4LF7T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf7T00
4JI7T 4DR1T 4B3TT 4X66T 3OTOT 4JI4T 4LF7T 1HNWT 4X65T 4YY3T 4JI2T 4GKKT 4LF8T 1XMOT 4DV2T 5IWAT 5BR8T 4LFAT 4B3RT 4LFBT 4NXNT 1HR0T 2F4VT 1FJGT 4YHHT 1IBLT 4DR2T 4DR6T 4JI5T 4DV1T 4DV7T 1XMQT 4LF4T 4LF5T 3T1YT 1HNXT 4B3ST 4DV5T 4X62T 2UXDT 4AQYT 5LMUT 3T1HT 2VQET 1J5ET 1IBKT 2HHHT 4LFCT 2UUCT 1N34T 4DR4T 2UU9T 1IBMT 4JI0T 1N32T 4NXMT 4K0KT 2UUBT 4DUZT 4GKJT 4DR7T 4DV6T 4X64T 4OX9T 2UXCT 4JV5T 1HNZT 2ZM6T 1XNQT 4KHPT 4DV3T 4JI3T 4JI8T 1N36T 1N33T 4DR5T 1I94T 2E5LT 4DUYT 4LF9T 4B3MT 4JI1T 4JI6T 5LMNT 4DV4T 4JYAT 4LF6T 4DR3T 2UUAT 1XNRT 4DV0T 2VQFT 2UXBT
chains in the Genus database with same CATH superfamily
5L3DB 4PK5A 3AVSA 5J2UE 1HCIA 2DLRA 2PJQA 2VKDA 3SS1A 1ZOYA 2LM9A 3E08A 3GMIA 1QLBA 4TX5A 2BS4A 3BQKA 1KF6A 2CBIA 3ANWA 3CX8B 3HA4A 3Q5WA 4PAGA 4EAHA 3UFGA 3AAIA 2XQ8A 5LBMA 2GK9A 3KBTA 2VL0A 1VOMA 2BKNA 3AE9A 4ILBA 2M67A 4CI1B 3C4ZA 3OVUA 3EDVA 4HGAA 2FJBA 1ZP0A 1NENA 2NW8A 4PFPA 1UX5A 4QH4A 2W67A 3I1AA 3ZMSB 5J2TE 2DWKA 4HTEA 2X51A 4IE6A 4L9IA 3FB2A 3LK42 4TZ4C 5AQKB 2HH7A 5AQSB 2W66A 5CA0E 1SA0E 2CA5A 2LHRA 2VKJA 2WWUA 2E9XC 3F31A 3FXDB 3KBUA 4CXWA 4NXNT 1MNDA 2N2NA 3VRBA 1HR0T 3N9NA 5L47A 3A8YC 4IGUA 2XHEB 2L8KA 4PJLA 2ZM0A 1B7TA 3OPCA 4H63H 4YHHT 1GQEA 2CXDA 4HE8A 3OJAA 3L39A 3LFMA 4U2ZA 3IF8B 2I59A 4C91A 5EK2A 3N9QA 5F8PA 2IC9A 1W9RA 2WSSV 4AKGA 1MMDA 1W0BA 1M7KA 3C98B 4F8HA 3AE5A 4H9PC 5AFUL 4O2BE 4QHOA 3KVAA 2ZLYA 4DV1T 1US7B 2LHNA 4UEMA 5FL0A 5AQHB 4CI3B 2H3RA 1FMWA 2Q9QC 2XTLA 3ANWB 2CXFA 3KV9A 2HPLA 3LG7A 2NOXA 3AEBA 4PJJA 3ZN1B 5JH7E 4DV5T 2UXDT 2W2UA 2C5IT 4AQYT 3PV0F 5LMUT 3N2OA 2BBHA 3NZQA 4ZOLE 2E9XA 3DJBA 4U31A 4JEHB 2VQET 3OYZA 2XQ9A 3PUXF 4AKHA 2CEAA 5LHIB 3RRCA 5LG4A 3CX6B 1WFDA 2V8SV 4QKNA 5L3BB 4UXNB 3TLVA 3NWIA 3LBXB 4PJNA 4P0AA 1D1AA 4JI0T 3ZC0A 5LB7B 4U72A 5HYAA 2HN2A 5EK3A 2KLQA 4CN1A 2DL1A 3FZFB 3HI2A 4OHFA 4PNIA 1FEWA 4UV8B 4K0KT 1HS7A 3CQGB 2BG9E 4L0RA 4ERRA 3R6NA 4ZI3C 4AKRB 3AECA 4NIQA 3IHRA 2KNDA 5CGMA 4QH1A 2EHOD 5GONE 5JVDE 5L3FB 2MTQA 2V7MA 2Y48B 4IHJE 4UELA 4O4JE 4EIWA 2XAGB 4YSZA 4DO0A 1HNZT 2X9WA 4P1NA 1HX1B 2BVMA 1MMAA 2DWGA 3CKDA 1D0XA 3KFWX 4H63V 3CQXC 4IDQA 4U33A 3T8OA 4AIUA 2EHOB 2XUEA 2WDQA 3KV4A 1HX8A 3K3NA 3NVOA 4H9QC 4Q25A 4UR9A 4EOZB 4EYYR 5J1GA 5CJ5A 4U2YA 1XNQT 4O4LE 1EZ3A 3RKGA 3LK2B 1SUMB 2CCQA 3FZHB 4TWHA 5LJNA 3AVRA 4WYVA 4JI3T 3PUGA 2YU2A 1NAFA 3IBPA 3K3QC 4DMWA 5LBQB 3PTRB 3TLSA 3ZC1A 4HN9A 5ABHA 3HKDE 5FY7A 1N33T 2D0TA 2CBJA 3PE0A 2JMHA 2DI4A 2X0YA 3QC9A 4J2CA 5EZYE 2W00A 2XZEA 3CK6A 1T98A 2YDSA 2H7VC 4KUMB 4DUYT 4PW8A 4B3MT 2V6YA 4I50E 1M62A 4A98A 4JI1T 4JI6T 1DU2A 2AXDS 1UX4A 2BG9B 4QX7B 3VU7H 5J0ZA 1IZNB 4GYSA 4PJMA 1MNEA 4YTMA 4GKKT 2QRXA 3KINB 1BR2A 2MYSA 3EHZA 3P8CD 4X1YE 3RC3A 4CXXA 1XDOA 5ADXL 2VL8A 3E22E 5LGNB 4DR3T 3UU5A 5CB4E 4DV0T 4NPPA 3KVBA 3VR9A 3O1HA 1WRDA 3MACA 3UUBA 3ZCIA 3HKCE 4U74A 3P4RA 2XAHB 2FJDA 4YHJA 4AKIA 2ACZA 2X9XA 4CI2B 1BR4A 3O9XA 3LDQB 4UF0B 3RKOA 2XM1A 1JNZA 3G06A 4HKAA 3SFDA 2W62A 1IJ6A 1V9DA 1YQ3A 2M6BA 2R6GF 1CUNA 3BQLA 3CIRA 3DP7A 4QXBB 2WS3A 4DBRA 4EZHA 2CE7A 4Z91A 4JI4T 2XSBA 3MKDA 4IDOA 1MMNA 1HNWT 2B76A 3GN5B 2D2SA 4OYJA 5L4HA 1YXRA 2ZM8A 4UV9B 5C2TA 5AQVB 2KWHA 4HFBA 3SFEA 5C8YE 2MBGA 2JRKA 3AE8A 4K0UA 1YQ4A 5AQNB 2V6YB 5IWAT 2CHNA 2Q9QD 4O4IE 3AEEA 3BK9A 3PUWF 4ZS3A 1E7PA 1UCUA 3N5LA 2K48A 5LA6E 5AQQB 4LFAT 5DQVA 3AE4A 3RIUA 1YW0A 2AE9A 4BJMA 4H9OC 3E0ZA 2VWAA 3S4UA 3ZT5A 3PUSA 5LNKA 3J7Yq 3C51A 1S94A 4GIWA 3MK7C 4YSXA 2VASA 5LGUB 3KDSE 4PK4A 3AXJB 2I6HA 2XAQB 4DR6T 3N9OA 2CLYC 2W0GA 2BKPA 2VURA 4JI5T 5L3CB 1MIVA 5LHHB 2NTXA 2X66A 4I43B 4LF4T 5JDHA 4LF5T 2VKHA 4ADZA 2XAJB 2X68A 4ILCA 4L5GA 5AQGB 1HNXT 2V6XA 1O3XA 3QB5A 4I55E 5LOVE 2Y6XA 4O2AE 3PUVF 2DHRA 2CLYB 2YOEA 5FXZA 3V5UA 2W63A 3ZMTB 4ZEYA 1YD8G 4KP3C 5FNVE 3AE6A 3RIUC 1J5ET 3EUHA 2NR4A 3BQIA 4MFRA 4QXHB 5LJMA 1N34T 4JEUB 4TV8E 3I0QA 4UVAB 5A1LA 4DR4T 4P0BA 2UU9T 1LKXA 3N9LA 4PFOA 1N32T 2BKOA 2OV9A 3NRYA 4JLEA 2LRKA 2D0UA 2D9DA 1UGOA 2LSIA 2Q9QA 3ABVA 3SRZA 4UF0A 1ZV4X 2KXPB 3WI3A 4YXDA 2VK9A 5JDGA 4NXMT 4XZCA 2BG9C 2IUBA 2J47A 2E5VA 2L3LA 2WB5A 2YDQA 1OEDA 5KX5E 2V7JA 4DMVA 5AQRB 2WWVA 2QA7A 2NWBA 4HEAA 4JV5T 2RPAA 2LSKA 2VKOA 4TNWA 5HXRA 5JDLA 2LT3A 3H3MA 4E7ZA 4DNDA 2QVAA 1T7SA 2D5UA 2LSYA 4BJNA 4HFIA 4JBWF 3UU8A 3RGLA 4CN6A 2ODUA 2CM0A 4TWDA 4ZZCA 3NBXX 4JI8T 1HF8A 2WBLA 4EYUA 4NUUA 2WMOA 4DIDB 4XBFB 3QNUA 4CN4A 4DR5T 2JIWA 2K5BB 3TLWA 3RC8A 4WBOA 2XPKA 2MPKA 3FHNA 4EEDA 3P4WA 1L0VA 2CWOA 2NW7A 3ETVA 4EV6A 5LXTE 5LMNT 4CXYA 5HAXA 3AEDA 5JR9C 3KV5A 2FBWA 4MHCA 5LP6E 1D0ZA 3WAJA 1VCTA 2DNXA 2LLYA 2X0HA 4ZHQE 4KHZF 4MBQA 4LF6T 4X1IE 4ILAA 4ISSA 2UUAT 3PUYF 3C4WA 4AKLA 3A7MA 2JMKA 3HL6A 3ETUA 4YFSA 5L4EA 3N9PA 4XAXB 2KMFA 4JUYA 3AAAB 1NEKA 5HEOA 2XM2A 2A9UA 3RF1A 4N78D 4TNVA 3AE2A 4JI7T 3D0TA 1FIOA 2IMLA 5AQTB 4B6XA 1R8IA 3RIFA 4DR1T 5HXCA 2BBJA 3FZMB 4ZS2A 3AA6B 5H6RB 5IYZE 3U3IA 1ZKEA 3ONXA 2V7LA 3P4PA 2H7OA 4WNKA 3ZT6A 5F3JA 1NWMX 1ZHCA 2MOZA 2XJ7A 3FBZA 4QX8B 4X66T 2H88A 3ONJA 2DCFA 2FJEA 4WBNE 5ABFA 4LF7T 5KDMC 3JCFA 4CQIA 3AA1B 3I9WA 2EHOA 4HFDA 4X65T 3NKZA 1Z8UA 4GK0E 3ZEFB 3N9MA 2A2FX 2X9HA 3PJAJ 1IJ5A 4M1PA 3C64A 2JQ9A 3PUAA 4OFZA 2RP4A 4LF8T 4JI2T 3ZCJA 4UIGA 5AQJB 4DVDA 4DV2T 3ZN0B 1XMOT 4AISA 5HWXA 3P50A 5CFBA 2X0LB 5FMNA 5BR8T 1OXZA 2LSGA 4HFHA 3UUNA 3MXZA 2XAFB 2N1GA 3EVYA 5DJQC 4O4HE 2WAUA 5HXHA 5H6QB 3VR8A 3LBXA 3CWZB 3ZLIA 4IE7A 5HEUA 3X1DA 5FKYA 3UT5E 4P09A 3AE7A 3FZKB 1IAPA 1IBLT 4I4TE 2J62A 4MALA 4X1KE 4G63A 4DR2T 3IA3A 4KMCA 5AQUB 4HWIB 3W15B 3VHLA 5HCJA 5HCMA 3NZPA 2BG9A 3UQ7A 1G73A 4O8SA 1KNZA 1I6ZA 1HFAA 1U4QA 2XQ3A 5L3GB 4AQGA 3RYCE 4IIJE 3UULA 3OBVE 3SOLA 4ZXLA 3L8RA 2VVSA 2WZIA 2FJAA 5IHYA 3O4XE 3FXEB 1XZYA 1X79A 5LCYA 3RQWA 2WDVA 3LJCA 3RYFE 1Y64B 3T1HT 1LVKA 4DR7T 4MLKA 3PU8A 2QYWA 5JQGE 1IBKT 3TKLB 2BZBA 4WW0A 2PG8A 5JDMA 2HHHT 2NTYA 4IE0A 3RYIE 3ZYMA 2UUCT 2BVLA 4ASKA 3MJXA 4YLHA 5BMVE 2YKSA 3F57A 5AQMB 3HKEE 5JR9B 5LGTB 5JDQA 3AE1A 4WZXA 1SHZC 3AE3A 1D0YA 3ZKRA 4Z8XA 4BAYB 2CHOA 4DUZT 4GKJT 1OEDE 4QXCB 4YSYA 2ACXA 1IBMT 3CMLA 4X64T 3RH3A 3LK3B 4IDZA 2XQ4A 2WCAA 2CWYA 2LKGA 3A5XA 2ZMAA 1QUUA 3I0OA 2K3WA 2A72A 2WP9A 5IUXA 2IW5B 2PFVA 2IC6A 4G2AA 3I9YA 4IT4A 3KV6A 2LKHA 4F6RC 2N9DA 2B1EA 2FUPA 3UU3A 5JDNA 1G8XA 2KINB 3PJAA 2LEHA 1WR0A 2WMNA 4HFVA 1VRBA 2RA1A 3PU3A 4IL4A 3AXJA 3LSVA 3RI5A 3SWHA 3UU6A 4A5XA 2KSRA 4E7SA 5DQWA 5E0OA 3Q5XA 4YJ3E 3U78A 4PK6A 1I94T 3VKHA 1WLXA 4GOUA 4IE4A 2YINA 2VB6A 4HWCA 4AQFC 2WU5A 1OEDB 4A97A 1UURA 2M6IA 3V5SA 1WYBA 3CQCB 2BS3A 2KT9A 2LOPA 2X9YA 3CX7B 5FY0A 4HWFA 3M3ZB 3L09A 3Q2MA 3RYHE 2NP9A 4YT0A 3O1IA 4UVBB 2WZHA 4UVCB 5JRCB 3HR0A 5AQPB 3AEAA 3M65A 3RIAA 2LOSA 2J1DG 4CZZB 3ZPOA 3GA8A 3B13A 3MZKB 2VQFT 1XNRT 3C50A 2J4GA 3JC6C 3QK6A 5DABA 3O1JA 1KNPA 3H37A 2Y8DA 4IL9A 1LVFA 1SE7A 4GK5E 2WDRA 2NW9A 3TLTA 2WU2A 3B5MA 1YKHB 1MMGA 4BA9A 4EXTA 2LRLA 1D1CA 2C0SA 2LSJA 3EDUA 3EI0A 4TWFA 2P9BA 1E1HB 4X5TA 4ZI2D 5HXSA 5LHGB 4B3TT 4HWHA 3UUMA 2XY8B 5FL1A 5AQLB 5FVLA 3ZJ1A 2VVNA 4V1Av 3RX6A 3OTOT 2JQHA 4AQFA 3AB3B 2Q9QB 5ABFB 3VKGA 2L9QA 2E8IA 3Q9DA 2WM9A 1UUSA 4QWNB 5HEHA 4YTNA 4ILUA 5HEGA 4U3CA 4YY3T 3ZMVB 3N2KE 3PDYA 1MIWA 1JNRA 5AQIB 2CXLA 2H89A 3CVRA 1W09A 1CHUA 2JQKA 3MA9A 4H9RC 5FXVA 4YTPA 5LYJE 5L2LA 2G0UA 5ABGA 5L3EB 2E2AA 4B3RT 4LFBT 2BDEA 4EGWA 3K3OA 2V5CA 4IE5A 3UFEA 5JDFA 2F4VT 2QGSA 3P4QA 5FY1A 3ZYKA 4AI6A 2WY2A 3QOFA 2LM2A 5AQOB 1FJGT 2LJLA 1X9BA 2YK0A 5F5WA 5JR9A 3JAFA 4NUVA 2XASB 3PURA 1QSDA 1T72A 1Y01A 2V7IA 3UU4A 3PUQA 3ONLC 3FZLB 3JAEA 2LE8A 3K1SA 4LMJA 4DV7T 5M4YA 1BR1A 1XMQT 2C5KT 2JPFA 3AAEB 1OWAA 3T1YT 4C90A 4B3ST 1KEYA 4GYRA 2SPCA 4ZI7E 5JTGA 5HEJA 4QH5A 5CA1E 4I0UA 4X62T 1HG5A 3TLUA 2V7KA 2HPJA 2Z6EA 5FXWA 2BS2A 1S35A 1J1JA 3QUJA 3UQ4A 2IDOB 3ZMZB 2K24A 1W0AA 3OKQA 3AEGA 4ISTA 5KMGP 5KXJA 2KZ7B 1Z0PA 1VCSA 1ZEEA 3K8PC 4FI5A 3RLFF 1HG2A 5JRCA 1BR0A 3ZSSA 4LFCT 1H7CA 4IREA 3UUXB 5ETWA 2I0MA 4IDPA 3ZMUB 3AA7B 3AEFA 2JQQA 4HWDA 4KBMB 4TN7B 3GN5A 3Q5DA 2IAKA 4IDNA 3ZJ2A 3ZSTA 3H3AA 2ZM2A 2OLTA 3ZYLA 5HXEA 3B57A 2UUBT 4HFEA 3VRAA 1D1BA 1KK7A 1YKEB 4OK0A 4LMKA 3UTKA 1WCRA 3AA0B 2YU1A 3QB5K 3IEEA 1U5PA 4KX6A 4U7IA 4YJ2E 5C3JA 4DV6T 3RPUA 2C5JA 2WQYA 4EB6E 4ZZBA 2PBIA 5LG3A 2CMRA 3CPZA 4OX9T 2UXCT 4DBQA 2PTFA 5FXXA 4TUYE 3NRXA 5EK4A 2IHR1 2W61A 2ZM6T 2K9AA 3R84B 1AJ3A 4X20E 4LMLA 2ES0A 2XQ5A 5FYMA 3FBLA 3PUZF 4KHPT 2V1DB 4ANJA 3OYXA 4DV3T 3GWHA 1MIYA 5HWYA 3RHWA 1WYCA 1XDPA 2A3DA 2XQYA 4HFCA 3JC6D 1UK5A 5ABEA 1N36T 3ZT7A 3L3PA 4FJOA 2YN6A 3N2GE 1E2AA 2OA5A 4U7YA 5FP3A 5TAOA 4ZI3D 2E9XD 3WAKA 4A56A 2X67A 1OEDC 2EHOC 4AXPA 2E5LT 2XQ7A 3DTOA 4LF9T 5AQFB 2MAWA 2CRBA 3C4XA 5FVKA 3J9X1 4ZI2C 3F2EA 4OYKA 2IIUA 2UXXB 2YDRA 4EZ4A 2HN1A 4DV4T 1J5WA 2E9XB 3JADA 3P4SA 5JREA 1WR6A 4H9NC 3RRWA 2W4XA 3HKBE 2ODVA 4TV9E 1HTJF 4JYAT 1KNRA 4EEBA 4KI0F 2XQAA 2CPTA 4Z90A 1T8BA 3EAMA 3P7IA 2KWIB 1FMVA 2V26A 1XWMA 2UXNB 1LRZA 3EABA 3RQUA 3Q5EA 1KFYA 2V5DA 2YEVC 2XQ6A 2XSAA 3ESLA 4COFA 4H9SE 2UXBT 2JJ9A
chains in the Genus database with same CATH topology
4JI7T 4DR1T 4B3TT 4X66T 3OTOT 4JI4T 4LF7T 1HNWT 4X65T 4YY3T 4JI2T 4GKKT 4LF8T 1XMOT 4DV2T 5IWAT 5BR8T 4LFAT 4B3RT 4LFBT 4NXNT 1HR0T 2F4VT 1FJGT 4YHHT 1IBLT 4DR2T 4DR6T 4JI5T 4DV1T 4DV7T 1XMQT 4LF4T 4LF5T 3T1YT 1HNXT 4B3ST 4DV5T 4X62T 2UXDT 4AQYT 5LMUT 3T1HT 2VQET 1J5ET 1IBKT 2HHHT 4LFCT 2UUCT 1N34T 4DR4T 2UU9T 1IBMT 4JI0T 1N32T 4NXMT 4K0KT 2UUBT 4DUZT 4GKJT 4DR7T 4DV6T 4X64T 4OX9T 2UXCT 4JV5T 1HNZT 2ZM6T 1XNQT 4KHPT 4DV3T 4JI3T 4JI8T 1N36T 1N33T 4DR5T 1I94T 2E5LT 4DUYT 4LF9T 4B3MT 4JI1T 4JI6T 5LMNT 4DV4T 4JYAT 4LF6T 4DR3T 2UUAT 1XNRT 4DV0T 2VQFT 2UXBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 T;  4DR1 T;  4B3T T;  4X66 T;  3OTO T;  4JI4 T;  4LF7 T;  1HNW T;  4X65 T;  4YY3 T;  4JI2 T;  4GKK T;  4LF8 T;  1XMO T;  4DV2 T;  5IWA T;  5BR8 T;  4LFA T;  4B3R T;  4LFB T;  4NXN T;  1HR0 T;  2F4V T;  1FJG T;  4YHH T;  1IBL T;  4DR2 T;  4DR6 T;  4JI5 T;  4DV1 T;  4DV7 T;  1XMQ T;  4LF4 T;  4LF5 T;  3T1Y T;  1HNX T;  4B3S T;  4DV5 T;  4X62 T;  2UXD T;  4AQY T;  5LMU T;  3T1H T;  2VQE T;  1J5E T;  1IBK T;  2HHH T;  4LFC T;  2UUC T;  1N34 T;  4DR4 T;  2UU9 T;  1IBM T;  4JI0 T;  1N32 T;  4NXM T;  4K0K T;  2UUB T;  4DUZ T;  4GKJ T;  4DR7 T;  4DV6 T;  4X64 T;  4OX9 T;  2UXC T;  4JV5 T;  1HNZ T;  2ZM6 T;  1XNQ T;  4KHP T;  4DV3 T;  4JI3 T;  4JI8 T;  1N36 T;  1N33 T;  4DR5 T;  1I94 T;  2E5L T;  4DUY T;  4LF9 T;  4B3M T;  4JI1 T;  4JI6 T;  5LMN T;  4DV4 T;  4JYA T;  4LF6 T;  4DR3 T;  2UUA T;  1XNR T;  4DV0 T;  2VQF T;  2UXB T; 
#chains in the Genus database with same CATH topology
 5L3D B;  4PK5 A;  3AVS A;  5J2U E;  1HCI A;  2DLR A;  2PJQ A;  2VKD A;  3SS1 A;  1ZOY A;  2LM9 A;  3E08 A;  3GMI A;  1QLB A;  4TX5 A;  2BS4 A;  3BQK A;  1KF6 A;  2CBI A;  3ANW A;  3CX8 B;  3HA4 A;  3Q5W A;  4PAG A;  4EAH A;  3UFG A;  3AAI A;  2XQ8 A;  5LBM A;  2GK9 A;  3KBT A;  2VL0 A;  1VOM A;  2BKN A;  3AE9 A;  4ILB A;  2M67 A;  4CI1 B;  3C4Z A;  3OVU A;  3EDV A;  4HGA A;  2FJB A;  1ZP0 A;  1NEN A;  2NW8 A;  4PFP A;  1UX5 A;  4QH4 A;  2W67 A;  3I1A A;  3ZMS B;  5J2T E;  2DWK A;  4HTE A;  2X51 A;  4IE6 A;  4L9I A;  3FB2 A;  3LK4 2;  4TZ4 C;  5AQK B;  2HH7 A;  5AQS B;  2W66 A;  5CA0 E;  1SA0 E;  2CA5 A;  2LHR A;  2VKJ A;  2WWU A;  2E9X C;  3F31 A;  3FXD B;  3KBU A;  4CXW A;  4NXN T;  1MND A;  2N2N A;  3VRB A;  1HR0 T;  3N9N A;  5L47 A;  3A8Y C;  4IGU A;  2XHE B;  2L8K A;  4PJL A;  2ZM0 A;  1B7T A;  3OPC A;  4H63 H;  4YHH T;  1GQE A;  2CXD A;  4HE8 A;  3OJA A;  3L39 A;  3LFM A;  4U2Z A;  3IF8 B;  2I59 A;  4C91 A;  5EK2 A;  3N9Q A;  5F8P A;  2IC9 A;  1W9R A;  2WSS V;  4AKG A;  1MMD A;  1W0B A;  1M7K A;  3C98 B;  4F8H A;  3AE5 A;  4H9P C;  5AFU L;  4O2B E;  4QHO A;  3KVA A;  2ZLY A;  4DV1 T;  1US7 B;  2LHN A;  4UEM A;  5FL0 A;  5AQH B;  4CI3 B;  2H3R A;  1FMW A;  2Q9Q C;  2XTL A;  3ANW B;  2CXF A;  3KV9 A;  2HPL A;  3LG7 A;  2NOX A;  3AEB A;  4PJJ A;  3ZN1 B;  5JH7 E;  4DV5 T;  2UXD T;  2W2U A;  2C5I T;  4AQY T;  3PV0 F;  5LMU T;  3N2O A;  2BBH A;  3NZQ A;  4ZOL E;  2E9X A;  3DJB A;  4U31 A;  4JEH B;  2VQE T;  3OYZ A;  2XQ9 A;  3PUX F;  4AKH A;  2CEA A;  5LHI B;  3RRC A;  5LG4 A;  3CX6 B;  1WFD A;  2V8S V;  4QKN A;  5L3B B;  4UXN B;  3TLV A;  3NWI A;  3LBX B;  4PJN A;  4P0A A;  1D1A A;  4JI0 T;  3ZC0 A;  5LB7 B;  4U72 A;  5HYA A;  2HN2 A;  5EK3 A;  2KLQ A;  4CN1 A;  2DL1 A;  3FZF B;  3HI2 A;  4OHF A;  4PNI A;  1FEW A;  4UV8 B;  4K0K T;  1HS7 A;  3CQG B;  2BG9 E;  4L0R A;  4ERR A;  3R6N A;  4ZI3 C;  4AKR B;  3AEC A;  4NIQ A;  3IHR A;  2KND A;  5CGM A;  4QH1 A;  2EHO D;  5GON E;  5JVD E;  5L3F B;  2MTQ A;  2V7M A;  2Y48 B;  4IHJ E;  4UEL A;  4O4J E;  4EIW A;  2XAG B;  4YSZ A;  4DO0 A;  1HNZ T;  2X9W A;  4P1N A;  1HX1 B;  2BVM A;  1MMA A;  2DWG A;  3CKD A;  1D0X A;  3KFW X;  4H63 V;  3CQX C;  4IDQ A;  4U33 A;  3T8O A;  4AIU A;  2EHO B;  2XUE A;  2WDQ A;  3KV4 A;  1HX8 A;  3K3N A;  3NVO A;  4H9Q C;  4Q25 A;  4UR9 A;  4EOZ B;  4EYY R;  5J1G A;  5CJ5 A;  4U2Y A;  1XNQ T;  4O4L E;  1EZ3 A;  3RKG A;  3LK2 B;  1SUM B;  2CCQ A;  3FZH B;  4TWH A;  5LJN A;  3AVR A;  4WYV A;  4JI3 T;  3PUG A;  2YU2 A;  1NAF A;  3IBP A;  3K3Q C;  4DMW A;  5LBQ B;  3PTR B;  3TLS A;  3ZC1 A;  4HN9 A;  5ABH A;  3HKD E;  5FY7 A;  1N33 T;  2D0T A;  2CBJ A;  3PE0 A;  2JMH A;  2DI4 A;  2X0Y A;  3QC9 A;  4J2C A;  5EZY E;  2W00 A;  2XZE A;  3CK6 A;  1T98 A;  2YDS A;  2H7V C;  4KUM B;  4DUY T;  4PW8 A;  4B3M T;  2V6Y A;  4I50 E;  1M62 A;  4A98 A;  4JI1 T;  4JI6 T;  1DU2 A;  2AXD S;  1UX4 A;  2BG9 B;  4QX7 B;  3VU7 H;  5J0Z A;  1IZN B;  4GYS A;  4PJM A;  1MNE A;  4YTM A;  4GKK T;  2QRX A;  3KIN B;  1BR2 A;  2MYS A;  3EHZ A;  3P8C D;  4X1Y E;  3RC3 A;  4CXX A;  1XDO A;  5ADX L;  2VL8 A;  3E22 E;  5LGN B;  4DR3 T;  3UU5 A;  5CB4 E;  4DV0 T;  4NPP A;  3KVB A;  3VR9 A;  3O1H A;  1WRD A;  3MAC A;  3UUB A;  3ZCI A;  3HKC E;  4U74 A;  3P4R A;  2XAH B;  2FJD A;  4YHJ A;  4AKI A;  2ACZ A;  2X9X A;  4CI2 B;  1BR4 A;  3O9X A;  3LDQ B;  4UF0 B;  3RKO A;  2XM1 A;  1JNZ A;  3G06 A;  4HKA A;  3SFD A;  2W62 A;  1IJ6 A;  1V9D A;  1YQ3 A;  2M6B A;  2R6G F;  1CUN A;  3BQL A;  3CIR A;  3DP7 A;  4QXB B;  2WS3 A;  4DBR A;  4EZH A;  2CE7 A;  4Z91 A;  4JI4 T;  2XSB A;  3MKD A;  4IDO A;  1MMN A;  1HNW T;  2B76 A;  3GN5 B;  2D2S A;  4OYJ A;  5L4H A;  1YXR A;  2ZM8 A;  4UV9 B;  5C2T A;  5AQV B;  2KWH A;  4HFB A;  3SFE A;  5C8Y E;  2MBG A;  2JRK A;  3AE8 A;  4K0U A;  1YQ4 A;  5AQN B;  2V6Y B;  5IWA T;  2CHN A;  2Q9Q D;  4O4I E;  3AEE A;  3BK9 A;  3PUW F;  4ZS3 A;  1E7P A;  1UCU A;  3N5L A;  2K48 A;  5LA6 E;  5AQQ B;  4LFA T;  5DQV A;  3AE4 A;  3RIU A;  1YW0 A;  2AE9 A;  4BJM A;  4H9O C;  3E0Z A;  2VWA A;  3S4U A;  3ZT5 A;  3PUS A;  5LNK A;  3J7Y q;  3C51 A;  1S94 A;  4GIW A;  3MK7 C;  4YSX A;  2VAS A;  5LGU B;  3KDS E;  4PK4 A;  3AXJ B;  2I6H A;  2XAQ B;  4DR6 T;  3N9O A;  2CLY C;  2W0G A;  2BKP A;  2VUR A;  4JI5 T;  5L3C B;  1MIV A;  5LHH B;  2NTX A;  2X66 A;  4I43 B;  4LF4 T;  5JDH A;  4LF5 T;  2VKH A;  4ADZ A;  2XAJ B;  2X68 A;  4ILC A;  4L5G A;  5AQG B;  1HNX T;  2V6X A;  1O3X A;  3QB5 A;  4I55 E;  5LOV E;  2Y6X A;  4O2A E;  3PUV F;  2DHR A;  2CLY B;  2YOE A;  5FXZ A;  3V5U A;  2W63 A;  3ZMT B;  4ZEY A;  1YD8 G;  4KP3 C;  5FNV E;  3AE6 A;  3RIU C;  1J5E T;  3EUH A;  2NR4 A;  3BQI A;  4MFR A;  4QXH B;  5LJM A;  1N34 T;  4JEU B;  4TV8 E;  3I0Q A;  4UVA B;  5A1L A;  4DR4 T;  4P0B A;  2UU9 T;  1LKX A;  3N9L A;  4PFO A;  1N32 T;  2BKO A;  2OV9 A;  3NRY A;  4JLE A;  2LRK A;  2D0U A;  2D9D A;  1UGO A;  2LSI A;  2Q9Q A;  3ABV A;  3SRZ A;  4UF0 A;  1ZV4 X;  2KXP B;  3WI3 A;  4YXD A;  2VK9 A;  5JDG A;  4NXM T;  4XZC A;  2BG9 C;  2IUB A;  2J47 A;  2E5V A;  2L3L A;  2WB5 A;  2YDQ A;  1OED A;  5KX5 E;  2V7J A;  4DMV A;  5AQR B;  2WWV A;  2QA7 A;  2NWB A;  4HEA A;  4JV5 T;  2RPA A;  2LSK A;  2VKO A;  4TNW A;  5HXR A;  5JDL A;  2LT3 A;  3H3M A;  4E7Z A;  4DND A;  2QVA A;  1T7S A;  2D5U A;  2LSY A;  4BJN A;  4HFI A;  4JBW F;  3UU8 A;  3RGL A;  4CN6 A;  2ODU A;  2CM0 A;  4TWD A;  4ZZC A;  3NBX X;  4JI8 T;  1HF8 A;  2WBL A;  4EYU A;  4NUU A;  2WMO A;  4DID B;  4XBF B;  3QNU A;  4CN4 A;  4DR5 T;  2JIW A;  2K5B B;  3TLW A;  3RC8 A;  4WBO A;  2XPK A;  2MPK A;  3FHN A;  4EED A;  3P4W A;  1L0V A;  2CWO A;  2NW7 A;  3ETV A;  4EV6 A;  5LXT E;  5LMN T;  4CXY A;  5HAX A;  3AED A;  5JR9 C;  3KV5 A;  2FBW A;  4MHC A;  5LP6 E;  1D0Z A;  3WAJ A;  1VCT A;  2DNX A;  2LLY A;  2X0H A;  4ZHQ E;  4KHZ F;  4MBQ A;  4LF6 T;  4X1I E;  4ILA A;  4ISS A;  2UUA T;  3PUY F;  3C4W A;  4AKL A;  3A7M A;  2JMK A;  3HL6 A;  3ETU A;  4YFS A;  5L4E A;  3N9P A;  4XAX B;  2KMF A;  4JUY A;  3AAA B;  1NEK A;  5HEO A;  2XM2 A;  2A9U A;  3RF1 A;  4N78 D;  4TNV A;  3AE2 A;  4JI7 T;  3D0T A;  1FIO A;  2IML A;  5AQT B;  4B6X A;  1R8I A;  3RIF A;  4DR1 T;  5HXC A;  2BBJ A;  3FZM B;  4ZS2 A;  3AA6 B;  5H6R B;  5IYZ E;  3U3I A;  1ZKE A;  3ONX A;  2V7L A;  3P4P A;  2H7O A;  4WNK A;  3ZT6 A;  5F3J A;  1NWM X;  1ZHC A;  2MOZ A;  2XJ7 A;  3FBZ A;  4QX8 B;  4X66 T;  2H88 A;  3ONJ A;  2DCF A;  2FJE A;  4WBN E;  5ABF A;  4LF7 T;  5KDM C;  3JCF A;  4CQI A;  3AA1 B;  3I9W A;  2EHO A;  4HFD A;  4X65 T;  3NKZ A;  1Z8U A;  4GK0 E;  3ZEF B;  3N9M A;  2A2F X;  2X9H A;  3PJA J;  1IJ5 A;  4M1P A;  3C64 A;  2JQ9 A;  3PUA A;  4OFZ A;  2RP4 A;  4LF8 T;  4JI2 T;  3ZCJ A;  4UIG A;  5AQJ B;  4DVD A;  4DV2 T;  3ZN0 B;  1XMO T;  4AIS A;  5HWX A;  3P50 A;  5CFB A;  2X0L B;  5FMN A;  5BR8 T;  1OXZ A;  2LSG A;  4HFH A;  3UUN A;  3MXZ A;  2XAF B;  2N1G A;  3EVY A;  5DJQ C;  4O4H E;  2WAU A;  5HXH A;  5H6Q B;  3VR8 A;  3LBX A;  3CWZ B;  3ZLI A;  4IE7 A;  5HEU A;  3X1D A;  5FKY A;  3UT5 E;  4P09 A;  3AE7 A;  3FZK B;  1IAP A;  1IBL T;  4I4T E;  2J62 A;  4MAL A;  4X1K E;  4G63 A;  4DR2 T;  3IA3 A;  4KMC A;  5AQU B;  4HWI B;  3W15 B;  3VHL A;  5HCJ A;  5HCM A;  3NZP A;  2BG9 A;  3UQ7 A;  1G73 A;  4O8S A;  1KNZ A;  1I6Z A;  1HFA A;  1U4Q A;  2XQ3 A;  5L3G B;  4AQG A;  3RYC E;  4IIJ E;  3UUL A;  3OBV E;  3SOL A;  4ZXL A;  3L8R A;  2VVS A;  2WZI A;  2FJA A;  5IHY A;  3O4X E;  3FXE B;  1XZY A;  1X79 A;  5LCY A;  3RQW A;  2WDV A;  3LJC A;  3RYF E;  1Y64 B;  3T1H T;  1LVK A;  4DR7 T;  4MLK A;  3PU8 A;  2QYW A;  5JQG E;  1IBK T;  3TKL B;  2BZB A;  4WW0 A;  2PG8 A;  5JDM A;  2HHH T;  2NTY A;  4IE0 A;  3RYI E;  3ZYM A;  2UUC T;  2BVL A;  4ASK A;  3MJX A;  4YLH A;  5BMV E;  2YKS A;  3F57 A;  5AQM B;  3HKE E;  5JR9 B;  5LGT B;  5JDQ A;  3AE1 A;  4WZX A;  1SHZ C;  3AE3 A;  1D0Y A;  3ZKR A;  4Z8X A;  4BAY B;  2CHO A;  4DUZ T;  4GKJ T;  1OED E;  4QXC B;  4YSY A;  2ACX A;  1IBM T;  3CML A;  4X64 T;  3RH3 A;  3LK3 B;  4IDZ A;  2XQ4 A;  2WCA A;  2CWY A;  2LKG A;  3A5X A;  2ZMA A;  1QUU A;  3I0O A;  2K3W A;  2A72 A;  2WP9 A;  5IUX A;  2IW5 B;  2PFV A;  2IC6 A;  4G2A A;  3I9Y A;  4IT4 A;  3KV6 A;  2LKH A;  4F6R C;  2N9D A;  2B1E A;  2FUP A;  3UU3 A;  5JDN A;  1G8X A;  2KIN B;  3PJA A;  2LEH A;  1WR0 A;  2WMN A;  4HFV A;  1VRB A;  2RA1 A;  3PU3 A;  4IL4 A;  3AXJ A;  3LSV A;  3RI5 A;  3SWH A;  3UU6 A;  4A5X A;  2KSR A;  4E7S A;  5DQW A;  5E0O A;  3Q5X A;  4YJ3 E;  3U78 A;  4PK6 A;  1I94 T;  3VKH A;  1WLX A;  4GOU A;  4IE4 A;  2YIN A;  2VB6 A;  4HWC A;  4AQF C;  2WU5 A;  1OED B;  4A97 A;  1UUR A;  2M6I A;  3V5S A;  1WYB A;  3CQC B;  2BS3 A;  2KT9 A;  2LOP A;  2X9Y A;  3CX7 B;  5FY0 A;  4HWF A;  3M3Z B;  3L09 A;  3Q2M A;  3RYH E;  2NP9 A;  4YT0 A;  3O1I A;  4UVB B;  2WZH A;  4UVC B;  5JRC B;  3HR0 A;  5AQP B;  3AEA A;  3M65 A;  3RIA A;  2LOS A;  2J1D G;  4CZZ B;  3ZPO A;  3GA8 A;  3B13 A;  3MZK B;  2VQF T;  1XNR T;  3C50 A;  2J4G A;  3JC6 C;  3QK6 A;  5DAB A;  3O1J A;  1KNP A;  3H37 A;  2Y8D A;  4IL9 A;  1LVF A;  1SE7 A;  4GK5 E;  2WDR A;  2NW9 A;  3TLT A;  2WU2 A;  3B5M A;  1YKH B;  1MMG A;  4BA9 A;  4EXT A;  2LRL A;  1D1C A;  2C0S A;  2LSJ A;  3EDU A;  3EI0 A;  4TWF A;  2P9B A;  1E1H B;  4X5T A;  4ZI2 D;  5HXS A;  5LHG B;  4B3T T;  4HWH A;  3UUM A;  2XY8 B;  5FL1 A;  5AQL B;  5FVL A;  3ZJ1 A;  2VVN A;  4V1A v;  3RX6 A;  3OTO T;  2JQH A;  4AQF A;  3AB3 B;  2Q9Q B;  5ABF B;  3VKG A;  2L9Q A;  2E8I A;  3Q9D A;  2WM9 A;  1UUS A;  4QWN B;  5HEH A;  4YTN A;  4ILU A;  5HEG A;  4U3C A;  4YY3 T;  3ZMV B;  3N2K E;  3PDY A;  1MIW A;  1JNR A;  5AQI B;  2CXL A;  2H89 A;  3CVR A;  1W09 A;  1CHU A;  2JQK A;  3MA9 A;  4H9R C;  5FXV A;  4YTP A;  5LYJ E;  5L2L A;  2G0U A;  5ABG A;  5L3E B;  2E2A A;  4B3R T;  4LFB T;  2BDE A;  4EGW A;  3K3O A;  2V5C A;  4IE5 A;  3UFE A;  5JDF A;  2F4V T;  2QGS A;  3P4Q A;  5FY1 A;  3ZYK A;  4AI6 A;  2WY2 A;  3QOF A;  2LM2 A;  5AQO B;  1FJG T;  2LJL A;  1X9B A;  2YK0 A;  5F5W A;  5JR9 A;  3JAF A;  4NUV A;  2XAS B;  3PUR A;  1QSD A;  1T72 A;  1Y01 A;  2V7I A;  3UU4 A;  3PUQ A;  3ONL C;  3FZL B;  3JAE A;  2LE8 A;  3K1S A;  4LMJ A;  4DV7 T;  5M4Y A;  1BR1 A;  1XMQ T;  2C5K T;  2JPF A;  3AAE B;  1OWA A;  3T1Y T;  4C90 A;  4B3S T;  1KEY A;  4GYR A;  2SPC A;  4ZI7 E;  5JTG A;  5HEJ A;  4QH5 A;  5CA1 E;  4I0U A;  4X62 T;  1HG5 A;  3TLU A;  2V7K A;  2HPJ A;  2Z6E A;  5FXW A;  2BS2 A;  1S35 A;  1J1J A;  3QUJ A;  3UQ4 A;  2IDO B;  3ZMZ B;  2K24 A;  1W0A A;  3OKQ A;  3AEG A;  4IST A;  5KMG P;  5KXJ A;  2KZ7 B;  1Z0P A;  1VCS A;  1ZEE A;  3K8P C;  4FI5 A;  3RLF F;  1HG2 A;  5JRC A;  1BR0 A;  3ZSS A;  4LFC T;  1H7C A;  4IRE A;  3UUX B;  5ETW A;  2I0M A;  4IDP A;  3ZMU B;  3AA7 B;  3AEF A;  2JQQ A;  4HWD A;  4KBM B;  4TN7 B;  3GN5 A;  3Q5D A;  2IAK A;  4IDN A;  3ZJ2 A;  3ZST A;  3H3A A;  2ZM2 A;  2OLT A;  3ZYL A;  5HXE A;  3B57 A;  2UUB T;  4HFE A;  3VRA A;  1D1B A;  1KK7 A;  1YKE B;  4OK0 A;  4LMK A;  3UTK A;  1WCR A;  3AA0 B;  2YU1 A;  3QB5 K;  3IEE A;  1U5P A;  4KX6 A;  4U7I A;  4YJ2 E;  5C3J A;  4DV6 T;  3RPU A;  2C5J A;  2WQY A;  4EB6 E;  4ZZB A;  2PBI A;  5LG3 A;  2CMR A;  3CPZ A;  4OX9 T;  2UXC T;  4DBQ A;  2PTF A;  5FXX A;  4TUY E;  3NRX A;  5EK4 A;  2IHR 1;  2W61 A;  2ZM6 T;  2K9A A;  3R84 B;  1AJ3 A;  4X20 E;  4LML A;  2ES0 A;  2XQ5 A;  5FYM A;  3FBL A;  3PUZ F;  4KHP T;  2V1D B;  4ANJ A;  3OYX A;  4DV3 T;  3GWH A;  1MIY A;  5HWY A;  3RHW A;  1WYC A;  1XDP A;  2A3D A;  2XQY A;  4HFC A;  3JC6 D;  1UK5 A;  5ABE A;  1N36 T;  3ZT7 A;  3L3P A;  4FJO A;  2YN6 A;  3N2G E;  1E2A A;  2OA5 A;  4U7Y A;  5FP3 A;  5TAO A;  4ZI3 D;  2E9X D;  3WAK A;  4A56 A;  2X67 A;  1OED C;  2EHO C;  4AXP A;  2E5L T;  2XQ7 A;  3DTO A;  4LF9 T;  5AQF B;  2MAW A;  2CRB A;  3C4X A;  5FVK A;  3J9X 1;  4ZI2 C;  3F2E A;  4OYK A;  2IIU A;  2UXX B;  2YDR A;  4EZ4 A;  2HN1 A;  4DV4 T;  1J5W A;  2E9X B;  3JAD A;  3P4S A;  5JRE A;  1WR6 A;  4H9N C;  3RRW A;  2W4X A;  3HKB E;  2ODV A;  4TV9 E;  1HTJ F;  4JYA T;  1KNR A;  4EEB A;  4KI0 F;  2XQA A;  2CPT A;  4Z90 A;  1T8B A;  3EAM A;  3P7I A;  2KWI B;  1FMV A;  2V26 A;  1XWM A;  2UXN B;  1LRZ A;  3EAB A;  3RQU A;  3Q5E A;  1KFY A;  2V5D A;  2YEV C;  2XQ6 A;  2XSA A;  3ESL A;  4COF A;  4H9S E;  2UXB T;  2JJ9 A; 
#chains in the Genus database with same CATH homology
 4JI7 T;  4DR1 T;  4B3T T;  4X66 T;  3OTO T;  4JI4 T;  4LF7 T;  1HNW T;  4X65 T;  4YY3 T;  4JI2 T;  4GKK T;  4LF8 T;  1XMO T;  4DV2 T;  5IWA T;  5BR8 T;  4LFA T;  4B3R T;  4LFB T;  4NXN T;  1HR0 T;  2F4V T;  1FJG T;  4YHH T;  1IBL T;  4DR2 T;  4DR6 T;  4JI5 T;  4DV1 T;  4DV7 T;  1XMQ T;  4LF4 T;  4LF5 T;  3T1Y T;  1HNX T;  4B3S T;  4DV5 T;  4X62 T;  2UXD T;  4AQY T;  5LMU T;  3T1H T;  2VQE T;  1J5E T;  1IBK T;  2HHH T;  4LFC T;  2UUC T;  1N34 T;  4DR4 T;  2UU9 T;  1IBM T;  4JI0 T;  1N32 T;  4NXM T;  4K0K T;  2UUB T;  4DUZ T;  4GKJ T;  4DR7 T;  4DV6 T;  4X64 T;  4OX9 T;  2UXC T;  4JV5 T;  1HNZ T;  2ZM6 T;  1XNQ T;  4KHP T;  4DV3 T;  4JI3 T;  4JI8 T;  1N36 T;  1N33 T;  4DR5 T;  1I94 T;  2E5L T;  4DUY T;  4LF9 T;  4B3M T;  4JI1 T;  4JI6 T;  5LMN T;  4DV4 T;  4JYA T;  4LF6 T;  4DR3 T;  2UUA T;  1XNR T;  4DV0 T;  2VQF T;  2UXB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...