4HWDA

Crystal structure of atbag2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
86
structure length
86
Chain Sequence
b'SSSKAISDISFQVERLAGQLSAFDTVIGKGGKVEEKNLENLMEMLMNQLVKLDAISGDGDVKLKKKMQEERLHKYVEALDLLKIKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 2
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 39
structure length 86
sequence length 86
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwdA00
5AQPB 5AQNB 5AQTB 5AQIB 1T7SA 3FZKB 3M3ZB 3FZLB 3LDQB 5AQLB 1UK5A 5AQUB 5AQSB 5AQQB 4HWFA 3FZMB 2D9DA 3A8YC 5AQRB 5AQFB 3FZHB 4HWHA 1UGOA 5AQKB 5AQVB 4HWCA 1I6ZA 1M62A 5AQGB 1HX1B 5AQHB 4HWIB 5AQMB 5AQOB 3FZFB 4HWDA 5AQJB 1M7KA
chains in the Genus database with same CATH superfamily
1T7SA 4OK0A 2LOPA 2A3DA 1ZEEA 2CXFA 5ETWA 2KLQA 4DR1T 3QOFA 4I50E 4IGUA 4MLKA 3KV9A 5LBMA 3K3OA 4DNDA 2WSSV 2KWHA 3E08A 4PK4A 3WAJA 1D0YA 5JQGE 3F31A 3C4XA 1HTJF 1S94A 4UVCB 2R6GF 5ABHA 2HPJA 3S4UA 1QSDA 1OEDB 3OPCA 2CXDA 5EK2A 3VR9A 2X0HA 2JPFA 2KINB 3HI2A 1UCUA 4OYJA 2YN6A 5ABGA 3PU8A 2ODVA 2DI4A 3RKGA 2ODUA 3SS1A 3MA9A 5CFBA 1KNPA 3OKQA 2LRLA 3ZCJA 4H63V 3RRCA 3Q9DA 4YJ3E 5JRCB 4A97A 5FVKA 3CKDA 4K0UA 2VVNA 4EB6E 3PUAA 3TLTA 2DWKA 4FI5A 1WR0A 3H3AA 2CEAA 3PUGA 2JQQA 1KK7A 2QYWA 3UUMA 3RGLA 3O1HA 2L8KA 2P9BA 3AEBA 3X1DA 5FL0A 1YD8G 4HFIA 2PBIA 4H9RC 2JMKA 4ILBA 1EZ3A 3LDQB 2H7VC 2B76A 2CXLA 4HFHA 1XMQT 4K0KT 2CBIA 3LK42 3BK9A 2VKDA 3RKOA 1W9RA 4V1Av 2X9WA 4X1IE 3RI5A 4H9QC 4MHCA 5IHYA 2BKOA 2Y6XA 4CQIA 1E7PA 3KV4A 4O4JE 5J0ZA 4EIWA 3OJAA 1YKEB 1XWMA 3JC6D 2X0YA 5EK4A 4PFOA 5LCYA 3C98B 4AKRB 2A2FX 2CBJA 3EVYA 3UUNA 2FJBA 5L4HA 1BR4A 3ZMZB 1WYBA 3AE1A 3AEAA 2VASA 3AB3B 4X20E 3FZMB 5LMNT 4PK6A 3RIAA 3ONLC 5F3JA 4LMJA 1LVFA 3NVOA 4IT4A 2ZM6T 5L3BB 5FXVA 4QH1A 3ONJA 5HEJA 1FJGT 2E8IA 4ZOLE 3A5XA 4ZEYA 3UQ4A 3RQWA 5LHGB 4DV1T 5IYZE 4YXDA 4Z91A 3HA4A 3ZC1A 5J2UE 4E7ZA 5AQMB 3H37A 4X1KE 5AQIB 4AQYT 2Y8DA 3ZC0A 1SA0E 5LGNB 2BKPA 1D1CA 4UIGA 2D0UA 2D9DA 1MMNA 4PW8A 2YU2A 2NW9A 2FUPA 2VVSA 3CQXC 1J5WA 5LG3A 4EAHA 3PUSA 1W0AA 2PFVA 2LRKA 4QXCB 1HNZT 2GK9A 4EGWA 2NW7A 4IL4A 3F57A 2KWIB 4M1PA 2FJAA 2YU1A 3CX6B 2ZMAA 3RX6A 5AQKB 2BS3A 4DR3T 4Q25A 3O1JA 5JRCA 5L3DB 4DV4T 4JI7T 3PE0A 2VB6A 3CWZB 1S35A 5ABFB 2LOSA 2UXCT 3E0ZA 4H63H 3EDUA 3QB5K 2E9XD 2W2UA 3K8PC 1HX1B 3GN5B 3E22E 3GWHA 2JMHA 3ZLIA 2WMNA 2XQ6A 4JI6T 3NRYA 4XAXB 2X9HA 5JDHA 2BS2A 2EHOA 3AE9A 4DBQA 4LF7T 4JI4T 1R8IA 2UXNB 4LF6T 1FMWA 2L9QA 1LVKA 5AQPB 3J7Yq 2C5JA 4G63A 3L09A 3AE3A 2NP9A 1D1BA 3ZMSB 2WDVA 1ZOYA 4EXTA 1VCTA 4CN1A 3AXJA 2V26A 1T98A 1VRBA 1G73A 3RIUA 3AAAB 2YDRA 4DV0T 1D0ZA 2VQFT 4DV5T 3UU3A 3W15B 5HAXA 2UUBT 2X68A 4WBNE 2LEHA 2ZM8A 3ZN1B 1XZYA 2SPCA 5DABA 2M6BA 5HEUA 3UTKA 3KFWX 5KMGP 4DBRA 3RQUA 4DV2T 2LE8A 3R6NA 2VK9A 4CZZB 4DR4T 2DL1A 2EHOC 1I94T 4ERRA 2UU9T 4HFBA 1N34T 5JDFA 4DR6T 2D5UA 1HNXT 3NZPA 5LB7B 4AKIA 3RIUC 2IUBA 2WAUA 1J1JA 4IE5A 5CA1E 4UF0B 4HFDA 5LGUB 3QC9A 3ZYLA 2HPLA 2I6HA 2RA1A 3ZN0B 1O3XA 4YHHT 1Z8UA 2XZEA 2XASB 4HEAA 3N9MA 4WBOA 4EYYR 2W67A 4GIWA 4PAGA 4DV3T 4YT0A 2OA5A 1J5ET 3N2GE 5ABEA 3KBUA 3M65A 5J2TE 1FEWA 3FZFB 3K3NA 4MALA 2K5BB 3NKZA 5KX5E 1G8XA 5AQLB 2WWVA 2UUAT 4I55E 4KX6A 5KXJA 2CMRA 4BA9A 2HH7A 5ABFA 4U74A 2VL0A 3AEEA 5HXSA 2V7KA 3IEEA 3PJAJ 2V6YB 4B3RT 2IMLA 4IE4A 1MIWA 4HWDA 2DCFA 3DTOA 5FYMA 3GN5A 2WS3A 2LHNA 5LJMA 4U2YA 3AE7A 3QUJA 2YDQA 4ZZBA 5TAOA 3MK7C 3I0OA 2I0MA 4OFZA 5JTGA 2JQ9A 4QX8B 3WAKA 4X5TA 2CM0A 4KBMB 3AA6B 2UXXB 3AAEB 2CWOA 2DHRA 3N9QA 1BR2A 2WWUA 2OLTA 4PJNA 4IE7A 3FZKB 4X62T 4B3ST 1X9BA 3KINB 2QA7A 4GK0E 2CCQA 1Y01A 5HXCA 3VHLA 3Q5DA 1ZP0A 5E0OA 5FKYA 5JH7E 3ZSTA 2CA5A 5L3FB 5AQJB 2YOEA 3EUHA 3UFEA 5DQVA 2UXBT 3BQKA 5JDMA 4HFVA 3P4RA 3I0QA 5LNKA 3PUYF 5C2TA 2XQ4A 1FMVA 4BAYB 4PK5A 3OYZA 1M7KA 2G0UA 2WP9A 1W09A 2XQ5A 4WW0A 2LSJA 2E2AA 4EZHA 5HXRA 5LBQB 2DNXA 4UF0A 2BKNA 3IHRA 3ESLA 3ONXA 2LKHA 4P09A 2XAQB 4COFA 4DUYT 2LT3A 5C8YE 5JDNA 4TV8E 5AQVB 2UUCT 3HR0A 4LMLA 2BS4A 4DUZT 1MNEA 1E2AA 2CHNA 5BMVE 1UK5A 3ZSSA 1US7B 2ZM2A 2X51A 4JI1T 1KNZA 4DIDB 2MAWA 3H3MA 4NXNT 1WYCA 3CPZA 4CXXA 1IAPA 2CPTA 4JI2T 4EEDA 4IDQA 4IE6A 1XDPA 3TLVA 3ZJ1A 4CI2B 2RPAA 2W0GA 2MPKA 5LJNA 2W61A 2H88A 3ZCIA 1OEDE 3JADA 2XPKA 4YSZA 1YXRA 2XQYA 4IIJE 4AKGA 3F2EA 1IZNB 4IREA 3LK2B 3ZYKA 2XAGB 3DJBA 4CN6A 3BQLA 4F8HA 4U72A 3I9YA 1I6ZA 2ES0A 4JYAT 2VKHA 3IA3A 5JDLA 5LP6E 3ZMTB 3NZQA 3FBLA 4LFAT 5LYJE 2WDRA 4QWNB 3GA8A 4U7IA 3A8YC 2Q9QB 3GMIA 4AKLA 3UU4A 3WI3A 1QUUA 2X9XA 4LF5T 4H9PC 2VQET 3C4ZA 1XNQT 2CRBA 4IHJE 5AQNB 3P4PA 3ZMUB 4KUMB 4AKHA 2IHR1 4TNVA 2EHOD 1MMDA 1NAFA 4ZI2D 4LF8T 1NENA 2OV9A 3AVRA 3SRZA 2W4XA 3C64A 4I4TE 2WU2A 1U5PA 2NTYA 3AA0B 3QK6A 2CLYB 4HE8A 3P4SA 2J1DG 4PNIA 4LFBT 1KFYA 2X0LB 4WNKA 1XMOT 3DP7A 4TWDA 3FBZA 2E5VA 1OEDA 2LM2A 2LLYA 5L4EA 3HKBE 5JDQA 2E9XB 3PUXF 5AQOB 4ILCA 2V5CA 2A9UA 3N9OA 3P4QA 4IE0A 4U2ZA 2XJ7A 3MXZA 3AE4A 4KMCA 3FZHB 2XM2A 1UGOA 1KEYA 1VOMA 5H6QB 4KI0F 3LJCA 2BBHA 5L47A 1IJ6A 4H9OC 4DV7T 4QXHB 4X64T 2WMOA 1QLBA 2AE9A 3Q5XA 4QXBB 5CB4E 2XY8B 5FXXA 5FNVE 1ZV4X 2ACZA 1YW0A 1OEDC 4XBFB 4U33A 1IJ5A 4UVBB 3V5SA 4TN7B 1BR1A 2KT9A 3RLFF 4AQGA 4YY3T 5LHIB 4HKAA 1HG5A 4XZCA 4ZS3A 3PJAA 3PV0F 4JEHB 4JBWF 3NWIA 3O1IA 4KHPT 2BVMA 2BG9B 4U7YA 4HWCA 3UU8A 2LKGA 3CMLA 3MACA 4JI5T 3UUXB 4A98A 4TNWA 4TX5A 5HYAA 2V1DB 5AQUB 3PUZF 1WCRA 5FVLA 4LFCT 2H3RA 2WY2A 3ZYMA 3AA7B 4ADZA 4B3MT 2Q9QA 2RP4A 3ETVA 1UX4A 2V8SV 2N9DA 3HKCE 1MMAA 2CWYA 2XAHB 2KMFA 3L39A 3UUBA 3O9XA 4TV9E 2QVAA 5FY7A 1KNRA 5HEGA 4ZI2C 1OXZA 2V7JA 5L2LA 4O2BE 1UURA 3VRBA 2IIUA 1MIVA 4C90A 4HGAA 2XAFB 4B3TT 1T72A 5AQQB 4HWFA 5JDGA 5F5WA 3L3PA 5EZYE 2V6XA 3EHZA 3VR8A 4ZI7E 5JVDE 3OYXA 4O2AE 5HCJA 5JR9B 3ZPOA 1XNRT 2KSRA 4JUYA 2BG9E 2Y48B 3IF8B 4FJOA 4TUYE 2AXDS 4ZS2A 4X66T 2ZM0A 4P0AA 5HXHA 1MMGA 5ADXL 4PFPA 1U4QA 1L0VA 1HS7A 4GK5E 5AQGB 4WYVA 2VWAA 1NEKA 4CI1B 1NWMX 1DU2A 4YHJA 2W63A 1HF8A 4JI3T 3RH3A 2CLYC 1MIYA 4B6XA 4DVDA 3PU3A 4YSYA 2PJQA 4JI0T 4DR2T 3JAFA 3KV6A 4U31A 3K3QC 2HN2A 1GQEA 2XQAA 5FMNA 3UQ7A 2IC6A 3C4WA 4BJMA 4BJNA 5DJQC 4KHZF 4IL9A 3LBXB 4YTMA 2X66A 2E5LT 5AQTB 5FL1A 4F6RC 2N2NA 1UUSA 5HCMA 4JI8T 2BZBA 3N2KE 5FY1A 1IBKT 2NR4A 2K9AA 2LM9A 1D0XA 2BG9A 2K48A 2NOXA 3RYFE 2LSIA 4CXYA 5M4YA 4TWHA 4IDPA 2V7LA 2N1GA 4EEBA 3AE2A 3G06A 4HWHA 3P8CD 2MOZA 4P1NA 2NWBA 2IDOB 3FHNA 4JV5T 2JQKA 4DMVA 4O8SA 2YK0A 5CA0E 4H9SE 1HR0T 4DV6T 3ZT6A 3RIFA 1HNWT 3NRXA 5C3JA 4KP3C 4UXNB 1X79A 2LSGA 5AFUL 1KF6A 4O4LE 4O4IE 2H89A 1WRDA 3AECA 5LHHB 3MJXA 2W66A 2XQ3A 4UEMA 4YJ2E 3ANWB 2BG9C 4GKKT 4U3CA 4ZXLA 5IUXA 3PDYA 2K24A 2PG8A 2MTQA 2A72A 2I59A 5JR9A 2WBLA 3CVRA 3N9NA 3UFGA 4MBQA 2C5IT 1CUNA 5EK3A 1XDOA 3PUWF 4AISA 4ZZCA 2V7IA 3C50A 2FBWA 4NIQA 4QKNA 4ZI3D 3FB2A 3AA1B 1HX8A 2BBJA 3SFEA 1SE7A 3AEDA 3J9X1 4UV9B 4UV8B 5DQWA 2QGSA 4HWIB 2IAKA 4LF4T 3Q2MA 5HEHA 4DR5T 3ZMVB 1Z0PA 2VKJA 2LSKA 4ASKA 2WU5A 4UELA 4L0RA 4PJMA 3T1HT 1M62A 2XM1A 2C5KT 2D2SA 3RYCE 3ZT7A 4YTPA 1Y64B 3SFDA 2V6YA 3ZEFB 4PJJA 3HL6A 2W00A 2V5DA 3U3IA 2UXDT 4QH4A 5FP3A 3RRWA 5JR9C 3B57A 3KBTA 5LA6E 3LFMA 2IW5B 2LHRA 3LBXA 3SWHA 3PTRB 3N2OA 2EHOB 3AE6A 2LJLA 5HWYA 4P0BA 3AE5A 4YSXA 2IC9A 1IBLT 2WZHA 3RC8A 4CN4A 3N9LA 3FXDB 5L3CB 3KDSE 5F8PA 3ETUA 1LRZA 5BR8T 3ZJ2A 1H7CA 3EI0A 5HEOA 3AXJB 3FZLB 2XHEB 3T8OA 2WB5A 5GONE 1JNZA 3P7IA 2JRKA 4IDOA 2PTFA 2YKSA 1FIOA 1W0BA 3KVAA 4NPPA 1JNRA 4OHFA 1AJ3A 1HG2A 2K3WA 1T8BA 4DMWA 2J47A 3RYIE 4X1YE 5LOVE 1YQ3A 2WDQA 3M3ZB 2F4VT 3JAEA 2WQYA 3RHWA 2M67A 3RYHE 3EAMA 3CK6A 4OYKA 4AXPA 4YLHA 1YQ4A 3MKDA 4NUUA 4UR9A 4WZXA 3Q5WA 3RPUA 5FY0A 1IBMT 2QRXA 1MNDA 3ANWA 2HN1A 5L3EB 2J62A 2YEVC 2KNDA 3FXEB 4HFCA 1ZHCA 3AVSA 4EYUA 4ISSA 2X9YA 4C91A 4AQFA 2Q9QD 3CIRA 3I9WA 3EABA 3R84B 4UVAB 2ACXA 3MZKB 4ZI3C 4HN9A 3PURA 4I0UA 3QB5A 2MYSA 4NXMT 1HCIA 2JJ9A 3VKGA 2XQ7A 3TLUA 3TKLB 5HXEA 3ZT5A 3Q5EA 4AIUA 3B13A 2DLRA 4GOUA 3UULA 5L3GB 3NBXX 1V9DA 1HFAA 1OWAA 2VURA 4QX7B 2VL8A 3PUVF 5JREA 2WZIA 3UU6A 4YFSA 3T1YT 2C0SA 3I1AA 4QH5A 4N78D 2J4GA 4I43B 4ILUA 3PUQA 4AQFC 3LSVA 4DO0A 3CX7B 3RF1A 2YDSA 1VCSA 3LG7A 4EZ4A 4O4HE 2YINA 5AQSB 3P50A 5LGTB 3B5MA 2KXPB 2XQ8A 4LMKA 4CXWA 3ZKRA 3D0TA 5CGMA 5AQHB 2L3LA 2DWGA 5A1LA 2Z6EA 3KV5A 1N33T 2KZ7B 3N9PA 5HWXA 4ZHQE 3V5UA 3VKHA 5H6RB 3O4XE 2WCAA 2X67A 4JLEA 3JC6C 4TZ4C 3C51A 2NTXA 4E7SA 2ZLYA 3BQIA 2VKOA 5IWAT 2FJDA 4YTNA 2FJEA 2HHHT 2XSAA 4Z90A 2NW8A 1B7TA 2MBGA 5AQFB 3A7MA 1WLXA 3AEFA 1ZKEA 4ISTA 1UX5A 2JQHA 5LG4A 4OX9T 3AE8A 3SOLA 2XQ9A 4CI3B 3AEGA 3L8RA 2XAJB 3U78A 3CX8B 4ILAA 3ABVA 2CHOA 3HKDE 3JCFA 4H9NC 2E9XA 2V7MA 2Q9QC 4NUVA 3VRAA 4MFRA 5LXTE 1CHUA 5CJ5A 4Z8XA 4GYSA 3OTOT 1LKXA 1WR6A 2XTLA 3OVUA 3TLSA 4HFEA 5LMUT 4EOZB 4X65T 4LF9T 2BDEA 4IDNA 4G2AA 5FXWA 2W62A 4L5GA 2XSBA 2H7OA 1WFDA 4DR7T 4PJLA 1N32T 3N5LA 1BR0A 3UU5A 4A5XA 2E9XC 2CE7A 3OBVE 4J2CA 5KDMC 3UT5E 4AI6A 1E1HB 4QHOA 1D1AA 4L9IA 4GYRA 3CQCB 3HKEE 3EDVA 3QNUA 2BVLA 5J1GA 4ANJA 2JIWA 3K1SA 4A56A 5AQRB 2M6IA 4JEUB 3TLWA 4GKJT 3KVBA 3P4WA 2B1EA 4TWFA 3AAIA 1SHZC 1YKHB 4IDZA 4HTEA 4EV6A 3CQGB 2XUEA 3VU7H 2WM9A 3IBPA 2LSYA 5FXZA 1SUMB 1N36T 3LK3B 2D0TA 3RC3A
chains in the Genus database with same CATH topology
5AQPB 5AQNB 5AQTB 5AQIB 1T7SA 3FZKB 3M3ZB 3FZLB 3LDQB 5AQLB 1UK5A 5AQUB 5AQSB 5AQQB 4HWFA 3FZMB 2D9DA 3A8YC 5AQRB 5AQFB 3FZHB 4HWHA 1UGOA 5AQKB 5AQVB 4HWCA 1I6ZA 1M62A 5AQGB 1HX1B 5AQHB 4HWIB 5AQMB 5AQOB 3FZFB 4HWDA 5AQJB 1M7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQP B;  5AQN B;  5AQT B;  5AQI B;  1T7S A;  3FZK B;  3M3Z B;  3FZL B;  3LDQ B;  5AQL B;  1UK5 A;  5AQU B;  5AQS B;  5AQQ B;  4HWF A;  3FZM B;  2D9D A;  3A8Y C;  5AQR B;  5AQF B;  3FZH B;  4HWH A;  1UGO A;  5AQK B;  5AQV B;  4HWC A;  1I6Z A;  1M62 A;  5AQG B;  1HX1 B;  5AQH B;  4HWI B;  5AQM B;  5AQO B;  3FZF B;  4HWD A;  5AQJ B;  1M7K A; 
#chains in the Genus database with same CATH topology
 1T7S A;  4OK0 A;  2LOP A;  2A3D A;  1ZEE A;  2CXF A;  5ETW A;  2KLQ A;  4DR1 T;  3QOF A;  4I50 E;  4IGU A;  4MLK A;  3KV9 A;  5LBM A;  3K3O A;  4DND A;  2WSS V;  2KWH A;  3E08 A;  4PK4 A;  3WAJ A;  1D0Y A;  5JQG E;  3F31 A;  3C4X A;  1HTJ F;  1S94 A;  4UVC B;  2R6G F;  5ABH A;  2HPJ A;  3S4U A;  1QSD A;  1OED B;  3OPC A;  2CXD A;  5EK2 A;  3VR9 A;  2X0H A;  2JPF A;  2KIN B;  3HI2 A;  1UCU A;  4OYJ A;  2YN6 A;  5ABG A;  3PU8 A;  2ODV A;  2DI4 A;  3RKG A;  2ODU A;  3SS1 A;  3MA9 A;  5CFB A;  1KNP A;  3OKQ A;  2LRL A;  3ZCJ A;  4H63 V;  3RRC A;  3Q9D A;  4YJ3 E;  5JRC B;  4A97 A;  5FVK A;  3CKD A;  4K0U A;  2VVN A;  4EB6 E;  3PUA A;  3TLT A;  2DWK A;  4FI5 A;  1WR0 A;  3H3A A;  2CEA A;  3PUG A;  2JQQ A;  1KK7 A;  2QYW A;  3UUM A;  3RGL A;  3O1H A;  2L8K A;  2P9B A;  3AEB A;  3X1D A;  5FL0 A;  1YD8 G;  4HFI A;  2PBI A;  4H9R C;  2JMK A;  4ILB A;  1EZ3 A;  3LDQ B;  2H7V C;  2B76 A;  2CXL A;  4HFH A;  1XMQ T;  4K0K T;  2CBI A;  3LK4 2;  3BK9 A;  2VKD A;  3RKO A;  1W9R A;  4V1A v;  2X9W A;  4X1I E;  3RI5 A;  4H9Q C;  4MHC A;  5IHY A;  2BKO A;  2Y6X A;  4CQI A;  1E7P A;  3KV4 A;  4O4J E;  5J0Z A;  4EIW A;  3OJA A;  1YKE B;  1XWM A;  3JC6 D;  2X0Y A;  5EK4 A;  4PFO A;  5LCY A;  3C98 B;  4AKR B;  2A2F X;  2CBJ A;  3EVY A;  3UUN A;  2FJB A;  5L4H A;  1BR4 A;  3ZMZ B;  1WYB A;  3AE1 A;  3AEA A;  2VAS A;  3AB3 B;  4X20 E;  3FZM B;  5LMN T;  4PK6 A;  3RIA A;  3ONL C;  5F3J A;  4LMJ A;  1LVF A;  3NVO A;  4IT4 A;  2ZM6 T;  5L3B B;  5FXV A;  4QH1 A;  3ONJ A;  5HEJ A;  1FJG T;  2E8I A;  4ZOL E;  3A5X A;  4ZEY A;  3UQ4 A;  3RQW A;  5LHG B;  4DV1 T;  5IYZ E;  4YXD A;  4Z91 A;  3HA4 A;  3ZC1 A;  5J2U E;  4E7Z A;  5AQM B;  3H37 A;  4X1K E;  5AQI B;  4AQY T;  2Y8D A;  3ZC0 A;  1SA0 E;  5LGN B;  2BKP A;  1D1C A;  4UIG A;  2D0U A;  2D9D A;  1MMN A;  4PW8 A;  2YU2 A;  2NW9 A;  2FUP A;  2VVS A;  3CQX C;  1J5W A;  5LG3 A;  4EAH A;  3PUS A;  1W0A A;  2PFV A;  2LRK A;  4QXC B;  1HNZ T;  2GK9 A;  4EGW A;  2NW7 A;  4IL4 A;  3F57 A;  2KWI B;  4M1P A;  2FJA A;  2YU1 A;  3CX6 B;  2ZMA A;  3RX6 A;  5AQK B;  2BS3 A;  4DR3 T;  4Q25 A;  3O1J A;  5JRC A;  5L3D B;  4DV4 T;  4JI7 T;  3PE0 A;  2VB6 A;  3CWZ B;  1S35 A;  5ABF B;  2LOS A;  2UXC T;  3E0Z A;  4H63 H;  3EDU A;  3QB5 K;  2E9X D;  2W2U A;  3K8P C;  1HX1 B;  3GN5 B;  3E22 E;  3GWH A;  2JMH A;  3ZLI A;  2WMN A;  2XQ6 A;  4JI6 T;  3NRY A;  4XAX B;  2X9H A;  5JDH A;  2BS2 A;  2EHO A;  3AE9 A;  4DBQ A;  4LF7 T;  4JI4 T;  1R8I A;  2UXN B;  4LF6 T;  1FMW A;  2L9Q A;  1LVK A;  5AQP B;  3J7Y q;  2C5J A;  4G63 A;  3L09 A;  3AE3 A;  2NP9 A;  1D1B A;  3ZMS B;  2WDV A;  1ZOY A;  4EXT A;  1VCT A;  4CN1 A;  3AXJ A;  2V26 A;  1T98 A;  1VRB A;  1G73 A;  3RIU A;  3AAA B;  2YDR A;  4DV0 T;  1D0Z A;  2VQF T;  4DV5 T;  3UU3 A;  3W15 B;  5HAX A;  2UUB T;  2X68 A;  4WBN E;  2LEH A;  2ZM8 A;  3ZN1 B;  1XZY A;  2SPC A;  5DAB A;  2M6B A;  5HEU A;  3UTK A;  3KFW X;  5KMG P;  4DBR A;  3RQU A;  4DV2 T;  2LE8 A;  3R6N A;  2VK9 A;  4CZZ B;  4DR4 T;  2DL1 A;  2EHO C;  1I94 T;  4ERR A;  2UU9 T;  4HFB A;  1N34 T;  5JDF A;  4DR6 T;  2D5U A;  1HNX T;  3NZP A;  5LB7 B;  4AKI A;  3RIU C;  2IUB A;  2WAU A;  1J1J A;  4IE5 A;  5CA1 E;  4UF0 B;  4HFD A;  5LGU B;  3QC9 A;  3ZYL A;  2HPL A;  2I6H A;  2RA1 A;  3ZN0 B;  1O3X A;  4YHH T;  1Z8U A;  2XZE A;  2XAS B;  4HEA A;  3N9M A;  4WBO A;  4EYY R;  2W67 A;  4GIW A;  4PAG A;  4DV3 T;  4YT0 A;  2OA5 A;  1J5E T;  3N2G E;  5ABE A;  3KBU A;  3M65 A;  5J2T E;  1FEW A;  3FZF B;  3K3N A;  4MAL A;  2K5B B;  3NKZ A;  5KX5 E;  1G8X A;  5AQL B;  2WWV A;  2UUA T;  4I55 E;  4KX6 A;  5KXJ A;  2CMR A;  4BA9 A;  2HH7 A;  5ABF A;  4U74 A;  2VL0 A;  3AEE A;  5HXS A;  2V7K A;  3IEE A;  3PJA J;  2V6Y B;  4B3R T;  2IML A;  4IE4 A;  1MIW A;  4HWD A;  2DCF A;  3DTO A;  5FYM A;  3GN5 A;  2WS3 A;  2LHN A;  5LJM A;  4U2Y A;  3AE7 A;  3QUJ A;  2YDQ A;  4ZZB A;  5TAO A;  3MK7 C;  3I0O A;  2I0M A;  4OFZ A;  5JTG A;  2JQ9 A;  4QX8 B;  3WAK A;  4X5T A;  2CM0 A;  4KBM B;  3AA6 B;  2UXX B;  3AAE B;  2CWO A;  2DHR A;  3N9Q A;  1BR2 A;  2WWU A;  2OLT A;  4PJN A;  4IE7 A;  3FZK B;  4X62 T;  4B3S T;  1X9B A;  3KIN B;  2QA7 A;  4GK0 E;  2CCQ A;  1Y01 A;  5HXC A;  3VHL A;  3Q5D A;  1ZP0 A;  5E0O A;  5FKY A;  5JH7 E;  3ZST A;  2CA5 A;  5L3F B;  5AQJ B;  2YOE A;  3EUH A;  3UFE A;  5DQV A;  2UXB T;  3BQK A;  5JDM A;  4HFV A;  3P4R A;  3I0Q A;  5LNK A;  3PUY F;  5C2T A;  2XQ4 A;  1FMV A;  4BAY B;  4PK5 A;  3OYZ A;  1M7K A;  2G0U A;  2WP9 A;  1W09 A;  2XQ5 A;  4WW0 A;  2LSJ A;  2E2A A;  4EZH A;  5HXR A;  5LBQ B;  2DNX A;  4UF0 A;  2BKN A;  3IHR A;  3ESL A;  3ONX A;  2LKH A;  4P09 A;  2XAQ B;  4COF A;  4DUY T;  2LT3 A;  5C8Y E;  5JDN A;  4TV8 E;  5AQV B;  2UUC T;  3HR0 A;  4LML A;  2BS4 A;  4DUZ T;  1MNE A;  1E2A A;  2CHN A;  5BMV E;  1UK5 A;  3ZSS A;  1US7 B;  2ZM2 A;  2X51 A;  4JI1 T;  1KNZ A;  4DID B;  2MAW A;  3H3M A;  4NXN T;  1WYC A;  3CPZ A;  4CXX A;  1IAP A;  2CPT A;  4JI2 T;  4EED A;  4IDQ A;  4IE6 A;  1XDP A;  3TLV A;  3ZJ1 A;  4CI2 B;  2RPA A;  2W0G A;  2MPK A;  5LJN A;  2W61 A;  2H88 A;  3ZCI A;  1OED E;  3JAD A;  2XPK A;  4YSZ A;  1YXR A;  2XQY A;  4IIJ E;  4AKG A;  3F2E A;  1IZN B;  4IRE A;  3LK2 B;  3ZYK A;  2XAG B;  3DJB A;  4CN6 A;  3BQL A;  4F8H A;  4U72 A;  3I9Y A;  1I6Z A;  2ES0 A;  4JYA T;  2VKH A;  3IA3 A;  5JDL A;  5LP6 E;  3ZMT B;  3NZQ A;  3FBL A;  4LFA T;  5LYJ E;  2WDR A;  4QWN B;  3GA8 A;  4U7I A;  3A8Y C;  2Q9Q B;  3GMI A;  4AKL A;  3UU4 A;  3WI3 A;  1QUU A;  2X9X A;  4LF5 T;  4H9P C;  2VQE T;  3C4Z A;  1XNQ T;  2CRB A;  4IHJ E;  5AQN B;  3P4P A;  3ZMU B;  4KUM B;  4AKH A;  2IHR 1;  4TNV A;  2EHO D;  1MMD A;  1NAF A;  4ZI2 D;  4LF8 T;  1NEN A;  2OV9 A;  3AVR A;  3SRZ A;  2W4X A;  3C64 A;  4I4T E;  2WU2 A;  1U5P A;  2NTY A;  3AA0 B;  3QK6 A;  2CLY B;  4HE8 A;  3P4S A;  2J1D G;  4PNI A;  4LFB T;  1KFY A;  2X0L B;  4WNK A;  1XMO T;  3DP7 A;  4TWD A;  3FBZ A;  2E5V A;  1OED A;  2LM2 A;  2LLY A;  5L4E A;  3HKB E;  5JDQ A;  2E9X B;  3PUX F;  5AQO B;  4ILC A;  2V5C A;  2A9U A;  3N9O A;  3P4Q A;  4IE0 A;  4U2Z A;  2XJ7 A;  3MXZ A;  3AE4 A;  4KMC A;  3FZH B;  2XM2 A;  1UGO A;  1KEY A;  1VOM A;  5H6Q B;  4KI0 F;  3LJC A;  2BBH A;  5L47 A;  1IJ6 A;  4H9O C;  4DV7 T;  4QXH B;  4X64 T;  2WMO A;  1QLB A;  2AE9 A;  3Q5X A;  4QXB B;  5CB4 E;  2XY8 B;  5FXX A;  5FNV E;  1ZV4 X;  2ACZ A;  1YW0 A;  1OED C;  4XBF B;  4U33 A;  1IJ5 A;  4UVB B;  3V5S A;  4TN7 B;  1BR1 A;  2KT9 A;  3RLF F;  4AQG A;  4YY3 T;  5LHI B;  4HKA A;  1HG5 A;  4XZC A;  4ZS3 A;  3PJA A;  3PV0 F;  4JEH B;  4JBW F;  3NWI A;  3O1I A;  4KHP T;  2BVM A;  2BG9 B;  4U7Y A;  4HWC A;  3UU8 A;  2LKG A;  3CML A;  3MAC A;  4JI5 T;  3UUX B;  4A98 A;  4TNW A;  4TX5 A;  5HYA A;  2V1D B;  5AQU B;  3PUZ F;  1WCR A;  5FVL A;  4LFC T;  2H3R A;  2WY2 A;  3ZYM A;  3AA7 B;  4ADZ A;  4B3M T;  2Q9Q A;  2RP4 A;  3ETV A;  1UX4 A;  2V8S V;  2N9D A;  3HKC E;  1MMA A;  2CWY A;  2XAH B;  2KMF A;  3L39 A;  3UUB A;  3O9X A;  4TV9 E;  2QVA A;  5FY7 A;  1KNR A;  5HEG A;  4ZI2 C;  1OXZ A;  2V7J A;  5L2L A;  4O2B E;  1UUR A;  3VRB A;  2IIU A;  1MIV A;  4C90 A;  4HGA A;  2XAF B;  4B3T T;  1T72 A;  5AQQ B;  4HWF A;  5JDG A;  5F5W A;  3L3P A;  5EZY E;  2V6X A;  3EHZ A;  3VR8 A;  4ZI7 E;  5JVD E;  3OYX A;  4O2A E;  5HCJ A;  5JR9 B;  3ZPO A;  1XNR T;  2KSR A;  4JUY A;  2BG9 E;  2Y48 B;  3IF8 B;  4FJO A;  4TUY E;  2AXD S;  4ZS2 A;  4X66 T;  2ZM0 A;  4P0A A;  5HXH A;  1MMG A;  5ADX L;  4PFP A;  1U4Q A;  1L0V A;  1HS7 A;  4GK5 E;  5AQG B;  4WYV A;  2VWA A;  1NEK A;  4CI1 B;  1NWM X;  1DU2 A;  4YHJ A;  2W63 A;  1HF8 A;  4JI3 T;  3RH3 A;  2CLY C;  1MIY A;  4B6X A;  4DVD A;  3PU3 A;  4YSY A;  2PJQ A;  4JI0 T;  4DR2 T;  3JAF A;  3KV6 A;  4U31 A;  3K3Q C;  2HN2 A;  1GQE A;  2XQA A;  5FMN A;  3UQ7 A;  2IC6 A;  3C4W A;  4BJM A;  4BJN A;  5DJQ C;  4KHZ F;  4IL9 A;  3LBX B;  4YTM A;  2X66 A;  2E5L T;  5AQT B;  5FL1 A;  4F6R C;  2N2N A;  1UUS A;  5HCM A;  4JI8 T;  2BZB A;  3N2K E;  5FY1 A;  1IBK T;  2NR4 A;  2K9A A;  2LM9 A;  1D0X A;  2BG9 A;  2K48 A;  2NOX A;  3RYF E;  2LSI A;  4CXY A;  5M4Y A;  4TWH A;  4IDP A;  2V7L A;  2N1G A;  4EEB A;  3AE2 A;  3G06 A;  4HWH A;  3P8C D;  2MOZ A;  4P1N A;  2NWB A;  2IDO B;  3FHN A;  4JV5 T;  2JQK A;  4DMV A;  4O8S A;  2YK0 A;  5CA0 E;  4H9S E;  1HR0 T;  4DV6 T;  3ZT6 A;  3RIF A;  1HNW T;  3NRX A;  5C3J A;  4KP3 C;  4UXN B;  1X79 A;  2LSG A;  5AFU L;  1KF6 A;  4O4L E;  4O4I E;  2H89 A;  1WRD A;  3AEC A;  5LHH B;  3MJX A;  2W66 A;  2XQ3 A;  4UEM A;  4YJ2 E;  3ANW B;  2BG9 C;  4GKK T;  4U3C A;  4ZXL A;  5IUX A;  3PDY A;  2K24 A;  2PG8 A;  2MTQ A;  2A72 A;  2I59 A;  5JR9 A;  2WBL A;  3CVR A;  3N9N A;  3UFG A;  4MBQ A;  2C5I T;  1CUN A;  5EK3 A;  1XDO A;  3PUW F;  4AIS A;  4ZZC A;  2V7I A;  3C50 A;  2FBW A;  4NIQ A;  4QKN A;  4ZI3 D;  3FB2 A;  3AA1 B;  1HX8 A;  2BBJ A;  3SFE A;  1SE7 A;  3AED A;  3J9X 1;  4UV9 B;  4UV8 B;  5DQW A;  2QGS A;  4HWI B;  2IAK A;  4LF4 T;  3Q2M A;  5HEH A;  4DR5 T;  3ZMV B;  1Z0P A;  2VKJ A;  2LSK A;  4ASK A;  2WU5 A;  4UEL A;  4L0R A;  4PJM A;  3T1H T;  1M62 A;  2XM1 A;  2C5K T;  2D2S A;  3RYC E;  3ZT7 A;  4YTP A;  1Y64 B;  3SFD A;  2V6Y A;  3ZEF B;  4PJJ A;  3HL6 A;  2W00 A;  2V5D A;  3U3I A;  2UXD T;  4QH4 A;  5FP3 A;  3RRW A;  5JR9 C;  3B57 A;  3KBT A;  5LA6 E;  3LFM A;  2IW5 B;  2LHR A;  3LBX A;  3SWH A;  3PTR B;  3N2O A;  2EHO B;  3AE6 A;  2LJL A;  5HWY A;  4P0B A;  3AE5 A;  4YSX A;  2IC9 A;  1IBL T;  2WZH A;  3RC8 A;  4CN4 A;  3N9L A;  3FXD B;  5L3C B;  3KDS E;  5F8P A;  3ETU A;  1LRZ A;  5BR8 T;  3ZJ2 A;  1H7C A;  3EI0 A;  5HEO A;  3AXJ B;  3FZL B;  2XHE B;  3T8O A;  2WB5 A;  5GON E;  1JNZ A;  3P7I A;  2JRK A;  4IDO A;  2PTF A;  2YKS A;  1FIO A;  1W0B A;  3KVA A;  4NPP A;  1JNR A;  4OHF A;  1AJ3 A;  1HG2 A;  2K3W A;  1T8B A;  4DMW A;  2J47 A;  3RYI E;  4X1Y E;  5LOV E;  1YQ3 A;  2WDQ A;  3M3Z B;  2F4V T;  3JAE A;  2WQY A;  3RHW A;  2M67 A;  3RYH E;  3EAM A;  3CK6 A;  4OYK A;  4AXP A;  4YLH A;  1YQ4 A;  3MKD A;  4NUU A;  4UR9 A;  4WZX A;  3Q5W A;  3RPU A;  5FY0 A;  1IBM T;  2QRX A;  1MND A;  3ANW A;  2HN1 A;  5L3E B;  2J62 A;  2YEV C;  2KND A;  3FXE B;  4HFC A;  1ZHC A;  3AVS A;  4EYU A;  4ISS A;  2X9Y A;  4C91 A;  4AQF A;  2Q9Q D;  3CIR A;  3I9W A;  3EAB A;  3R84 B;  4UVA B;  2ACX A;  3MZK B;  4ZI3 C;  4HN9 A;  3PUR A;  4I0U A;  3QB5 A;  2MYS A;  4NXM T;  1HCI A;  2JJ9 A;  3VKG A;  2XQ7 A;  3TLU A;  3TKL B;  5HXE A;  3ZT5 A;  3Q5E A;  4AIU A;  3B13 A;  2DLR A;  4GOU A;  3UUL A;  5L3G B;  3NBX X;  1V9D A;  1HFA A;  1OWA A;  2VUR A;  4QX7 B;  2VL8 A;  3PUV F;  5JRE A;  2WZI A;  3UU6 A;  4YFS A;  3T1Y T;  2C0S A;  3I1A A;  4QH5 A;  4N78 D;  2J4G A;  4I43 B;  4ILU A;  3PUQ A;  4AQF C;  3LSV A;  4DO0 A;  3CX7 B;  3RF1 A;  2YDS A;  1VCS A;  3LG7 A;  4EZ4 A;  4O4H E;  2YIN A;  5AQS B;  3P50 A;  5LGT B;  3B5M A;  2KXP B;  2XQ8 A;  4LMK A;  4CXW A;  3ZKR A;  3D0T A;  5CGM A;  5AQH B;  2L3L A;  2DWG A;  5A1L A;  2Z6E A;  3KV5 A;  1N33 T;  2KZ7 B;  3N9P A;  5HWX A;  4ZHQ E;  3V5U A;  3VKH A;  5H6R B;  3O4X E;  2WCA A;  2X67 A;  4JLE A;  3JC6 C;  4TZ4 C;  3C51 A;  2NTX A;  4E7S A;  2ZLY A;  3BQI A;  2VKO A;  5IWA T;  2FJD A;  4YTN A;  2FJE A;  2HHH T;  2XSA A;  4Z90 A;  2NW8 A;  1B7T A;  2MBG A;  5AQF B;  3A7M A;  1WLX A;  3AEF A;  1ZKE A;  4IST A;  1UX5 A;  2JQH A;  5LG4 A;  4OX9 T;  3AE8 A;  3SOL A;  2XQ9 A;  4CI3 B;  3AEG A;  3L8R A;  2XAJ B;  3U78 A;  3CX8 B;  4ILA A;  3ABV A;  2CHO A;  3HKD E;  3JCF A;  4H9N C;  2E9X A;  2V7M A;  2Q9Q C;  4NUV A;  3VRA A;  4MFR A;  5LXT E;  1CHU A;  5CJ5 A;  4Z8X A;  4GYS A;  3OTO T;  1LKX A;  1WR6 A;  2XTL A;  3OVU A;  3TLS A;  4HFE A;  5LMU T;  4EOZ B;  4X65 T;  4LF9 T;  2BDE A;  4IDN A;  4G2A A;  5FXW A;  2W62 A;  4L5G A;  2XSB A;  2H7O A;  1WFD A;  4DR7 T;  4PJL A;  1N32 T;  3N5L A;  1BR0 A;  3UU5 A;  4A5X A;  2E9X C;  2CE7 A;  3OBV E;  4J2C A;  5KDM C;  3UT5 E;  4AI6 A;  1E1H B;  4QHO A;  1D1A A;  4L9I A;  4GYR A;  3CQC B;  3HKE E;  3EDV A;  3QNU A;  2BVL A;  5J1G A;  4ANJ A;  2JIW A;  3K1S A;  4A56 A;  5AQR B;  2M6I A;  4JEU B;  3TLW A;  4GKJ T;  3KVB A;  3P4W A;  2B1E A;  4TWF A;  3AAI A;  1SHZ C;  1YKH B;  4IDZ A;  4HTE A;  4EV6 A;  3CQG B;  2XUE A;  3VU7 H;  2WM9 A;  3IBP A;  2LSY A;  5FXZ A;  1SUM B;  1N36 T;  3LK3 B;  2D0T A;  3RC3 A; 
#chains in the Genus database with same CATH homology
 5AQP B;  5AQN B;  5AQT B;  5AQI B;  1T7S A;  3FZK B;  3M3Z B;  3FZL B;  3LDQ B;  5AQL B;  1UK5 A;  5AQU B;  5AQS B;  5AQQ B;  4HWF A;  3FZM B;  2D9D A;  3A8Y C;  5AQR B;  5AQF B;  3FZH B;  4HWH A;  1UGO A;  5AQK B;  5AQV B;  4HWC A;  1I6Z A;  1M62 A;  5AQG B;  1HX1 B;  5AQH B;  4HWI B;  5AQM B;  5AQO B;  3FZF B;  4HWD A;  5AQJ B;  1M7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...