2JMHA

Nmr solution structure of blo t 5, a major mite allergen from blomia tropicalis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
QEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mite allergen Blo t 5
publication title Roles of Structure and Structural Dynamics in the Antibody Recognition of the Allergen Proteins: An NMR Study on Blomia tropicalis Major Allergen
pubmed doi rcsb
source organism Blomia tropicalis
molecule tags Allergen
total genus 40
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jmhA01
2JRKA 2LM9A 2JMHA
chains in the Genus database with same CATH superfamily
2CEAA 3PUXF 4UF0B 4EZHA 4MLKA 3P4WA 3RQUA 1UCUA 4ZI2D 5DQWA 4IDQA 4GKKT 3CX6B 4YTMA 1HS7A 3CMLA 4A97A 4TV8E 4AXPA 1QUUA 2IW5B 2BG9B 4AISA 1R8IA 2NW8A 4HFCA 2UXXB 2J62A 4YSYA 2B1EA 4DNDA 2M67A 2X0HA 2DL1A 3Q5EA 4EZ4A 2CBJA 4O4HE 4IDPA 2H3RA 1MMDA 3PUGA 3ZT5A 3UQ4A 4BAYB 3PUWF 3P50A 3C50A 3A5XA 1OEDE 4KUMB 2EHOC 3H3MA 1MIVA 1X79A 2BZBA 4GIWA 3SS1A 5HXCA 3RYCE 1ZKEA 1UX4A 1YQ3A 5HXRA 4Z91A 2H88A 2Q9QC 4XZCA 4MBQA 3HI2A 3AE6A 5HWXA 2OA5A 4P09A 5LP6E 3FZMB 2X0LB 1EZ3A 3RIFA 2WDRA 3ZMTB 5CGMA 4BJNA 1S94A 2Y8DA 3PJAJ 2WWVA 1MIWA 1OEDA 2NR4A 2XASB 3L39A 1IBMT 3NVOA 5HEOA 2YK0A 2VB6A 1KK7A 4KHZF 2XUEA 1YD8G 4UEMA 5F5WA 1L0VA 3ETUA 3ZSTA 2D0UA 4X64T 2E9XC 1ZOYA 4HWFA 2KWIB 3L3PA 1FMVA 4YXDA 3QOFA 3ZCJA 4HGAA 5IYZE 2VL0A 3PJAA 2LSGA 2XY8B 4TNVA 3B57A 3JC6D 1MMAA 2BS3A 4K0KT 2HH7A 2LSIA 5JDQA 5AQSB 2G0UA 3RIAA 3AA1B 4I0UA 3HKBE 5KDMC 3ZCIA 3A7MA 3CX8B 3RGLA 2ZM0A 2J1DG 1MMNA 3KDSE 3AXJB 4UR9A 2QRXA 1U4QA 3ZMVB 4TUYE 5J2UE 3GMIA 4DR5T 1OXZA 3ZKRA 4DBQA 3ZJ1A 3VHLA 5AFUL 2Y6XA 4AKRB 4YJ2E 4TWDA 4F8HA 1NAFA 2DHRA 3ZT6A 5FY7A 1N33T 2C5KT 4X1YE 4LMLA 4X65T 4BA9A 2CCQA 1WR6A 4U72A 1FJGT 4DBRA 3NZQA 4ILCA 3LG7A 4IL9A 3LBXB 4C91A 3PUVF 5AQVB 4U31A 2GK9A 5LBQB 3V5SA 4WBNE 2Z6EA 3RX6A 2UXDT 5HEJA 4LMJA 4DV2T 2XM1A 4NIQA 2BDEA 4AI6A 2ZM2A 5JDGA 2BBHA 1N36T 4ZHQE 3GWHA 3N9OA 5HXHA 5J0ZA 3AEEA 4YSXA 5JDMA 4O2BE 3UFEA 2H89A 1I6ZA 3ZSSA 1WYCA 2KSRA 3ANWB 3O9XA 1IBKT 1HG2A 2J4GA 4YTNA 3HR0A 1W9RA 5AQKB 4E7SA 3IF8B 3AEGA 3ZPOA 2X9XA 3EAMA 2CWOA 2K3WA 2V7JA 3CVRA 4DV6T 4H63V 3UQ7A 3C4WA 2NTYA 2C0SA 3X1DA 4COFA 1SHZC 2WSSV 2XSBA 4HFVA 4I43B 4UV8B 2OLTA 3B13A 3O1JA 5ABFB 5LG4A 2VQFT 3HL6A 2BS4A 4U7YA 2K48A 2V8SV 3SRZA 2K5BB 2CLYB 4IE5A 5FXZA 5FP3A 3TLVA 1M7KA 2BS2A 2LKGA 3TKLB 2XAHB 4XBFB 3KV9A 2PJQA 3FBZA 2LLYA 3PUAA 3LFMA 2W4XA 2XQ7A 5AQNB 1D0ZA 2CBIA 5F3JA 3QB5K 1YKEB 2V7MA 2V5CA 4MALA 4DUZT 2KMFA 4WBOA 5LB7B 3D0TA 4YTPA 3KBUA 3AEBA 3A8YC 2QA7A 4U2YA 2XHEB 2BKPA 4A56A 2D0TA 3I9WA 2D9DA 2W0GA 5JRCA 4HWHA 2FUPA 5HAXA 2LSJA 3ZYLA 4X62T 2I6HA 4EOZB 4ERRA 1D0XA 4WNKA 2XAJB 1HX8A 2DLRA 4CN6A 5AQQB 3OYZA 2XPKA 2ZMAA 5FY1A 2W63A 3LJCA 3ONJA 3P8CD 3R84B 1HNXT 5LXTE 3FZHB 4QXHB 3N9PA 3H3AA 4EEDA 4PJLA 2VQET 3ZYMA 3HKDE 3QUJA 2WY2A 2X9YA 2LT3A 5FMNA 2IC6A 5JDFA 2W66A 1WR0A 2WM9A 4YT0A 3AB3B 2X0YA 4EYYR 4ZI3C 4ISSA 2H7OA 4H63H 2WU5A 3KINB 1G73A 2HN1A 2WWUA 4GK0E 3MJXA 2CXDA 5HYAA 4QWNB 2JJ9A 2F4VT 3AEDA 3T8OA 4HWDA 3GN5A 3CK6A 2V6YA 2VK9A 2WB5A 5HXSA 3PU8A 4KX6A 3VR8A 2LM2A 3OJAA 3ZMSB 3C64A 4LF4T 4QHOA 2A3DA 3C4XA 4G2AA 2FBWA 3N2GE 4ZZBA 4H9PC 3SWHA 2IC9A 4F6RC 4L0RA 2JMKA 3TLSA 2VL8A 3AE1A 3FBLA 2P9BA 3CIRA 2YDRA 4IE7A 5FXXA 3OYXA 3RH3A 2XQYA 2VKDA 4H9OC 2HPLA 4DV7T 4Z90A 2CRBA 4ZXLA 5IWAT 3UUNA 2BG9C 1MMGA 2FJBA 3ZLIA 4TN7B 1WYBA 4CZZB 2E8IA 2VWAA 5JDHA 4JI0T 4IT4A 1IBLT 2A9UA 3JAFA 4LF6T 1D1CA 4DR2T 3G06A 2DI4A 3NRYA 3OPCA 1IAPA 2DWKA 3CQGB 3LDQB 1Y64B 1D1AA 2BKOA 4IDOA 4ZI2C 3NWIA 2IDOB 2VURA 3JCFA 2VVNA 1IJ5A 1UX5A 2WCAA 2DNXA 1KF6A 1GQEA 1T7SA 3RC3A 5IHYA 4B3ST 5FL0A 2JQKA 5AQLB 1D0YA 4U3CA 4GK5E 4NXMT 4ISTA 4MFRA 2VKOA 2LHRA 4JI8T 5DQVA 5KMGP 3CPZA 5AQOB 2BG9E 2UXNB 2XAFB 5FVLA 3Q5WA 4UVAB 3JADA 4EB6E 3H37A 1KNZA 4IDNA 2D5UA 2KT9A 4PJMA 3VR9A 2E5VA 4P1NA 4WW0A 1HNWT 4KBMB 2IAKA 4DV3T 3KBTA 1UK5A 1HFAA 4PFOA 1HF8A 2J47A 5LGUB 1D1BA 3AA7B 5HWYA 2WDVA 3AE4A 3PV0F 4KMCA 4HKAA 4GOUA 4HFHA 4AQFA 3ZC1A 1VCSA 2YOEA 3RF1A 3ZN0B 4ZEYA 4DO0A 3BK9A 1XDOA 4CQIA 4CN1A 4BJMA 4GYSA 2PBIA 2IIUA 5AQUB 1JNRA 4U7IA 1E1HB 2FJDA 4JI4T 1W09A 4XAXB 3Q2MA 2X9WA 2WQYA 3CQCB 3PUYF 3HA4A 4OYJA 4UELA 3BQIA 3OTOT 3AEAA 4QX8B 3MZKB 2EHOA 3B5MA 3RQWA 2C5IT 2NWBA 4CN4A 5FY0A 3KV6A 3JC6C 4ZZCA 2LJLA 2X51A 4DV5T 3K8PC 5HEHA 1LRZA 2ES0A 2PTFA 2MTQA 1G8XA 3RPUA 2UXBT 1UUSA 2Q9QA 4L5GA 5LHGB 2NW9A 4JEUB 3PE0A 3U3IA 4A5XA 4QH5A 2VASA 3KFWX 5FKYA 3RI5A 4JI3T 2PG8A 4ZS2A 2JQ9A 2SPCA 4E7ZA 4AQYT 5HEUA 4TV9E 1QSDA 5CJ5A 4M1PA 5LJMA 2KXPB 5CB4E 2A2FX 3VRAA 2LHNA 3K3NA 5EK4A 4HTEA 4TX5A 3KV4A 2E9XA 4WYVA 1BR0A 3T1YT 1NENA 1FEWA 2V1DB 2JIWA 2ACXA 2W2UA 1U5PA 3MKDA 2CM0A 4OX9T 3RLFF 5TAOA 2RP4A 5AQRB 4LFAT 5L3FB 1Y01A 1O3XA 2UUCT 5JR9C 4DV1T 5ABEA 3UTKA 3NZPA 3UUBA 3F31A 4AIUA 2BBJA 4JI2T 2V6XA 4EAHA 3FZKB 4CI1B 5LJNA 4TWFA 3AVSA 3J7Yq 1BR4A 5LYJE 3EI0A 4KHPT 2WAUA 2KLQA 3U78A 3ZJ2A 1HNZT 3I0OA 4QXCB 4ASKA 3O1HA 4B6XA 5JRCB 3E08A 4IHJE 3W15B 1HR0T 3WAJA 1Z8UA 4LMKA 5FXWA 4DR4T 2I59A 5L4EA 3RYIE 5HEGA 2XQ4A 3AA6B 1OWAA 1IZNB 2XTLA 3RIUC 4JUYA 4DUYT 2N1GA 4CI3B 4I4TE 2LOPA 2V7LA 3DJBA 4NUVA 3WAKA 3PUQA 3VU7H 4H9RC 3OKQA 2M6IA 2X66A 2V7KA 2NP9A 1T98A 3KVAA 4QH4A 3AECA 1US7B 3AE3A 3JAEA 5L47A 4KI0F 3EABA 1YQ4A 2XAGB 2XQ3A 4YFSA 2X67A 3RKOA 5FXVA 2FJEA 3Q9DA 5LGNB 2K24A 2R6GF 3OVUA 2L9QA 3NBXX 5LBMA 3ONLC 2BVLA 2N9DA 4EIWA 5FL1A 5JR9A 4IIJE 4JI7T 1J5WA 2WBLA 3EVYA 5KX5E 5A1LA 3GN5B 2V6YB 1IJ6A 4JV5T 4ANJA 1MNDA 2YINA 5L3GB 4DMWA 1V9DA 4WZXA 4ZOLE 2CWYA 4I55E 4U33A 3PURA 4ILAA 2UU9T 4PJJA 3RHWA 4OK0A 2XAQB 3DTOA 5CA0E 3CWZB 3FZLB 3UU5A 2MBGA 3E22E 1J1JA 1XMOT 3MACA 1KFYA 2H7VC 1ZHCA 3PUZF 4AKIA 4DR3T 3PU3A 3P7IA 3QB5A 5L3BB 3DP7A 3IA3A 5AQJB 3IBPA 2CHOA 3K3QC 2VKHA 4IE6A 4HWCA 4UVBB 5LNKA 4JI5T 4HFBA 1VCTA 4H9QC 4QX7B 4NPPA 3N9QA 5L3DB 2K9AA 5L4HA 3UT5E 3VRBA 2MOZA 4AKHA 5E0OA 2YN6A 4HFIA 3Q5XA 4B3RT 3FXEB 4Z8XA 2X9HA 2ACZA 5AQFB 1HG5A 4OYKA 5AQGB 2CPTA 3UULA 3UUXB 4IREA 5LG3A 3N9LA 5LMUT 3C51A 4YJ3E 4ZS3A 3UU4A 3TLUA 2LSKA 5BR8T 2AXDS 4YLHA 3GA8A 4PW8A 4JI6T 3T1HT 4HEAA 3KV5A 1JNZA 2CMRA 2HN2A 3FXDB 5L2LA 2UUBT 1OEDB 1SA0E 2JMHA 2LOSA 1LKXA 4Q25A 3ABVA 2JRKA 1S35A 4EYUA 2NOXA 3M65A 1KNPA 3AEFA 2I0MA 2EHOD 5C3JA 3K1SA 4IL4A 3Q5DA 4QH1A 4X1KE 2VKJA 2IHR1 4CXWA 4LF9T 4CXYA 4ZI7E 2JQHA 5LA6E 3AE2A 2QVAA 2ZM6T 3CQXC 2D2SA 5DJQC 3I1AA 2Q9QD 4U2ZA 4UIGA 3EHZA 1T8BA 5EK2A 3MK7C 4C90A 2CXFA 3LK42 5C2TA 3OBVE 1SE7A 3VKHA 1XWMA 5HCJA 4FJOA 1YW0A 1X9BA 4L9IA 2EHOB 4DR6T 2JPFA 3O4XE 3AA0B 1QLBA 2ZM8A 2QGSA 3QNUA 3UUMA 2E9XD 1CHUA 4UV9B 3AAIA 2YEVC 3F2EA 4LF8T 1KNRA 1SUMB 1WLXA 4GYRA 4UF0A 2Q9QB 5C8YE 4EGWA 3C4ZA 5CA1E 2BG9A 3ONXA 3P4QA 3J9X1 4EXTA 2BVMA 5IUXA 5AQMB 3F57A 5ABGA 4UVCB 4O2AE 3TLTA 2ODVA 2WDQA 1YKHB 3PTRB 4PFPA 2MAWA 3QK6A 3TLWA 2E9XB 2N2NA 5JTGA 4TZ4C 1LVKA 5ETWA 1WRDA 3AE7A 5LGTB 4LF7T 4JEHB 3RC8A 4HFDA 5FYMA 3R6NA 3RYHE 5FNVE 4UXNB 1YXRA 3LK3B 2KINB 2WZHA 5J2TE 3ZC0A 3SFEA 2LEHA 2UXCT 5L3CB 2BKNA 5AQHB 4YSZA 3UU8A 3LSVA 4DV0T 2UUAT 3E0ZA 2WMOA 3UU6A 3WI3A 3MXZA 5BMVE 4O4JE 2XQ8A 3ESLA 4PK4A 3N5LA 3SFDA 3ZMUB 1W0AA 2NW7A 4DVDA 3RRWA 3EDVA 5J1GA 2Y48B 2DCFA 5LMNT 4QKNA 1BR1A 3ZN1B 3RKGA 5DABA 2W61A 1DU2A 2W00A 1MNEA 4PNIA 3P4PA 1E2AA 5H6RB 1HX1B 3PUSA 5AQPB 1HTJF 3UFGA 5ADXL 4AKLA 2WMNA 5JQGE 1MIYA 3NKZA 2XM2A 3SOLA 2LKHA 1M62A 2ZLYA 2IMLA 4J2CA 3ZT7A 3AXJA 3ZYKA 2W67A 1UGOA 1H7CA 2W62A 5GONE 2YU2A 3P4SA 5JDLA 3NRXA 3FZFB 4DIDB 1B7TA 1VRBA 4OFZA 4LFBT 4EEBA 2CXLA 4MHCA 1UURA 3EUHA 4DMVA 4H9SE 3CX7B 4G63A 1LVFA 4YY3T 1XMQT 4X5TA 2E5LT 2WP9A 5LOVE 2LRLA 5JVDE 5JR9B 1XNRT 4HFEA 4HWIB 1ZEEA 4JLEA 3ZEFB 2LM9A 2CLYC 3S4UA 3EDUA 3AAEB 4ILBA 2KWHA 5FVKA 3AVRA 5CFBA 2PFVA 3LBXA 4O4LE 1Z0PA 5L3EB 4OHFA 1HCIA 4AKGA 5HXEA 2RPAA 3RRCA 4TWHA 1J5ET 2LSYA 2YU1A 4A98A 2CHNA 4CI2B 4H9NC 1BR2A 3MA9A 4IGUA 2NTXA 3KVBA 4HE8A 4O4IE 4B3TT 4N78D 4U74A 2WZIA 3BQKA 2XQAA 1AJ3A 1I94T 3IHRA 4JBWF 3M3ZB 3HKEE 2WU2A 4X1IE 4JI1T 4PK6A 2E2AA 3ANWA 4ILUA 3I9YA 2M6BA 2KNDA 2L8KA 2MYSA 2LRKA 4P0BA 2KZ7B 4IDZA 4O8SA 4HN9A 5JDNA 5ABHA 4YHJA 4X66T 3AE9A 4PAGA 3ETVA 5ABFA 2MPKA 4K0UA 4TNWA 3L09A 3O1IA 4V1Av 1FMWA 2AE9A 4LF5T 3LK2B 1FIOA 3UU3A 2IUBA 2YDSA 2DWGA 1VOMA 4ZI3D 1ZP0A 2ODUA 4KP3C 2YDQA 2XJ7A 3N9MA 5JREA 4DR7T 2FJAA 3RYFE 1WFDA 2OV9A 3RIUA 4PK5A 5AQIB 2A72A 1XZYA 1E7PA 2V26A 2B76A 3BQLA 2LE8A 4QXBB 4DV4T 4EV6A 2CE7A 1N34T 2JQQA 3N2KE 5H6QB 4IE0A 3N9NA 1WCRA 4LFCT 3C98B 2YKSA 1NEKA 3FHNA 2V5DA 2RA1A 2XQ6A 1ZV4X 3ZMZB 2WS3A 3PDYA 1N32T 1XNQT 3IEEA 4AQGA 4DR1T 3QC9A 1W0BA 3AE8A 5JH7E 5LHIB 1NWMX 4CXXA 5F8PA 3V5UA 4FI5A 1T72A 4ADZA 2XSAA 2CA5A 5M4YA 4NUUA 5LCYA 4GKJT 1KEYA 1CUNA 3P4RA 4NXNT 5LHHB 4X20E 5HCMA 2XZEA 5EK3A 4PJNA 2V7IA 3K3OA 3CKDA 2C5JA 5EZYE 3I0QA 2XQ9A 4IE4A 2HHHT 3L8RA 2X68A 1OEDC 4P0AA 3HKCE 3AAAB 2L3LA 1XDPA 5KXJA 3VKGA 2XQ5A 3AE5A 2HPJA 4YHHT 4JYAT 2QYWA 5AQTB 3N2OA 2VVSA 4B3MT 4I50E 3FB2A 4AQFC
chains in the Genus database with same CATH topology
2CEAA 4PFPA 2XAJB 4WNKA 3QK6A 4UF0B 4EZHA 1HX8A 4MLKA 4EAHA 1UCUA 2E9XB 2N2NA 4CI1B 2DLRA 4ZI2D 4TZ4C 5DQWA 5LJNA 3CX6B 1LVKA 5ETWA 1HS7A 3AVSA 1WRDA 3CMLA 3J7Yq 1BR4A 4TV8E 3OYZA 5LGTB 4AXPA 5LYJE 2WAUA 1QUUA 2KLQA 2ZMAA 4JEHB 3U78A 2IW5B 5FY1A 3RC8A 2W63A 5FYMA 3R6NA 3ZJ2A 3F31A 3RYHE 3LJCA 5FNVE 3P8CD 3I0OA 4QXCB 4ASKA 3R84B 3O1HA 3LK3B 4UXNB 2NW8A 5LXTE 4QXHB 2KINB 2UXXB 4B6XA 3N9PA 3H3AA 5J2TE 5JRCB 3E08A 4IHJE 3ZC0A 2B1EA 4PJLA 3W15B 4DNDA 2M67A 2LEHA 3WAJA 5L3CB 3ZYMA 3HKDE 4EZ4A 5FXWA 3QUJA 2X9YA 2LT3A 5FMNA 2I59A 2IC6A 4O4HE 5JDFA 3RYIE 2H3RA 1MMDA 3PUGA 2WM9A 3E0ZA 3AA6B 3AB3B 4BAYB 2WMOA 4EYYR 3WI3A 4ZI3C 3C50A 3A5XA 1OWAA 4KUMB 2EHOC 1IZNB 2H7OA 2XTLA 4ISSA 4H63H 1MIVA 3MXZA 1X79A 5BMVE 2BZBA 4O4JE 4JUYA 4GIWA 3ESLA 4PK4A 3N5LA 2N1GA 3ZMUB 3KINB 3SS1A 4CI3B 1G73A 5HXCA 3RYCE 1ZKEA 2LOPA 2NW7A 2WWUA 4GK0E 4I4TE 4DVDA 3MJXA 2CXDA 3RRWA 2V7LA 1UX4A 3DJBA 3EDVA 4NUVA 5HYAA 4QWNB 3WAKA 3PUQA 3VU7H 5HXRA 5J1GA 4H9RC 2JJ9A 2Y48B 3OKQA 3T8OA 2DCFA 2Q9QC 4XZCA 4MBQA 3GN5A 2X66A 4QKNA 1BR1A 3ZN1B 2VK9A 2V7KA 2NP9A 2W61A 3HI2A 5DABA 5HXSA 5HWXA 3PU8A 2OA5A 4P09A 5LP6E 1T98A 2X0LB 1EZ3A 4BJNA 3ZMTB 2W00A 3OJAA 3ZMSB 1MNEA 3C64A 3KVAA 1S94A 2Y8DA 4PNIA 4QHOA 2A3DA 3C4XA 5H6RB 1US7B 4G2AA 1MIWA 3PUSA 3N2GE 2XAGB 1HTJF 4YFSA 4H9PC 2X67A 5ADXL 3RKOA 4AKLA 5FXVA 2WMNA 2XASB 3SWHA 3Q9DA 2IC9A 4F6RC 5JQGE 5LGNB 4L0RA 2K24A 1MIYA 2YK0A 2VB6A 1KK7A 2JMKA 2L9QA 3NBXX 5LBMA 2VL8A 3SOLA 2BVLA 3FBLA 2XUEA 2N9DA 1YD8G 4UEMA 2ZLYA 2P9BA 4EIWA 4IE7A 5JR9A 4J2CA 4IIJE 3ETUA 5FXXA 3ZYKA 3OYXA 3RH3A 2D0UA 2WBLA 3EVYA 5KX5E 2E9XC 5A1LA 2KWIB 3L3PA 2XQYA 1FMVA 3GN5B 1H7CA 2VKDA 2W62A 5GONE 4H9OC 2YU2A 2HPLA 1IJ6A 5JDLA 3ZCJA 3NRXA 4ANJA 1MNDA 4HGAA 5IYZE 1B7TA 1VRBA 4OFZA 2YINA 5L3GB 2LSGA 3UUNA 4DMWA 1MMGA 2CXLA 4MHCA 3ZLIA 1V9DA 4TN7B 3B57A 4ZOLE 1WYBA 2CWYA 4I55E 3JC6D 1MMAA 4CZZB 3EUHA 4DMVA 2HH7A 2LSIA 3PURA 2E8IA 5JDQA 4H9SE 2VWAA 3CX7B 5JDHA 4G63A 2G0UA 4PJJA 1LVFA 3AA1B 4OK0A 2XAQB 3HKBE 5KDMC 3ZCIA 3DTOA 5CA0E 5LOVE 3CX8B 1D1CA 2ZM0A 3CWZB 5JVDE 2J1DG 5JR9B 2MBGA 1MMNA 3KDSE 3E22E 2DI4A 3NRYA 1ZEEA 4JLEA 1U4QA 3ZMVB 3MACA 3ZEFB 2LM9A 2H7VC 1IAPA 2DWKA 3GMIA 4TUYE 5J2UE 1ZHCA 3CQGB 2CLYC 3S4UA 4AKIA 1OXZA 3EDUA 3AAEB 2KWHA 4DBQA 3ZJ1A 3VHLA 5AFUL 1Y64B 2Y6XA 3AVRA 1D1AA 4AKRB 3PU3A 4YJ2E 3P7IA 2PFVA 3LBXA 4O4LE 5L3BB 4ZI2C 3DP7A 1Z0PA 5L3EB 1IJ5A 1UX5A 4OHFA 2DNXA 3IBPA 1HCIA 4AKGA 5HXEA 3K3QC 3RC3A 3RRCA 1NAFA 5IHYA 2DHRA 5FY7A 2LSYA 1D0YA 2YU1A 4GK5E 2VKHA 4IE6A 4ISTA 4MFRA 2C5KT 4CI2B 4H9NC 2VKOA 4UVBB 1BR2A 2LHRA 3MA9A 4IGUA 2NTXA 4X1YE 5LNKA 3KVBA 5DQVA 4HE8A 4O4IE 4N78D 4U74A 5KMGP 4BA9A 2CCQA 3CPZA 4H9QC 2UXNB 4QX7B 1WR6A 2XAFB 3N9QA 3Q5WA 4U72A 5L3DB 4DBRA 2K9AA 4UVAB 3BQKA 3NZQA 4EB6E 3H37A 4ERRA 3LG7A 3UT5E 1KNZA 2D5UA 1AJ3A 2KT9A 3IHRA 2MOZA 4PJMA 4AKHA 3LBXB 5E0OA 4C91A 3HKEE 4WW0A 4X1IE 4KBMB 2IAKA 3KBTA 4PK6A 2GK9A 3Q5XA 5LBQB 1HFAA 3ANWA 1HF8A 4PFOA 3V5SA 2Z6EA 3RX6A 3FXEB 4ILUA 4WBNE 4Z8XA 2X9HA 5LGUB 1D1BA 3AA7B 3I9YA 1HG5A 4OYKA 5HWYA 2BDEA 4AI6A 4KMCA 2ZM2A 5JDGA 3UULA 2KNDA 4HKAA 4GOUA 3UUXB 2L8KA 4AQFA 4ZHQE 3N9LA 3ZC1A 3GWHA 2MYSA 3N9OA 3ZN0B 5HXHA 3C51A 4DO0A 4YJ3E 4ZS3A 4P0BA 2KZ7B 4IDZA 3BK9A 4O8SA 2LSKA 5JDMA 4HN9A 4O2BE 5JDNA 4CQIA 4YLHA 3GA8A 4BJMA 4PW8A 4YHJA 3UFEA 4HEAA 4GYSA 2PBIA 3KV5A 2CMRA 4PAGA 3ETVA 1WYCA 4K0UA 3ANWB 3O9XA 3L09A 1HG2A 3FXDB 3O1IA 4V1Av 1FMWA 5L2LA 3HR0A 1SA0E 4E7SA 2JMHA 2LOSA 1LKXA 3IF8B 3LK2B 3ZPOA 2X9XA 1FIOA 1E1HB 2JRKA 1S35A 2CWOA 4EYUA 2NOXA 2V7JA 4XAXB 3CVRA 3M65A 2DWGA 4H63V 3Q2MA 1VOMA 2X9WA 4ZI3D 3CQCB 2EHOD 2ODUA 3C4WA 4KP3C 2NTYA 3HA4A 3N9MA 5JREA 2C0SA 4OYJA 3RYFE 4UELA 4X1KE 3BQIA 4QX8B 3MZKB 2EHOA 2VKJA 1SHZC 2WSSV 4CXWA 2C5IT 2NWBA 4CXYA 4PK5A 5FY0A 4ZI7E 3KV6A 3JC6C 4HFVA 4I43B 2A72A 5LA6E 2LJLA 4UV8B 3CQXC 2D2SA 2X51A 5DJQC 3B13A 3I1AA 3O1JA 2Q9QD 5LG4A 2V26A 3K8PC 3HL6A 1LRZA 4UIGA 2ES0A 5EK2A 3BQLA 2LE8A 4QXBB 2MTQA 1G8XA 3RPUA 3MK7C 2K48A 2CE7A 2JQQA 2Q9QA 4L5GA 3N2KE 5H6QB 5LHGB 4IE0A 2NW9A 3N9NA 4C90A 4JEUB 2CXFA 3LK42 3PE0A 3U3IA 3SRZA 3C98B 2VASA 3OBVE 2K5BB 2CLYB 4IE5A 3FHNA 3KFWX 3VKHA 2RA1A 5FXZA 5FP3A 2PG8A 4FJOA 4ZS2A 1YW0A 2SPCA 1ZV4X 3ZMZB 4E7ZA 4L9IA 3PDYA 2EHOB 4TV9E 1QSDA 3IEEA 2JPFA 3TKLB 4AQGA 2XAHB 4M1PA 5LJMA 4XBFB 2KXPB 3O4XE 5CB4E 3KV9A 3AA0B 2PJQA 3FBZA 2ZM8A 3QC9A 5JH7E 2QGSA 2A2FX 2E9XD 3UUMA 1NWMX 5LHIB 4UV9B 4CXXA 2LHNA 3AAIA 2YEVC 3PUAA 5F8PA 3V5UA 3K3NA 3LFMA 5EK4A 3F2EA 4FI5A 4HTEA 4ADZA 4TX5A 1WLXA 4GYRA 4UF0A 3KV4A 2CA5A 2E9XA 1D0ZA 2Q9QB 5C8YE 5M4YA 1BR0A 4NUUA 3C4ZA 5F3JA 5CA1E 5LCYA 1YKEB 1FEWA 2V1DB 2V7MA 4MALA 1CUNA 5LHHB 4X20E 2ACXA 5EK3A 2KMFA 1U5PA 4WBOA 3MKDA 4PJNA 2V7IA 3D0TA 2CM0A 3K3OA 3CKDA 3KBUA 3ONXA 2C5JA 2QA7A 5EZYE 3I0QA 2XHEB 4IE4A 3J9X1 4EXTA 2X68A 5TAOA 4P0AA 3HKCE 3AAAB 2BVMA 2L3LA 3VKGA 2RP4A 4A56A 2D0TA 2HPJA 3I9WA 5L3FB 2W0GA 5JRCA 3F57A 1O3XA 3N2OA 4UVCB 5HAXA 2LSJA 4O2AE 3ZYLA 5JR9C 4I50E 2ODVA 3UTKA 3NZPA 4EOZB 3FB2A 4AQFC 1YKHB 1D0XA 3PTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRK A;  2LM9 A;  2JMH A; 
#chains in the Genus database with same CATH topology
 2CEA A;  3PUX F;  4UF0 B;  4EZH A;  4MLK A;  3P4W A;  3RQU A;  1UCU A;  4ZI2 D;  5DQW A;  4IDQ A;  4GKK T;  3CX6 B;  4YTM A;  1HS7 A;  3CML A;  4A97 A;  4TV8 E;  4AXP A;  1QUU A;  2IW5 B;  2BG9 B;  4AIS A;  1R8I A;  2NW8 A;  4HFC A;  2UXX B;  2J62 A;  4YSY A;  2B1E A;  4DND A;  2M67 A;  2X0H A;  2DL1 A;  3Q5E A;  4EZ4 A;  2CBJ A;  4O4H E;  4IDP A;  2H3R A;  1MMD A;  3PUG A;  3ZT5 A;  3UQ4 A;  4BAY B;  3PUW F;  3P50 A;  3C50 A;  3A5X A;  1OED E;  4KUM B;  2EHO C;  3H3M A;  1MIV A;  1X79 A;  2BZB A;  4GIW A;  3SS1 A;  5HXC A;  3RYC E;  1ZKE A;  1UX4 A;  1YQ3 A;  5HXR A;  4Z91 A;  2H88 A;  2Q9Q C;  4XZC A;  4MBQ A;  3HI2 A;  3AE6 A;  5HWX A;  2OA5 A;  4P09 A;  5LP6 E;  3FZM B;  2X0L B;  1EZ3 A;  3RIF A;  2WDR A;  3ZMT B;  5CGM A;  4BJN A;  1S94 A;  2Y8D A;  3PJA J;  2WWV A;  1MIW A;  1OED A;  2NR4 A;  2XAS B;  3L39 A;  1IBM T;  3NVO A;  5HEO A;  2YK0 A;  2VB6 A;  1KK7 A;  4KHZ F;  2XUE A;  1YD8 G;  4UEM A;  5F5W A;  1L0V A;  3ETU A;  3ZST A;  2D0U A;  4X64 T;  2E9X C;  1ZOY A;  4HWF A;  2KWI B;  3L3P A;  1FMV A;  4YXD A;  3QOF A;  3ZCJ A;  4HGA A;  5IYZ E;  2VL0 A;  3PJA A;  2LSG A;  2XY8 B;  4TNV A;  3B57 A;  3JC6 D;  1MMA A;  2BS3 A;  4K0K T;  2HH7 A;  2LSI A;  5JDQ A;  5AQS B;  2G0U A;  3RIA A;  3AA1 B;  4I0U A;  3HKB E;  5KDM C;  3ZCI A;  3A7M A;  3CX8 B;  3RGL A;  2ZM0 A;  2J1D G;  1MMN A;  3KDS E;  3AXJ B;  4UR9 A;  2QRX A;  1U4Q A;  3ZMV B;  4TUY E;  5J2U E;  3GMI A;  4DR5 T;  1OXZ A;  3ZKR A;  4DBQ A;  3ZJ1 A;  3VHL A;  5AFU L;  2Y6X A;  4AKR B;  4YJ2 E;  4TWD A;  4F8H A;  1NAF A;  2DHR A;  3ZT6 A;  5FY7 A;  1N33 T;  2C5K T;  4X1Y E;  4LML A;  4X65 T;  4BA9 A;  2CCQ A;  1WR6 A;  4U72 A;  1FJG T;  4DBR A;  3NZQ A;  4ILC A;  3LG7 A;  4IL9 A;  3LBX B;  4C91 A;  3PUV F;  5AQV B;  4U31 A;  2GK9 A;  5LBQ B;  3V5S A;  4WBN E;  2Z6E A;  3RX6 A;  2UXD T;  5HEJ A;  4LMJ A;  4DV2 T;  2XM1 A;  4NIQ A;  2BDE A;  4AI6 A;  2ZM2 A;  5JDG A;  2BBH A;  1N36 T;  4ZHQ E;  3GWH A;  3N9O A;  5HXH A;  5J0Z A;  3AEE A;  4YSX A;  5JDM A;  4O2B E;  3UFE A;  2H89 A;  1I6Z A;  3ZSS A;  1WYC A;  2KSR A;  3ANW B;  3O9X A;  1IBK T;  1HG2 A;  2J4G A;  4YTN A;  3HR0 A;  1W9R A;  5AQK B;  4E7S A;  3IF8 B;  3AEG A;  3ZPO A;  2X9X A;  3EAM A;  2CWO A;  2K3W A;  2V7J A;  3CVR A;  4DV6 T;  4H63 V;  3UQ7 A;  3C4W A;  2NTY A;  2C0S A;  3X1D A;  4COF A;  1SHZ C;  2WSS V;  2XSB A;  4HFV A;  4I43 B;  4UV8 B;  2OLT A;  3B13 A;  3O1J A;  5ABF B;  5LG4 A;  2VQF T;  3HL6 A;  2BS4 A;  4U7Y A;  2K48 A;  2V8S V;  3SRZ A;  2K5B B;  2CLY B;  4IE5 A;  5FXZ A;  5FP3 A;  3TLV A;  1M7K A;  2BS2 A;  2LKG A;  3TKL B;  2XAH B;  4XBF B;  3KV9 A;  2PJQ A;  3FBZ A;  2LLY A;  3PUA A;  3LFM A;  2W4X A;  2XQ7 A;  5AQN B;  1D0Z A;  2CBI A;  5F3J A;  3QB5 K;  1YKE B;  2V7M A;  2V5C A;  4MAL A;  4DUZ T;  2KMF A;  4WBO A;  5LB7 B;  3D0T A;  4YTP A;  3KBU A;  3AEB A;  3A8Y C;  2QA7 A;  4U2Y A;  2XHE B;  2BKP A;  4A56 A;  2D0T A;  3I9W A;  2D9D A;  2W0G A;  5JRC A;  4HWH A;  2FUP A;  5HAX A;  2LSJ A;  3ZYL A;  4X62 T;  2I6H A;  4EOZ B;  4ERR A;  1D0X A;  4WNK A;  2XAJ B;  1HX8 A;  2DLR A;  4CN6 A;  5AQQ B;  3OYZ A;  2XPK A;  2ZMA A;  5FY1 A;  2W63 A;  3LJC A;  3ONJ A;  3P8C D;  3R84 B;  1HNX T;  5LXT E;  3FZH B;  4QXH B;  3N9P A;  3H3A A;  4EED A;  4PJL A;  2VQE T;  3ZYM A;  3HKD E;  3QUJ A;  2WY2 A;  2X9Y A;  2LT3 A;  5FMN A;  2IC6 A;  5JDF A;  2W66 A;  1WR0 A;  2WM9 A;  4YT0 A;  3AB3 B;  2X0Y A;  4EYY R;  4ZI3 C;  4ISS A;  2H7O A;  4H63 H;  2WU5 A;  3KIN B;  1G73 A;  2HN1 A;  2WWU A;  4GK0 E;  3MJX A;  2CXD A;  5HYA A;  4QWN B;  2JJ9 A;  2F4V T;  3AED A;  3T8O A;  4HWD A;  3GN5 A;  3CK6 A;  2V6Y A;  2VK9 A;  2WB5 A;  5HXS A;  3PU8 A;  4KX6 A;  3VR8 A;  2LM2 A;  3OJA A;  3ZMS B;  3C64 A;  4LF4 T;  4QHO A;  2A3D A;  3C4X A;  4G2A A;  2FBW A;  3N2G E;  4ZZB A;  4H9P C;  3SWH A;  2IC9 A;  4F6R C;  4L0R A;  2JMK A;  3TLS A;  2VL8 A;  3AE1 A;  3FBL A;  2P9B A;  3CIR A;  2YDR A;  4IE7 A;  5FXX A;  3OYX A;  3RH3 A;  2XQY A;  2VKD A;  4H9O C;  2HPL A;  4DV7 T;  4Z90 A;  2CRB A;  4ZXL A;  5IWA T;  3UUN A;  2BG9 C;  1MMG A;  2FJB A;  3ZLI A;  4TN7 B;  1WYB A;  4CZZ B;  2E8I A;  2VWA A;  5JDH A;  4JI0 T;  4IT4 A;  1IBL T;  2A9U A;  3JAF A;  4LF6 T;  1D1C A;  4DR2 T;  3G06 A;  2DI4 A;  3NRY A;  3OPC A;  1IAP A;  2DWK A;  3CQG B;  3LDQ B;  1Y64 B;  1D1A A;  2BKO A;  4IDO A;  4ZI2 C;  3NWI A;  2IDO B;  2VUR A;  3JCF A;  2VVN A;  1IJ5 A;  1UX5 A;  2WCA A;  2DNX A;  1KF6 A;  1GQE A;  1T7S A;  3RC3 A;  5IHY A;  4B3S T;  5FL0 A;  2JQK A;  5AQL B;  1D0Y A;  4U3C A;  4GK5 E;  4NXM T;  4IST A;  4MFR A;  2VKO A;  2LHR A;  4JI8 T;  5DQV A;  5KMG P;  3CPZ A;  5AQO B;  2BG9 E;  2UXN B;  2XAF B;  5FVL A;  3Q5W A;  4UVA B;  3JAD A;  4EB6 E;  3H37 A;  1KNZ A;  4IDN A;  2D5U A;  2KT9 A;  4PJM A;  3VR9 A;  2E5V A;  4P1N A;  4WW0 A;  1HNW T;  4KBM B;  2IAK A;  4DV3 T;  3KBT A;  1UK5 A;  1HFA A;  4PFO A;  1HF8 A;  2J47 A;  5LGU B;  1D1B A;  3AA7 B;  5HWY A;  2WDV A;  3AE4 A;  3PV0 F;  4KMC A;  4HKA A;  4GOU A;  4HFH A;  4AQF A;  3ZC1 A;  1VCS A;  2YOE A;  3RF1 A;  3ZN0 B;  4ZEY A;  4DO0 A;  3BK9 A;  1XDO A;  4CQI A;  4CN1 A;  4BJM A;  4GYS A;  2PBI A;  2IIU A;  5AQU B;  1JNR A;  4U7I A;  1E1H B;  2FJD A;  4JI4 T;  1W09 A;  4XAX B;  3Q2M A;  2X9W A;  2WQY A;  3CQC B;  3PUY F;  3HA4 A;  4OYJ A;  4UEL A;  3BQI A;  3OTO T;  3AEA A;  4QX8 B;  3MZK B;  2EHO A;  3B5M A;  3RQW A;  2C5I T;  2NWB A;  4CN4 A;  5FY0 A;  3KV6 A;  3JC6 C;  4ZZC A;  2LJL A;  2X51 A;  4DV5 T;  3K8P C;  5HEH A;  1LRZ A;  2ES0 A;  2PTF A;  2MTQ A;  1G8X A;  3RPU A;  2UXB T;  1UUS A;  2Q9Q A;  4L5G A;  5LHG B;  2NW9 A;  4JEU B;  3PE0 A;  3U3I A;  4A5X A;  4QH5 A;  2VAS A;  3KFW X;  5FKY A;  3RI5 A;  4JI3 T;  2PG8 A;  4ZS2 A;  2JQ9 A;  2SPC A;  4E7Z A;  4AQY T;  5HEU A;  4TV9 E;  1QSD A;  5CJ5 A;  4M1P A;  5LJM A;  2KXP B;  5CB4 E;  2A2F X;  3VRA A;  2LHN A;  3K3N A;  5EK4 A;  4HTE A;  4TX5 A;  3KV4 A;  2E9X A;  4WYV A;  1BR0 A;  3T1Y T;  1NEN A;  1FEW A;  2V1D B;  2JIW A;  2ACX A;  2W2U A;  1U5P A;  3MKD A;  2CM0 A;  4OX9 T;  3RLF F;  5TAO A;  2RP4 A;  5AQR B;  4LFA T;  5L3F B;  1Y01 A;  1O3X A;  2UUC T;  5JR9 C;  4DV1 T;  5ABE A;  3UTK A;  3NZP A;  3UUB A;  3F31 A;  4AIU A;  2BBJ A;  4JI2 T;  2V6X A;  4EAH A;  3FZK B;  4CI1 B;  5LJN A;  4TWF A;  3AVS A;  3J7Y q;  1BR4 A;  5LYJ E;  3EI0 A;  4KHP T;  2WAU A;  2KLQ A;  3U78 A;  3ZJ2 A;  1HNZ T;  3I0O A;  4QXC B;  4ASK A;  3O1H A;  4B6X A;  5JRC B;  3E08 A;  4IHJ E;  3W15 B;  1HR0 T;  3WAJ A;  1Z8U A;  4LMK A;  5FXW A;  4DR4 T;  2I59 A;  5L4E A;  3RYI E;  5HEG A;  2XQ4 A;  3AA6 B;  1OWA A;  1IZN B;  2XTL A;  3RIU C;  4JUY A;  4DUY T;  2N1G A;  4CI3 B;  4I4T E;  2LOP A;  2V7L A;  3DJB A;  4NUV A;  3WAK A;  3PUQ A;  3VU7 H;  4H9R C;  3OKQ A;  2M6I A;  2X66 A;  2V7K A;  2NP9 A;  1T98 A;  3KVA A;  4QH4 A;  3AEC A;  1US7 B;  3AE3 A;  3JAE A;  5L47 A;  4KI0 F;  3EAB A;  1YQ4 A;  2XAG B;  2XQ3 A;  4YFS A;  2X67 A;  3RKO A;  5FXV A;  2FJE A;  3Q9D A;  5LGN B;  2K24 A;  2R6G F;  3OVU A;  2L9Q A;  3NBX X;  5LBM A;  3ONL C;  2BVL A;  2N9D A;  4EIW A;  5FL1 A;  5JR9 A;  4IIJ E;  4JI7 T;  1J5W A;  2WBL A;  3EVY A;  5KX5 E;  5A1L A;  3GN5 B;  2V6Y B;  1IJ6 A;  4JV5 T;  4ANJ A;  1MND A;  2YIN A;  5L3G B;  4DMW A;  1V9D A;  4WZX A;  4ZOL E;  2CWY A;  4I55 E;  4U33 A;  3PUR A;  4ILA A;  2UU9 T;  4PJJ A;  3RHW A;  4OK0 A;  2XAQ B;  3DTO A;  5CA0 E;  3CWZ B;  3FZL B;  3UU5 A;  2MBG A;  3E22 E;  1J1J A;  1XMO T;  3MAC A;  1KFY A;  2H7V C;  1ZHC A;  3PUZ F;  4AKI A;  4DR3 T;  3PU3 A;  3P7I A;  3QB5 A;  5L3B B;  3DP7 A;  3IA3 A;  5AQJ B;  3IBP A;  2CHO A;  3K3Q C;  2VKH A;  4IE6 A;  4HWC A;  4UVB B;  5LNK A;  4JI5 T;  4HFB A;  1VCT A;  4H9Q C;  4QX7 B;  4NPP A;  3N9Q A;  5L3D B;  2K9A A;  5L4H A;  3UT5 E;  3VRB A;  2MOZ A;  4AKH A;  5E0O A;  2YN6 A;  4HFI A;  3Q5X A;  4B3R T;  3FXE B;  4Z8X A;  2X9H A;  2ACZ A;  5AQF B;  1HG5 A;  4OYK A;  5AQG B;  2CPT A;  3UUL A;  3UUX B;  4IRE A;  5LG3 A;  3N9L A;  5LMU T;  3C51 A;  4YJ3 E;  4ZS3 A;  3UU4 A;  3TLU A;  2LSK A;  5BR8 T;  2AXD S;  4YLH A;  3GA8 A;  4PW8 A;  4JI6 T;  3T1H T;  4HEA A;  3KV5 A;  1JNZ A;  2CMR A;  2HN2 A;  3FXD B;  5L2L A;  2UUB T;  1OED B;  1SA0 E;  2JMH A;  2LOS A;  1LKX A;  4Q25 A;  3ABV A;  2JRK A;  1S35 A;  4EYU A;  2NOX A;  3M65 A;  1KNP A;  3AEF A;  2I0M A;  2EHO D;  5C3J A;  3K1S A;  4IL4 A;  3Q5D A;  4QH1 A;  4X1K E;  2VKJ A;  2IHR 1;  4CXW A;  4LF9 T;  4CXY A;  4ZI7 E;  2JQH A;  5LA6 E;  3AE2 A;  2QVA A;  2ZM6 T;  3CQX C;  2D2S A;  5DJQ C;  3I1A A;  2Q9Q D;  4U2Z A;  4UIG A;  3EHZ A;  1T8B A;  5EK2 A;  3MK7 C;  4C90 A;  2CXF A;  3LK4 2;  5C2T A;  3OBV E;  1SE7 A;  3VKH A;  1XWM A;  5HCJ A;  4FJO A;  1YW0 A;  1X9B A;  4L9I A;  2EHO B;  4DR6 T;  2JPF A;  3O4X E;  3AA0 B;  1QLB A;  2ZM8 A;  2QGS A;  3QNU A;  3UUM A;  2E9X D;  1CHU A;  4UV9 B;  3AAI A;  2YEV C;  3F2E A;  4LF8 T;  1KNR A;  1SUM B;  1WLX A;  4GYR A;  4UF0 A;  2Q9Q B;  5C8Y E;  4EGW A;  3C4Z A;  5CA1 E;  2BG9 A;  3ONX A;  3P4Q A;  3J9X 1;  4EXT A;  2BVM A;  5IUX A;  5AQM B;  3F57 A;  5ABG A;  4UVC B;  4O2A E;  3TLT A;  2ODV A;  2WDQ A;  1YKH B;  3PTR B;  4PFP A;  2MAW A;  3QK6 A;  3TLW A;  2E9X B;  2N2N A;  5JTG A;  4TZ4 C;  1LVK A;  5ETW A;  1WRD A;  3AE7 A;  5LGT B;  4LF7 T;  4JEH B;  3RC8 A;  4HFD A;  5FYM A;  3R6N A;  3RYH E;  5FNV E;  4UXN B;  1YXR A;  3LK3 B;  2KIN B;  2WZH A;  5J2T E;  3ZC0 A;  3SFE A;  2LEH A;  2UXC T;  5L3C B;  2BKN A;  5AQH B;  4YSZ A;  3UU8 A;  3LSV A;  4DV0 T;  2UUA T;  3E0Z A;  2WMO A;  3UU6 A;  3WI3 A;  3MXZ A;  5BMV E;  4O4J E;  2XQ8 A;  3ESL A;  4PK4 A;  3N5L A;  3SFD A;  3ZMU B;  1W0A A;  2NW7 A;  4DVD A;  3RRW A;  3EDV A;  5J1G A;  2Y48 B;  2DCF A;  5LMN T;  4QKN A;  1BR1 A;  3ZN1 B;  3RKG A;  5DAB A;  2W61 A;  1DU2 A;  2W00 A;  1MNE A;  4PNI A;  3P4P A;  1E2A A;  5H6R B;  1HX1 B;  3PUS A;  5AQP B;  1HTJ F;  3UFG A;  5ADX L;  4AKL A;  2WMN A;  5JQG E;  1MIY A;  3NKZ A;  2XM2 A;  3SOL A;  2LKH A;  1M62 A;  2ZLY A;  2IML A;  4J2C A;  3ZT7 A;  3AXJ A;  3ZYK A;  2W67 A;  1UGO A;  1H7C A;  2W62 A;  5GON E;  2YU2 A;  3P4S A;  5JDL A;  3NRX A;  3FZF B;  4DID B;  1B7T A;  1VRB A;  4OFZ A;  4LFB T;  4EEB A;  2CXL A;  4MHC A;  1UUR A;  3EUH A;  4DMV A;  4H9S E;  3CX7 B;  4G63 A;  1LVF A;  4YY3 T;  1XMQ T;  4X5T A;  2E5L T;  2WP9 A;  5LOV E;  2LRL A;  5JVD E;  5JR9 B;  1XNR T;  4HFE A;  4HWI B;  1ZEE A;  4JLE A;  3ZEF B;  2LM9 A;  2CLY C;  3S4U A;  3EDU A;  3AAE B;  4ILB A;  2KWH A;  5FVK A;  3AVR A;  5CFB A;  2PFV A;  3LBX A;  4O4L E;  1Z0P A;  5L3E B;  4OHF A;  1HCI A;  4AKG A;  5HXE A;  2RPA A;  3RRC A;  4TWH A;  1J5E T;  2LSY A;  2YU1 A;  4A98 A;  2CHN A;  4CI2 B;  4H9N C;  1BR2 A;  3MA9 A;  4IGU A;  2NTX A;  3KVB A;  4HE8 A;  4O4I E;  4B3T T;  4N78 D;  4U74 A;  2WZI A;  3BQK A;  2XQA A;  1AJ3 A;  1I94 T;  3IHR A;  4JBW F;  3M3Z B;  3HKE E;  2WU2 A;  4X1I E;  4JI1 T;  4PK6 A;  2E2A A;  3ANW A;  4ILU A;  3I9Y A;  2M6B A;  2KND A;  2L8K A;  2MYS A;  2LRK A;  4P0B A;  2KZ7 B;  4IDZ A;  4O8S A;  4HN9 A;  5JDN A;  5ABH A;  4YHJ A;  4X66 T;  3AE9 A;  4PAG A;  3ETV A;  5ABF A;  2MPK A;  4K0U A;  4TNW A;  3L09 A;  3O1I A;  4V1A v;  1FMW A;  2AE9 A;  4LF5 T;  3LK2 B;  1FIO A;  3UU3 A;  2IUB A;  2YDS A;  2DWG A;  1VOM A;  4ZI3 D;  1ZP0 A;  2ODU A;  4KP3 C;  2YDQ A;  2XJ7 A;  3N9M A;  5JRE A;  4DR7 T;  2FJA A;  3RYF E;  1WFD A;  2OV9 A;  3RIU A;  4PK5 A;  5AQI B;  2A72 A;  1XZY A;  1E7P A;  2V26 A;  2B76 A;  3BQL A;  2LE8 A;  4QXB B;  4DV4 T;  4EV6 A;  2CE7 A;  1N34 T;  2JQQ A;  3N2K E;  5H6Q B;  4IE0 A;  3N9N A;  1WCR A;  4LFC T;  3C98 B;  2YKS A;  1NEK A;  3FHN A;  2V5D A;  2RA1 A;  2XQ6 A;  1ZV4 X;  3ZMZ B;  2WS3 A;  3PDY A;  1N32 T;  1XNQ T;  3IEE A;  4AQG A;  4DR1 T;  3QC9 A;  1W0B A;  3AE8 A;  5JH7 E;  5LHI B;  1NWM X;  4CXX A;  5F8P A;  3V5U A;  4FI5 A;  1T72 A;  4ADZ A;  2XSA A;  2CA5 A;  5M4Y A;  4NUU A;  5LCY A;  4GKJ T;  1KEY A;  1CUN A;  3P4R A;  4NXN T;  5LHH B;  4X20 E;  5HCM A;  2XZE A;  5EK3 A;  4PJN A;  2V7I A;  3K3O A;  3CKD A;  2C5J A;  5EZY E;  3I0Q A;  2XQ9 A;  4IE4 A;  2HHH T;  3L8R A;  2X68 A;  1OED C;  4P0A A;  3HKC E;  3AAA B;  2L3L A;  1XDP A;  5KXJ A;  3VKG A;  2XQ5 A;  3AE5 A;  2HPJ A;  4YHH T;  4JYA T;  2QYW A;  5AQT B;  3N2O A;  2VVS A;  4B3M T;  4I50 E;  3FB2 A;  4AQF C; 
#chains in the Genus database with same CATH homology
 2CEA A;  4PFP A;  2XAJ B;  4WNK A;  3QK6 A;  4UF0 B;  4EZH A;  1HX8 A;  4MLK A;  4EAH A;  1UCU A;  2E9X B;  2N2N A;  4CI1 B;  2DLR A;  4ZI2 D;  4TZ4 C;  5DQW A;  5LJN A;  3CX6 B;  1LVK A;  5ETW A;  1HS7 A;  3AVS A;  1WRD A;  3CML A;  3J7Y q;  1BR4 A;  4TV8 E;  3OYZ A;  5LGT B;  4AXP A;  5LYJ E;  2WAU A;  1QUU A;  2KLQ A;  2ZMA A;  4JEH B;  3U78 A;  2IW5 B;  5FY1 A;  3RC8 A;  2W63 A;  5FYM A;  3R6N A;  3ZJ2 A;  3F31 A;  3RYH E;  3LJC A;  5FNV E;  3P8C D;  3I0O A;  4QXC B;  4ASK A;  3R84 B;  3O1H A;  3LK3 B;  4UXN B;  2NW8 A;  5LXT E;  4QXH B;  2KIN B;  2UXX B;  4B6X A;  3N9P A;  3H3A A;  5J2T E;  5JRC B;  3E08 A;  4IHJ E;  3ZC0 A;  2B1E A;  4PJL A;  3W15 B;  4DND A;  2M67 A;  2LEH A;  3WAJ A;  5L3C B;  3ZYM A;  3HKD E;  4EZ4 A;  5FXW A;  3QUJ A;  2X9Y A;  2LT3 A;  5FMN A;  2I59 A;  2IC6 A;  4O4H E;  5JDF A;  3RYI E;  2H3R A;  1MMD A;  3PUG A;  2WM9 A;  3E0Z A;  3AA6 B;  3AB3 B;  4BAY B;  2WMO A;  4EYY R;  3WI3 A;  4ZI3 C;  3C50 A;  3A5X A;  1OWA A;  4KUM B;  2EHO C;  1IZN B;  2H7O A;  2XTL A;  4ISS A;  4H63 H;  1MIV A;  3MXZ A;  1X79 A;  5BMV E;  2BZB A;  4O4J E;  4JUY A;  4GIW A;  3ESL A;  4PK4 A;  3N5L A;  2N1G A;  3ZMU B;  3KIN B;  3SS1 A;  4CI3 B;  1G73 A;  5HXC A;  3RYC E;  1ZKE A;  2LOP A;  2NW7 A;  2WWU A;  4GK0 E;  4I4T E;  4DVD A;  3MJX A;  2CXD A;  3RRW A;  2V7L A;  1UX4 A;  3DJB A;  3EDV A;  4NUV A;  5HYA A;  4QWN B;  3WAK A;  3PUQ A;  3VU7 H;  5HXR A;  5J1G A;  4H9R C;  2JJ9 A;  2Y48 B;  3OKQ A;  3T8O A;  2DCF A;  2Q9Q C;  4XZC A;  4MBQ A;  3GN5 A;  2X66 A;  4QKN A;  1BR1 A;  3ZN1 B;  2VK9 A;  2V7K A;  2NP9 A;  2W61 A;  3HI2 A;  5DAB A;  5HXS A;  5HWX A;  3PU8 A;  2OA5 A;  4P09 A;  5LP6 E;  1T98 A;  2X0L B;  1EZ3 A;  4BJN A;  3ZMT B;  2W00 A;  3OJA A;  3ZMS B;  1MNE A;  3C64 A;  3KVA A;  1S94 A;  2Y8D A;  4PNI A;  4QHO A;  2A3D A;  3C4X A;  5H6R B;  1US7 B;  4G2A A;  1MIW A;  3PUS A;  3N2G E;  2XAG B;  1HTJ F;  4YFS A;  4H9P C;  2X67 A;  5ADX L;  3RKO A;  4AKL A;  5FXV A;  2WMN A;  2XAS B;  3SWH A;  3Q9D A;  2IC9 A;  4F6R C;  5JQG E;  5LGN B;  4L0R A;  2K24 A;  1MIY A;  2YK0 A;  2VB6 A;  1KK7 A;  2JMK A;  2L9Q A;  3NBX X;  5LBM A;  2VL8 A;  3SOL A;  2BVL A;  3FBL A;  2XUE A;  2N9D A;  1YD8 G;  4UEM A;  2ZLY A;  2P9B A;  4EIW A;  4IE7 A;  5JR9 A;  4J2C A;  4IIJ E;  3ETU A;  5FXX A;  3ZYK A;  3OYX A;  3RH3 A;  2D0U A;  2WBL A;  3EVY A;  5KX5 E;  2E9X C;  5A1L A;  2KWI B;  3L3P A;  2XQY A;  1FMV A;  3GN5 B;  1H7C A;  2VKD A;  2W62 A;  5GON E;  4H9O C;  2YU2 A;  2HPL A;  1IJ6 A;  5JDL A;  3ZCJ A;  3NRX A;  4ANJ A;  1MND A;  4HGA A;  5IYZ E;  1B7T A;  1VRB A;  4OFZ A;  2YIN A;  5L3G B;  2LSG A;  3UUN A;  4DMW A;  1MMG A;  2CXL A;  4MHC A;  3ZLI A;  1V9D A;  4TN7 B;  3B57 A;  4ZOL E;  1WYB A;  2CWY A;  4I55 E;  3JC6 D;  1MMA A;  4CZZ B;  3EUH A;  4DMV A;  2HH7 A;  2LSI A;  3PUR A;  2E8I A;  5JDQ A;  4H9S E;  2VWA A;  3CX7 B;  5JDH A;  4G63 A;  2G0U A;  4PJJ A;  1LVF A;  3AA1 B;  4OK0 A;  2XAQ B;  3HKB E;  5KDM C;  3ZCI A;  3DTO A;  5CA0 E;  5LOV E;  3CX8 B;  1D1C A;  2ZM0 A;  3CWZ B;  5JVD E;  2J1D G;  5JR9 B;  2MBG A;  1MMN A;  3KDS E;  3E22 E;  2DI4 A;  3NRY A;  1ZEE A;  4JLE A;  1U4Q A;  3ZMV B;  3MAC A;  3ZEF B;  2LM9 A;  2H7V C;  1IAP A;  2DWK A;  3GMI A;  4TUY E;  5J2U E;  1ZHC A;  3CQG B;  2CLY C;  3S4U A;  4AKI A;  1OXZ A;  3EDU A;  3AAE B;  2KWH A;  4DBQ A;  3ZJ1 A;  3VHL A;  5AFU L;  1Y64 B;  2Y6X A;  3AVR A;  1D1A A;  4AKR B;  3PU3 A;  4YJ2 E;  3P7I A;  2PFV A;  3LBX A;  4O4L E;  5L3B B;  4ZI2 C;  3DP7 A;  1Z0P A;  5L3E B;  1IJ5 A;  1UX5 A;  4OHF A;  2DNX A;  3IBP A;  1HCI A;  4AKG A;  5HXE A;  3K3Q C;  3RC3 A;  3RRC A;  1NAF A;  5IHY A;  2DHR A;  5FY7 A;  2LSY A;  1D0Y A;  2YU1 A;  4GK5 E;  2VKH A;  4IE6 A;  4IST A;  4MFR A;  2C5K T;  4CI2 B;  4H9N C;  2VKO A;  4UVB B;  1BR2 A;  2LHR A;  3MA9 A;  4IGU A;  2NTX A;  4X1Y E;  5LNK A;  3KVB A;  5DQV A;  4HE8 A;  4O4I E;  4N78 D;  4U74 A;  5KMG P;  4BA9 A;  2CCQ A;  3CPZ A;  4H9Q C;  2UXN B;  4QX7 B;  1WR6 A;  2XAF B;  3N9Q A;  3Q5W A;  4U72 A;  5L3D B;  4DBR A;  2K9A A;  4UVA B;  3BQK A;  3NZQ A;  4EB6 E;  3H37 A;  4ERR A;  3LG7 A;  3UT5 E;  1KNZ A;  2D5U A;  1AJ3 A;  2KT9 A;  3IHR A;  2MOZ A;  4PJM A;  4AKH A;  3LBX B;  5E0O A;  4C91 A;  3HKE E;  4WW0 A;  4X1I E;  4KBM B;  2IAK A;  3KBT A;  4PK6 A;  2GK9 A;  3Q5X A;  5LBQ B;  1HFA A;  3ANW A;  1HF8 A;  4PFO A;  3V5S A;  2Z6E A;  3RX6 A;  3FXE B;  4ILU A;  4WBN E;  4Z8X A;  2X9H A;  5LGU B;  1D1B A;  3AA7 B;  3I9Y A;  1HG5 A;  4OYK A;  5HWY A;  2BDE A;  4AI6 A;  4KMC A;  2ZM2 A;  5JDG A;  3UUL A;  2KND A;  4HKA A;  4GOU A;  3UUX B;  2L8K A;  4AQF A;  4ZHQ E;  3N9L A;  3ZC1 A;  3GWH A;  2MYS A;  3N9O A;  3ZN0 B;  5HXH A;  3C51 A;  4DO0 A;  4YJ3 E;  4ZS3 A;  4P0B A;  2KZ7 B;  4IDZ A;  3BK9 A;  4O8S A;  2LSK A;  5JDM A;  4HN9 A;  4O2B E;  5JDN A;  4CQI A;  4YLH A;  3GA8 A;  4BJM A;  4PW8 A;  4YHJ A;  3UFE A;  4HEA A;  4GYS A;  2PBI A;  3KV5 A;  2CMR A;  4PAG A;  3ETV A;  1WYC A;  4K0U A;  3ANW B;  3O9X A;  3L09 A;  1HG2 A;  3FXD B;  3O1I A;  4V1A v;  1FMW A;  5L2L A;  3HR0 A;  1SA0 E;  4E7S A;  2JMH A;  2LOS A;  1LKX A;  3IF8 B;  3LK2 B;  3ZPO A;  2X9X A;  1FIO A;  1E1H B;  2JRK A;  1S35 A;  2CWO A;  4EYU A;  2NOX A;  2V7J A;  4XAX B;  3CVR A;  3M65 A;  2DWG A;  4H63 V;  3Q2M A;  1VOM A;  2X9W A;  4ZI3 D;  3CQC B;  2EHO D;  2ODU A;  3C4W A;  4KP3 C;  2NTY A;  3HA4 A;  3N9M A;  5JRE A;  2C0S A;  4OYJ A;  3RYF E;  4UEL A;  4X1K E;  3BQI A;  4QX8 B;  3MZK B;  2EHO A;  2VKJ A;  1SHZ C;  2WSS V;  4CXW A;  2C5I T;  2NWB A;  4CXY A;  4PK5 A;  5FY0 A;  4ZI7 E;  3KV6 A;  3JC6 C;  4HFV A;  4I43 B;  2A72 A;  5LA6 E;  2LJL A;  4UV8 B;  3CQX C;  2D2S A;  2X51 A;  5DJQ C;  3B13 A;  3I1A A;  3O1J A;  2Q9Q D;  5LG4 A;  2V26 A;  3K8P C;  3HL6 A;  1LRZ A;  4UIG A;  2ES0 A;  5EK2 A;  3BQL A;  2LE8 A;  4QXB B;  2MTQ A;  1G8X A;  3RPU A;  3MK7 C;  2K48 A;  2CE7 A;  2JQQ A;  2Q9Q A;  4L5G A;  3N2K E;  5H6Q B;  5LHG B;  4IE0 A;  2NW9 A;  3N9N A;  4C90 A;  4JEU B;  2CXF A;  3LK4 2;  3PE0 A;  3U3I A;  3SRZ A;  3C98 B;  2VAS A;  3OBV E;  2K5B B;  2CLY B;  4IE5 A;  3FHN A;  3KFW X;  3VKH A;  2RA1 A;  5FXZ A;  5FP3 A;  2PG8 A;  4FJO A;  4ZS2 A;  1YW0 A;  2SPC A;  1ZV4 X;  3ZMZ B;  4E7Z A;  4L9I A;  3PDY A;  2EHO B;  4TV9 E;  1QSD A;  3IEE A;  2JPF A;  3TKL B;  4AQG A;  2XAH B;  4M1P A;  5LJM A;  4XBF B;  2KXP B;  3O4X E;  5CB4 E;  3KV9 A;  3AA0 B;  2PJQ A;  3FBZ A;  2ZM8 A;  3QC9 A;  5JH7 E;  2QGS A;  2A2F X;  2E9X D;  3UUM A;  1NWM X;  5LHI B;  4UV9 B;  4CXX A;  2LHN A;  3AAI A;  2YEV C;  3PUA A;  5F8P A;  3V5U A;  3K3N A;  3LFM A;  5EK4 A;  3F2E A;  4FI5 A;  4HTE A;  4ADZ A;  4TX5 A;  1WLX A;  4GYR A;  4UF0 A;  3KV4 A;  2CA5 A;  2E9X A;  1D0Z A;  2Q9Q B;  5C8Y E;  5M4Y A;  1BR0 A;  4NUU A;  3C4Z A;  5F3J A;  5CA1 E;  5LCY A;  1YKE B;  1FEW A;  2V1D B;  2V7M A;  4MAL A;  1CUN A;  5LHH B;  4X20 E;  2ACX A;  5EK3 A;  2KMF A;  1U5P A;  4WBO A;  3MKD A;  4PJN A;  2V7I A;  3D0T A;  2CM0 A;  3K3O A;  3CKD A;  3KBU A;  3ONX A;  2C5J A;  2QA7 A;  5EZY E;  3I0Q A;  2XHE B;  4IE4 A;  3J9X 1;  4EXT A;  2X68 A;  5TAO A;  4P0A A;  3HKC E;  3AAA B;  2BVM A;  2L3L A;  3VKG A;  2RP4 A;  4A56 A;  2D0T A;  2HPJ A;  3I9W A;  5L3F B;  2W0G A;  5JRC A;  3F57 A;  1O3X A;  3N2O A;  4UVC B;  5HAX A;  2LSJ A;  4O2A E;  3ZYL A;  5JR9 C;  4I50 E;  2ODV A;  3UTK A;  3NZP A;  4EOZ B;  3FB2 A;  4AQF C;  1YKH B;  1D0X A;  3PTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...