4HWDA

Crystal structure of atbag2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
86
structure length
86
Chain Sequence
SSSKAISDISFQVERLAGQLSAFDTVIGKGGKVEEKNLENLMEMLMNQLVKLDAISGDGDVKLKKKMQEERLHKYVEALDLLKIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 2
total genus 39
structure length 86
sequence length 86
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwdA00
5AQRB 3FZHB 4HWFA 3LDQB 4HWIB 1M7KA 3M3ZB 1UGOA 1T7SA 5AQMB 1HX1B 5AQKB 4HWDA 1M62A 5AQIB 5AQSB 3FZMB 5AQQB 2D9DA 5AQTB 4HWHA 3FZKB 5AQPB 1UK5A 5AQHB 5AQLB 3A8YC 5AQUB 5AQNB 5AQFB 5AQGB 3FZFB 5AQOB 3FZLB 5AQVB 5AQJB 1I6ZA 4HWCA
chains in the Genus database with same CATH superfamily
3N2OA 4DR5T 4JI3T 5AQRB 1UUSA 3KDSE 4J2CA 3RQWA 4I0UA 5HEGA 4AKRB 3PURA 2BG9A 2XAFB 5FP3A 4DR7T 2C5IT 3I0OA 1OEDE 2NP9A 2N9DA 3FHNA 4H9OC 3UFEA 1LKXA 2WBLA 3FBLA 3P7IA 4EB6E 2DI4A 2XJ7A 3JCFA 2BVMA 2YU1A 4YTMA 2XQ8A 3RGLA 3VR8A 3OPCA 1KEYA 4I43B 2FJBA 1UX4A 3QB5K 2CE7A 2WQYA 4NIQA 3QK6A 3IBPA 3UUBA 4MALA 3WI3A 2WDVA 2E9XB 2V7JA 2V7LA 2VWAA 3OKQA 2MPKA 2W2UA 3KV9A 4JV5T 3UQ4A 4KMCA 4NXMT 4KBMB 2W61A 4KP3C 5L2LA 4ERRA 2CWOA 5JR9C 3NWIA 2W0GA 2IIUA 5AQJB 3Q5XA 2ACZA 2LKHA 3N9OA 2ZM2A 3P4SA 2XUEA 1H7CA 4HGAA 4YTNA 5FL1A 1BR1A 2DHRA 2N2NA 3RRWA 4BA9A 3ZT6A 4JI0T 3WAJA 2XQ9A 3LK2B 2XSAA 3F57A 2H7OA 1J5ET 2XQ3A 2I59A 3AE8A 3CQCB 3K1SA 4IL9A 4JEUB 3U3IA 2XQYA 4ZHQE 1IAPA 2D5UA 3J9X1 2XQ5A 3N9LA 4N78D 5FXXA 2X9WA 4PJMA 4I55E 3OTOT 4QXBB 2WU5A 4PK5A 2ZLYA 3B5MA 2RP4A 5JDFA 2IC9A 2BS2A 3AEDA 4Z91A 4O4HE 1DU2A 1KNRA 4K0UA 3L39A 3V5UA 2LM9A 1XZYA 3ZPOA 2JQQA 3F31A 3GN5B 5AQGB 2XM1A 2VL8A 3UU5A 4ZZBA 1XNQT 4FJOA 4DNDA 1I6ZA 5C3JA 3LBXB 4P09A 1T72A 4V1Av 4OX9T 1WR6A 4HFHA 1E2AA 1FMWA 1NAFA 1S94A 2EHOA 1MNEA 4H63V 4U74A 4QKNA 4CXWA 4U7YA 4AKHA 1U5PA 4GK0E 5FY0A 1HNXT 3M3ZB 1D1AA 2BG9B 2HN2A 2IAKA 4KHZF 4PK6A 4TV8E 5CA0E 3LK3B 5J2UE 4DR1T 5HXSA 5JH7E 4LFAT 3RC8A 4XBFB 1U4QA 1MIYA 2JQHA 2CXFA 3C98B 4IE5A 1KF6A 5FKYA 4MLKA 3S4UA 3AEBA 4KX6A 2HN1A 3A7MA 4QH4A 2M6BA 4QXCB 3ZLIA 4PNIA 3AAIA 4JUYA 5FY7A 3UULA 4A97A 3RQUA 3CWZB 3R84B 4B3MT 3PUXF 5DQWA 1HTJF 5GONE 2DL1A 2LSYA 2YDQA 2K3WA 2A3DA 2E9XA 2FJAA 3HKCE 3N2GE 3NZPA 5F3JA 4IDQA 3FZFB 4CI1B 3O1HA 3FBZA 4PFOA 5HEHA 4QX8B 4X1YE 3BQLA 2C0SA 4EAHA 4DV6T 5LJNA 5BMVE 5LBMA 3ZMSB 3RIFA 2E5LT 3AA1B 5L3DB 3LDQB 3MJXA 4TWFA 2X9XA 5LB7B 1QLBA 3FB2A 4F6RC 2BDEA 2ES0A 5JR9B 4O8SA 3AXJA 5L4HA 4GYRA 4LMKA 1IZNB 4F8HA 1D1CA 3UFGA 5HEUA 3IA3A 1XNRT 2YU2A 4X20E 2E9XD 5AQKB 3BQIA 2VASA 3N9QA 2BKNA 3B57A 2Q9QC 3ETUA 5LG4A 2P9BA 1SA0E 2A9UA 3FZKB 2V6YA 2DWKA 3FXDB 2JIWA 4PAGA 4DO0A 1J5WA 2QGSA 3ZEFB 5LGTB 4CN4A 2QRXA 3B13A 2LOSA 3A8YC 4ZI2D 3M65A 4U7IA 1GQEA 2HPLA 4LF6T 4O2AE 5AQNB 2LLYA 2WU2A 1OEDB 4OHFA 3AEFA 2MYSA 2DLRA 3PUQA 2V6YB 3OJAA 3FZLB 4L5GA 4PFPA 4U72A 4WBNE 2KZ7B 5CA1E 5CFBA 1FJGT 4YSYA 4JI1T 4YHJA 3AB3B 5IHYA 5LG3A 1XMOT 4U31A 4G63A 5JDMA 2A2FX 2JQ9A 3EI0A 4TZ4C 2WAUA 3ONJA 4BJMA 2CA5A 2H3RA 3H3AA 4YJ2E 1OEDC 2EHOB 2IMLA 4YSZA 4UVAB 3ETVA 2MBGA 3AEAA 1W0BA 2D0TA 3RF1A 3AAAB 1IBLT 4ANJA 4DIDB 3MK7C 2VKDA 3AEEA 4AKIA 3PV0F 1HG2A 2V7MA 2YK0A 3RKOA 1KNZA 2VURA 2XAJB 3MA9A 4EEBA 4OYJA 3QNUA 4EYYR 4O4LE 2K48A 1ZV4X 4YJ3E 5LOVE 3VRBA 1YXRA 2F4VT 1T8BA 2CEAA 3MXZA 4UELA 4AQGA 2X0HA 1OXZA 4XAXB 2WMOA 4H9SE 3BK9A 3PUSA 4L0RA 2CLYC 3K8PC 3FZHB 4YT0A 2LOPA 3AE1A 4YLHA 5ETWA 2LM2A 5FXWA 2XM2A 1VRBA 3JAFA 5H6QB 2VKJA 4CQIA 5IUXA 3CPZA 4UEMA 3T1HT 2UUAT 1Z8UA 4MBQA 5F5WA 2PBIA 1Y01A 2VVNA 1T7SA 2UXXB 3N9NA 3HKEE 4WYVA 3CVRA 1YW0A 1ZEEA 2OA5A 3KBTA 2YDSA 4HFEA 4WW0A 3N2KE 2CXLA 4AQFC 2CRBA 4DV0T 3ZYKA 4LFCT 3O1JA 4YFSA 5HCMA 2CBJA 3N9PA 5H6RB 1NWMX 2X68A 2IW5B 1QUUA 4DR2T 4WZXA 2NTYA 3TLSA 4O2BE 1SE7A 5AQUB 3ZKRA 5TAOA 4UVCB 4GOUA 2V6XA 4DV4T 2N1GA 3FXEB 2J47A 4ZXLA 5FXVA 5AQVB 1ZHCA 2XZEA 3AE3A 3E08A 4X5TA 3SFDA 1KFYA 2GK9A 2QA7A 2H7VC 2WY2A 1D0XA 3E0ZA 4H9NC 4MFRA 1XDPA 2JMKA 4HEAA 4O4IE 3PE0A 4TWDA 2NR4A 3ZMVB 1WCRA 3P4QA 3L3PA 4AXPA 5A1LA 1NEKA 1M7KA 3N9MA 4AI6A 1UCUA 2FJDA 3T8OA 5ABHA 1UGOA 5LMUT 2CMRA 2KMFA 3LSVA 2WSSV 3CX7B 1MMAA 5HCJA 1L0VA 2XQ7A 3TLVA 1HF8A 4KI0F 4DR6T 2VKOA 4HWHA 1CUNA 2XQ4A 3UU4A 3ZT7A 2HH7A 2NW8A 3PUAA 4U33A 4EOZB 3PUYF 3SOLA 1HS7A 2Q9QD 3X1DA 3C4ZA 2MAWA 3ZN1B 2E8IA 2XTLA 2G0UA 1IJ6A 2KNDA 4G2AA 1N34T 2KLQA 3AECA 3QUJA 5LHGB 2KINB 2IUBA 2LE8A 1LVKA 4IHJE 3NKZA 3EDUA 5F8PA 1IBMT 2BG9E 5EK2A 3TLWA 2E2AA 4IDPA 4HE8A 5M4YA 2KT9A 3IF8B 3C4WA 4TX5A 5JDNA 3CQGB 3LFMA 4HFCA 2M6IA 4AISA 1LRZA 3V5SA 4YTPA 3EUHA 3Q2MA 1WFDA 4PJJA 4UF0B 2YKSA 4P1NA 2IC6A 2MTQA 3FZMB 3IEEA 2QVAA 2BKOA 2Q9QB 3NZQA 5JVDE 4JI4T 4X65T 3C51A 5HXCA 4NPPA 4B3RT 5CJ5A 2YOEA 4DV7T 3NBXX 2J1DG 3RLFF 5L4EA 2LT3A 2WMNA 3A5XA 3CK6A 3R6NA 2MOZA 2AE9A 4IL4A 1XMQT 2W00A 3UU3A 2L3LA 2UXNB 3RYCE 2A72A 3O9XA 2ZM0A 4U3CA 2X9YA 3SWHA 4HWFA 4ZI2C 3HKDE 2J62A 4ILBA 5C8YE 3L09A 2L8KA 2YDRA 5LBQB 3UUXB 4LF5T 3ZJ1A 2FUPA 4UV8B 4DVDA 3UQ7A 2KWIB 3ANWB 4OFZA 4EEDA 4E7SA 2WWUA 1Y64B 2IHR1 5IYZE 4LF9T 3VKGA 4YXDA 4HFBA 2WP9A 3T1YT 3AE7A 3MKDA 2WB5A 3L8RA 2I0MA 3PUWF 5AQQB 2UXBT 3PU3A 3PUZF 5AQTB 2LHRA 4AKLA 2JMHA 2NWBA 3ANWA 3O4XE 5EK4A 4CXYA 1JNRA 2YN6A 2JRKA 2V5DA 3PUGA 2J4GA 3EABA 3CX6B 4HFDA 3GA8A 1J1JA 5E0OA 3MACA 3RPUA 4EZ4A 1FIOA 2W67A 3KVBA 4HFIA 3ZN0B 2LRLA 4EGWA 4IT4A 1X79A 1ZP0A 5FNVE 4ZI3D 1FEWA 5LHIB 3MZKB 3AEGA 3RI5A 5LCYA 4U2ZA 4DUZT 3AXJB 4H9RC 5ABGA 2JQKA 3OYZA 4LF7T 4YY3T 5FVKA 5HWYA 5KX5E 3H37A 3P4PA 2HPJA 2BKPA 3TLTA 3VKHA 2SPCA 1HG5A 4C90A 1BR0A 2CHOA 3HKBE 4WBOA 4DMWA 3P4RA 2V7IA 1D1BA 2XHEB 2H88A 2PFVA 4JBWF 1T98A 4ZS2A 1M62A 2CBIA 4HWDA 4LMJA 5AQSB 4HKAA 2LJLA 3RKGA 2D9DA 2PTFA 3AVRA 3IHRA 1SUMB 3LG7A 3QC9A 3LJCA 5L3CB 5LMNT 2UUCT 3AVSA 5FXZA 2LRKA 4B6XA 3C50A 2FBWA 2AXDS 3QOFA 4X1IE 3AA6B 5CB4E 2W62A 3P50A 2JPFA 4EYUA 3OBVE 4TN7B 3W15B 3RC3A 4U2YA 2DNXA 4IE6A 1V9DA 3KV4A 4IDNA 4H9QC 3JADA 4PJNA 5AQOB 3ESLA 3WAKA 5EK3A 4KHPT 2CWYA 2C5JA 3ZCIA 1B7TA 3EHZA 4IIJE 4IE0A 1N36T 5JRCA 4UVBB 2XAQB 3UUMA 3NRYA 4ISSA 4AQFA 4CI3B 5JQGE 1WYBA 3SS1A 2CPTA 3AA0B 4AIUA 3KV5A 3CMLA 2VK9A 2KXPB 5KMGP 4ILCA 4GIWA 5ABFB 1YKHB 4L9IA 3ABVA 1O3XA 4NXNT 1HCIA 4DMVA 3PJAA 4QH5A 2BBHA 2XAGB 1VCSA 5AQMB 4EZHA 4A98A 3TKLB 3ONXA 4JLEA 3ZMZB 4GYSA 2CHNA 5FY1A 3RIUA 4EIWA 5L47A 3EAMA 2DCFA 3CX8B 3ZCJA 3UTKA 4ASKA 5ABFA 2WCAA 2NOXA 5AQHB 2V8SV 3ZMUB 2X0LB 3OYXA 4P0BA 2H89A 4YSXA 5JDQA 2EHOD 4AQYT 2M67A 2E5VA 3Q5DA 4I50E 2RA1A 4IDOA 3K3OA 3BQKA 4LF8T 4B3TT 4TWHA 3K3NA 4DBRA 4DV3T 2K24A 5L3EB 3QB5A 2OLTA 3SFEA 3H3MA 2BG9C 2V7KA 3E22E 3PJAJ 5HYAA 4JI5T 1I94T 3EVYA 3CQXC 4KUMB 2YINA 4ZEYA 2Y48B 2WWVA 1D0YA 2WS3A 3AE5A 4HWIB 4C91A 5ABEA 3TLUA 3VU7H 2LSIA 4GKJT 1HNWT 3DJBA 2X0YA 3I9YA 2NW9A 3ZJ2A 1OWAA 2V5CA 5JDLA 5BR8T 2IDOB 4ZI3C 2WZHA 3HR0A 2W66A 4X64T 4DR3T 5ADXL 5AQIB 3AA7B 3CKDA 4QHOA 3RH3A 2HHHT 3KFWX 3AAEB 4ADZA 2V1DB 1MMNA 2XAHB 3RIAA 1YQ3A 2DWGA 5CGMA 2XSBA 4QH1A 5FYMA 1E7PA 1W0AA 5JR9A 4CN6A 4JI6T 3C4XA 1S35A 4ILUA 4HFVA 2BZBA 1XDOA 2PG8A 2NTXA 2ZMAA 2K5BB 2XY8B 4BJNA 3F2EA 4CZZB 3ZYLA 2PJQA 5JTGA 4BAYB 1QSDA 1N33T 5JRCB 4ZS3A 5HXHA 3EDVA 5HAXA 2ACXA 3PU8A 4IDZA 4ZZCA 4IGUA 2VKHA 5LNKA 4PW8A 4A56A 5HWXA 3RRCA 1W9RA 2CLYB 3CIRA 3Q5WA 4NUVA 5J2TE 1VOMA 3HA4A 4ISTA 3JC6C 3KV6A 3AE9A 4TNWA 5L3FB 1HFAA 2BS3A 4UV9B 1R8IA 3HI2A 5DJQC 4O4JE 3PTRB 4TUYE 4TV9E 4CI2B 4ZOLE 2UXCT 5JREA 3RYHE 5L3BB 5JDHA 1NENA 5LHHB 3U78A 1G73A 1MMGA 2ZM8A 5C2TA 1Z0PA 3Q9DA 4HN9A 2Y6XA 5L3GB 2WM9A 2WDQA 4JI7T 2RPAA 4OYKA 4H9PC 4DV2T 4B3ST 2LKGA 2LSJA 4JYAT 4HWCA 3UU6A 3G06A 3I0QA 2EHOC 3HL6A 3C64A 3PDYA 3JAEA 3SRZA 5J0ZA 3RYFE 3VRAA 4DUYT 5AFUL 1W09A 1HR0T 3GN5A 1UURA 3NVOA 1SHZC 2JJ9A 4IE4A 5LYJE 2WDRA 1ZKEA 5DQVA 1WRDA 3KINB 3RX6A 5IWAT 4LF4T 2Q9QA 3UU8A 3OVUA 4Z8XA 3UUNA 1HX1B 4JI2T 1YKEB 2UXDT 4K0KT 1BR4A 4XZCA 3GWHA 2B1EA 5AQPB 2K9AA 1WYCA 4LMLA 5KXJA 2VL0A 2XQAA 2BS4A 3RYIE 5HEOA 3ZSSA 2E9XC 2D2SA 2LHNA 3PUVF 3D0TA 1FMVA 3AE2A 4ILAA 4UR9A 3VR9A 4TNVA 5KDMC 1EZ3A 1UX5A 2Y8DA 4JEHB 5LGUB 1N32T 4UF0A 4DBQA 3P8CD 2X51A 4COFA 2NW7A 1D0ZA 3LBXA 4DV5T 4WNKA 2CXDA 3AE4A 3ZC0A 3N5LA 3ZMTB 4P0AA 2ODVA 2W63A 1MIVA 1X9BA 2QYWA 3ONLC 5EZYE 3VHLA 5LGNB 4YHHT 2BVLA 4GK5E 2FJEA 1BR2A 4Q25A 2YEVC 4MHCA 2L9QA 4QWNB 5FVLA 2X66A 4I4TE 4CXXA 1E1HB 5LJMA 2VVSA 4PK4A 2LEHA 4EV6A 3J7Yq 1HX8A 3GMIA 4NUUA 2XPKA 5DABA 2XASB 3AE6A 2CM0A 3DP7A 3P4WA 3Q5EA 2I6HA 5FL0A 3UT5E 1LVFA 1MMDA 3KVAA 4IREA 4X1KE 4DV1T 2OV9A 5AQLB 2UUBT 4IE7A 2V26A 4PJLA 3KBUA 2Z6EA 1G8XA 1KK7A 3JC6D 4UXNB 3RHWA 5AQFB 2VQFT 3DTOA 3ZC1A 3I9WA 4Z90A 2WZIA 2LSGA 2VB6A 1YQ4A 2W4XA 4M1PA 1MNDA 2C5KT 2XQ6A 5FMNA 5JDGA 4X66T 4QXHB 2X67A 4JI8T 4OK0A 2KWHA 4QX7B 2X9HA 3ZYMA 1OEDA 1KNPA 4HTEA 1VCTA 4LFBT 2ODUA 1CHUA 5J1GA 4ZI7E 1IBKT 2CCQA 2VQET 1AJ3A 2ZM6T 4FI5A 1XWMA 3I1AA 4E7ZA 2BBJA 4UIGA 3RIUC 3ZT5A 3ZSTA 4AKGA 2R6GF 4A5XA 5HEJA 3NRXA 4X62T 1MIWA 4EXTA 3LK42 1IJ5A 1UK5A 1JNZA 4CN1A 1WR0A 3K3QC 5LP6E 5LXTE 2KSRA 1HNZT 5LA6E 1YD8G 4DR4T 2D0UA 4GKKT 2B76A 3O1IA 5HXEA 1US7B 4H63H 2UU9T 2LSKA 1ZOYA 1WLXA 5HXRA
chains in the Genus database with same CATH topology
5AQRB 3FZHB 4HWFA 3LDQB 4HWIB 1M7KA 3M3ZB 1UGOA 1T7SA 5AQMB 1HX1B 5AQKB 4HWDA 1M62A 5AQIB 5AQSB 3FZMB 5AQQB 2D9DA 5AQTB 4HWHA 3FZKB 5AQPB 1UK5A 5AQHB 5AQLB 3A8YC 5AQUB 5AQNB 5AQFB 5AQGB 3FZFB 5AQOB 3FZLB 5AQVB 5AQJB 1I6ZA 4HWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQR B;  3FZH B;  4HWF A;  3LDQ B;  4HWI B;  1M7K A;  3M3Z B;  1UGO A;  1T7S A;  5AQM B;  1HX1 B;  5AQK B;  4HWD A;  1M62 A;  5AQI B;  5AQS B;  3FZM B;  5AQQ B;  2D9D A;  5AQT B;  4HWH A;  3FZK B;  5AQP B;  1UK5 A;  5AQH B;  5AQL B;  3A8Y C;  5AQU B;  5AQN B;  5AQF B;  5AQG B;  3FZF B;  5AQO B;  3FZL B;  5AQV B;  5AQJ B;  1I6Z A;  4HWC A; 
#chains in the Genus database with same CATH topology
 3N2O A;  4DR5 T;  4JI3 T;  5AQR B;  1UUS A;  3KDS E;  4J2C A;  3RQW A;  4I0U A;  5HEG A;  4AKR B;  3PUR A;  2BG9 A;  2XAF B;  5FP3 A;  4DR7 T;  2C5I T;  3I0O A;  1OED E;  2NP9 A;  2N9D A;  3FHN A;  4H9O C;  3UFE A;  1LKX A;  2WBL A;  3FBL A;  3P7I A;  4EB6 E;  2DI4 A;  2XJ7 A;  3JCF A;  2BVM A;  2YU1 A;  4YTM A;  2XQ8 A;  3RGL A;  3VR8 A;  3OPC A;  1KEY A;  4I43 B;  2FJB A;  1UX4 A;  3QB5 K;  2CE7 A;  2WQY A;  4NIQ A;  3QK6 A;  3IBP A;  3UUB A;  4MAL A;  3WI3 A;  2WDV A;  2E9X B;  2V7J A;  2V7L A;  2VWA A;  3OKQ A;  2MPK A;  2W2U A;  3KV9 A;  4JV5 T;  3UQ4 A;  4KMC A;  4NXM T;  4KBM B;  2W61 A;  4KP3 C;  5L2L A;  4ERR A;  2CWO A;  5JR9 C;  3NWI A;  2W0G A;  2IIU A;  5AQJ B;  3Q5X A;  2ACZ A;  2LKH A;  3N9O A;  2ZM2 A;  3P4S A;  2XUE A;  1H7C A;  4HGA A;  4YTN A;  5FL1 A;  1BR1 A;  2DHR A;  2N2N A;  3RRW A;  4BA9 A;  3ZT6 A;  4JI0 T;  3WAJ A;  2XQ9 A;  3LK2 B;  2XSA A;  3F57 A;  2H7O A;  1J5E T;  2XQ3 A;  2I59 A;  3AE8 A;  3CQC B;  3K1S A;  4IL9 A;  4JEU B;  3U3I A;  2XQY A;  4ZHQ E;  1IAP A;  2D5U A;  3J9X 1;  2XQ5 A;  3N9L A;  4N78 D;  5FXX A;  2X9W A;  4PJM A;  4I55 E;  3OTO T;  4QXB B;  2WU5 A;  4PK5 A;  2ZLY A;  3B5M A;  2RP4 A;  5JDF A;  2IC9 A;  2BS2 A;  3AED A;  4Z91 A;  4O4H E;  1DU2 A;  1KNR A;  4K0U A;  3L39 A;  3V5U A;  2LM9 A;  1XZY A;  3ZPO A;  2JQQ A;  3F31 A;  3GN5 B;  5AQG B;  2XM1 A;  2VL8 A;  3UU5 A;  4ZZB A;  1XNQ T;  4FJO A;  4DND A;  1I6Z A;  5C3J A;  3LBX B;  4P09 A;  1T72 A;  4V1A v;  4OX9 T;  1WR6 A;  4HFH A;  1E2A A;  1FMW A;  1NAF A;  1S94 A;  2EHO A;  1MNE A;  4H63 V;  4U74 A;  4QKN A;  4CXW A;  4U7Y A;  4AKH A;  1U5P A;  4GK0 E;  5FY0 A;  1HNX T;  3M3Z B;  1D1A A;  2BG9 B;  2HN2 A;  2IAK A;  4KHZ F;  4PK6 A;  4TV8 E;  5CA0 E;  3LK3 B;  5J2U E;  4DR1 T;  5HXS A;  5JH7 E;  4LFA T;  3RC8 A;  4XBF B;  1U4Q A;  1MIY A;  2JQH A;  2CXF A;  3C98 B;  4IE5 A;  1KF6 A;  5FKY A;  4MLK A;  3S4U A;  3AEB A;  4KX6 A;  2HN1 A;  3A7M A;  4QH4 A;  2M6B A;  4QXC B;  3ZLI A;  4PNI A;  3AAI A;  4JUY A;  5FY7 A;  3UUL A;  4A97 A;  3RQU A;  3CWZ B;  3R84 B;  4B3M T;  3PUX F;  5DQW A;  1HTJ F;  5GON E;  2DL1 A;  2LSY A;  2YDQ A;  2K3W A;  2A3D A;  2E9X A;  2FJA A;  3HKC E;  3N2G E;  3NZP A;  5F3J A;  4IDQ A;  3FZF B;  4CI1 B;  3O1H A;  3FBZ A;  4PFO A;  5HEH A;  4QX8 B;  4X1Y E;  3BQL A;  2C0S A;  4EAH A;  4DV6 T;  5LJN A;  5BMV E;  5LBM A;  3ZMS B;  3RIF A;  2E5L T;  3AA1 B;  5L3D B;  3LDQ B;  3MJX A;  4TWF A;  2X9X A;  5LB7 B;  1QLB A;  3FB2 A;  4F6R C;  2BDE A;  2ES0 A;  5JR9 B;  4O8S A;  3AXJ A;  5L4H A;  4GYR A;  4LMK A;  1IZN B;  4F8H A;  1D1C A;  3UFG A;  5HEU A;  3IA3 A;  1XNR T;  2YU2 A;  4X20 E;  2E9X D;  5AQK B;  3BQI A;  2VAS A;  3N9Q A;  2BKN A;  3B57 A;  2Q9Q C;  3ETU A;  5LG4 A;  2P9B A;  1SA0 E;  2A9U A;  3FZK B;  2V6Y A;  2DWK A;  3FXD B;  2JIW A;  4PAG A;  4DO0 A;  1J5W A;  2QGS A;  3ZEF B;  5LGT B;  4CN4 A;  2QRX A;  3B13 A;  2LOS A;  3A8Y C;  4ZI2 D;  3M65 A;  4U7I A;  1GQE A;  2HPL A;  4LF6 T;  4O2A E;  5AQN B;  2LLY A;  2WU2 A;  1OED B;  4OHF A;  3AEF A;  2MYS A;  2DLR A;  3PUQ A;  2V6Y B;  3OJA A;  3FZL B;  4L5G A;  4PFP A;  4U72 A;  4WBN E;  2KZ7 B;  5CA1 E;  5CFB A;  1FJG T;  4YSY A;  4JI1 T;  4YHJ A;  3AB3 B;  5IHY A;  5LG3 A;  1XMO T;  4U31 A;  4G63 A;  5JDM A;  2A2F X;  2JQ9 A;  3EI0 A;  4TZ4 C;  2WAU A;  3ONJ A;  4BJM A;  2CA5 A;  2H3R A;  3H3A A;  4YJ2 E;  1OED C;  2EHO B;  2IML A;  4YSZ A;  4UVA B;  3ETV A;  2MBG A;  3AEA A;  1W0B A;  2D0T A;  3RF1 A;  3AAA B;  1IBL T;  4ANJ A;  4DID B;  3MK7 C;  2VKD A;  3AEE A;  4AKI A;  3PV0 F;  1HG2 A;  2V7M A;  2YK0 A;  3RKO A;  1KNZ A;  2VUR A;  2XAJ B;  3MA9 A;  4EEB A;  4OYJ A;  3QNU A;  4EYY R;  4O4L E;  2K48 A;  1ZV4 X;  4YJ3 E;  5LOV E;  3VRB A;  1YXR A;  2F4V T;  1T8B A;  2CEA A;  3MXZ A;  4UEL A;  4AQG A;  2X0H A;  1OXZ A;  4XAX B;  2WMO A;  4H9S E;  3BK9 A;  3PUS A;  4L0R A;  2CLY C;  3K8P C;  3FZH B;  4YT0 A;  2LOP A;  3AE1 A;  4YLH A;  5ETW A;  2LM2 A;  5FXW A;  2XM2 A;  1VRB A;  3JAF A;  5H6Q B;  2VKJ A;  4CQI A;  5IUX A;  3CPZ A;  4UEM A;  3T1H T;  2UUA T;  1Z8U A;  4MBQ A;  5F5W A;  2PBI A;  1Y01 A;  2VVN A;  1T7S A;  2UXX B;  3N9N A;  3HKE E;  4WYV A;  3CVR A;  1YW0 A;  1ZEE A;  2OA5 A;  3KBT A;  2YDS A;  4HFE A;  4WW0 A;  3N2K E;  2CXL A;  4AQF C;  2CRB A;  4DV0 T;  3ZYK A;  4LFC T;  3O1J A;  4YFS A;  5HCM A;  2CBJ A;  3N9P A;  5H6R B;  1NWM X;  2X68 A;  2IW5 B;  1QUU A;  4DR2 T;  4WZX A;  2NTY A;  3TLS A;  4O2B E;  1SE7 A;  5AQU B;  3ZKR A;  5TAO A;  4UVC B;  4GOU A;  2V6X A;  4DV4 T;  2N1G A;  3FXE B;  2J47 A;  4ZXL A;  5FXV A;  5AQV B;  1ZHC A;  2XZE A;  3AE3 A;  3E08 A;  4X5T A;  3SFD A;  1KFY A;  2GK9 A;  2QA7 A;  2H7V C;  2WY2 A;  1D0X A;  3E0Z A;  4H9N C;  4MFR A;  1XDP A;  2JMK A;  4HEA A;  4O4I E;  3PE0 A;  4TWD A;  2NR4 A;  3ZMV B;  1WCR A;  3P4Q A;  3L3P A;  4AXP A;  5A1L A;  1NEK A;  1M7K A;  3N9M A;  4AI6 A;  1UCU A;  2FJD A;  3T8O A;  5ABH A;  1UGO A;  5LMU T;  2CMR A;  2KMF A;  3LSV A;  2WSS V;  3CX7 B;  1MMA A;  5HCJ A;  1L0V A;  2XQ7 A;  3TLV A;  1HF8 A;  4KI0 F;  4DR6 T;  2VKO A;  4HWH A;  1CUN A;  2XQ4 A;  3UU4 A;  3ZT7 A;  2HH7 A;  2NW8 A;  3PUA A;  4U33 A;  4EOZ B;  3PUY F;  3SOL A;  1HS7 A;  2Q9Q D;  3X1D A;  3C4Z A;  2MAW A;  3ZN1 B;  2E8I A;  2XTL A;  2G0U A;  1IJ6 A;  2KND A;  4G2A A;  1N34 T;  2KLQ A;  3AEC A;  3QUJ A;  5LHG B;  2KIN B;  2IUB A;  2LE8 A;  1LVK A;  4IHJ E;  3NKZ A;  3EDU A;  5F8P A;  1IBM T;  2BG9 E;  5EK2 A;  3TLW A;  2E2A A;  4IDP A;  4HE8 A;  5M4Y A;  2KT9 A;  3IF8 B;  3C4W A;  4TX5 A;  5JDN A;  3CQG B;  3LFM A;  4HFC A;  2M6I A;  4AIS A;  1LRZ A;  3V5S A;  4YTP A;  3EUH A;  3Q2M A;  1WFD A;  4PJJ A;  4UF0 B;  2YKS A;  4P1N A;  2IC6 A;  2MTQ A;  3FZM B;  3IEE A;  2QVA A;  2BKO A;  2Q9Q B;  3NZQ A;  5JVD E;  4JI4 T;  4X65 T;  3C51 A;  5HXC A;  4NPP A;  4B3R T;  5CJ5 A;  2YOE A;  4DV7 T;  3NBX X;  2J1D G;  3RLF F;  5L4E A;  2LT3 A;  2WMN A;  3A5X A;  3CK6 A;  3R6N A;  2MOZ A;  2AE9 A;  4IL4 A;  1XMQ T;  2W00 A;  3UU3 A;  2L3L A;  2UXN B;  3RYC E;  2A72 A;  3O9X A;  2ZM0 A;  4U3C A;  2X9Y A;  3SWH A;  4HWF A;  4ZI2 C;  3HKD E;  2J62 A;  4ILB A;  5C8Y E;  3L09 A;  2L8K A;  2YDR A;  5LBQ B;  3UUX B;  4LF5 T;  3ZJ1 A;  2FUP A;  4UV8 B;  4DVD A;  3UQ7 A;  2KWI B;  3ANW B;  4OFZ A;  4EED A;  4E7S A;  2WWU A;  1Y64 B;  2IHR 1;  5IYZ E;  4LF9 T;  3VKG A;  4YXD A;  4HFB A;  2WP9 A;  3T1Y T;  3AE7 A;  3MKD A;  2WB5 A;  3L8R A;  2I0M A;  3PUW F;  5AQQ B;  2UXB T;  3PU3 A;  3PUZ F;  5AQT B;  2LHR A;  4AKL A;  2JMH A;  2NWB A;  3ANW A;  3O4X E;  5EK4 A;  4CXY A;  1JNR A;  2YN6 A;  2JRK A;  2V5D A;  3PUG A;  2J4G A;  3EAB A;  3CX6 B;  4HFD A;  3GA8 A;  1J1J A;  5E0O A;  3MAC A;  3RPU A;  4EZ4 A;  1FIO A;  2W67 A;  3KVB A;  4HFI A;  3ZN0 B;  2LRL A;  4EGW A;  4IT4 A;  1X79 A;  1ZP0 A;  5FNV E;  4ZI3 D;  1FEW A;  5LHI B;  3MZK B;  3AEG A;  3RI5 A;  5LCY A;  4U2Z A;  4DUZ T;  3AXJ B;  4H9R C;  5ABG A;  2JQK A;  3OYZ A;  4LF7 T;  4YY3 T;  5FVK A;  5HWY A;  5KX5 E;  3H37 A;  3P4P A;  2HPJ A;  2BKP A;  3TLT A;  3VKH A;  2SPC A;  1HG5 A;  4C90 A;  1BR0 A;  2CHO A;  3HKB E;  4WBO A;  4DMW A;  3P4R A;  2V7I A;  1D1B A;  2XHE B;  2H88 A;  2PFV A;  4JBW F;  1T98 A;  4ZS2 A;  1M62 A;  2CBI A;  4HWD A;  4LMJ A;  5AQS B;  4HKA A;  2LJL A;  3RKG A;  2D9D A;  2PTF A;  3AVR A;  3IHR A;  1SUM B;  3LG7 A;  3QC9 A;  3LJC A;  5L3C B;  5LMN T;  2UUC T;  3AVS A;  5FXZ A;  2LRK A;  4B6X A;  3C50 A;  2FBW A;  2AXD S;  3QOF A;  4X1I E;  3AA6 B;  5CB4 E;  2W62 A;  3P50 A;  2JPF A;  4EYU A;  3OBV E;  4TN7 B;  3W15 B;  3RC3 A;  4U2Y A;  2DNX A;  4IE6 A;  1V9D A;  3KV4 A;  4IDN A;  4H9Q C;  3JAD A;  4PJN A;  5AQO B;  3ESL A;  3WAK A;  5EK3 A;  4KHP T;  2CWY A;  2C5J A;  3ZCI A;  1B7T A;  3EHZ A;  4IIJ E;  4IE0 A;  1N36 T;  5JRC A;  4UVB B;  2XAQ B;  3UUM A;  3NRY A;  4ISS A;  4AQF A;  4CI3 B;  5JQG E;  1WYB A;  3SS1 A;  2CPT A;  3AA0 B;  4AIU A;  3KV5 A;  3CML A;  2VK9 A;  2KXP B;  5KMG P;  4ILC A;  4GIW A;  5ABF B;  1YKH B;  4L9I A;  3ABV A;  1O3X A;  4NXN T;  1HCI A;  4DMV A;  3PJA A;  4QH5 A;  2BBH A;  2XAG B;  1VCS A;  5AQM B;  4EZH A;  4A98 A;  3TKL B;  3ONX A;  4JLE A;  3ZMZ B;  4GYS A;  2CHN A;  5FY1 A;  3RIU A;  4EIW A;  5L47 A;  3EAM A;  2DCF A;  3CX8 B;  3ZCJ A;  3UTK A;  4ASK A;  5ABF A;  2WCA A;  2NOX A;  5AQH B;  2V8S V;  3ZMU B;  2X0L B;  3OYX A;  4P0B A;  2H89 A;  4YSX A;  5JDQ A;  2EHO D;  4AQY T;  2M67 A;  2E5V A;  3Q5D A;  4I50 E;  2RA1 A;  4IDO A;  3K3O A;  3BQK A;  4LF8 T;  4B3T T;  4TWH A;  3K3N A;  4DBR A;  4DV3 T;  2K24 A;  5L3E B;  3QB5 A;  2OLT A;  3SFE A;  3H3M A;  2BG9 C;  2V7K A;  3E22 E;  3PJA J;  5HYA A;  4JI5 T;  1I94 T;  3EVY A;  3CQX C;  4KUM B;  2YIN A;  4ZEY A;  2Y48 B;  2WWV A;  1D0Y A;  2WS3 A;  3AE5 A;  4HWI B;  4C91 A;  5ABE A;  3TLU A;  3VU7 H;  2LSI A;  4GKJ T;  1HNW T;  3DJB A;  2X0Y A;  3I9Y A;  2NW9 A;  3ZJ2 A;  1OWA A;  2V5C A;  5JDL A;  5BR8 T;  2IDO B;  4ZI3 C;  2WZH A;  3HR0 A;  2W66 A;  4X64 T;  4DR3 T;  5ADX L;  5AQI B;  3AA7 B;  3CKD A;  4QHO A;  3RH3 A;  2HHH T;  3KFW X;  3AAE B;  4ADZ A;  2V1D B;  1MMN A;  2XAH B;  3RIA A;  1YQ3 A;  2DWG A;  5CGM A;  2XSB A;  4QH1 A;  5FYM A;  1E7P A;  1W0A A;  5JR9 A;  4CN6 A;  4JI6 T;  3C4X A;  1S35 A;  4ILU A;  4HFV A;  2BZB A;  1XDO A;  2PG8 A;  2NTX A;  2ZMA A;  2K5B B;  2XY8 B;  4BJN A;  3F2E A;  4CZZ B;  3ZYL A;  2PJQ A;  5JTG A;  4BAY B;  1QSD A;  1N33 T;  5JRC B;  4ZS3 A;  5HXH A;  3EDV A;  5HAX A;  2ACX A;  3PU8 A;  4IDZ A;  4ZZC A;  4IGU A;  2VKH A;  5LNK A;  4PW8 A;  4A56 A;  5HWX A;  3RRC A;  1W9R A;  2CLY B;  3CIR A;  3Q5W A;  4NUV A;  5J2T E;  1VOM A;  3HA4 A;  4IST A;  3JC6 C;  3KV6 A;  3AE9 A;  4TNW A;  5L3F B;  1HFA A;  2BS3 A;  4UV9 B;  1R8I A;  3HI2 A;  5DJQ C;  4O4J E;  3PTR B;  4TUY E;  4TV9 E;  4CI2 B;  4ZOL E;  2UXC T;  5JRE A;  3RYH E;  5L3B B;  5JDH A;  1NEN A;  5LHH B;  3U78 A;  1G73 A;  1MMG A;  2ZM8 A;  5C2T A;  1Z0P A;  3Q9D A;  4HN9 A;  2Y6X A;  5L3G B;  2WM9 A;  2WDQ A;  4JI7 T;  2RPA A;  4OYK A;  4H9P C;  4DV2 T;  4B3S T;  2LKG A;  2LSJ A;  4JYA T;  4HWC A;  3UU6 A;  3G06 A;  3I0Q A;  2EHO C;  3HL6 A;  3C64 A;  3PDY A;  3JAE A;  3SRZ A;  5J0Z A;  3RYF E;  3VRA A;  4DUY T;  5AFU L;  1W09 A;  1HR0 T;  3GN5 A;  1UUR A;  3NVO A;  1SHZ C;  2JJ9 A;  4IE4 A;  5LYJ E;  2WDR A;  1ZKE A;  5DQV A;  1WRD A;  3KIN B;  3RX6 A;  5IWA T;  4LF4 T;  2Q9Q A;  3UU8 A;  3OVU A;  4Z8X A;  3UUN A;  1HX1 B;  4JI2 T;  1YKE B;  2UXD T;  4K0K T;  1BR4 A;  4XZC A;  3GWH A;  2B1E A;  5AQP B;  2K9A A;  1WYC A;  4LML A;  5KXJ A;  2VL0 A;  2XQA A;  2BS4 A;  3RYI E;  5HEO A;  3ZSS A;  2E9X C;  2D2S A;  2LHN A;  3PUV F;  3D0T A;  1FMV A;  3AE2 A;  4ILA A;  4UR9 A;  3VR9 A;  4TNV A;  5KDM C;  1EZ3 A;  1UX5 A;  2Y8D A;  4JEH B;  5LGU B;  1N32 T;  4UF0 A;  4DBQ A;  3P8C D;  2X51 A;  4COF A;  2NW7 A;  1D0Z A;  3LBX A;  4DV5 T;  4WNK A;  2CXD A;  3AE4 A;  3ZC0 A;  3N5L A;  3ZMT B;  4P0A A;  2ODV A;  2W63 A;  1MIV A;  1X9B A;  2QYW A;  3ONL C;  5EZY E;  3VHL A;  5LGN B;  4YHH T;  2BVL A;  4GK5 E;  2FJE A;  1BR2 A;  4Q25 A;  2YEV C;  4MHC A;  2L9Q A;  4QWN B;  5FVL A;  2X66 A;  4I4T E;  4CXX A;  1E1H B;  5LJM A;  2VVS A;  4PK4 A;  2LEH A;  4EV6 A;  3J7Y q;  1HX8 A;  3GMI A;  4NUU A;  2XPK A;  5DAB A;  2XAS B;  3AE6 A;  2CM0 A;  3DP7 A;  3P4W A;  3Q5E A;  2I6H A;  5FL0 A;  3UT5 E;  1LVF A;  1MMD A;  3KVA A;  4IRE A;  4X1K E;  4DV1 T;  2OV9 A;  5AQL B;  2UUB T;  4IE7 A;  2V26 A;  4PJL A;  3KBU A;  2Z6E A;  1G8X A;  1KK7 A;  3JC6 D;  4UXN B;  3RHW A;  5AQF B;  2VQF T;  3DTO A;  3ZC1 A;  3I9W A;  4Z90 A;  2WZI A;  2LSG A;  2VB6 A;  1YQ4 A;  2W4X A;  4M1P A;  1MND A;  2C5K T;  2XQ6 A;  5FMN A;  5JDG A;  4X66 T;  4QXH B;  2X67 A;  4JI8 T;  4OK0 A;  2KWH A;  4QX7 B;  2X9H A;  3ZYM A;  1OED A;  1KNP A;  4HTE A;  1VCT A;  4LFB T;  2ODU A;  1CHU A;  5J1G A;  4ZI7 E;  1IBK T;  2CCQ A;  2VQE T;  1AJ3 A;  2ZM6 T;  4FI5 A;  1XWM A;  3I1A A;  4E7Z A;  2BBJ A;  4UIG A;  3RIU C;  3ZT5 A;  3ZST A;  4AKG A;  2R6G F;  4A5X A;  5HEJ A;  3NRX A;  4X62 T;  1MIW A;  4EXT A;  3LK4 2;  1IJ5 A;  1UK5 A;  1JNZ A;  4CN1 A;  1WR0 A;  3K3Q C;  5LP6 E;  5LXT E;  2KSR A;  1HNZ T;  5LA6 E;  1YD8 G;  4DR4 T;  2D0U A;  4GKK T;  2B76 A;  3O1I A;  5HXE A;  1US7 B;  4H63 H;  2UU9 T;  2LSK A;  1ZOY A;  1WLX A;  5HXR A; 
#chains in the Genus database with same CATH homology
 5AQR B;  3FZH B;  4HWF A;  3LDQ B;  4HWI B;  1M7K A;  3M3Z B;  1UGO A;  1T7S A;  5AQM B;  1HX1 B;  5AQK B;  4HWD A;  1M62 A;  5AQI B;  5AQS B;  3FZM B;  5AQQ B;  2D9D A;  5AQT B;  4HWH A;  3FZK B;  5AQP B;  1UK5 A;  5AQH B;  5AQL B;  3A8Y C;  5AQU B;  5AQN B;  5AQF B;  5AQG B;  3FZF B;  5AQO B;  3FZL B;  5AQV B;  5AQJ B;  1I6Z A;  4HWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...