4HWDA

Crystal structure of atbag2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
86
structure length
86
Chain Sequence
SSSKAISDISFQVERLAGQLSAFDTVIGKGGKVEEKNLENLMEMLMNQLVKLDAISGDGDVKLKKKMQEERLHKYVEALDLLKIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 2
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 39
structure length 86
sequence length 86
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwdA00
4HWDA 4HWCA 5AQRB 3FZLB 1UGOA 3FZFB 3LDQB 5AQMB 1HX1B 3A8YC 5AQJB 5AQOB 5AQQB 5AQTB 1T7SA 5AQGB 5AQSB 4HWIB 3M3ZB 1M7KA 4HWHA 3FZHB 5AQFB 2D9DA 1UK5A 1M62A 3FZKB 5AQNB 5AQVB 5AQKB 5AQHB 5AQPB 5AQIB 4HWFA 5AQUB 1I6ZA 3FZMB 5AQLB
chains in the Genus database with same CATH superfamily
4X20E 4JI1T 5LBQB 3ZN0B 4PJMA 4HKAA 3PDYA 3LSVA 1IJ6A 2J4GA 3IF8B 5ABHA 4OX9T 2CM0A 3ZT6A 3UUNA 4BJNA 4ZS3A 3U3IA 4HWCA 3AVSA 1UGOA 4YLHA 4YT0A 5HEOA 1D1AA 4JYAT 2KMFA 1HTJF 5ABEA 5EK2A 1IJ5A 2DL1A 4IIJE 1XWMA 4U3CA 5L47A 2WMOA 2R6GF 4ILAA 2JIWA 2CE7A 3ANWA 5CA0E 3PU8A 3RX6A 5FVKA 3RKGA 3UU8A 2WB5A 4CN6A 4QXCB 4TZ4C 4PJJA 5LYJE 3E08A 1B7TA 1W09A 2V26A 3N9QA 4ILUA 5JDFA 1Y64B 4FJOA 5JQGE 3VR9A 4EYUA 5FP3A 2NTYA 1KNZA 2V6YA 2F4VT 1OWAA 2MBGA 3LFMA 2XSBA 2LSIA 2VKJA 4H9RC 3Q5XA 2CEAA 2LSJA 2KXPB 4WZXA 4B3TT 2XAFB 4NUUA 2KLQA 4DO0A 5F8PA 2QA7A 1FIOA 4AKRB 3MJXA 2Q9QB 3QC9A 4DV5T 2L3LA 2C5JA 4WBOA 4WYVA 3ZT5A 4GYSA 1MMNA 2ZLYA 1JNRA 3L09A 5AQQB 4B3MT 4YHJA 4G63A 3RKOA 2VQFT 4GOUA 4EOZB 1IBKT 2DWKA 5H6QB 2K3WA 4E7ZA 4JI7T 2BBJA 3ABVA 4AQYT 4H9SE 4UVAB 5LGNB 1OXZA 4HFDA 3N5LA 3C51A 3UFGA 5HXRA 4EZHA 3EUHA 1XDOA 2JPFA 2Q9QC 1V9DA 2XTLA 5CFBA 5CA1E 5HYAA 4EIWA 4IREA 5HCMA 2E8IA 3RRCA 5ABGA 3C4XA 1HR0T 4EXTA 3C64A 3UU4A 5AQPB 2BVMA 4XZCA 1E1HB 4O4HE 4JUYA 2X0HA 2ZM6T 3KBUA 4YJ2E 1Z8UA 5LMNT 2WU5A 2YINA 2EHOA 2BDEA 3CWZB 1WYCA 2XM1A 2LSKA 3UQ4A 4NXMT 4CN1A 2W63A 4QH5A 3ZJ1A 1BR0A 3RIUC 5LCYA 3RH3A 3T1HT 2NP9A 1IAPA 3ZMVB 4TWHA 3NVOA 5A1LA 3AVRA 4O2AE 3I1AA 5AQGB 5HXHA 2WU2A 2V7LA 2X0LB 3PJAA 3ZC0A 3BQKA 2NTXA 3CQXC 2LM9A 5HEJA 3AA7B 4ISTA 5AQUB 4B6XA 4PJLA 4AISA 4A5XA 5LMUT 4UVCB 2YDRA 4F8HA 3HI2A 4ERRA 3LK42 3MK7C 3K3NA 4TNWA 4IDNA 2KNDA 3KBTA 4QXHB 4EZ4A 5AQVB 1KFYA 4DR1T 4CI3B 2OLTA 3KDSE 4GKKT 3HR0A 2YKSA 4GK5E 4WW0A 3P4SA 1FJGT 4UF0B 2XZEA 2XQ3A 2C0SA 4U33A 2BG9B 2M6BA 4ADZA 4ZZCA 1G73A 3AE4A 1MIVA 4X65T 4L5GA 5BMVE 4A98A 1HG2A 3KV4A 5AQTB 3RIAA 2HPJA 3MACA 4MHCA 3P8CD 4TN7B 1SA0E 2LE8A 5KXJA 2RPAA 5FL1A 1T98A 5HWYA 5AQLB 3AE7A 1VRBA 4ZXLA 5IYZE 5JRCB 3SOLA 3B13A 3K8PC 3F2EA 4LFCT 4O4LE 4ZI2C 5JDHA 3AEDA 5L3EB 2BG9C 4O4JE 4BAYB 3KFWX 5LBMA 2XQAA 5L4HA 5JH7E 1FMVA 4OYJA 4TWDA 3NWIA 4NPPA 3O4XE 4LF6T 3PUQA 4U2YA 2K48A 1YW0A 3IBPA 2CCQA 3T1YT 4N78D 4U31A 2CRBA 2QVAA 4AIUA 2YDSA 1W9RA 2W62A 4UELA 2I0MA 4BJMA 1UX5A 4ZI3C 3Q2MA 3ZCIA 1OEDC 3EVYA 2CBJA 2WMNA 3IEEA 2KZ7B 4YTPA 1NAFA 4UV9B 5JVDE 3ZYLA 1XMOT 3B57A 3RC8A 3PE0A 3G06A 1GQEA 2A9UA 5L3DB 2WWUA 1LKXA 2Q9QD 3Q5EA 5J2TE 4ZS2A 3CKDA 4X66T 1M62A 5FY1A 3N9PA 4QHOA 3ZLIA 2Z6EA 1J1JA 1MNDA 4LFAT 1O3XA 1HFAA 2PJQA 2Q9QA 2RA1A 3B5MA 3AAIA 4KHZF 2UXCT 5AQSB 5AQFB 3MA9A 1QSDA 4LFBT 2A72A 3FZMB 2DNXA 4ZHQE 4YSXA 2B1EA 3EDUA 2IMLA 2Y8DA 3LBXB 3OYXA 3PUYF 2V6XA 3DJBA 2KINB 3PUSA 2UUBT 3E22E 5AQHB 2ZMAA 2IUBA 2D5UA 2LOSA 3AA6B 3RIUA 3FZLB 1HX1B 4H63H 4IDOA 4TV9E 4ILCA 4YHHT 3N9MA 4U7YA 5LHGB 2IW5B 5FXXA 3HKCE 3RQUA 4YFSA 5CB4E 4TV8E 4DR4T 1MIWA 3UTKA 1KNPA 5FXVA 2LM2A 2N1GA 4IDZA 2VKDA 3QB5K 2XJ7A 2V8SV 3EI0A 2E2AA 5L3CB 5AQIB 3AEAA 3C50A 3AEBA 4XBFB 4QH4A 5LHIB 3VKGA 2CWOA 4DR7T 2UU9T 2JQQA 5TAOA 2CHNA 2HHHT 2IC6A 2V1DB 2MAWA 4FI5A 4PK5A 5CJ5A 5HXSA 4DV6T 1WLXA 3EAMA 1LRZA 4CZZB 3PUAA 2MPKA 2XQ4A 1M7KA 4GIWA 3E0ZA 2V5DA 2VURA 4OYKA 3FXEB 5LNKA 1WYBA 2I59A 3AECA 2RP4A 5IUXA 1US7B 4HN9A 3C4ZA 2YU1A 4C91A 4ZI2D 2CLYB 3H3MA 1D0YA 3ETUA 4U72A 2UUCT 5C3JA 4IGUA 5FMNA 2WZIA 2VWAA 5ABFA 4X1KE 2E9XB 3SRZA 2BG9A 3ZMTB 3RQWA 4CI2B 3NBXX 3CX6B 1QLBA 4EGWA 1LVKA 4AQGA 3X1DA 3RHWA 4ZI3D 1E7PA 4L9IA 2LOPA 2X9WA 1YD8G 2CXDA 3AA1B 3A5XA 1S35A 2MOZA 4M1PA 3CQCB 4GYRA 2CLYC 1SUMB 4O8SA 3GN5B 5JRCA 3K3OA 3SS1A 4K0KT 5J1GA 2XM2A 2LLYA 1OEDA 1SE7A 3RC3A 2CBIA 4O2BE 3NKZA 4H9QC 1UCUA 2QRXA 3P4RA 1T7SA 2WCAA 2W0GA 2YOEA 3FBLA 5HAXA 3FB2A 4U74A 3C98B 3BK9A 5LOVE 2QGSA 4DV7T 1MNEA 3NRYA 4U2ZA 4AKGA 1ZHCA 2K9AA 4I4TE 4PJNA 3F57A 4B3ST 1FMWA 2VL0A 3TLWA 2L9QA 3QUJA 3N2OA 1XDPA 2LSGA 4KP3C 3TKLB 4NXNT 4QKNA 4KX6A 1W0BA 4ZI7E 3K3QC 3KV6A 3CMLA 4IT4A 1HF8A 3M3ZB 4DR2T 5GONE 5JDGA 3PUWF 3ZSSA 4GKJT 2FJBA 4ASKA 2PFVA 3ZMZB 3N9LA 2ACZA 3OBVE 4GK0E 1ZV4X 2VVNA 2E5LT 5FXZA 4HFIA 4WNKA 5AQKB 2FJAA 4UXNB 4JLEA 2IHR1 1IBLT 3OPCA 5LJNA 3O1IA 4BA9A 4AXPA 1LVFA 3TLSA 1KEYA 4JI0T 5C2TA 3EABA 4V1Av 3V5UA 2OV9A 4IE7A 3LK3B 1WCRA 3LBXA 3AXJA 3UFEA 1IZNB 4X62T 4LMKA 3AEFA 4TX5A 1D1BA 2W66A 3ZSTA 3KVBA 5F5WA 5JDMA 2KWHA 1CUNA 2LHNA 3KVAA 4X5TA 2NOXA 4DV1T 5DJQC 3WAJA 4H9NC 3AE6A 1E2AA 4IHJE 2VASA 2XY8B 3RF1A 3RYHE 1D1CA 1BR4A 1NWMX 3WI3A 3AE9A 4CI1B 4YSYA 3AE2A 2XQ7A 4B3RT 4P0BA 2ODUA 5F3JA 2H3RA 3PUGA 4DV2T 3RYFE 4LMLA 4IE6A 4C90A 3PU3A 2BKOA 4JI2T 1DU2A 3GA8A 3JCFA 1XNQT 2HPLA 4KUMB 1MMDA 4HGAA 4JI3T 4YY3T 3N9NA 3HKDE 3ZC1A 4OHFA 2CPTA 3UUXB 3ZYMA 3EHZA 1KF6A 4AKHA 3AE3A 4L0RA 3PV0F 3HKEE 3K1SA 4PFOA 1QUUA 4E7SA 5AQOB 4P0AA 4X1YE 3I0OA 1XNRT 2VK9A 2K24A 4NUVA 2N2NA 4A56A 4EYYR 2KWIB 2XAJB 4X64T 2D9DA 4ZZBA 2HN2A 3IHRA 1HX8A 2BKNA 4ZEYA 1VCTA 2WDRA 4IE0A 2AXDS 5KX5E 2Y6XA 3N2KE 4ILBA 3VKHA 3AEEA 5LG4A 2XHEB 2LSYA 2NWBA 5FY0A 1N36T 4IE5A 2UXNB 4CXWA 3U78A 5FY7A 1J5WA 2NW8A 3UU5A 1KK7A 3UU3A 2X9YA 3GN5A 1X79A 3ZPOA 2C5IT 4CXYA 2VQET 4EAHA 5HXEA 4P09A 3TLVA 3AEGA 3I0QA 2D0UA 2VL8A 3CIRA 2EHOB 4ZOLE 2LT3A 4IE4A 3W15B 4ANJA 3VHLA 2VB6A 2IDOB 2WDQA 4PK6A 4DV4T 4HEAA 5IWAT 2JQHA 3NZQA 5E0OA 2P9BA 3GMIA 5J0ZA 2V7IA 2XAGB 2ODVA 3VRBA 4AQFC 2BS4A 1SHZC 3ONJA 1KNRA 3PUXF 1UUSA 2K5BB 3SFDA 4Z90A 2MYSA 3R6NA 3AAAB 2C5KT 2G0UA 1IBMT 1T8BA 1L0VA 3DP7A 3I9WA 3FXDB 1BR1A 4DUZT 3H3AA 3LJCA 4JI5T 3D0TA 3M65A 2W67A 3FBZA 2LEHA 3MZKB 1ZEEA 1W0AA 2D0TA 2W4XA 1YXRA 3AE1A 3RIFA 2X51A 2NR4A 3BQIA 4YXDA 4I50E 1N33T 4DNDA 5FKYA 3ONLC 4EEBA 4Q25A 2ZM8A 4KI0F 2L8KA 4PNIA 3WAKA 2XQ5A 3FZHB 3AE8A 5JDLA 1HCIA 1VOMA 2WBLA 3N2GE 4UEMA 4EB6E 4YSZA 3PUZF 4CXXA 3P4QA 2XQYA 2V7KA 2VVSA 4A97A 5L4EA 4DBRA 2WZHA 5HEUA 3O1JA 2LHRA 3RLFF 3MXZA 5FNVE 2V5CA 5ADXL 1R8IA 1UURA 1J5ET 4EV6A 5EK3A 3C4WA 4DR5T 3RGLA 4H9PC 4PAGA 3ZKRA 4UF0A 2XSAA 3NZPA 4UV8B 1YQ3A 4AI6A 4F6RC 4KHPT 2VKHA 4LF4T 3JC6C 2N9DA 3CX8B 2UXDT 4QH1A 3AA0B 3P7IA 4HTEA 4I55E 3UUMA 4IDQA 2XQ8A 5FXWA 1JNZA 3QNUA 4DR3T 2X9XA 3I9YA 2J1DG 4LF7T 1AJ3A 2ZM2A 1D0ZA 5L3FB 1X9BA 5FVLA 2W00A 2A2FX 4CN4A 3ZCJA 1NEKA 4HE8A 4OFZA 3MKDA 4JEUB 4I0UA 3TLTA 1XZYA 5JDNA 3SFEA 2E9XC 5FYMA 5AQJB 3FHNA 3HKBE 4HFVA 4QX8B 1NENA 2X66A 3OTOT 3AAEB 2JQKA 1HS7A 3CK6A 3KINB 3ZEFB 2YK0A 4HWIB 2DLRA 2BS3A 3L8RA 3RPUA 5AQNB 1H7CA 2UXBT 2LRKA 3R84B 2X68A 3O9XA 1MIYA 4JI6T 2FUPA 2CHOA 2PG8A 2PBIA 5EK4A 2BG9E 2XUEA 2H89A 1U4QA 4IL4A 2WQYA 2FJEA 5HWXA 2J62A 3CPZA 2DHRA 2W2UA 4DV3T 4IDPA 2NW9A 2XQ9A 4HWFA 4G2AA 4YJ3E 4DR6T 5LP6E 5KDMC 1UX4A 3RYIE 2BVLA 3L39A 3VU7H 5LGTB 2EHOD 1UK5A 2BZBA 4AQFA 2IAKA 1VCSA 3JAEA 5LB7B 2A3DA 4O4IE 2BS2A 4JEHB 1OEDE 5JR9B 1MMGA 2WY2A 2OA5A 5LJMA 3GWHA 2XASB 4CQIA 5LHHB 2WSSV 5CGMA 2X9HA 3L3PA 3HL6A 2B76A 2LRLA 3UUBA 1WFDA 3CQGB 2E5VA 5AFUL 2LKGA 2FBWA 2HH7A 4AKLA 1I6ZA 2SPCA 4XAXB 2DCFA 3SWHA 4J2CA 4X1IE 2CXFA 3DTOA 2X67A 4JBWF 2NW7A 2JRKA 5DABA 4YTMA 2JMKA 4UR9A 1S94A 3VRAA 5HEGA 5JR9C 2QYWA 3OYZA 4WBNE 5L3GB 5BR8T 3JAFA 3J7Yq 1BR2A 3N9OA 1T72A 3PJAJ 4QX7B 1I94T 4TNVA 5J2UE 3ANWB 1N32T 4K0UA 4LF5T 3PTRB 3LDQB 4HFEA 4LF8T 4PW8A 4PFPA 2UUAT 5ABFB 1FEWA 4COFA 4MLKA 4JI4T 3T8OA 3KV9A 4IL9A 1U5PA 1HNZT 4PK4A 3ETVA 1ZKEA 2YN6A 2Y48B 3JC6D 2UXXB 1YQ4A 4KBMB 2ZM0A 2I6HA 1WR6A 3ZT7A 2XQ6A 2AE9A 2V6YB 5AQMB 3P50A 4I43B 2WS3A 3ZN1B 2LKHA 3NRXA 4DV0T 4DBQA 2KSRA 4MALA 2ES0A 2W61A 2DWGA 2XAHB 3HA4A 2H7VC 2YDQA 2XAQB 4DVDA 3V5SA 3Q5DA 2DI4A 4QWNB 5HXCA 3ZJ2A 5H6RB 2J47A 4JV5T 5LGUB 2CXLA 5LA6E 3IA3A 4OK0A 1OEDB 1ZOYA 4HWHA 2M6IA 2ACXA 4HFCA 4H63V 3JADA 4NIQA 5M4YA 2E9XD 5DQWA 1CHUA 3ESLA 4UIGA 2CA5A 3S4UA 3CVRA 3H37A 3LK2B 5C8YE 2X0YA 2WAUA 5AQRB 2WWVA 4U7IA 1D0XA 2E9XA 4AKIA 2MTQA 1YKHB 4TUYE 4QXBB 3VR8A 4UVBB 5JREA 3ZMUB 1Y01A 3RYCE 4MBQA 3RI5A 4DMVA 2BKPA 3A8YC 4Z91A 1HG5A 3O1HA 3ZMSB 2JQ9A 2VKOA 5JTGA 3J9X1 3AE5A 1N34T 3PURA 3QB5A 4EEDA 1HNXT 5LG3A 4H9OC 3ZYKA 2M67A 1XMQT 5EZYE 2WP9A 3RRWA 2JJ9A 3OKQA 3KV5A 5LXTE 2H7OA 2XPKA 1MMAA 1Z0PA 2PTFA 3LG7A 1WRDA 4ISSA 3UULA 2CMRA 3BQLA 5HEHA 3ONXA 5DQVA 4HFHA 4TWFA 3AB3B 3QK6A 5HCJA 3OJAA 2JMHA 2WDVA 3UQ7A 1ZP0A 4LF9T 4DIDB 2V7MA 5KMGP 2FJDA 4LMJA 1EZ3A 3PUVF 4HWDA 3UU6A 3P4PA 3AXJB 4P1NA 5FL0A 2D2SA 4MFRA 4DMWA 2WM9A 3Q9DA 3P4WA 1G8XA 3FZKB 2IIUA 3EDVA 1WR0A 2IC9A 3OVUA 4KMCA 2EHOC 5L3BB 4Z8XA 5IHYA 4DUYT 2LJLA 3FZFB 2HN1A 2YEVC 2V7JA 3CX7B 2YU2A 3A7MA 3TLUA 3UT5E 1HNWT 2KT9A 5JDQA 2BBHA 2CWYA 3F31A 2H88A 4YTNA 5L2LA 4HFBA 2GK9A 1YKEB 5JR9A 4JI8T 5ETWA 3Q5WA 3QOFA
chains in the Genus database with same CATH topology
4HWDA 4HWCA 5AQRB 3FZLB 1UGOA 3FZFB 3LDQB 5AQMB 1HX1B 3A8YC 5AQJB 5AQOB 5AQQB 5AQTB 1T7SA 5AQGB 5AQSB 4HWIB 3M3ZB 1M7KA 4HWHA 3FZHB 5AQFB 2D9DA 1UK5A 1M62A 3FZKB 5AQNB 5AQVB 5AQKB 5AQHB 5AQPB 5AQIB 4HWFA 5AQUB 1I6ZA 3FZMB 5AQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWD A;  4HWC A;  5AQR B;  3FZL B;  1UGO A;  3FZF B;  3LDQ B;  5AQM B;  1HX1 B;  3A8Y C;  5AQJ B;  5AQO B;  5AQQ B;  5AQT B;  1T7S A;  5AQG B;  5AQS B;  4HWI B;  3M3Z B;  1M7K A;  4HWH A;  3FZH B;  5AQF B;  2D9D A;  1UK5 A;  1M62 A;  3FZK B;  5AQN B;  5AQV B;  5AQK B;  5AQH B;  5AQP B;  5AQI B;  4HWF A;  5AQU B;  1I6Z A;  3FZM B;  5AQL B; 
#chains in the Genus database with same CATH topology
 4X20 E;  4JI1 T;  5LBQ B;  3ZN0 B;  4PJM A;  4HKA A;  3PDY A;  3LSV A;  1IJ6 A;  2J4G A;  3IF8 B;  5ABH A;  4OX9 T;  2CM0 A;  3ZT6 A;  3UUN A;  4BJN A;  4ZS3 A;  3U3I A;  4HWC A;  3AVS A;  1UGO A;  4YLH A;  4YT0 A;  5HEO A;  1D1A A;  4JYA T;  2KMF A;  1HTJ F;  5ABE A;  5EK2 A;  1IJ5 A;  2DL1 A;  4IIJ E;  1XWM A;  4U3C A;  5L47 A;  2WMO A;  2R6G F;  4ILA A;  2JIW A;  2CE7 A;  3ANW A;  5CA0 E;  3PU8 A;  3RX6 A;  5FVK A;  3RKG A;  3UU8 A;  2WB5 A;  4CN6 A;  4QXC B;  4TZ4 C;  4PJJ A;  5LYJ E;  3E08 A;  1B7T A;  1W09 A;  2V26 A;  3N9Q A;  4ILU A;  5JDF A;  1Y64 B;  4FJO A;  5JQG E;  3VR9 A;  4EYU A;  5FP3 A;  2NTY A;  1KNZ A;  2V6Y A;  2F4V T;  1OWA A;  2MBG A;  3LFM A;  2XSB A;  2LSI A;  2VKJ A;  4H9R C;  3Q5X A;  2CEA A;  2LSJ A;  2KXP B;  4WZX A;  4B3T T;  2XAF B;  4NUU A;  2KLQ A;  4DO0 A;  5F8P A;  2QA7 A;  1FIO A;  4AKR B;  3MJX A;  2Q9Q B;  3QC9 A;  4DV5 T;  2L3L A;  2C5J A;  4WBO A;  4WYV A;  3ZT5 A;  4GYS A;  1MMN A;  2ZLY A;  1JNR A;  3L09 A;  5AQQ B;  4B3M T;  4YHJ A;  4G63 A;  3RKO A;  2VQF T;  4GOU A;  4EOZ B;  1IBK T;  2DWK A;  5H6Q B;  2K3W A;  4E7Z A;  4JI7 T;  2BBJ A;  3ABV A;  4AQY T;  4H9S E;  4UVA B;  5LGN B;  1OXZ A;  4HFD A;  3N5L A;  3C51 A;  3UFG A;  5HXR A;  4EZH A;  3EUH A;  1XDO A;  2JPF A;  2Q9Q C;  1V9D A;  2XTL A;  5CFB A;  5CA1 E;  5HYA A;  4EIW A;  4IRE A;  5HCM A;  2E8I A;  3RRC A;  5ABG A;  3C4X A;  1HR0 T;  4EXT A;  3C64 A;  3UU4 A;  5AQP B;  2BVM A;  4XZC A;  1E1H B;  4O4H E;  4JUY A;  2X0H A;  2ZM6 T;  3KBU A;  4YJ2 E;  1Z8U A;  5LMN T;  2WU5 A;  2YIN A;  2EHO A;  2BDE A;  3CWZ B;  1WYC A;  2XM1 A;  2LSK A;  3UQ4 A;  4NXM T;  4CN1 A;  2W63 A;  4QH5 A;  3ZJ1 A;  1BR0 A;  3RIU C;  5LCY A;  3RH3 A;  3T1H T;  2NP9 A;  1IAP A;  3ZMV B;  4TWH A;  3NVO A;  5A1L A;  3AVR A;  4O2A E;  3I1A A;  5AQG B;  5HXH A;  2WU2 A;  2V7L A;  2X0L B;  3PJA A;  3ZC0 A;  3BQK A;  2NTX A;  3CQX C;  2LM9 A;  5HEJ A;  3AA7 B;  4IST A;  5AQU B;  4B6X A;  4PJL A;  4AIS A;  4A5X A;  5LMU T;  4UVC B;  2YDR A;  4F8H A;  3HI2 A;  4ERR A;  3LK4 2;  3MK7 C;  3K3N A;  4TNW A;  4IDN A;  2KND A;  3KBT A;  4QXH B;  4EZ4 A;  5AQV B;  1KFY A;  4DR1 T;  4CI3 B;  2OLT A;  3KDS E;  4GKK T;  3HR0 A;  2YKS A;  4GK5 E;  4WW0 A;  3P4S A;  1FJG T;  4UF0 B;  2XZE A;  2XQ3 A;  2C0S A;  4U33 A;  2BG9 B;  2M6B A;  4ADZ A;  4ZZC A;  1G73 A;  3AE4 A;  1MIV A;  4X65 T;  4L5G A;  5BMV E;  4A98 A;  1HG2 A;  3KV4 A;  5AQT B;  3RIA A;  2HPJ A;  3MAC A;  4MHC A;  3P8C D;  4TN7 B;  1SA0 E;  2LE8 A;  5KXJ A;  2RPA A;  5FL1 A;  1T98 A;  5HWY A;  5AQL B;  3AE7 A;  1VRB A;  4ZXL A;  5IYZ E;  5JRC B;  3SOL A;  3B13 A;  3K8P C;  3F2E A;  4LFC T;  4O4L E;  4ZI2 C;  5JDH A;  3AED A;  5L3E B;  2BG9 C;  4O4J E;  4BAY B;  3KFW X;  5LBM A;  2XQA A;  5L4H A;  5JH7 E;  1FMV A;  4OYJ A;  4TWD A;  3NWI A;  4NPP A;  3O4X E;  4LF6 T;  3PUQ A;  4U2Y A;  2K48 A;  1YW0 A;  3IBP A;  2CCQ A;  3T1Y T;  4N78 D;  4U31 A;  2CRB A;  2QVA A;  4AIU A;  2YDS A;  1W9R A;  2W62 A;  4UEL A;  2I0M A;  4BJM A;  1UX5 A;  4ZI3 C;  3Q2M A;  3ZCI A;  1OED C;  3EVY A;  2CBJ A;  2WMN A;  3IEE A;  2KZ7 B;  4YTP A;  1NAF A;  4UV9 B;  5JVD E;  3ZYL A;  1XMO T;  3B57 A;  3RC8 A;  3PE0 A;  3G06 A;  1GQE A;  2A9U A;  5L3D B;  2WWU A;  1LKX A;  2Q9Q D;  3Q5E A;  5J2T E;  4ZS2 A;  3CKD A;  4X66 T;  1M62 A;  5FY1 A;  3N9P A;  4QHO A;  3ZLI A;  2Z6E A;  1J1J A;  1MND A;  4LFA T;  1O3X A;  1HFA A;  2PJQ A;  2Q9Q A;  2RA1 A;  3B5M A;  3AAI A;  4KHZ F;  2UXC T;  5AQS B;  5AQF B;  3MA9 A;  1QSD A;  4LFB T;  2A72 A;  3FZM B;  2DNX A;  4ZHQ E;  4YSX A;  2B1E A;  3EDU A;  2IML A;  2Y8D A;  3LBX B;  3OYX A;  3PUY F;  2V6X A;  3DJB A;  2KIN B;  3PUS A;  2UUB T;  3E22 E;  5AQH B;  2ZMA A;  2IUB A;  2D5U A;  2LOS A;  3AA6 B;  3RIU A;  3FZL B;  1HX1 B;  4H63 H;  4IDO A;  4TV9 E;  4ILC A;  4YHH T;  3N9M A;  4U7Y A;  5LHG B;  2IW5 B;  5FXX A;  3HKC E;  3RQU A;  4YFS A;  5CB4 E;  4TV8 E;  4DR4 T;  1MIW A;  3UTK A;  1KNP A;  5FXV A;  2LM2 A;  2N1G A;  4IDZ A;  2VKD A;  3QB5 K;  2XJ7 A;  2V8S V;  3EI0 A;  2E2A A;  5L3C B;  5AQI B;  3AEA A;  3C50 A;  3AEB A;  4XBF B;  4QH4 A;  5LHI B;  3VKG A;  2CWO A;  4DR7 T;  2UU9 T;  2JQQ A;  5TAO A;  2CHN A;  2HHH T;  2IC6 A;  2V1D B;  2MAW A;  4FI5 A;  4PK5 A;  5CJ5 A;  5HXS A;  4DV6 T;  1WLX A;  3EAM A;  1LRZ A;  4CZZ B;  3PUA A;  2MPK A;  2XQ4 A;  1M7K A;  4GIW A;  3E0Z A;  2V5D A;  2VUR A;  4OYK A;  3FXE B;  5LNK A;  1WYB A;  2I59 A;  3AEC A;  2RP4 A;  5IUX A;  1US7 B;  4HN9 A;  3C4Z A;  2YU1 A;  4C91 A;  4ZI2 D;  2CLY B;  3H3M A;  1D0Y A;  3ETU A;  4U72 A;  2UUC T;  5C3J A;  4IGU A;  5FMN A;  2WZI A;  2VWA A;  5ABF A;  4X1K E;  2E9X B;  3SRZ A;  2BG9 A;  3ZMT B;  3RQW A;  4CI2 B;  3NBX X;  3CX6 B;  1QLB A;  4EGW A;  1LVK A;  4AQG A;  3X1D A;  3RHW A;  4ZI3 D;  1E7P A;  4L9I A;  2LOP A;  2X9W A;  1YD8 G;  2CXD A;  3AA1 B;  3A5X A;  1S35 A;  2MOZ A;  4M1P A;  3CQC B;  4GYR A;  2CLY C;  1SUM B;  4O8S A;  3GN5 B;  5JRC A;  3K3O A;  3SS1 A;  4K0K T;  5J1G A;  2XM2 A;  2LLY A;  1OED A;  1SE7 A;  3RC3 A;  2CBI A;  4O2B E;  3NKZ A;  4H9Q C;  1UCU A;  2QRX A;  3P4R A;  1T7S A;  2WCA A;  2W0G A;  2YOE A;  3FBL A;  5HAX A;  3FB2 A;  4U74 A;  3C98 B;  3BK9 A;  5LOV E;  2QGS A;  4DV7 T;  1MNE A;  3NRY A;  4U2Z A;  4AKG A;  1ZHC A;  2K9A A;  4I4T E;  4PJN A;  3F57 A;  4B3S T;  1FMW A;  2VL0 A;  3TLW A;  2L9Q A;  3QUJ A;  3N2O A;  1XDP A;  2LSG A;  4KP3 C;  3TKL B;  4NXN T;  4QKN A;  4KX6 A;  1W0B A;  4ZI7 E;  3K3Q C;  3KV6 A;  3CML A;  4IT4 A;  1HF8 A;  3M3Z B;  4DR2 T;  5GON E;  5JDG A;  3PUW F;  3ZSS A;  4GKJ T;  2FJB A;  4ASK A;  2PFV A;  3ZMZ B;  3N9L A;  2ACZ A;  3OBV E;  4GK0 E;  1ZV4 X;  2VVN A;  2E5L T;  5FXZ A;  4HFI A;  4WNK A;  5AQK B;  2FJA A;  4UXN B;  4JLE A;  2IHR 1;  1IBL T;  3OPC A;  5LJN A;  3O1I A;  4BA9 A;  4AXP A;  1LVF A;  3TLS A;  1KEY A;  4JI0 T;  5C2T A;  3EAB A;  4V1A v;  3V5U A;  2OV9 A;  4IE7 A;  3LK3 B;  1WCR A;  3LBX A;  3AXJ A;  3UFE A;  1IZN B;  4X62 T;  4LMK A;  3AEF A;  4TX5 A;  1D1B A;  2W66 A;  3ZST A;  3KVB A;  5F5W A;  5JDM A;  2KWH A;  1CUN A;  2LHN A;  3KVA A;  4X5T A;  2NOX A;  4DV1 T;  5DJQ C;  3WAJ A;  4H9N C;  3AE6 A;  1E2A A;  4IHJ E;  2VAS A;  2XY8 B;  3RF1 A;  3RYH E;  1D1C A;  1BR4 A;  1NWM X;  3WI3 A;  3AE9 A;  4CI1 B;  4YSY A;  3AE2 A;  2XQ7 A;  4B3R T;  4P0B A;  2ODU A;  5F3J A;  2H3R A;  3PUG A;  4DV2 T;  3RYF E;  4LML A;  4IE6 A;  4C90 A;  3PU3 A;  2BKO A;  4JI2 T;  1DU2 A;  3GA8 A;  3JCF A;  1XNQ T;  2HPL A;  4KUM B;  1MMD A;  4HGA A;  4JI3 T;  4YY3 T;  3N9N A;  3HKD E;  3ZC1 A;  4OHF A;  2CPT A;  3UUX B;  3ZYM A;  3EHZ A;  1KF6 A;  4AKH A;  3AE3 A;  4L0R A;  3PV0 F;  3HKE E;  3K1S A;  4PFO A;  1QUU A;  4E7S A;  5AQO B;  4P0A A;  4X1Y E;  3I0O A;  1XNR T;  2VK9 A;  2K24 A;  4NUV A;  2N2N A;  4A56 A;  4EYY R;  2KWI B;  2XAJ B;  4X64 T;  2D9D A;  4ZZB A;  2HN2 A;  3IHR A;  1HX8 A;  2BKN A;  4ZEY A;  1VCT A;  2WDR A;  4IE0 A;  2AXD S;  5KX5 E;  2Y6X A;  3N2K E;  4ILB A;  3VKH A;  3AEE A;  5LG4 A;  2XHE B;  2LSY A;  2NWB A;  5FY0 A;  1N36 T;  4IE5 A;  2UXN B;  4CXW A;  3U78 A;  5FY7 A;  1J5W A;  2NW8 A;  3UU5 A;  1KK7 A;  3UU3 A;  2X9Y A;  3GN5 A;  1X79 A;  3ZPO A;  2C5I T;  4CXY A;  2VQE T;  4EAH A;  5HXE A;  4P09 A;  3TLV A;  3AEG A;  3I0Q A;  2D0U A;  2VL8 A;  3CIR A;  2EHO B;  4ZOL E;  2LT3 A;  4IE4 A;  3W15 B;  4ANJ A;  3VHL A;  2VB6 A;  2IDO B;  2WDQ A;  4PK6 A;  4DV4 T;  4HEA A;  5IWA T;  2JQH A;  3NZQ A;  5E0O A;  2P9B A;  3GMI A;  5J0Z A;  2V7I A;  2XAG B;  2ODV A;  3VRB A;  4AQF C;  2BS4 A;  1SHZ C;  3ONJ A;  1KNR A;  3PUX F;  1UUS A;  2K5B B;  3SFD A;  4Z90 A;  2MYS A;  3R6N A;  3AAA B;  2C5K T;  2G0U A;  1IBM T;  1T8B A;  1L0V A;  3DP7 A;  3I9W A;  3FXD B;  1BR1 A;  4DUZ T;  3H3A A;  3LJC A;  4JI5 T;  3D0T A;  3M65 A;  2W67 A;  3FBZ A;  2LEH A;  3MZK B;  1ZEE A;  1W0A A;  2D0T A;  2W4X A;  1YXR A;  3AE1 A;  3RIF A;  2X51 A;  2NR4 A;  3BQI A;  4YXD A;  4I50 E;  1N33 T;  4DND A;  5FKY A;  3ONL C;  4EEB A;  4Q25 A;  2ZM8 A;  4KI0 F;  2L8K A;  4PNI A;  3WAK A;  2XQ5 A;  3FZH B;  3AE8 A;  5JDL A;  1HCI A;  1VOM A;  2WBL A;  3N2G E;  4UEM A;  4EB6 E;  4YSZ A;  3PUZ F;  4CXX A;  3P4Q A;  2XQY A;  2V7K A;  2VVS A;  4A97 A;  5L4E A;  4DBR A;  2WZH A;  5HEU A;  3O1J A;  2LHR A;  3RLF F;  3MXZ A;  5FNV E;  2V5C A;  5ADX L;  1R8I A;  1UUR A;  1J5E T;  4EV6 A;  5EK3 A;  3C4W A;  4DR5 T;  3RGL A;  4H9P C;  4PAG A;  3ZKR A;  4UF0 A;  2XSA A;  3NZP A;  4UV8 B;  1YQ3 A;  4AI6 A;  4F6R C;  4KHP T;  2VKH A;  4LF4 T;  3JC6 C;  2N9D A;  3CX8 B;  2UXD T;  4QH1 A;  3AA0 B;  3P7I A;  4HTE A;  4I55 E;  3UUM A;  4IDQ A;  2XQ8 A;  5FXW A;  1JNZ A;  3QNU A;  4DR3 T;  2X9X A;  3I9Y A;  2J1D G;  4LF7 T;  1AJ3 A;  2ZM2 A;  1D0Z A;  5L3F B;  1X9B A;  5FVL A;  2W00 A;  2A2F X;  4CN4 A;  3ZCJ A;  1NEK A;  4HE8 A;  4OFZ A;  3MKD A;  4JEU B;  4I0U A;  3TLT A;  1XZY A;  5JDN A;  3SFE A;  2E9X C;  5FYM A;  5AQJ B;  3FHN A;  3HKB E;  4HFV A;  4QX8 B;  1NEN A;  2X66 A;  3OTO T;  3AAE B;  2JQK A;  1HS7 A;  3CK6 A;  3KIN B;  3ZEF B;  2YK0 A;  4HWI B;  2DLR A;  2BS3 A;  3L8R A;  3RPU A;  5AQN B;  1H7C A;  2UXB T;  2LRK A;  3R84 B;  2X68 A;  3O9X A;  1MIY A;  4JI6 T;  2FUP A;  2CHO A;  2PG8 A;  2PBI A;  5EK4 A;  2BG9 E;  2XUE A;  2H89 A;  1U4Q A;  4IL4 A;  2WQY A;  2FJE A;  5HWX A;  2J62 A;  3CPZ A;  2DHR A;  2W2U A;  4DV3 T;  4IDP A;  2NW9 A;  2XQ9 A;  4HWF A;  4G2A A;  4YJ3 E;  4DR6 T;  5LP6 E;  5KDM C;  1UX4 A;  3RYI E;  2BVL A;  3L39 A;  3VU7 H;  5LGT B;  2EHO D;  1UK5 A;  2BZB A;  4AQF A;  2IAK A;  1VCS A;  3JAE A;  5LB7 B;  2A3D A;  4O4I E;  2BS2 A;  4JEH B;  1OED E;  5JR9 B;  1MMG A;  2WY2 A;  2OA5 A;  5LJM A;  3GWH A;  2XAS B;  4CQI A;  5LHH B;  2WSS V;  5CGM A;  2X9H A;  3L3P A;  3HL6 A;  2B76 A;  2LRL A;  3UUB A;  1WFD A;  3CQG B;  2E5V A;  5AFU L;  2LKG A;  2FBW A;  2HH7 A;  4AKL A;  1I6Z A;  2SPC A;  4XAX B;  2DCF A;  3SWH A;  4J2C A;  4X1I E;  2CXF A;  3DTO A;  2X67 A;  4JBW F;  2NW7 A;  2JRK A;  5DAB A;  4YTM A;  2JMK A;  4UR9 A;  1S94 A;  3VRA A;  5HEG A;  5JR9 C;  2QYW A;  3OYZ A;  4WBN E;  5L3G B;  5BR8 T;  3JAF A;  3J7Y q;  1BR2 A;  3N9O A;  1T72 A;  3PJA J;  4QX7 B;  1I94 T;  4TNV A;  5J2U E;  3ANW B;  1N32 T;  4K0U A;  4LF5 T;  3PTR B;  3LDQ B;  4HFE A;  4LF8 T;  4PW8 A;  4PFP A;  2UUA T;  5ABF B;  1FEW A;  4COF A;  4MLK A;  4JI4 T;  3T8O A;  3KV9 A;  4IL9 A;  1U5P A;  1HNZ T;  4PK4 A;  3ETV A;  1ZKE A;  2YN6 A;  2Y48 B;  3JC6 D;  2UXX B;  1YQ4 A;  4KBM B;  2ZM0 A;  2I6H A;  1WR6 A;  3ZT7 A;  2XQ6 A;  2AE9 A;  2V6Y B;  5AQM B;  3P50 A;  4I43 B;  2WS3 A;  3ZN1 B;  2LKH A;  3NRX A;  4DV0 T;  4DBQ A;  2KSR A;  4MAL A;  2ES0 A;  2W61 A;  2DWG A;  2XAH B;  3HA4 A;  2H7V C;  2YDQ A;  2XAQ B;  4DVD A;  3V5S A;  3Q5D A;  2DI4 A;  4QWN B;  5HXC A;  3ZJ2 A;  5H6R B;  2J47 A;  4JV5 T;  5LGU B;  2CXL A;  5LA6 E;  3IA3 A;  4OK0 A;  1OED B;  1ZOY A;  4HWH A;  2M6I A;  2ACX A;  4HFC A;  4H63 V;  3JAD A;  4NIQ A;  5M4Y A;  2E9X D;  5DQW A;  1CHU A;  3ESL A;  4UIG A;  2CA5 A;  3S4U A;  3CVR A;  3H37 A;  3LK2 B;  5C8Y E;  2X0Y A;  2WAU A;  5AQR B;  2WWV A;  4U7I A;  1D0X A;  2E9X A;  4AKI A;  2MTQ A;  1YKH B;  4TUY E;  4QXB B;  3VR8 A;  4UVB B;  5JRE A;  3ZMU B;  1Y01 A;  3RYC E;  4MBQ A;  3RI5 A;  4DMV A;  2BKP A;  3A8Y C;  4Z91 A;  1HG5 A;  3O1H A;  3ZMS B;  2JQ9 A;  2VKO A;  5JTG A;  3J9X 1;  3AE5 A;  1N34 T;  3PUR A;  3QB5 A;  4EED A;  1HNX T;  5LG3 A;  4H9O C;  3ZYK A;  2M67 A;  1XMQ T;  5EZY E;  2WP9 A;  3RRW A;  2JJ9 A;  3OKQ A;  3KV5 A;  5LXT E;  2H7O A;  2XPK A;  1MMA A;  1Z0P A;  2PTF A;  3LG7 A;  1WRD A;  4ISS A;  3UUL A;  2CMR A;  3BQL A;  5HEH A;  3ONX A;  5DQV A;  4HFH A;  4TWF A;  3AB3 B;  3QK6 A;  5HCJ A;  3OJA A;  2JMH A;  2WDV A;  3UQ7 A;  1ZP0 A;  4LF9 T;  4DID B;  2V7M A;  5KMG P;  2FJD A;  4LMJ A;  1EZ3 A;  3PUV F;  4HWD A;  3UU6 A;  3P4P A;  3AXJ B;  4P1N A;  5FL0 A;  2D2S A;  4MFR A;  4DMW A;  2WM9 A;  3Q9D A;  3P4W A;  1G8X A;  3FZK B;  2IIU A;  3EDV A;  1WR0 A;  2IC9 A;  3OVU A;  4KMC A;  2EHO C;  5L3B B;  4Z8X A;  5IHY A;  4DUY T;  2LJL A;  3FZF B;  2HN1 A;  2YEV C;  2V7J A;  3CX7 B;  2YU2 A;  3A7M A;  3TLU A;  3UT5 E;  1HNW T;  2KT9 A;  5JDQ A;  2BBH A;  2CWY A;  3F31 A;  2H88 A;  4YTN A;  5L2L A;  4HFB A;  2GK9 A;  1YKE B;  5JR9 A;  4JI8 T;  5ETW A;  3Q5W A;  3QOF A; 
#chains in the Genus database with same CATH homology
 4HWD A;  4HWC A;  5AQR B;  3FZL B;  1UGO A;  3FZF B;  3LDQ B;  5AQM B;  1HX1 B;  3A8Y C;  5AQJ B;  5AQO B;  5AQQ B;  5AQT B;  1T7S A;  5AQG B;  5AQS B;  4HWI B;  3M3Z B;  1M7K A;  4HWH A;  3FZH B;  5AQF B;  2D9D A;  1UK5 A;  1M62 A;  3FZK B;  5AQN B;  5AQV B;  5AQK B;  5AQH B;  5AQP B;  5AQI B;  4HWF A;  5AQU B;  1I6Z A;  3FZM B;  5AQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...