3E0ZA

Crystal structure of a putative imidazole glycerol phosphate synthase homolog (eubrec_1070) from eubacterium rectale at 1.75 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
107
structure length
107
Chain Sequence
GMITSIARQSIILKCLRQKSVLVSNYELYYTAGLAKKCFGIAVDADMEPKQLLEELQKHIDKVSPADEQEKYLIHLLGNYEPDDTHDEQTVELFHMGETEEHIWQVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein of unknown function
publication title Crystal structure of protein of unknown function (RER070207001348) from Eubacterium rectale at 1.75 A resolution
rcsb
source organism Eubacterium rectale
molecule tags Unknown function
total genus 37
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3e0zA00
3E0ZA
chains in the Genus database with same CATH superfamily
3HKCE 1EZ3A 2HN2A 2VQFT 2UUCT 1BR4A 4UF0A 3FXEB 5FP3A 2JQ9A 3ZSSA 3V5SA 3M65A 5CA1E 4ILUA 1XMOT 4EOZB 2ODVA 1KF6A 2VKJA 5BR8T 3AEFA 2B1EA 3FZMB 2I6HA 3VRAA 3ONJA 4B3ST 1OEDA 4QH4A 5TAOA 5BMVE 1OXZA 4ILAA 4YSXA 2WDVA 2W67A 5L3BB 2CLYC 4KHZF 2EHOB 1E7PA 1ZP0A 2LJLA 4DBQA 3RKGA 3RI5A 4KBMB 3ETVA 5EK3A 3LSVA 3N2KE 4WZXA 1ZHCA 3SFDA 4DV4T 2BS3A 4GOUA 4KUMB 1BR0A 4MALA 4GK5E 3UUNA 3ZN1B 5CB4E 3AEDA 5JDLA 2H88A 2JQQA 2X0HA 2XPKA 3FBZA 3D0TA 2OA5A 3ZYMA 4OFZA 4DR3T 3LBXA 4NXMT 3U78A 1WCRA 2J47A 1HNXT 1Y64B 2MPKA 4H9QC 3EVYA 5LP6E 3BQLA 3LFMA 2IHR1 2LE8A 2C5KT 1LVKA 2VVSA 3R84B 4U7YA 4H9RC 4OHFA 1HTJF 2V26A 2E9XD 2XQ4A 3KFWX 4JV5T 2XAJB 2VURA 1D0ZA 2NR4A 4NXNT 2SPCA 2QYWA 4L5GA 2ZM2A 4TN7B 4MBQA 3MA9A 3PJAJ 1MIVA 3BQIA 4ZZBA 2WSSV 3C50A 4JEHB 5JR9C 5F5WA 4DR5T 3FHNA 2Q9QC 4C91A 4KHPT 1D1BA 2LSKA 2D2SA 4AI6A 4K0UA 5HEUA 3UUMA 2F4VT 4UF0B 3UT5E 4E7ZA 4JUYA 2KXPB 3PUSA 1ZEEA 2WWUA 3SWHA 2E5VA 5ABFA 3IEEA 2FJBA 3AVSA 5KX5E 3F31A 4LMLA 2IIUA 2DWKA 2C5JA 4E7SA 2J62A 2RP4A 4X65T 4UV8B 3GA8A 1W9RA 3OPCA 2LSGA 5CGMA 2UXCT 3PDYA 4CN1A 4H9PC 4DMVA 5HEOA 5FY0A 4DIDB 1XMQT 2W0GA 2PG8A 5LGTB 2RA1A 5LJNA 1HX8A 4QX8B 2BBHA 2X9WA 4CXYA 2YDQA 3J9X1 3PUQA 5AQSB 3N9OA 3PV0F 3SOLA 3TLVA 3IHRA 4ASKA 5FXVA 4EYUA 3CQXC 1ZOYA 3Q5EA 1X79A 3VR8A 4HFVA 3LK3B 5HYAA 3UUBA 3RLFF 2ZM8A 2XQAA 2A2FX 2BS2A 4DVDA 3B13A 2JMKA 3UU4A 1E2AA 2DHRA 1UGOA 3I9WA 4HWCA 3CKDA 1YQ4A 5FVLA 2ZMAA 3QK6A 3FXDB 3QB5K 2WU2A 2LHNA 3DTOA 4XZCA 2LM9A 4LMJA 4HEAA 5FMNA 4TWDA 2Q9QD 3L39A 5FYMA 4YLHA 1BR2A 4IL9A 2G0UA 1Z8UA 4U31A 4JI4T 3AAAB 1MIWA 3UULA 3E08A 3MACA 1B7TA 3NRYA 2CE7A 4IHJE 4NUUA 3O1HA 2BG9A 4LF9T 4FI5A 5ABEA 2V6YA 4WNKA 2E9XA 4U3CA 2HH7A 4Z8XA 1WRDA 1KFYA 1AJ3A 1YXRA 3OTOT 5HWYA 4DR7T 5LA6E 4PAGA 2D9DA 3RQWA 2V7JA 2YN6A 5FXZA 3N2GE 1OWAA 3LJCA 2FUPA 2MBGA 3EABA 2YDSA 2V5CA 4ZS2A 2JQKA 3K3NA 3ONXA 1VCSA 1KNZA 4I55E 4AKLA 4X62T 4AQFC 2K9AA 2VB6A 2YU1A 4ILBA 3VRBA 3GN5A 5EK2A 4UVCB 4EZHA 4JI0T 3FB2A 4U2ZA 2Y48B 3TLSA 3E22E 4TNWA 5FL1A 3CVRA 3AECA 5FNVE 4JEUB 4JI2T 5JRCB 3K3OA 4ZI2C 3HR0A 4X66T 1XDPA 2DWGA 3N9QA 5LBQB 4PK4A 4HWIB 2LEHA 3C4XA 4IDPA 2LOPA 2WB5A 2WY2A 2XSBA 5AQKB 3LDQB 5CJ5A 3QNUA 4HTEA 4HFBA 3SS1A 1YQ3A 5EK4A 4H9NC 4DV0T 4ZXLA 1IJ5A 2X68A 3PUXF 2KLQA 3RIFA 3CX6B 2JQHA 3Q5WA 5C8YE 1U5PA 3QOFA 2HPJA 4QH5A 3OYXA 2VL0A 3AA7B 4ISSA 4TUYE 2XQ8A 2W4XA 3GMIA 1N32T 3O9XA 3ZT7A 2IC6A 2V6YB 5AQLB 2X0LB 1XZYA 5F8PA 2E9XB 5AQTB 2BKNA 4A97A 5JR9A 2Q9QA 2UXBT 3VR9A 2N9DA 4EGWA 1VOMA 2VVNA 5L3FB 4AQGA 5J0ZA 5HXRA 1W0AA 4PK5A 1ZKEA 2R6GF 2WWVA 4IE4A 3NWIA 3C4WA 3PTRB 3L8RA 4QXCB 5HXEA 3K8PC 4DUZT 4DV2T 1FJGT 2KWIB 2V7LA 2H3RA 4TV9E 5IYZE 4Z91A 1UX4A 2CXLA 2XHEB 2Y8DA 3HKDE 4COFA 2CMRA 4WBNE 2XAFB 3ZC0A 3O1IA 1QSDA 4LF7T 4ZI2D 2WU5A 3AAEB 3GN5B 3C98B 5LYJE 5H6QB 2YKSA 5LB7B 3H3MA 3JAFA 4Z90A 4ANJA 1XNRT 2YU2A 1IZNB 4X1YE 4I4TE 2YK0A 3ZJ2A 1US7B 3KV6A 1XDOA 4X5TA 4HFDA 1YKHB 3N9PA 3B5MA 2IAKA 2LKGA 1HFAA 3WAJA 2CHNA 4UR9A 4HGAA 2NW9A 2XASB 5F3JA 5FY1A 2AE9A 5L3EB 2WDRA 5JDMA 4KP3C 5L3GB 3WI3A 4EZ4A 2JPFA 5FKYA 4ZI7E 4GYRA 3ZYLA 5AFUL 3JCFA 5AQQB 2W62A 2LSYA 2WMOA 2UU9T 4YSZA 5LGNB 4Q25A 2V7IA 4A98A 1NAFA 5JR9B 5J2TE 2L9QA 2VKOA 3C51A 3GWHA 2IC9A 4FJOA 5HEJA 5LHHB 3W15B 4ZZCA 2BVMA 1HNZT 5HWXA 2LM2A 3RPUA 1FEWA 5AQGB 2XSAA 1HF8A 3BQKA 2V6XA 2LRKA 3VU7H 4L9IA 1MNDA 1W0BA 5KMGP 5LMUT 1I94T 2X66A 5C2TA 2NW7A 3AXJB 4TX5A 4ZS3A 4BJMA 3C64A 3AE7A 3Q9DA 3PJAA 3RIAA 2NW8A 3UU8A 3MKDA 4QXHB 4AQFA 2M6BA 3Q5XA 2J4GA 3PU3A 1XNQT 2MTQA 2EHOC 4UXNB 3RX6A 4F8HA 1D1CA 3ZEFB 5AQOB 2V5DA 1D0YA 3H3AA 1R8IA 5KDMC 3B57A 3P50A 4OX9T 3RKOA 3DP7A 3HL6A 2K3WA 1KEYA 4CN6A 2CCQA 3AA6B 1I6ZA 2BKPA 5CFBA 3LG7A 2XQ5A 4DV6T 3AE6A 5HEHA 4O4IE 4YXDA 3FZKB 3AE4A 5LNKA 1OEDB 3FZLB 2WZHA 5LOVE 2FJEA 3AVRA 1U4QA 2XAGB 1OEDE 1NWMX 2CEAA 2WDQA 4LMKA 4IGUA 1S35A 4JI8T 2XQYA 2LLYA 2LKHA 3I0OA 2DI4A 2I0MA 1W09A 3NZQA 1UCUA 4IT4A 5AQIB 3AE8A 5HXSA 4P09A 5ABGA 4NUVA 3KV4A 3LBXB 3UFGA 3KV9A 1M7KA 5LHIB 4U7IA 1MNEA 3CPZA 1YD8G 2OLTA 4YJ2E 4M1PA 3F57A 3N2OA 4U72A 4ISTA 1J5WA 1SA0E 2WMNA 2DLRA 5L4EA 1SE7A 4IDNA 3NRXA 2WCAA 3H37A 3EAMA 2E5LT 1E1HB 3LK2B 2EHOD 3ETUA 4P0AA 4MLKA 4ZHQE 3AA1B 5M4YA 2CBJA 3ZMVB 2LT3A 2XAHB 4IE5A 1CHUA 2H7OA 5LG3A 4IDQA 4N78D 2MAWA 3QC9A 2IDOB 2J1DG 1XWMA 2HHHT 3O1JA 3NKZA 1HNWT 2DNXA 2NTYA 2XM1A 2CWYA 3I0QA 4LF4T 1HX1B 4DMWA 4ZI3C 5ABFB 5JDNA 4I50E 4AKGA 3AE9A 1HG2A 4X1IE 3BK9A 2JMHA 2LHRA 1N33T 2CXDA 2QVAA 4LF5T 5JDGA 2BDEA 4EAHA 3MZKB 3UFEA 1WFDA 4KX6A 1DU2A 5JDHA 4DV3T 3N9MA 4YHJA 4ZEYA 3ZMTB 2X51A 3AE5A 3L09A 5LG4A 4JI1T 5L47A 4CI1B 1IJ6A 1MMDA 3RYCE 1VCTA 4UEMA 3P4RA 4PFPA 3UQ7A 4DUYT 2XQ9A 2V7KA 1HG5A 2BKOA 3AE1A 4HFIA 3RC8A 3MJXA 4A5XA 4DV1T 3RYHE 1FIOA 3R6NA 4YHHT 3P8CD 2XY8B 4YSYA 4QWNB 3ZMZB 3EDVA 5LMNT 3T1YT 3PUWF 2X67A 1LVFA 4U2YA 2JRKA 4IE7A 1MMNA 2MYSA 4GKJT 1IAPA 2VL8A 2IW5B 3KINB 5AQRB 3Q2MA 2WP9A 1J1JA 3VKGA 2ACXA 4QH1A 5HXHA 4C90A 5JDQA 4CZZB 5EZYE 4J2CA 5ABHA 2BG9B 4ZI3D 2XJ7A 3AE3A 4P1NA 4OK0A 4IE0A 4OYJA 4WYVA 5DQVA 3CQCB 4UIGA 2EHOA 2KMFA 2CM0A 5GONE 3I1AA 4ZOLE 4V1Av 2YEVC 4QHOA 1MMGA 5LGUB 4KMCA 2XTLA 2OV9A 3ZT6A 4B6XA 2VKDA 2WQYA 3IBPA 3OJAA 4A56A 4YTNA 4YJ3E 5FXXA 2D5UA 2FJDA 5HCJA 3RRWA 2CHOA 4LF8T 2BZBA 4XAXB 2XAQB 3OVUA 2D0UA 1IBLT 3CX7B 2WM9A 2K24A 4PNIA 5LBMA 2CLYB 4EYYR 5FY7A 2UUAT 2W00A 4O8SA 5LHGB 1IBMT 2W63A 4DV5T 2C5IT 4AXPA 3NBXX 3E0ZA 4AKRB 4B3MT 3EI0A 5LCYA 4DO0A 5H6RB 5L4HA 3OBVE 5E0OA 4LFCT 3ZKRA 3A7MA 3AEEA 2ACZA 5JTGA 2UXDT 2PBIA 5DJQC 1N36T 3PUYF 4U74A 2QGSA 3ABVA 2A9UA 5IUXA 5HAXA 3L3PA 4NIQA 2WAUA 2W61A 4GK0E 4CI3B 5IWAT 1D1AA 2UXNB 2H7VC 2LRLA 2X0YA 3PE0A 4K0KT 3ZMSB 4DNDA 1T72A 3V5UA 3JADA 4B3TT 2D0TA 4JLEA 5KXJA 2XQ7A 4HE8A 1D0XA 1M62A 1KK7A 5AQMB 4ILCA 2Q9QB 1MIYA 2KZ7B 5J1GA 3UTKA 2X9XA 1MMAA 2DCFA 3TLUA 2IMLA 1KNRA 4O2AE 2ZLYA 4X20E 3P4SA 3OKQA 3CIRA 1Z0PA 2DL1A 2ODUA 4G2AA 4IE6A 2K5BB 4PJLA 3Q5DA 4DV7T 4PFOA 3JAEA 5JH7E 5FXWA 3SRZA 4TNVA 4PJNA 4DBRA 1YW0A 4JI5T 5HEGA 4JYAT 3FBLA 4CN4A 2YINA 3FZHB 5ADXL 2NOXA 3IA3A 1KNPA 3EUHA 4I0UA 3MXZA 1NENA 5HXCA 2I59A 2FJAA 4HFEA 4P0BA 3VHLA 5AQHB 3A8YC 4LFAT 3RH3A 3I9YA 1WYCA 4IIJE 4QXBB 4EIWA 4KI0F 3ZC1A 4G63A 3P4WA 2QA7A 2N2NA 2M6IA 4JI7T 1ZV4X 5DQWA 5J2UE 2RPAA 3KV5A 3RIUC 5LXTE 3N9NA 2X9YA 4H9SE 4EV6A 4JI6T 3ZN0B 2XQ6A 3CX8B 3RQUA 1HR0T 3NZPA 3PUZF 4X64T 4CQIA 3ONLC 4AISA 1UURA 3PUAA 3TKLB 3TLWA 5L3DB 1JNZA 1G8XA 1H7CA 5FVKA 3PURA 4PJJA 4CXXA 4O4LE 3RHWA 3AEBA 5CA0E 4CXWA 3ZJ1A 5AQJB 4JI3T 4QX7B 4DR6T 4MHCA 3HI2A 4H63V 4B3RT 1X9BA 3ZSTA 2CPTA 2PFVA 3X1DA 1T7SA 1FMWA 4UVAB 2VASA 3RF1A 2XQ3A 3CQGB 2C0SA 2P9BA 4DR4T 2ZM0A 2IUBA 5AQUB 3CWZB 5ETWA 4IL4A 2H89A 3RRCA 3HKBE 3ANWA 4AKHA 3LK42 1QLBA 4EB6E 5L2LA 4YY3T 1JNRA 4O4HE 4BAYB 2M67A 4I43B 2YOEA 5JRCA 3EHZA 3U3IA 1SUMB 2N1GA 1QUUA 3UUXB 2GK9A 2KSRA 3P4QA 2XM2A 2NP9A 4TV8E 4L0RA 4XBFB 4ADZA 2WZIA 2CXFA 2ZM6T 4CI2B 4YTMA 2AXDS 4AQYT 4HFCA 3FZFB 5JREA 1OEDC 4YTPA 2WS3A 2CWOA 4ERRA 1LKXA 1BR1A 1UX5A 4UV9B 2VQET 3TLTA 4TWHA 4HWHA 4AIUA 5LJMA 4EEBA 3ZCIA 2VWAA 1LRZA 2UUBT 4IDZA 4LF6T 4HKAA 4NPPA 4PW8A 4IDOA 4O4JE 4UELA 5DABA 2CRBA 4YT0A 3O4XE 3RGLA 2X9HA 3JC6C 1HCIA 3KBTA 2V8SV 4X1KE 3G06A 3HA4A 2BS4A 3J7Yq 1UK5A 3VKHA 5C3JA 5IHYA 4GKKT 4JBWF 2FBWA 3P7IA 3EDUA 2W66A 3UQ4A 2JIWA 3S4UA 3RYIE 3HKEE 4UVBB 3ZYKA 1O3XA 3M3ZB 4DR2T 1L0VA 3KDSE 2Y6XA 5AQFB 1T98A 3AA0B 2BVLA 2QRXA 1HS7A 2L3LA 2HPLA 5FL0A 4TWFA 5L3CB 2YDRA 1GQEA 3AAIA 3CMLA 1J5ET 1WR0A 3ANWB 3K3QC 2VKHA 4HWFA 2ES0A 5HCMA 5AQNB 3T8OA 5AQVB 5JDFA 2XUEA 3DJBA 3KBUA 1WYBA 2B76A 2PTFA 2E2AA 3AE2A 3QB5A 4WBOA 2KWHA 3ZLIA 4WW0A 3ZCJA 2CBIA 4HWDA 3P4PA 2A72A 3N5LA 4O2BE 3IF8B 1CUNA 1IBKT 2UXXB 3PUVF 2E8IA 1V9DA 2BBJA 2XZEA 3UU3A 2NTXA 4HFHA 3K1SA 4GYSA 4YFSA 3ESLA 1T8BA 3AEAA 2MOZA 2PJQA 3JC6D 4EXTA 2BG9E 3UU5A 1NEKA 4IREA 2Z6EA 2CA5A 3N9LA 3WAKA 3QUJA 4MFRA 3MK7C 2VK9A 3A5XA 3AEGA 4BA9A 1Y01A 2NWBA 5AQPB 4GIWA 2LSIA 4OYKA 3RYFE 2KINB 3ZPOA 1FMVA 3RIUA 4PJMA 1N34T 3ZT5A 4TZ4C 3CK6A 1S94A 3KVAA 3T1HT 2JJ9A 5JVDE 2LSJA 1WLXA 4QKNA 1WR6A 4AKIA 3ZMUB 2L8KA 2W2UA 4LFBT 3UU6A 2K48A 4H63H 2V1DB 4EEDA 2WBLA 3SFEA 4F6RC 3OYZA 2KNDA 4H9OC 2HN1A 1SHZC 3AXJA 3PU8A 3PUGA 1UUSA 2V7MA 5A1LA 3KVBA 3NVOA 2KT9A 2LOSA 2BG9C 4U33A 1VRBA 2A3DA 4DR1T 4HN9A 4PK6A 3F2EA 1YKEB 2E9XC 1G73A 3C4ZA 4BJNA 3AB3B 5JQGE 3RC3A
chains in the Genus database with same CATH topology
4HTEA 3HKCE 2H7OA 3I9YA 1EZ3A 3SS1A 5EK4A 1WYCA 4N78D 4IIJE 4H9NC 4QXBB 3QC9A 4EIWA 1IJ5A 3ZC1A 2X68A 1BR4A 4UF0A 4G63A 2QA7A 3FXEB 2KLQA 2J1DG 2N2NA 5FP3A 1ZV4X 5DQWA 3CX6B 3V5SA 5J2UE 3M65A 5CA1E 4ILUA 3KV5A 5LXTE 3N9NA 4EOZB 2X9YA 3Q5WA 4H9SE 3O1JA 2ODVA 1U5PA 5C8YE 2VKJA 3ZN0B 2DNXA 2NTYA 3CX8B 2HPJA 2B1EA 2CWYA 3I0QA 3NZPA 3OYXA 4CQIA 3PUAA 3TKLB 3AA7B 5L3DB 1G8XA 1H7CA 4ISSA 4DMWA 4TUYE 3PURA 4PJJA 5TAOA 3GMIA 4ZI3C 1OXZA 5BMVE 4CXXA 3O9XA 2IC6A 4O4LE 5L3BB 2X0LB 2CLYC 2E9XB 5F8PA 5JDNA 4I50E 2EHOB 5CA0E 4CXWA 5JR9A 4DBQA 2LJLA 3ZJ1A 2Q9QA 4AKGA 4KBMB 1HG2A 4QX7B 4X1IE 3BK9A 2N9DA 3ETVA 5EK3A 2JMHA 1VOMA 5L3FB 4MHCA 2LHRA 3N2KE 4AQGA 1ZHCA 3HI2A 5HXRA 4H63V 2CXDA 4GOUA 5JDGA 4PK5A 4KUMB 1ZKEA 2BDEA 2PFVA 4EAHA 1BR0A 4MALA 3MZKB 4IE4A 1FMWA 4GK5E 3C4WA 3UFEA 3PTRB 3UUNA 3ZN1B 5CB4E 4QXCB 4UVAB 5HXEA 5JDHA 3K8PC 2JQQA 2VASA 5JDLA 3FBZA 3CQGB 3D0TA 2C0SA 2P9BA 3N9MA 4YHJA 2ZM0A 2KWIB 2V7LA 3ZMTB 2OA5A 3CWZB 5ETWA 2H3RA 2X51A 3RRCA 3HKBE 3ANWA 3L09A 5LG4A 4TV9E 3ZYMA 5IYZE 4AKHA 1UX4A 3LK42 4OFZA 4CI1B 2CXLA 2XHEB 1IJ6A 3LBXA 2Y8DA 3HKDE 4EB6E 5L2LA 1MMDA 3RYCE 4O4HE 2CMRA 4BAYB 3U78A 2M67A 4WBNE 2XAFB 4UEMA 3ZC0A 3O1IA 4I43B 1QSDA 4PFPA 1Y64B 4ZI2D 5JRCA 4H9QC 2V7KA 1HG5A 3EVYA 3U3IA 5LP6E 3AAEB 3GN5B 3BQLA 3C98B 5LYJE 3LFMA 2LE8A 2N1GA 5H6QB 2C5KT 1LVKA 1QUUA 3UUXB 3R84B 4ANJA 4H9RC 4OHFA 1HTJF 2GK9A 2YU2A 1IZNB 3MJXA 3RC8A 2V26A 2NP9A 3RYHE 2E9XD 4TV8E 4X1YE 4L0RA 1FIOA 2YK0A 4I4TE 3KFWX 3R6NA 4XBFB 4ADZA 3ZJ2A 2CXFA 4CI2B 2XAJB 1US7B 1D0ZA 3KV6A 2SPCA 1YKHB 3N9PA 3P8CD 2ZM2A 4L5GA 4TN7B 2IAKA 5JREA 4MBQA 3MA9A 4QWNB 3ZMZB 3EDVA 1MIVA 3BQIA 2WSSV 2CWOA 4ERRA 1HFAA 2X67A 3WAJA 3C50A 1LVFA 4JEHB 1LKXA 4HGAA 2JRKA 5JR9C 4IE7A 1MMNA 2MYSA 3FHNA 2NW9A 2Q9QC 1BR1A 4C91A 1UX5A 4UV9B 1D1BA 1IAPA 2XASB 2LSKA 2VL8A 2IW5B 2D2SA 3KINB 5F3JA 4AI6A 5FY1A 5LJMA 4K0UA 3Q2MA 3ZCIA 2VWAA 3UUMA 3VKGA 1LRZA 2ACXA 5HXHA 4UF0B 5L3EB 3UT5E 4E7ZA 4JUYA 2KXPB 4IDZA 4C90A 4HKAA 5JDQA 5JDMA 4KP3C 4PW8A 3PUSA 4CZZB 1ZEEA 5EZYE 4J2CA 4O4JE 5L3GB 4UELA 5DABA 3WI3A 4ZI3D 4OK0A 4IE0A 4OYJA 2WWUA 4EZ4A 3SWHA 3O4XE 2X9HA 2JPFA 4ZI7E 3JC6C 5DQVA 3CQCB 4UIGA 3IEEA 2EHOA 1HCIA 2KMFA 4GYRA 3ZYLA 3AVSA 3KBTA 5KX5E 3F31A 2DWKA 5AFUL 2C5JA 4X1KE 2CM0A 5GONE 4E7SA 3HA4A 2W62A 2RP4A 3I1AA 4ZOLE 2LSYA 4V1Av 2YEVC 4UV8B 3GA8A 4QHOA 3J7Yq 1MMGA 2LSGA 2WMOA 5LGNB 3PDYA 5LGUB 2V7IA 4H9PC 3VKHA 4KMCA 5IHYA 4DMVA 5FY0A 2XTLA 1NAFA 4B6XA 2W0GA 5JR9B 3P7IA 2PG8A 3EDUA 5LGTB 5J2TE 2L9QA 2RA1A 5LJNA 3S4UA 3RYIE 1HX8A 3HKEE 4QX8B 2VKDA 2VKOA 2X9WA 4UVBB 3IBPA 3C51A 3GWHA 3OJAA 1O3XA 3ZYKA 4CXYA 3J9X1 3PUQA 4A56A 2IC9A 4FJOA 3KDSE 4YJ3E 5FXXA 2Y6XA 5LHHB 3N9OA 1T98A 3SOLA 2D5UA 3W15B 3AA0B 2BVLA 1HS7A 3RRWA 3IHRA 2L3LA 4ASKA 2HPLA 5FXVA 2BVMA 2BZBA 5L3CB 4XAXB 2XAQB 5HWXA 2D0UA 3AAIA 3CX7B 2WM9A 2K24A 3CMLA 4PNIA 4EYUA 3CQXC 5LBMA 3RPUA 2CLYB 1FEWA 3ANWB 4EYYR 3K3QC 5FY7A 2VKHA 1HF8A 1X79A 3BQKA 4HFVA 3LK3B 5HYAA 2W00A 4O8SA 2ES0A 5LHGB 2W63A 3VU7H 2ZM8A 3T8OA 4L9IA 5JDFA 1MNDA 2A2FX 2C5IT 2XUEA 3RH3A 4DVDA 4AXPA 3DJBA 5KMGP 3B13A 2JMKA 2X66A 3KBUA 2NW7A 1WYBA 4TX5A 3NBXX 3E0ZA 4ZS3A 3C64A 4AKRB 4BJMA 2DHRA 3I9WA 5LCYA 3Q9DA 5H6RB 4DO0A 4WBOA 3CKDA 2KWHA 2NW8A 2ZMAA 3OBVE 3MKDA 3QK6A 5E0OA 3ZLIA 4QXHB 3FXDB 4AQFA 4WW0A 3ZCJA 3Q5XA 2LHNA 3DTOA 4XZCA 2LM9A 3PU3A 2A72A 2MTQA 4HEAA 5FMNA 3N5LA 2EHOC 2Q9QD 4O2BE 4UXNB 3RX6A 2PBIA 5DJQC 5FYMA 1D1CA 3IF8B 3ZEFB 4YLHA 1CUNA 4U74A 2UXXB 1BR2A 2QGSA 2G0UA 2E8IA 1D0YA 3H3AA 3AAAB 5HAXA 3L3PA 1V9DA 1MIWA 3UULA 3E08A 5KDMC 3B57A 3MACA 1B7TA 2WAUA 3NRYA 3RKOA 2CE7A 4IHJE 3DP7A 2W61A 4NUUA 4GK0E 4CI3B 3HL6A 1D1AA 2NTXA 3O1HA 2UXNB 2H7VC 3PE0A 2CCQA 3AA6B 4GYSA 4FI5A 4YFSA 3ZMSB 3ESLA 3LG7A 2MOZA 2PJQA 3JC6D 4WNKA 2E9XA 4DNDA 4EXTA 2HH7A 4Z8XA 4O4IE 3V5UA 2D0TA 2Z6EA 2CA5A 4JLEA 1WRDA 3N9LA 3WAKA 5LNKA 4HE8A 3QUJA 1AJ3A 4MFRA 1D0XA 5LOVE 1KK7A 5HWYA 3MK7C 2VK9A 3AVRA 3A5XA 5LA6E 4PAGA 4BA9A 1U4QA 2NWBA 2XAGB 2Q9QB 2V7JA 4GIWA 2LSIA 3N2GE 5FXZA 1MIYA 4OYKA 2KZ7B 3RYFE 5J1GA 3UTKA 1OWAA 1NWMX 2CEAA 2KINB 3LJCA 3ZPOA 2X9XA 2MBGA 1MMAA 1FMVA 4IGUA 1S35A 2DCFA 4PJMA 2XQYA 4O2AE 2ZLYA 4X20E 3OKQA 4ZS2A 3I0OA 2DI4A 4TZ4C 1Z0PA 3K3NA 3ONXA 1KNZA 1S94A 4I55E 4AKLA 2ODUA 3KVAA 2JJ9A 3NZQA 1UCUA 4G2AA 4IE6A 4AQFC 2K5BB 5JVDE 2K9AA 2LSJA 2VB6A 2YU1A 5HXSA 4PJLA 1WLXA 4QKNA 1WR6A 4AKIA 4P09A 3ZMUB 2L8KA 4PFOA 3GN5A 5EK2A 4UVCB 4NUVA 5FXWA 4EZHA 5JH7E 3KV4A 3LBXB 3KV9A 3FB2A 3SRZA 2Y48B 2K48A 3E22E 4H63H 5LHIB 2V1DB 4F6RC 2WBLA 3OYZA 1MNEA 3CPZA 1YD8G 2KNDA 4PJNA 4YJ2E 4DBRA 3CVRA 4H9OC 1SHZC 4M1PA 5FNVE 1YW0A 4JEUB 3F57A 5JRCB 3N2OA 3K3OA 4ZI2C 3PU8A 4U72A 3FBLA 4ISTA 3PUGA 2V7MA 3HR0A 1SA0E 3KVBA 5A1LA 2DWGA 2WMNA 3N9QA 2YINA 2KT9A 2DLRA 2LOSA 5ADXL 3NRXA 2NOXA 1VRBA 2A3DA 5LBQB 4PK4A 3H37A 4HN9A 2LEHA 3C4XA 3EUHA 2LOPA 4PK6A 3F2EA 1YKEB 1E1HB 1G73A 2E9XC 3C4ZA 3MXZA 3LK2B 2EHOD 5HXCA 2I59A 4BJNA 3ETUA 3AB3B 4P0AA 4MLKA 4ZHQE 3AA1B 5M4YA 4P0BA 3ZMVB 3VHLA 5JQGE 3RC3A 2LT3A 2XAHB 4IE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0Z A; 
#chains in the Genus database with same CATH topology
 3HKC E;  1EZ3 A;  2HN2 A;  2VQF T;  2UUC T;  1BR4 A;  4UF0 A;  3FXE B;  5FP3 A;  2JQ9 A;  3ZSS A;  3V5S A;  3M65 A;  5CA1 E;  4ILU A;  1XMO T;  4EOZ B;  2ODV A;  1KF6 A;  2VKJ A;  5BR8 T;  3AEF A;  2B1E A;  3FZM B;  2I6H A;  3VRA A;  3ONJ A;  4B3S T;  1OED A;  4QH4 A;  5TAO A;  5BMV E;  1OXZ A;  4ILA A;  4YSX A;  2WDV A;  2W67 A;  5L3B B;  2CLY C;  4KHZ F;  2EHO B;  1E7P A;  1ZP0 A;  2LJL A;  4DBQ A;  3RKG A;  3RI5 A;  4KBM B;  3ETV A;  5EK3 A;  3LSV A;  3N2K E;  4WZX A;  1ZHC A;  3SFD A;  4DV4 T;  2BS3 A;  4GOU A;  4KUM B;  1BR0 A;  4MAL A;  4GK5 E;  3UUN A;  3ZN1 B;  5CB4 E;  3AED A;  5JDL A;  2H88 A;  2JQQ A;  2X0H A;  2XPK A;  3FBZ A;  3D0T A;  2OA5 A;  3ZYM A;  4OFZ A;  4DR3 T;  3LBX A;  4NXM T;  3U78 A;  1WCR A;  2J47 A;  1HNX T;  1Y64 B;  2MPK A;  4H9Q C;  3EVY A;  5LP6 E;  3BQL A;  3LFM A;  2IHR 1;  2LE8 A;  2C5K T;  1LVK A;  2VVS A;  3R84 B;  4U7Y A;  4H9R C;  4OHF A;  1HTJ F;  2V26 A;  2E9X D;  2XQ4 A;  3KFW X;  4JV5 T;  2XAJ B;  2VUR A;  1D0Z A;  2NR4 A;  4NXN T;  2SPC A;  2QYW A;  4L5G A;  2ZM2 A;  4TN7 B;  4MBQ A;  3MA9 A;  3PJA J;  1MIV A;  3BQI A;  4ZZB A;  2WSS V;  3C50 A;  4JEH B;  5JR9 C;  5F5W A;  4DR5 T;  3FHN A;  2Q9Q C;  4C91 A;  4KHP T;  1D1B A;  2LSK A;  2D2S A;  4AI6 A;  4K0U A;  5HEU A;  3UUM A;  2F4V T;  4UF0 B;  3UT5 E;  4E7Z A;  4JUY A;  2KXP B;  3PUS A;  1ZEE A;  2WWU A;  3SWH A;  2E5V A;  5ABF A;  3IEE A;  2FJB A;  3AVS A;  5KX5 E;  3F31 A;  4LML A;  2IIU A;  2DWK A;  2C5J A;  4E7S A;  2J62 A;  2RP4 A;  4X65 T;  4UV8 B;  3GA8 A;  1W9R A;  3OPC A;  2LSG A;  5CGM A;  2UXC T;  3PDY A;  4CN1 A;  4H9P C;  4DMV A;  5HEO A;  5FY0 A;  4DID B;  1XMQ T;  2W0G A;  2PG8 A;  5LGT B;  2RA1 A;  5LJN A;  1HX8 A;  4QX8 B;  2BBH A;  2X9W A;  4CXY A;  2YDQ A;  3J9X 1;  3PUQ A;  5AQS B;  3N9O A;  3PV0 F;  3SOL A;  3TLV A;  3IHR A;  4ASK A;  5FXV A;  4EYU A;  3CQX C;  1ZOY A;  3Q5E A;  1X79 A;  3VR8 A;  4HFV A;  3LK3 B;  5HYA A;  3UUB A;  3RLF F;  2ZM8 A;  2XQA A;  2A2F X;  2BS2 A;  4DVD A;  3B13 A;  2JMK A;  3UU4 A;  1E2A A;  2DHR A;  1UGO A;  3I9W A;  4HWC A;  3CKD A;  1YQ4 A;  5FVL A;  2ZMA A;  3QK6 A;  3FXD B;  3QB5 K;  2WU2 A;  2LHN A;  3DTO A;  4XZC A;  2LM9 A;  4LMJ A;  4HEA A;  5FMN A;  4TWD A;  2Q9Q D;  3L39 A;  5FYM A;  4YLH A;  1BR2 A;  4IL9 A;  2G0U A;  1Z8U A;  4U31 A;  4JI4 T;  3AAA B;  1MIW A;  3UUL A;  3E08 A;  3MAC A;  1B7T A;  3NRY A;  2CE7 A;  4IHJ E;  4NUU A;  3O1H A;  2BG9 A;  4LF9 T;  4FI5 A;  5ABE A;  2V6Y A;  4WNK A;  2E9X A;  4U3C A;  2HH7 A;  4Z8X A;  1WRD A;  1KFY A;  1AJ3 A;  1YXR A;  3OTO T;  5HWY A;  4DR7 T;  5LA6 E;  4PAG A;  2D9D A;  3RQW A;  2V7J A;  2YN6 A;  5FXZ A;  3N2G E;  1OWA A;  3LJC A;  2FUP A;  2MBG A;  3EAB A;  2YDS A;  2V5C A;  4ZS2 A;  2JQK A;  3K3N A;  3ONX A;  1VCS A;  1KNZ A;  4I55 E;  4AKL A;  4X62 T;  4AQF C;  2K9A A;  2VB6 A;  2YU1 A;  4ILB A;  3VRB A;  3GN5 A;  5EK2 A;  4UVC B;  4EZH A;  4JI0 T;  3FB2 A;  4U2Z A;  2Y48 B;  3TLS A;  3E22 E;  4TNW A;  5FL1 A;  3CVR A;  3AEC A;  5FNV E;  4JEU B;  4JI2 T;  5JRC B;  3K3O A;  4ZI2 C;  3HR0 A;  4X66 T;  1XDP A;  2DWG A;  3N9Q A;  5LBQ B;  4PK4 A;  4HWI B;  2LEH A;  3C4X A;  4IDP A;  2LOP A;  2WB5 A;  2WY2 A;  2XSB A;  5AQK B;  3LDQ B;  5CJ5 A;  3QNU A;  4HTE A;  4HFB A;  3SS1 A;  1YQ3 A;  5EK4 A;  4H9N C;  4DV0 T;  4ZXL A;  1IJ5 A;  2X68 A;  3PUX F;  2KLQ A;  3RIF A;  3CX6 B;  2JQH A;  3Q5W A;  5C8Y E;  1U5P A;  3QOF A;  2HPJ A;  4QH5 A;  3OYX A;  2VL0 A;  3AA7 B;  4ISS A;  4TUY E;  2XQ8 A;  2W4X A;  3GMI A;  1N32 T;  3O9X A;  3ZT7 A;  2IC6 A;  2V6Y B;  5AQL B;  2X0L B;  1XZY A;  5F8P A;  2E9X B;  5AQT B;  2BKN A;  4A97 A;  5JR9 A;  2Q9Q A;  2UXB T;  3VR9 A;  2N9D A;  4EGW A;  1VOM A;  2VVN A;  5L3F B;  4AQG A;  5J0Z A;  5HXR A;  1W0A A;  4PK5 A;  1ZKE A;  2R6G F;  2WWV A;  4IE4 A;  3NWI A;  3C4W A;  3PTR B;  3L8R A;  4QXC B;  5HXE A;  3K8P C;  4DUZ T;  4DV2 T;  1FJG T;  2KWI B;  2V7L A;  2H3R A;  4TV9 E;  5IYZ E;  4Z91 A;  1UX4 A;  2CXL A;  2XHE B;  2Y8D A;  3HKD E;  4COF A;  2CMR A;  4WBN E;  2XAF B;  3ZC0 A;  3O1I A;  1QSD A;  4LF7 T;  4ZI2 D;  2WU5 A;  3AAE B;  3GN5 B;  3C98 B;  5LYJ E;  5H6Q B;  2YKS A;  5LB7 B;  3H3M A;  3JAF A;  4Z90 A;  4ANJ A;  1XNR T;  2YU2 A;  1IZN B;  4X1Y E;  4I4T E;  2YK0 A;  3ZJ2 A;  1US7 B;  3KV6 A;  1XDO A;  4X5T A;  4HFD A;  1YKH B;  3N9P A;  3B5M A;  2IAK A;  2LKG A;  1HFA A;  3WAJ A;  2CHN A;  4UR9 A;  4HGA A;  2NW9 A;  2XAS B;  5F3J A;  5FY1 A;  2AE9 A;  5L3E B;  2WDR A;  5JDM A;  4KP3 C;  5L3G B;  3WI3 A;  4EZ4 A;  2JPF A;  5FKY A;  4ZI7 E;  4GYR A;  3ZYL A;  5AFU L;  3JCF A;  5AQQ B;  2W62 A;  2LSY A;  2WMO A;  2UU9 T;  4YSZ A;  5LGN B;  4Q25 A;  2V7I A;  4A98 A;  1NAF A;  5JR9 B;  5J2T E;  2L9Q A;  2VKO A;  3C51 A;  3GWH A;  2IC9 A;  4FJO A;  5HEJ A;  5LHH B;  3W15 B;  4ZZC A;  2BVM A;  1HNZ T;  5HWX A;  2LM2 A;  3RPU A;  1FEW A;  5AQG B;  2XSA A;  1HF8 A;  3BQK A;  2V6X A;  2LRK A;  3VU7 H;  4L9I A;  1MND A;  1W0B A;  5KMG P;  5LMU T;  1I94 T;  2X66 A;  5C2T A;  2NW7 A;  3AXJ B;  4TX5 A;  4ZS3 A;  4BJM A;  3C64 A;  3AE7 A;  3Q9D A;  3PJA A;  3RIA A;  2NW8 A;  3UU8 A;  3MKD A;  4QXH B;  4AQF A;  2M6B A;  3Q5X A;  2J4G A;  3PU3 A;  1XNQ T;  2MTQ A;  2EHO C;  4UXN B;  3RX6 A;  4F8H A;  1D1C A;  3ZEF B;  5AQO B;  2V5D A;  1D0Y A;  3H3A A;  1R8I A;  5KDM C;  3B57 A;  3P50 A;  4OX9 T;  3RKO A;  3DP7 A;  3HL6 A;  2K3W A;  1KEY A;  4CN6 A;  2CCQ A;  3AA6 B;  1I6Z A;  2BKP A;  5CFB A;  3LG7 A;  2XQ5 A;  4DV6 T;  3AE6 A;  5HEH A;  4O4I E;  4YXD A;  3FZK B;  3AE4 A;  5LNK A;  1OED B;  3FZL B;  2WZH A;  5LOV E;  2FJE A;  3AVR A;  1U4Q A;  2XAG B;  1OED E;  1NWM X;  2CEA A;  2WDQ A;  4LMK A;  4IGU A;  1S35 A;  4JI8 T;  2XQY A;  2LLY A;  2LKH A;  3I0O A;  2DI4 A;  2I0M A;  1W09 A;  3NZQ A;  1UCU A;  4IT4 A;  5AQI B;  3AE8 A;  5HXS A;  4P09 A;  5ABG A;  4NUV A;  3KV4 A;  3LBX B;  3UFG A;  3KV9 A;  1M7K A;  5LHI B;  4U7I A;  1MNE A;  3CPZ A;  1YD8 G;  2OLT A;  4YJ2 E;  4M1P A;  3F57 A;  3N2O A;  4U72 A;  4IST A;  1J5W A;  1SA0 E;  2WMN A;  2DLR A;  5L4E A;  1SE7 A;  4IDN A;  3NRX A;  2WCA A;  3H37 A;  3EAM A;  2E5L T;  1E1H B;  3LK2 B;  2EHO D;  3ETU A;  4P0A A;  4MLK A;  4ZHQ E;  3AA1 B;  5M4Y A;  2CBJ A;  3ZMV B;  2LT3 A;  2XAH B;  4IE5 A;  1CHU A;  2H7O A;  5LG3 A;  4IDQ A;  4N78 D;  2MAW A;  3QC9 A;  2IDO B;  2J1D G;  1XWM A;  2HHH T;  3O1J A;  3NKZ A;  1HNW T;  2DNX A;  2NTY A;  2XM1 A;  2CWY A;  3I0Q A;  4LF4 T;  1HX1 B;  4DMW A;  4ZI3 C;  5ABF B;  5JDN A;  4I50 E;  4AKG A;  3AE9 A;  1HG2 A;  4X1I E;  3BK9 A;  2JMH A;  2LHR A;  1N33 T;  2CXD A;  2QVA A;  4LF5 T;  5JDG A;  2BDE A;  4EAH A;  3MZK B;  3UFE A;  1WFD A;  4KX6 A;  1DU2 A;  5JDH A;  4DV3 T;  3N9M A;  4YHJ A;  4ZEY A;  3ZMT B;  2X51 A;  3AE5 A;  3L09 A;  5LG4 A;  4JI1 T;  5L47 A;  4CI1 B;  1IJ6 A;  1MMD A;  3RYC E;  1VCT A;  4UEM A;  3P4R A;  4PFP A;  3UQ7 A;  4DUY T;  2XQ9 A;  2V7K A;  1HG5 A;  2BKO A;  3AE1 A;  4HFI A;  3RC8 A;  3MJX A;  4A5X A;  4DV1 T;  3RYH E;  1FIO A;  3R6N A;  4YHH T;  3P8C D;  2XY8 B;  4YSY A;  4QWN B;  3ZMZ B;  3EDV A;  5LMN T;  3T1Y T;  3PUW F;  2X67 A;  1LVF A;  4U2Y A;  2JRK A;  4IE7 A;  1MMN A;  2MYS A;  4GKJ T;  1IAP A;  2VL8 A;  2IW5 B;  3KIN B;  5AQR B;  3Q2M A;  2WP9 A;  1J1J A;  3VKG A;  2ACX A;  4QH1 A;  5HXH A;  4C90 A;  5JDQ A;  4CZZ B;  5EZY E;  4J2C A;  5ABH A;  2BG9 B;  4ZI3 D;  2XJ7 A;  3AE3 A;  4P1N A;  4OK0 A;  4IE0 A;  4OYJ A;  4WYV A;  5DQV A;  3CQC B;  4UIG A;  2EHO A;  2KMF A;  2CM0 A;  5GON E;  3I1A A;  4ZOL E;  4V1A v;  2YEV C;  4QHO A;  1MMG A;  5LGU B;  4KMC A;  2XTL A;  2OV9 A;  3ZT6 A;  4B6X A;  2VKD A;  2WQY A;  3IBP A;  3OJA A;  4A56 A;  4YTN A;  4YJ3 E;  5FXX A;  2D5U A;  2FJD A;  5HCJ A;  3RRW A;  2CHO A;  4LF8 T;  2BZB A;  4XAX B;  2XAQ B;  3OVU A;  2D0U A;  1IBL T;  3CX7 B;  2WM9 A;  2K24 A;  4PNI A;  5LBM A;  2CLY B;  4EYY R;  5FY7 A;  2UUA T;  2W00 A;  4O8S A;  5LHG B;  1IBM T;  2W63 A;  4DV5 T;  2C5I T;  4AXP A;  3NBX X;  3E0Z A;  4AKR B;  4B3M T;  3EI0 A;  5LCY A;  4DO0 A;  5H6R B;  5L4H A;  3OBV E;  5E0O A;  4LFC T;  3ZKR A;  3A7M A;  3AEE A;  2ACZ A;  5JTG A;  2UXD T;  2PBI A;  5DJQ C;  1N36 T;  3PUY F;  4U74 A;  2QGS A;  3ABV A;  2A9U A;  5IUX A;  5HAX A;  3L3P A;  4NIQ A;  2WAU A;  2W61 A;  4GK0 E;  4CI3 B;  5IWA T;  1D1A A;  2UXN B;  2H7V C;  2LRL A;  2X0Y A;  3PE0 A;  4K0K T;  3ZMS B;  4DND A;  1T72 A;  3V5U A;  3JAD A;  4B3T T;  2D0T A;  4JLE A;  5KXJ A;  2XQ7 A;  4HE8 A;  1D0X A;  1M62 A;  1KK7 A;  5AQM B;  4ILC A;  2Q9Q B;  1MIY A;  2KZ7 B;  5J1G A;  3UTK A;  2X9X A;  1MMA A;  2DCF A;  3TLU A;  2IML A;  1KNR A;  4O2A E;  2ZLY A;  4X20 E;  3P4S A;  3OKQ A;  3CIR A;  1Z0P A;  2DL1 A;  2ODU A;  4G2A A;  4IE6 A;  2K5B B;  4PJL A;  3Q5D A;  4DV7 T;  4PFO A;  3JAE A;  5JH7 E;  5FXW A;  3SRZ A;  4TNV A;  4PJN A;  4DBR A;  1YW0 A;  4JI5 T;  5HEG A;  4JYA T;  3FBL A;  4CN4 A;  2YIN A;  3FZH B;  5ADX L;  2NOX A;  3IA3 A;  1KNP A;  3EUH A;  4I0U A;  3MXZ A;  1NEN A;  5HXC A;  2I59 A;  2FJA A;  4HFE A;  4P0B A;  3VHL A;  5AQH B;  3A8Y C;  4LFA T;  3RH3 A;  3I9Y A;  1WYC A;  4IIJ E;  4QXB B;  4EIW A;  4KI0 F;  3ZC1 A;  4G63 A;  3P4W A;  2QA7 A;  2N2N A;  2M6I A;  4JI7 T;  1ZV4 X;  5DQW A;  5J2U E;  2RPA A;  3KV5 A;  3RIU C;  5LXT E;  3N9N A;  2X9Y A;  4H9S E;  4EV6 A;  4JI6 T;  3ZN0 B;  2XQ6 A;  3CX8 B;  3RQU A;  1HR0 T;  3NZP A;  3PUZ F;  4X64 T;  4CQI A;  3ONL C;  4AIS A;  1UUR A;  3PUA A;  3TKL B;  3TLW A;  5L3D B;  1JNZ A;  1G8X A;  1H7C A;  5FVK A;  3PUR A;  4PJJ A;  4CXX A;  4O4L E;  3RHW A;  3AEB A;  5CA0 E;  4CXW A;  3ZJ1 A;  5AQJ B;  4JI3 T;  4QX7 B;  4DR6 T;  4MHC A;  3HI2 A;  4H63 V;  4B3R T;  1X9B A;  3ZST A;  2CPT A;  2PFV A;  3X1D A;  1T7S A;  1FMW A;  4UVA B;  2VAS A;  3RF1 A;  2XQ3 A;  3CQG B;  2C0S A;  2P9B A;  4DR4 T;  2ZM0 A;  2IUB A;  5AQU B;  3CWZ B;  5ETW A;  4IL4 A;  2H89 A;  3RRC A;  3HKB E;  3ANW A;  4AKH A;  3LK4 2;  1QLB A;  4EB6 E;  5L2L A;  4YY3 T;  1JNR A;  4O4H E;  4BAY B;  2M67 A;  4I43 B;  2YOE A;  5JRC A;  3EHZ A;  3U3I A;  1SUM B;  2N1G A;  1QUU A;  3UUX B;  2GK9 A;  2KSR A;  3P4Q A;  2XM2 A;  2NP9 A;  4TV8 E;  4L0R A;  4XBF B;  4ADZ A;  2WZI A;  2CXF A;  2ZM6 T;  4CI2 B;  4YTM A;  2AXD S;  4AQY T;  4HFC A;  3FZF B;  5JRE A;  1OED C;  4YTP A;  2WS3 A;  2CWO A;  4ERR A;  1LKX A;  1BR1 A;  1UX5 A;  4UV9 B;  2VQE T;  3TLT A;  4TWH A;  4HWH A;  4AIU A;  5LJM A;  4EEB A;  3ZCI A;  2VWA A;  1LRZ A;  2UUB T;  4IDZ A;  4LF6 T;  4HKA A;  4NPP A;  4PW8 A;  4IDO A;  4O4J E;  4UEL A;  5DAB A;  2CRB A;  4YT0 A;  3O4X E;  3RGL A;  2X9H A;  3JC6 C;  1HCI A;  3KBT A;  2V8S V;  4X1K E;  3G06 A;  3HA4 A;  2BS4 A;  3J7Y q;  1UK5 A;  3VKH A;  5C3J A;  5IHY A;  4GKK T;  4JBW F;  2FBW A;  3P7I A;  3EDU A;  2W66 A;  3UQ4 A;  2JIW A;  3S4U A;  3RYI E;  3HKE E;  4UVB B;  3ZYK A;  1O3X A;  3M3Z B;  4DR2 T;  1L0V A;  3KDS E;  2Y6X A;  5AQF B;  1T98 A;  3AA0 B;  2BVL A;  2QRX A;  1HS7 A;  2L3L A;  2HPL A;  5FL0 A;  4TWF A;  5L3C B;  2YDR A;  1GQE A;  3AAI A;  3CML A;  1J5E T;  1WR0 A;  3ANW B;  3K3Q C;  2VKH A;  4HWF A;  2ES0 A;  5HCM A;  5AQN B;  3T8O A;  5AQV B;  5JDF A;  2XUE A;  3DJB A;  3KBU A;  1WYB A;  2B76 A;  2PTF A;  2E2A A;  3AE2 A;  3QB5 A;  4WBO A;  2KWH A;  3ZLI A;  4WW0 A;  3ZCJ A;  2CBI A;  4HWD A;  3P4P A;  2A72 A;  3N5L A;  4O2B E;  3IF8 B;  1CUN A;  1IBK T;  2UXX B;  3PUV F;  2E8I A;  1V9D A;  2BBJ A;  2XZE A;  3UU3 A;  2NTX A;  4HFH A;  3K1S A;  4GYS A;  4YFS A;  3ESL A;  1T8B A;  3AEA A;  2MOZ A;  2PJQ A;  3JC6 D;  4EXT A;  2BG9 E;  3UU5 A;  1NEK A;  4IRE A;  2Z6E A;  2CA5 A;  3N9L A;  3WAK A;  3QUJ A;  4MFR A;  3MK7 C;  2VK9 A;  3A5X A;  3AEG A;  4BA9 A;  1Y01 A;  2NWB A;  5AQP B;  4GIW A;  2LSI A;  4OYK A;  3RYF E;  2KIN B;  3ZPO A;  1FMV A;  3RIU A;  4PJM A;  1N34 T;  3ZT5 A;  4TZ4 C;  3CK6 A;  1S94 A;  3KVA A;  3T1H T;  2JJ9 A;  5JVD E;  2LSJ A;  1WLX A;  4QKN A;  1WR6 A;  4AKI A;  3ZMU B;  2L8K A;  2W2U A;  4LFB T;  3UU6 A;  2K48 A;  4H63 H;  2V1D B;  4EED A;  2WBL A;  3SFE A;  4F6R C;  3OYZ A;  2KND A;  4H9O C;  2HN1 A;  1SHZ C;  3AXJ A;  3PU8 A;  3PUG A;  1UUS A;  2V7M A;  5A1L A;  3KVB A;  3NVO A;  2KT9 A;  2LOS A;  2BG9 C;  4U33 A;  1VRB A;  2A3D A;  4DR1 T;  4HN9 A;  4PK6 A;  3F2E A;  1YKE B;  2E9X C;  1G73 A;  3C4Z A;  4BJN A;  3AB3 B;  5JQG E;  3RC3 A; 
#chains in the Genus database with same CATH homology
 4HTE A;  3HKC E;  2H7O A;  3I9Y A;  1EZ3 A;  3SS1 A;  5EK4 A;  1WYC A;  4N78 D;  4IIJ E;  4H9N C;  4QXB B;  3QC9 A;  4EIW A;  1IJ5 A;  3ZC1 A;  2X68 A;  1BR4 A;  4UF0 A;  4G63 A;  2QA7 A;  3FXE B;  2KLQ A;  2J1D G;  2N2N A;  5FP3 A;  1ZV4 X;  5DQW A;  3CX6 B;  3V5S A;  5J2U E;  3M65 A;  5CA1 E;  4ILU A;  3KV5 A;  5LXT E;  3N9N A;  4EOZ B;  2X9Y A;  3Q5W A;  4H9S E;  3O1J A;  2ODV A;  1U5P A;  5C8Y E;  2VKJ A;  3ZN0 B;  2DNX A;  2NTY A;  3CX8 B;  2HPJ A;  2B1E A;  2CWY A;  3I0Q A;  3NZP A;  3OYX A;  4CQI A;  3PUA A;  3TKL B;  3AA7 B;  5L3D B;  1G8X A;  1H7C A;  4ISS A;  4DMW A;  4TUY E;  3PUR A;  4PJJ A;  5TAO A;  3GMI A;  4ZI3 C;  1OXZ A;  5BMV E;  4CXX A;  3O9X A;  2IC6 A;  4O4L E;  5L3B B;  2X0L B;  2CLY C;  2E9X B;  5F8P A;  5JDN A;  4I50 E;  2EHO B;  5CA0 E;  4CXW A;  5JR9 A;  4DBQ A;  2LJL A;  3ZJ1 A;  2Q9Q A;  4AKG A;  4KBM B;  1HG2 A;  4QX7 B;  4X1I E;  3BK9 A;  2N9D A;  3ETV A;  5EK3 A;  2JMH A;  1VOM A;  5L3F B;  4MHC A;  2LHR A;  3N2K E;  4AQG A;  1ZHC A;  3HI2 A;  5HXR A;  4H63 V;  2CXD A;  4GOU A;  5JDG A;  4PK5 A;  4KUM B;  1ZKE A;  2BDE A;  2PFV A;  4EAH A;  1BR0 A;  4MAL A;  3MZK B;  4IE4 A;  1FMW A;  4GK5 E;  3C4W A;  3UFE A;  3PTR B;  3UUN A;  3ZN1 B;  5CB4 E;  4QXC B;  4UVA B;  5HXE A;  5JDH A;  3K8P C;  2JQQ A;  2VAS A;  5JDL A;  3FBZ A;  3CQG B;  3D0T A;  2C0S A;  2P9B A;  3N9M A;  4YHJ A;  2ZM0 A;  2KWI B;  2V7L A;  3ZMT B;  2OA5 A;  3CWZ B;  5ETW A;  2H3R A;  2X51 A;  3RRC A;  3HKB E;  3ANW A;  3L09 A;  5LG4 A;  4TV9 E;  3ZYM A;  5IYZ E;  4AKH A;  1UX4 A;  3LK4 2;  4OFZ A;  4CI1 B;  2CXL A;  2XHE B;  1IJ6 A;  3LBX A;  2Y8D A;  3HKD E;  4EB6 E;  5L2L A;  1MMD A;  3RYC E;  4O4H E;  2CMR A;  4BAY B;  3U78 A;  2M67 A;  4WBN E;  2XAF B;  4UEM A;  3ZC0 A;  3O1I A;  4I43 B;  1QSD A;  4PFP A;  1Y64 B;  4ZI2 D;  5JRC A;  4H9Q C;  2V7K A;  1HG5 A;  3EVY A;  3U3I A;  5LP6 E;  3AAE B;  3GN5 B;  3BQL A;  3C98 B;  5LYJ E;  3LFM A;  2LE8 A;  2N1G A;  5H6Q B;  2C5K T;  1LVK A;  1QUU A;  3UUX B;  3R84 B;  4ANJ A;  4H9R C;  4OHF A;  1HTJ F;  2GK9 A;  2YU2 A;  1IZN B;  3MJX A;  3RC8 A;  2V26 A;  2NP9 A;  3RYH E;  2E9X D;  4TV8 E;  4X1Y E;  4L0R A;  1FIO A;  2YK0 A;  4I4T E;  3KFW X;  3R6N A;  4XBF B;  4ADZ A;  3ZJ2 A;  2CXF A;  4CI2 B;  2XAJ B;  1US7 B;  1D0Z A;  3KV6 A;  2SPC A;  1YKH B;  3N9P A;  3P8C D;  2ZM2 A;  4L5G A;  4TN7 B;  2IAK A;  5JRE A;  4MBQ A;  3MA9 A;  4QWN B;  3ZMZ B;  3EDV A;  1MIV A;  3BQI A;  2WSS V;  2CWO A;  4ERR A;  1HFA A;  2X67 A;  3WAJ A;  3C50 A;  1LVF A;  4JEH B;  1LKX A;  4HGA A;  2JRK A;  5JR9 C;  4IE7 A;  1MMN A;  2MYS A;  3FHN A;  2NW9 A;  2Q9Q C;  1BR1 A;  4C91 A;  1UX5 A;  4UV9 B;  1D1B A;  1IAP A;  2XAS B;  2LSK A;  2VL8 A;  2IW5 B;  2D2S A;  3KIN B;  5F3J A;  4AI6 A;  5FY1 A;  5LJM A;  4K0U A;  3Q2M A;  3ZCI A;  2VWA A;  3UUM A;  3VKG A;  1LRZ A;  2ACX A;  5HXH A;  4UF0 B;  5L3E B;  3UT5 E;  4E7Z A;  4JUY A;  2KXP B;  4IDZ A;  4C90 A;  4HKA A;  5JDQ A;  5JDM A;  4KP3 C;  4PW8 A;  3PUS A;  4CZZ B;  1ZEE A;  5EZY E;  4J2C A;  4O4J E;  5L3G B;  4UEL A;  5DAB A;  3WI3 A;  4ZI3 D;  4OK0 A;  4IE0 A;  4OYJ A;  2WWU A;  4EZ4 A;  3SWH A;  3O4X E;  2X9H A;  2JPF A;  4ZI7 E;  3JC6 C;  5DQV A;  3CQC B;  4UIG A;  3IEE A;  2EHO A;  1HCI A;  2KMF A;  4GYR A;  3ZYL A;  3AVS A;  3KBT A;  5KX5 E;  3F31 A;  2DWK A;  5AFU L;  2C5J A;  4X1K E;  2CM0 A;  5GON E;  4E7S A;  3HA4 A;  2W62 A;  2RP4 A;  3I1A A;  4ZOL E;  2LSY A;  4V1A v;  2YEV C;  4UV8 B;  3GA8 A;  4QHO A;  3J7Y q;  1MMG A;  2LSG A;  2WMO A;  5LGN B;  3PDY A;  5LGU B;  2V7I A;  4H9P C;  3VKH A;  4KMC A;  5IHY A;  4DMV A;  5FY0 A;  2XTL A;  1NAF A;  4B6X A;  2W0G A;  5JR9 B;  3P7I A;  2PG8 A;  3EDU A;  5LGT B;  5J2T E;  2L9Q A;  2RA1 A;  5LJN A;  3S4U A;  3RYI E;  1HX8 A;  3HKE E;  4QX8 B;  2VKD A;  2VKO A;  2X9W A;  4UVB B;  3IBP A;  3C51 A;  3GWH A;  3OJA A;  1O3X A;  3ZYK A;  4CXY A;  3J9X 1;  3PUQ A;  4A56 A;  2IC9 A;  4FJO A;  3KDS E;  4YJ3 E;  5FXX A;  2Y6X A;  5LHH B;  3N9O A;  1T98 A;  3SOL A;  2D5U A;  3W15 B;  3AA0 B;  2BVL A;  1HS7 A;  3RRW A;  3IHR A;  2L3L A;  4ASK A;  2HPL A;  5FXV A;  2BVM A;  2BZB A;  5L3C B;  4XAX B;  2XAQ B;  5HWX A;  2D0U A;  3AAI A;  3CX7 B;  2WM9 A;  2K24 A;  3CML A;  4PNI A;  4EYU A;  3CQX C;  5LBM A;  3RPU A;  2CLY B;  1FEW A;  3ANW B;  4EYY R;  3K3Q C;  5FY7 A;  2VKH A;  1HF8 A;  1X79 A;  3BQK A;  4HFV A;  3LK3 B;  5HYA A;  2W00 A;  4O8S A;  2ES0 A;  5LHG B;  2W63 A;  3VU7 H;  2ZM8 A;  3T8O A;  4L9I A;  5JDF A;  1MND A;  2A2F X;  2C5I T;  2XUE A;  3RH3 A;  4DVD A;  4AXP A;  3DJB A;  5KMG P;  3B13 A;  2JMK A;  2X66 A;  3KBU A;  2NW7 A;  1WYB A;  4TX5 A;  3NBX X;  3E0Z A;  4ZS3 A;  3C64 A;  4AKR B;  4BJM A;  2DHR A;  3I9W A;  5LCY A;  3Q9D A;  5H6R B;  4DO0 A;  4WBO A;  3CKD A;  2KWH A;  2NW8 A;  2ZMA A;  3OBV E;  3MKD A;  3QK6 A;  5E0O A;  3ZLI A;  4QXH B;  3FXD B;  4AQF A;  4WW0 A;  3ZCJ A;  3Q5X A;  2LHN A;  3DTO A;  4XZC A;  2LM9 A;  3PU3 A;  2A72 A;  2MTQ A;  4HEA A;  5FMN A;  3N5L A;  2EHO C;  2Q9Q D;  4O2B E;  4UXN B;  3RX6 A;  2PBI A;  5DJQ C;  5FYM A;  1D1C A;  3IF8 B;  3ZEF B;  4YLH A;  1CUN A;  4U74 A;  2UXX B;  1BR2 A;  2QGS A;  2G0U A;  2E8I A;  1D0Y A;  3H3A A;  3AAA B;  5HAX A;  3L3P A;  1V9D A;  1MIW A;  3UUL A;  3E08 A;  5KDM C;  3B57 A;  3MAC A;  1B7T A;  2WAU A;  3NRY A;  3RKO A;  2CE7 A;  4IHJ E;  3DP7 A;  2W61 A;  4NUU A;  4GK0 E;  4CI3 B;  3HL6 A;  1D1A A;  2NTX A;  3O1H A;  2UXN B;  2H7V C;  3PE0 A;  2CCQ A;  3AA6 B;  4GYS A;  4FI5 A;  4YFS A;  3ZMS B;  3ESL A;  3LG7 A;  2MOZ A;  2PJQ A;  3JC6 D;  4WNK A;  2E9X A;  4DND A;  4EXT A;  2HH7 A;  4Z8X A;  4O4I E;  3V5U A;  2D0T A;  2Z6E A;  2CA5 A;  4JLE A;  1WRD A;  3N9L A;  3WAK A;  5LNK A;  4HE8 A;  3QUJ A;  1AJ3 A;  4MFR A;  1D0X A;  5LOV E;  1KK7 A;  5HWY A;  3MK7 C;  2VK9 A;  3AVR A;  3A5X A;  5LA6 E;  4PAG A;  4BA9 A;  1U4Q A;  2NWB A;  2XAG B;  2Q9Q B;  2V7J A;  4GIW A;  2LSI A;  3N2G E;  5FXZ A;  1MIY A;  4OYK A;  2KZ7 B;  3RYF E;  5J1G A;  3UTK A;  1OWA A;  1NWM X;  2CEA A;  2KIN B;  3LJC A;  3ZPO A;  2X9X A;  2MBG A;  1MMA A;  1FMV A;  4IGU A;  1S35 A;  2DCF A;  4PJM A;  2XQY A;  4O2A E;  2ZLY A;  4X20 E;  3OKQ A;  4ZS2 A;  3I0O A;  2DI4 A;  4TZ4 C;  1Z0P A;  3K3N A;  3ONX A;  1KNZ A;  1S94 A;  4I55 E;  4AKL A;  2ODU A;  3KVA A;  2JJ9 A;  3NZQ A;  1UCU A;  4G2A A;  4IE6 A;  4AQF C;  2K5B B;  5JVD E;  2K9A A;  2LSJ A;  2VB6 A;  2YU1 A;  5HXS A;  4PJL A;  1WLX A;  4QKN A;  1WR6 A;  4AKI A;  4P09 A;  3ZMU B;  2L8K A;  4PFO A;  3GN5 A;  5EK2 A;  4UVC B;  4NUV A;  5FXW A;  4EZH A;  5JH7 E;  3KV4 A;  3LBX B;  3KV9 A;  3FB2 A;  3SRZ A;  2Y48 B;  2K48 A;  3E22 E;  4H63 H;  5LHI B;  2V1D B;  4F6R C;  2WBL A;  3OYZ A;  1MNE A;  3CPZ A;  1YD8 G;  2KND A;  4PJN A;  4YJ2 E;  4DBR A;  3CVR A;  4H9O C;  1SHZ C;  4M1P A;  5FNV E;  1YW0 A;  4JEU B;  3F57 A;  5JRC B;  3N2O A;  3K3O A;  4ZI2 C;  3PU8 A;  4U72 A;  3FBL A;  4IST A;  3PUG A;  2V7M A;  3HR0 A;  1SA0 E;  3KVB A;  5A1L A;  2DWG A;  2WMN A;  3N9Q A;  2YIN A;  2KT9 A;  2DLR A;  2LOS A;  5ADX L;  3NRX A;  2NOX A;  1VRB A;  2A3D A;  5LBQ B;  4PK4 A;  3H37 A;  4HN9 A;  2LEH A;  3C4X A;  3EUH A;  2LOP A;  4PK6 A;  3F2E A;  1YKE B;  1E1H B;  1G73 A;  2E9X C;  3C4Z A;  3MXZ A;  3LK2 B;  2EHO D;  5HXC A;  2I59 A;  4BJN A;  3ETU A;  3AB3 B;  4P0A A;  4MLK A;  4ZHQ E;  3AA1 B;  5M4Y A;  4P0B A;  3ZMV B;  3VHL A;  5JQG E;  3RC3 A;  2LT3 A;  2XAH B;  4IE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...