3ZJ1A

Structure of nab2p tandem zinc finger 12
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
GSFTPTKKEGRCRLFPHCPLGRSCPHAHPTKVCNEYPNCPKPPGTCEFLHPNEDEELMKEMERTREEFQKRKADLLAAKRKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
total genus 18
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zj1A00
3ZJ1A 2LHNA 3ZJ2A 5L2LA
chains in the Genus database with same CATH superfamily
3TKLB 1MIVA 1KFYA 2CE7A 1JNRA 2WDQA 3U3IA 4EEDA 5AQNB 5JREA 4L0RA 3HR0A 3M65A 3K1SA 5FY7A 1ZP0A 5HCJA 3L39A 1W09A 1CHUA 4KI0F 1N32T 2KNDA 1XDPA 2RPAA 3AE4A 3P4RA 4H9PC 4B3MT 2E5VA 3OKQA 4YY3T 2NTXA 3NWIA 1Z8UA 4UR9A 1MMAA 5LJNA 1Y01A 3R84B 4COFA 2K48A 2X51A 2XQAA 3CPZA 4DV4T 1Y64B 3PTRB 3QK6A 2E9XC 3UU6A 2BBHA 2LRLA 3ZSSA 3NVOA 3N2GE 3OVUA 4OYJA 2XY8B 3FXEB 4HFDA 1WCRA 5DABA 3RGLA 3ZT6A 1EZ3A 3J7Yq 4HGAA 1OEDE 1ZEEA 1YQ4A 3EDUA 2XTLA 3AXJB 4DR5T 1B7TA 2ZMAA 1SUMB 2JMKA 5BMVE 1IBMT 1HR0T 4QX8B 3HKBE 3AE5A 3HI2A 4UXNB 2MBGA 2WAUA 3BK9A 3E22E 3CQXC 4GKJT 3MZKB 3Q2MA 1MIYA 2ODVA 3RIUC 3EHZA 2X67A 5JDMA 2VK9A 4MLKA 2R6GF 2V7LA 4DV2T 3KV5A 3P7IA 4CXXA 3AEEA 3O9XA 3ZC0A 2M67A 3G06A 2LKGA 1SE7A 2DCFA 2JIWA 3F57A 2Y48B 1H7CA 2G0UA 3NBXX 4IDOA 3PUXF 1MMGA 4IHJE 4ISSA 5CGMA 4PK5A 4TWDA 4NUVA 3O1JA 1IZNB 4UF0B 4YSZA 3TLWA 2OV9A 4ZS3A 3RYFE 4EZHA 3HKEE 1T98A 2MYSA 3M3ZB 3L8RA 4NUUA 2Y6XA 2D0UA 2FJBA 2I59A 2KMFA 2RA1A 1MIWA 3N5LA 3ONLC 3TLTA 4HWFA 2OLTA 4QHOA 3B5MA 5AQMB 4DR6T 5F8PA 2BS4A 4ZXLA 2LSGA 4QXCB 2YK0A 4TWHA 5CFBA 2MTQA 2XSBA 3F2EA 3KV4A 2M6BA 5F5WA 3ZYKA 2YEVC 3SRZA 4QX7B 3ZMVB 4EV6A 2W66A 3VHLA 2HN1A 3RHWA 3CQGB 3I0OA 4ZS2A 4GYSA 4LF6T 2W2UA 3LK42 3N9MA 4YJ3E 4YSXA 2XAGB 2Y8DA 2Q9QB 2V1DB 1BR1A 2H7OA 3P50A 1KK7A 1U4QA 4YTPA 5AQFB 2UXCT 2WU2A 5HCMA 1E7PA 4KUMB 3UT5E 2UUCT 5LG4A 1HX8A 3NZQA 5J0ZA 5JDFA 3CWZB 2X0LB 3H3AA 2HN2A 2AXDS 3PDYA 2VKJA 4HEAA 4OYKA 4BJNA 4EEBA 4YSYA 4LF4T 2LSJA 3PV0F 4EXTA 3MACA 1OEDB 3KV6A 5LJMA 1IBLT 2IDOB 2E9XD 3AE9A 2BG9B 3FZHB 4TNWA 4IIJE 5AQOB 4ZI3D 5JRCB 2UXXB 2K5BB 4JI2T 5C8YE 1T72A 2CXFA 3FHNA 1YXRA 2V5CA 1O3XA 1US7B 3AEAA 4DV7T 2BG9E 2PJQA 2CHOA 3CVRA 4OFZA 5L3DB 4ZOLE 3RRWA 5ETWA 4AKHA 5ABEA 3ESLA 3FB2A 4V1Av 4ZHQE 3RIFA 3I9WA 4TN7B 4L5GA 3CK6A 4L9IA 4NPPA 4O4LE 3UU5A 5KXJA 3QOFA 4O4IE 2XJ7A 3AE6A 3DP7A 4JI4T 2WB5A 2QA7A 1N36T 2KSRA 2DHRA 1LRZA 2VKDA 3O1IA 3PU8A 4JLEA 3BQKA 3ANWB 2XQ8A 2VKHA 3I9YA 2L9QA 1VRBA 3UU3A 4U2ZA 3P4PA 1I94T 5C2TA 1WFDA 2NP9A 2NTYA 3C50A 2IHR1 3AAAB 3AEDA 2CMRA 5L2LA 2WWUA 4WBNE 1UCUA 4OX9T 2A72A 4XZCA 3H3MA 2JMHA 4DR3T 2XM1A 1D1BA 2XPKA 4GIWA 1UUSA 2WZHA 3EI0A 1WR0A 2BZBA 2K9AA 5AQTB 3ZN0B 3RYCE 1R8IA 3VR9A 4F6RC 5AFUL 3CX7B 3FBLA 3TLUA 3EUHA 1M62A 3RIAA 4EAHA 5LGUB 1U5PA 4EOZB 3ZMZB 1T8BA 1KEYA 3Q5EA 2ZM0A 4YLHA 5TAOA 3AEFA 4ISTA 5IUXA 2XQ6A 4UIGA 3RPUA 1BR0A 4QKNA 2V7MA 4A56A 2BKNA 2DWKA 2XASB 2XAQB 4CZZB 2C5KT 2K24A 3VR8A 4Z8XA 3PE0A 3VRAA 2ZM6T 5EZYE 4I4TE 2BS3A 3K3OA 4JUYA 3LK2B 2YKSA 5H6RB 3K3QC 3K8PC 3RI5A 5AQKB 3FZLB 2JQHA 5L3CB 2KT9A 2LOPA 2ES0A 2HH7A 2NW7A 2XM2A 4HWCA 5LA6E 3EAMA 4LMKA 3UUBA 2V6YA 5JDGA 2H7VC 1D0YA 2X0HA 3CMLA 4HFCA 5LBQB 4ASKA 2VQFT 4JI8T 1OEDA 2D0TA 4IE6A 2XHEB 4TV9E 3ZEFB 3ETVA 5E0OA 3RKGA 4ERRA 2CBJA 5JDNA 1IBKT 2H3RA 3PUAA 2X9WA 2ZM2A 2M6IA 4O8SA 4PK4A 3JADA 4ZI2C 3OTOT 5AQQB 2PG8A 4AKIA 4B3ST 4CI1B 4OHFA 2XAJB 3S4UA 4CN4A 2CHNA 2KWIB 2J62A 4AIUA 2QYWA 4HFVA 2WCAA 4JBWF 1NAFA 4A97A 1QSDA 5CB4E 4P0BA 1KNZA 4K0UA 4BA9A 1UX5A 5HXHA 3IA3A 3K3NA 3PUSA 1ZKEA 5LMNT 2XSAA 2BS2A 2LT3A 1YKEB 2CLYB 3C98B 4UV9B 2LSYA 2UUBT 2V26A 5JR9C 4DR7T 4LF7T 4KHZF 1X9BA 4X62T 3QB5K 2YU1A 1M7KA 4BJMA 5HWXA 3QC9A 1QLBA 3Q5WA 3RIUA 5EK4A 3LJCA 3NZPA 4Z91A 3GWHA 2VURA 2WP9A 5HWYA 3RF1A 3Q5DA 1NENA 2JQ9A 2XAHB 2XQYA 2ZLYA 3FZKB 2FJDA 3OYZA 3Q5XA 4GK0E 2VKOA 4JEUB 5AQGB 3ZLIA 4XAXB 2HPJA 1VOMA 4HKAA 3AB3B 4WW0A 5H6QB 2JRKA 3UULA 5ABFA 4DNDA 4A98A 1HG5A 2CCQA 2W62A 1MNDA 4ZI2D 4CXYA 1AJ3A 3RQUA 4EZ4A 4X5TA 3KINB 4KP3C 2B1EA 5L4HA 3P8CD 3B57A 4IE5A 3ZJ2A 1MMDA 2LKHA 2CPTA 3NRYA 4UVCB 3ZMUB 5KX5E 5AQUB 4ILUA 5M4YA 2XQ5A 2XQ7A 4LFAT 2PTFA 5FNVE 4AQFC 3PURA 5ABGA 4JI6T 1HS7A 3MK7C 4QXBB 2KLQA 4MALA 3RLFF 3X1DA 4JEHB 3C4WA 3PJAJ 3RC3A 2WWVA 2XQ3A 4YT0A 3EABA 4Z90A 1D0ZA 3UU8A 4P1NA 4FI5A 5C3JA 4PFOA 2N2NA 1IJ6A 3AA0B 3Q9DA 3JAEA 4X20E 2LSIA 3GMIA 3NKZA 4G2AA 4HE8A 4DR2T 2J4GA 3LBXB 2NWBA 1HNZT 5L3FB 3UUXB 3W15B 4PAGA 1WYBA 3RYIE 3RKOA 3O4XE 4HFHA 2C5IT 4IL4A 1L0VA 2V6YB 2YN6A 4GK5E 3AEGA 5L3GB 4EIWA 4DUYT 5JRCA 2Q9QA 2BG9A 2V8SV 2F4VT 1HFAA 3GN5A 5EK3A 2E9XA 3HKCE 4LF9T 2KINB 5IYZE 4C91A 4LFCT 5ADXL 5FKYA 1ZV4X 1CUNA 4ZZBA 3PJAA 5FVKA 5DQWA 2VVSA 3PUVF 4JI5T 5AQJB 5DJQC 4IDNA 4PJMA 1OEDC 2EHOD 2NW8A 5LHIB 4JI0T 2CXDA 2NR4A 3ONXA 4ILAA 2LE8A 4O2BE 3AE2A 3EDVA 4UELA 5FY0A 5LHGB 3T1HT 4NXNT 4P0AA 4B6XA 2C0SA 3O1HA 5AQIB 1JNZA 3HA4A 5FXWA 1FJGT 4DR4T 1J1JA 2X0YA 3ETUA 1XNRT 1HTJF 3AE7A 3JC6D 2FJEA 5HEOA 1N33T 4PK6A 2RP4A 2X9XA 5CJ5A 4KHPT 5BR8T 4X65T 3QUJA 2CWYA 3IBPA 3A7MA 4JI1T 2CXLA 2YDSA 4GKKT 3T1YT 3IF8B 3KBTA 4FJOA 4H9SE 3DJBA 4H9OC 4WZXA 5JR9A 1XWMA 4U31A 2WZIA 3H37A 3N9OA 3ZMSB 2LM2A 2OA5A 3C64A 3N9LA 4N78D 4LFBT 4HFIA 3LBXA 4IE0A 4QWNB 1LKXA 4IT4A 1YKHB 2H89A 3ANWA 4ZZCA 4AI6A 5GONE 5L3BB 3CX6B 4AQYT 3A5XA 4KMCA 1BR4A 1FIOA 1KNPA 2LEHA 2E2AA 3MA9A 3QB5A 2LSKA 2UXNB 5JVDE 5A1LA 3MKDA 2XAFB 2YDQA 2VWAA 5EK2A 2FJAA 3UFGA 4DO0A 2E5LT 3U78A 5F3JA 1FMVA 2J47A 1XNQT 2X9HA 2E8IA 5LYJE 4NIQA 2CLYC 4UVAB 4ZEYA 1LVKA 5JR9B 1OXZA 1D1AA 4JI3T 2K3WA 2IC6A 4ANJA 2YDRA 5JDQA 4B3RT 2IC9A 4HWDA 2D5UA 1LVFA 2CRBA 2JQQA 1NWMX 4CXWA 5JQGE 3KDSE 3PUWF 3ONJA 4YHJA 2I6HA 5FXXA 3ZCIA 4BAYB 4F8HA 5KDMC 5J2TE 2IMLA 1W0BA 1KF6A 4YFSA 2AE9A 2D9DA 3AE8A 4X1KE 5FXZA 3AE3A 3OBVE 4TX5A 2WSSV 4B3TT 3OPCA 2WMOA 1HG2A 3E08A 2DWGA 2HPLA 4X1YE 3V5SA 1W0AA 1VCSA 3CKDA 4H63V 5LNKA 1D1CA 2X66A 2YOEA 3P4SA 3FZFB 3AAEB 4CQIA 1SA0E 5AQPB 5AQHB 4DV0T 2W63A 3TLSA 3KVBA 4IGUA 2WBLA 4U74A 4DMVA 4DVDA 4E7SA 4TZ4C 4YHHT 3SFEA 5HEHA 4U33A 4EYUA 3IHRA 2H88A 2EHOC 3CQCB 4U72A 4AXPA 1J5ET 2LHRA 1HNXT 2DNXA 1ZHCA 2IUBA 2LLYA 3NRXA 2WM9A 5KMGP 2W00A 4H9NC 2WDVA 5JDHA 4AKGA 3SFDA 3GN5B 3VRBA 1XMQT 5LG3A 4J2CA 4CI3B 4UEMA 1X79A 3E0ZA 3PUQA 5IHYA 2IAKA 3SWHA 1G73A 2IIUA 5HXSA 4I55E 2XZEA 3IEEA 4JI7T 4ZI7E 3N2KE 3LDQB 4U2YA 2P9BA 2ZM8A 3UQ7A 2VASA 4TV8E 3OJAA 3ZC1A 3JC6C 1S35A 1YD8G 2CM0A 3LK3B 3PUYF 4PNIA 3ZPOA 4Q25A 1XDOA 2V6XA 1XMOT 3AVRA 4JV5T 2UXBT 2B76A 2LOSA 4TWFA 3VU7H 5CA1E 3J9X1 3PUZF 2UXDT 2QGSA 1E2AA 2V5DA 4DV3T 2LRKA 2N1GA 3AXJA 3ZYLA 3C4XA 3ZYMA 3GA8A 3OYXA 4EB6E 2X68A 1KNRA 3N9QA 1N34T 3I0QA 4ILBA 4UVBB 4YJ2E 1DU2A 5FYMA 5LBMA 3ZCJA 4DBQA 2WDRA 2X9YA 5LGNB 4XBFB 1HX1B 2L3LA 3A8YC 3LSVA 4X1IE 5HEUA 5FVLA 2CBIA 3UFEA 1ZOYA 4DV6T 5LB7B 1MMNA 5J2UE 4LF5T 3AA1B 4IDZA 2MAWA 4QH1A 4WNKA 3ZJ1A 1XZYA 4WBOA 2KWHA 3ZSTA 4U7YA 4QH5A 5FL0A 4DBRA 2A9UA 4IL9A 4MHCA 4X64T 3RC8A 2VB6A 2KXPB 2W61A 1NEKA 3N9NA 4KBMB 3RYHE 5IWAT 2CEAA 2A3DA 2Q9QD 2BBJA 3L09A 4C90A 4EGWA 4EYYR 4HTEA 3PUGA 1YQ3A 3D0TA 3UQ4A 2WY2A 3KBUA 3FXDB 4I50E 4YTNA 5J1GA 3ZT5A 4DV1T 3P4QA 2DLRA 1OWAA 3MJXA 1E1HB 1HCIA 3HL6A 2WMNA 2JPFA 3UTKA 2BVMA 2I0MA 2E9XB 1MNEA 3C4ZA 3UUNA 2LHNA 5JDLA 4I43B 2GK9A 5FY1A 3AAIA 2FBWA 4IDPA 3SS1A 1GQEA 3RX6A 4AKRB 3MXZA 1T7SA 1UURA 2LM9A 2NOXA 4PJNA 5AQLB 3ABVA 4G63A 2ACXA 1S94A 3SOLA 4CI2B 2Z6EA 4X66T 5L4EA 3FZMB 2A2FX 3N9PA 4E7ZA 2QRXA 3UU4A 2ODUA 2UUAT 5L3EB 2QVAA 4PJLA 3KFWX 3F31A 4ILCA 2SPCA 4H63H 3R6NA 3AECA 4ADZA 2UU9T 2DL1A 1UGOA 4H9RC 1BR2A 3AA6B 2CWOA 1WR6A 1Z0PA 3AEBA 2YU2A 4PFPA 3FBZA 5LHHB 4UV8B 2V7IA 5DQVA 4CN6A 5JTGA 3WAJA 3L3PA 2CA5A 3DTOA 4TNVA 1WRDA 2D2SA 4U7IA 4K0KT 4IE7A 3AE1A 3KV9A 3V5UA 2KZ7B 4AKLA 4H9QC 2C5JA 2L8KA 1IJ5A 4GOUA 5HEGA 3EVYA 2IW5B 2V7JA 4DIDB 1UK5A 4AISA 5ABHA 4DV5T 2W4XA 1W9RA 3RH3A 2VVNA 5HAXA 3CX8B 4MBQA 4HWHA 3P4WA 2BVLA 5FP3A 2PBIA 5AQSB 5HXCA 3ZN1B 5L47A 1HNWT 4TUYE 3VKHA 3VKGA 4IE4A 2EHOB 3JCFA 4LMLA 1FMWA 2BKPA 5LCYA 4HFEA 2W0GA 3LFMA 4HFBA 4UF0A 4I0UA 1WYCA 4ZI3C 1D0XA 5ABFB 2EHOA 5LXTE 5AQVB 1YW0A 4O4JE 3RQWA 2BDEA 2XUEA 5HEJA 1IAPA 2LJLA 4DUZT 3KVAA 4AQFA 1G8XA 3QNUA 5FMNA 1SHZC 2J1DG 3I1AA 5AQRB 2N9DA 2NW9A 3T8OA 5JH7E 3PU3A 4HWIB 4U3CA 4KX6A 5LP6E 4QXHB 2VL8A 4PJJA 4CN1A 4A5XA 4O4HE 4IDQA 2V7KA 2XQ9A 3B13A 4M1PA 2JJ9A 4PW8A 4LF8T 2ACZA 3CIRA 2MOZA 2WQYA 5HYAA 1WLXA 2Q9QC 3LG7A 4YXDA 4OK0A 3BQLA 4YTMA 3TLVA 3ZKRA 5LMUT 3AA7B 3JAFA 1V9DA 4IREA 3WI3A 2BKOA 1FEWA 2FUPA 2YINA 2MPKA 3C51A 3ZMTB 4WYVA 4MFRA 4DMWA 4QH4A 5FL1A 1J5WA 3UUMA 4GYRA 5CA0E 5LGTB 2VQET 3N2OA 4HN9A 2JQKA 2W67A 2BG9C 3RRCA 2XQ4A 4LMJA 2PFVA 2DI4A 1QUUA 2WS3A 3BQIA 5FXVA 4NXMT 3AVSA 2WU5A 1I6ZA 1HF8A 5HXRA 3HKDE 3WAKA 4P09A 2VL0A 5HXEA 4JYAT 2HHHT 1UX4A 4O2AE 5LOVE 4AQGA 1VCTA 3ZT7A 4DR1T
chains in the Genus database with same CATH topology
3TKLB 1MIVA 2CE7A 5JREA 3U3IA 4L0RA 3HR0A 3M65A 5FY7A 2KNDA 4H9PC 3OKQA 2NTXA 5LJNA 1MMAA 3R84B 2K48A 2X51A 3CPZA 1Y64B 3PTRB 3QK6A 2E9XC 3N2GE 4OYJA 3FXEB 5DABA 1EZ3A 3J7Yq 4HGAA 1ZEEA 3EDUA 2XTLA 1B7TA 2ZMAA 2JMKA 5BMVE 4QX8B 3HKBE 3HI2A 4UXNB 2MBGA 2WAUA 3BK9A 3E22E 3CQXC 3MZKB 3Q2MA 1MIYA 2ODVA 2X67A 5JDMA 2VK9A 4MLKA 2V7LA 3KV5A 3P7IA 4CXXA 3O9XA 3ZC0A 2M67A 2DCFA 3F57A 2Y48B 1H7CA 2G0UA 3NBXX 1MMGA 4IHJE 4ISSA 4PK5A 4NUVA 3O1JA 1IZNB 4UF0B 4ZS3A 3RYFE 4EZHA 3HKEE 1T98A 2MYSA 4NUUA 2Y6XA 2D0UA 2I59A 3N5LA 2KMFA 2RA1A 1MIWA 4QHOA 5F8PA 2LSGA 4QXCB 2YK0A 2MTQA 3F2EA 3KV4A 3ZYKA 2YEVC 3SRZA 4QX7B 3ZMVB 3VHLA 3CQGB 3I0OA 4ZS2A 4GYSA 3LK42 3N9MA 4YJ3E 2XAGB 2Y8DA 2Q9QB 2V1DB 1BR1A 2H7OA 1KK7A 1U4QA 4KUMB 3UT5E 5LG4A 1HX8A 3NZQA 5JDFA 3CWZB 2X0LB 3H3AA 3PDYA 4HEAA 4BJNA 2VKJA 4OYKA 2LSJA 4EXTA 3MACA 3KV6A 5LJMA 2E9XD 4ZI3D 4IIJE 5JRCB 2UXXB 2K5BB 5C8YE 2CXFA 3FHNA 1O3XA 1US7B 2PJQA 5L3DB 3CVRA 4OFZA 4ZOLE 3RRWA 5ETWA 4AKHA 3ESLA 3FB2A 4V1Av 4ZHQE 3I9WA 4TN7B 4L5GA 4L9IA 4O4LE 4O4IE 3DP7A 2QA7A 2DHRA 1LRZA 2VKDA 3O1IA 3PU8A 4JLEA 3BQKA 3ANWB 2VKHA 3I9YA 2L9QA 1VRBA 2NP9A 2NTYA 3C50A 3AAAB 2CMRA 5L2LA 2WWUA 4WBNE 1UCUA 2A72A 4XZCA 2JMHA 1D1BA 4GIWA 2BZBA 2K9AA 3ZN0B 3RYCE 4F6RC 5AFUL 3CX7B 3FBLA 3EUHA 4EAHA 5LGUB 1U5PA 4EOZB 3ZMZB 5TAOA 4YLHA 2ZM0A 1BR0A 4ISTA 4UIGA 3RPUA 4QKNA 2V7MA 4A56A 4CZZB 2DWKA 2XASB 2XAQB 2C5KT 2K24A 4Z8XA 3PE0A 5EZYE 4I4TE 4JUYA 3K3OA 3LK2B 5H6RB 3K3QC 3K8PC 5L3CB 2KT9A 2LOPA 2ES0A 2HH7A 2NW7A 5LA6E 5JDGA 2H7VC 1D0YA 3CMLA 5LBQB 2D0TA 4IE6A 4TV9E 2XHEB 3ZEFB 3ETVA 5E0OA 4ERRA 5JDNA 2H3RA 3PUAA 2X9WA 2ZM2A 4O8SA 4PK4A 4ZI2C 2PG8A 4AKIA 4CI1B 4OHFA 2XAJB 3S4UA 2KWIB 1KNZA 4HFVA 1NAFA 1QSDA 5CB4E 4P0BA 4K0UA 4BA9A 1UX5A 5HXHA 3K3NA 3PUSA 1ZKEA 2LT3A 1YKEB 2CLYB 3C98B 4UV9B 2LSYA 2V26A 5JR9C 2YU1A 4BJMA 5HWXA 3QC9A 3Q5WA 5EK4A 3LJCA 3NZPA 3GWHA 5HWYA 2XAHB 2XQYA 3Q5XA 2ZLYA 3OYZA 4GK0E 4JEUB 3ZLIA 2VKOA 4XAXB 2HPJA 1VOMA 4HKAA 3AB3B 4WW0A 5H6QB 2JRKA 3UULA 4DNDA 1HG5A 2CCQA 2W62A 1MNDA 4ZI2D 4CXYA 1AJ3A 4EZ4A 3KINB 4KP3C 2B1EA 3P8CD 3B57A 4IE5A 3ZJ2A 1MMDA 3NRYA 5KX5E 4UVCB 3ZMUB 5M4YA 4ILUA 5FNVE 4AQFC 3PURA 1HS7A 3MK7C 4QXBB 2KLQA 4MALA 4JEHB 3C4WA 3RC3A 1D0ZA 4FI5A 4PFOA 2N2NA 1IJ6A 3AA0B 3Q9DA 4X20E 2LSIA 3GMIA 4G2AA 4HE8A 3LBXB 2NWBA 5L3FB 3UUXB 3W15B 4PAGA 1WYBA 3RYIE 3RKOA 3O4XE 2C5IT 4GK5E 5L3GB 4EIWA 5JRCA 2Q9QA 1HFAA 3GN5A 5EK3A 2E9XA 3HKCE 2KINB 5IYZE 4C91A 5ADXL 1ZV4X 1CUNA 5DQWA 5DJQC 4PJMA 2NW8A 2EHOD 5LHIB 2CXDA 3ONXA 4O2BE 4UELA 2LE8A 5FY0A 3EDVA 5LHGB 4P0AA 4B6XA 2C0SA 3O1HA 4AKGA 3HA4A 5FXWA 3ETUA 1HTJF 3JC6D 4PK6A 2RP4A 2X9XA 3QUJA 2CWYA 3IBPA 2CXLA 3IF8B 3KBTA 4FJOA 4H9SE 3DJBA 4H9OC 5JR9A 3ZMSB 3N9OA 3H37A 2OA5A 3C64A 3N9LA 4N78D 3LBXA 4IE0A 4QWNB 1LKXA 4AI6A 1YKHB 3ANWA 5GONE 5L3BB 3CX6B 3A5XA 4KMCA 1BR4A 1FIOA 2LEHA 3MA9A 5JVDE 2LSKA 2UXNB 5A1LA 3MKDA 2XAFB 5EK2A 2VWAA 4DO0A 3U78A 5F3JA 1FMVA 2X9HA 2E8IA 5LYJE 2CLYC 4UVAB 1LVKA 5JR9B 1OXZA 1D1AA 2IC6A 4ANJA 5JDQA 2IC9A 2D5UA 1LVFA 2JQQA 1NWMX 4CXWA 5JQGE 3KDSE 3ZCIA 4YHJA 5FXXA 4BAYB 5KDMC 5J2TE 4YFSA 4X1KE 5FXZA 3OBVE 4TX5A 2WSSV 3V5SA 2WMOA 1HG2A 3E08A 2DWGA 2HPLA 4X1YE 3CKDA 4H63V 5LNKA 1D1CA 2X66A 4CQIA 3AAEB 1SA0E 2W63A 3KVBA 4IGUA 2WBLA 4U74A 4DMVA 4DVDA 4E7SA 4TZ4C 4EYUA 3IHRA 4U72A 2EHOC 3CQCB 4AXPA 2LHRA 2DNXA 1ZHCA 3NRXA 2WM9A 5KMGP 2W00A 4H9NC 5JDHA 3GN5B 4J2CA 4CI3B 4UEMA 1X79A 3E0ZA 3PUQA 5IHYA 2IAKA 3SWHA 1G73A 5HXSA 4I55E 3IEEA 4ZI7E 3N2KE 2P9BA 2ZM8A 2VASA 4TV8E 3OJAA 3ZC1A 3JC6C 1S35A 1YD8G 2CM0A 3LK3B 4PNIA 3ZPOA 3AVRA 2LOSA 3VU7H 5CA1E 3J9X1 2QGSA 2N1GA 3ZYLA 3ZYMA 3C4XA 4EB6E 3GA8A 3OYXA 2X68A 3N9QA 3I0QA 4UVBB 4YJ2E 5FYMA 5LBMA 3ZCJA 4DBQA 2X9YA 4XBFB 2L3LA 3UFEA 4X1IE 1MMNA 5J2UE 3AA1B 4IDZA 4WNKA 3ZJ1A 4WBOA 2KWHA 4DBRA 4MHCA 3RC8A 2VB6A 2KXPB 2W61A 3N9NA 4KBMB 3RYHE 2CEAA 2A3DA 2Q9QD 3L09A 4C90A 4EYYR 4HTEA 3PUGA 3D0TA 3KBUA 3FXDB 4I50E 5J1GA 2DLRA 1OWAA 3MJXA 1E1HB 1HCIA 3HL6A 2WMNA 2JPFA 3UTKA 2BVMA 2E9XB 1MNEA 3C4ZA 3UUNA 2LHNA 5JDLA 4I43B 2GK9A 5FY1A 3AAIA 3SS1A 3RX6A 4AKRB 3MXZA 2LM9A 2NOXA 4PJNA 4G63A 2ACXA 1S94A 3SOLA 4CI2B 2Z6EA 2A2FX 3N9PA 4E7ZA 2ODUA 5L3EB 4PJLA 3KFWX 3F31A 2SPCA 4H63H 3R6NA 4ADZA 4H9RC 1BR2A 3AA6B 2CWOA 1WR6A 1Z0PA 2YU2A 4PFPA 3FBZA 4UV8B 2V7IA 5DQVA 3WAJA 3L3PA 2CA5A 3DTOA 1WRDA 2D2SA 4IE7A 3KV9A 3V5UA 2KZ7B 4AKLA 4H9QC 2C5JA 2L8KA 1IJ5A 4GOUA 3EVYA 2IW5B 2V7JA 3RH3A 5HAXA 3CX8B 4MBQA 2BVLA 5FP3A 2PBIA 3ZN1B 5HXCA 3VKGA 3VKHA 4TUYE 4IE4A 2EHOB 5LCYA 1FMWA 2W0GA 3LFMA 4UF0A 1WYCA 4ZI3C 1D0XA 2EHOA 5LXTE 1YW0A 4O4JE 2BDEA 2XUEA 1IAPA 2LJLA 3KVAA 4AQFA 1G8XA 5FMNA 3T8OA 1SHZC 2J1DG 3I1AA 5LGNB 2N9DA 2NW9A 5JH7E 3PU3A 5LP6E 4QXHB 2VL8A 4PJJA 4O4HE 2V7KA 3B13A 4PW8A 4M1PA 2JJ9A 5HYAA 2MOZA 1WLXA 2Q9QC 3LG7A 4OK0A 3BQLA 3AA7B 1V9DA 3WI3A 2YINA 1FEWA 3ZMTB 3C51A 4ASKA 5LHHB 4DMWA 4MFRA 5LGTB 3UUMA 4GYRA 5CA0E 3N2OA 4HN9A 3RRCA 2PFVA 2DI4A 1QUUA 3BQIA 5FXVA 3AVSA 1HF8A 5HXRA 3HKDE 3WAKA 4P09A 5HXEA 1UX4A 4O2AE 5LOVE 4AQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJ1 A;  2LHN A;  3ZJ2 A;  5L2L A; 
#chains in the Genus database with same CATH topology
 3TKL B;  1MIV A;  1KFY A;  2CE7 A;  1JNR A;  2WDQ A;  3U3I A;  4EED A;  5AQN B;  5JRE A;  4L0R A;  3HR0 A;  3M65 A;  3K1S A;  5FY7 A;  1ZP0 A;  5HCJ A;  3L39 A;  1W09 A;  1CHU A;  4KI0 F;  1N32 T;  2KND A;  1XDP A;  2RPA A;  3AE4 A;  3P4R A;  4H9P C;  4B3M T;  2E5V A;  3OKQ A;  4YY3 T;  2NTX A;  3NWI A;  1Z8U A;  4UR9 A;  1MMA A;  5LJN A;  1Y01 A;  3R84 B;  4COF A;  2K48 A;  2X51 A;  2XQA A;  3CPZ A;  4DV4 T;  1Y64 B;  3PTR B;  3QK6 A;  2E9X C;  3UU6 A;  2BBH A;  2LRL A;  3ZSS A;  3NVO A;  3N2G E;  3OVU A;  4OYJ A;  2XY8 B;  3FXE B;  4HFD A;  1WCR A;  5DAB A;  3RGL A;  3ZT6 A;  1EZ3 A;  3J7Y q;  4HGA A;  1OED E;  1ZEE A;  1YQ4 A;  3EDU A;  2XTL A;  3AXJ B;  4DR5 T;  1B7T A;  2ZMA A;  1SUM B;  2JMK A;  5BMV E;  1IBM T;  1HR0 T;  4QX8 B;  3HKB E;  3AE5 A;  3HI2 A;  4UXN B;  2MBG A;  2WAU A;  3BK9 A;  3E22 E;  3CQX C;  4GKJ T;  3MZK B;  3Q2M A;  1MIY A;  2ODV A;  3RIU C;  3EHZ A;  2X67 A;  5JDM A;  2VK9 A;  4MLK A;  2R6G F;  2V7L A;  4DV2 T;  3KV5 A;  3P7I A;  4CXX A;  3AEE A;  3O9X A;  3ZC0 A;  2M67 A;  3G06 A;  2LKG A;  1SE7 A;  2DCF A;  2JIW A;  3F57 A;  2Y48 B;  1H7C A;  2G0U A;  3NBX X;  4IDO A;  3PUX F;  1MMG A;  4IHJ E;  4ISS A;  5CGM A;  4PK5 A;  4TWD A;  4NUV A;  3O1J A;  1IZN B;  4UF0 B;  4YSZ A;  3TLW A;  2OV9 A;  4ZS3 A;  3RYF E;  4EZH A;  3HKE E;  1T98 A;  2MYS A;  3M3Z B;  3L8R A;  4NUU A;  2Y6X A;  2D0U A;  2FJB A;  2I59 A;  2KMF A;  2RA1 A;  1MIW A;  3N5L A;  3ONL C;  3TLT A;  4HWF A;  2OLT A;  4QHO A;  3B5M A;  5AQM B;  4DR6 T;  5F8P A;  2BS4 A;  4ZXL A;  2LSG A;  4QXC B;  2YK0 A;  4TWH A;  5CFB A;  2MTQ A;  2XSB A;  3F2E A;  3KV4 A;  2M6B A;  5F5W A;  3ZYK A;  2YEV C;  3SRZ A;  4QX7 B;  3ZMV B;  4EV6 A;  2W66 A;  3VHL A;  2HN1 A;  3RHW A;  3CQG B;  3I0O A;  4ZS2 A;  4GYS A;  4LF6 T;  2W2U A;  3LK4 2;  3N9M A;  4YJ3 E;  4YSX A;  2XAG B;  2Y8D A;  2Q9Q B;  2V1D B;  1BR1 A;  2H7O A;  3P50 A;  1KK7 A;  1U4Q A;  4YTP A;  5AQF B;  2UXC T;  2WU2 A;  5HCM A;  1E7P A;  4KUM B;  3UT5 E;  2UUC T;  5LG4 A;  1HX8 A;  3NZQ A;  5J0Z A;  5JDF A;  3CWZ B;  2X0L B;  3H3A A;  2HN2 A;  2AXD S;  3PDY A;  2VKJ A;  4HEA A;  4OYK A;  4BJN A;  4EEB A;  4YSY A;  4LF4 T;  2LSJ A;  3PV0 F;  4EXT A;  3MAC A;  1OED B;  3KV6 A;  5LJM A;  1IBL T;  2IDO B;  2E9X D;  3AE9 A;  2BG9 B;  3FZH B;  4TNW A;  4IIJ E;  5AQO B;  4ZI3 D;  5JRC B;  2UXX B;  2K5B B;  4JI2 T;  5C8Y E;  1T72 A;  2CXF A;  3FHN A;  1YXR A;  2V5C A;  1O3X A;  1US7 B;  3AEA A;  4DV7 T;  2BG9 E;  2PJQ A;  2CHO A;  3CVR A;  4OFZ A;  5L3D B;  4ZOL E;  3RRW A;  5ETW A;  4AKH A;  5ABE A;  3ESL A;  3FB2 A;  4V1A v;  4ZHQ E;  3RIF A;  3I9W A;  4TN7 B;  4L5G A;  3CK6 A;  4L9I A;  4NPP A;  4O4L E;  3UU5 A;  5KXJ A;  3QOF A;  4O4I E;  2XJ7 A;  3AE6 A;  3DP7 A;  4JI4 T;  2WB5 A;  2QA7 A;  1N36 T;  2KSR A;  2DHR A;  1LRZ A;  2VKD A;  3O1I A;  3PU8 A;  4JLE A;  3BQK A;  3ANW B;  2XQ8 A;  2VKH A;  3I9Y A;  2L9Q A;  1VRB A;  3UU3 A;  4U2Z A;  3P4P A;  1I94 T;  5C2T A;  1WFD A;  2NP9 A;  2NTY A;  3C50 A;  2IHR 1;  3AAA B;  3AED A;  2CMR A;  5L2L A;  2WWU A;  4WBN E;  1UCU A;  4OX9 T;  2A72 A;  4XZC A;  3H3M A;  2JMH A;  4DR3 T;  2XM1 A;  1D1B A;  2XPK A;  4GIW A;  1UUS A;  2WZH A;  3EI0 A;  1WR0 A;  2BZB A;  2K9A A;  5AQT B;  3ZN0 B;  3RYC E;  1R8I A;  3VR9 A;  4F6R C;  5AFU L;  3CX7 B;  3FBL A;  3TLU A;  3EUH A;  1M62 A;  3RIA A;  4EAH A;  5LGU B;  1U5P A;  4EOZ B;  3ZMZ B;  1T8B A;  1KEY A;  3Q5E A;  2ZM0 A;  4YLH A;  5TAO A;  3AEF A;  4IST A;  5IUX A;  2XQ6 A;  4UIG A;  3RPU A;  1BR0 A;  4QKN A;  2V7M A;  4A56 A;  2BKN A;  2DWK A;  2XAS B;  2XAQ B;  4CZZ B;  2C5K T;  2K24 A;  3VR8 A;  4Z8X A;  3PE0 A;  3VRA A;  2ZM6 T;  5EZY E;  4I4T E;  2BS3 A;  3K3O A;  4JUY A;  3LK2 B;  2YKS A;  5H6R B;  3K3Q C;  3K8P C;  3RI5 A;  5AQK B;  3FZL B;  2JQH A;  5L3C B;  2KT9 A;  2LOP A;  2ES0 A;  2HH7 A;  2NW7 A;  2XM2 A;  4HWC A;  5LA6 E;  3EAM A;  4LMK A;  3UUB A;  2V6Y A;  5JDG A;  2H7V C;  1D0Y A;  2X0H A;  3CML A;  4HFC A;  5LBQ B;  4ASK A;  2VQF T;  4JI8 T;  1OED A;  2D0T A;  4IE6 A;  2XHE B;  4TV9 E;  3ZEF B;  3ETV A;  5E0O A;  3RKG A;  4ERR A;  2CBJ A;  5JDN A;  1IBK T;  2H3R A;  3PUA A;  2X9W A;  2ZM2 A;  2M6I A;  4O8S A;  4PK4 A;  3JAD A;  4ZI2 C;  3OTO T;  5AQQ B;  2PG8 A;  4AKI A;  4B3S T;  4CI1 B;  4OHF A;  2XAJ B;  3S4U A;  4CN4 A;  2CHN A;  2KWI B;  2J62 A;  4AIU A;  2QYW A;  4HFV A;  2WCA A;  4JBW F;  1NAF A;  4A97 A;  1QSD A;  5CB4 E;  4P0B A;  1KNZ A;  4K0U A;  4BA9 A;  1UX5 A;  5HXH A;  3IA3 A;  3K3N A;  3PUS A;  1ZKE A;  5LMN T;  2XSA A;  2BS2 A;  2LT3 A;  1YKE B;  2CLY B;  3C98 B;  4UV9 B;  2LSY A;  2UUB T;  2V26 A;  5JR9 C;  4DR7 T;  4LF7 T;  4KHZ F;  1X9B A;  4X62 T;  3QB5 K;  2YU1 A;  1M7K A;  4BJM A;  5HWX A;  3QC9 A;  1QLB A;  3Q5W A;  3RIU A;  5EK4 A;  3LJC A;  3NZP A;  4Z91 A;  3GWH A;  2VUR A;  2WP9 A;  5HWY A;  3RF1 A;  3Q5D A;  1NEN A;  2JQ9 A;  2XAH B;  2XQY A;  2ZLY A;  3FZK B;  2FJD A;  3OYZ A;  3Q5X A;  4GK0 E;  2VKO A;  4JEU B;  5AQG B;  3ZLI A;  4XAX B;  2HPJ A;  1VOM A;  4HKA A;  3AB3 B;  4WW0 A;  5H6Q B;  2JRK A;  3UUL A;  5ABF A;  4DND A;  4A98 A;  1HG5 A;  2CCQ A;  2W62 A;  1MND A;  4ZI2 D;  4CXY A;  1AJ3 A;  3RQU A;  4EZ4 A;  4X5T A;  3KIN B;  4KP3 C;  2B1E A;  5L4H A;  3P8C D;  3B57 A;  4IE5 A;  3ZJ2 A;  1MMD A;  2LKH A;  2CPT A;  3NRY A;  4UVC B;  3ZMU B;  5KX5 E;  5AQU B;  4ILU A;  5M4Y A;  2XQ5 A;  2XQ7 A;  4LFA T;  2PTF A;  5FNV E;  4AQF C;  3PUR A;  5ABG A;  4JI6 T;  1HS7 A;  3MK7 C;  4QXB B;  2KLQ A;  4MAL A;  3RLF F;  3X1D A;  4JEH B;  3C4W A;  3PJA J;  3RC3 A;  2WWV A;  2XQ3 A;  4YT0 A;  3EAB A;  4Z90 A;  1D0Z A;  3UU8 A;  4P1N A;  4FI5 A;  5C3J A;  4PFO A;  2N2N A;  1IJ6 A;  3AA0 B;  3Q9D A;  3JAE A;  4X20 E;  2LSI A;  3GMI A;  3NKZ A;  4G2A A;  4HE8 A;  4DR2 T;  2J4G A;  3LBX B;  2NWB A;  1HNZ T;  5L3F B;  3UUX B;  3W15 B;  4PAG A;  1WYB A;  3RYI E;  3RKO A;  3O4X E;  4HFH A;  2C5I T;  4IL4 A;  1L0V A;  2V6Y B;  2YN6 A;  4GK5 E;  3AEG A;  5L3G B;  4EIW A;  4DUY T;  5JRC A;  2Q9Q A;  2BG9 A;  2V8S V;  2F4V T;  1HFA A;  3GN5 A;  5EK3 A;  2E9X A;  3HKC E;  4LF9 T;  2KIN B;  5IYZ E;  4C91 A;  4LFC T;  5ADX L;  5FKY A;  1ZV4 X;  1CUN A;  4ZZB A;  3PJA A;  5FVK A;  5DQW A;  2VVS A;  3PUV F;  4JI5 T;  5AQJ B;  5DJQ C;  4IDN A;  4PJM A;  1OED C;  2EHO D;  2NW8 A;  5LHI B;  4JI0 T;  2CXD A;  2NR4 A;  3ONX A;  4ILA A;  2LE8 A;  4O2B E;  3AE2 A;  3EDV A;  4UEL A;  5FY0 A;  5LHG B;  3T1H T;  4NXN T;  4P0A A;  4B6X A;  2C0S A;  3O1H A;  5AQI B;  1JNZ A;  3HA4 A;  5FXW A;  1FJG T;  4DR4 T;  1J1J A;  2X0Y A;  3ETU A;  1XNR T;  1HTJ F;  3AE7 A;  3JC6 D;  2FJE A;  5HEO A;  1N33 T;  4PK6 A;  2RP4 A;  2X9X A;  5CJ5 A;  4KHP T;  5BR8 T;  4X65 T;  3QUJ A;  2CWY A;  3IBP A;  3A7M A;  4JI1 T;  2CXL A;  2YDS A;  4GKK T;  3T1Y T;  3IF8 B;  3KBT A;  4FJO A;  4H9S E;  3DJB A;  4H9O C;  4WZX A;  5JR9 A;  1XWM A;  4U31 A;  2WZI A;  3H37 A;  3N9O A;  3ZMS B;  2LM2 A;  2OA5 A;  3C64 A;  3N9L A;  4N78 D;  4LFB T;  4HFI A;  3LBX A;  4IE0 A;  4QWN B;  1LKX A;  4IT4 A;  1YKH B;  2H89 A;  3ANW A;  4ZZC A;  4AI6 A;  5GON E;  5L3B B;  3CX6 B;  4AQY T;  3A5X A;  4KMC A;  1BR4 A;  1FIO A;  1KNP A;  2LEH A;  2E2A A;  3MA9 A;  3QB5 A;  2LSK A;  2UXN B;  5JVD E;  5A1L A;  3MKD A;  2XAF B;  2YDQ A;  2VWA A;  5EK2 A;  2FJA A;  3UFG A;  4DO0 A;  2E5L T;  3U78 A;  5F3J A;  1FMV A;  2J47 A;  1XNQ T;  2X9H A;  2E8I A;  5LYJ E;  4NIQ A;  2CLY C;  4UVA B;  4ZEY A;  1LVK A;  5JR9 B;  1OXZ A;  1D1A A;  4JI3 T;  2K3W A;  2IC6 A;  4ANJ A;  2YDR A;  5JDQ A;  4B3R T;  2IC9 A;  4HWD A;  2D5U A;  1LVF A;  2CRB A;  2JQQ A;  1NWM X;  4CXW A;  5JQG E;  3KDS E;  3PUW F;  3ONJ A;  4YHJ A;  2I6H A;  5FXX A;  3ZCI A;  4BAY B;  4F8H A;  5KDM C;  5J2T E;  2IML A;  1W0B A;  1KF6 A;  4YFS A;  2AE9 A;  2D9D A;  3AE8 A;  4X1K E;  5FXZ A;  3AE3 A;  3OBV E;  4TX5 A;  2WSS V;  4B3T T;  3OPC A;  2WMO A;  1HG2 A;  3E08 A;  2DWG A;  2HPL A;  4X1Y E;  3V5S A;  1W0A A;  1VCS A;  3CKD A;  4H63 V;  5LNK A;  1D1C A;  2X66 A;  2YOE A;  3P4S A;  3FZF B;  3AAE B;  4CQI A;  1SA0 E;  5AQP B;  5AQH B;  4DV0 T;  2W63 A;  3TLS A;  3KVB A;  4IGU A;  2WBL A;  4U74 A;  4DMV A;  4DVD A;  4E7S A;  4TZ4 C;  4YHH T;  3SFE A;  5HEH A;  4U33 A;  4EYU A;  3IHR A;  2H88 A;  2EHO C;  3CQC B;  4U72 A;  4AXP A;  1J5E T;  2LHR A;  1HNX T;  2DNX A;  1ZHC A;  2IUB A;  2LLY A;  3NRX A;  2WM9 A;  5KMG P;  2W00 A;  4H9N C;  2WDV A;  5JDH A;  4AKG A;  3SFD A;  3GN5 B;  3VRB A;  1XMQ T;  5LG3 A;  4J2C A;  4CI3 B;  4UEM A;  1X79 A;  3E0Z A;  3PUQ A;  5IHY A;  2IAK A;  3SWH A;  1G73 A;  2IIU A;  5HXS A;  4I55 E;  2XZE A;  3IEE A;  4JI7 T;  4ZI7 E;  3N2K E;  3LDQ B;  4U2Y A;  2P9B A;  2ZM8 A;  3UQ7 A;  2VAS A;  4TV8 E;  3OJA A;  3ZC1 A;  3JC6 C;  1S35 A;  1YD8 G;  2CM0 A;  3LK3 B;  3PUY F;  4PNI A;  3ZPO A;  4Q25 A;  1XDO A;  2V6X A;  1XMO T;  3AVR A;  4JV5 T;  2UXB T;  2B76 A;  2LOS A;  4TWF A;  3VU7 H;  5CA1 E;  3J9X 1;  3PUZ F;  2UXD T;  2QGS A;  1E2A A;  2V5D A;  4DV3 T;  2LRK A;  2N1G A;  3AXJ A;  3ZYL A;  3C4X A;  3ZYM A;  3GA8 A;  3OYX A;  4EB6 E;  2X68 A;  1KNR A;  3N9Q A;  1N34 T;  3I0Q A;  4ILB A;  4UVB B;  4YJ2 E;  1DU2 A;  5FYM A;  5LBM A;  3ZCJ A;  4DBQ A;  2WDR A;  2X9Y A;  5LGN B;  4XBF B;  1HX1 B;  2L3L A;  3A8Y C;  3LSV A;  4X1I E;  5HEU A;  5FVL A;  2CBI A;  3UFE A;  1ZOY A;  4DV6 T;  5LB7 B;  1MMN A;  5J2U E;  4LF5 T;  3AA1 B;  4IDZ A;  2MAW A;  4QH1 A;  4WNK A;  3ZJ1 A;  1XZY A;  4WBO A;  2KWH A;  3ZST A;  4U7Y A;  4QH5 A;  5FL0 A;  4DBR A;  2A9U A;  4IL9 A;  4MHC A;  4X64 T;  3RC8 A;  2VB6 A;  2KXP B;  2W61 A;  1NEK A;  3N9N A;  4KBM B;  3RYH E;  5IWA T;  2CEA A;  2A3D A;  2Q9Q D;  2BBJ A;  3L09 A;  4C90 A;  4EGW A;  4EYY R;  4HTE A;  3PUG A;  1YQ3 A;  3D0T A;  3UQ4 A;  2WY2 A;  3KBU A;  3FXD B;  4I50 E;  4YTN A;  5J1G A;  3ZT5 A;  4DV1 T;  3P4Q A;  2DLR A;  1OWA A;  3MJX A;  1E1H B;  1HCI A;  3HL6 A;  2WMN A;  2JPF A;  3UTK A;  2BVM A;  2I0M A;  2E9X B;  1MNE A;  3C4Z A;  3UUN A;  2LHN A;  5JDL A;  4I43 B;  2GK9 A;  5FY1 A;  3AAI A;  2FBW A;  4IDP A;  3SS1 A;  1GQE A;  3RX6 A;  4AKR B;  3MXZ A;  1T7S A;  1UUR A;  2LM9 A;  2NOX A;  4PJN A;  5AQL B;  3ABV A;  4G63 A;  2ACX A;  1S94 A;  3SOL A;  4CI2 B;  2Z6E A;  4X66 T;  5L4E A;  3FZM B;  2A2F X;  3N9P A;  4E7Z A;  2QRX A;  3UU4 A;  2ODU A;  2UUA T;  5L3E B;  2QVA A;  4PJL A;  3KFW X;  3F31 A;  4ILC A;  2SPC A;  4H63 H;  3R6N A;  3AEC A;  4ADZ A;  2UU9 T;  2DL1 A;  1UGO A;  4H9R C;  1BR2 A;  3AA6 B;  2CWO A;  1WR6 A;  1Z0P A;  3AEB A;  2YU2 A;  4PFP A;  3FBZ A;  5LHH B;  4UV8 B;  2V7I A;  5DQV A;  4CN6 A;  5JTG A;  3WAJ A;  3L3P A;  2CA5 A;  3DTO A;  4TNV A;  1WRD A;  2D2S A;  4U7I A;  4K0K T;  4IE7 A;  3AE1 A;  3KV9 A;  3V5U A;  2KZ7 B;  4AKL A;  4H9Q C;  2C5J A;  2L8K A;  1IJ5 A;  4GOU A;  5HEG A;  3EVY A;  2IW5 B;  2V7J A;  4DID B;  1UK5 A;  4AIS A;  5ABH A;  4DV5 T;  2W4X A;  1W9R A;  3RH3 A;  2VVN A;  5HAX A;  3CX8 B;  4MBQ A;  4HWH A;  3P4W A;  2BVL A;  5FP3 A;  2PBI A;  5AQS B;  5HXC A;  3ZN1 B;  5L47 A;  1HNW T;  4TUY E;  3VKH A;  3VKG A;  4IE4 A;  2EHO B;  3JCF A;  4LML A;  1FMW A;  2BKP A;  5LCY A;  4HFE A;  2W0G A;  3LFM A;  4HFB A;  4UF0 A;  4I0U A;  1WYC A;  4ZI3 C;  1D0X A;  5ABF B;  2EHO A;  5LXT E;  5AQV B;  1YW0 A;  4O4J E;  3RQW A;  2BDE A;  2XUE A;  5HEJ A;  1IAP A;  2LJL A;  4DUZ T;  3KVA A;  4AQF A;  1G8X A;  3QNU A;  5FMN A;  1SHZ C;  2J1D G;  3I1A A;  5AQR B;  2N9D A;  2NW9 A;  3T8O A;  5JH7 E;  3PU3 A;  4HWI B;  4U3C A;  4KX6 A;  5LP6 E;  4QXH B;  2VL8 A;  4PJJ A;  4CN1 A;  4A5X A;  4O4H E;  4IDQ A;  2V7K A;  2XQ9 A;  3B13 A;  4M1P A;  2JJ9 A;  4PW8 A;  4LF8 T;  2ACZ A;  3CIR A;  2MOZ A;  2WQY A;  5HYA A;  1WLX A;  2Q9Q C;  3LG7 A;  4YXD A;  4OK0 A;  3BQL A;  4YTM A;  3TLV A;  3ZKR A;  5LMU T;  3AA7 B;  3JAF A;  1V9D A;  4IRE A;  3WI3 A;  2BKO A;  1FEW A;  2FUP A;  2YIN A;  2MPK A;  3C51 A;  3ZMT B;  4WYV A;  4MFR A;  4DMW A;  4QH4 A;  5FL1 A;  1J5W A;  3UUM A;  4GYR A;  5CA0 E;  5LGT B;  2VQE T;  3N2O A;  4HN9 A;  2JQK A;  2W67 A;  2BG9 C;  3RRC A;  2XQ4 A;  4LMJ A;  2PFV A;  2DI4 A;  1QUU A;  2WS3 A;  3BQI A;  5FXV A;  4NXM T;  3AVS A;  2WU5 A;  1I6Z A;  1HF8 A;  5HXR A;  3HKD E;  3WAK A;  4P09 A;  2VL0 A;  5HXE A;  4JYA T;  2HHH T;  1UX4 A;  4O2A E;  5LOV E;  4AQG A;  1VCT A;  3ZT7 A;  4DR1 T; 
#chains in the Genus database with same CATH homology
 3TKL B;  1MIV A;  2CE7 A;  5JRE A;  3U3I A;  4L0R A;  3HR0 A;  3M65 A;  5FY7 A;  2KND A;  4H9P C;  3OKQ A;  2NTX A;  5LJN A;  1MMA A;  3R84 B;  2K48 A;  2X51 A;  3CPZ A;  1Y64 B;  3PTR B;  3QK6 A;  2E9X C;  3N2G E;  4OYJ A;  3FXE B;  5DAB A;  1EZ3 A;  3J7Y q;  4HGA A;  1ZEE A;  3EDU A;  2XTL A;  1B7T A;  2ZMA A;  2JMK A;  5BMV E;  4QX8 B;  3HKB E;  3HI2 A;  4UXN B;  2MBG A;  2WAU A;  3BK9 A;  3E22 E;  3CQX C;  3MZK B;  3Q2M A;  1MIY A;  2ODV A;  2X67 A;  5JDM A;  2VK9 A;  4MLK A;  2V7L A;  3KV5 A;  3P7I A;  4CXX A;  3O9X A;  3ZC0 A;  2M67 A;  2DCF A;  3F57 A;  2Y48 B;  1H7C A;  2G0U A;  3NBX X;  1MMG A;  4IHJ E;  4ISS A;  4PK5 A;  4NUV A;  3O1J A;  1IZN B;  4UF0 B;  4ZS3 A;  3RYF E;  4EZH A;  3HKE E;  1T98 A;  2MYS A;  4NUU A;  2Y6X A;  2D0U A;  2I59 A;  3N5L A;  2KMF A;  2RA1 A;  1MIW A;  4QHO A;  5F8P A;  2LSG A;  4QXC B;  2YK0 A;  2MTQ A;  3F2E A;  3KV4 A;  3ZYK A;  2YEV C;  3SRZ A;  4QX7 B;  3ZMV B;  3VHL A;  3CQG B;  3I0O A;  4ZS2 A;  4GYS A;  3LK4 2;  3N9M A;  4YJ3 E;  2XAG B;  2Y8D A;  2Q9Q B;  2V1D B;  1BR1 A;  2H7O A;  1KK7 A;  1U4Q A;  4KUM B;  3UT5 E;  5LG4 A;  1HX8 A;  3NZQ A;  5JDF A;  3CWZ B;  2X0L B;  3H3A A;  3PDY A;  4HEA A;  4BJN A;  2VKJ A;  4OYK A;  2LSJ A;  4EXT A;  3MAC A;  3KV6 A;  5LJM A;  2E9X D;  4ZI3 D;  4IIJ E;  5JRC B;  2UXX B;  2K5B B;  5C8Y E;  2CXF A;  3FHN A;  1O3X A;  1US7 B;  2PJQ A;  5L3D B;  3CVR A;  4OFZ A;  4ZOL E;  3RRW A;  5ETW A;  4AKH A;  3ESL A;  3FB2 A;  4V1A v;  4ZHQ E;  3I9W A;  4TN7 B;  4L5G A;  4L9I A;  4O4L E;  4O4I E;  3DP7 A;  2QA7 A;  2DHR A;  1LRZ A;  2VKD A;  3O1I A;  3PU8 A;  4JLE A;  3BQK A;  3ANW B;  2VKH A;  3I9Y A;  2L9Q A;  1VRB A;  2NP9 A;  2NTY A;  3C50 A;  3AAA B;  2CMR A;  5L2L A;  2WWU A;  4WBN E;  1UCU A;  2A72 A;  4XZC A;  2JMH A;  1D1B A;  4GIW A;  2BZB A;  2K9A A;  3ZN0 B;  3RYC E;  4F6R C;  5AFU L;  3CX7 B;  3FBL A;  3EUH A;  4EAH A;  5LGU B;  1U5P A;  4EOZ B;  3ZMZ B;  5TAO A;  4YLH A;  2ZM0 A;  1BR0 A;  4IST A;  4UIG A;  3RPU A;  4QKN A;  2V7M A;  4A56 A;  4CZZ B;  2DWK A;  2XAS B;  2XAQ B;  2C5K T;  2K24 A;  4Z8X A;  3PE0 A;  5EZY E;  4I4T E;  4JUY A;  3K3O A;  3LK2 B;  5H6R B;  3K3Q C;  3K8P C;  5L3C B;  2KT9 A;  2LOP A;  2ES0 A;  2HH7 A;  2NW7 A;  5LA6 E;  5JDG A;  2H7V C;  1D0Y A;  3CML A;  5LBQ B;  2D0T A;  4IE6 A;  4TV9 E;  2XHE B;  3ZEF B;  3ETV A;  5E0O A;  4ERR A;  5JDN A;  2H3R A;  3PUA A;  2X9W A;  2ZM2 A;  4O8S A;  4PK4 A;  4ZI2 C;  2PG8 A;  4AKI A;  4CI1 B;  4OHF A;  2XAJ B;  3S4U A;  2KWI B;  1KNZ A;  4HFV A;  1NAF A;  1QSD A;  5CB4 E;  4P0B A;  4K0U A;  4BA9 A;  1UX5 A;  5HXH A;  3K3N A;  3PUS A;  1ZKE A;  2LT3 A;  1YKE B;  2CLY B;  3C98 B;  4UV9 B;  2LSY A;  2V26 A;  5JR9 C;  2YU1 A;  4BJM A;  5HWX A;  3QC9 A;  3Q5W A;  5EK4 A;  3LJC A;  3NZP A;  3GWH A;  5HWY A;  2XAH B;  2XQY A;  3Q5X A;  2ZLY A;  3OYZ A;  4GK0 E;  4JEU B;  3ZLI A;  2VKO A;  4XAX B;  2HPJ A;  1VOM A;  4HKA A;  3AB3 B;  4WW0 A;  5H6Q B;  2JRK A;  3UUL A;  4DND A;  1HG5 A;  2CCQ A;  2W62 A;  1MND A;  4ZI2 D;  4CXY A;  1AJ3 A;  4EZ4 A;  3KIN B;  4KP3 C;  2B1E A;  3P8C D;  3B57 A;  4IE5 A;  3ZJ2 A;  1MMD A;  3NRY A;  5KX5 E;  4UVC B;  3ZMU B;  5M4Y A;  4ILU A;  5FNV E;  4AQF C;  3PUR A;  1HS7 A;  3MK7 C;  4QXB B;  2KLQ A;  4MAL A;  4JEH B;  3C4W A;  3RC3 A;  1D0Z A;  4FI5 A;  4PFO A;  2N2N A;  1IJ6 A;  3AA0 B;  3Q9D A;  4X20 E;  2LSI A;  3GMI A;  4G2A A;  4HE8 A;  3LBX B;  2NWB A;  5L3F B;  3UUX B;  3W15 B;  4PAG A;  1WYB A;  3RYI E;  3RKO A;  3O4X E;  2C5I T;  4GK5 E;  5L3G B;  4EIW A;  5JRC A;  2Q9Q A;  1HFA A;  3GN5 A;  5EK3 A;  2E9X A;  3HKC E;  2KIN B;  5IYZ E;  4C91 A;  5ADX L;  1ZV4 X;  1CUN A;  5DQW A;  5DJQ C;  4PJM A;  2NW8 A;  2EHO D;  5LHI B;  2CXD A;  3ONX A;  4O2B E;  4UEL A;  2LE8 A;  5FY0 A;  3EDV A;  5LHG B;  4P0A A;  4B6X A;  2C0S A;  3O1H A;  4AKG A;  3HA4 A;  5FXW A;  3ETU A;  1HTJ F;  3JC6 D;  4PK6 A;  2RP4 A;  2X9X A;  3QUJ A;  2CWY A;  3IBP A;  2CXL A;  3IF8 B;  3KBT A;  4FJO A;  4H9S E;  3DJB A;  4H9O C;  5JR9 A;  3ZMS B;  3N9O A;  3H37 A;  2OA5 A;  3C64 A;  3N9L A;  4N78 D;  3LBX A;  4IE0 A;  4QWN B;  1LKX A;  4AI6 A;  1YKH B;  3ANW A;  5GON E;  5L3B B;  3CX6 B;  3A5X A;  4KMC A;  1BR4 A;  1FIO A;  2LEH A;  3MA9 A;  5JVD E;  2LSK A;  2UXN B;  5A1L A;  3MKD A;  2XAF B;  5EK2 A;  2VWA A;  4DO0 A;  3U78 A;  5F3J A;  1FMV A;  2X9H A;  2E8I A;  5LYJ E;  2CLY C;  4UVA B;  1LVK A;  5JR9 B;  1OXZ A;  1D1A A;  2IC6 A;  4ANJ A;  5JDQ A;  2IC9 A;  2D5U A;  1LVF A;  2JQQ A;  1NWM X;  4CXW A;  5JQG E;  3KDS E;  3ZCI A;  4YHJ A;  5FXX A;  4BAY B;  5KDM C;  5J2T E;  4YFS A;  4X1K E;  5FXZ A;  3OBV E;  4TX5 A;  2WSS V;  3V5S A;  2WMO A;  1HG2 A;  3E08 A;  2DWG A;  2HPL A;  4X1Y E;  3CKD A;  4H63 V;  5LNK A;  1D1C A;  2X66 A;  4CQI A;  3AAE B;  1SA0 E;  2W63 A;  3KVB A;  4IGU A;  2WBL A;  4U74 A;  4DMV A;  4DVD A;  4E7S A;  4TZ4 C;  4EYU A;  3IHR A;  4U72 A;  2EHO C;  3CQC B;  4AXP A;  2LHR A;  2DNX A;  1ZHC A;  3NRX A;  2WM9 A;  5KMG P;  2W00 A;  4H9N C;  5JDH A;  3GN5 B;  4J2C A;  4CI3 B;  4UEM A;  1X79 A;  3E0Z A;  3PUQ A;  5IHY A;  2IAK A;  3SWH A;  1G73 A;  5HXS A;  4I55 E;  3IEE A;  4ZI7 E;  3N2K E;  2P9B A;  2ZM8 A;  2VAS A;  4TV8 E;  3OJA A;  3ZC1 A;  3JC6 C;  1S35 A;  1YD8 G;  2CM0 A;  3LK3 B;  4PNI A;  3ZPO A;  3AVR A;  2LOS A;  3VU7 H;  5CA1 E;  3J9X 1;  2QGS A;  2N1G A;  3ZYL A;  3ZYM A;  3C4X A;  4EB6 E;  3GA8 A;  3OYX A;  2X68 A;  3N9Q A;  3I0Q A;  4UVB B;  4YJ2 E;  5FYM A;  5LBM A;  3ZCJ A;  4DBQ A;  2X9Y A;  4XBF B;  2L3L A;  3UFE A;  4X1I E;  1MMN A;  5J2U E;  3AA1 B;  4IDZ A;  4WNK A;  3ZJ1 A;  4WBO A;  2KWH A;  4DBR A;  4MHC A;  3RC8 A;  2VB6 A;  2KXP B;  2W61 A;  3N9N A;  4KBM B;  3RYH E;  2CEA A;  2A3D A;  2Q9Q D;  3L09 A;  4C90 A;  4EYY R;  4HTE A;  3PUG A;  3D0T A;  3KBU A;  3FXD B;  4I50 E;  5J1G A;  2DLR A;  1OWA A;  3MJX A;  1E1H B;  1HCI A;  3HL6 A;  2WMN A;  2JPF A;  3UTK A;  2BVM A;  2E9X B;  1MNE A;  3C4Z A;  3UUN A;  2LHN A;  5JDL A;  4I43 B;  2GK9 A;  5FY1 A;  3AAI A;  3SS1 A;  3RX6 A;  4AKR B;  3MXZ A;  2LM9 A;  2NOX A;  4PJN A;  4G63 A;  2ACX A;  1S94 A;  3SOL A;  4CI2 B;  2Z6E A;  2A2F X;  3N9P A;  4E7Z A;  2ODU A;  5L3E B;  4PJL A;  3KFW X;  3F31 A;  2SPC A;  4H63 H;  3R6N A;  4ADZ A;  4H9R C;  1BR2 A;  3AA6 B;  2CWO A;  1WR6 A;  1Z0P A;  2YU2 A;  4PFP A;  3FBZ A;  4UV8 B;  2V7I A;  5DQV A;  3WAJ A;  3L3P A;  2CA5 A;  3DTO A;  1WRD A;  2D2S A;  4IE7 A;  3KV9 A;  3V5U A;  2KZ7 B;  4AKL A;  4H9Q C;  2C5J A;  2L8K A;  1IJ5 A;  4GOU A;  3EVY A;  2IW5 B;  2V7J A;  3RH3 A;  5HAX A;  3CX8 B;  4MBQ A;  2BVL A;  5FP3 A;  2PBI A;  3ZN1 B;  5HXC A;  3VKG A;  3VKH A;  4TUY E;  4IE4 A;  2EHO B;  5LCY A;  1FMW A;  2W0G A;  3LFM A;  4UF0 A;  1WYC A;  4ZI3 C;  1D0X A;  2EHO A;  5LXT E;  1YW0 A;  4O4J E;  2BDE A;  2XUE A;  1IAP A;  2LJL A;  3KVA A;  4AQF A;  1G8X A;  5FMN A;  3T8O A;  1SHZ C;  2J1D G;  3I1A A;  5LGN B;  2N9D A;  2NW9 A;  5JH7 E;  3PU3 A;  5LP6 E;  4QXH B;  2VL8 A;  4PJJ A;  4O4H E;  2V7K A;  3B13 A;  4PW8 A;  4M1P A;  2JJ9 A;  5HYA A;  2MOZ A;  1WLX A;  2Q9Q C;  3LG7 A;  4OK0 A;  3BQL A;  3AA7 B;  1V9D A;  3WI3 A;  2YIN A;  1FEW A;  3ZMT B;  3C51 A;  4ASK A;  5LHH B;  4DMW A;  4MFR A;  5LGT B;  3UUM A;  4GYR A;  5CA0 E;  3N2O A;  4HN9 A;  3RRC A;  2PFV A;  2DI4 A;  1QUU A;  3BQI A;  5FXV A;  3AVS A;  1HF8 A;  5HXR A;  3HKD E;  3WAK A;  4P09 A;  5HXE A;  1UX4 A;  4O2A E;  5LOV E;  4AQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...