3E0ZA

Crystal structure of a putative imidazole glycerol phosphate synthase homolog (eubrec_1070) from eubacterium rectale at 1.75 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
GMITSIARQSIILKCLRQKSVLVSNYELYYTAGLAKKCFGIAVDADMEPKQLLEELQKHIDKVSPADEQEKYLIHLLGNYEPDDTHDEQTVELFHMGETEEHIWQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein of unknown function
publication title Crystal structure of protein of unknown function (RER070207001348) from Eubacterium rectale at 1.75 A resolution
rcsb
source organism Eubacterium rectale
molecule tags Unknown function
total genus 37
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3e0zA00
3E0ZA
chains in the Genus database with same CATH superfamily
2BG9B 2KNDA 4BAYB 3TLTA 3P4RA 3JAEA 4TUYE 3ZMZB 4EEDA 2IAKA 3M3ZB 4UVAB 3AE9A 2AXDS 3CX6B 4X65T 5E0OA 3FZMB 4TX5A 3O1IA 4DMWA 2YDRA 2UUAT 3ZEFB 3SFEA 3RKOA 3OVUA 2YEVC 4JI4T 2CHNA 4DR6T 2E9XA 1G8XA 3QB5K 3KVBA 2UXCT 4HFBA 5JDLA 2WY2A 1YKHB 3ZC0A 4YFSA 1M62A 4IDPA 5ABGA 4LF9T 1FMVA 4ZS3A 1ZOYA 4OX9T 1J5ET 3PUSA 2KWHA 1OXZA 3HA4A 2DHRA 3AEBA 1IBKT 2NWBA 3GN5A 2RPAA 4O8SA 4DIDB 3EDUA 5FY7A 4QWNB 2QYWA 1OEDE 2WWUA 4OYJA 4LF8T 2HPLA 4F6RC 3HI2A 2ACZA 4O4LE 3TLSA 3AVRA 2LM2A 2OLTA 4YTMA 3TLWA 5AQPB 2KSRA 3GA8A 2YU2A 3LK42 3P50A 2E5VA 4QH4A 3AE1A 4GKJT 1W0BA 5CB4E 1UUSA 4P0AA 4ZZBA 3Q2MA 5FXXA 2NOXA 3R6NA 2CXDA 1E2AA 4KMCA 4B3TT 1U4QA 2ZM0A 3E22E 4IGUA 3H3AA 1MMGA 1N34T 4NUUA 5CA0E 5HEUA 4GKKT 1XMOT 4QX7B 2DL1A 1KNZA 1VCTA 2HPJA 2W63A 2CXFA 2M6BA 1I94T 4JV5T 5L4HA 2J4GA 5AQNB 4OHFA 4MHCA 1OEDC 5FVLA 4HFHA 4DR7T 2LE8A 4QX8B 3P4WA 3ONJA 3FZFB 2LRLA 3P4PA 4AKLA 5IUXA 3F57A 3P4QA 2JQQA 4KP3C 4YY3T 2H3RA 4EEBA 3UQ7A 1IJ6A 2PFVA 4AXPA 2Q9QB 1IAPA 1H7CA 2NW8A 1U5PA 2XHEB 3ONLC 4IL4A 4U7IA 2HH7A 4F8HA 2WAUA 1VRBA 1D1CA 4U2ZA 3UUNA 4L9IA 3ZYKA 4KHZF 1HR0T 5LJNA 4LFAT 2VL0A 5JR9C 3J9X1 2KT9A 5EK3A 3F2EA 4X1IE 5JDMA 4AKIA 4HWFA 3B57A 5H6QB 1ZHCA 4CXWA 4UR9A 2XSAA 2QVAA 2JJ9A 1BR1A 2VQFT 3KBUA 4LF6T 3SOLA 2CRBA 1XZYA 2ODUA 4JEHB 4DUZT 4TN7B 3L3PA 3VR8A 2NTXA 2EHOB 3A7MA 1LVKA 1MIWA 1LKXA 3EVYA 3RX6A 2H89A 3EAMA 4V1Av 2D2SA 4X1KE 3I1AA 4YXDA 2XQ7A 4DV1T 3C50A 4P0BA 3CX8B 4GYRA 1HG5A 4L5GA 1BR2A 1UCUA 4IDZA 4AKGA 4QXBB 1SHZC 5DQVA 3AE7A 1W0AA 1ZKEA 2K48A 3W15B 3LDQB 3RYCE 3N2KE 2VL8A 5HCJA 4HFEA 4ILCA 2WM9A 4EXTA 3G06A 3VRAA 4PFOA 3TLVA 1MMDA 3HL6A 2BDEA 3C51A 3PE0A 4ASKA 2A3DA 4OYKA 2I0MA 5AQJB 3ZPOA 4PW8A 4TWFA 2BG9A 3ZMTB 4NXMT 5AQKB 3JC6D 3PUXF 4X64T 3AEGA 2B1EA 3IHRA 5LBMA 3T1YT 3HKDE 2D0UA 5CGMA 3LBXA 3ZKRA 3FB2A 4JUYA 5LHGB 3RYHE 4HWHA 2DWKA 4KX6A 4DR5T 2ZM8A 3N2OA 4H9PC 3U78A 3ZT7A 4HEAA 1W09A 5F3JA 4I50E 4UXNB 4ANJA 3NBXX 3PDYA 4I55E 3N9LA 3ZCIA 3UT5E 4NUVA 2YDSA 4JI1T 2IHR1 3AE6A 2CHOA 3PUGA 3N9OA 5AQRB 2VVSA 3M65A 2LSJA 3CKDA 1HTJF 1CHUA 2V6XA 2XQ9A 3Q5XA 2ZM6T 3Q5DA 2XUEA 4ADZA 2XZEA 3IBPA 4DV0T 2N1GA 1HNWT 3C98B 4UVBB 3AAIA 2XTLA 3ZSSA 3UU6A 3C4WA 3ZYLA 2IMLA 4YLHA 2VKHA 1OEDA 2W62A 5GONE 3ONXA 4YTNA 3U3IA 4YT0A 5HYAA 4B3RT 4AQYT 3VKHA 3RIUC 5AQQB 5L3EB 2WMOA 3NKZA 4IE5A 5LOVE 4DMVA 4JBWF 5KXJA 2LM9A 5LG4A 2OA5A 1Y64B 4UF0A 3N9MA 3PUQA 4AI6A 2WQYA 2R6GF 2YKSA 4NXNT 1MIYA 2P9BA 4GK5E 4A56A 4KI0F 2GK9A 2XQ8A 4E7ZA 1FEWA 3NZPA 3J7Yq 4O4HE 2Y6XA 2CM0A 5JR9A 3O1HA 4X62T 2UXBT 4TWHA 4X20E 4AQGA 2WDQA 3VKGA 4K0KT 3N5LA 5AFUL 3LK3B 3RKGA 2AE9A 5AQUB 2BG9E 3ZMVB 5LA6E 2FUPA 3JAFA 2JMKA 3N9QA 1E7PA 5ADXL 2Q9QA 2BKOA 5LB7B 3NWIA 4C91A 4YHHT 3HKBE 4PJNA 3UTKA 2E5LT 2VKDA 3UU5A 2V5CA 5L3CB 3QUJA 3N9NA 4PJLA 3H3MA 4HKAA 5EZYE 5FKYA 4DO0A 5C2TA 5JRCA 2E9XD 4ERRA 4TNVA 2CLYB 4P1NA 2C5IT 2WZIA 2YK0A 2XAFB 5JDFA 3RRCA 3OYZA 3LK2B 2L3LA 2EHOD 1HNXT 3E08A 1YQ3A 2WB5A 2XQYA 4DV6T 3K1SA 3CMLA 3AE2A 1E1HB 3AECA 4TNWA 4YSZA 5AQFB 3FHNA 3LSVA 4WBNE 5LGUB 2BG9C 3OKQA 2WU5A 4I4TE 2UXDT 3L39A 5LNKA 2F4VT 2D9DA 2X0HA 5LHIB 2PTFA 5HEHA 3RYIE 4CI1B 4QH5A 2W67A 4CN4A 4BA9A 4LMKA 3K3QC 3FZHB 3PUVF 2XQ6A 2BS4A 2MYSA 4PNIA 3AVSA 2KWIB 2BS3A 3IF8B 3MJXA 4WYVA 3KFWX 1O3XA 3E0ZA 3EI0A 1M7KA 2V7KA 2V5DA 3MXZA 4CZZB 1XDPA 3QB5A 3AA6B 2K3WA 4AKRB 2JPFA 3KV5A 2VQET 2JQ9A 5LBQB 2YU1A 4JI6T 3ZYMA 5L2LA 5HEOA 5L3FB 4IIJE 4NIQA 3O9XA 5BR8T 2CCQA 3AXJB 1HFAA 3KVAA 4ZI2D 2X68A 4UVCB 5LCYA 2OV9A 4H63H 1D0XA 2FJDA 4O4IE 3Q5EA 1D0ZA 3QNUA 3MA9A 1LVFA 3N2GE 2KMFA 2J1DG 4JI3T 4BJMA 3CQGB 3OJAA 5ABFB 2XQ5A 1T7SA 4PFPA 2DI4A 3TLUA 2BVMA 4UV8B 5C3JA 1KNRA 3B5MA 3KV4A 3LG7A 2WBLA 2UUBT 5C8YE 5AQOB 1IBMT 3RQUA 4FI5A 1FIOA 4N78D 4LMLA 3A5XA 3PU8A 1X79A 3RIUA 4HTEA 3FZKB 3MACA 2KZ7B 5KDMC 4FJOA 1MNEA 2MOZA 5HXHA 1MIVA 3WAJA 3QC9A 3UU4A 1JNZA 3FBLA 3HR0A 1VCSA 2BVLA 2YDQA 5HEGA 4ZS2A 1WLXA 1S35A 1D1AA 1MNDA 3UQ4A 5ETWA 2FJBA 3R84B 3ZJ2A 2A2FX 2FJAA 5F8PA 2X67A 1OWAA 5TAOA 4HE8A 1NAFA 2V7MA 2LKHA 2A9UA 2W00A 4COFA 2Q9QC 1WFDA 5AQMB 4GYSA 2XY8B 3UUMA 1ZV4X 4C90A 3ANWB 4DR1T 2X9YA 5JDNA 2CWOA 2WDVA 2E9XB 2X9HA 2WS3A 1SA0E 5LGTB 1NWMX 1W9RA 3MKDA 4HWCA 3K8PC 1UX4A 4IE7A 1YKEB 2LOSA 2LOPA 1HX8A 3AA0B 3AEEA 2VURA 3CIRA 4OK0A 1IJ5A 2CPTA 3QOFA 3RC8A 3PU3A 2LKGA 4UELA 3Q5WA 4WW0A 3GN5B 1BR0A 1IBLT 2VKOA 2N9DA 4WBOA 1YXRA 5J2UE 4ZEYA 2VK9A 3NZQA 1QSDA 2BBJA 5IYZE 5LGNB 4IDOA 2V6YB 3T1HT 2JQKA 4YJ3E 3N9PA 3QK6A 2MTQA 5HXCA 2XPKA 4QH1A 2EHOC 2C5JA 3DTOA 3TKLB 4M1PA 4UIGA 1T8BA 5FNVE 1G73A 3OBVE 2SPCA 5HWXA 2LLYA 3C4ZA 5IWAT 2UUCT 2Z6EA 2J62A 4IREA 2W0GA 3SWHA 5M4YA 1D1BA 1T72A 4HFVA 3KINB 4J2CA 4DV4T 3BQIA 3AEFA 2BZBA 3CQCB 5LJMA 2ZLYA 4YSXA 2Y8DA 4DBQA 2V8SV 4U7YA 5HXSA 3PTRB 4JI2T 3I9YA 2PG8A 1UX5A 5JVDE 1HG2A 5HXRA 4UEMA 2G0UA 2CE7A 3NRYA 4WNKA 2XASB 3RC3A 2XQ4A 2CEAA 2UU9T 2XQAA 2V7JA 5JQGE 2ZM2A 3OPCA 1D0YA 4IDQA 2I6HA 2L8KA 2LT3A 1XNRT 4DV7T 1KK7A 1XNQT 4H9QC 1WR0A 3RLFF 4LF7T 4MALA 4AQFC 3GMIA 1XWMA 5ABEA 1ZP0A 5IHYA 4LFCT 1NENA 3KBTA 1VOMA 2LRKA 3L8RA 4MFRA 4ZHQE 5L3DB 4I0UA 4I43B 3VHLA 2YINA 4HFIA 5LXTE 2W2UA 4DV5T 3X1DA 4IE4A 4A97A 2X0YA 2K5BB 4IE0A 5CA1E 3CPZA 4PAGA 3AEDA 1B7TA 1WYBA 1WCRA 4CQIA 2XJ7A 5FVKA 5DQWA 1QLBA 2JRKA 3FXDB 5FL1A 2DWGA 2E8IA 1IZNB 4DNDA 4ZI7E 5ABFA 2YN6A 4ILUA 3HKEE 4NPPA 2IDOB 3ZCJA 5CJ5A 1R8IA 2HN2A 4B3MT 5AQIB 1HNZT 2J47A 2ACXA 1J5WA 4KHPT 5LP6E 2DLRA 4MLKA 3RQWA 2W61A 3FXEB 2XAHB 3RIFA 5LYJE 2BBHA 3KDSE 1HS7A 4PK4A 4H63V 3LJCA 2ODVA 2LSKA 1US7B 4GK0E 3L09A 5J1GA 1N32T 2XAQB 2CBIA 3ESLA 4IT4A 5AQLB 4E7SA 4ZI3D 4PJJA 2HHHT 5KX5E 4EIWA 4X1YE 2HN1A 5L3BB 2H7VC 3OTOT 2JQHA 2WWVA 1WR6A 4EB6E 3C64A 3AAEB 4EYYR 4QHOA 1X9BA 3I9WA 3KV6A 3JADA 4GOUA 3ZSTA 4EYUA 2B76A 1Z8UA 4U72A 1MMAA 3LBXB 2NTYA 4Q25A 3AA1B 3ANWA 5EK2A 2YOEA 2IC6A 1I6ZA 4DR4T 2D0TA 2VASA 2LSGA 3Q9DA 3ZC1A 4IDNA 3A8YC 2NW9A 2CLYC 1JNRA 3ZLIA 2FBWA 3ZN1B 2LSYA 3S4UA 3CWZB 2EHOA 5HEJA 1YQ4A 1EZ3A 2V26A 3PJAJ 2K24A 2UXXB 3VRBA 5LHHB 3JCFA 2XM1A 2IUBA 2RA1A 4IHJE 4DR3T 3NRXA 1SUMB 2XAGB 4H9NC 5FY1A 2BKPA 1DU2A 3PUAA 3PJAA 4G63A 4O2BE 4A98A 4LFBT 2WP9A 3SFDA 3RRWA 2I59A 4ISSA 2WZHA 2V6YA 3JC6C 2QGSA 1UURA 3RH3A 5H6RB 1OEDB 4TZ4C 2QRXA 1S94A 1HCIA 4JLEA 4A5XA 1LRZA 2LJLA 2IIUA 2LEHA 5JREA 5AQTB 1N36T 4DVDA 3AA7B 4Z8XA 1BR4A 3AE5A 5J2TE 4U33A 1Z0PA 4UF0B 4AISA 3AE3A 2XQ3A 3ZMUB 3NVOA 4AQFA 1HF8A 2NW7A 2W66A 2K9AA 2L9QA 5FY0A 4DR2T 3K3OA 2PJQA 4HWIB 5JR9B 4YSYA 2H7OA 2JIWA 1N33T 3PURA 4H9OC 3O4XE 4HWDA 3EABA 5HAXA 3PUWF 3K3NA 1XMQT 5JDGA 4EGWA 3HKCE 1ZEEA 3OYXA 2C0SA 3EHZA 2LHNA 4O2AE 5JTGA 3O1JA 4YJ2E 3IA3A 2H88A 3RYFE 2X66A 1HX1B 3DJBA 1FMWA 3I0OA 2XAJB 3FZLB 2RP4A 5A1LA 2WU2A 3RPUA 3P7IA 5L3GB 2KXPB 5JRCB 4YTPA 5FYMA 2WDRA 4X66T 1V9DA 4K0UA 2M6IA 4CXXA 3MZKB 4LMJA 3ZT6A 5AQVB 4Z90A 4ZZCA 3VR9A 3RGLA 4H9SE 4XBFB 2CMRA 3H37A 3UUXB 5LMNT 2VVNA 4JI0T 1FJGT 5KMGP 4O4JE 2NR4A 1J1JA 2CWYA 5FMNA 3RIAA 3V5UA 4TWDA 2DNXA 3CK6A 2CA5A 4Z91A 5HXEA 4CN6A 1YD8G 1KFYA 4QXHB 2CBJA 4B3ST 5FXVA 3PUZF 4U3CA 2V7IA 2X0LB 2UXNB 5ABHA 3FBZA 1YW0A 3UFEA 4ILAA 3CX7B 4P09A 3CVRA 3F31A 2E9XC 3V5SA 4IE6A 4ZI3C 5L4EA 2D5UA 3P4SA 5L47A 1WYCA 4MBQA 1QUUA 2DCFA 2Y48B 3AB3B 3UULA 3AE8A 1AJ3A 4DV2T 2PBIA 4OFZA 4AIUA 3KV9A 4EV6A 4TV8E 2BS2A 4G2AA 3GWHA 3D0TA 4X5TA 3RF1A 2JMHA 2CXLA 4HFDA 1KEYA 3ABVA 3ETUA 3C4XA 4EAHA 4CI2B 3B13A 4JI5T 3ZT5A 2MAWA 3ZMSB 4DBRA 2WCAA 1XDOA 3ETVA 4LF4T 2XSBA 4WZXA 4CXYA 3EDVA 4U31A 2VWAA 2IW5B 3UU3A 5FP3A 5LG3A 2V7LA 2A72A 5CFBA 5LMUT 4DV3T 4L0RA 4HGAA 5J0ZA 2LSIA 4JYAT 3DP7A 3I0QA 2ES0A 2X9XA 5HWYA 4PK5A 2LHRA 2E2AA 2X9WA 1UK5A 4AKHA 3UU8A 4ILBA 5DABA 1UGOA 2C5KT 1CUNA 3SS1A 2QA7A 3WAKA 4EZHA 4PK6A 3PV0F 3PUYF 4JI8T 2VKJA 4U2YA 4UV9B 2NP9A 5HCMA 2FJEA 3AE4A 2WSSV 4GIWA 2KLQA 4H9RC 5JH7E 2WMNA 2X51A 3BQKA 5JDHA 4KUMB 5AQSB 4ZI2C 3ZN0B 1SE7A 2ZMAA 4CI3B 5FXZA 4ZOLE 2VB6A 3AXJA 4QKNA 2MBGA 3MK7C 5AQHB 5JDQA 1WRDA 4EOZB 2W4XA 5AQGB 3UFGA 2MPKA 2Q9QD 1T98A 4TV9E 3RI5A 4BJNA 5F5WA 3WI3A 2M67A 3T8OA 4XZCA 4HFCA 5BMVE 4PJMA 4JI7T 5EK4A 1L0VA 4CN1A 3UUBA 4IL9A 4ISTA 4DUYT 4KBMB 3LFMA 3IEEA 4EZ4A 2XM2A 3BQLA 2V1DB 4QXCB 2N2NA 2KINB 5FXWA 4U74A 2BKNA 1MMNA 4XAXB 4YHJA 4HN9A 3CQXC 3RHWA 3ZJ1A 3VU7H 1KF6A 3AEAA 4JEUB 3AAAB 1Y01A 2IC9A 4B6XA 1KNPA 3BK9A 1NEKA 3P8CD 1GQEA 4ZXLA 5FL0A 5DJQC 4LF5T 3EUHA 3SRZA
chains in the Genus database with same CATH topology
1HX8A 2KNDA 4BAYB 3AA0B 5J2TE 3Q5XA 2XUEA 4TUYE 4ADZA 3ZMZB 3IBPA 4OK0A 2IAKA 2N1GA 1IJ5A 1Z0PA 1HTJF 3RC8A 4UF0B 3PU3A 4UELA 4UVAB 3C98B 3Q5WA 4UVBB 4WW0A 3ZMUB 3CX6B 3AAIA 3GN5B 2XTLA 4AQFA 1BR0A 5E0OA 1HF8A 4TX5A 3C4WA 2NW7A 3ZYLA 3O1IA 2K9AA 2L9QA 4YLHA 4DMWA 3ZEFB 2VKOA 2N9DA 4WBOA 5FY0A 3RKOA 2VKHA 3K3OA 2PJQA 5J2UE 2VK9A 2YEVC 2W62A 3NZQA 5GONE 3ONXA 1QSDA 5JR9B 3U3IA 5HYAA 5IYZE 5LGNB 2E9XA 2H7OA 3PURA 1G8XA 4H9OC 3O4XE 3VKHA 5HAXA 3KVBA 3K3NA 5JDGA 3HKCE 1ZEEA 3N9PA 3OYXA 2C0SA 4YJ3E 1YKHB 5JDLA 3ZC0A 3QK6A 4YFSA 5L3EB 2MTQA 2LHNA 1FMVA 4ZS3A 4O2AE 2WMOA 4IE5A 5HXCA 5LOVE 4DMVA 3O1JA 5LG4A 2LM9A 4YJ2E 3PUSA 2EHOC 2KWHA 2C5JA 3DTOA 2OA5A 1Y64B 3TKLB 4UF0A 4M1PA 1OXZA 4UIGA 3N9MA 3PUQA 3RYFE 4AI6A 2X66A 3HA4A 2DHRA 2NWBA 5FNVE 3GN5A 3DJBA 1FMWA 3I0OA 4O8SA 2XAJB 1MIYA 1G73A 2P9BA 2RP4A 3OBVE 5A1LA 2SPCA 3EDUA 5HWXA 4GK5E 5FY7A 3C4ZA 3RPUA 4A56A 3P7IA 2Z6EA 4QWNB 2KXPB 5L3GB 2GK9A 5JRCB 2W0GA 2WWUA 1FEWA 3NZPA 4E7ZA 3J7Yq 4O4HE 2Y6XA 2CM0A 3SWHA 5M4YA 5JR9A 5FYMA 1D1BA 4OYJA 4HFVA 2HPLA 4F6RC 3O1HA 3KINB 4J2CA 3HI2A 4O4LE 3BQIA 3AVRA 1V9DA 4K0UA 4X20E 4AQGA 3MZKB 4CXXA 3VKGA 3EUHA 3N5LA 3CQCB 2BZBA 3SRZA 5AFUL 3LK3B 5LJMA 2ZLYA 3GA8A 2YU2A 2Y8DA 4DBQA 3LK42 3ZMVB 5LA6E 2JMKA 3N9QA 5ADXL 4H9SE 2Q9QA 4XBFB 5HXSA 3PTRB 2CMRA 3H37A 3I9YA 3UUXB 4C91A 3HKBE 2PG8A 4PJNA 5CB4E 3UTKA 1UX5A 4P0AA 3Q2MA 5KMGP 5JVDE 2VKDA 5FXXA 1HG2A 2NOXA 4O4JE 4UEMA 5HXRA 3R6NA 2CXDA 5L3CB 2G0UA 2CWYA 5FMNA 2CE7A 3NRYA 3QUJA 4KMCA 1U4QA 3N9NA 2ZM0A 3E22E 4IGUA 4PJLA 2XASB 4WNKA 4HKAA 3H3AA 3RC3A 5EZYE 1MMGA 3V5UA 4DO0A 2CEAA 2DNXA 4NUUA 2CA5A 2V7JA 5HXEA 2E9XD 5CA0E 4ERRA 5JRCA 5JQGE 2ZM2A 1D0YA 1YD8G 2CLYB 2C5IT 2L8KA 2LT3A 2YK0A 4QXHB 2XAFB 4QX7B 1KK7A 1KNZA 2HPJA 2W63A 4H9QC 5FXVA 2CXFA 5JDFA 3RRCA 4MALA 3OYZA 4AQFC 3LK2B 2L3LA 3GMIA 5IHYA 2EHOD 4OHFA 2V7IA 3E08A 2X0LB 2UXNB 4MHCA 3KBTA 2XQYA 3FBZA 1YW0A 1VOMA 4MFRA 3UFEA 4ZHQE 2LE8A 3CMLA 5L3DB 3CX7B 4P09A 4QX8B 4I43B 3VHLA 2YINA 1E1HB 3CVRA 3F31A 2E9XC 3V5SA 4IE6A 4ZI3C 4AKLA 5LXTE 2D5UA 3FHNA 1WYCA 3F57A 1QUUA 2DCFA 4IE4A 4MBQA 2Y48B 2JQQA 3AB3B 4KP3C 3UULA 2H3RA 1AJ3A 2PBIA 4WBNE 5LGUB 4OFZA 2K5BB 3KV9A 4IE0A 4TV8E 3OKQA 4I4TE 4G2AA 1IJ6A 2PFVA 3GWHA 5CA1E 4AXPA 3CPZA 2Q9QB 3D0TA 4PAGA 1IAPA 1H7CA 2CXLA 2JMHA 1B7TA 2NW8A 1U5PA 1WYBA 2XHEB 5LNKA 4CQIA 5LHIB 2HH7A 3ETUA 3C4XA 4EAHA 1VRBA 5DQWA 3B13A 1D1CA 4CI2B 2JRKA 3UUNA 3ZMSB 3FXDB 3RYIE 4CI1B 4DBRA 4L9IA 3ZYKA 2DWGA 2E8IA 5LJNA 1IZNB 4BA9A 4DNDA 3ETVA 4ZI7E 5JR9C 3K3QC 4ILUA 3HKEE 4CXYA 3EDVA 3J9X1 3ZCJA 2KT9A 2MYSA 2VWAA 5EK3A 4PNIA 3F2EA 3AVSA 2IW5B 2KWIB 4X1IE 5FP3A 5JDMA 4AKIA 2V7LA 2A72A 3IF8B 3MJXA 2ACXA 4L0RA 3KFWX 1O3XA 5LP6E 4HGAA 3E0ZA 3B57A 2LSIA 5H6QB 3DP7A 2DLRA 2V7KA 3MXZA 3I0QA 2ES0A 2X9XA 4MLKA 5HWYA 4CZZB 1ZHCA 4PK5A 2LHRA 4CXWA 2W61A 2X9WA 3FXEB 4AKHA 2XAHB 5LYJE 3KDSE 1HS7A 4PK4A 4H63V 3LJCA 2ODVA 2LSKA 1US7B 4GK0E 5DABA 3L09A 3AA6B 2C5KT 2JJ9A 1BR1A 5J1GA 4AKRB 1CUNA 2JPFA 2XAQB 3KBUA 3KV5A 3ESLA 3SS1A 2QA7A 3SOLA 4E7SA 4ZI3D 4PJJA 5LBQB 2YU1A 3ZYMA 3WAKA 5L2LA 5L3FB 4IIJE 4EZHA 5KX5E 4EIWA 4PK6A 3O9XA 4X1YE 2CCQA 2ODUA 4JEHB 1HFAA 3KVAA 4ZI2D 2X68A 2VKJA 4UVCB 5LCYA 4UV9B 4TN7B 4H63H 1D0XA 2NP9A 3L3PA 5L3BB 4O4IE 1D0ZA 3MA9A 1LVFA 2NTXA 3N2GE 2KMFA 2J1DG 2EHOB 1LVKA 2H7VC 1MIWA 1LKXA 3EVYA 3RX6A 1WR6A 4V1Av 4EB6E 2D2SA 4X1KE 2WSSV 3I1AA 4BJMA 3C64A 3C50A 4P0BA 3AAEB 3CQGB 4GIWA 3OJAA 4EYYR 3CX8B 4QHOA 2KLQA 4H9RC 4GYRA 4PFPA 2DI4A 3I9WA 3KV6A 1HG5A 4GOUA 4L5GA 1BR2A 1UCUA 2BVMA 4IDZA 5JH7E 2WMNA 4UV8B 2X51A 4EYUA 3BQKA 4AKGA 5JDHA 4U72A 1MMAA 4QXBB 1SHZC 3LBXB 5DQVA 1ZKEA 2NTYA 4KUMB 3KV4A 2K48A 3LG7A 3W15B 4ZI2C 3RYCE 3AA1B 2WBLA 3ANWA 3N2KE 5EK2A 2VL8A 5C8YE 2IC6A 3ZN0B 2D0TA 2WM9A 4EXTA 4FI5A 1FIOA 2ZMAA 4PFOA 2VASA 4CI3B 4N78D 1MMDA 2LSGA 3Q9DA 3ZC1A 3HL6A 5FXZA 2NW9A 2BDEA 3A5XA 2CLYC 3C51A 3PE0A 3PU8A 4ZOLE 4ASKA 1X79A 3ZLIA 2A3DA 4HTEA 2VB6A 4OYKA 4QKNA 3ZN1B 2LSYA 3MACA 2MBGA 2KZ7B 5KDMC 4FJOA 1MNEA 3ZPOA 2MOZA 5HXHA 1MIVA 4PW8A 3MK7C 3QC9A 3WAJA 5JDQA 1WRDA 3S4UA 3FBLA 3CWZB 3HR0A 2EHOA 3ZMTB 4EOZB 3JC6D 2BVLA 2Q9QD 1T98A 1EZ3A 4TV9E 4BJNA 2V26A 1WLXA 4ZS2A 3WI3A 2K24A 1S35A 2UXXB 2M67A 1D1AA 2B1EA 4XZCA 3T8OA 5BMVE 1MNDA 3IHRA 5LBMA 5LHHB 5ETWA 4PJMA 3HKDE 2D0UA 2RA1A 4IHJE 3NRXA 2XAGB 4H9NC 5FY1A 5EK4A 3R84B 3ZJ2A 3LBXA 3PUAA 2A2FX 4G63A 4ISTA 3FB2A 4JUYA 5F8PA 5LHGB 4O2BE 2X67A 3RYHE 1OWAA 4KBMB 5TAOA 3LFMA 2DWKA 3IEEA 4HE8A 1NAFA 2V7MA 2I59A 3RRWA 4EZ4A 4ISSA 2ZM8A 3N2OA 3JC6C 2W00A 3BQLA 2V1DB 4H9PC 4QXCB 2N2NA 2KINB 3U78A 2QGSA 2Q9QC 5FXWA 4U74A 4HEAA 5F3JA 1MMNA 4I50E 4GYSA 3RH3A 4UXNB 4XAXB 4ANJA 3NBXX 4YHJA 4HN9A 5H6RB 3PDYA 3CQXC 4I55E 3UUMA 4TZ4C 1ZV4X 3ZJ1A 3N9LA 4C90A 3VU7H 3ZCIA 3ANWB 2X9YA 1S94A 1HCIA 4JEUB 4NUVA 3UT5E 3AAAB 5JDNA 4JLEA 2CWOA 2E9XB 2IC9A 2X9HA 4B6XA 3BK9A 1SA0E 1LRZA 3PUGA 2LJLA 3N9OA 5LGTB 2LEHA 3P8CD 5JREA 1NWMX 3MKDA 3K8PC 1UX4A 3M65A 4IE7A 1YKEB 2LSJA 3CKDA 5DJQC 2LOSA 4DVDA 2LOPA 3AA7B 4Z8XA 1BR4A 2WAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0Z A; 
#chains in the Genus database with same CATH topology
 2BG9 B;  2KND A;  4BAY B;  3TLT A;  3P4R A;  3JAE A;  4TUY E;  3ZMZ B;  4EED A;  2IAK A;  3M3Z B;  4UVA B;  3AE9 A;  2AXD S;  3CX6 B;  4X65 T;  5E0O A;  3FZM B;  4TX5 A;  3O1I A;  4DMW A;  2YDR A;  2UUA T;  3ZEF B;  3SFE A;  3RKO A;  3OVU A;  2YEV C;  4JI4 T;  2CHN A;  4DR6 T;  2E9X A;  1G8X A;  3QB5 K;  3KVB A;  2UXC T;  4HFB A;  5JDL A;  2WY2 A;  1YKH B;  3ZC0 A;  4YFS A;  1M62 A;  4IDP A;  5ABG A;  4LF9 T;  1FMV A;  4ZS3 A;  1ZOY A;  4OX9 T;  1J5E T;  3PUS A;  2KWH A;  1OXZ A;  3HA4 A;  2DHR A;  3AEB A;  1IBK T;  2NWB A;  3GN5 A;  2RPA A;  4O8S A;  4DID B;  3EDU A;  5FY7 A;  4QWN B;  2QYW A;  1OED E;  2WWU A;  4OYJ A;  4LF8 T;  2HPL A;  4F6R C;  3HI2 A;  2ACZ A;  4O4L E;  3TLS A;  3AVR A;  2LM2 A;  2OLT A;  4YTM A;  3TLW A;  5AQP B;  2KSR A;  3GA8 A;  2YU2 A;  3LK4 2;  3P50 A;  2E5V A;  4QH4 A;  3AE1 A;  4GKJ T;  1W0B A;  5CB4 E;  1UUS A;  4P0A A;  4ZZB A;  3Q2M A;  5FXX A;  2NOX A;  3R6N A;  2CXD A;  1E2A A;  4KMC A;  4B3T T;  1U4Q A;  2ZM0 A;  3E22 E;  4IGU A;  3H3A A;  1MMG A;  1N34 T;  4NUU A;  5CA0 E;  5HEU A;  4GKK T;  1XMO T;  4QX7 B;  2DL1 A;  1KNZ A;  1VCT A;  2HPJ A;  2W63 A;  2CXF A;  2M6B A;  1I94 T;  4JV5 T;  5L4H A;  2J4G A;  5AQN B;  4OHF A;  4MHC A;  1OED C;  5FVL A;  4HFH A;  4DR7 T;  2LE8 A;  4QX8 B;  3P4W A;  3ONJ A;  3FZF B;  2LRL A;  3P4P A;  4AKL A;  5IUX A;  3F57 A;  3P4Q A;  2JQQ A;  4KP3 C;  4YY3 T;  2H3R A;  4EEB A;  3UQ7 A;  1IJ6 A;  2PFV A;  4AXP A;  2Q9Q B;  1IAP A;  1H7C A;  2NW8 A;  1U5P A;  2XHE B;  3ONL C;  4IL4 A;  4U7I A;  2HH7 A;  4F8H A;  2WAU A;  1VRB A;  1D1C A;  4U2Z A;  3UUN A;  4L9I A;  3ZYK A;  4KHZ F;  1HR0 T;  5LJN A;  4LFA T;  2VL0 A;  5JR9 C;  3J9X 1;  2KT9 A;  5EK3 A;  3F2E A;  4X1I E;  5JDM A;  4AKI A;  4HWF A;  3B57 A;  5H6Q B;  1ZHC A;  4CXW A;  4UR9 A;  2XSA A;  2QVA A;  2JJ9 A;  1BR1 A;  2VQF T;  3KBU A;  4LF6 T;  3SOL A;  2CRB A;  1XZY A;  2ODU A;  4JEH B;  4DUZ T;  4TN7 B;  3L3P A;  3VR8 A;  2NTX A;  2EHO B;  3A7M A;  1LVK A;  1MIW A;  1LKX A;  3EVY A;  3RX6 A;  2H89 A;  3EAM A;  4V1A v;  2D2S A;  4X1K E;  3I1A A;  4YXD A;  2XQ7 A;  4DV1 T;  3C50 A;  4P0B A;  3CX8 B;  4GYR A;  1HG5 A;  4L5G A;  1BR2 A;  1UCU A;  4IDZ A;  4AKG A;  4QXB B;  1SHZ C;  5DQV A;  3AE7 A;  1W0A A;  1ZKE A;  2K48 A;  3W15 B;  3LDQ B;  3RYC E;  3N2K E;  2VL8 A;  5HCJ A;  4HFE A;  4ILC A;  2WM9 A;  4EXT A;  3G06 A;  3VRA A;  4PFO A;  3TLV A;  1MMD A;  3HL6 A;  2BDE A;  3C51 A;  3PE0 A;  4ASK A;  2A3D A;  4OYK A;  2I0M A;  5AQJ B;  3ZPO A;  4PW8 A;  4TWF A;  2BG9 A;  3ZMT B;  4NXM T;  5AQK B;  3JC6 D;  3PUX F;  4X64 T;  3AEG A;  2B1E A;  3IHR A;  5LBM A;  3T1Y T;  3HKD E;  2D0U A;  5CGM A;  3LBX A;  3ZKR A;  3FB2 A;  4JUY A;  5LHG B;  3RYH E;  4HWH A;  2DWK A;  4KX6 A;  4DR5 T;  2ZM8 A;  3N2O A;  4H9P C;  3U78 A;  3ZT7 A;  4HEA A;  1W09 A;  5F3J A;  4I50 E;  4UXN B;  4ANJ A;  3NBX X;  3PDY A;  4I55 E;  3N9L A;  3ZCI A;  3UT5 E;  4NUV A;  2YDS A;  4JI1 T;  2IHR 1;  3AE6 A;  2CHO A;  3PUG A;  3N9O A;  5AQR B;  2VVS A;  3M65 A;  2LSJ A;  3CKD A;  1HTJ F;  1CHU A;  2V6X A;  2XQ9 A;  3Q5X A;  2ZM6 T;  3Q5D A;  2XUE A;  4ADZ A;  2XZE A;  3IBP A;  4DV0 T;  2N1G A;  1HNW T;  3C98 B;  4UVB B;  3AAI A;  2XTL A;  3ZSS A;  3UU6 A;  3C4W A;  3ZYL A;  2IML A;  4YLH A;  2VKH A;  1OED A;  2W62 A;  5GON E;  3ONX A;  4YTN A;  3U3I A;  4YT0 A;  5HYA A;  4B3R T;  4AQY T;  3VKH A;  3RIU C;  5AQQ B;  5L3E B;  2WMO A;  3NKZ A;  4IE5 A;  5LOV E;  4DMV A;  4JBW F;  5KXJ A;  2LM9 A;  5LG4 A;  2OA5 A;  1Y64 B;  4UF0 A;  3N9M A;  3PUQ A;  4AI6 A;  2WQY A;  2R6G F;  2YKS A;  4NXN T;  1MIY A;  2P9B A;  4GK5 E;  4A56 A;  4KI0 F;  2GK9 A;  2XQ8 A;  4E7Z A;  1FEW A;  3NZP A;  3J7Y q;  4O4H E;  2Y6X A;  2CM0 A;  5JR9 A;  3O1H A;  4X62 T;  2UXB T;  4TWH A;  4X20 E;  4AQG A;  2WDQ A;  3VKG A;  4K0K T;  3N5L A;  5AFU L;  3LK3 B;  3RKG A;  2AE9 A;  5AQU B;  2BG9 E;  3ZMV B;  5LA6 E;  2FUP A;  3JAF A;  2JMK A;  3N9Q A;  1E7P A;  5ADX L;  2Q9Q A;  2BKO A;  5LB7 B;  3NWI A;  4C91 A;  4YHH T;  3HKB E;  4PJN A;  3UTK A;  2E5L T;  2VKD A;  3UU5 A;  2V5C A;  5L3C B;  3QUJ A;  3N9N A;  4PJL A;  3H3M A;  4HKA A;  5EZY E;  5FKY A;  4DO0 A;  5C2T A;  5JRC A;  2E9X D;  4ERR A;  4TNV A;  2CLY B;  4P1N A;  2C5I T;  2WZI A;  2YK0 A;  2XAF B;  5JDF A;  3RRC A;  3OYZ A;  3LK2 B;  2L3L A;  2EHO D;  1HNX T;  3E08 A;  1YQ3 A;  2WB5 A;  2XQY A;  4DV6 T;  3K1S A;  3CML A;  3AE2 A;  1E1H B;  3AEC A;  4TNW A;  4YSZ A;  5AQF B;  3FHN A;  3LSV A;  4WBN E;  5LGU B;  2BG9 C;  3OKQ A;  2WU5 A;  4I4T E;  2UXD T;  3L39 A;  5LNK A;  2F4V T;  2D9D A;  2X0H A;  5LHI B;  2PTF A;  5HEH A;  3RYI E;  4CI1 B;  4QH5 A;  2W67 A;  4CN4 A;  4BA9 A;  4LMK A;  3K3Q C;  3FZH B;  3PUV F;  2XQ6 A;  2BS4 A;  2MYS A;  4PNI A;  3AVS A;  2KWI B;  2BS3 A;  3IF8 B;  3MJX A;  4WYV A;  3KFW X;  1O3X A;  3E0Z A;  3EI0 A;  1M7K A;  2V7K A;  2V5D A;  3MXZ A;  4CZZ B;  1XDP A;  3QB5 A;  3AA6 B;  2K3W A;  4AKR B;  2JPF A;  3KV5 A;  2VQE T;  2JQ9 A;  5LBQ B;  2YU1 A;  4JI6 T;  3ZYM A;  5L2L A;  5HEO A;  5L3F B;  4IIJ E;  4NIQ A;  3O9X A;  5BR8 T;  2CCQ A;  3AXJ B;  1HFA A;  3KVA A;  4ZI2 D;  2X68 A;  4UVC B;  5LCY A;  2OV9 A;  4H63 H;  1D0X A;  2FJD A;  4O4I E;  3Q5E A;  1D0Z A;  3QNU A;  3MA9 A;  1LVF A;  3N2G E;  2KMF A;  2J1D G;  4JI3 T;  4BJM A;  3CQG B;  3OJA A;  5ABF B;  2XQ5 A;  1T7S A;  4PFP A;  2DI4 A;  3TLU A;  2BVM A;  4UV8 B;  5C3J A;  1KNR A;  3B5M A;  3KV4 A;  3LG7 A;  2WBL A;  2UUB T;  5C8Y E;  5AQO B;  1IBM T;  3RQU A;  4FI5 A;  1FIO A;  4N78 D;  4LML A;  3A5X A;  3PU8 A;  1X79 A;  3RIU A;  4HTE A;  3FZK B;  3MAC A;  2KZ7 B;  5KDM C;  4FJO A;  1MNE A;  2MOZ A;  5HXH A;  1MIV A;  3WAJ A;  3QC9 A;  3UU4 A;  1JNZ A;  3FBL A;  3HR0 A;  1VCS A;  2BVL A;  2YDQ A;  5HEG A;  4ZS2 A;  1WLX A;  1S35 A;  1D1A A;  1MND A;  3UQ4 A;  5ETW A;  2FJB A;  3R84 B;  3ZJ2 A;  2A2F X;  2FJA A;  5F8P A;  2X67 A;  1OWA A;  5TAO A;  4HE8 A;  1NAF A;  2V7M A;  2LKH A;  2A9U A;  2W00 A;  4COF A;  2Q9Q C;  1WFD A;  5AQM B;  4GYS A;  2XY8 B;  3UUM A;  1ZV4 X;  4C90 A;  3ANW B;  4DR1 T;  2X9Y A;  5JDN A;  2CWO A;  2WDV A;  2E9X B;  2X9H A;  2WS3 A;  1SA0 E;  5LGT B;  1NWM X;  1W9R A;  3MKD A;  4HWC A;  3K8P C;  1UX4 A;  4IE7 A;  1YKE B;  2LOS A;  2LOP A;  1HX8 A;  3AA0 B;  3AEE A;  2VUR A;  3CIR A;  4OK0 A;  1IJ5 A;  2CPT A;  3QOF A;  3RC8 A;  3PU3 A;  2LKG A;  4UEL A;  3Q5W A;  4WW0 A;  3GN5 B;  1BR0 A;  1IBL T;  2VKO A;  2N9D A;  4WBO A;  1YXR A;  5J2U E;  4ZEY A;  2VK9 A;  3NZQ A;  1QSD A;  2BBJ A;  5IYZ E;  5LGN B;  4IDO A;  2V6Y B;  3T1H T;  2JQK A;  4YJ3 E;  3N9P A;  3QK6 A;  2MTQ A;  5HXC A;  2XPK A;  4QH1 A;  2EHO C;  2C5J A;  3DTO A;  3TKL B;  4M1P A;  4UIG A;  1T8B A;  5FNV E;  1G73 A;  3OBV E;  2SPC A;  5HWX A;  2LLY A;  3C4Z A;  5IWA T;  2UUC T;  2Z6E A;  2J62 A;  4IRE A;  2W0G A;  3SWH A;  5M4Y A;  1D1B A;  1T72 A;  4HFV A;  3KIN B;  4J2C A;  4DV4 T;  3BQI A;  3AEF A;  2BZB A;  3CQC B;  5LJM A;  2ZLY A;  4YSX A;  2Y8D A;  4DBQ A;  2V8S V;  4U7Y A;  5HXS A;  3PTR B;  4JI2 T;  3I9Y A;  2PG8 A;  1UX5 A;  5JVD E;  1HG2 A;  5HXR A;  4UEM A;  2G0U A;  2CE7 A;  3NRY A;  4WNK A;  2XAS B;  3RC3 A;  2XQ4 A;  2CEA A;  2UU9 T;  2XQA A;  2V7J A;  5JQG E;  2ZM2 A;  3OPC A;  1D0Y A;  4IDQ A;  2I6H A;  2L8K A;  2LT3 A;  1XNR T;  4DV7 T;  1KK7 A;  1XNQ T;  4H9Q C;  1WR0 A;  3RLF F;  4LF7 T;  4MAL A;  4AQF C;  3GMI A;  1XWM A;  5ABE A;  1ZP0 A;  5IHY A;  4LFC T;  1NEN A;  3KBT A;  1VOM A;  2LRK A;  3L8R A;  4MFR A;  4ZHQ E;  5L3D B;  4I0U A;  4I43 B;  3VHL A;  2YIN A;  4HFI A;  5LXT E;  2W2U A;  4DV5 T;  3X1D A;  4IE4 A;  4A97 A;  2X0Y A;  2K5B B;  4IE0 A;  5CA1 E;  3CPZ A;  4PAG A;  3AED A;  1B7T A;  1WYB A;  1WCR A;  4CQI A;  2XJ7 A;  5FVK A;  5DQW A;  1QLB A;  2JRK A;  3FXD B;  5FL1 A;  2DWG A;  2E8I A;  1IZN B;  4DND A;  4ZI7 E;  5ABF A;  2YN6 A;  4ILU A;  3HKE E;  4NPP A;  2IDO B;  3ZCJ A;  5CJ5 A;  1R8I A;  2HN2 A;  4B3M T;  5AQI B;  1HNZ T;  2J47 A;  2ACX A;  1J5W A;  4KHP T;  5LP6 E;  2DLR A;  4MLK A;  3RQW A;  2W61 A;  3FXE B;  2XAH B;  3RIF A;  5LYJ E;  2BBH A;  3KDS E;  1HS7 A;  4PK4 A;  4H63 V;  3LJC A;  2ODV A;  2LSK A;  1US7 B;  4GK0 E;  3L09 A;  5J1G A;  1N32 T;  2XAQ B;  2CBI A;  3ESL A;  4IT4 A;  5AQL B;  4E7S A;  4ZI3 D;  4PJJ A;  2HHH T;  5KX5 E;  4EIW A;  4X1Y E;  2HN1 A;  5L3B B;  2H7V C;  3OTO T;  2JQH A;  2WWV A;  1WR6 A;  4EB6 E;  3C64 A;  3AAE B;  4EYY R;  4QHO A;  1X9B A;  3I9W A;  3KV6 A;  3JAD A;  4GOU A;  3ZST A;  4EYU A;  2B76 A;  1Z8U A;  4U72 A;  1MMA A;  3LBX B;  2NTY A;  4Q25 A;  3AA1 B;  3ANW A;  5EK2 A;  2YOE A;  2IC6 A;  1I6Z A;  4DR4 T;  2D0T A;  2VAS A;  2LSG A;  3Q9D A;  3ZC1 A;  4IDN A;  3A8Y C;  2NW9 A;  2CLY C;  1JNR A;  3ZLI A;  2FBW A;  3ZN1 B;  2LSY A;  3S4U A;  3CWZ B;  2EHO A;  5HEJ A;  1YQ4 A;  1EZ3 A;  2V26 A;  3PJA J;  2K24 A;  2UXX B;  3VRB A;  5LHH B;  3JCF A;  2XM1 A;  2IUB A;  2RA1 A;  4IHJ E;  4DR3 T;  3NRX A;  1SUM B;  2XAG B;  4H9N C;  5FY1 A;  2BKP A;  1DU2 A;  3PUA A;  3PJA A;  4G63 A;  4O2B E;  4A98 A;  4LFB T;  2WP9 A;  3SFD A;  3RRW A;  2I59 A;  4ISS A;  2WZH A;  2V6Y A;  3JC6 C;  2QGS A;  1UUR A;  3RH3 A;  5H6R B;  1OED B;  4TZ4 C;  2QRX A;  1S94 A;  1HCI A;  4JLE A;  4A5X A;  1LRZ A;  2LJL A;  2IIU A;  2LEH A;  5JRE A;  5AQT B;  1N36 T;  4DVD A;  3AA7 B;  4Z8X A;  1BR4 A;  3AE5 A;  5J2T E;  4U33 A;  1Z0P A;  4UF0 B;  4AIS A;  3AE3 A;  2XQ3 A;  3ZMU B;  3NVO A;  4AQF A;  1HF8 A;  2NW7 A;  2W66 A;  2K9A A;  2L9Q A;  5FY0 A;  4DR2 T;  3K3O A;  2PJQ A;  4HWI B;  5JR9 B;  4YSY A;  2H7O A;  2JIW A;  1N33 T;  3PUR A;  4H9O C;  3O4X E;  4HWD A;  3EAB A;  5HAX A;  3PUW F;  3K3N A;  1XMQ T;  5JDG A;  4EGW A;  3HKC E;  1ZEE A;  3OYX A;  2C0S A;  3EHZ A;  2LHN A;  4O2A E;  5JTG A;  3O1J A;  4YJ2 E;  3IA3 A;  2H88 A;  3RYF E;  2X66 A;  1HX1 B;  3DJB A;  1FMW A;  3I0O A;  2XAJ B;  3FZL B;  2RP4 A;  5A1L A;  2WU2 A;  3RPU A;  3P7I A;  5L3G B;  2KXP B;  5JRC B;  4YTP A;  5FYM A;  2WDR A;  4X66 T;  1V9D A;  4K0U A;  2M6I A;  4CXX A;  3MZK B;  4LMJ A;  3ZT6 A;  5AQV B;  4Z90 A;  4ZZC A;  3VR9 A;  3RGL A;  4H9S E;  4XBF B;  2CMR A;  3H37 A;  3UUX B;  5LMN T;  2VVN A;  4JI0 T;  1FJG T;  5KMG P;  4O4J E;  2NR4 A;  1J1J A;  2CWY A;  5FMN A;  3RIA A;  3V5U A;  4TWD A;  2DNX A;  3CK6 A;  2CA5 A;  4Z91 A;  5HXE A;  4CN6 A;  1YD8 G;  1KFY A;  4QXH B;  2CBJ A;  4B3S T;  5FXV A;  3PUZ F;  4U3C A;  2V7I A;  2X0L B;  2UXN B;  5ABH A;  3FBZ A;  1YW0 A;  3UFE A;  4ILA A;  3CX7 B;  4P09 A;  3CVR A;  3F31 A;  2E9X C;  3V5S A;  4IE6 A;  4ZI3 C;  5L4E A;  2D5U A;  3P4S A;  5L47 A;  1WYC A;  4MBQ A;  1QUU A;  2DCF A;  2Y48 B;  3AB3 B;  3UUL A;  3AE8 A;  1AJ3 A;  4DV2 T;  2PBI A;  4OFZ A;  4AIU A;  3KV9 A;  4EV6 A;  4TV8 E;  2BS2 A;  4G2A A;  3GWH A;  3D0T A;  4X5T A;  3RF1 A;  2JMH A;  2CXL A;  4HFD A;  1KEY A;  3ABV A;  3ETU A;  3C4X A;  4EAH A;  4CI2 B;  3B13 A;  4JI5 T;  3ZT5 A;  2MAW A;  3ZMS B;  4DBR A;  2WCA A;  1XDO A;  3ETV A;  4LF4 T;  2XSB A;  4WZX A;  4CXY A;  3EDV A;  4U31 A;  2VWA A;  2IW5 B;  3UU3 A;  5FP3 A;  5LG3 A;  2V7L A;  2A72 A;  5CFB A;  5LMU T;  4DV3 T;  4L0R A;  4HGA A;  5J0Z A;  2LSI A;  4JYA T;  3DP7 A;  3I0Q A;  2ES0 A;  2X9X A;  5HWY A;  4PK5 A;  2LHR A;  2E2A A;  2X9W A;  1UK5 A;  4AKH A;  3UU8 A;  4ILB A;  5DAB A;  1UGO A;  2C5K T;  1CUN A;  3SS1 A;  2QA7 A;  3WAK A;  4EZH A;  4PK6 A;  3PV0 F;  3PUY F;  4JI8 T;  2VKJ A;  4U2Y A;  4UV9 B;  2NP9 A;  5HCM A;  2FJE A;  3AE4 A;  2WSS V;  4GIW A;  2KLQ A;  4H9R C;  5JH7 E;  2WMN A;  2X51 A;  3BQK A;  5JDH A;  4KUM B;  5AQS B;  4ZI2 C;  3ZN0 B;  1SE7 A;  2ZMA A;  4CI3 B;  5FXZ A;  4ZOL E;  2VB6 A;  3AXJ A;  4QKN A;  2MBG A;  3MK7 C;  5AQH B;  5JDQ A;  1WRD A;  4EOZ B;  2W4X A;  5AQG B;  3UFG A;  2MPK A;  2Q9Q D;  1T98 A;  4TV9 E;  3RI5 A;  4BJN A;  5F5W A;  3WI3 A;  2M67 A;  3T8O A;  4XZC A;  4HFC A;  5BMV E;  4PJM A;  4JI7 T;  5EK4 A;  1L0V A;  4CN1 A;  3UUB A;  4IL9 A;  4IST A;  4DUY T;  4KBM B;  3LFM A;  3IEE A;  4EZ4 A;  2XM2 A;  3BQL A;  2V1D B;  4QXC B;  2N2N A;  2KIN B;  5FXW A;  4U74 A;  2BKN A;  1MMN A;  4XAX B;  4YHJ A;  4HN9 A;  3CQX C;  3RHW A;  3ZJ1 A;  3VU7 H;  1KF6 A;  3AEA A;  4JEU B;  3AAA B;  1Y01 A;  2IC9 A;  4B6X A;  1KNP A;  3BK9 A;  1NEK A;  3P8C D;  1GQE A;  4ZXL A;  5FL0 A;  5DJQ C;  4LF5 T;  3EUH A;  3SRZ A; 
#chains in the Genus database with same CATH homology
 1HX8 A;  2KND A;  4BAY B;  3AA0 B;  5J2T E;  3Q5X A;  2XUE A;  4TUY E;  4ADZ A;  3ZMZ B;  3IBP A;  4OK0 A;  2IAK A;  2N1G A;  1IJ5 A;  1Z0P A;  1HTJ F;  3RC8 A;  4UF0 B;  3PU3 A;  4UEL A;  4UVA B;  3C98 B;  3Q5W A;  4UVB B;  4WW0 A;  3ZMU B;  3CX6 B;  3AAI A;  3GN5 B;  2XTL A;  4AQF A;  1BR0 A;  5E0O A;  1HF8 A;  4TX5 A;  3C4W A;  2NW7 A;  3ZYL A;  3O1I A;  2K9A A;  2L9Q A;  4YLH A;  4DMW A;  3ZEF B;  2VKO A;  2N9D A;  4WBO A;  5FY0 A;  3RKO A;  2VKH A;  3K3O A;  2PJQ A;  5J2U E;  2VK9 A;  2YEV C;  2W62 A;  3NZQ A;  5GON E;  3ONX A;  1QSD A;  5JR9 B;  3U3I A;  5HYA A;  5IYZ E;  5LGN B;  2E9X A;  2H7O A;  3PUR A;  1G8X A;  4H9O C;  3O4X E;  3VKH A;  5HAX A;  3KVB A;  3K3N A;  5JDG A;  3HKC E;  1ZEE A;  3N9P A;  3OYX A;  2C0S A;  4YJ3 E;  1YKH B;  5JDL A;  3ZC0 A;  3QK6 A;  4YFS A;  5L3E B;  2MTQ A;  2LHN A;  1FMV A;  4ZS3 A;  4O2A E;  2WMO A;  4IE5 A;  5HXC A;  5LOV E;  4DMV A;  3O1J A;  5LG4 A;  2LM9 A;  4YJ2 E;  3PUS A;  2EHO C;  2KWH A;  2C5J A;  3DTO A;  2OA5 A;  1Y64 B;  3TKL B;  4UF0 A;  4M1P A;  1OXZ A;  4UIG A;  3N9M A;  3PUQ A;  3RYF E;  4AI6 A;  2X66 A;  3HA4 A;  2DHR A;  2NWB A;  5FNV E;  3GN5 A;  3DJB A;  1FMW A;  3I0O A;  4O8S A;  2XAJ B;  1MIY A;  1G73 A;  2P9B A;  2RP4 A;  3OBV E;  5A1L A;  2SPC A;  3EDU A;  5HWX A;  4GK5 E;  5FY7 A;  3C4Z A;  3RPU A;  4A56 A;  3P7I A;  2Z6E A;  4QWN B;  2KXP B;  5L3G B;  2GK9 A;  5JRC B;  2W0G A;  2WWU A;  1FEW A;  3NZP A;  4E7Z A;  3J7Y q;  4O4H E;  2Y6X A;  2CM0 A;  3SWH A;  5M4Y A;  5JR9 A;  5FYM A;  1D1B A;  4OYJ A;  4HFV A;  2HPL A;  4F6R C;  3O1H A;  3KIN B;  4J2C A;  3HI2 A;  4O4L E;  3BQI A;  3AVR A;  1V9D A;  4K0U A;  4X20 E;  4AQG A;  3MZK B;  4CXX A;  3VKG A;  3EUH A;  3N5L A;  3CQC B;  2BZB A;  3SRZ A;  5AFU L;  3LK3 B;  5LJM A;  2ZLY A;  3GA8 A;  2YU2 A;  2Y8D A;  4DBQ A;  3LK4 2;  3ZMV B;  5LA6 E;  2JMK A;  3N9Q A;  5ADX L;  4H9S E;  2Q9Q A;  4XBF B;  5HXS A;  3PTR B;  2CMR A;  3H37 A;  3I9Y A;  3UUX B;  4C91 A;  3HKB E;  2PG8 A;  4PJN A;  5CB4 E;  3UTK A;  1UX5 A;  4P0A A;  3Q2M A;  5KMG P;  5JVD E;  2VKD A;  5FXX A;  1HG2 A;  2NOX A;  4O4J E;  4UEM A;  5HXR A;  3R6N A;  2CXD A;  5L3C B;  2G0U A;  2CWY A;  5FMN A;  2CE7 A;  3NRY A;  3QUJ A;  4KMC A;  1U4Q A;  3N9N A;  2ZM0 A;  3E22 E;  4IGU A;  4PJL A;  2XAS B;  4WNK A;  4HKA A;  3H3A A;  3RC3 A;  5EZY E;  1MMG A;  3V5U A;  4DO0 A;  2CEA A;  2DNX A;  4NUU A;  2CA5 A;  2V7J A;  5HXE A;  2E9X D;  5CA0 E;  4ERR A;  5JRC A;  5JQG E;  2ZM2 A;  1D0Y A;  1YD8 G;  2CLY B;  2C5I T;  2L8K A;  2LT3 A;  2YK0 A;  4QXH B;  2XAF B;  4QX7 B;  1KK7 A;  1KNZ A;  2HPJ A;  2W63 A;  4H9Q C;  5FXV A;  2CXF A;  5JDF A;  3RRC A;  4MAL A;  3OYZ A;  4AQF C;  3LK2 B;  2L3L A;  3GMI A;  5IHY A;  2EHO D;  4OHF A;  2V7I A;  3E08 A;  2X0L B;  2UXN B;  4MHC A;  3KBT A;  2XQY A;  3FBZ A;  1YW0 A;  1VOM A;  4MFR A;  3UFE A;  4ZHQ E;  2LE8 A;  3CML A;  5L3D B;  3CX7 B;  4P09 A;  4QX8 B;  4I43 B;  3VHL A;  2YIN A;  1E1H B;  3CVR A;  3F31 A;  2E9X C;  3V5S A;  4IE6 A;  4ZI3 C;  4AKL A;  5LXT E;  2D5U A;  3FHN A;  1WYC A;  3F57 A;  1QUU A;  2DCF A;  4IE4 A;  4MBQ A;  2Y48 B;  2JQQ A;  3AB3 B;  4KP3 C;  3UUL A;  2H3R A;  1AJ3 A;  2PBI A;  4WBN E;  5LGU B;  4OFZ A;  2K5B B;  3KV9 A;  4IE0 A;  4TV8 E;  3OKQ A;  4I4T E;  4G2A A;  1IJ6 A;  2PFV A;  3GWH A;  5CA1 E;  4AXP A;  3CPZ A;  2Q9Q B;  3D0T A;  4PAG A;  1IAP A;  1H7C A;  2CXL A;  2JMH A;  1B7T A;  2NW8 A;  1U5P A;  1WYB A;  2XHE B;  5LNK A;  4CQI A;  5LHI B;  2HH7 A;  3ETU A;  3C4X A;  4EAH A;  1VRB A;  5DQW A;  3B13 A;  1D1C A;  4CI2 B;  2JRK A;  3UUN A;  3ZMS B;  3FXD B;  3RYI E;  4CI1 B;  4DBR A;  4L9I A;  3ZYK A;  2DWG A;  2E8I A;  5LJN A;  1IZN B;  4BA9 A;  4DND A;  3ETV A;  4ZI7 E;  5JR9 C;  3K3Q C;  4ILU A;  3HKE E;  4CXY A;  3EDV A;  3J9X 1;  3ZCJ A;  2KT9 A;  2MYS A;  2VWA A;  5EK3 A;  4PNI A;  3F2E A;  3AVS A;  2IW5 B;  2KWI B;  4X1I E;  5FP3 A;  5JDM A;  4AKI A;  2V7L A;  2A72 A;  3IF8 B;  3MJX A;  2ACX A;  4L0R A;  3KFW X;  1O3X A;  5LP6 E;  4HGA A;  3E0Z A;  3B57 A;  2LSI A;  5H6Q B;  3DP7 A;  2DLR A;  2V7K A;  3MXZ A;  3I0Q A;  2ES0 A;  2X9X A;  4MLK A;  5HWY A;  4CZZ B;  1ZHC A;  4PK5 A;  2LHR A;  4CXW A;  2W61 A;  2X9W A;  3FXE B;  4AKH A;  2XAH B;  5LYJ E;  3KDS E;  1HS7 A;  4PK4 A;  4H63 V;  3LJC A;  2ODV A;  2LSK A;  1US7 B;  4GK0 E;  5DAB A;  3L09 A;  3AA6 B;  2C5K T;  2JJ9 A;  1BR1 A;  5J1G A;  4AKR B;  1CUN A;  2JPF A;  2XAQ B;  3KBU A;  3KV5 A;  3ESL A;  3SS1 A;  2QA7 A;  3SOL A;  4E7S A;  4ZI3 D;  4PJJ A;  5LBQ B;  2YU1 A;  3ZYM A;  3WAK A;  5L2L A;  5L3F B;  4IIJ E;  4EZH A;  5KX5 E;  4EIW A;  4PK6 A;  3O9X A;  4X1Y E;  2CCQ A;  2ODU A;  4JEH B;  1HFA A;  3KVA A;  4ZI2 D;  2X68 A;  2VKJ A;  4UVC B;  5LCY A;  4UV9 B;  4TN7 B;  4H63 H;  1D0X A;  2NP9 A;  3L3P A;  5L3B B;  4O4I E;  1D0Z A;  3MA9 A;  1LVF A;  2NTX A;  3N2G E;  2KMF A;  2J1D G;  2EHO B;  1LVK A;  2H7V C;  1MIW A;  1LKX A;  3EVY A;  3RX6 A;  1WR6 A;  4V1A v;  4EB6 E;  2D2S A;  4X1K E;  2WSS V;  3I1A A;  4BJM A;  3C64 A;  3C50 A;  4P0B A;  3AAE B;  3CQG B;  4GIW A;  3OJA A;  4EYY R;  3CX8 B;  4QHO A;  2KLQ A;  4H9R C;  4GYR A;  4PFP A;  2DI4 A;  3I9W A;  3KV6 A;  1HG5 A;  4GOU A;  4L5G A;  1BR2 A;  1UCU A;  2BVM A;  4IDZ A;  5JH7 E;  2WMN A;  4UV8 B;  2X51 A;  4EYU A;  3BQK A;  4AKG A;  5JDH A;  4U72 A;  1MMA A;  4QXB B;  1SHZ C;  3LBX B;  5DQV A;  1ZKE A;  2NTY A;  4KUM B;  3KV4 A;  2K48 A;  3LG7 A;  3W15 B;  4ZI2 C;  3RYC E;  3AA1 B;  2WBL A;  3ANW A;  3N2K E;  5EK2 A;  2VL8 A;  5C8Y E;  2IC6 A;  3ZN0 B;  2D0T A;  2WM9 A;  4EXT A;  4FI5 A;  1FIO A;  2ZMA A;  4PFO A;  2VAS A;  4CI3 B;  4N78 D;  1MMD A;  2LSG A;  3Q9D A;  3ZC1 A;  3HL6 A;  5FXZ A;  2NW9 A;  2BDE A;  3A5X A;  2CLY C;  3C51 A;  3PE0 A;  3PU8 A;  4ZOL E;  4ASK A;  1X79 A;  3ZLI A;  2A3D A;  4HTE A;  2VB6 A;  4OYK A;  4QKN A;  3ZN1 B;  2LSY A;  3MAC A;  2MBG A;  2KZ7 B;  5KDM C;  4FJO A;  1MNE A;  3ZPO A;  2MOZ A;  5HXH A;  1MIV A;  4PW8 A;  3MK7 C;  3QC9 A;  3WAJ A;  5JDQ A;  1WRD A;  3S4U A;  3FBL A;  3CWZ B;  3HR0 A;  2EHO A;  3ZMT B;  4EOZ B;  3JC6 D;  2BVL A;  2Q9Q D;  1T98 A;  1EZ3 A;  4TV9 E;  4BJN A;  2V26 A;  1WLX A;  4ZS2 A;  3WI3 A;  2K24 A;  1S35 A;  2UXX B;  2M67 A;  1D1A A;  2B1E A;  4XZC A;  3T8O A;  5BMV E;  1MND A;  3IHR A;  5LBM A;  5LHH B;  5ETW A;  4PJM A;  3HKD E;  2D0U A;  2RA1 A;  4IHJ E;  3NRX A;  2XAG B;  4H9N C;  5FY1 A;  5EK4 A;  3R84 B;  3ZJ2 A;  3LBX A;  3PUA A;  2A2F X;  4G63 A;  4IST A;  3FB2 A;  4JUY A;  5F8P A;  5LHG B;  4O2B E;  2X67 A;  3RYH E;  1OWA A;  4KBM B;  5TAO A;  3LFM A;  2DWK A;  3IEE A;  4HE8 A;  1NAF A;  2V7M A;  2I59 A;  3RRW A;  4EZ4 A;  4ISS A;  2ZM8 A;  3N2O A;  3JC6 C;  2W00 A;  3BQL A;  2V1D B;  4H9P C;  4QXC B;  2N2N A;  2KIN B;  3U78 A;  2QGS A;  2Q9Q C;  5FXW A;  4U74 A;  4HEA A;  5F3J A;  1MMN A;  4I50 E;  4GYS A;  3RH3 A;  4UXN B;  4XAX B;  4ANJ A;  3NBX X;  4YHJ A;  4HN9 A;  5H6R B;  3PDY A;  3CQX C;  4I55 E;  3UUM A;  4TZ4 C;  1ZV4 X;  3ZJ1 A;  3N9L A;  4C90 A;  3VU7 H;  3ZCI A;  3ANW B;  2X9Y A;  1S94 A;  1HCI A;  4JEU B;  4NUV A;  3UT5 E;  3AAA B;  5JDN A;  4JLE A;  2CWO A;  2E9X B;  2IC9 A;  2X9H A;  4B6X A;  3BK9 A;  1SA0 E;  1LRZ A;  3PUG A;  2LJL A;  3N9O A;  5LGT B;  2LEH A;  3P8C D;  5JRE A;  1NWM X;  3MKD A;  3K8P C;  1UX4 A;  3M65 A;  4IE7 A;  1YKE B;  2LSJ A;  3CKD A;  5DJQ C;  2LOS A;  4DVD A;  2LOP A;  3AA7 B;  4Z8X A;  1BR4 A;  2WAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...