4HWDA

Crystal structure of atbag2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
86
structure length
86
Chain Sequence
SSSKAISDISFQVERLAGQLSAFDTVIGKGGKVEEKNLENLMEMLMNQLVKLDAISGDGDVKLKKKMQEERLHKYVEALDLLKIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 2
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 39
structure length 86
sequence length 86
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwdA00
1UGOA 5AQNB 1T7SA 3FZKB 5AQUB 5AQMB 4HWHA 5AQSB 5AQRB 1UK5A 3FZFB 5AQPB 3A8YC 4HWIB 1M7KA 1I6ZA 3LDQB 5AQGB 5AQKB 4HWCA 5AQIB 2D9DA 5AQTB 1M62A 3FZHB 5AQJB 5AQOB 5AQVB 5AQFB 3FZMB 5AQQB 4HWFA 4HWDA 1HX1B 3M3ZB 3FZLB 5AQHB 5AQLB
chains in the Genus database with same CATH superfamily
5HWYA 2LHRA 3CMLA 2OLTA 1OEDE 2E5VA 4IE5A 2NP9A 1IJ6A 1YD8G 4H9PC 2CXLA 2C5KT 3VKGA 3TLUA 2XAGB 2ZMAA 5LJMA 2Q9QB 2WWVA 4GYSA 3AEEA 4YLHA 1YQ3A 4ILUA 2H7VC 5JDQA 2RPAA 1T8BA 1WYCA 3RGLA 2VQFT 5L3FB 4NXNT 4X20E 2BBHA 4IREA 3FB2A 4AKIA 4IIJE 4DMWA 3E22E 3MA9A 2X51A 2QA7A 5L4HA 3RIAA 2WDVA 2CWOA 2C5JA 2E9XC 3S4UA 1ZOYA 3UULA 5HEJA 4EYYR 4QX8B 3N9OA 2KZ7B 5JRCA 3R84B 4DR2T 4X1IE 4X5TA 4CI2B 5J2TE 4DR1T 3GMIA 3AE3A 3CX6B 2XSAA 1W0AA 3EDUA 4OK0A 3KVAA 4PJNA 5JR9A 4UR9A 3VHLA 2LKGA 4BJMA 1IZNB 2R6GF 4U74A 2YU1A 4CN4A 1UGOA 2XY8B 1T7SA 2KNDA 4UV8B 5HEOA 3QB5A 2L3LA 3QUJA 3KVBA 3PUZF 4YHHT 4XZCA 2BG9A 2D2SA 3AVSA 1VOMA 3AE8A 2N1GA 5C2TA 5JTGA 1BR0A 5HXRA 2Y48B 4K0UA 5DABA 5LHGB 2NR4A 3WAKA 4BAYB 3UQ7A 3B13A 2WDRA 2WZIA 2UXBT 2VK9A 1HNZT 4QX7B 1MIYA 3RI5A 1OEDC 3CPZA 4DV6T 4UEMA 1SUMB 3GA8A 2A9UA 3N9QA 4JI3T 2ZM0A 2LKHA 1NAFA 4DV7T 4YY3T 5C3JA 4AQFA 2ZM2A 3N9LA 4HKAA 2KLQA 3ZPOA 2HH7A 1D1BA 4A56A 2I6HA 5LXTE 3AXJB 4IE0A 1R8IA 2PTFA 3HKDE 1NWMX 2Y8DA 2VVSA 2LOPA 1HX1B 3RYFE 3DTOA 3LBXB 3KBTA 1JNRA 4U7IA 1WFDA 4A98A 5CA1E 3C98B 2YU2A 1QLBA 3WAJA 2UU9T 3RQUA 2WY2A 4Z8XA 5M4YA 2H7OA 4PK6A 5FY7A 5FY0A 2KINB 2BDEA 2IHR1 3LK3B 1XMQT 4I55E 1XZYA 3TLWA 1IBLT 4DUZT 4X64T 4P0AA 1IBMT 3Q5EA 1YKHB 2WCAA 4G63A 2W2UA 2LLYA 3OVUA 5LBMA 3N9PA 5ABEA 4AQGA 4YHJA 5JDHA 5LYJE 1BR1A 5JDGA 4TWHA 4IE4A 4ZZBA 5IUXA 5KX5E 1ZHCA 2CCQA 3CQCB 3QK6A 4ISSA 2E9XB 5FXVA 5ETWA 5BMVE 3ANWB 2LT3A 1XDPA 3TLTA 3OTOT 5AQOB 1E2AA 1E7PA 4TN7B 3UU3A 4DUYT 2JQHA 1D1CA 4JI6T 3LSVA 2AE9A 1G73A 2Q9QD 4JUYA 1UCUA 4IDQA 4HEAA 4JEHB 4U2ZA 2YN6A 3FZHB 5HWXA 1KFYA 2VKDA 1Y64B 1AJ3A 3A7MA 4ZI2C 2V6YB 3ZC0A 4XBFB 4ZHQE 5CJ5A 2NOXA 3QB5K 5EK4A 2MAWA 2I0MA 4X65T 3AAAB 3HKEE 1HNWT 1FMVA 1HF8A 3SFEA 2P9BA 1T72A 3PUAA 5L3CB 3P4RA 3T1HT 4KMCA 4TWFA 4QXCB 2WQYA 4B3TT 5ABFA 4DIDB 4PK5A 2I59A 4CXYA 1XNQT 3KINB 1H7CA 4AKHA 3QC9A 3E08A 3ZC1A 3P4SA 1OEDB 3PUYF 1HS7A 3FXEB 3PTRB 5EK3A 4O4HE 4KP3C 3RYIE 3AVRA 4OHFA 2XZEA 3NRXA 4H9OC 4BA9A 4OYKA 3K1SA 3P7IA 2FJAA 2NTXA 5AQPB 3EHZA 4HFBA 4AISA 3N9NA 4V1Av 5E0OA 3IBPA 4CI1B 4JBWF 4XAXB 1E1HB 3UFEA 4HWDA 2CEAA 3EVYA 1FMWA 2VASA 1YKEB 2XUEA 1VRBA 2HPLA 4DR6T 3I0QA 2Q9QA 2CHOA 4COFA 3C51A 3KV9A 1U5PA 5AQUB 3J7Yq 2EHOC 1D0ZA 5FP3A 4G2AA 4DMVA 4ASKA 4HFHA 2WU5A 2A3DA 2VWAA 4F6RC 3HKCE 5HXCA 1BR2A 1N32T 4A5XA 4H9SE 4I4TE 2X67A 4O4LE 1IAPA 2IIUA 4QXHB 1HTJF 5H6QB 2DWKA 3SRZA 3E0ZA 2J62A 1V9DA 1GQEA 4YSYA 3C4XA 3FZLB 5L4EA 2K5BB 4JI8T 2K24A 1J5ET 4WZXA 2VB6A 3V5SA 2QVAA 3CQGB 1W9RA 4LF7T 2J1DG 3ZJ2A 4LFBT 2ES0A 1D1AA 1OWAA 5L2LA 3PUSA 2DCFA 4KHPT 2BG9C 1D0YA 2JQQA 2VKHA 4UF0B 1M7KA 3OPCA 1HX8A 2UXXB 3MKDA 1KF6A 4MLKA 2CLYB 4DV5T 2DHRA 2CM0A 3ETVA 4L0RA 4ZS2A 4CN1A 1I94T 1KEYA 3AAIA 3PUVF 3EDVA 3K8PC 3UT5E 4GK0E 4O8SA 3LJCA 4LMLA 2ZLYA 2D0UA 3JCFA 3KV4A 3RIUC 2YEVC 3ZYMA 4PAGA 2X9YA 3UU5A 4GIWA 2E9XD 5FYMA 5LMUT 3FXDB 2PBIA 2M6BA 3AEAA 2QGSA 2LRLA 3CIRA 4X66T 3RX6A 3K3OA 3DJBA 4M1PA 4TV8E 3ZLIA 2K9AA 3FZKB 3TLSA 5LG3A 4EB6E 5AFUL 3AA6B 5LHHB 2X0LB 4EZHA 3AXJA 4OYJA 2V7MA 2XJ7A 3B5MA 3K3QC 3PJAA 2V5CA 1MNDA 5FNVE 3N2KE 1HG5A 3ZMVB 1Z8UA 2BS2A 2XQ5A 1OXZA 5AQQB 2LSJA 4N78D 3LBXA 4IHJE 3AE7A 4IL9A 2ZM8A 3JAFA 5LA6E 4JI4T 4YSXA 3FHNA 5AQTB 3WI3A 3N2OA 2XAQB 4IDPA 1UX5A 1MNEA 1L0VA 3IHRA 4DO0A 5FVLA 4F8HA 2W4XA 2XTLA 2V8SV 5L3EB 1IBKT 5FVKA 4MHCA 5AQLB 3ZMUB 5AQSB 1W09A 3AA7B 4WW0A 1CHUA 4DVDA 4LFCT 4PW8A 2XQ8A 1UUSA 2EHOB 4LFAT 4YSZA 3W15B 2E8IA 3NVOA 5DQVA 4LF9T 4DNDA 5LGUB 4IDOA 2DNXA 3G06A 4IDNA 3QOFA 2J4GA 2WZHA 3O4XE 2E9XA 4LF4T 4U31A 4HE8A 2W62A 4KI0F 2VQET 3KFWX 5AQGB 5AQKB 5J0ZA 3ANWA 2D9DA 4AKRB 3AAEB 2BKOA 4YT0A 3I0OA 1WRDA 4KHZF 4IT4A 2LSIA 3KV5A 3AE2A 5HEUA 3AEDA 3CWZB 2VVNA 4LMJA 2DWGA 3AE6A 4WBOA 3ZYLA 4IE6A 2GK9A 1DU2A 1KK7A 2V7KA 3BK9A 3M65A 4B3MT 2ODVA 4HGAA 3Q9DA 1MMNA 4JEUB 2MYSA 4EOZB 2LE8A 2V6YA 4PFOA 3OYXA 4AQYT 5JH7E 4ILCA 4ZXLA 2LM9A 4PJJA 4LF6T 3Q5DA 4I0UA 4P09A 4ZI3C 3ZMZB 2XQ9A 4DR7T 3H37A 3JC6C 2CRBA 4DBQA 2KXPB 1FJGT 5AQRB 5LGNB 2XQ4A 1W0BA 4AXPA 2LEHA 2WWUA 4CI3B 3ABVA 1XMOT 2XAHB 3RYCE 5HXHA 4HWFA 3ZJ1A 3AEGA 1OEDA 5HYAA 5IWAT 2UXDT 3VR8A 2V5DA 1G8XA 1LKXA 3PUGA 3EI0A 2M6IA 4ILAA 1O3XA 3LDQB 5HXSA 5JDFA 4OFZA 5JQGE 4EEDA 2JJ9A 2PFVA 3VRBA 3GN5B 1HG2A 3CKDA 2RP4A 3C50A 3U78A 2Y6XA 2Z6EA 2V7IA 4GOUA 1ZEEA 4LF8T 4QXBB 2E5LT 2YDQA 2VKOA 2WB5A 3BQIA 3OBVE 2JRKA 3O1JA 3ZT7A 3LG7A 1HFAA 4EYUA 4C91A 4ZI2D 3ZMTB 3J9X1 4AIUA 3NKZA 2B76A 4JI2T 2CMRA 1US7B 3ESLA 2XQ6A 3P8CD 2L9QA 3CQXC 1MMAA 1J1JA 1U4QA 4A97A 2RA1A 2IUBA 2XQ7A 4NUVA 3RH3A 2WAUA 1MMDA 4LMKA 1FEWA 1WLXA 1XWMA 4I50E 2ACXA 4DV0T 4JLEA 5LOVE 4HWCA 2VL0A 4QH4A 1X9BA 3U3IA 2SPCA 3VKHA 3DP7A 2KMFA 2FBWA 2BG9E 3RHWA 3N5LA 3NZPA 5F8PA 4H9NC 4YTNA 3X1DA 3ETUA 3MK7C 3ZCJA 4YTMA 2N2NA 4HFEA 3PDYA 3KBUA 1S35A 2XQAA 2XAJB 1VCSA 5L3GB 2QYWA 2C0SA 1XDOA 2X68A 4AI6A 2IMLA 2HN2A 4TX5A 3SFDA 4IE7A 3OKQA 3AE9A 4ZZCA 3RKGA 2ZM6T 3UU8A 2CE7A 4JI0T 3FBLA 2IDOB 2JMHA 2UXCT 5HEGA 2XASB 2BVLA 3HI2A 2IW5B 4ANJA 3RIFA 4UF0A 2V1DB 2AXDS 4O4IE 3UFGA 2CWYA 2YDRA 2NW7A 3F31A 1N33T 3RF1A 2LSKA 1LRZA 2BKNA 3RPUA 3CVRA 3MJXA 4E7ZA 3H3MA 4JV5T 5A1LA 2DLRA 3VU7H 3RQWA 2EHOD 2W0GA 5HCJA 4EZ4A 3N2GE 4U33A 4I43B 2D5UA 5LCYA 3ZT6A 2YKSA 2V7LA 2YK0A 4U3CA 4YTPA 2JIWA 5JDLA 3PUQA 2NTYA 3ZYKA 5LG4A 1WR6A 3C4ZA 2C5IT 5ABHA 4HN9A 5CGMA 4YJ2E 2MOZA 5JR9C 2M67A 1B7TA 4HTEA 4DR4T 5FL1A 4PFPA 3ZKRA 5KXJA 4HWIB 3TKLB 1SE7A 2WU2A 1ZP0A 5AQJB 5CA0E 2KSRA 4PJMA 1LVFA 1J5WA 2W67A 1KNRA 3PV0F 5TAOA 3PURA 2NW9A 3L3PA 3PUWF 3O9XA 5CFBA 1I6ZA 4DV1T 2UUAT 4O4JE 2HN1A 4GK5E 1WCRA 2LSGA 2LHNA 5ADXL 5FXWA 3HKBE 1NEKA 1T98A 4WBNE 5JDNA 3L09A 4B3ST 1KNPA 4TV9E 2XQ3A 4CZZB 5FL0A 4ISTA 2MBGA 4MALA 5GONE 2BBJA 2HPJA 2IC6A 3CX7B 4YJ3E 3PJAJ 1MIWA 2W00A 3JAEA 4ILBA 2V7JA 2XAFB 4AQFC 3AECA 2EHOA 1FIOA 2NW8A 5AQFB 3IA3A 3NWIA 2CXDA 4L5GA 2YOEA 3RRWA 4JI5T 4Z90A 4KUMB 1D0XA 1MIVA 1WYBA 3H3AA 4B6XA 5L47A 2FJBA 5LB7B 2BKPA 2X0HA 4WNKA 5LNKA 3AEFA 5J1GA 4H63H 3TLVA 4CQIA 4QWNB 2BZBA 3NBXX 4NPPA 4ERRA 3AE5A 3AEBA 4CXWA 1SA0E 2OA5A 3ZSTA 2UXNB 2WP9A 2XSBA 2QRXA 1VCTA 3IF8B 4ZOLE 3R6NA 2NWBA 4CN6A 2X9XA 2WS3A 3P4PA 4MBQA 3IEEA 4Z91A 2W66A 2LOSA 1YW0A 4H63V 2VL8A 3RKOA 3RYHE 3UUNA 2DI4A 1QSDA 3MACA 4FJOA 3PUXF 1NENA 4YFSA 4QH1A 4PK4A 4UELA 3MZKB 2CBJA 1KNZA 3NRYA 3F2EA 4UXNB 3AA0B 3UUMA 4TWDA 4WYVA 2FJEA 4JYAT 4HFIA 3A5XA 3EABA 3ZT5A 4X62T 3SS1A 1EZ3A 4TUYE 3M3ZB 2FJDA 4H9RC 1S94A 3GWHA 2JQKA 1UX4A 4X1KE 2IC9A 4EEBA 2K3WA 4EV6A 3T1YT 3RIUA 1XNRT 4K0KT 1LVKA 4ZEYA 1YXRA 1BR4A 5JRCB 2CHNA 2D0TA 3VR9A 2V26A 4NXMT 2MPKA 2FUPA 3GN5A 3MXZA 2KWHA 4EGWA 3FZFB 4EXTA 2K48A 3C4WA 1X79A 3RLFF 5JR9B 2KT9A 3BQLA 3UQ4A 1M62A 4H9QC 4C90A 4GKJT 4LF5T 4X1YE 4OX9T 2YINA 3O1HA 4CXXA 3PE0A 2G0UA 4UVAB 2WBLA 4HFVA 2JMKA 3VRAA 2UUBT 4PJLA 4YXDA 4DV2T 4GKKT 5C8YE 5JREA 2BG9B 3EAMA 2H3RA 4AKGA 3QNUA 2V6XA 2XHEB 5JVDE 3ONXA 4DR3T 4ZI3D 4ZI7E 4U72A 3JC6D 3ZMSB 4NIQA 5DJQC 2LRKA 3HR0A 3NZQA 3UUBA 4UV9B 5HXEA 4IL4A 3UTKA 5LMNT 4ADZA 2BS4A 1ZKEA 3SWHA 2LSYA 5AQNB 3AE4A 1HNXT 3F57A 3K3NA 2BVMA 2DL1A 3HL6A 4KBMB 3I1AA 1Y01A 5AQIB 4EIWA 3HA4A 4HFCA 5AQVB 5FY1A 2A72A 2J47A 5KDMC 2VKJA 3Q2MA 5FKYA 2UUCT 3C64A 5BR8T 4HWHA 2MTQA 4AKLA 3ZN1B 4TZ4C 4ZS3A 4P0BA 4DBRA 5EK2A 2XM2A 4IGUA 4UVBB 3PU3A 4DV3T 4J2CA 1HR0T 1UK5A 2Q9QC 3KDSE 2KWIB 1YQ4A 1WR0A 5HAXA 4MFRA 5F3JA 5LP6E 5FXZA 2CLYC 3SOLA 4O2BE 2W61A 3P4QA 3UU4A 4Q25A 4L9IA 3OJAA 5FXXA 2B1EA 2ODUA 4E7SA 1CUNA 3RC8A 4U7YA 3ZN0B 2N9DA 3UU6A 3OYZA 4UIGA 3O1IA 4B3RT 3UUXB 5L3BB 2XM1A 4QHOA 2XQYA 2CXFA 2H89A 2X9WA 5LGTB 3AA1B 1Z0PA 2LM2A 3ZCIA 2YDSA 5DQWA 3A8YC 1JNZA 5H6RB 3ZEFB 2HHHT 5CB4E 3Q5XA 5JDMA 2ACZA 3N9MA 2JQ9A 3FZMB 4JI1T 3AB3B 3T8OA 4O2AE 1IJ5A 3PU8A 3D0TA 5AQMB 3LFMA 2PJQA 3EUHA 3B57A 3LK2B 2VURA 1SHZC 2WM9A 2PG8A 3P50A 3ONJA 4TNWA 5L3DB 4GYRA 1HCIA 4HFDA 4EAHA 5F5WA 2CPTA 2L8KA 4NUUA 4DR5T 3I9YA 2CA5A 4FI5A 5IYZE 5FMNA 2LJLA 3V5UA 1QUUA 3CK6A 5ABGA 5J2UE 1N34T 2F4VT 4IDZA 2X9HA 5IHYA 2W63A 1MMGA 4UVCB 2OV9A 3LK42 3KV6A 3AE1A 3L8RA 2WMNA 2JPFA 5HCMA 3ZSSA 5LJNA 3Q5WA 5EZYE 2WDQA 1N36T 4DV4T 2H88A 4KX6A 3L39A 3BQKA 1ZV4X 5LHIB 5HEHA 5LBQB 5ABFB 3RRCA 3P4WA 2CBIA 3RC3A 2E2AA 2IAKA 2BS3A 2WMOA 4P1NA 5KMGP 4TNVA 1UURA 2X66A 3FBZA 4PNIA 3ONLC 3CX8B 2XPKA 2X0YA 3JADA 2A2FX 4QH5A 4BJNA 4U2YA 4JI7T 2WSSV 4QKNA 3I9WA 5AQHB
chains in the Genus database with same CATH topology
1UGOA 5AQNB 1T7SA 3FZKB 5AQUB 5AQMB 4HWHA 5AQSB 5AQRB 1UK5A 3FZFB 5AQPB 3A8YC 4HWIB 1M7KA 1I6ZA 3LDQB 5AQGB 5AQKB 4HWCA 5AQIB 2D9DA 5AQTB 1M62A 3FZHB 5AQJB 5AQOB 5AQVB 5AQFB 3FZMB 5AQQB 4HWFA 4HWDA 1HX1B 3M3ZB 3FZLB 5AQHB 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGO A;  5AQN B;  1T7S A;  3FZK B;  5AQU B;  5AQM B;  4HWH A;  5AQS B;  5AQR B;  1UK5 A;  3FZF B;  5AQP B;  3A8Y C;  4HWI B;  1M7K A;  1I6Z A;  3LDQ B;  5AQG B;  5AQK B;  4HWC A;  5AQI B;  2D9D A;  5AQT B;  1M62 A;  3FZH B;  5AQJ B;  5AQO B;  5AQV B;  5AQF B;  3FZM B;  5AQQ B;  4HWF A;  4HWD A;  1HX1 B;  3M3Z B;  3FZL B;  5AQH B;  5AQL B; 
#chains in the Genus database with same CATH topology
 5HWY A;  2LHR A;  3CML A;  2OLT A;  1OED E;  2E5V A;  4IE5 A;  2NP9 A;  1IJ6 A;  1YD8 G;  4H9P C;  2CXL A;  2C5K T;  3VKG A;  3TLU A;  2XAG B;  2ZMA A;  5LJM A;  2Q9Q B;  2WWV A;  4GYS A;  3AEE A;  4YLH A;  1YQ3 A;  4ILU A;  2H7V C;  5JDQ A;  2RPA A;  1T8B A;  1WYC A;  3RGL A;  2VQF T;  5L3F B;  4NXN T;  4X20 E;  2BBH A;  4IRE A;  3FB2 A;  4AKI A;  4IIJ E;  4DMW A;  3E22 E;  3MA9 A;  2X51 A;  2QA7 A;  5L4H A;  3RIA A;  2WDV A;  2CWO A;  2C5J A;  2E9X C;  3S4U A;  1ZOY A;  3UUL A;  5HEJ A;  4EYY R;  4QX8 B;  3N9O A;  2KZ7 B;  5JRC A;  3R84 B;  4DR2 T;  4X1I E;  4X5T A;  4CI2 B;  5J2T E;  4DR1 T;  3GMI A;  3AE3 A;  3CX6 B;  2XSA A;  1W0A A;  3EDU A;  4OK0 A;  3KVA A;  4PJN A;  5JR9 A;  4UR9 A;  3VHL A;  2LKG A;  4BJM A;  1IZN B;  2R6G F;  4U74 A;  2YU1 A;  4CN4 A;  1UGO A;  2XY8 B;  1T7S A;  2KND A;  4UV8 B;  5HEO A;  3QB5 A;  2L3L A;  3QUJ A;  3KVB A;  3PUZ F;  4YHH T;  4XZC A;  2BG9 A;  2D2S A;  3AVS A;  1VOM A;  3AE8 A;  2N1G A;  5C2T A;  5JTG A;  1BR0 A;  5HXR A;  2Y48 B;  4K0U A;  5DAB A;  5LHG B;  2NR4 A;  3WAK A;  4BAY B;  3UQ7 A;  3B13 A;  2WDR A;  2WZI A;  2UXB T;  2VK9 A;  1HNZ T;  4QX7 B;  1MIY A;  3RI5 A;  1OED C;  3CPZ A;  4DV6 T;  4UEM A;  1SUM B;  3GA8 A;  2A9U A;  3N9Q A;  4JI3 T;  2ZM0 A;  2LKH A;  1NAF A;  4DV7 T;  4YY3 T;  5C3J A;  4AQF A;  2ZM2 A;  3N9L A;  4HKA A;  2KLQ A;  3ZPO A;  2HH7 A;  1D1B A;  4A56 A;  2I6H A;  5LXT E;  3AXJ B;  4IE0 A;  1R8I A;  2PTF A;  3HKD E;  1NWM X;  2Y8D A;  2VVS A;  2LOP A;  1HX1 B;  3RYF E;  3DTO A;  3LBX B;  3KBT A;  1JNR A;  4U7I A;  1WFD A;  4A98 A;  5CA1 E;  3C98 B;  2YU2 A;  1QLB A;  3WAJ A;  2UU9 T;  3RQU A;  2WY2 A;  4Z8X A;  5M4Y A;  2H7O A;  4PK6 A;  5FY7 A;  5FY0 A;  2KIN B;  2BDE A;  2IHR 1;  3LK3 B;  1XMQ T;  4I55 E;  1XZY A;  3TLW A;  1IBL T;  4DUZ T;  4X64 T;  4P0A A;  1IBM T;  3Q5E A;  1YKH B;  2WCA A;  4G63 A;  2W2U A;  2LLY A;  3OVU A;  5LBM A;  3N9P A;  5ABE A;  4AQG A;  4YHJ A;  5JDH A;  5LYJ E;  1BR1 A;  5JDG A;  4TWH A;  4IE4 A;  4ZZB A;  5IUX A;  5KX5 E;  1ZHC A;  2CCQ A;  3CQC B;  3QK6 A;  4ISS A;  2E9X B;  5FXV A;  5ETW A;  5BMV E;  3ANW B;  2LT3 A;  1XDP A;  3TLT A;  3OTO T;  5AQO B;  1E2A A;  1E7P A;  4TN7 B;  3UU3 A;  4DUY T;  2JQH A;  1D1C A;  4JI6 T;  3LSV A;  2AE9 A;  1G73 A;  2Q9Q D;  4JUY A;  1UCU A;  4IDQ A;  4HEA A;  4JEH B;  4U2Z A;  2YN6 A;  3FZH B;  5HWX A;  1KFY A;  2VKD A;  1Y64 B;  1AJ3 A;  3A7M A;  4ZI2 C;  2V6Y B;  3ZC0 A;  4XBF B;  4ZHQ E;  5CJ5 A;  2NOX A;  3QB5 K;  5EK4 A;  2MAW A;  2I0M A;  4X65 T;  3AAA B;  3HKE E;  1HNW T;  1FMV A;  1HF8 A;  3SFE A;  2P9B A;  1T72 A;  3PUA A;  5L3C B;  3P4R A;  3T1H T;  4KMC A;  4TWF A;  4QXC B;  2WQY A;  4B3T T;  5ABF A;  4DID B;  4PK5 A;  2I59 A;  4CXY A;  1XNQ T;  3KIN B;  1H7C A;  4AKH A;  3QC9 A;  3E08 A;  3ZC1 A;  3P4S A;  1OED B;  3PUY F;  1HS7 A;  3FXE B;  3PTR B;  5EK3 A;  4O4H E;  4KP3 C;  3RYI E;  3AVR A;  4OHF A;  2XZE A;  3NRX A;  4H9O C;  4BA9 A;  4OYK A;  3K1S A;  3P7I A;  2FJA A;  2NTX A;  5AQP B;  3EHZ A;  4HFB A;  4AIS A;  3N9N A;  4V1A v;  5E0O A;  3IBP A;  4CI1 B;  4JBW F;  4XAX B;  1E1H B;  3UFE A;  4HWD A;  2CEA A;  3EVY A;  1FMW A;  2VAS A;  1YKE B;  2XUE A;  1VRB A;  2HPL A;  4DR6 T;  3I0Q A;  2Q9Q A;  2CHO A;  4COF A;  3C51 A;  3KV9 A;  1U5P A;  5AQU B;  3J7Y q;  2EHO C;  1D0Z A;  5FP3 A;  4G2A A;  4DMV A;  4ASK A;  4HFH A;  2WU5 A;  2A3D A;  2VWA A;  4F6R C;  3HKC E;  5HXC A;  1BR2 A;  1N32 T;  4A5X A;  4H9S E;  4I4T E;  2X67 A;  4O4L E;  1IAP A;  2IIU A;  4QXH B;  1HTJ F;  5H6Q B;  2DWK A;  3SRZ A;  3E0Z A;  2J62 A;  1V9D A;  1GQE A;  4YSY A;  3C4X A;  3FZL B;  5L4E A;  2K5B B;  4JI8 T;  2K24 A;  1J5E T;  4WZX A;  2VB6 A;  3V5S A;  2QVA A;  3CQG B;  1W9R A;  4LF7 T;  2J1D G;  3ZJ2 A;  4LFB T;  2ES0 A;  1D1A A;  1OWA A;  5L2L A;  3PUS A;  2DCF A;  4KHP T;  2BG9 C;  1D0Y A;  2JQQ A;  2VKH A;  4UF0 B;  1M7K A;  3OPC A;  1HX8 A;  2UXX B;  3MKD A;  1KF6 A;  4MLK A;  2CLY B;  4DV5 T;  2DHR A;  2CM0 A;  3ETV A;  4L0R A;  4ZS2 A;  4CN1 A;  1I94 T;  1KEY A;  3AAI A;  3PUV F;  3EDV A;  3K8P C;  3UT5 E;  4GK0 E;  4O8S A;  3LJC A;  4LML A;  2ZLY A;  2D0U A;  3JCF A;  3KV4 A;  3RIU C;  2YEV C;  3ZYM A;  4PAG A;  2X9Y A;  3UU5 A;  4GIW A;  2E9X D;  5FYM A;  5LMU T;  3FXD B;  2PBI A;  2M6B A;  3AEA A;  2QGS A;  2LRL A;  3CIR A;  4X66 T;  3RX6 A;  3K3O A;  3DJB A;  4M1P A;  4TV8 E;  3ZLI A;  2K9A A;  3FZK B;  3TLS A;  5LG3 A;  4EB6 E;  5AFU L;  3AA6 B;  5LHH B;  2X0L B;  4EZH A;  3AXJ A;  4OYJ A;  2V7M A;  2XJ7 A;  3B5M A;  3K3Q C;  3PJA A;  2V5C A;  1MND A;  5FNV E;  3N2K E;  1HG5 A;  3ZMV B;  1Z8U A;  2BS2 A;  2XQ5 A;  1OXZ A;  5AQQ B;  2LSJ A;  4N78 D;  3LBX A;  4IHJ E;  3AE7 A;  4IL9 A;  2ZM8 A;  3JAF A;  5LA6 E;  4JI4 T;  4YSX A;  3FHN A;  5AQT B;  3WI3 A;  3N2O A;  2XAQ B;  4IDP A;  1UX5 A;  1MNE A;  1L0V A;  3IHR A;  4DO0 A;  5FVL A;  4F8H A;  2W4X A;  2XTL A;  2V8S V;  5L3E B;  1IBK T;  5FVK A;  4MHC A;  5AQL B;  3ZMU B;  5AQS B;  1W09 A;  3AA7 B;  4WW0 A;  1CHU A;  4DVD A;  4LFC T;  4PW8 A;  2XQ8 A;  1UUS A;  2EHO B;  4LFA T;  4YSZ A;  3W15 B;  2E8I A;  3NVO A;  5DQV A;  4LF9 T;  4DND A;  5LGU B;  4IDO A;  2DNX A;  3G06 A;  4IDN A;  3QOF A;  2J4G A;  2WZH A;  3O4X E;  2E9X A;  4LF4 T;  4U31 A;  4HE8 A;  2W62 A;  4KI0 F;  2VQE T;  3KFW X;  5AQG B;  5AQK B;  5J0Z A;  3ANW A;  2D9D A;  4AKR B;  3AAE B;  2BKO A;  4YT0 A;  3I0O A;  1WRD A;  4KHZ F;  4IT4 A;  2LSI A;  3KV5 A;  3AE2 A;  5HEU A;  3AED A;  3CWZ B;  2VVN A;  4LMJ A;  2DWG A;  3AE6 A;  4WBO A;  3ZYL A;  4IE6 A;  2GK9 A;  1DU2 A;  1KK7 A;  2V7K A;  3BK9 A;  3M65 A;  4B3M T;  2ODV A;  4HGA A;  3Q9D A;  1MMN A;  4JEU B;  2MYS A;  4EOZ B;  2LE8 A;  2V6Y A;  4PFO A;  3OYX A;  4AQY T;  5JH7 E;  4ILC A;  4ZXL A;  2LM9 A;  4PJJ A;  4LF6 T;  3Q5D A;  4I0U A;  4P09 A;  4ZI3 C;  3ZMZ B;  2XQ9 A;  4DR7 T;  3H37 A;  3JC6 C;  2CRB A;  4DBQ A;  2KXP B;  1FJG T;  5AQR B;  5LGN B;  2XQ4 A;  1W0B A;  4AXP A;  2LEH A;  2WWU A;  4CI3 B;  3ABV A;  1XMO T;  2XAH B;  3RYC E;  5HXH A;  4HWF A;  3ZJ1 A;  3AEG A;  1OED A;  5HYA A;  5IWA T;  2UXD T;  3VR8 A;  2V5D A;  1G8X A;  1LKX A;  3PUG A;  3EI0 A;  2M6I A;  4ILA A;  1O3X A;  3LDQ B;  5HXS A;  5JDF A;  4OFZ A;  5JQG E;  4EED A;  2JJ9 A;  2PFV A;  3VRB A;  3GN5 B;  1HG2 A;  3CKD A;  2RP4 A;  3C50 A;  3U78 A;  2Y6X A;  2Z6E A;  2V7I A;  4GOU A;  1ZEE A;  4LF8 T;  4QXB B;  2E5L T;  2YDQ A;  2VKO A;  2WB5 A;  3BQI A;  3OBV E;  2JRK A;  3O1J A;  3ZT7 A;  3LG7 A;  1HFA A;  4EYU A;  4C91 A;  4ZI2 D;  3ZMT B;  3J9X 1;  4AIU A;  3NKZ A;  2B76 A;  4JI2 T;  2CMR A;  1US7 B;  3ESL A;  2XQ6 A;  3P8C D;  2L9Q A;  3CQX C;  1MMA A;  1J1J A;  1U4Q A;  4A97 A;  2RA1 A;  2IUB A;  2XQ7 A;  4NUV A;  3RH3 A;  2WAU A;  1MMD A;  4LMK A;  1FEW A;  1WLX A;  1XWM A;  4I50 E;  2ACX A;  4DV0 T;  4JLE A;  5LOV E;  4HWC A;  2VL0 A;  4QH4 A;  1X9B A;  3U3I A;  2SPC A;  3VKH A;  3DP7 A;  2KMF A;  2FBW A;  2BG9 E;  3RHW A;  3N5L A;  3NZP A;  5F8P A;  4H9N C;  4YTN A;  3X1D A;  3ETU A;  3MK7 C;  3ZCJ A;  4YTM A;  2N2N A;  4HFE A;  3PDY A;  3KBU A;  1S35 A;  2XQA A;  2XAJ B;  1VCS A;  5L3G B;  2QYW A;  2C0S A;  1XDO A;  2X68 A;  4AI6 A;  2IML A;  2HN2 A;  4TX5 A;  3SFD A;  4IE7 A;  3OKQ A;  3AE9 A;  4ZZC A;  3RKG A;  2ZM6 T;  3UU8 A;  2CE7 A;  4JI0 T;  3FBL A;  2IDO B;  2JMH A;  2UXC T;  5HEG A;  2XAS B;  2BVL A;  3HI2 A;  2IW5 B;  4ANJ A;  3RIF A;  4UF0 A;  2V1D B;  2AXD S;  4O4I E;  3UFG A;  2CWY A;  2YDR A;  2NW7 A;  3F31 A;  1N33 T;  3RF1 A;  2LSK A;  1LRZ A;  2BKN A;  3RPU A;  3CVR A;  3MJX A;  4E7Z A;  3H3M A;  4JV5 T;  5A1L A;  2DLR A;  3VU7 H;  3RQW A;  2EHO D;  2W0G A;  5HCJ A;  4EZ4 A;  3N2G E;  4U33 A;  4I43 B;  2D5U A;  5LCY A;  3ZT6 A;  2YKS A;  2V7L A;  2YK0 A;  4U3C A;  4YTP A;  2JIW A;  5JDL A;  3PUQ A;  2NTY A;  3ZYK A;  5LG4 A;  1WR6 A;  3C4Z A;  2C5I T;  5ABH A;  4HN9 A;  5CGM A;  4YJ2 E;  2MOZ A;  5JR9 C;  2M67 A;  1B7T A;  4HTE A;  4DR4 T;  5FL1 A;  4PFP A;  3ZKR A;  5KXJ A;  4HWI B;  3TKL B;  1SE7 A;  2WU2 A;  1ZP0 A;  5AQJ B;  5CA0 E;  2KSR A;  4PJM A;  1LVF A;  1J5W A;  2W67 A;  1KNR A;  3PV0 F;  5TAO A;  3PUR A;  2NW9 A;  3L3P A;  3PUW F;  3O9X A;  5CFB A;  1I6Z A;  4DV1 T;  2UUA T;  4O4J E;  2HN1 A;  4GK5 E;  1WCR A;  2LSG A;  2LHN A;  5ADX L;  5FXW A;  3HKB E;  1NEK A;  1T98 A;  4WBN E;  5JDN A;  3L09 A;  4B3S T;  1KNP A;  4TV9 E;  2XQ3 A;  4CZZ B;  5FL0 A;  4IST A;  2MBG A;  4MAL A;  5GON E;  2BBJ A;  2HPJ A;  2IC6 A;  3CX7 B;  4YJ3 E;  3PJA J;  1MIW A;  2W00 A;  3JAE A;  4ILB A;  2V7J A;  2XAF B;  4AQF C;  3AEC A;  2EHO A;  1FIO A;  2NW8 A;  5AQF B;  3IA3 A;  3NWI A;  2CXD A;  4L5G A;  2YOE A;  3RRW A;  4JI5 T;  4Z90 A;  4KUM B;  1D0X A;  1MIV A;  1WYB A;  3H3A A;  4B6X A;  5L47 A;  2FJB A;  5LB7 B;  2BKP A;  2X0H A;  4WNK A;  5LNK A;  3AEF A;  5J1G A;  4H63 H;  3TLV A;  4CQI A;  4QWN B;  2BZB A;  3NBX X;  4NPP A;  4ERR A;  3AE5 A;  3AEB A;  4CXW A;  1SA0 E;  2OA5 A;  3ZST A;  2UXN B;  2WP9 A;  2XSB A;  2QRX A;  1VCT A;  3IF8 B;  4ZOL E;  3R6N A;  2NWB A;  4CN6 A;  2X9X A;  2WS3 A;  3P4P A;  4MBQ A;  3IEE A;  4Z91 A;  2W66 A;  2LOS A;  1YW0 A;  4H63 V;  2VL8 A;  3RKO A;  3RYH E;  3UUN A;  2DI4 A;  1QSD A;  3MAC A;  4FJO A;  3PUX F;  1NEN A;  4YFS A;  4QH1 A;  4PK4 A;  4UEL A;  3MZK B;  2CBJ A;  1KNZ A;  3NRY A;  3F2E A;  4UXN B;  3AA0 B;  3UUM A;  4TWD A;  4WYV A;  2FJE A;  4JYA T;  4HFI A;  3A5X A;  3EAB A;  3ZT5 A;  4X62 T;  3SS1 A;  1EZ3 A;  4TUY E;  3M3Z B;  2FJD A;  4H9R C;  1S94 A;  3GWH A;  2JQK A;  1UX4 A;  4X1K E;  2IC9 A;  4EEB A;  2K3W A;  4EV6 A;  3T1Y T;  3RIU A;  1XNR T;  4K0K T;  1LVK A;  4ZEY A;  1YXR A;  1BR4 A;  5JRC B;  2CHN A;  2D0T A;  3VR9 A;  2V26 A;  4NXM T;  2MPK A;  2FUP A;  3GN5 A;  3MXZ A;  2KWH A;  4EGW A;  3FZF B;  4EXT A;  2K48 A;  3C4W A;  1X79 A;  3RLF F;  5JR9 B;  2KT9 A;  3BQL A;  3UQ4 A;  1M62 A;  4H9Q C;  4C90 A;  4GKJ T;  4LF5 T;  4X1Y E;  4OX9 T;  2YIN A;  3O1H A;  4CXX A;  3PE0 A;  2G0U A;  4UVA B;  2WBL A;  4HFV A;  2JMK A;  3VRA A;  2UUB T;  4PJL A;  4YXD A;  4DV2 T;  4GKK T;  5C8Y E;  5JRE A;  2BG9 B;  3EAM A;  2H3R A;  4AKG A;  3QNU A;  2V6X A;  2XHE B;  5JVD E;  3ONX A;  4DR3 T;  4ZI3 D;  4ZI7 E;  4U72 A;  3JC6 D;  3ZMS B;  4NIQ A;  5DJQ C;  2LRK A;  3HR0 A;  3NZQ A;  3UUB A;  4UV9 B;  5HXE A;  4IL4 A;  3UTK A;  5LMN T;  4ADZ A;  2BS4 A;  1ZKE A;  3SWH A;  2LSY A;  5AQN B;  3AE4 A;  1HNX T;  3F57 A;  3K3N A;  2BVM A;  2DL1 A;  3HL6 A;  4KBM B;  3I1A A;  1Y01 A;  5AQI B;  4EIW A;  3HA4 A;  4HFC A;  5AQV B;  5FY1 A;  2A72 A;  2J47 A;  5KDM C;  2VKJ A;  3Q2M A;  5FKY A;  2UUC T;  3C64 A;  5BR8 T;  4HWH A;  2MTQ A;  4AKL A;  3ZN1 B;  4TZ4 C;  4ZS3 A;  4P0B A;  4DBR A;  5EK2 A;  2XM2 A;  4IGU A;  4UVB B;  3PU3 A;  4DV3 T;  4J2C A;  1HR0 T;  1UK5 A;  2Q9Q C;  3KDS E;  2KWI B;  1YQ4 A;  1WR0 A;  5HAX A;  4MFR A;  5F3J A;  5LP6 E;  5FXZ A;  2CLY C;  3SOL A;  4O2B E;  2W61 A;  3P4Q A;  3UU4 A;  4Q25 A;  4L9I A;  3OJA A;  5FXX A;  2B1E A;  2ODU A;  4E7S A;  1CUN A;  3RC8 A;  4U7Y A;  3ZN0 B;  2N9D A;  3UU6 A;  3OYZ A;  4UIG A;  3O1I A;  4B3R T;  3UUX B;  5L3B B;  2XM1 A;  4QHO A;  2XQY A;  2CXF A;  2H89 A;  2X9W A;  5LGT B;  3AA1 B;  1Z0P A;  2LM2 A;  3ZCI A;  2YDS A;  5DQW A;  3A8Y C;  1JNZ A;  5H6R B;  3ZEF B;  2HHH T;  5CB4 E;  3Q5X A;  5JDM A;  2ACZ A;  3N9M A;  2JQ9 A;  3FZM B;  4JI1 T;  3AB3 B;  3T8O A;  4O2A E;  1IJ5 A;  3PU8 A;  3D0T A;  5AQM B;  3LFM A;  2PJQ A;  3EUH A;  3B57 A;  3LK2 B;  2VUR A;  1SHZ C;  2WM9 A;  2PG8 A;  3P50 A;  3ONJ A;  4TNW A;  5L3D B;  4GYR A;  1HCI A;  4HFD A;  4EAH A;  5F5W A;  2CPT A;  2L8K A;  4NUU A;  4DR5 T;  3I9Y A;  2CA5 A;  4FI5 A;  5IYZ E;  5FMN A;  2LJL A;  3V5U A;  1QUU A;  3CK6 A;  5ABG A;  5J2U E;  1N34 T;  2F4V T;  4IDZ A;  2X9H A;  5IHY A;  2W63 A;  1MMG A;  4UVC B;  2OV9 A;  3LK4 2;  3KV6 A;  3AE1 A;  3L8R A;  2WMN A;  2JPF A;  5HCM A;  3ZSS A;  5LJN A;  3Q5W A;  5EZY E;  2WDQ A;  1N36 T;  4DV4 T;  2H88 A;  4KX6 A;  3L39 A;  3BQK A;  1ZV4 X;  5LHI B;  5HEH A;  5LBQ B;  5ABF B;  3RRC A;  3P4W A;  2CBI A;  3RC3 A;  2E2A A;  2IAK A;  2BS3 A;  2WMO A;  4P1N A;  5KMG P;  4TNV A;  1UUR A;  2X66 A;  3FBZ A;  4PNI A;  3ONL C;  3CX8 B;  2XPK A;  2X0Y A;  3JAD A;  2A2F X;  4QH5 A;  4BJN A;  4U2Y A;  4JI7 T;  2WSS V;  4QKN A;  3I9W A;  5AQH B; 
#chains in the Genus database with same CATH homology
 1UGO A;  5AQN B;  1T7S A;  3FZK B;  5AQU B;  5AQM B;  4HWH A;  5AQS B;  5AQR B;  1UK5 A;  3FZF B;  5AQP B;  3A8Y C;  4HWI B;  1M7K A;  1I6Z A;  3LDQ B;  5AQG B;  5AQK B;  4HWC A;  5AQI B;  2D9D A;  5AQT B;  1M62 A;  3FZH B;  5AQJ B;  5AQO B;  5AQV B;  5AQF B;  3FZM B;  5AQQ B;  4HWF A;  4HWD A;  1HX1 B;  3M3Z B;  3FZL B;  5AQH B;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...