4DV5T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv5T00
3T1HT 1HR0T 1XMOT 4DR2T 4LF4T 1XNQT 3T1YT 1N36T 4DV1T 4YY3T 4B3RT 4JI8T 4X62T 1N32T 4X64T 1IBMT 5BR8T 4DV7T 2VQFT 2UXBT 5LMNT 1FJGT 4LF7T 4DV2T 4LFBT 1I94T 1IBKT 4B3MT 4DUYT 4JV5T 5LMUT 1IBLT 4X65T 4JI4T 2E5LT 4LF5T 4NXMT 4JI7T 4YHHT 4AQYT 2HHHT 4DUZT 4OX9T 4KHPT 1N33T 4B3ST 4DR5T 1N34T 4JI1T 1J5ET 4DV6T 4DR4T 4GKJT 2UU9T 4LFAT 1HNXT 4JI6T 2VQET 1XNRT 4B3TT 4DR3T 4DV4T 2UXDT 4LF8T 4DV5T 5IWAT 4JI3T 2UUBT 4GKKT 4DV0T 4DV3T 4LF6T 2ZM6T 4DR7T 2UUCT 4LFCT 1HNWT 4LF9T 4DR6T 3OTOT 4JI2T 2F4VT 4K0KT 1XMQT 4X66T 4JYAT 1HNZT 4DR1T 4NXNT 2UXCT 2UUAT 4JI0T 4JI5T
chains in the Genus database with same CATH superfamily
4ERRA 4YFSA 3H3AA 5HEOA 2XAHB 3ZKRA 4B3RT 4WBNE 3AE8A 1HG5A 2XQ4A 4ADZA 1IAPA 1ZKEA 1IBMT 4ILBA 2XSAA 4YJ2E 1HF8A 2W00A 5HXSA 4LMLA 3ETUA 2YU1A 3I9WA 3K3OA 2KWIB 4OX9T 5E0OA 5F5WA 1VCSA 2XJ7A 3PUZF 2NW7A 3I0QA 2E9XD 4HWDA 3NBXX 4ZOLE 2LSGA 3WI3A 3KINB 4IDPA 2VK9A 4QX7B 3UFGA 3UU4A 3WAJA 3K3NA 5H6RB 2H89A 4EXTA 2YKSA 3Q5XA 4U3CA 4ISTA 4LF6T 1HNWT 2WSSV 3RKGA 1FEWA 4K0KT 3AEBA 3N9MA 5FXWA 3RIUA 2VASA 4NXNT 1WFDA 3GWHA 4TX5A 2UUAT 4JI0T 1E2AA 4U7YA 2HPJA 4QXHB 3EDUA 3P4QA 2WDRA 3GMIA 3O9XA 2JMKA 2IW5B 2WZIA 3EHZA 3UU5A 3O1HA 5DQVA 2KWHA 5KXJA 2V6XA 4X5TA 2EHOA 2N2NA 4AQGA 3PUXF 4MFRA 2L8KA 1LRZA 2VKDA 3AB3B 4YHHT 2QVAA 3SFEA 3AE4A 5CA1E 5AQOB 2V5DA 4O2BE 1G73A 3P4PA 4H9SE 5J1GA 3TKLB 5CJ5A 2V6YB 3DJBA 1O3XA 2LSKA 1JNRA 1VRBA 4HWFA 3M65A 5JRCB 5CFBA 3BQLA 3ZSTA 3ZSSA 3CVRA 2ZM6T 3MA9A 3LSVA 4LFCT 1D0YA 3AA0B 1W0AA 1WCRA 3ZT5A 4XZCA 1MNEA 5FL0A 2LSIA 4ZHQE 3AEFA 2JPFA 4EB6E 3N2OA 5LBQB 5AQRB 1ZP0A 4CN1A 3P7IA 2PJQA 4MBQA 2GK9A 4JI8T 1Z0PA 2V26A 3MK7C 4A56A 4DNDA 1OWAA 2FJEA 3NRYA 3UFEA 2N9DA 2ODUA 4KP3C 5C2TA 2FJBA 4DMWA 3O4XE 1HX1B 3VRBA 4JI4T 4CXYA 4DO0A 3UQ7A 3N9PA 3FB2A 2NW8A 2YK0A 1KEYA 2ES0A 4TWFA 2X66A 3TLVA 3PUYF 2V7JA 3ZN1B 5LGUB 2LRKA 2XTLA 2ACZA 5KX5E 2PFVA 5LOVE 1J5ET 2JQ9A 1J5WA 5FXXA 3FXEB 4GKJT 2XAGB 4IE6A 3RIFA 5FL1A 1U4QA 3VR8A 4KI0F 3FBLA 5H6QB 2UUCT 4LF9T 2CA5A 3ZPOA 2M6BA 2F4VT 4WZXA 3A7MA 3ABVA 2XM1A 4ZI3C 2LSJA 1T98A 3LBXB 2VWAA 3K1SA 3UUXB 1XNQT 3NZPA 1EZ3A 3UULA 5L3BB 4DV1T 2YDQA 5LGNB 2C5IT 5FY0A 2QRXA 1UUSA 5HWYA 1UCUA 3JADA 5LMNT 3ZLIA 2LM2A 3EABA 2V7IA 2JIWA 4ILAA 4HEAA 3RQWA 2A72A 1LVKA 3RGLA 3A8YC 3ZYKA 2K48A 2XQ5A 1D0ZA 2JQKA 3KDSE 4OHFA 2HH7A 3UQ4A 3VRAA 5LBMA 4X20E 4COFA 2QYWA 3EDVA 2W4XA 3I0OA 2G0UA 1XNRT 3CWZB 4CN6A 3PTRB 3ZCIA 2BS3A 4NUUA 4JI3T 4P1NA 3FZFB 3NVOA 1OEDC 4DV3T 2A9UA 3N2KE 3HR0A 4AKLA 4GYSA 5FY1A 5FXZA 4DR6T 1KNZA 2WQYA 3JAFA 3AA1B 4IDOA 4YSXA 3G06A 5AQNB 3ZMZB 2HPLA 2KMFA 2CRBA 2WS3A 2CPTA 3MACA 5LJNA 5AQKB 2XQ3A 4DR2T 2VB6A 1BR2A 3VKGA 1YKEB 1WYCA 2VKHA 4YY3T 2RA1A 2DNXA 2NTXA 4UXNB 2Q9QA 3RHWA 3PDYA 4JLEA 2VQFT 3FZHB 3LK3B 3WAKA 4JUYA 4H63H 5IHYA 4X1IE 4WNKA 5L3GB 5EK4A 1T8BA 3RLFF 4YSYA 2FBWA 1IBKT 2BVLA 4UEMA 5L3CB 2Y8DA 4ZXLA 3FZMB 4NXMT 5HEJA 5HEHA 1HCIA 2BKOA 1ZOYA 2SPCA 3AEDA 1NAFA 2BKPA 4ASKA 1KNRA 1UURA 3B5MA 4MALA 3QUJA 4F8HA 2EHOD 4F6RC 4CI3B 3C50A 3NRXA 4P0BA 2C5JA 4Z8XA 1ZV4X 3BQIA 5LHHB 2FJDA 3B13A 4HFVA 2CXLA 5LJMA 4OYKA 3N9LA 4AKIA 2YU2A 2H7VC 4QH4A 4ZEYA 4I4TE 4GK0E 2LKHA 4JYAT 5J2UE 3U3IA 1LKXA 1OEDB 3H37A 1HFAA 1XMOT 3EVYA 4OFZA 3J9X1 3RRWA 4HWCA 5M4YA 5CGMA 3IF8B 4X62T 2WMOA 4PJLA 5HCJA 2E2AA 2UXBT 2K5BB 4P09A 3N9OA 4I0UA 3RYCE 2X9HA 4PJMA 2YDRA 1E1HB 4K0UA 5L4HA 2BG9C 1I94T 3KV5A 3CPZA 4B3MT 3AA7B 2V7KA 4PW8A 2CBJA 3AVRA 4LF5T 5ABHA 4JI7T 5AQFB 4AQYT 2D0UA 2H7OA 4HN9A 2CXFA 3LG7A 4HFBA 2ODVA 4ZI7E 2BVMA 4UVBB 2YN6A 3E0ZA 2ACXA 2UU9T 1UK5A 2KNDA 3TLSA 4TZ4C 4I43B 2IMLA 2YINA 3RF1A 2J4GA 2MTQA 2WDVA 4L9IA 4IE7A 3PU3A 3UU8A 4FJOA 1IJ6A 3FZLB 3JCFA 2IDOB 5CB4E 1Y64B 2QA7A 4JI2T 4CN4A 5F8PA 5JDHA 3NKZA 1Y01A 4IHJE 5HCMA 2V6YA 3JAEA 1CHUA 1HG2A 5IUXA 3N9NA 3T1HT 1HR0T 2CCQA 4H9QC 4V1Av 3ZYMA 5JDGA 5JRCA 4PJNA 3Q5EA 2LJLA 5LG3A 3W15B 5ETWA 4YSZA 2DI4A 3OBVE 2W0GA 3GA8A 4DV2T 3SWHA 4PK6A 1E7PA 2E5LT 5AQTB 3QK6A 2I59A 4WW0A 2XAJB 4U74A 3ZEFB 4DUZT 2D9DA 3O1IA 2BG9B 4AXPA 4CI2B 3OVUA 5AQVB 3AE6A 3F2EA 3KBTA 2PG8A 1Z8UA 4DBRA 3AE5A 4H9RC 4CI1B 2CXDA 2KZ7B 4EOZB 2NOXA 4OYJA 2Y6XA 4HFHA 2WU5A 2MYSA 2X0YA 4O4IE 3RC8A 3UT5E 4ANJA 4EZHA 4IREA 3OTOT 5LB7B 3K3QC 4ZZCA 1XMQT 2XQ6A 2DHRA 2N1GA 2WWUA 3OPCA 1MNDA 4CZZB 1XDOA 1G8XA 3JC6C 3CMLA 5JDQA 4LF4T 3T1YT 4ZI2D 4UF0B 4AIUA 3ZYLA 3VHLA 3ZN0B 3CX7B 2NWBA 4TNWA 4X64T 2Y48B 4P0AA 3DTOA 4IE4A 1JNZA 4PJJA 3O1JA 3Q5WA 5FNVE 1WLXA 4IE5A 2BZBA 5AQLB 2WM9A 5AQPB 1IBLT 4IT4A 2ZLYA 2CLYC 3LBXA 2CHOA 1X79A 5EZYE 3PUGA 1VCTA 2OA5A 4H9PC 2LT3A 2XAQB 5L4EA 2K24A 3UUMA 3RYIE 5AQJB 4JI1T 2XASB 4I50E 4EIWA 3P8CD 2AE9A 3HKCE 2LRLA 1HNXT 4HWIB 2E9XC 4AI6A 4BA9A 4BAYB 4UELA 4LF8T 4DV5T 1UX4A 1WYBA 3ZJ2A 5EK2A 3IHRA 2CE7A 4QXBB 2V5CA 4I55E 2L3LA 3V5SA 4YT0A 3HKEE 3CQCB 4KHZF 2XHEB 3ZJ1A 4O4JE 4X66T 2E9XA 2YOEA 1AJ3A 5JVDE 4IGUA 2C5KT 2VVSA 5FMNA 3OJAA 1N36T 3I9YA 3Q2MA 3T8OA 4X1YE 3C51A 4E7ZA 5HXEA 5JH7E 2XY8B 4QHOA 1W9RA 2DCFA 3KV9A 2KXPB 3SRZA 2CBIA 3QC9A 4JV5T 4A98A 1HS7A 5AFUL 4B6XA 2XQ7A 2LSYA 4EAHA 5HEGA 4UR9A 5HXHA 3HA4A 5AQMB 5HAXA 5DJQC 2VL0A 3D0TA 1GQEA 2XAFB 3VU7H 3L39A 2CLYB 2D2SA 3GN5A 2RPAA 4PK4A 1MMGA 2NW9A 3ZMSB 4PK5A 4KX6A 4MHCA 1VOMA 4DVDA 1LVFA 4ISSA 3RX6A 2IUBA 3EI0A 5JR9C 4HKAA 3QNUA 4GKKT 1NENA 2LKGA 2E9XB 3PV0F 4EYYR 3HI2A 2MAWA 3CK6A 3B57A 3P4RA 2HN1A 2PBIA 1HNZT 4AKGA 5JR9A 2YEVC 4IDQA 3AE3A 4IE0A 3MZKB 2FJAA 3SFDA 2D5UA 5BR8T 3ZC0A 3TLUA 2BKNA 4AQFC 2LOPA 2LHRA 1OEDA 2CM0A 2J1DG 4E7SA 4YXDA 4EZ4A 5HXCA 5L47A 2JJ9A 5ABGA 3ZT6A 1H7CA 2ZM8A 3GN5B 2HHHT 3N5LA 2X68A 1HTJF 2KLQA 4DR5T 1SHZC 2ZM0A 5AQGB 4AQFA 2ZM2A 3Q5DA 2XZEA 2MPKA 5ABFA 1I6ZA 3C4WA 4DV6T 3UUBA 2E8IA 5C3JA 4HFEA 4M1PA 3PJAA 5AQHB 3RRCA 4DR3T 4DIDB 1MIWA 3CQXC 2LHNA 2K9AA 4DR7T 1YW0A 4EEBA 5JR9B 2H3RA 2VL8A 4WBOA 4U2ZA 4DR1T 3P50A 2CEAA 4NIQA 2VKOA 2H88A 4YTPA 3HKBE 2HN2A 3AE2A 4H9OC 2LM9A 5LNKA 3AAEB 3KBUA 1ZEEA 5JTGA 4DV7T 5ADXL 4GYRA 1V9DA 2W67A 1OEDE 2JQHA 1ZHCA 2L9QA 1IJ5A 4IIJE 1WR6A 2DL1A 4Z90A 4G63A 4EV6A 2V7MA 3P4SA 4IDZA 3ANWA 3K8PC 5ABFB 5HYAA 5L3EB 1D1CA 3UTKA 4YTNA 5L3FB 4OK0A 1MMAA 1SUMB 2X9YA 4DR4T 1HX8A 2JRKA 4JEUB 4CXXA 4TWHA 1KK7A 5LHGB 5AQIB 1KF6A 5JDNA 2WCAA 3KV4A 5IWAT 2JQQA 1WRDA 3CX8B 5ABEA 3ONLC 2BG9A 1D1BA 3C64A 2P9BA 4HGAA 2VVNA 3CX6B 3P4WA 4BJNA 2W63A 3PUVF 3UU3A 3AECA 1XWMA 4AKRB 3EUHA 4KMCA 2D0TA 3SOLA 3MJXA 5IYZE 5CA0E 3F57A 3LK2B 4U72A 1M7KA 3L09A 4DBQA 1NWMX 3C98B 4IDNA 2DWGA 5FY7A 1N32T 2W66A 4PFOA 2OLTA 4TNVA 2IHR1 4YHJA 4GOUA 3AA6B 3J7Yq 3ANWB 3R6NA 4YLHA 4FI5A 3PU8A 5JDFA 4LMJA 3RIUC 2XUEA 1XDPA 3N2GE 4X1KE 4H9NC 4NPPA 2B1EA 5DABA 4UF0A 3VKHA 1US7B 2WBLA 1YQ3A 5HXRA 1N34T 1FMWA 4HFIA 4WYVA 3NZQA 1OXZA 4JI6T 2BS4A 4HFCA 1DU2A 4ILCA 2EHOC 3ZC1A 4TWDA 5HEUA 3UU6A 2BG9E 5AQUB 3BQKA 3VR9A 2BS2A 2CWYA 1XZYA 4TV9E 4EGWA 4ZI3D 3V5UA 4CXWA 1W09A 3RQUA 1T7SA 4UV8B 2MOZA 4U31A 5LCYA 3RYHE 1WR0A 3FZKB 5C8YE 1YXRA 4HFDA 3RI5A 2OV9A 3AAAB 2J47A 2V7LA 5FXVA 2BDEA 4HWHA 3AAIA 3PUAA 3MXZA 2C0SA 1YD8G 3QOFA 4ZZBA 3C4XA 2WY2A 3UUNA 4O2AE 3AE1A 4QKNA 2IC9A 3OKQA 2WWVA 5LP6E 4EYUA 3RC3A 3KVBA 3S4UA 2BBJA 3ONJA 3L3PA 4H63V 2W61A 3ZT7A 4ZS3A 4KBMB 2WZHA 4TUYE 2XQYA 5KDMC 4PNIA 5L2LA 1FMVA 3CQGB 1J1JA 3AEGA 1UGOA 2Q9QD 2R6GF 5EK3A 4JBWF 4U33A 5F3JA 4J2CA 3ETVA 4Q25A 4XAXB 2EHOB 2VURA 3RYFE 4C91A 5FP3A 5A1LA 1MMNA 2M6IA 2WP9A 3MKDA 2CWOA 2BBHA 2QGSA 2UXCT 2IIUA 5DQWA 4O8SA 5GONE 2VKJA 3PUSA 2X0HA 1M62A 3F31A 3ZCJA 5JREA 2CMRA 4GIWA 5FYMA 1YQ4A 3A5XA 2XQ9A 2NP9A 1D0XA 4LF7T 2XSBA 4IL9A 3TLTA 1B7TA 2WDQA 3FHNA 1X9BA 4QXCB 2NR4A 4UV9B 1KNPA 2JMHA 3BK9A 1MIVA 4CQIA 4HTEA 3PJAJ 2WU2A 2ZMAA 2KT9A 4UVCB 3IBPA 3H3MA 5FVLA 1W0BA 5L3DB 5LHIB 2X67A 2I0MA 3LK42 4NUVA 2X0LB 4QX8B 2Z6EA 2V1DB 3RKOA 5LGTB 5JQGE 2LOSA 3PURA 4O4LE 4L0RA 3RH3A 2XM2A 2IAKA 3PE0A 3IA3A 3OYZA 2LLYA 4G2AA 3N9QA 3R84B 3CKDA 1QLBA 2YDSA 2J62A 2WMNA 3FBZA 3E22E 1S94A 2M67A 5J0ZA 3AEAA 3I1AA 3CIRA 1SA0E 3SS1A 3U78A 5LG4A 3DP7A 3KV6A 1U5PA 2X9WA 4AKHA 2I6HA 4KUMB 2E5VA 3ZMTB 3M3ZB 1R8IA 4C90A 4EEDA 3ZMVB 4ZI2C 1T72A 3ONXA 1FJGT 1FIOA 2V8SV 3LDQB 4AISA 4LFBT 1QSDA 5KMGP 4MLKA 2CHNA 3QB5K 3ESLA 4N78D 2XQ8A 3RIAA 2WB5A 1N33T 4B3ST 4ZS2A 5LXTE 3HKDE 3ZMUB 3L8RA 3E08A 2XQAA 2Q9QC 5LYJE 3AE7A 3HL6A 2UXXB 2NTYA 3IEEA 3QB5A 2X51A 4DV4T 4DMVA 2UXDT 2PTFA 5AQSB 1YKHB 4YTMA 2IC6A 1D1AA 4O4HE 4U7IA 1L0VA 2W62A 3FXDB 3AXJA 1MMDA 3LFMA 3X1DA 4QWNB 1SE7A 5BMVE 4HE8A 4L5GA 2X9XA 2XPKA 5FKYA 4IL4A 4A5XA 3KFWX 1NEKA 4UIGA 5HWXA 3AVSA 1IZNB 3C4ZA 4JEHB 5J2TE 5JDLA 2MBGA 2W2UA 3AE9A 2KSRA 2A3DA 5AQQB 1QUUA 3RPUA 3PUQA 4GK5E 3LJCA 1BR1A 4DUYT 1S35A 5LMUT 1UX5A 4X65T 2WAUA 4LMKA 4BJMA 4XBFB 5JDMA 1CUNA 4KHPT 4A97A 1BR4A 3NWIA 3KVAA 2UXNB 2A2FX 2KINB 5TAOA 2DWKA 2DLRA 4PAGA 3TLWA 4TV8E 5LA6E 4QH5A 1BR0A 4YJ3E 2FUPA 3AEEA 4LFAT 2LEHA 4UVAB 2VQET 4TN7B 4B3TT 2LE8A 2B76A 4ILUA 3EAMA 2AXDS 3OYXA 2Q9QB 2UUBT 4DV0T 3AXJB 2K3WA 5FVKA 1MIYA 3JC6D 4Z91A 3Q9DA 4U2YA 1KFYA 2RP4A 4QH1A 3PUWF 4JI5T 4PFPA
chains in the Genus database with same CATH topology
3T1HT 1HR0T 1XMOT 4DR2T 4LF4T 1XNQT 3T1YT 1N36T 4DV1T 4YY3T 4B3RT 4JI8T 4X62T 1N32T 4X64T 1IBMT 5BR8T 4DV7T 2VQFT 2UXBT 5LMNT 1FJGT 4LF7T 4DV2T 4LFBT 1I94T 1IBKT 4B3MT 4DUYT 4JV5T 5LMUT 1IBLT 4X65T 4JI4T 2E5LT 4LF5T 4NXMT 4JI7T 4YHHT 4AQYT 2HHHT 4DUZT 4OX9T 4KHPT 1N33T 4B3ST 4DR5T 1N34T 4JI1T 1J5ET 4DV6T 4DR4T 4GKJT 2UU9T 4LFAT 1HNXT 4JI6T 2VQET 1XNRT 4B3TT 4DR3T 4DV4T 2UXDT 4LF8T 4DV5T 5IWAT 4JI3T 2UUBT 4GKKT 4DV0T 4DV3T 4LF6T 2ZM6T 4DR7T 2UUCT 4LFCT 1HNWT 4LF9T 4DR6T 3OTOT 4JI2T 2F4VT 4K0KT 1XMQT 4X66T 4JYAT 1HNZT 4DR1T 4NXNT 2UXCT 2UUAT 4JI0T 4JI5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H T;  1HR0 T;  1XMO T;  4DR2 T;  4LF4 T;  1XNQ T;  3T1Y T;  1N36 T;  4DV1 T;  4YY3 T;  4B3R T;  4JI8 T;  4X62 T;  1N32 T;  4X64 T;  1IBM T;  5BR8 T;  4DV7 T;  2VQF T;  2UXB T;  5LMN T;  1FJG T;  4LF7 T;  4DV2 T;  4LFB T;  1I94 T;  1IBK T;  4B3M T;  4DUY T;  4JV5 T;  5LMU T;  1IBL T;  4X65 T;  4JI4 T;  2E5L T;  4LF5 T;  4NXM T;  4JI7 T;  4YHH T;  4AQY T;  2HHH T;  4DUZ T;  4OX9 T;  4KHP T;  1N33 T;  4B3S T;  4DR5 T;  1N34 T;  4JI1 T;  1J5E T;  4DV6 T;  4DR4 T;  4GKJ T;  2UU9 T;  4LFA T;  1HNX T;  4JI6 T;  2VQE T;  1XNR T;  4B3T T;  4DR3 T;  4DV4 T;  2UXD T;  4LF8 T;  4DV5 T;  5IWA T;  4JI3 T;  2UUB T;  4GKK T;  4DV0 T;  4DV3 T;  4LF6 T;  2ZM6 T;  4DR7 T;  2UUC T;  4LFC T;  1HNW T;  4LF9 T;  4DR6 T;  3OTO T;  4JI2 T;  2F4V T;  4K0K T;  1XMQ T;  4X66 T;  4JYA T;  1HNZ T;  4DR1 T;  4NXN T;  2UXC T;  2UUA T;  4JI0 T;  4JI5 T; 
#chains in the Genus database with same CATH topology
 4ERR A;  4YFS A;  3H3A A;  5HEO A;  2XAH B;  3ZKR A;  4B3R T;  4WBN E;  3AE8 A;  1HG5 A;  2XQ4 A;  4ADZ A;  1IAP A;  1ZKE A;  1IBM T;  4ILB A;  2XSA A;  4YJ2 E;  1HF8 A;  2W00 A;  5HXS A;  4LML A;  3ETU A;  2YU1 A;  3I9W A;  3K3O A;  2KWI B;  4OX9 T;  5E0O A;  5F5W A;  1VCS A;  2XJ7 A;  3PUZ F;  2NW7 A;  3I0Q A;  2E9X D;  4HWD A;  3NBX X;  4ZOL E;  2LSG A;  3WI3 A;  3KIN B;  4IDP A;  2VK9 A;  4QX7 B;  3UFG A;  3UU4 A;  3WAJ A;  3K3N A;  5H6R B;  2H89 A;  4EXT A;  2YKS A;  3Q5X A;  4U3C A;  4IST A;  4LF6 T;  1HNW T;  2WSS V;  3RKG A;  1FEW A;  4K0K T;  3AEB A;  3N9M A;  5FXW A;  3RIU A;  2VAS A;  4NXN T;  1WFD A;  3GWH A;  4TX5 A;  2UUA T;  4JI0 T;  1E2A A;  4U7Y A;  2HPJ A;  4QXH B;  3EDU A;  3P4Q A;  2WDR A;  3GMI A;  3O9X A;  2JMK A;  2IW5 B;  2WZI A;  3EHZ A;  3UU5 A;  3O1H A;  5DQV A;  2KWH A;  5KXJ A;  2V6X A;  4X5T A;  2EHO A;  2N2N A;  4AQG A;  3PUX F;  4MFR A;  2L8K A;  1LRZ A;  2VKD A;  3AB3 B;  4YHH T;  2QVA A;  3SFE A;  3AE4 A;  5CA1 E;  5AQO B;  2V5D A;  4O2B E;  1G73 A;  3P4P A;  4H9S E;  5J1G A;  3TKL B;  5CJ5 A;  2V6Y B;  3DJB A;  1O3X A;  2LSK A;  1JNR A;  1VRB A;  4HWF A;  3M65 A;  5JRC B;  5CFB A;  3BQL A;  3ZST A;  3ZSS A;  3CVR A;  2ZM6 T;  3MA9 A;  3LSV A;  4LFC T;  1D0Y A;  3AA0 B;  1W0A A;  1WCR A;  3ZT5 A;  4XZC A;  1MNE A;  5FL0 A;  2LSI A;  4ZHQ E;  3AEF A;  2JPF A;  4EB6 E;  3N2O A;  5LBQ B;  5AQR B;  1ZP0 A;  4CN1 A;  3P7I A;  2PJQ A;  4MBQ A;  2GK9 A;  4JI8 T;  1Z0P A;  2V26 A;  3MK7 C;  4A56 A;  4DND A;  1OWA A;  2FJE A;  3NRY A;  3UFE A;  2N9D A;  2ODU A;  4KP3 C;  5C2T A;  2FJB A;  4DMW A;  3O4X E;  1HX1 B;  3VRB A;  4JI4 T;  4CXY A;  4DO0 A;  3UQ7 A;  3N9P A;  3FB2 A;  2NW8 A;  2YK0 A;  1KEY A;  2ES0 A;  4TWF A;  2X66 A;  3TLV A;  3PUY F;  2V7J A;  3ZN1 B;  5LGU B;  2LRK A;  2XTL A;  2ACZ A;  5KX5 E;  2PFV A;  5LOV E;  1J5E T;  2JQ9 A;  1J5W A;  5FXX A;  3FXE B;  4GKJ T;  2XAG B;  4IE6 A;  3RIF A;  5FL1 A;  1U4Q A;  3VR8 A;  4KI0 F;  3FBL A;  5H6Q B;  2UUC T;  4LF9 T;  2CA5 A;  3ZPO A;  2M6B A;  2F4V T;  4WZX A;  3A7M A;  3ABV A;  2XM1 A;  4ZI3 C;  2LSJ A;  1T98 A;  3LBX B;  2VWA A;  3K1S A;  3UUX B;  1XNQ T;  3NZP A;  1EZ3 A;  3UUL A;  5L3B B;  4DV1 T;  2YDQ A;  5LGN B;  2C5I T;  5FY0 A;  2QRX A;  1UUS A;  5HWY A;  1UCU A;  3JAD A;  5LMN T;  3ZLI A;  2LM2 A;  3EAB A;  2V7I A;  2JIW A;  4ILA A;  4HEA A;  3RQW A;  2A72 A;  1LVK A;  3RGL A;  3A8Y C;  3ZYK A;  2K48 A;  2XQ5 A;  1D0Z A;  2JQK A;  3KDS E;  4OHF A;  2HH7 A;  3UQ4 A;  3VRA A;  5LBM A;  4X20 E;  4COF A;  2QYW A;  3EDV A;  2W4X A;  3I0O A;  2G0U A;  1XNR T;  3CWZ B;  4CN6 A;  3PTR B;  3ZCI A;  2BS3 A;  4NUU A;  4JI3 T;  4P1N A;  3FZF B;  3NVO A;  1OED C;  4DV3 T;  2A9U A;  3N2K E;  3HR0 A;  4AKL A;  4GYS A;  5FY1 A;  5FXZ A;  4DR6 T;  1KNZ A;  2WQY A;  3JAF A;  3AA1 B;  4IDO A;  4YSX A;  3G06 A;  5AQN B;  3ZMZ B;  2HPL A;  2KMF A;  2CRB A;  2WS3 A;  2CPT A;  3MAC A;  5LJN A;  5AQK B;  2XQ3 A;  4DR2 T;  2VB6 A;  1BR2 A;  3VKG A;  1YKE B;  1WYC A;  2VKH A;  4YY3 T;  2RA1 A;  2DNX A;  2NTX A;  4UXN B;  2Q9Q A;  3RHW A;  3PDY A;  4JLE A;  2VQF T;  3FZH B;  3LK3 B;  3WAK A;  4JUY A;  4H63 H;  5IHY A;  4X1I E;  4WNK A;  5L3G B;  5EK4 A;  1T8B A;  3RLF F;  4YSY A;  2FBW A;  1IBK T;  2BVL A;  4UEM A;  5L3C B;  2Y8D A;  4ZXL A;  3FZM B;  4NXM T;  5HEJ A;  5HEH A;  1HCI A;  2BKO A;  1ZOY A;  2SPC A;  3AED A;  1NAF A;  2BKP A;  4ASK A;  1KNR A;  1UUR A;  3B5M A;  4MAL A;  3QUJ A;  4F8H A;  2EHO D;  4F6R C;  4CI3 B;  3C50 A;  3NRX A;  4P0B A;  2C5J A;  4Z8X A;  1ZV4 X;  3BQI A;  5LHH B;  2FJD A;  3B13 A;  4HFV A;  2CXL A;  5LJM A;  4OYK A;  3N9L A;  4AKI A;  2YU2 A;  2H7V C;  4QH4 A;  4ZEY A;  4I4T E;  4GK0 E;  2LKH A;  4JYA T;  5J2U E;  3U3I A;  1LKX A;  1OED B;  3H37 A;  1HFA A;  1XMO T;  3EVY A;  4OFZ A;  3J9X 1;  3RRW A;  4HWC A;  5M4Y A;  5CGM A;  3IF8 B;  4X62 T;  2WMO A;  4PJL A;  5HCJ A;  2E2A A;  2UXB T;  2K5B B;  4P09 A;  3N9O A;  4I0U A;  3RYC E;  2X9H A;  4PJM A;  2YDR A;  1E1H B;  4K0U A;  5L4H A;  2BG9 C;  1I94 T;  3KV5 A;  3CPZ A;  4B3M T;  3AA7 B;  2V7K A;  4PW8 A;  2CBJ A;  3AVR A;  4LF5 T;  5ABH A;  4JI7 T;  5AQF B;  4AQY T;  2D0U A;  2H7O A;  4HN9 A;  2CXF A;  3LG7 A;  4HFB A;  2ODV A;  4ZI7 E;  2BVM A;  4UVB B;  2YN6 A;  3E0Z A;  2ACX A;  2UU9 T;  1UK5 A;  2KND A;  3TLS A;  4TZ4 C;  4I43 B;  2IML A;  2YIN A;  3RF1 A;  2J4G A;  2MTQ A;  2WDV A;  4L9I A;  4IE7 A;  3PU3 A;  3UU8 A;  4FJO A;  1IJ6 A;  3FZL B;  3JCF A;  2IDO B;  5CB4 E;  1Y64 B;  2QA7 A;  4JI2 T;  4CN4 A;  5F8P A;  5JDH A;  3NKZ A;  1Y01 A;  4IHJ E;  5HCM A;  2V6Y A;  3JAE A;  1CHU A;  1HG2 A;  5IUX A;  3N9N A;  3T1H T;  1HR0 T;  2CCQ A;  4H9Q C;  4V1A v;  3ZYM A;  5JDG A;  5JRC A;  4PJN A;  3Q5E A;  2LJL A;  5LG3 A;  3W15 B;  5ETW A;  4YSZ A;  2DI4 A;  3OBV E;  2W0G A;  3GA8 A;  4DV2 T;  3SWH A;  4PK6 A;  1E7P A;  2E5L T;  5AQT B;  3QK6 A;  2I59 A;  4WW0 A;  2XAJ B;  4U74 A;  3ZEF B;  4DUZ T;  2D9D A;  3O1I A;  2BG9 B;  4AXP A;  4CI2 B;  3OVU A;  5AQV B;  3AE6 A;  3F2E A;  3KBT A;  2PG8 A;  1Z8U A;  4DBR A;  3AE5 A;  4H9R C;  4CI1 B;  2CXD A;  2KZ7 B;  4EOZ B;  2NOX A;  4OYJ A;  2Y6X A;  4HFH A;  2WU5 A;  2MYS A;  2X0Y A;  4O4I E;  3RC8 A;  3UT5 E;  4ANJ A;  4EZH A;  4IRE A;  3OTO T;  5LB7 B;  3K3Q C;  4ZZC A;  1XMQ T;  2XQ6 A;  2DHR A;  2N1G A;  2WWU A;  3OPC A;  1MND A;  4CZZ B;  1XDO A;  1G8X A;  3JC6 C;  3CML A;  5JDQ A;  4LF4 T;  3T1Y T;  4ZI2 D;  4UF0 B;  4AIU A;  3ZYL A;  3VHL A;  3ZN0 B;  3CX7 B;  2NWB A;  4TNW A;  4X64 T;  2Y48 B;  4P0A A;  3DTO A;  4IE4 A;  1JNZ A;  4PJJ A;  3O1J A;  3Q5W A;  5FNV E;  1WLX A;  4IE5 A;  2BZB A;  5AQL B;  2WM9 A;  5AQP B;  1IBL T;  4IT4 A;  2ZLY A;  2CLY C;  3LBX A;  2CHO A;  1X79 A;  5EZY E;  3PUG A;  1VCT A;  2OA5 A;  4H9P C;  2LT3 A;  2XAQ B;  5L4E A;  2K24 A;  3UUM A;  3RYI E;  5AQJ B;  4JI1 T;  2XAS B;  4I50 E;  4EIW A;  3P8C D;  2AE9 A;  3HKC E;  2LRL A;  1HNX T;  4HWI B;  2E9X C;  4AI6 A;  4BA9 A;  4BAY B;  4UEL A;  4LF8 T;  4DV5 T;  1UX4 A;  1WYB A;  3ZJ2 A;  5EK2 A;  3IHR A;  2CE7 A;  4QXB B;  2V5C A;  4I55 E;  2L3L A;  3V5S A;  4YT0 A;  3HKE E;  3CQC B;  4KHZ F;  2XHE B;  3ZJ1 A;  4O4J E;  4X66 T;  2E9X A;  2YOE A;  1AJ3 A;  5JVD E;  4IGU A;  2C5K T;  2VVS A;  5FMN A;  3OJA A;  1N36 T;  3I9Y A;  3Q2M A;  3T8O A;  4X1Y E;  3C51 A;  4E7Z A;  5HXE A;  5JH7 E;  2XY8 B;  4QHO A;  1W9R A;  2DCF A;  3KV9 A;  2KXP B;  3SRZ A;  2CBI A;  3QC9 A;  4JV5 T;  4A98 A;  1HS7 A;  5AFU L;  4B6X A;  2XQ7 A;  2LSY A;  4EAH A;  5HEG A;  4UR9 A;  5HXH A;  3HA4 A;  5AQM B;  5HAX A;  5DJQ C;  2VL0 A;  3D0T A;  1GQE A;  2XAF B;  3VU7 H;  3L39 A;  2CLY B;  2D2S A;  3GN5 A;  2RPA A;  4PK4 A;  1MMG A;  2NW9 A;  3ZMS B;  4PK5 A;  4KX6 A;  4MHC A;  1VOM A;  4DVD A;  1LVF A;  4ISS A;  3RX6 A;  2IUB A;  3EI0 A;  5JR9 C;  4HKA A;  3QNU A;  4GKK T;  1NEN A;  2LKG A;  2E9X B;  3PV0 F;  4EYY R;  3HI2 A;  2MAW A;  3CK6 A;  3B57 A;  3P4R A;  2HN1 A;  2PBI A;  1HNZ T;  4AKG A;  5JR9 A;  2YEV C;  4IDQ A;  3AE3 A;  4IE0 A;  3MZK B;  2FJA A;  3SFD A;  2D5U A;  5BR8 T;  3ZC0 A;  3TLU A;  2BKN A;  4AQF C;  2LOP A;  2LHR A;  1OED A;  2CM0 A;  2J1D G;  4E7S A;  4YXD A;  4EZ4 A;  5HXC A;  5L47 A;  2JJ9 A;  5ABG A;  3ZT6 A;  1H7C A;  2ZM8 A;  3GN5 B;  2HHH T;  3N5L A;  2X68 A;  1HTJ F;  2KLQ A;  4DR5 T;  1SHZ C;  2ZM0 A;  5AQG B;  4AQF A;  2ZM2 A;  3Q5D A;  2XZE A;  2MPK A;  5ABF A;  1I6Z A;  3C4W A;  4DV6 T;  3UUB A;  2E8I A;  5C3J A;  4HFE A;  4M1P A;  3PJA A;  5AQH B;  3RRC A;  4DR3 T;  4DID B;  1MIW A;  3CQX C;  2LHN A;  2K9A A;  4DR7 T;  1YW0 A;  4EEB A;  5JR9 B;  2H3R A;  2VL8 A;  4WBO A;  4U2Z A;  4DR1 T;  3P50 A;  2CEA A;  4NIQ A;  2VKO A;  2H88 A;  4YTP A;  3HKB E;  2HN2 A;  3AE2 A;  4H9O C;  2LM9 A;  5LNK A;  3AAE B;  3KBU A;  1ZEE A;  5JTG A;  4DV7 T;  5ADX L;  4GYR A;  1V9D A;  2W67 A;  1OED E;  2JQH A;  1ZHC A;  2L9Q A;  1IJ5 A;  4IIJ E;  1WR6 A;  2DL1 A;  4Z90 A;  4G63 A;  4EV6 A;  2V7M A;  3P4S A;  4IDZ A;  3ANW A;  3K8P C;  5ABF B;  5HYA A;  5L3E B;  1D1C A;  3UTK A;  4YTN A;  5L3F B;  4OK0 A;  1MMA A;  1SUM B;  2X9Y A;  4DR4 T;  1HX8 A;  2JRK A;  4JEU B;  4CXX A;  4TWH A;  1KK7 A;  5LHG B;  5AQI B;  1KF6 A;  5JDN A;  2WCA A;  3KV4 A;  5IWA T;  2JQQ A;  1WRD A;  3CX8 B;  5ABE A;  3ONL C;  2BG9 A;  1D1B A;  3C64 A;  2P9B A;  4HGA A;  2VVN A;  3CX6 B;  3P4W A;  4BJN A;  2W63 A;  3PUV F;  3UU3 A;  3AEC A;  1XWM A;  4AKR B;  3EUH A;  4KMC A;  2D0T A;  3SOL A;  3MJX A;  5IYZ E;  5CA0 E;  3F57 A;  3LK2 B;  4U72 A;  1M7K A;  3L09 A;  4DBQ A;  1NWM X;  3C98 B;  4IDN A;  2DWG A;  5FY7 A;  1N32 T;  2W66 A;  4PFO A;  2OLT A;  4TNV A;  2IHR 1;  4YHJ A;  4GOU A;  3AA6 B;  3J7Y q;  3ANW B;  3R6N A;  4YLH A;  4FI5 A;  3PU8 A;  5JDF A;  4LMJ A;  3RIU C;  2XUE A;  1XDP A;  3N2G E;  4X1K E;  4H9N C;  4NPP A;  2B1E A;  5DAB A;  4UF0 A;  3VKH A;  1US7 B;  2WBL A;  1YQ3 A;  5HXR A;  1N34 T;  1FMW A;  4HFI A;  4WYV A;  3NZQ A;  1OXZ A;  4JI6 T;  2BS4 A;  4HFC A;  1DU2 A;  4ILC A;  2EHO C;  3ZC1 A;  4TWD A;  5HEU A;  3UU6 A;  2BG9 E;  5AQU B;  3BQK A;  3VR9 A;  2BS2 A;  2CWY A;  1XZY A;  4TV9 E;  4EGW A;  4ZI3 D;  3V5U A;  4CXW A;  1W09 A;  3RQU A;  1T7S A;  4UV8 B;  2MOZ A;  4U31 A;  5LCY A;  3RYH E;  1WR0 A;  3FZK B;  5C8Y E;  1YXR A;  4HFD A;  3RI5 A;  2OV9 A;  3AAA B;  2J47 A;  2V7L A;  5FXV A;  2BDE A;  4HWH A;  3AAI A;  3PUA A;  3MXZ A;  2C0S A;  1YD8 G;  3QOF A;  4ZZB A;  3C4X A;  2WY2 A;  3UUN A;  4O2A E;  3AE1 A;  4QKN A;  2IC9 A;  3OKQ A;  2WWV A;  5LP6 E;  4EYU A;  3RC3 A;  3KVB A;  3S4U A;  2BBJ A;  3ONJ A;  3L3P A;  4H63 V;  2W61 A;  3ZT7 A;  4ZS3 A;  4KBM B;  2WZH A;  4TUY E;  2XQY A;  5KDM C;  4PNI A;  5L2L A;  1FMV A;  3CQG B;  1J1J A;  3AEG A;  1UGO A;  2Q9Q D;  2R6G F;  5EK3 A;  4JBW F;  4U33 A;  5F3J A;  4J2C A;  3ETV A;  4Q25 A;  4XAX B;  2EHO B;  2VUR A;  3RYF E;  4C91 A;  5FP3 A;  5A1L A;  1MMN A;  2M6I A;  2WP9 A;  3MKD A;  2CWO A;  2BBH A;  2QGS A;  2UXC T;  2IIU A;  5DQW A;  4O8S A;  5GON E;  2VKJ A;  3PUS A;  2X0H A;  1M62 A;  3F31 A;  3ZCJ A;  5JRE A;  2CMR A;  4GIW A;  5FYM A;  1YQ4 A;  3A5X A;  2XQ9 A;  2NP9 A;  1D0X A;  4LF7 T;  2XSB A;  4IL9 A;  3TLT A;  1B7T A;  2WDQ A;  3FHN A;  1X9B A;  4QXC B;  2NR4 A;  4UV9 B;  1KNP A;  2JMH A;  3BK9 A;  1MIV A;  4CQI A;  4HTE A;  3PJA J;  2WU2 A;  2ZMA A;  2KT9 A;  4UVC B;  3IBP A;  3H3M A;  5FVL A;  1W0B A;  5L3D B;  5LHI B;  2X67 A;  2I0M A;  3LK4 2;  4NUV A;  2X0L B;  4QX8 B;  2Z6E A;  2V1D B;  3RKO A;  5LGT B;  5JQG E;  2LOS A;  3PUR A;  4O4L E;  4L0R A;  3RH3 A;  2XM2 A;  2IAK A;  3PE0 A;  3IA3 A;  3OYZ A;  2LLY A;  4G2A A;  3N9Q A;  3R84 B;  3CKD A;  1QLB A;  2YDS A;  2J62 A;  2WMN A;  3FBZ A;  3E22 E;  1S94 A;  2M67 A;  5J0Z A;  3AEA A;  3I1A A;  3CIR A;  1SA0 E;  3SS1 A;  3U78 A;  5LG4 A;  3DP7 A;  3KV6 A;  1U5P A;  2X9W A;  4AKH A;  2I6H A;  4KUM B;  2E5V A;  3ZMT B;  3M3Z B;  1R8I A;  4C90 A;  4EED A;  3ZMV B;  4ZI2 C;  1T72 A;  3ONX A;  1FJG T;  1FIO A;  2V8S V;  3LDQ B;  4AIS A;  4LFB T;  1QSD A;  5KMG P;  4MLK A;  2CHN A;  3QB5 K;  3ESL A;  4N78 D;  2XQ8 A;  3RIA A;  2WB5 A;  1N33 T;  4B3S T;  4ZS2 A;  5LXT E;  3HKD E;  3ZMU B;  3L8R A;  3E08 A;  2XQA A;  2Q9Q C;  5LYJ E;  3AE7 A;  3HL6 A;  2UXX B;  2NTY A;  3IEE A;  3QB5 A;  2X51 A;  4DV4 T;  4DMV A;  2UXD T;  2PTF A;  5AQS B;  1YKH B;  4YTM A;  2IC6 A;  1D1A A;  4O4H E;  4U7I A;  1L0V A;  2W62 A;  3FXD B;  3AXJ A;  1MMD A;  3LFM A;  3X1D A;  4QWN B;  1SE7 A;  5BMV E;  4HE8 A;  4L5G A;  2X9X A;  2XPK A;  5FKY A;  4IL4 A;  4A5X A;  3KFW X;  1NEK A;  4UIG A;  5HWX A;  3AVS A;  1IZN B;  3C4Z A;  4JEH B;  5J2T E;  5JDL A;  2MBG A;  2W2U A;  3AE9 A;  2KSR A;  2A3D A;  5AQQ B;  1QUU A;  3RPU A;  3PUQ A;  4GK5 E;  3LJC A;  1BR1 A;  4DUY T;  1S35 A;  5LMU T;  1UX5 A;  4X65 T;  2WAU A;  4LMK A;  4BJM A;  4XBF B;  5JDM A;  1CUN A;  4KHP T;  4A97 A;  1BR4 A;  3NWI A;  3KVA A;  2UXN B;  2A2F X;  2KIN B;  5TAO A;  2DWK A;  2DLR A;  4PAG A;  3TLW A;  4TV8 E;  5LA6 E;  4QH5 A;  1BR0 A;  4YJ3 E;  2FUP A;  3AEE A;  4LFA T;  2LEH A;  4UVA B;  2VQE T;  4TN7 B;  4B3T T;  2LE8 A;  2B76 A;  4ILU A;  3EAM A;  2AXD S;  3OYX A;  2Q9Q B;  2UUB T;  4DV0 T;  3AXJ B;  2K3W A;  5FVK A;  1MIY A;  3JC6 D;  4Z91 A;  3Q9D A;  4U2Y A;  1KFY A;  2RP4 A;  4QH1 A;  3PUW F;  4JI5 T;  4PFP A; 
#chains in the Genus database with same CATH homology
 3T1H T;  1HR0 T;  1XMO T;  4DR2 T;  4LF4 T;  1XNQ T;  3T1Y T;  1N36 T;  4DV1 T;  4YY3 T;  4B3R T;  4JI8 T;  4X62 T;  1N32 T;  4X64 T;  1IBM T;  5BR8 T;  4DV7 T;  2VQF T;  2UXB T;  5LMN T;  1FJG T;  4LF7 T;  4DV2 T;  4LFB T;  1I94 T;  1IBK T;  4B3M T;  4DUY T;  4JV5 T;  5LMU T;  1IBL T;  4X65 T;  4JI4 T;  2E5L T;  4LF5 T;  4NXM T;  4JI7 T;  4YHH T;  4AQY T;  2HHH T;  4DUZ T;  4OX9 T;  4KHP T;  1N33 T;  4B3S T;  4DR5 T;  1N34 T;  4JI1 T;  1J5E T;  4DV6 T;  4DR4 T;  4GKJ T;  2UU9 T;  4LFA T;  1HNX T;  4JI6 T;  2VQE T;  1XNR T;  4B3T T;  4DR3 T;  4DV4 T;  2UXD T;  4LF8 T;  4DV5 T;  5IWA T;  4JI3 T;  2UUB T;  4GKK T;  4DV0 T;  4DV3 T;  4LF6 T;  2ZM6 T;  4DR7 T;  2UUC T;  4LFC T;  1HNW T;  4LF9 T;  4DR6 T;  3OTO T;  4JI2 T;  2F4V T;  4K0K T;  1XMQ T;  4X66 T;  4JYA T;  1HNZ T;  4DR1 T;  4NXN T;  2UXC T;  2UUA T;  4JI0 T;  4JI5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...