4HWDA

Crystal structure of atbag2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
86
structure length
86
Chain Sequence
SSSKAISDISFQVERLAGQLSAFDTVIGKGGKVEEKNLENLMEMLMNQLVKLDAISGDGDVKLKKKMQEERLHKYVEALDLLKIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 2
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 39
structure length 86
sequence length 86
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwdA00
5AQGB 4HWCA 5AQKB 1HX1B 3FZHB 5AQUB 4HWIB 4HWHA 3FZLB 3FZKB 3A8YC 5AQPB 3FZFB 4HWDA 5AQLB 5AQMB 3M3ZB 5AQOB 1I6ZA 5AQNB 2D9DA 1UK5A 5AQQB 5AQFB 1UGOA 5AQTB 5AQIB 5AQJB 1M7KA 5AQHB 5AQRB 5AQVB 1T7SA 4HWFA 1M62A 3FZMB 3LDQB 5AQSB
chains in the Genus database with same CATH superfamily
4YT0A 4DR2T 4LMLA 3ZMUB 2Z6EA 2NP9A 1S35A 3W15B 4DIDB 3LBXA 4EZ4A 4YY3T 1E1HB 2LOPA 4G63A 5AQHB 3AA7B 4H9QC 4YLHA 4JUYA 5EK4A 4UV8B 2LEHA 1WYBA 2EHOD 4E7SA 2BZBA 3T8OA 1XNRT 1IAPA 4QH4A 3MKDA 3AAAB 4ZZBA 3IA3A 4X1YE 5LXTE 4MBQA 3TLWA 1N33T 3RLFF 1MIVA 2HN2A 2V7IA 2L9QA 2LM9A 4JI8T 1T7SA 3PUWF 4IT4A 4UEMA 2V8SV 3PU3A 2ACXA 1D1AA 4HWIB 2YDRA 5JTGA 4IDQA 5HXRA 3U78A 2VK9A 3UUNA 5ABEA 3ZPOA 4WW0A 2V7LA 2V5DA 3K3OA 4KI0F 2A72A 3CWZB 2PJQA 1G73A 2RP4A 4ISSA 2V6YA 4TWDA 3NRXA 3SS1A 2LHNA 3NWIA 1OEDA 3B13A 5JDQA 4EEBA 5BMVE 3OTOT 2YU1A 4YXDA 4E7ZA 5LCYA 4CZZB 3J9X1 4UIGA 4ZI2D 3ONXA 2N9DA 1NWMX 4HKAA 5FVKA 1I6ZA 3C4WA 2WDQA 2BVMA 2VQFT 1NENA 5LP6E 1BR2A 3L8RA 2XAHB 2M6BA 2WWUA 5LG4A 4HE8A 1YXRA 2X9YA 2LKGA 4J2CA 1XDPA 3RYCE 3E22E 1H7CA 5AQTB 5HWYA 2XAJB 4IE5A 2VKJA 2XM1A 2I59A 2X0LB 5LHHB 2E5VA 2H3RA 2D9DA 4OHFA 2HPLA 4IDOA 4JLEA 4IE7A 3HKDE 4TWFA 5DABA 5JDGA 5HEGA 4UF0A 2NW7A 4NXMT 1CUNA 2BS4A 3AEAA 5BR8T 4P09A 2PFVA 2CHNA 5DQWA 2PBIA 3L39A 1ZV4X 4EV6A 2IAKA 4CN1A 5AQOB 4MHCA 2CRBA 3ZCJA 4F8HA 5C3JA 4TNVA 1D0ZA 1GQEA 2V5CA 3CPZA 1LVKA 1KNZA 5GONE 2WAUA 4YTMA 2C5KT 3AEGA 3AE5A 3AE4A 3EVYA 2XPKA 3FHNA 2XQAA 5LHIB 3R84B 4ILBA 1XMQT 4XBFB 4AIUA 4YSZA 2BBJA 2CWYA 1XZYA 4QH5A 3PJAA 1HNZT 5EK3A 4LFCT 4A98A 2WU5A 1S94A 2KZ7B 2XSBA 5FKYA 2K9AA 1UURA 3FXDB 5ABGA 4PW8A 3UQ4A 1XWMA 5ADXL 2XSAA 5J2TE 4PJLA 2NTYA 1UX4A 4H63V 3AE9A 4ZI7E 4U7YA 4JI1T 2BG9C 3VU7H 5LGUB 2LM2A 3ZYLA 2P9BA 4KHPT 2K24A 2IUBA 1HTJF 1VRBA 4GKJT 3RIUA 2IC6A 3P4SA 3ANWB 3F2EA 1OEDE 2IMLA 4X1KE 2C5IT 4DV2T 3UTKA 4CXWA 3KBTA 4Z91A 5AQGB 4CXXA 2JQ9A 3I0QA 2WZHA 3VRBA 2W00A 3N9PA 4I43B 2XQYA 3S4UA 4L9IA 4G2AA 2E5LT 1D0YA 2MAWA 3C64A 2FJBA 2K3WA 5HEOA 1Y01A 4HFBA 3H3AA 2RA1A 4XZCA 1KNRA 3EDUA 2MYSA 3N2OA 5L3FB 4U7IA 2XQ6A 2KMFA 3MACA 5AQUB 1MMNA 4ASKA 2NW9A 2WB5A 5CA0E 3JCFA 4PAGA 3RHWA 4GYSA 3DTOA 2VL8A 3FXEB 2J4GA 3HKEE 4COFA 2KSRA 4DV6T 4DVDA 4EYUA 2CPTA 3PUYF 4ILCA 4K0UA 2N2NA 2ZM2A 3RPUA 2IIUA 4O4LE 3UU4A 5EK2A 5LYJE 2DCFA 5LGTB 4KP3C 1UGOA 2OV9A 1WYCA 3GMIA 3DP7A 3H37A 1LRZA 3FZMB 2Q9QC 4IGUA 2XHEB 3WI3A 3AECA 2HHHT 1X9BA 1Z8UA 3K8PC 3Q9DA 2DWGA 3RYHE 4B3TT 4JI5T 1XNQT 4H63H 4N78D 1KEYA 2DL1A 4PJMA 1IZNB 3L3PA 3PDYA 3LFMA 4U2ZA 3ZKRA 2E9XB 3K3NA 4HWHA 3JAEA 2CA5A 3PUQA 3MZKB 5FXWA 5HYAA 4X5TA 4EOZB 4IREA 2KWIB 2X9WA 5FXVA 2C0SA 5AQKB 3LK42 1D1CA 1Y64B 2CXLA 2XM2A 4K0KT 2BKNA 5AQMB 2J47A 3ONLC 3O9XA 5L3EB 3O1IA 3T1YT 3RRCA 3P4PA 5FP3A 4X62T 1NAFA 3FB2A 5HCJA 5ABFB 4CI2B 5JR9B 2EHOC 3WAKA 2WS3A 2CE7A 5DJQC 2NWBA 3A8YC 1WRDA 4Z8XA 2XAFB 4TN7B 3N9LA 2JQKA 1W0BA 2YKSA 3NZPA 3O1HA 3LJCA 4BA9A 3Q5EA 2A3DA 2ZLYA 4KX6A 3KV5A 5J0ZA 2LSGA 4PJNA 4HFCA 2BVLA 5LG3A 1SUMB 4ANJA 5CGMA 4PNIA 4Z90A 1U5PA 1B7TA 2YOEA 4F6RC 4NIQA 4WYVA 3RX6A 1FJGT 2LRLA 3EHZA 2FBWA 4GKKT 4IE6A 3UULA 2ODVA 5H6QB 2BBHA 1YW0A 2V26A 2Y8DA 2HH7A 2B76A 2BS3A 2CBIA 1VOMA 4DR5T 4DR3T 5M4YA 4X20E 3ZT6A 1W09A 4AQFA 3FZHB 3DJBA 3IBPA 2LJLA 4ZS2A 2JMKA 4QXHB 1HG2A 4YSXA 1U4QA 2CLYC 3UU3A 3Q5DA 3FBLA 2DI4A 3AXJB 2X0HA 2HN1A 5LHGB 2OLTA 4EEDA 1UK5A 2IDOB 3CX8B 4DO0A 3MXZA 3AEFA 1KNPA 2M6IA 5JDLA 1HNXT 3OKQA 1WR6A 4HN9A 3VR8A 4WNKA 4DMVA 5JDNA 2KWHA 1EZ3A 2MTQA 5LJMA 5AQSB 3ZMZB 5AFUL 1HCIA 5HWXA 2YINA 2DHRA 3AA6B 4UVCB 4EB6E 2NW8A 5L47A 4MLKA 5AQVB 2XTLA 4IDZA 2V7KA 4HFDA 4OX9T 3AEDA 4JI3T 3SFDA 3GN5A 4B3ST 4TX5A 3QK6A 1SE7A 5F8PA 1N36T 1HFAA 3KBUA 1YQ4A 4QXCB 4YTPA 2QGSA 3QOFA 3AE2A 1SA0E 4JI4T 3CX7B 5KXJA 3QB5K 4O8SA 4NXNT 3FZFB 1OWAA 2L8KA 5CB4E 5FXZA 1IBMT 4CQIA 4HFIA 3ZCIA 1UUSA 3RI5A 2FJDA 2PTFA 3I9WA 3U3IA 3ZJ2A 5LBQB 4P0BA 2LSKA 2VURA 5AQIB 4BAYB 2VKDA 3SRZA 5KDMC 1FEWA 2UUAT 4M1PA 3PUXF 2FUPA 4DV1T 3N2KE 5DQVA 2VQET 2DWKA 4LF7T 2YU2A 2KNDA 3FZLB 4YFSA 4IDPA 5AQQB 3CIRA 5FY0A 2CCQA 4C91A 1AJ3A 2XQ3A 2WP9A 4LMKA 4HFEA 2H7VC 4H9RC 2D0UA 2W4XA 4PK5A 4IL4A 2WY2A 4U74A 4DMWA 2J62A 3K1SA 3Q5XA 4CN6A 2WQYA 2UXNB 4DBQA 3ZC1A 5CFBA 5LA6E 1X79A 5FMNA 4HEAA 3ZT7A 3C4ZA 4OYKA 3KINB 2LE8A 1OEDC 1SHZC 4AQGA 4DV0T 2BG9B 4ZZCA 2UUBT 4CI3B 4O2AE 5FYMA 5LGNB 1BR0A 4WBNE 4U2YA 3P7IA 3CVRA 5HXEA 2H7OA 4I50E 4H9OC 1LKXA 4JI7T 2BKOA 3ZYMA 1MNDA 5EZYE 3AE3A 2CBJA 3NRYA 4ZXLA 5A1LA 2WSSV 2FJEA 5JDMA 2AXDS 4ZHQE 5L3DB 4DR7T 4C90A 3RIFA 1R8IA 2V6XA 2UU9T 2AE9A 3B5MA 2WMNA 3V5UA 4KHZF 3HL6A 4JI6T 1M62A 1NEKA 1W9RA 1WR0A 5CJ5A 1YD8G 4PFOA 3AE1A 2E9XA 4HTEA 4ZI3D 2VL0A 5J2UE 2CXFA 3KV9A 3ZMTB 5FVLA 3CMLA 3NZQA 4UR9A 4CI1B 2N1GA 2UXCT 2BG9E 4JEHB 5C8YE 2ACZA 2E8IA 4JV5T 2Q9QB 4PFPA 4I4TE 2X0YA 3AVSA 3L09A 5IUXA 3CK6A 4B3MT 4JYAT 2VVSA 4QX8B 3C4XA 3SOLA 1WFDA 3EABA 2BKPA 1IBKT 5JR9A 5ABFA 4A56A 4P0AA 1Z0PA 3GWHA 3RC3A 4YHJA 1E2AA 3IF8B 4WZXA 2LSYA 5JREA 4KMCA 4B3RT 3T1HT 3RH3A 1J5WA 4U72A 2WDRA 2QRXA 3QUJA 4ISTA 3RIUC 3G06A 4AISA 3RQUA 4X66T 1T72A 3B57A 4EAHA 2H88A 1D1BA 5FY1A 4X1IE 1J5ET 4ZOLE 5HEHA 3C51A 2W0GA 2V7JA 3NBXX 3BQKA 2MPKA 1ZOYA 1D0XA 4LMJA 3LSVA 2EHOB 4FJOA 5L3BB 3ZN0B 3P4WA 3CQGB 4U31A 2LKHA 2X68A 5JRCB 3MA9A 1IBLT 3P8CD 2XZEA 2SPCA 1L0VA 4HWFA 1T8BA 2ZM8A 4BJNA 1YKEB 2IW5B 3TLVA 3M65A 2CHOA 2I0MA 4DV3T 4IL9A 3M3ZB 4EGWA 4TWHA 3WAJA 2KT9A 3VKHA 2YK0A 3BQLA 3AXJA 3KV4A 4AKIA 4WBOA 2LOSA 5LOVE 2ZM0A 2C5JA 4O4HE 3FZKB 3QB5A 3RRWA 3ESLA 3UU5A 3EUHA 2A9UA 2XQ7A 3AE7A 4ILAA 3OBVE 3E0ZA 1YQ3A 2X9HA 4EYYR 4QKNA 4NUUA 3N9MA 2LSJA 3UT5E 1MIYA 3IEEA 5HEJA 5KX5E 3CX6B 5ABHA 4CN4A 5L4HA 1MIWA 2Y48B 3HI2A 2VVNA 2CLYB 2PG8A 3BK9A 2YDSA 1ZP0A 3R6NA 4DUZT 3AVRA 4ZI2C 5AQPB 2UXXB 2W66A 4DR6T 1WCRA 2WBLA 4QHOA 4B6XA 4HFVA 5JVDE 4UV9B 4UVAB 1US7B 1J1JA 4A97A 2VASA 4ADZA 3KVAA 3ONJA 4LF9T 2MBGA 1WLXA 3VKGA 2D2SA 3UU6A 5FXXA 4O2BE 4XAXB 3TLTA 2E9XD 3PV0F 5IWAT 2JQHA 3QNUA 5LBMA 2LT3A 3JADA 2D0TA 3P4QA 3D0TA 4AXPA 3PJAJ 4JI2T 4X64T 3RGLA 4IE0A 1IJ5A 2X67A 2LRKA 5JQGE 3OVUA 3AA0B 3LK3B 3O4XE 1LVFA 1N34T 1CHUA 3ZSTA 5HCMA 2ODUA 1JNZA 4H9NC 3AEEA 3H3MA 3JC6D 3AAIA 2W62A 5AQNB 2JJ9A 4H9PC 3MJXA 1MNEA 5F3JA 5HXCA 2NOXA 3AAEB 3RC8A 3KV6A 2QA7A 4HFHA 4AQFC 5J1GA 5LMNT 1QUUA 1HX1B 3EI0A 3RKGA 5JDHA 3N9NA 3F31A 5L4EA 1OXZA 2HPJA 3LBXB 4DR4T 5FL0A 1VCTA 3PUVF 1HF8A 2WZIA 4UELA 2H89A 1XMOT 4UVBB 5LJNA 2XY8B 4IDNA 2XJ7A 2L3LA 2W63A 2Y6XA 2OA5A 3ETVA 3TKLB 3QC9A 3RIAA 4AI6A 5HEUA 2D5UA 3A5XA 5AQJB 2XQ8A 2BG9A 1FMWA 3RQWA 2YN6A 4P1NA 2KXPB 4O4JE 4DV4T 2I6HA 3PE0A 4JI0T 2CM0A 1O3XA 4LF5T 4MFRA 4I0UA 2WCAA 5FNVE 4LFBT 1JNRA 3UFEA 2NR4A 3GN5B 2ES0A 2V6YB 4ZI3C 3ZSSA 4YSYA 2WWVA 3ANWA 3VHLA 5AQFB 1OEDB 4EXTA 2DLRA 3KVBA 1ZKEA 2YEVC 3MK7C 4AQYT 4DBRA 5H6RB 4TV8E 3ZJ1A 4PK4A 2XQ4A 2BS2A 4TZ4C 5LNKA 3X1DA 3LG7A 2W67A 5HXHA 4KUMB 2CMRA 1V9DA 1G8XA 4GK0E 4TNWA 4QXBB 2GK9A 3OJAA 5E0OA 4GYRA 2LLYA 1KK7A 2WM9A 3UQ7A 3I0OA 4EIWA 2X66A 2LSIA 2Q9QA 1HX8A 3N9QA 4X65T 4ERRA 1HR0T 2UXDT 3V5SA 4QH1A 3K3QC 4UF0B 3SFEA 3LDQB 3N5LA 1BR4A 1VCSA 5HAXA 3J7Yq 3ZT5A 5L3GB 2V1DB 5HXSA 2M67A 2UUCT 5IHYA 1FMVA 3PU8A 3ZLIA 2KINB 4LF4T 3E08A 2KLQA 5KMGP 2A2FX 3VRAA 3SWHA 2R6GF 3A7MA 4IHJE 2K5BB 2BDEA 3RYFE 5CA1E 2DNXA 4U33A 1IJ6A 3NKZA 4O4IE 2J1DG 5LMUT 4YTNA 3UUMA 2JIWA 1HG5A 4AKLA 3AE8A 4IE4A 3OPCA 3F57A 4HWCA 4Q25A 3ZYKA 2CEAA 2EHOA 4ZS3A 3O1JA 1YKHB 5JRCA 2X9XA 1HNWT 1QSDA 2W2UA 2FJAA 1HS7A 3ZMVB 3C50A 4OFZA 4EZHA 2RPAA 2G0UA 5AQLB 3AEBA 2QYWA 3LK2B 2XUEA 5F5WA 4OK0A 1ZEEA 4DV7T 4H9SE 2IC9A 3PTRB 4GOUA 4CXYA 3GA8A 3ZMSB 2F4VT 5FY7A 3N9OA 3N2GE 4TV9E 4U3CA 4LFAT 4PJJA 3I9YA 3I1AA 3HR0A 3UFGA 3ETUA 3PURA 5IYZE 3OYZA 5L3CB 3ZEFB 4AKGA 1M7KA 3CQXC 1MMAA 4DV5T 3AB3B 4HGAA 1I94T 3HKBE 4I55E 3AE6A 2VKHA 4IIJE 3OYXA 4LF8T 2LHRA 3RF1A 2YDQA 1MMGA 4V1Av 4JEUB 5JH7E 3BQIA 3VR9A 3UU8A 4ILUA 2E9XC 4L5GA 2JRKA 3P4RA 4QX7B 2X51A 3AA1B 3KDSE 1DU2A 3IHRA 3KFWX 3EAMA 2W61A 2XAQB 4KBMB 3CKDA 4NPPA 3HA4A 2XASB 4A5XA 2V7MA 2MOZA 4DR1T 4TUYE 1N32T 4FI5A 2JMHA 2NTXA 3RKOA 4GK5E 3UUXB 2K48A 2VB6A 3TLUA 5L2LA 2ZMAA 2IHR1 1KFYA 1BR1A 4LF6T 1QLBA 4GIWA 3C98B 4ZEYA 5JR9C 1E7PA 1UCUA 3ZC0A 2XQ5A 4DNDA 3Q5WA 2E2AA 4PK6A 4AKRB 2UXBT 1MMDA 1FIOA 3JC6C 3PUGA 4UXNB 4NUVA 4YHHT 3PUAA 1T98A 5AQRB 2XQ9A 2QVAA 3P50A 5TAOA 2Q9QD 5LB7B 4JBWF 4QWNB 1UX5A 2VWAA 3PUZF 3EDVA 5ETWA 1KF6A 2CWOA 4OYJA 4L0RA 4HWDA 4YJ2E 3UUBA 3PUSA 2WU2A 3JAFA 1ZHCA 2XAGB 2WMOA 2CXDA 2ZM6T 3RYIE 1W0AA 3NVOA 2VKOA 4BJMA 3Q2MA 4MALA 3CQCB 1XDOA 4AKHA 3ABVA 5FL1A 4YJ3E 5JDFA 2WDVA 4DUYT 2B1EA 3ZN1B 3FBZA 2JQQA 3HKCE 3TLSA 2JPFA 5C2TA
chains in the Genus database with same CATH topology
5AQGB 4HWCA 5AQKB 1HX1B 3FZHB 5AQUB 4HWIB 4HWHA 3FZLB 3FZKB 3A8YC 5AQPB 3FZFB 4HWDA 5AQLB 5AQMB 3M3ZB 5AQOB 1I6ZA 5AQNB 2D9DA 1UK5A 5AQQB 5AQFB 1UGOA 5AQTB 5AQIB 5AQJB 1M7KA 5AQHB 5AQRB 5AQVB 1T7SA 4HWFA 1M62A 3FZMB 3LDQB 5AQSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQG B;  4HWC A;  5AQK B;  1HX1 B;  3FZH B;  5AQU B;  4HWI B;  4HWH A;  3FZL B;  3FZK B;  3A8Y C;  5AQP B;  3FZF B;  4HWD A;  5AQL B;  5AQM B;  3M3Z B;  5AQO B;  1I6Z A;  5AQN B;  2D9D A;  1UK5 A;  5AQQ B;  5AQF B;  1UGO A;  5AQT B;  5AQI B;  5AQJ B;  1M7K A;  5AQH B;  5AQR B;  5AQV B;  1T7S A;  4HWF A;  1M62 A;  3FZM B;  3LDQ B;  5AQS B; 
#chains in the Genus database with same CATH topology
 4YT0 A;  4DR2 T;  4LML A;  3ZMU B;  2Z6E A;  2NP9 A;  1S35 A;  3W15 B;  4DID B;  3LBX A;  4EZ4 A;  4YY3 T;  1E1H B;  2LOP A;  4G63 A;  5AQH B;  3AA7 B;  4H9Q C;  4YLH A;  4JUY A;  5EK4 A;  4UV8 B;  2LEH A;  1WYB A;  2EHO D;  4E7S A;  2BZB A;  3T8O A;  1XNR T;  1IAP A;  4QH4 A;  3MKD A;  3AAA B;  4ZZB A;  3IA3 A;  4X1Y E;  5LXT E;  4MBQ A;  3TLW A;  1N33 T;  3RLF F;  1MIV A;  2HN2 A;  2V7I A;  2L9Q A;  2LM9 A;  4JI8 T;  1T7S A;  3PUW F;  4IT4 A;  4UEM A;  2V8S V;  3PU3 A;  2ACX A;  1D1A A;  4HWI B;  2YDR A;  5JTG A;  4IDQ A;  5HXR A;  3U78 A;  2VK9 A;  3UUN A;  5ABE A;  3ZPO A;  4WW0 A;  2V7L A;  2V5D A;  3K3O A;  4KI0 F;  2A72 A;  3CWZ B;  2PJQ A;  1G73 A;  2RP4 A;  4ISS A;  2V6Y A;  4TWD A;  3NRX A;  3SS1 A;  2LHN A;  3NWI A;  1OED A;  3B13 A;  5JDQ A;  4EEB A;  5BMV E;  3OTO T;  2YU1 A;  4YXD A;  4E7Z A;  5LCY A;  4CZZ B;  3J9X 1;  4UIG A;  4ZI2 D;  3ONX A;  2N9D A;  1NWM X;  4HKA A;  5FVK A;  1I6Z A;  3C4W A;  2WDQ A;  2BVM A;  2VQF T;  1NEN A;  5LP6 E;  1BR2 A;  3L8R A;  2XAH B;  2M6B A;  2WWU A;  5LG4 A;  4HE8 A;  1YXR A;  2X9Y A;  2LKG A;  4J2C A;  1XDP A;  3RYC E;  3E22 E;  1H7C A;  5AQT B;  5HWY A;  2XAJ B;  4IE5 A;  2VKJ A;  2XM1 A;  2I59 A;  2X0L B;  5LHH B;  2E5V A;  2H3R A;  2D9D A;  4OHF A;  2HPL A;  4IDO A;  4JLE A;  4IE7 A;  3HKD E;  4TWF A;  5DAB A;  5JDG A;  5HEG A;  4UF0 A;  2NW7 A;  4NXM T;  1CUN A;  2BS4 A;  3AEA A;  5BR8 T;  4P09 A;  2PFV A;  2CHN A;  5DQW A;  2PBI A;  3L39 A;  1ZV4 X;  4EV6 A;  2IAK A;  4CN1 A;  5AQO B;  4MHC A;  2CRB A;  3ZCJ A;  4F8H A;  5C3J A;  4TNV A;  1D0Z A;  1GQE A;  2V5C A;  3CPZ A;  1LVK A;  1KNZ A;  5GON E;  2WAU A;  4YTM A;  2C5K T;  3AEG A;  3AE5 A;  3AE4 A;  3EVY A;  2XPK A;  3FHN A;  2XQA A;  5LHI B;  3R84 B;  4ILB A;  1XMQ T;  4XBF B;  4AIU A;  4YSZ A;  2BBJ A;  2CWY A;  1XZY A;  4QH5 A;  3PJA A;  1HNZ T;  5EK3 A;  4LFC T;  4A98 A;  2WU5 A;  1S94 A;  2KZ7 B;  2XSB A;  5FKY A;  2K9A A;  1UUR A;  3FXD B;  5ABG A;  4PW8 A;  3UQ4 A;  1XWM A;  5ADX L;  2XSA A;  5J2T E;  4PJL A;  2NTY A;  1UX4 A;  4H63 V;  3AE9 A;  4ZI7 E;  4U7Y A;  4JI1 T;  2BG9 C;  3VU7 H;  5LGU B;  2LM2 A;  3ZYL A;  2P9B A;  4KHP T;  2K24 A;  2IUB A;  1HTJ F;  1VRB A;  4GKJ T;  3RIU A;  2IC6 A;  3P4S A;  3ANW B;  3F2E A;  1OED E;  2IML A;  4X1K E;  2C5I T;  4DV2 T;  3UTK A;  4CXW A;  3KBT A;  4Z91 A;  5AQG B;  4CXX A;  2JQ9 A;  3I0Q A;  2WZH A;  3VRB A;  2W00 A;  3N9P A;  4I43 B;  2XQY A;  3S4U A;  4L9I A;  4G2A A;  2E5L T;  1D0Y A;  2MAW A;  3C64 A;  2FJB A;  2K3W A;  5HEO A;  1Y01 A;  4HFB A;  3H3A A;  2RA1 A;  4XZC A;  1KNR A;  3EDU A;  2MYS A;  3N2O A;  5L3F B;  4U7I A;  2XQ6 A;  2KMF A;  3MAC A;  5AQU B;  1MMN A;  4ASK A;  2NW9 A;  2WB5 A;  5CA0 E;  3JCF A;  4PAG A;  3RHW A;  4GYS A;  3DTO A;  2VL8 A;  3FXE B;  2J4G A;  3HKE E;  4COF A;  2KSR A;  4DV6 T;  4DVD A;  4EYU A;  2CPT A;  3PUY F;  4ILC A;  4K0U A;  2N2N A;  2ZM2 A;  3RPU A;  2IIU A;  4O4L E;  3UU4 A;  5EK2 A;  5LYJ E;  2DCF A;  5LGT B;  4KP3 C;  1UGO A;  2OV9 A;  1WYC A;  3GMI A;  3DP7 A;  3H37 A;  1LRZ A;  3FZM B;  2Q9Q C;  4IGU A;  2XHE B;  3WI3 A;  3AEC A;  2HHH T;  1X9B A;  1Z8U A;  3K8P C;  3Q9D A;  2DWG A;  3RYH E;  4B3T T;  4JI5 T;  1XNQ T;  4H63 H;  4N78 D;  1KEY A;  2DL1 A;  4PJM A;  1IZN B;  3L3P A;  3PDY A;  3LFM A;  4U2Z A;  3ZKR A;  2E9X B;  3K3N A;  4HWH A;  3JAE A;  2CA5 A;  3PUQ A;  3MZK B;  5FXW A;  5HYA A;  4X5T A;  4EOZ B;  4IRE A;  2KWI B;  2X9W A;  5FXV A;  2C0S A;  5AQK B;  3LK4 2;  1D1C A;  1Y64 B;  2CXL A;  2XM2 A;  4K0K T;  2BKN A;  5AQM B;  2J47 A;  3ONL C;  3O9X A;  5L3E B;  3O1I A;  3T1Y T;  3RRC A;  3P4P A;  5FP3 A;  4X62 T;  1NAF A;  3FB2 A;  5HCJ A;  5ABF B;  4CI2 B;  5JR9 B;  2EHO C;  3WAK A;  2WS3 A;  2CE7 A;  5DJQ C;  2NWB A;  3A8Y C;  1WRD A;  4Z8X A;  2XAF B;  4TN7 B;  3N9L A;  2JQK A;  1W0B A;  2YKS A;  3NZP A;  3O1H A;  3LJC A;  4BA9 A;  3Q5E A;  2A3D A;  2ZLY A;  4KX6 A;  3KV5 A;  5J0Z A;  2LSG A;  4PJN A;  4HFC A;  2BVL A;  5LG3 A;  1SUM B;  4ANJ A;  5CGM A;  4PNI A;  4Z90 A;  1U5P A;  1B7T A;  2YOE A;  4F6R C;  4NIQ A;  4WYV A;  3RX6 A;  1FJG T;  2LRL A;  3EHZ A;  2FBW A;  4GKK T;  4IE6 A;  3UUL A;  2ODV A;  5H6Q B;  2BBH A;  1YW0 A;  2V26 A;  2Y8D A;  2HH7 A;  2B76 A;  2BS3 A;  2CBI A;  1VOM A;  4DR5 T;  4DR3 T;  5M4Y A;  4X20 E;  3ZT6 A;  1W09 A;  4AQF A;  3FZH B;  3DJB A;  3IBP A;  2LJL A;  4ZS2 A;  2JMK A;  4QXH B;  1HG2 A;  4YSX A;  1U4Q A;  2CLY C;  3UU3 A;  3Q5D A;  3FBL A;  2DI4 A;  3AXJ B;  2X0H A;  2HN1 A;  5LHG B;  2OLT A;  4EED A;  1UK5 A;  2IDO B;  3CX8 B;  4DO0 A;  3MXZ A;  3AEF A;  1KNP A;  2M6I A;  5JDL A;  1HNX T;  3OKQ A;  1WR6 A;  4HN9 A;  3VR8 A;  4WNK A;  4DMV A;  5JDN A;  2KWH A;  1EZ3 A;  2MTQ A;  5LJM A;  5AQS B;  3ZMZ B;  5AFU L;  1HCI A;  5HWX A;  2YIN A;  2DHR A;  3AA6 B;  4UVC B;  4EB6 E;  2NW8 A;  5L47 A;  4MLK A;  5AQV B;  2XTL A;  4IDZ A;  2V7K A;  4HFD A;  4OX9 T;  3AED A;  4JI3 T;  3SFD A;  3GN5 A;  4B3S T;  4TX5 A;  3QK6 A;  1SE7 A;  5F8P A;  1N36 T;  1HFA A;  3KBU A;  1YQ4 A;  4QXC B;  4YTP A;  2QGS A;  3QOF A;  3AE2 A;  1SA0 E;  4JI4 T;  3CX7 B;  5KXJ A;  3QB5 K;  4O8S A;  4NXN T;  3FZF B;  1OWA A;  2L8K A;  5CB4 E;  5FXZ A;  1IBM T;  4CQI A;  4HFI A;  3ZCI A;  1UUS A;  3RI5 A;  2FJD A;  2PTF A;  3I9W A;  3U3I A;  3ZJ2 A;  5LBQ B;  4P0B A;  2LSK A;  2VUR A;  5AQI B;  4BAY B;  2VKD A;  3SRZ A;  5KDM C;  1FEW A;  2UUA T;  4M1P A;  3PUX F;  2FUP A;  4DV1 T;  3N2K E;  5DQV A;  2VQE T;  2DWK A;  4LF7 T;  2YU2 A;  2KND A;  3FZL B;  4YFS A;  4IDP A;  5AQQ B;  3CIR A;  5FY0 A;  2CCQ A;  4C91 A;  1AJ3 A;  2XQ3 A;  2WP9 A;  4LMK A;  4HFE A;  2H7V C;  4H9R C;  2D0U A;  2W4X A;  4PK5 A;  4IL4 A;  2WY2 A;  4U74 A;  4DMW A;  2J62 A;  3K1S A;  3Q5X A;  4CN6 A;  2WQY A;  2UXN B;  4DBQ A;  3ZC1 A;  5CFB A;  5LA6 E;  1X79 A;  5FMN A;  4HEA A;  3ZT7 A;  3C4Z A;  4OYK A;  3KIN B;  2LE8 A;  1OED C;  1SHZ C;  4AQG A;  4DV0 T;  2BG9 B;  4ZZC A;  2UUB T;  4CI3 B;  4O2A E;  5FYM A;  5LGN B;  1BR0 A;  4WBN E;  4U2Y A;  3P7I A;  3CVR A;  5HXE A;  2H7O A;  4I50 E;  4H9O C;  1LKX A;  4JI7 T;  2BKO A;  3ZYM A;  1MND A;  5EZY E;  3AE3 A;  2CBJ A;  3NRY A;  4ZXL A;  5A1L A;  2WSS V;  2FJE A;  5JDM A;  2AXD S;  4ZHQ E;  5L3D B;  4DR7 T;  4C90 A;  3RIF A;  1R8I A;  2V6X A;  2UU9 T;  2AE9 A;  3B5M A;  2WMN A;  3V5U A;  4KHZ F;  3HL6 A;  4JI6 T;  1M62 A;  1NEK A;  1W9R A;  1WR0 A;  5CJ5 A;  1YD8 G;  4PFO A;  3AE1 A;  2E9X A;  4HTE A;  4ZI3 D;  2VL0 A;  5J2U E;  2CXF A;  3KV9 A;  3ZMT B;  5FVL A;  3CML A;  3NZQ A;  4UR9 A;  4CI1 B;  2N1G A;  2UXC T;  2BG9 E;  4JEH B;  5C8Y E;  2ACZ A;  2E8I A;  4JV5 T;  2Q9Q B;  4PFP A;  4I4T E;  2X0Y A;  3AVS A;  3L09 A;  5IUX A;  3CK6 A;  4B3M T;  4JYA T;  2VVS A;  4QX8 B;  3C4X A;  3SOL A;  1WFD A;  3EAB A;  2BKP A;  1IBK T;  5JR9 A;  5ABF A;  4A56 A;  4P0A A;  1Z0P A;  3GWH A;  3RC3 A;  4YHJ A;  1E2A A;  3IF8 B;  4WZX A;  2LSY A;  5JRE A;  4KMC A;  4B3R T;  3T1H T;  3RH3 A;  1J5W A;  4U72 A;  2WDR A;  2QRX A;  3QUJ A;  4IST A;  3RIU C;  3G06 A;  4AIS A;  3RQU A;  4X66 T;  1T72 A;  3B57 A;  4EAH A;  2H88 A;  1D1B A;  5FY1 A;  4X1I E;  1J5E T;  4ZOL E;  5HEH A;  3C51 A;  2W0G A;  2V7J A;  3NBX X;  3BQK A;  2MPK A;  1ZOY A;  1D0X A;  4LMJ A;  3LSV A;  2EHO B;  4FJO A;  5L3B B;  3ZN0 B;  3P4W A;  3CQG B;  4U31 A;  2LKH A;  2X68 A;  5JRC B;  3MA9 A;  1IBL T;  3P8C D;  2XZE A;  2SPC A;  1L0V A;  4HWF A;  1T8B A;  2ZM8 A;  4BJN A;  1YKE B;  2IW5 B;  3TLV A;  3M65 A;  2CHO A;  2I0M A;  4DV3 T;  4IL9 A;  3M3Z B;  4EGW A;  4TWH A;  3WAJ A;  2KT9 A;  3VKH A;  2YK0 A;  3BQL A;  3AXJ A;  3KV4 A;  4AKI A;  4WBO A;  2LOS A;  5LOV E;  2ZM0 A;  2C5J A;  4O4H E;  3FZK B;  3QB5 A;  3RRW A;  3ESL A;  3UU5 A;  3EUH A;  2A9U A;  2XQ7 A;  3AE7 A;  4ILA A;  3OBV E;  3E0Z A;  1YQ3 A;  2X9H A;  4EYY R;  4QKN A;  4NUU A;  3N9M A;  2LSJ A;  3UT5 E;  1MIY A;  3IEE A;  5HEJ A;  5KX5 E;  3CX6 B;  5ABH A;  4CN4 A;  5L4H A;  1MIW A;  2Y48 B;  3HI2 A;  2VVN A;  2CLY B;  2PG8 A;  3BK9 A;  2YDS A;  1ZP0 A;  3R6N A;  4DUZ T;  3AVR A;  4ZI2 C;  5AQP B;  2UXX B;  2W66 A;  4DR6 T;  1WCR A;  2WBL A;  4QHO A;  4B6X A;  4HFV A;  5JVD E;  4UV9 B;  4UVA B;  1US7 B;  1J1J A;  4A97 A;  2VAS A;  4ADZ A;  3KVA A;  3ONJ A;  4LF9 T;  2MBG A;  1WLX A;  3VKG A;  2D2S A;  3UU6 A;  5FXX A;  4O2B E;  4XAX B;  3TLT A;  2E9X D;  3PV0 F;  5IWA T;  2JQH A;  3QNU A;  5LBM A;  2LT3 A;  3JAD A;  2D0T A;  3P4Q A;  3D0T A;  4AXP A;  3PJA J;  4JI2 T;  4X64 T;  3RGL A;  4IE0 A;  1IJ5 A;  2X67 A;  2LRK A;  5JQG E;  3OVU A;  3AA0 B;  3LK3 B;  3O4X E;  1LVF A;  1N34 T;  1CHU A;  3ZST A;  5HCM A;  2ODU A;  1JNZ A;  4H9N C;  3AEE A;  3H3M A;  3JC6 D;  3AAI A;  2W62 A;  5AQN B;  2JJ9 A;  4H9P C;  3MJX A;  1MNE A;  5F3J A;  5HXC A;  2NOX A;  3AAE B;  3RC8 A;  3KV6 A;  2QA7 A;  4HFH A;  4AQF C;  5J1G A;  5LMN T;  1QUU A;  1HX1 B;  3EI0 A;  3RKG A;  5JDH A;  3N9N A;  3F31 A;  5L4E A;  1OXZ A;  2HPJ A;  3LBX B;  4DR4 T;  5FL0 A;  1VCT A;  3PUV F;  1HF8 A;  2WZI A;  4UEL A;  2H89 A;  1XMO T;  4UVB B;  5LJN A;  2XY8 B;  4IDN A;  2XJ7 A;  2L3L A;  2W63 A;  2Y6X A;  2OA5 A;  3ETV A;  3TKL B;  3QC9 A;  3RIA A;  4AI6 A;  5HEU A;  2D5U A;  3A5X A;  5AQJ B;  2XQ8 A;  2BG9 A;  1FMW A;  3RQW A;  2YN6 A;  4P1N A;  2KXP B;  4O4J E;  4DV4 T;  2I6H A;  3PE0 A;  4JI0 T;  2CM0 A;  1O3X A;  4LF5 T;  4MFR A;  4I0U A;  2WCA A;  5FNV E;  4LFB T;  1JNR A;  3UFE A;  2NR4 A;  3GN5 B;  2ES0 A;  2V6Y B;  4ZI3 C;  3ZSS A;  4YSY A;  2WWV A;  3ANW A;  3VHL A;  5AQF B;  1OED B;  4EXT A;  2DLR A;  3KVB A;  1ZKE A;  2YEV C;  3MK7 C;  4AQY T;  4DBR A;  5H6R B;  4TV8 E;  3ZJ1 A;  4PK4 A;  2XQ4 A;  2BS2 A;  4TZ4 C;  5LNK A;  3X1D A;  3LG7 A;  2W67 A;  5HXH A;  4KUM B;  2CMR A;  1V9D A;  1G8X A;  4GK0 E;  4TNW A;  4QXB B;  2GK9 A;  3OJA A;  5E0O A;  4GYR A;  2LLY A;  1KK7 A;  2WM9 A;  3UQ7 A;  3I0O A;  4EIW A;  2X66 A;  2LSI A;  2Q9Q A;  1HX8 A;  3N9Q A;  4X65 T;  4ERR A;  1HR0 T;  2UXD T;  3V5S A;  4QH1 A;  3K3Q C;  4UF0 B;  3SFE A;  3LDQ B;  3N5L A;  1BR4 A;  1VCS A;  5HAX A;  3J7Y q;  3ZT5 A;  5L3G B;  2V1D B;  5HXS A;  2M67 A;  2UUC T;  5IHY A;  1FMV A;  3PU8 A;  3ZLI A;  2KIN B;  4LF4 T;  3E08 A;  2KLQ A;  5KMG P;  2A2F X;  3VRA A;  3SWH A;  2R6G F;  3A7M A;  4IHJ E;  2K5B B;  2BDE A;  3RYF E;  5CA1 E;  2DNX A;  4U33 A;  1IJ6 A;  3NKZ A;  4O4I E;  2J1D G;  5LMU T;  4YTN A;  3UUM A;  2JIW A;  1HG5 A;  4AKL A;  3AE8 A;  4IE4 A;  3OPC A;  3F57 A;  4HWC A;  4Q25 A;  3ZYK A;  2CEA A;  2EHO A;  4ZS3 A;  3O1J A;  1YKH B;  5JRC A;  2X9X A;  1HNW T;  1QSD A;  2W2U A;  2FJA A;  1HS7 A;  3ZMV B;  3C50 A;  4OFZ A;  4EZH A;  2RPA A;  2G0U A;  5AQL B;  3AEB A;  2QYW A;  3LK2 B;  2XUE A;  5F5W A;  4OK0 A;  1ZEE A;  4DV7 T;  4H9S E;  2IC9 A;  3PTR B;  4GOU A;  4CXY A;  3GA8 A;  3ZMS B;  2F4V T;  5FY7 A;  3N9O A;  3N2G E;  4TV9 E;  4U3C A;  4LFA T;  4PJJ A;  3I9Y A;  3I1A A;  3HR0 A;  3UFG A;  3ETU A;  3PUR A;  5IYZ E;  3OYZ A;  5L3C B;  3ZEF B;  4AKG A;  1M7K A;  3CQX C;  1MMA A;  4DV5 T;  3AB3 B;  4HGA A;  1I94 T;  3HKB E;  4I55 E;  3AE6 A;  2VKH A;  4IIJ E;  3OYX A;  4LF8 T;  2LHR A;  3RF1 A;  2YDQ A;  1MMG A;  4V1A v;  4JEU B;  5JH7 E;  3BQI A;  3VR9 A;  3UU8 A;  4ILU A;  2E9X C;  4L5G A;  2JRK A;  3P4R A;  4QX7 B;  2X51 A;  3AA1 B;  3KDS E;  1DU2 A;  3IHR A;  3KFW X;  3EAM A;  2W61 A;  2XAQ B;  4KBM B;  3CKD A;  4NPP A;  3HA4 A;  2XAS B;  4A5X A;  2V7M A;  2MOZ A;  4DR1 T;  4TUY E;  1N32 T;  4FI5 A;  2JMH A;  2NTX A;  3RKO A;  4GK5 E;  3UUX B;  2K48 A;  2VB6 A;  3TLU A;  5L2L A;  2ZMA A;  2IHR 1;  1KFY A;  1BR1 A;  4LF6 T;  1QLB A;  4GIW A;  3C98 B;  4ZEY A;  5JR9 C;  1E7P A;  1UCU A;  3ZC0 A;  2XQ5 A;  4DND A;  3Q5W A;  2E2A A;  4PK6 A;  4AKR B;  2UXB T;  1MMD A;  1FIO A;  3JC6 C;  3PUG A;  4UXN B;  4NUV A;  4YHH T;  3PUA A;  1T98 A;  5AQR B;  2XQ9 A;  2QVA A;  3P50 A;  5TAO A;  2Q9Q D;  5LB7 B;  4JBW F;  4QWN B;  1UX5 A;  2VWA A;  3PUZ F;  3EDV A;  5ETW A;  1KF6 A;  2CWO A;  4OYJ A;  4L0R A;  4HWD A;  4YJ2 E;  3UUB A;  3PUS A;  2WU2 A;  3JAF A;  1ZHC A;  2XAG B;  2WMO A;  2CXD A;  2ZM6 T;  3RYI E;  1W0A A;  3NVO A;  2VKO A;  4BJM A;  3Q2M A;  4MAL A;  3CQC B;  1XDO A;  4AKH A;  3ABV A;  5FL1 A;  4YJ3 E;  5JDF A;  2WDV A;  4DUY T;  2B1E A;  3ZN1 B;  3FBZ A;  2JQQ A;  3HKC E;  3TLS A;  2JPF A;  5C2T A; 
#chains in the Genus database with same CATH homology
 5AQG B;  4HWC A;  5AQK B;  1HX1 B;  3FZH B;  5AQU B;  4HWI B;  4HWH A;  3FZL B;  3FZK B;  3A8Y C;  5AQP B;  3FZF B;  4HWD A;  5AQL B;  5AQM B;  3M3Z B;  5AQO B;  1I6Z A;  5AQN B;  2D9D A;  1UK5 A;  5AQQ B;  5AQF B;  1UGO A;  5AQT B;  5AQI B;  5AQJ B;  1M7K A;  5AQH B;  5AQR B;  5AQV B;  1T7S A;  4HWF A;  1M62 A;  3FZM B;  3LDQ B;  5AQS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...