3ZJ1A

Structure of nab2p tandem zinc finger 12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
GSFTPTKKEGRCRLFPHCPLGRSCPHAHPTKVCNEYPNCPKPPGTCEFLHPNEDEELMKEMERTREEFQKRKADLLAAKRKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zj1A00
3ZJ2A 3ZJ1A 5L2LA 2LHNA
chains in the Genus database with same CATH superfamily
1UCUA 2DCFA 2BKPA 2OLTA 2IC6A 3A8YC 3IEEA 4JEHB 3OBVE 5HEOA 5HXHA 3O1JA 2X51A 4UV9B 3SFDA 3O9XA 3ZYMA 1KNPA 1UURA 3P8CD 4ZZCA 5HXEA 1LVKA 3CX6B 2V7MA 3V5UA 3ZMVB 2LSYA 5KX5E 1LKXA 1MIVA 2N2NA 5FY7A 3PUQA 3AE1A 3FZKB 4ZS3A 4IE5A 3RYCE 3S4UA 2B76A 3RYFE 3P4QA 1D1CA 1QLBA 4H9RC 4LMKA 3BK9A 1IZNB 5JREA 4LMLA 2J47A 2VURA 1OEDB 3N9OA 4QKNA 4QXCB 4XAXB 2XQ5A 5BR8T 4CZZB 4QHOA 3RKOA 2V6XA 2V7IA 3OVUA 2CLYC 1X9BA 2LKGA 3RF1A 3U78A 4YLHA 3CKDA 2EHOA 2X9WA 3P4SA 4HFBA 4X20E 4UXNB 4G2AA 2WMOA 4ILUA 5LG4A 1D1BA 3UQ4A 3Q5EA 2WM9A 5GONE 2MYSA 3CWZB 2IHR1 3DJBA 3QNUA 4TWHA 3IHRA 3FXDB 5LG3A 2MPKA 5FKYA 2HH7A 2CA5A 2V5DA 1L0VA 4U31A 1FMVA 2HN1A 1OWAA 3C4WA 3L39A 4WYVA 4BJNA 3ZSTA 5LYJE 4ILAA 4Z8XA 2LSIA 4IDOA 2AE9A 3AAAB 4EZ4A 2J4GA 4A97A 2NP9A 5FL0A 1SHZC 2XM2A 2YK0A 3AVSA 4OHFA 3FHNA 5FYMA 3W15B 4GKJT 3LSVA 3B13A 3D0TA 3RRCA 3K3OA 4KUMB 4EAHA 4ZI2D 5L2LA 4XBFB 4L9IA 4DV6T 2DI4A 2VKJA 1VCSA 2IAKA 3ETUA 5DABA 3K8PC 1UX4A 2IUBA 4A98A 1Y01A 3Q9DA 2CEAA 5C2TA 5JDGA 3OPCA 2WDQA 3PV0F 5AQGB 1T98A 3N2GE 2JQKA 3RYIE 3ONXA 5H6RB 2VQFT 2E5VA 2BZBA 1YQ3A 1ZP0A 2VKHA 4CXXA 5LGTB 2CHOA 3N2OA 4JI3T 2X0LB 2XTLA 5J2TE 5JVDE 2VB6A 5AQQB 3GA8A 4CI2B 2G0UA 4YSXA 4QWNB 3B57A 3EHZA 2W2UA 2UUBT 2LKHA 3QOFA 2Q9QD 1NWMX 3LK2B 3LK42 2IDOB 4FJOA 1HX1B 2CMRA 4O2BE 1KK7A 4P1NA 5AQIB 3UU8A 2CBJA 4IREA 5CB4E 3TLWA 1LRZA 5F3JA 3ZN0B 1V9DA 1SUMB 4ZS2A 3ZCJA 1Y64B 5LB7B 1WYCA 3UUMA 4DV7T 1XMOT 4JI2T 3AEFA 3X1DA 4KP3C 3ZMTB 4H63H 5IYZE 3HL6A 1WFDA 3PUVF 2M6BA 5ETWA 2Y8DA 4QH4A 4F8HA 5BMVE 3K3QC 2E9XD 4NPPA 1HS7A 3CPZA 3EABA 3JAEA 3ZYLA 5DQWA 4L5GA 2VKDA 4IDPA 1MMDA 4LFBT 2DLRA 3UTKA 4PK5A 2N9DA 5HEUA 1VOMA 2BKOA 5IUXA 5AQHB 2EHOC 4X64T 3F2EA 1FMWA 4LFCT 2P9BA 3SS1A 4DIDB 2JMHA 2BVMA 3RC8A 1JNZA 4DBRA 3MKDA 1NEKA 5HEGA 4I4TE 1E1HB 3VR9A 2OV9A 4CXYA 2ACXA 2C5KT 3ONJA 3CX7B 3ZCIA 4WBNE 3Q5DA 4HWHA 2W63A 1R8IA 3ZN1B 3T1YT 5EK4A 5M4YA 4TN7B 3VRBA 3PUSA 4DMWA 4Z90A 4K0UA 3BQLA 4LF9T 2I59A 2WZIA 3O4XE 2W67A 5KXJA 2X9YA 2FJBA 1YKEB 5LXTE 4GOUA 3V5SA 4DR1T 1T8BA 2C5JA 2JQQA 4N78D 1MMAA 4QX7B 4YSYA 5E0OA 4EGWA 2K9AA 3F57A 3MXZA 4X1KE 5AQRB 3R84B 3RIFA 3O1IA 4PFPA 4HFEA 2BKNA 4ZEYA 2HPJA 1HFAA 4H9OC 4NIQA 5HXSA 4PJNA 4BAYB 5HWXA 4U7YA 3HKDE 3M65A 3M3ZB 4YSZA 2CHNA 1HR0T 1MNEA 3N9LA 4HWDA 3LBXA 4HKAA 2WU5A 3BQIA 3FBLA 5F8PA 4YT0A 3MA9A 4DR5T 4H9NC 4X62T 4JV5T 2XQ8A 2FJAA 3ZSSA 2VL8A 2J1DG 2MAWA 1WR0A 2NTXA 3Q5WA 4AKGA 4EIWA 2CWYA 3PUYF 3NKZA 3ZMZB 3RIUA 1SE7A 3AA6B 4EYYR 2JQ9A 4XZCA 4BA9A 4DV4T 4K0KT 4IE6A 2MOZA 2ODVA 2V6YB 4TUYE 5A1LA 4HWFA 2LSJA 3PU3A 4EZHA 4IGUA 4JI8T 4CN4A 3CQGB 2WBLA 3ABVA 2UXNB 3H3AA 2BS4A 1IBKT 2KT9A 1CUNA 3HKCE 4PJLA 4GK0E 2X67A 4YTMA 5CGMA 5L3EB 2X9XA 4DR3T 1W09A 2A2FX 2A3DA 3AE6A 3E08A 4E7ZA 4QX8B 4UVBB 3HKBE 3RI5A 1BR4A 3UFGA 2LEHA 4GKKT 2J62A 2LSKA 2BS2A 3K3NA 3NBXX 4Q25A 2BBHA 4JEUB 5FY1A 3C51A 3GN5A 4WNKA 5L4EA 2PFVA 2HHHT 1U5PA 4I0UA 4QXHB 5C3JA 4H9SE 5JR9A 4TWFA 5L47A 5FXWA 1M62A 1HTJF 2C5IT 4IL9A 3IA3A 5HXRA 2UU9T 4C90A 1W0AA 1IAPA 2BG9A 3DP7A 2V1DB 3L3PA 4ZI3D 5LMNT 1OEDE 4YXDA 2XAJB 4TV9E 2L3LA 2HPLA 1NAFA 2OA5A 1ZV4X 3UULA 4HN9A 1T7SA 3ZPOA 5AQFB 2WP9A 3JAFA 4BJMA 5J2UE 1SA0E 2BG9B 2V8SV 4J2CA 4NXNT 2CLYB 2KZ7B 1XDOA 3ZJ2A 2M67A 2N1GA 4IE4A 2C0SA 4DV1T 4MALA 4ZXLA 4HGAA 2Q9QC 4FI5A 4YHJA 4DMVA 3TLUA 1WRDA 5JQGE 2H89A 3AEDA 2LJLA 3NVOA 3RYHE 2JMKA 2QRXA 4EV6A 2LRLA 4ISTA 2L9QA 2LRKA 4UVCB 2BVLA 4QH1A 3UUBA 2NW9A 2IMLA 4DO0A 1J5ET 3SWHA 4HFVA 3LK3B 5LGNB 4JI0T 2VVNA 3CQXC 2ACZA 5CA1E 5KDMC 1MIYA 1HF8A 3I1AA 3JADA 3AE7A 4LF8T 3RLFF 3TLTA 4A5XA 1J1JA 4OYJA 2YEVC 1D0YA 4NUUA 2ODUA 3H37A 4ZHQE 4O4HE 2CXLA 2NOXA 2PBIA 2WU2A 3A5XA 4KHZF 4UELA 5HXCA 1E7PA 4PW8A 4DR2T 1FJGT 3UU3A 2KWHA 1HG5A 3KINB 2EHOD 4DUZT 3EVYA 5FVLA 4DV0T 3O1HA 3C4ZA 5JH7E 5JR9C 2QGSA 2VWAA 2XQ9A 2LHRA 2VL0A 3AE5A 3AEBA 3CIRA 4IDZA 1HG2A 4KI0F 5JDQA 3EUHA 5LJMA 4PK4A 4X1IE 4P09A 4EB6E 4F6RC 4I50E 2BBJA 2WSSV 3JC6C 1BR0A 4AKHA 2XQ3A 4O4IE 1UK5A 3AVRA 4U7IA 2DL1A 2WY2A 4UF0A 5LA6E 4ASKA 3AE9A 3DTOA 2CRBA 2XASB 3AEGA 2I0MA 3T1HT 4YY3T 4NXMT 1HNXT 1G8XA 3UU6A 2X9HA 2XAGB 3AA1B 2ES0A 4L0RA 4NUVA 4ADZA 5JRCB 4PJMA 2PTFA 5LJNA 4DUYT 3PUAA 2DWGA 4HFDA 2A72A 2QA7A 1KFYA 1KNRA 1FEWA 1Z8UA 1XZYA 2E9XC 2H7VC 3E0ZA 3EI0A 3KBUA 3OYZA 2ZM2A 3MK7C 5AQSB 3PUWF 2E9XA 3L09A 4PK6A 2E2AA 3FBZA 4PFOA 3VR8A 2ZM6T 5JRCA 4ZOLE 4OFZA 3VKGA 2BS3A 4UV8B 1IJ6A 5JTGA 3KV9A 4UIGA 2BG9E 2XAQB 3HI2A 1OEDA 4OK0A 3AXJB 5AQTB 4YJ3E 4CQIA 3OTOT 3RGLA 1XMQT 1OEDC 2NWBA 1XNQT 1MMNA 2KXPB 4PNIA 4MFRA 5FXVA 5HCMA 3IBPA 2WWVA 3SRZA 4PAGA 4X5TA 3AE2A 2MTQA 3AEEA 3UUXB 2SPCA 3QB5K 2K48A 4IDQA 3AB3B 5H6QB 3WAJA 2WAUA 4ISSA 5LMUT 3G06A 1VRBA 2WZHA 3QUJA 1OXZA 1S35A 1FIOA 3FZLB 3PJAA 2V6YA 3KVAA 2YN6A 3AAIA 3TLSA 4CN1A 4U74A 4JBWF 3GWHA 3KBTA 4EEBA 3AE3A 3C64A 4YJ2E 3ZC0A 3AEAA 4GYRA 2DHRA 3I9WA 2RPAA 5IHYA 4EYUA 5JR9B 4AI6A 2KLQA 4KBMB 4TWDA 3PUZF 1D1AA 2L8KA 4OX9T 4KHPT 2CXFA 3RPUA 4IHJE 2CE7A 3I9YA 1W0BA 2FUPA 4HFIA 3P50A 3PDYA 3ZKRA 3C98B 2FBWA 2JJ9A 1HCIA 5LOVE 4AKLA 4ZZBA 1ZHCA 2FJDA 2XQ7A 1XWMA 3HA4A 3GN5B 3LDQB 3N5LA 1HNWT 5JDMA 1CHUA 3KVBA 1WCRA 4IT4A 4YTNA 1YQ4A 3JCFA 4EXTA 2H3RA 3T8OA 2D9DA 2NW7A 4AKRB 2WDRA 4B3TT 3HKEE 4HWIB 2X66A 3I0QA 5AQKB 3K1SA 2CM0A 5LBMA 1US7B 2A9UA 1UGOA 3UU4A 4HE8A 3Q5XA 2D5UA 1E2AA 3BQKA 2K5BB 4YFSA 4DR6T 2JIWA 2JRKA 3ZMUB 3F31A 3H3MA 3NZQA 2XAFB 4H9QC 4O8SA 4LF6T 1I6ZA 3ONLC 3MZKB 5KMGP 4DR7T 4JI5T 2XPKA 5J1GA 5L3DB 1QUUA 4JI7T 3FB2A 2Q9QA 2RP4A 2XQYA 5L3BB 2W66A 3PTRB 4IDNA 3KDSE 4M1PA 1YXRA 3B5MA 2GK9A 1D0ZA 2LSGA 4WBOA 3QB5A 3ANWB 4JUYA 4X1YE 5AQJB 5AQUB 2Y6XA 3N9MA 3LBXB 2KWIB 3EDUA 4UEMA 2HN2A 1VCTA 2XQ4A 5ABEA 2X0HA 4EEDA 3KV6A 2UUCT 1N33T 2UXBT 1JNRA 3UU5A 2AXDS 2W0GA 2WQYA 3NRYA 1BR1A 5FP3A 5DJQC 2E8IA 3RC3A 5AQMB 5FVKA 4OYKA 2LT3A 3NRXA 3L8RA 2IW5B 3IF8B 4I55E 3MJXA 3AAEB 2E9XB 3E22E 1H7CA 5FXXA 2NW8A 4LF4T 4QH5A 3MACA 5FNVE 2LOSA 3NWIA 4CI1B 2XSBA 3LJCA 1X79A 4EOZB 4MLKA 5LHIB 4AQFA 5JDLA 2D0TA 4CXWA 3JC6D 3FZHB 5FL1A 1N34T 2LOPA 3OKQA 4JI6T 2KINB 4TNVA 3ZT5A 1WYBA 3PUGA 5AQOB 2KMFA 3P4RA 4B6XA 5HYAA 1QSDA 5L3CB 3KV4A 3OJAA 5JDNA 1MIWA 3RQWA 3OYXA 4WW0A 5AQVB 3AXJA 2W4XA 4G63A 1WR6A 1M7KA 4HWCA 4U2YA 3VHLA 2YDSA 5JDHA 4DVDA 2LLYA 2Q9QB 3PUXF 2D0UA 3TKLB 4AXPA 2V7LA 4ILCA 4GK5E 5HEJA 1IBLT 5ABGA 3KV5A 5ABHA 2XJ7A 4TNWA 3AE8A 5ABFA 1LVFA 2W00A 2XQ6A 3N9QA 3RRWA 4ZI3C 3CMLA 5EK3A 4P0BA 3P7IA 5ABFB 4O2AE 2UUAT 3N9NA 2WB5A 3RKGA 2CBIA 2WCAA 4IE7A 2XSAA 3SOLA 4KMCA 4U72A 4ZI7E 4KX6A 2XHEB 1XDPA 4U2ZA 1Z0PA 2ZM8A 2VK9A 4GYSA 2V7KA 3I0OA 3ZT6A 4DNDA 2YU2A 4DBQA 4P0AA 3ANWA 1BR2A 1NENA 1HX8A 3FXEB 3LFMA 5L3FB 4X66T 2DNXA 3EDVA 5CJ5A 3P4WA 1B7TA 3RX6A 2BDEA 3QK6A 5IWAT 2LE8A 2KNDA 5TAOA 2XM1A 3ZYKA 3CK6A 4IIJE 3RIAA 3ZLIA 5AQLB 2PJQA 2DWKA 4ZI2C 5CA0E 5EK2A 4LF5T 4PJJA 3RHWA 2WMNA 2YOEA 3SFEA 4HFHA 4JYAT 2JQHA 1ZEEA 3C50A 3RQUA 4U33A 3UFEA 3AA7B 2XZEA 3QC9A 4CI3B 4YTPA 3FZFB 4ERRA 2YU1A 1IBMT 3CQCB 2YINA 3U3IA 1MMGA 3ZC1A 3ZT7A 2VQET 1N36T 5AQNB 4B3RT 4V1Av 3VU7H 4AQYT 4B3MT 3AA0B 5LCYA 5LGUB 4DV3T 2Z6EA 3J9X1 3CX8B 4UF0B 5HAXA 2YDQA 2M6IA 3UUNA 2D2SA 1S94A 5LHHB 2CCQA 5AQPB 4JI4T 3PJAJ 3NZPA 4JLEA 4Z91A 4COFA 5LHGB 4AKIA 1EZ3A 3N2KE 4HEAA 5J0ZA 2V5CA 4HFCA 2H7OA 2NTYA 3A7MA 4TV8E 1KNZA 2K3WA 3P4PA 1T72A 2CWOA 2RA1A 4UVAB 5F5WA 4CN6A 3WI3A 4H9PC 2V7JA 2WDVA 4IL4A 2I6HA 5AFUL 1WLXA 1ZOYA 2UXXB 2VVSA 2X0YA 3KFWX 1MNDA 2XAHB 2EHOB 3ZJ1A 4AQGA 2FJEA 1XNRT 3ESLA 4LF7T 1IJ5A 2CPTA 1YD8G 4QXBB 1G73A 2IIUA 2E5LT 3PE0A 4MBQA 2QVAA 4LFAT 2H88A 2XQAA 3AE4A 1AJ3A 3AECA 4DV2T 2PG8A 2BG9C 5FMNA 5JDFA 1O3XA 3LG7A 3VRAA 3FZMB 3RH3A 2YDRA 4H63V 4ANJA 3Q2MA 5CFBA 4UR9A 3UT5E 4YHHT 2CXDA 5FXZA 2XY8B 5HEHA 4DR4T 4O4JE 2LM2A 4HTEA 2R6GF 4DV5T 1U4QA 1UX5A 2QYWA 4AIUA 4E7SA 2UXDT 2KSRA 5EZYE 3ETVA 3RIUC 4AQFC 5ADXL 5L3GB 1YW0A 2F4VT 5DQVA 1KF6A 1I94T 2NR4A 3UQ7A 4A56A 2WWUA 3R6NA 3ZMSB 1J5WA 2ZLYA 2ZM0A 3TLVA 4JI1T 1KEYA 2K24A 5HWYA 5FY0A 5LP6E 1N32T 3PURA 2W61A 4MHCA 4ILBA 3WAKA 4B3ST 2LM9A 1D0XA 2W62A 5HCJA 4C91A 2XUEA 2VKOA 3EAMA 3PU8A 4WZXA 2UXCT 4IE0A 2WS3A 2V26A 5C8YE 3ZEFB 1DU2A 1W9RA 3N9PA 1GQEA 2IC9A 1UUSA 2Y48B 4O4LE 4I43B 1HNZT 1ZKEA 2LHNA 3GMIA 4GIWA 4TZ4C 3VKHA 3J7Yq 5LNKA 2YKSA 5LBQB 2VASA 4X65T 2B1EA 3C4XA 1YKHB 4TX5A 5L4HA 4AISA 3CVRA 2JPFA 4LMJA 3HR0A 2ZMAA 2MBGA 2X68A 4U3CA
chains in the Genus database with same CATH topology
1UCUA 2DCFA 2IC6A 3IEEA 4JEHB 3OBVE 3O1JA 2X51A 4UV9B 3O9XA 3ZYMA 3P8CD 5HXEA 1LVKA 3CX6B 2V7MA 3V5UA 3ZMVB 2LSYA 5KX5E 1LKXA 1MIVA 2N2NA 5FY7A 3PUQA 3RYCE 3S4UA 4IE5A 3RYFE 1D1CA 4H9RC 3BK9A 1IZNB 5JREA 3N9OA 4XAXB 4QKNA 4QXCB 4CZZB 4QHOA 3RKOA 2V7IA 2CLYC 3U78A 4YLHA 3CKDA 2EHOA 2X9WA 4X20E 4UXNB 4G2AA 2WMOA 4ILUA 5LG4A 1D1BA 2WM9A 5GONE 3CWZB 2MYSA 3DJBA 3IHRA 3FXDB 2HH7A 2CA5A 1FMVA 1OWAA 3C4WA 4BJNA 5LYJE 4Z8XA 4EZ4A 2LSIA 3AAAB 2NP9A 3W15B 1SHZC 2YK0A 3AVSA 4OHFA 5FYMA 3FHNA 3B13A 3D0TA 3RRCA 3K3OA 4KUMB 4EAHA 4ZI2D 5L2LA 4XBFB 4L9IA 2DI4A 2VKJA 2IAKA 3ETUA 5DABA 3K8PC 1UX4A 3Q9DA 2CEAA 5JDGA 1T98A 3N2GE 3RYIE 3ONXA 5H6RB 2BZBA 2VKHA 4CXXA 3N2OA 2X0LB 2XTLA 5JVDE 2VB6A 4CI2B 3GA8A 2G0UA 4QWNB 3B57A 2Q9QD 1NWMX 3LK2B 3LK42 4FJOA 4O2BE 4EB6E 2CMRA 1KK7A 5CB4E 1LRZA 5F3JA 3ZN0B 1V9DA 4ZS2A 3ZCJA 1Y64B 1WYCA 3UUMA 4KP3C 3ZMTB 4H63H 5IYZE 3HL6A 5ETWA 2Y8DA 5BMVE 3K3QC 2E9XD 1HS7A 3CPZA 3ZYLA 5DQWA 4L5GA 2VKDA 1MMDA 2DLRA 3UTKA 4PK5A 2N9DA 1VOMA 2EHOC 3F2EA 1FMWA 2P9BA 3SS1A 3RC8A 2JMHA 2BVMA 4DBRA 3MKDA 4I4TE 1E1HB 4CXYA 2ACXA 2C5KT 3CX7B 3ZCIA 4WBNE 2W63A 3ZN1B 5EK4A 5M4YA 4TN7B 4DMWA 3PUSA 4K0UA 3BQLA 2I59A 3O4XE 2X9YA 1YKEB 5LXTE 4GOUA 3V5SA 2C5JA 2JQQA 4N78D 1MMAA 4QX7B 5E0OA 2K9AA 3F57A 3MXZA 4X1KE 5JR9B 3R84B 3O1IA 4PFPA 5HXSA 5HWXA 2HPJA 1HFAA 4H9OC 4PJNA 4BAYB 3HKDE 3M65A 1MNEA 3N9LA 3LBXA 4HKAA 3BQIA 3FBLA 5F8PA 3MA9A 4H9NC 2VL8A 2J1DG 2NTXA 3Q5WA 4AKGA 4EIWA 2CWYA 3ZMZB 4EYYR 3AA6B 4BA9A 4XZCA 4IE6A 2MOZA 2ODVA 4TUYE 5A1LA 2LSJA 3PU3A 4EZHA 4IGUA 3CQGB 2WBLA 3H3AA 2UXNB 2KT9A 1CUNA 3HKCE 4PJLA 4GK0E 2X67A 5L3EB 2X9XA 2A2FX 2A3DA 3E08A 4E7ZA 4QX8B 4UVBB 3HKBE 1BR4A 2LEHA 2LSKA 3K3NA 3NBXX 5FY1A 4JEUB 3C51A 3GN5A 4WNKA 2PFVA 1U5PA 4QXHB 4H9SE 5JR9A 5FXWA 2C5IT 1HTJF 5HXRA 3L3PA 1IAPA 3DP7A 2V1DB 4ZI3D 2XAJB 4TV9E 2L3LA 2HPLA 1NAFA 2OA5A 1ZV4X 3UULA 4HN9A 3ZPOA 4BJMA 5J2UE 1SA0E 4J2CA 2CLYB 2KZ7B 3ZJ2A 2M67A 2N1GA 4IE4A 2C0SA 4MALA 4DMVA 4HGAA 2Q9QC 4FI5A 4YHJA 1WRDA 5JQGE 2LJLA 3RYHE 2JMKA 4ISTA 2L9QA 4UVCB 2BVLA 2NW9A 4DO0A 3SWHA 4HFVA 3LK3B 5LGNB 3CQXC 5CA1E 5KDMC 1MIYA 1HF8A 3I1AA 4OYJA 2YEVC 1D0YA 4NUUA 2ODUA 3H37A 4ZHQE 4O4HE 2CXLA 2NOXA 2PBIA 3A5XA 4UELA 5HXCA 4PW8A 2KWHA 1HG5A 3KINB 2EHOD 3EVYA 3O1HA 3C4ZA 5JR9C 2QGSA 2VWAA 5HXHA 2LHRA 4IDZA 1HG2A 5JDQA 3EUHA 5LJMA 4PK4A 4X1IE 4P09A 4F6RC 4I50E 3JC6C 2WSSV 1BR0A 4AKHA 4O4IE 3AVRA 4UF0A 5LA6E 4ASKA 3DTOA 2XASB 1G8XA 2X9HA 2XAGB 3AA1B 2ES0A 4L0RA 4NUVA 4ADZA 5JRCB 4PJMA 5LJNA 3PUAA 2DWGA 4ZS3A 2A72A 2QA7A 4PJJA 2E9XC 1FEWA 2H7VC 3E0ZA 3OYZA 4AXPA 3KBUA 2ZM2A 3MK7C 4PK6A 2E9XA 3L09A 4PFOA 5JRCA 3FBZA 4ZOLE 4OFZA 3VKGA 4UV8B 1IJ6A 3KV9A 4UIGA 2XAQB 3HI2A 4CQIA 4OK0A 4YJ3E 2NWBA 1MMNA 2KXPB 4PNIA 4MFRA 5FXVA 3IBPA 3SRZA 4PAGA 2MTQA 3UUXB 2SPCA 2K48A 3AB3B 5H6QB 3WAJA 2WAUA 4ISSA 1VRBA 3QUJA 1OXZA 1S35A 1FIOA 3KVAA 3AAIA 4U74A 3GWHA 3KBTA 3C64A 4YJ2E 3ZC0A 4GYRA 4AI6A 2DHRA 3I9WA 5IHYA 4EYUA 2KLQA 4KBMB 1D1AA 2L8KA 2CXFA 3RPUA 4IHJE 2CE7A 3I9YA 3PDYA 3C98B 2JJ9A 1HCIA 5LOVE 4AKLA 1ZHCA 3N5LA 3HA4A 3GN5B 5JDMA 3KVBA 4EXTA 2H3RA 3T8OA 2NW7A 4AKRB 3HKEE 2X66A 3I0QA 2CM0A 5LBMA 1US7B 4HE8A 3Q5XA 2D5UA 3BQKA 4YFSA 2K5BB 2JRKA 3ZMUB 3F31A 3NZQA 2XAFB 4H9QC 4O8SA 3MZKB 5KMGP 5J1GA 5L3DB 1QUUA 3FB2A 2Q9QA 2RP4A 2XQYA 5L3BB 3PTRB 3KDSE 4M1PA 5LHHB 2GK9A 1D0ZA 2LSGA 4WBOA 4X1YE 3ANWB 4JUYA 2Y6XA 3N9MA 3LBXB 2KWIB 3EDUA 4UEMA 3KV6A 2W0GA 3NRYA 1BR1A 5FP3A 5DJQC 2E8IA 3RC3A 4OYKA 2LT3A 3NRXA 2IW5B 3IF8B 4I55E 3MJXA 3AAEB 2E9XB 3E22E 1H7CA 5FXXA 2NW8A 5FNVE 3MACA 2LOSA 4CI1B 3LJCA 1X79A 4EOZB 4MLKA 5LHIB 4AQFA 5JDLA 2D0TA 4CXWA 3JC6D 2LOPA 3OKQA 2KINB 5HYAA 5L3CB 1WYBA 3PUGA 4B6XA 2KMFA 5LGTB 1QSDA 3KV4A 3OJAA 5JDNA 1MIWA 3OYXA 4WW0A 5JH7E 4G63A 1WR6A 5JDHA 3VHLA 4DVDA 2Q9QB 3TKLB 2D0UA 2V7LA 4GK5E 3KV5A 1LVFA 2W00A 3N9QA 3RRWA 4ZI3C 3CMLA 5EK3A 4P0BA 3P7IA 4O2AE 3N9NA 4IE7A 3SOLA 4KMCA 4U72A 4ZI7E 2XHEB 1Z0PA 2ZM8A 2VK9A 4GYSA 2V7KA 3I0OA 4DNDA 4P0AA 2YU2A 4DBQA 3ANWA 1BR2A 3FXEB 1HX8A 3LFMA 5L3FB 2DNXA 3EDVA 1B7TA 3RX6A 2BDEA 3QK6A 2LE8A 2KNDA 5TAOA 3ZYKA 4IIJE 3ZLIA 4ZI2C 2PJQA 2DWKA 5CA0E 5EK2A 2WMNA 3C50A 1ZEEA 3UFEA 4CI3B 5J2TE 3AA7B 3QC9A 4ERRA 2YU1A 3CQCB 2YINA 3U3IA 1MMGA 3ZC1A 4V1Av 3VU7H 3AA0B 5LCYA 5LGUB 2Z6EA 3J9X1 3CX8B 4UF0B 5HAXA 3UUNA 2D2SA 1S94A 2CCQA 4JLEA 3NZPA 5LHGB 4AKIA 1EZ3A 3N2KE 4HEAA 4TV8E 1KNZA 2H7OA 2NTYA 2CWOA 2RA1A 4UVAB 3WI3A 4H9PC 2V7JA 5AFUL 1WLXA 3ZJ1A 2UXXB 3KFWX 1MNDA 2XAHB 2EHOB 4AQGA 3ESLA 1IJ5A 1YD8G 4QXBB 1G73A 3PE0A 4MBQA 1AJ3A 2PG8A 5FMNA 5JDFA 1O3XA 3LG7A 3RH3A 4ANJA 4H63V 3Q2MA 3UT5E 2CXDA 5FXZA 4O4JE 4HTEA 1U4QA 1UX5A 4E7SA 5ADXL 5EZYE 3ETVA 4AQFC 5L3GB 1YW0A 5DQVA 4A56A 2WWUA 3R6NA 3ZMSB 2ZLYA 2ZM0A 5HWYA 2K24A 5FY0A 5LP6E 3PURA 2W61A 4MHCA 3WAKA 2LM9A 1D0XA 2W62A 4C91A 2XUEA 2VKOA 3PU8A 4IE0A 2V26A 5C8YE 3ZEFB 3N9PA 2IC9A 2Y48B 4O4LE 4I43B 1ZKEA 2LHNA 3GMIA 4GIWA 4TZ4C 3VKHA 3J7Yq 5LNKA 5LBQB 2VASA 2B1EA 3C4XA 1YKHB 4TX5A 3CVRA 2JPFA 3HR0A 2ZMAA 2MBGA 2X68A 4C90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJ2 A;  3ZJ1 A;  5L2L A;  2LHN A; 
#chains in the Genus database with same CATH topology
 1UCU A;  2DCF A;  2BKP A;  2OLT A;  2IC6 A;  3A8Y C;  3IEE A;  4JEH B;  3OBV E;  5HEO A;  5HXH A;  3O1J A;  2X51 A;  4UV9 B;  3SFD A;  3O9X A;  3ZYM A;  1KNP A;  1UUR A;  3P8C D;  4ZZC A;  5HXE A;  1LVK A;  3CX6 B;  2V7M A;  3V5U A;  3ZMV B;  2LSY A;  5KX5 E;  1LKX A;  1MIV A;  2N2N A;  5FY7 A;  3PUQ A;  3AE1 A;  3FZK B;  4ZS3 A;  4IE5 A;  3RYC E;  3S4U A;  2B76 A;  3RYF E;  3P4Q A;  1D1C A;  1QLB A;  4H9R C;  4LMK A;  3BK9 A;  1IZN B;  5JRE A;  4LML A;  2J47 A;  2VUR A;  1OED B;  3N9O A;  4QKN A;  4QXC B;  4XAX B;  2XQ5 A;  5BR8 T;  4CZZ B;  4QHO A;  3RKO A;  2V6X A;  2V7I A;  3OVU A;  2CLY C;  1X9B A;  2LKG A;  3RF1 A;  3U78 A;  4YLH A;  3CKD A;  2EHO A;  2X9W A;  3P4S A;  4HFB A;  4X20 E;  4UXN B;  4G2A A;  2WMO A;  4ILU A;  5LG4 A;  1D1B A;  3UQ4 A;  3Q5E A;  2WM9 A;  5GON E;  2MYS A;  3CWZ B;  2IHR 1;  3DJB A;  3QNU A;  4TWH A;  3IHR A;  3FXD B;  5LG3 A;  2MPK A;  5FKY A;  2HH7 A;  2CA5 A;  2V5D A;  1L0V A;  4U31 A;  1FMV A;  2HN1 A;  1OWA A;  3C4W A;  3L39 A;  4WYV A;  4BJN A;  3ZST A;  5LYJ E;  4ILA A;  4Z8X A;  2LSI A;  4IDO A;  2AE9 A;  3AAA B;  4EZ4 A;  2J4G A;  4A97 A;  2NP9 A;  5FL0 A;  1SHZ C;  2XM2 A;  2YK0 A;  3AVS A;  4OHF A;  3FHN A;  5FYM A;  3W15 B;  4GKJ T;  3LSV A;  3B13 A;  3D0T A;  3RRC A;  3K3O A;  4KUM B;  4EAH A;  4ZI2 D;  5L2L A;  4XBF B;  4L9I A;  4DV6 T;  2DI4 A;  2VKJ A;  1VCS A;  2IAK A;  3ETU A;  5DAB A;  3K8P C;  1UX4 A;  2IUB A;  4A98 A;  1Y01 A;  3Q9D A;  2CEA A;  5C2T A;  5JDG A;  3OPC A;  2WDQ A;  3PV0 F;  5AQG B;  1T98 A;  3N2G E;  2JQK A;  3RYI E;  3ONX A;  5H6R B;  2VQF T;  2E5V A;  2BZB A;  1YQ3 A;  1ZP0 A;  2VKH A;  4CXX A;  5LGT B;  2CHO A;  3N2O A;  4JI3 T;  2X0L B;  2XTL A;  5J2T E;  5JVD E;  2VB6 A;  5AQQ B;  3GA8 A;  4CI2 B;  2G0U A;  4YSX A;  4QWN B;  3B57 A;  3EHZ A;  2W2U A;  2UUB T;  2LKH A;  3QOF A;  2Q9Q D;  1NWM X;  3LK2 B;  3LK4 2;  2IDO B;  4FJO A;  1HX1 B;  2CMR A;  4O2B E;  1KK7 A;  4P1N A;  5AQI B;  3UU8 A;  2CBJ A;  4IRE A;  5CB4 E;  3TLW A;  1LRZ A;  5F3J A;  3ZN0 B;  1V9D A;  1SUM B;  4ZS2 A;  3ZCJ A;  1Y64 B;  5LB7 B;  1WYC A;  3UUM A;  4DV7 T;  1XMO T;  4JI2 T;  3AEF A;  3X1D A;  4KP3 C;  3ZMT B;  4H63 H;  5IYZ E;  3HL6 A;  1WFD A;  3PUV F;  2M6B A;  5ETW A;  2Y8D A;  4QH4 A;  4F8H A;  5BMV E;  3K3Q C;  2E9X D;  4NPP A;  1HS7 A;  3CPZ A;  3EAB A;  3JAE A;  3ZYL A;  5DQW A;  4L5G A;  2VKD A;  4IDP A;  1MMD A;  4LFB T;  2DLR A;  3UTK A;  4PK5 A;  2N9D A;  5HEU A;  1VOM A;  2BKO A;  5IUX A;  5AQH B;  2EHO C;  4X64 T;  3F2E A;  1FMW A;  4LFC T;  2P9B A;  3SS1 A;  4DID B;  2JMH A;  2BVM A;  3RC8 A;  1JNZ A;  4DBR A;  3MKD A;  1NEK A;  5HEG A;  4I4T E;  1E1H B;  3VR9 A;  2OV9 A;  4CXY A;  2ACX A;  2C5K T;  3ONJ A;  3CX7 B;  3ZCI A;  4WBN E;  3Q5D A;  4HWH A;  2W63 A;  1R8I A;  3ZN1 B;  3T1Y T;  5EK4 A;  5M4Y A;  4TN7 B;  3VRB A;  3PUS A;  4DMW A;  4Z90 A;  4K0U A;  3BQL A;  4LF9 T;  2I59 A;  2WZI A;  3O4X E;  2W67 A;  5KXJ A;  2X9Y A;  2FJB A;  1YKE B;  5LXT E;  4GOU A;  3V5S A;  4DR1 T;  1T8B A;  2C5J A;  2JQQ A;  4N78 D;  1MMA A;  4QX7 B;  4YSY A;  5E0O A;  4EGW A;  2K9A A;  3F57 A;  3MXZ A;  4X1K E;  5AQR B;  3R84 B;  3RIF A;  3O1I A;  4PFP A;  4HFE A;  2BKN A;  4ZEY A;  2HPJ A;  1HFA A;  4H9O C;  4NIQ A;  5HXS A;  4PJN A;  4BAY B;  5HWX A;  4U7Y A;  3HKD E;  3M65 A;  3M3Z B;  4YSZ A;  2CHN A;  1HR0 T;  1MNE A;  3N9L A;  4HWD A;  3LBX A;  4HKA A;  2WU5 A;  3BQI A;  3FBL A;  5F8P A;  4YT0 A;  3MA9 A;  4DR5 T;  4H9N C;  4X62 T;  4JV5 T;  2XQ8 A;  2FJA A;  3ZSS A;  2VL8 A;  2J1D G;  2MAW A;  1WR0 A;  2NTX A;  3Q5W A;  4AKG A;  4EIW A;  2CWY A;  3PUY F;  3NKZ A;  3ZMZ B;  3RIU A;  1SE7 A;  3AA6 B;  4EYY R;  2JQ9 A;  4XZC A;  4BA9 A;  4DV4 T;  4K0K T;  4IE6 A;  2MOZ A;  2ODV A;  2V6Y B;  4TUY E;  5A1L A;  4HWF A;  2LSJ A;  3PU3 A;  4EZH A;  4IGU A;  4JI8 T;  4CN4 A;  3CQG B;  2WBL A;  3ABV A;  2UXN B;  3H3A A;  2BS4 A;  1IBK T;  2KT9 A;  1CUN A;  3HKC E;  4PJL A;  4GK0 E;  2X67 A;  4YTM A;  5CGM A;  5L3E B;  2X9X A;  4DR3 T;  1W09 A;  2A2F X;  2A3D A;  3AE6 A;  3E08 A;  4E7Z A;  4QX8 B;  4UVB B;  3HKB E;  3RI5 A;  1BR4 A;  3UFG A;  2LEH A;  4GKK T;  2J62 A;  2LSK A;  2BS2 A;  3K3N A;  3NBX X;  4Q25 A;  2BBH A;  4JEU B;  5FY1 A;  3C51 A;  3GN5 A;  4WNK A;  5L4E A;  2PFV A;  2HHH T;  1U5P A;  4I0U A;  4QXH B;  5C3J A;  4H9S E;  5JR9 A;  4TWF A;  5L47 A;  5FXW A;  1M62 A;  1HTJ F;  2C5I T;  4IL9 A;  3IA3 A;  5HXR A;  2UU9 T;  4C90 A;  1W0A A;  1IAP A;  2BG9 A;  3DP7 A;  2V1D B;  3L3P A;  4ZI3 D;  5LMN T;  1OED E;  4YXD A;  2XAJ B;  4TV9 E;  2L3L A;  2HPL A;  1NAF A;  2OA5 A;  1ZV4 X;  3UUL A;  4HN9 A;  1T7S A;  3ZPO A;  5AQF B;  2WP9 A;  3JAF A;  4BJM A;  5J2U E;  1SA0 E;  2BG9 B;  2V8S V;  4J2C A;  4NXN T;  2CLY B;  2KZ7 B;  1XDO A;  3ZJ2 A;  2M67 A;  2N1G A;  4IE4 A;  2C0S A;  4DV1 T;  4MAL A;  4ZXL A;  4HGA A;  2Q9Q C;  4FI5 A;  4YHJ A;  4DMV A;  3TLU A;  1WRD A;  5JQG E;  2H89 A;  3AED A;  2LJL A;  3NVO A;  3RYH E;  2JMK A;  2QRX A;  4EV6 A;  2LRL A;  4IST A;  2L9Q A;  2LRK A;  4UVC B;  2BVL A;  4QH1 A;  3UUB A;  2NW9 A;  2IML A;  4DO0 A;  1J5E T;  3SWH A;  4HFV A;  3LK3 B;  5LGN B;  4JI0 T;  2VVN A;  3CQX C;  2ACZ A;  5CA1 E;  5KDM C;  1MIY A;  1HF8 A;  3I1A A;  3JAD A;  3AE7 A;  4LF8 T;  3RLF F;  3TLT A;  4A5X A;  1J1J A;  4OYJ A;  2YEV C;  1D0Y A;  4NUU A;  2ODU A;  3H37 A;  4ZHQ E;  4O4H E;  2CXL A;  2NOX A;  2PBI A;  2WU2 A;  3A5X A;  4KHZ F;  4UEL A;  5HXC A;  1E7P A;  4PW8 A;  4DR2 T;  1FJG T;  3UU3 A;  2KWH A;  1HG5 A;  3KIN B;  2EHO D;  4DUZ T;  3EVY A;  5FVL A;  4DV0 T;  3O1H A;  3C4Z A;  5JH7 E;  5JR9 C;  2QGS A;  2VWA A;  2XQ9 A;  2LHR A;  2VL0 A;  3AE5 A;  3AEB A;  3CIR A;  4IDZ A;  1HG2 A;  4KI0 F;  5JDQ A;  3EUH A;  5LJM A;  4PK4 A;  4X1I E;  4P09 A;  4EB6 E;  4F6R C;  4I50 E;  2BBJ A;  2WSS V;  3JC6 C;  1BR0 A;  4AKH A;  2XQ3 A;  4O4I E;  1UK5 A;  3AVR A;  4U7I A;  2DL1 A;  2WY2 A;  4UF0 A;  5LA6 E;  4ASK A;  3AE9 A;  3DTO A;  2CRB A;  2XAS B;  3AEG A;  2I0M A;  3T1H T;  4YY3 T;  4NXM T;  1HNX T;  1G8X A;  3UU6 A;  2X9H A;  2XAG B;  3AA1 B;  2ES0 A;  4L0R A;  4NUV A;  4ADZ A;  5JRC B;  4PJM A;  2PTF A;  5LJN A;  4DUY T;  3PUA A;  2DWG A;  4HFD A;  2A72 A;  2QA7 A;  1KFY A;  1KNR A;  1FEW A;  1Z8U A;  1XZY A;  2E9X C;  2H7V C;  3E0Z A;  3EI0 A;  3KBU A;  3OYZ A;  2ZM2 A;  3MK7 C;  5AQS B;  3PUW F;  2E9X A;  3L09 A;  4PK6 A;  2E2A A;  3FBZ A;  4PFO A;  3VR8 A;  2ZM6 T;  5JRC A;  4ZOL E;  4OFZ A;  3VKG A;  2BS3 A;  4UV8 B;  1IJ6 A;  5JTG A;  3KV9 A;  4UIG A;  2BG9 E;  2XAQ B;  3HI2 A;  1OED A;  4OK0 A;  3AXJ B;  5AQT B;  4YJ3 E;  4CQI A;  3OTO T;  3RGL A;  1XMQ T;  1OED C;  2NWB A;  1XNQ T;  1MMN A;  2KXP B;  4PNI A;  4MFR A;  5FXV A;  5HCM A;  3IBP A;  2WWV A;  3SRZ A;  4PAG A;  4X5T A;  3AE2 A;  2MTQ A;  3AEE A;  3UUX B;  2SPC A;  3QB5 K;  2K48 A;  4IDQ A;  3AB3 B;  5H6Q B;  3WAJ A;  2WAU A;  4ISS A;  5LMU T;  3G06 A;  1VRB A;  2WZH A;  3QUJ A;  1OXZ A;  1S35 A;  1FIO A;  3FZL B;  3PJA A;  2V6Y A;  3KVA A;  2YN6 A;  3AAI A;  3TLS A;  4CN1 A;  4U74 A;  4JBW F;  3GWH A;  3KBT A;  4EEB A;  3AE3 A;  3C64 A;  4YJ2 E;  3ZC0 A;  3AEA A;  4GYR A;  2DHR A;  3I9W A;  2RPA A;  5IHY A;  4EYU A;  5JR9 B;  4AI6 A;  2KLQ A;  4KBM B;  4TWD A;  3PUZ F;  1D1A A;  2L8K A;  4OX9 T;  4KHP T;  2CXF A;  3RPU A;  4IHJ E;  2CE7 A;  3I9Y A;  1W0B A;  2FUP A;  4HFI A;  3P50 A;  3PDY A;  3ZKR A;  3C98 B;  2FBW A;  2JJ9 A;  1HCI A;  5LOV E;  4AKL A;  4ZZB A;  1ZHC A;  2FJD A;  2XQ7 A;  1XWM A;  3HA4 A;  3GN5 B;  3LDQ B;  3N5L A;  1HNW T;  5JDM A;  1CHU A;  3KVB A;  1WCR A;  4IT4 A;  4YTN A;  1YQ4 A;  3JCF A;  4EXT A;  2H3R A;  3T8O A;  2D9D A;  2NW7 A;  4AKR B;  2WDR A;  4B3T T;  3HKE E;  4HWI B;  2X66 A;  3I0Q A;  5AQK B;  3K1S A;  2CM0 A;  5LBM A;  1US7 B;  2A9U A;  1UGO A;  3UU4 A;  4HE8 A;  3Q5X A;  2D5U A;  1E2A A;  3BQK A;  2K5B B;  4YFS A;  4DR6 T;  2JIW A;  2JRK A;  3ZMU B;  3F31 A;  3H3M A;  3NZQ A;  2XAF B;  4H9Q C;  4O8S A;  4LF6 T;  1I6Z A;  3ONL C;  3MZK B;  5KMG P;  4DR7 T;  4JI5 T;  2XPK A;  5J1G A;  5L3D B;  1QUU A;  4JI7 T;  3FB2 A;  2Q9Q A;  2RP4 A;  2XQY A;  5L3B B;  2W66 A;  3PTR B;  4IDN A;  3KDS E;  4M1P A;  1YXR A;  3B5M A;  2GK9 A;  1D0Z A;  2LSG A;  4WBO A;  3QB5 A;  3ANW B;  4JUY A;  4X1Y E;  5AQJ B;  5AQU B;  2Y6X A;  3N9M A;  3LBX B;  2KWI B;  3EDU A;  4UEM A;  2HN2 A;  1VCT A;  2XQ4 A;  5ABE A;  2X0H A;  4EED A;  3KV6 A;  2UUC T;  1N33 T;  2UXB T;  1JNR A;  3UU5 A;  2AXD S;  2W0G A;  2WQY A;  3NRY A;  1BR1 A;  5FP3 A;  5DJQ C;  2E8I A;  3RC3 A;  5AQM B;  5FVK A;  4OYK A;  2LT3 A;  3NRX A;  3L8R A;  2IW5 B;  3IF8 B;  4I55 E;  3MJX A;  3AAE B;  2E9X B;  3E22 E;  1H7C A;  5FXX A;  2NW8 A;  4LF4 T;  4QH5 A;  3MAC A;  5FNV E;  2LOS A;  3NWI A;  4CI1 B;  2XSB A;  3LJC A;  1X79 A;  4EOZ B;  4MLK A;  5LHI B;  4AQF A;  5JDL A;  2D0T A;  4CXW A;  3JC6 D;  3FZH B;  5FL1 A;  1N34 T;  2LOP A;  3OKQ A;  4JI6 T;  2KIN B;  4TNV A;  3ZT5 A;  1WYB A;  3PUG A;  5AQO B;  2KMF A;  3P4R A;  4B6X A;  5HYA A;  1QSD A;  5L3C B;  3KV4 A;  3OJA A;  5JDN A;  1MIW A;  3RQW A;  3OYX A;  4WW0 A;  5AQV B;  3AXJ A;  2W4X A;  4G63 A;  1WR6 A;  1M7K A;  4HWC A;  4U2Y A;  3VHL A;  2YDS A;  5JDH A;  4DVD A;  2LLY A;  2Q9Q B;  3PUX F;  2D0U A;  3TKL B;  4AXP A;  2V7L A;  4ILC A;  4GK5 E;  5HEJ A;  1IBL T;  5ABG A;  3KV5 A;  5ABH A;  2XJ7 A;  4TNW A;  3AE8 A;  5ABF A;  1LVF A;  2W00 A;  2XQ6 A;  3N9Q A;  3RRW A;  4ZI3 C;  3CML A;  5EK3 A;  4P0B A;  3P7I A;  5ABF B;  4O2A E;  2UUA T;  3N9N A;  2WB5 A;  3RKG A;  2CBI A;  2WCA A;  4IE7 A;  2XSA A;  3SOL A;  4KMC A;  4U72 A;  4ZI7 E;  4KX6 A;  2XHE B;  1XDP A;  4U2Z A;  1Z0P A;  2ZM8 A;  2VK9 A;  4GYS A;  2V7K A;  3I0O A;  3ZT6 A;  4DND A;  2YU2 A;  4DBQ A;  4P0A A;  3ANW A;  1BR2 A;  1NEN A;  1HX8 A;  3FXE B;  3LFM A;  5L3F B;  4X66 T;  2DNX A;  3EDV A;  5CJ5 A;  3P4W A;  1B7T A;  3RX6 A;  2BDE A;  3QK6 A;  5IWA T;  2LE8 A;  2KND A;  5TAO A;  2XM1 A;  3ZYK A;  3CK6 A;  4IIJ E;  3RIA A;  3ZLI A;  5AQL B;  2PJQ A;  2DWK A;  4ZI2 C;  5CA0 E;  5EK2 A;  4LF5 T;  4PJJ A;  3RHW A;  2WMN A;  2YOE A;  3SFE A;  4HFH A;  4JYA T;  2JQH A;  1ZEE A;  3C50 A;  3RQU A;  4U33 A;  3UFE A;  3AA7 B;  2XZE A;  3QC9 A;  4CI3 B;  4YTP A;  3FZF B;  4ERR A;  2YU1 A;  1IBM T;  3CQC B;  2YIN A;  3U3I A;  1MMG A;  3ZC1 A;  3ZT7 A;  2VQE T;  1N36 T;  5AQN B;  4B3R T;  4V1A v;  3VU7 H;  4AQY T;  4B3M T;  3AA0 B;  5LCY A;  5LGU B;  4DV3 T;  2Z6E A;  3J9X 1;  3CX8 B;  4UF0 B;  5HAX A;  2YDQ A;  2M6I A;  3UUN A;  2D2S A;  1S94 A;  5LHH B;  2CCQ A;  5AQP B;  4JI4 T;  3PJA J;  3NZP A;  4JLE A;  4Z91 A;  4COF A;  5LHG B;  4AKI A;  1EZ3 A;  3N2K E;  4HEA A;  5J0Z A;  2V5C A;  4HFC A;  2H7O A;  2NTY A;  3A7M A;  4TV8 E;  1KNZ A;  2K3W A;  3P4P A;  1T72 A;  2CWO A;  2RA1 A;  4UVA B;  5F5W A;  4CN6 A;  3WI3 A;  4H9P C;  2V7J A;  2WDV A;  4IL4 A;  2I6H A;  5AFU L;  1WLX A;  1ZOY A;  2UXX B;  2VVS A;  2X0Y A;  3KFW X;  1MND A;  2XAH B;  2EHO B;  3ZJ1 A;  4AQG A;  2FJE A;  1XNR T;  3ESL A;  4LF7 T;  1IJ5 A;  2CPT A;  1YD8 G;  4QXB B;  1G73 A;  2IIU A;  2E5L T;  3PE0 A;  4MBQ A;  2QVA A;  4LFA T;  2H88 A;  2XQA A;  3AE4 A;  1AJ3 A;  3AEC A;  4DV2 T;  2PG8 A;  2BG9 C;  5FMN A;  5JDF A;  1O3X A;  3LG7 A;  3VRA A;  3FZM B;  3RH3 A;  2YDR A;  4H63 V;  4ANJ A;  3Q2M A;  5CFB A;  4UR9 A;  3UT5 E;  4YHH T;  2CXD A;  5FXZ A;  2XY8 B;  5HEH A;  4DR4 T;  4O4J E;  2LM2 A;  4HTE A;  2R6G F;  4DV5 T;  1U4Q A;  1UX5 A;  2QYW A;  4AIU A;  4E7S A;  2UXD T;  2KSR A;  5EZY E;  3ETV A;  3RIU C;  4AQF C;  5ADX L;  5L3G B;  1YW0 A;  2F4V T;  5DQV A;  1KF6 A;  1I94 T;  2NR4 A;  3UQ7 A;  4A56 A;  2WWU A;  3R6N A;  3ZMS B;  1J5W A;  2ZLY A;  2ZM0 A;  3TLV A;  4JI1 T;  1KEY A;  2K24 A;  5HWY A;  5FY0 A;  5LP6 E;  1N32 T;  3PUR A;  2W61 A;  4MHC A;  4ILB A;  3WAK A;  4B3S T;  2LM9 A;  1D0X A;  2W62 A;  5HCJ A;  4C91 A;  2XUE A;  2VKO A;  3EAM A;  3PU8 A;  4WZX A;  2UXC T;  4IE0 A;  2WS3 A;  2V26 A;  5C8Y E;  3ZEF B;  1DU2 A;  1W9R A;  3N9P A;  1GQE A;  2IC9 A;  1UUS A;  2Y48 B;  4O4L E;  4I43 B;  1HNZ T;  1ZKE A;  2LHN A;  3GMI A;  4GIW A;  4TZ4 C;  3VKH A;  3J7Y q;  5LNK A;  2YKS A;  5LBQ B;  2VAS A;  4X65 T;  2B1E A;  3C4X A;  1YKH B;  4TX5 A;  5L4H A;  4AIS A;  3CVR A;  2JPF A;  4LMJ A;  3HR0 A;  2ZMA A;  2MBG A;  2X68 A;  4U3C A; 
#chains in the Genus database with same CATH homology
 1UCU A;  2DCF A;  2IC6 A;  3IEE A;  4JEH B;  3OBV E;  3O1J A;  2X51 A;  4UV9 B;  3O9X A;  3ZYM A;  3P8C D;  5HXE A;  1LVK A;  3CX6 B;  2V7M A;  3V5U A;  3ZMV B;  2LSY A;  5KX5 E;  1LKX A;  1MIV A;  2N2N A;  5FY7 A;  3PUQ A;  3RYC E;  3S4U A;  4IE5 A;  3RYF E;  1D1C A;  4H9R C;  3BK9 A;  1IZN B;  5JRE A;  3N9O A;  4XAX B;  4QKN A;  4QXC B;  4CZZ B;  4QHO A;  3RKO A;  2V7I A;  2CLY C;  3U78 A;  4YLH A;  3CKD A;  2EHO A;  2X9W A;  4X20 E;  4UXN B;  4G2A A;  2WMO A;  4ILU A;  5LG4 A;  1D1B A;  2WM9 A;  5GON E;  3CWZ B;  2MYS A;  3DJB A;  3IHR A;  3FXD B;  2HH7 A;  2CA5 A;  1FMV A;  1OWA A;  3C4W A;  4BJN A;  5LYJ E;  4Z8X A;  4EZ4 A;  2LSI A;  3AAA B;  2NP9 A;  3W15 B;  1SHZ C;  2YK0 A;  3AVS A;  4OHF A;  5FYM A;  3FHN A;  3B13 A;  3D0T A;  3RRC A;  3K3O A;  4KUM B;  4EAH A;  4ZI2 D;  5L2L A;  4XBF B;  4L9I A;  2DI4 A;  2VKJ A;  2IAK A;  3ETU A;  5DAB A;  3K8P C;  1UX4 A;  3Q9D A;  2CEA A;  5JDG A;  1T98 A;  3N2G E;  3RYI E;  3ONX A;  5H6R B;  2BZB A;  2VKH A;  4CXX A;  3N2O A;  2X0L B;  2XTL A;  5JVD E;  2VB6 A;  4CI2 B;  3GA8 A;  2G0U A;  4QWN B;  3B57 A;  2Q9Q D;  1NWM X;  3LK2 B;  3LK4 2;  4FJO A;  4O2B E;  4EB6 E;  2CMR A;  1KK7 A;  5CB4 E;  1LRZ A;  5F3J A;  3ZN0 B;  1V9D A;  4ZS2 A;  3ZCJ A;  1Y64 B;  1WYC A;  3UUM A;  4KP3 C;  3ZMT B;  4H63 H;  5IYZ E;  3HL6 A;  5ETW A;  2Y8D A;  5BMV E;  3K3Q C;  2E9X D;  1HS7 A;  3CPZ A;  3ZYL A;  5DQW A;  4L5G A;  2VKD A;  1MMD A;  2DLR A;  3UTK A;  4PK5 A;  2N9D A;  1VOM A;  2EHO C;  3F2E A;  1FMW A;  2P9B A;  3SS1 A;  3RC8 A;  2JMH A;  2BVM A;  4DBR A;  3MKD A;  4I4T E;  1E1H B;  4CXY A;  2ACX A;  2C5K T;  3CX7 B;  3ZCI A;  4WBN E;  2W63 A;  3ZN1 B;  5EK4 A;  5M4Y A;  4TN7 B;  4DMW A;  3PUS A;  4K0U A;  3BQL A;  2I59 A;  3O4X E;  2X9Y A;  1YKE B;  5LXT E;  4GOU A;  3V5S A;  2C5J A;  2JQQ A;  4N78 D;  1MMA A;  4QX7 B;  5E0O A;  2K9A A;  3F57 A;  3MXZ A;  4X1K E;  5JR9 B;  3R84 B;  3O1I A;  4PFP A;  5HXS A;  5HWX A;  2HPJ A;  1HFA A;  4H9O C;  4PJN A;  4BAY B;  3HKD E;  3M65 A;  1MNE A;  3N9L A;  3LBX A;  4HKA A;  3BQI A;  3FBL A;  5F8P A;  3MA9 A;  4H9N C;  2VL8 A;  2J1D G;  2NTX A;  3Q5W A;  4AKG A;  4EIW A;  2CWY A;  3ZMZ B;  4EYY R;  3AA6 B;  4BA9 A;  4XZC A;  4IE6 A;  2MOZ A;  2ODV A;  4TUY E;  5A1L A;  2LSJ A;  3PU3 A;  4EZH A;  4IGU A;  3CQG B;  2WBL A;  3H3A A;  2UXN B;  2KT9 A;  1CUN A;  3HKC E;  4PJL A;  4GK0 E;  2X67 A;  5L3E B;  2X9X A;  2A2F X;  2A3D A;  3E08 A;  4E7Z A;  4QX8 B;  4UVB B;  3HKB E;  1BR4 A;  2LEH A;  2LSK A;  3K3N A;  3NBX X;  5FY1 A;  4JEU B;  3C51 A;  3GN5 A;  4WNK A;  2PFV A;  1U5P A;  4QXH B;  4H9S E;  5JR9 A;  5FXW A;  2C5I T;  1HTJ F;  5HXR A;  3L3P A;  1IAP A;  3DP7 A;  2V1D B;  4ZI3 D;  2XAJ B;  4TV9 E;  2L3L A;  2HPL A;  1NAF A;  2OA5 A;  1ZV4 X;  3UUL A;  4HN9 A;  3ZPO A;  4BJM A;  5J2U E;  1SA0 E;  4J2C A;  2CLY B;  2KZ7 B;  3ZJ2 A;  2M67 A;  2N1G A;  4IE4 A;  2C0S A;  4MAL A;  4DMV A;  4HGA A;  2Q9Q C;  4FI5 A;  4YHJ A;  1WRD A;  5JQG E;  2LJL A;  3RYH E;  2JMK A;  4IST A;  2L9Q A;  4UVC B;  2BVL A;  2NW9 A;  4DO0 A;  3SWH A;  4HFV A;  3LK3 B;  5LGN B;  3CQX C;  5CA1 E;  5KDM C;  1MIY A;  1HF8 A;  3I1A A;  4OYJ A;  2YEV C;  1D0Y A;  4NUU A;  2ODU A;  3H37 A;  4ZHQ E;  4O4H E;  2CXL A;  2NOX A;  2PBI A;  3A5X A;  4UEL A;  5HXC A;  4PW8 A;  2KWH A;  1HG5 A;  3KIN B;  2EHO D;  3EVY A;  3O1H A;  3C4Z A;  5JR9 C;  2QGS A;  2VWA A;  5HXH A;  2LHR A;  4IDZ A;  1HG2 A;  5JDQ A;  3EUH A;  5LJM A;  4PK4 A;  4X1I E;  4P09 A;  4F6R C;  4I50 E;  3JC6 C;  2WSS V;  1BR0 A;  4AKH A;  4O4I E;  3AVR A;  4UF0 A;  5LA6 E;  4ASK A;  3DTO A;  2XAS B;  1G8X A;  2X9H A;  2XAG B;  3AA1 B;  2ES0 A;  4L0R A;  4NUV A;  4ADZ A;  5JRC B;  4PJM A;  5LJN A;  3PUA A;  2DWG A;  4ZS3 A;  2A72 A;  2QA7 A;  4PJJ A;  2E9X C;  1FEW A;  2H7V C;  3E0Z A;  3OYZ A;  4AXP A;  3KBU A;  2ZM2 A;  3MK7 C;  4PK6 A;  2E9X A;  3L09 A;  4PFO A;  5JRC A;  3FBZ A;  4ZOL E;  4OFZ A;  3VKG A;  4UV8 B;  1IJ6 A;  3KV9 A;  4UIG A;  2XAQ B;  3HI2 A;  4CQI A;  4OK0 A;  4YJ3 E;  2NWB A;  1MMN A;  2KXP B;  4PNI A;  4MFR A;  5FXV A;  3IBP A;  3SRZ A;  4PAG A;  2MTQ A;  3UUX B;  2SPC A;  2K48 A;  3AB3 B;  5H6Q B;  3WAJ A;  2WAU A;  4ISS A;  1VRB A;  3QUJ A;  1OXZ A;  1S35 A;  1FIO A;  3KVA A;  3AAI A;  4U74 A;  3GWH A;  3KBT A;  3C64 A;  4YJ2 E;  3ZC0 A;  4GYR A;  4AI6 A;  2DHR A;  3I9W A;  5IHY A;  4EYU A;  2KLQ A;  4KBM B;  1D1A A;  2L8K A;  2CXF A;  3RPU A;  4IHJ E;  2CE7 A;  3I9Y A;  3PDY A;  3C98 B;  2JJ9 A;  1HCI A;  5LOV E;  4AKL A;  1ZHC A;  3N5L A;  3HA4 A;  3GN5 B;  5JDM A;  3KVB A;  4EXT A;  2H3R A;  3T8O A;  2NW7 A;  4AKR B;  3HKE E;  2X66 A;  3I0Q A;  2CM0 A;  5LBM A;  1US7 B;  4HE8 A;  3Q5X A;  2D5U A;  3BQK A;  4YFS A;  2K5B B;  2JRK A;  3ZMU B;  3F31 A;  3NZQ A;  2XAF B;  4H9Q C;  4O8S A;  3MZK B;  5KMG P;  5J1G A;  5L3D B;  1QUU A;  3FB2 A;  2Q9Q A;  2RP4 A;  2XQY A;  5L3B B;  3PTR B;  3KDS E;  4M1P A;  5LHH B;  2GK9 A;  1D0Z A;  2LSG A;  4WBO A;  4X1Y E;  3ANW B;  4JUY A;  2Y6X A;  3N9M A;  3LBX B;  2KWI B;  3EDU A;  4UEM A;  3KV6 A;  2W0G A;  3NRY A;  1BR1 A;  5FP3 A;  5DJQ C;  2E8I A;  3RC3 A;  4OYK A;  2LT3 A;  3NRX A;  2IW5 B;  3IF8 B;  4I55 E;  3MJX A;  3AAE B;  2E9X B;  3E22 E;  1H7C A;  5FXX A;  2NW8 A;  5FNV E;  3MAC A;  2LOS A;  4CI1 B;  3LJC A;  1X79 A;  4EOZ B;  4MLK A;  5LHI B;  4AQF A;  5JDL A;  2D0T A;  4CXW A;  3JC6 D;  2LOP A;  3OKQ A;  2KIN B;  5HYA A;  5L3C B;  1WYB A;  3PUG A;  4B6X A;  2KMF A;  5LGT B;  1QSD A;  3KV4 A;  3OJA A;  5JDN A;  1MIW A;  3OYX A;  4WW0 A;  5JH7 E;  4G63 A;  1WR6 A;  5JDH A;  3VHL A;  4DVD A;  2Q9Q B;  3TKL B;  2D0U A;  2V7L A;  4GK5 E;  3KV5 A;  1LVF A;  2W00 A;  3N9Q A;  3RRW A;  4ZI3 C;  3CML A;  5EK3 A;  4P0B A;  3P7I A;  4O2A E;  3N9N A;  4IE7 A;  3SOL A;  4KMC A;  4U72 A;  4ZI7 E;  2XHE B;  1Z0P A;  2ZM8 A;  2VK9 A;  4GYS A;  2V7K A;  3I0O A;  4DND A;  4P0A A;  2YU2 A;  4DBQ A;  3ANW A;  1BR2 A;  3FXE B;  1HX8 A;  3LFM A;  5L3F B;  2DNX A;  3EDV A;  1B7T A;  3RX6 A;  2BDE A;  3QK6 A;  2LE8 A;  2KND A;  5TAO A;  3ZYK A;  4IIJ E;  3ZLI A;  4ZI2 C;  2PJQ A;  2DWK A;  5CA0 E;  5EK2 A;  2WMN A;  3C50 A;  1ZEE A;  3UFE A;  4CI3 B;  5J2T E;  3AA7 B;  3QC9 A;  4ERR A;  2YU1 A;  3CQC B;  2YIN A;  3U3I A;  1MMG A;  3ZC1 A;  4V1A v;  3VU7 H;  3AA0 B;  5LCY A;  5LGU B;  2Z6E A;  3J9X 1;  3CX8 B;  4UF0 B;  5HAX A;  3UUN A;  2D2S A;  1S94 A;  2CCQ A;  4JLE A;  3NZP A;  5LHG B;  4AKI A;  1EZ3 A;  3N2K E;  4HEA A;  4TV8 E;  1KNZ A;  2H7O A;  2NTY A;  2CWO A;  2RA1 A;  4UVA B;  3WI3 A;  4H9P C;  2V7J A;  5AFU L;  1WLX A;  3ZJ1 A;  2UXX B;  3KFW X;  1MND A;  2XAH B;  2EHO B;  4AQG A;  3ESL A;  1IJ5 A;  1YD8 G;  4QXB B;  1G73 A;  3PE0 A;  4MBQ A;  1AJ3 A;  2PG8 A;  5FMN A;  5JDF A;  1O3X A;  3LG7 A;  3RH3 A;  4ANJ A;  4H63 V;  3Q2M A;  3UT5 E;  2CXD A;  5FXZ A;  4O4J E;  4HTE A;  1U4Q A;  1UX5 A;  4E7S A;  5ADX L;  5EZY E;  3ETV A;  4AQF C;  5L3G B;  1YW0 A;  5DQV A;  4A56 A;  2WWU A;  3R6N A;  3ZMS B;  2ZLY A;  2ZM0 A;  5HWY A;  2K24 A;  5FY0 A;  5LP6 E;  3PUR A;  2W61 A;  4MHC A;  3WAK A;  2LM9 A;  1D0X A;  2W62 A;  4C91 A;  2XUE A;  2VKO A;  3PU8 A;  4IE0 A;  2V26 A;  5C8Y E;  3ZEF B;  3N9P A;  2IC9 A;  2Y48 B;  4O4L E;  4I43 B;  1ZKE A;  2LHN A;  3GMI A;  4GIW A;  4TZ4 C;  3VKH A;  3J7Y q;  5LNK A;  5LBQ B;  2VAS A;  2B1E A;  3C4X A;  1YKH B;  4TX5 A;  3CVR A;  2JPF A;  3HR0 A;  2ZMA A;  2MBG A;  2X68 A;  4C90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...