4DV5T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv5T00
2UUCT 4LF6T 4JI5T 1XNQT 4LFAT 4X66T 2HHHT 3T1YT 4DR6T 4DV7T 2UUBT 4X64T 4B3ST 1XMQT 2UXDT 4OX9T 1N33T 1XMOT 4YY3T 4DR7T 4JI2T 4NXNT 4LF9T 1HNZT 4JI1T 4B3MT 4X62T 3OTOT 4JI4T 2VQET 1I94T 4DV1T 4LF8T 4DV3T 4JI7T 4LF7T 2UU9T 1N34T 2ZM6T 1N36T 4K0KT 1HR0T 2UUAT 4DV4T 4DV6T 1IBMT 4JI6T 4DR5T 4JI0T 3T1HT 1XNRT 2E5LT 4B3TT 4JV5T 5IWAT 4LFBT 4DUYT 1J5ET 4JI8T 1FJGT 4JYAT 1N32T 4GKKT 4DR3T 4B3RT 5BR8T 2VQFT 5LMUT 4KHPT 1HNXT 4DR4T 4DV2T 4DR1T 2F4VT 4DR2T 4X65T 4LF4T 4JI3T 4DV0T 4LF5T 5LMNT 4DV5T 2UXCT 4AQYT 4NXMT 4LFCT 4GKJT 4DUZT 1IBLT 4YHHT 1HNWT 2UXBT 1IBKT
chains in the Genus database with same CATH superfamily
4ZZBA 3DP7A 3N2KE 3RC8A 2X68A 2D2SA 3N9NA 4IDQA 4NPPA 1M7KA 1YD8G 3OJAA 2DNXA 4PJJA 2B1EA 2XAGB 2QYWA 4UV9B 3PUGA 4IE0A 4LF6T 3PUYF 3TKLB 3L09A 3AXJB 4I55E 2LOSA 2JQHA 3O1HA 2RPAA 4UXNB 4IL9A 4K0UA 3HR0A 3UTKA 3ZJ2A 5JQGE 3T1YT 5FY7A 4GK5E 5LGTB 3FZFB 4DR6T 1YKHB 2VVNA 3NRXA 5JRCB 2BKOA 2Q9QD 4JEHB 5F8PA 4UVAB 4UIGA 3EI0A 2Y48B 4ZOLE 3C4XA 2LKGA 2VB6A 4GIWA 4J2CA 4X64T 2VL0A 2KLQA 2YU2A 3KBUA 4CXYA 4B3ST 3ETVA 4KX6A 1O3XA 2CHNA 1N33T 3PURA 5DQWA 5LCYA 2DWGA 3SFEA 4ZI3D 4UF0A 2Z6EA 5H6QB 5HEGA 2WZIA 3KV9A 5AQNB 2IC6A 4I50E 3SS1A 3TLWA 2E9XD 4HN9A 3N2GE 4QX7B 5JTGA 4I4TE 1BR4A 2I6HA 1QLBA 4O8SA 2NW8A 3EABA 5JVDE 2IIUA 3AECA 2JRKA 5LJMA 4TNWA 3R6NA 2BG9A 2WU5A 1G8XA 1S94A 3LSVA 3ZCJA 4EYYR 4YSZA 1WYCA 3UU6A 3PU3A 3CX8B 4EXTA 3I0QA 2LLYA 1WFDA 3AE3A 4KP3C 3ZT5A 5LYJE 4GYRA 4Q25A 3JCFA 4PNIA 5HYAA 4U31A 5AQFB 2DCFA 1SHZC 2PJQA 3Q9DA 4LMJA 4YJ3E 2BS4A 3G06A 1T98A 5ABGA 2WMOA 4PK4A 2CXFA 2H3RA 3PU8A 2V1DB 2LHNA 2V5DA 5H6RB 3ZSSA 4A98A 4CXXA 1N36T 3B5MA 3HKDE 1YQ3A 4L5GA 3H3AA 4YSYA 1I6ZA 2D0UA 3BQKA 4H9NC 1MMAA 2X66A 5AQHB 4YLHA 2NP9A 3UUXB 4G2AA 3ZMUB 4HWDA 2V26A 4DBRA 5ABFB 5JR9C 3C64A 4JLEA 3CKDA 4HKAA 1MIVA 2V6YB 2UUAT 3ESLA 4LMLA 4HGAA 1SUMB 1KNRA 3B13A 4DV4T 4DV6T 3LJCA 1E7PA 2XAJB 4ANJA 2WS3A 4U2ZA 4DR5T 4JI0T 5JREA 3RX6A 3CX6B 4UVBB 2UXXB 3OVUA 2HN2A 3ZT6A 5CJ5A 3HI2A 4B3TT 4JV5T 4NUVA 2LHRA 4UR9A 5J2UE 5ABHA 3UU8A 1V9DA 1FIOA 2LRKA 3F31A 4GOUA 1WCRA 5HXHA 1VCSA 1J5ET 3UU4A 3LFMA 3Q5DA 2LSIA 5JDHA 1OEDB 5HEHA 4QXBB 4JYAT 5JR9B 4L9IA 4GKKT 1UX5A 3AEEA 1VRBA 2IDOB 3NVOA 5FXXA 4JEUB 4YTPA 5FVLA 5M4YA 3K3NA 5HEUA 2LEHA 3SFDA 3UQ7A 3RKGA 4HEAA 3W15B 5JH7E 1NAFA 3MK7C 1D0YA 3RH3A 3RYFE 1FEWA 1KEYA 1S35A 2LSGA 4TUYE 2CLYC 4XAXB 3QB5A 2HPLA 4I43B 4HFIA 2M6IA 2K3WA 4DR1T 3H3MA 4DR4T 5HCJA 3C98B 2JIWA 5AQGB 4LF4T 2XQYA 4JBWF 4QXCB 2MAWA 1CHUA 3AE1A 4A5XA 1DU2A 4ASKA 1W9RA 3O4XE 2X9XA 2E5VA 3K3OA 3S4UA 3MACA 1US7B 2D9DA 3RYCE 2M67A 1X79A 2X9YA 5HXEA 1D0ZA 5ABFA 2IW5B 3ZMTB 3RGLA 3UUMA 1WRDA 4CN4A 1R8IA 5F3JA 4IL4A 1IBLT 3ZC0A 1BR0A 3PJAA 2CE7A 1JNRA 3GA8A 1IBKT 2DWKA 2N1GA 5F5WA 5FL0A 4IE7A 4CI2B 2KZ7B 4HFEA 4UELA 4EZ4A 3CVRA 2UUCT 4JI5T 4EGWA 3NKZA 4OYJA 3AVRA 2KWIB 1YKEB 1LKXA 2BG9B 3CQXC 5AQOB 1UUSA 4IGUA 4X66T 5AQJB 2E8IA 3PJAJ 3AE2A 4DO0A 2CXLA 2FJAA 2C5IT 5CA1E 3AEAA 2KINB 2ODUA 3N9QA 2BBJA 2ZM2A 3CMLA 3CX7B 4MFRA 4AKIA 3ZYLA 1KK7A 4DV7T 3E22E 3I9YA 2N9DA 3PE0A 5L2LA 5KDMC 3OPCA 3LDQB 4HFCA 4PJNA 2SPCA 5LHGB 3FBZA 1XMQT 3K3QC 4WW0A 1UCUA 2LKHA 3IA3A 1T72A 3L3PA 3AA0B 1HX1B 3C4WA 3OYXA 3UFEA 3ZJ1A 4BAYB 4XBFB 2AXDS 3DJBA 4YY3T 4HWFA 2A9UA 1UK5A 5LHHB 4DR7T 4PK5A 3FZKB 3FBLA 4UF0B 3E0ZA 4NXNT 3AAIA 2IC9A 1UX4A 5AQIB 3I1AA 4TN7B 4EB6E 2V6YA 3P7IA 4X62T 1D0XA 2LOPA 4HWHA 4ZI2D 2E2AA 5AQMB 4YTNA 3UUBA 3WAJA 3F2EA 5DABA 3EDVA 4C90A 2D5UA 2K24A 3NWIA 4HWCA 2WB5A 4ILUA 1T8BA 1SE7A 3MXZA 2CBJA 3J9X1 2X51A 3P4RA 5LG3A 2KWHA 1IJ6A 5LBMA 2JQ9A 2KNDA 2V7JA 4A97A 3HKEE 5JDNA 2EHOD 2FJBA 2QGSA 2V7KA 5J0ZA 2XQ4A 4H9QC 1ZKEA 2LE8A 3CK6A 4LF8T 3RPUA 3EHZA 4JI7T 2Y8DA 2V8SV 4A56A 4CQIA 2A2FX 2EHOB 3Q2MA 4LF7T 4O4LE 4ZZCA 1KNZA 3GN5A 3SWHA 4PFPA 3AA7B 4ISTA 3ZT7A 3E08A 1E1HB 5HEJA 1ZOYA 3RYIE 3WI3A 4AQFC 2VKJA 4K0KT 2BS2A 5LNKA 2HH7A 5AQSB 3PTRB 1XDPA 3RKOA 1HR0T 4O4HE 4X5TA 1YQ4A 2WBLA 4LMKA 4U72A 4G63A 5FXZA 1ZP0A 3ZYKA 5AQTB 4U33A 5HXCA 3RRCA 3OBVE 2YU1A 2J4GA 3U78A 1OEDA 2DI4A 5JDMA 2MBGA 2VASA 3NBXX 1L0VA 3AEDA 3N9MA 3LBXB 3ZMVB 3Q5EA 5AQPB 4EOZB 4QH1A 3AA6B 5C3JA 2XHEB 2YEVC 4HE8A 4U74A 4X1IE 4EAHA 5L4EA 5L47A 2PG8A 3FZMB 2J1DG 3JADA 3P8CD 4FJOA 4PAGA 4QX8B 5AQVB 5LB7B 2BBHA 1Y01A 2YK0A 4IE6A 4CN1A 4ZI7E 2KMFA 2KXPB 4WYVA 3RF1A 5C2TA 4ZHQE 1W0BA 1N32T 4MBQA 2L8KA 3CIRA 5EK4A 3CQGB 3R84B 2K9AA 3OYZA 4YFSA 1Y64B 3VHLA 3KVBA 4P0BA 5KXJA 2XAQB 2JQKA 1BR1A 3CWZB 4MLKA 3AE8A 2FBWA 2LRLA 1ZHCA 2J62A 2K5BB 2W63A 3B57A 3QC9A 3LK42 1LVFA 4IDPA 1EZ3A 2HPJA 5FKYA 3CPZA 5HAXA 2NW7A 1HNXT 1OXZA 2JJ9A 2QA7A 4WZXA 2CRBA 5DJQC 2J47A 4OHFA 1WLXA 2LSKA 4EEDA 5A1LA 4TV9E 4EV6A 4LF5T 2A72A 2JQQA 3PV0F 4MHCA 5LOVE 5LMNT 2EHOA 2OV9A 2VVSA 3LG7A 4F6RC 2UXCT 3ONJA 1KF6A 4QWNB 4YHJA 4WBOA 1HTJF 4LFCT 2YDRA 3RQWA 4YHHT 3N9LA 4QH4A 5HWXA 4AKHA 4E7SA 1MIYA 3BK9A 2OA5A 2QVAA 2WAUA 5L3FB 3QB5K 2DL1A 3QUJA 5JDQA 3KV5A 2OLTA 1XNQT 3PUZF 3GN5B 2Y6XA 2BG9E 2R6GF 3ETUA 2HHHT 2VK9A 3K8PC 3AE7A 4TWHA 3MJXA 3TLVA 1VOMA 3UT5E 2DHRA 4HFBA 4O2AE 3VR8A 1JNZA 2L3LA 4GYSA 1SA0E 3V5UA 1MMDA 1MNEA 2WDVA 2CM0A 4KMCA 2XPKA 4BJMA 4CI3B 3F57A 2FJDA 3C50A 5HXRA 2JMKA 3P50A 4OX9T 2NTXA 2H7OA 2NTYA 3HA4A 3WAKA 4YJ2E 1XMOT 3RRWA 3EUHA 3ZKRA 3JC6D 1MIWA 5AQQB 4AI6A 4O4JE 2ZLYA 1UGOA 2BS3A 2PFVA 4N78D 5L3GB 3AEGA 3MA9A 3MKDA 4YT0A 2H88A 1HNZT 4LF9T 2CXDA 2MYSA 3NZQA 4OFZA 2VURA 3UQ4A 3UUNA 5FY0A 2CWYA 4IDZA 3VRBA 3A7MA 4PJLA 3ABVA 4ZS2A 3JAEA 3AE4A 4IHJE 3OTOT 3ZCIA 2JPFA 3O9XA 4AQGA 2XY8B 3Q5WA 5L3BB 4JI4T 3M65A 4H9SE 4P09A 4AQFA 2IHR1 3P4QA 4O4IE 4I0UA 3RI5A 3RLFF 5C8YE 2X0LB 1I94T 1UURA 4P1NA 5CGMA 3T8OA 3IF8B 3ZN0B 4E7ZA 4AKRB 3FZLB 5FXVA 4HFVA 5L4HA 4AXPA 4NIQA 4H9RC 2XQ3A 3J7Yq 4DVDA 2ZM6T 1W09A 2MTQA 3KINB 3KVAA 3PUQA 5JDLA 4U3CA 4L0RA 5LP6E 3AAEB 4MALA 1NEKA 1MMNA 4ZS3A 4P0AA 2LSYA 3ANWB 4U7IA 4XZCA 4IDOA 4ZI3C 4TZ4C 3BQLA 3LK2B 4X1KE 2CLYB 2LSJA 1VCTA 2LT3A 1G73A 2E9XB 1FMWA 3KV6A 4NUUA 5IHYA 4COFA 5FL1A 3EVYA 3RHWA 3UU3A 5ETWA 4ZI2C 3ONLC 5EK2A 5J1GA 1NENA 2W66A 1IBMT 2JMHA 2KT9A 3AE6A 4ADZA 1E2AA 5FXWA 2NOXA 1MNDA 3N9PA 4ZEYA 2X67A 2FUPA 2YDQA 3KFWX 2BDEA 2XSBA 5LA6E 3BQIA 5ABEA 1GQEA 5AQRB 1XNRT 4DNDA 2BZBA 4AIUA 4DUYT 1ZV4X 2A3DA 4H9PC 4TWFA 4JI8T 2C5JA 1HX8A 1XZYA 1U4QA 3D0TA 3DTOA 4H9OC 4KUMB 3ZPOA 5AFUL 1D1CA 2WSSV 1HFAA 2N2NA 2V7IA 2ZM0A 3AE5A 3P4WA 2ACZA 2LM2A 4YTMA 2XQ5A 3I0OA 3PUWF 2AE9A 4ERRA 3IHRA 5L3EB 3Q5XA 5EZYE 2UXNB 4IREA 3ZYMA 3C4ZA 5HCMA 4UVCB 1NWMX 2W67A 4IT4A 4M1PA 1HG5A 3GMIA 4ILAA 4KHZF 1D1BA 3V5SA 5J2TE 4B3RT 2UXDT 2DLRA 3N2OA 2WMNA 3TLUA 5BR8T 2VQFT 1FMVA 2WM9A 4ISSA 4KHPT 1D1AA 4V1Av 3RQUA 3N9OA 4DIDB 4YSXA 5AQLB 1AJ3A 1T7SA 4ILBA 2WY2A 3U3IA 4BA9A 3FHNA 2CEAA 4JI3T 1YXRA 5AQUB 3ZSTA 2ES0A 1YW0A 2D0TA 2XQ6A 1KNPA 2I0MA 4TNVA 1QUUA 1J1JA 2XUEA 1M62A 2X0YA 4UV8B 2GK9A 4JUYA 1XDOA 2CBIA 2V7MA 4DUZT 2VKHA 3X1DA 1HNWT 2XM1A 2ACXA 4U7YA 3SOLA 2UXBT 2W2UA 3L39A 4EIWA 2WCAA 3UU5A 5KX5E 3ZN1B 1Z0PA 1U5PA 2WDRA 3JAFA 4PK6A 2V6XA 2CPTA 5CFBA 2RA1A 2XQ9A 4IE5A 3TLTA 4CI1B 5LG4A 4LFAT 1BR2A 2V5CA 2XAHB 3FXDB 4GK0E 3ONXA 4DMVA 2FJEA 1H7CA 2XQ7A 3KV4A 2LM9A 2W0GA 1X9BA 2K48A 2WP9A 5DQVA 2WWVA 2CMRA 4C91A 3GWHA 3NZPA 2WQYA 2NWBA 3EAMA 5E0OA 5JR9A 4EEBA 2BVLA 2UUBT 5JDFA 3M3ZB 1B7TA 2W61A 3NRYA 4CZZB 3L8RA 4EZHA 3QNUA 4O2BE 4HFHA 2ODVA 3VKGA 3PUXF 3VKHA 2H89A 3P4PA 5LGUB 1XWMA 4JI2T 5BMVE 2XAFB 3P4SA 3N5LA 2NR4A 2BKNA 2X9HA 3IBPA 4ILCA 4OK0A 2XM2A 4PW8A 2XQ8A 4KBMB 4X20E 3SRZA 3PUAA 4JI1T 4B3MT 5JRCA 3AEFA 1W0AA 1HF8A 2BVMA 3PDYA 3RC3A 5HXSA 1WR6A 2E9XA 4QKNA 2IAKA 4WNKA 2XTLA 3VRAA 3RIUC 2BKPA 2IMLA 3AXJA 2BG9C 2XJ7A 3LK3B 1J5WA 2LJLA 4B6XA 1IJ5A 5LJNA 3A8YC 5AQKB 2MOZA 4OYKA 5JDGA 2VQET 3HL6A 1HS7A 3I9WA 2W62A 3C51A 3KBTA 2WU2A 2VL8A 3AE9A 5LGNB 4KI0F 4Z91A 5LXTE 4DV1T 2X0HA 3ZMSB 4DV3T 3MZKB 3FB2A 2Q9QA 3ANWA 4PJMA 5FY1A 1N34T 2XASB 3FZHB 1QSDA 2UU9T 2NW9A 2IUBA 2YKSA 4QHOA 4PFOA 4Z90A 5FVKA 3FXEB 5HEOA 5CB4E 3VR9A 2X9WA 3O1IA 3PUSA 3AVSA 3H37A 3T1HT 4AKLA 4AISA 4DR3T 2M6BA 2L9QA 1Z8UA 3HKCE 4X1YE 5FNVE 2ZM8A 3JC6C 2C0SA 2H7VC 2VKDA 5HWYA 3A5XA 1MMGA 4F8HA 2HN1A 2ZMAA 4WBNE 4IDNA 4QH5A 5FP3A 5FMNA 3AA1B 1OWAA 3AAAB 4HFDA 2B76A 4DBQA 5L3CB 4JI6T 3HKBE 3AB3B 1WR0A 4HTEA 2F4VT 2CCQA 4AKGA 2E5LT 2WDQA 5IWAT 4LFBT 5GONE 3EDUA 5EK3A 2W4XA 2V7LA 2KSRA 2YN6A 2CWOA 3IEEA 3K1SA 5FYMA 2EHOC 4DMWA 5CA0E 3QOFA 3RIUA 5ADXL 1FJGT 3UULA 3ZC1A 3RYHE 1HG2A 2CHOA 2G0UA 4HWIB 2YINA 3UFGA 2I59A 5TAOA 4BJNA 4YXDA 2VWAA 4TX5A 3ZEFB 2Q9QC 2CA5A 2RP4A 4EYUA 5KMGP 4TV8E 2QRXA 4H63H 2C5KT 2PBIA 5LMUT 2XZEA 4ZXLA 3KDSE 2YOEA 3CQCB 4H63V 4U2YA 5LBQB 5L3DB 4DV2T 2P9BA 2XQAA 3LBXA 3ZLIA 2YDSA 4IIJE 4DR2T 4CN6A 1IZNB 5IYZE 4UEMA 1CUNA 1HCIA 1LVKA 3QK6A 1OEDE 4IE4A 1OEDC 1LRZA 4X65T 2PTFA 2XSAA 1ZEEA 3OKQA 3PUVF 4DV0T 4QXHB 2WWUA 2W00A 2E9XC 3AEBA 1KFYA 2WZHA 4FI5A 4TWDA 3RIAA 2Q9QB 4DV5T 5LHIB 1IAPA 3ZMZB 3VU7H 4CXWA 4AQYT 3RIFA 4NXMT 4GKJT 2MPKA 3O1JA 4Z8XA 3TLSA 1WYBA 5IUXA 2VKOA
chains in the Genus database with same CATH topology
2UUCT 4LF6T 4JI5T 1XNQT 4LFAT 4X66T 2HHHT 3T1YT 4DR6T 4DV7T 2UUBT 4X64T 4B3ST 1XMQT 2UXDT 4OX9T 1N33T 1XMOT 4YY3T 4DR7T 4JI2T 4NXNT 4LF9T 1HNZT 4JI1T 4B3MT 4X62T 3OTOT 4JI4T 2VQET 1I94T 4DV1T 4LF8T 4DV3T 4JI7T 4LF7T 2UU9T 1N34T 2ZM6T 1N36T 4K0KT 1HR0T 2UUAT 4DV4T 4DV6T 1IBMT 4JI6T 4DR5T 4JI0T 3T1HT 1XNRT 2E5LT 4B3TT 4JV5T 5IWAT 4LFBT 4DUYT 1J5ET 4JI8T 1FJGT 4JYAT 1N32T 4GKKT 4DR3T 4B3RT 5BR8T 2VQFT 5LMUT 4KHPT 1HNXT 4DR4T 4DV2T 4DR1T 2F4VT 4DR2T 4X65T 4LF4T 4JI3T 4DV0T 4LF5T 5LMNT 4DV5T 2UXCT 4AQYT 4NXMT 4LFCT 4GKJT 4DUZT 1IBLT 4YHHT 1HNWT 2UXBT 1IBKT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC T;  4LF6 T;  4JI5 T;  1XNQ T;  4LFA T;  4X66 T;  2HHH T;  3T1Y T;  4DR6 T;  4DV7 T;  2UUB T;  4X64 T;  4B3S T;  1XMQ T;  2UXD T;  4OX9 T;  1N33 T;  1XMO T;  4YY3 T;  4DR7 T;  4JI2 T;  4NXN T;  4LF9 T;  1HNZ T;  4JI1 T;  4B3M T;  4X62 T;  3OTO T;  4JI4 T;  2VQE T;  1I94 T;  4DV1 T;  4LF8 T;  4DV3 T;  4JI7 T;  4LF7 T;  2UU9 T;  1N34 T;  2ZM6 T;  1N36 T;  4K0K T;  1HR0 T;  2UUA T;  4DV4 T;  4DV6 T;  1IBM T;  4JI6 T;  4DR5 T;  4JI0 T;  3T1H T;  1XNR T;  2E5L T;  4B3T T;  4JV5 T;  5IWA T;  4LFB T;  4DUY T;  1J5E T;  4JI8 T;  1FJG T;  4JYA T;  1N32 T;  4GKK T;  4DR3 T;  4B3R T;  5BR8 T;  2VQF T;  5LMU T;  4KHP T;  1HNX T;  4DR4 T;  4DV2 T;  4DR1 T;  2F4V T;  4DR2 T;  4X65 T;  4LF4 T;  4JI3 T;  4DV0 T;  4LF5 T;  5LMN T;  4DV5 T;  2UXC T;  4AQY T;  4NXM T;  4LFC T;  4GKJ T;  4DUZ T;  1IBL T;  4YHH T;  1HNW T;  2UXB T;  1IBK T; 
#chains in the Genus database with same CATH topology
 4ZZB A;  3DP7 A;  3N2K E;  3RC8 A;  2X68 A;  2D2S A;  3N9N A;  4IDQ A;  4NPP A;  1M7K A;  1YD8 G;  3OJA A;  2DNX A;  4PJJ A;  2B1E A;  2XAG B;  2QYW A;  4UV9 B;  3PUG A;  4IE0 A;  4LF6 T;  3PUY F;  3TKL B;  3L09 A;  3AXJ B;  4I55 E;  2LOS A;  2JQH A;  3O1H A;  2RPA A;  4UXN B;  4IL9 A;  4K0U A;  3HR0 A;  3UTK A;  3ZJ2 A;  5JQG E;  3T1Y T;  5FY7 A;  4GK5 E;  5LGT B;  3FZF B;  4DR6 T;  1YKH B;  2VVN A;  3NRX A;  5JRC B;  2BKO A;  2Q9Q D;  4JEH B;  5F8P A;  4UVA B;  4UIG A;  3EI0 A;  2Y48 B;  4ZOL E;  3C4X A;  2LKG A;  2VB6 A;  4GIW A;  4J2C A;  4X64 T;  2VL0 A;  2KLQ A;  2YU2 A;  3KBU A;  4CXY A;  4B3S T;  3ETV A;  4KX6 A;  1O3X A;  2CHN A;  1N33 T;  3PUR A;  5DQW A;  5LCY A;  2DWG A;  3SFE A;  4ZI3 D;  4UF0 A;  2Z6E A;  5H6Q B;  5HEG A;  2WZI A;  3KV9 A;  5AQN B;  2IC6 A;  4I50 E;  3SS1 A;  3TLW A;  2E9X D;  4HN9 A;  3N2G E;  4QX7 B;  5JTG A;  4I4T E;  1BR4 A;  2I6H A;  1QLB A;  4O8S A;  2NW8 A;  3EAB A;  5JVD E;  2IIU A;  3AEC A;  2JRK A;  5LJM A;  4TNW A;  3R6N A;  2BG9 A;  2WU5 A;  1G8X A;  1S94 A;  3LSV A;  3ZCJ A;  4EYY R;  4YSZ A;  1WYC A;  3UU6 A;  3PU3 A;  3CX8 B;  4EXT A;  3I0Q A;  2LLY A;  1WFD A;  3AE3 A;  4KP3 C;  3ZT5 A;  5LYJ E;  4GYR A;  4Q25 A;  3JCF A;  4PNI A;  5HYA A;  4U31 A;  5AQF B;  2DCF A;  1SHZ C;  2PJQ A;  3Q9D A;  4LMJ A;  4YJ3 E;  2BS4 A;  3G06 A;  1T98 A;  5ABG A;  2WMO A;  4PK4 A;  2CXF A;  2H3R A;  3PU8 A;  2V1D B;  2LHN A;  2V5D A;  5H6R B;  3ZSS A;  4A98 A;  4CXX A;  1N36 T;  3B5M A;  3HKD E;  1YQ3 A;  4L5G A;  3H3A A;  4YSY A;  1I6Z A;  2D0U A;  3BQK A;  4H9N C;  1MMA A;  2X66 A;  5AQH B;  4YLH A;  2NP9 A;  3UUX B;  4G2A A;  3ZMU B;  4HWD A;  2V26 A;  4DBR A;  5ABF B;  5JR9 C;  3C64 A;  4JLE A;  3CKD A;  4HKA A;  1MIV A;  2V6Y B;  2UUA T;  3ESL A;  4LML A;  4HGA A;  1SUM B;  1KNR A;  3B13 A;  4DV4 T;  4DV6 T;  3LJC A;  1E7P A;  2XAJ B;  4ANJ A;  2WS3 A;  4U2Z A;  4DR5 T;  4JI0 T;  5JRE A;  3RX6 A;  3CX6 B;  4UVB B;  2UXX B;  3OVU A;  2HN2 A;  3ZT6 A;  5CJ5 A;  3HI2 A;  4B3T T;  4JV5 T;  4NUV A;  2LHR A;  4UR9 A;  5J2U E;  5ABH A;  3UU8 A;  1V9D A;  1FIO A;  2LRK A;  3F31 A;  4GOU A;  1WCR A;  5HXH A;  1VCS A;  1J5E T;  3UU4 A;  3LFM A;  3Q5D A;  2LSI A;  5JDH A;  1OED B;  5HEH A;  4QXB B;  4JYA T;  5JR9 B;  4L9I A;  4GKK T;  1UX5 A;  3AEE A;  1VRB A;  2IDO B;  3NVO A;  5FXX A;  4JEU B;  4YTP A;  5FVL A;  5M4Y A;  3K3N A;  5HEU A;  2LEH A;  3SFD A;  3UQ7 A;  3RKG A;  4HEA A;  3W15 B;  5JH7 E;  1NAF A;  3MK7 C;  1D0Y A;  3RH3 A;  3RYF E;  1FEW A;  1KEY A;  1S35 A;  2LSG A;  4TUY E;  2CLY C;  4XAX B;  3QB5 A;  2HPL A;  4I43 B;  4HFI A;  2M6I A;  2K3W A;  4DR1 T;  3H3M A;  4DR4 T;  5HCJ A;  3C98 B;  2JIW A;  5AQG B;  4LF4 T;  2XQY A;  4JBW F;  4QXC B;  2MAW A;  1CHU A;  3AE1 A;  4A5X A;  1DU2 A;  4ASK A;  1W9R A;  3O4X E;  2X9X A;  2E5V A;  3K3O A;  3S4U A;  3MAC A;  1US7 B;  2D9D A;  3RYC E;  2M67 A;  1X79 A;  2X9Y A;  5HXE A;  1D0Z A;  5ABF A;  2IW5 B;  3ZMT B;  3RGL A;  3UUM A;  1WRD A;  4CN4 A;  1R8I A;  5F3J A;  4IL4 A;  1IBL T;  3ZC0 A;  1BR0 A;  3PJA A;  2CE7 A;  1JNR A;  3GA8 A;  1IBK T;  2DWK A;  2N1G A;  5F5W A;  5FL0 A;  4IE7 A;  4CI2 B;  2KZ7 B;  4HFE A;  4UEL A;  4EZ4 A;  3CVR A;  2UUC T;  4JI5 T;  4EGW A;  3NKZ A;  4OYJ A;  3AVR A;  2KWI B;  1YKE B;  1LKX A;  2BG9 B;  3CQX C;  5AQO B;  1UUS A;  4IGU A;  4X66 T;  5AQJ B;  2E8I A;  3PJA J;  3AE2 A;  4DO0 A;  2CXL A;  2FJA A;  2C5I T;  5CA1 E;  3AEA A;  2KIN B;  2ODU A;  3N9Q A;  2BBJ A;  2ZM2 A;  3CML A;  3CX7 B;  4MFR A;  4AKI A;  3ZYL A;  1KK7 A;  4DV7 T;  3E22 E;  3I9Y A;  2N9D A;  3PE0 A;  5L2L A;  5KDM C;  3OPC A;  3LDQ B;  4HFC A;  4PJN A;  2SPC A;  5LHG B;  3FBZ A;  1XMQ T;  3K3Q C;  4WW0 A;  1UCU A;  2LKH A;  3IA3 A;  1T72 A;  3L3P A;  3AA0 B;  1HX1 B;  3C4W A;  3OYX A;  3UFE A;  3ZJ1 A;  4BAY B;  4XBF B;  2AXD S;  3DJB A;  4YY3 T;  4HWF A;  2A9U A;  1UK5 A;  5LHH B;  4DR7 T;  4PK5 A;  3FZK B;  3FBL A;  4UF0 B;  3E0Z A;  4NXN T;  3AAI A;  2IC9 A;  1UX4 A;  5AQI B;  3I1A A;  4TN7 B;  4EB6 E;  2V6Y A;  3P7I A;  4X62 T;  1D0X A;  2LOP A;  4HWH A;  4ZI2 D;  2E2A A;  5AQM B;  4YTN A;  3UUB A;  3WAJ A;  3F2E A;  5DAB A;  3EDV A;  4C90 A;  2D5U A;  2K24 A;  3NWI A;  4HWC A;  2WB5 A;  4ILU A;  1T8B A;  1SE7 A;  3MXZ A;  2CBJ A;  3J9X 1;  2X51 A;  3P4R A;  5LG3 A;  2KWH A;  1IJ6 A;  5LBM A;  2JQ9 A;  2KND A;  2V7J A;  4A97 A;  3HKE E;  5JDN A;  2EHO D;  2FJB A;  2QGS A;  2V7K A;  5J0Z A;  2XQ4 A;  4H9Q C;  1ZKE A;  2LE8 A;  3CK6 A;  4LF8 T;  3RPU A;  3EHZ A;  4JI7 T;  2Y8D A;  2V8S V;  4A56 A;  4CQI A;  2A2F X;  2EHO B;  3Q2M A;  4LF7 T;  4O4L E;  4ZZC A;  1KNZ A;  3GN5 A;  3SWH A;  4PFP A;  3AA7 B;  4IST A;  3ZT7 A;  3E08 A;  1E1H B;  5HEJ A;  1ZOY A;  3RYI E;  3WI3 A;  4AQF C;  2VKJ A;  4K0K T;  2BS2 A;  5LNK A;  2HH7 A;  5AQS B;  3PTR B;  1XDP A;  3RKO A;  1HR0 T;  4O4H E;  4X5T A;  1YQ4 A;  2WBL A;  4LMK A;  4U72 A;  4G63 A;  5FXZ A;  1ZP0 A;  3ZYK A;  5AQT B;  4U33 A;  5HXC A;  3RRC A;  3OBV E;  2YU1 A;  2J4G A;  3U78 A;  1OED A;  2DI4 A;  5JDM A;  2MBG A;  2VAS A;  3NBX X;  1L0V A;  3AED A;  3N9M A;  3LBX B;  3ZMV B;  3Q5E A;  5AQP B;  4EOZ B;  4QH1 A;  3AA6 B;  5C3J A;  2XHE B;  2YEV C;  4HE8 A;  4U74 A;  4X1I E;  4EAH A;  5L4E A;  5L47 A;  2PG8 A;  3FZM B;  2J1D G;  3JAD A;  3P8C D;  4FJO A;  4PAG A;  4QX8 B;  5AQV B;  5LB7 B;  2BBH A;  1Y01 A;  2YK0 A;  4IE6 A;  4CN1 A;  4ZI7 E;  2KMF A;  2KXP B;  4WYV A;  3RF1 A;  5C2T A;  4ZHQ E;  1W0B A;  1N32 T;  4MBQ A;  2L8K A;  3CIR A;  5EK4 A;  3CQG B;  3R84 B;  2K9A A;  3OYZ A;  4YFS A;  1Y64 B;  3VHL A;  3KVB A;  4P0B A;  5KXJ A;  2XAQ B;  2JQK A;  1BR1 A;  3CWZ B;  4MLK A;  3AE8 A;  2FBW A;  2LRL A;  1ZHC A;  2J62 A;  2K5B B;  2W63 A;  3B57 A;  3QC9 A;  3LK4 2;  1LVF A;  4IDP A;  1EZ3 A;  2HPJ A;  5FKY A;  3CPZ A;  5HAX A;  2NW7 A;  1HNX T;  1OXZ A;  2JJ9 A;  2QA7 A;  4WZX A;  2CRB A;  5DJQ C;  2J47 A;  4OHF A;  1WLX A;  2LSK A;  4EED A;  5A1L A;  4TV9 E;  4EV6 A;  4LF5 T;  2A72 A;  2JQQ A;  3PV0 F;  4MHC A;  5LOV E;  5LMN T;  2EHO A;  2OV9 A;  2VVS A;  3LG7 A;  4F6R C;  2UXC T;  3ONJ A;  1KF6 A;  4QWN B;  4YHJ A;  4WBO A;  1HTJ F;  4LFC T;  2YDR A;  3RQW A;  4YHH T;  3N9L A;  4QH4 A;  5HWX A;  4AKH A;  4E7S A;  1MIY A;  3BK9 A;  2OA5 A;  2QVA A;  2WAU A;  5L3F B;  3QB5 K;  2DL1 A;  3QUJ A;  5JDQ A;  3KV5 A;  2OLT A;  1XNQ T;  3PUZ F;  3GN5 B;  2Y6X A;  2BG9 E;  2R6G F;  3ETU A;  2HHH T;  2VK9 A;  3K8P C;  3AE7 A;  4TWH A;  3MJX A;  3TLV A;  1VOM A;  3UT5 E;  2DHR A;  4HFB A;  4O2A E;  3VR8 A;  1JNZ A;  2L3L A;  4GYS A;  1SA0 E;  3V5U A;  1MMD A;  1MNE A;  2WDV A;  2CM0 A;  4KMC A;  2XPK A;  4BJM A;  4CI3 B;  3F57 A;  2FJD A;  3C50 A;  5HXR A;  2JMK A;  3P50 A;  4OX9 T;  2NTX A;  2H7O A;  2NTY A;  3HA4 A;  3WAK A;  4YJ2 E;  1XMO T;  3RRW A;  3EUH A;  3ZKR A;  3JC6 D;  1MIW A;  5AQQ B;  4AI6 A;  4O4J E;  2ZLY A;  1UGO A;  2BS3 A;  2PFV A;  4N78 D;  5L3G B;  3AEG A;  3MA9 A;  3MKD A;  4YT0 A;  2H88 A;  1HNZ T;  4LF9 T;  2CXD A;  2MYS A;  3NZQ A;  4OFZ A;  2VUR A;  3UQ4 A;  3UUN A;  5FY0 A;  2CWY A;  4IDZ A;  3VRB A;  3A7M A;  4PJL A;  3ABV A;  4ZS2 A;  3JAE A;  3AE4 A;  4IHJ E;  3OTO T;  3ZCI A;  2JPF A;  3O9X A;  4AQG A;  2XY8 B;  3Q5W A;  5L3B B;  4JI4 T;  3M65 A;  4H9S E;  4P09 A;  4AQF A;  2IHR 1;  3P4Q A;  4O4I E;  4I0U A;  3RI5 A;  3RLF F;  5C8Y E;  2X0L B;  1I94 T;  1UUR A;  4P1N A;  5CGM A;  3T8O A;  3IF8 B;  3ZN0 B;  4E7Z A;  4AKR B;  3FZL B;  5FXV A;  4HFV A;  5L4H A;  4AXP A;  4NIQ A;  4H9R C;  2XQ3 A;  3J7Y q;  4DVD A;  2ZM6 T;  1W09 A;  2MTQ A;  3KIN B;  3KVA A;  3PUQ A;  5JDL A;  4U3C A;  4L0R A;  5LP6 E;  3AAE B;  4MAL A;  1NEK A;  1MMN A;  4ZS3 A;  4P0A A;  2LSY A;  3ANW B;  4U7I A;  4XZC A;  4IDO A;  4ZI3 C;  4TZ4 C;  3BQL A;  3LK2 B;  4X1K E;  2CLY B;  2LSJ A;  1VCT A;  2LT3 A;  1G73 A;  2E9X B;  1FMW A;  3KV6 A;  4NUU A;  5IHY A;  4COF A;  5FL1 A;  3EVY A;  3RHW A;  3UU3 A;  5ETW A;  4ZI2 C;  3ONL C;  5EK2 A;  5J1G A;  1NEN A;  2W66 A;  1IBM T;  2JMH A;  2KT9 A;  3AE6 A;  4ADZ A;  1E2A A;  5FXW A;  2NOX A;  1MND A;  3N9P A;  4ZEY A;  2X67 A;  2FUP A;  2YDQ A;  3KFW X;  2BDE A;  2XSB A;  5LA6 E;  3BQI A;  5ABE A;  1GQE A;  5AQR B;  1XNR T;  4DND A;  2BZB A;  4AIU A;  4DUY T;  1ZV4 X;  2A3D A;  4H9P C;  4TWF A;  4JI8 T;  2C5J A;  1HX8 A;  1XZY A;  1U4Q A;  3D0T A;  3DTO A;  4H9O C;  4KUM B;  3ZPO A;  5AFU L;  1D1C A;  2WSS V;  1HFA A;  2N2N A;  2V7I A;  2ZM0 A;  3AE5 A;  3P4W A;  2ACZ A;  2LM2 A;  4YTM A;  2XQ5 A;  3I0O A;  3PUW F;  2AE9 A;  4ERR A;  3IHR A;  5L3E B;  3Q5X A;  5EZY E;  2UXN B;  4IRE A;  3ZYM A;  3C4Z A;  5HCM A;  4UVC B;  1NWM X;  2W67 A;  4IT4 A;  4M1P A;  1HG5 A;  3GMI A;  4ILA A;  4KHZ F;  1D1B A;  3V5S A;  5J2T E;  4B3R T;  2UXD T;  2DLR A;  3N2O A;  2WMN A;  3TLU A;  5BR8 T;  2VQF T;  1FMV A;  2WM9 A;  4ISS A;  4KHP T;  1D1A A;  4V1A v;  3RQU A;  3N9O A;  4DID B;  4YSX A;  5AQL B;  1AJ3 A;  1T7S A;  4ILB A;  2WY2 A;  3U3I A;  4BA9 A;  3FHN A;  2CEA A;  4JI3 T;  1YXR A;  5AQU B;  3ZST A;  2ES0 A;  1YW0 A;  2D0T A;  2XQ6 A;  1KNP A;  2I0M A;  4TNV A;  1QUU A;  1J1J A;  2XUE A;  1M62 A;  2X0Y A;  4UV8 B;  2GK9 A;  4JUY A;  1XDO A;  2CBI A;  2V7M A;  4DUZ T;  2VKH A;  3X1D A;  1HNW T;  2XM1 A;  2ACX A;  4U7Y A;  3SOL A;  2UXB T;  2W2U A;  3L39 A;  4EIW A;  2WCA A;  3UU5 A;  5KX5 E;  3ZN1 B;  1Z0P A;  1U5P A;  2WDR A;  3JAF A;  4PK6 A;  2V6X A;  2CPT A;  5CFB A;  2RA1 A;  2XQ9 A;  4IE5 A;  3TLT A;  4CI1 B;  5LG4 A;  4LFA T;  1BR2 A;  2V5C A;  2XAH B;  3FXD B;  4GK0 E;  3ONX A;  4DMV A;  2FJE A;  1H7C A;  2XQ7 A;  3KV4 A;  2LM9 A;  2W0G A;  1X9B A;  2K48 A;  2WP9 A;  5DQV A;  2WWV A;  2CMR A;  4C91 A;  3GWH A;  3NZP A;  2WQY A;  2NWB A;  3EAM A;  5E0O A;  5JR9 A;  4EEB A;  2BVL A;  2UUB T;  5JDF A;  3M3Z B;  1B7T A;  2W61 A;  3NRY A;  4CZZ B;  3L8R A;  4EZH A;  3QNU A;  4O2B E;  4HFH A;  2ODV A;  3VKG A;  3PUX F;  3VKH A;  2H89 A;  3P4P A;  5LGU B;  1XWM A;  4JI2 T;  5BMV E;  2XAF B;  3P4S A;  3N5L A;  2NR4 A;  2BKN A;  2X9H A;  3IBP A;  4ILC A;  4OK0 A;  2XM2 A;  4PW8 A;  2XQ8 A;  4KBM B;  4X20 E;  3SRZ A;  3PUA A;  4JI1 T;  4B3M T;  5JRC A;  3AEF A;  1W0A A;  1HF8 A;  2BVM A;  3PDY A;  3RC3 A;  5HXS A;  1WR6 A;  2E9X A;  4QKN A;  2IAK A;  4WNK A;  2XTL A;  3VRA A;  3RIU C;  2BKP A;  2IML A;  3AXJ A;  2BG9 C;  2XJ7 A;  3LK3 B;  1J5W A;  2LJL A;  4B6X A;  1IJ5 A;  5LJN A;  3A8Y C;  5AQK B;  2MOZ A;  4OYK A;  5JDG A;  2VQE T;  3HL6 A;  1HS7 A;  3I9W A;  2W62 A;  3C51 A;  3KBT A;  2WU2 A;  2VL8 A;  3AE9 A;  5LGN B;  4KI0 F;  4Z91 A;  5LXT E;  4DV1 T;  2X0H A;  3ZMS B;  4DV3 T;  3MZK B;  3FB2 A;  2Q9Q A;  3ANW A;  4PJM A;  5FY1 A;  1N34 T;  2XAS B;  3FZH B;  1QSD A;  2UU9 T;  2NW9 A;  2IUB A;  2YKS A;  4QHO A;  4PFO A;  4Z90 A;  5FVK A;  3FXE B;  5HEO A;  5CB4 E;  3VR9 A;  2X9W A;  3O1I A;  3PUS A;  3AVS A;  3H37 A;  3T1H T;  4AKL A;  4AIS A;  4DR3 T;  2M6B A;  2L9Q A;  1Z8U A;  3HKC E;  4X1Y E;  5FNV E;  2ZM8 A;  3JC6 C;  2C0S A;  2H7V C;  2VKD A;  5HWY A;  3A5X A;  1MMG A;  4F8H A;  2HN1 A;  2ZMA A;  4WBN E;  4IDN A;  4QH5 A;  5FP3 A;  5FMN A;  3AA1 B;  1OWA A;  3AAA B;  4HFD A;  2B76 A;  4DBQ A;  5L3C B;  4JI6 T;  3HKB E;  3AB3 B;  1WR0 A;  4HTE A;  2F4V T;  2CCQ A;  4AKG A;  2E5L T;  2WDQ A;  5IWA T;  4LFB T;  5GON E;  3EDU A;  5EK3 A;  2W4X A;  2V7L A;  2KSR A;  2YN6 A;  2CWO A;  3IEE A;  3K1S A;  5FYM A;  2EHO C;  4DMW A;  5CA0 E;  3QOF A;  3RIU A;  5ADX L;  1FJG T;  3UUL A;  3ZC1 A;  3RYH E;  1HG2 A;  2CHO A;  2G0U A;  4HWI B;  2YIN A;  3UFG A;  2I59 A;  5TAO A;  4BJN A;  4YXD A;  2VWA A;  4TX5 A;  3ZEF B;  2Q9Q C;  2CA5 A;  2RP4 A;  4EYU A;  5KMG P;  4TV8 E;  2QRX A;  4H63 H;  2C5K T;  2PBI A;  5LMU T;  2XZE A;  4ZXL A;  3KDS E;  2YOE A;  3CQC B;  4H63 V;  4U2Y A;  5LBQ B;  5L3D B;  4DV2 T;  2P9B A;  2XQA A;  3LBX A;  3ZLI A;  2YDS A;  4IIJ E;  4DR2 T;  4CN6 A;  1IZN B;  5IYZ E;  4UEM A;  1CUN A;  1HCI A;  1LVK A;  3QK6 A;  1OED E;  4IE4 A;  1OED C;  1LRZ A;  4X65 T;  2PTF A;  2XSA A;  1ZEE A;  3OKQ A;  3PUV F;  4DV0 T;  4QXH B;  2WWU A;  2W00 A;  2E9X C;  3AEB A;  1KFY A;  2WZH A;  4FI5 A;  4TWD A;  3RIA A;  2Q9Q B;  4DV5 T;  5LHI B;  1IAP A;  3ZMZ B;  3VU7 H;  4CXW A;  4AQY T;  3RIF A;  4NXM T;  4GKJ T;  2MPK A;  3O1J A;  4Z8X A;  3TLS A;  1WYB A;  5IUX A;  2VKO A; 
#chains in the Genus database with same CATH homology
 2UUC T;  4LF6 T;  4JI5 T;  1XNQ T;  4LFA T;  4X66 T;  2HHH T;  3T1Y T;  4DR6 T;  4DV7 T;  2UUB T;  4X64 T;  4B3S T;  1XMQ T;  2UXD T;  4OX9 T;  1N33 T;  1XMO T;  4YY3 T;  4DR7 T;  4JI2 T;  4NXN T;  4LF9 T;  1HNZ T;  4JI1 T;  4B3M T;  4X62 T;  3OTO T;  4JI4 T;  2VQE T;  1I94 T;  4DV1 T;  4LF8 T;  4DV3 T;  4JI7 T;  4LF7 T;  2UU9 T;  1N34 T;  2ZM6 T;  1N36 T;  4K0K T;  1HR0 T;  2UUA T;  4DV4 T;  4DV6 T;  1IBM T;  4JI6 T;  4DR5 T;  4JI0 T;  3T1H T;  1XNR T;  2E5L T;  4B3T T;  4JV5 T;  5IWA T;  4LFB T;  4DUY T;  1J5E T;  4JI8 T;  1FJG T;  4JYA T;  1N32 T;  4GKK T;  4DR3 T;  4B3R T;  5BR8 T;  2VQF T;  5LMU T;  4KHP T;  1HNX T;  4DR4 T;  4DV2 T;  4DR1 T;  2F4V T;  4DR2 T;  4X65 T;  4LF4 T;  4JI3 T;  4DV0 T;  4LF5 T;  5LMN T;  4DV5 T;  2UXC T;  4AQY T;  4NXM T;  4LFC T;  4GKJ T;  4DUZ T;  1IBL T;  4YHH T;  1HNW T;  2UXB T;  1IBK T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...