3ZJ1A

Structure of nab2p tandem zinc finger 12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
GSFTPTKKEGRCRLFPHCPLGRSCPHAHPTKVCNEYPNCPKPPGTCEFLHPNEDEELMKEMERTREEFQKRKADLLAAKRKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
publication title Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zj1A00
5L2LA 2LHNA 3ZJ1A 3ZJ2A
chains in the Genus database with same CATH superfamily
1E7PA 3UQ4A 2V6YB 2LHNA 5LP6E 5J0ZA 3RYHE 5FY7A 2B1EA 2W61A 4QXBB 2M67A 1W0BA 5AQLB 4IT4A 5JVDE 2ACXA 5L3BB 2KINB 4EOZB 3PUWF 4IE7A 4WBNE 4LFBT 3AE2A 2BBHA 3RI5A 3VU7H 5J2TE 1HTJF 4DR3T 3B13A 2XY8B 4IE5A 5JDNA 2M6BA 2IAKA 3UT5E 2WBLA 2D5UA 2WDRA 4IDQA 3AVRA 3J9X1 2V6XA 2WQYA 4QH1A 2HN2A 4OYJA 2RP4A 5L2LA 4GYRA 2LSYA 3LJCA 1XDOA 4OX9T 2WY2A 4EAHA 3HA4A 1M7KA 4ZS2A 3RGLA 5HEOA 2V7LA 2XQAA 5LBMA 2UXDT 5DQVA 3X1DA 4B3TT 3AAAB 3FB2A 4UXNB 4JYAT 4DR4T 2CE7A 2LRKA 2FJAA 4UVBB 5M4YA 3AXJA 4P1NA 4JBWF 5LMNT 2WAUA 2WCAA 2LRLA 2XM1A 3V5UA 3PUZF 2XQ8A 2XAFB 4ZI3C 3AAEB 2EHOA 1D1BA 4KHPT 2A72A 2BG9B 2V5CA 2X9HA 5HEUA 2VKHA 5EZYE 3NVOA 5JQGE 4FI5A 3ZMZB 2IC9A 5AQMB 2XASB 1H7CA 4MHCA 2LKGA 2VK9A 2V26A 5LNKA 5LJNA 4EB6E 5FMNA 3ZSTA 4DMWA 4TZ4C 5ETWA 4ANJA 2FJEA 3RYFE 3ONXA 4ILBA 5FL1A 2X0HA 4H9QC 3ZEFB 3LBXB 2LEHA 1J5WA 2YDQA 5FP3A 1WYBA 3O1JA 3H37A 4YJ2E 2LJLA 3K1SA 4ADZA 2ZLYA 4WZXA 2BKPA 4O4HE 4UV8B 3OYXA 3N2OA 4AKIA 2W4XA 3RKGA 3NBXX 5H6QB 2VL8A 3UTKA 3O4XE 5L47A 1JNZA 4IDPA 4IE0A 2L3LA 3O1IA 2FJDA 4L0RA 3IA3A 3U78A 1E2AA 3A5XA 3OBVE 4QH4A 4AQFA 4YSYA 4DIDB 4PJMA 3JAEA 4DMVA 3ZT5A 1UGOA 1FMVA 3MJXA 2K5BB 2LLYA 5FNVE 3WAKA 3RC3A 3RC8A 2QRXA 3N2GE 4TX5A 3PUYF 4I0UA 4FJOA 3UUMA 4KX6A 3ANWA 1IBKT 5ABGA 2LSJA 3OVUA 4U7YA 4F8HA 4CI3B 1QLBA 5HXSA 2XQ6A 3PE0A 3NKZA 4H9NC 2ZM6T 4GK0E 2X9WA 3B57A 4LMJA 3JAFA 1OEDE 2Y48B 3TLWA 4CZZB 3GWHA 3T1HT 2UXBT 4COFA 2NR4A 2LOPA 3P4QA 1KEYA 1ZP0A 3SWHA 4DBRA 3WI3A 3L3PA 3NRXA 5HWXA 4J2CA 3RIUC 2X9XA 4U3CA 4HWHA 4HWDA 3FXEB 2DLRA 5KDMC 2PG8A 2KMFA 1XZYA 4B3RT 3SFEA 1MNDA 4KMCA 4IE4A 4HFCA 1ZOYA 3TLUA 3ZMTB 3EHZA 2V8SV 3FXDB 1R8IA 4F6RC 2H89A 1VCTA 4PW8A 4X1IE 2MTQA 3C4ZA 1NAFA 3KV5A 3CKDA 2L9QA 2XPKA 5L3DB 2ES0A 1BR0A 5LXTE 4HFIA 4EZ4A 3SS1A 4AQGA 3A8YC 4Q25A 1LRZA 4IDZA 3NWIA 4I4TE 3RH3A 5AQQB 3QB5A 1HG5A 5HYAA 1ZEEA 5AQRB 2LT3A 4E7SA 4YJ3E 1HX8A 2V7JA 5AQVB 4BAYB 4BJNA 3AEEA 3LDQB 2BKOA 5HEJA 2CBJA 4XBFB 2NW7A 4DBQA 4DV0T 3RLFF 4MLKA 2WDQA 2YU2A 2EHOD 2SPCA 4L5GA 3UU5A 3Q5WA 2HH7A 4UF0A 2MAWA 2X9YA 1UUSA 2FJBA 3LK42 4QX7B 1FJGT 4HWFA 1QUUA 3CIRA 4DR7T 4OYKA 4PAGA 2WZIA 1YQ4A 1G73A 2V5DA 4WW0A 1HFAA 4QWNB 4C91A 2D9DA 5JH7E 3N9QA 2YDRA 5JR9A 3CQCB 5C8YE 3ZYKA 5AQGB 4DV4T 2WWUA 2XSAA 2W63A 3ZKRA 2GK9A 3AE7A 4Z90A 2NWBA 3PUXF 1D0ZA 4GIWA 2MOZA 3GN5B 2W00A 4X20E 4HWIB 4K0UA 5FXVA 3AB3B 3UUNA 1N36T 2DI4A 3Q5EA 2W62A 3AE3A 4YTPA 2QVAA 4OFZA 3NZPA 5KMGP 3PU8A 2LSIA 4ZZBA 4Z91A 2NTYA 1T7SA 3LK3B 3ZT7A 3KBUA 2E5VA 3ZN0B 3FZMB 3RKOA 2DCFA 1N33T 1XDPA 3FZFB 3PU3A 5JDQA 2HPJA 2UXNB 4X62T 3B5MA 5ABFB 2AE9A 3M65A 2QA7A 3AEBA 3IBPA 3SRZA 2E9XA 4LF7T 3AE4A 4LF5T 5L3CB 4G2AA 1Z0PA 5FY0A 3LSVA 2PFVA 4EGWA 4M1PA 4ILAA 3UQ7A 4UELA 4LFAT 2XHEB 3C50A 4HE8A 5JDGA 4E7ZA 1XMOT 4JI4T 1OEDA 1IBMT 1WCRA 1T98A 2NOXA 4NUVA 5DQWA 1IBLT 2VURA 2JPFA 1WYCA 3F31A 5IUXA 2CXDA 2V7MA 4KUMB 1T72A 4HGAA 4AKLA 3UFGA 1WRDA 5H6RB 2YK0A 4ILUA 3ZYMA 4A56A 1HF8A 3BQLA 5CGMA 2LM9A 2V1DB 3RPUA 4B3MT 1MMNA 1J5ET 3C4XA 3HKBE 3KV6A 5JDHA 2YOEA 4JI2T 2VB6A 3AA0B 3PUQA 4JEHB 4TWHA 1XNQT 5AQOB 5EK4A 1VCSA 5FL0A 1KNPA 4LMLA 2ODUA 1LVKA 2J4GA 1KFYA 4NUUA 4CN1A 2YN6A 2XSBA 5HCMA 5L3GB 5AQPB 2QYWA 4G63A 3PV0F 1X79A 4LMKA 2BG9C 2RPAA 2NW9A 3DP7A 5LCYA 4HFVA 3KBTA 1VRBA 4H9OC 5CA0E 2VQFT 4O4LE 3P7IA 3RIFA 3I1AA 2B76A 2KNDA 1X9BA 4LFCT 1S35A 4P0AA 2BVMA 4JI1T 4UVAB 2CA5A 5LA6E 1UCUA 1I94T 3CPZA 3ZN1B 2IIUA 3GA8A 2XQYA 3RYCE 2BS3A 4HTEA 2LHRA 3KDSE 4KI0F 5DABA 1WR0A 4AQYT 5LG4A 4TV9E 3A7MA 2HHHT 3VRAA 1US7B 2PBIA 2X51A 1FEWA 3I9YA 4OHFA 3RIAA 3OTOT 1E1HB 3KFWX 2EHOC 4O8SA 2KWIB 3VRBA 2WM9A 5AQIB 1HNZT 3EI0A 4O4IE 2V7IA 5IYZE 4GYSA 5LOVE 4QXCB 3Q9DA 4O2AE 1WFDA 2XTLA 5FXWA 3ETVA 4U74A 5L3EB 4HWCA 2I0MA 3AXJB 3L09A 4V1Av 1ZV4X 1I6ZA 3BK9A 1YW0A 1YKEB 1W0AA 2WS3A 2EHOB 4U31A 2IHR1 2IW5B 3OKQA 5J2UE 5EK3A 3LFMA 1KNZA 5LGUB 3UUXB 2A3DA 1BR4A 2XAJB 3TKLB 1ZKEA 3QOFA 2JMHA 4H9RC 2E9XD 3KINB 2H3RA 2WU2A 4AKHA 3ZLIA 1UURA 3IEEA 2NTXA 1NEKA 3ONJA 4MALA 5LHIB 5LGTB 4PJJA 4ZI2D 4GKJT 3CX8B 4IE6A 4HFBA 4YLHA 5AFUL 4B6XA 2KLQA 2CHOA 1UX5A 2ZMAA 2A2FX 2MBGA 2N9DA 3N9PA 2W67A 3OPCA 1L0VA 2M6IA 4MBQA 3E22E 2XQ4A 2JRKA 4QH5A 4ZXLA 4H9SE 4ASKA 3IF8B 2CM0A 4PFPA 2KXPB 1O3XA 3PUSA 4YXDA 3BQIA 4H63H 2XZEA 2WP9A 4AKRB 4PK6A 3I0QA 1WR6A 3RRCA 3UU8A 2LOSA 3EVYA 4UIGA 3K3NA 2WMNA 4ISSA 2I59A 3HI2A 4DV2T 3WAJA 4P09A 5ADXL 4H63V 1VOMA 5HEHA 3ANWB 5JTGA 2QGSA 4WNKA 2XAQB 4PNIA 3FZKB 5EK2A 3PUGA 2UXCT 2LKHA 3N5LA 2WSSV 4GOUA 5C3JA 2CWOA 4WBOA 2CHNA 1SE7A 2H88A 4DV7T 1XMQT 3PJAA 3FZHB 3LK2B 2X0LB 2LE8A 4U2ZA 3H3MA 3ZMVB 4YHJA 4X64T 2D0TA 4HEAA 2Q9QA 3AE6A 2WWVA 2VKJA 2OA5A 3JC6D 3HKEE 4DR2T 2OV9A 3MKDA 1NWMX 4UVCB 1Z8UA 4AISA 1U4QA 3AE5A 2MPKA 3PUAA 5AQUB 4BJMA 4HN9A 2CCQA 5LJMA 3V5SA 1T8BA 2IMLA 2C5JA 4OK0A 1D0XA 4QKNA 2Y6XA 2D2SA 1QSDA 5F5WA 4ILCA 4TUYE 3ETUA 3Q5XA 4DV6T 4NIQA 5FXZA 4AI6A 3ZJ1A 3G06A 5FYMA 2C0SA 4IHJE 2Q9QB 4DUZT 4NXNT 4UR9A 4JI5T 1KK7A 5BMVE 4CXWA 5JR9C 3QC9A 3CQGB 4DR5T 1MMDA 1YXRA 3EABA 4ERRA 3UUBA 3IHRA 4UF0B 2XQ7A 3CVRA 4U7IA 1YKHB 2V7KA 2ZM8A 4AKGA 4LF6T 2X66A 2VQET 3N9LA 5L4EA 1W9RA 3ZC0A 2BVLA 4TV8E 4IIJE 2JMKA 3ABVA 2CEAA 4QX8B 5JR9B 1M62A 2V6YA 5LYJE 2XJ7A 1BR2A 3GMIA 3AAIA 2W66A 1FIOA 1HR0T 3J7Yq 4JI8T 4PFOA 1FMWA 3AA7B 4XZCA 2UXXB 2WMOA 3RQWA 4ZS3A 4DR1T 5AQNB 5LHGB 4JI6T 4HKAA 4CQIA 3ZPOA 2X67A 4QHOA 3N9OA 2IUBA 3KV4A 2WB5A 1Y01A 2BDEA 4PK4A 2E9XC 2LM2A 2N2NA 3RQUA 5LMUT 3ZC1A 2YU1A 2R6GF 2HN1A 3UU3A 4U33A 4K0KT 4ZI2C 3L8RA 3RX6A 3Q2MA 3ZCIA 5HXRA 4A97A 3QB5K 3AE9A 4TWFA 2VVNA 5LGNB 3UULA 1MNEA 1OEDC 2E9XB 2CLYC 3K3OA 4YSXA 3W15B 1XWMA 5ABHA 1KNRA 3AE1A 4JLEA 2JJ9A 5F3JA 3EAMA 1UK5A 3H3AA 2BZBA 2WU5A 5AQSB 4ZEYA 3KVAA 3O9XA 2JIWA 1MIYA 1MIWA 2J62A 4CN4A 3RRWA 3FHNA 2Z6EA 3AECA 1OEDB 2CLYB 4YTMA 3RHWA 2ACZA 4IREA 3ESLA 1MMAA 4DUYT 4DV3T 4UEMA 3R84B 4KP3C 2E8IA 2X68A 2Q9QD 2UU9T 3RYIE 2BG9A 4CI1B 2YDSA 2E2AA 1XNRT 4JI7T 2XQ3A 4ZI7E 3TLTA 1N34T 5CB4E 3R6NA 3PDYA 5HCJA 4ZHQE 3K8PC 2H7VC 4ZOLE 2D0UA 3EUHA 3C98B 4X1YE 5IHYA 2DWGA 2CXFA 5LBQB 4TNWA 1V9DA 4A5XA 2BBJA 3Q5DA 4HFEA 2ZM0A 2CXLA 4EYYR 3LBXA 3MXZA 1SA0E 5E0OA 3KVBA 4O2BE 4I55E 5CJ5A 3VKGA 1B7TA 3DJBA 3ZMSB 2BKNA 3P4SA 1D1CA 5LB7B 1IJ5A 4EXTA 1MIVA 3AEAA 3JC6C 4EIWA 5FKYA 2BS2A 4LF8T 4P0BA 1D1AA 3D0TA 4I50E 3MZKB 4QXHB 3M3ZB 1G8XA 3HKDE 4TWDA 3VKHA 4PJLA 2C5IT 4X65T 2UUCT 4C90A 2VKDA 4MFRA 3N9NA 4DR6T 3BQKA 2BS4A 2K48A 5IWAT 2I6HA 5JDFA 5CA1E 2W0GA 2DL1A 4HFDA 5AQJB 4LF9T 3C4WA 4YHHT 2DWKA 2UUAT 2L8KA 1MMGA 4EYUA 3VHLA 3K3QC 3L39A 4IL4A 2LSKA 2PJQA 3AVSA 4X66T 2VL0A 3MK7C 5AQFB 1SUMB 2XAGB 3OJAA 2KT9A 1LVFA 2J47A 5JDMA 2XAHB 2CWYA 1HCIA 1HNXT 3P4RA 4U72A 5CFBA 3VR9A 4ISTA 4TN7B 5GONE 1OWAA 1IJ6A 4UV9B 2CMRA 3ZT6A 2CPTA 2XUEA 2K3WA 1UX4A 3HR0A 2E5LT 4AQFC 3F2EA 3ZSSA 2MYSA 3FBZA 4AIUA 4YT0A 4WYVA 2VASA 3ZMUB 1YD8G 2JQKA 2KSRA 3UU6A 3LG7A 4BA9A 1W09A 2DNXA 1N32T 2J1DG 4YTNA 1NENA 3MA9A 5F8PA 4PK5A 2F4VT 4IGUA 2RA1A 4L9IA 3RIUA 3F57A 3N2KE 5KXJA 4JI0T 5HXEA 3UU4A 1KF6A 2JQHA 2OLTA 2XM2A 2X0YA 3I9WA 3CX6B 2WDVA 2VVSA 4B3ST 4O4JE 1U5PA 2VKOA 3EDVA 2YKSA 3TLSA 4YSZA 4TNVA 2ODVA 5J1GA 5L4HA 4NXMT 3RF1A 5LG3A 2WZHA 4AXPA 2P9BA 4ZZCA 1CUNA 4IDNA 1IAPA 2VWAA 4DV5T 3QNUA 5C2TA 5HXCA 2FUPA 3DTOA 3CWZB 1AJ3A 4CXYA 2CBIA 4X5TA 4JV5T 5TAOA 1WLXA 3E0ZA 4XAXB 2G0UA 2BG9E 3I0OA 3UFEA 1DU2A 2N1GA 5JREA 4ZI3D 4JUYA 3CX7B 4I43B 2A9UA 4CN6A 2YINA 3ONLC 3SFDA 4HFHA 3AA1B 1HG2A 2Q9QC 5A1LA 3GN5A 3E08A 4DV1T 2AXDS 1HX1B 2FBWA 5HXHA 3PTRB 1J1JA 4NPPA 2LSGA 3ZCJA 1ZHCA 3CK6A 1JNRA 4GK5E 2Y8DA 2CRBA 5AQKB 2K24A 5HWYA 5FY1A 4EEBA 3TLVA 4PJNA 3T8OA 3CMLA 3SOLA 1IZNB 3PUVF 4GKKT 3JADA 3U3IA 5FXXA 4N78D 1CHUA 4A98A 4DNDA 3C51A 2C5KT 5ABFA 3P50A 1SHZC 4YY3T 4IDOA 4IL9A 2HPLA 4DVDA 3O1HA 5DJQC 3N9MA 1HNWT 3ZYLA 2PTFA 3FZLB 5JRCA 4EEDA 2IDOB 2IC6A 1OXZA 4YFSA 3HKCE 3AA6B 2NW8A 4KBMB 5JDLA 3OYZA 1D0YA 3NZQA 2JQ9A 3P4WA 2DHRA 3P4PA 4CI2B 3NRYA 3VR8A 1BR1A 3MACA 3C64A 4U2YA 1S94A 4EV6A 3AEFA 2JQQA 2XQ5A 3P8CD 4JI3T 5FVKA 3T1YT 1GQEA 5AQTB 2K9AA 3ZJ2A 1EZ3A 3KV9A 2KZ7B 3S4UA 2H7OA 3CQXC 3QUJA 3AEGA 3EDUA 5ABEA 5BR8T 2UUBT 4Z8XA 4LF4T 2NP9A 5JRCB 4EZHA 3FBLA 4H9PC 5L3FB 1Y64B 5FVLA 5AQHB 1LKXA 3JCFA 5HEGA 4DO0A 4X1KE 3PJAJ 4KHZF 3PURA 3AE8A 5HAXA 5KX5E 2ZM2A 3HL6A 2KWHA 4CXXA 2W2UA 3AEDA 2XQ9A 3QK6A 1HS7A 4JEUB 2YEVC 1YQ3A 5LHHB
chains in the Genus database with same CATH topology
3IF8B 2CM0A 4PFPA 4P0BA 1G73A 2LHNA 1D1AA 3D0TA 4WW0A 5LP6E 2KXPB 3RYHE 5FY7A 1HFAA 4I50E 2B1EA 4QWNB 2W61A 1O3XA 3PUSA 4C91A 4QXBB 3BQIA 2M67A 4H63H 4AKRB 5JH7E 3MZKB 3N9QA 4PK6A 5JVDE 5JR9A 3CQCB 5C8YE 4QXHB 1G8XA 3HKDE 3VKHA 2ACXA 4PJLA 2C5IT 5L3BB 3ZYKA 2KINB 4EOZB 4IE7A 3I0QA 1WR6A 3RRCA 2WWUA 4WBNE 4C90A 2VKDA 2LOSA 3EVYA 2W63A 4UIGA 4MFRA 3N9NA 2GK9A 3K3NA 2WMNA 2NWBA 4ISSA 1D0ZA 3BQKA 2I59A 3HI2A 2K48A 4GIWA 2MOZA 3GN5B 2W00A 3VU7H 4X20E 5J2TE 1HTJF 3B13A 3WAJA 4P09A 4IE5A 5JDFA 4K0UA 5JDNA 2IAKA 5FXVA 3UT5E 2WBLA 5ADXL 2D5UA 4H63V 2W0GA 3AB3B 5CA1E 1VOMA 3C4WA 3ANWB 2DWKA 2QGSA 4WNKA 3UUNA 2XAQB 3AVRA 4PNIA 2DI4A 5EK2A 2L8KA 3PUGA 2W62A 3N5LA 3J9X1 4OFZA 2WSSV 3NZPA 4GOUA 1MMGA 3PU8A 2CWOA 5KMGP 4EYUA 2LSIA 4OYJA 4WBOA 2RP4A 3VHLA 3K3QC 2NTYA 5L2LA 3LK3B 4GYRA 2LSYA 2LSKA 2PJQA 3KBUA 3LJCA 3ZN0B 3AVSA 4EAHA 3RKOA 3MK7C 3HA4A 2DCFA 2XAGB 3OJAA 2KT9A 4ZS2A 3PU3A 5JDQA 1LVFA 5JDMA 2XAHB 3LK2B 2HPJA 2CWYA 1HCIA 2X0LB 2UXNB 2LE8A 4U72A 3ZMVB 3M65A 4YHJA 2QA7A 3IBPA 3SRZA 2D0TA 4HEAA 2Q9QA 2V7LA 4ISTA 2E9XA 5LBMA 4TN7B 2VKJA 5GONE 2OA5A 3JC6D 1OWAA 3HKEE 5DQVA 1IJ6A 3AAAB 1NWMX 3MKDA 4UVCB 3FB2A 5LHHB 5L3CB 4G2AA 4UV9B 2CMRA 1Z0PA 4UXNB 1U4QA 2XUEA 5FY0A 1UX4A 3HR0A 2PFVA 4AQFC 3F2EA 2CE7A 2MYSA 4M1PA 4UVBB 5M4YA 3PUAA 4UELA 4BJMA 2WAUA 4HN9A 2CCQA 3FBZA 5LJMA 3V5SA 3V5UA 2XHEB 3C50A 4HE8A 5JDGA 4E7ZA 2VASA 3ZMUB 1YD8G 2C5JA 2XAFB 4OK0A 4ZI3C 3AAEB 1D0XA 4QKNA 2Y6XA 2D2SA 2EHOA 1T98A 1D1BA 2NOXA 2A72A 1QSDA 2X9HA 4NUVA 4EIWA 5DQWA 3LG7A 2VKHA 4BA9A 5EZYE 2JPFA 5JQGE 4FI5A 2DNXA 1WYCA 2J1DG 3F31A 2CXDA 4TUYE 3MA9A 5F8PA 2V7MA 3ETUA 3Q5XA 4KUMB 4PK5A 4IGUA 3ZMZB 2IC9A 2RA1A 2XASB 1H7CA 4HGAA 5FXZA 4MHCA 4L9IA 4AI6A 4AKLA 2VK9A 2V26A 3ZJ1A 5LNKA 1WRDA 3F57A 5FYMA 5H6RB 3N2KE 5LJNA 2C0SA 4IHJE 5HXEA 2YK0A 4ILUA 3ZYMA 4EB6E 4A56A 5FMNA 1HF8A 2Q9QB 3BQLA 4DMWA 2LM9A 3I9WA 3CX6B 4TZ4C 2V1DB 5ETWA 4ANJA 3RPUA 1MMNA 3RYFE 3ONXA 1KK7A 3C4XA 5BMVE 3HKBE 4O4JE 1U5PA 3KV6A 4CXWA 2VKOA 5JDHA 3EDVA 5JR9C 4H9QC 3ZEFB 3LBXB 3QC9A 3CQGB 1MMDA 2LEHA 4ERRA 5FP3A 1WYBA 2VB6A 2ODVA 5J1GA 3O1JA 3AA0B 3IHRA 3PUQA 4UF0B 3CVRA 4JEHB 3H37A 4AXPA 4YJ2E 2LJLA 5EK4A 1YKHB 2P9BA 2V7KA 4ADZA 2ZLYA 1CUNA 1IAPA 2ZM8A 4AKGA 2X66A 2ODUA 2VWAA 4O4HE 4UV8B 1LVKA 3OYXA 3N2OA 3N9LA 4AKIA 3ZC0A 2BVLA 4TV8E 4IIJE 2JMKA 5H6QB 2VL8A 5HXCA 3DTOA 4NUUA 3CWZB 3UTKA 3O4XE 2CEAA 4QX8B 1AJ3A 4CXYA 5JR9B 5L3GB 4IE0A 5TAOA 1WLXA 5LYJE 4G63A 3E0ZA 4XAXB 2L3LA 2G0UA 3O1IA 3I0OA 4L0RA 1X79A 1BR2A 3UFEA 3U78A 2NW9A 2N1GA 3GMIA 3DP7A 3AAIA 5LCYA 4ZI3D 5JREA 4HFVA 1FIOA 4JUYA 3J7Yq 3A5XA 4PFOA 3CX7B 3KBTA 1FMWA 1VRBA 4H9OC 3AA7B 4XZCA 5CA0E 3OBVE 4I43B 4AQFA 2UXXB 2WMOA 4O4LE 4PJMA 4ZS3A 2YINA 3P7IA 4DMVA 5LHGB 3I1AA 4HKAA 4CQIA 2KNDA 1FMVA 3MJXA 2K5BB 3WAKA 5FNVE 3AA1B 3ZPOA 2X67A 4QHOA 1S35A 3N9OA 3RC3A 4P0AA 3RC8A 3KV4A 2BDEA 1HG2A 2Q9QC 4PK4A 5A1LA 2E9XC 3N2GE 2BVMA 3GN5A 3E08A 4TX5A 2N2NA 4UVAB 4FJOA 3UUMA 2CA5A 5LA6E 3ZC1A 1UCUA 2YU1A 5HXHA 3CPZA 3PTRB 3ZN1B 3ANWA 2LSGA 3GA8A 3ZCJA 2XQYA 1ZHCA 3RYCE 2LSJA 4ZI2C 4GK5E 4HTEA 2LHRA 3RX6A 3KDSE 5DABA 4CI3B 2Y8DA 5LG4A 3Q2MA 2K24A 3ZCIA 5HWYA 5FY1A 4TV9E 5HXSA 5HXRA 3PE0A 4H9NC 4GK0E 4PJNA 2X9WA 1US7B 3T8OA 3B57A 3CMLA 2PBIA 3SOLA 1IZNB 3U3IA 2X51A 1FEWA 2Y48B 5LGNB 4CZZB 3UULA 3GWHA 3I9YA 1MNEA 4OHFA 5FXXA 1E1HB 2E9XB 3KFWX 4N78D 2EHOC 2CLYC 3K3OA 3W15B 4O8SA 2KWIB 2LOPA 2WM9A 4DNDA 4O4IE 2V7IA 5IYZE 3SWHA 4DBRA 3C51A 4GYSA 5LOVE 4QXCB 2C5KT 3Q9DA 3WI3A 4JLEA 4O2AE 1SHZC 3L3PA 3NRXA 2XTLA 2HPLA 2JJ9A 5F3JA 4DVDA 3O1HA 5HWXA 5FXWA 3ETVA 4U74A 5DJQC 4J2CA 5L3EB 3N9MA 2X9XA 3H3AA 2BZBA 3L09A 3ZYLA 3FXEB 2DLRA 4V1Av 2PG8A 2KMFA 5KDMC 5JRCA 3KVAA 3O9XA 1MIYA 2IC6A 1OXZA 1MIWA 1ZV4X 3BK9A 4YFSA 1YW0A 1YKEB 3HKCE 1MNDA 3RRWA 3AA6B 2NW8A 3FHNA 4KMCA 4IE4A 2Z6EA 4KBMB 3ZMTB 2EHOB 2CLYB 5JDLA 2IW5B 3FXDB 3OYZA 3OKQA 4F6RC 1D0YA 3ESLA 5J2UE 1MMAA 3NZQA 5EK3A 4PW8A 4X1IE 2MTQA 3C4ZA 3LFMA 1KNZA 2DHRA 5LGUB 3UUXB 2A3DA 4UEMA 4KP3C 3R84B 4CI2B 1BR4A 1NAFA 2E8IA 3CKDA 3KV5A 2XAJB 2L9QA 3NRYA 3TKLB 1ZKEA 1BR1A 2X68A 3MACA 2JMHA 2Q9QD 3C64A 4H9RC 5L3DB 2E9XD 3RYIE 1S94A 2ES0A 3KINB 2JQQA 2H3RA 3P8CD 4CI1B 1BR0A 4AKHA 5LXTE 3ZLIA 4EZ4A 3SS1A 4AQGA 3IEEA 2NTXA 1LRZA 4ZI7E 4IDZA 4I4TE 5CB4E 3RH3A 2K9AA 4MALA 3R6NA 3ZJ2A 5LHIB 5LGTB 4PJJA 1HG5A 3PDYA 5HYAA 4ZI2D 1EZ3A 3KV9A 4ZHQE 1ZEEA 3K8PC 2LT3A 2H7VC 4ZOLE 2KZ7B 3S4UA 2H7OA 4E7SA 2D0UA 4YJ3E 1HX8A 3CQXC 3QUJA 3CX8B 2V7JA 3C98B 3EUHA 4IE6A 4BAYB 4BJNA 4X1YE 5IHYA 2DWGA 3EDUA 2CXFA 4YLHA 4Z8XA 4XBFB 5AFUL 5LBQB 2NP9A 2NW7A 4B6XA 4DBQA 1V9DA 2KLQA 5JRCB 4MLKA 1UX5A 4EZHA 3FBLA 4H9PC 5L3FB 2ZM0A 2CXLA 2YU2A 1Y64B 4EYYR 2ZMAA 2EHOD 2SPCA 2A2FX 3LBXA 3MXZA 1SA0E 2MBGA 1LKXA 4L5GA 5E0OA 3Q5WA 3KVBA 4O2BE 4I55E 2N9DA 3N9PA 3VKGA 4DO0A 2HH7A 4X1KE 1B7TA 3DJBA 3PURA 3ZMSB 4UF0A 5HAXA 5KX5E 2ZM2A 3HL6A 2X9YA 2KWHA 4CXXA 1D1CA 3LK42 4QX7B 4MBQA 3E22E 1IJ5A 4EXTA 1MIVA 2JRKA 3JC6C 3QK6A 1QUUA 1HS7A 4JEUB 2YEVC 4OYKA 4H9SE 4PAGA 3NBXX 4ASKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L2L A;  2LHN A;  3ZJ1 A;  3ZJ2 A; 
#chains in the Genus database with same CATH topology
 1E7P A;  3UQ4 A;  2V6Y B;  2LHN A;  5LP6 E;  5J0Z A;  3RYH E;  5FY7 A;  2B1E A;  2W61 A;  4QXB B;  2M67 A;  1W0B A;  5AQL B;  4IT4 A;  5JVD E;  2ACX A;  5L3B B;  2KIN B;  4EOZ B;  3PUW F;  4IE7 A;  4WBN E;  4LFB T;  3AE2 A;  2BBH A;  3RI5 A;  3VU7 H;  5J2T E;  1HTJ F;  4DR3 T;  3B13 A;  2XY8 B;  4IE5 A;  5JDN A;  2M6B A;  2IAK A;  3UT5 E;  2WBL A;  2D5U A;  2WDR A;  4IDQ A;  3AVR A;  3J9X 1;  2V6X A;  2WQY A;  4QH1 A;  2HN2 A;  4OYJ A;  2RP4 A;  5L2L A;  4GYR A;  2LSY A;  3LJC A;  1XDO A;  4OX9 T;  2WY2 A;  4EAH A;  3HA4 A;  1M7K A;  4ZS2 A;  3RGL A;  5HEO A;  2V7L A;  2XQA A;  5LBM A;  2UXD T;  5DQV A;  3X1D A;  4B3T T;  3AAA B;  3FB2 A;  4UXN B;  4JYA T;  4DR4 T;  2CE7 A;  2LRK A;  2FJA A;  4UVB B;  5M4Y A;  3AXJ A;  4P1N A;  4JBW F;  5LMN T;  2WAU A;  2WCA A;  2LRL A;  2XM1 A;  3V5U A;  3PUZ F;  2XQ8 A;  2XAF B;  4ZI3 C;  3AAE B;  2EHO A;  1D1B A;  4KHP T;  2A72 A;  2BG9 B;  2V5C A;  2X9H A;  5HEU A;  2VKH A;  5EZY E;  3NVO A;  5JQG E;  4FI5 A;  3ZMZ B;  2IC9 A;  5AQM B;  2XAS B;  1H7C A;  4MHC A;  2LKG A;  2VK9 A;  2V26 A;  5LNK A;  5LJN A;  4EB6 E;  5FMN A;  3ZST A;  4DMW A;  4TZ4 C;  5ETW A;  4ANJ A;  2FJE A;  3RYF E;  3ONX A;  4ILB A;  5FL1 A;  2X0H A;  4H9Q C;  3ZEF B;  3LBX B;  2LEH A;  1J5W A;  2YDQ A;  5FP3 A;  1WYB A;  3O1J A;  3H37 A;  4YJ2 E;  2LJL A;  3K1S A;  4ADZ A;  2ZLY A;  4WZX A;  2BKP A;  4O4H E;  4UV8 B;  3OYX A;  3N2O A;  4AKI A;  2W4X A;  3RKG A;  3NBX X;  5H6Q B;  2VL8 A;  3UTK A;  3O4X E;  5L47 A;  1JNZ A;  4IDP A;  4IE0 A;  2L3L A;  3O1I A;  2FJD A;  4L0R A;  3IA3 A;  3U78 A;  1E2A A;  3A5X A;  3OBV E;  4QH4 A;  4AQF A;  4YSY A;  4DID B;  4PJM A;  3JAE A;  4DMV A;  3ZT5 A;  1UGO A;  1FMV A;  3MJX A;  2K5B B;  2LLY A;  5FNV E;  3WAK A;  3RC3 A;  3RC8 A;  2QRX A;  3N2G E;  4TX5 A;  3PUY F;  4I0U A;  4FJO A;  3UUM A;  4KX6 A;  3ANW A;  1IBK T;  5ABG A;  2LSJ A;  3OVU A;  4U7Y A;  4F8H A;  4CI3 B;  1QLB A;  5HXS A;  2XQ6 A;  3PE0 A;  3NKZ A;  4H9N C;  2ZM6 T;  4GK0 E;  2X9W A;  3B57 A;  4LMJ A;  3JAF A;  1OED E;  2Y48 B;  3TLW A;  4CZZ B;  3GWH A;  3T1H T;  2UXB T;  4COF A;  2NR4 A;  2LOP A;  3P4Q A;  1KEY A;  1ZP0 A;  3SWH A;  4DBR A;  3WI3 A;  3L3P A;  3NRX A;  5HWX A;  4J2C A;  3RIU C;  2X9X A;  4U3C A;  4HWH A;  4HWD A;  3FXE B;  2DLR A;  5KDM C;  2PG8 A;  2KMF A;  1XZY A;  4B3R T;  3SFE A;  1MND A;  4KMC A;  4IE4 A;  4HFC A;  1ZOY A;  3TLU A;  3ZMT B;  3EHZ A;  2V8S V;  3FXD B;  1R8I A;  4F6R C;  2H89 A;  1VCT A;  4PW8 A;  4X1I E;  2MTQ A;  3C4Z A;  1NAF A;  3KV5 A;  3CKD A;  2L9Q A;  2XPK A;  5L3D B;  2ES0 A;  1BR0 A;  5LXT E;  4HFI A;  4EZ4 A;  3SS1 A;  4AQG A;  3A8Y C;  4Q25 A;  1LRZ A;  4IDZ A;  3NWI A;  4I4T E;  3RH3 A;  5AQQ B;  3QB5 A;  1HG5 A;  5HYA A;  1ZEE A;  5AQR B;  2LT3 A;  4E7S A;  4YJ3 E;  1HX8 A;  2V7J A;  5AQV B;  4BAY B;  4BJN A;  3AEE A;  3LDQ B;  2BKO A;  5HEJ A;  2CBJ A;  4XBF B;  2NW7 A;  4DBQ A;  4DV0 T;  3RLF F;  4MLK A;  2WDQ A;  2YU2 A;  2EHO D;  2SPC A;  4L5G A;  3UU5 A;  3Q5W A;  2HH7 A;  4UF0 A;  2MAW A;  2X9Y A;  1UUS A;  2FJB A;  3LK4 2;  4QX7 B;  1FJG T;  4HWF A;  1QUU A;  3CIR A;  4DR7 T;  4OYK A;  4PAG A;  2WZI A;  1YQ4 A;  1G73 A;  2V5D A;  4WW0 A;  1HFA A;  4QWN B;  4C91 A;  2D9D A;  5JH7 E;  3N9Q A;  2YDR A;  5JR9 A;  3CQC B;  5C8Y E;  3ZYK A;  5AQG B;  4DV4 T;  2WWU A;  2XSA A;  2W63 A;  3ZKR A;  2GK9 A;  3AE7 A;  4Z90 A;  2NWB A;  3PUX F;  1D0Z A;  4GIW A;  2MOZ A;  3GN5 B;  2W00 A;  4X20 E;  4HWI B;  4K0U A;  5FXV A;  3AB3 B;  3UUN A;  1N36 T;  2DI4 A;  3Q5E A;  2W62 A;  3AE3 A;  4YTP A;  2QVA A;  4OFZ A;  3NZP A;  5KMG P;  3PU8 A;  2LSI A;  4ZZB A;  4Z91 A;  2NTY A;  1T7S A;  3LK3 B;  3ZT7 A;  3KBU A;  2E5V A;  3ZN0 B;  3FZM B;  3RKO A;  2DCF A;  1N33 T;  1XDP A;  3FZF B;  3PU3 A;  5JDQ A;  2HPJ A;  2UXN B;  4X62 T;  3B5M A;  5ABF B;  2AE9 A;  3M65 A;  2QA7 A;  3AEB A;  3IBP A;  3SRZ A;  2E9X A;  4LF7 T;  3AE4 A;  4LF5 T;  5L3C B;  4G2A A;  1Z0P A;  5FY0 A;  3LSV A;  2PFV A;  4EGW A;  4M1P A;  4ILA A;  3UQ7 A;  4UEL A;  4LFA T;  2XHE B;  3C50 A;  4HE8 A;  5JDG A;  4E7Z A;  1XMO T;  4JI4 T;  1OED A;  1IBM T;  1WCR A;  1T98 A;  2NOX A;  4NUV A;  5DQW A;  1IBL T;  2VUR A;  2JPF A;  1WYC A;  3F31 A;  5IUX A;  2CXD A;  2V7M A;  4KUM B;  1T72 A;  4HGA A;  4AKL A;  3UFG A;  1WRD A;  5H6R B;  2YK0 A;  4ILU A;  3ZYM A;  4A56 A;  1HF8 A;  3BQL A;  5CGM A;  2LM9 A;  2V1D B;  3RPU A;  4B3M T;  1MMN A;  1J5E T;  3C4X A;  3HKB E;  3KV6 A;  5JDH A;  2YOE A;  4JI2 T;  2VB6 A;  3AA0 B;  3PUQ A;  4JEH B;  4TWH A;  1XNQ T;  5AQO B;  5EK4 A;  1VCS A;  5FL0 A;  1KNP A;  4LML A;  2ODU A;  1LVK A;  2J4G A;  1KFY A;  4NUU A;  4CN1 A;  2YN6 A;  2XSB A;  5HCM A;  5L3G B;  5AQP B;  2QYW A;  4G63 A;  3PV0 F;  1X79 A;  4LMK A;  2BG9 C;  2RPA A;  2NW9 A;  3DP7 A;  5LCY A;  4HFV A;  3KBT A;  1VRB A;  4H9O C;  5CA0 E;  2VQF T;  4O4L E;  3P7I A;  3RIF A;  3I1A A;  2B76 A;  2KND A;  1X9B A;  4LFC T;  1S35 A;  4P0A A;  2BVM A;  4JI1 T;  4UVA B;  2CA5 A;  5LA6 E;  1UCU A;  1I94 T;  3CPZ A;  3ZN1 B;  2IIU A;  3GA8 A;  2XQY A;  3RYC E;  2BS3 A;  4HTE A;  2LHR A;  3KDS E;  4KI0 F;  5DAB A;  1WR0 A;  4AQY T;  5LG4 A;  4TV9 E;  3A7M A;  2HHH T;  3VRA A;  1US7 B;  2PBI A;  2X51 A;  1FEW A;  3I9Y A;  4OHF A;  3RIA A;  3OTO T;  1E1H B;  3KFW X;  2EHO C;  4O8S A;  2KWI B;  3VRB A;  2WM9 A;  5AQI B;  1HNZ T;  3EI0 A;  4O4I E;  2V7I A;  5IYZ E;  4GYS A;  5LOV E;  4QXC B;  3Q9D A;  4O2A E;  1WFD A;  2XTL A;  5FXW A;  3ETV A;  4U74 A;  5L3E B;  4HWC A;  2I0M A;  3AXJ B;  3L09 A;  4V1A v;  1ZV4 X;  1I6Z A;  3BK9 A;  1YW0 A;  1YKE B;  1W0A A;  2WS3 A;  2EHO B;  4U31 A;  2IHR 1;  2IW5 B;  3OKQ A;  5J2U E;  5EK3 A;  3LFM A;  1KNZ A;  5LGU B;  3UUX B;  2A3D A;  1BR4 A;  2XAJ B;  3TKL B;  1ZKE A;  3QOF A;  2JMH A;  4H9R C;  2E9X D;  3KIN B;  2H3R A;  2WU2 A;  4AKH A;  3ZLI A;  1UUR A;  3IEE A;  2NTX A;  1NEK A;  3ONJ A;  4MAL A;  5LHI B;  5LGT B;  4PJJ A;  4ZI2 D;  4GKJ T;  3CX8 B;  4IE6 A;  4HFB A;  4YLH A;  5AFU L;  4B6X A;  2KLQ A;  2CHO A;  1UX5 A;  2ZMA A;  2A2F X;  2MBG A;  2N9D A;  3N9P A;  2W67 A;  3OPC A;  1L0V A;  2M6I A;  4MBQ A;  3E22 E;  2XQ4 A;  2JRK A;  4QH5 A;  4ZXL A;  4H9S E;  4ASK A;  3IF8 B;  2CM0 A;  4PFP A;  2KXP B;  1O3X A;  3PUS A;  4YXD A;  3BQI A;  4H63 H;  2XZE A;  2WP9 A;  4AKR B;  4PK6 A;  3I0Q A;  1WR6 A;  3RRC A;  3UU8 A;  2LOS A;  3EVY A;  4UIG A;  3K3N A;  2WMN A;  4ISS A;  2I59 A;  3HI2 A;  4DV2 T;  3WAJ A;  4P09 A;  5ADX L;  4H63 V;  1VOM A;  5HEH A;  3ANW B;  5JTG A;  2QGS A;  4WNK A;  2XAQ B;  4PNI A;  3FZK B;  5EK2 A;  3PUG A;  2UXC T;  2LKH A;  3N5L A;  2WSS V;  4GOU A;  5C3J A;  2CWO A;  4WBO A;  2CHN A;  1SE7 A;  2H88 A;  4DV7 T;  1XMQ T;  3PJA A;  3FZH B;  3LK2 B;  2X0L B;  2LE8 A;  4U2Z A;  3H3M A;  3ZMV B;  4YHJ A;  4X64 T;  2D0T A;  4HEA A;  2Q9Q A;  3AE6 A;  2WWV A;  2VKJ A;  2OA5 A;  3JC6 D;  3HKE E;  4DR2 T;  2OV9 A;  3MKD A;  1NWM X;  4UVC B;  1Z8U A;  4AIS A;  1U4Q A;  3AE5 A;  2MPK A;  3PUA A;  5AQU B;  4BJM A;  4HN9 A;  2CCQ A;  5LJM A;  3V5S A;  1T8B A;  2IML A;  2C5J A;  4OK0 A;  1D0X A;  4QKN A;  2Y6X A;  2D2S A;  1QSD A;  5F5W A;  4ILC A;  4TUY E;  3ETU A;  3Q5X A;  4DV6 T;  4NIQ A;  5FXZ A;  4AI6 A;  3ZJ1 A;  3G06 A;  5FYM A;  2C0S A;  4IHJ E;  2Q9Q B;  4DUZ T;  4NXN T;  4UR9 A;  4JI5 T;  1KK7 A;  5BMV E;  4CXW A;  5JR9 C;  3QC9 A;  3CQG B;  4DR5 T;  1MMD A;  1YXR A;  3EAB A;  4ERR A;  3UUB A;  3IHR A;  4UF0 B;  2XQ7 A;  3CVR A;  4U7I A;  1YKH B;  2V7K A;  2ZM8 A;  4AKG A;  4LF6 T;  2X66 A;  2VQE T;  3N9L A;  5L4E A;  1W9R A;  3ZC0 A;  2BVL A;  4TV8 E;  4IIJ E;  2JMK A;  3ABV A;  2CEA A;  4QX8 B;  5JR9 B;  1M62 A;  2V6Y A;  5LYJ E;  2XJ7 A;  1BR2 A;  3GMI A;  3AAI A;  2W66 A;  1FIO A;  1HR0 T;  3J7Y q;  4JI8 T;  4PFO A;  1FMW A;  3AA7 B;  4XZC A;  2UXX B;  2WMO A;  3RQW A;  4ZS3 A;  4DR1 T;  5AQN B;  5LHG B;  4JI6 T;  4HKA A;  4CQI A;  3ZPO A;  2X67 A;  4QHO A;  3N9O A;  2IUB A;  3KV4 A;  2WB5 A;  1Y01 A;  2BDE A;  4PK4 A;  2E9X C;  2LM2 A;  2N2N A;  3RQU A;  5LMU T;  3ZC1 A;  2YU1 A;  2R6G F;  2HN1 A;  3UU3 A;  4U33 A;  4K0K T;  4ZI2 C;  3L8R A;  3RX6 A;  3Q2M A;  3ZCI A;  5HXR A;  4A97 A;  3QB5 K;  3AE9 A;  4TWF A;  2VVN A;  5LGN B;  3UUL A;  1MNE A;  1OED C;  2E9X B;  2CLY C;  3K3O A;  4YSX A;  3W15 B;  1XWM A;  5ABH A;  1KNR A;  3AE1 A;  4JLE A;  2JJ9 A;  5F3J A;  3EAM A;  1UK5 A;  3H3A A;  2BZB A;  2WU5 A;  5AQS B;  4ZEY A;  3KVA A;  3O9X A;  2JIW A;  1MIY A;  1MIW A;  2J62 A;  4CN4 A;  3RRW A;  3FHN A;  2Z6E A;  3AEC A;  1OED B;  2CLY B;  4YTM A;  3RHW A;  2ACZ A;  4IRE A;  3ESL A;  1MMA A;  4DUY T;  4DV3 T;  4UEM A;  3R84 B;  4KP3 C;  2E8I A;  2X68 A;  2Q9Q D;  2UU9 T;  3RYI E;  2BG9 A;  4CI1 B;  2YDS A;  2E2A A;  1XNR T;  4JI7 T;  2XQ3 A;  4ZI7 E;  3TLT A;  1N34 T;  5CB4 E;  3R6N A;  3PDY A;  5HCJ A;  4ZHQ E;  3K8P C;  2H7V C;  4ZOL E;  2D0U A;  3EUH A;  3C98 B;  4X1Y E;  5IHY A;  2DWG A;  2CXF A;  5LBQ B;  4TNW A;  1V9D A;  4A5X A;  2BBJ A;  3Q5D A;  4HFE A;  2ZM0 A;  2CXL A;  4EYY R;  3LBX A;  3MXZ A;  1SA0 E;  5E0O A;  3KVB A;  4O2B E;  4I55 E;  5CJ5 A;  3VKG A;  1B7T A;  3DJB A;  3ZMS B;  2BKN A;  3P4S A;  1D1C A;  5LB7 B;  1IJ5 A;  4EXT A;  1MIV A;  3AEA A;  3JC6 C;  4EIW A;  5FKY A;  2BS2 A;  4LF8 T;  4P0B A;  1D1A A;  3D0T A;  4I50 E;  3MZK B;  4QXH B;  3M3Z B;  1G8X A;  3HKD E;  4TWD A;  3VKH A;  4PJL A;  2C5I T;  4X65 T;  2UUC T;  4C90 A;  2VKD A;  4MFR A;  3N9N A;  4DR6 T;  3BQK A;  2BS4 A;  2K48 A;  5IWA T;  2I6H A;  5JDF A;  5CA1 E;  2W0G A;  2DL1 A;  4HFD A;  5AQJ B;  4LF9 T;  3C4W A;  4YHH T;  2DWK A;  2UUA T;  2L8K A;  1MMG A;  4EYU A;  3VHL A;  3K3Q C;  3L39 A;  4IL4 A;  2LSK A;  2PJQ A;  3AVS A;  4X66 T;  2VL0 A;  3MK7 C;  5AQF B;  1SUM B;  2XAG B;  3OJA A;  2KT9 A;  1LVF A;  2J47 A;  5JDM A;  2XAH B;  2CWY A;  1HCI A;  1HNX T;  3P4R A;  4U72 A;  5CFB A;  3VR9 A;  4IST A;  4TN7 B;  5GON E;  1OWA A;  1IJ6 A;  4UV9 B;  2CMR A;  3ZT6 A;  2CPT A;  2XUE A;  2K3W A;  1UX4 A;  3HR0 A;  2E5L T;  4AQF C;  3F2E A;  3ZSS A;  2MYS A;  3FBZ A;  4AIU A;  4YT0 A;  4WYV A;  2VAS A;  3ZMU B;  1YD8 G;  2JQK A;  2KSR A;  3UU6 A;  3LG7 A;  4BA9 A;  1W09 A;  2DNX A;  1N32 T;  2J1D G;  4YTN A;  1NEN A;  3MA9 A;  5F8P A;  4PK5 A;  2F4V T;  4IGU A;  2RA1 A;  4L9I A;  3RIU A;  3F57 A;  3N2K E;  5KXJ A;  4JI0 T;  5HXE A;  3UU4 A;  1KF6 A;  2JQH A;  2OLT A;  2XM2 A;  2X0Y A;  3I9W A;  3CX6 B;  2WDV A;  2VVS A;  4B3S T;  4O4J E;  1U5P A;  2VKO A;  3EDV A;  2YKS A;  3TLS A;  4YSZ A;  4TNV A;  2ODV A;  5J1G A;  5L4H A;  4NXM T;  3RF1 A;  5LG3 A;  2WZH A;  4AXP A;  2P9B A;  4ZZC A;  1CUN A;  4IDN A;  1IAP A;  2VWA A;  4DV5 T;  3QNU A;  5C2T A;  5HXC A;  2FUP A;  3DTO A;  3CWZ B;  1AJ3 A;  4CXY A;  2CBI A;  4X5T A;  4JV5 T;  5TAO A;  1WLX A;  3E0Z A;  4XAX B;  2G0U A;  2BG9 E;  3I0O A;  3UFE A;  1DU2 A;  2N1G A;  5JRE A;  4ZI3 D;  4JUY A;  3CX7 B;  4I43 B;  2A9U A;  4CN6 A;  2YIN A;  3ONL C;  3SFD A;  4HFH A;  3AA1 B;  1HG2 A;  2Q9Q C;  5A1L A;  3GN5 A;  3E08 A;  4DV1 T;  2AXD S;  1HX1 B;  2FBW A;  5HXH A;  3PTR B;  1J1J A;  4NPP A;  2LSG A;  3ZCJ A;  1ZHC A;  3CK6 A;  1JNR A;  4GK5 E;  2Y8D A;  2CRB A;  5AQK B;  2K24 A;  5HWY A;  5FY1 A;  4EEB A;  3TLV A;  4PJN A;  3T8O A;  3CML A;  3SOL A;  1IZN B;  3PUV F;  4GKK T;  3JAD A;  3U3I A;  5FXX A;  4N78 D;  1CHU A;  4A98 A;  4DND A;  3C51 A;  2C5K T;  5ABF A;  3P50 A;  1SHZ C;  4YY3 T;  4IDO A;  4IL9 A;  2HPL A;  4DVD A;  3O1H A;  5DJQ C;  3N9M A;  1HNW T;  3ZYL A;  2PTF A;  3FZL B;  5JRC A;  4EED A;  2IDO B;  2IC6 A;  1OXZ A;  4YFS A;  3HKC E;  3AA6 B;  2NW8 A;  4KBM B;  5JDL A;  3OYZ A;  1D0Y A;  3NZQ A;  2JQ9 A;  3P4W A;  2DHR A;  3P4P A;  4CI2 B;  3NRY A;  3VR8 A;  1BR1 A;  3MAC A;  3C64 A;  4U2Y A;  1S94 A;  4EV6 A;  3AEF A;  2JQQ A;  2XQ5 A;  3P8C D;  4JI3 T;  5FVK A;  3T1Y T;  1GQE A;  5AQT B;  2K9A A;  3ZJ2 A;  1EZ3 A;  3KV9 A;  2KZ7 B;  3S4U A;  2H7O A;  3CQX C;  3QUJ A;  3AEG A;  3EDU A;  5ABE A;  5BR8 T;  2UUB T;  4Z8X A;  4LF4 T;  2NP9 A;  5JRC B;  4EZH A;  3FBL A;  4H9P C;  5L3F B;  1Y64 B;  5FVL A;  5AQH B;  1LKX A;  3JCF A;  5HEG A;  4DO0 A;  4X1K E;  3PJA J;  4KHZ F;  3PUR A;  3AE8 A;  5HAX A;  5KX5 E;  2ZM2 A;  3HL6 A;  2KWH A;  4CXX A;  2W2U A;  3AED A;  2XQ9 A;  3QK6 A;  1HS7 A;  4JEU B;  2YEV C;  1YQ3 A;  5LHH B; 
#chains in the Genus database with same CATH homology
 3IF8 B;  2CM0 A;  4PFP A;  4P0B A;  1G73 A;  2LHN A;  1D1A A;  3D0T A;  4WW0 A;  5LP6 E;  2KXP B;  3RYH E;  5FY7 A;  1HFA A;  4I50 E;  2B1E A;  4QWN B;  2W61 A;  1O3X A;  3PUS A;  4C91 A;  4QXB B;  3BQI A;  2M67 A;  4H63 H;  4AKR B;  5JH7 E;  3MZK B;  3N9Q A;  4PK6 A;  5JVD E;  5JR9 A;  3CQC B;  5C8Y E;  4QXH B;  1G8X A;  3HKD E;  3VKH A;  2ACX A;  4PJL A;  2C5I T;  5L3B B;  3ZYK A;  2KIN B;  4EOZ B;  4IE7 A;  3I0Q A;  1WR6 A;  3RRC A;  2WWU A;  4WBN E;  4C90 A;  2VKD A;  2LOS A;  3EVY A;  2W63 A;  4UIG A;  4MFR A;  3N9N A;  2GK9 A;  3K3N A;  2WMN A;  2NWB A;  4ISS A;  1D0Z A;  3BQK A;  2I59 A;  3HI2 A;  2K48 A;  4GIW A;  2MOZ A;  3GN5 B;  2W00 A;  3VU7 H;  4X20 E;  5J2T E;  1HTJ F;  3B13 A;  3WAJ A;  4P09 A;  4IE5 A;  5JDF A;  4K0U A;  5JDN A;  2IAK A;  5FXV A;  3UT5 E;  2WBL A;  5ADX L;  2D5U A;  4H63 V;  2W0G A;  3AB3 B;  5CA1 E;  1VOM A;  3C4W A;  3ANW B;  2DWK A;  2QGS A;  4WNK A;  3UUN A;  2XAQ B;  3AVR A;  4PNI A;  2DI4 A;  5EK2 A;  2L8K A;  3PUG A;  2W62 A;  3N5L A;  3J9X 1;  4OFZ A;  2WSS V;  3NZP A;  4GOU A;  1MMG A;  3PU8 A;  2CWO A;  5KMG P;  4EYU A;  2LSI A;  4OYJ A;  4WBO A;  2RP4 A;  3VHL A;  3K3Q C;  2NTY A;  5L2L A;  3LK3 B;  4GYR A;  2LSY A;  2LSK A;  2PJQ A;  3KBU A;  3LJC A;  3ZN0 B;  3AVS A;  4EAH A;  3RKO A;  3MK7 C;  3HA4 A;  2DCF A;  2XAG B;  3OJA A;  2KT9 A;  4ZS2 A;  3PU3 A;  5JDQ A;  1LVF A;  5JDM A;  2XAH B;  3LK2 B;  2HPJ A;  2CWY A;  1HCI A;  2X0L B;  2UXN B;  2LE8 A;  4U72 A;  3ZMV B;  3M65 A;  4YHJ A;  2QA7 A;  3IBP A;  3SRZ A;  2D0T A;  4HEA A;  2Q9Q A;  2V7L A;  4IST A;  2E9X A;  5LBM A;  4TN7 B;  2VKJ A;  5GON E;  2OA5 A;  3JC6 D;  1OWA A;  3HKE E;  5DQV A;  1IJ6 A;  3AAA B;  1NWM X;  3MKD A;  4UVC B;  3FB2 A;  5LHH B;  5L3C B;  4G2A A;  4UV9 B;  2CMR A;  1Z0P A;  4UXN B;  1U4Q A;  2XUE A;  5FY0 A;  1UX4 A;  3HR0 A;  2PFV A;  4AQF C;  3F2E A;  2CE7 A;  2MYS A;  4M1P A;  4UVB B;  5M4Y A;  3PUA A;  4UEL A;  4BJM A;  2WAU A;  4HN9 A;  2CCQ A;  3FBZ A;  5LJM A;  3V5S A;  3V5U A;  2XHE B;  3C50 A;  4HE8 A;  5JDG A;  4E7Z A;  2VAS A;  3ZMU B;  1YD8 G;  2C5J A;  2XAF B;  4OK0 A;  4ZI3 C;  3AAE B;  1D0X A;  4QKN A;  2Y6X A;  2D2S A;  2EHO A;  1T98 A;  1D1B A;  2NOX A;  2A72 A;  1QSD A;  2X9H A;  4NUV A;  4EIW A;  5DQW A;  3LG7 A;  2VKH A;  4BA9 A;  5EZY E;  2JPF A;  5JQG E;  4FI5 A;  2DNX A;  1WYC A;  2J1D G;  3F31 A;  2CXD A;  4TUY E;  3MA9 A;  5F8P A;  2V7M A;  3ETU A;  3Q5X A;  4KUM B;  4PK5 A;  4IGU A;  3ZMZ B;  2IC9 A;  2RA1 A;  2XAS B;  1H7C A;  4HGA A;  5FXZ A;  4MHC A;  4L9I A;  4AI6 A;  4AKL A;  2VK9 A;  2V26 A;  3ZJ1 A;  5LNK A;  1WRD A;  3F57 A;  5FYM A;  5H6R B;  3N2K E;  5LJN A;  2C0S A;  4IHJ E;  5HXE A;  2YK0 A;  4ILU A;  3ZYM A;  4EB6 E;  4A56 A;  5FMN A;  1HF8 A;  2Q9Q B;  3BQL A;  4DMW A;  2LM9 A;  3I9W A;  3CX6 B;  4TZ4 C;  2V1D B;  5ETW A;  4ANJ A;  3RPU A;  1MMN A;  3RYF E;  3ONX A;  1KK7 A;  3C4X A;  5BMV E;  3HKB E;  4O4J E;  1U5P A;  3KV6 A;  4CXW A;  2VKO A;  5JDH A;  3EDV A;  5JR9 C;  4H9Q C;  3ZEF B;  3LBX B;  3QC9 A;  3CQG B;  1MMD A;  2LEH A;  4ERR A;  5FP3 A;  1WYB A;  2VB6 A;  2ODV A;  5J1G A;  3O1J A;  3AA0 B;  3IHR A;  3PUQ A;  4UF0 B;  3CVR A;  4JEH B;  3H37 A;  4AXP A;  4YJ2 E;  2LJL A;  5EK4 A;  1YKH B;  2P9B A;  2V7K A;  4ADZ A;  2ZLY A;  1CUN A;  1IAP A;  2ZM8 A;  4AKG A;  2X66 A;  2ODU A;  2VWA A;  4O4H E;  4UV8 B;  1LVK A;  3OYX A;  3N2O A;  3N9L A;  4AKI A;  3ZC0 A;  2BVL A;  4TV8 E;  4IIJ E;  2JMK A;  5H6Q B;  2VL8 A;  5HXC A;  3DTO A;  4NUU A;  3CWZ B;  3UTK A;  3O4X E;  2CEA A;  4QX8 B;  1AJ3 A;  4CXY A;  5JR9 B;  5L3G B;  4IE0 A;  5TAO A;  1WLX A;  5LYJ E;  4G63 A;  3E0Z A;  4XAX B;  2L3L A;  2G0U A;  3O1I A;  3I0O A;  4L0R A;  1X79 A;  1BR2 A;  3UFE A;  3U78 A;  2NW9 A;  2N1G A;  3GMI A;  3DP7 A;  3AAI A;  5LCY A;  4ZI3 D;  5JRE A;  4HFV A;  1FIO A;  4JUY A;  3J7Y q;  3A5X A;  4PFO A;  3CX7 B;  3KBT A;  1FMW A;  1VRB A;  4H9O C;  3AA7 B;  4XZC A;  5CA0 E;  3OBV E;  4I43 B;  4AQF A;  2UXX B;  2WMO A;  4O4L E;  4PJM A;  4ZS3 A;  2YIN A;  3P7I A;  4DMV A;  5LHG B;  3I1A A;  4HKA A;  4CQI A;  2KND A;  1FMV A;  3MJX A;  2K5B B;  3WAK A;  5FNV E;  3AA1 B;  3ZPO A;  2X67 A;  4QHO A;  1S35 A;  3N9O A;  3RC3 A;  4P0A A;  3RC8 A;  3KV4 A;  2BDE A;  1HG2 A;  2Q9Q C;  4PK4 A;  5A1L A;  2E9X C;  3N2G E;  2BVM A;  3GN5 A;  3E08 A;  4TX5 A;  2N2N A;  4UVA B;  4FJO A;  3UUM A;  2CA5 A;  5LA6 E;  3ZC1 A;  1UCU A;  2YU1 A;  5HXH A;  3CPZ A;  3PTR B;  3ZN1 B;  3ANW A;  2LSG A;  3GA8 A;  3ZCJ A;  2XQY A;  1ZHC A;  3RYC E;  2LSJ A;  4ZI2 C;  4GK5 E;  4HTE A;  2LHR A;  3RX6 A;  3KDS E;  5DAB A;  4CI3 B;  2Y8D A;  5LG4 A;  3Q2M A;  2K24 A;  3ZCI A;  5HWY A;  5FY1 A;  4TV9 E;  5HXS A;  5HXR A;  3PE0 A;  4H9N C;  4GK0 E;  4PJN A;  2X9W A;  1US7 B;  3T8O A;  3B57 A;  3CML A;  2PBI A;  3SOL A;  1IZN B;  3U3I A;  2X51 A;  1FEW A;  2Y48 B;  5LGN B;  4CZZ B;  3UUL A;  3GWH A;  3I9Y A;  1MNE A;  4OHF A;  5FXX A;  1E1H B;  2E9X B;  3KFW X;  4N78 D;  2EHO C;  2CLY C;  3K3O A;  3W15 B;  4O8S A;  2KWI B;  2LOP A;  2WM9 A;  4DND A;  4O4I E;  2V7I A;  5IYZ E;  3SWH A;  4DBR A;  3C51 A;  4GYS A;  5LOV E;  4QXC B;  2C5K T;  3Q9D A;  3WI3 A;  4JLE A;  4O2A E;  1SHZ C;  3L3P A;  3NRX A;  2XTL A;  2HPL A;  2JJ9 A;  5F3J A;  4DVD A;  3O1H A;  5HWX A;  5FXW A;  3ETV A;  4U74 A;  5DJQ C;  4J2C A;  5L3E B;  3N9M A;  2X9X A;  3H3A A;  2BZB A;  3L09 A;  3ZYL A;  3FXE B;  2DLR A;  4V1A v;  2PG8 A;  2KMF A;  5KDM C;  5JRC A;  3KVA A;  3O9X A;  1MIY A;  2IC6 A;  1OXZ A;  1MIW A;  1ZV4 X;  3BK9 A;  4YFS A;  1YW0 A;  1YKE B;  3HKC E;  1MND A;  3RRW A;  3AA6 B;  2NW8 A;  3FHN A;  4KMC A;  4IE4 A;  2Z6E A;  4KBM B;  3ZMT B;  2EHO B;  2CLY B;  5JDL A;  2IW5 B;  3FXD B;  3OYZ A;  3OKQ A;  4F6R C;  1D0Y A;  3ESL A;  5J2U E;  1MMA A;  3NZQ A;  5EK3 A;  4PW8 A;  4X1I E;  2MTQ A;  3C4Z A;  3LFM A;  1KNZ A;  2DHR A;  5LGU B;  3UUX B;  2A3D A;  4UEM A;  4KP3 C;  3R84 B;  4CI2 B;  1BR4 A;  1NAF A;  2E8I A;  3CKD A;  3KV5 A;  2XAJ B;  2L9Q A;  3NRY A;  3TKL B;  1ZKE A;  1BR1 A;  2X68 A;  3MAC A;  2JMH A;  2Q9Q D;  3C64 A;  4H9R C;  5L3D B;  2E9X D;  3RYI E;  1S94 A;  2ES0 A;  3KIN B;  2JQQ A;  2H3R A;  3P8C D;  4CI1 B;  1BR0 A;  4AKH A;  5LXT E;  3ZLI A;  4EZ4 A;  3SS1 A;  4AQG A;  3IEE A;  2NTX A;  1LRZ A;  4ZI7 E;  4IDZ A;  4I4T E;  5CB4 E;  3RH3 A;  2K9A A;  4MAL A;  3R6N A;  3ZJ2 A;  5LHI B;  5LGT B;  4PJJ A;  1HG5 A;  3PDY A;  5HYA A;  4ZI2 D;  1EZ3 A;  3KV9 A;  4ZHQ E;  1ZEE A;  3K8P C;  2LT3 A;  2H7V C;  4ZOL E;  2KZ7 B;  3S4U A;  2H7O A;  4E7S A;  2D0U A;  4YJ3 E;  1HX8 A;  3CQX C;  3QUJ A;  3CX8 B;  2V7J A;  3C98 B;  3EUH A;  4IE6 A;  4BAY B;  4BJN A;  4X1Y E;  5IHY A;  2DWG A;  3EDU A;  2CXF A;  4YLH A;  4Z8X A;  4XBF B;  5AFU L;  5LBQ B;  2NP9 A;  2NW7 A;  4B6X A;  4DBQ A;  1V9D A;  2KLQ A;  5JRC B;  4MLK A;  1UX5 A;  4EZH A;  3FBL A;  4H9P C;  5L3F B;  2ZM0 A;  2CXL A;  2YU2 A;  1Y64 B;  4EYY R;  2ZMA A;  2EHO D;  2SPC A;  2A2F X;  3LBX A;  3MXZ A;  1SA0 E;  2MBG A;  1LKX A;  4L5G A;  5E0O A;  3Q5W A;  3KVB A;  4O2B E;  4I55 E;  2N9D A;  3N9P A;  3VKG A;  4DO0 A;  2HH7 A;  4X1K E;  1B7T A;  3DJB A;  3PUR A;  3ZMS B;  4UF0 A;  5HAX A;  5KX5 E;  2ZM2 A;  3HL6 A;  2X9Y A;  2KWH A;  4CXX A;  1D1C A;  3LK4 2;  4QX7 B;  4MBQ A;  3E22 E;  1IJ5 A;  4EXT A;  1MIV A;  2JRK A;  3JC6 C;  3QK6 A;  1QUU A;  1HS7 A;  4JEU B;  2YEV C;  4OYK A;  4H9S E;  4PAG A;  3NBX X;  4ASK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...