3GA8A

Structure of the n-terminal domain of the e. coli protein mqsa (ygit/b3021)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MqsA (YgiT/B3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2009-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ga8A00
3O9XA 3HI2A 3GN5A 3GA8A 3GN5B
chains in the Genus database with same CATH superfamily
1B7TA 2SPCA 5LXTE 4X1YE 5FMNA 3E22E 2J4GA 1D0ZA 3PUSA 3AAEB 2V7JA 5LNKA 3CX6B 1ZKEA 3AA1B 5CJ5A 3KVBA 2Q9QB 4P0BA 4TWHA 1HX8A 3LBXA 2V7IA 5AQLB 3FZLB 3PJAA 3L8RA 1IBMT 3G06A 1VCSA 5L4EA 4U7YA 5JDHA 1T72A 4JI5T 4GKKT 4BA9A 1QUUA 1KNRA 5LGUB 3AE7A 2B76A 4QHOA 2WBLA 2XAJB 2WCAA 4YSXA 2V7KA 4YSZA 3ZMVB 3WI3A 1NAFA 2V1DB 4MBQA 1UX4A 3CPZA 2VL8A 3PUGA 4ZXLA 2I0MA 5ABHA 4DVDA 5C2TA 1I6ZA 4QX7B 3OKQA 2WDVA 1BR2A 4TWDA 2LT3A 3RGLA 2DHRA 4ZEYA 4QXBB 4U7IA 1W0AA 4B3MT 3R6NA 2K24A 4U33A 2NTXA 4DR4T 1WRDA 2ZM2A 2FJEA 4OK0A 3WAJA 4O2AE 4UF0A 4ZS3A 3AE5A 4HWDA 3RHWA 4ZHQE 4K0KT 4EAHA 2NP9A 2BS2A 4H9OC 3FXDB 4PAGA 5IUXA 5KMGP 4KHZF 2WU5A 1FJGT 2W0GA 2LM2A 4ISTA 3P4PA 3ZMSB 1S35A 2XAGB 4J2CA 2XQ4A 3O1HA 3RQWA 4PK6A 4EZ4A 3JADA 3O4XE 1D1BA 2CXFA 4EYYR 4P0AA 4HFHA 3I9YA 3ZCJA 2IUBA 2PJQA 3CQXC 5HXEA 3P4SA 2Y48B 5L3FB 2X9WA 2PTFA 4PW8A 3PUWF 5EK2A 3MKDA 4H9RC 3I0QA 4KBMB 3RC3A 2E5VA 5CA0E 1AJ3A 3RRCA 3OYZA 3O1JA 3L09A 5ABEA 5LA6E 2JPFA 5EK4A 3AXJB 3L39A 2H7OA 3HKBE 3ANWA 1N33T 3SS1A 3LFMA 3OPCA 4YHHT 4I0UA 2LRKA 2DL1A 4TUYE 3ZYMA 3C4ZA 1IJ5A 2X9YA 1YQ4A 3GN5B 1SE7A 2N9DA 5LHIB 1NWMX 5A1LA 1L0VA 3UUXB 1XNRT 2JQKA 3CKDA 5LB7B 3B57A 3N2GE 2FJAA 3W15B 1D1CA 1N34T 5GONE 3ESLA 2J1DG 1JNZA 2CXLA 4DV6T 5CB4E 2LSIA 3JAEA 5LG4A 4V1Av 2LEHA 4AKHA 3OYXA 4O4LE 2HN2A 3AEDA 3CQCB 1MMDA 1BR4A 3KDSE 2IHR1 3KV4A 3ZPOA 1M62A 2PBIA 1T8BA 2ODUA 3ZLIA 2JJ9A 3CX8B 2RPAA 4P1NA 2LHRA 2ZM6T 3PU8A 4X65T 4QX8B 1MIWA 2W2UA 4QXHB 1I94T 3BQKA 2ES0A 4K0UA 3NRXA 1JNRA 1SUMB 2KNDA 4O2BE 4L5GA 2LSKA 4NPPA 2KINB 4L0RA 2JMKA 3MJXA 4U72A 3PTRB 1FMVA 4DR5T 1WLXA 2VKHA 3RIAA 5DJQC 4HFDA 2OA5A 4IDOA 3ZT7A 2DNXA 3UUNA 3B5MA 4LFAT 3LG7A 4AQGA 2X0YA 2E2AA 3K1SA 2WU2A 1UURA 4ASKA 5JVDE 4EOZB 2VQFT 3U3IA 2KWIB 4IREA 5JR9C 4A97A 1MMGA 4YT0A 4DMVA 2JQQA 1BR1A 2C5KT 3VKHA 3EI0A 2LSGA 2MBGA 2KXPB 3ZYLA 5FL1A 5AQGB 4FI5A 3H3MA 3P4QA 4ANJA 4GKJT 2WY2A 2XSAA 4WNKA 2UUBT 5EK3A 3N9OA 3SOLA 2D5UA 1CUNA 4NIQA 4DUYT 3HKCE 3Q5XA 1MIYA 2B1EA 4HWCA 3ZMZB 5HXHA 4I55E 2NTYA 5FXWA 5DQVA 3BQLA 3OJAA 3NKZA 5HEGA 4GYSA 5JR9B 5BR8T 1XDPA 4PK4A 4AKRB 2R6GF 3Q5WA 3AE2A 5KXJA 3UTKA 4TNVA 5JRCA 5KDMC 1Y01A 4EEBA 2QGSA 4X20E 3LDQB 4JEUB 4HN9A 4O4HE 1YKEB 4IE4A 4YLHA 2PFVA 3AVSA 3SFDA 3O9XA 2CA5A 5AQFB 4HE8A 1KNPA 1WFDA 3TLTA 1O3XA 2BBJA 2M6BA 3N9QA 1Z0PA 3M65A 3N9PA 4A56A 3N9LA 3IEEA 4AISA 4EEDA 2JMHA 4UVBB 4UXNB 4LFCT 2YKSA 4QKNA 4ZZBA 3I1AA 2GK9A 3QUJA 3RI5A 4C91A 3CVRA 2V5CA 4PJNA 5JREA 4COFA 1YKHB 2XJ7A 1VOMA 3E08A 2WWVA 5JQGE 3MK7C 1YW0A 5EZYE 1W9RA 1KNZA 2XASB 2V6YB 4YTPA 2IW5B 2BS4A 3MZKB 2UXXB 1HNXT 2XQ3A 2MPKA 4O4JE 3CIRA 4JI2T 2LLYA 2H89A 3CQGB 2XAQB 5FY1A 1FIOA 3EHZA 1IBKT 4AKGA 5HWYA 1WR0A 1IAPA 3NWIA 1HNZT 2VKDA 4U3CA 4ILAA 3TLUA 2E8IA 4MALA 2UXNB 2WDRA 5ETWA 3ZJ1A 4CXXA 1D1AA 1E1HB 1IBLT 1XMOT 3FBLA 4TNWA 1KF6A 5AFUL 1YD8G 2BKPA 3PV0F 2W62A 2YDRA 3GWHA 5FXXA 1ZP0A 3DP7A 4UR9A 3PUXF 4LF6T 3PUYF 5L2LA 4HTEA 3Q5EA 2W4XA 3KV5A 3HR0A 2RP4A 3CMLA 5FVKA 1D0YA 2WAUA 2J62A 1X79A 4AKLA 5JTGA 3A7MA 4CZZB 2X68A 2CBJA 4ZZCA 5HEJA 1XMQT 2XQ6A 3KBTA 4UVCB 2XQ7A 4EGWA 4DMWA 1ZV4X 1Z8UA 2BG9E 2FUPA 4ILCA 4X1KE 5FVLA 5H6QB 2VASA 2VK9A 4FJOA 3TLSA 4ADZA 3TKLB 1X9BA 4Z91A 2LOSA 5LJNA 4WYVA 5TAOA 4TN7B 2LM9A 2VL0A 2V5DA 4PJLA 2W63A 1N36T 2ZM0A 3T1HT 2XQ8A 3AAAB 4IL4A 2LKGA 3QK6A 4WZXA 2EHOA 3P4WA 5JRCB 2QA7A 2I59A 3FHNA 5DABA 4E7ZA 3ZEFB 4YTMA 2LJLA 1FMWA 4HGAA 5LMNT 4JI6T 4QH4A 5AQVB 4IIJE 2MTQA 2ACXA 1HTJF 4WBOA 4IDZA 4H9PC 4JI0T 3KBUA 3C4XA 4U31A 4DR7T 2WP9A 2CBIA 4I4TE 2YU2A 2LSJA 4ZI3D 2D0UA 1MNEA 2VVSA 3ONJA 2UUCT 3KFWX 1VCTA 2KT9A 2WS3A 4LF8T 4X64T 3PUVF 4BJMA 3KV9A 3IA3A 4M1PA 3B13A 3ZKRA 3RIFA 2X0HA 3P8CD 3ZN1B 4HFBA 2XM2A 3AEAA 5FYMA 3ETUA 4UELA 2BDEA 2IC9A 5M4YA 3UULA 2IAKA 4WW0A 4HWFA 3RX6A 5AQQB 3ZMUB 2AXDS 4AXPA 2X0LB 1HG5A 5DQWA 3UQ7A 1YQ3A 3RKGA 4WBNE 4UVAB 5HXSA 2F4VT 1MNDA 4MFRA 4ZOLE 4ZI3C 4TZ4C 5JDNA 3ZN0B 1HCIA 3AA0B 4PJJA 4ZI2D 4LF4T 2VB6A 3OTOT 3NBXX 2IIUA 1J5ET 3RH3A 3AA6B 2BBHA 3SWHA 3AE3A 2ZLYA 2HN1A 3KVAA 4DV3T 3LBXB 2ZM8A 3OBVE 3VKGA 3VR8A 3K8PC 1H7CA 4OFZA 3AAIA 5ADXL 3LK3B 4U2YA 4XBFB 4OYJA 3AE8A 5AQNB 5HCJA 2W66A 1ZHCA 3RPUA 2IC6A 4F6RC 3ZSTA 4O4IE 2L9QA 4UEMA 3NZQA 2JQ9A 3SRZA 3H3AA 4ILUA 3SFEA 3F2EA 3ONLC 2M6IA 3ZSSA 2MYSA 4IT4A 3HI2A 3N2OA 2YINA 4ZI2C 1OXZA 3JAFA 5J2TE 1NEKA 2YDQA 4X5TA 3RYIE 3FB2A 3I9WA 2E9XA 5L3CB 4CN6A 3PUZF 3HL6A 1M7KA 4DR1T 4DV5T 4B3RT 1HS7A 2BG9A 4UF0B 4DIDB 2X9XA 5C3JA 3PDYA 1QLBA 2BVMA 4JV5T 4EXTA 4LF7T 3NZPA 3OVUA 2KZ7B 4IDPA 1QSDA 3X1DA 4JI1T 2LOPA 3PJAJ 2WWUA 3UFEA 3UU8A 1N32T 4JYAT 4AI6A 2Y8DA 4A5XA 3AB3B 3UU4A 4NUUA 5FY7A 3VR9A 4HFVA 3CWZB 3UU3A 2WZIA 2W61A 3AE6A 2NW8A 3ZYKA 2YOEA 2WB5A 2CLYC 1LVFA 3MXZA 4JI8T 2N1GA 2DI4A 5LOVE 4E7SA 4NXMT 5L3EB 3T8OA 3J7Yq 3Q5DA 4ILBA 2A2FX 4JLEA 3EABA 3LJCA 2E5LT 2NR4A 1J5WA 3PUAA 4H9SE 2XM1A 1J1JA 2OLTA 5JDLA 4LMJA 2ACZA 3EDVA 3QB5A 2DWKA 4F8HA 4AKIA 2LKHA 3RYCE 1IZNB 2HHHT 2V26A 3H37A 3ANWB 2CWOA 4DR3T 2VVNA 4I50E 1S94A 4PK5A 2RA1A 2E9XD 3RC8A 2UXBT 4XAXB 2CPTA 5HEOA 1XZYA 4X1IE 5FXVA 2K48A 2OV9A 2CLYB 3AVRA 4DNDA 3CK6A 4UV9B 5L4HA 1D0XA 5AQUB 5JDGA 3AEFA 4QWNB 2FBWA 3VRBA 4ZI7E 2XAFB 4LFBT 3ZCIA 2BVLA 5AQJB 2C0SA 1G73A 4LF5T 2JQHA 4KP3C 4NUVA 3VU7H 5LGTB 4DR6T 4PNIA 2HPLA 5AQHB 4Z8XA 4EB6E 1CHUA 4BJNA 4YSYA 2D9DA 2XQ9A 3DTOA 2NW9A 4KX6A 2XY8B 2CHNA 4HFCA 2XAHB 2UXCT 3ZJ2A 2QVAA 5LGNB 1KK7A 4EZHA 2E9XC 3AECA 5HYAA 2C5JA 2I6HA 4YJ2E 2XZEA 3F57A 2XPKA 1HX1B 4DR2T 3AA7B 4CXWA 2V7MA 2BG9C 3R84B 3K3NA 4CI1B 4IE6A 2IMLA 3ZMTB 3FXEB 1WYCA 5FY0A 1HG2A 4UV8B 3AEGA 1WCRA 5IHYA 2XQAA 4B3TT 4HFEA 3C50A 1EZ3A 5LP6E 1OEDA 1XDOA 2KWHA 5F8PA 2YEVC 4X66T 1E7PA 4GYRA 1E2AA 3RYHE 3ABVA 4IE0A 2X66A 2NWBA 5CGMA 5JDFA 3HKDE 5J0ZA 4DV7T 2E9XB 4IL9A 4B3ST 2D2SA 4O8SA 4EV6A 3C64A 3LSVA 4LMLA 4PFPA 3PE0A 3LK42 4EIWA 1LKXA 1VRBA 3ZT6A 5AQRB 2BG9B 3EAMA 4CN4A 4IE7A 1W09A 4DUZT 2HH7A 3TLVA 4KMCA 5FL0A 3GA8A 3TLWA 2ZMAA 4CXYA 4QXCB 1HF8A 5IWAT 3RLFF 1XWMA 3IF8B 1HR0T 1UUSA 2CEAA 2L3LA 3T1YT 2A3DA 2G0UA 4OHFA 4YY3T 3N2KE 2K3WA 4HEAA 2KSRA 5ABFA 4TX5A 2WQYA 2DWGA 5JR9A 2LRLA 1KEYA 5HAXA 2CE7A 4QH1A 3MACA 3AEEA 2Z6EA 2N2NA 4MHCA 4GIWA 3UQ4A 2H7VC 1MMAA 3P7IA 2FJDA 3O1IA 3Q9DA 3IHRA 1SHZC 2J47A 1ZOYA 4IGUA 1UCUA 3IBPA 5LJMA 5LG3A 3FZKB 4DV4T 3AE9A 3K3OA 2WDQA 2X51A 4CQIA 5ABGA 1DU2A 3ZT5A 5F3JA 3NVOA 5CA1E 4JI7T 4CI2B 3S4UA 5JH7E 1T7SA 5HEUA 1R8IA 2V8SV 4DBQA 4AQFA 3FZHB 4OX9T 2DLRA 3ETVA 3RIUA 2HPJA 2XSBA 4Q25A 2QRXA 2XTLA 3JC6D 5HCMA 5LHHB 3BQIA 4PFOA 3KV6A 3ZC1A 5FP3A 4JEHB 2H3RA 5J1GA 4KUMB 2CXDA 5JDQA 4TWFA 4ERRA 2V7LA 4DO0A 4YFSA 5JDMA 4H9NC 5AQSB 1OEDC 5AQMB 2L8KA 3N9MA 2IDOB 4TV8E 3RKOA 2A9UA 2CCQA 3UUMA 4HWIB 4PJMA 3QC9A 4HFIA 2LE8A 2M67A 2V6YA 3AE1A 5L3DB 3HA4A 2X67A 2KLQA 2AE9A 2EHOD 2D0TA 2PG8A 1Y64B 4P09A 5LBQB 3UU6A 3Q2MA 1IJ6A 2CRBA 2CMRA 3RF1A 1U4QA 3WAKA 3UU5A 2WM9A 2LSYA 4IHJE 3F31A 3AEBA 4Z90A 1UX5A 2XQYA 2VKOA 1HNWT 2NOXA 2C5IT 2UXDT 5KX5E 1NENA 2X9HA 2Q9QA 3JC6C 5HEHA 3MA9A 2CHOA 3FBZA 5LMUT 4JI4T 3N9NA 1US7B 2WSSV 2JIWA 5AQOB 4IDQA 5L47A 4QH5A 2BS3A 3GMIA 1OEDE 1OEDB 3PU3A 3EVYA 5L3GB 2CWYA 3FZFB 3P50A 5C8YE 4G2AA 5HXCA 2MAWA 3C4WA 2EHOC 4H63H 3NRYA 1OWAA 2H88A 1ZEEA 1FEWA 2KMFA 3BK9A 2WMNA 4CN1A 2DCFA 1LRZA 4DV1T 4YXDA 2VURA 1LVKA 1V9DA 1XNQT 3HKEE 2YDSA 3M3ZB 5H6RB 4G63A 2QYWA 5L3BB 4L9IA 2UUAT 1WYBA 4ISSA 2A72A 4ZS2A 2XHEB 2JRKA 1T98A 4GK5E 5F5WA 2XUEA 3E0ZA 1W0BA 2W00A 1WR6A 5FNVE 3QB5K 2P9BA 4LMKA 1GQEA 3VRAA 3V5UA 2CM0A 3A8YC 4JI3T 1G8XA 3A5XA 5LYJE 5LBMA 3U78A 2YN6A 3PURA 3EUHA 4XZCA 3VHLA 3UFGA 4A98A 1SA0E 5ABFB 2EHOB 1U5PA 4GK0E 4HWHA 4AQFC 5J2UE 3QOFA 3P4RA 3RIUC 4OYKA 2K5BB 5AQKB 2Q9QD 4HKAA 4AIUA 2YK0A 4B6XA 1HFAA 4KI0F 5HXRA 4JUYA 2MOZA 3CX7B 3RYFE 4TV9E 4I43B 3V5SA 3AE4A 4YHJA 5AQIB 4YJ3E 3C98B 4UIGA 5IYZE 1BR0A 4N78D 4CI3B 2Y6XA 2NW7A 4IDNA 4EYUA 3JCFA 3AXJA 4X62T 5AQTB 5LCYA 4DV0T 1YXRA 3ONXA 2VQET 3RRWA 2BKNA 2XQ5A 4C90A 2YU1A 2UU9T 3ZC0A 4KHPT 2V6XA 1MMNA 3EDUA 2W67A 2Q9QC 3I0OA 4U2ZA 3C51A 5CFBA 2LHNA 4LF9T 4YTNA 3N5LA 3DJBA 4DV2T 2VKJA 2BZBA 3RQUA 3GN5A 3UUBA 4JBWF 3KINB 2K9AA 1UK5A 2FJBA 5LHGB 3UT5E 3PUQA 1KFYA 4MLKA 4BAYB 3FZMB 4AQYT 4DBRA 4H63V 5AQPB 3LK2B 1UGOA 4U74A 5FKYA 3J9X1 3K3QC 3L3PA 3D0TA 4NXNT 1MIVA 2ODVA 5E0OA 2WZHA 4H9QC 2VWAA 5BMVE 4GOUA 5HWXA 4IE5A 5FXZA 2BKOA 3QNUA 2WMOA
chains in the Genus database with same CATH topology
2DWGA 1B7TA 2SPCA 5LXTE 4X1YE 5FMNA 3E22E 5JR9A 2ZLYA 3KVAA 3UTKA 1D0ZA 3PUSA 3AAEB 2V7JA 3LBXB 5LNKA 5HAXA 2CE7A 5JRCA 5KDMC 3MACA 3CX6B 2Z6EA 2ZM8A 3OBVE 1ZKEA 3AA1B 3VKGA 3KVBA 2QGSA 2N2NA 4MHCA 2Q9QB 1H7CA 3K8PC 4GIWA 4P0BA 4X20E 1HX8A 3LBXA 2V7IA 4JEUB 2H7VC 4OFZA 3AAIA 4HN9A 5ADXL 3LK3B 1MMAA 3P7IA 4O4HE 4XBFB 3O1IA 1YKEB 4OYJA 4IE4A 4YLHA 3Q9DA 3IHRA 2PFVA 5JDHA 3AVSA 1SHZC 4BA9A 1QUUA 4IGUA 1ZHCA 3RPUA 1UCUA 5LGUB 2IC6A 3IBPA 3O9XA 4QHOA 5LJMA 4F6RC 2CA5A 2WBLA 2XAJB 2V7KA 3K3OA 4O4IE 2L9QA 4HE8A 2X51A 4UEMA 1O3XA 3WI3A 3NZQA 3ZMVB 4CQIA 1NAFA 3SRZA 2V1DB 3N9QA 1Z0PA 3H3AA 3M65A 4ILUA 5F3JA 3F2EA 3N9PA 4MBQA 1UX4A 3CPZA 5CA1E 4A56A 2VL8A 2MYSA 3PUGA 4CI2B 3HI2A 3N9LA 3IEEA 3N2OA 2JMHA 4UVBB 2YINA 4ZI2C 4UXNB 3S4UA 1OXZA 4QKNA 4DVDA 5JH7E 3I1AA 5J2TE 4QX7B 3OKQA 2GK9A 3QUJA 4C91A 3CVRA 3RYIE 3FB2A 3I9WA 4DBQA 2E9XA 4PJNA 1BR2A 5L3CB 4AQFA 2LT3A 5JREA 2DHRA 2DLRA 3ETVA 1YKHB 2HPJA 3HL6A 1VOMA 2XTLA 3JC6D 4QXBB 5LHHB 3E08A 3R6NA 2K24A 3BQIA 5JQGE 3MK7C 1HS7A 4PFOA 1YW0A 3KV6A 5FP3A 3ZC1A 4JEHB 2H3RA 4UF0B 5J1GA 2NTXA 2X9XA 1WRDA 4KUMB 2ZM2A 3PDYA 2CXDA 5JDQA 2BVMA 4OK0A 4ERRA 3WAJA 2V7LA 4O2AE 4UF0A 4ZS3A 5EZYE 4YFSA 4DO0A 4EXTA 5JDMA 4H9NC 3NZPA 1KNZA 2KZ7B 4ZHQE 2XASB 4EAHA 2NP9A 1QSDA 2L8KA 3N9MA 4TV8E 2IW5B 2LOPA 3MZKB 4H9OC 3RKOA 2CCQA 3UUMA 2UXXB 4PJMA 3QC9A 3FXDB 2WWUA 4PAGA 2LE8A 2M67A 3UFEA 4O4JE 5L3DB 3HA4A 5KMGP 2X67A 4AI6A 2KLQA 2Y8DA 3AB3B 2W0GA 3CQGB 2EHOD 2D0TA 2PG8A 2XAQB 5FY1A 1Y64B 4NUUA 1FIOA 4ISTA 5FY7A 1S35A 4HFVA 3CWZB 2XAGB 4J2CA 4P09A 5LBQB 3ZMSB 5HWYA 3Q2MA 4AKGA 3O1HA 1IJ6A 4PK6A 4EZ4A 2W61A 2CMRA 1IAPA 1U4QA 3WAKA 2NW8A 2WM9A 3ZYKA 2LSYA 2VKDA 4IHJE 3F31A 3O4XE 2CLYC 1D1BA 1LVFA 2CXFA 3MXZA 1UX5A 2XQYA 4EYYR 2N1GA 4P0AA 2VKOA 2DI4A 5LOVE 4E7SA 5L3EB 2NOXA 3T8OA 3I9YA 3ZCJA 3J7Yq 2E8IA 2C5IT 4MALA 2A2FX 2PJQA 2UXNB 3CQXC 4JLEA 5KX5E 3LJCA 2X9HA 2Q9QA 3JC6C 5ETWA 5HXEA 2Y48B 5L3FB 2X9WA 3PUAA 3MA9A 3ZJ1A 4CXXA 3FBZA 1D1AA 1E1HB 3N9NA 4H9SE 1US7B 2WSSV 5JDLA 4PW8A 3FBLA 5EK2A 3MKDA 4H9RC 3EDVA 3I0QA 4KBMB 3RC3A 5AFUL 2DWKA 1YD8G 3GMIA 5CA0E 4AKIA 1AJ3A 3RRCA 3OYZA 3O1JA 2W62A 3L09A 3PU3A 5LA6E 2JPFA 3GWHA 3EVYA 5EK4A 5FXXA 1IZNB 3RYCE 5L3GB 3DP7A 2V26A 3H37A 2H7OA 3ANWB 2CWYA 3HKBE 2CWOA 5C8YE 4G2AA 4I50E 1S94A 4PK5A 5L2LA 5HXCA 4H63H 3C4WA 2EHOC 4HTEA 2RA1A 2E9XD 3NRYA 3ANWA 1OWAA 3RC8A 1ZEEA 1FEWA 4XAXB 3SS1A 2KMFA 3LFMA 3BK9A 2WMNA 3KV5A 2DCFA 3HR0A 1LRZA 2RP4A 3CMLA 1LVKA 1D0YA 4X1IE 5FXVA 1V9DA 4TUYE 2K48A 3HKEE 2WAUA 3ZYMA 1X79A 3C4ZA 1IJ5A 4AKLA 2CLYB 4CZZB 2X9YA 2X68A 3AVRA 4DNDA 5H6RB 4G63A 4UV9B 1D0XA 3KBTA 3GN5B 5JDGA 4UVCB 5L3BB 4DMWA 2N9DA 5LHIB 1NWMX 4L9IA 4QWNB 5A1LA 1ZV4X 1WYBA 3UUXB 4ISSA 2A72A 4ZS2A 4ZI7E 2XAFB 2XHEB 2BVLA 2JRKA 3CKDA 3ZCIA 1T98A 4X1KE 2C0SA 4GK5E 1G73A 2XUEA 3E0ZA 4KP3C 4NUVA 3VU7H 2W00A 3B57A 5LGTB 3N2GE 5H6QB 1WR6A 2VASA 5FNVE 3W15B 2VK9A 4PNIA 1D1CA 2P9BA 4FJOA 2HPLA 5GONE 4Z8XA 4EB6E 4ADZA 3V5UA 3ESLA 2J1DG 4BJNA 2CM0A 2CXLA 3TKLB 3DTOA 2LOSA 5CB4E 2LSIA 5LJNA 1G8XA 3A5XA 5TAOA 2NW9A 4TN7B 4V1Av 2LM9A 5LG4A 5LYJE 5LBMA 2LEHA 4AKHA 3OYXA 3U78A 4O4LE 4PJLA 2XAHB 2W63A 2ZM0A 3PURA 3CQCB 1MMDA 1BR4A 3ZJ2A 3KDSE 3EUHA 4XZCA 3AAAB 3KV4A 3ZPOA 3VHLA 2PBIA 1SA0E 2ODUA 5LGNB 3ZLIA 2JJ9A 3CX8B 1KK7A 4EZHA 2E9XC 2EHOB 2LHRA 1U5PA 4GK0E 3QK6A 5HYAA 4AQFC 2C5JA 5J2UE 3PU8A 4QX8B 1MIWA 4OYKA 2K5BB 4YJ2E 4QXHB 3F57A 2EHOA 2Q9QD 3BQKA 2ES0A 5JRCB 4HKAA 4K0UA 2YK0A 3AA7B 2QA7A 3NRXA 4CXWA 2V7MA 2I59A 3FHNA 5DABA 4E7ZA 3R84B 3ZEFB 3K3NA 4CI1B 4B6XA 4IE6A 1HFAA 3ZMTB 2KNDA 4O2BE 3FXEB 1WYCA 2LJLA 2LSKA 4L5GA 5FY0A 2KINB 5HXRA 1FMWA 4HGAA 4JUYA 4L0RA 2MOZA 1HG2A 2JMKA 3CX7B 4IIJE 2MTQA 3MJXA 2ACXA 1HTJF 4UV8B 4U72A 4WBOA 3PTRB 3RYFE 4TV9E 4IDZA 1FMVA 4I43B 4H9PC 1WLXA 3V5SA 3KBUA 3C4XA 4YHJA 2VKHA 5DJQC 5IHYA 4I4TE 2OA5A 2YU2A 2DNXA 2LSJA 3UUNA 4ZI3D 2D0UA 4YJ3E 1MNEA 3C98B 3C50A 4UIGA 5IYZE 3LG7A 1BR0A 1EZ3A 4N78D 5LP6E 4AQGA 4CI3B 2Y6XA 2NW7A 2KWHA 4EYUA 5F8PA 3KFWX 2YEVC 4ASKA 5LCYA 2KT9A 5JVDE 4GYRA 4EOZB 3U3IA 3RYHE 2KWIB 5JR9C 4IE0A 3ONXA 2X66A 4BJMA 3KV9A 3RRWA 4C90A 1MMGA 2YU1A 2NWBA 5JDFA 3HKDE 4M1PA 3ZC0A 3B13A 4DMVA 2JQQA 1BR1A 2C5KT 3VKHA 2E9XB 1MMNA 3P8CD 2D2SA 4O8SA 2LSGA 2MBGA 3C64A 3ZN1B 3EDUA 4PFPA 2KXPB 3PE0A 2Q9QC 3I0OA 3LK42 3ZYLA 4EIWA 3C51A 2LHNA 1LKXA 1VRBA 3N5LA 5FYMA 3DJBA 3ETUA 2VKJA 2BZBA 4UELA 3GN5A 4FI5A 2BDEA 2IC9A 3KINB 5M4YA 2K9AA 3UULA 2IAKA 4WW0A 3RX6A 4IE7A 3ZMUB 5LHGB 4AXPA 3UT5E 2X0LB 1HG5A 3PUQA 5DQWA 2HH7A 4KMCA 4MLKA 4ANJA 4BAYB 3GA8A 4DBRA 2ZMAA 4WNKA 4CXYA 4H63V 4QXCB 4WBNE 5EK3A 4UVAB 3LK2B 3N9OA 5HXSA 4U74A 3SOLA 1MNDA 3J9X1 4MFRA 3K3QC 1HF8A 2D5UA 4ZOLE 4ZI3C 3L3PA 1CUNA 3D0TA 4TZ4C 3HKCE 3Q5XA 3IF8B 5JDNA 1MIYA 2B1EA 3ZMZB 3ZN0B 1HCIA 3AA0B 5HXHA 1MIVA 4I55E 2CEAA 4PJJA 2L3LA 2NTYA 2A3DA 2ODVA 2G0UA 4ZI2D 4OHFA 5FXWA 3N2KE 2VB6A 5DQVA 3NBXX 5E0OA 4H9QC 3RH3A 3AA6B 3BQLA 3OJAA 4HEAA 2VWAA 4GYSA 5BMVE 5JR9B 4GOUA 5HWXA 4PK4A 4TX5A 4IE5A 3SWHA 5FXZA 4AKRB 3Q5WA 2WMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9X A;  3HI2 A;  3GN5 A;  3GA8 A;  3GN5 B; 
#chains in the Genus database with same CATH topology
 1B7T A;  2SPC A;  5LXT E;  4X1Y E;  5FMN A;  3E22 E;  2J4G A;  1D0Z A;  3PUS A;  3AAE B;  2V7J A;  5LNK A;  3CX6 B;  1ZKE A;  3AA1 B;  5CJ5 A;  3KVB A;  2Q9Q B;  4P0B A;  4TWH A;  1HX8 A;  3LBX A;  2V7I A;  5AQL B;  3FZL B;  3PJA A;  3L8R A;  1IBM T;  3G06 A;  1VCS A;  5L4E A;  4U7Y A;  5JDH A;  1T72 A;  4JI5 T;  4GKK T;  4BA9 A;  1QUU A;  1KNR A;  5LGU B;  3AE7 A;  2B76 A;  4QHO A;  2WBL A;  2XAJ B;  2WCA A;  4YSX A;  2V7K A;  4YSZ A;  3ZMV B;  3WI3 A;  1NAF A;  2V1D B;  4MBQ A;  1UX4 A;  3CPZ A;  2VL8 A;  3PUG A;  4ZXL A;  2I0M A;  5ABH A;  4DVD A;  5C2T A;  1I6Z A;  4QX7 B;  3OKQ A;  2WDV A;  1BR2 A;  4TWD A;  2LT3 A;  3RGL A;  2DHR A;  4ZEY A;  4QXB B;  4U7I A;  1W0A A;  4B3M T;  3R6N A;  2K24 A;  4U33 A;  2NTX A;  4DR4 T;  1WRD A;  2ZM2 A;  2FJE A;  4OK0 A;  3WAJ A;  4O2A E;  4UF0 A;  4ZS3 A;  3AE5 A;  4HWD A;  3RHW A;  4ZHQ E;  4K0K T;  4EAH A;  2NP9 A;  2BS2 A;  4H9O C;  3FXD B;  4PAG A;  5IUX A;  5KMG P;  4KHZ F;  2WU5 A;  1FJG T;  2W0G A;  2LM2 A;  4IST A;  3P4P A;  3ZMS B;  1S35 A;  2XAG B;  4J2C A;  2XQ4 A;  3O1H A;  3RQW A;  4PK6 A;  4EZ4 A;  3JAD A;  3O4X E;  1D1B A;  2CXF A;  4EYY R;  4P0A A;  4HFH A;  3I9Y A;  3ZCJ A;  2IUB A;  2PJQ A;  3CQX C;  5HXE A;  3P4S A;  2Y48 B;  5L3F B;  2X9W A;  2PTF A;  4PW8 A;  3PUW F;  5EK2 A;  3MKD A;  4H9R C;  3I0Q A;  4KBM B;  3RC3 A;  2E5V A;  5CA0 E;  1AJ3 A;  3RRC A;  3OYZ A;  3O1J A;  3L09 A;  5ABE A;  5LA6 E;  2JPF A;  5EK4 A;  3AXJ B;  3L39 A;  2H7O A;  3HKB E;  3ANW A;  1N33 T;  3SS1 A;  3LFM A;  3OPC A;  4YHH T;  4I0U A;  2LRK A;  2DL1 A;  4TUY E;  3ZYM A;  3C4Z A;  1IJ5 A;  2X9Y A;  1YQ4 A;  3GN5 B;  1SE7 A;  2N9D A;  5LHI B;  1NWM X;  5A1L A;  1L0V A;  3UUX B;  1XNR T;  2JQK A;  3CKD A;  5LB7 B;  3B57 A;  3N2G E;  2FJA A;  3W15 B;  1D1C A;  1N34 T;  5GON E;  3ESL A;  2J1D G;  1JNZ A;  2CXL A;  4DV6 T;  5CB4 E;  2LSI A;  3JAE A;  5LG4 A;  4V1A v;  2LEH A;  4AKH A;  3OYX A;  4O4L E;  2HN2 A;  3AED A;  3CQC B;  1MMD A;  1BR4 A;  3KDS E;  2IHR 1;  3KV4 A;  3ZPO A;  1M62 A;  2PBI A;  1T8B A;  2ODU A;  3ZLI A;  2JJ9 A;  3CX8 B;  2RPA A;  4P1N A;  2LHR A;  2ZM6 T;  3PU8 A;  4X65 T;  4QX8 B;  1MIW A;  2W2U A;  4QXH B;  1I94 T;  3BQK A;  2ES0 A;  4K0U A;  3NRX A;  1JNR A;  1SUM B;  2KND A;  4O2B E;  4L5G A;  2LSK A;  4NPP A;  2KIN B;  4L0R A;  2JMK A;  3MJX A;  4U72 A;  3PTR B;  1FMV A;  4DR5 T;  1WLX A;  2VKH A;  3RIA A;  5DJQ C;  4HFD A;  2OA5 A;  4IDO A;  3ZT7 A;  2DNX A;  3UUN A;  3B5M A;  4LFA T;  3LG7 A;  4AQG A;  2X0Y A;  2E2A A;  3K1S A;  2WU2 A;  1UUR A;  4ASK A;  5JVD E;  4EOZ B;  2VQF T;  3U3I A;  2KWI B;  4IRE A;  5JR9 C;  4A97 A;  1MMG A;  4YT0 A;  4DMV A;  2JQQ A;  1BR1 A;  2C5K T;  3VKH A;  3EI0 A;  2LSG A;  2MBG A;  2KXP B;  3ZYL A;  5FL1 A;  5AQG B;  4FI5 A;  3H3M A;  3P4Q A;  4ANJ A;  4GKJ T;  2WY2 A;  2XSA A;  4WNK A;  2UUB T;  5EK3 A;  3N9O A;  3SOL A;  2D5U A;  1CUN A;  4NIQ A;  4DUY T;  3HKC E;  3Q5X A;  1MIY A;  2B1E A;  4HWC A;  3ZMZ B;  5HXH A;  4I55 E;  2NTY A;  5FXW A;  5DQV A;  3BQL A;  3OJA A;  3NKZ A;  5HEG A;  4GYS A;  5JR9 B;  5BR8 T;  1XDP A;  4PK4 A;  4AKR B;  2R6G F;  3Q5W A;  3AE2 A;  5KXJ A;  3UTK A;  4TNV A;  5JRC A;  5KDM C;  1Y01 A;  4EEB A;  2QGS A;  4X20 E;  3LDQ B;  4JEU B;  4HN9 A;  4O4H E;  1YKE B;  4IE4 A;  4YLH A;  2PFV A;  3AVS A;  3SFD A;  3O9X A;  2CA5 A;  5AQF B;  4HE8 A;  1KNP A;  1WFD A;  3TLT A;  1O3X A;  2BBJ A;  2M6B A;  3N9Q A;  1Z0P A;  3M65 A;  3N9P A;  4A56 A;  3N9L A;  3IEE A;  4AIS A;  4EED A;  2JMH A;  4UVB B;  4UXN B;  4LFC T;  2YKS A;  4QKN A;  4ZZB A;  3I1A A;  2GK9 A;  3QUJ A;  3RI5 A;  4C91 A;  3CVR A;  2V5C A;  4PJN A;  5JRE A;  4COF A;  1YKH B;  2XJ7 A;  1VOM A;  3E08 A;  2WWV A;  5JQG E;  3MK7 C;  1YW0 A;  5EZY E;  1W9R A;  1KNZ A;  2XAS B;  2V6Y B;  4YTP A;  2IW5 B;  2BS4 A;  3MZK B;  2UXX B;  1HNX T;  2XQ3 A;  2MPK A;  4O4J E;  3CIR A;  4JI2 T;  2LLY A;  2H89 A;  3CQG B;  2XAQ B;  5FY1 A;  1FIO A;  3EHZ A;  1IBK T;  4AKG A;  5HWY A;  1WR0 A;  1IAP A;  3NWI A;  1HNZ T;  2VKD A;  4U3C A;  4ILA A;  3TLU A;  2E8I A;  4MAL A;  2UXN B;  2WDR A;  5ETW A;  3ZJ1 A;  4CXX A;  1D1A A;  1E1H B;  1IBL T;  1XMO T;  3FBL A;  4TNW A;  1KF6 A;  5AFU L;  1YD8 G;  2BKP A;  3PV0 F;  2W62 A;  2YDR A;  3GWH A;  5FXX A;  1ZP0 A;  3DP7 A;  4UR9 A;  3PUX F;  4LF6 T;  3PUY F;  5L2L A;  4HTE A;  3Q5E A;  2W4X A;  3KV5 A;  3HR0 A;  2RP4 A;  3CML A;  5FVK A;  1D0Y A;  2WAU A;  2J62 A;  1X79 A;  4AKL A;  5JTG A;  3A7M A;  4CZZ B;  2X68 A;  2CBJ A;  4ZZC A;  5HEJ A;  1XMQ T;  2XQ6 A;  3KBT A;  4UVC B;  2XQ7 A;  4EGW A;  4DMW A;  1ZV4 X;  1Z8U A;  2BG9 E;  2FUP A;  4ILC A;  4X1K E;  5FVL A;  5H6Q B;  2VAS A;  2VK9 A;  4FJO A;  3TLS A;  4ADZ A;  3TKL B;  1X9B A;  4Z91 A;  2LOS A;  5LJN A;  4WYV A;  5TAO A;  4TN7 B;  2LM9 A;  2VL0 A;  2V5D A;  4PJL A;  2W63 A;  1N36 T;  2ZM0 A;  3T1H T;  2XQ8 A;  3AAA B;  4IL4 A;  2LKG A;  3QK6 A;  4WZX A;  2EHO A;  3P4W A;  5JRC B;  2QA7 A;  2I59 A;  3FHN A;  5DAB A;  4E7Z A;  3ZEF B;  4YTM A;  2LJL A;  1FMW A;  4HGA A;  5LMN T;  4JI6 T;  4QH4 A;  5AQV B;  4IIJ E;  2MTQ A;  2ACX A;  1HTJ F;  4WBO A;  4IDZ A;  4H9P C;  4JI0 T;  3KBU A;  3C4X A;  4U31 A;  4DR7 T;  2WP9 A;  2CBI A;  4I4T E;  2YU2 A;  2LSJ A;  4ZI3 D;  2D0U A;  1MNE A;  2VVS A;  3ONJ A;  2UUC T;  3KFW X;  1VCT A;  2KT9 A;  2WS3 A;  4LF8 T;  4X64 T;  3PUV F;  4BJM A;  3KV9 A;  3IA3 A;  4M1P A;  3B13 A;  3ZKR A;  3RIF A;  2X0H A;  3P8C D;  3ZN1 B;  4HFB A;  2XM2 A;  3AEA A;  5FYM A;  3ETU A;  4UEL A;  2BDE A;  2IC9 A;  5M4Y A;  3UUL A;  2IAK A;  4WW0 A;  4HWF A;  3RX6 A;  5AQQ B;  3ZMU B;  2AXD S;  4AXP A;  2X0L B;  1HG5 A;  5DQW A;  3UQ7 A;  1YQ3 A;  3RKG A;  4WBN E;  4UVA B;  5HXS A;  2F4V T;  1MND A;  4MFR A;  4ZOL E;  4ZI3 C;  4TZ4 C;  5JDN A;  3ZN0 B;  1HCI A;  3AA0 B;  4PJJ A;  4ZI2 D;  4LF4 T;  2VB6 A;  3OTO T;  3NBX X;  2IIU A;  1J5E T;  3RH3 A;  3AA6 B;  2BBH A;  3SWH A;  3AE3 A;  2ZLY A;  2HN1 A;  3KVA A;  4DV3 T;  3LBX B;  2ZM8 A;  3OBV E;  3VKG A;  3VR8 A;  3K8P C;  1H7C A;  4OFZ A;  3AAI A;  5ADX L;  3LK3 B;  4U2Y A;  4XBF B;  4OYJ A;  3AE8 A;  5AQN B;  5HCJ A;  2W66 A;  1ZHC A;  3RPU A;  2IC6 A;  4F6R C;  3ZST A;  4O4I E;  2L9Q A;  4UEM A;  3NZQ A;  2JQ9 A;  3SRZ A;  3H3A A;  4ILU A;  3SFE A;  3F2E A;  3ONL C;  2M6I A;  3ZSS A;  2MYS A;  4IT4 A;  3HI2 A;  3N2O A;  2YIN A;  4ZI2 C;  1OXZ A;  3JAF A;  5J2T E;  1NEK A;  2YDQ A;  4X5T A;  3RYI E;  3FB2 A;  3I9W A;  2E9X A;  5L3C B;  4CN6 A;  3PUZ F;  3HL6 A;  1M7K A;  4DR1 T;  4DV5 T;  4B3R T;  1HS7 A;  2BG9 A;  4UF0 B;  4DID B;  2X9X A;  5C3J A;  3PDY A;  1QLB A;  2BVM A;  4JV5 T;  4EXT A;  4LF7 T;  3NZP A;  3OVU A;  2KZ7 B;  4IDP A;  1QSD A;  3X1D A;  4JI1 T;  2LOP A;  3PJA J;  2WWU A;  3UFE A;  3UU8 A;  1N32 T;  4JYA T;  4AI6 A;  2Y8D A;  4A5X A;  3AB3 B;  3UU4 A;  4NUU A;  5FY7 A;  3VR9 A;  4HFV A;  3CWZ B;  3UU3 A;  2WZI A;  2W61 A;  3AE6 A;  2NW8 A;  3ZYK A;  2YOE A;  2WB5 A;  2CLY C;  1LVF A;  3MXZ A;  4JI8 T;  2N1G A;  2DI4 A;  5LOV E;  4E7S A;  4NXM T;  5L3E B;  3T8O A;  3J7Y q;  3Q5D A;  4ILB A;  2A2F X;  4JLE A;  3EAB A;  3LJC A;  2E5L T;  2NR4 A;  1J5W A;  3PUA A;  4H9S E;  2XM1 A;  1J1J A;  2OLT A;  5JDL A;  4LMJ A;  2ACZ A;  3EDV A;  3QB5 A;  2DWK A;  4F8H A;  4AKI A;  2LKH A;  3RYC E;  1IZN B;  2HHH T;  2V26 A;  3H37 A;  3ANW B;  2CWO A;  4DR3 T;  2VVN A;  4I50 E;  1S94 A;  4PK5 A;  2RA1 A;  2E9X D;  3RC8 A;  2UXB T;  4XAX B;  2CPT A;  5HEO A;  1XZY A;  4X1I E;  5FXV A;  2K48 A;  2OV9 A;  2CLY B;  3AVR A;  4DND A;  3CK6 A;  4UV9 B;  5L4H A;  1D0X A;  5AQU B;  5JDG A;  3AEF A;  4QWN B;  2FBW A;  3VRB A;  4ZI7 E;  2XAF B;  4LFB T;  3ZCI A;  2BVL A;  5AQJ B;  2C0S A;  1G73 A;  4LF5 T;  2JQH A;  4KP3 C;  4NUV A;  3VU7 H;  5LGT B;  4DR6 T;  4PNI A;  2HPL A;  5AQH B;  4Z8X A;  4EB6 E;  1CHU A;  4BJN A;  4YSY A;  2D9D A;  2XQ9 A;  3DTO A;  2NW9 A;  4KX6 A;  2XY8 B;  2CHN A;  4HFC A;  2XAH B;  2UXC T;  3ZJ2 A;  2QVA A;  5LGN B;  1KK7 A;  4EZH A;  2E9X C;  3AEC A;  5HYA A;  2C5J A;  2I6H A;  4YJ2 E;  2XZE A;  3F57 A;  2XPK A;  1HX1 B;  4DR2 T;  3AA7 B;  4CXW A;  2V7M A;  2BG9 C;  3R84 B;  3K3N A;  4CI1 B;  4IE6 A;  2IML A;  3ZMT B;  3FXE B;  1WYC A;  5FY0 A;  1HG2 A;  4UV8 B;  3AEG A;  1WCR A;  5IHY A;  2XQA A;  4B3T T;  4HFE A;  3C50 A;  1EZ3 A;  5LP6 E;  1OED A;  1XDO A;  2KWH A;  5F8P A;  2YEV C;  4X66 T;  1E7P A;  4GYR A;  1E2A A;  3RYH E;  3ABV A;  4IE0 A;  2X66 A;  2NWB A;  5CGM A;  5JDF A;  3HKD E;  5J0Z A;  4DV7 T;  2E9X B;  4IL9 A;  4B3S T;  2D2S A;  4O8S A;  4EV6 A;  3C64 A;  3LSV A;  4LML A;  4PFP A;  3PE0 A;  3LK4 2;  4EIW A;  1LKX A;  1VRB A;  3ZT6 A;  5AQR B;  2BG9 B;  3EAM A;  4CN4 A;  4IE7 A;  1W09 A;  4DUZ T;  2HH7 A;  3TLV A;  4KMC A;  5FL0 A;  3GA8 A;  3TLW A;  2ZMA A;  4CXY A;  4QXC B;  1HF8 A;  5IWA T;  3RLF F;  1XWM A;  3IF8 B;  1HR0 T;  1UUS A;  2CEA A;  2L3L A;  3T1Y T;  2A3D A;  2G0U A;  4OHF A;  4YY3 T;  3N2K E;  2K3W A;  4HEA A;  2KSR A;  5ABF A;  4TX5 A;  2WQY A;  2DWG A;  5JR9 A;  2LRL A;  1KEY A;  5HAX A;  2CE7 A;  4QH1 A;  3MAC A;  3AEE A;  2Z6E A;  2N2N A;  4MHC A;  4GIW A;  3UQ4 A;  2H7V C;  1MMA A;  3P7I A;  2FJD A;  3O1I A;  3Q9D A;  3IHR A;  1SHZ C;  2J47 A;  1ZOY A;  4IGU A;  1UCU A;  3IBP A;  5LJM A;  5LG3 A;  3FZK B;  4DV4 T;  3AE9 A;  3K3O A;  2WDQ A;  2X51 A;  4CQI A;  5ABG A;  1DU2 A;  3ZT5 A;  5F3J A;  3NVO A;  5CA1 E;  4JI7 T;  4CI2 B;  3S4U A;  5JH7 E;  1T7S A;  5HEU A;  1R8I A;  2V8S V;  4DBQ A;  4AQF A;  3FZH B;  4OX9 T;  2DLR A;  3ETV A;  3RIU A;  2HPJ A;  2XSB A;  4Q25 A;  2QRX A;  2XTL A;  3JC6 D;  5HCM A;  5LHH B;  3BQI A;  4PFO A;  3KV6 A;  3ZC1 A;  5FP3 A;  4JEH B;  2H3R A;  5J1G A;  4KUM B;  2CXD A;  5JDQ A;  4TWF A;  4ERR A;  2V7L A;  4DO0 A;  4YFS A;  5JDM A;  4H9N C;  5AQS B;  1OED C;  5AQM B;  2L8K A;  3N9M A;  2IDO B;  4TV8 E;  3RKO A;  2A9U A;  2CCQ A;  3UUM A;  4HWI B;  4PJM A;  3QC9 A;  4HFI A;  2LE8 A;  2M67 A;  2V6Y A;  3AE1 A;  5L3D B;  3HA4 A;  2X67 A;  2KLQ A;  2AE9 A;  2EHO D;  2D0T A;  2PG8 A;  1Y64 B;  4P09 A;  5LBQ B;  3UU6 A;  3Q2M A;  1IJ6 A;  2CRB A;  2CMR A;  3RF1 A;  1U4Q A;  3WAK A;  3UU5 A;  2WM9 A;  2LSY A;  4IHJ E;  3F31 A;  3AEB A;  4Z90 A;  1UX5 A;  2XQY A;  2VKO A;  1HNW T;  2NOX A;  2C5I T;  2UXD T;  5KX5 E;  1NEN A;  2X9H A;  2Q9Q A;  3JC6 C;  5HEH A;  3MA9 A;  2CHO A;  3FBZ A;  5LMU T;  4JI4 T;  3N9N A;  1US7 B;  2WSS V;  2JIW A;  5AQO B;  4IDQ A;  5L47 A;  4QH5 A;  2BS3 A;  3GMI A;  1OED E;  1OED B;  3PU3 A;  3EVY A;  5L3G B;  2CWY A;  3FZF B;  3P50 A;  5C8Y E;  4G2A A;  5HXC A;  2MAW A;  3C4W A;  2EHO C;  4H63 H;  3NRY A;  1OWA A;  2H88 A;  1ZEE A;  1FEW A;  2KMF A;  3BK9 A;  2WMN A;  4CN1 A;  2DCF A;  1LRZ A;  4DV1 T;  4YXD A;  2VUR A;  1LVK A;  1V9D A;  1XNQ T;  3HKE E;  2YDS A;  3M3Z B;  5H6R B;  4G63 A;  2QYW A;  5L3B B;  4L9I A;  2UUA T;  1WYB A;  4ISS A;  2A72 A;  4ZS2 A;  2XHE B;  2JRK A;  1T98 A;  4GK5 E;  5F5W A;  2XUE A;  3E0Z A;  1W0B A;  2W00 A;  1WR6 A;  5FNV E;  3QB5 K;  2P9B A;  4LMK A;  1GQE A;  3VRA A;  3V5U A;  2CM0 A;  3A8Y C;  4JI3 T;  1G8X A;  3A5X A;  5LYJ E;  5LBM A;  3U78 A;  2YN6 A;  3PUR A;  3EUH A;  4XZC A;  3VHL A;  3UFG A;  4A98 A;  1SA0 E;  5ABF B;  2EHO B;  1U5P A;  4GK0 E;  4HWH A;  4AQF C;  5J2U E;  3QOF A;  3P4R A;  3RIU C;  4OYK A;  2K5B B;  5AQK B;  2Q9Q D;  4HKA A;  4AIU A;  2YK0 A;  4B6X A;  1HFA A;  4KI0 F;  5HXR A;  4JUY A;  2MOZ A;  3CX7 B;  3RYF E;  4TV9 E;  4I43 B;  3V5S A;  3AE4 A;  4YHJ A;  5AQI B;  4YJ3 E;  3C98 B;  4UIG A;  5IYZ E;  1BR0 A;  4N78 D;  4CI3 B;  2Y6X A;  2NW7 A;  4IDN A;  4EYU A;  3JCF A;  3AXJ A;  4X62 T;  5AQT B;  5LCY A;  4DV0 T;  1YXR A;  3ONX A;  2VQE T;  3RRW A;  2BKN A;  2XQ5 A;  4C90 A;  2YU1 A;  2UU9 T;  3ZC0 A;  4KHP T;  2V6X A;  1MMN A;  3EDU A;  2W67 A;  2Q9Q C;  3I0O A;  4U2Z A;  3C51 A;  5CFB A;  2LHN A;  4LF9 T;  4YTN A;  3N5L A;  3DJB A;  4DV2 T;  2VKJ A;  2BZB A;  3RQU A;  3GN5 A;  3UUB A;  4JBW F;  3KIN B;  2K9A A;  1UK5 A;  2FJB A;  5LHG B;  3UT5 E;  3PUQ A;  1KFY A;  4MLK A;  4BAY B;  3FZM B;  4AQY T;  4DBR A;  4H63 V;  5AQP B;  3LK2 B;  1UGO A;  4U74 A;  5FKY A;  3J9X 1;  3K3Q C;  3L3P A;  3D0T A;  4NXN T;  1MIV A;  2ODV A;  5E0O A;  2WZH A;  4H9Q C;  2VWA A;  5BMV E;  4GOU A;  5HWX A;  4IE5 A;  5FXZ A;  2BKO A;  3QNU A;  2WMO A; 
#chains in the Genus database with same CATH homology
 2DWG A;  1B7T A;  2SPC A;  5LXT E;  4X1Y E;  5FMN A;  3E22 E;  5JR9 A;  2ZLY A;  3KVA A;  3UTK A;  1D0Z A;  3PUS A;  3AAE B;  2V7J A;  3LBX B;  5LNK A;  5HAX A;  2CE7 A;  5JRC A;  5KDM C;  3MAC A;  3CX6 B;  2Z6E A;  2ZM8 A;  3OBV E;  1ZKE A;  3AA1 B;  3VKG A;  3KVB A;  2QGS A;  2N2N A;  4MHC A;  2Q9Q B;  1H7C A;  3K8P C;  4GIW A;  4P0B A;  4X20 E;  1HX8 A;  3LBX A;  2V7I A;  4JEU B;  2H7V C;  4OFZ A;  3AAI A;  4HN9 A;  5ADX L;  3LK3 B;  1MMA A;  3P7I A;  4O4H E;  4XBF B;  3O1I A;  1YKE B;  4OYJ A;  4IE4 A;  4YLH A;  3Q9D A;  3IHR A;  2PFV A;  5JDH A;  3AVS A;  1SHZ C;  4BA9 A;  1QUU A;  4IGU A;  1ZHC A;  3RPU A;  1UCU A;  5LGU B;  2IC6 A;  3IBP A;  3O9X A;  4QHO A;  5LJM A;  4F6R C;  2CA5 A;  2WBL A;  2XAJ B;  2V7K A;  3K3O A;  4O4I E;  2L9Q A;  4HE8 A;  2X51 A;  4UEM A;  1O3X A;  3WI3 A;  3NZQ A;  3ZMV B;  4CQI A;  1NAF A;  3SRZ A;  2V1D B;  3N9Q A;  1Z0P A;  3H3A A;  3M65 A;  4ILU A;  5F3J A;  3F2E A;  3N9P A;  4MBQ A;  1UX4 A;  3CPZ A;  5CA1 E;  4A56 A;  2VL8 A;  2MYS A;  3PUG A;  4CI2 B;  3HI2 A;  3N9L A;  3IEE A;  3N2O A;  2JMH A;  4UVB B;  2YIN A;  4ZI2 C;  4UXN B;  3S4U A;  1OXZ A;  4QKN A;  4DVD A;  5JH7 E;  3I1A A;  5J2T E;  4QX7 B;  3OKQ A;  2GK9 A;  3QUJ A;  4C91 A;  3CVR A;  3RYI E;  3FB2 A;  3I9W A;  4DBQ A;  2E9X A;  4PJN A;  1BR2 A;  5L3C B;  4AQF A;  2LT3 A;  5JRE A;  2DHR A;  2DLR A;  3ETV A;  1YKH B;  2HPJ A;  3HL6 A;  1VOM A;  2XTL A;  3JC6 D;  4QXB B;  5LHH B;  3E08 A;  3R6N A;  2K24 A;  3BQI A;  5JQG E;  3MK7 C;  1HS7 A;  4PFO A;  1YW0 A;  3KV6 A;  5FP3 A;  3ZC1 A;  4JEH B;  2H3R A;  4UF0 B;  5J1G A;  2NTX A;  2X9X A;  1WRD A;  4KUM B;  2ZM2 A;  3PDY A;  2CXD A;  5JDQ A;  2BVM A;  4OK0 A;  4ERR A;  3WAJ A;  2V7L A;  4O2A E;  4UF0 A;  4ZS3 A;  5EZY E;  4YFS A;  4DO0 A;  4EXT A;  5JDM A;  4H9N C;  3NZP A;  1KNZ A;  2KZ7 B;  4ZHQ E;  2XAS B;  4EAH A;  2NP9 A;  1QSD A;  2L8K A;  3N9M A;  4TV8 E;  2IW5 B;  2LOP A;  3MZK B;  4H9O C;  3RKO A;  2CCQ A;  3UUM A;  2UXX B;  4PJM A;  3QC9 A;  3FXD B;  2WWU A;  4PAG A;  2LE8 A;  2M67 A;  3UFE A;  4O4J E;  5L3D B;  3HA4 A;  5KMG P;  2X67 A;  4AI6 A;  2KLQ A;  2Y8D A;  3AB3 B;  2W0G A;  3CQG B;  2EHO D;  2D0T A;  2PG8 A;  2XAQ B;  5FY1 A;  1Y64 B;  4NUU A;  1FIO A;  4IST A;  5FY7 A;  1S35 A;  4HFV A;  3CWZ B;  2XAG B;  4J2C A;  4P09 A;  5LBQ B;  3ZMS B;  5HWY A;  3Q2M A;  4AKG A;  3O1H A;  1IJ6 A;  4PK6 A;  4EZ4 A;  2W61 A;  2CMR A;  1IAP A;  1U4Q A;  3WAK A;  2NW8 A;  2WM9 A;  3ZYK A;  2LSY A;  2VKD A;  4IHJ E;  3F31 A;  3O4X E;  2CLY C;  1D1B A;  1LVF A;  2CXF A;  3MXZ A;  1UX5 A;  2XQY A;  4EYY R;  2N1G A;  4P0A A;  2VKO A;  2DI4 A;  5LOV E;  4E7S A;  5L3E B;  2NOX A;  3T8O A;  3I9Y A;  3ZCJ A;  3J7Y q;  2E8I A;  2C5I T;  4MAL A;  2A2F X;  2PJQ A;  2UXN B;  3CQX C;  4JLE A;  5KX5 E;  3LJC A;  2X9H A;  2Q9Q A;  3JC6 C;  5ETW A;  5HXE A;  2Y48 B;  5L3F B;  2X9W A;  3PUA A;  3MA9 A;  3ZJ1 A;  4CXX A;  3FBZ A;  1D1A A;  1E1H B;  3N9N A;  4H9S E;  1US7 B;  2WSS V;  5JDL A;  4PW8 A;  3FBL A;  5EK2 A;  3MKD A;  4H9R C;  3EDV A;  3I0Q A;  4KBM B;  3RC3 A;  5AFU L;  2DWK A;  1YD8 G;  3GMI A;  5CA0 E;  4AKI A;  1AJ3 A;  3RRC A;  3OYZ A;  3O1J A;  2W62 A;  3L09 A;  3PU3 A;  5LA6 E;  2JPF A;  3GWH A;  3EVY A;  5EK4 A;  5FXX A;  1IZN B;  3RYC E;  5L3G B;  3DP7 A;  2V26 A;  3H37 A;  2H7O A;  3ANW B;  2CWY A;  3HKB E;  2CWO A;  5C8Y E;  4G2A A;  4I50 E;  1S94 A;  4PK5 A;  5L2L A;  5HXC A;  4H63 H;  3C4W A;  2EHO C;  4HTE A;  2RA1 A;  2E9X D;  3NRY A;  3ANW A;  1OWA A;  3RC8 A;  1ZEE A;  1FEW A;  4XAX B;  3SS1 A;  2KMF A;  3LFM A;  3BK9 A;  2WMN A;  3KV5 A;  2DCF A;  3HR0 A;  1LRZ A;  2RP4 A;  3CML A;  1LVK A;  1D0Y A;  4X1I E;  5FXV A;  1V9D A;  4TUY E;  2K48 A;  3HKE E;  2WAU A;  3ZYM A;  1X79 A;  3C4Z A;  1IJ5 A;  4AKL A;  2CLY B;  4CZZ B;  2X9Y A;  2X68 A;  3AVR A;  4DND A;  5H6R B;  4G63 A;  4UV9 B;  1D0X A;  3KBT A;  3GN5 B;  5JDG A;  4UVC B;  5L3B B;  4DMW A;  2N9D A;  5LHI B;  1NWM X;  4L9I A;  4QWN B;  5A1L A;  1ZV4 X;  1WYB A;  3UUX B;  4ISS A;  2A72 A;  4ZS2 A;  4ZI7 E;  2XAF B;  2XHE B;  2BVL A;  2JRK A;  3CKD A;  3ZCI A;  1T98 A;  4X1K E;  2C0S A;  4GK5 E;  1G73 A;  2XUE A;  3E0Z A;  4KP3 C;  4NUV A;  3VU7 H;  2W00 A;  3B57 A;  5LGT B;  3N2G E;  5H6Q B;  1WR6 A;  2VAS A;  5FNV E;  3W15 B;  2VK9 A;  4PNI A;  1D1C A;  2P9B A;  4FJO A;  2HPL A;  5GON E;  4Z8X A;  4EB6 E;  4ADZ A;  3V5U A;  3ESL A;  2J1D G;  4BJN A;  2CM0 A;  2CXL A;  3TKL B;  3DTO A;  2LOS A;  5CB4 E;  2LSI A;  5LJN A;  1G8X A;  3A5X A;  5TAO A;  2NW9 A;  4TN7 B;  4V1A v;  2LM9 A;  5LG4 A;  5LYJ E;  5LBM A;  2LEH A;  4AKH A;  3OYX A;  3U78 A;  4O4L E;  4PJL A;  2XAH B;  2W63 A;  2ZM0 A;  3PUR A;  3CQC B;  1MMD A;  1BR4 A;  3ZJ2 A;  3KDS E;  3EUH A;  4XZC A;  3AAA B;  3KV4 A;  3ZPO A;  3VHL A;  2PBI A;  1SA0 E;  2ODU A;  5LGN B;  3ZLI A;  2JJ9 A;  3CX8 B;  1KK7 A;  4EZH A;  2E9X C;  2EHO B;  2LHR A;  1U5P A;  4GK0 E;  3QK6 A;  5HYA A;  4AQF C;  2C5J A;  5J2U E;  3PU8 A;  4QX8 B;  1MIW A;  4OYK A;  2K5B B;  4YJ2 E;  4QXH B;  3F57 A;  2EHO A;  2Q9Q D;  3BQK A;  2ES0 A;  5JRC B;  4HKA A;  4K0U A;  2YK0 A;  3AA7 B;  2QA7 A;  3NRX A;  4CXW A;  2V7M A;  2I59 A;  3FHN A;  5DAB A;  4E7Z A;  3R84 B;  3ZEF B;  3K3N A;  4CI1 B;  4B6X A;  4IE6 A;  1HFA A;  3ZMT B;  2KND A;  4O2B E;  3FXE B;  1WYC A;  2LJL A;  2LSK A;  4L5G A;  5FY0 A;  2KIN B;  5HXR A;  1FMW A;  4HGA A;  4JUY A;  4L0R A;  2MOZ A;  1HG2 A;  2JMK A;  3CX7 B;  4IIJ E;  2MTQ A;  3MJX A;  2ACX A;  1HTJ F;  4UV8 B;  4U72 A;  4WBO A;  3PTR B;  3RYF E;  4TV9 E;  4IDZ A;  1FMV A;  4I43 B;  4H9P C;  1WLX A;  3V5S A;  3KBU A;  3C4X A;  4YHJ A;  2VKH A;  5DJQ C;  5IHY A;  4I4T E;  2OA5 A;  2YU2 A;  2DNX A;  2LSJ A;  3UUN A;  4ZI3 D;  2D0U A;  4YJ3 E;  1MNE A;  3C98 B;  3C50 A;  4UIG A;  5IYZ E;  3LG7 A;  1BR0 A;  1EZ3 A;  4N78 D;  5LP6 E;  4AQG A;  4CI3 B;  2Y6X A;  2NW7 A;  2KWH A;  4EYU A;  5F8P A;  3KFW X;  2YEV C;  4ASK A;  5LCY A;  2KT9 A;  5JVD E;  4GYR A;  4EOZ B;  3U3I A;  3RYH E;  2KWI B;  5JR9 C;  4IE0 A;  3ONX A;  2X66 A;  4BJM A;  3KV9 A;  3RRW A;  4C90 A;  1MMG A;  2YU1 A;  2NWB A;  5JDF A;  3HKD E;  4M1P A;  3ZC0 A;  3B13 A;  4DMV A;  2JQQ A;  1BR1 A;  2C5K T;  3VKH A;  2E9X B;  1MMN A;  3P8C D;  2D2S A;  4O8S A;  2LSG A;  2MBG A;  3C64 A;  3ZN1 B;  3EDU A;  4PFP A;  2KXP B;  3PE0 A;  2Q9Q C;  3I0O A;  3LK4 2;  3ZYL A;  4EIW A;  3C51 A;  2LHN A;  1LKX A;  1VRB A;  3N5L A;  5FYM A;  3DJB A;  3ETU A;  2VKJ A;  2BZB A;  4UEL A;  3GN5 A;  4FI5 A;  2BDE A;  2IC9 A;  3KIN B;  5M4Y A;  2K9A A;  3UUL A;  2IAK A;  4WW0 A;  3RX6 A;  4IE7 A;  3ZMU B;  5LHG B;  4AXP A;  3UT5 E;  2X0L B;  1HG5 A;  3PUQ A;  5DQW A;  2HH7 A;  4KMC A;  4MLK A;  4ANJ A;  4BAY B;  3GA8 A;  4DBR A;  2ZMA A;  4WNK A;  4CXY A;  4H63 V;  4QXC B;  4WBN E;  5EK3 A;  4UVA B;  3LK2 B;  3N9O A;  5HXS A;  4U74 A;  3SOL A;  1MND A;  3J9X 1;  4MFR A;  3K3Q C;  1HF8 A;  2D5U A;  4ZOL E;  4ZI3 C;  3L3P A;  1CUN A;  3D0T A;  4TZ4 C;  3HKC E;  3Q5X A;  3IF8 B;  5JDN A;  1MIY A;  2B1E A;  3ZMZ B;  3ZN0 B;  1HCI A;  3AA0 B;  5HXH A;  1MIV A;  4I55 E;  2CEA A;  4PJJ A;  2L3L A;  2NTY A;  2A3D A;  2ODV A;  2G0U A;  4ZI2 D;  4OHF A;  5FXW A;  3N2K E;  2VB6 A;  5DQV A;  3NBX X;  5E0O A;  4H9Q C;  3RH3 A;  3AA6 B;  3BQL A;  3OJA A;  4HEA A;  2VWA A;  4GYS A;  5BMV E;  5JR9 B;  4GOU A;  5HWX A;  4PK4 A;  4TX5 A;  4IE5 A;  3SWH A;  5FXZ A;  4AKR B;  3Q5W A;  2WMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...