3E0ZA

Crystal structure of a putative imidazole glycerol phosphate synthase homolog (eubrec_1070) from eubacterium rectale at 1.75 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
GMITSIARQSIILKCLRQKSVLVSNYELYYTAGLAKKCFGIAVDADMEPKQLLEELQKHIDKVSPADEQEKYLIHLLGNYEPDDTHDEQTVELFHMGETEEHIWQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords protein of unknown function
publication title Crystal structure of protein of unknown function (RER070207001348) from Eubacterium rectale at 1.75 A resolution
rcsb
source organism Eubacterium rectale
total genus 37
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3e0zA00
3E0ZA
chains in the Genus database with same CATH superfamily
1KFYA 3NZQA 3UQ7A 4DUYT 3LBXA 2XQ8A 1O3XA 3AE8A 3FZKB 3KV9A 4QXHB 4ERRA 3EDUA 1MIWA 4O8SA 4DMVA 4HFVA 3KDSE 4IDZA 2BS2A 3T1HT 3GMIA 2XY8B 3EHZA 4OYJA 4YJ2E 2LKGA 4EB6E 5E0OA 2VKDA 2E5LT 5IYZE 4LMLA 4DNDA 1BR4A 1SE7A 3OKQA 3ZMZB 4EGWA 2CEAA 2NTXA 5JDFA 4IGUA 2X9YA 3PJAA 5LXTE 4JI5T 5FY1A 3RRWA 2CXDA 4GIWA 2UXNB 4Z90A 2XTLA 1WR0A 2K9AA 3ZMTB 3BQIA 4TWFA 5AQKB 2RA1A 5F8PA 4MFRA 2VL0A 4DO0A 1X9BA 3RGLA 1E2AA 1M62A 5L4EA 4Z91A 2IMLA 3AE4A 4OYKA 5FXXA 3ZSTA 1E1HB 2UUBT 3OYXA 4HTEA 4GKKT 1FEWA 3PUQA 5AFUL 2VKOA 4TUYE 5DQVA 4QXCB 4JI6T 1XDOA 1NAFA 1VCSA 2CWOA 3L39A 2LSJA 5AQJB 1CHUA 1IJ6A 4HKAA 2CLYB 4I43B 3N2OA 3J9X1 3ZLIA 4AQFC 3HKDE 4WNKA 4ZI2D 3VKGA 5JQGE 2XUEA 3HR0A 5AQHB 2RP4A 2WMOA 3PUGA 2IIUA 5J2UE 2V7IA 3ZEFB 4QXBB 4DV5T 5EK2A 3IHRA 2BG9E 5L4HA 1J5WA 4JBWF 5FXWA 4YSXA 4X1IE 5BMVE 5M4YA 3AE5A 1J1JA 1MIVA 4U33A 4GK0E 4ZS2A 3N2KE 4DVDA 4DR7T 3CQXC 4ZZBA 2HH7A 3NBXX 3S4UA 2PBIA 2JMHA 2CPTA 2L3LA 3LDQB 4A98A 4IE7A 4B3TT 3VR8A 2J4GA 1IBLT 4DR5T 4JUYA 2ACZA 3AEFA 2DWGA 2LJLA 4NXMT 4UVCB 2CMRA 3AE7A 4CXXA 3Q5WA 4CN1A 2CHNA 1HTJF 2H3RA 1WYBA 4KUMB 4IDPA 3ZSSA 3K1SA 2FBWA 2I0MA 4IE5A 2Q9QA 2V7MA 4LMKA 4C90A 2XSBA 3BQLA 4P0BA 3V5UA 3OJAA 3TLVA 3EABA 2E9XC 3DTOA 1CUNA 3NRXA 2BS4A 4UF0A 4F8HA 5JDGA 3FZHB 2M6IA 3CX6B 1LRZA 4L9IA 2GK9A 1HFAA 1M7KA 2H89A 4H9QC 3PUZF 5CGMA 1U5PA 3FB2A 1VOMA 3AA0B 2YOEA 2CHOA 4H63H 2BG9B 3CIRA 2VL8A 2VURA 2D9DA 4L5GA 2CBJA 4ZXLA 4BJMA 5AQTB 2CXFA 3LFMA 2UU9T 2V7KA 2NOXA 3JAFA 4IHJE 4CI2B 3L09A 2VK9A 2VASA 3R84B 3ANWB 5LCYA 3N9PA 3P4RA 4JI8T 3CWZB 1D0XA 2M6BA 4DV6T 3G06A 2XSAA 3X1DA 3GA8A 4LMJA 4U7IA 2PG8A 3RI5A 1HNWT 3AEBA 2K5BB 3ANWA 3OTOT 2G0UA 5JR9A 3OVUA 1N32T 5AQLB 3C51A 5L3BB 4EXTA 5F3JA 2W2UA 2HHHT 3EUHA 4HGAA 3ZT5A 5AQVB 2KMFA 4GK5E 5LMNT 5KMGP 3L8RA 3W15B 3L3PA 5HXRA 1XNRT 3ZC0A 4I50E 1R8IA 3VKHA 1ZP0A 3UUBA 3QOFA 2V6YB 4P1NA 5ABHA 3JADA 3UULA 4H9SE 2BVLA 3RH3A 2XM1A 4GOUA 4CI1B 3AXJB 2A72A 1YQ4A 4HFIA 4UVBB 2XQ9A 4C91A 3MACA 3ONLC 2V6YA 4AKGA 5JDMA 2ZM0A 5TAOA 3B57A 4DR3T 3I9YA 5ADXL 1LVFA 1N33T 3RIUA 5KX5E 1QLBA 4F6RC 5JDQA 2RPAA 2V8SV 4IL9A 2NW9A 3BQKA 2CA5A 2KT9A 1FJGT 1OEDC 5HXCA 4CI3B 1HS7A 3PUYF 4JI7T 4EOZB 2AE9A 5JDHA 4KP3C 3FZFB 1UK5A 3ABVA 2X66A 4FJOA 2IDOB 2W67A 4IIJE 3HA4A 2X0YA 2D0UA 4X62T 3BK9A 2XQYA 4QH5A 3U3IA 4O4JE 4PAGA 3OBVE 5A1LA 4HFBA 5AQRB 5LBMA 3PUXF 2ES0A 3RKGA 2W00A 5CB4E 3AAEB 1KEYA 2LSYA 4CXWA 4XZCA 1E7PA 2XQ6A 4YY3T 2CRBA 1Z8UA 2LOSA 3PTRB 3C50A 4LF6T 4Z8XA 4U2YA 2LLYA 4IE6A 3I0QA 5LG4A 4O4HE 3AVRA 4DV3T 4PK6A 5CA0E 4NPPA 2W62A 2IC9A 3ZN0B 4YSYA 5C8YE 4QWNB 4PW8A 1KNZA 3AEAA 3N2GE 2C5IT 5DJQC 3AB3B 2OLTA 3HL6A 2IUBA 4BA9A 5HCMA 4X65T 3P4PA 3T8OA 2WSSV 3GN5A 4ZI3D 4HWFA 4PFPA 3N9OA 1YW0A 4X20E 5FYMA 2UXCT 2D5UA 3UU5A 2JJ9A 2C5KT 2Y48B 4HWHA 5JDLA 4HWCA 2E9XB 3FHNA 5LA6E 2VB6A 2DLRA 3LK42 3N9MA 5JRCB 2H7VC 1IJ5A 1XZYA 3I1AA 5IWAT 1FIOA 5CJ5A 2E9XA 4OHFA 4OFZA 3FZMB 4UV8B 3FXEB 5FXVA 4JEUB 3MZKB 4WZXA 4DIDB 2N1GA 1WFDA 2YU2A 3AA1B 2V7LA 1QUUA 3H3AA 2DCFA 2QA7A 3ZCJA 4PJMA 5DQWA 1S94A 2WAUA 5KXJA 5ETWA 3RYCE 2X9WA 4J2CA 2VQFT 2BBJA 3PUVF 5EK4A 3SFEA 1OEDE 3K3QC 4UEMA 5FVLA 2CBIA 3CK6A 3TKLB 2NR4A 2DHRA 4EYUA 5FL1A 2W0GA 3AAIA 2EHOC 4EAHA 5ABGA 1MNDA 2CE7A 3TLSA 3UTKA 3RC3A 1ZOYA 4HN9A 4ILBA 2VVNA 2JRKA 2XJ7A 3UUNA 3UFEA 1OWAA 1KK7A 1FMVA 2ZLYA 3AEGA 2E2AA 2FUPA 4CN6A 2CM0A 5GONE 3P4SA 2JQKA 4TNWA 2UXDT 3RF1A 3NRYA 3PUSA 1OXZA 2JQ9A 5LMUT 1MMGA 3RPUA 3KV6A 1DU2A 2ZM6T 3CVRA 2OV9A 4U72A 2WU2A 3N9LA 4XAXB 5L3CB 3IBPA 2LOPA 1XMQT 1N34T 5KDMC 2KLQA 4ILUA 4NIQA 3ZMSB 2H7OA 2XQ5A 2X0HA 3RQWA 2X9XA 1SA0E 2VKHA 1IAPA 2ZM2A 3HI2A 4IE0A 4UXNB 2KWHA 5HXHA 3P7IA 2JQHA 4KHZF 3ONXA 3HKBE 2YDQA 5FXZA 2SPCA 3EVYA 1OEDB 3K8PC 3PE0A 2ZMAA 4YT0A 4H9NC 2NTYA 3RYHE 2WM9A 5LG3A 2LM2A 5LGUB 1X79A 3AE6A 3KV5A 1HG2A 4PK5A 3LJCA 2VQET 2V6XA 5FKYA 3FZLB 3RRCA 3SWHA 4TV9E 3RX6A 4HWDA 3D0TA 2CXLA 3PUAA 4A97A 2LKHA 2W63A 5LHHB 5HAXA 2XQ3A 5HEOA 1KNRA 4FI5A 2I6HA 4U31A 2XQ4A 3PU3A 2UUCT 1JNRA 1NEKA 2JPFA 1Z0PA 5HCJA 5LGNB 2XAJB 4CZZB 3QB5A 3EAMA 2MAWA 2BG9A 2J1DG 2V5CA 1D1CA 2X67A 1HX1B 5J1GA 4B3RT 4QKNA 2K48A 4G63A 2X9HA 4V1Av 5C3JA 3JC6C 4M1PA 1H7CA 5LBQB 2YINA 3RC8A 1UUSA 3JAEA 1SUMB 2HPJA 4AKRB 3P4WA 3VRAA 2PJQA 1WRDA 3UUMA 2X68A 1WCRA 1JNZA 2LT3A 2VVSA 2LEHA 2ODVA 3AE9A 3HKCE 2E8IA 3AAAB 2LHRA 3O1JA 3KVBA 1KNPA 1WR6A 1YD8G 4TWHA 3ZCIA 2IHR1 5HYAA 3K3OA 5LHIB 3U78A 3QUJA 4DMWA 2UUAT 3C4XA 3UQ4A 2E9XD 4ZZCA 2WZIA 2MBGA 4MBQA 1HR0T 2WB5A 2ZM8A 1KF6A 3MJXA 1UX4A 2D2SA 3QC9A 2KZ7B 4NUVA 2WU5A 3AECA 4LFBT 1US7B 1BR0A 2R6GF 4JYAT 4HFDA 1VRBA 3LK3B 2V7JA 4WBNE 3FBLA 4KBMB 4WW0A 1IZNB 5IUXA 3WAKA 3QK6A 2YK0A 3JCFA 3O1IA 4O2BE 2WDRA 4ILCA 5L2LA 3AXJA 2V1DB 1U4QA 4L0RA 3HKEE 5LJMA 4DBQA 4IDOA 2XAFB 3PDYA 5AQPB 5FY0A 3VR9A 2FJEA 5JDNA 1XDPA 2CWYA 2Q9QC 1LVKA 1MNEA 2B76A 4HFHA 2Z6EA 3P50A 4I0UA 4GYSA 5EK3A 4MALA 4YLHA 3ZYKA 2C0SA 2QVAA 3UU3A 1XWMA 2XASB 4JI4T 4DR4T 2OA5A 4WYVA 3C4WA 4A5XA 3VU7H 1D0YA 2EHOB 4YFSA 2L9QA 5AQFB 3SRZA 5AQSB 1G8XA 4LF8T 2PTFA 3SFDA 3C64A 4BJNA 4AXPA 4EYYR 2KXPB 3LK2B 3VRBA 4DR2T 1UCUA 3LG7A 5AQGB 2W66A 4JLEA 5IHYA 2WDVA 1W9RA 4WBOA 3VHLA 4AQFA 5EZYE 2JMKA 2XAQB 4MHCA 4PJNA 3RQUA 3RLFF 1T98A 2K24A 3AEDA 2WCAA 1HF8A 4UIGA 3I0OA 3UU8A 4YXDA 5LOVE 3RKOA 2FJBA 4DR1T 1T8BA 4K0KT 5F5WA 4EZHA 4O4LE 5JR9C 3F2EA 4NXNT 1GQEA 5J2TE 4AKHA 3Q9DA 2BZBA 2HN1A 3DJBA 5AQNB 3CPZA 4HFCA 3LBXB 5JH7E 2YDRA 3ZJ2A 1W09A 4X64T 1I6ZA 3F57A 2FJDA 2MTQA 4DBRA 3PJAJ 4ZEYA 4QX8B 3WI3A 3PUWF 4TNVA 1V9DA 5L47A 3UT5E 3MXZA 5CA1E 2Y8DA 1AJ3A 3M65A 3WAJA 3ZT6A 4EZ4A 4TV8E 1G73A 3KV4A 4XBFB 2WMNA 1WLXA 2BVMA 2KSRA 4ZI2C 4LF7T 4UR9A 3N9QA 2AXDS 5FY7A 4DV0T 5BR8T 1ZV4X 3CQCB 3CMLA 5C2TA 5JVDE 4QX7B 1SHZC 2UXBT 4ASKA 3V5SA 4JV5T 1QSDA 2LRLA 5AQUB 4DV4T 1MMNA 5AQIB 4CXYA 4EV6A 4LF9T 4LF4T 2YU1A 5JRCA 2WBLA 4JI0T 5HEHA 3RIUC 3ZYLA 2QGSA 1EZ3A 2NWBA 2Y6XA 4QH4A 3A8YC 3SS1A 2MOZA 4PJLA 2XAGB 2YEVC 2V5DA 3MKDA 2C5JA 4CQIA 3ZMVB 2W61A 3MA9A 3UUXB 3QB5K 3AE3A 5L3DB 1HX8A 4EEBA 3E22E 1YKEB 1I94T 3R6NA 2BDEA 3ZT7A 3Q5XA 2V26A 3GWHA 4AKLA 2E5VA 3B13A 4IT4A 4YTPA 3ETVA 4P0AA 4DR6T 2KNDA 3A5XA 4U7YA 2IAKA 4KI0F 3PV0F 2NW7A 1UX5A 5JTGA 1YKHB 3N5LA 3KVAA 3F31A 4ANJA 3DP7A 3ESLA 3B5MA 5LHGB 4TZ4C 1T7SA 3CX7B 2BKPA 1HG5A 3RYFE 5H6RB 1IBKT 4YHHT 3IEEA 4PJJA 1MMDA 2M67A 2WY2A 2LRKA 4LFAT 4P09A 4AI6A 3NVOA 3FBZA 4QH1A 3UU6A 2B1EA 2JIWA 4QHOA 4UV9B 3E0ZA 3O4XE 5HWXA 3LSVA 3Q5EA 1T72A 4B6XA 2WQYA 2XHEB 1NWMX 2LE8A 2KINB 2VWAA 3O9XA 4AIUA 5HXEA 2BS3A 1FMWA 2DNXA 3KINB 2D0TA 1BR1A 2I59A 3RIAA 4GYRA 1ZHCA 5HWYA 4ILAA 4I55E 2Q9QB 1J5ET 2A3DA 2XZEA 4HWIB 4IDNA 2WWUA 2P9BA 3ZJ1A 3Q2MA 4UF0B 5H6QB 5LYJE 1L0VA 2EHOD 4ZHQE 4YHJA 3A7MA 3EDVA 3KFWX 4YJ3E 1OEDA 3P8CD 4HFEA 4H9RC 2LHNA 4B3ST 5ABFB 2LSKA 3IF8B 5FL0A 2DWKA 2JQQA 1ZEEA 4I4TE 1NENA 4K0UA 3MK7C 1W0BA 4IL4A 5L3EB 1D1BA 4AISA 4TWDA 4JEHB 3AE1A 3CX8B 5ABFA 4B3MT 4ISTA 2YN6A 3ZC1A 2VKJA 1UGOA 3J7Yq 2IC6A 3TLTA 3AVSA 3PU8A 3K3NA 5J0ZA 3AA6B 3Q5DA 4DUZT 5LB7B 2K3WA 4PNIA 3ZN1B 3AEEA 4EEDA 1N36T 4H63V 2N2NA 4BAYB 5L3FB 1HCIA 3H3MA 5JR9B 3AE2A 4LFCT 5FMNA 1YXRA 3NZPA 3P4QA 1LKXA 2IW5B 3RYIE 4X1KE 3RHWA 2WZHA 4HEAA 2XPKA 2QRXA 2BKOA 2KWIB 2N9DA 2CLYC 1YQ3A 1D0ZA 2YKSA 4E7ZA 5ABEA 5FP3A 4DV2T 2ODUA 1MIYA 4X1YE 3I9WA 4U74A 4YSZA 3EI0A 3NKZA 4HE8A 4PK4A 2A2FX 4KMCA 5HXSA 5FNVE 4O2AE 3ZKRA 1MMAA 1XMOT 2WS3A 2BBHA 4AKIA 3CQGB 3C98B 3H37A 4AQYT 3C4ZA 3ZYMA 4EIWA 4G2AA 3T1YT 1W0AA 3O1HA 4N78D 4NUUA 4PFOA 2L8KA 4COFA 3M3ZB 2BKNA 1B7TA 5JREA 5HEGA 3E08A 4DV1T 2CCQA 3NWIA 3SOLA 2ACXA 4UVAB 3ZMUB 4DV7T 2W4XA 2HPLA 5AQQB 4CN4A 4LF5T 1WYCA 5CFBA 2LM9A 3JC6D 1XNQT 2DL1A 3ZPOA 5DABA 2LSGA 2XQ7A 3QNUA 5HEJA 3OYZA 4Q25A 4U2ZA 4IE4A 4ZI3C 1IBMT 2XM2A 2H88A 3TLWA 3AA7B 3ETUA 3PURA 4ADZA 2MPKA 4UELA 4ISSA 2NP9A 4KX6A 4ZS3A 1ZKEA 2PFVA 4X66T 5LJNA 2F4VT 1HNXT 5L3GB 1HNZT 2EHOA 5HEUA 2X51A 2A9UA 4ZI7E 2WDQA 4TN7B 5LNKA 4KHPT 2BG9C 4TX5A 4U3CA 3ONJA 1VCTA 4YTNA 2FJAA 4ZOLE 3RIFA 3IA3A 2X0LB 1D1AA 3TLUA 2UXXB 4H9PC 5AQOB 4H9OC 4E7SA 4GKJT 4JI1T 1S35A 4YTMA 4MLKA 3FXDB 4X5TA 3UU4A 3KBUA 3OPCA 5FVKA 3UFGA 2YDSA 4IREA 5LGTB 4A56A 2QYWA 3N9NA 2NW8A 3CKDA 4JI3T 2LSIA 2MYSA 2WP9A 5LP6E 2XAHB 3KBTA 4AQGA 1BR2A 2J62A 4O4IE 2HN2A 4IDQA 1Y01A 1Y64B 1UURA 4OK0A 4JI2T 5AQMB 4OX9T 3GN5B 2J47A 2Q9QD 2DI4A 2WWVA 2XQAA
chains in the Genus database with same CATH topology
5ADXL 2JPFA 3ESLA 3NZQA 1LVFA 5LHGB 1Z0PA 3LBXA 4TZ4C 5LGNB 2XAJB 3CX7B 4CZZB 5KX5E 4F6RC 5JDQA 1O3XA 1HG5A 4QXHB 3KV9A 3RYFE 4ERRA 2J1DG 3BQKA 2NW9A 5H6RB 3EDUA 2CA5A 2KT9A 1D1CA 1MIWA 2X67A 4O8SA 5J1GA 4DMVA 4HFVA 5HXCA 4CI3B 3KDSE 1HS7A 4QKNA 4IDZA 2K48A 4G63A 2X9HA 3IEEA 4V1Av 3JC6C 3GMIA 4M1PA 4EOZB 1H7CA 4PJJA 1MMDA 5JDHA 4KP3C 5LBQB 4OYJA 2YINA 3RC8A 4YJ2E 2HPJA 4AKRB 2M67A 4EB6E 5E0OA 2VKDA 5IYZE 4DNDA 4P09A 4AI6A 1BR4A 3FBZA 3OKQA 2B1EA 1WRDA 2PJQA 2X66A 4FJOA 3UUMA 4QHOA 4UV9B 2X68A 3E0ZA 3O4XE 3ZMZB 5HWXA 4IIJE 3HA4A 2CEAA 2D0UA 2NTXA 2LT3A 3BK9A 2LEHA 2ODVA 5JDFA 4B6XA 4IGUA 2X9YA 2XHEB 2E8IA 3HKCE 5LXTE 3AAAB 5FY1A 2XQYA 2LHRA 1NWMX 2LE8A 3RRWA 3O1JA 2KINB 3KVBA 2VWAA 3U3IA 4O4JE 2CXDA 3O9XA 4PAGA 4GIWA 1WR6A 3OBVE 1FMWA 2DNXA 2UXNB 5HXEA 2XTLA 5A1LA 1YD8G 3KINB 3ZCIA 5HYAA 2D0TA 1BR1A 2I59A 3K3OA 5LBMA 2K9AA 5LHIB 4GYRA 2ES0A 3U78A 3QUJA 3ZMTB 1ZHCA 3BQIA 5HWYA 2W00A 5CB4E 3AAEB 4I55E 2Q9QB 4DMWA 2A3DA 3C4XA 2LSYA 4CXWA 2E9XD 4XZCA 2RA1A 5F8PA 2WWUA 2LOSA 3PTRB 3C50A 2P9BA 2MBGA 4MBQA 4MFRA 3ZJ1A 3Q2MA 4UF0B 5H6QB 2ZM8A 4ZHQE 2EHOD 5LYJE 4Z8XA 4DO0A 4YHJA 3EDVA 3MJXA 4IE6A 1UX4A 3KFWX 2D2SA 3QC9A 2KZ7B 3I0QA 4YJ3E 3P8CD 4H9RC 2LHNA 4NUVA 4OYKA 5LG4A 5FXXA 4O4HE 1E1HB 2LSKA 3AVRA 3OYXA 4HTEA 3IF8B 4PK6A 1FEWA 3PUQA 5AFUL 1US7B 1BR0A 5CA0E 2DWKA 2JQQA 1ZEEA 4I4TE 2W62A 3I9YA 1VRBA 2VKOA 3LK3B 2IC9A 2V7JA 4TUYE 5DQVA 4WBNE 3ZN0B 3FBLA 5C8YE 4QXCB 4QWNB 4KBMB 4PW8A 4K0UA 4WW0A 1IZNB 1KNZA 3MK7C 3WAKA 3QK6A 1NAFA 5L3EB 1D1BA 2YK0A 3O1IA 2CWOA 4O2BE 3N2GE 4JEHB 2LSJA 2C5IT 3CX8B 5DJQC 3AB3B 4ISTA 1IJ6A 3HL6A 4HKAA 5L2LA 2CLYB 3ZC1A 2VKJA 4I43B 3N2OA 2V1DB 1U4QA 3J9X1 3ZLIA 4L0RA 4AQFC 4BA9A 3HKEE 3J7Yq 5LJMA 2IC6A 4DBQA 3HKDE 3AVSA 4WNKA 3T8OA 4ZI2D 3PU8A 3K3NA 3VKGA 2XAFB 2XUEA 5JQGE 3HR0A 3PDYA 2RP4A 2WMOA 3PUGA 2WSSV 3GN5A 4ZI3D 5J2UE 2V7IA 5FY0A 3ZEFB 4PFPA 3N9OA 3AA6B 4QXBB 5EK2A 3IHRA 5JDNA 1YW0A 2CWYA 2Q9QC 4X20E 5FYMA 5FXWA 1LVKA 1MNEA 4PNIA 2Z6EA 2D5UA 4GYSA 5EK3A 4MALA 4YLHA 4X1IE 3ZN1B 3ZYKA 2C0SA 2JJ9A 2C5KT 2Y48B 5BMVE 5JDLA 4H63V 2E9XB 5M4YA 2N2NA 3FHNA 4BAYB 5LA6E 1MIVA 2XASB 5L3FB 1HCIA 2OA5A 2VB6A 3C4WA 5JR9B 2DLRA 3VU7H 4GK0E 4ZS2A 3N2KE 3LK42 1D0YA 4DVDA 3N9MA 2EHOB 4YFSA 2L9QA 5JRCB 3SRZA 2H7VC 5FMNA 1IJ5A 1G8XA 3I1AA 3CQXC 3NZPA 3C64A 4BJNA 1LKXA 2HH7A 3NBXX 1FIOA 2IW5B 3S4UA 3RYIE 2E9XA 4AXPA 2PBIA 4EYYR 2JMHA 2KXPB 4OFZA 4OHFA 4X1KE 2L3LA 3LK2B 4HEAA 4IE7A 4UV8B 3FXEB 1UCUA 3LG7A 5FXVA 4JEUB 3MZKB 2KWIB 2N9DA 2CLYC 1D0ZA 4JLEA 4JUYA 5IHYA 2DWGA 2LJLA 4E7ZA 2N1GA 2YU2A 5FP3A 4UVCB 4WBOA 3VHLA 2ODUA 1MIYA 3AA1B 4X1YE 2CMRA 3I9WA 4AQFA 2V7LA 1QUUA 4CXXA 3H3AA 4U74A 3Q5WA 2DCFA 5EZYE 2JMKA 2XAQB 4HE8A 2A2FX 2QA7A 4PK4A 3ZCJA 4MHCA 4KMCA 4PJMA 5DQWA 4PJNA 1HTJF 1S94A 5FNVE 2H3RA 1WYBA 5HXSA 2WAUA 4KUMB 5ETWA 3RYCE 2X9WA 4O2AE 1MMAA 1T98A 4J2CA 4AKIA 2K24A 4IE5A 3CQGB 3C98B 3H37A 2Q9QA 2V7MA 5EK4A 4C90A 3BQLA 1HF8A 4P0BA 4UIGA 3V5UA 3K3QC 3I0OA 3OJAA 4UEMA 3C4ZA 2E9XC 3ZYMA 4EIWA 4G2AA 5LOVE 3RKOA 3DTOA 1CUNA 3NRXA 4UF0A 3O1HA 4N78D 3TKLB 5JDGA 4EZHA 4NUUA 4O4LE 5JR9C 2DHRA 3F2EA 4EYUA 4PFOA 2W0GA 3AAIA 2L8KA 2EHOC 4EAHA 5J2TE 1MNDA 2CE7A 4AKHA 3CX6B 1B7TA 1LRZA 3Q9DA 4L9IA 2BZBA 5JREA 3DJBA 2GK9A 3CPZA 3UTKA 3RC3A 3LBXB 5JH7E 1HFAA 4HN9A 3ZJ2A 4H9QC 3E08A 2CCQA 2JRKA 3F57A 1U5PA 2MTQA 4DBRA 3FB2A 1VOMA 3AA0B 4QX8B 3SOLA 3UFEA 3UUNA 3WI3A 2ACXA 4H63H 4UVAB 3ZMUB 1OWAA 1KK7A 2VL8A 2HPLA 1FMVA 2ZLYA 1V9DA 1WYCA 4L5GA 3UT5E 2CM0A 3MXZA 5CA1E 2LM9A 2Y8DA 3JC6D 4BJMA 5GONE 1AJ3A 2CXFA 3LFMA 3M65A 3WAJA 2V7KA 3ZPOA 5DABA 2LSGA 4EZ4A 4TV8E 1G73A 3NRYA 2NOXA 3KV4A 4XBFB 2WMNA 3PUSA 1WLXA 2BVMA 4IHJE 4CI2B 3L09A 2VK9A 1OXZA 4ZI2C 2VASA 3R84B 3OYZA 3ANWB 3N9QA 5LCYA 3N9PA 3CWZB 5FY7A 1D0XA 4IE4A 1ZV4X 3CQCB 1MMGA 3CMLA 4ZI3C 5JVDE 3RPUA 4QX7B 3KV6A 1SHZC 3AA7B 3ETUA 4ASKA 3V5SA 1QSDA 3CVRA 4U72A 3PURA 4ADZA 3GA8A 3N9LA 4XAXB 5L3CB 3IBPA 2LOPA 2PG8A 4UELA 4ISSA 2NP9A 4ZS3A 1ZKEA 2PFVA 2K5BB 5KDMC 3ANWA 2KLQA 4ILUA 5LJNA 3ZMSB 2H7OA 5L3GB 2G0UA 5JR9A 1MMNA 4CXYA 3C51A 5L3BB 2EHOA 2YU1A 4EXTA 5JRCA 2X9XA 2WBLA 2X51A 5F3JA 4ZI7E 1SA0E 2VKHA 3ZYLA 1IAPA 2ZM2A 2QGSA 3HI2A 4IE0A 1EZ3A 4TN7B 5LNKA 3EUHA 4HGAA 4UXNB 2NWBA 2KWHA 2Y6XA 3SS1A 5HXHA 2MOZA 3P7IA 4TX5A 4PJLA 3ONXA 2XAGB 3HKBE 2KMFA 2YEVC 4GK5E 5FXZA 5KMGP 3MKDA 2SPCA 3EVYA 4ZOLE 3PE0A 3K8PC 3W15B 2C5JA 4CQIA 3L3PA 2ZMAA 2W61A 3MA9A 3ZMVB 3UUXB 5HXRA 2X0LB 3ZC0A 4H9NC 2NTYA 1D1AA 4I50E 3RYHE 3VKHA 2UXXB 4H9PC 2WM9A 5L3DB 1HX8A 4H9OC 5LGUB 4E7SA 1X79A 3E22E 1YKEB 3KV5A 1HG2A 4PK5A 1S35A 3LJCA 4MLKA 3R6NA 2BDEA 3FXDB 3Q5XA 3UULA 2V26A 4H9SE 3KBUA 3RRCA 2BVLA 3GWHA 4AKLA 3RH3A 3SWHA 4GOUA 4TV9E 3RX6A 4CI1B 3B13A 4A56A 5LGTB 3D0TA 3ETVA 2CXLA 3N9NA 3PUAA 2NW8A 2W63A 3CKDA 5LHHB 4P0AA 2LSIA 2A72A 5HAXA 4UVBB 2KNDA 3A5XA 2MYSA 2IAKA 5LP6E 4C91A 2XAHB 3KBTA 4AQGA 1BR2A 4O4IE 3MACA 2NW7A 1Y64B 1UX5A 1YKHB 4FI5A 4OK0A 3N5LA 4AKGA 3GN5B 5JDMA 3KVAA 2ZM0A 5TAOA 3PU3A 3F31A 3B57A 2Q9QD 4ANJA 2DI4A 3DP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0Z A; 
#chains in the Genus database with same CATH topology
 1KFY A;  3NZQ A;  3UQ7 A;  4DUY T;  3LBX A;  2XQ8 A;  1O3X A;  3AE8 A;  3FZK B;  3KV9 A;  4QXH B;  4ERR A;  3EDU A;  1MIW A;  4O8S A;  4DMV A;  4HFV A;  3KDS E;  4IDZ A;  2BS2 A;  3T1H T;  3GMI A;  2XY8 B;  3EHZ A;  4OYJ A;  4YJ2 E;  2LKG A;  4EB6 E;  5E0O A;  2VKD A;  2E5L T;  5IYZ E;  4LML A;  4DND A;  1BR4 A;  1SE7 A;  3OKQ A;  3ZMZ B;  4EGW A;  2CEA A;  2NTX A;  5JDF A;  4IGU A;  2X9Y A;  3PJA A;  5LXT E;  4JI5 T;  5FY1 A;  3RRW A;  2CXD A;  4GIW A;  2UXN B;  4Z90 A;  2XTL A;  1WR0 A;  2K9A A;  3ZMT B;  3BQI A;  4TWF A;  5AQK B;  2RA1 A;  5F8P A;  4MFR A;  2VL0 A;  4DO0 A;  1X9B A;  3RGL A;  1E2A A;  1M62 A;  5L4E A;  4Z91 A;  2IML A;  3AE4 A;  4OYK A;  5FXX A;  3ZST A;  1E1H B;  2UUB T;  3OYX A;  4HTE A;  4GKK T;  1FEW A;  3PUQ A;  5AFU L;  2VKO A;  4TUY E;  5DQV A;  4QXC B;  4JI6 T;  1XDO A;  1NAF A;  1VCS A;  2CWO A;  3L39 A;  2LSJ A;  5AQJ B;  1CHU A;  1IJ6 A;  4HKA A;  2CLY B;  4I43 B;  3N2O A;  3J9X 1;  3ZLI A;  4AQF C;  3HKD E;  4WNK A;  4ZI2 D;  3VKG A;  5JQG E;  2XUE A;  3HR0 A;  5AQH B;  2RP4 A;  2WMO A;  3PUG A;  2IIU A;  5J2U E;  2V7I A;  3ZEF B;  4QXB B;  4DV5 T;  5EK2 A;  3IHR A;  2BG9 E;  5L4H A;  1J5W A;  4JBW F;  5FXW A;  4YSX A;  4X1I E;  5BMV E;  5M4Y A;  3AE5 A;  1J1J A;  1MIV A;  4U33 A;  4GK0 E;  4ZS2 A;  3N2K E;  4DVD A;  4DR7 T;  3CQX C;  4ZZB A;  2HH7 A;  3NBX X;  3S4U A;  2PBI A;  2JMH A;  2CPT A;  2L3L A;  3LDQ B;  4A98 A;  4IE7 A;  4B3T T;  3VR8 A;  2J4G A;  1IBL T;  4DR5 T;  4JUY A;  2ACZ A;  3AEF A;  2DWG A;  2LJL A;  4NXM T;  4UVC B;  2CMR A;  3AE7 A;  4CXX A;  3Q5W A;  4CN1 A;  2CHN A;  1HTJ F;  2H3R A;  1WYB A;  4KUM B;  4IDP A;  3ZSS A;  3K1S A;  2FBW A;  2I0M A;  4IE5 A;  2Q9Q A;  2V7M A;  4LMK A;  4C90 A;  2XSB A;  3BQL A;  4P0B A;  3V5U A;  3OJA A;  3TLV A;  3EAB A;  2E9X C;  3DTO A;  1CUN A;  3NRX A;  2BS4 A;  4UF0 A;  4F8H A;  5JDG A;  3FZH B;  2M6I A;  3CX6 B;  1LRZ A;  4L9I A;  2GK9 A;  1HFA A;  1M7K A;  2H89 A;  4H9Q C;  3PUZ F;  5CGM A;  1U5P A;  3FB2 A;  1VOM A;  3AA0 B;  2YOE A;  2CHO A;  4H63 H;  2BG9 B;  3CIR A;  2VL8 A;  2VUR A;  2D9D A;  4L5G A;  2CBJ A;  4ZXL A;  4BJM A;  5AQT B;  2CXF A;  3LFM A;  2UU9 T;  2V7K A;  2NOX A;  3JAF A;  4IHJ E;  4CI2 B;  3L09 A;  2VK9 A;  2VAS A;  3R84 B;  3ANW B;  5LCY A;  3N9P A;  3P4R A;  4JI8 T;  3CWZ B;  1D0X A;  2M6B A;  4DV6 T;  3G06 A;  2XSA A;  3X1D A;  3GA8 A;  4LMJ A;  4U7I A;  2PG8 A;  3RI5 A;  1HNW T;  3AEB A;  2K5B B;  3ANW A;  3OTO T;  2G0U A;  5JR9 A;  3OVU A;  1N32 T;  5AQL B;  3C51 A;  5L3B B;  4EXT A;  5F3J A;  2W2U A;  2HHH T;  3EUH A;  4HGA A;  3ZT5 A;  5AQV B;  2KMF A;  4GK5 E;  5LMN T;  5KMG P;  3L8R A;  3W15 B;  3L3P A;  5HXR A;  1XNR T;  3ZC0 A;  4I50 E;  1R8I A;  3VKH A;  1ZP0 A;  3UUB A;  3QOF A;  2V6Y B;  4P1N A;  5ABH A;  3JAD A;  3UUL A;  4H9S E;  2BVL A;  3RH3 A;  2XM1 A;  4GOU A;  4CI1 B;  3AXJ B;  2A72 A;  1YQ4 A;  4HFI A;  4UVB B;  2XQ9 A;  4C91 A;  3MAC A;  3ONL C;  2V6Y A;  4AKG A;  5JDM A;  2ZM0 A;  5TAO A;  3B57 A;  4DR3 T;  3I9Y A;  5ADX L;  1LVF A;  1N33 T;  3RIU A;  5KX5 E;  1QLB A;  4F6R C;  5JDQ A;  2RPA A;  2V8S V;  4IL9 A;  2NW9 A;  3BQK A;  2CA5 A;  2KT9 A;  1FJG T;  1OED C;  5HXC A;  4CI3 B;  1HS7 A;  3PUY F;  4JI7 T;  4EOZ B;  2AE9 A;  5JDH A;  4KP3 C;  3FZF B;  1UK5 A;  3ABV A;  2X66 A;  4FJO A;  2IDO B;  2W67 A;  4IIJ E;  3HA4 A;  2X0Y A;  2D0U A;  4X62 T;  3BK9 A;  2XQY A;  4QH5 A;  3U3I A;  4O4J E;  4PAG A;  3OBV E;  5A1L A;  4HFB A;  5AQR B;  5LBM A;  3PUX F;  2ES0 A;  3RKG A;  2W00 A;  5CB4 E;  3AAE B;  1KEY A;  2LSY A;  4CXW A;  4XZC A;  1E7P A;  2XQ6 A;  4YY3 T;  2CRB A;  1Z8U A;  2LOS A;  3PTR B;  3C50 A;  4LF6 T;  4Z8X A;  4U2Y A;  2LLY A;  4IE6 A;  3I0Q A;  5LG4 A;  4O4H E;  3AVR A;  4DV3 T;  4PK6 A;  5CA0 E;  4NPP A;  2W62 A;  2IC9 A;  3ZN0 B;  4YSY A;  5C8Y E;  4QWN B;  4PW8 A;  1KNZ A;  3AEA A;  3N2G E;  2C5I T;  5DJQ C;  3AB3 B;  2OLT A;  3HL6 A;  2IUB A;  4BA9 A;  5HCM A;  4X65 T;  3P4P A;  3T8O A;  2WSS V;  3GN5 A;  4ZI3 D;  4HWF A;  4PFP A;  3N9O A;  1YW0 A;  4X20 E;  5FYM A;  2UXC T;  2D5U A;  3UU5 A;  2JJ9 A;  2C5K T;  2Y48 B;  4HWH A;  5JDL A;  4HWC A;  2E9X B;  3FHN A;  5LA6 E;  2VB6 A;  2DLR A;  3LK4 2;  3N9M A;  5JRC B;  2H7V C;  1IJ5 A;  1XZY A;  3I1A A;  5IWA T;  1FIO A;  5CJ5 A;  2E9X A;  4OHF A;  4OFZ A;  3FZM B;  4UV8 B;  3FXE B;  5FXV A;  4JEU B;  3MZK B;  4WZX A;  4DID B;  2N1G A;  1WFD A;  2YU2 A;  3AA1 B;  2V7L A;  1QUU A;  3H3A A;  2DCF A;  2QA7 A;  3ZCJ A;  4PJM A;  5DQW A;  1S94 A;  2WAU A;  5KXJ A;  5ETW A;  3RYC E;  2X9W A;  4J2C A;  2VQF T;  2BBJ A;  3PUV F;  5EK4 A;  3SFE A;  1OED E;  3K3Q C;  4UEM A;  5FVL A;  2CBI A;  3CK6 A;  3TKL B;  2NR4 A;  2DHR A;  4EYU A;  5FL1 A;  2W0G A;  3AAI A;  2EHO C;  4EAH A;  5ABG A;  1MND A;  2CE7 A;  3TLS A;  3UTK A;  3RC3 A;  1ZOY A;  4HN9 A;  4ILB A;  2VVN A;  2JRK A;  2XJ7 A;  3UUN A;  3UFE A;  1OWA A;  1KK7 A;  1FMV A;  2ZLY A;  3AEG A;  2E2A A;  2FUP A;  4CN6 A;  2CM0 A;  5GON E;  3P4S A;  2JQK A;  4TNW A;  2UXD T;  3RF1 A;  3NRY A;  3PUS A;  1OXZ A;  2JQ9 A;  5LMU T;  1MMG A;  3RPU A;  3KV6 A;  1DU2 A;  2ZM6 T;  3CVR A;  2OV9 A;  4U72 A;  2WU2 A;  3N9L A;  4XAX B;  5L3C B;  3IBP A;  2LOP A;  1XMQ T;  1N34 T;  5KDM C;  2KLQ A;  4ILU A;  4NIQ A;  3ZMS B;  2H7O A;  2XQ5 A;  2X0H A;  3RQW A;  2X9X A;  1SA0 E;  2VKH A;  1IAP A;  2ZM2 A;  3HI2 A;  4IE0 A;  4UXN B;  2KWH A;  5HXH A;  3P7I A;  2JQH A;  4KHZ F;  3ONX A;  3HKB E;  2YDQ A;  5FXZ A;  2SPC A;  3EVY A;  1OED B;  3K8P C;  3PE0 A;  2ZMA A;  4YT0 A;  4H9N C;  2NTY A;  3RYH E;  2WM9 A;  5LG3 A;  2LM2 A;  5LGU B;  1X79 A;  3AE6 A;  3KV5 A;  1HG2 A;  4PK5 A;  3LJC A;  2VQE T;  2V6X A;  5FKY A;  3FZL B;  3RRC A;  3SWH A;  4TV9 E;  3RX6 A;  4HWD A;  3D0T A;  2CXL A;  3PUA A;  4A97 A;  2LKH A;  2W63 A;  5LHH B;  5HAX A;  2XQ3 A;  5HEO A;  1KNR A;  4FI5 A;  2I6H A;  4U31 A;  2XQ4 A;  3PU3 A;  2UUC T;  1JNR A;  1NEK A;  2JPF A;  1Z0P A;  5HCJ A;  5LGN B;  2XAJ B;  4CZZ B;  3QB5 A;  3EAM A;  2MAW A;  2BG9 A;  2J1D G;  2V5C A;  1D1C A;  2X67 A;  1HX1 B;  5J1G A;  4B3R T;  4QKN A;  2K48 A;  4G63 A;  2X9H A;  4V1A v;  5C3J A;  3JC6 C;  4M1P A;  1H7C A;  5LBQ B;  2YIN A;  3RC8 A;  1UUS A;  3JAE A;  1SUM B;  2HPJ A;  4AKR B;  3P4W A;  3VRA A;  2PJQ A;  1WRD A;  3UUM A;  2X68 A;  1WCR A;  1JNZ A;  2LT3 A;  2VVS A;  2LEH A;  2ODV A;  3AE9 A;  3HKC E;  2E8I A;  3AAA B;  2LHR A;  3O1J A;  3KVB A;  1KNP A;  1WR6 A;  1YD8 G;  4TWH A;  3ZCI A;  2IHR 1;  5HYA A;  3K3O A;  5LHI B;  3U78 A;  3QUJ A;  4DMW A;  2UUA T;  3C4X A;  3UQ4 A;  2E9X D;  4ZZC A;  2WZI A;  2MBG A;  4MBQ A;  1HR0 T;  2WB5 A;  2ZM8 A;  1KF6 A;  3MJX A;  1UX4 A;  2D2S A;  3QC9 A;  2KZ7 B;  4NUV A;  2WU5 A;  3AEC A;  4LFB T;  1US7 B;  1BR0 A;  2R6G F;  4JYA T;  4HFD A;  1VRB A;  3LK3 B;  2V7J A;  4WBN E;  3FBL A;  4KBM B;  4WW0 A;  1IZN B;  5IUX A;  3WAK A;  3QK6 A;  2YK0 A;  3JCF A;  3O1I A;  4O2B E;  2WDR A;  4ILC A;  5L2L A;  3AXJ A;  2V1D B;  1U4Q A;  4L0R A;  3HKE E;  5LJM A;  4DBQ A;  4IDO A;  2XAF B;  3PDY A;  5AQP B;  5FY0 A;  3VR9 A;  2FJE A;  5JDN A;  1XDP A;  2CWY A;  2Q9Q C;  1LVK A;  1MNE A;  2B76 A;  4HFH A;  2Z6E A;  3P50 A;  4I0U A;  4GYS A;  5EK3 A;  4MAL A;  4YLH A;  3ZYK A;  2C0S A;  2QVA A;  3UU3 A;  1XWM A;  2XAS B;  4JI4 T;  4DR4 T;  2OA5 A;  4WYV A;  3C4W A;  4A5X A;  3VU7 H;  1D0Y A;  2EHO B;  4YFS A;  2L9Q A;  5AQF B;  3SRZ A;  5AQS B;  1G8X A;  4LF8 T;  2PTF A;  3SFD A;  3C64 A;  4BJN A;  4AXP A;  4EYY R;  2KXP B;  3LK2 B;  3VRB A;  4DR2 T;  1UCU A;  3LG7 A;  5AQG B;  2W66 A;  4JLE A;  5IHY A;  2WDV A;  1W9R A;  4WBO A;  3VHL A;  4AQF A;  5EZY E;  2JMK A;  2XAQ B;  4MHC A;  4PJN A;  3RQU A;  3RLF F;  1T98 A;  2K24 A;  3AED A;  2WCA A;  1HF8 A;  4UIG A;  3I0O A;  3UU8 A;  4YXD A;  5LOV E;  3RKO A;  2FJB A;  4DR1 T;  1T8B A;  4K0K T;  5F5W A;  4EZH A;  4O4L E;  5JR9 C;  3F2E A;  4NXN T;  1GQE A;  5J2T E;  4AKH A;  3Q9D A;  2BZB A;  2HN1 A;  3DJB A;  5AQN B;  3CPZ A;  4HFC A;  3LBX B;  5JH7 E;  2YDR A;  3ZJ2 A;  1W09 A;  4X64 T;  1I6Z A;  3F57 A;  2FJD A;  2MTQ A;  4DBR A;  3PJA J;  4ZEY A;  4QX8 B;  3WI3 A;  3PUW F;  4TNV A;  1V9D A;  5L47 A;  3UT5 E;  3MXZ A;  5CA1 E;  2Y8D A;  1AJ3 A;  3M65 A;  3WAJ A;  3ZT6 A;  4EZ4 A;  4TV8 E;  1G73 A;  3KV4 A;  4XBF B;  2WMN A;  1WLX A;  2BVM A;  2KSR A;  4ZI2 C;  4LF7 T;  4UR9 A;  3N9Q A;  2AXD S;  5FY7 A;  4DV0 T;  5BR8 T;  1ZV4 X;  3CQC B;  3CML A;  5C2T A;  5JVD E;  4QX7 B;  1SHZ C;  2UXB T;  4ASK A;  3V5S A;  4JV5 T;  1QSD A;  2LRL A;  5AQU B;  4DV4 T;  1MMN A;  5AQI B;  4CXY A;  4EV6 A;  4LF9 T;  4LF4 T;  2YU1 A;  5JRC A;  2WBL A;  4JI0 T;  5HEH A;  3RIU C;  3ZYL A;  2QGS A;  1EZ3 A;  2NWB A;  2Y6X A;  4QH4 A;  3A8Y C;  3SS1 A;  2MOZ A;  4PJL A;  2XAG B;  2YEV C;  2V5D A;  3MKD A;  2C5J A;  4CQI A;  3ZMV B;  2W61 A;  3MA9 A;  3UUX B;  3QB5 K;  3AE3 A;  5L3D B;  1HX8 A;  4EEB A;  3E22 E;  1YKE B;  1I94 T;  3R6N A;  2BDE A;  3ZT7 A;  3Q5X A;  2V26 A;  3GWH A;  4AKL A;  2E5V A;  3B13 A;  4IT4 A;  4YTP A;  3ETV A;  4P0A A;  4DR6 T;  2KND A;  3A5X A;  4U7Y A;  2IAK A;  4KI0 F;  3PV0 F;  2NW7 A;  1UX5 A;  5JTG A;  1YKH B;  3N5L A;  3KVA A;  3F31 A;  4ANJ A;  3DP7 A;  3ESL A;  3B5M A;  5LHG B;  4TZ4 C;  1T7S A;  3CX7 B;  2BKP A;  1HG5 A;  3RYF E;  5H6R B;  1IBK T;  4YHH T;  3IEE A;  4PJJ A;  1MMD A;  2M67 A;  2WY2 A;  2LRK A;  4LFA T;  4P09 A;  4AI6 A;  3NVO A;  3FBZ A;  4QH1 A;  3UU6 A;  2B1E A;  2JIW A;  4QHO A;  4UV9 B;  3E0Z A;  3O4X E;  5HWX A;  3LSV A;  3Q5E A;  1T72 A;  4B6X A;  2WQY A;  2XHE B;  1NWM X;  2LE8 A;  2KIN B;  2VWA A;  3O9X A;  4AIU A;  5HXE A;  2BS3 A;  1FMW A;  2DNX A;  3KIN B;  2D0T A;  1BR1 A;  2I59 A;  3RIA A;  4GYR A;  1ZHC A;  5HWY A;  4ILA A;  4I55 E;  2Q9Q B;  1J5E T;  2A3D A;  2XZE A;  4HWI B;  4IDN A;  2WWU A;  2P9B A;  3ZJ1 A;  3Q2M A;  4UF0 B;  5H6Q B;  5LYJ E;  1L0V A;  2EHO D;  4ZHQ E;  4YHJ A;  3A7M A;  3EDV A;  3KFW X;  4YJ3 E;  1OED A;  3P8C D;  4HFE A;  4H9R C;  2LHN A;  4B3S T;  5ABF B;  2LSK A;  3IF8 B;  5FL0 A;  2DWK A;  2JQQ A;  1ZEE A;  4I4T E;  1NEN A;  4K0U A;  3MK7 C;  1W0B A;  4IL4 A;  5L3E B;  1D1B A;  4AIS A;  4TWD A;  4JEH B;  3AE1 A;  3CX8 B;  5ABF A;  4B3M T;  4IST A;  2YN6 A;  3ZC1 A;  2VKJ A;  1UGO A;  3J7Y q;  2IC6 A;  3TLT A;  3AVS A;  3PU8 A;  3K3N A;  5J0Z A;  3AA6 B;  3Q5D A;  4DUZ T;  5LB7 B;  2K3W A;  4PNI A;  3ZN1 B;  3AEE A;  4EED A;  1N36 T;  4H63 V;  2N2N A;  4BAY B;  5L3F B;  1HCI A;  3H3M A;  5JR9 B;  3AE2 A;  4LFC T;  5FMN A;  1YXR A;  3NZP A;  3P4Q A;  1LKX A;  2IW5 B;  3RYI E;  4X1K E;  3RHW A;  2WZH A;  4HEA A;  2XPK A;  2QRX A;  2BKO A;  2KWI B;  2N9D A;  2CLY C;  1YQ3 A;  1D0Z A;  2YKS A;  4E7Z A;  5ABE A;  5FP3 A;  4DV2 T;  2ODU A;  1MIY A;  4X1Y E;  3I9W A;  4U74 A;  4YSZ A;  3EI0 A;  3NKZ A;  4HE8 A;  4PK4 A;  2A2F X;  4KMC A;  5HXS A;  5FNV E;  4O2A E;  3ZKR A;  1MMA A;  1XMO T;  2WS3 A;  2BBH A;  4AKI A;  3CQG B;  3C98 B;  3H37 A;  4AQY T;  3C4Z A;  3ZYM A;  4EIW A;  4G2A A;  3T1Y T;  1W0A A;  3O1H A;  4N78 D;  4NUU A;  4PFO A;  2L8K A;  4COF A;  3M3Z B;  2BKN A;  1B7T A;  5JRE A;  5HEG A;  3E08 A;  4DV1 T;  2CCQ A;  3NWI A;  3SOL A;  2ACX A;  4UVA B;  3ZMU B;  4DV7 T;  2W4X A;  2HPL A;  5AQQ B;  4CN4 A;  4LF5 T;  1WYC A;  5CFB A;  2LM9 A;  3JC6 D;  1XNQ T;  2DL1 A;  3ZPO A;  5DAB A;  2LSG A;  2XQ7 A;  3QNU A;  5HEJ A;  3OYZ A;  4Q25 A;  4U2Z A;  4IE4 A;  4ZI3 C;  1IBM T;  2XM2 A;  2H88 A;  3TLW A;  3AA7 B;  3ETU A;  3PUR A;  4ADZ A;  2MPK A;  4UEL A;  4ISS A;  2NP9 A;  4KX6 A;  4ZS3 A;  1ZKE A;  2PFV A;  4X66 T;  5LJN A;  2F4V T;  1HNX T;  5L3G B;  1HNZ T;  2EHO A;  5HEU A;  2X51 A;  2A9U A;  4ZI7 E;  2WDQ A;  4TN7 B;  5LNK A;  4KHP T;  2BG9 C;  4TX5 A;  4U3C A;  3ONJ A;  1VCT A;  4YTN A;  2FJA A;  4ZOL E;  3RIF A;  3IA3 A;  2X0L B;  1D1A A;  3TLU A;  2UXX B;  4H9P C;  5AQO B;  4H9O C;  4E7S A;  4GKJ T;  4JI1 T;  1S35 A;  4YTM A;  4MLK A;  3FXD B;  4X5T A;  3UU4 A;  3KBU A;  3OPC A;  5FVK A;  3UFG A;  2YDS A;  4IRE A;  5LGT B;  4A56 A;  2QYW A;  3N9N A;  2NW8 A;  3CKD A;  4JI3 T;  2LSI A;  2MYS A;  2WP9 A;  5LP6 E;  2XAH B;  3KBT A;  4AQG A;  1BR2 A;  2J62 A;  4O4I E;  2HN2 A;  4IDQ A;  1Y01 A;  1Y64 B;  1UUR A;  4OK0 A;  4JI2 T;  5AQM B;  4OX9 T;  3GN5 B;  2J47 A;  2Q9Q D;  2DI4 A;  2WWV A;  2XQA A; 
#chains in the Genus database with same CATH homology
 5ADX L;  2JPF A;  3ESL A;  3NZQ A;  1LVF A;  5LHG B;  1Z0P A;  3LBX A;  4TZ4 C;  5LGN B;  2XAJ B;  3CX7 B;  4CZZ B;  5KX5 E;  4F6R C;  5JDQ A;  1O3X A;  1HG5 A;  4QXH B;  3KV9 A;  3RYF E;  4ERR A;  2J1D G;  3BQK A;  2NW9 A;  5H6R B;  3EDU A;  2CA5 A;  2KT9 A;  1D1C A;  1MIW A;  2X67 A;  4O8S A;  5J1G A;  4DMV A;  4HFV A;  5HXC A;  4CI3 B;  3KDS E;  1HS7 A;  4QKN A;  4IDZ A;  2K48 A;  4G63 A;  2X9H A;  3IEE A;  4V1A v;  3JC6 C;  3GMI A;  4M1P A;  4EOZ B;  1H7C A;  4PJJ A;  1MMD A;  5JDH A;  4KP3 C;  5LBQ B;  4OYJ A;  2YIN A;  3RC8 A;  4YJ2 E;  2HPJ A;  4AKR B;  2M67 A;  4EB6 E;  5E0O A;  2VKD A;  5IYZ E;  4DND A;  4P09 A;  4AI6 A;  1BR4 A;  3FBZ A;  3OKQ A;  2B1E A;  1WRD A;  2PJQ A;  2X66 A;  4FJO A;  3UUM A;  4QHO A;  4UV9 B;  2X68 A;  3E0Z A;  3O4X E;  3ZMZ B;  5HWX A;  4IIJ E;  3HA4 A;  2CEA A;  2D0U A;  2NTX A;  2LT3 A;  3BK9 A;  2LEH A;  2ODV A;  5JDF A;  4B6X A;  4IGU A;  2X9Y A;  2XHE B;  2E8I A;  3HKC E;  5LXT E;  3AAA B;  5FY1 A;  2XQY A;  2LHR A;  1NWM X;  2LE8 A;  3RRW A;  3O1J A;  2KIN B;  3KVB A;  2VWA A;  3U3I A;  4O4J E;  2CXD A;  3O9X A;  4PAG A;  4GIW A;  1WR6 A;  3OBV E;  1FMW A;  2DNX A;  2UXN B;  5HXE A;  2XTL A;  5A1L A;  1YD8 G;  3KIN B;  3ZCI A;  5HYA A;  2D0T A;  1BR1 A;  2I59 A;  3K3O A;  5LBM A;  2K9A A;  5LHI B;  4GYR A;  2ES0 A;  3U78 A;  3QUJ A;  3ZMT B;  1ZHC A;  3BQI A;  5HWY A;  2W00 A;  5CB4 E;  3AAE B;  4I55 E;  2Q9Q B;  4DMW A;  2A3D A;  3C4X A;  2LSY A;  4CXW A;  2E9X D;  4XZC A;  2RA1 A;  5F8P A;  2WWU A;  2LOS A;  3PTR B;  3C50 A;  2P9B A;  2MBG A;  4MBQ A;  4MFR A;  3ZJ1 A;  3Q2M A;  4UF0 B;  5H6Q B;  2ZM8 A;  4ZHQ E;  2EHO D;  5LYJ E;  4Z8X A;  4DO0 A;  4YHJ A;  3EDV A;  3MJX A;  4IE6 A;  1UX4 A;  3KFW X;  2D2S A;  3QC9 A;  2KZ7 B;  3I0Q A;  4YJ3 E;  3P8C D;  4H9R C;  2LHN A;  4NUV A;  4OYK A;  5LG4 A;  5FXX A;  4O4H E;  1E1H B;  2LSK A;  3AVR A;  3OYX A;  4HTE A;  3IF8 B;  4PK6 A;  1FEW A;  3PUQ A;  5AFU L;  1US7 B;  1BR0 A;  5CA0 E;  2DWK A;  2JQQ A;  1ZEE A;  4I4T E;  2W62 A;  3I9Y A;  1VRB A;  2VKO A;  3LK3 B;  2IC9 A;  2V7J A;  4TUY E;  5DQV A;  4WBN E;  3ZN0 B;  3FBL A;  5C8Y E;  4QXC B;  4QWN B;  4KBM B;  4PW8 A;  4K0U A;  4WW0 A;  1IZN B;  1KNZ A;  3MK7 C;  3WAK A;  3QK6 A;  1NAF A;  5L3E B;  1D1B A;  2YK0 A;  3O1I A;  2CWO A;  4O2B E;  3N2G E;  4JEH B;  2LSJ A;  2C5I T;  3CX8 B;  5DJQ C;  3AB3 B;  4IST A;  1IJ6 A;  3HL6 A;  4HKA A;  5L2L A;  2CLY B;  3ZC1 A;  2VKJ A;  4I43 B;  3N2O A;  2V1D B;  1U4Q A;  3J9X 1;  3ZLI A;  4L0R A;  4AQF C;  4BA9 A;  3HKE E;  3J7Y q;  5LJM A;  2IC6 A;  4DBQ A;  3HKD E;  3AVS A;  4WNK A;  3T8O A;  4ZI2 D;  3PU8 A;  3K3N A;  3VKG A;  2XAF B;  2XUE A;  5JQG E;  3HR0 A;  3PDY A;  2RP4 A;  2WMO A;  3PUG A;  2WSS V;  3GN5 A;  4ZI3 D;  5J2U E;  2V7I A;  5FY0 A;  3ZEF B;  4PFP A;  3N9O A;  3AA6 B;  4QXB B;  5EK2 A;  3IHR A;  5JDN A;  1YW0 A;  2CWY A;  2Q9Q C;  4X20 E;  5FYM A;  5FXW A;  1LVK A;  1MNE A;  4PNI A;  2Z6E A;  2D5U A;  4GYS A;  5EK3 A;  4MAL A;  4YLH A;  4X1I E;  3ZN1 B;  3ZYK A;  2C0S A;  2JJ9 A;  2C5K T;  2Y48 B;  5BMV E;  5JDL A;  4H63 V;  2E9X B;  5M4Y A;  2N2N A;  3FHN A;  4BAY B;  5LA6 E;  1MIV A;  2XAS B;  5L3F B;  1HCI A;  2OA5 A;  2VB6 A;  3C4W A;  5JR9 B;  2DLR A;  3VU7 H;  4GK0 E;  4ZS2 A;  3N2K E;  3LK4 2;  1D0Y A;  4DVD A;  3N9M A;  2EHO B;  4YFS A;  2L9Q A;  5JRC B;  3SRZ A;  2H7V C;  5FMN A;  1IJ5 A;  1G8X A;  3I1A A;  3CQX C;  3NZP A;  3C64 A;  4BJN A;  1LKX A;  2HH7 A;  3NBX X;  1FIO A;  2IW5 B;  3S4U A;  3RYI E;  2E9X A;  4AXP A;  2PBI A;  4EYY R;  2JMH A;  2KXP B;  4OFZ A;  4OHF A;  4X1K E;  2L3L A;  3LK2 B;  4HEA A;  4IE7 A;  4UV8 B;  3FXE B;  1UCU A;  3LG7 A;  5FXV A;  4JEU B;  3MZK B;  2KWI B;  2N9D A;  2CLY C;  1D0Z A;  4JLE A;  4JUY A;  5IHY A;  2DWG A;  2LJL A;  4E7Z A;  2N1G A;  2YU2 A;  5FP3 A;  4UVC B;  4WBO A;  3VHL A;  2ODU A;  1MIY A;  3AA1 B;  4X1Y E;  2CMR A;  3I9W A;  4AQF A;  2V7L A;  1QUU A;  4CXX A;  3H3A A;  4U74 A;  3Q5W A;  2DCF A;  5EZY E;  2JMK A;  2XAQ B;  4HE8 A;  2A2F X;  2QA7 A;  4PK4 A;  3ZCJ A;  4MHC A;  4KMC A;  4PJM A;  5DQW A;  4PJN A;  1HTJ F;  1S94 A;  5FNV E;  2H3R A;  1WYB A;  5HXS A;  2WAU A;  4KUM B;  5ETW A;  3RYC E;  2X9W A;  4O2A E;  1MMA A;  1T98 A;  4J2C A;  4AKI A;  2K24 A;  4IE5 A;  3CQG B;  3C98 B;  3H37 A;  2Q9Q A;  2V7M A;  5EK4 A;  4C90 A;  3BQL A;  1HF8 A;  4P0B A;  4UIG A;  3V5U A;  3K3Q C;  3I0O A;  3OJA A;  4UEM A;  3C4Z A;  2E9X C;  3ZYM A;  4EIW A;  4G2A A;  5LOV E;  3RKO A;  3DTO A;  1CUN A;  3NRX A;  4UF0 A;  3O1H A;  4N78 D;  3TKL B;  5JDG A;  4EZH A;  4NUU A;  4O4L E;  5JR9 C;  2DHR A;  3F2E A;  4EYU A;  4PFO A;  2W0G A;  3AAI A;  2L8K A;  2EHO C;  4EAH A;  5J2T E;  1MND A;  2CE7 A;  4AKH A;  3CX6 B;  1B7T A;  1LRZ A;  3Q9D A;  4L9I A;  2BZB A;  5JRE A;  3DJB A;  2GK9 A;  3CPZ A;  3UTK A;  3RC3 A;  3LBX B;  5JH7 E;  1HFA A;  4HN9 A;  3ZJ2 A;  4H9Q C;  3E08 A;  2CCQ A;  2JRK A;  3F57 A;  1U5P A;  2MTQ A;  4DBR A;  3FB2 A;  1VOM A;  3AA0 B;  4QX8 B;  3SOL A;  3UFE A;  3UUN A;  3WI3 A;  2ACX A;  4H63 H;  4UVA B;  3ZMU B;  1OWA A;  1KK7 A;  2VL8 A;  2HPL A;  1FMV A;  2ZLY A;  1V9D A;  1WYC A;  4L5G A;  3UT5 E;  2CM0 A;  3MXZ A;  5CA1 E;  2LM9 A;  2Y8D A;  3JC6 D;  4BJM A;  5GON E;  1AJ3 A;  2CXF A;  3LFM A;  3M65 A;  3WAJ A;  2V7K A;  3ZPO A;  5DAB A;  2LSG A;  4EZ4 A;  4TV8 E;  1G73 A;  3NRY A;  2NOX A;  3KV4 A;  4XBF B;  2WMN A;  3PUS A;  1WLX A;  2BVM A;  4IHJ E;  4CI2 B;  3L09 A;  2VK9 A;  1OXZ A;  4ZI2 C;  2VAS A;  3R84 B;  3OYZ A;  3ANW B;  3N9Q A;  5LCY A;  3N9P A;  3CWZ B;  5FY7 A;  1D0X A;  4IE4 A;  1ZV4 X;  3CQC B;  1MMG A;  3CML A;  4ZI3 C;  5JVD E;  3RPU A;  4QX7 B;  3KV6 A;  1SHZ C;  3AA7 B;  3ETU A;  4ASK A;  3V5S A;  1QSD A;  3CVR A;  4U72 A;  3PUR A;  4ADZ A;  3GA8 A;  3N9L A;  4XAX B;  5L3C B;  3IBP A;  2LOP A;  2PG8 A;  4UEL A;  4ISS A;  2NP9 A;  4ZS3 A;  1ZKE A;  2PFV A;  2K5B B;  5KDM C;  3ANW A;  2KLQ A;  4ILU A;  5LJN A;  3ZMS B;  2H7O A;  5L3G B;  2G0U A;  5JR9 A;  1MMN A;  4CXY A;  3C51 A;  5L3B B;  2EHO A;  2YU1 A;  4EXT A;  5JRC A;  2X9X A;  2WBL A;  2X51 A;  5F3J A;  4ZI7 E;  1SA0 E;  2VKH A;  3ZYL A;  1IAP A;  2ZM2 A;  2QGS A;  3HI2 A;  4IE0 A;  1EZ3 A;  4TN7 B;  5LNK A;  3EUH A;  4HGA A;  4UXN B;  2NWB A;  2KWH A;  2Y6X A;  3SS1 A;  5HXH A;  2MOZ A;  3P7I A;  4TX5 A;  4PJL A;  3ONX A;  2XAG B;  3HKB E;  2KMF A;  2YEV C;  4GK5 E;  5FXZ A;  5KMG P;  3MKD A;  2SPC A;  3EVY A;  4ZOL E;  3PE0 A;  3K8P C;  3W15 B;  2C5J A;  4CQI A;  3L3P A;  2ZMA A;  2W61 A;  3MA9 A;  3ZMV B;  3UUX B;  5HXR A;  2X0L B;  3ZC0 A;  4H9N C;  2NTY A;  1D1A A;  4I50 E;  3RYH E;  3VKH A;  2UXX B;  4H9P C;  2WM9 A;  5L3D B;  1HX8 A;  4H9O C;  5LGU B;  4E7S A;  1X79 A;  3E22 E;  1YKE B;  3KV5 A;  1HG2 A;  4PK5 A;  1S35 A;  3LJC A;  4MLK A;  3R6N A;  2BDE A;  3FXD B;  3Q5X A;  3UUL A;  2V26 A;  4H9S E;  3KBU A;  3RRC A;  2BVL A;  3GWH A;  4AKL A;  3RH3 A;  3SWH A;  4GOU A;  4TV9 E;  3RX6 A;  4CI1 B;  3B13 A;  4A56 A;  5LGT B;  3D0T A;  3ETV A;  2CXL A;  3N9N A;  3PUA A;  2NW8 A;  2W63 A;  3CKD A;  5LHH B;  4P0A A;  2LSI A;  2A72 A;  5HAX A;  4UVB B;  2KND A;  3A5X A;  2MYS A;  2IAK A;  5LP6 E;  4C91 A;  2XAH B;  3KBT A;  4AQG A;  1BR2 A;  4O4I E;  3MAC A;  2NW7 A;  1Y64 B;  1UX5 A;  1YKH B;  4FI5 A;  4OK0 A;  3N5L A;  4AKG A;  3GN5 B;  5JDM A;  3KVA A;  2ZM0 A;  5TAO A;  3PU3 A;  3F31 A;  3B57 A;  2Q9Q D;  4ANJ A;  2DI4 A;  3DP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...