4LF7T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf7T00
4GKKT 4NXMT 1N36T 5LMNT 5LMUT 4YHHT 4DV1T 1IBMT 4DV6T 4B3ST 4LF8T 1HNWT 1HNZT 5IWAT 4NXNT 1HNXT 2HHHT 4DUZT 4DUYT 4B3RT 4LF5T 1IBLT 1N34T 4JI4T 1XNRT 1J5ET 4DV4T 4JI0T 2E5LT 4LFCT 4LF9T 4DV2T 4K0KT 4DV5T 2UXCT 1I94T 3T1YT 4DR4T 4KHPT 1HR0T 1IBKT 1XMQT 1N33T 4B3TT 2UXDT 4DR5T 1FJGT 4JYAT 4JI2T 4X64T 1XNQT 4DR2T 4LFAT 4OX9T 4LF4T 4DV7T 2VQFT 1N32T 2UXBT 4JV5T 4JI5T 5BR8T 4DR3T 4JI1T 4LFBT 2ZM6T 4LF6T 4B3MT 2UU9T 4JI7T 2VQET 4DR6T 2UUAT 4DV0T 4DR7T 4DR1T 4LF7T 4YY3T 3T1HT 2UUCT 4DV3T 4AQYT 4JI8T 1XMOT 4JI3T 4X65T 4JI6T 4X62T 3OTOT 2UUBT 2F4VT 4GKJT 4X66T
chains in the Genus database with same CATH superfamily
2D0UA 1OEDA 5KX5E 2BVMA 3AEDA 3ANWB 3RYFE 3C4ZA 4AKGA 3P4WA 2HPLA 4UELA 4IE5A 4O4IE 1IBLT 3CK6A 3RI5A 3B13A 4HWHA 3RIFA 4JUYA 2PJQA 2CM0A 3SS1A 1KNZA 5LBMA 3T1YT 4ZHQE 1EZ3A 4KHPT 4U33A 1HG5A 2IMLA 3Q5DA 2Y6XA 5EK3A 3HKEE 1YD8G 1Y01A 3F57A 2WWUA 4IL4A 4HFVA 2J62A 3MK7C 4LMLA 1JNZA 5FYMA 1NWMX 5LYJE 4QH5A 2LSGA 2XQ5A 2VVNA 3ZPOA 5JR9B 5FNVE 5AQOB 4UIGA 2MBGA 2A2FX 2HN2A 4YHJA 4B3MT 2NW7A 3UU5A 4N78D 2VQET 3K8PC 2LJLA 2VKHA 3ZYMA 4YY3T 2FBWA 3NRYA 3RF1A 3AA1B 2UXNB 3I9YA 4QXHB 5LHGB 4AKLA 1XMOT 2IUBA 4JI6T 3OTOT 2CXLA 3C64A 3PUAA 3PUGA 5JVDE 3FHNA 4PNIA 2BVLA 5LMNT 5EK4A 2VURA 5JR9C 3CWZB 1IJ6A 3OKQA 2BG9E 5L3BB 2CRBA 5HYAA 2VKOA 2YN6A 1MIYA 2AXDS 5L4HA 3NRXA 1BR0A 3AEEA 2NW9A 3C4XA 1ZV4X 4PK6A 1LVFA 3CMLA 3VKGA 4ISTA 4ZI2C 1R8IA 2BS4A 2LT3A 1D0ZA 1Z0PA 3JADA 5LGTB 2MAWA 3UU6A 1OXZA 4WW0A 3RRWA 3H3AA 3F31A 3L39A 4JI1T 2ZM0A 5LBQB 3LK42 3LFMA 4AXPA 1NEKA 4LMKA 3P8CD 3QB5A 3N2KE 1UURA 3CQCB 5KMGP 1HTJF 1O3XA 3EABA 5L3DB 4P1NA 5LHHB 4PJJA 3ANWA 2NTXA 3HL6A 5AQGB 5LG4A 2QYWA 2F4VT 3C98B 5IYZE 4Q25A 2WAUA 2V5CA 2V1DB 3B5MA 2YDQA 2H7OA 4YTMA 4LF8T 4KHZF 3ZC0A 3EHZA 5FVLA 2BDEA 4YJ3E 4ILBA 5CFBA 3QUJA 5BMVE 4M1PA 2CEAA 3RX6A 2IHR1 2DL1A 3FB2A 2D5UA 3NZPA 3KINB 4J2CA 2MYSA 5EZYE 2C5KT 1MIVA 4AQFC 1T98A 4DR4T 2VK9A 5IUXA 5L47A 2ZMAA 2DWKA 3N9NA 1UX5A 4CXXA 2KLQA 4B6XA 1AJ3A 4IE4A 5DABA 2SPCA 4UXNB 3PUVF 1HG2A 1MNDA 3UFEA 5AQSB 4ADZA 2CMRA 2VL0A 3AE4A 1W0BA 2XM1A 2IAKA 1VCTA 2MPKA 2PG8A 3VR9A 4LF7T 3RYIE 4YFSA 5JTGA 2W61A 3K1SA 3E08A 5ABHA 3PU8A 3GA8A 4X65T 3PU3A 4O8SA 3J9X1 2CWYA 3M3ZB 4ISSA 3N9PA 3PJAJ 3O1JA 1HNWT 2BG9B 3G06A 5EK2A 4JLEA 4KBMB 3ESLA 4GYSA 4IE7A 2ODUA 2JJ9A 2V7LA 5J1GA 3AE9A 3WAKA 4UF0B 1E2AA 3UU3A 3U78A 5L3FB 4JBWF 3P4PA 5JH7E 2LRKA 2JRKA 1IBKT 4IHJE 2D9DA 4I0UA 2BG9C 2KWHA 2JQ9A 2B1EA 2LEHA 3SOLA 4E7ZA 2YOEA 4LFAT 2BS2A 5AQNB 2ES0A 3RKOA 4DV7T 4GK0E 2WB5A 4E7SA 4JI5T 3MXZA 4QXBB 3IHRA 2ACXA 3LK3B 3NVOA 2YEVC 2X9HA 2BKNA 4AQFA 1S94A 2XQ4A 3IEEA 2VL8A 3ZT7A 5AQLB 3MJXA 2K5BB 5FL0A 4QX8B 2NWBA 2XSAA 3GMIA 2X67A 2E5VA 4AI6A 3FZMB 5LMUT 4DV1T 1IBMT 3QB5K 2WY2A 4C90A 1VRBA 4FJOA 1HNXT 3N2GE 2L8KA 3ONXA 1T7SA 4JI4T 1YQ4A 1BR2A 3BQLA 3MZKB 4TZ4C 4DV2T 2K24A 3WAJA 3EDVA 4XAXB 4EEBA 2X9YA 4IDPA 4EZHA 2YK0A 4TV8E 4NIQA 3RH3A 1YKEB 2X0HA 3QNUA 3ZT6A 4O2AE 2K48A 2WM9A 4U2YA 4V1Av 3AEBA 3FZFB 4PFOA 5JDHA 2OA5A 1KNRA 3SFEA 4P0AA 1UK5A 4AIUA 5L3CB 3DTOA 1WR0A 3N5LA 2VB6A 3ZEFB 5AQKB 3Q5XA 4P09A 2XQ9A 5F5WA 2V7IA 3PUYF 2BG9A 5JDQA 5FL1A 3AECA 4MFRA 4A98A 5JDGA 3FZKB 3JCFA 4UF0A 4ZI2D 4XZCA 2LKGA 2HHHT 4HFHA 3K3OA 3GN5B 1CHUA 3ZT5A 3X1DA 3Q5EA 1G8XA 4JI0T 1HCIA 5J2UE 1KEYA 3A8YC 3EI0A 4LF9T 4P0BA 2N1GA 2RPAA 3QK6A 2KWIB 4DV5T 3C51A 5AQTB 3PUSA 3PE0A 2XAQB 1MMNA 1YXRA 1G73A 3RRCA 3Q2MA 3RIAA 4JI2T 3VRBA 4DVDA 2A3DA 4DR2T 1VOMA 4HWCA 4QH4A 3RQUA 3N9MA 3RGLA 3UUXB 1FIOA 2OLTA 4H9NC 4IDQA 4H9RC 2IIUA 5IHYA 1ZEEA 2PFVA 2X9XA 3LSVA 1WYBA 2YDSA 2GK9A 5FVKA 4HWFA 2ACZA 1ZHCA 4L5GA 2XPKA 4QXCB 3ONJA 3ZLIA 4PFPA 3J7Yq 4BJMA 4GK5E 4NXNT 1KFYA 4TNWA 3CQGB 4MLKA 2X9WA 3L8RA 4OHFA 3CVRA 3R84B 4PW8A 4UV8B 5LNKA 2CWOA 1D0XA 2H7VC 1YQ3A 5AQJB 4ASKA 4K0KT 5FY0A 2BS3A 2WWVA 1XDPA 2WMOA 2WU5A 5C8YE 3ZCJA 2VKJA 2H3RA 1WRDA 2W00A 5AQIB 2E9XB 4OFZA 2NW8A 2ZM2A 4EEDA 2VVSA 3FZHB 4UEMA 2VQFT 2FJEA 4ZZBA 2DLRA 2CE7A 5H6RB 4H9QC 3OBVE 2JPFA 2Q9QB 1D0YA 2XASB 4XBFB 1X9BA 3C50A 4O4JE 3P50A 1W09A 2XUEA 3P7IA 2XQ3A 2E9XC 4HFDA 5LCYA 2JMKA 2OV9A 2I59A 2LM9A 4O2BE 3GN5A 2J4GA 3TKLB 3AE3A 3ETUA 4WZXA 2WBLA 4PJMA 2HPJA 2H88A 4CN4A 2G0UA 3RHWA 5F8PA 2Q9QC 1NENA 4Z90A 5KXJA 5JDFA 4AISA 3AE5A 2M67A 3B57A 2Z6EA 5TAOA 3ZJ1A 4HFEA 5JQGE 1LKXA 3CPZA 2DI4A 3AAAB 3QC9A 3QOFA 2V6YB 4DR5T 4ZEYA 2DCFA 2X0YA 4PK4A 2XAJB 3PUXF 3JC6D 4O4HE 4ZI7E 4U7YA 2JQKA 4L9IA 2E2AA 1KF6A 4TX5A 3PTRB 3V5UA 2WZHA 3W15B 4U72A 5LA6E 3HKDE 1U5PA 4A5XA 3TLUA 4TWHA 3RIUA 2KT9A 4O4LE 4QHOA 4IE0A 1HX8A 4BAYB 5AQVB 3EAMA 4X66T 3CX8B 3VRAA 3CIRA 4HN9A 4H9SE 2KMFA 3ZMUB 3ZC1A 4IE6A 4YT0A 2X66A 3IF8B 2Y8DA 4EAHA 2PBIA 2XAFB 5CA1E 4YSZA 4HFCA 1XNRT 3T8OA 1UUSA 5AQPB 3IA3A 2V26A 3UUBA 2E9XA 4I4TE 5FY7A 4A56A 2J47A 1WYCA 2N2NA 3RPUA 1ZP0A 3LDQB 3AEFA 3R6NA 1OWAA 1SUMB 3AA0B 5KDMC 1Z8UA 1WLXA 3LJCA 3SFDA 3TLWA 2Q9QA 2V5DA 3OJAA 2UXBT 5BR8T 4JEUB 3CKDA 4LFBT 2ZM6T 3A7MA 3KV4A 3PURA 4UVCB 4YLHA 2P9BA 1W0AA 1ZOYA 2Y48B 3OVUA 5ETWA 5AFUL 3ZJ2A 3I9WA 1Y64B 4DO0A 3Q5WA 1T8BA 2N9DA 4HTEA 3AAIA 1V9DA 3AB3B 5HEUA 5M4YA 1MNEA 1IJ5A 3NWIA 1DU2A 1M62A 3ZSSA 3AE1A 3OYZA 2WP9A 5LB7B 1B7TA 4DUZT 3KDSE 3N9OA 4IREA 3PV0F 4AKIA 3RC8A 2HH7A 4OYKA 3JAEA 2QVAA 3L09A 4AKRB 3AVRA 2V6YA 3RQWA 3OYXA 3UU4A 5ABGA 3AA7B 2I0MA 2WDVA 5H6QB 5HCMA 2LSIA 4X5TA 5E0OA 4LMJA 1XMQT 2EHOB 2UXDT 5HWYA 3ZMSB 2XQAA 3NZQA 2KXPB 3Q9DA 2W4XA 2LHNA 3F2EA 2XQ8A 2L3LA 4DR3T 3H3MA 4DMVA 5HAXA 4JI7T 2W0GA 3WI3A 2UUAT 1SE7A 1T72A 1VCSA 3T1HT 2EHOC 5GONE 3EUHA 5AQUB 4TWFA 5HCJA 3ZYLA 3KV6A 5F3JA 1SHZC 5C2TA 4GYRA 4ANJA 5LJNA 5JREA 3UULA 3PUZF 1N36T 2WS3A 1E1HB 2CBIA 5HXCA 5IWAT 1NAFA 1KNPA 5CA0E 3ZMZB 3O9XA 4I50E 1US7B 2W62A 2LRLA 5CGMA 3KV9A 2ZM8A 3BQKA 2RA1A 2YINA 3AE2A 4HWIB 4GIWA 5LJMA 5FXWA 4X1KE 4CXYA 2XZEA 1SA0E 4ILUA 3CX6B 2LKHA 4I55E 4A97A 4PJLA 3UUMA 5HXHA 1XWMA 3ZSTA 5C3JA 2UXCT 4QX7B 4ILAA 3L3PA 4QKNA 1BR4A 4TV9E 2LSJA 4ZZCA 1JNRA 3ZN1B 3HA4A 5FXZA 4OK0A 3MA9A 4PK5A 2WZIA 3ZKRA 2FJDA 4LF4T 2QA7A 1N32T 2W67A 5LXTE 3S4UA 4X20E 4KX6A 2LLYA 4U3CA 1X79A 3PDYA 3AEAA 4G2AA 4CN1A 2DWGA 4DV0T 5HEGA 4GOUA 1KK7A 2XM2A 4ZXLA 4NPPA 2WDRA 4I43B 3FBLA 2XJ7A 5JRCB 3ZYKA 4DV3T 5JDLA 2XAHB 4JI3T 1FEWA 4X62T 5HXSA 5JDMA 2Q9QD 2XHEB 4TNVA 2XQ6A 4ILCA 4IIJE 4JEHB 5ABFA 2V7MA 4GKKT 4HEAA 3AA6B 2AE9A 1HX1B 4YHHT 2XY8B 2BBJA 2ZLYA 4KI0F 5FKYA 1QSDA 2CHOA 1D1AA 4B3RT 3TLSA 4YTNA 1LRZA 3NBXX 1UX4A 3KFWX 1XDOA 2L9QA 1FMWA 4YXDA 5CB4E 2EHOA 2BKOA 3LK2B 2KSRA 5HWXA 4IDZA 2W2UA 4ZS2A 2BBHA 2NOXA 2LM2A 2LOPA 4UVBB 4B3TT 3O1IA 2CPTA 3V5SA 2E8IA 2LE8A 4YSXA 5AQHB 3A5XA 1XNQT 2MOZA 2LSKA 5A1LA 5LOVE 1D1CA 2DNXA 4ZI3C 4QWNB 3RIUC 2FJAA 4F6RC 3AE6A 3AVSA 2KINB 4MALA 2W66A 4DBRA 2X68A 2V7KA 1QLBA 1W9RA 1WR6A 2D0TA 3DJBA 3N2OA 3TLTA 4CI2B 2A72A 5CJ5A 3U3IA 3RKGA 4KP3C 2CA5A 4H9PC 4B3ST 4EOZB 4BA9A 2K9AA 1MIWA 3OPCA 3FBZA 4DUYT 5L3GB 3SRZA 1OEDE 3KBTA 2WMNA 2WCAA 4AKHA 5JDNA 4CXWA 4EV6A 1MMAA 1I94T 3ZMTB 2QGSA 5FXXA 1HR0T 4IDNA 1FJGT 4H9OC 2I6HA 2A9UA 3HKBE 3H37A 4U31A 3BK9A 3MKDA 2YKSA 4YTPA 2M6IA 3GWHA 3AXJB 5AQFB 4JV5T 2C5IT 2IC6A 1QUUA 5JRCA 4LF6T 4YJ2E 4H63H 3E22E 3P4QA 1MMDA 4IDOA 5LP6E 2NTYA 4MBQA 3SWHA 2PTFA 2HN1A 4CI1B 3KBUA 2IC9A 2UXXB 2K3WA 3LBXB 2UUCT 3PJAA 2D2SA 1M7KA 4GKJT 4U74A 2XAGB 4NXMT 4EYUA 1J1JA 1UCUA 1FMVA 5HEOA 2CXFA 3ZN0B 2M6BA 2NR4A 4DV6T 3EVYA 1U4QA 4EYYR 3UFGA 5FXVA 1HNZT 4NUVA 5DJQC 3ETVA 3C4WA 2ODVA 2VWAA 1E7PA 4LF5T 4IL9A 3HKCE 3DP7A 3HI2A 5JR9A 1J5ET 4TUYE 2J1DG 5AQMB 1MMGA 3IBPA 5DQWA 3BQIA 1L0VA 2H89A 3AE8A 3FXEB 2VASA 5L3EB 2YDRA 2X51A 3AEGA 2C5JA 1N33T 2VKDA 3E0ZA 4JYAT 5AQQB 3RLFF 4UV9B 5ABEA 3UT5E 4ERRA 1WFDA 3CQXC 1S35A 4OX9T 3N9LA 2XSBA 2EHOD 5J2TE 3UU8A 2WSSV 2YU2A 4DIDB 4Z8XA 4G63A 2LOSA 5FY1A 2V7JA 5J0ZA 5HXRA 1GQEA 3AAEB 4FI5A 3I0QA 4DR7T 3JAFA 3UTKA 3LG7A 4CZZB 2WDQA 4IGUA 3VHLA 2KZ7B 2WU2A 3N9QA 4EXTA 2CCQA 2XTLA 4QH1A 4CN6A 2FUPA 2CHNA 1J5WA 2XQ7A 4WBNE 3M65A 4TN7B 3ONLC 4CI3B 5LG3A 2NP9A 1CUNA 2W63A 2KNDA 3PUWF 1OEDB 5LGUB 5HXEA 1H7CA 3P4SA 4WBOA 3I1AA 3KVBA 4KUMB 5AQRB 3NKZA 5FP3A 4F8HA 4HFIA 4WYVA 2B76A 2E5LT 1HS7A 2JMHA 4U7IA 1WCRA 4H63V 5ABFB 3AXJA 4KMCA 5LGNB 3K3QC 2CXDA 2WQYA 2XQYA 4PJNA 5LHIB 4TWDA 1YKHB 4DBQA 4X64T 4ZS3A 3JC6C 4CQIA 1LVKA 1OEDC 4HKAA 3KV5A 4L0RA 3FXDB 4DNDA 3HR0A 2FJBA 3ABVA 4HFBA 4EZ4A 3LBXA 5ADXL 4COFA 2QRXA 4YSYA 3VKHA 3O1HA 5DQVA 4HWDA 4PAGA 4C91A 4DMWA 2MTQA 3KVAA 4EIWA 3I0OA 3UQ4A 4AQYT 3VR8A 4JI8T 3AE7A 3P4RA 4UR9A 2UUBT 1D1BA 2LSYA 2LHRA 2CLYB 2YU1A 4UVAB 4HE8A 4AQGA 4U2ZA 5FMNA 3O4XE 1I6ZA 3UQ7A 1HFAA 5L2LA 3RYCE 1N34T 3ZMVB 3CX7B 2IW5B 2V6XA 4DV4T 2CBJA 4OYJA 1BR1A 4X1IE 4LFCT 4Z91A 4MHCA 3K3NA 2BKPA 1UGOA 1IZNB 4ZI3D 2CLYC 1YW0A 4BJNA 1ZKEA 3FZLB 2JQQA 2RP4A 4NUUA 4EB6E 4K0UA 5L4EA 3PUQA 3EDUA 3VU7H 2DHRA 3D0TA 2BZBA 1IAPA 3RYHE 3TLVA 2JIWA 2C0SA 4X1YE 2JQHA 4EGWA 1HF8A 4WNKA 2UU9T 4ZOLE 2IDOB 4HGAA 2R6GF 4DR6T 4DR1T 2X0LB 4IT4A 1XZYA 3UUNA 3RC3A 3ZCIA 2V8SV 2E9XD 3MACA 5HEJA 5HEHA
chains in the Genus database with same CATH topology
4GKKT 4NXMT 1N36T 5LMNT 5LMUT 4YHHT 4DV1T 1IBMT 4DV6T 4B3ST 4LF8T 1HNWT 1HNZT 5IWAT 4NXNT 1HNXT 2HHHT 4DUZT 4DUYT 4B3RT 4LF5T 1IBLT 1N34T 4JI4T 1XNRT 1J5ET 4DV4T 4JI0T 2E5LT 4LFCT 4LF9T 4DV2T 4K0KT 4DV5T 2UXCT 1I94T 3T1YT 4DR4T 4KHPT 1HR0T 1IBKT 1XMQT 1N33T 4B3TT 2UXDT 4DR5T 1FJGT 4JYAT 4JI2T 4X64T 1XNQT 4DR2T 4LFAT 4OX9T 4LF4T 4DV7T 2VQFT 1N32T 2UXBT 4JV5T 4JI5T 5BR8T 4DR3T 4JI1T 4LFBT 2ZM6T 4LF6T 4B3MT 2UU9T 4JI7T 2VQET 4DR6T 2UUAT 4DV0T 4DR7T 4DR1T 4LF7T 4YY3T 3T1HT 2UUCT 4DV3T 4AQYT 4JI8T 1XMOT 4JI3T 4X65T 4JI6T 4X62T 3OTOT 2UUBT 2F4VT 4GKJT 4X66T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK T;  4NXM T;  1N36 T;  5LMN T;  5LMU T;  4YHH T;  4DV1 T;  1IBM T;  4DV6 T;  4B3S T;  4LF8 T;  1HNW T;  1HNZ T;  5IWA T;  4NXN T;  1HNX T;  2HHH T;  4DUZ T;  4DUY T;  4B3R T;  4LF5 T;  1IBL T;  1N34 T;  4JI4 T;  1XNR T;  1J5E T;  4DV4 T;  4JI0 T;  2E5L T;  4LFC T;  4LF9 T;  4DV2 T;  4K0K T;  4DV5 T;  2UXC T;  1I94 T;  3T1Y T;  4DR4 T;  4KHP T;  1HR0 T;  1IBK T;  1XMQ T;  1N33 T;  4B3T T;  2UXD T;  4DR5 T;  1FJG T;  4JYA T;  4JI2 T;  4X64 T;  1XNQ T;  4DR2 T;  4LFA T;  4OX9 T;  4LF4 T;  4DV7 T;  2VQF T;  1N32 T;  2UXB T;  4JV5 T;  4JI5 T;  5BR8 T;  4DR3 T;  4JI1 T;  4LFB T;  2ZM6 T;  4LF6 T;  4B3M T;  2UU9 T;  4JI7 T;  2VQE T;  4DR6 T;  2UUA T;  4DV0 T;  4DR7 T;  4DR1 T;  4LF7 T;  4YY3 T;  3T1H T;  2UUC T;  4DV3 T;  4AQY T;  4JI8 T;  1XMO T;  4JI3 T;  4X65 T;  4JI6 T;  4X62 T;  3OTO T;  2UUB T;  2F4V T;  4GKJ T;  4X66 T; 
#chains in the Genus database with same CATH topology
 2D0U A;  1OED A;  5KX5 E;  2BVM A;  3AED A;  3ANW B;  3RYF E;  3C4Z A;  4AKG A;  3P4W A;  2HPL A;  4UEL A;  4IE5 A;  4O4I E;  1IBL T;  3CK6 A;  3RI5 A;  3B13 A;  4HWH A;  3RIF A;  4JUY A;  2PJQ A;  2CM0 A;  3SS1 A;  1KNZ A;  5LBM A;  3T1Y T;  4ZHQ E;  1EZ3 A;  4KHP T;  4U33 A;  1HG5 A;  2IML A;  3Q5D A;  2Y6X A;  5EK3 A;  3HKE E;  1YD8 G;  1Y01 A;  3F57 A;  2WWU A;  4IL4 A;  4HFV A;  2J62 A;  3MK7 C;  4LML A;  1JNZ A;  5FYM A;  1NWM X;  5LYJ E;  4QH5 A;  2LSG A;  2XQ5 A;  2VVN A;  3ZPO A;  5JR9 B;  5FNV E;  5AQO B;  4UIG A;  2MBG A;  2A2F X;  2HN2 A;  4YHJ A;  4B3M T;  2NW7 A;  3UU5 A;  4N78 D;  2VQE T;  3K8P C;  2LJL A;  2VKH A;  3ZYM A;  4YY3 T;  2FBW A;  3NRY A;  3RF1 A;  3AA1 B;  2UXN B;  3I9Y A;  4QXH B;  5LHG B;  4AKL A;  1XMO T;  2IUB A;  4JI6 T;  3OTO T;  2CXL A;  3C64 A;  3PUA A;  3PUG A;  5JVD E;  3FHN A;  4PNI A;  2BVL A;  5LMN T;  5EK4 A;  2VUR A;  5JR9 C;  3CWZ B;  1IJ6 A;  3OKQ A;  2BG9 E;  5L3B B;  2CRB A;  5HYA A;  2VKO A;  2YN6 A;  1MIY A;  2AXD S;  5L4H A;  3NRX A;  1BR0 A;  3AEE A;  2NW9 A;  3C4X A;  1ZV4 X;  4PK6 A;  1LVF A;  3CML A;  3VKG A;  4IST A;  4ZI2 C;  1R8I A;  2BS4 A;  2LT3 A;  1D0Z A;  1Z0P A;  3JAD A;  5LGT B;  2MAW A;  3UU6 A;  1OXZ A;  4WW0 A;  3RRW A;  3H3A A;  3F31 A;  3L39 A;  4JI1 T;  2ZM0 A;  5LBQ B;  3LK4 2;  3LFM A;  4AXP A;  1NEK A;  4LMK A;  3P8C D;  3QB5 A;  3N2K E;  1UUR A;  3CQC B;  5KMG P;  1HTJ F;  1O3X A;  3EAB A;  5L3D B;  4P1N A;  5LHH B;  4PJJ A;  3ANW A;  2NTX A;  3HL6 A;  5AQG B;  5LG4 A;  2QYW A;  2F4V T;  3C98 B;  5IYZ E;  4Q25 A;  2WAU A;  2V5C A;  2V1D B;  3B5M A;  2YDQ A;  2H7O A;  4YTM A;  4LF8 T;  4KHZ F;  3ZC0 A;  3EHZ A;  5FVL A;  2BDE A;  4YJ3 E;  4ILB A;  5CFB A;  3QUJ A;  5BMV E;  4M1P A;  2CEA A;  3RX6 A;  2IHR 1;  2DL1 A;  3FB2 A;  2D5U A;  3NZP A;  3KIN B;  4J2C A;  2MYS A;  5EZY E;  2C5K T;  1MIV A;  4AQF C;  1T98 A;  4DR4 T;  2VK9 A;  5IUX A;  5L47 A;  2ZMA A;  2DWK A;  3N9N A;  1UX5 A;  4CXX A;  2KLQ A;  4B6X A;  1AJ3 A;  4IE4 A;  5DAB A;  2SPC A;  4UXN B;  3PUV F;  1HG2 A;  1MND A;  3UFE A;  5AQS B;  4ADZ A;  2CMR A;  2VL0 A;  3AE4 A;  1W0B A;  2XM1 A;  2IAK A;  1VCT A;  2MPK A;  2PG8 A;  3VR9 A;  4LF7 T;  3RYI E;  4YFS A;  5JTG A;  2W61 A;  3K1S A;  3E08 A;  5ABH A;  3PU8 A;  3GA8 A;  4X65 T;  3PU3 A;  4O8S A;  3J9X 1;  2CWY A;  3M3Z B;  4ISS A;  3N9P A;  3PJA J;  3O1J A;  1HNW T;  2BG9 B;  3G06 A;  5EK2 A;  4JLE A;  4KBM B;  3ESL A;  4GYS A;  4IE7 A;  2ODU A;  2JJ9 A;  2V7L A;  5J1G A;  3AE9 A;  3WAK A;  4UF0 B;  1E2A A;  3UU3 A;  3U78 A;  5L3F B;  4JBW F;  3P4P A;  5JH7 E;  2LRK A;  2JRK A;  1IBK T;  4IHJ E;  2D9D A;  4I0U A;  2BG9 C;  2KWH A;  2JQ9 A;  2B1E A;  2LEH A;  3SOL A;  4E7Z A;  2YOE A;  4LFA T;  2BS2 A;  5AQN B;  2ES0 A;  3RKO A;  4DV7 T;  4GK0 E;  2WB5 A;  4E7S A;  4JI5 T;  3MXZ A;  4QXB B;  3IHR A;  2ACX A;  3LK3 B;  3NVO A;  2YEV C;  2X9H A;  2BKN A;  4AQF A;  1S94 A;  2XQ4 A;  3IEE A;  2VL8 A;  3ZT7 A;  5AQL B;  3MJX A;  2K5B B;  5FL0 A;  4QX8 B;  2NWB A;  2XSA A;  3GMI A;  2X67 A;  2E5V A;  4AI6 A;  3FZM B;  5LMU T;  4DV1 T;  1IBM T;  3QB5 K;  2WY2 A;  4C90 A;  1VRB A;  4FJO A;  1HNX T;  3N2G E;  2L8K A;  3ONX A;  1T7S A;  4JI4 T;  1YQ4 A;  1BR2 A;  3BQL A;  3MZK B;  4TZ4 C;  4DV2 T;  2K24 A;  3WAJ A;  3EDV A;  4XAX B;  4EEB A;  2X9Y A;  4IDP A;  4EZH A;  2YK0 A;  4TV8 E;  4NIQ A;  3RH3 A;  1YKE B;  2X0H A;  3QNU A;  3ZT6 A;  4O2A E;  2K48 A;  2WM9 A;  4U2Y A;  4V1A v;  3AEB A;  3FZF B;  4PFO A;  5JDH A;  2OA5 A;  1KNR A;  3SFE A;  4P0A A;  1UK5 A;  4AIU A;  5L3C B;  3DTO A;  1WR0 A;  3N5L A;  2VB6 A;  3ZEF B;  5AQK B;  3Q5X A;  4P09 A;  2XQ9 A;  5F5W A;  2V7I A;  3PUY F;  2BG9 A;  5JDQ A;  5FL1 A;  3AEC A;  4MFR A;  4A98 A;  5JDG A;  3FZK B;  3JCF A;  4UF0 A;  4ZI2 D;  4XZC A;  2LKG A;  2HHH T;  4HFH A;  3K3O A;  3GN5 B;  1CHU A;  3ZT5 A;  3X1D A;  3Q5E A;  1G8X A;  4JI0 T;  1HCI A;  5J2U E;  1KEY A;  3A8Y C;  3EI0 A;  4LF9 T;  4P0B A;  2N1G A;  2RPA A;  3QK6 A;  2KWI B;  4DV5 T;  3C51 A;  5AQT B;  3PUS A;  3PE0 A;  2XAQ B;  1MMN A;  1YXR A;  1G73 A;  3RRC A;  3Q2M A;  3RIA A;  4JI2 T;  3VRB A;  4DVD A;  2A3D A;  4DR2 T;  1VOM A;  4HWC A;  4QH4 A;  3RQU A;  3N9M A;  3RGL A;  3UUX B;  1FIO A;  2OLT A;  4H9N C;  4IDQ A;  4H9R C;  2IIU A;  5IHY A;  1ZEE A;  2PFV A;  2X9X A;  3LSV A;  1WYB A;  2YDS A;  2GK9 A;  5FVK A;  4HWF A;  2ACZ A;  1ZHC A;  4L5G A;  2XPK A;  4QXC B;  3ONJ A;  3ZLI A;  4PFP A;  3J7Y q;  4BJM A;  4GK5 E;  4NXN T;  1KFY A;  4TNW A;  3CQG B;  4MLK A;  2X9W A;  3L8R A;  4OHF A;  3CVR A;  3R84 B;  4PW8 A;  4UV8 B;  5LNK A;  2CWO A;  1D0X A;  2H7V C;  1YQ3 A;  5AQJ B;  4ASK A;  4K0K T;  5FY0 A;  2BS3 A;  2WWV A;  1XDP A;  2WMO A;  2WU5 A;  5C8Y E;  3ZCJ A;  2VKJ A;  2H3R A;  1WRD A;  2W00 A;  5AQI B;  2E9X B;  4OFZ A;  2NW8 A;  2ZM2 A;  4EED A;  2VVS A;  3FZH B;  4UEM A;  2VQF T;  2FJE A;  4ZZB A;  2DLR A;  2CE7 A;  5H6R B;  4H9Q C;  3OBV E;  2JPF A;  2Q9Q B;  1D0Y A;  2XAS B;  4XBF B;  1X9B A;  3C50 A;  4O4J E;  3P50 A;  1W09 A;  2XUE A;  3P7I A;  2XQ3 A;  2E9X C;  4HFD A;  5LCY A;  2JMK A;  2OV9 A;  2I59 A;  2LM9 A;  4O2B E;  3GN5 A;  2J4G A;  3TKL B;  3AE3 A;  3ETU A;  4WZX A;  2WBL A;  4PJM A;  2HPJ A;  2H88 A;  4CN4 A;  2G0U A;  3RHW A;  5F8P A;  2Q9Q C;  1NEN A;  4Z90 A;  5KXJ A;  5JDF A;  4AIS A;  3AE5 A;  2M67 A;  3B57 A;  2Z6E A;  5TAO A;  3ZJ1 A;  4HFE A;  5JQG E;  1LKX A;  3CPZ A;  2DI4 A;  3AAA B;  3QC9 A;  3QOF A;  2V6Y B;  4DR5 T;  4ZEY A;  2DCF A;  2X0Y A;  4PK4 A;  2XAJ B;  3PUX F;  3JC6 D;  4O4H E;  4ZI7 E;  4U7Y A;  2JQK A;  4L9I A;  2E2A A;  1KF6 A;  4TX5 A;  3PTR B;  3V5U A;  2WZH A;  3W15 B;  4U72 A;  5LA6 E;  3HKD E;  1U5P A;  4A5X A;  3TLU A;  4TWH A;  3RIU A;  2KT9 A;  4O4L E;  4QHO A;  4IE0 A;  1HX8 A;  4BAY B;  5AQV B;  3EAM A;  4X66 T;  3CX8 B;  3VRA A;  3CIR A;  4HN9 A;  4H9S E;  2KMF A;  3ZMU B;  3ZC1 A;  4IE6 A;  4YT0 A;  2X66 A;  3IF8 B;  2Y8D A;  4EAH A;  2PBI A;  2XAF B;  5CA1 E;  4YSZ A;  4HFC A;  1XNR T;  3T8O A;  1UUS A;  5AQP B;  3IA3 A;  2V26 A;  3UUB A;  2E9X A;  4I4T E;  5FY7 A;  4A56 A;  2J47 A;  1WYC A;  2N2N A;  3RPU A;  1ZP0 A;  3LDQ B;  3AEF A;  3R6N A;  1OWA A;  1SUM B;  3AA0 B;  5KDM C;  1Z8U A;  1WLX A;  3LJC A;  3SFD A;  3TLW A;  2Q9Q A;  2V5D A;  3OJA A;  2UXB T;  5BR8 T;  4JEU B;  3CKD A;  4LFB T;  2ZM6 T;  3A7M A;  3KV4 A;  3PUR A;  4UVC B;  4YLH A;  2P9B A;  1W0A A;  1ZOY A;  2Y48 B;  3OVU A;  5ETW A;  5AFU L;  3ZJ2 A;  3I9W A;  1Y64 B;  4DO0 A;  3Q5W A;  1T8B A;  2N9D A;  4HTE A;  3AAI A;  1V9D A;  3AB3 B;  5HEU A;  5M4Y A;  1MNE A;  1IJ5 A;  3NWI A;  1DU2 A;  1M62 A;  3ZSS A;  3AE1 A;  3OYZ A;  2WP9 A;  5LB7 B;  1B7T A;  4DUZ T;  3KDS E;  3N9O A;  4IRE A;  3PV0 F;  4AKI A;  3RC8 A;  2HH7 A;  4OYK A;  3JAE A;  2QVA A;  3L09 A;  4AKR B;  3AVR A;  2V6Y A;  3RQW A;  3OYX A;  3UU4 A;  5ABG A;  3AA7 B;  2I0M A;  2WDV A;  5H6Q B;  5HCM A;  2LSI A;  4X5T A;  5E0O A;  4LMJ A;  1XMQ T;  2EHO B;  2UXD T;  5HWY A;  3ZMS B;  2XQA A;  3NZQ A;  2KXP B;  3Q9D A;  2W4X A;  2LHN A;  3F2E A;  2XQ8 A;  2L3L A;  4DR3 T;  3H3M A;  4DMV A;  5HAX A;  4JI7 T;  2W0G A;  3WI3 A;  2UUA T;  1SE7 A;  1T72 A;  1VCS A;  3T1H T;  2EHO C;  5GON E;  3EUH A;  5AQU B;  4TWF A;  5HCJ A;  3ZYL A;  3KV6 A;  5F3J A;  1SHZ C;  5C2T A;  4GYR A;  4ANJ A;  5LJN A;  5JRE A;  3UUL A;  3PUZ F;  1N36 T;  2WS3 A;  1E1H B;  2CBI A;  5HXC A;  5IWA T;  1NAF A;  1KNP A;  5CA0 E;  3ZMZ B;  3O9X A;  4I50 E;  1US7 B;  2W62 A;  2LRL A;  5CGM A;  3KV9 A;  2ZM8 A;  3BQK A;  2RA1 A;  2YIN A;  3AE2 A;  4HWI B;  4GIW A;  5LJM A;  5FXW A;  4X1K E;  4CXY A;  2XZE A;  1SA0 E;  4ILU A;  3CX6 B;  2LKH A;  4I55 E;  4A97 A;  4PJL A;  3UUM A;  5HXH A;  1XWM A;  3ZST A;  5C3J A;  2UXC T;  4QX7 B;  4ILA A;  3L3P A;  4QKN A;  1BR4 A;  4TV9 E;  2LSJ A;  4ZZC A;  1JNR A;  3ZN1 B;  3HA4 A;  5FXZ A;  4OK0 A;  3MA9 A;  4PK5 A;  2WZI A;  3ZKR A;  2FJD A;  4LF4 T;  2QA7 A;  1N32 T;  2W67 A;  5LXT E;  3S4U A;  4X20 E;  4KX6 A;  2LLY A;  4U3C A;  1X79 A;  3PDY A;  3AEA A;  4G2A A;  4CN1 A;  2DWG A;  4DV0 T;  5HEG A;  4GOU A;  1KK7 A;  2XM2 A;  4ZXL A;  4NPP A;  2WDR A;  4I43 B;  3FBL A;  2XJ7 A;  5JRC B;  3ZYK A;  4DV3 T;  5JDL A;  2XAH B;  4JI3 T;  1FEW A;  4X62 T;  5HXS A;  5JDM A;  2Q9Q D;  2XHE B;  4TNV A;  2XQ6 A;  4ILC A;  4IIJ E;  4JEH B;  5ABF A;  2V7M A;  4GKK T;  4HEA A;  3AA6 B;  2AE9 A;  1HX1 B;  4YHH T;  2XY8 B;  2BBJ A;  2ZLY A;  4KI0 F;  5FKY A;  1QSD A;  2CHO A;  1D1A A;  4B3R T;  3TLS A;  4YTN A;  1LRZ A;  3NBX X;  1UX4 A;  3KFW X;  1XDO A;  2L9Q A;  1FMW A;  4YXD A;  5CB4 E;  2EHO A;  2BKO A;  3LK2 B;  2KSR A;  5HWX A;  4IDZ A;  2W2U A;  4ZS2 A;  2BBH A;  2NOX A;  2LM2 A;  2LOP A;  4UVB B;  4B3T T;  3O1I A;  2CPT A;  3V5S A;  2E8I A;  2LE8 A;  4YSX A;  5AQH B;  3A5X A;  1XNQ T;  2MOZ A;  2LSK A;  5A1L A;  5LOV E;  1D1C A;  2DNX A;  4ZI3 C;  4QWN B;  3RIU C;  2FJA A;  4F6R C;  3AE6 A;  3AVS A;  2KIN B;  4MAL A;  2W66 A;  4DBR A;  2X68 A;  2V7K A;  1QLB A;  1W9R A;  1WR6 A;  2D0T A;  3DJB A;  3N2O A;  3TLT A;  4CI2 B;  2A72 A;  5CJ5 A;  3U3I A;  3RKG A;  4KP3 C;  2CA5 A;  4H9P C;  4B3S T;  4EOZ B;  4BA9 A;  2K9A A;  1MIW A;  3OPC A;  3FBZ A;  4DUY T;  5L3G B;  3SRZ A;  1OED E;  3KBT A;  2WMN A;  2WCA A;  4AKH A;  5JDN A;  4CXW A;  4EV6 A;  1MMA A;  1I94 T;  3ZMT B;  2QGS A;  5FXX A;  1HR0 T;  4IDN A;  1FJG T;  4H9O C;  2I6H A;  2A9U A;  3HKB E;  3H37 A;  4U31 A;  3BK9 A;  3MKD A;  2YKS A;  4YTP A;  2M6I A;  3GWH A;  3AXJ B;  5AQF B;  4JV5 T;  2C5I T;  2IC6 A;  1QUU A;  5JRC A;  4LF6 T;  4YJ2 E;  4H63 H;  3E22 E;  3P4Q A;  1MMD A;  4IDO A;  5LP6 E;  2NTY A;  4MBQ A;  3SWH A;  2PTF A;  2HN1 A;  4CI1 B;  3KBU A;  2IC9 A;  2UXX B;  2K3W A;  3LBX B;  2UUC T;  3PJA A;  2D2S A;  1M7K A;  4GKJ T;  4U74 A;  2XAG B;  4NXM T;  4EYU A;  1J1J A;  1UCU A;  1FMV A;  5HEO A;  2CXF A;  3ZN0 B;  2M6B A;  2NR4 A;  4DV6 T;  3EVY A;  1U4Q A;  4EYY R;  3UFG A;  5FXV A;  1HNZ T;  4NUV A;  5DJQ C;  3ETV A;  3C4W A;  2ODV A;  2VWA A;  1E7P A;  4LF5 T;  4IL9 A;  3HKC E;  3DP7 A;  3HI2 A;  5JR9 A;  1J5E T;  4TUY E;  2J1D G;  5AQM B;  1MMG A;  3IBP A;  5DQW A;  3BQI A;  1L0V A;  2H89 A;  3AE8 A;  3FXE B;  2VAS A;  5L3E B;  2YDR A;  2X51 A;  3AEG A;  2C5J A;  1N33 T;  2VKD A;  3E0Z A;  4JYA T;  5AQQ B;  3RLF F;  4UV9 B;  5ABE A;  3UT5 E;  4ERR A;  1WFD A;  3CQX C;  1S35 A;  4OX9 T;  3N9L A;  2XSB A;  2EHO D;  5J2T E;  3UU8 A;  2WSS V;  2YU2 A;  4DID B;  4Z8X A;  4G63 A;  2LOS A;  5FY1 A;  2V7J A;  5J0Z A;  5HXR A;  1GQE A;  3AAE B;  4FI5 A;  3I0Q A;  4DR7 T;  3JAF A;  3UTK A;  3LG7 A;  4CZZ B;  2WDQ A;  4IGU A;  3VHL A;  2KZ7 B;  2WU2 A;  3N9Q A;  4EXT A;  2CCQ A;  2XTL A;  4QH1 A;  4CN6 A;  2FUP A;  2CHN A;  1J5W A;  2XQ7 A;  4WBN E;  3M65 A;  4TN7 B;  3ONL C;  4CI3 B;  5LG3 A;  2NP9 A;  1CUN A;  2W63 A;  2KND A;  3PUW F;  1OED B;  5LGU B;  5HXE A;  1H7C A;  3P4S A;  4WBO A;  3I1A A;  3KVB A;  4KUM B;  5AQR B;  3NKZ A;  5FP3 A;  4F8H A;  4HFI A;  4WYV A;  2B76 A;  2E5L T;  1HS7 A;  2JMH A;  4U7I A;  1WCR A;  4H63 V;  5ABF B;  3AXJ A;  4KMC A;  5LGN B;  3K3Q C;  2CXD A;  2WQY A;  2XQY A;  4PJN A;  5LHI B;  4TWD A;  1YKH B;  4DBQ A;  4X64 T;  4ZS3 A;  3JC6 C;  4CQI A;  1LVK A;  1OED C;  4HKA A;  3KV5 A;  4L0R A;  3FXD B;  4DND A;  3HR0 A;  2FJB A;  3ABV A;  4HFB A;  4EZ4 A;  3LBX A;  5ADX L;  4COF A;  2QRX A;  4YSY A;  3VKH A;  3O1H A;  5DQV A;  4HWD A;  4PAG A;  4C91 A;  4DMW A;  2MTQ A;  3KVA A;  4EIW A;  3I0O A;  3UQ4 A;  4AQY T;  3VR8 A;  4JI8 T;  3AE7 A;  3P4R A;  4UR9 A;  2UUB T;  1D1B A;  2LSY A;  2LHR A;  2CLY B;  2YU1 A;  4UVA B;  4HE8 A;  4AQG A;  4U2Z A;  5FMN A;  3O4X E;  1I6Z A;  3UQ7 A;  1HFA A;  5L2L A;  3RYC E;  1N34 T;  3ZMV B;  3CX7 B;  2IW5 B;  2V6X A;  4DV4 T;  2CBJ A;  4OYJ A;  1BR1 A;  4X1I E;  4LFC T;  4Z91 A;  4MHC A;  3K3N A;  2BKP A;  1UGO A;  1IZN B;  4ZI3 D;  2CLY C;  1YW0 A;  4BJN A;  1ZKE A;  3FZL B;  2JQQ A;  2RP4 A;  4NUU A;  4EB6 E;  4K0U A;  5L4E A;  3PUQ A;  3EDU A;  3VU7 H;  2DHR A;  3D0T A;  2BZB A;  1IAP A;  3RYH E;  3TLV A;  2JIW A;  2C0S A;  4X1Y E;  2JQH A;  4EGW A;  1HF8 A;  4WNK A;  2UU9 T;  4ZOL E;  2IDO B;  4HGA A;  2R6G F;  4DR6 T;  4DR1 T;  2X0L B;  4IT4 A;  1XZY A;  3UUN A;  3RC3 A;  3ZCI A;  2V8S V;  2E9X D;  3MAC A;  5HEJ A;  5HEH A; 
#chains in the Genus database with same CATH homology
 4GKK T;  4NXM T;  1N36 T;  5LMN T;  5LMU T;  4YHH T;  4DV1 T;  1IBM T;  4DV6 T;  4B3S T;  4LF8 T;  1HNW T;  1HNZ T;  5IWA T;  4NXN T;  1HNX T;  2HHH T;  4DUZ T;  4DUY T;  4B3R T;  4LF5 T;  1IBL T;  1N34 T;  4JI4 T;  1XNR T;  1J5E T;  4DV4 T;  4JI0 T;  2E5L T;  4LFC T;  4LF9 T;  4DV2 T;  4K0K T;  4DV5 T;  2UXC T;  1I94 T;  3T1Y T;  4DR4 T;  4KHP T;  1HR0 T;  1IBK T;  1XMQ T;  1N33 T;  4B3T T;  2UXD T;  4DR5 T;  1FJG T;  4JYA T;  4JI2 T;  4X64 T;  1XNQ T;  4DR2 T;  4LFA T;  4OX9 T;  4LF4 T;  4DV7 T;  2VQF T;  1N32 T;  2UXB T;  4JV5 T;  4JI5 T;  5BR8 T;  4DR3 T;  4JI1 T;  4LFB T;  2ZM6 T;  4LF6 T;  4B3M T;  2UU9 T;  4JI7 T;  2VQE T;  4DR6 T;  2UUA T;  4DV0 T;  4DR7 T;  4DR1 T;  4LF7 T;  4YY3 T;  3T1H T;  2UUC T;  4DV3 T;  4AQY T;  4JI8 T;  1XMO T;  4JI3 T;  4X65 T;  4JI6 T;  4X62 T;  3OTO T;  2UUB T;  2F4V T;  4GKJ T;  4X66 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...