3GA8A

Structure of the n-terminal domain of the e. coli protein mqsa (ygit/b3021)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MqsA (YgiT/B3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2009-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ga8A00
3HI2A 3GN5B 3GA8A 3GN5A 3O9XA
chains in the Genus database with same CATH superfamily
5J2UE 3M3ZB 1ZP0A 4PJLA 3F2EA 3RX6A 4ISSA 4HKAA 2VL0A 4WW0A 3UTKA 5JR9C 3P4WA 3PU3A 2QGSA 4ILBA 3RRWA 3AE1A 5AQMB 2VASA 4H9QC 3ETUA 4AI6A 5AQNB 5JDMA 3ABVA 1W9RA 5JR9A 3NKZA 4CI3B 2V5CA 5JDNA 4E7ZA 2J62A 2C5KT 5HEOA 3AECA 2NOXA 3RYCE 4YJ2E 4AQFC 3BQIA 4CXWA 2PJQA 2CWYA 2LOPA 4EGWA 2ZM6T 3TLSA 2BKNA 5L3CB 2OLTA 5FP3A 1YKEB 3ESLA 3OBVE 3T1YT 3HL6A 4AQFA 2C0SA 2YK0A 3AEDA 2LEHA 1IBLT 3AE8A 4U7YA 1T98A 4DVDA 3PUAA 5AQPB 3QB5A 5C8YE 3CX8B 3LG7A 3ZSTA 5C3JA 1WFDA 2XM1A 5HCMA 2DL1A 2W0GA 4DR4T 3PJAJ 1ZOYA 4U31A 2UXDT 2BBJA 3NVOA 4EAHA 4O4JE 3QUJA 2NTXA 3PUVF 4L5GA 5LMNT 4YY3T 4YSYA 4X65T 4U3CA 4YHJA 1ZHCA 2XAHB 5LJNA 4X62T 4QKNA 4WBOA 3TKLB 4H9PC 3QC9A 2X51A 3P4SA 4L0RA 4B3TT 3N9NA 2LSGA 2OA5A 4ASKA 3VKGA 4DR5T 5TAOA 4OK0A 3MKDA 3KBTA 4CI1B 4QH1A 1YXRA 2ZM8A 2CWOA 3RRCA 4HWHA 1Y64B 4CN4A 2MAWA 3AA6B 2ZM0A 3P4RA 3UU6A 2XTLA 3WAJA 4IL9A 1NAFA 3VRAA 1J5WA 2XQ3A 2E9XC 3PDYA 3AE3A 4JI8T 4HWFA 2BS3A 2WBLA 3G06A 3P7IA 4IT4A 3P8CD 1WR0A 3OJAA 4WZXA 2WWVA 4P1NA 2K3WA 4QH5A 1MMAA 2LSKA 1XDPA 2E9XA 3FZKB 2WWUA 4KI0F 5BR8T 3AVSA 5JDFA 4TV8E 3FZMB 4EZHA 4U72A 2UUAT 3ETVA 1US7B 3PTRB 3RC3A 3P50A 3TLTA 1HX1B 2KMFA 4P0BA 1HNXT 1X9BA 2CBIA 1N32T 1CHUA 3AEEA 2VURA 2YDSA 4QWNB 5LHGB 1BR4A 5HWXA 2ZM2A 4LFBT 1WRDA 4PJMA 4DV5T 4ZXLA 1FEWA 5FY1A 3QNUA 5LHIB 4IE5A 2WAUA 3RF1A 2X9XA 4XBFB 2WSSV 2NTYA 5FXXA 4EV6A 5FXZA 1IJ6A 1HNZT 1NEKA 4HFDA 3KFWX 5HEGA 4PK6A 3UT5E 2D5UA 3UUMA 4O4LE 4Q25A 2CE7A 2R6GF 3PUYF 2CLYC 2IUBA 3ZYLA 1BR0A 3E0ZA 2IMLA 3ZLIA 2X0YA 4A97A 2VKJA 5F3JA 4X1YE 4GOUA 2ZLYA 2UU9T 1IAPA 4OX9T 4HFEA 3PV0F 3CK6A 3CWZB 4TWDA 3N9PA 5AQFB 3I0QA 2YKSA 1HG5A 2I0MA 3MA9A 4HEAA 2E9XD 1KEYA 3EUHA 4DMWA 4O8SA 4H63V 3K8PC 1OEDC 2EHOC 3NRYA 4J2CA 5JR9B 3BK9A 2H7VC 1WYBA 1QUUA 1HF8A 2JJ9A 4KMCA 2B1EA 3P4QA 4F8HA 2D0TA 4NUVA 5L3DB 4B3ST 2XQ4A 1OEDA 2EHOA 1AJ3A 4Z91A 2M6IA 4AXPA 4I4TE 4ZI3C 2HH7A 4ZS2A 1OWAA 3C50A 1I94T 4UIGA 5DQWA 5JDGA 3RIUA 2Z6EA 3GMIA 4TNVA 4DV0T 1FJGT 1E1HB 2UXCT 1QSDA 3L8RA 4ZS3A 2PTFA 4DR2T 3ZMTB 1N36T 2BVMA 3P4PA 2Q9QC 2KLQA 3D0TA 5H6RB 5LHHB 4AQYT 1U5PA 3JC6C 3UU4A 3AAEB 5FL1A 4MALA 5HXRA 2BVLA 3B5MA 2VVSA 2XJ7A 3N5LA 5L3GB 1T8BA 2Q9QA 2DNXA 3FXDB 2IAKA 2N9DA 2JMHA 1KK7A 2ODUA 2WM9A 2K24A 5LBQB 2G0UA 3K3NA 3IHRA 2JQ9A 1W09A 1YD8G 3RYHE 4CQIA 2J4GA 2W66A 4AKGA 3SRZA 4F6RC 1MNEA 2XSAA 3CIRA 2MBGA 2QVAA 2VWAA 3AVRA 3NRXA 3FBZA 5CGMA 2JQKA 3N9QA 4TZ4C 1G8XA 2MPKA 2EHOD 2HN1A 3ZT7A 4I55E 1XNQT 2NR4A 2XQ8A 4CN1A 3VU7H 2UXNB 2DWKA 3H3MA 1ZKEA 3ONXA 3VKHA 2XAJB 3HKDE 5LJMA 5J0ZA 2BG9C 3MACA 4MFRA 2FJAA 3UU8A 1DU2A 3C51A 4X20E 1UX5A 1S35A 2E9XB 5EK3A 2MOZA 3RGLA 4HFCA 5JH7E 1VCSA 3ZMZB 2WDVA 4DV7T 2DCFA 2BG9A 3ZC1A 3H37A 2E2AA 2JQQA 2P9BA 2Q9QD 2WB5A 4K0KT 4G2AA 4IIJE 3E08A 3JC6D 4TX5A 5AQKB 5KDMC 5AQVB 5LG4A 4GK0E 4BA9A 2YDQA 2BZBA 1R8IA 5F8PA 4KX6A 3UFGA 2XM2A 2IC9A 5LG3A 2RA1A 2LKHA 3CVRA 4O4HE 3ZN1B 1KNPA 3ZMUB 3ZMVB 3RPUA 2LRLA 4H9OC 2D2SA 3RI5A 3I0OA 4UV9B 3ZSSA 4X66T 1N34T 5HXHA 3N9LA 3BQLA 2JIWA 4TNWA 2X67A 5FVLA 4ILCA 4B6XA 5DJQC 1LKXA 3AEGA 5HYAA 2LJLA 4NIQA 5EK4A 5AQJB 5KMGP 3RKOA 4QHOA 1LVKA 3QB5K 2CLYB 3AEAA 5CB4E 1SUMB 3U78A 1EZ3A 4P0AA 2L8KA 2CM0A 4K0UA 4DNDA 2NWBA 3ZJ2A 5FXVA 3AA0B 1NWMX 2YOEA 3N2OA 3Q5WA 5FXWA 3UU5A 3CPZA 3KV4A 4OYKA 3PUSA 1XDOA 5HXEA 4IDPA 2X9HA 4AKHA 2NW7A 4H9NC 4QXBB 4LF8T 3V5SA 2HHHT 2WZHA 4COFA 1OEDB 2EHOB 2DWGA 5ABGA 2V7KA 4LMLA 4EIWA 1IBKT 5FY0A 2M6BA 4EYUA 2JQHA 3NBXX 4Z8XA 4A98A 2VQFT 2H3RA 1XMOT 2VKDA 1D1AA 2XPKA 3JAEA 1FIOA 3ZMSB 2V7IA 3U3IA 1M62A 3PUXF 1JNRA 4JLEA 4KP3C 2QYWA 4JV5T 1MIVA 1SE7A 4UR9A 2XUEA 1HCIA 3ZCJA 2VB6A 4GK5E 2DI4A 2L9QA 5LOVE 2Q9QB 3RH3A 2L3LA 1YW0A 4PW8A 3FXEB 3JAFA 5AQOB 3AE7A 5HEJA 4IHJE 5M4YA 1D1CA 3AEBA 2HPJA 2LOSA 1UCUA 4ZI7E 4DBQA 1J1JA 2X9WA 4EYYR 1MMGA 1SHZC 2WMOA 5IYZE 2XHEB 4PJNA 4CN6A 3ANWA 3AE9A 2OV9A 4ADZA 3UFEA 4UELA 3AE4A 4GKJT 2CXLA 3EVYA 4A56A 3QOFA 3OYZA 5GONE 2D9DA 4LF9T 3IBPA 4YSZA 4PK5A 2KWHA 1ZEEA 3L39A 2KWIB 4A5XA 3F31A 5HXCA 4IGUA 4JI5T 2A9UA 3KVBA 3KV9A 2W00A 4H9SE 4FI5A 3I1AA 2UUBT 3ZEFB 3FB2A 3DTOA 4UV8B 5L4HA 3ZKRA 4JEUB 1FMVA 2H89A 4JI2T 2LLYA 1Z8UA 3ZT5A 4DMVA 3Q5XA 2CMRA 4OYJA 1S94A 3ZYMA 2XAGB 3OKQA 1X79A 2C5IT 2XQ9A 4BJNA 4PFPA 4IDQA 2BG9B 5L4EA 4X64T 4NPPA 3SFDA 1I6ZA 3RLFF 3E22E 3GN5A 5ADXL 5CFBA 5AFUL 3R6NA 3RYIE 2I59A 4EB6E 3C98B 4LMJA 4LFAT 4GYSA 2LKGA 3FBLA 5IHYA 4GIWA 1W0BA 3VRBA 2X0HA 3RQWA 3EDVA 2VL8A 2ODVA 2WS3A 4DV6T 5HAXA 2YN6A 3KV6A 4P09A 4PAGA 4IE4A 5E0OA 1HS7A 4ZOLE 2JPFA 5AQQB 3RQUA 3CQXC 5CJ5A 3S4UA 3PUGA 3RIFA 1UX4A 3FZFB 2Y48B 4QXCB 3HI2A 1KNZA 4HWCA 3KVAA 1BR2A 3HA4A 2WDRA 4GYRA 3NZQA 5LNKA 2WY2A 4U74A 2BBHA 2V5DA 4ZZBA 4QH4A 5AQRB 2JRKA 3A7MA 5AQGB 1L0VA 4YHHT 2QRXA 2WQYA 4XZCA 2DHRA 5L47A 4CI2B 2LRKA 4JUYA 1UK5A 4Z90A 2AXDS 4DUYT 2JMKA 1SA0E 2K5BB 4IDNA 5L3EB 2V7JA 5LA6E 3BQKA 3K1SA 5LP6E 4YT0A 2H7OA 4YSXA 2VK9A 3C4WA 1CUNA 4NUUA 3TLVA 2QA7A 4MBQA 1KF6A 3N9MA 3ZPOA 3FZLB 3C4ZA 2LSYA 3AE5A 1J5ET 5JVDE 2E5VA 2YEVC 5ETWA 3ZC0A 3OYXA 5AQLB 4DR3T 1H7CA 2FJDA 4C91A 5CA1E 4XAXB 4I50E 4LMKA 4DR1T 2CHNA 4EEDA 5KX5E 1W0AA 2KT9A 5HEHA 2ES0A 3N2GE 2V6YB 3AXJB 2J1DG 4PJJA 5FY7A 3ZJ1A 3SFEA 3RC8A 2K9AA 2PG8A 4YFSA 2UXBT 2K48A 1BR1A 3O1JA 5DQVA 3UUBA 2XY8B 2CBJA 2WU2A 4KHZF 2IHR1 4UF0B 4WBNE 4OHFA 3KDSE 4M1PA 5LB7B 1WLXA 4TN7B 2IC6A 3LK2B 3ZCIA 2ZMAA 3DP7A 4ZI3D 3I9YA 1IBMT 1IJ5A 3ANWB 3IEEA 3UUNA 3PJAA 2X66A 2W2UA 3O4XE 5JREA 2XSBA 3J7Yq 3PE0A 4TWFA 3EDUA 4GKKT 3AB3B 3QK6A 1HG2A 3RHWA 3I9WA 1LRZA 2YU1A 1D0XA 2W63A 2CXDA 5EZYE 3RIAA 1MIYA 1YQ3A 3NZPA 1MMNA 2IW5B 2BS4A 3LBXA 5LGNB 4HWIB 1WYCA 2LSJA 4YTNA 3AA1B 3WI3A 4B3RT 4U2ZA 4ISTA 3ZYKA 1YQ4A 4U2YA 4HE8A 4YJ3E 1KFYA 2ACZA 5JRCA 2A72A 2KXPB 5LBMA 3V5UA 5LYJE 3AE6A 3T1HT 4ZHQE 1OXZA 3JCFA 4DV4T 3GN5B 4E7SA 4EXTA 3K3OA 1D0YA 2WP9A 4N78D 2NW9A 2PFVA 1MNDA 4EZ4A 3N9OA 3PUQA 4BJMA 4ZI2C 4L9IA 3C64A 5IWAT 3O1IA 3R84B 4X1KE 4UVBB 2N2NA 5EK2A 2D0UA 4O2AE 2VKOA 3CX6B 2W67A 1XNRT 1E7PA 4KHPT 4LF5T 4C90A 4DV1T 4B3MT 5LCYA 4CZZB 1OEDE 5ABFA 5LMUT 3SWHA 4JEHB 3J9X1 5DABA 4QX7B 4DV2T 1Y01A 3LK42 3AE2A 4H9RC 1JNZA 3H3AA 3GWHA 2V7MA 3UUXB 5AQTB 4JBWF 4JI7T 4JI4T 1M7KA 4IDOA 2MYSA 2WZIA 1QLBA 3C4XA 4X1IE 4FJOA 5L3FB 2VQET 3PU8A 5HCJA 3SS1A 4AQGA 1G73A 4HFBA 1VOMA 3MZKB 2M67A 2CEAA 5L3BB 4I0UA 3W15B 1D1BA 3TLUA 2IIUA 2XQ6A 5AQHB 4HFHA 3O1HA 4IE6A 4HGAA 3LFMA 3CQCB 5LGTB 3X1DA 2V6YA 3AXJA 1MMDA 2J47A 3CMLA 4JI1T 2E5LT 4IDZA 5JDHA 4AIUA 1UURA 2XAQB 1XMQT 2N1GA 2YINA 5AQUB 4PK4A 2UXXB 4DR6T 2BS2A 1B7TA 1HR0T 2Y6XA 4UF0A 4DIDB 3L09A 1IZNB 4H63H 4ZI2D 1VCTA 5JDQA 5HEUA 2LM9A 1HTJF 2HPLA 3F57A 4U33A 2CHOA 3GA8A 3ZN0B 2H88A 1UUSA 2CPTA 1LVFA 2AE9A 2V26A 3PUWF 3SOLA 2WCAA 3WAKA 2I6HA 5L2LA 4WYVA 4EOZB 2WU5A 4PNIA 2A2FX 2CCQA 3Q2MA 2CA5A 3HR0A 4YXDA 5JTGA 3AA7B 3LJCA 2IDOB 4HFIA 1ZV4X 3IF8B 4IL4A 2NW8A 4WNKA 4AKLA 3NWIA 2XQ5A 4QX8B 1YKHB 3VHLA 3RYFE 4ILUA 2HN2A 2BG9E 5J1GA 3VR8A 2ACXA 5FNVE 4DV3T 5JDLA 2PBIA 2LSIA 3T8OA 3KBUA 2Y8DA 1O3XA 4KBMB 1HNWT 3AAIA 4HN9A 3HKBE 1U4QA 5ABEA 3OVUA 4BAYB 3LBXB 5C2TA 5AQSB 2XQAA 4G63A 4DUZT 4HFVA 5HWYA 4AISA 4O4IE 4ERRA 3AEFA 1XWMA 3UQ7A 3A8YC 5KXJA 3O9XA 2YDRA 4ZZCA 2C5JA 2WDQA 3Q5EA 2YU2A 4UXNB 5JRCB 3UU3A 4TUYE 2GK9A 4MLKA 5HXSA 5LGUB 5H6QB 2KZ7B 4UEMA 5IUXA 1WCRA 2KINB 2CXFA 4I43B 3N2KE 2XASB 2V7LA 4JI6T 2WMNA 5CA0E 5J2TE 3JADA 4NXMT 2XAFB 5FL0A 2FBWA 3RKGA 5JQGE 3ONLC 2RP4A 4V1Av 2W4XA 2XZEA 2A3DA 3MK7C 1UGOA 4PFOA 3PUZF 2RPAA 3RIUC 2LM2A 2LE8A 2NP9A 2XQ7A 4JI0T 4JYAT 3EAMA 3K3QC 4UVAB 1HFAA 5AQIB 2LT3A 5ABFB 3HKCE 4IREA 4IE7A 1WR6A 4LF4T 2CRBA 3LSVA 4LF6T 4TV9E 3OTOT 3OPCA 5ABHA 3PURA 3A5XA 2KSRA 2E8IA 2X68A 3MJXA 1T7SA 3DJBA 4JI3T 5FMNA 2LHRA 4CXYA 4X5TA 3Q9DA 4DR7T 2F4VT 1XZYA 4MHCA 4IE0A 5BMVE 4TWHA 3LDQB 2BDEA 1GQEA 2VVNA 2W61A 2BKOA 2XQYA 2V6XA 2X0LB 4HTEA 4HWDA 3KINB 1HX8A 3B13A 3LK3B 4YTPA 4DBRA 1VRBA 2X9YA 3ONJA 4YLHA 1FMWA 3VR9A 5LXTE 2KNDA 1E2AA 4CXXA 3B57A 2FJEA 2MTQA 3M65A 4ILAA 4EEBA 4UVCB 2B76A 3FHNA 4ZEYA 3AAAB 4AKRB 2SPCA 5FVKA 2UUCT 1D0ZA 4O2BE 2LHNA 3UULA 3KV5A 2V8SV 4KUMB 3L3PA 4ANJA 3CKDA 1V9DA 4YTMA 4AKIA 3EI0A 4QXHB 3CQGB 1MIWA 3EHZA 5FYMA 3UQ4A 2W62A 2BKPA 2FJBA 1NENA 5A1LA 3IA3A 2FUPA 4LF7T 1N33T 3TLWA 4U7IA 2V1DB 3MXZA 4LFCT 4OFZA 3Q5DA 5FKYA 1Z0PA 3FZHB 2DLRA 1KNRA 4DO0A 3EABA 1T72A 3CX7B 2VKHA 5F5WA 3HKEE 3ZT6A 4NXNT
chains in the Genus database with same CATH topology
5L3GB 5J2UE 3E22E 2Q9QA 3GN5A 3O1HA 2DNXA 3FXDB 2IAKA 4HGAA 4IE6A 5ADXL 4PJLA 5AFUL 2N9DA 3LFMA 3R6NA 3F2EA 3RX6A 3RYIE 2I59A 2JMHA 1KK7A 3C98B 3CQCB 4EB6E 2ODUA 4ISSA 5LGTB 4HKAA 2WM9A 4WW0A 2K24A 1MMDA 3UTKA 5LBQB 5JR9C 4GYSA 2G0UA 3K3NA 3CMLA 3PU3A 2QGSA 3RRWA 3FBLA 5IHYA 3IHRA 4IDZA 5JDHA 2VASA 4GIWA 2XAQB 1YD8G 4H9QC 3ETUA 2N1GA 2YINA 4AI6A 3RYHE 4PK4A 2UXXB 4CQIA 5JDMA 3EDVA 1B7TA 2VL8A 2ODVA 4AKGA 3SRZA 4F6RC 2Y6XA 1MNEA 4UF0A 5HAXA 5JR9A 3L09A 4CI3B 4YJ2E 5JDNA 4E7ZA 2MBGA 1IZNB 3KV6A 4H63H 4ZI2D 2C5KT 5JDQA 2NOXA 2VWAA 2LM9A 3AVRA 3RYCE 1HTJF 4AQFC 4P09A 3NRXA 3BQIA 4IE4A 3FBZA 4PAGA 5E0OA 2HPLA 3F57A 4CXWA 2PJQA 1HS7A 2CWYA 2LOPA 3GA8A 3N9QA 3ZN0B 4ZOLE 2JPFA 1LVFA 4TZ4C 1G8XA 2V26A 2EHOD 3CQXC 3S4UA 5L3CB 3PUGA 3SOLA 5FP3A 1UX4A 4I55E 1YKEB 2Y48B 4QXCB 3WAKA 3HI2A 1KNZA 3ESLA 3OBVE 5L2LA 3KVAA 1BR2A 3HL6A 4EOZB 3HA4A 4AQFA 2C0SA 3VU7H 4PNIA 2UXNB 4GYRA 2YK0A 2A2FX 2CCQA 2DWKA 3Q2MA 1ZKEA 3ONXA 2CA5A 2LEHA 3VKHA 2XAJB 3HKDE 5LJMA 3HR0A 3NZQA 3AA7B 5LNKA 1T98A 3LJCA 4U74A 4DVDA 3PUAA 3MACA 1ZV4X 4MFRA 3IF8B 5C8YE 2NW8A 3CX8B 3C51A 3LG7A 4X20E 1UX5A 4WNKA 2JRKA 4AKLA 1S35A 2E9XB 4QX8B 5EK3A 2MOZA 2W0GA 1YKHB 3VHLA 5JH7E 3ZMZB 3RYFE 2DCFA 4ILUA 4XZCA 2DHRA 3ZC1A 5J1GA 3H37A 2ACXA 5FNVE 2JQQA 4CI2B 5JDLA 2P9BA 4EAHA 2PBIA 4JUYA 3QUJA 2LSIA 4O4JE 2Q9QD 2NTXA 3T8OA 3KBUA 4G2AA 4IIJE 4L5GA 2Y8DA 1O3XA 3E08A 2JMKA 3JC6D 1SA0E 2K5BB 4KBMB 4TX5A 5L3EB 4YHJA 2V7JA 3AAIA 5LA6E 1ZHCA 2XAHB 5KDMC 5LJNA 4HN9A 3BQKA 4QKNA 3HKBE 4WBOA 3TKLB 5LG4A 4GK0E 1U4QA 4BA9A 5LP6E 2BZBA 4H9PC 2H7OA 3QC9A 2X51A 2VK9A 5F8PA 4BAYB 3C4WA 4L0RA 3LBXB 2IC9A 3N9NA 2LSGA 2OA5A 4ASKA 4G63A 1CUNA 4NUUA 3VKGA 2QA7A 2RA1A 3CVRA 4HFVA 5HWYA 5TAOA 4O4HE 3ZN1B 4O4IE 4MBQA 3ZMUB 4OK0A 4ERRA 3N9MA 3ZMVB 3RPUA 3ZPOA 3C4ZA 3MKDA 4H9OC 2D2SA 2LSYA 3KBTA 4CI1B 3I0OA 5JVDE 2YEVC 4UV9B 5ETWA 3O9XA 5HXHA 3ZC0A 3N9LA 3OYXA 3BQLA 2C5JA 2ZM8A 2CWOA 2X67A 1H7CA 2YU2A 4UXNB 3RRCA 5JRCB 4B6XA 5DJQC 4C91A 5CA1E 4XAXB 4I50E 1LKXA 1Y64B 5KX5E 2KT9A 4TUYE 2GK9A 4MLKA 5HXSA 5HYAA 5LGUB 5H6QB 2KZ7B 2LJLA 3AA6B 2ES0A 3N2GE 2ZM0A 4UEMA 5EK4A 2CXFA 2KINB 2J1DG 4I43B 3N2KE 2XTLA 3WAJA 5KMGP 4PJJA 5FY7A 2XASB 1NAFA 3RKOA 2V7LA 4QHOA 3ZJ1A 3RC8A 2K9AA 1LVKA 2PG8A 2E9XC 4YFSA 2WMNA 5CA0E 5J2TE 2CLYB 5CB4E 3U78A 3PDYA 1EZ3A 2K48A 1BR1A 4P0AA 2L8KA 2CM0A 2XAFB 3O1JA 5DQVA 4K0UA 4DNDA 2WBLA 3P7IA 3P8CD 3OJAA 5JQGE 4UF0B 4WBNE 4OHFA 2RP4A 1MMAA 4V1Av 3KDSE 2LSKA 2NWBA 4M1PA 1WLXA 3ZJ2A 4TN7B 2IC6A 2A3DA 3AA0B 5FXVA 3MK7C 2E9XA 3LK2B 1NWMX 3N2OA 3ZCIA 4PFOA 2WWUA 3Q5WA 3AVSA 2ZMAA 3DP7A 3I9YA 5JDFA 4TV8E 5FXWA 1IJ5A 2LE8A 3ANWB 3IEEA 3CPZA 4ZI3D 3UUNA 2NP9A 4EZHA 2X66A 3KV4A 4OYKA 4U72A 3ETVA 3O4XE 1US7B 3K3QC 3PTRB 3PUSA 5JREA 3RC3A 4UVAB 5HXEA 2X9HA 4AKHA 2KMFA 4P0BA 2NW7A 4H9NC 1HFAA 3J7Yq 3PE0A 4QWNB 5LHGB 1BR4A 4QXBB 3EDUA 3V5SA 3AB3B 3QK6A 5HWXA 2ZM2A 1HG2A 3I9WA 1LRZA 2YU1A 1D0XA 2LT3A 2EHOB 1WRDA 2DWGA 2W63A 2CXDA 3HKCE 4PJMA 1FEWA 2V7KA 5FY1A 5EZYE 5LHIB 4IE5A 4IE7A 1WR6A 4EIWA 1MIYA 2WAUA 5FY0A 3NZPA 1MMNA 2IW5B 2X9XA 4TV9E 4EYUA 3NBXX 3LBXA 4XBFB 2WSSV 2NTYA 4Z8XA 5FXXA 3PURA 3A5XA 2H3RA 2E8IA 2X68A 5FXZA 5LGNB 1IJ6A 3MJXA 3DJBA 1WYCA 2LSJA 3AA1B 2VKDA 1D1AA 3KFWX 5FMNA 4PK6A 3UT5E 2LHRA 4CXYA 1FIOA 2D5UA 3WI3A 3ZMSB 3Q9DA 3UUMA 2V7IA 4O4LE 2CE7A 4ISTA 3ZYKA 4HE8A 4MHCA 3U3IA 4YJ3E 4IE0A 2CLYC 3ZYLA 1BR0A 3E0ZA 5BMVE 5JRCA 2A72A 3ZLIA 2BDEA 2KXPB 5LBMA 2W61A 3V5UA 4JLEA 4KP3C 2VKJA 2XQYA 1MIVA 5LYJE 2X0LB 5F3JA 4X1YE 4ZHQE 2XUEA 1HCIA 4HTEA 3KINB 3ZCJA 2VB6A 4GK5E 1HX8A 2DI4A 1OXZA 2L9QA 3B13A 5LOVE 2Q9QB 3GN5B 2L3LA 3RH3A 3LK3B 2ZLYA 4GOUA 1YW0A 4E7SA 4EXTA 4DBRA 1VRBA 2X9YA 3K3OA 1D0YA 4PW8A 3FXEB 1IAPA 4YLHA 4N78D 1FMWA 2NW9A 4IHJE 5LXTE 5M4YA 2PFVA 1MNDA 2KNDA 4EZ4A 1D1CA 3CWZB 3N9OA 3PUQA 4CXXA 2HPJA 4BJMA 4ZI2C 2LOSA 3B57A 1UCUA 3N9PA 4ZI7E 4L9IA 4DBQA 3I0QA 3C64A 2MTQA 2X9WA 1HG5A 3M65A 3O1IA 4EYYR 3R84B 3MA9A 4HEAA 1MMGA 2E9XD 4X1KE 1SHZC 4UVBB 2WMOA 4UVCB 2N2NA 3EUHA 5IYZE 4DMWA 4O8SA 5EK2A 3FHNA 3AAAB 2XHEB 2D0UA 4AKRB 4O2AE 2SPCA 4PJNA 4H63V 3K8PC 3ANWA 2EHOC 3NRYA 2VKOA 4J2CA 3CX6B 5JR9B 3BK9A 4ADZA 2H7VC 3UFEA 1D0ZA 4UELA 4O2BE 2LHNA 3UULA 1WYBA 3KV5A 2CXLA 3EVYA 1QUUA 1HF8A 2JJ9A 4KMCA 4A56A 4KUMB 4C90A 3OYZA 5GONE 3L3PA 5LCYA 4ANJA 2B1EA 3IBPA 3CKDA 2D0TA 4PK5A 2KWHA 4NUVA 1ZEEA 5L3DB 4CZZB 2KWIB 1V9DA 2EHOA 4AKIA 1AJ3A 3F31A 3SWHA 5HXCA 4JEHB 3CQGB 4QXHB 4IGUA 1MIWA 4AXPA 3J9X1 4I4TE 4ZI3C 5FYMA 5DABA 2HH7A 4ZS2A 3KVBA 2W62A 2W00A 3KV9A 4H9SE 4FI5A 3LK42 1OWAA 3C50A 3I1AA 4QX7B 4H9RC 4UIGA 5DQWA 5JDGA 5A1LA 2Z6EA 3ZEFB 3GMIA 3FB2A 3DTOA 4UV8B 3H3AA 2V1DB 3GWHA 2V7MA 3MXZA 1E1HB 4OFZA 3UUXB 4JEUB 1QSDA 1FMVA 4ZS3A 2MYSA 1Z0PA 3ZMTB 2DLRA 3C4XA 4X1IE 4DO0A 4FJOA 2BVMA 4DMVA 5L3FB 3Q5XA 3PU8A 2CMRA 4OYJA 1S94A 3ZYMA 2Q9QC 2XAGB 2KLQA 3SS1A 3D0TA 5H6RB 1G73A 4AQGA 5LHHB 3CX7B 1VOMA 3MZKB 1U5PA 3OKQA 1X79A 3JC6C 2C5IT 2M67A 2CEAA 2VKHA 3AAEB 4BJNA 5L3BB 4PFPA 3W15B 1D1BA 3HKEE 4MALA 5HXRA 2BVLA 3N5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HI2 A;  3GN5 B;  3GA8 A;  3GN5 A;  3O9X A; 
#chains in the Genus database with same CATH topology
 5J2U E;  3M3Z B;  1ZP0 A;  4PJL A;  3F2E A;  3RX6 A;  4ISS A;  4HKA A;  2VL0 A;  4WW0 A;  3UTK A;  5JR9 C;  3P4W A;  3PU3 A;  2QGS A;  4ILB A;  3RRW A;  3AE1 A;  5AQM B;  2VAS A;  4H9Q C;  3ETU A;  4AI6 A;  5AQN B;  5JDM A;  3ABV A;  1W9R A;  5JR9 A;  3NKZ A;  4CI3 B;  2V5C A;  5JDN A;  4E7Z A;  2J62 A;  2C5K T;  5HEO A;  3AEC A;  2NOX A;  3RYC E;  4YJ2 E;  4AQF C;  3BQI A;  4CXW A;  2PJQ A;  2CWY A;  2LOP A;  4EGW A;  2ZM6 T;  3TLS A;  2BKN A;  5L3C B;  2OLT A;  5FP3 A;  1YKE B;  3ESL A;  3OBV E;  3T1Y T;  3HL6 A;  4AQF A;  2C0S A;  2YK0 A;  3AED A;  2LEH A;  1IBL T;  3AE8 A;  4U7Y A;  1T98 A;  4DVD A;  3PUA A;  5AQP B;  3QB5 A;  5C8Y E;  3CX8 B;  3LG7 A;  3ZST A;  5C3J A;  1WFD A;  2XM1 A;  5HCM A;  2DL1 A;  2W0G A;  4DR4 T;  3PJA J;  1ZOY A;  4U31 A;  2UXD T;  2BBJ A;  3NVO A;  4EAH A;  4O4J E;  3QUJ A;  2NTX A;  3PUV F;  4L5G A;  5LMN T;  4YY3 T;  4YSY A;  4X65 T;  4U3C A;  4YHJ A;  1ZHC A;  2XAH B;  5LJN A;  4X62 T;  4QKN A;  4WBO A;  3TKL B;  4H9P C;  3QC9 A;  2X51 A;  3P4S A;  4L0R A;  4B3T T;  3N9N A;  2LSG A;  2OA5 A;  4ASK A;  3VKG A;  4DR5 T;  5TAO A;  4OK0 A;  3MKD A;  3KBT A;  4CI1 B;  4QH1 A;  1YXR A;  2ZM8 A;  2CWO A;  3RRC A;  4HWH A;  1Y64 B;  4CN4 A;  2MAW A;  3AA6 B;  2ZM0 A;  3P4R A;  3UU6 A;  2XTL A;  3WAJ A;  4IL9 A;  1NAF A;  3VRA A;  1J5W A;  2XQ3 A;  2E9X C;  3PDY A;  3AE3 A;  4JI8 T;  4HWF A;  2BS3 A;  2WBL A;  3G06 A;  3P7I A;  4IT4 A;  3P8C D;  1WR0 A;  3OJA A;  4WZX A;  2WWV A;  4P1N A;  2K3W A;  4QH5 A;  1MMA A;  2LSK A;  1XDP A;  2E9X A;  3FZK B;  2WWU A;  4KI0 F;  5BR8 T;  3AVS A;  5JDF A;  4TV8 E;  3FZM B;  4EZH A;  4U72 A;  2UUA T;  3ETV A;  1US7 B;  3PTR B;  3RC3 A;  3P50 A;  3TLT A;  1HX1 B;  2KMF A;  4P0B A;  1HNX T;  1X9B A;  2CBI A;  1N32 T;  1CHU A;  3AEE A;  2VUR A;  2YDS A;  4QWN B;  5LHG B;  1BR4 A;  5HWX A;  2ZM2 A;  4LFB T;  1WRD A;  4PJM A;  4DV5 T;  4ZXL A;  1FEW A;  5FY1 A;  3QNU A;  5LHI B;  4IE5 A;  2WAU A;  3RF1 A;  2X9X A;  4XBF B;  2WSS V;  2NTY A;  5FXX A;  4EV6 A;  5FXZ A;  1IJ6 A;  1HNZ T;  1NEK A;  4HFD A;  3KFW X;  5HEG A;  4PK6 A;  3UT5 E;  2D5U A;  3UUM A;  4O4L E;  4Q25 A;  2CE7 A;  2R6G F;  3PUY F;  2CLY C;  2IUB A;  3ZYL A;  1BR0 A;  3E0Z A;  2IML A;  3ZLI A;  2X0Y A;  4A97 A;  2VKJ A;  5F3J A;  4X1Y E;  4GOU A;  2ZLY A;  2UU9 T;  1IAP A;  4OX9 T;  4HFE A;  3PV0 F;  3CK6 A;  3CWZ B;  4TWD A;  3N9P A;  5AQF B;  3I0Q A;  2YKS A;  1HG5 A;  2I0M A;  3MA9 A;  4HEA A;  2E9X D;  1KEY A;  3EUH A;  4DMW A;  4O8S A;  4H63 V;  3K8P C;  1OED C;  2EHO C;  3NRY A;  4J2C A;  5JR9 B;  3BK9 A;  2H7V C;  1WYB A;  1QUU A;  1HF8 A;  2JJ9 A;  4KMC A;  2B1E A;  3P4Q A;  4F8H A;  2D0T A;  4NUV A;  5L3D B;  4B3S T;  2XQ4 A;  1OED A;  2EHO A;  1AJ3 A;  4Z91 A;  2M6I A;  4AXP A;  4I4T E;  4ZI3 C;  2HH7 A;  4ZS2 A;  1OWA A;  3C50 A;  1I94 T;  4UIG A;  5DQW A;  5JDG A;  3RIU A;  2Z6E A;  3GMI A;  4TNV A;  4DV0 T;  1FJG T;  1E1H B;  2UXC T;  1QSD A;  3L8R A;  4ZS3 A;  2PTF A;  4DR2 T;  3ZMT B;  1N36 T;  2BVM A;  3P4P A;  2Q9Q C;  2KLQ A;  3D0T A;  5H6R B;  5LHH B;  4AQY T;  1U5P A;  3JC6 C;  3UU4 A;  3AAE B;  5FL1 A;  4MAL A;  5HXR A;  2BVL A;  3B5M A;  2VVS A;  2XJ7 A;  3N5L A;  5L3G B;  1T8B A;  2Q9Q A;  2DNX A;  3FXD B;  2IAK A;  2N9D A;  2JMH A;  1KK7 A;  2ODU A;  2WM9 A;  2K24 A;  5LBQ B;  2G0U A;  3K3N A;  3IHR A;  2JQ9 A;  1W09 A;  1YD8 G;  3RYH E;  4CQI A;  2J4G A;  2W66 A;  4AKG A;  3SRZ A;  4F6R C;  1MNE A;  2XSA A;  3CIR A;  2MBG A;  2QVA A;  2VWA A;  3AVR A;  3NRX A;  3FBZ A;  5CGM A;  2JQK A;  3N9Q A;  4TZ4 C;  1G8X A;  2MPK A;  2EHO D;  2HN1 A;  3ZT7 A;  4I55 E;  1XNQ T;  2NR4 A;  2XQ8 A;  4CN1 A;  3VU7 H;  2UXN B;  2DWK A;  3H3M A;  1ZKE A;  3ONX A;  3VKH A;  2XAJ B;  3HKD E;  5LJM A;  5J0Z A;  2BG9 C;  3MAC A;  4MFR A;  2FJA A;  3UU8 A;  1DU2 A;  3C51 A;  4X20 E;  1UX5 A;  1S35 A;  2E9X B;  5EK3 A;  2MOZ A;  3RGL A;  4HFC A;  5JH7 E;  1VCS A;  3ZMZ B;  2WDV A;  4DV7 T;  2DCF A;  2BG9 A;  3ZC1 A;  3H37 A;  2E2A A;  2JQQ A;  2P9B A;  2Q9Q D;  2WB5 A;  4K0K T;  4G2A A;  4IIJ E;  3E08 A;  3JC6 D;  4TX5 A;  5AQK B;  5KDM C;  5AQV B;  5LG4 A;  4GK0 E;  4BA9 A;  2YDQ A;  2BZB A;  1R8I A;  5F8P A;  4KX6 A;  3UFG A;  2XM2 A;  2IC9 A;  5LG3 A;  2RA1 A;  2LKH A;  3CVR A;  4O4H E;  3ZN1 B;  1KNP A;  3ZMU B;  3ZMV B;  3RPU A;  2LRL A;  4H9O C;  2D2S A;  3RI5 A;  3I0O A;  4UV9 B;  3ZSS A;  4X66 T;  1N34 T;  5HXH A;  3N9L A;  3BQL A;  2JIW A;  4TNW A;  2X67 A;  5FVL A;  4ILC A;  4B6X A;  5DJQ C;  1LKX A;  3AEG A;  5HYA A;  2LJL A;  4NIQ A;  5EK4 A;  5AQJ B;  5KMG P;  3RKO A;  4QHO A;  1LVK A;  3QB5 K;  2CLY B;  3AEA A;  5CB4 E;  1SUM B;  3U78 A;  1EZ3 A;  4P0A A;  2L8K A;  2CM0 A;  4K0U A;  4DND A;  2NWB A;  3ZJ2 A;  5FXV A;  3AA0 B;  1NWM X;  2YOE A;  3N2O A;  3Q5W A;  5FXW A;  3UU5 A;  3CPZ A;  3KV4 A;  4OYK A;  3PUS A;  1XDO A;  5HXE A;  4IDP A;  2X9H A;  4AKH A;  2NW7 A;  4H9N C;  4QXB B;  4LF8 T;  3V5S A;  2HHH T;  2WZH A;  4COF A;  1OED B;  2EHO B;  2DWG A;  5ABG A;  2V7K A;  4LML A;  4EIW A;  1IBK T;  5FY0 A;  2M6B A;  4EYU A;  2JQH A;  3NBX X;  4Z8X A;  4A98 A;  2VQF T;  2H3R A;  1XMO T;  2VKD A;  1D1A A;  2XPK A;  3JAE A;  1FIO A;  3ZMS B;  2V7I A;  3U3I A;  1M62 A;  3PUX F;  1JNR A;  4JLE A;  4KP3 C;  2QYW A;  4JV5 T;  1MIV A;  1SE7 A;  4UR9 A;  2XUE A;  1HCI A;  3ZCJ A;  2VB6 A;  4GK5 E;  2DI4 A;  2L9Q A;  5LOV E;  2Q9Q B;  3RH3 A;  2L3L A;  1YW0 A;  4PW8 A;  3FXE B;  3JAF A;  5AQO B;  3AE7 A;  5HEJ A;  4IHJ E;  5M4Y A;  1D1C A;  3AEB A;  2HPJ A;  2LOS A;  1UCU A;  4ZI7 E;  4DBQ A;  1J1J A;  2X9W A;  4EYY R;  1MMG A;  1SHZ C;  2WMO A;  5IYZ E;  2XHE B;  4PJN A;  4CN6 A;  3ANW A;  3AE9 A;  2OV9 A;  4ADZ A;  3UFE A;  4UEL A;  3AE4 A;  4GKJ T;  2CXL A;  3EVY A;  4A56 A;  3QOF A;  3OYZ A;  5GON E;  2D9D A;  4LF9 T;  3IBP A;  4YSZ A;  4PK5 A;  2KWH A;  1ZEE A;  3L39 A;  2KWI B;  4A5X A;  3F31 A;  5HXC A;  4IGU A;  4JI5 T;  2A9U A;  3KVB A;  3KV9 A;  2W00 A;  4H9S E;  4FI5 A;  3I1A A;  2UUB T;  3ZEF B;  3FB2 A;  3DTO A;  4UV8 B;  5L4H A;  3ZKR A;  4JEU B;  1FMV A;  2H89 A;  4JI2 T;  2LLY A;  1Z8U A;  3ZT5 A;  4DMV A;  3Q5X A;  2CMR A;  4OYJ A;  1S94 A;  3ZYM A;  2XAG B;  3OKQ A;  1X79 A;  2C5I T;  2XQ9 A;  4BJN A;  4PFP A;  4IDQ A;  2BG9 B;  5L4E A;  4X64 T;  4NPP A;  3SFD A;  1I6Z A;  3RLF F;  3E22 E;  3GN5 A;  5ADX L;  5CFB A;  5AFU L;  3R6N A;  3RYI E;  2I59 A;  4EB6 E;  3C98 B;  4LMJ A;  4LFA T;  4GYS A;  2LKG A;  3FBL A;  5IHY A;  4GIW A;  1W0B A;  3VRB A;  2X0H A;  3RQW A;  3EDV A;  2VL8 A;  2ODV A;  2WS3 A;  4DV6 T;  5HAX A;  2YN6 A;  3KV6 A;  4P09 A;  4PAG A;  4IE4 A;  5E0O A;  1HS7 A;  4ZOL E;  2JPF A;  5AQQ B;  3RQU A;  3CQX C;  5CJ5 A;  3S4U A;  3PUG A;  3RIF A;  1UX4 A;  3FZF B;  2Y48 B;  4QXC B;  3HI2 A;  1KNZ A;  4HWC A;  3KVA A;  1BR2 A;  3HA4 A;  2WDR A;  4GYR A;  3NZQ A;  5LNK A;  2WY2 A;  4U74 A;  2BBH A;  2V5D A;  4ZZB A;  4QH4 A;  5AQR B;  2JRK A;  3A7M A;  5AQG B;  1L0V A;  4YHH T;  2QRX A;  2WQY A;  4XZC A;  2DHR A;  5L47 A;  4CI2 B;  2LRK A;  4JUY A;  1UK5 A;  4Z90 A;  2AXD S;  4DUY T;  2JMK A;  1SA0 E;  2K5B B;  4IDN A;  5L3E B;  2V7J A;  5LA6 E;  3BQK A;  3K1S A;  5LP6 E;  4YT0 A;  2H7O A;  4YSX A;  2VK9 A;  3C4W A;  1CUN A;  4NUU A;  3TLV A;  2QA7 A;  4MBQ A;  1KF6 A;  3N9M A;  3ZPO A;  3FZL B;  3C4Z A;  2LSY A;  3AE5 A;  1J5E T;  5JVD E;  2E5V A;  2YEV C;  5ETW A;  3ZC0 A;  3OYX A;  5AQL B;  4DR3 T;  1H7C A;  2FJD A;  4C91 A;  5CA1 E;  4XAX B;  4I50 E;  4LMK A;  4DR1 T;  2CHN A;  4EED A;  5KX5 E;  1W0A A;  2KT9 A;  5HEH A;  2ES0 A;  3N2G E;  2V6Y B;  3AXJ B;  2J1D G;  4PJJ A;  5FY7 A;  3ZJ1 A;  3SFE A;  3RC8 A;  2K9A A;  2PG8 A;  4YFS A;  2UXB T;  2K48 A;  1BR1 A;  3O1J A;  5DQV A;  3UUB A;  2XY8 B;  2CBJ A;  2WU2 A;  4KHZ F;  2IHR 1;  4UF0 B;  4WBN E;  4OHF A;  3KDS E;  4M1P A;  5LB7 B;  1WLX A;  4TN7 B;  2IC6 A;  3LK2 B;  3ZCI A;  2ZMA A;  3DP7 A;  4ZI3 D;  3I9Y A;  1IBM T;  1IJ5 A;  3ANW B;  3IEE A;  3UUN A;  3PJA A;  2X66 A;  2W2U A;  3O4X E;  5JRE A;  2XSB A;  3J7Y q;  3PE0 A;  4TWF A;  3EDU A;  4GKK T;  3AB3 B;  3QK6 A;  1HG2 A;  3RHW A;  3I9W A;  1LRZ A;  2YU1 A;  1D0X A;  2W63 A;  2CXD A;  5EZY E;  3RIA A;  1MIY A;  1YQ3 A;  3NZP A;  1MMN A;  2IW5 B;  2BS4 A;  3LBX A;  5LGN B;  4HWI B;  1WYC A;  2LSJ A;  4YTN A;  3AA1 B;  3WI3 A;  4B3R T;  4U2Z A;  4IST A;  3ZYK A;  1YQ4 A;  4U2Y A;  4HE8 A;  4YJ3 E;  1KFY A;  2ACZ A;  5JRC A;  2A72 A;  2KXP B;  5LBM A;  3V5U A;  5LYJ E;  3AE6 A;  3T1H T;  4ZHQ E;  1OXZ A;  3JCF A;  4DV4 T;  3GN5 B;  4E7S A;  4EXT A;  3K3O A;  1D0Y A;  2WP9 A;  4N78 D;  2NW9 A;  2PFV A;  1MND A;  4EZ4 A;  3N9O A;  3PUQ A;  4BJM A;  4ZI2 C;  4L9I A;  3C64 A;  5IWA T;  3O1I A;  3R84 B;  4X1K E;  4UVB B;  2N2N A;  5EK2 A;  2D0U A;  4O2A E;  2VKO A;  3CX6 B;  2W67 A;  1XNR T;  1E7P A;  4KHP T;  4LF5 T;  4C90 A;  4DV1 T;  4B3M T;  5LCY A;  4CZZ B;  1OED E;  5ABF A;  5LMU T;  3SWH A;  4JEH B;  3J9X 1;  5DAB A;  4QX7 B;  4DV2 T;  1Y01 A;  3LK4 2;  3AE2 A;  4H9R C;  1JNZ A;  3H3A A;  3GWH A;  2V7M A;  3UUX B;  5AQT B;  4JBW F;  4JI7 T;  4JI4 T;  1M7K A;  4IDO A;  2MYS A;  2WZI A;  1QLB A;  3C4X A;  4X1I E;  4FJO A;  5L3F B;  2VQE T;  3PU8 A;  5HCJ A;  3SS1 A;  4AQG A;  1G73 A;  4HFB A;  1VOM A;  3MZK B;  2M67 A;  2CEA A;  5L3B B;  4I0U A;  3W15 B;  1D1B A;  3TLU A;  2IIU A;  2XQ6 A;  5AQH B;  4HFH A;  3O1H A;  4IE6 A;  4HGA A;  3LFM A;  3CQC B;  5LGT B;  3X1D A;  2V6Y A;  3AXJ A;  1MMD A;  2J47 A;  3CML A;  4JI1 T;  2E5L T;  4IDZ A;  5JDH A;  4AIU A;  1UUR A;  2XAQ B;  1XMQ T;  2N1G A;  2YIN A;  5AQU B;  4PK4 A;  2UXX B;  4DR6 T;  2BS2 A;  1B7T A;  1HR0 T;  2Y6X A;  4UF0 A;  4DID B;  3L09 A;  1IZN B;  4H63 H;  4ZI2 D;  1VCT A;  5JDQ A;  5HEU A;  2LM9 A;  1HTJ F;  2HPL A;  3F57 A;  4U33 A;  2CHO A;  3GA8 A;  3ZN0 B;  2H88 A;  1UUS A;  2CPT A;  1LVF A;  2AE9 A;  2V26 A;  3PUW F;  3SOL A;  2WCA A;  3WAK A;  2I6H A;  5L2L A;  4WYV A;  4EOZ B;  2WU5 A;  4PNI A;  2A2F X;  2CCQ A;  3Q2M A;  2CA5 A;  3HR0 A;  4YXD A;  5JTG A;  3AA7 B;  3LJC A;  2IDO B;  4HFI A;  1ZV4 X;  3IF8 B;  4IL4 A;  2NW8 A;  4WNK A;  4AKL A;  3NWI A;  2XQ5 A;  4QX8 B;  1YKH B;  3VHL A;  3RYF E;  4ILU A;  2HN2 A;  2BG9 E;  5J1G A;  3VR8 A;  2ACX A;  5FNV E;  4DV3 T;  5JDL A;  2PBI A;  2LSI A;  3T8O A;  3KBU A;  2Y8D A;  1O3X A;  4KBM B;  1HNW T;  3AAI A;  4HN9 A;  3HKB E;  1U4Q A;  5ABE A;  3OVU A;  4BAY B;  3LBX B;  5C2T A;  5AQS B;  2XQA A;  4G63 A;  4DUZ T;  4HFV A;  5HWY A;  4AIS A;  4O4I E;  4ERR A;  3AEF A;  1XWM A;  3UQ7 A;  3A8Y C;  5KXJ A;  3O9X A;  2YDR A;  4ZZC A;  2C5J A;  2WDQ A;  3Q5E A;  2YU2 A;  4UXN B;  5JRC B;  3UU3 A;  4TUY E;  2GK9 A;  4MLK A;  5HXS A;  5LGU B;  5H6Q B;  2KZ7 B;  4UEM A;  5IUX A;  1WCR A;  2KIN B;  2CXF A;  4I43 B;  3N2K E;  2XAS B;  2V7L A;  4JI6 T;  2WMN A;  5CA0 E;  5J2T E;  3JAD A;  4NXM T;  2XAF B;  5FL0 A;  2FBW A;  3RKG A;  5JQG E;  3ONL C;  2RP4 A;  4V1A v;  2W4X A;  2XZE A;  2A3D A;  3MK7 C;  1UGO A;  4PFO A;  3PUZ F;  2RPA A;  3RIU C;  2LM2 A;  2LE8 A;  2NP9 A;  2XQ7 A;  4JI0 T;  4JYA T;  3EAM A;  3K3Q C;  4UVA B;  1HFA A;  5AQI B;  2LT3 A;  5ABF B;  3HKC E;  4IRE A;  4IE7 A;  1WR6 A;  4LF4 T;  2CRB A;  3LSV A;  4LF6 T;  4TV9 E;  3OTO T;  3OPC A;  5ABH A;  3PUR A;  3A5X A;  2KSR A;  2E8I A;  2X68 A;  3MJX A;  1T7S A;  3DJB A;  4JI3 T;  5FMN A;  2LHR A;  4CXY A;  4X5T A;  3Q9D A;  4DR7 T;  2F4V T;  1XZY A;  4MHC A;  4IE0 A;  5BMV E;  4TWH A;  3LDQ B;  2BDE A;  1GQE A;  2VVN A;  2W61 A;  2BKO A;  2XQY A;  2V6X A;  2X0L B;  4HTE A;  4HWD A;  3KIN B;  1HX8 A;  3B13 A;  3LK3 B;  4YTP A;  4DBR A;  1VRB A;  2X9Y A;  3ONJ A;  4YLH A;  1FMW A;  3VR9 A;  5LXT E;  2KND A;  1E2A A;  4CXX A;  3B57 A;  2FJE A;  2MTQ A;  3M65 A;  4ILA A;  4EEB A;  4UVC B;  2B76 A;  3FHN A;  4ZEY A;  3AAA B;  4AKR B;  2SPC A;  5FVK A;  2UUC T;  1D0Z A;  4O2B E;  2LHN A;  3UUL A;  3KV5 A;  2V8S V;  4KUM B;  3L3P A;  4ANJ A;  3CKD A;  1V9D A;  4YTM A;  4AKI A;  3EI0 A;  4QXH B;  3CQG B;  1MIW A;  3EHZ A;  5FYM A;  3UQ4 A;  2W62 A;  2BKP A;  2FJB A;  1NEN A;  5A1L A;  3IA3 A;  2FUP A;  4LF7 T;  1N33 T;  3TLW A;  4U7I A;  2V1D B;  3MXZ A;  4LFC T;  4OFZ A;  3Q5D A;  5FKY A;  1Z0P A;  3FZH B;  2DLR A;  1KNR A;  4DO0 A;  3EAB A;  1T72 A;  3CX7 B;  2VKH A;  5F5W A;  3HKE E;  3ZT6 A;  4NXN T; 
#chains in the Genus database with same CATH homology
 5L3G B;  5J2U E;  3E22 E;  2Q9Q A;  3GN5 A;  3O1H A;  2DNX A;  3FXD B;  2IAK A;  4HGA A;  4IE6 A;  5ADX L;  4PJL A;  5AFU L;  2N9D A;  3LFM A;  3R6N A;  3F2E A;  3RX6 A;  3RYI E;  2I59 A;  2JMH A;  1KK7 A;  3C98 B;  3CQC B;  4EB6 E;  2ODU A;  4ISS A;  5LGT B;  4HKA A;  2WM9 A;  4WW0 A;  2K24 A;  1MMD A;  3UTK A;  5LBQ B;  5JR9 C;  4GYS A;  2G0U A;  3K3N A;  3CML A;  3PU3 A;  2QGS A;  3RRW A;  3FBL A;  5IHY A;  3IHR A;  4IDZ A;  5JDH A;  2VAS A;  4GIW A;  2XAQ B;  1YD8 G;  4H9Q C;  3ETU A;  2N1G A;  2YIN A;  4AI6 A;  3RYH E;  4PK4 A;  2UXX B;  4CQI A;  5JDM A;  3EDV A;  1B7T A;  2VL8 A;  2ODV A;  4AKG A;  3SRZ A;  4F6R C;  2Y6X A;  1MNE A;  4UF0 A;  5HAX A;  5JR9 A;  3L09 A;  4CI3 B;  4YJ2 E;  5JDN A;  4E7Z A;  2MBG A;  1IZN B;  3KV6 A;  4H63 H;  4ZI2 D;  2C5K T;  5JDQ A;  2NOX A;  2VWA A;  2LM9 A;  3AVR A;  3RYC E;  1HTJ F;  4AQF C;  4P09 A;  3NRX A;  3BQI A;  4IE4 A;  3FBZ A;  4PAG A;  5E0O A;  2HPL A;  3F57 A;  4CXW A;  2PJQ A;  1HS7 A;  2CWY A;  2LOP A;  3GA8 A;  3N9Q A;  3ZN0 B;  4ZOL E;  2JPF A;  1LVF A;  4TZ4 C;  1G8X A;  2V26 A;  2EHO D;  3CQX C;  3S4U A;  5L3C B;  3PUG A;  3SOL A;  5FP3 A;  1UX4 A;  4I55 E;  1YKE B;  2Y48 B;  4QXC B;  3WAK A;  3HI2 A;  1KNZ A;  3ESL A;  3OBV E;  5L2L A;  3KVA A;  1BR2 A;  3HL6 A;  4EOZ B;  3HA4 A;  4AQF A;  2C0S A;  3VU7 H;  4PNI A;  2UXN B;  4GYR A;  2YK0 A;  2A2F X;  2CCQ A;  2DWK A;  3Q2M A;  1ZKE A;  3ONX A;  2CA5 A;  2LEH A;  3VKH A;  2XAJ B;  3HKD E;  5LJM A;  3HR0 A;  3NZQ A;  3AA7 B;  5LNK A;  1T98 A;  3LJC A;  4U74 A;  4DVD A;  3PUA A;  3MAC A;  1ZV4 X;  4MFR A;  3IF8 B;  5C8Y E;  2NW8 A;  3CX8 B;  3C51 A;  3LG7 A;  4X20 E;  1UX5 A;  4WNK A;  2JRK A;  4AKL A;  1S35 A;  2E9X B;  4QX8 B;  5EK3 A;  2MOZ A;  2W0G A;  1YKH B;  3VHL A;  5JH7 E;  3ZMZ B;  3RYF E;  2DCF A;  4ILU A;  4XZC A;  2DHR A;  3ZC1 A;  5J1G A;  3H37 A;  2ACX A;  5FNV E;  2JQQ A;  4CI2 B;  5JDL A;  2P9B A;  4EAH A;  2PBI A;  4JUY A;  3QUJ A;  2LSI A;  4O4J E;  2Q9Q D;  2NTX A;  3T8O A;  3KBU A;  4G2A A;  4IIJ E;  4L5G A;  2Y8D A;  1O3X A;  3E08 A;  2JMK A;  3JC6 D;  1SA0 E;  2K5B B;  4KBM B;  4TX5 A;  5L3E B;  4YHJ A;  2V7J A;  3AAI A;  5LA6 E;  1ZHC A;  2XAH B;  5KDM C;  5LJN A;  4HN9 A;  3BQK A;  4QKN A;  3HKB E;  4WBO A;  3TKL B;  5LG4 A;  4GK0 E;  1U4Q A;  4BA9 A;  5LP6 E;  2BZB A;  4H9P C;  2H7O A;  3QC9 A;  2X51 A;  2VK9 A;  5F8P A;  4BAY B;  3C4W A;  4L0R A;  3LBX B;  2IC9 A;  3N9N A;  2LSG A;  2OA5 A;  4ASK A;  4G63 A;  1CUN A;  4NUU A;  3VKG A;  2QA7 A;  2RA1 A;  3CVR A;  4HFV A;  5HWY A;  5TAO A;  4O4H E;  3ZN1 B;  4O4I E;  4MBQ A;  3ZMU B;  4OK0 A;  4ERR A;  3N9M A;  3ZMV B;  3RPU A;  3ZPO A;  3C4Z A;  3MKD A;  4H9O C;  2D2S A;  2LSY A;  3KBT A;  4CI1 B;  3I0O A;  5JVD E;  2YEV C;  4UV9 B;  5ETW A;  3O9X A;  5HXH A;  3ZC0 A;  3N9L A;  3OYX A;  3BQL A;  2C5J A;  2ZM8 A;  2CWO A;  2X67 A;  1H7C A;  2YU2 A;  4UXN B;  3RRC A;  5JRC B;  4B6X A;  5DJQ C;  4C91 A;  5CA1 E;  4XAX B;  4I50 E;  1LKX A;  1Y64 B;  5KX5 E;  2KT9 A;  4TUY E;  2GK9 A;  4MLK A;  5HXS A;  5HYA A;  5LGU B;  5H6Q B;  2KZ7 B;  2LJL A;  3AA6 B;  2ES0 A;  3N2G E;  2ZM0 A;  4UEM A;  5EK4 A;  2CXF A;  2KIN B;  2J1D G;  4I43 B;  3N2K E;  2XTL A;  3WAJ A;  5KMG P;  4PJJ A;  5FY7 A;  2XAS B;  1NAF A;  3RKO A;  2V7L A;  4QHO A;  3ZJ1 A;  3RC8 A;  2K9A A;  1LVK A;  2PG8 A;  2E9X C;  4YFS A;  2WMN A;  5CA0 E;  5J2T E;  2CLY B;  5CB4 E;  3U78 A;  3PDY A;  1EZ3 A;  2K48 A;  1BR1 A;  4P0A A;  2L8K A;  2CM0 A;  2XAF B;  3O1J A;  5DQV A;  4K0U A;  4DND A;  2WBL A;  3P7I A;  3P8C D;  3OJA A;  5JQG E;  4UF0 B;  4WBN E;  4OHF A;  2RP4 A;  1MMA A;  4V1A v;  3KDS E;  2LSK A;  2NWB A;  4M1P A;  1WLX A;  3ZJ2 A;  4TN7 B;  2IC6 A;  2A3D A;  3AA0 B;  5FXV A;  3MK7 C;  2E9X A;  3LK2 B;  1NWM X;  3N2O A;  3ZCI A;  4PFO A;  2WWU A;  3Q5W A;  3AVS A;  2ZMA A;  3DP7 A;  3I9Y A;  5JDF A;  4TV8 E;  5FXW A;  1IJ5 A;  2LE8 A;  3ANW B;  3IEE A;  3CPZ A;  4ZI3 D;  3UUN A;  2NP9 A;  4EZH A;  2X66 A;  3KV4 A;  4OYK A;  4U72 A;  3ETV A;  3O4X E;  1US7 B;  3K3Q C;  3PTR B;  3PUS A;  5JRE A;  3RC3 A;  4UVA B;  5HXE A;  2X9H A;  4AKH A;  2KMF A;  4P0B A;  2NW7 A;  4H9N C;  1HFA A;  3J7Y q;  3PE0 A;  4QWN B;  5LHG B;  1BR4 A;  4QXB B;  3EDU A;  3V5S A;  3AB3 B;  3QK6 A;  5HWX A;  2ZM2 A;  1HG2 A;  3I9W A;  1LRZ A;  2YU1 A;  1D0X A;  2LT3 A;  2EHO B;  1WRD A;  2DWG A;  2W63 A;  2CXD A;  3HKC E;  4PJM A;  1FEW A;  2V7K A;  5FY1 A;  5EZY E;  5LHI B;  4IE5 A;  4IE7 A;  1WR6 A;  4EIW A;  1MIY A;  2WAU A;  5FY0 A;  3NZP A;  1MMN A;  2IW5 B;  2X9X A;  4TV9 E;  4EYU A;  3NBX X;  3LBX A;  4XBF B;  2WSS V;  2NTY A;  4Z8X A;  5FXX A;  3PUR A;  3A5X A;  2H3R A;  2E8I A;  2X68 A;  5FXZ A;  5LGN B;  1IJ6 A;  3MJX A;  3DJB A;  1WYC A;  2LSJ A;  3AA1 B;  2VKD A;  1D1A A;  3KFW X;  5FMN A;  4PK6 A;  3UT5 E;  2LHR A;  4CXY A;  1FIO A;  2D5U A;  3WI3 A;  3ZMS B;  3Q9D A;  3UUM A;  2V7I A;  4O4L E;  2CE7 A;  4IST A;  3ZYK A;  4HE8 A;  4MHC A;  3U3I A;  4YJ3 E;  4IE0 A;  2CLY C;  3ZYL A;  1BR0 A;  3E0Z A;  5BMV E;  5JRC A;  2A72 A;  3ZLI A;  2BDE A;  2KXP B;  5LBM A;  2W61 A;  3V5U A;  4JLE A;  4KP3 C;  2VKJ A;  2XQY A;  1MIV A;  5LYJ E;  2X0L B;  5F3J A;  4X1Y E;  4ZHQ E;  2XUE A;  1HCI A;  4HTE A;  3KIN B;  3ZCJ A;  2VB6 A;  4GK5 E;  1HX8 A;  2DI4 A;  1OXZ A;  2L9Q A;  3B13 A;  5LOV E;  2Q9Q B;  3GN5 B;  2L3L A;  3RH3 A;  3LK3 B;  2ZLY A;  4GOU A;  1YW0 A;  4E7S A;  4EXT A;  4DBR A;  1VRB A;  2X9Y A;  3K3O A;  1D0Y A;  4PW8 A;  3FXE B;  1IAP A;  4YLH A;  4N78 D;  1FMW A;  2NW9 A;  4IHJ E;  5LXT E;  5M4Y A;  2PFV A;  1MND A;  2KND A;  4EZ4 A;  1D1C A;  3CWZ B;  3N9O A;  3PUQ A;  4CXX A;  2HPJ A;  4BJM A;  4ZI2 C;  2LOS A;  3B57 A;  1UCU A;  3N9P A;  4ZI7 E;  4L9I A;  4DBQ A;  3I0Q A;  3C64 A;  2MTQ A;  2X9W A;  1HG5 A;  3M65 A;  3O1I A;  4EYY R;  3R84 B;  3MA9 A;  4HEA A;  1MMG A;  2E9X D;  4X1K E;  1SHZ C;  4UVB B;  2WMO A;  4UVC B;  2N2N A;  3EUH A;  5IYZ E;  4DMW A;  4O8S A;  5EK2 A;  3FHN A;  3AAA B;  2XHE B;  2D0U A;  4AKR B;  4O2A E;  2SPC A;  4PJN A;  4H63 V;  3K8P C;  3ANW A;  2EHO C;  3NRY A;  2VKO A;  4J2C A;  3CX6 B;  5JR9 B;  3BK9 A;  4ADZ A;  2H7V C;  3UFE A;  1D0Z A;  4UEL A;  4O2B E;  2LHN A;  3UUL A;  1WYB A;  3KV5 A;  2CXL A;  3EVY A;  1QUU A;  1HF8 A;  2JJ9 A;  4KMC A;  4A56 A;  4KUM B;  4C90 A;  3OYZ A;  5GON E;  3L3P A;  5LCY A;  4ANJ A;  2B1E A;  3IBP A;  3CKD A;  2D0T A;  4PK5 A;  2KWH A;  4NUV A;  1ZEE A;  5L3D B;  4CZZ B;  2KWI B;  1V9D A;  2EHO A;  4AKI A;  1AJ3 A;  3F31 A;  3SWH A;  5HXC A;  4JEH B;  3CQG B;  4QXH B;  4IGU A;  1MIW A;  4AXP A;  3J9X 1;  4I4T E;  4ZI3 C;  5FYM A;  5DAB A;  2HH7 A;  4ZS2 A;  3KVB A;  2W62 A;  2W00 A;  3KV9 A;  4H9S E;  4FI5 A;  3LK4 2;  1OWA A;  3C50 A;  3I1A A;  4QX7 B;  4H9R C;  4UIG A;  5DQW A;  5JDG A;  5A1L A;  2Z6E A;  3ZEF B;  3GMI A;  3FB2 A;  3DTO A;  4UV8 B;  3H3A A;  2V1D B;  3GWH A;  2V7M A;  3MXZ A;  1E1H B;  4OFZ A;  3UUX B;  4JEU B;  1QSD A;  1FMV A;  4ZS3 A;  2MYS A;  1Z0P A;  3ZMT B;  2DLR A;  3C4X A;  4X1I E;  4DO0 A;  4FJO A;  2BVM A;  4DMV A;  5L3F B;  3Q5X A;  3PU8 A;  2CMR A;  4OYJ A;  1S94 A;  3ZYM A;  2Q9Q C;  2XAG B;  2KLQ A;  3SS1 A;  3D0T A;  5H6R B;  1G73 A;  4AQG A;  5LHH B;  3CX7 B;  1VOM A;  3MZK B;  1U5P A;  3OKQ A;  1X79 A;  3JC6 C;  2C5I T;  2M67 A;  2CEA A;  2VKH A;  3AAE B;  4BJN A;  5L3B B;  4PFP A;  3W15 B;  1D1B A;  3HKE E;  4MAL A;  5HXR A;  2BVL A;  3N5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...