4DV5T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv5T00
2VQFT 1FJGT 4LF7T 4X62T 4NXMT 4YHHT 2UXBT 4YY3T 4DV5T 2HHHT 1XNRT 4JI6T 2UXCT 4LFCT 5BR8T 1XMQT 4DV7T 4LFBT 4JI7T 4DV1T 1XMOT 1HNXT 2F4VT 1N36T 4K0KT 2VQET 4JI8T 4DR2T 2UUAT 4B3ST 4X64T 4JI3T 4DR1T 4DV2T 1I94T 4JV5T 2ZM6T 4GKKT 3OTOT 4B3MT 1N34T 4DV6T 3T1HT 5IWAT 4LF4T 4X66T 4KHPT 1XNQT 4LF8T 1IBMT 4DUYT 1HNWT 4DV3T 2UUBT 4X65T 1J5ET 5LMNT 4DUZT 4JI0T 4OX9T 4DR7T 4B3RT 4DR6T 4DV0T 4GKJT 1HNZT 4NXNT 4DR5T 2UU9T 5LMUT 2E5LT 1IBLT 4JYAT 4JI5T 2UUCT 4JI4T 1N33T 4JI2T 4DR4T 1HR0T 4JI1T 4LF5T 1N32T 4B3TT 3T1YT 4DV4T 4LFAT 4LF6T 4DR3T 2UXDT 4AQYT 1IBKT 4LF9T
chains in the Genus database with same CATH superfamily
4NIQA 2VQFT 4NXMT 3ZSTA 4C91A 1NWMX 4DV5T 4G63A 3CKDA 2VL0A 3NKZA 1XMQT 5GONE 5LJMA 2I0MA 4GYRA 3ZMVB 2LJLA 2X68A 4TV9E 3UU6A 3ZKRA 2V26A 2W67A 1US7B 3PUQA 3K3NA 3PUYF 3VKGA 4IT4A 2J47A 3ZSSA 4Z90A 1FEWA 2DL1A 1GQEA 2QYWA 1J5ET 2M6IA 2D0TA 5AQRB 2YKSA 1LKXA 2BVMA 3O1HA 1WYBA 3OKQA 5HXHA 3ZJ1A 2XQ5A 1X79A 3MJXA 4QHOA 2H7VC 2AE9A 2UUCT 3RIAA 1HG5A 3AEGA 5ABGA 4NPPA 2E5VA 2CBJA 2XAFB 5LGNB 1YQ3A 4EGWA 2NTXA 2EHOB 2BKNA 5LBMA 3QC9A 3VHLA 4A5XA 1T7SA 4EEBA 2L8KA 4DV7T 1KEYA 5AQVB 3ANWB 1ZHCA 4TWHA 5LG3A 1D0ZA 2WDVA 3UU3A 2VQET 4JI8T 3IEEA 3ZEFB 4X64T 3AE2A 2XJ7A 2L9QA 4KX6A 2J62A 4Z8XA 2LKGA 4LF8T 2CMRA 3FZMB 4HFHA 4PJLA 4QX7B 2UUBT 3RIUC 4F8HA 2XPKA 4HFDA 1VCSA 1HG2A 1CHUA 3Q9DA 1NENA 4QXCB 4HWFA 3AEFA 3TKLB 3BQLA 1X9BA 1YQ4A 4DMWA 5F3JA 3K3QC 5ABHA 5LA6E 4OYKA 4EEDA 3CK6A 4HKAA 2P9BA 2J4GA 2E5LT 3ONJA 1D1CA 4TX5A 5CA1E 5HEGA 2IC6A 1U5PA 4HFEA 2LSGA 2W63A 2W62A 5L3CB 5HWYA 4ISTA 3QNUA 2KLQA 2BKPA 4AQYT 4LF9T 2CXLA 5AQHB 2XM2A 2NOXA 3KDSE 2XTLA 3ONXA 2MBGA 3H3AA 5JR9B 4QH5A 1XWMA 3TLVA 2GK9A 3MA9A 3P4QA 1MMDA 2HPLA 2LSJA 5HEOA 2VKHA 4ZI7E 3P4SA 3UT5E 2E8IA 5HEUA 4B3ST 4WYVA 4DVDA 1KNZA 4HGAA 4UXNB 3AEAA 2JQHA 4PAGA 1D1AA 2RP4A 4IDZA 4U3CA 4YTMA 2YDSA 2PFVA 4LMKA 3KBUA 4CI3B 1IBMT 4DUYT 1HNWT 4KHZF 2CWOA 4X65T 1OEDE 4KUMB 5L4HA 4HWIB 3RGLA 2XQ9A 4CN4A 5C3JA 4HFBA 5DABA 5HXEA 4EB6E 2V5DA 3PUWF 3PUVF 1N33T 4PW8A 3N2KE 2WZHA 3N2GE 1KK7A 2UXXB 1D0XA 4ZS2A 3BQIA 1M62A 3T1YT 4H63H 3CPZA 5H6RB 5LG4A 2YDQA 3IBPA 2BS4A 2BDEA 4HWCA 4HFVA 4IDNA 2MYSA 4EZ4A 2X9WA 2K3WA 4IE6A 4IL9A 3HL6A 4IGUA 1ZEEA 1WR0A 2B1EA 4KBMB 4ZZCA 2BG9C 5L4EA 2VKOA 3RRWA 4L0RA 2CEAA 4O4LE 3HI2A 2JMKA 1JNZA 4LFBT 5LBQB 5LHIB 4UF0A 5CFBA 5LXTE 3P4RA 4K0KT 4YXDA 3D0TA 5AQPB 2W2UA 4PK5A 5LCYA 2LEHA 2Y6XA 3ETVA 4WW0A 2SPCA 4YTNA 4Q25A 2EHOC 3JAEA 4JV5T 4HEAA 2X51A 3F2EA 4UV9B 2R6GF 4ZHQE 3ONLC 2H89A 3LK2B 2X67A 5F8PA 3J9X1 4TV8E 2WM9A 3C51A 3AE5A 5FXVA 5CJ5A 2PBIA 2LE8A 1VOMA 2J1DG 1MMGA 5J1GA 5AQQB 2V5CA 4ASKA 3ZT5A 2N9DA 5AQKB 2BBHA 4DR5T 2PG8A 5FKYA 1MIWA 2HPJA 4ISSA 4PNIA 3UTKA 1CUNA 4GK0E 4EV6A 4JI5T 3KV9A 3CX7B 3RLFF 3UU4A 2XSAA 4PFPA 4EXTA 2VWAA 4UV8B 3AEEA 1UX4A 4CI1B 2QVAA 4H9SE 3RHWA 1FJGT 5JDQA 2ODVA 2UXBT 4XZCA 2WMOA 2DCFA 2X0HA 2WMNA 2LOSA 5JREA 2ZMAA 2W4XA 3V5UA 4UVAB 2FBWA 2WP9A 5FVKA 2CA5A 3N9NA 2DNXA 5ADXL 3H37A 3LFMA 5LP6E 4ZEYA 4YJ3E 2V7MA 3RKGA 5JR9C 1OEDA 2M67A 1Z8UA 1D1BA 2WWUA 2B76A 3UUMA 1AJ3A 5M4YA 1XDOA 1W0BA 4KMCA 2WQYA 2WZIA 4QH4A 4O4HE 4IE7A 1Y01A 5ABFA 5C8YE 4WBOA 2D5UA 2CPTA 4OYJA 1HNZT 2W00A 3AE3A 3AXJA 2WDRA 3N9PA 3HKCE 4PFOA 4AKHA 5AQTB 5EZYE 2VK9A 3UQ4A 1UK5A 2ACZA 4ZZBA 5DJQC 1N32T 5KDMC 4JBWF 5JRCB 4F6RC 2IC9A 1E1HB 4TWFA 4XBFB 4P09A 3J7Yq 3SFDA 1W9RA 5IHYA 4Z91A 4UIGA 2IUBA 5JDGA 2X9HA 5JDFA 5CA0E 3Q5XA 2YOEA 3HKDE 1BR2A 2C5KT 1XNRT 3E0ZA 2E9XA 3TLWA 4DV1T 2CLYC 2VVSA 2X66A 4I55E 3RPUA 1XDPA 4YLHA 2ACXA 3GWHA 3JC6D 1O3XA 3P4PA 3GMIA 1ZV4X 2Y48B 1NEKA 2KSRA 4JI3T 3AA0B 2NR4A 3VKHA 4KI0F 2K48A 4KP3C 4X5TA 3K8PC 5EK4A 3MXZA 1IJ5A 1LRZA 2NW9A 3RH3A 1W0AA 2W66A 3QOFA 4PJJA 2V6YB 3AE7A 3T8OA 4UVCB 1M7KA 2KZ7B 4P0BA 2V7LA 4GIWA 4TZ4C 3G06A 5A1LA 1YKEB 4ZI3C 1KNRA 3L39A 1IBLT 1B7TA 4QX8B 4O2AE 1H7CA 5AQUB 3ZT6A 3SFEA 3MACA 3RQWA 1MNDA 4H9OC 3OYZA 1S94A 4WZXA 2K9AA 4AI6A 3HR0A 3Q5WA 3C98B 5AQJB 4HWDA 2CXFA 4CI2B 5L3GB 5J2UE 2BG9B 3FZFB 4B6XA 4A97A 3ZLIA 2JPFA 3FXEB 2HN2A 3RRCA 3LK3B 2V1DB 5HEJA 2CXDA 3JAFA 4WNKA 3PDYA 4AISA 1HNXT 4PJNA 1HX1B 5FXWA 3PU8A 2ES0A 3N2OA 1MNEA 2XQ4A 4DNDA 3LSVA 4AQFA 1E2AA 4U31A 2KT9A 1N34T 5IWAT 2VB6A 1XNQT 2BS3A 2XASB 4NUUA 1YXRA 3O4XE 5LMNT 2CBIA 3M65A 2VASA 2H88A 3AEBA 1LVFA 3FZHB 5IYZE 1OXZA 2XAJB 1QLBA 4TN7B 4LMLA 3MZKB 3SS1A 5LGUB 2ZM0A 3NZQA 3HKEE 3B5MA 4IDPA 4UELA 3LBXB 2ZLYA 4QXBB 3L09A 4ILAA 3AEDA 2RA1A 3PUGA 2A72A 3QB5K 3EDUA 3Q2MA 3ZPOA 3U3IA 3WAJA 2DHRA 4ZI2D 4GYSA 3FXDB 3NRYA 2Q9QC 3JADA 2IMLA 5KX5E 2KMFA 1YD8G 2JQKA 3NZPA 4UVBB 3CQGB 1EZ3A 4MHCA 4GOUA 3EHZA 4UR9A 4ZXLA 2LM9A 4B3MT 4LF4T 2YU1A 2E9XC 2LSIA 3RX6A 5HXRA 2CHNA 5KMGP 4DV3T 2LLYA 3AE6A 4U2YA 3RYFE 3ZMSB 5JDLA 2NWBA 2FJDA 5JVDE 4I0UA 2XQYA 5FY0A 2K24A 1MIVA 5TAOA 2VL8A 3AE1A 4G2AA 3W15B 4MLKA 5DQWA 3DJBA 3I0OA 1T72A 2WU2A 3U78A 4LFAT 5JDNA 2C5IT 3C4WA 2WBLA 1XZYA 3AA7B 1MIYA 5AQIB 4HN9A 3CVRA 2WSSV 3SRZA 2BKOA 2D0UA 5L3EB 4YHHT 3KV6A 3TLSA 4I50E 2WAUA 5L3FB 4LFCT 2CLYB 5BR8T 3BK9A 1UURA 3N9MA 2JQQA 5DQVA 3NBXX 4EOZB 5EK2A 3AE4A 3B57A 1XMOT 3P4WA 2FJEA 3A8YC 2WDQA 2LRKA 3R84B 3UUNA 5AFUL 3HKBE 4J2CA 3OTOT 2OLTA 4L5GA 4E7SA 2JMHA 2XQ8A 3UQ7A 4UF0B 4BA9A 3AAIA 3I1AA 2JIWA 3CMLA 2FJBA 2G0UA 2PTFA 4I43B 1MMAA 3KINB 4AQFC 4DR7T 3VU7H 5HXCA 1L0VA 4DR6T 2H3RA 4DBQA 2CHOA 3UFGA 4YFSA 2WCAA 5BMVE 2YINA 2LRLA 3WI3A 5ABEA 3ZCJA 4B3TT 2KINB 2XQ6A 3OBVE 2HH7A 4IE4A 3VR8A 4YSXA 5HYAA 3FB2A 3SOLA 3LDQB 4EAHA 2BS2A 3AB3B 4MFRA 4N78D 3BQKA 3RKOA 5L3BB 3GN5A 2E2AA 2UXCT 3RF1A 1WR6A 4H9RC 2WB5A 3S4UA 1S35A 2CCQA 2KWIB 2DWGA 3KV4A 2UUAT 4MALA 4DV2T 1IAPA 4A56A 3P50A 2XZEA 2NW7A 3MKDA 4X66T 4X1KE 2OV9A 5E0OA 1SE7A 4IIJE 2LM2A 3CWZB 1Z0PA 2W0GA 3C64A 2BG9E 4CN6A 4GKJT 3FHNA 2K5BB 1ZOYA 2N2NA 4EYUA 2XY8B 5AQOB 2XHEB 3AE8A 3AVRA 3O1IA 2YK0A 5ABFB 4E7ZA 3KV5A 2DLRA 1T98A 3WAKA 4AKLA 3TLUA 3AXJB 2VURA 2ZM2A 3RIUA 2W61A 3AAAB 2LKHA 4BJNA 5F5WA 3VRAA 2Q9QB 3IF8B 2JJ9A 3PUXF 5HEHA 1MMNA 1NAFA 5FL0A 3OPCA 4QKNA 3ZJ2A 2XQ3A 3NWIA 3RIFA 5FXZA 2L3LA 1SHZC 4TNVA 2IAKA 2KNDA 2WWVA 4AQGA 2CRBA 4U72A 4IL4A 1E7PA 4ZS3A 3H3MA 2E9XB 3L8RA 2VKDA 1YKHB 4TWDA 3E22E 4O4IE 4U2ZA 2KXPB 4X1YE 5FXXA 3KVAA 2CWYA 4U33A 3IHRA 3P8CD 4CXYA 3PTRB 4OK0A 5AQGB 3ZMTB 3IA3A 3UULA 1DU2A 3EI0A 1LVKA 3M3ZB 2A2FX 5LJNA 4JLEA 1Y64B 3O9XA 5HAXA 5LOVE 5FL1A 5FVLA 1R8IA 2VKJA 2DWKA 2IDOB 3PUAA 3CX6B 4DV4T 2MOZA 3CX8B 3Q5EA 4FJOA 4YT0A 1QSDA 5J0ZA 4DR3T 3N9QA 1IBKT 4CXWA 2V6YA 2JQ9A 3P7IA 4JEHB 3PU3A 5EK3A 4CZZB 2XQAA 4O2BE 1WCRA 4ANJA 3ZCIA 4COFA 3QK6A 2OA5A 2EHOD 2QGSA 3SWHA 4QH1A 3Q5DA 1FIOA 2F4VT 1N36T 3ABVA 5JDHA 2NTYA 3OJAA 3ZC0A 4AKRB 2MAWA 2I6HA 3RYHE 4EZHA 4DV6T 3RYCE 3ZT7A 4PK6A 3KVBA 4PJMA 1QUUA 2BG9A 4AIUA 2CM0A 3PUSA 3R6NA 1T8BA 3AAEB 2NW8A 4QXHB 1I6ZA 1UCUA 3RC3A 2IW5B 5AQMB 2YU2A 3LJCA 2UU9T 4YJ2E 2BZBA 1WLXA 2MTQA 3UUBA 2EHOA 4H9PC 3ZN1B 3PUZF 3C4XA 5FNVE 4H9QC 2LOPA 2JRKA 3VR9A 3ZC1A 3ANWA 5FP3A 2UXDT 1OEDC 4EIWA 3JCFA 4LF7T 1HX8A 4ILBA 3O1JA 3VRBA 2KWHA 5AQSB 5FMNA 1BR0A 3EUHA 4JI7T 2WS3A 1OWAA 4MBQA 4U74A 5LB7B 4DMVA 3ZYKA 5HXSA 4DR2T 2ZM8A 3C4ZA 3LBXA 2ZM6T 3EDVA 2XAHB 2QA7A 1J5WA 4A98A 4O4JE 3B13A 4PK4A 5ETWA 2WU5A 1WRDA 4DUZT 1VRBA 3I9WA 4OX9T 3C50A 3N9LA 4UEMA 4ERRA 2V7KA 1J1JA 4NXNT 3AA6B 2YDRA 3UUXB 2M6BA 3ZYLA 4JYAT 2UXNB 1UUSA 4CN1A 2VVNA 2XAGB 4YHJA 1ZP0A 5JR9A 4YSYA 1WYCA 2HN1A 2X9YA 3FBZA 2V8SV 3UFEA 4X62T 1UGOA 2C5JA 2FJAA 4HFCA 2YEVC 3EAMA 4U7YA 5LNKA 5L2LA 3EVYA 4TNWA 2Z6EA 3ZN0B 1HTJF 3LG7A 2D2SA 2V6XA 3KFWX 4DO0A 1U4QA 4CXXA 4DR1T 4IDQA 5HWXA 1I94T 3TLTA 5HCMA 4GK5E 2X0YA 3JC6C 4LMJA 4KHPT 4QWNB 2XUEA 4ZOLE 3L3PA 1HS7A 4DBRA 4ZI3D 1UX5A 3LK42 1V9DA 1WFDA 1FMVA 4IREA 4FI5A 4TUYE 5AQNB 3AA1B 2H7OA 3CQCB 4M1PA 2YN6A 5H6QB 3CQXC 3ETUA 5FY1A 5JTGA 2XSBA 4IE0A 1HR0T 5L3DB 4ILCA 3CIRA 4JI1T 4LF5T 2LHRA 1JNRA 3RC8A 2XQ7A 1ZKEA 3DP7A 3F57A 2BVLA 2I59A 3QUJA 3E08A 1SUMB 2XAQB 3AECA 3AVSA 4YSZA 3ZYMA 4OFZA 3V5SA 3ZMUB 4H9NC 2FUPA 4YY3T 2A3DA 5J2TE 2D9DA 3RYIE 2V7JA 3PJAJ 4JI6T 3KBTA 4WBNE 1HFAA 2WY2A 4HWHA 3FZLB 3ZMZB 2LSKA 4IDOA 4BJMA 2XM1A 3MK7C 4X1IE 1KNPA 2V7IA 4BAYB 3AE9A 1HF8A 4YTPA 3DTOA 5AQFB 2N1GA 3GN5B 5C2TA 3K1SA 3PV0F 3N5LA 4GKKT 4AKGA 5IUXA 4IE5A 3UU5A 1HCIA 3K3OA 4ILUA 1W09A 3I0QA 4I4TE 4X20E 5JDMA 5FYMA 2RPAA 1YW0A 5JQGE 5CB4E 5JH7E 2Y8DA 2X0LB 4P0AA 2CE7A 5LGTB 3F31A 1IZNB 1VCTA 4EYYR 3NRXA 3FBLA 3A7MA 3X1DA 1G8XA 4O8SA 3GA8A 5L47A 2DI4A 4HFIA 4DIDB 2NP9A 2X9XA 5CGMA 2Q9QD 1OEDB 4IHJE 2C0SA 3PE0A 2QRXA 3HA4A 4AKIA 1FMWA 4V1Av 1BR1A 1IJ6A 5FY7A 4P1NA 5HCJA 5KXJA 2HHHT 4OHFA 4HTEA 3OVUA 3PURA 2PJQA 4CQIA 3NVOA 5AQLB 3A5XA 2E9XD 2LHNA 2IHR1 2AXDS 4ZI2C 4ADZA 4L9IA 4H63V 3QB5A 5LHHB 1KF6A 2A9UA 5LHGB 1SA0E 4C90A 4JUYA 4AXPA 2LSYA 3T1HT 2ODUA 1BR4A 3EABA 3UU8A 4XAXB 4HE8A 1G73A 4JI0T 2Q9QA 5LYJE 2IIUA 5JRCA 4B3RT 3PJAA 4DV0T 3FZKB 4K0UA 2LT3A 3OYXA 5LMUT 3RI5A 4JI4T 4JI2T 3N9OA 1KFYA 4NUVA 3ESLA 4DR4T 2MPKA 4U7IA 2BBJA 3RQUA 1D0YA 4LF6T 3I9YA 4JEUB
chains in the Genus database with same CATH topology
2VQFT 1FJGT 4LF7T 4X62T 4NXMT 4YHHT 2UXBT 4YY3T 4DV5T 2HHHT 1XNRT 4JI6T 2UXCT 4LFCT 5BR8T 1XMQT 4DV7T 4LFBT 4JI7T 4DV1T 1XMOT 1HNXT 2F4VT 1N36T 4K0KT 2VQET 4JI8T 4DR2T 2UUAT 4B3ST 4X64T 4JI3T 4DR1T 4DV2T 1I94T 4JV5T 2ZM6T 4GKKT 3OTOT 4B3MT 1N34T 4DV6T 3T1HT 5IWAT 4LF4T 4X66T 4KHPT 1XNQT 4LF8T 1IBMT 4DUYT 1HNWT 4DV3T 2UUBT 4X65T 1J5ET 5LMNT 4DUZT 4JI0T 4OX9T 4DR7T 4B3RT 4DR6T 4DV0T 4GKJT 1HNZT 4NXNT 4DR5T 2UU9T 5LMUT 2E5LT 1IBLT 4JYAT 4JI5T 2UUCT 4JI4T 1N33T 4JI2T 4DR4T 1HR0T 4JI1T 4LF5T 1N32T 4B3TT 3T1YT 4DV4T 4LFAT 4LF6T 4DR3T 2UXDT 4AQYT 1IBKT 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF T;  1FJG T;  4LF7 T;  4X62 T;  4NXM T;  4YHH T;  2UXB T;  4YY3 T;  4DV5 T;  2HHH T;  1XNR T;  4JI6 T;  2UXC T;  4LFC T;  5BR8 T;  1XMQ T;  4DV7 T;  4LFB T;  4JI7 T;  4DV1 T;  1XMO T;  1HNX T;  2F4V T;  1N36 T;  4K0K T;  2VQE T;  4JI8 T;  4DR2 T;  2UUA T;  4B3S T;  4X64 T;  4JI3 T;  4DR1 T;  4DV2 T;  1I94 T;  4JV5 T;  2ZM6 T;  4GKK T;  3OTO T;  4B3M T;  1N34 T;  4DV6 T;  3T1H T;  5IWA T;  4LF4 T;  4X66 T;  4KHP T;  1XNQ T;  4LF8 T;  1IBM T;  4DUY T;  1HNW T;  4DV3 T;  2UUB T;  4X65 T;  1J5E T;  5LMN T;  4DUZ T;  4JI0 T;  4OX9 T;  4DR7 T;  4B3R T;  4DR6 T;  4DV0 T;  4GKJ T;  1HNZ T;  4NXN T;  4DR5 T;  2UU9 T;  5LMU T;  2E5L T;  1IBL T;  4JYA T;  4JI5 T;  2UUC T;  4JI4 T;  1N33 T;  4JI2 T;  4DR4 T;  1HR0 T;  4JI1 T;  4LF5 T;  1N32 T;  4B3T T;  3T1Y T;  4DV4 T;  4LFA T;  4LF6 T;  4DR3 T;  2UXD T;  4AQY T;  1IBK T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 4NIQ A;  2VQF T;  4NXM T;  3ZST A;  4C91 A;  1NWM X;  4DV5 T;  4G63 A;  3CKD A;  2VL0 A;  3NKZ A;  1XMQ T;  5GON E;  5LJM A;  2I0M A;  4GYR A;  3ZMV B;  2LJL A;  2X68 A;  4TV9 E;  3UU6 A;  3ZKR A;  2V26 A;  2W67 A;  1US7 B;  3PUQ A;  3K3N A;  3PUY F;  3VKG A;  4IT4 A;  2J47 A;  3ZSS A;  4Z90 A;  1FEW A;  2DL1 A;  1GQE A;  2QYW A;  1J5E T;  2M6I A;  2D0T A;  5AQR B;  2YKS A;  1LKX A;  2BVM A;  3O1H A;  1WYB A;  3OKQ A;  5HXH A;  3ZJ1 A;  2XQ5 A;  1X79 A;  3MJX A;  4QHO A;  2H7V C;  2AE9 A;  2UUC T;  3RIA A;  1HG5 A;  3AEG A;  5ABG A;  4NPP A;  2E5V A;  2CBJ A;  2XAF B;  5LGN B;  1YQ3 A;  4EGW A;  2NTX A;  2EHO B;  2BKN A;  5LBM A;  3QC9 A;  3VHL A;  4A5X A;  1T7S A;  4EEB A;  2L8K A;  4DV7 T;  1KEY A;  5AQV B;  3ANW B;  1ZHC A;  4TWH A;  5LG3 A;  1D0Z A;  2WDV A;  3UU3 A;  2VQE T;  4JI8 T;  3IEE A;  3ZEF B;  4X64 T;  3AE2 A;  2XJ7 A;  2L9Q A;  4KX6 A;  2J62 A;  4Z8X A;  2LKG A;  4LF8 T;  2CMR A;  3FZM B;  4HFH A;  4PJL A;  4QX7 B;  2UUB T;  3RIU C;  4F8H A;  2XPK A;  4HFD A;  1VCS A;  1HG2 A;  1CHU A;  3Q9D A;  1NEN A;  4QXC B;  4HWF A;  3AEF A;  3TKL B;  3BQL A;  1X9B A;  1YQ4 A;  4DMW A;  5F3J A;  3K3Q C;  5ABH A;  5LA6 E;  4OYK A;  4EED A;  3CK6 A;  4HKA A;  2P9B A;  2J4G A;  2E5L T;  3ONJ A;  1D1C A;  4TX5 A;  5CA1 E;  5HEG A;  2IC6 A;  1U5P A;  4HFE A;  2LSG A;  2W63 A;  2W62 A;  5L3C B;  5HWY A;  4IST A;  3QNU A;  2KLQ A;  2BKP A;  4AQY T;  4LF9 T;  2CXL A;  5AQH B;  2XM2 A;  2NOX A;  3KDS E;  2XTL A;  3ONX A;  2MBG A;  3H3A A;  5JR9 B;  4QH5 A;  1XWM A;  3TLV A;  2GK9 A;  3MA9 A;  3P4Q A;  1MMD A;  2HPL A;  2LSJ A;  5HEO A;  2VKH A;  4ZI7 E;  3P4S A;  3UT5 E;  2E8I A;  5HEU A;  4B3S T;  4WYV A;  4DVD A;  1KNZ A;  4HGA A;  4UXN B;  3AEA A;  2JQH A;  4PAG A;  1D1A A;  2RP4 A;  4IDZ A;  4U3C A;  4YTM A;  2YDS A;  2PFV A;  4LMK A;  3KBU A;  4CI3 B;  1IBM T;  4DUY T;  1HNW T;  4KHZ F;  2CWO A;  4X65 T;  1OED E;  4KUM B;  5L4H A;  4HWI B;  3RGL A;  2XQ9 A;  4CN4 A;  5C3J A;  4HFB A;  5DAB A;  5HXE A;  4EB6 E;  2V5D A;  3PUW F;  3PUV F;  1N33 T;  4PW8 A;  3N2K E;  2WZH A;  3N2G E;  1KK7 A;  2UXX B;  1D0X A;  4ZS2 A;  3BQI A;  1M62 A;  3T1Y T;  4H63 H;  3CPZ A;  5H6R B;  5LG4 A;  2YDQ A;  3IBP A;  2BS4 A;  2BDE A;  4HWC A;  4HFV A;  4IDN A;  2MYS A;  4EZ4 A;  2X9W A;  2K3W A;  4IE6 A;  4IL9 A;  3HL6 A;  4IGU A;  1ZEE A;  1WR0 A;  2B1E A;  4KBM B;  4ZZC A;  2BG9 C;  5L4E A;  2VKO A;  3RRW A;  4L0R A;  2CEA A;  4O4L E;  3HI2 A;  2JMK A;  1JNZ A;  4LFB T;  5LBQ B;  5LHI B;  4UF0 A;  5CFB A;  5LXT E;  3P4R A;  4K0K T;  4YXD A;  3D0T A;  5AQP B;  2W2U A;  4PK5 A;  5LCY A;  2LEH A;  2Y6X A;  3ETV A;  4WW0 A;  2SPC A;  4YTN A;  4Q25 A;  2EHO C;  3JAE A;  4JV5 T;  4HEA A;  2X51 A;  3F2E A;  4UV9 B;  2R6G F;  4ZHQ E;  3ONL C;  2H89 A;  3LK2 B;  2X67 A;  5F8P A;  3J9X 1;  4TV8 E;  2WM9 A;  3C51 A;  3AE5 A;  5FXV A;  5CJ5 A;  2PBI A;  2LE8 A;  1VOM A;  2J1D G;  1MMG A;  5J1G A;  5AQQ B;  2V5C A;  4ASK A;  3ZT5 A;  2N9D A;  5AQK B;  2BBH A;  4DR5 T;  2PG8 A;  5FKY A;  1MIW A;  2HPJ A;  4ISS A;  4PNI A;  3UTK A;  1CUN A;  4GK0 E;  4EV6 A;  4JI5 T;  3KV9 A;  3CX7 B;  3RLF F;  3UU4 A;  2XSA A;  4PFP A;  4EXT A;  2VWA A;  4UV8 B;  3AEE A;  1UX4 A;  4CI1 B;  2QVA A;  4H9S E;  3RHW A;  1FJG T;  5JDQ A;  2ODV A;  2UXB T;  4XZC A;  2WMO A;  2DCF A;  2X0H A;  2WMN A;  2LOS A;  5JRE A;  2ZMA A;  2W4X A;  3V5U A;  4UVA B;  2FBW A;  2WP9 A;  5FVK A;  2CA5 A;  3N9N A;  2DNX A;  5ADX L;  3H37 A;  3LFM A;  5LP6 E;  4ZEY A;  4YJ3 E;  2V7M A;  3RKG A;  5JR9 C;  1OED A;  2M67 A;  1Z8U A;  1D1B A;  2WWU A;  2B76 A;  3UUM A;  1AJ3 A;  5M4Y A;  1XDO A;  1W0B A;  4KMC A;  2WQY A;  2WZI A;  4QH4 A;  4O4H E;  4IE7 A;  1Y01 A;  5ABF A;  5C8Y E;  4WBO A;  2D5U A;  2CPT A;  4OYJ A;  1HNZ T;  2W00 A;  3AE3 A;  3AXJ A;  2WDR A;  3N9P A;  3HKC E;  4PFO A;  4AKH A;  5AQT B;  5EZY E;  2VK9 A;  3UQ4 A;  1UK5 A;  2ACZ A;  4ZZB A;  5DJQ C;  1N32 T;  5KDM C;  4JBW F;  5JRC B;  4F6R C;  2IC9 A;  1E1H B;  4TWF A;  4XBF B;  4P09 A;  3J7Y q;  3SFD A;  1W9R A;  5IHY A;  4Z91 A;  4UIG A;  2IUB A;  5JDG A;  2X9H A;  5JDF A;  5CA0 E;  3Q5X A;  2YOE A;  3HKD E;  1BR2 A;  2C5K T;  1XNR T;  3E0Z A;  2E9X A;  3TLW A;  4DV1 T;  2CLY C;  2VVS A;  2X66 A;  4I55 E;  3RPU A;  1XDP A;  4YLH A;  2ACX A;  3GWH A;  3JC6 D;  1O3X A;  3P4P A;  3GMI A;  1ZV4 X;  2Y48 B;  1NEK A;  2KSR A;  4JI3 T;  3AA0 B;  2NR4 A;  3VKH A;  4KI0 F;  2K48 A;  4KP3 C;  4X5T A;  3K8P C;  5EK4 A;  3MXZ A;  1IJ5 A;  1LRZ A;  2NW9 A;  3RH3 A;  1W0A A;  2W66 A;  3QOF A;  4PJJ A;  2V6Y B;  3AE7 A;  3T8O A;  4UVC B;  1M7K A;  2KZ7 B;  4P0B A;  2V7L A;  4GIW A;  4TZ4 C;  3G06 A;  5A1L A;  1YKE B;  4ZI3 C;  1KNR A;  3L39 A;  1IBL T;  1B7T A;  4QX8 B;  4O2A E;  1H7C A;  5AQU B;  3ZT6 A;  3SFE A;  3MAC A;  3RQW A;  1MND A;  4H9O C;  3OYZ A;  1S94 A;  4WZX A;  2K9A A;  4AI6 A;  3HR0 A;  3Q5W A;  3C98 B;  5AQJ B;  4HWD A;  2CXF A;  4CI2 B;  5L3G B;  5J2U E;  2BG9 B;  3FZF B;  4B6X A;  4A97 A;  3ZLI A;  2JPF A;  3FXE B;  2HN2 A;  3RRC A;  3LK3 B;  2V1D B;  5HEJ A;  2CXD A;  3JAF A;  4WNK A;  3PDY A;  4AIS A;  1HNX T;  4PJN A;  1HX1 B;  5FXW A;  3PU8 A;  2ES0 A;  3N2O A;  1MNE A;  2XQ4 A;  4DND A;  3LSV A;  4AQF A;  1E2A A;  4U31 A;  2KT9 A;  1N34 T;  5IWA T;  2VB6 A;  1XNQ T;  2BS3 A;  2XAS B;  4NUU A;  1YXR A;  3O4X E;  5LMN T;  2CBI A;  3M65 A;  2VAS A;  2H88 A;  3AEB A;  1LVF A;  3FZH B;  5IYZ E;  1OXZ A;  2XAJ B;  1QLB A;  4TN7 B;  4LML A;  3MZK B;  3SS1 A;  5LGU B;  2ZM0 A;  3NZQ A;  3HKE E;  3B5M A;  4IDP A;  4UEL A;  3LBX B;  2ZLY A;  4QXB B;  3L09 A;  4ILA A;  3AED A;  2RA1 A;  3PUG A;  2A72 A;  3QB5 K;  3EDU A;  3Q2M A;  3ZPO A;  3U3I A;  3WAJ A;  2DHR A;  4ZI2 D;  4GYS A;  3FXD B;  3NRY A;  2Q9Q C;  3JAD A;  2IML A;  5KX5 E;  2KMF A;  1YD8 G;  2JQK A;  3NZP A;  4UVB B;  3CQG B;  1EZ3 A;  4MHC A;  4GOU A;  3EHZ A;  4UR9 A;  4ZXL A;  2LM9 A;  4B3M T;  4LF4 T;  2YU1 A;  2E9X C;  2LSI A;  3RX6 A;  5HXR A;  2CHN A;  5KMG P;  4DV3 T;  2LLY A;  3AE6 A;  4U2Y A;  3RYF E;  3ZMS B;  5JDL A;  2NWB A;  2FJD A;  5JVD E;  4I0U A;  2XQY A;  5FY0 A;  2K24 A;  1MIV A;  5TAO A;  2VL8 A;  3AE1 A;  4G2A A;  3W15 B;  4MLK A;  5DQW A;  3DJB A;  3I0O A;  1T72 A;  2WU2 A;  3U78 A;  4LFA T;  5JDN A;  2C5I T;  3C4W A;  2WBL A;  1XZY A;  3AA7 B;  1MIY A;  5AQI B;  4HN9 A;  3CVR A;  2WSS V;  3SRZ A;  2BKO A;  2D0U A;  5L3E B;  4YHH T;  3KV6 A;  3TLS A;  4I50 E;  2WAU A;  5L3F B;  4LFC T;  2CLY B;  5BR8 T;  3BK9 A;  1UUR A;  3N9M A;  2JQQ A;  5DQV A;  3NBX X;  4EOZ B;  5EK2 A;  3AE4 A;  3B57 A;  1XMO T;  3P4W A;  2FJE A;  3A8Y C;  2WDQ A;  2LRK A;  3R84 B;  3UUN A;  5AFU L;  3HKB E;  4J2C A;  3OTO T;  2OLT A;  4L5G A;  4E7S A;  2JMH A;  2XQ8 A;  3UQ7 A;  4UF0 B;  4BA9 A;  3AAI A;  3I1A A;  2JIW A;  3CML A;  2FJB A;  2G0U A;  2PTF A;  4I43 B;  1MMA A;  3KIN B;  4AQF C;  4DR7 T;  3VU7 H;  5HXC A;  1L0V A;  4DR6 T;  2H3R A;  4DBQ A;  2CHO A;  3UFG A;  4YFS A;  2WCA A;  5BMV E;  2YIN A;  2LRL A;  3WI3 A;  5ABE A;  3ZCJ A;  4B3T T;  2KIN B;  2XQ6 A;  3OBV E;  2HH7 A;  4IE4 A;  3VR8 A;  4YSX A;  5HYA A;  3FB2 A;  3SOL A;  3LDQ B;  4EAH A;  2BS2 A;  3AB3 B;  4MFR A;  4N78 D;  3BQK A;  3RKO A;  5L3B B;  3GN5 A;  2E2A A;  2UXC T;  3RF1 A;  1WR6 A;  4H9R C;  2WB5 A;  3S4U A;  1S35 A;  2CCQ A;  2KWI B;  2DWG A;  3KV4 A;  2UUA T;  4MAL A;  4DV2 T;  1IAP A;  4A56 A;  3P50 A;  2XZE A;  2NW7 A;  3MKD A;  4X66 T;  4X1K E;  2OV9 A;  5E0O A;  1SE7 A;  4IIJ E;  2LM2 A;  3CWZ B;  1Z0P A;  2W0G A;  3C64 A;  2BG9 E;  4CN6 A;  4GKJ T;  3FHN A;  2K5B B;  1ZOY A;  2N2N A;  4EYU A;  2XY8 B;  5AQO B;  2XHE B;  3AE8 A;  3AVR A;  3O1I A;  2YK0 A;  5ABF B;  4E7Z A;  3KV5 A;  2DLR A;  1T98 A;  3WAK A;  4AKL A;  3TLU A;  3AXJ B;  2VUR A;  2ZM2 A;  3RIU A;  2W61 A;  3AAA B;  2LKH A;  4BJN A;  5F5W A;  3VRA A;  2Q9Q B;  3IF8 B;  2JJ9 A;  3PUX F;  5HEH A;  1MMN A;  1NAF A;  5FL0 A;  3OPC A;  4QKN A;  3ZJ2 A;  2XQ3 A;  3NWI A;  3RIF A;  5FXZ A;  2L3L A;  1SHZ C;  4TNV A;  2IAK A;  2KND A;  2WWV A;  4AQG A;  2CRB A;  4U72 A;  4IL4 A;  1E7P A;  4ZS3 A;  3H3M A;  2E9X B;  3L8R A;  2VKD A;  1YKH B;  4TWD A;  3E22 E;  4O4I E;  4U2Z A;  2KXP B;  4X1Y E;  5FXX A;  3KVA A;  2CWY A;  4U33 A;  3IHR A;  3P8C D;  4CXY A;  3PTR B;  4OK0 A;  5AQG B;  3ZMT B;  3IA3 A;  3UUL A;  1DU2 A;  3EI0 A;  1LVK A;  3M3Z B;  2A2F X;  5LJN A;  4JLE A;  1Y64 B;  3O9X A;  5HAX A;  5LOV E;  5FL1 A;  5FVL A;  1R8I A;  2VKJ A;  2DWK A;  2IDO B;  3PUA A;  3CX6 B;  4DV4 T;  2MOZ A;  3CX8 B;  3Q5E A;  4FJO A;  4YT0 A;  1QSD A;  5J0Z A;  4DR3 T;  3N9Q A;  1IBK T;  4CXW A;  2V6Y A;  2JQ9 A;  3P7I A;  4JEH B;  3PU3 A;  5EK3 A;  4CZZ B;  2XQA A;  4O2B E;  1WCR A;  4ANJ A;  3ZCI A;  4COF A;  3QK6 A;  2OA5 A;  2EHO D;  2QGS A;  3SWH A;  4QH1 A;  3Q5D A;  1FIO A;  2F4V T;  1N36 T;  3ABV A;  5JDH A;  2NTY A;  3OJA A;  3ZC0 A;  4AKR B;  2MAW A;  2I6H A;  3RYH E;  4EZH A;  4DV6 T;  3RYC E;  3ZT7 A;  4PK6 A;  3KVB A;  4PJM A;  1QUU A;  2BG9 A;  4AIU A;  2CM0 A;  3PUS A;  3R6N A;  1T8B A;  3AAE B;  2NW8 A;  4QXH B;  1I6Z A;  1UCU A;  3RC3 A;  2IW5 B;  5AQM B;  2YU2 A;  3LJC A;  2UU9 T;  4YJ2 E;  2BZB A;  1WLX A;  2MTQ A;  3UUB A;  2EHO A;  4H9P C;  3ZN1 B;  3PUZ F;  3C4X A;  5FNV E;  4H9Q C;  2LOP A;  2JRK A;  3VR9 A;  3ZC1 A;  3ANW A;  5FP3 A;  2UXD T;  1OED C;  4EIW A;  3JCF A;  4LF7 T;  1HX8 A;  4ILB A;  3O1J A;  3VRB A;  2KWH A;  5AQS B;  5FMN A;  1BR0 A;  3EUH A;  4JI7 T;  2WS3 A;  1OWA A;  4MBQ A;  4U74 A;  5LB7 B;  4DMV A;  3ZYK A;  5HXS A;  4DR2 T;  2ZM8 A;  3C4Z A;  3LBX A;  2ZM6 T;  3EDV A;  2XAH B;  2QA7 A;  1J5W A;  4A98 A;  4O4J E;  3B13 A;  4PK4 A;  5ETW A;  2WU5 A;  1WRD A;  4DUZ T;  1VRB A;  3I9W A;  4OX9 T;  3C50 A;  3N9L A;  4UEM A;  4ERR A;  2V7K A;  1J1J A;  4NXN T;  3AA6 B;  2YDR A;  3UUX B;  2M6B A;  3ZYL A;  4JYA T;  2UXN B;  1UUS A;  4CN1 A;  2VVN A;  2XAG B;  4YHJ A;  1ZP0 A;  5JR9 A;  4YSY A;  1WYC A;  2HN1 A;  2X9Y A;  3FBZ A;  2V8S V;  3UFE A;  4X62 T;  1UGO A;  2C5J A;  2FJA A;  4HFC A;  2YEV C;  3EAM A;  4U7Y A;  5LNK A;  5L2L A;  3EVY A;  4TNW A;  2Z6E A;  3ZN0 B;  1HTJ F;  3LG7 A;  2D2S A;  2V6X A;  3KFW X;  4DO0 A;  1U4Q A;  4CXX A;  4DR1 T;  4IDQ A;  5HWX A;  1I94 T;  3TLT A;  5HCM A;  4GK5 E;  2X0Y A;  3JC6 C;  4LMJ A;  4KHP T;  4QWN B;  2XUE A;  4ZOL E;  3L3P A;  1HS7 A;  4DBR A;  4ZI3 D;  1UX5 A;  3LK4 2;  1V9D A;  1WFD A;  1FMV A;  4IRE A;  4FI5 A;  4TUY E;  5AQN B;  3AA1 B;  2H7O A;  3CQC B;  4M1P A;  2YN6 A;  5H6Q B;  3CQX C;  3ETU A;  5FY1 A;  5JTG A;  2XSB A;  4IE0 A;  1HR0 T;  5L3D B;  4ILC A;  3CIR A;  4JI1 T;  4LF5 T;  2LHR A;  1JNR A;  3RC8 A;  2XQ7 A;  1ZKE A;  3DP7 A;  3F57 A;  2BVL A;  2I59 A;  3QUJ A;  3E08 A;  1SUM B;  2XAQ B;  3AEC A;  3AVS A;  4YSZ A;  3ZYM A;  4OFZ A;  3V5S A;  3ZMU B;  4H9N C;  2FUP A;  4YY3 T;  2A3D A;  5J2T E;  2D9D A;  3RYI E;  2V7J A;  3PJA J;  4JI6 T;  3KBT A;  4WBN E;  1HFA A;  2WY2 A;  4HWH A;  3FZL B;  3ZMZ B;  2LSK A;  4IDO A;  4BJM A;  2XM1 A;  3MK7 C;  4X1I E;  1KNP A;  2V7I A;  4BAY B;  3AE9 A;  1HF8 A;  4YTP A;  3DTO A;  5AQF B;  2N1G A;  3GN5 B;  5C2T A;  3K1S A;  3PV0 F;  3N5L A;  4GKK T;  4AKG A;  5IUX A;  4IE5 A;  3UU5 A;  1HCI A;  3K3O A;  4ILU A;  1W09 A;  3I0Q A;  4I4T E;  4X20 E;  5JDM A;  5FYM A;  2RPA A;  1YW0 A;  5JQG E;  5CB4 E;  5JH7 E;  2Y8D A;  2X0L B;  4P0A A;  2CE7 A;  5LGT B;  3F31 A;  1IZN B;  1VCT A;  4EYY R;  3NRX A;  3FBL A;  3A7M A;  3X1D A;  1G8X A;  4O8S A;  3GA8 A;  5L47 A;  2DI4 A;  4HFI A;  4DID B;  2NP9 A;  2X9X A;  5CGM A;  2Q9Q D;  1OED B;  4IHJ E;  2C0S A;  3PE0 A;  2QRX A;  3HA4 A;  4AKI A;  1FMW A;  4V1A v;  1BR1 A;  1IJ6 A;  5FY7 A;  4P1N A;  5HCJ A;  5KXJ A;  2HHH T;  4OHF A;  4HTE A;  3OVU A;  3PUR A;  2PJQ A;  4CQI A;  3NVO A;  5AQL B;  3A5X A;  2E9X D;  2LHN A;  2IHR 1;  2AXD S;  4ZI2 C;  4ADZ A;  4L9I A;  4H63 V;  3QB5 A;  5LHH B;  1KF6 A;  2A9U A;  5LHG B;  1SA0 E;  4C90 A;  4JUY A;  4AXP A;  2LSY A;  3T1H T;  2ODU A;  1BR4 A;  3EAB A;  3UU8 A;  4XAX B;  4HE8 A;  1G73 A;  4JI0 T;  2Q9Q A;  5LYJ E;  2IIU A;  5JRC A;  4B3R T;  3PJA A;  4DV0 T;  3FZK B;  4K0U A;  2LT3 A;  3OYX A;  5LMU T;  3RI5 A;  4JI4 T;  4JI2 T;  3N9O A;  1KFY A;  4NUV A;  3ESL A;  4DR4 T;  2MPK A;  4U7I A;  2BBJ A;  3RQU A;  1D0Y A;  4LF6 T;  3I9Y A;  4JEU B; 
#chains in the Genus database with same CATH homology
 2VQF T;  1FJG T;  4LF7 T;  4X62 T;  4NXM T;  4YHH T;  2UXB T;  4YY3 T;  4DV5 T;  2HHH T;  1XNR T;  4JI6 T;  2UXC T;  4LFC T;  5BR8 T;  1XMQ T;  4DV7 T;  4LFB T;  4JI7 T;  4DV1 T;  1XMO T;  1HNX T;  2F4V T;  1N36 T;  4K0K T;  2VQE T;  4JI8 T;  4DR2 T;  2UUA T;  4B3S T;  4X64 T;  4JI3 T;  4DR1 T;  4DV2 T;  1I94 T;  4JV5 T;  2ZM6 T;  4GKK T;  3OTO T;  4B3M T;  1N34 T;  4DV6 T;  3T1H T;  5IWA T;  4LF4 T;  4X66 T;  4KHP T;  1XNQ T;  4LF8 T;  1IBM T;  4DUY T;  1HNW T;  4DV3 T;  2UUB T;  4X65 T;  1J5E T;  5LMN T;  4DUZ T;  4JI0 T;  4OX9 T;  4DR7 T;  4B3R T;  4DR6 T;  4DV0 T;  4GKJ T;  1HNZ T;  4NXN T;  4DR5 T;  2UU9 T;  5LMU T;  2E5L T;  1IBL T;  4JYA T;  4JI5 T;  2UUC T;  4JI4 T;  1N33 T;  4JI2 T;  4DR4 T;  1HR0 T;  4JI1 T;  4LF5 T;  1N32 T;  4B3T T;  3T1Y T;  4DV4 T;  4LFA T;  4LF6 T;  4DR3 T;  2UXD T;  4AQY T;  1IBK T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...