2JMHA

Nmr solution structure of blo t 5, a major mite allergen from blomia tropicalis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
QEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Mite allergen Blo t 5
publication title Roles of Structure and Structural Dynamics in the Antibody Recognition of the Allergen Proteins: An NMR Study on Blomia tropicalis Major Allergen
pubmed doi rcsb
source organism Blomia tropicalis
total genus 40
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.970 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jmhA01
2LM9A 2JMHA 2JRKA
chains in the Genus database with same CATH superfamily
3N5LA 4DR1T 3LSVA 3EUHA 2I0MA 3K3QC 2M6IA 3KBTA 3AAIA 1HG2A 5JR9C 4QXBB 5AQRB 2PBIA 4A5XA 4UVCB 3TLWA 3ZYKA 4IE4A 2X0LB 3BQKA 3L3PA 5TAOA 3KINB 2D0TA 1XWMA 3ANWA 3P50A 1M7KA 1UUSA 2JPFA 2Z6EA 3OBVE 3B5MA 2BS4A 2LEHA 1KFYA 2D9DA 5JDGA 3ZMZB 4YSYA 1T72A 2W2UA 3K3OA 3TLSA 2J1DG 5AQNB 4ZI2D 5CA1E 2DCFA 4P09A 3I9WA 1NWMX 3T8OA 4ADZA 4CN6A 1FJGT 1KK7A 5IHYA 1IJ5A 3BQLA 4L0RA 2FUPA 2WWVA 2HPJA 3KV4A 3ZEFB 3AECA 1I94T 1NEKA 2X9WA 4KHZF 4MBQA 1MMGA 4JI4T 4LMKA 4X62T 2ODVA 5DQVA 3FHNA 2FBWA 5IWAT 3ZT5A 2HH7A 2GK9A 1HX8A 4HKAA 2FJBA 4EEDA 2WAUA 3KV9A 2LM9A 3TLTA 3NKZA 3AEEA 2WZIA 1OXZA 2JMHA 4JI0T 5CGMA 3NVOA 4EB6E 4F6RC 4UV8B 2LE8A 4DNDA 3KDSE 5HYAA 2D2SA 4TWFA 3LDQB 4EZHA 2XASB 3ZN0B 2J4GA 4HFCA 4LMJA 5LXTE 3VU7H 3AE4A 4AI6A 2C5JA 4DO0A 1GQEA 5HEJA 1BR1A 4QXCB 2IC9A 2XQ6A 3IEEA 1OEDA 3RKGA 5LHIB 4NUVA 3UUBA 2X0YA 1VRBA 3LBXA 1YXRA 4OYKA 5FP3A 4LF6T 1X9BA 3GA8A 5AQPB 3N9QA 1W0AA 3KV6A 4EGWA 2IMLA 3TLUA 3M65A 2H89A 3ONJA 4JUYA 4B3ST 2F4VT 2IW5B 3KVAA 1XDPA 1OEDB 1LKXA 2UXBT 2JQQA 4ISTA 4JI6T 3ESLA 4LF4T 1XDOA 4PJNA 3LBXB 5A1LA 4AQFC 2LKGA 3FZFB 3KVBA 3N9NA 4IIJE 5JDFA 3VRAA 5ABEA 4ERRA 4NXNT 4B3TT 3MKDA 3MJXA 2XHEB 3EDVA 1D1CA 1HF8A 4IDZA 2XQ3A 2V7JA 4EOZB 2LRKA 3N2OA 3T1HT 3MZKB 2K5BB 2XM2A 5FNVE 3AVRA 3ETUA 3FZHB 3QB5A 3FXDB 3FB2A 5LB7B 4YSZA 4EZ4A 3C4WA 3UFEA 4A97A 3ZKRA 2VVNA 3CX8B 4DMVA 3JCFA 2IAKA 3IF8B 3OKQA 2JJ9A 4O2BE 4MHCA 3SRZA 3ZJ1A 4IE5A 4ZZCA 3WAKA 5L4EA 2MTQA 3MK7C 3W15B 3RQWA 3VKHA 2ES0A 2KXPB 1ZP0A 2WS3A 3Q5XA 4U72A 2LRLA 5LGTB 4LF8T 4WBNE 4XAXB 3EABA 1US7B 3AA0B 2K24A 1AJ3A 4EV6A 5HXHA 4HFIA 4LMLA 2Y48B 2X67A 3F2EA 4L9IA 1HNWT 2X9XA 4CXWA 4UVBB 3HKEE 2ZM6T 2WMOA 3EVYA 3PJAA 4IDQA 4FI5A 1HR0T 2IC6A 5HEHA 3J9X1 3CQGB 2L9QA 3ZLIA 1YKHB 1UURA 4PK4A 2G0UA 2QA7A 5CFBA 2KINB 4GIWA 4LF5T 5LHGB 5AQJB 3Q9DA 2WQYA 3SWHA 3WI3A 2LJLA 2Q9QD 4EIWA 2UUCT 4K0KT 4U3CA 1VOMA 1JNRA 2HN1A 3F31A 4YTPA 2MBGA 2NW8A 5H6RB 3FBLA 5BMVE 2XQ8A 3PDYA 2UXXB 2W67A 2XY8B 3QB5K 1IBLT 4YFSA 3PU3A 5LMNT 4PW8A 2YINA 3EI0A 5HEGA 2KWHA 4H9OC 3UTKA 3CX6B 1HFAA 4KHPT 4OK0A 2X0HA 3Q2MA 4LF9T 5JR9A 3P4WA 2IUBA 3P7IA 4QH5A 2CHNA 3L39A 4YJ2E 5JDHA 5FY1A 4ZI3C 2V7KA 2VKDA 5LNKA 4DV6T 4UEMA 2FJEA 5GONE 3PURA 4DR6T 5JREA 3BQIA 2DWKA 2WMNA 5ABHA 1WR0A 1QLBA 1MIWA 2N2NA 2NW9A 3RYFE 4YJ3E 4DV0T 3F57A 5JR9B 3Q5WA 5L3CB 3AE9A 2XAFB 4TWHA 3JADA 4IL4A 5L4HA 2VKJA 4DR7T 1UCUA 3AAAB 2RPAA 4LF7T 5C3JA 2HHHT 2ACXA 3MACA 3RKOA 5EK4A 5HXRA 4IREA 2XJ7A 5AQKB 2DLRA 1ZV4X 4JV5T 5FVKA 3LK3B 5AQSB 2H7OA 3EHZA 5JDQA 4ILUA 4YY3T 2Q9QA 4U33A 5J0ZA 1X79A 4I55E 2AE9A 5CJ5A 2J47A 1H7CA 2WY2A 4KI0F 3AXJA 2E9XD 5JVDE 1DU2A 4DR5T 5LBMA 3O1HA 3B57A 3CWZB 4PK5A 4E7ZA 3E0ZA 3CPZA 4KX6A 1KNZA 3K1SA 3ZCJA 1QSDA 3QK6A 2XAQB 2Q9QB 4ILAA 3JC6C 5LGUB 2D0UA 5FKYA 4QKNA 4AXPA 4TN7B 1SHZC 3E08A 2XZEA 4EYYR 3OYXA 3AXJB 3ABVA 2YK0A 4JI5T 1WFDA 4O4LE 4COFA 2BG9E 1XNQT 4BJMA 4NUUA 2YDQA 4U7YA 4U31A 3NWIA 3UUNA 4AQGA 2WBLA 1B7TA 3AE1A 3CMLA 4DV4T 3PUZF 3AEAA 2V1DB 5HWXA 1QUUA 2A72A 3AVSA 4JLEA 3PUXF 5JTGA 3RLFF 1G73A 2QRXA 3TKLB 5HXSA 2Q9QC 2OA5A 5FMNA 4L5GA 5EZYE 3UQ7A 2BZBA 1N32T 4U2ZA 3ZMUB 2MAWA 3WAJA 3ZSTA 3HL6A 5FVLA 2HPLA 2V5DA 4Z8XA 1T7SA 2YU2A 4BA9A 5JDLA 4B3RT 5LA6E 3FXEB 4AQFA 4EYUA 1CHUA 4TNWA 4I0UA 3AB3B 4JBWF 3PTRB 3ZT6A 2WU5A 4DUZT 4QX7B 1NAFA 2A2FX 2W63A 5CA0E 4QX8B 5FL1A 3PUWF 3V5UA 3ZSSA 2ZM8A 2AXDS 5HEUA 4V1Av 2BS3A 4IT4A 4KP3C 4HEAA 2WDQA 4A56A 1UX4A 3QOFA 4JEHB 1YW0A 4HWFA 3TLVA 4HWHA 4WBOA 5LCYA 4DV7T 3NRYA 4C91A 2IHR1 4Z91A 2V7MA 3PV0F 5DABA 2BG9C 2XQYA 2VKHA 4MALA 3RC3A 4AKRB 2VURA 4X1IE 2YKSA 4EAHA 5JH7E 3AEBA 2V5CA 4LFCT 4GK0E 3H3AA 4TX5A 4DV5T 2E9XB 2WCAA 2DWGA 4ZZBA 1IBMT 2SPCA 5AQGB 4UVAB 4ZI3D 1O3XA 4DBRA 3CK6A 3RI5A 3VR8A 3RIAA 3R84B 3RIUC 2P9BA 2FJAA 3AE3A 4HFVA 5H6QB 3UUXB 2DL1A 4H9SE 2WB5A 2UUBT 2VL8A 4JYAT 3HI2A 2W00A 3FBZA 4IE0A 1YQ3A 3P4SA 1MIVA 3AA6B 2VKOA 1HNXT 3N9LA 4X1YE 3DJBA 3PJAJ 2W4XA 2VQET 2YDRA 1LVKA 3KFWX 3OTOT 2VK9A 3GMIA 5J2TE 2XQ5A 4HWIB 5HEOA 4UR9A 2V6XA 2WZHA 3ZCIA 2LSKA 2ZM0A 4ISSA 3UU4A 1XZYA 1BR4A 3PE0A 3UUMA 2XTLA 2E9XC 1WYCA 3O1JA 3I0OA 3C4ZA 3I9YA 2VWAA 5C8YE 2QVAA 3DP7A 5AFUL 2KT9A 1XMOT 2KLQA 2JRKA 2YDSA 4I4TE 5EK2A 2K9AA 1ZOYA 4PNIA 3RF1A 3N2KE 2VL0A 3HKCE 2CWOA 3PUGA 4XBFB 3ZMSB 3UQ4A 4ZOLE 3C4XA 2ACZA 2X51A 3EAMA 3Q5EA 3VR9A 1D0XA 3U78A 3RPUA 2M67A 1D0YA 1E7PA 3AE8A 4CXYA 3AAEB 3CQXC 2VQFT 3PUAA 4G63A 2CWYA 3JC6D 2DNXA 5F5WA 2JIWA 3NRXA 3OYZA 5AQMB 3OJAA 2CXDA 5HXCA 1D1AA 3UU6A 3G06A 2N9DA 1N33T 1V9DA 4E7SA 2UU9T 1IJ6A 2NTXA 5IYZE 1S94A 2WU2A 3N2GE 1HNZT 4OX9T 1KEYA 3QC9A 3P8CD 4QH4A 3RRWA 2ZMAA 5JDNA 4CI2B 3IHRA 3FZLB 4YHHT 3JAEA 3MXZA 4JI3T 1LRZA 1KNRA 3FZMB 2V7IA 3KV5A 4PFOA 4O4JE 2WSSV 1WLXA 4ILCA 2VASA 2XUEA 4YHJA 4N78D 2WWUA 1Z8UA 3SOLA 5M4YA 1BR2A 5LG3A 2K3WA 1N36T 3A5XA 5ADXL 4YLHA 2JMKA 4H9PC 4HFHA 3O9XA 3NBXX 1S35A 3AE7A 4QWNB 3NZQA 4K0UA 5E0OA 4UIGA 5AQIB 4YXDA 2WDRA 3OVUA 4LFBT 3ONXA 1IZNB 5FL0A 2EHOC 4TNVA 4IDPA 2OV9A 4PJLA 4OFZA 4EEBA 3K8PC 5L2LA 3IBPA 1W0BA 3KBUA 4P1NA 3N9MA 3K3NA 4HFBA 1T98A 4KMCA 5AQHB 2UXDT 5FXZA 3CX7B 4JEUB 2K48A 5L3GB 2JQKA 4X1KE 4DR3T 5FY7A 3C51A 5LGNB 3T1YT 4DVDA 2XAHB 3LK2B 3AE5A 2CM0A 1ZEEA 3VRBA 4GKJT 2KNDA 3ZYLA 4O4IE 4KBMB 4WNKA 3I0QA 4TZ4C 5HCMA 1VCTA 3L09A 2LM2A 3SS1A 5LJMA 4H9NC 2NW7A 4UELA 2Y8DA 3UU5A 1U5PA 1J5WA 4JI1T 4U7IA 4U74A 2MYSA 3IA3A 1T8BA 4NPPA 4BAYB 2B1EA 5AQQB 4CQIA 2YN6A 5AQVB 1I6ZA 3C98B 2ZM2A 4O8SA 2KMFA 1WCRA 3ZN1B 1FEWA 2CRBA 3LJCA 3AA1B 2WDVA 4DV1T 3UULA 4DMWA 4UV9B 2E5LT 5KX5E 2DI4A 4DBQA 4HTEA 5KXJA 1HX1B 3HR0A 3R6NA 5F8PA 4TV9E 3NZPA 2V26A 3PUYF 5KMGP 4GOUA 1BR0A 2OLTA 4H63V 3FZKB 2W66A 2PTFA 3CQCB 4M1PA 2XAJB 5FXVA 3HA4A 4HWCA 2XQ7A 5DQWA 2VVSA 3AE6A 2KZ7B 4Q25A 4ZXLA 4AKGA 1YKEB 3AEFA 1R8IA 2V6YA 2LSJA 4PAGA 2LSGA 1EZ3A 5L3EB 3N9PA 4ANJA 2CE7A 4H9RC 3RYHE 1WYBA 4AKIA 4HN9A 4PJJA 5J2UE 3V5SA 4IDOA 4CI3B 2CPTA 2BG9A 4O2AE 1E2AA 3AEDA 2KSRA 2PG8A 4UXNB 2LSIA 3AE2A 1NENA 4ZHQE 1FMWA 4TUYE 5LJNA 2IIUA 1G8XA 2V6YB 2LLYA 5ETWA 1KF6A 4XZCA 3P4RA 3OPCA 4WZXA 3LG7A 3A7MA 5CB4E 2XQAA 4Z90A 3ANWB 3LFMA 1CUNA 2CBIA 2X9YA 4JI7T 3RIUA 2LHRA 2BG9B 2BVMA 1N34T 2BVLA 3N9OA 5AQUB 4X65T 3S4UA 4KUMB 1ZHCA 2BBHA 3ZMTB 4J2CA 2XM1A 3PU8A 1HTJF 4DUYT 4ILBA 1MNDA 1D1BA 4ZS3A 4YTMA 3I1AA 1MIYA 2E9XA 3P4QA 4HFEA 4YTNA 3UFGA 3UT5E 2RA1A 2PJQA 4AKHA 1J1JA 2XAGB 2HN2A 3RHWA 2MPKA 4B6XA 4AKLA 3AEGA 3CVRA 1FMVA 4UF0A 2M6BA 3GN5A 4LFAT 2EHOD 4AISA 1L0VA 3P4PA 4X20E 4QH1A 3GWHA 2LOSA 2BDEA 4CXXA 1OEDE 4FJOA 4YT0A 4IE6A 4IHJE 3RYCE 4JI8T 5LG4A 3ZYMA 5LMUT 2XQ9A 2C5KT 2CCQA 2IDOB 2J62A 1HCIA 3L8RA 2CLYB 2LOPA 4DIDB 5AQFB 4UF0B 3GN5B 4H9QC 3SFDA 5AQTB 3C50A 2BKPA 2E8IA 2A9UA 4HE8A 4TV8E 5FXWA 4QHOA 2V8SV 2H7VC 1MNEA 1SA0E 3JAFA 1LVFA 4P0BA 1Z0PA 4ZI7E 4TWDA 2L3LA 5F3JA 4HGAA 4YSXA 2WM9A 4IGUA 5IUXA 2W61A 4HFDA 2W0GA 4AQYT 4GK5E 2UUAT 2YOEA 4MFRA 5L3DB 5LYJE 4JI2T 4HWDA 3RYIE 1IBKT 4O4HE 2VB6A 3ZT7A 2XPKA 2JQHA 3ZC1A 4ZS2A 2I6HA 3H3MA 1FIOA 2CLYC 2V7LA 3PUVF 4CI1B 1SE7A 2I59A 2YEVC 4CN4A 5HXEA 4WW0A 4B3MT 2UXNB 3HKDE 4ZEYA 4QXHB 5DJQC 5LP6E 4ASKA 1OEDC 1W9RA 3RQUA 2C5IT 4WYVA 3CKDA 2EHOA 3ZPOA 3PUQA 2NTYA 1MMAA 4OYJA 1J5ET 2NP9A 4A98A 4ZI2C 2L8KA 1SUMB 1U4QA 1YQ4A 4CN1A 3D0TA 3U3IA 1JNZA 5ABGA 5AQOB 2CMRA 1WR6A 4P0AA 2ZLYA 2ODUA 2H88A 3UU3A 2NOXA 2EHOB 1KNPA 2LSYA 1UK5A 3VKGA 3M3ZB 5FXXA 5L47A 3A8YC 5BR8T 2CXFA 4F8HA 4PFPA 3ZMVB 1D0ZA 2RP4A 5L3BB 5FY0A 3DTOA 4PK6A 2XQ4A 4C90A 3RH3A 4IE7A 3QUJA 4IL9A 2MOZA 3QNUA 4DV3T 2H3RA 3CIRA 2E5VA 2BKOA 3RX6A 1MMNA 5J1GA 2C0SA 4OHFA 4I43B 4X64T 2FJDA 2A3DA 3LK42 2R6GF 5FYMA 1HG5A 1YD8G 3HKBE 4G2AA 4X5TA 4NIQA 5KDMC 2D5UA 2B76A 3ETVA 1XMQT 3BK9A 2DHRA 3RIFA 4H63H 5LHHB 4AIUA 3B13A 3ZJ2A 2X68A 4U2YA 1ZKEA 5C2TA 3RC8A 3H37A 3X1DA 2X9HA 1UGOA 1W09A 3PUSA 2WP9A 5LBQB 4GYSA 5AQLB 4DV2T 1HS7A 2CEAA 2E2AA 2Y6XA 2JQ9A 3ONLC 3AA7B 5JQGE 1VCSA 2X66A 3SFEA 1M62A 3MA9A 2CBJA 4EXTA 2LT3A 1E1HB 2BKNA 5EK3A 3Q5DA 2QGSA 2QYWA 2NWBA 3RGLA 3RRCA 1Y01A 1XNRT 2KWIB 5JDMA 1UX5A 4NXMT 2BS2A 3O4XE 3UU8A 4GKKT 2LHNA 4MLKA 2W62A 5LOVE 2YU1A 4IDNA 2XSBA 5L3FB 5JRCA 2CA5A 2CXLA 5ABFA 4I50E 2LKHA 5HCJA 4CZZB 3EDUA 1MMDA 1OWAA 4BJNA 4DR4T 2N1GA 2PFVA 4GYRA 5HAXA 3J7Yq 2UXCT 4X66T 3E22E 2NR4A 3ZC0A 4DR2T 1IAPA 3C64A 1WRDA 2XSAA 4PJMA 2CHOA 3O1IA 2BBJA 5HWYA 3VHLA 1Y64B 5JRCB 5ABFB
chains in the Genus database with same CATH topology
5EK2A 4AKHA 3N5LA 2K9AA 4PNIA 4YFSA 3EUHA 3K3QC 2XAGB 3N2KE 3PU3A 4PW8A 2YINA 3HKCE 2CWOA 3KBTA 3AAIA 1HG2A 3PUGA 4B6XA 5JR9C 4QXBB 4XBFB 4AKLA 3ZMSB 4ZOLE 3C4XA 3CVRA 2KWHA 1FMVA 2PBIA 4H9OC 4UF0A 4UVCB 2X51A 3CX6B 3UTKA 3GN5A 3ZYKA 1HFAA 4OK0A 4IE4A 2X0LB 1D0XA 2EHOD 3BQKA 3U78A 3L3PA 3Q2MA 5TAOA 3RPUA 3KINB 2M67A 1D0YA 2D0TA 5JR9A 4X20E 3P7IA 3ANWA 3GWHA 2LOSA 4CXYA 3AAEB 3CQXC 2BDEA 4YJ2E 5JDHA 5FY1A 4ZI3C 4CXXA 2JPFA 2Z6EA 2V7KA 3OBVE 3PUAA 2LEHA 2VKDA 4G63A 4FJOA 2CWYA 3JC6D 5LNKA 2DNXA 4IE6A 4IHJE 3RYCE 5JDGA 4UEMA 3NRXA 5LG4A 3ZYMA 3ZMZB 3OYZA 5GONE 3PURA 2C5KT 3OJAA 2CXDA 5HXCA 2CCQA 1D1AA 3K3OA 2N9DA 5JREA 1HCIA 2J1DG 3BQIA 2DWKA 2WMNA 1V9DA 4E7SA 2CLYB 2LOPA 4ZI2D 1IJ6A 4UF0B 1MIWA 3GN5B 4H9QC 2NTXA 5IYZE 1S94A 5CA1E 2DCFA 2N2NA 2NW9A 3RYFE 3N2GE 3C50A 4YJ3E 4P09A 3I9WA 2E8IA 3QC9A 1NWMX 3T8OA 4ADZA 3F57A 3P8CD 4HE8A 1KK7A 2ZMAA 3RRWA 4TV8E 5FXWA 5JDNA 5IHYA 4CI2B 3Q5WA 5JR9B 5L3CB 3IHRA 1IJ5A 4QHOA 3BQLA 4L0RA 2H7VC 2XAFB 2HPJA 3KV4A 1MNEA 1SA0E 3ZEFB 1LVFA 4P0BA 3MXZA 1Z0PA 2X9WA 4MBQA 2VKJA 1LRZA 4ZI7E 1MMGA 1UCUA 2L3LA 5F3JA 3AAAB 4HGAA 2V7IA 2ODVA 2ACXA 2WM9A 3MACA 4IGUA 3FHNA 3KV5A 5DQVA 5EK4A 5HXRA 3RKOA 2W61A 2DLRA 1ZV4X 4PFOA 2HH7A 4O4JE 2WSSV 1WLXA 2GK9A 1HX8A 2VASA 3LK3B 2XUEA 4HKAA 4YHJA 2W0GA 2WAUA 2WWUA 4N78D 2H7OA 4GK5E 5JDQA 3SOLA 4MFRA 4ILUA 3KV9A 5M4YA 1BR2A 5L3DB 5LYJE 2Q9QA 2LM9A 3RYIE 3A5XA 1X79A 4O4HE 2VB6A 5ADXL 4YLHA 4I55E 1OXZA 2JMHA 2JMKA 3ZC1A 4H9PC 3O9XA 4ZS2A 1FIOA 2CLYC 2V7LA 3NBXX 1H7CA 4EB6E 1S35A 4F6RC 4QWNB 4CI1B 4UV8B 2E9XD 5JVDE 2LE8A 4DNDA 2I59A 3NZQA 3KDSE 4K0UA 2YEVC 5E0OA 4UIGA 5HYAA 5HXEA 5LBMA 3O1HA 3ONXA 1IZNB 2D2SA 4WW0A 3B57A 3CWZB 4PK5A 2EHOC 3E0ZA 4E7ZA 4EZHA 2XASB 3ZN0B 2UXNB 3CPZA 3HKDE 4PJLA 4OFZA 4QXHB 5DJQC 1KNZA 5LP6E 3K8PC 4ASKA 5L2LA 3IBPA 5LXTE 3VU7H 4AI6A 3KBUA 3ZCJA 1QSDA 3N9MA 3K3NA 2C5JA 3QK6A 4DO0A 2C5IT 2XAQB 2Q9QB 1T98A 4KMCA 3JC6C 3CKDA 1BR1A 2EHOA 3ZPOA 3PUQA 5LGUB 2NTYA 4QXCB 5FXZA 2D0UA 3CX7B 4JEUB 2K48A 1MMAA 4OYJA 5L3GB 2IC9A 4QKNA 4X1KE 4AXPA 3IEEA 4TN7B 1SHZC 5FY7A 3E08A 3C51A 2NP9A 5LGNB 4EYYR 4NUVA 3OYXA 5LHIB 1VRBA 2YK0A 4O4LE 4DVDA 4ZI2C 3LBXA 2L8KA 2XAHB 3LK2B 1U4QA 4BJMA 3D0TA 3U3IA 2CM0A 1ZEEA 4NUUA 2KNDA 4OYKA 5FP3A 3ZYLA 4O4IE 2CMRA 4KBMB 3UUNA 4WNKA 3I0QA 4TZ4C 4AQGA 2WBLA 1B7TA 1WR6A 4P0AA 3CMLA 2ZLYA 3L09A 3GA8A 3SS1A 2ODUA 5LJMA 4H9NC 2NW7A 3N9QA 2NOXA 3KV6A 4UELA 2Y8DA 2EHOB 2V1DB 1U5PA 1QUUA 5HWXA 2A72A 3M65A 3AVSA 4JLEA 4U74A 4JUYA 2LSYA 2MYSA 2IW5B 3VKGA 3KVAA 4BAYB 1LKXA 1G73A 5FXXA 2JQQA 4ISTA 3TKLB 2B1EA 3ESLA 5HXSA 4PJNA 2Q9QC 2OA5A 3LBXB 5FMNA 4L5GA 4CQIA 5EZYE 2CXFA 5A1LA 4AQFC 2BZBA 3KVBA 4PFPA 3ZMVB 3C98B 2ZM2A 3N9NA 4O8SA 1D0ZA 3ZMUB 4IIJE 3WAJA 2KMFA 2RP4A 5JDFA 3HL6A 3ZN1B 1FEWA 2HPLA 3LJCA 4ERRA 3AA1B 5L3BB 3MKDA 5FY0A 4Z8XA 3MJXA 3UULA 2XHEB 2YU2A 4BA9A 3DTOA 4DMWA 3EDVA 4PK6A 1D1CA 4UV9B 5JDLA 4C90A 3RH3A 1HF8A 4IDZA 4IE7A 3QUJA 5LA6E 3FXEB 4AQFA 2V7JA 5KX5E 2MOZA 4EOZB 4EYUA 2DI4A 4DBQA 2H3RA 3N2OA 3AB3B 3MZKB 3PTRB 2K5BB 4HTEA 5FNVE 3HR0A 3R6NA 3AVRA 5F8PA 4TV9E 3RX6A 4QX7B 1MMNA 3ETUA 1NAFA 5J1GA 2A2FX 2C0SA 4OHFA 2W63A 4I43B 3NZPA 5CA0E 2V26A 4QX8B 3FXDB 3FB2A 2A3DA 3LK42 5KMGP 4GOUA 3V5UA 5FYMA 1BR0A 2ZM8A 1HG5A 4EZ4A 3C4WA 3UFEA 4V1Av 1YD8G 4H63V 3HKBE 4G2AA 4KP3C 5KDMC 2D5UA 3ETVA 4HEAA 3BK9A 4A56A 3CX8B 1UX4A 2DHRA 4DMVA 4H63H 3CQCB 4JEHB 5LHHB 4M1PA 2XAJB 3B13A 5FXVA 1YW0A 2IAKA 3HA4A 3IF8B 3ZJ2A 3OKQA 2X68A 5DQWA 1ZKEA 2JJ9A 4WBOA 2KZ7B 3RC8A 4O2BE 5LCYA 3H37A 3NRYA 4C91A 4AKGA 4MHCA 2V7MA 3SRZA 3ZJ1A 4IE5A 1YKEB 5DABA 2X9HA 3WAKA 2MTQA 2VKHA 2XQYA 3PUSA 3MK7C 2LSJA 3W15B 4MALA 4PAGA 5LBQB 3VKHA 3RC3A 4GYSA 2LSGA 1EZ3A 5L3EB 2ES0A 1HS7A 3N9PA 2CEAA 4AKRB 2CE7A 4H9RC 4X1IE 3RYHE 4ANJA 2KXPB 2Y6XA 1WYBA 4AKIA 4HN9A 4EAHA 3Q5XA 5JH7E 4PJJA 5J2UE 3V5SA 4GK0E 3H3AA 4U72A 4TX5A 5LGTB 2E9XB 4CI3B 4WBNE 4XAXB 3AA7B 2DWGA 1US7B 4O2AE 2SPCA 5JQGE 3AA0B 2K24A 4UVAB 1AJ3A 2PG8A 4UXNB 2X66A 5HXHA 2LSIA 4ZI3D 1O3XA 4DBRA 4ZHQE 3MA9A 1FMWA 2Y48B 4TUYE 4EXTA 2LT3A 1E1HB 5EK3A 2X67A 5LJNA 2QGSA 3R84B 2NWBA 2P9BA 3RRCA 3F2EA 4HFVA 1G8XA 4L9IA 5H6QB 5ETWA 3UUXB 4XZCA 4H9SE 2KWIB 2VL8A 5JDMA 2X9XA 3HI2A 4CXWA 1UX5A 3LG7A 4UVBB 2W00A 3FBZA 4IE0A 3O4XE 5CB4E 3HKEE 1MIVA 2WMOA 2LHNA 1CUNA 2VKOA 3AA6B 3ANWB 3EVYA 2W62A 3LFMA 3N9LA 4MLKA 3DJBA 4X1YE 2X9YA 2YU1A 5LOVE 4FI5A 2LHRA 5L3FB 1LVKA 3KFWX 2BVMA 2IC6A 2CA5A 2CXLA 2VK9A 3GMIA 3CQGB 3J9X1 5J2TE 5JRCA 2L9QA 3ZLIA 4I50E 1YKHB 2BVLA 3N9OA 4PK4A 2LSKA 3ZCIA 2ZM0A 2G0UA 2QA7A 2KINB 4GIWA 4CZZB 4ISSA 5LHGB 3Q9DA 3EDUA 3S4UA 1MMDA 4KUMB 1BR4A 1OWAA 3PE0A 3SWHA 3UUMA 1ZHCA 2XTLA 4BJNA 2E9XC 3WI3A 3ZMTB 4J2CA 1WYCA 2N1GA 2PFVA 2LJLA 3O1JA 3PU8A 1HTJF 2Q9QD 3C4ZA 3I0OA 4GYRA 3I9YA 4EIWA 2VWAA 5HAXA 3J7Yq 1MNDA 1D1BA 4ZS3A 3I1AA 3E22E 1VOMA 3ZC0A 3F31A 5C8YE 1IAPA 2MBGA 2NW8A 5H6RB 3C64A 1WRDA 1MIYA 3DP7A 3FBLA 4PJMA 2E9XA 5AFUL 5BMVE 2KT9A 2KLQA 2JRKA 3PDYA 3O1IA 2UXXB 5HWYA 3VHLA 3UT5E 1Y64B 2RA1A 5JRCB 2PJQA 4I4TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM9 A;  2JMH A;  2JRK A; 
#chains in the Genus database with same CATH topology
 3N5L A;  4DR1 T;  3LSV A;  3EUH A;  2I0M A;  3K3Q C;  2M6I A;  3KBT A;  3AAI A;  1HG2 A;  5JR9 C;  4QXB B;  5AQR B;  2PBI A;  4A5X A;  4UVC B;  3TLW A;  3ZYK A;  4IE4 A;  2X0L B;  3BQK A;  3L3P A;  5TAO A;  3KIN B;  2D0T A;  1XWM A;  3ANW A;  3P50 A;  1M7K A;  1UUS A;  2JPF A;  2Z6E A;  3OBV E;  3B5M A;  2BS4 A;  2LEH A;  1KFY A;  2D9D A;  5JDG A;  3ZMZ B;  4YSY A;  1T72 A;  2W2U A;  3K3O A;  3TLS A;  2J1D G;  5AQN B;  4ZI2 D;  5CA1 E;  2DCF A;  4P09 A;  3I9W A;  1NWM X;  3T8O A;  4ADZ A;  4CN6 A;  1FJG T;  1KK7 A;  5IHY A;  1IJ5 A;  3BQL A;  4L0R A;  2FUP A;  2WWV A;  2HPJ A;  3KV4 A;  3ZEF B;  3AEC A;  1I94 T;  1NEK A;  2X9W A;  4KHZ F;  4MBQ A;  1MMG A;  4JI4 T;  4LMK A;  4X62 T;  2ODV A;  5DQV A;  3FHN A;  2FBW A;  5IWA T;  3ZT5 A;  2HH7 A;  2GK9 A;  1HX8 A;  4HKA A;  2FJB A;  4EED A;  2WAU A;  3KV9 A;  2LM9 A;  3TLT A;  3NKZ A;  3AEE A;  2WZI A;  1OXZ A;  2JMH A;  4JI0 T;  5CGM A;  3NVO A;  4EB6 E;  4F6R C;  4UV8 B;  2LE8 A;  4DND A;  3KDS E;  5HYA A;  2D2S A;  4TWF A;  3LDQ B;  4EZH A;  2XAS B;  3ZN0 B;  2J4G A;  4HFC A;  4LMJ A;  5LXT E;  3VU7 H;  3AE4 A;  4AI6 A;  2C5J A;  4DO0 A;  1GQE A;  5HEJ A;  1BR1 A;  4QXC B;  2IC9 A;  2XQ6 A;  3IEE A;  1OED A;  3RKG A;  5LHI B;  4NUV A;  3UUB A;  2X0Y A;  1VRB A;  3LBX A;  1YXR A;  4OYK A;  5FP3 A;  4LF6 T;  1X9B A;  3GA8 A;  5AQP B;  3N9Q A;  1W0A A;  3KV6 A;  4EGW A;  2IML A;  3TLU A;  3M65 A;  2H89 A;  3ONJ A;  4JUY A;  4B3S T;  2F4V T;  2IW5 B;  3KVA A;  1XDP A;  1OED B;  1LKX A;  2UXB T;  2JQQ A;  4IST A;  4JI6 T;  3ESL A;  4LF4 T;  1XDO A;  4PJN A;  3LBX B;  5A1L A;  4AQF C;  2LKG A;  3FZF B;  3KVB A;  3N9N A;  4IIJ E;  5JDF A;  3VRA A;  5ABE A;  4ERR A;  4NXN T;  4B3T T;  3MKD A;  3MJX A;  2XHE B;  3EDV A;  1D1C A;  1HF8 A;  4IDZ A;  2XQ3 A;  2V7J A;  4EOZ B;  2LRK A;  3N2O A;  3T1H T;  3MZK B;  2K5B B;  2XM2 A;  5FNV E;  3AVR A;  3ETU A;  3FZH B;  3QB5 A;  3FXD B;  3FB2 A;  5LB7 B;  4YSZ A;  4EZ4 A;  3C4W A;  3UFE A;  4A97 A;  3ZKR A;  2VVN A;  3CX8 B;  4DMV A;  3JCF A;  2IAK A;  3IF8 B;  3OKQ A;  2JJ9 A;  4O2B E;  4MHC A;  3SRZ A;  3ZJ1 A;  4IE5 A;  4ZZC A;  3WAK A;  5L4E A;  2MTQ A;  3MK7 C;  3W15 B;  3RQW A;  3VKH A;  2ES0 A;  2KXP B;  1ZP0 A;  2WS3 A;  3Q5X A;  4U72 A;  2LRL A;  5LGT B;  4LF8 T;  4WBN E;  4XAX B;  3EAB A;  1US7 B;  3AA0 B;  2K24 A;  1AJ3 A;  4EV6 A;  5HXH A;  4HFI A;  4LML A;  2Y48 B;  2X67 A;  3F2E A;  4L9I A;  1HNW T;  2X9X A;  4CXW A;  4UVB B;  3HKE E;  2ZM6 T;  2WMO A;  3EVY A;  3PJA A;  4IDQ A;  4FI5 A;  1HR0 T;  2IC6 A;  5HEH A;  3J9X 1;  3CQG B;  2L9Q A;  3ZLI A;  1YKH B;  1UUR A;  4PK4 A;  2G0U A;  2QA7 A;  5CFB A;  2KIN B;  4GIW A;  4LF5 T;  5LHG B;  5AQJ B;  3Q9D A;  2WQY A;  3SWH A;  3WI3 A;  2LJL A;  2Q9Q D;  4EIW A;  2UUC T;  4K0K T;  4U3C A;  1VOM A;  1JNR A;  2HN1 A;  3F31 A;  4YTP A;  2MBG A;  2NW8 A;  5H6R B;  3FBL A;  5BMV E;  2XQ8 A;  3PDY A;  2UXX B;  2W67 A;  2XY8 B;  3QB5 K;  1IBL T;  4YFS A;  3PU3 A;  5LMN T;  4PW8 A;  2YIN A;  3EI0 A;  5HEG A;  2KWH A;  4H9O C;  3UTK A;  3CX6 B;  1HFA A;  4KHP T;  4OK0 A;  2X0H A;  3Q2M A;  4LF9 T;  5JR9 A;  3P4W A;  2IUB A;  3P7I A;  4QH5 A;  2CHN A;  3L39 A;  4YJ2 E;  5JDH A;  5FY1 A;  4ZI3 C;  2V7K A;  2VKD A;  5LNK A;  4DV6 T;  4UEM A;  2FJE A;  5GON E;  3PUR A;  4DR6 T;  5JRE A;  3BQI A;  2DWK A;  2WMN A;  5ABH A;  1WR0 A;  1QLB A;  1MIW A;  2N2N A;  2NW9 A;  3RYF E;  4YJ3 E;  4DV0 T;  3F57 A;  5JR9 B;  3Q5W A;  5L3C B;  3AE9 A;  2XAF B;  4TWH A;  3JAD A;  4IL4 A;  5L4H A;  2VKJ A;  4DR7 T;  1UCU A;  3AAA B;  2RPA A;  4LF7 T;  5C3J A;  2HHH T;  2ACX A;  3MAC A;  3RKO A;  5EK4 A;  5HXR A;  4IRE A;  2XJ7 A;  5AQK B;  2DLR A;  1ZV4 X;  4JV5 T;  5FVK A;  3LK3 B;  5AQS B;  2H7O A;  3EHZ A;  5JDQ A;  4ILU A;  4YY3 T;  2Q9Q A;  4U33 A;  5J0Z A;  1X79 A;  4I55 E;  2AE9 A;  5CJ5 A;  2J47 A;  1H7C A;  2WY2 A;  4KI0 F;  3AXJ A;  2E9X D;  5JVD E;  1DU2 A;  4DR5 T;  5LBM A;  3O1H A;  3B57 A;  3CWZ B;  4PK5 A;  4E7Z A;  3E0Z A;  3CPZ A;  4KX6 A;  1KNZ A;  3K1S A;  3ZCJ A;  1QSD A;  3QK6 A;  2XAQ B;  2Q9Q B;  4ILA A;  3JC6 C;  5LGU B;  2D0U A;  5FKY A;  4QKN A;  4AXP A;  4TN7 B;  1SHZ C;  3E08 A;  2XZE A;  4EYY R;  3OYX A;  3AXJ B;  3ABV A;  2YK0 A;  4JI5 T;  1WFD A;  4O4L E;  4COF A;  2BG9 E;  1XNQ T;  4BJM A;  4NUU A;  2YDQ A;  4U7Y A;  4U31 A;  3NWI A;  3UUN A;  4AQG A;  2WBL A;  1B7T A;  3AE1 A;  3CML A;  4DV4 T;  3PUZ F;  3AEA A;  2V1D B;  5HWX A;  1QUU A;  2A72 A;  3AVS A;  4JLE A;  3PUX F;  5JTG A;  3RLF F;  1G73 A;  2QRX A;  3TKL B;  5HXS A;  2Q9Q C;  2OA5 A;  5FMN A;  4L5G A;  5EZY E;  3UQ7 A;  2BZB A;  1N32 T;  4U2Z A;  3ZMU B;  2MAW A;  3WAJ A;  3ZST A;  3HL6 A;  5FVL A;  2HPL A;  2V5D A;  4Z8X A;  1T7S A;  2YU2 A;  4BA9 A;  5JDL A;  4B3R T;  5LA6 E;  3FXE B;  4AQF A;  4EYU A;  1CHU A;  4TNW A;  4I0U A;  3AB3 B;  4JBW F;  3PTR B;  3ZT6 A;  2WU5 A;  4DUZ T;  4QX7 B;  1NAF A;  2A2F X;  2W63 A;  5CA0 E;  4QX8 B;  5FL1 A;  3PUW F;  3V5U A;  3ZSS A;  2ZM8 A;  2AXD S;  5HEU A;  4V1A v;  2BS3 A;  4IT4 A;  4KP3 C;  4HEA A;  2WDQ A;  4A56 A;  1UX4 A;  3QOF A;  4JEH B;  1YW0 A;  4HWF A;  3TLV A;  4HWH A;  4WBO A;  5LCY A;  4DV7 T;  3NRY A;  4C91 A;  2IHR 1;  4Z91 A;  2V7M A;  3PV0 F;  5DAB A;  2BG9 C;  2XQY A;  2VKH A;  4MAL A;  3RC3 A;  4AKR B;  2VUR A;  4X1I E;  2YKS A;  4EAH A;  5JH7 E;  3AEB A;  2V5C A;  4LFC T;  4GK0 E;  3H3A A;  4TX5 A;  4DV5 T;  2E9X B;  2WCA A;  2DWG A;  4ZZB A;  1IBM T;  2SPC A;  5AQG B;  4UVA B;  4ZI3 D;  1O3X A;  4DBR A;  3CK6 A;  3RI5 A;  3VR8 A;  3RIA A;  3R84 B;  3RIU C;  2P9B A;  2FJA A;  3AE3 A;  4HFV A;  5H6Q B;  3UUX B;  2DL1 A;  4H9S E;  2WB5 A;  2UUB T;  2VL8 A;  4JYA T;  3HI2 A;  2W00 A;  3FBZ A;  4IE0 A;  1YQ3 A;  3P4S A;  1MIV A;  3AA6 B;  2VKO A;  1HNX T;  3N9L A;  4X1Y E;  3DJB A;  3PJA J;  2W4X A;  2VQE T;  2YDR A;  1LVK A;  3KFW X;  3OTO T;  2VK9 A;  3GMI A;  5J2T E;  2XQ5 A;  4HWI B;  5HEO A;  4UR9 A;  2V6X A;  2WZH A;  3ZCI A;  2LSK A;  2ZM0 A;  4ISS A;  3UU4 A;  1XZY A;  1BR4 A;  3PE0 A;  3UUM A;  2XTL A;  2E9X C;  1WYC A;  3O1J A;  3I0O A;  3C4Z A;  3I9Y A;  2VWA A;  5C8Y E;  2QVA A;  3DP7 A;  5AFU L;  2KT9 A;  1XMO T;  2KLQ A;  2JRK A;  2YDS A;  4I4T E;  5EK2 A;  2K9A A;  1ZOY A;  4PNI A;  3RF1 A;  3N2K E;  2VL0 A;  3HKC E;  2CWO A;  3PUG A;  4XBF B;  3ZMS B;  3UQ4 A;  4ZOL E;  3C4X A;  2ACZ A;  2X51 A;  3EAM A;  3Q5E A;  3VR9 A;  1D0X A;  3U78 A;  3RPU A;  2M67 A;  1D0Y A;  1E7P A;  3AE8 A;  4CXY A;  3AAE B;  3CQX C;  2VQF T;  3PUA A;  4G63 A;  2CWY A;  3JC6 D;  2DNX A;  5F5W A;  2JIW A;  3NRX A;  3OYZ A;  5AQM B;  3OJA A;  2CXD A;  5HXC A;  1D1A A;  3UU6 A;  3G06 A;  2N9D A;  1N33 T;  1V9D A;  4E7S A;  2UU9 T;  1IJ6 A;  2NTX A;  5IYZ E;  1S94 A;  2WU2 A;  3N2G E;  1HNZ T;  4OX9 T;  1KEY A;  3QC9 A;  3P8C D;  4QH4 A;  3RRW A;  2ZMA A;  5JDN A;  4CI2 B;  3IHR A;  3FZL B;  4YHH T;  3JAE A;  3MXZ A;  4JI3 T;  1LRZ A;  1KNR A;  3FZM B;  2V7I A;  3KV5 A;  4PFO A;  4O4J E;  2WSS V;  1WLX A;  4ILC A;  2VAS A;  2XUE A;  4YHJ A;  4N78 D;  2WWU A;  1Z8U A;  3SOL A;  5M4Y A;  1BR2 A;  5LG3 A;  2K3W A;  1N36 T;  3A5X A;  5ADX L;  4YLH A;  2JMK A;  4H9P C;  4HFH A;  3O9X A;  3NBX X;  1S35 A;  3AE7 A;  4QWN B;  3NZQ A;  4K0U A;  5E0O A;  4UIG A;  5AQI B;  4YXD A;  2WDR A;  3OVU A;  4LFB T;  3ONX A;  1IZN B;  5FL0 A;  2EHO C;  4TNV A;  4IDP A;  2OV9 A;  4PJL A;  4OFZ A;  4EEB A;  3K8P C;  5L2L A;  3IBP A;  1W0B A;  3KBU A;  4P1N A;  3N9M A;  3K3N A;  4HFB A;  1T98 A;  4KMC A;  5AQH B;  2UXD T;  5FXZ A;  3CX7 B;  4JEU B;  2K48 A;  5L3G B;  2JQK A;  4X1K E;  4DR3 T;  5FY7 A;  3C51 A;  5LGN B;  3T1Y T;  4DVD A;  2XAH B;  3LK2 B;  3AE5 A;  2CM0 A;  1ZEE A;  3VRB A;  4GKJ T;  2KND A;  3ZYL A;  4O4I E;  4KBM B;  4WNK A;  3I0Q A;  4TZ4 C;  5HCM A;  1VCT A;  3L09 A;  2LM2 A;  3SS1 A;  5LJM A;  4H9N C;  2NW7 A;  4UEL A;  2Y8D A;  3UU5 A;  1U5P A;  1J5W A;  4JI1 T;  4U7I A;  4U74 A;  2MYS A;  3IA3 A;  1T8B A;  4NPP A;  4BAY B;  2B1E A;  5AQQ B;  4CQI A;  2YN6 A;  5AQV B;  1I6Z A;  3C98 B;  2ZM2 A;  4O8S A;  2KMF A;  1WCR A;  3ZN1 B;  1FEW A;  2CRB A;  3LJC A;  3AA1 B;  2WDV A;  4DV1 T;  3UUL A;  4DMW A;  4UV9 B;  2E5L T;  5KX5 E;  2DI4 A;  4DBQ A;  4HTE A;  5KXJ A;  1HX1 B;  3HR0 A;  3R6N A;  5F8P A;  4TV9 E;  3NZP A;  2V26 A;  3PUY F;  5KMG P;  4GOU A;  1BR0 A;  2OLT A;  4H63 V;  3FZK B;  2W66 A;  2PTF A;  3CQC B;  4M1P A;  2XAJ B;  5FXV A;  3HA4 A;  4HWC A;  2XQ7 A;  5DQW A;  2VVS A;  3AE6 A;  2KZ7 B;  4Q25 A;  4ZXL A;  4AKG A;  1YKE B;  3AEF A;  1R8I A;  2V6Y A;  2LSJ A;  4PAG A;  2LSG A;  1EZ3 A;  5L3E B;  3N9P A;  4ANJ A;  2CE7 A;  4H9R C;  3RYH E;  1WYB A;  4AKI A;  4HN9 A;  4PJJ A;  5J2U E;  3V5S A;  4IDO A;  4CI3 B;  2CPT A;  2BG9 A;  4O2A E;  1E2A A;  3AED A;  2KSR A;  2PG8 A;  4UXN B;  2LSI A;  3AE2 A;  1NEN A;  4ZHQ E;  1FMW A;  4TUY E;  5LJN A;  2IIU A;  1G8X A;  2V6Y B;  2LLY A;  5ETW A;  1KF6 A;  4XZC A;  3P4R A;  3OPC A;  4WZX A;  3LG7 A;  3A7M A;  5CB4 E;  2XQA A;  4Z90 A;  3ANW B;  3LFM A;  1CUN A;  2CBI A;  2X9Y A;  4JI7 T;  3RIU A;  2LHR A;  2BG9 B;  2BVM A;  1N34 T;  2BVL A;  3N9O A;  5AQU B;  4X65 T;  3S4U A;  4KUM B;  1ZHC A;  2BBH A;  3ZMT B;  4J2C A;  2XM1 A;  3PU8 A;  1HTJ F;  4DUY T;  4ILB A;  1MND A;  1D1B A;  4ZS3 A;  4YTM A;  3I1A A;  1MIY A;  2E9X A;  3P4Q A;  4HFE A;  4YTN A;  3UFG A;  3UT5 E;  2RA1 A;  2PJQ A;  4AKH A;  1J1J A;  2XAG B;  2HN2 A;  3RHW A;  2MPK A;  4B6X A;  4AKL A;  3AEG A;  3CVR A;  1FMV A;  4UF0 A;  2M6B A;  3GN5 A;  4LFA T;  2EHO D;  4AIS A;  1L0V A;  3P4P A;  4X20 E;  4QH1 A;  3GWH A;  2LOS A;  2BDE A;  4CXX A;  1OED E;  4FJO A;  4YT0 A;  4IE6 A;  4IHJ E;  3RYC E;  4JI8 T;  5LG4 A;  3ZYM A;  5LMU T;  2XQ9 A;  2C5K T;  2CCQ A;  2IDO B;  2J62 A;  1HCI A;  3L8R A;  2CLY B;  2LOP A;  4DID B;  5AQF B;  4UF0 B;  3GN5 B;  4H9Q C;  3SFD A;  5AQT B;  3C50 A;  2BKP A;  2E8I A;  2A9U A;  4HE8 A;  4TV8 E;  5FXW A;  4QHO A;  2V8S V;  2H7V C;  1MNE A;  1SA0 E;  3JAF A;  1LVF A;  4P0B A;  1Z0P A;  4ZI7 E;  4TWD A;  2L3L A;  5F3J A;  4HGA A;  4YSX A;  2WM9 A;  4IGU A;  5IUX A;  2W61 A;  4HFD A;  2W0G A;  4AQY T;  4GK5 E;  2UUA T;  2YOE A;  4MFR A;  5L3D B;  5LYJ E;  4JI2 T;  4HWD A;  3RYI E;  1IBK T;  4O4H E;  2VB6 A;  3ZT7 A;  2XPK A;  2JQH A;  3ZC1 A;  4ZS2 A;  2I6H A;  3H3M A;  1FIO A;  2CLY C;  2V7L A;  3PUV F;  4CI1 B;  1SE7 A;  2I59 A;  2YEV C;  4CN4 A;  5HXE A;  4WW0 A;  4B3M T;  2UXN B;  3HKD E;  4ZEY A;  4QXH B;  5DJQ C;  5LP6 E;  4ASK A;  1OED C;  1W9R A;  3RQU A;  2C5I T;  4WYV A;  3CKD A;  2EHO A;  3ZPO A;  3PUQ A;  2NTY A;  1MMA A;  4OYJ A;  1J5E T;  2NP9 A;  4A98 A;  4ZI2 C;  2L8K A;  1SUM B;  1U4Q A;  1YQ4 A;  4CN1 A;  3D0T A;  3U3I A;  1JNZ A;  5ABG A;  5AQO B;  2CMR A;  1WR6 A;  4P0A A;  2ZLY A;  2ODU A;  2H88 A;  3UU3 A;  2NOX A;  2EHO B;  1KNP A;  2LSY A;  1UK5 A;  3VKG A;  3M3Z B;  5FXX A;  5L47 A;  3A8Y C;  5BR8 T;  2CXF A;  4F8H A;  4PFP A;  3ZMV B;  1D0Z A;  2RP4 A;  5L3B B;  5FY0 A;  3DTO A;  4PK6 A;  2XQ4 A;  4C90 A;  3RH3 A;  4IE7 A;  3QUJ A;  4IL9 A;  2MOZ A;  3QNU A;  4DV3 T;  2H3R A;  3CIR A;  2E5V A;  2BKO A;  3RX6 A;  1MMN A;  5J1G A;  2C0S A;  4OHF A;  4I43 B;  4X64 T;  2FJD A;  2A3D A;  3LK4 2;  2R6G F;  5FYM A;  1HG5 A;  1YD8 G;  3HKB E;  4G2A A;  4X5T A;  4NIQ A;  5KDM C;  2D5U A;  2B76 A;  3ETV A;  1XMQ T;  3BK9 A;  2DHR A;  3RIF A;  4H63 H;  5LHH B;  4AIU A;  3B13 A;  3ZJ2 A;  2X68 A;  4U2Y A;  1ZKE A;  5C2T A;  3RC8 A;  3H37 A;  3X1D A;  2X9H A;  1UGO A;  1W09 A;  3PUS A;  2WP9 A;  5LBQ B;  4GYS A;  5AQL B;  4DV2 T;  1HS7 A;  2CEA A;  2E2A A;  2Y6X A;  2JQ9 A;  3ONL C;  3AA7 B;  5JQG E;  1VCS A;  2X66 A;  3SFE A;  1M62 A;  3MA9 A;  2CBJ A;  4EXT A;  2LT3 A;  1E1H B;  2BKN A;  5EK3 A;  3Q5D A;  2QGS A;  2QYW A;  2NWB A;  3RGL A;  3RRC A;  1Y01 A;  1XNR T;  2KWI B;  5JDM A;  1UX5 A;  4NXM T;  2BS2 A;  3O4X E;  3UU8 A;  4GKK T;  2LHN A;  4MLK A;  2W62 A;  5LOV E;  2YU1 A;  4IDN A;  2XSB A;  5L3F B;  5JRC A;  2CA5 A;  2CXL A;  5ABF A;  4I50 E;  2LKH A;  5HCJ A;  4CZZ B;  3EDU A;  1MMD A;  1OWA A;  4BJN A;  4DR4 T;  2N1G A;  2PFV A;  4GYR A;  5HAX A;  3J7Y q;  2UXC T;  4X66 T;  3E22 E;  2NR4 A;  3ZC0 A;  4DR2 T;  1IAP A;  3C64 A;  1WRD A;  2XSA A;  4PJM A;  2CHO A;  3O1I A;  2BBJ A;  5HWY A;  3VHL A;  1Y64 B;  5JRC B;  5ABF B; 
#chains in the Genus database with same CATH homology
 5EK2 A;  4AKH A;  3N5L A;  2K9A A;  4PNI A;  4YFS A;  3EUH A;  3K3Q C;  2XAG B;  3N2K E;  3PU3 A;  4PW8 A;  2YIN A;  3HKC E;  2CWO A;  3KBT A;  3AAI A;  1HG2 A;  3PUG A;  4B6X A;  5JR9 C;  4QXB B;  4XBF B;  4AKL A;  3ZMS B;  4ZOL E;  3C4X A;  3CVR A;  2KWH A;  1FMV A;  2PBI A;  4H9O C;  4UF0 A;  4UVC B;  2X51 A;  3CX6 B;  3UTK A;  3GN5 A;  3ZYK A;  1HFA A;  4OK0 A;  4IE4 A;  2X0L B;  1D0X A;  2EHO D;  3BQK A;  3U78 A;  3L3P A;  3Q2M A;  5TAO A;  3RPU A;  3KIN B;  2M67 A;  1D0Y A;  2D0T A;  5JR9 A;  4X20 E;  3P7I A;  3ANW A;  3GWH A;  2LOS A;  4CXY A;  3AAE B;  3CQX C;  2BDE A;  4YJ2 E;  5JDH A;  5FY1 A;  4ZI3 C;  4CXX A;  2JPF A;  2Z6E A;  2V7K A;  3OBV E;  3PUA A;  2LEH A;  2VKD A;  4G63 A;  4FJO A;  2CWY A;  3JC6 D;  5LNK A;  2DNX A;  4IE6 A;  4IHJ E;  3RYC E;  5JDG A;  4UEM A;  3NRX A;  5LG4 A;  3ZYM A;  3ZMZ B;  3OYZ A;  5GON E;  3PUR A;  2C5K T;  3OJA A;  2CXD A;  5HXC A;  2CCQ A;  1D1A A;  3K3O A;  2N9D A;  5JRE A;  1HCI A;  2J1D G;  3BQI A;  2DWK A;  2WMN A;  1V9D A;  4E7S A;  2CLY B;  2LOP A;  4ZI2 D;  1IJ6 A;  4UF0 B;  1MIW A;  3GN5 B;  4H9Q C;  2NTX A;  5IYZ E;  1S94 A;  5CA1 E;  2DCF A;  2N2N A;  2NW9 A;  3RYF E;  3N2G E;  3C50 A;  4YJ3 E;  4P09 A;  3I9W A;  2E8I A;  3QC9 A;  1NWM X;  3T8O A;  4ADZ A;  3F57 A;  3P8C D;  4HE8 A;  1KK7 A;  2ZMA A;  3RRW A;  4TV8 E;  5FXW A;  5JDN A;  5IHY A;  4CI2 B;  3Q5W A;  5JR9 B;  5L3C B;  3IHR A;  1IJ5 A;  4QHO A;  3BQL A;  4L0R A;  2H7V C;  2XAF B;  2HPJ A;  3KV4 A;  1MNE A;  1SA0 E;  3ZEF B;  1LVF A;  4P0B A;  3MXZ A;  1Z0P A;  2X9W A;  4MBQ A;  2VKJ A;  1LRZ A;  4ZI7 E;  1MMG A;  1UCU A;  2L3L A;  5F3J A;  3AAA B;  4HGA A;  2V7I A;  2ODV A;  2ACX A;  2WM9 A;  3MAC A;  4IGU A;  3FHN A;  3KV5 A;  5DQV A;  5EK4 A;  5HXR A;  3RKO A;  2W61 A;  2DLR A;  1ZV4 X;  4PFO A;  2HH7 A;  4O4J E;  2WSS V;  1WLX A;  2GK9 A;  1HX8 A;  2VAS A;  3LK3 B;  2XUE A;  4HKA A;  4YHJ A;  2W0G A;  2WAU A;  2WWU A;  4N78 D;  2H7O A;  4GK5 E;  5JDQ A;  3SOL A;  4MFR A;  4ILU A;  3KV9 A;  5M4Y A;  1BR2 A;  5L3D B;  5LYJ E;  2Q9Q A;  2LM9 A;  3RYI E;  3A5X A;  1X79 A;  4O4H E;  2VB6 A;  5ADX L;  4YLH A;  4I55 E;  1OXZ A;  2JMH A;  2JMK A;  3ZC1 A;  4H9P C;  3O9X A;  4ZS2 A;  1FIO A;  2CLY C;  2V7L A;  3NBX X;  1H7C A;  4EB6 E;  1S35 A;  4F6R C;  4QWN B;  4CI1 B;  4UV8 B;  2E9X D;  5JVD E;  2LE8 A;  4DND A;  2I59 A;  3NZQ A;  3KDS E;  4K0U A;  2YEV C;  5E0O A;  4UIG A;  5HYA A;  5HXE A;  5LBM A;  3O1H A;  3ONX A;  1IZN B;  2D2S A;  4WW0 A;  3B57 A;  3CWZ B;  4PK5 A;  2EHO C;  3E0Z A;  4E7Z A;  4EZH A;  2XAS B;  3ZN0 B;  2UXN B;  3CPZ A;  3HKD E;  4PJL A;  4OFZ A;  4QXH B;  5DJQ C;  1KNZ A;  5LP6 E;  3K8P C;  4ASK A;  5L2L A;  3IBP A;  5LXT E;  3VU7 H;  4AI6 A;  3KBU A;  3ZCJ A;  1QSD A;  3N9M A;  3K3N A;  2C5J A;  3QK6 A;  4DO0 A;  2C5I T;  2XAQ B;  2Q9Q B;  1T98 A;  4KMC A;  3JC6 C;  3CKD A;  1BR1 A;  2EHO A;  3ZPO A;  3PUQ A;  5LGU B;  2NTY A;  4QXC B;  5FXZ A;  2D0U A;  3CX7 B;  4JEU B;  2K48 A;  1MMA A;  4OYJ A;  5L3G B;  2IC9 A;  4QKN A;  4X1K E;  4AXP A;  3IEE A;  4TN7 B;  1SHZ C;  5FY7 A;  3E08 A;  3C51 A;  2NP9 A;  5LGN B;  4EYY R;  4NUV A;  3OYX A;  5LHI B;  1VRB A;  2YK0 A;  4O4L E;  4DVD A;  4ZI2 C;  3LBX A;  2L8K A;  2XAH B;  3LK2 B;  1U4Q A;  4BJM A;  3D0T A;  3U3I A;  2CM0 A;  1ZEE A;  4NUU A;  2KND A;  4OYK A;  5FP3 A;  3ZYL A;  4O4I E;  2CMR A;  4KBM B;  3UUN A;  4WNK A;  3I0Q A;  4TZ4 C;  4AQG A;  2WBL A;  1B7T A;  1WR6 A;  4P0A A;  3CML A;  2ZLY A;  3L09 A;  3GA8 A;  3SS1 A;  2ODU A;  5LJM A;  4H9N C;  2NW7 A;  3N9Q A;  2NOX A;  3KV6 A;  4UEL A;  2Y8D A;  2EHO B;  2V1D B;  1U5P A;  1QUU A;  5HWX A;  2A72 A;  3M65 A;  3AVS A;  4JLE A;  4U74 A;  4JUY A;  2LSY A;  2MYS A;  2IW5 B;  3VKG A;  3KVA A;  4BAY B;  1LKX A;  1G73 A;  5FXX A;  2JQQ A;  4IST A;  3TKL B;  2B1E A;  3ESL A;  5HXS A;  4PJN A;  2Q9Q C;  2OA5 A;  3LBX B;  5FMN A;  4L5G A;  4CQI A;  5EZY E;  2CXF A;  5A1L A;  4AQF C;  2BZB A;  3KVB A;  4PFP A;  3ZMV B;  3C98 B;  2ZM2 A;  3N9N A;  4O8S A;  1D0Z A;  3ZMU B;  4IIJ E;  3WAJ A;  2KMF A;  2RP4 A;  5JDF A;  3HL6 A;  3ZN1 B;  1FEW A;  2HPL A;  3LJC A;  4ERR A;  3AA1 B;  5L3B B;  3MKD A;  5FY0 A;  4Z8X A;  3MJX A;  3UUL A;  2XHE B;  2YU2 A;  4BA9 A;  3DTO A;  4DMW A;  3EDV A;  4PK6 A;  1D1C A;  4UV9 B;  5JDL A;  4C90 A;  3RH3 A;  1HF8 A;  4IDZ A;  4IE7 A;  3QUJ A;  5LA6 E;  3FXE B;  4AQF A;  2V7J A;  5KX5 E;  2MOZ A;  4EOZ B;  4EYU A;  2DI4 A;  4DBQ A;  2H3R A;  3N2O A;  3AB3 B;  3MZK B;  3PTR B;  2K5B B;  4HTE A;  5FNV E;  3HR0 A;  3R6N A;  3AVR A;  5F8P A;  4TV9 E;  3RX6 A;  4QX7 B;  1MMN A;  3ETU A;  1NAF A;  5J1G A;  2A2F X;  2C0S A;  4OHF A;  2W63 A;  4I43 B;  3NZP A;  5CA0 E;  2V26 A;  4QX8 B;  3FXD B;  3FB2 A;  2A3D A;  3LK4 2;  5KMG P;  4GOU A;  3V5U A;  5FYM A;  1BR0 A;  2ZM8 A;  1HG5 A;  4EZ4 A;  3C4W A;  3UFE A;  4V1A v;  1YD8 G;  4H63 V;  3HKB E;  4G2A A;  4KP3 C;  5KDM C;  2D5U A;  3ETV A;  4HEA A;  3BK9 A;  4A56 A;  3CX8 B;  1UX4 A;  2DHR A;  4DMV A;  4H63 H;  3CQC B;  4JEH B;  5LHH B;  4M1P A;  2XAJ B;  3B13 A;  5FXV A;  1YW0 A;  2IAK A;  3HA4 A;  3IF8 B;  3ZJ2 A;  3OKQ A;  2X68 A;  5DQW A;  1ZKE A;  2JJ9 A;  4WBO A;  2KZ7 B;  3RC8 A;  4O2B E;  5LCY A;  3H37 A;  3NRY A;  4C91 A;  4AKG A;  4MHC A;  2V7M A;  3SRZ A;  3ZJ1 A;  4IE5 A;  1YKE B;  5DAB A;  2X9H A;  3WAK A;  2MTQ A;  2VKH A;  2XQY A;  3PUS A;  3MK7 C;  2LSJ A;  3W15 B;  4MAL A;  4PAG A;  5LBQ B;  3VKH A;  3RC3 A;  4GYS A;  2LSG A;  1EZ3 A;  5L3E B;  2ES0 A;  1HS7 A;  3N9P A;  2CEA A;  4AKR B;  2CE7 A;  4H9R C;  4X1I E;  3RYH E;  4ANJ A;  2KXP B;  2Y6X A;  1WYB A;  4AKI A;  4HN9 A;  4EAH A;  3Q5X A;  5JH7 E;  4PJJ A;  5J2U E;  3V5S A;  4GK0 E;  3H3A A;  4U72 A;  4TX5 A;  5LGT B;  2E9X B;  4CI3 B;  4WBN E;  4XAX B;  3AA7 B;  2DWG A;  1US7 B;  4O2A E;  2SPC A;  5JQG E;  3AA0 B;  2K24 A;  4UVA B;  1AJ3 A;  2PG8 A;  4UXN B;  2X66 A;  5HXH A;  2LSI A;  4ZI3 D;  1O3X A;  4DBR A;  4ZHQ E;  3MA9 A;  1FMW A;  2Y48 B;  4TUY E;  4EXT A;  2LT3 A;  1E1H B;  5EK3 A;  2X67 A;  5LJN A;  2QGS A;  3R84 B;  2NWB A;  2P9B A;  3RRC A;  3F2E A;  4HFV A;  1G8X A;  4L9I A;  5H6Q B;  5ETW A;  3UUX B;  4XZC A;  4H9S E;  2KWI B;  2VL8 A;  5JDM A;  2X9X A;  3HI2 A;  4CXW A;  1UX5 A;  3LG7 A;  4UVB B;  2W00 A;  3FBZ A;  4IE0 A;  3O4X E;  5CB4 E;  3HKE E;  1MIV A;  2WMO A;  2LHN A;  1CUN A;  2VKO A;  3AA6 B;  3ANW B;  3EVY A;  2W62 A;  3LFM A;  3N9L A;  4MLK A;  3DJB A;  4X1Y E;  2X9Y A;  2YU1 A;  5LOV E;  4FI5 A;  2LHR A;  5L3F B;  1LVK A;  3KFW X;  2BVM A;  2IC6 A;  2CA5 A;  2CXL A;  2VK9 A;  3GMI A;  3CQG B;  3J9X 1;  5J2T E;  5JRC A;  2L9Q A;  3ZLI A;  4I50 E;  1YKH B;  2BVL A;  3N9O A;  4PK4 A;  2LSK A;  3ZCI A;  2ZM0 A;  2G0U A;  2QA7 A;  2KIN B;  4GIW A;  4CZZ B;  4ISS A;  5LHG B;  3Q9D A;  3EDU A;  3S4U A;  1MMD A;  4KUM B;  1BR4 A;  1OWA A;  3PE0 A;  3SWH A;  3UUM A;  1ZHC A;  2XTL A;  4BJN A;  2E9X C;  3WI3 A;  3ZMT B;  4J2C A;  1WYC A;  2N1G A;  2PFV A;  2LJL A;  3O1J A;  3PU8 A;  1HTJ F;  2Q9Q D;  3C4Z A;  3I0O A;  4GYR A;  3I9Y A;  4EIW A;  2VWA A;  5HAX A;  3J7Y q;  1MND A;  1D1B A;  4ZS3 A;  3I1A A;  3E22 E;  1VOM A;  3ZC0 A;  3F31 A;  5C8Y E;  1IAP A;  2MBG A;  2NW8 A;  5H6R B;  3C64 A;  1WRD A;  1MIY A;  3DP7 A;  3FBL A;  4PJM A;  2E9X A;  5AFU L;  5BMV E;  2KT9 A;  2KLQ A;  2JRK A;  3PDY A;  3O1I A;  2UXX B;  5HWY A;  3VHL A;  3UT5 E;  1Y64 B;  2RA1 A;  5JRC B;  2PJQ A;  4I4T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...