2NW8A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and tryptophan. northeast structural genomics target xcr13.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
266
structure length
266
Chain Sequence
b'EGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
molecule tags Oxidoreductase
source organism Xanthomonas campestris pv. campestris
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
total genus 105
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw8A00
5EK2A 4PK5A 2D0UA 4U74A 2X67A 2D0TA 3BK9A 2V7IA 1ZEEA 2NWBA 2NW8A 2NW7A 4PW8A 4PK6A 3E08A 2NOXA 5EK3A 2X66A 4U72A 5EK4A 5ETWA 2NW9A 2V7KA 2V7MA 2X68A 4HKAA 2V7LA 2V7JA 1YW0A
chains in the Genus database with same CATH superfamily
2QYWA 4Z8XA 2V1DB 3A7MA 3NWIA 4HEAA 2MYSA 1IAPA 2KXPB 1G8XA 4ZOLE 4YJ2E 2VL8A 4EEBA 4A5XA 1UGOA 2CE7A 1XDOA 3ZYMA 4U2YA 5LHGB 3LDQB 1WFDA 3RX6A 4PAGA 2LM9A 4UR9A 2LE8A 3LFMA 4ZI3C 5LCYA 3ZJ1A 3R6NA 3NBXX 3VRBA 1XZYA 4FJOA 1MMGA 2ACZA 3O1JA 3UU4A 2QVAA 4AQFA 4AIUA 5AQRB 3MA9A 4TNWA 4JEUB 4UEMA 2LOSA 3HI2A 5DABA 5EK4A 2CWOA 3VR9A 3ONJA 4I50E 3DP7A 3WI3A 4WBNE 2BG9E 4X1KE 1HF8A 2CEAA 4CI2B 5JDLA 1LKXA 4IE0A 4LF7T 3W15B 3FB2A 1IZNB 4AQYT 3AA1B 4B3TT 5HXRA 3B5MA 3KV9A 3N2OA 4YSXA 2LKGA 1UX4A 4AKLA 4H9SE 5HWYA 2NP9A 5HXEA 3MK7C 4IGUA 4DBRA 4U3CA 2K3WA 1D1BA 1M7KA 1VCSA 4NXMT 3KV5A 4AI6A 2JQHA 4QXBB 4EYUA 4LF4T 2CHOA 3X1DA 2J62A 3UU3A 1MNDA 2PFVA 2KT9A 3EHZA 4P0AA 3ANWB 5LYJE 3BQKA 4C90A 4LFCT 2WY2A 4OYKA 2XTLA 1US7B 3J7Yq 4PK6A 2D2SA 3SWHA 3U3IA 1BR2A 2CBIA 4YLHA 5CA0E 2LSIA 5M4YA 4NPPA 3WAJA 2WWUA 1FIOA 3HKBE 4O4JE 2VKHA 5AQHB 3Q9DA 1B7TA 3PU8A 4I55E 4QHOA 5JREA 5FXWA 2ZM2A 4DMVA 2NTXA 2ZLYA 4HTEA 5J2TE 3B13A 4KX6A 4OHFA 4A56A 4JLEA 4CXWA 2N1GA 2HH7A 4KHZF 3AEFA 4QX8B 2D5UA 1XMOT 2CRBA 4AXPA 1T7SA 5ABGA 3N2KE 2N2NA 1HG5A 4GOUA 2AE9A 2LSJA 4PFPA 5HCJA 3CKDA 3I9YA 5L4EA 4BAYB 1YXRA 3AE5A 3JADA 5ADXL 1D1CA 4HWIB 4IDPA 5H6RB 1HNWT 2E2AA 5LNKA 4UV8B 1S94A 3PJAJ 3V5SA 3ZMSB 4B6XA 1IJ5A 2HPLA 2WU2A 2YDSA 4YTMA 4H9OC 2HN2A 2PBIA 1T8BA 1Y01A 2EHOA 3CQXC 4DV0T 4JYAT 4OX9T 4ISTA 1WR0A 4ZS2A 2DWGA 2XQ9A 3ZPOA 3KV6A 4CXXA 3UUMA 3T1YT 3CX7B 4EXTA 1OWAA 2LM2A 4IDOA 2VQFT 4EGWA 2KWHA 5FNVE 1QSDA 2VVSA 4JEHB 3NVOA 5LGTB 4XZCA 5LP6E 5LXTE 3C4WA 4G2AA 4IE7A 2X9XA 3MKDA 4DR3T 1G73A 5HEOA 2IC6A 4AQFC 2CXDA 3IBPA 3WAKA 2WQYA 2Z6EA 3JAFA 4ILBA 2V6YA 4QH1A 3A5XA 3K3OA 3PE0A 3ZCIA 3O1HA 4GYRA 1MIWA 4L0RA 2LHRA 2QRXA 5ABHA 3VRAA 2MPKA 3RRCA 3ZT6A 4NIQA 2OA5A 5HEGA 5HEUA 1CHUA 4EV6A 5LJNA 1XMQT 2VKDA 4DO0A 4YHHT 2NW9A 2E5LT 2XM1A 4HN9A 1Z0PA 2XUEA 3IEEA 5LOVE 2K48A 5L2LA 2H3RA 3LK3B 4JI3T 2UXDT 1ZEEA 2BVMA 2YEVC 5LA6E 3RI5A 3H3MA 5BMVE 3PV0F 5EK2A 4L5GA 5IUXA 3AEGA 4JI7T 5HXHA 2VL0A 2JQQA 3HA4A 5L3DB 3FXEB 3PUAA 1HNZT 5JDFA 2XJ7A 3ZMZB 2VURA 2L3LA 3AB3B 5DQVA 4CN1A 4IDZA 2VKJA 2W2UA 4UVBB 3TLWA 4XBFB 2WZIA 2WWVA 5LG4A 5AQSB 3ZT7A 2JMKA 2X0LB 4MBQA 4CXYA 4QWNB 2X9YA 4JI2T 5AQNB 2JQKA 2XHEB 4G63A 2W63A 1BR0A 4F6RC 4ZI3D 5ETWA 4B3MT 4GIWA 4ZZBA 5TAOA 2IW5B 2ZMAA 1FEWA 4GKJT 2V26A 4F8HA 2VWAA 4MHCA 4IIJE 2YDQA 5FXZA 2I6HA 3ONLC 2XQ4A 1O3XA 3AEDA 4HFIA 3AAIA 2BG9C 2E9XB 2JRKA 4DNDA 3K3QC 3L8RA 2AXDS 5HEHA 2FUPA 4TN7B 3AVSA 2M6IA 4YSYA 4YTNA 2XSBA 3I0QA 4LMJA 5GONE 4EB6E 4EYYR 4UELA 5CGMA 2M67A 5AQKB 4GKKT 4ZXLA 2BS4A 1VRBA 4X5TA 3UULA 1WCRA 5IWAT 4LMLA 5JDGA 1X9BA 2LHNA 2V7IA 3EI0A 5DQWA 3ZMTB 4DV5T 4B3ST 2W61A 2KZ7B 3P4QA 3AXJB 3K1SA 1W0AA 2BS2A 4TX5A 5FMNA 2K24A 4MLKA 3E08A 3RIAA 2BVLA 4NUUA 1M62A 3Q5XA 2JMHA 2CWYA 2BBHA 3E0ZA 4HWFA 5C8YE 3RYHE 4U33A 2UUCT 4JI0T 4QXHB 3N9OA 4O2AE 4UF0A 2FJAA 2HN1A 2JPFA 3BQIA 4GK0E 2EHOC 3K3NA 5AQOB 1UK5A 2MBGA 4YHJA 4DR4T 2WMNA 3P4PA 4K0UA 4ISSA 4O2BE 4PJMA 2JJ9A 3A8YC 2LSGA 3HL6A 3OJAA 5FYMA 2V6YB 4YXDA 2CXFA 4QH4A 4EOZB 4QX7B 4HWDA 2KSRA 1E1HB 2LJLA 2X9HA 3C98B 2OV9A 4EIWA 3O9XA 1N34T 5C2TA 1N32T 2IDOB 4HFHA 1NAFA 4IREA 4X20E 5JVDE 4DV1T 1D0YA 4AKIA 2YKSA 4H9NC 3LSVA 5IHYA 5CFBA 4AKGA 4ZI2C 3CVRA 1HS7A 2NW7A 2XQYA 4PW8A 4MALA 5JH7E 4K0KT 1MIYA 3OKQA 4CN4A 1KFYA 2GK9A 4U7IA 2VQET 4IDNA 4X1YE 5JR9A 4YT0A 2K9AA 3PUGA 1KNRA 2C5JA 2J1DG 4ADZA 3GMIA 4X64T 1J5ET 3NZPA 2RPAA 1E7PA 2L9QA 4O4LE 4BJNA 1XDPA 2DNXA 4DMWA 1HX8A 4UVCB 5FL1A 2H88A 4HFBA 1MIVA 4MFRA 5HWXA 4LFAT 2DL1A 4JBWF 2P9BA 2L8KA 2BZBA 3RYCE 2YK0A 3PUWF 5LB7B 3TLVA 2DCFA 3NRXA 2PJQA 2JQ9A 5AQLB 5BR8T 3FZKB 4PJLA 2KWIB 2DLRA 3FXDB 2IHR1 3AE9A 2W00A 3I1AA 3QUJA 3HKCE 2YN6A 1D0ZA 4IHJE 1ZKEA 3RPUA 4UV9B 2CMRA 2UXBT 4TV9E 1FMVA 2FBWA 4DR2T 1J1JA 2WCAA 4IE6A 1HG2A 4N78D 2H7VC 3OTOT 3AAAB 4JI1T 3KFWX 4HFDA 2ODUA 4TWFA 3QNUA 1QLBA 1LRZA 2ZM0A 3SFDA 3U78A 2UXCT 4KHPT 3PTRB 5AQIB 3KINB 5FXVA 5KDMC 4LF9T 1CUNA 2I0MA 3ZT5A 4IT4A 1X79A 4U72A 2XPKA 5FVLA 3ZSTA 5JDNA 3QC9A 5JR9B 5L3FB 1IBLT 3ABVA 4HFCA 1T98A 3RYFE 2NTYA 3CMLA 2Y6XA 2CLYB 2DWKA 3EVYA 4ANJA 3AE7A 1S35A 2X0YA 5ABFA 2QA7A 2YDRA 3L09A 4JUYA 3Q5DA 3UFEA 1YQ4A 4PNIA 4JI5T 2NR4A 5LHHB 2Q9QC 4BA9A 5E0OA 5C3JA 5AQFB 3RC3A 2XASB 2V5DA 2EHOD 3LJCA 4O4IE 4YJ3E 2XZEA 4DUYT 5JDHA 2UUBT 2W66A 3AE8A 4ZZCA 1XNRT 3LG7A 5HXCA 4ASKA 5H6QB 2V5CA 3CWZB 3M65A 1SUMB 5LMUT 3RRWA 3UQ4A 2XQAA 3AEEA 4YY3T 1MMAA 1MMDA 2WBLA 2CLYC 1YQ3A 2DI4A 3MACA 4QKNA 3AAEB 2UUAT 1Z8UA 2H7OA 5L3CB 4KI0F 4U31A 3LK42 3JCFA 3FZLB 3OBVE 1ZOYA 3VKHA 1IBMT 2V7LA 4EEDA 2WU5A 2A9UA 1FMWA 2RP4A 3CX6B 2LRKA 2LT3A 2VASA 2M6BA 3F31A 4QH5A 4TZ4C 3Q2MA 5L4HA 2LRLA 5JTGA 2D0UA 4JI6T 2VK9A 3N5LA 4PFOA 5JQGE 4H9PC 3P50A 2YOEA 3RKGA 1OEDB 2X67A 2XM2A 4WNKA 3S4UA 2A72A 5FY0A 2Q9QA 3AA6B 3B57A 3ZLIA 1WR6A 3SS1A 4PJNA 3QOFA 3ZKRA 4U7YA 2CCQA 4O8SA 3RIUC 3SRZA 5JDQA 3ZMUB 2IAKA 2WS3A 4PK4A 3AA7B 2BKNA 1I94T 3PU3A 5FXXA 5JDMA 1OEDC 4QXCB 2ZM6T 1HR0T 5KXJA 3T1HT 1V9DA 3ONXA 3ZN0B 1H7CA 1KF6A 1LVKA 3AE4A 4CQIA 5LJMA 5AQJB 3RYIE 1UX5A 1ZHCA 5HCMA 4CZZB 3CX8B 4O4HE 4UIGA 2KINB 5AQVB 2E9XA 3C64A 3D0TA 3EDUA 3ZMVB 5F8PA 4BJMA 1UUSA 3RLFF 2V8SV 3NZQA 2V7JA 2XAQB 3RIFA 3G06A 3ETUA 1BR1A 2CPTA 2VKOA 2B76A 1U4QA 3EAMA 4KBMB 2MAWA 4PK5A 5HAXA 2E9XC 2HPJA 2N9DA 1LVFA 3GA8A 3P4WA 3ZSSA 4ZI7E 1I6ZA 4DV3T 4LFBT 3O4XE 3AA0B 3RGLA 1W0BA 4E7ZA 2Y48B 3C51A 3TLTA 3AECA 2PTFA 3ANWA 1XWMA 4H63H 5IYZE 3RF1A 2FJEA 3SFEA 2XQ7A 1OEDA 3JC6C 4ILUA 5CA1E 4DV7T 1D0XA 3OYXA 2Q9QB 3AEBA 5KX5E 3UUXB 4V1Av 3RIUA 3P8CD 1ZP0A 3NRYA 4Z91A 4OK0A 1HCIA 4UF0B 2W62A 2WMOA 2SPCA 5EK3A 4GK5E 2E8IA 4DV2T 3ZYKA 1KNPA 1Y64B 2BG9B 2WDRA 2XQ8A 3FBLA 3FHNA 4PJJA 4ILAA 4AISA 2WM9A 3P4RA 1J5WA 5DJQC 2IMLA 2OLTA 4HWCA 3CK6A 4M1PA 5J1GA 4CN6A 2KNDA 3PUXF 5JRCA 3FZFB 1OXZA 4ZS3A 3SOLA 2C5KT 4EAHA 4B3RT 2CBJA 4CI3B 3HKEE 3AVRA 3QK6A 5FKYA 4NUVA 2LLYA 4COFA 2J4GA 2ZM8A 3EUHA 4P0BA 4OYJA 4DR7T 4A98A 3N9PA 1MMNA 2H89A 2LEHA 2XSAA 3GWHA 2LOPA 2JIWA 4KUMB 3GN5B 4XAXB 1YKEB 4DR1T 3JC6D 3OVUA 2CXLA 3PUZF 4WW0A 5AQMB 2C5IT 2A2FX 3ESLA 3Q5EA 2XY8B 5ABFB 5L3GB 3AEAA 1KEYA 2V6XA 3FZMB 2WDVA 1KK7A 3AE3A 4UVAB 1SA0E 2A3DA 1UURA 2FJDA 3AE1A 4IL9A 1KNZA 2V7MA 2X68A 2IIUA 4HKAA 2XQ5A 4I4TE 4U74A 3PUSA 1YW0A 1N33T 3O1IA 4GYSA 4YTPA 5F5WA 3LBXB 4P1NA 4YFSA 3TLUA 1FJGT 1SE7A 4DBQA 3AXJA 3LK2B 2VVNA 3F2EA 4EZHA 2UXNB 5L3BB 1N36T 3ZC0A 2BS3A 2XQ3A 1QUUA 3TKLB 2BDEA 2CHNA 4I0UA 3K8PC 5J2UE 3N9LA 2X9WA 2Q9QD 3VHLA 3V5UA 1SHZC 2MTQA 2XAGB 3N2GE 5CB4E 5L3EB 3I0OA 2UXXB 1OEDE 2Y8DA 3BK9A 4DR6T 4H9QC 3UU5A 4X65T 3RC8A 2XQ6A 2D9DA 4LF6T 2K5BB 2YU2A 2J47A 4ILCA 2WP9A 4Q25A 4UXNB 5J0ZA 4DV6T 1HNXT 4LF5T 2X0HA 2LSKA 3ZC1A 2X66A 2DHRA 2E5VA 2WSSV 3UU8A 1HTJF 2VB6A 5LBMA 2WB5A 4IE5A 2BKOA 2V7KA 4TWDA 1XNQT 3PJAA 3RH3A 4WZXA 1U5PA 2UU9T 3PUYF 3UUBA 4DR5T 3C4XA 2C0SA 1DU2A 5AFUL 3H37A 5F3JA 3H3AA 4ZHQE 5EZYE 1JNZA 3ZJ2A 2W67A 4DUZT 3QB5A 2RA1A 3QB5K 3TLSA 2I59A 3UU6A 2HHHT 3UT5E 3PUQA 3R84B 3FZHB 2D0TA 4HFEA 5A1LA 3KBUA 4I43B 5LGUB 3L3PA 3GN5A 4WBOA 2XAJB 2CA5A 2FJBA 4TWHA 1L0VA 3T8OA 5JRCB 1WRDA 3HKDE 2PG8A 1NENA 2XAHB 3PDYA 3PUVF 4OFZA 4AQGA 4JI4T 3OPCA 1T72A 5CJ5A 4C91A 3UUNA 5ABEA 1IBKT 3CQGB 2XAFB 5AQGB 3C50A 1AJ3A 4TV8E 4H9RC 4KMCA 3DJBA 4IE4A 4AKRB 3OYZA 4J2CA 5HYAA 1W9RA 3VKGA 3RQWA 2YU1A 2ODVA 3P7IA 4HFVA 3FBZA 4ZEYA 1WLXA 3L39A 4FI5A 4A97A 4L9IA 1EZ3A 3PURA 5AQUB 4WYVA 4CI1B 1NEKA 3KV4A 3Q5WA 4TNVA 4NXNT 2ACXA 1E2AA 3MXZA 3IA3A 5AQQB 3MJXA 2LKHA 3KDSE 2YINA 2WDQA 3CPZA 3I9WA 3RKOA 3F57A 1ZV4X 2NW8A 3BQLA 4ERRA 4JI8T 5LHIB 2KMFA 3MZKB 3VR8A 4IL4A 3UTKA 2LSYA 2WAUA 1HFAA 2MOZA 2B1EA 3UQ7A 2QGSA 2X51A 1HX1B 3IF8B 5FP3A 1NWMX 4P09A 3ZCJA 4DV4T 3N9MA 1UCUA 1JNRA 4KP3C 2BG9A 2IUBA 1R8IA 1GQEA 1VOMA 2BBJA 3M3ZB 5LMNT 2R6GF 1D1AA 3CIRA 5FY7A 2KLQA 2W0GA 4Z90A 5AQPB 3RQUA 3VU7H 1YD8G 4HWHA 5FL0A 3CQCB 4IDQA 4LF8T 5JR9C 1IJ6A 2G0UA 2E9XD 4U2ZA 5LGNB 2ES0A 3ETVA 3HR0A 4TUYE 3KBTA 4ZI2D 4HGAA 3IHRA 3E22E 4X62T 4DIDB 5L47A 1YKHB 2NWBA 1BR4A 3N9NA 4HE8A 4LMKA 1WYBA 2WZHA 5LBQB 4X1IE 3RHWA 4EZ4A 2BKPA 3P4SA 3LBXA 5FVKA 3J9X1 5LG3A 2EHOB 3AE6A 5HXSA 5FY1A 2NOXA 4E7SA 5AQTB 1WYCA 4X66T 3ZEFB 3C4ZA 4DVDA 4YSZA 4JV5T 5HEJA 3JAEA 3EDVA 3UFGA 2F4VT 3KVAA 3DTOA 3N9QA 3ZN1B 2CM0A 1VCTA 3ZYLA 5KMGP 4AKHA 3KVBA 2IC9A 2W4XA 3AE2A 1W09A 4H63V 1MNEA 3EABA 3NKZA
chains in the Genus database with same CATH topology
4Z8XA 2V1DB 4HEAA 2MYSA 1IAPA 2KXPB 1G8XA 4ZOLE 4YJ2E 2VL8A 2CE7A 3ZYMA 5LHGB 3RX6A 4PAGA 2LM9A 5LCYA 2LE8A 3LFMA 4ZI3C 3ZJ1A 3R6NA 3NBXX 4FJOA 1MMGA 3O1JA 4AQFA 3MA9A 4JEUB 4UEMA 2LOSA 3HI2A 5DABA 5EK4A 2CWOA 4I50E 3DP7A 3WI3A 4WBNE 4X1KE 1HF8A 2CEAA 4CI2B 5JDLA 1LKXA 4IE0A 3W15B 3FB2A 1IZNB 3AA1B 3KV9A 5LJMA 3N2OA 5HXEA 1UX4A 4AKLA 4H9SE 5HWYA 2NP9A 3MK7C 4IGUA 4DBRA 1D1BA 4AI6A 3KV5A 4QXBB 4EYUA 1MNDA 2PFVA 2KT9A 4P0AA 3ANWB 5LYJE 3BQKA 4C90A 4OYKA 2XTLA 1US7B 3J7Yq 4PK6A 2D2SA 3SWHA 3U3IA 1BR2A 4YLHA 5CA0E 2LSIA 5M4YA 3WAJA 2WWUA 1FIOA 3HKBE 4O4JE 2VKHA 3Q9DA 1B7TA 3PU8A 4I55E 4QHOA 5JREA 5FXWA 2ZM2A 4DMVA 2NTXA 2ZLYA 4HTEA 5J2TE 3B13A 4OHFA 4A56A 4JLEA 4CXWA 2N1GA 2HH7A 4QX8B 2D5UA 4AXPA 3N2KE 2N2NA 1HG5A 4GOUA 2LSJA 4PFPA 3CKDA 3I9YA 4BAYB 5ADXL 1D1CA 5H6RB 5LNKA 4UV8B 1S94A 3V5SA 3ZMSB 4B6XA 1IJ5A 2HPLA 5HXRA 4H9OC 2PBIA 3CQXC 2EHOA 4ISTA 4ZS2A 2DWGA 3ZPOA 3KV6A 4CXXA 3UUMA 3CX7B 4EXTA 1OWAA 2KWHA 5FNVE 1QSDA 4JEHB 5LGTB 4XZCA 5LP6E 5LXTE 3C4WA 4G2AA 4IE7A 2X9XA 3MKDA 1G73A 2IC6A 4AQFC 2CXDA 3IBPA 3WAKA 2Z6EA 3A5XA 3K3OA 3PE0A 3ZCIA 3O1HA 4GYRA 1MIWA 4L0RA 2LHRA 3RRCA 2OA5A 5LJNA 2VKDA 4DO0A 2NW9A 4HN9A 1Z0PA 2XUEA 3IEEA 5LOVE 2K48A 5L2LA 2H3RA 3LK3B 1ZEEA 2BVMA 2YEVC 5LA6E 5BMVE 5EK2A 4L5GA 5HXHA 2JQQA 3HA4A 5L3DB 3FXEB 3PUAA 5JDFA 3ZMZB 2L3LA 5DQVA 4IDZA 2VKJA 4UVBB 4XBFB 5LG4A 2JMKA 2X0LB 4MBQA 4CXYA 4QWNB 2X9YA 2XHEB 4G63A 2W63A 1BR0A 4F6RC 5ETWA 4GIWA 5TAOA 2IW5B 2ZMAA 1FEWA 2V26A 2VWAA 4MHCA 4IIJE 5FXZA 1O3XA 3AAIA 2E9XB 2JRKA 4DNDA 3K3QC 4TN7B 3AVSA 3I0QA 5GONE 4EB6E 4EYYR 4UELA 2M67A 1VRBA 3UULA 5JDGA 2V7IA 2LHNA 5DQWA 3ZMTB 2W61A 2KZ7B 4TX5A 5FMNA 2K24A 4MLKA 3E08A 2BVLA 4NUUA 3Q5XA 2JMHA 2CWYA 3E0ZA 5C8YE 4QXHB 3N9OA 4O2AE 4UF0A 2JPFA 3BQIA 4GK0E 2EHOC 3K3NA 2MBGA 4YHJA 2WMNA 4K0UA 4O2BE 4ISSA 4PJMA 3RYHE 2JJ9A 2LSGA 3HL6A 3OJAA 5FYMA 2CXFA 4EOZB 4QX7B 1E1HB 2LJLA 2X9HA 3C98B 4EIWA 3O9XA 1NAFA 4X20E 5JVDE 1D0YA 4AKIA 4H9NC 5IHYA 4AKGA 4ZI2C 3CVRA 1HS7A 2NW7A 2XQYA 4PW8A 4MALA 5JH7E 1MIYA 3OKQA 2GK9A 4X1YE 5JR9A 2K9AA 3PUGA 4ADZA 2C5JA 2J1DG 3GMIA 3NZPA 2L9QA 4O4LE 4BJNA 2DNXA 4DMWA 1HX8A 4UVCB 5HWXA 1MIVA 4MFRA 2P9BA 2L8KA 2BZBA 3RYCE 2YK0A 2DCFA 3NRXA 2PJQA 4PJLA 2KWIB 2DLRA 3FXDB 3I1AA 2W00A 3QUJA 3RPUA 3HKCE 1D0ZA 4IHJE 1ZKEA 4UV9B 2CMRA 4TV9E 1FMVA 4IE6A 4N78D 1HG2A 2H7VC 3AAAB 3KFWX 2ODUA 1LRZA 2ZM0A 3U78A 3PTRB 5FXVA 3KINB 1CUNA 4U72A 1X79A 5L3FB 5JDNA 3QC9A 5JR9B 1T98A 3RYFE 2NTYA 3CMLA 3EVYA 2CLYB 2DWKA 2Y6XA 4ANJA 1S35A 2QA7A 4JUYA 3L09A 3UFEA 4PNIA 5LHHB 2Q9QC 4BA9A 5E0OA 3RC3A 2XASB 2EHOD 3LJCA 4O4IE 4YJ3E 5JDHA 3LG7A 5HXCA 5H6QB 3CWZB 3M65A 3RRWA 1MMAA 1MMDA 2WBLA 2CLYC 2DI4A 4QKNA 3MACA 3AAEB 5L3CB 2H7OA 3LK42 3OBVE 3VKHA 2V7LA 4ZI3D 1FMWA 2RP4A 3CX6B 2VASA 2LT3A 3F31A 4TZ4C 3Q2MA 2D0UA 2VK9A 3N5LA 4PFOA 5JQGE 4H9PC 2X67A 4WNKA 3S4UA 2A72A 5FY0A 2Q9QA 3AA6B 3B57A 3ZLIA 1WR6A 3SS1A 4PJNA 4ASKA 4EAHA 5JDQA 2CCQA 4O8SA 3SRZA 3ZMUB 2IAKA 4PK4A 3AA7B 3PU3A 5FXXA 5JDMA 4QXCB 1V9DA 3ONXA 3ZN0B 1H7CA 1LVKA 4CQIA 3RYIE 1UX5A 1ZHCA 4CZZB 3CX8B 4O4HE 4UIGA 2KINB 2E9XA 3C64A 3D0TA 3EDUA 3ZMVB 5F8PA 4BJMA 3NZQA 2V7JA 2XAQB 3ETUA 1BR1A 2VKOA 4PK5A 1U4QA 5HAXA 4KBMB 2E9XC 2HPJA 2N9DA 1LVFA 3GA8A 4ZI7E 3O4XE 3AA0B 4E7ZA 2Y48B 3C51A 3ANWA 5IYZE 4H63H 3JC6C 4ILUA 5CA1E 1D0XA 3OYXA 2Q9QB 5KX5E 3UUXB 4V1Av 3P8CD 3NRYA 4OK0A 1HCIA 4UF0B 2W62A 2WMOA 2SPCA 5EK3A 4GK5E 2E8IA 3ZYKA 1Y64B 3FHNA 4PJJA 3FBLA 5JR9C 5KDMC 2WM9A 5DJQC 5J1GA 4M1PA 2KNDA 5JRCA 1OXZA 4ZS3A 3SOLA 2C5KT 4CI3B 3HKEE 3AVRA 3QK6A 4NUVA 4P0BA 2ZM8A 3EUHA 4OYJA 3N9PA 1MMNA 2LEHA 3GWHA 2LOPA 4KUMB 4XAXB 3GN5B 1YKEB 3JC6D 4WW0A 2CXLA 2C5IT 2A2FX 3ESLA 5L3GB 1KK7A 4UVAB 1SA0E 2A3DA 1KNZA 2V7MA 2X68A 4HKAA 4I4TE 4U74A 3PUSA 1YW0A 3O1IA 4GYSA 3LBXB 4YFSA 4DBQA 4EZHA 3LK2B 3F2EA 5L3BB 3ZC0A 2UXNB 1QUUA 3TKLB 2BDEA 3K8PC 5J2UE 3N9LA 2X9WA 2Q9QD 3VHLA 3V5UA 1SHZC 2MTQA 2XAGB 3N2GE 5CB4E 5L3EB 3I0OA 2UXXB 2Y8DA 3BK9A 4H9QC 3RC8A 2K5BB 2YU2A 4UXNB 2LSKA 3ZC1A 2X66A 2DHRA 2WSSV 1HTJF 2VB6A 5LBMA 4IE5A 2V7KA 3RH3A 1U5PA 3C4XA 2C0SA 5AFUL 3H37A 5F3JA 3H3AA 4ZHQE 5EZYE 3ZJ2A 2RA1A 2I59A 3UT5E 3PUQA 3R84B 2D0TA 5A1LA 3KBUA 4I43B 5LGUB 3L3PA 3GN5A 4WBOA 2XAJB 2CA5A 3T8OA 5JRCB 1WRDA 3HKDE 2PG8A 2XAHB 4OFZA 3PDYA 4AQGA 4C91A 3UUNA 3CQGB 2XAFB 3C50A 1AJ3A 4TV8E 4H9RC 4KMCA 3DJBA 4IE4A 4AKRB 3OYZA 4J2CA 5HYAA 3VKGA 2YU1A 2ODVA 3P7IA 4HFVA 3FBZA 1WLXA 4FI5A 4L9IA 1EZ3A 3PURA 4CI1B 3Q5WA 3KV4A 2ACXA 3MXZA 3MJXA 3KDSE 2YINA 3I9WA 3CPZA 3RKOA 3F57A 1ZV4X 2NW8A 3BQLA 4ERRA 5LHIB 2KMFA 3MZKB 3UTKA 2LSYA 2WAUA 1HFAA 2MOZA 2B1EA 2QGSA 2X51A 3IF8B 5FP3A 1NWMX 4P09A 3ZCJA 3N9MA 1UCUA 4KP3C 1VOMA 1D1AA 5FY7A 2KLQA 2W0GA 3VU7H 1YD8G 3CQCB 1IJ6A 2G0UA 2E9XD 5LGNB 2ES0A 3ETVA 3HR0A 4TUYE 3KBTA 4ZI2D 4HGAA 3IHRA 3E22E 1YKHB 2NWBA 1BR4A 3N9NA 4HE8A 1WYBA 5LBQB 4X1IE 4EZ4A 3LBXA 3J9X1 2EHOB 5HXSA 5FY1A 2NOXA 4E7SA 1WYCA 3ZEFB 3C4ZA 4DVDA 3EDVA 3KVAA 3DTOA 3N9QA 3ZN1B 2CM0A 3ZYLA 5KMGP 4AKHA 3KVBA 2IC9A 3AB3B 4H63V 1MNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EK2 A;  4PK5 A;  2D0U A;  4U74 A;  2X67 A;  2D0T A;  3BK9 A;  2V7I A;  1ZEE A;  2NWB A;  2NW8 A;  2NW7 A;  4PW8 A;  4PK6 A;  3E08 A;  2NOX A;  5EK3 A;  2X66 A;  4U72 A;  5EK4 A;  5ETW A;  2NW9 A;  2V7K A;  2V7M A;  2X68 A;  4HKA A;  2V7L A;  2V7J A;  1YW0 A; 
#chains in the Genus database with same CATH topology
 2QYW A;  4Z8X A;  2V1D B;  3A7M A;  3NWI A;  4HEA A;  2MYS A;  1IAP A;  2KXP B;  1G8X A;  4ZOL E;  4YJ2 E;  2VL8 A;  4EEB A;  4A5X A;  1UGO A;  2CE7 A;  1XDO A;  3ZYM A;  4U2Y A;  5LHG B;  3LDQ B;  1WFD A;  3RX6 A;  4PAG A;  2LM9 A;  4UR9 A;  2LE8 A;  3LFM A;  4ZI3 C;  5LCY A;  3ZJ1 A;  3R6N A;  3NBX X;  3VRB A;  1XZY A;  4FJO A;  1MMG A;  2ACZ A;  3O1J A;  3UU4 A;  2QVA A;  4AQF A;  4AIU A;  5AQR B;  3MA9 A;  4TNW A;  4JEU B;  4UEM A;  2LOS A;  3HI2 A;  5DAB A;  5EK4 A;  2CWO A;  3VR9 A;  3ONJ A;  4I50 E;  3DP7 A;  3WI3 A;  4WBN E;  2BG9 E;  4X1K E;  1HF8 A;  2CEA A;  4CI2 B;  5JDL A;  1LKX A;  4IE0 A;  4LF7 T;  3W15 B;  3FB2 A;  1IZN B;  4AQY T;  3AA1 B;  4B3T T;  5HXR A;  3B5M A;  3KV9 A;  3N2O A;  4YSX A;  2LKG A;  1UX4 A;  4AKL A;  4H9S E;  5HWY A;  2NP9 A;  5HXE A;  3MK7 C;  4IGU A;  4DBR A;  4U3C A;  2K3W A;  1D1B A;  1M7K A;  1VCS A;  4NXM T;  3KV5 A;  4AI6 A;  2JQH A;  4QXB B;  4EYU A;  4LF4 T;  2CHO A;  3X1D A;  2J62 A;  3UU3 A;  1MND A;  2PFV A;  2KT9 A;  3EHZ A;  4P0A A;  3ANW B;  5LYJ E;  3BQK A;  4C90 A;  4LFC T;  2WY2 A;  4OYK A;  2XTL A;  1US7 B;  3J7Y q;  4PK6 A;  2D2S A;  3SWH A;  3U3I A;  1BR2 A;  2CBI A;  4YLH A;  5CA0 E;  2LSI A;  5M4Y A;  4NPP A;  3WAJ A;  2WWU A;  1FIO A;  3HKB E;  4O4J E;  2VKH A;  5AQH B;  3Q9D A;  1B7T A;  3PU8 A;  4I55 E;  4QHO A;  5JRE A;  5FXW A;  2ZM2 A;  4DMV A;  2NTX A;  2ZLY A;  4HTE A;  5J2T E;  3B13 A;  4KX6 A;  4OHF A;  4A56 A;  4JLE A;  4CXW A;  2N1G A;  2HH7 A;  4KHZ F;  3AEF A;  4QX8 B;  2D5U A;  1XMO T;  2CRB A;  4AXP A;  1T7S A;  5ABG A;  3N2K E;  2N2N A;  1HG5 A;  4GOU A;  2AE9 A;  2LSJ A;  4PFP A;  5HCJ A;  3CKD A;  3I9Y A;  5L4E A;  4BAY B;  1YXR A;  3AE5 A;  3JAD A;  5ADX L;  1D1C A;  4HWI B;  4IDP A;  5H6R B;  1HNW T;  2E2A A;  5LNK A;  4UV8 B;  1S94 A;  3PJA J;  3V5S A;  3ZMS B;  4B6X A;  1IJ5 A;  2HPL A;  2WU2 A;  2YDS A;  4YTM A;  4H9O C;  2HN2 A;  2PBI A;  1T8B A;  1Y01 A;  2EHO A;  3CQX C;  4DV0 T;  4JYA T;  4OX9 T;  4IST A;  1WR0 A;  4ZS2 A;  2DWG A;  2XQ9 A;  3ZPO A;  3KV6 A;  4CXX A;  3UUM A;  3T1Y T;  3CX7 B;  4EXT A;  1OWA A;  2LM2 A;  4IDO A;  2VQF T;  4EGW A;  2KWH A;  5FNV E;  1QSD A;  2VVS A;  4JEH B;  3NVO A;  5LGT B;  4XZC A;  5LP6 E;  5LXT E;  3C4W A;  4G2A A;  4IE7 A;  2X9X A;  3MKD A;  4DR3 T;  1G73 A;  5HEO A;  2IC6 A;  4AQF C;  2CXD A;  3IBP A;  3WAK A;  2WQY A;  2Z6E A;  3JAF A;  4ILB A;  2V6Y A;  4QH1 A;  3A5X A;  3K3O A;  3PE0 A;  3ZCI A;  3O1H A;  4GYR A;  1MIW A;  4L0R A;  2LHR A;  2QRX A;  5ABH A;  3VRA A;  2MPK A;  3RRC A;  3ZT6 A;  4NIQ A;  2OA5 A;  5HEG A;  5HEU A;  1CHU A;  4EV6 A;  5LJN A;  1XMQ T;  2VKD A;  4DO0 A;  4YHH T;  2NW9 A;  2E5L T;  2XM1 A;  4HN9 A;  1Z0P A;  2XUE A;  3IEE A;  5LOV E;  2K48 A;  5L2L A;  2H3R A;  3LK3 B;  4JI3 T;  2UXD T;  1ZEE A;  2BVM A;  2YEV C;  5LA6 E;  3RI5 A;  3H3M A;  5BMV E;  3PV0 F;  5EK2 A;  4L5G A;  5IUX A;  3AEG A;  4JI7 T;  5HXH A;  2VL0 A;  2JQQ A;  3HA4 A;  5L3D B;  3FXE B;  3PUA A;  1HNZ T;  5JDF A;  2XJ7 A;  3ZMZ B;  2VUR A;  2L3L A;  3AB3 B;  5DQV A;  4CN1 A;  4IDZ A;  2VKJ A;  2W2U A;  4UVB B;  3TLW A;  4XBF B;  2WZI A;  2WWV A;  5LG4 A;  5AQS B;  3ZT7 A;  2JMK A;  2X0L B;  4MBQ A;  4CXY A;  4QWN B;  2X9Y A;  4JI2 T;  5AQN B;  2JQK A;  2XHE B;  4G63 A;  2W63 A;  1BR0 A;  4F6R C;  4ZI3 D;  5ETW A;  4B3M T;  4GIW A;  4ZZB A;  5TAO A;  2IW5 B;  2ZMA A;  1FEW A;  4GKJ T;  2V26 A;  4F8H A;  2VWA A;  4MHC A;  4IIJ E;  2YDQ A;  5FXZ A;  2I6H A;  3ONL C;  2XQ4 A;  1O3X A;  3AED A;  4HFI A;  3AAI A;  2BG9 C;  2E9X B;  2JRK A;  4DND A;  3K3Q C;  3L8R A;  2AXD S;  5HEH A;  2FUP A;  4TN7 B;  3AVS A;  2M6I A;  4YSY A;  4YTN A;  2XSB A;  3I0Q A;  4LMJ A;  5GON E;  4EB6 E;  4EYY R;  4UEL A;  5CGM A;  2M67 A;  5AQK B;  4GKK T;  4ZXL A;  2BS4 A;  1VRB A;  4X5T A;  3UUL A;  1WCR A;  5IWA T;  4LML A;  5JDG A;  1X9B A;  2LHN A;  2V7I A;  3EI0 A;  5DQW A;  3ZMT B;  4DV5 T;  4B3S T;  2W61 A;  2KZ7 B;  3P4Q A;  3AXJ B;  3K1S A;  1W0A A;  2BS2 A;  4TX5 A;  5FMN A;  2K24 A;  4MLK A;  3E08 A;  3RIA A;  2BVL A;  4NUU A;  1M62 A;  3Q5X A;  2JMH A;  2CWY A;  2BBH A;  3E0Z A;  4HWF A;  5C8Y E;  3RYH E;  4U33 A;  2UUC T;  4JI0 T;  4QXH B;  3N9O A;  4O2A E;  4UF0 A;  2FJA A;  2HN1 A;  2JPF A;  3BQI A;  4GK0 E;  2EHO C;  3K3N A;  5AQO B;  1UK5 A;  2MBG A;  4YHJ A;  4DR4 T;  2WMN A;  3P4P A;  4K0U A;  4ISS A;  4O2B E;  4PJM A;  2JJ9 A;  3A8Y C;  2LSG A;  3HL6 A;  3OJA A;  5FYM A;  2V6Y B;  4YXD A;  2CXF A;  4QH4 A;  4EOZ B;  4QX7 B;  4HWD A;  2KSR A;  1E1H B;  2LJL A;  2X9H A;  3C98 B;  2OV9 A;  4EIW A;  3O9X A;  1N34 T;  5C2T A;  1N32 T;  2IDO B;  4HFH A;  1NAF A;  4IRE A;  4X20 E;  5JVD E;  4DV1 T;  1D0Y A;  4AKI A;  2YKS A;  4H9N C;  3LSV A;  5IHY A;  5CFB A;  4AKG A;  4ZI2 C;  3CVR A;  1HS7 A;  2NW7 A;  2XQY A;  4PW8 A;  4MAL A;  5JH7 E;  4K0K T;  1MIY A;  3OKQ A;  4CN4 A;  1KFY A;  2GK9 A;  4U7I A;  2VQE T;  4IDN A;  4X1Y E;  5JR9 A;  4YT0 A;  2K9A A;  3PUG A;  1KNR A;  2C5J A;  2J1D G;  4ADZ A;  3GMI A;  4X64 T;  1J5E T;  3NZP A;  2RPA A;  1E7P A;  2L9Q A;  4O4L E;  4BJN A;  1XDP A;  2DNX A;  4DMW A;  1HX8 A;  4UVC B;  5FL1 A;  2H88 A;  4HFB A;  1MIV A;  4MFR A;  5HWX A;  4LFA T;  2DL1 A;  4JBW F;  2P9B A;  2L8K A;  2BZB A;  3RYC E;  2YK0 A;  3PUW F;  5LB7 B;  3TLV A;  2DCF A;  3NRX A;  2PJQ A;  2JQ9 A;  5AQL B;  5BR8 T;  3FZK B;  4PJL A;  2KWI B;  2DLR A;  3FXD B;  2IHR 1;  3AE9 A;  2W00 A;  3I1A A;  3QUJ A;  3HKC E;  2YN6 A;  1D0Z A;  4IHJ E;  1ZKE A;  3RPU A;  4UV9 B;  2CMR A;  2UXB T;  4TV9 E;  1FMV A;  2FBW A;  4DR2 T;  1J1J A;  2WCA A;  4IE6 A;  1HG2 A;  4N78 D;  2H7V C;  3OTO T;  3AAA B;  4JI1 T;  3KFW X;  4HFD A;  2ODU A;  4TWF A;  3QNU A;  1QLB A;  1LRZ A;  2ZM0 A;  3SFD A;  3U78 A;  2UXC T;  4KHP T;  3PTR B;  5AQI B;  3KIN B;  5FXV A;  5KDM C;  4LF9 T;  1CUN A;  2I0M A;  3ZT5 A;  4IT4 A;  1X79 A;  4U72 A;  2XPK A;  5FVL A;  3ZST A;  5JDN A;  3QC9 A;  5JR9 B;  5L3F B;  1IBL T;  3ABV A;  4HFC A;  1T98 A;  3RYF E;  2NTY A;  3CML A;  2Y6X A;  2CLY B;  2DWK A;  3EVY A;  4ANJ A;  3AE7 A;  1S35 A;  2X0Y A;  5ABF A;  2QA7 A;  2YDR A;  3L09 A;  4JUY A;  3Q5D A;  3UFE A;  1YQ4 A;  4PNI A;  4JI5 T;  2NR4 A;  5LHH B;  2Q9Q C;  4BA9 A;  5E0O A;  5C3J A;  5AQF B;  3RC3 A;  2XAS B;  2V5D A;  2EHO D;  3LJC A;  4O4I E;  4YJ3 E;  2XZE A;  4DUY T;  5JDH A;  2UUB T;  2W66 A;  3AE8 A;  4ZZC A;  1XNR T;  3LG7 A;  5HXC A;  4ASK A;  5H6Q B;  2V5C A;  3CWZ B;  3M65 A;  1SUM B;  5LMU T;  3RRW A;  3UQ4 A;  2XQA A;  3AEE A;  4YY3 T;  1MMA A;  1MMD A;  2WBL A;  2CLY C;  1YQ3 A;  2DI4 A;  3MAC A;  4QKN A;  3AAE B;  2UUA T;  1Z8U A;  2H7O A;  5L3C B;  4KI0 F;  4U31 A;  3LK4 2;  3JCF A;  3FZL B;  3OBV E;  1ZOY A;  3VKH A;  1IBM T;  2V7L A;  4EED A;  2WU5 A;  2A9U A;  1FMW A;  2RP4 A;  3CX6 B;  2LRK A;  2LT3 A;  2VAS A;  2M6B A;  3F31 A;  4QH5 A;  4TZ4 C;  3Q2M A;  5L4H A;  2LRL A;  5JTG A;  2D0U A;  4JI6 T;  2VK9 A;  3N5L A;  4PFO A;  5JQG E;  4H9P C;  3P50 A;  2YOE A;  3RKG A;  1OED B;  2X67 A;  2XM2 A;  4WNK A;  3S4U A;  2A72 A;  5FY0 A;  2Q9Q A;  3AA6 B;  3B57 A;  3ZLI A;  1WR6 A;  3SS1 A;  4PJN A;  3QOF A;  3ZKR A;  4U7Y A;  2CCQ A;  4O8S A;  3RIU C;  3SRZ A;  5JDQ A;  3ZMU B;  2IAK A;  2WS3 A;  4PK4 A;  3AA7 B;  2BKN A;  1I94 T;  3PU3 A;  5FXX A;  5JDM A;  1OED C;  4QXC B;  2ZM6 T;  1HR0 T;  5KXJ A;  3T1H T;  1V9D A;  3ONX A;  3ZN0 B;  1H7C A;  1KF6 A;  1LVK A;  3AE4 A;  4CQI A;  5LJM A;  5AQJ B;  3RYI E;  1UX5 A;  1ZHC A;  5HCM A;  4CZZ B;  3CX8 B;  4O4H E;  4UIG A;  2KIN B;  5AQV B;  2E9X A;  3C64 A;  3D0T A;  3EDU A;  3ZMV B;  5F8P A;  4BJM A;  1UUS A;  3RLF F;  2V8S V;  3NZQ A;  2V7J A;  2XAQ B;  3RIF A;  3G06 A;  3ETU A;  1BR1 A;  2CPT A;  2VKO A;  2B76 A;  1U4Q A;  3EAM A;  4KBM B;  2MAW A;  4PK5 A;  5HAX A;  2E9X C;  2HPJ A;  2N9D A;  1LVF A;  3GA8 A;  3P4W A;  3ZSS A;  4ZI7 E;  1I6Z A;  4DV3 T;  4LFB T;  3O4X E;  3AA0 B;  3RGL A;  1W0B A;  4E7Z A;  2Y48 B;  3C51 A;  3TLT A;  3AEC A;  2PTF A;  3ANW A;  1XWM A;  4H63 H;  5IYZ E;  3RF1 A;  2FJE A;  3SFE A;  2XQ7 A;  1OED A;  3JC6 C;  4ILU A;  5CA1 E;  4DV7 T;  1D0X A;  3OYX A;  2Q9Q B;  3AEB A;  5KX5 E;  3UUX B;  4V1A v;  3RIU A;  3P8C D;  1ZP0 A;  3NRY A;  4Z91 A;  4OK0 A;  1HCI A;  4UF0 B;  2W62 A;  2WMO A;  2SPC A;  5EK3 A;  4GK5 E;  2E8I A;  4DV2 T;  3ZYK A;  1KNP A;  1Y64 B;  2BG9 B;  2WDR A;  2XQ8 A;  3FBL A;  3FHN A;  4PJJ A;  4ILA A;  4AIS A;  2WM9 A;  3P4R A;  1J5W A;  5DJQ C;  2IML A;  2OLT A;  4HWC A;  3CK6 A;  4M1P A;  5J1G A;  4CN6 A;  2KND A;  3PUX F;  5JRC A;  3FZF B;  1OXZ A;  4ZS3 A;  3SOL A;  2C5K T;  4EAH A;  4B3R T;  2CBJ A;  4CI3 B;  3HKE E;  3AVR A;  3QK6 A;  5FKY A;  4NUV A;  2LLY A;  4COF A;  2J4G A;  2ZM8 A;  3EUH A;  4P0B A;  4OYJ A;  4DR7 T;  4A98 A;  3N9P A;  1MMN A;  2H89 A;  2LEH A;  2XSA A;  3GWH A;  2LOP A;  2JIW A;  4KUM B;  3GN5 B;  4XAX B;  1YKE B;  4DR1 T;  3JC6 D;  3OVU A;  2CXL A;  3PUZ F;  4WW0 A;  5AQM B;  2C5I T;  2A2F X;  3ESL A;  3Q5E A;  2XY8 B;  5ABF B;  5L3G B;  3AEA A;  1KEY A;  2V6X A;  3FZM B;  2WDV A;  1KK7 A;  3AE3 A;  4UVA B;  1SA0 E;  2A3D A;  1UUR A;  2FJD A;  3AE1 A;  4IL9 A;  1KNZ A;  2V7M A;  2X68 A;  2IIU A;  4HKA A;  2XQ5 A;  4I4T E;  4U74 A;  3PUS A;  1YW0 A;  1N33 T;  3O1I A;  4GYS A;  4YTP A;  5F5W A;  3LBX B;  4P1N A;  4YFS A;  3TLU A;  1FJG T;  1SE7 A;  4DBQ A;  3AXJ A;  3LK2 B;  2VVN A;  3F2E A;  4EZH A;  2UXN B;  5L3B B;  1N36 T;  3ZC0 A;  2BS3 A;  2XQ3 A;  1QUU A;  3TKL B;  2BDE A;  2CHN A;  4I0U A;  3K8P C;  5J2U E;  3N9L A;  2X9W A;  2Q9Q D;  3VHL A;  3V5U A;  1SHZ C;  2MTQ A;  2XAG B;  3N2G E;  5CB4 E;  5L3E B;  3I0O A;  2UXX B;  1OED E;  2Y8D A;  3BK9 A;  4DR6 T;  4H9Q C;  3UU5 A;  4X65 T;  3RC8 A;  2XQ6 A;  2D9D A;  4LF6 T;  2K5B B;  2YU2 A;  2J47 A;  4ILC A;  2WP9 A;  4Q25 A;  4UXN B;  5J0Z A;  4DV6 T;  1HNX T;  4LF5 T;  2X0H A;  2LSK A;  3ZC1 A;  2X66 A;  2DHR A;  2E5V A;  2WSS V;  3UU8 A;  1HTJ F;  2VB6 A;  5LBM A;  2WB5 A;  4IE5 A;  2BKO A;  2V7K A;  4TWD A;  1XNQ T;  3PJA A;  3RH3 A;  4WZX A;  1U5P A;  2UU9 T;  3PUY F;  3UUB A;  4DR5 T;  3C4X A;  2C0S A;  1DU2 A;  5AFU L;  3H37 A;  5F3J A;  3H3A A;  4ZHQ E;  5EZY E;  1JNZ A;  3ZJ2 A;  2W67 A;  4DUZ T;  3QB5 A;  2RA1 A;  3QB5 K;  3TLS A;  2I59 A;  3UU6 A;  2HHH T;  3UT5 E;  3PUQ A;  3R84 B;  3FZH B;  2D0T A;  4HFE A;  5A1L A;  3KBU A;  4I43 B;  5LGU B;  3L3P A;  3GN5 A;  4WBO A;  2XAJ B;  2CA5 A;  2FJB A;  4TWH A;  1L0V A;  3T8O A;  5JRC B;  1WRD A;  3HKD E;  2PG8 A;  1NEN A;  2XAH B;  3PDY A;  3PUV F;  4OFZ A;  4AQG A;  4JI4 T;  3OPC A;  1T72 A;  5CJ5 A;  4C91 A;  3UUN A;  5ABE A;  1IBK T;  3CQG B;  2XAF B;  5AQG B;  3C50 A;  1AJ3 A;  4TV8 E;  4H9R C;  4KMC A;  3DJB A;  4IE4 A;  4AKR B;  3OYZ A;  4J2C A;  5HYA A;  1W9R A;  3VKG A;  3RQW A;  2YU1 A;  2ODV A;  3P7I A;  4HFV A;  3FBZ A;  4ZEY A;  1WLX A;  3L39 A;  4FI5 A;  4A97 A;  4L9I A;  1EZ3 A;  3PUR A;  5AQU B;  4WYV A;  4CI1 B;  1NEK A;  3KV4 A;  3Q5W A;  4TNV A;  4NXN T;  2ACX A;  1E2A A;  3MXZ A;  3IA3 A;  5AQQ B;  3MJX A;  2LKH A;  3KDS E;  2YIN A;  2WDQ A;  3CPZ A;  3I9W A;  3RKO A;  3F57 A;  1ZV4 X;  2NW8 A;  3BQL A;  4ERR A;  4JI8 T;  5LHI B;  2KMF A;  3MZK B;  3VR8 A;  4IL4 A;  3UTK A;  2LSY A;  2WAU A;  1HFA A;  2MOZ A;  2B1E A;  3UQ7 A;  2QGS A;  2X51 A;  1HX1 B;  3IF8 B;  5FP3 A;  1NWM X;  4P09 A;  3ZCJ A;  4DV4 T;  3N9M A;  1UCU A;  1JNR A;  4KP3 C;  2BG9 A;  2IUB A;  1R8I A;  1GQE A;  1VOM A;  2BBJ A;  3M3Z B;  5LMN T;  2R6G F;  1D1A A;  3CIR A;  5FY7 A;  2KLQ A;  2W0G A;  4Z90 A;  5AQP B;  3RQU A;  3VU7 H;  1YD8 G;  4HWH A;  5FL0 A;  3CQC B;  4IDQ A;  4LF8 T;  5JR9 C;  1IJ6 A;  2G0U A;  2E9X D;  4U2Z A;  5LGN B;  2ES0 A;  3ETV A;  3HR0 A;  4TUY E;  3KBT A;  4ZI2 D;  4HGA A;  3IHR A;  3E22 E;  4X62 T;  4DID B;  5L47 A;  1YKH B;  2NWB A;  1BR4 A;  3N9N A;  4HE8 A;  4LMK A;  1WYB A;  2WZH A;  5LBQ B;  4X1I E;  3RHW A;  4EZ4 A;  2BKP A;  3P4S A;  3LBX A;  5FVK A;  3J9X 1;  5LG3 A;  2EHO B;  3AE6 A;  5HXS A;  5FY1 A;  2NOX A;  4E7S A;  5AQT B;  1WYC A;  4X66 T;  3ZEF B;  3C4Z A;  4DVD A;  4YSZ A;  4JV5 T;  5HEJ A;  3JAE A;  3EDV A;  3UFG A;  2F4V T;  3KVA A;  3DTO A;  3N9Q A;  3ZN1 B;  2CM0 A;  1VCT A;  3ZYL A;  5KMG P;  4AKH A;  3KVB A;  2IC9 A;  2W4X A;  3AE2 A;  1W09 A;  4H63 V;  1MNE A;  3EAB A;  3NKZ A; 
#chains in the Genus database with same CATH homology
 4Z8X A;  2V1D B;  4HEA A;  2MYS A;  1IAP A;  2KXP B;  1G8X A;  4ZOL E;  4YJ2 E;  2VL8 A;  2CE7 A;  3ZYM A;  5LHG B;  3RX6 A;  4PAG A;  2LM9 A;  5LCY A;  2LE8 A;  3LFM A;  4ZI3 C;  3ZJ1 A;  3R6N A;  3NBX X;  4FJO A;  1MMG A;  3O1J A;  4AQF A;  3MA9 A;  4JEU B;  4UEM A;  2LOS A;  3HI2 A;  5DAB A;  5EK4 A;  2CWO A;  4I50 E;  3DP7 A;  3WI3 A;  4WBN E;  4X1K E;  1HF8 A;  2CEA A;  4CI2 B;  5JDL A;  1LKX A;  4IE0 A;  3W15 B;  3FB2 A;  1IZN B;  3AA1 B;  3KV9 A;  5LJM A;  3N2O A;  5HXE A;  1UX4 A;  4AKL A;  4H9S E;  5HWY A;  2NP9 A;  3MK7 C;  4IGU A;  4DBR A;  1D1B A;  4AI6 A;  3KV5 A;  4QXB B;  4EYU A;  1MND A;  2PFV A;  2KT9 A;  4P0A A;  3ANW B;  5LYJ E;  3BQK A;  4C90 A;  4OYK A;  2XTL A;  1US7 B;  3J7Y q;  4PK6 A;  2D2S A;  3SWH A;  3U3I A;  1BR2 A;  4YLH A;  5CA0 E;  2LSI A;  5M4Y A;  3WAJ A;  2WWU A;  1FIO A;  3HKB E;  4O4J E;  2VKH A;  3Q9D A;  1B7T A;  3PU8 A;  4I55 E;  4QHO A;  5JRE A;  5FXW A;  2ZM2 A;  4DMV A;  2NTX A;  2ZLY A;  4HTE A;  5J2T E;  3B13 A;  4OHF A;  4A56 A;  4JLE A;  4CXW A;  2N1G A;  2HH7 A;  4QX8 B;  2D5U A;  4AXP A;  3N2K E;  2N2N A;  1HG5 A;  4GOU A;  2LSJ A;  4PFP A;  3CKD A;  3I9Y A;  4BAY B;  5ADX L;  1D1C A;  5H6R B;  5LNK A;  4UV8 B;  1S94 A;  3V5S A;  3ZMS B;  4B6X A;  1IJ5 A;  2HPL A;  5HXR A;  4H9O C;  2PBI A;  3CQX C;  2EHO A;  4IST A;  4ZS2 A;  2DWG A;  3ZPO A;  3KV6 A;  4CXX A;  3UUM A;  3CX7 B;  4EXT A;  1OWA A;  2KWH A;  5FNV E;  1QSD A;  4JEH B;  5LGT B;  4XZC A;  5LP6 E;  5LXT E;  3C4W A;  4G2A A;  4IE7 A;  2X9X A;  3MKD A;  1G73 A;  2IC6 A;  4AQF C;  2CXD A;  3IBP A;  3WAK A;  2Z6E A;  3A5X A;  3K3O A;  3PE0 A;  3ZCI A;  3O1H A;  4GYR A;  1MIW A;  4L0R A;  2LHR A;  3RRC A;  2OA5 A;  5LJN A;  2VKD A;  4DO0 A;  2NW9 A;  4HN9 A;  1Z0P A;  2XUE A;  3IEE A;  5LOV E;  2K48 A;  5L2L A;  2H3R A;  3LK3 B;  1ZEE A;  2BVM A;  2YEV C;  5LA6 E;  5BMV E;  5EK2 A;  4L5G A;  5HXH A;  2JQQ A;  3HA4 A;  5L3D B;  3FXE B;  3PUA A;  5JDF A;  3ZMZ B;  2L3L A;  5DQV A;  4IDZ A;  2VKJ A;  4UVB B;  4XBF B;  5LG4 A;  2JMK A;  2X0L B;  4MBQ A;  4CXY A;  4QWN B;  2X9Y A;  2XHE B;  4G63 A;  2W63 A;  1BR0 A;  4F6R C;  5ETW A;  4GIW A;  5TAO A;  2IW5 B;  2ZMA A;  1FEW A;  2V26 A;  2VWA A;  4MHC A;  4IIJ E;  5FXZ A;  1O3X A;  3AAI A;  2E9X B;  2JRK A;  4DND A;  3K3Q C;  4TN7 B;  3AVS A;  3I0Q A;  5GON E;  4EB6 E;  4EYY R;  4UEL A;  2M67 A;  1VRB A;  3UUL A;  5JDG A;  2V7I A;  2LHN A;  5DQW A;  3ZMT B;  2W61 A;  2KZ7 B;  4TX5 A;  5FMN A;  2K24 A;  4MLK A;  3E08 A;  2BVL A;  4NUU A;  3Q5X A;  2JMH A;  2CWY A;  3E0Z A;  5C8Y E;  4QXH B;  3N9O A;  4O2A E;  4UF0 A;  2JPF A;  3BQI A;  4GK0 E;  2EHO C;  3K3N A;  2MBG A;  4YHJ A;  2WMN A;  4K0U A;  4O2B E;  4ISS A;  4PJM A;  3RYH E;  2JJ9 A;  2LSG A;  3HL6 A;  3OJA A;  5FYM A;  2CXF A;  4EOZ B;  4QX7 B;  1E1H B;  2LJL A;  2X9H A;  3C98 B;  4EIW A;  3O9X A;  1NAF A;  4X20 E;  5JVD E;  1D0Y A;  4AKI A;  4H9N C;  5IHY A;  4AKG A;  4ZI2 C;  3CVR A;  1HS7 A;  2NW7 A;  2XQY A;  4PW8 A;  4MAL A;  5JH7 E;  1MIY A;  3OKQ A;  2GK9 A;  4X1Y E;  5JR9 A;  2K9A A;  3PUG A;  4ADZ A;  2C5J A;  2J1D G;  3GMI A;  3NZP A;  2L9Q A;  4O4L E;  4BJN A;  2DNX A;  4DMW A;  1HX8 A;  4UVC B;  5HWX A;  1MIV A;  4MFR A;  2P9B A;  2L8K A;  2BZB A;  3RYC E;  2YK0 A;  2DCF A;  3NRX A;  2PJQ A;  4PJL A;  2KWI B;  2DLR A;  3FXD B;  3I1A A;  2W00 A;  3QUJ A;  3RPU A;  3HKC E;  1D0Z A;  4IHJ E;  1ZKE A;  4UV9 B;  2CMR A;  4TV9 E;  1FMV A;  4IE6 A;  4N78 D;  1HG2 A;  2H7V C;  3AAA B;  3KFW X;  2ODU A;  1LRZ A;  2ZM0 A;  3U78 A;  3PTR B;  5FXV A;  3KIN B;  1CUN A;  4U72 A;  1X79 A;  5L3F B;  5JDN A;  3QC9 A;  5JR9 B;  1T98 A;  3RYF E;  2NTY A;  3CML A;  3EVY A;  2CLY B;  2DWK A;  2Y6X A;  4ANJ A;  1S35 A;  2QA7 A;  4JUY A;  3L09 A;  3UFE A;  4PNI A;  5LHH B;  2Q9Q C;  4BA9 A;  5E0O A;  3RC3 A;  2XAS B;  2EHO D;  3LJC A;  4O4I E;  4YJ3 E;  5JDH A;  3LG7 A;  5HXC A;  5H6Q B;  3CWZ B;  3M65 A;  3RRW A;  1MMA A;  1MMD A;  2WBL A;  2CLY C;  2DI4 A;  4QKN A;  3MAC A;  3AAE B;  5L3C B;  2H7O A;  3LK4 2;  3OBV E;  3VKH A;  2V7L A;  4ZI3 D;  1FMW A;  2RP4 A;  3CX6 B;  2VAS A;  2LT3 A;  3F31 A;  4TZ4 C;  3Q2M A;  2D0U A;  2VK9 A;  3N5L A;  4PFO A;  5JQG E;  4H9P C;  2X67 A;  4WNK A;  3S4U A;  2A72 A;  5FY0 A;  2Q9Q A;  3AA6 B;  3B57 A;  3ZLI A;  1WR6 A;  3SS1 A;  4PJN A;  4ASK A;  4EAH A;  5JDQ A;  2CCQ A;  4O8S A;  3SRZ A;  3ZMU B;  2IAK A;  4PK4 A;  3AA7 B;  3PU3 A;  5FXX A;  5JDM A;  4QXC B;  1V9D A;  3ONX A;  3ZN0 B;  1H7C A;  1LVK A;  4CQI A;  3RYI E;  1UX5 A;  1ZHC A;  4CZZ B;  3CX8 B;  4O4H E;  4UIG A;  2KIN B;  2E9X A;  3C64 A;  3D0T A;  3EDU A;  3ZMV B;  5F8P A;  4BJM A;  3NZQ A;  2V7J A;  2XAQ B;  3ETU A;  1BR1 A;  2VKO A;  4PK5 A;  1U4Q A;  5HAX A;  4KBM B;  2E9X C;  2HPJ A;  2N9D A;  1LVF A;  3GA8 A;  4ZI7 E;  3O4X E;  3AA0 B;  4E7Z A;  2Y48 B;  3C51 A;  3ANW A;  5IYZ E;  4H63 H;  3JC6 C;  4ILU A;  5CA1 E;  1D0X A;  3OYX A;  2Q9Q B;  5KX5 E;  3UUX B;  4V1A v;  3P8C D;  3NRY A;  4OK0 A;  1HCI A;  4UF0 B;  2W62 A;  2WMO A;  2SPC A;  5EK3 A;  4GK5 E;  2E8I A;  3ZYK A;  1Y64 B;  3FHN A;  4PJJ A;  3FBL A;  5JR9 C;  5KDM C;  2WM9 A;  5DJQ C;  5J1G A;  4M1P A;  2KND A;  5JRC A;  1OXZ A;  4ZS3 A;  3SOL A;  2C5K T;  4CI3 B;  3HKE E;  3AVR A;  3QK6 A;  4NUV A;  4P0B A;  2ZM8 A;  3EUH A;  4OYJ A;  3N9P A;  1MMN A;  2LEH A;  3GWH A;  2LOP A;  4KUM B;  4XAX B;  3GN5 B;  1YKE B;  3JC6 D;  4WW0 A;  2CXL A;  2C5I T;  2A2F X;  3ESL A;  5L3G B;  1KK7 A;  4UVA B;  1SA0 E;  2A3D A;  1KNZ A;  2V7M A;  2X68 A;  4HKA A;  4I4T E;  4U74 A;  3PUS A;  1YW0 A;  3O1I A;  4GYS A;  3LBX B;  4YFS A;  4DBQ A;  4EZH A;  3LK2 B;  3F2E A;  5L3B B;  3ZC0 A;  2UXN B;  1QUU A;  3TKL B;  2BDE A;  3K8P C;  5J2U E;  3N9L A;  2X9W A;  2Q9Q D;  3VHL A;  3V5U A;  1SHZ C;  2MTQ A;  2XAG B;  3N2G E;  5CB4 E;  5L3E B;  3I0O A;  2UXX B;  2Y8D A;  3BK9 A;  4H9Q C;  3RC8 A;  2K5B B;  2YU2 A;  4UXN B;  2LSK A;  3ZC1 A;  2X66 A;  2DHR A;  2WSS V;  1HTJ F;  2VB6 A;  5LBM A;  4IE5 A;  2V7K A;  3RH3 A;  1U5P A;  3C4X A;  2C0S A;  5AFU L;  3H37 A;  5F3J A;  3H3A A;  4ZHQ E;  5EZY E;  3ZJ2 A;  2RA1 A;  2I59 A;  3UT5 E;  3PUQ A;  3R84 B;  2D0T A;  5A1L A;  3KBU A;  4I43 B;  5LGU B;  3L3P A;  3GN5 A;  4WBO A;  2XAJ B;  2CA5 A;  3T8O A;  5JRC B;  1WRD A;  3HKD E;  2PG8 A;  2XAH B;  4OFZ A;  3PDY A;  4AQG A;  4C91 A;  3UUN A;  3CQG B;  2XAF B;  3C50 A;  1AJ3 A;  4TV8 E;  4H9R C;  4KMC A;  3DJB A;  4IE4 A;  4AKR B;  3OYZ A;  4J2C A;  5HYA A;  3VKG A;  2YU1 A;  2ODV A;  3P7I A;  4HFV A;  3FBZ A;  1WLX A;  4FI5 A;  4L9I A;  1EZ3 A;  3PUR A;  4CI1 B;  3Q5W A;  3KV4 A;  2ACX A;  3MXZ A;  3MJX A;  3KDS E;  2YIN A;  3I9W A;  3CPZ A;  3RKO A;  3F57 A;  1ZV4 X;  2NW8 A;  3BQL A;  4ERR A;  5LHI B;  2KMF A;  3MZK B;  3UTK A;  2LSY A;  2WAU A;  1HFA A;  2MOZ A;  2B1E A;  2QGS A;  2X51 A;  3IF8 B;  5FP3 A;  1NWM X;  4P09 A;  3ZCJ A;  3N9M A;  1UCU A;  4KP3 C;  1VOM A;  1D1A A;  5FY7 A;  2KLQ A;  2W0G A;  3VU7 H;  1YD8 G;  3CQC B;  1IJ6 A;  2G0U A;  2E9X D;  5LGN B;  2ES0 A;  3ETV A;  3HR0 A;  4TUY E;  3KBT A;  4ZI2 D;  4HGA A;  3IHR A;  3E22 E;  1YKH B;  2NWB A;  1BR4 A;  3N9N A;  4HE8 A;  1WYB A;  5LBQ B;  4X1I E;  4EZ4 A;  3LBX A;  3J9X 1;  2EHO B;  5HXS A;  5FY1 A;  2NOX A;  4E7S A;  1WYC A;  3ZEF B;  3C4Z A;  4DVD A;  3EDV A;  3KVA A;  3DTO A;  3N9Q A;  3ZN1 B;  2CM0 A;  3ZYL A;  5KMG P;  4AKH A;  3KVB A;  2IC9 A;  3AB3 B;  4H63 V;  1MNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...