E;  1AJ3 A;  4HFV A;  1NAF A;  4P09 A;  2CXD A;  3RPU A;  4O2A E;  3GN5 B;  2D2S A;  1QUU A;  2XAS B;  1G73 A;  4KP3 C;  2XUE A;  1WYC A;  2CM0 A;  2EHO C;  3C98 B;  3PUG A;  3EVY A;  3IHR A;  4CI1 B;  2X9Y A;  1FMW A;  1YKH B;  2NOX A;  2DHR A;  2HPL A;  4MHC A;  5A1L A;  4AQG A;  2VKD A;  2I59 A;  2WSS V;  5LYJ E;  2BZB A;  1MIY A;  2E9X A;  3HA4 A;  3AA6 B;  5JDN A;  3KFW X;  3MXZ A;  3PTR B;  1IZN B;  2ACX A;  4WBN E;  3V5U A;  3GMI A;  3CKD A;  3HKE E;  3UTK A;  4PK5 A;  4CI3 B;  5JDQ A;  4H9P C;  4QXB B;  3OBV E;  5JQG E;  4JLE A;  5J2T E;  4PW8 A;  5DQW A;  4P0B A;  3ETU A;  2KND A;  5L3D B;  2DI4 A;  1U5P A;  4I50 E;  4EZ4 A;  4CZZ B;  5JRC B;  2LT3 A;  2X68 A;  3AVR A;  3UUM A;  4YHJ A;  4UVC B;  2BVM A;  4DND A;  3MA9 A;  3N9Q A;  4UV9 B;  3SWH A;  2RP4 A;  4H9O C;  3UUN A;  3I9W A;  4YJ2 E;  4XBF B;  2X9X A;  4XAX B;  1MMN A;  5FNV E;  4ZI7 E;  3AA0 B;  4L9I A;  4IHJ E;  4WW0 A;  3NZQ A;  5F8P A;  2VWA A;  4ASK A;  5HAX A;  4HTE A;  4ZS2 A;  4O4I E;  3HL6 A;  2V7I A;  4BAY B;  2ODV A;  2CLY C;  2VL8 A;  4WNK A;  3ZMZ B;  3C50 A;  4TV8 E;  5JDF A;  2NTY A;  2E9X D;  1WR6 A;  3NRX A;  5JH7 E;  3HKB E;  3SRZ A;  4UEM A;  5JDM A;  3CVR A;  3N2G E;  4AKL A;  4X1Y E;  5JR9 C;  4ADZ A;  3ZCI A;  3ZN1 B;  4X20 E;  2CE7 A;  5LA6 E;  3RH3 A;  1OXZ A;  3CX8 B;  2NW8 A;  4U72 A;  3WI3 A;  2VB6 A;  2C5J A;  5HXS A;  2K9A A;  1MIV A;  2A2F X;  1SA0 E;  3J7Y q;  2XQY A;  3KDS E;  3ANW B;  5EK4 A;  1HFA A;  4FI5 A;  3MJX A;  5LGN B;  2JRK A;  3P7I A;  1ZKE A;  4AKI A;  3JC6 C;  4QXH B;  1YD8 G;  3N9P A;  4TZ4 C;  2CMR A;  2VKJ A;  2WWU A;  4XZC A;  5AFU L;  3GWH A;  4TV9 E;  1CUN A;  3AAA B;  4PK4 A;  2YK0 A;  3OYZ A;  2VKH A;  2W62 A;  5DQV A;  3FB2 A;  3ZYK A;  3ZPO A;  4QWN B;  1H7C A;  4J2C A;  2DLR A;  3O4X E;  3CX7 B;  4M1P A;  2KIN B;  3SOL A;  3ZMU B;  1OWA A;  5L2L A;  3N9N A;  5FXW A;  3N2O A;  2KZ7 B;  3PUR A;  4AQF C;  2XTL A;  1MMA A;  5J2U E;  3FBZ A;  4ZI3 D;  5JR9 A;  1HG5 A;  2WMO A;  3KV4 A;  3FBL A;  4H9Q C;  1BR0 A;  2PG8 A;  4GIW A;  2DWG A;  4UV8 B;  4E7Z A;  3NBX X;  4E7S A;  3U3I A;  3LFM A;  2Y48 B;  2L9Q A;  5J1G A;  2BVL A;  4TX5 A;  4ZHQ E;  5FY7 A;  4WBO A;  3WAJ A;  4JUY A;  3DTO A;  2N2N A;  4HEA A;  4EOZ B;  4PNI A;  4UIG A;  1D1B A;  5JRC A;  2KWH A;  4OHF A;  1VOM A;  2D0T A;  4X1I E;  3PUQ A;  4A56 A;  2ODU A;  3O1J A;  2D0U A;  2UXX B;  1FMV A;  2RA1 A;  2A72 A;  3LG7 A;  4ERR A;  3ZMT B;  4X1K E;  3QC9 A;  4Z8X A;  3PU3 A;  2PFV A;  2QGS A;  2E9X B;  3F57 A;  2LSG A;  3N9L A;  3MZK B;  2LSI A;  3O9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...