3GA8A

Structure of the n-terminal domain of the e. coli protein mqsa (ygit/b3021)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator MqsA (YgiT/B3021)
publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
total genus 17
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2009-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.720 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ga8A00
3GN5B 3GN5A 3HI2A 3GA8A 3O9XA
chains in the Genus database with same CATH superfamily
5FKYA 3P4SA 4DV3T 3WAKA 3FZKB 5FMNA 3VKHA 3L8RA 4YY3T 2LE8A 2VKJA 3L09A 1US7B 3W15B 2FJAA 2QVAA 2BVLA 1E2AA 2D0TA 5FL1A 4IIJE 3KV4A 3RQUA 4FI5A 1X9BA 3AE3A 3MA9A 3PU3A 1D1BA 3IEEA 4X62T 5FY7A 5LHGB 3VU7H 2IMLA 3ZT5A 3O4XE 4V1Av 2X68A 4N78D 2L8KA 5AQTB 5J0ZA 4DR1T 3UUMA 1WRDA 2KXPB 2MYSA 5JDLA 2K5BB 3PUWF 2A9UA 3NRXA 4TV9E 2WZIA 2ZM2A 2XAHB 1MIYA 4UR9A 4LMJA 4G2AA 3Q5WA 4JI7T 3OVUA 3PE0A 4CN6A 4AQFA 3KDSE 2X51A 3Q9DA 1VCTA 2LOPA 2FJBA 4DMWA 4QX8B 3B57A 1HG5A 4HGAA 4IDQA 1Z0PA 4EEDA 3MJXA 2ACXA 1W0BA 2BVMA 2CBIA 3VR8A 3QUJA 2JMKA 2K48A 4HFIA 3MACA 4HWFA 2KSRA 4DV6T 3CX7B 5KMGP 4GIWA 4EYYR 3JC6D 2WP9A 2NTXA 4P09A 4FJOA 1OEDC 2W61A 2M67A 3ANWA 1GQEA 2V6XA 3CWZB 4PK6A 3N2GE 3ZN0B 3C4WA 2XQ5A 4OK0A 3ZCIA 3AE8A 1J5ET 3K1SA 1XMQT 2VWAA 4BA9A 4LF4T 3EABA 5L47A 2ZM6T 5TAOA 5L4EA 4O4JE 3FXDB 5LG3A 4EGWA 4IL9A 3VHLA 2D0UA 2X9HA 2PJQA 3LFMA 4CXXA 4EAHA 2WB5A 4LFBT 4CQIA 3UU3A 2ZM8A 2V26A 3O1IA 1DU2A 5FVKA 1KNPA 4O8SA 2ZM0A 3AE6A 5LGTB 1MNEA 4AQGA 2HN1A 2Y6XA 2JMHA 3QK6A 2UXDT 5M4YA 4XBFB 2V7KA 3LBXA 4Z90A 3I0QA 3N9LA 3NZQA 5AQUB 2MPKA 3ZPOA 5HXHA 1BR2A 5JREA 2IUBA 2Q9QC 5L3FB 2BS2A 1D0XA 1OEDB 2XM1A 1Z8UA 3A5XA 3PUGA 2K9AA 2JQQA 1XMOT 2IHR1 1IJ5A 5ABFB 1UURA 3UU4A 4IHJE 2XAFB 1HNZT 2JRKA 2G0UA 1G8XA 1JNZA 4YLHA 4Q25A 3ZKRA 2XASB 3AEFA 3K3OA 4X65T 3Q5EA 1J5WA 2RPAA 3R6NA 3KINB 2IAKA 2UXXB 1SHZC 2V6YB 1L0VA 4MLKA 4DR2T 3ONJA 3I9YA 4A5XA 5LP6E 2XPKA 3UFEA 5LJNA 2BBJA 3CX6B 2DLRA 3KFWX 4AIUA 3LK2B 5L3BB 3PUSA 5AQLB 2C5IT 2V7IA 5BMVE 5LXTE 2WDVA 2WZHA 1ZP0A 2PG8A 5C3JA 2Y8DA 4TX5A 5FVLA 5JH7E 4IDOA 4EV6A 1M62A 4DV0T 1UCUA 5AQHB 1EZ3A 3AA7B 2XQ7A 3UU6A 3HI2A 4I0UA 3LG7A 3N2KE 3AECA 3HKDE 2HPLA 2WU2A 5H6RB 4DBQA 2A72A 4LMLA 2Q9QB 4UF0A 5JVDE 4JYAT 4QH1A 4CI1B 4LF9T 2NW8A 2EHOC 4PJNA 4CN1A 4ZI2D 2LSKA 2KNDA 2W67A 3E22E 4AI6A 5KX5E 4KI0F 1S94A 2W2UA 3ZYKA 3CPZA 4GK5E 2HN2A 1D1AA 4CXWA 3ZJ1A 3CKDA 5AQJB 4QH4A 3SWHA 2BKOA 4XAXB 4GYSA 3H3MA 2UXBT 4PJLA 2YU1A 4H63V 4HFDA 3C64A 1LVKA 5CA0E 2NTYA 4WZXA 2XY8B 3GN5B 4TNVA 4BJNA 5L3DB 2XUEA 3OKQA 2H7OA 2AXDS 2V1DB 3AEBA 3N9MA 1D1CA 4JI6T 5JR9A 5HWXA 2IC9A 5CB4E 4B3ST 3CK6A 4X20E 2XQ3A 3N9OA 4AKRB 5AQIB 2L3LA 5ETWA 2AE9A 3N9NA 3BQIA 5LBMA 2W66A 1UX5A 4QHOA 5IHYA 2LHRA 5EZYE 4G63A 4IE0A 3RIFA 2H3RA 1LVFA 4DV1T 4AKHA 3N9QA 4UIGA 4ZZBA 2EHOB 3BQLA 2X0LB 4ZI7E 4ZEYA 4AQFC 3ESLA 3ETVA 3LJCA 3NWIA 3RQWA 1NWMX 2CCQA 4DUZT 4X66T 3C98B 4LFAT 5CJ5A 2J1DG 3H37A 2J47A 2LSYA 2PFVA 5AQSB 2LHNA 2C5JA 5LCYA 5DABA 3HKBE 1IBKT 3LK42 4HWCA 1YD8G 1WR0A 1T72A 2CXLA 5J1GA 2D2SA 1WYBA 4MFRA 1YKHB 2V8SV 2WS3A 5HCMA 4YTNA 4A98A 4H9RC 2YKSA 2C0SA 3ZYLA 3C4XA 3AXJB 2R6GF 4P0BA 4TWFA 4O2BE 2CHOA 2XQAA 2LKGA 4P1NA 5IYZE 3EUHA 3IA3A 1JNRA 1MMDA 2E5VA 5LHHB 2I59A 3C50A 3A8YC 4P0AA 3B5MA 4X64T 4IREA 2XJ7A 2YDSA 2DWKA 4QXHB 5AQVB 1G73A 3ZCJA 3J7Yq 3MXZA 3AAAB 2CBJA 1HCIA 4QKNA 4IT4A 3AEDA 1SUMB 4UXNB 3UQ4A 2VKOA 3NZPA 3Q5DA 3MK7C 3FXEB 2NWBA 4K0UA 2CXFA 4PK4A 2FBWA 4WBOA 3LK3B 2X9XA 2V5DA 5BR8T 2E9XA 2VK9A 2XQYA 5L3CB 3JCFA 3AE9A 4HFHA 2UU9T 3RF1A 3JADA 5LJMA 1SA0E 2WDRA 2YDQA 2XHEB 2MOZA 4HWDA 2LKHA 4JI3T 5LGUB 2XQ8A 3ETUA 2B1EA 2ODVA 1KK7A 4IE6A 1OXZA 4QX7B 1M7KA 4Z91A 5LNKA 3ZN1B 2YDRA 1E1HB 3P4PA 1HTJF 3CQCB 2KLQA 4JV5T 4U72A 3CIRA 4X5TA 1UGOA 2W0GA 5JTGA 4YSXA 4A97A 5J2UE 1IZNB 2DWGA 4HE8A 4DV4T 3K3QC 2E9XD 4YXDA 2YINA 2VQET 4ZOLE 3MKDA 2NW9A 2DNXA 3L39A 4LFCT 5HXCA 3RGLA 2M6BA 4F8HA 5L3EB 1E7PA 2HPJA 2VURA 2W62A 3VRAA 4HKAA 2V7JA 3NBXX 3P4RA 4DBRA 4EB6E 3PUZF 3AB3B 3EDVA 3LSVA 3UUBA 2LJLA 1S35A 4BJMA 2LEHA 3QB5K 3RPUA 1J1JA 5FXWA 4DR3T 4DR4T 4IE7A 4KP3C 3U78A 3PV0F 5FY1A 3UQ7A 3IHRA 3CVRA 3AE7A 4A56A 3RRCA 5LA6E 2VKDA 3OPCA 4TUYE 2WAUA 2HHHT 4YHJA 4DNDA 4ISTA 4I55E 1KFYA 3DJBA 5AQQB 4AKIA 4H9QC 2LSIA 2SPCA 5EK3A 5DQWA 3A7MA 2XAQB 4O4IE 4U31A 2NOXA 2OA5A 3PDYA 1SE7A 4L0RA 3RH3A 1D0YA 5LYJE 3T1YT 2IDOB 3S4UA 2BG9A 4U3CA 4JI5T 4GYRA 5AQOB 4E7SA 3KV9A 2IIUA 3FZHB 3O1HA 3IF8B 5A1LA 3ZT7A 3UUNA 3OTOT 1HR0T 3C51A 5CGMA 5LB7B 3HA4A 3UULA 3V5UA 4DV5T 2BS4A 2F4VT 2DL1A 3TLWA 3AEAA 5LMNT 3ABVA 4UEMA 3AA1B 2Y48B 4H9NC 1YXRA 4ZI3C 2LOSA 3U3IA 2KWIB 2YU2A 3KVAA 4JLEA 4PJJA 4UF0B 4OYJA 3TLTA 4Z8XA 4WYVA 2P9BA 3D0TA 2LM2A 1W0AA 1OEDA 3P4WA 5H6QB 3F57A 3FHNA 3H3AA 4ISSA 4UVBB 1CUNA 3FZFB 1W9RA 5JDQA 5ABFA 3R84B 1WFDA 4IDNA 3FZMB 5AQMB 3RC8A 2XSAA 2CLYC 2X66A 2BKNA 4ASKA 2XAGB 4ZS2A 1XNQT 1MIVA 4QXCB 1MMGA 4B3MT 2V6YA 4OYKA 4DR7T 1N32T 2H7VC 2E5LT 3ZSSA 3TLSA 3UU8A 2VASA 4PJMA 5FP3A 4DUYT 2JQHA 3GMIA 2K24A 2WQYA 3AEEA 5FL0A 3AE4A 2XM2A 3HR0A 3BK9A 5HCJA 1O3XA 4TNWA 5FNVE 4WW0A 1U4QA 4DR6T 4U2ZA 2LT3A 3HKEE 4M1PA 2MTQA 1LKXA 4GOUA 1AJ3A 1FMVA 2CPTA 4TZ4C 5LMUT 3ZMVB 3ZT6A 1IAPA 1HS7A 2Q9QA 4U2YA 4UVCB 3TLUA 2QRXA 4ILAA 2W00A 5AQNB 2CXDA 4U74A 3VR9A 5JRCA 4X1YE 3GA8A 1IJ6A 5ABHA 2VVNA 4TV8E 3CX8B 1V9DA 2XZEA 3AEGA 2CLYB 5CFBA 2KZ7B 5IWAT 3KVBA 2ODUA 3JC6C 4TWHA 2IW5B 2KMFA 1Y01A 4H9PC 4UV8B 2IC6A 5HEGA 1IBLT 4AKLA 2VL0A 2N2NA 1H7CA 2WDQA 4LF8T 1LRZA 5F8PA 5LBQB 2K3WA 5HEOA 1HX8A 4DV2T 4WNKA 1HFAA 4ERRA 2Q9QD 4H63H 3PUAA 2NP9A 4L9IA 4PW8A 4UELA 3C4ZA 1XWMA 2UUBT 4K0KT 4O2AE 2DI4A 4NPPA 4QWNB 3L3PA 4IDPA 1T98A 4U7YA 3P50A 1T8BA 4PFOA 5AQPB 3EVYA 1W09A 2Z6EA 1N33T 3ONLC 4DR5T 1CHUA 1IBMT 3PUYF 4UV9B 5LOVE 2J62A 2BG9E 3X1DA 2EHOA 4EYUA 2QA7A 5ABGA 2BBHA 3SFDA 4KHZF 1FJGT 5JDMA 3I9WA 1WYCA 4AQYT 2XAJB 4AKGA 3I1AA 4JEUB 3ONXA 2JIWA 5ADXL 3TLVA 2LRLA 2UXCT 4DIDB 1ZOYA 3ZMUB 2C5KT 4JBWF 4NUUA 4IDZA 3SFEA 1ZEEA 4O4LE 2I0MA 4IE4A 3O9XA 2WMNA 4X1IE 3BQKA 1B7TA 2X0HA 3RHWA 5CA1E 4KX6A 4DMVA 1N36T 2ES0A 5HEHA 5JDGA 3P8CD 3ZC0A 1KNZA 1BR0A 3AE5A 2LSGA 3AXJA 5F3JA 3RLFF 4MALA 4HFCA 1OWAA 2EHOD 1OEDE 2V7MA 5FXZA 3FBLA 1QLBA 4JI1T 1XZYA 3DP7A 4L5GA 3KBTA 3SS1A 2BDEA 5JQGE 2ACZA 3PUXF 1WCRA 2BG9C 1KNRA 4PNIA 2V7LA 4ZHQE 4DO0A 4H9OC 3P7IA 1XDOA 1I6ZA 3ANWB 4QH5A 4ZXLA 2KT9A 4IE5A 5IUXA 3F2EA 4DV7T 4PAGA 3N2OA 3HKCE 4BAYB 4YSYA 1R8IA 4NXNT 1NEKA 2W4XA 4GKKT 3QOFA 2VB6A 5DJQC 2JPFA 4NIQA 4TWDA 4U33A 2CE7A 3RIUA 2QYWA 4KUMB 1WLXA 3ZLIA 5JDHA 2X9YA 5HAXA 1U5PA 4ZI2C 5LG4A 3DTOA 2VL8A 2DCFA 4JI0T 2UUCT 3PJAA 3RX6A 2I6HA 4ZZCA 3M3ZB 3RRWA 1UX4A 2VVSA 3GWHA 5HWYA 3CMLA 2XQ9A 3RYCE 3ZC1A 4HFVA 5J2TE 4NXMT 3RYIE 5EK2A 3EI0A 1BR1A 5EK4A 3PJAJ 3LBXB 3AE1A 4MBQA 1HX1B 3T1HT 5AQFB 1UK5A 3UT5E 2YOEA 4EZHA 4MHCA 1MMAA 4CI3B 5L2LA 3NRYA 4ILUA 2BG9B 1Y64B 4EXTA 4YHHT 1YQ3A 3Q5XA 2A2FX 3K8PC 4LF7T 2UUAT 4F6RC 4WBNE 5FYMA 2WCAA 2WY2A 3UTKA 4JI8T 2WSSV 1ZHCA 3AVSA 5FXXA 3SRZA 4E7ZA 4B3TT 2WWVA 5KDMC 3N9PA 5F5WA 2CWYA 2FJEA 2NR4A 3E0ZA 2H88A 2KWHA 2KINB 3OBVE 4TN7B 3PUVF 2B76A 5L3GB 3M65A 1QUUA 4YSZA 2WBLA 4HTEA 4QXBB 3AE2A 3UUXB 3LDQB 1FMWA 4CZZB 4ANJA 3RI5A 2BZBA 2VKHA 3Q2MA 2PTFA 1I94T 5JR9C 1VCSA 2JQKA 4IL4A 3EDUA 2E2AA 3FBZA 2WU5A 4AXPA 3UU5A 3J9X1 4B6XA 3PUQA 4HWHA 4JI4T 3T8OA 3ZMTB 3ZEFB 4HFBA 3VKGA 3AA0B 3EHZA 2GK9A 1KF6A 3P4QA 4KHPT 3RIAA 4OFZA 4I4TE 5DQVA 3RC3A 2YK0A 2N1GA 1FIOA 2BS3A 4OHFA 1QSDA 4KBMB 2WWUA 3OYXA 4O4HE 5HXEA 3F31A 3OYZA 5C8YE 1VOMA 2YEVC 3VRBA 5AQRB 4JEHB 4GK0E 4IGUA 4C91A 3V5SA 3HL6A 3PURA 5ABEA 4C90A 5HEJA 1NAFA 3NKZA 1YW0A 1XNRT 3QB5A 5AFUL 4KMCA 2NW7A 2H89A 5HYAA 3KBUA 4EIWA 2CRBA 1ZV4X 1BR4A 3OJAA 4YTMA 1D0ZA 4HEAA 5LHIB 3FZLB 3WAJA 2LSJA 4YT0A 1MMNA 5GONE 2L9QA 3N5LA 1XDPA 5JR9B 3CQXC 4HN9A 4EZ4A 2LM9A 5JRCB 3FB2A 3NVOA 3SOLA 5HXRA 2FUPA 2M6IA 4EOZB 2CWOA 2XQ6A 5AQGB 4JUYA 2V5CA 4CN4A 2PBIA 5HEUA 4YFSA 1VRBA 2D5UA 4X1KE 2WMOA 3ZSTA 2E8IA 2OLTA 1X79A 3I0OA 2UXNB 4HFEA 5FY0A 3AAIA 2XTLA 3QC9A 2A3DA 1N34T 2WM9A 3WI3A 2D9DA 2CA5A 4YJ2E 3MZKB 5HXSA 2YN6A 5FXVA 4LF5T 2QGSA 2FJDA 3RYFE 5JDFA 4COFA 4CXYA 2XQ4A 1YQ4A 4CI2B 2XSBA 3RYHE 3ZYMA 2E9XC 3IBPA 3ZMSB 2ZMAA 5KXJA 3E08A 3QNUA 4H9SE 4YJ3E 3G06A 1HF8A 3ZMZB 4EEBA 4JI2T 2CM0A 2N9DA 1T7SA 1NENA 1WR6A 3PU8A 5AQKB 4YTPA 3ZJ2A 1UUSA 2MAWA 2LLYA 2W63A 5JDNA 3TKLB 3UFGA 1HNXT 2X67A 3GN5A 4LF6T 2ZLYA 2RP4A 2CHNA 2X9WA 1FEWA 2HH7A 1MIWA 2VQFT 4HWIB 3PTRB 5C2TA 3B13A 1HNWT 3AVRA 2OV9A 4ILBA 4DVDA 5E0OA 2CMRA 3RKOA 1YKEB 2JJ9A 3JAFA 3KV6A 2MBGA 5LGNB 3EAMA 4OX9T 3KV5A 1MNDA 3RIUC 4NUVA 4I50E 3O1JA 4I43B 4AISA 4B3RT 2JQ9A 2BKPA 4J2CA 2J4GA 2LRKA 4PK5A 2RA1A 4UVAB 2X0YA 2DHRA 4GKJT 3RKGA 4XZCA 1ZKEA 4PFPA 3JAEA 4U7IA 4ZI3D 3CQGB 4ADZA 1HG2A 2E9XB 5L4HA 4LMKA 4ILCA 1KEYA 2CEAA 3AA6B 3AAEB 4ZS3A 3K3NA
chains in the Genus database with same CATH topology
3OKQA 3RRWA 1UX4A 2H7OA 3GWHA 5HWYA 2V1DB 3CMLA 3N9MA 1D1CA 4UEMA 3RYCE 3ZC1A 4HFVA 3WAKA 3AA1B 5J2TE 5JR9A 5HWXA 2IC9A 5FMNA 5CB4E 3VKHA 2Y48B 4H9NC 3RYIE 2LE8A 4ZI3C 5EK2A 2VKJA 4X20E 3N9OA 4AKRB 1BR1A 2L3LA 5ETWA 3L09A 2LOSA 3U3IA 5EK4A 1US7B 2KWIB 2YU2A 3KVAA 3LBXB 3N9NA 4JLEA 4PJJA 4OYJA 4UF0B 3W15B 3BQIA 4MBQA 5LBMA 2BVLA 2D0TA 1UX5A 4QHOA 4Z8XA 2P9BA 4IIJE 3KV4A 3UT5E 3D0TA 5IHYA 4FI5A 4EZHA 2LHRA 4MHCA 1MMAA 5H6QB 5EZYE 3F57A 3FHNA 3MA9A 3H3AA 4G63A 3PU3A 4ISSA 1CUNA 4UVBB 3NRYA 4ILUA 4CI3B 5L2LA 4IE0A 1Y64B 4EXTA 5JDQA 3R84B 3Q5XA 1D1BA 1LVFA 2A2FX 2H3RA 3IEEA 3K8PC 4F6RC 4AKHA 4WBNE 5FYMA 3N9QA 5FY7A 5LHGB 3VU7H 3UTKA 3RC8A 4UIGA 3O4XE 2EHOB 2WSSV 1ZHCA 3AVSA 2CLYC 4V1Av 5FXXA 2X66A 3SRZA 2X68A 4N78D 4E7ZA 2L8KA 3BQLA 2X0LB 4ZI7E 4AQFC 3UUMA 1WRDA 4ASKA 3ESLA 2KXPB 3ETVA 3LJCA 2XAGB 2MYSA 5JDLA 4ZS2A 1NWMX 2K5BB 1MIVA 2CCQA 3N9PA 5KDMC 3NRXA 4TV9E 2CWYA 4QXCB 2ZM2A 3C98B 3E0ZA 1MMGA 2KWHA 4OYKA 2XAHB 1MIYA 2J1DG 3H37A 2KINB 3OBVE 4TN7B 2H7VC 2LSYA 2PFVA 2LHNA 5L3GB 2C5JA 4G2AA 3M65A 3Q5WA 5LCYA 5DABA 3HKBE 3PE0A 1QUUA 3LK42 4AQFA 1YD8G 2WBLA 2VASA 4PJMA 5FP3A 3GMIA 4HTEA 3KDSE 2X51A 2K24A 3Q9DA 4QXBB 3UUXB 2CXLA 5J1GA 2D2SA 1FMWA 1WYBA 2LOPA 4MFRA 4CZZB 4ANJA 2BZBA 1YKHB 3HR0A 3BK9A 2VKHA 1O3XA 5FNVE 4DMWA 4H9RC 4QX8B 3Q2MA 4WW0A 1U4QA 3B57A 1HG5A 4HGAA 2LT3A 3HKEE 5JR9C 2C0SA 3ZYLA 4M1PA 2MTQA 3C4XA 1LKXA 1Z0PA 4P0BA 3EDUA 4O2BE 3FBZA 3MJXA 5IYZE 4AXPA 2ACXA 3EUHA 4GOUA 2BVMA 1AJ3A 3QUJA 2JMKA 1MMDA 2K48A 1FMVA 3MACA 4TZ4C 5LHHB 3ZMVB 3J9X1 4B6XA 2I59A 3C50A 3CX7B 5KMGP 3PUQA 4GIWA 4EYYR 4P0AA 3JC6D 3T8OA 1IAPA 3ZMTB 2NTXA 3ZEFB 4P09A 1HS7A 2Q9QA 3VKGA 3AA0B 4FJOA 4UVCB 2GK9A 2W61A 2DWKA 2M67A 2W00A 2CXDA 3ANWA 4QXHB 1G73A 4U74A 3ZCJA 3CWZB 5JRCA 3J7Yq 4PK6A 3N2GE 3ZN0B 3MXZA 3AAAB 3C4WA 1HCIA 3GA8A 4I4TE 4OFZA 4OK0A 4QKNA 4X1YE 5DQVA 3ZCIA 1IJ6A 3RC3A 2YK0A 2N1GA 2VWAA 4TV8E 3CX8B 1V9DA 4BA9A 1FIOA 4UXNB 4OHFA 1QSDA 2CLYB 4KBMB 2WWUA 2VKOA 3OYXA 4O4HE 2KZ7B 3NZPA 3KVBA 5TAOA 2ODUA 3JC6C 5HXEA 3F31A 2IW5B 3MK7C 3FXEB 3OYZA 5C8YE 1VOMA 2YEVC 4O4JE 2NWBA 4K0UA 2CXFA 4PK4A 3FXDB 2KMFA 4WBOA 4JEHB 4GK0E 3LK3B 4IGUA 4C91A 3V5SA 3HL6A 4H9PC 3PURA 4UV8B 2X9XA 3VHLA 4C90A 2IC6A 1NAFA 1YW0A 4AKLA 2D0UA 2X9HA 2E9XA 2VK9A 2N2NA 1H7CA 2XQYA 2NW7A 2PJQA 4KMCA 5AFUL 3LFMA 5L3CB 1LRZA 4CXXA 5F8PA 4EAHA 5HYAA 3KBUA 5LBQB 4CQIA 4EIWA 2ZM8A 2V26A 1ZV4X 1HX8A 1BR4A 5LJMA 3OJAA 3O1IA 1SA0E 4O8SA 2XHEB 4WNKA 1D0ZA 4HEAA 1HFAA 4ERRA 2MOZA 2Q9QD 5LHIB 2ZM0A 4H63H 3PUAA 2NP9A 3WAJA 5LGTB 2LSJA 4L9IA 4PW8A 4UELA 5LGUB 1MNEA 1MMNA 3ETUA 5GONE 2L9QA 2B1EA 3C4ZA 4AQGA 2ODVA 1KK7A 3N5LA 2Y6XA 4IE6A 1OXZA 2JMHA 3QK6A 4QX7B 5M4YA 4XBFB 5JR9B 2V7KA 3LBXA 3CQXC 3I0QA 3N9LA 5LNKA 3NZQA 4O2AE 4HN9A 2DI4A 4QWNB 3ZN1B 2LM9A 4EZ4A 5JRCB 3FB2A 3ZPOA 3L3PA 5HXHA 1BR2A 1T98A 1E1HB 3SOLA 5JREA 4PFOA 5HXRA 3EVYA 4EOZB 2CWOA 1HTJF 2Z6EA 3CQCB 4JUYA 2Q9QC 2KLQA 2PBIA 5L3FB 4U72A 4UV9B 4YFSA 1VRBA 2D5UA 4X1KE 5LOVE 2WMOA 1D0XA 2E8IA 3A5XA 2W0GA 3PUGA 1X79A 2K9AA 2JQQA 5J2UE 1IZNB 2DWGA 3I0OA 2EHOA 4HE8A 1IJ5A 2UXNB 3K3QC 2E9XD 2QA7A 4IHJE 4EYUA 2YINA 2XAFB 5FY0A 3AAIA 2JRKA 2G0UA 2XTLA 5JDMA 3QC9A 2A3DA 1G8XA 3I9WA 3MKDA 1WYCA 4ZOLE 4YLHA 2NW9A 2WM9A 2DNXA 5HXCA 3WI3A 2XAJB 4AKGA 3I1AA 2CA5A 4YJ2E 4JEUB 3MZKB 2XASB 3K3OA 5HXSA 3R6NA 5L3EB 3ONXA 2HPJA 3KINB 5FXVA 2QGSA 2W62A 5ADXL 2IAKA 2UXXB 3RYFE 5JDFA 1SHZC 4CXYA 3ZMUB 2C5KT 4NUUA 4IDZA 4CI2B 4MLKA 1ZEEA 3RYHE 4O4LE 4HKAA 2V7JA 3ZYMA 2E9XC 3NBXX 3I9YA 3IBPA 4IE4A 5LP6E 3O9XA 4DBRA 3ZMSB 2WMNA 4EB6E 4X1IE 3BQKA 2ZMAA 1B7TA 3E08A 3UFEA 4H9SE 4YJ3E 5LJNA 1HF8A 3AB3B 3EDVA 3ZMZB 3CX6B 5CA1E 4DMVA 2ES0A 2CM0A 2N9DA 3PU8A 2DLRA 1WR6A 3ZJ2A 5JDGA 2LJLA 3KFWX 3P8CD 1S35A 3LK2B 3ZC0A 1KNZA 1BR0A 4BJMA 2W63A 2LSGA 5JDNA 5L3BB 3PUSA 3TKLB 2LEHA 2C5IT 2V7IA 3RPUA 5BMVE 5LXTE 2X67A 5FXWA 4IE7A 2PG8A 2Y8DA 4KP3C 4TX5A 5JH7E 3GN5A 1UCUA 4MALA 3U78A 5F3JA 1EZ3A 1OWAA 3AA7B 2EHOD 2V7MA 5FY1A 5FXZA 3FBLA 3IHRA 3CVRA 2ZLYA 2RP4A 3HI2A 2X9WA 1FEWA 2HH7A 1MIWA 3DP7A 3PTRB 4L5GA 4A56A 3LG7A 3N2KE 3RRCA 3KBTA 3SS1A 2BDEA 5LA6E 3B13A 3HKDE 2VKDA 5JQGE 4TUYE 3AVRA 2WAUA 2HPLA 4DVDA 5H6RB 4YHJA 5E0OA 2CMRA 4DNDA 4DBQA 4ISTA 2A72A 4I55E 3RKOA 1YKEB 2JJ9A 4PNIA 3DJBA 2V7LA 4AKIA 2Q9QB 4H9QC 4ZHQE 2LSIA 4UF0A 5JVDE 4DO0A 2SPCA 4H9OC 3P7IA 5EK3A 5DQWA 3KV6A 4CI1B 3ANWB 2MBGA 5LGNB 2XAQB 2KT9A 3KV5A 2NW8A 4O4IE 4IE5A 2EHOC 4PJNA 1MNDA 2NOXA 3F2EA 4NUVA 4I50E 3O1JA 4I43B 4ZI2D 2LSKA 2OA5A 3PDYA 2KNDA 4PAGA 4L0RA 3RH3A 1D0YA 3N2OA 3HKCE 3E22E 4AI6A 5LYJE 5KX5E 1S94A 4BAYB 3S4UA 3ZYKA 4J2CA 3CPZA 4GK5E 4GYRA 4E7SA 3KV9A 2VB6A 3O1HA 1D1AA 4PK5A 4UVAB 2RA1A 5DJQC 2JPFA 3IF8B 2DHRA 3ZJ1A 4XZCA 3CKDA 4CXWA 3SWHA 1ZKEA 2CE7A 4PFPA 4XAXB 5A1LA 4GYSA 4KUMB 1WLXA 3ZLIA 4ZI3D 4PJLA 5JDHA 2YU1A 2X9YA 4H63V 5HAXA 1U5PA 3C64A 3CQGB 4ZI2C 1LVKA 4ADZA 3UUNA 1HG2A 5LG4A 2E9XB 3DTOA 2VL8A 2DCFA 3C51A 5CA0E 2NTYA 3GN5B 3RX6A 3HA4A 3UULA 2CEAA 4BJNA 5L3DB 3AA6B 3AAEB 3V5UA 2XUEA 4ZS3A 3K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN5 B;  3GN5 A;  3HI2 A;  3GA8 A;  3O9X A; 
#chains in the Genus database with same CATH topology
 5FKY A;  3P4S A;  4DV3 T;  3WAK A;  3FZK B;  5FMN A;  3VKH A;  3L8R A;  4YY3 T;  2LE8 A;  2VKJ A;  3L09 A;  1US7 B;  3W15 B;  2FJA A;  2QVA A;  2BVL A;  1E2A A;  2D0T A;  5FL1 A;  4IIJ E;  3KV4 A;  3RQU A;  4FI5 A;  1X9B A;  3AE3 A;  3MA9 A;  3PU3 A;  1D1B A;  3IEE A;  4X62 T;  5FY7 A;  5LHG B;  3VU7 H;  2IML A;  3ZT5 A;  3O4X E;  4V1A v;  2X68 A;  4N78 D;  2L8K A;  5AQT B;  5J0Z A;  4DR1 T;  3UUM A;  1WRD A;  2KXP B;  2MYS A;  5JDL A;  2K5B B;  3PUW F;  2A9U A;  3NRX A;  4TV9 E;  2WZI A;  2ZM2 A;  2XAH B;  1MIY A;  4UR9 A;  4LMJ A;  4G2A A;  3Q5W A;  4JI7 T;  3OVU A;  3PE0 A;  4CN6 A;  4AQF A;  3KDS E;  2X51 A;  3Q9D A;  1VCT A;  2LOP A;  2FJB A;  4DMW A;  4QX8 B;  3B57 A;  1HG5 A;  4HGA A;  4IDQ A;  1Z0P A;  4EED A;  3MJX A;  2ACX A;  1W0B A;  2BVM A;  2CBI A;  3VR8 A;  3QUJ A;  2JMK A;  2K48 A;  4HFI A;  3MAC A;  4HWF A;  2KSR A;  4DV6 T;  3CX7 B;  5KMG P;  4GIW A;  4EYY R;  3JC6 D;  2WP9 A;  2NTX A;  4P09 A;  4FJO A;  1OED C;  2W61 A;  2M67 A;  3ANW A;  1GQE A;  2V6X A;  3CWZ B;  4PK6 A;  3N2G E;  3ZN0 B;  3C4W A;  2XQ5 A;  4OK0 A;  3ZCI A;  3AE8 A;  1J5E T;  3K1S A;  1XMQ T;  2VWA A;  4BA9 A;  4LF4 T;  3EAB A;  5L47 A;  2ZM6 T;  5TAO A;  5L4E A;  4O4J E;  3FXD B;  5LG3 A;  4EGW A;  4IL9 A;  3VHL A;  2D0U A;  2X9H A;  2PJQ A;  3LFM A;  4CXX A;  4EAH A;  2WB5 A;  4LFB T;  4CQI A;  3UU3 A;  2ZM8 A;  2V26 A;  3O1I A;  1DU2 A;  5FVK A;  1KNP A;  4O8S A;  2ZM0 A;  3AE6 A;  5LGT B;  1MNE A;  4AQG A;  2HN1 A;  2Y6X A;  2JMH A;  3QK6 A;  2UXD T;  5M4Y A;  4XBF B;  2V7K A;  3LBX A;  4Z90 A;  3I0Q A;  3N9L A;  3NZQ A;  5AQU B;  2MPK A;  3ZPO A;  5HXH A;  1BR2 A;  5JRE A;  2IUB A;  2Q9Q C;  5L3F B;  2BS2 A;  1D0X A;  1OED B;  2XM1 A;  1Z8U A;  3A5X A;  3PUG A;  2K9A A;  2JQQ A;  1XMO T;  2IHR 1;  1IJ5 A;  5ABF B;  1UUR A;  3UU4 A;  4IHJ E;  2XAF B;  1HNZ T;  2JRK A;  2G0U A;  1G8X A;  1JNZ A;  4YLH A;  4Q25 A;  3ZKR A;  2XAS B;  3AEF A;  3K3O A;  4X65 T;  3Q5E A;  1J5W A;  2RPA A;  3R6N A;  3KIN B;  2IAK A;  2UXX B;  1SHZ C;  2V6Y B;  1L0V A;  4MLK A;  4DR2 T;  3ONJ A;  3I9Y A;  4A5X A;  5LP6 E;  2XPK A;  3UFE A;  5LJN A;  2BBJ A;  3CX6 B;  2DLR A;  3KFW X;  4AIU A;  3LK2 B;  5L3B B;  3PUS A;  5AQL B;  2C5I T;  2V7I A;  5BMV E;  5LXT E;  2WDV A;  2WZH A;  1ZP0 A;  2PG8 A;  5C3J A;  2Y8D A;  4TX5 A;  5FVL A;  5JH7 E;  4IDO A;  4EV6 A;  1M62 A;  4DV0 T;  1UCU A;  5AQH B;  1EZ3 A;  3AA7 B;  2XQ7 A;  3UU6 A;  3HI2 A;  4I0U A;  3LG7 A;  3N2K E;  3AEC A;  3HKD E;  2HPL A;  2WU2 A;  5H6R B;  4DBQ A;  2A72 A;  4LML A;  2Q9Q B;  4UF0 A;  5JVD E;  4JYA T;  4QH1 A;  4CI1 B;  4LF9 T;  2NW8 A;  2EHO C;  4PJN A;  4CN1 A;  4ZI2 D;  2LSK A;  2KND A;  2W67 A;  3E22 E;  4AI6 A;  5KX5 E;  4KI0 F;  1S94 A;  2W2U A;  3ZYK A;  3CPZ A;  4GK5 E;  2HN2 A;  1D1A A;  4CXW A;  3ZJ1 A;  3CKD A;  5AQJ B;  4QH4 A;  3SWH A;  2BKO A;  4XAX B;  4GYS A;  3H3M A;  2UXB T;  4PJL A;  2YU1 A;  4H63 V;  4HFD A;  3C64 A;  1LVK A;  5CA0 E;  2NTY A;  4WZX A;  2XY8 B;  3GN5 B;  4TNV A;  4BJN A;  5L3D B;  2XUE A;  3OKQ A;  2H7O A;  2AXD S;  2V1D B;  3AEB A;  3N9M A;  1D1C A;  4JI6 T;  5JR9 A;  5HWX A;  2IC9 A;  5CB4 E;  4B3S T;  3CK6 A;  4X20 E;  2XQ3 A;  3N9O A;  4AKR B;  5AQI B;  2L3L A;  5ETW A;  2AE9 A;  3N9N A;  3BQI A;  5LBM A;  2W66 A;  1UX5 A;  4QHO A;  5IHY A;  2LHR A;  5EZY E;  4G63 A;  4IE0 A;  3RIF A;  2H3R A;  1LVF A;  4DV1 T;  4AKH A;  3N9Q A;  4UIG A;  4ZZB A;  2EHO B;  3BQL A;  2X0L B;  4ZI7 E;  4ZEY A;  4AQF C;  3ESL A;  3ETV A;  3LJC A;  3NWI A;  3RQW A;  1NWM X;  2CCQ A;  4DUZ T;  4X66 T;  3C98 B;  4LFA T;  5CJ5 A;  2J1D G;  3H37 A;  2J47 A;  2LSY A;  2PFV A;  5AQS B;  2LHN A;  2C5J A;  5LCY A;  5DAB A;  3HKB E;  1IBK T;  3LK4 2;  4HWC A;  1YD8 G;  1WR0 A;  1T72 A;  2CXL A;  5J1G A;  2D2S A;  1WYB A;  4MFR A;  1YKH B;  2V8S V;  2WS3 A;  5HCM A;  4YTN A;  4A98 A;  4H9R C;  2YKS A;  2C0S A;  3ZYL A;  3C4X A;  3AXJ B;  2R6G F;  4P0B A;  4TWF A;  4O2B E;  2CHO A;  2XQA A;  2LKG A;  4P1N A;  5IYZ E;  3EUH A;  3IA3 A;  1JNR A;  1MMD A;  2E5V A;  5LHH B;  2I59 A;  3C50 A;  3A8Y C;  4P0A A;  3B5M A;  4X64 T;  4IRE A;  2XJ7 A;  2YDS A;  2DWK A;  4QXH B;  5AQV B;  1G73 A;  3ZCJ A;  3J7Y q;  3MXZ A;  3AAA B;  2CBJ A;  1HCI A;  4QKN A;  4IT4 A;  3AED A;  1SUM B;  4UXN B;  3UQ4 A;  2VKO A;  3NZP A;  3Q5D A;  3MK7 C;  3FXE B;  2NWB A;  4K0U A;  2CXF A;  4PK4 A;  2FBW A;  4WBO A;  3LK3 B;  2X9X A;  2V5D A;  5BR8 T;  2E9X A;  2VK9 A;  2XQY A;  5L3C B;  3JCF A;  3AE9 A;  4HFH A;  2UU9 T;  3RF1 A;  3JAD A;  5LJM A;  1SA0 E;  2WDR A;  2YDQ A;  2XHE B;  2MOZ A;  4HWD A;  2LKH A;  4JI3 T;  5LGU B;  2XQ8 A;  3ETU A;  2B1E A;  2ODV A;  1KK7 A;  4IE6 A;  1OXZ A;  4QX7 B;  1M7K A;  4Z91 A;  5LNK A;  3ZN1 B;  2YDR A;  1E1H B;  3P4P A;  1HTJ F;  3CQC B;  2KLQ A;  4JV5 T;  4U72 A;  3CIR A;  4X5T A;  1UGO A;  2W0G A;  5JTG A;  4YSX A;  4A97 A;  5J2U E;  1IZN B;  2DWG A;  4HE8 A;  4DV4 T;  3K3Q C;  2E9X D;  4YXD A;  2YIN A;  2VQE T;  4ZOL E;  3MKD A;  2NW9 A;  2DNX A;  3L39 A;  4LFC T;  5HXC A;  3RGL A;  2M6B A;  4F8H A;  5L3E B;  1E7P A;  2HPJ A;  2VUR A;  2W62 A;  3VRA A;  4HKA A;  2V7J A;  3NBX X;  3P4R A;  4DBR A;  4EB6 E;  3PUZ F;  3AB3 B;  3EDV A;  3LSV A;  3UUB A;  2LJL A;  1S35 A;  4BJM A;  2LEH A;  3QB5 K;  3RPU A;  1J1J A;  5FXW A;  4DR3 T;  4DR4 T;  4IE7 A;  4KP3 C;  3U78 A;  3PV0 F;  5FY1 A;  3UQ7 A;  3IHR A;  3CVR A;  3AE7 A;  4A56 A;  3RRC A;  5LA6 E;  2VKD A;  3OPC A;  4TUY E;  2WAU A;  2HHH T;  4YHJ A;  4DND A;  4IST A;  4I55 E;  1KFY A;  3DJB A;  5AQQ B;  4AKI A;  4H9Q C;  2LSI A;  2SPC A;  5EK3 A;  5DQW A;  3A7M A;  2XAQ B;  4O4I E;  4U31 A;  2NOX A;  2OA5 A;  3PDY A;  1SE7 A;  4L0R A;  3RH3 A;  1D0Y A;  5LYJ E;  3T1Y T;  2IDO B;  3S4U A;  2BG9 A;  4U3C A;  4JI5 T;  4GYR A;  5AQO B;  4E7S A;  3KV9 A;  2IIU A;  3FZH B;  3O1H A;  3IF8 B;  5A1L A;  3ZT7 A;  3UUN A;  3OTO T;  1HR0 T;  3C51 A;  5CGM A;  5LB7 B;  3HA4 A;  3UUL A;  3V5U A;  4DV5 T;  2BS4 A;  2F4V T;  2DL1 A;  3TLW A;  3AEA A;  5LMN T;  3ABV A;  4UEM A;  3AA1 B;  2Y48 B;  4H9N C;  1YXR A;  4ZI3 C;  2LOS A;  3U3I A;  2KWI B;  2YU2 A;  3KVA A;  4JLE A;  4PJJ A;  4UF0 B;  4OYJ A;  3TLT A;  4Z8X A;  4WYV A;  2P9B A;  3D0T A;  2LM2 A;  1W0A A;  1OED A;  3P4W A;  5H6Q B;  3F57 A;  3FHN A;  3H3A A;  4ISS A;  4UVB B;  1CUN A;  3FZF B;  1W9R A;  5JDQ A;  5ABF A;  3R84 B;  1WFD A;  4IDN A;  3FZM B;  5AQM B;  3RC8 A;  2XSA A;  2CLY C;  2X66 A;  2BKN A;  4ASK A;  2XAG B;  4ZS2 A;  1XNQ T;  1MIV A;  4QXC B;  1MMG A;  4B3M T;  2V6Y A;  4OYK A;  4DR7 T;  1N32 T;  2H7V C;  2E5L T;  3ZSS A;  3TLS A;  3UU8 A;  2VAS A;  4PJM A;  5FP3 A;  4DUY T;  2JQH A;  3GMI A;  2K24 A;  2WQY A;  3AEE A;  5FL0 A;  3AE4 A;  2XM2 A;  3HR0 A;  3BK9 A;  5HCJ A;  1O3X A;  4TNW A;  5FNV E;  4WW0 A;  1U4Q A;  4DR6 T;  4U2Z A;  2LT3 A;  3HKE E;  4M1P A;  2MTQ A;  1LKX A;  4GOU A;  1AJ3 A;  1FMV A;  2CPT A;  4TZ4 C;  5LMU T;  3ZMV B;  3ZT6 A;  1IAP A;  1HS7 A;  2Q9Q A;  4U2Y A;  4UVC B;  3TLU A;  2QRX A;  4ILA A;  2W00 A;  5AQN B;  2CXD A;  4U74 A;  3VR9 A;  5JRC A;  4X1Y E;  3GA8 A;  1IJ6 A;  5ABH A;  2VVN A;  4TV8 E;  3CX8 B;  1V9D A;  2XZE A;  3AEG A;  2CLY B;  5CFB A;  2KZ7 B;  5IWA T;  3KVB A;  2ODU A;  3JC6 C;  4TWH A;  2IW5 B;  2KMF A;  1Y01 A;  4H9P C;  4UV8 B;  2IC6 A;  5HEG A;  1IBL T;  4AKL A;  2VL0 A;  2N2N A;  1H7C A;  2WDQ A;  4LF8 T;  1LRZ A;  5F8P A;  5LBQ B;  2K3W A;  5HEO A;  1HX8 A;  4DV2 T;  4WNK A;  1HFA A;  4ERR A;  2Q9Q D;  4H63 H;  3PUA A;  2NP9 A;  4L9I A;  4PW8 A;  4UEL A;  3C4Z A;  1XWM A;  2UUB T;  4K0K T;  4O2A E;  2DI4 A;  4NPP A;  4QWN B;  3L3P A;  4IDP A;  1T98 A;  4U7Y A;  3P50 A;  1T8B A;  4PFO A;  5AQP B;  3EVY A;  1W09 A;  2Z6E A;  1N33 T;  3ONL C;  4DR5 T;  1CHU A;  1IBM T;  3PUY F;  4UV9 B;  5LOV E;  2J62 A;  2BG9 E;  3X1D A;  2EHO A;  4EYU A;  2QA7 A;  5ABG A;  2BBH A;  3SFD A;  4KHZ F;  1FJG T;  5JDM A;  3I9W A;  1WYC A;  4AQY T;  2XAJ B;  4AKG A;  3I1A A;  4JEU B;  3ONX A;  2JIW A;  5ADX L;  3TLV A;  2LRL A;  2UXC T;  4DID B;  1ZOY A;  3ZMU B;  2C5K T;  4JBW F;  4NUU A;  4IDZ A;  3SFE A;  1ZEE A;  4O4L E;  2I0M A;  4IE4 A;  3O9X A;  2WMN A;  4X1I E;  3BQK A;  1B7T A;  2X0H A;  3RHW A;  5CA1 E;  4KX6 A;  4DMV A;  1N36 T;  2ES0 A;  5HEH A;  5JDG A;  3P8C D;  3ZC0 A;  1KNZ A;  1BR0 A;  3AE5 A;  2LSG A;  3AXJ A;  5F3J A;  3RLF F;  4MAL A;  4HFC A;  1OWA A;  2EHO D;  1OED E;  2V7M A;  5FXZ A;  3FBL A;  1QLB A;  4JI1 T;  1XZY A;  3DP7 A;  4L5G A;  3KBT A;  3SS1 A;  2BDE A;  5JQG E;  2ACZ A;  3PUX F;  1WCR A;  2BG9 C;  1KNR A;  4PNI A;  2V7L A;  4ZHQ E;  4DO0 A;  4H9O C;  3P7I A;  1XDO A;  1I6Z A;  3ANW B;  4QH5 A;  4ZXL A;  2KT9 A;  4IE5 A;  5IUX A;  3F2E A;  4DV7 T;  4PAG A;  3N2O A;  3HKC E;  4BAY B;  4YSY A;  1R8I A;  4NXN T;  1NEK A;  2W4X A;  4GKK T;  3QOF A;  2VB6 A;  5DJQ C;  2JPF A;  4NIQ A;  4TWD A;  4U33 A;  2CE7 A;  3RIU A;  2QYW A;  4KUM B;  1WLX A;  3ZLI A;  5JDH A;  2X9Y A;  5HAX A;  1U5P A;  4ZI2 C;  5LG4 A;  3DTO A;  2VL8 A;  2DCF A;  4JI0 T;  2UUC T;  3PJA A;  3RX6 A;  2I6H A;  4ZZC A;  3M3Z B;  3RRW A;  1UX4 A;  2VVS A;  3GWH A;  5HWY A;  3CML A;  2XQ9 A;  3RYC E;  3ZC1 A;  4HFV A;  5J2T E;  4NXM T;  3RYI E;  5EK2 A;  3EI0 A;  1BR1 A;  5EK4 A;  3PJA J;  3LBX B;  3AE1 A;  4MBQ A;  1HX1 B;  3T1H T;  5AQF B;  1UK5 A;  3UT5 E;  2YOE A;  4EZH A;  4MHC A;  1MMA A;  4CI3 B;  5L2L A;  3NRY A;  4ILU A;  2BG9 B;  1Y64 B;  4EXT A;  4YHH T;  1YQ3 A;  3Q5X A;  2A2F X;  3K8P C;  4LF7 T;  2UUA T;  4F6R C;  4WBN E;  5FYM A;  2WCA A;  2WY2 A;  3UTK A;  4JI8 T;  2WSS V;  1ZHC A;  3AVS A;  5FXX A;  3SRZ A;  4E7Z A;  4B3T T;  2WWV A;  5KDM C;  3N9P A;  5F5W A;  2CWY A;  2FJE A;  2NR4 A;  3E0Z A;  2H88 A;  2KWH A;  2KIN B;  3OBV E;  4TN7 B;  3PUV F;  2B76 A;  5L3G B;  3M65 A;  1QUU A;  4YSZ A;  2WBL A;  4HTE A;  4QXB B;  3AE2 A;  3UUX B;  3LDQ B;  1FMW A;  4CZZ B;  4ANJ A;  3RI5 A;  2BZB A;  2VKH A;  3Q2M A;  2PTF A;  1I94 T;  5JR9 C;  1VCS A;  2JQK A;  4IL4 A;  3EDU A;  2E2A A;  3FBZ A;  2WU5 A;  4AXP A;  3UU5 A;  3J9X 1;  4B6X A;  3PUQ A;  4HWH A;  4JI4 T;  3T8O A;  3ZMT B;  3ZEF B;  4HFB A;  3VKG A;  3AA0 B;  3EHZ A;  2GK9 A;  1KF6 A;  3P4Q A;  4KHP T;  3RIA A;  4OFZ A;  4I4T E;  5DQV A;  3RC3 A;  2YK0 A;  2N1G A;  1FIO A;  2BS3 A;  4OHF A;  1QSD A;  4KBM B;  2WWU A;  3OYX A;  4O4H E;  5HXE A;  3F31 A;  3OYZ A;  5C8Y E;  1VOM A;  2YEV C;  3VRB A;  5AQR B;  4JEH B;  4GK0 E;  4IGU A;  4C91 A;  3V5S A;  3HL6 A;  3PUR A;  5ABE A;  4C90 A;  5HEJ A;  1NAF A;  3NKZ A;  1YW0 A;  1XNR T;  3QB5 A;  5AFU L;  4KMC A;  2NW7 A;  2H89 A;  5HYA A;  3KBU A;  4EIW A;  2CRB A;  1ZV4 X;  1BR4 A;  3OJA A;  4YTM A;  1D0Z A;  4HEA A;  5LHI B;  3FZL B;  3WAJ A;  2LSJ A;  4YT0 A;  1MMN A;  5GON E;  2L9Q A;  3N5L A;  1XDP A;  5JR9 B;  3CQX C;  4HN9 A;  4EZ4 A;  2LM9 A;  5JRC B;  3FB2 A;  3NVO A;  3SOL A;  5HXR A;  2FUP A;  2M6I A;  4EOZ B;  2CWO A;  2XQ6 A;  5AQG B;  4JUY A;  2V5C A;  4CN4 A;  2PBI A;  5HEU A;  4YFS A;  1VRB A;  2D5U A;  4X1K E;  2WMO A;  3ZST A;  2E8I A;  2OLT A;  1X79 A;  3I0O A;  2UXN B;  4HFE A;  5FY0 A;  3AAI A;  2XTL A;  3QC9 A;  2A3D A;  1N34 T;  2WM9 A;  3WI3 A;  2D9D A;  2CA5 A;  4YJ2 E;  3MZK B;  5HXS A;  2YN6 A;  5FXV A;  4LF5 T;  2QGS A;  2FJD A;  3RYF E;  5JDF A;  4COF A;  4CXY A;  2XQ4 A;  1YQ4 A;  4CI2 B;  2XSB A;  3RYH E;  3ZYM A;  2E9X C;  3IBP A;  3ZMS B;  2ZMA A;  5KXJ A;  3E08 A;  3QNU A;  4H9S E;  4YJ3 E;  3G06 A;  1HF8 A;  3ZMZ B;  4EEB A;  4JI2 T;  2CM0 A;  2N9D A;  1T7S A;  1NEN A;  1WR6 A;  3PU8 A;  5AQK B;  4YTP A;  3ZJ2 A;  1UUS A;  2MAW A;  2LLY A;  2W63 A;  5JDN A;  3TKL B;  3UFG A;  1HNX T;  2X67 A;  3GN5 A;  4LF6 T;  2ZLY A;  2RP4 A;  2CHN A;  2X9W A;  1FEW A;  2HH7 A;  1MIW A;  2VQF T;  4HWI B;  3PTR B;  5C2T A;  3B13 A;  1HNW T;  3AVR A;  2OV9 A;  4ILB A;  4DVD A;  5E0O A;  2CMR A;  3RKO A;  1YKE B;  2JJ9 A;  3JAF A;  3KV6 A;  2MBG A;  5LGN B;  3EAM A;  4OX9 T;  3KV5 A;  1MND A;  3RIU C;  4NUV A;  4I50 E;  3O1J A;  4I43 B;  4AIS A;  4B3R T;  2JQ9 A;  2BKP A;  4J2C A;  2J4G A;  2LRK A;  4PK5 A;  2RA1 A;  4UVA B;  2X0Y A;  2DHR A;  4GKJ T;  3RKG A;  4XZC A;  1ZKE A;  4PFP A;  3JAE A;  4U7I A;  4ZI3 D;  3CQG B;  4ADZ A;  1HG2 A;  2E9X B;  5L4H A;  4LMK A;  4ILC A;  1KEY A;  2CEA A;  3AA6 B;  3AAE B;  4ZS3 A;  3K3N A; 
#chains in the Genus database with same CATH homology
 3OKQ A;  3RRW A;  1UX4 A;  2H7O A;  3GWH A;  5HWY A;  2V1D B;  3CML A;  3N9M A;  1D1C A;  4UEM A;  3RYC E;  3ZC1 A;  4HFV A;  3WAK A;  3AA1 B;  5J2T E;  5JR9 A;  5HWX A;  2IC9 A;  5FMN A;  5CB4 E;  3VKH A;  2Y48 B;  4H9N C;  3RYI E;  2LE8 A;  4ZI3 C;  5EK2 A;  2VKJ A;  4X20 E;  3N9O A;  4AKR B;  1BR1 A;  2L3L A;  5ETW A;  3L09 A;  2LOS A;  3U3I A;  5EK4 A;  1US7 B;  2KWI B;  2YU2 A;  3KVA A;  3LBX B;  3N9N A;  4JLE A;  4PJJ A;  4OYJ A;  4UF0 B;  3W15 B;  3BQI A;  4MBQ A;  5LBM A;  2BVL A;  2D0T A;  1UX5 A;  4QHO A;  4Z8X A;  2P9B A;  4IIJ E;  3KV4 A;  3UT5 E;  3D0T A;  5IHY A;  4FI5 A;  4EZH A;  2LHR A;  4MHC A;  1MMA A;  5H6Q B;  5EZY E;  3F57 A;  3FHN A;  3MA9 A;  3H3A A;  4G63 A;  3PU3 A;  4ISS A;  1CUN A;  4UVB B;  3NRY A;  4ILU A;  4CI3 B;  5L2L A;  4IE0 A;  1Y64 B;  4EXT A;  5JDQ A;  3R84 B;  3Q5X A;  1D1B A;  1LVF A;  2A2F X;  2H3R A;  3IEE A;  3K8P C;  4F6R C;  4AKH A;  4WBN E;  5FYM A;  3N9Q A;  5FY7 A;  5LHG B;  3VU7 H;  3UTK A;  3RC8 A;  4UIG A;  3O4X E;  2EHO B;  2WSS V;  1ZHC A;  3AVS A;  2CLY C;  4V1A v;  5FXX A;  2X66 A;  3SRZ A;  2X68 A;  4N78 D;  4E7Z A;  2L8K A;  3BQL A;  2X0L B;  4ZI7 E;  4AQF C;  3UUM A;  1WRD A;  4ASK A;  3ESL A;  2KXP B;  3ETV A;  3LJC A;  2XAG B;  2MYS A;  5JDL A;  4ZS2 A;  1NWM X;  2K5B B;  1MIV A;  2CCQ A;  3N9P A;  5KDM C;  3NRX A;  4TV9 E;  2CWY A;  4QXC B;  2ZM2 A;  3C98 B;  3E0Z A;  1MMG A;  2KWH A;  4OYK A;  2XAH B;  1MIY A;  2J1D G;  3H37 A;  2KIN B;  3OBV E;  4TN7 B;  2H7V C;  2LSY A;  2PFV A;  2LHN A;  5L3G B;  2C5J A;  4G2A A;  3M65 A;  3Q5W A;  5LCY A;  5DAB A;  3HKB E;  3PE0 A;  1QUU A;  3LK4 2;  4AQF A;  1YD8 G;  2WBL A;  2VAS A;  4PJM A;  5FP3 A;  3GMI A;  4HTE A;  3KDS E;  2X51 A;  2K24 A;  3Q9D A;  4QXB B;  3UUX B;  2CXL A;  5J1G A;  2D2S A;  1FMW A;  1WYB A;  2LOP A;  4MFR A;  4CZZ B;  4ANJ A;  2BZB A;  1YKH B;  3HR0 A;  3BK9 A;  2VKH A;  1O3X A;  5FNV E;  4DMW A;  4H9R C;  4QX8 B;  3Q2M A;  4WW0 A;  1U4Q A;  3B57 A;  1HG5 A;  4HGA A;  2LT3 A;  3HKE E;  5JR9 C;  2C0S A;  3ZYL A;  4M1P A;  2MTQ A;  3C4X A;  1LKX A;  1Z0P A;  4P0B A;  3EDU A;  4O2B E;  3FBZ A;  3MJX A;  5IYZ E;  4AXP A;  2ACX A;  3EUH A;  4GOU A;  2BVM A;  1AJ3 A;  3QUJ A;  2JMK A;  1MMD A;  2K48 A;  1FMV A;  3MAC A;  4TZ4 C;  5LHH B;  3ZMV B;  3J9X 1;  4B6X A;  2I59 A;  3C50 A;  3CX7 B;  5KMG P;  3PUQ A;  4GIW A;  4EYY R;  4P0A A;  3JC6 D;  3T8O A;  1IAP A;  3ZMT B;  2NTX A;  3ZEF B;  4P09 A;  1HS7 A;  2Q9Q A;  3VKG A;  3AA0 B;  4FJO A;  4UVC B;  2GK9 A;  2W61 A;  2DWK A;  2M67 A;  2W00 A;  2CXD A;  3ANW A;  4QXH B;  1G73 A;  4U74 A;  3ZCJ A;  3CWZ B;  5JRC A;  3J7Y q;  4PK6 A;  3N2G E;  3ZN0 B;  3MXZ A;  3AAA B;  3C4W A;  1HCI A;  3GA8 A;  4I4T E;  4OFZ A;  4OK0 A;  4QKN A;  4X1Y E;  5DQV A;  3ZCI A;  1IJ6 A;  3RC3 A;  2YK0 A;  2N1G A;  2VWA A;  4TV8 E;  3CX8 B;  1V9D A;  4BA9 A;  1FIO A;  4UXN B;  4OHF A;  1QSD A;  2CLY B;  4KBM B;  2WWU A;  2VKO A;  3OYX A;  4O4H E;  2KZ7 B;  3NZP A;  3KVB A;  5TAO A;  2ODU A;  3JC6 C;  5HXE A;  3F31 A;  2IW5 B;  3MK7 C;  3FXE B;  3OYZ A;  5C8Y E;  1VOM A;  2YEV C;  4O4J E;  2NWB A;  4K0U A;  2CXF A;  4PK4 A;  3FXD B;  2KMF A;  4WBO A;  4JEH B;  4GK0 E;  3LK3 B;  4IGU A;  4C91 A;  3V5S A;  3HL6 A;  4H9P C;  3PUR A;  4UV8 B;  2X9X A;  3VHL A;  4C90 A;  2IC6 A;  1NAF A;  1YW0 A;  4AKL A;  2D0U A;  2X9H A;  2E9X A;  2VK9 A;  2N2N A;  1H7C A;  2XQY A;  2NW7 A;  2PJQ A;  4KMC A;  5AFU L;  3LFM A;  5L3C B;  1LRZ A;  4CXX A;  5F8P A;  4EAH A;  5HYA A;  3KBU A;  5LBQ B;  4CQI A;  4EIW A;  2ZM8 A;  2V26 A;  1ZV4 X;  1HX8 A;  1BR4 A;  5LJM A;  3OJA A;  3O1I A;  1SA0 E;  4O8S A;  2XHE B;  4WNK A;  1D0Z A;  4HEA A;  1HFA A;  4ERR A;  2MOZ A;  2Q9Q D;  5LHI B;  2ZM0 A;  4H63 H;  3PUA A;  2NP9 A;  3WAJ A;  5LGT B;  2LSJ A;  4L9I A;  4PW8 A;  4UEL A;  5LGU B;  1MNE A;  1MMN A;  3ETU A;  5GON E;  2L9Q A;  2B1E A;  3C4Z A;  4AQG A;  2ODV A;  1KK7 A;  3N5L A;  2Y6X A;  4IE6 A;  1OXZ A;  2JMH A;  3QK6 A;  4QX7 B;  5M4Y A;  4XBF B;  5JR9 B;  2V7K A;  3LBX A;  3CQX C;  3I0Q A;  3N9L A;  5LNK A;  3NZQ A;  4O2A E;  4HN9 A;  2DI4 A;  4QWN B;  3ZN1 B;  2LM9 A;  4EZ4 A;  5JRC B;  3FB2 A;  3ZPO A;  3L3P A;  5HXH A;  1BR2 A;  1T98 A;  1E1H B;  3SOL A;  5JRE A;  4PFO A;  5HXR A;  3EVY A;  4EOZ B;  2CWO A;  1HTJ F;  2Z6E A;  3CQC B;  4JUY A;  2Q9Q C;  2KLQ A;  2PBI A;  5L3F B;  4U72 A;  4UV9 B;  4YFS A;  1VRB A;  2D5U A;  4X1K E;  5LOV E;  2WMO A;  1D0X A;  2E8I A;  3A5X A;  2W0G A;  3PUG A;  1X79 A;  2K9A A;  2JQQ A;  5J2U E;  1IZN B;  2DWG A;  3I0O A;  2EHO A;  4HE8 A;  1IJ5 A;  2UXN B;  3K3Q C;  2E9X D;  2QA7 A;  4IHJ E;  4EYU A;  2YIN A;  2XAF B;  5FY0 A;  3AAI A;  2JRK A;  2G0U A;  2XTL A;  5JDM A;  3QC9 A;  2A3D A;  1G8X A;  3I9W A;  3MKD A;  1WYC A;  4ZOL E;  4YLH A;  2NW9 A;  2WM9 A;  2DNX A;  5HXC A;  3WI3 A;  2XAJ B;  4AKG A;  3I1A A;  2CA5 A;  4YJ2 E;  4JEU B;  3MZK B;  2XAS B;  3K3O A;  5HXS A;  3R6N A;  5L3E B;  3ONX A;  2HPJ A;  3KIN B;  5FXV A;  2QGS A;  2W62 A;  5ADX L;  2IAK A;  2UXX B;  3RYF E;  5JDF A;  1SHZ C;  4CXY A;  3ZMU B;  2C5K T;  4NUU A;  4IDZ A;  4CI2 B;  4MLK A;  1ZEE A;  3RYH E;  4O4L E;  4HKA A;  2V7J A;  3ZYM A;  2E9X C;  3NBX X;  3I9Y A;  3IBP A;  4IE4 A;  5LP6 E;  3O9X A;  4DBR A;  3ZMS B;  2WMN A;  4EB6 E;  4X1I E;  3BQK A;  2ZMA A;  1B7T A;  3E08 A;  3UFE A;  4H9S E;  4YJ3 E;  5LJN A;  1HF8 A;  3AB3 B;  3EDV A;  3ZMZ B;  3CX6 B;  5CA1 E;  4DMV A;  2ES0 A;  2CM0 A;  2N9D A;  3PU8 A;  2DLR A;  1WR6 A;  3ZJ2 A;  5JDG A;  2LJL A;  3KFW X;  3P8C D;  1S35 A;  3LK2 B;  3ZC0 A;  1KNZ A;  1BR0 A;  4BJM A;  2W63 A;  2LSG A;  5JDN A;  5L3B B;  3PUS A;  3TKL B;  2LEH A;  2C5I T;  2V7I A;  3RPU A;  5BMV E;  5LXT E;  2X67 A;  5FXW A;  4IE7 A;  2PG8 A;  2Y8D A;  4KP3 C;  4TX5 A;  5JH7 E;  3GN5 A;  1UCU A;  4MAL A;  3U78 A;  5F3J A;  1EZ3 A;  1OWA A;  3AA7 B;  2EHO D;  2V7M A;  5FY1 A;  5FXZ A;  3FBL A;  3IHR A;  3CVR A;  2ZLY A;  2RP4 A;  3HI2 A;  2X9W A;  1FEW A;  2HH7 A;  1MIW A;  3DP7 A;  3PTR B;  4L5G A;  4A56 A;  3LG7 A;  3N2K E;  3RRC A;  3KBT A;  3SS1 A;  2BDE A;  5LA6 E;  3B13 A;  3HKD E;  2VKD A;  5JQG E;  4TUY E;  3AVR A;  2WAU A;  2HPL A;  4DVD A;  5H6R B;  4YHJ A;  5E0O A;  2CMR A;  4DND A;  4DBQ A;  4IST A;  2A72 A;  4I55 E;  3RKO A;  1YKE B;  2JJ9 A;  4PNI A;  3DJB A;  2V7L A;  4AKI A;  2Q9Q B;  4H9Q C;  4ZHQ E;  2LSI A;  4UF0 A;  5JVD E;  4DO0 A;  2SPC A;  4H9O C;  3P7I A;  5EK3 A;  5DQW A;  3KV6 A;  4CI1 B;  3ANW B;  2MBG A;  5LGN B;  2XAQ B;  2KT9 A;  3KV5 A;  2NW8 A;  4O4I E;  4IE5 A;  2EHO C;  4PJN A;  1MND A;  2NOX A;  3F2E A;  4NUV A;  4I50 E;  3O1J A;  4I43 B;  4ZI2 D;  2LSK A;  2OA5 A;  3PDY A;  2KND A;  4PAG A;  4L0R A;  3RH3 A;  1D0Y A;  3N2O A;  3HKC E;  3E22 E;  4AI6 A;  5LYJ E;  5KX5 E;  1S94 A;  4BAY B;  3S4U A;  3ZYK A;  4J2C A;  3CPZ A;  4GK5 E;  4GYR A;  4E7S A;  3KV9 A;  2VB6 A;  3O1H A;  1D1A A;  4PK5 A;  4UVA B;  2RA1 A;  5DJQ C;  2JPF A;  3IF8 B;  2DHR A;  3ZJ1 A;  4XZC A;  3CKD A;  4CXW A;  3SWH A;  1ZKE A;  2CE7 A;  4PFP A;  4XAX B;  5A1L A;  4GYS A;  4KUM B;  1WLX A;  3ZLI A;  4ZI3 D;  4PJL A;  5JDH A;  2YU1 A;  2X9Y A;  4H63 V;  5HAX A;  1U5P A;  3C64 A;  3CQG B;  4ZI2 C;  1LVK A;  4ADZ A;  3UUN A;  1HG2 A;  5LG4 A;  2E9X B;  3DTO A;  2VL8 A;  2DCF A;  3C51 A;  5CA0 E;  2NTY A;  3GN5 B;  3RX6 A;  3HA4 A;  3UUL A;  2CEA A;  4BJN A;  5L3D B;  3AA6 B;  3AAE B;  3V5U A;  2XUE A;  4ZS3 A;  3K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...