4LF7T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf7T00
4LF9T 4LF4T 4B3RT 4LF8T 4DR6T 4DV2T 2ZM6T 1XMOT 2UUAT 5IWAT 1IBKT 4DV6T 3OTOT 4JI4T 4LF6T 4LF5T 4KHPT 4LFBT 4JV5T 2UU9T 1FJGT 1N33T 4DV0T 4JYAT 4DR2T 4JI8T 1I94T 5LMNT 4JI2T 2UUBT 2UUCT 3T1YT 1XNQT 4GKKT 1HNZT 5LMUT 4NXNT 2VQFT 4LFAT 4K0KT 4YHHT 1HR0T 2UXCT 5BR8T 3T1HT 4X65T 4DV7T 4NXMT 4DV5T 4DUYT 4OX9T 4B3ST 4JI5T 4DR4T 4JI3T 1XNRT 4DUZT 4DR5T 4DV3T 1HNWT 4B3TT 2UXBT 2VQET 4DV1T 4AQYT 4JI6T 4DR7T 4DV4T 1J5ET 1HNXT 1N34T 1N32T 1N36T 4JI0T 4X64T 2UXDT 2E5LT 2HHHT 4B3MT 4JI7T 4X66T 4GKJT 4X62T 4DR1T 4DR3T 4LF7T 4LFCT 2F4VT 1XMQT 4YY3T 4JI1T 1IBLT 1IBMT
chains in the Genus database with same CATH superfamily
2YU1A 3VRBA 3H37A 4GK5E 5FL1A 2VKHA 3I0QA 2V6YA 3KV5A 3AEBA 5DJQC 5FL0A 1V9DA 3O4XE 4DBRA 2UU9T 4A56A 2XHEB 4NPPA 5HXSA 3LBXB 4GK0E 3T1YT 4C90A 4NXNT 2YINA 4P0AA 3Q5XA 3PUQA 1WR0A 3L3PA 2N9DA 4L9IA 3WAJA 2VWAA 2WP9A 4NXMT 4EIWA 2LHNA 4JI5T 3VKHA 3N2KE 5FYMA 3G06A 4K0UA 4YJ3E 5EK2A 5AQPB 3SS1A 2WCAA 3AECA 5JTGA 4HWCA 1N32T 1EZ3A 3KVBA 3C98B 4XBFB 5L3DB 4MALA 2EHOA 2PBIA 4X20E 4JI1T 2W66A 2KWIB 4ZI3D 2R6GF 2KNDA 4QH4A 3D0TA 4HFDA 4IREA 3AVRA 1IBKT 3P4WA 3CIRA 2VVNA 1MMDA 3AXJB 4UV9B 2HH7A 4KHPT 3PU3A 3HKDE 2OA5A 2JQHA 4HWDA 3SFEA 4WBOA 3PURA 3Q9DA 3JC6D 3NRYA 4DBQA 3QC9A 1BR1A 4EGWA 2XAGB 5BR8T 3NZPA 4IDOA 5AQNB 5JR9B 4B6XA 4CXXA 5LG4A 2XASB 2K9AA 2VASA 4L0RA 3X1DA 5ABFB 2CE7A 5FY7A 3FXDB 1G73A 3ONLC 4QXBB 3N2GE 1J5ET 2A72A 3QNUA 3HR0A 3CQCB 1IJ6A 2XQAA 3RRCA 5L3BB 2BS2A 3E22E 5AQLB 4HFBA 4PJJA 4HWIB 1YKHB 2NW7A 4DR3T 4FJOA 3ZC0A 4QXHB 3NKZA 2YU2A 5HEJA 2RA1A 2BG9E 4LF8T 4DR6T 2ODVA 2VL0A 5AQTB 2WDRA 5CB4E 3AEAA 3CMLA 3P4RA 2OV9A 3OTOT 3PV0F 2XM2A 4YSZA 3EI0A 3O1HA 1MIVA 4X1KE 3NZQA 4IDNA 5IYZE 5AQGB 4ZZCA 5HXEA 5CGMA 4AISA 5ETWA 1ZEEA 3NVOA 3AA6B 2NOXA 4H9PC 4O4IE 5JDGA 2H7OA 3Q2MA 5LG3A 1HF8A 1D1CA 2HN2A 4TUYE 3ANWA 1LKXA 2LOPA 4QWNB 5CFBA 2WDVA 2KINB 2WBLA 3CX8B 5HCJA 4B3TT 2V7KA 2FUPA 1YW0A 2WY2A 2V6XA 3TLUA 2WU2A 1R8IA 1BR2A 3UQ7A 2HN1A 2WM9A 4Q25A 3WAKA 3T8OA 3ZJ2A 4X66T 3MA9A 1MMNA 3H3MA 3C4XA 2LKHA 3S4UA 4H63H 4YJ2E 2MYSA 2WS3A 2ES0A 5GONE 3K3NA 4Z8XA 4B3RT 1WRDA 5JREA 1KFYA 2XAHB 4J2CA 2N2NA 4IDZA 3OVUA 3RH3A 2W63A 1UX5A 1XZYA 4TWDA 4A97A 3VR9A 5CJ5A 2C5IT 1ZP0A 2CXDA 4ASKA 4DMVA 2YDRA 5H6QB 1I94T 3LK3B 4IE6A 5LOVE 2BKPA 4WNKA 3A8YC 4WBNE 1XNQT 1HG2A 2JQ9A 4Z90A 1CHUA 4U2ZA 4K0KT 5J2UE 2B76A 4X1IE 2BKOA 4ZXLA 3PUYF 4DUYT 2CBIA 4ILAA 4HEAA 4TX5A 4F8HA 2WMNA 3RRWA 3VRAA 2VQET 4P1NA 1U5PA 1WFDA 5AQQB 5IHYA 2XQ8A 3AAEB 2LJLA 4PNIA 2E9XA 3F57A 4ILBA 2X9YA 3ETVA 3PUSA 4QXCB 3W15B 2YDSA 4KMCA 2WB5A 4QKNA 3AA7B 3C50A 4EAHA 1LVFA 1IJ5A 4YY3T 2MPKA 4WW0A 3R84B 3UQ4A 2BKNA 5AQJB 4ADZA 3ZCIA 1XMOT 3OPCA 2M6IA 2KT9A 5JR9C 1YQ4A 3ZMZB 4OYJA 3AEEA 3EAMA 3ZN1B 4ZEYA 1T98A 2YK0A 2L8KA 3O1IA 4I50E 5LGNB 2X0YA 1NENA 1IZNB 1M62A 4DV5T 1D1BA 3E0ZA 1ZOYA 2MBGA 2W67A 3RC3A 3V5UA 5HXHA 5HAXA 2VK9A 1VOMA 2WSSV 4IE5A 4ZS3A 4IE7A 3N9MA 4DV4T 1HNXT 2NR4A 2ZMAA 1BR0A 5EZYE 3KV6A 4IL4A 2H7VC 2NP9A 2X67A 4X5TA 1OEDB 3ZKRA 3HKEE 2H3RA 2JRKA 3JAFA 1W09A 4X1YE 3JC6C 1UGOA 4IGUA 3EABA 4DIDB 3CQXC 3AE3A 4DV2T 3ZT6A 5KX5E 3UUMA 2X68A 1KK7A 2LE8A 5J2TE 3SRZA 2JJ9A 5DABA 4LF5T 3KBTA 4GYSA 3CQGB 3P50A 3LDQB 3FZMB 4H63V 2LM9A 1FIOA 1XDPA 2G0UA 2J47A 5AQVB 3IA3A 3AB3B 5L47A 3RGLA 4EYUA 2CA5A 3HA4A 1HNZT 3LK2B 1HR0T 5CA0E 3C64A 5LGUB 1ZV4X 3F2EA 4BAYB 2CCQA 2MTQA 4I43B 3UU8A 3FZFB 4EYYR 1YD8G 4UF0B 2BG9A 2KLQA 5FXXA 4QHOA 1XNRT 3ZCJA 3Q5EA 4NUUA 2EHOD 4TV9E 3LFMA 4KBMB 2W0GA 2ZM0A 2KSRA 5AFUL 5HCMA 3PUXF 3DP7A 4C91A 4JEUB 5LHIB 4E7SA 4MFRA 1OXZA 4KI0F 1QSDA 3R6NA 4HWHA 1G8XA 2KMFA 2XJ7A 2IW5B 3N9QA 4ILUA 3U3IA 2LSIA 4CI1B 2V6YB 4N78D 3OYZA 3HKCE 4UVCB 4LF7T 3GMIA 3K8PC 2DNXA 2BVLA 5LP6E 2I59A 2LHRA 1HS7A 1WLXA 4O2BE 2XAFB 1VCTA 1LRZA 4ZOLE 4JEHB 2CBJA 3I1AA 2LOSA 2XQYA 2XQ6A 5JDLA 1WR6A 2GK9A 4QX8B 5AQKB 1FJGT 4ERRA 3MJXA 4EEBA 2Z6EA 2ACXA 2WDQA 2DWKA 3CPZA 4BA9A 3N9NA 3RKGA 4UXNB 1GQEA 4ISSA 3RLFF 4EB6E 1E1HB 3ZPOA 1S35A 1SA0E 2YKSA 3ZSTA 5LYJE 4IIJE 4ZZBA 3KVAA 3TLTA 1T72A 2DWGA 3UFGA 5ABEA 2EHOB 4AQFC 4KP3C 5LXTE 5BMVE 5JDMA 3UT5E 3VR8A 4DR7T 3LJCA 2J62A 2Q9QA 3SOLA 4PJNA 5F8PA 5AQHB 4A5XA 2XTLA 4IT4A 4GYRA 1D0XA 1YQ3A 4TWHA 3AAAB 4X62T 3LSVA 4XZCA 4M1PA 2DHRA 3P4PA 5HEOA 3LK42 4YSYA 4GOUA 2D5UA 3KV9A 2D9DA 2BS3A 4AKLA 2IIUA 3BQKA 5FXWA 5DQWA 2X0LB 4EEDA 2JQQA 2CWOA 2HPJA 4PAGA 4CN1A 4YHJA 2V7IA 4OFZA 3KFWX 2HPLA 2E5VA 1OEDC 3IEEA 5LNKA 5M4YA 2CMRA 5JDNA 3CX6B 2DCFA 5L4HA 4HWFA 1NWMX 2QGSA 2X9WA 2IMLA 2UXBT 2L9QA 4I55E 3GN5A 3MACA 4QH5A 2VKDA 2M67A 3EDUA 4CI2B 1N36T 4JI0T 3ZN0B 5AQFB 3L8RA 4ILCA 4NIQA 4B3MT 3B13A 2ZM8A 4ZI7E 5ABHA 2KXPB 4QX7B 1J1JA 2PG8A 3A7MA 2X9HA 3DJBA 5FY1A 3O1JA 3AE8A 3RIUC 3CX7B 4OHFA 2UUAT 2X51A 3K3OA 4IE4A 1YXRA 2XPKA 3RIAA 2CHNA 4IDQA 4YT0A 4LFBT 2BVMA 1L0VA 1N33T 4ZHQE 5HXRA 3PJAA 5CA1E 4JLEA 1MMAA 4PW8A 3L39A 3ZLIA 5JH7E 4LMLA 4HFVA 2FJBA 2UUCT 3AE4A 2W62A 5LMUT 3AAIA 4H9QC 3AE9A 4KUMB 1IAPA 3V5SA 2E9XD 2BBJA 1Y64B 4CN6A 1HX1B 4GIWA 3Q5DA 1VRBA 4JI3T 2XQ7A 1MNDA 5C3JA 5LJNA 4UIGA 3QOFA 1NEKA 1MIYA 4PK5A 4OYKA 3UU5A 4AQYT 4A98A 2IC6A 2A9UA 1T8BA 2VB6A 3N2OA 3GA8A 2UXDT 2LSGA 2J1DG 1X79A 2K3WA 3RX6A 4YTMA 4O8SA 3OBVE 2P9BA 1H7CA 2W2UA 4AKRB 2X66A 5HXCA 5L4EA 4P0BA 1IBMT 2V26A 4YSXA 5LA6E 4TV8E 4EXTA 2JQKA 4H9OC 5FXZA 4QH1A 2YDQA 2JPFA 2PJQA 5EK4A 4CN4A 5J0ZA 3PUZF 4TWFA 5L3FB 4AKHA 3U78A 2K48A 2EHOC 3JAEA 4LF6T 2V5CA 2XSBA 4JV5T 4U3CA 4AKIA 4YXDA 2LLYA 2FJDA 1HG5A 1O3XA 2XY8B 2M6BA 2FJEA 4L5GA 4ISTA 2W00A 4CXYA 3FB2A 4XAXB 4V1Av 4ZI2D 5HWYA 4YHHT 2Y48B 2VKJA 1UCUA 1UUSA 3FBZA 4CQIA 3RQWA 1Z0PA 3ZYKA 3RI5A 4MLKA 3MK7C 4IL9A 3K1SA 3A5XA 2SPCA 4YTNA 3UUBA 4EZHA 1HFAA 2XAQB 2PTFA 3SFDA 4U74A 3AEDA 2KZ7B 3BQLA 4MHCA 2K5BB 2XM1A 4NUVA 3RIFA 4H9RC 4JBWF 3ETUA 3RF1A 3ONXA 4ZI3C 2LKGA 2C0SA 2JMHA 4LFCT 3CWZB 5JQGE 3B5MA 4IHJE 4UEMA 2WWUA 4AI6A 2BS4A 3IF8B 1IBLT 2LRKA 2XZEA 2DLRA 1FMVA 3O9XA 3PJAJ 4WZXA 2OLTA 3GWHA 4JI4T 1UX4A 3RQUA 4DV0T 4JYAT 4DR2T 4UELA 2E2AA 3ZC1A 3LG7A 2ZLYA 5DQVA 1XDOA 4E7ZA 1X9BA 3L09A 2XQ3A 2X9XA 5HWXA 5LBMA 3EDVA 2XSAA 3KDSE 2W4XA 2BBHA 5JRCB 3FZKB 3T1HT 2CPTA 4KX6A 4PJMA 2H89A 3TLSA 3LBXA 4DUZT 3IBPA 3MKDA 2YEVC 4DV3T 3UU4A 3FXEB 2V8SV 1E2AA 2WU5A 2CHOA 2NWBA 3N9PA 2BZBA 3EUHA 3N9OA 3AA1B 1US7B 2D0UA 3C51A 4CI3B 2LSKA 4I0UA 3ZMSB 3RYCE 2CLYB 5LB7B 3QUJA 2AXDS 3ABVA 4U31A 3PTRB 4IE0A 4AXPA 1UURA 3I0OA 4LMKA 1BR4A 3M65A 3ZMTB 2C5JA 1FMWA 5LHHB 4PFPA 1D0ZA 2VVSA 3RPUA 3E08A 2D2SA 4CZZB 4MBQA 4COFA 1KEYA 3P4QA 3J9X1 1XWMA 3FBLA 1SE7A 2BG9B 5EK3A 1NAFA 2W61A 5KMGP 5TAOA 3PUGA 4DVDA 4H9SE 3I9YA 4JI2T 4P09A 3ONJA 2VURA 4U72A 2K24A 1B7TA 3AXJA 2V7LA 2Q9QD 2XQ9A 2CXFA 2NW8A 4OX9T 2D0TA 2FJAA 4DR4T 3RKOA 3KBUA 2ACZA 5KDMC 3AE7A 4HFHA 3P7IA 3SWHA 1OWAA 4I4TE 2QYWA 3H3AA 4AQGA 1W0BA 1OEDE 2LT3A 4TN7B 4DV1T 3DTOA 1J5WA 3MXZA 4UV8B 3K3QC 2WWVA 2NTYA 4U7YA 4WYVA 3RHWA 1T7SA 5JR9A 2PFVA 5LGTB 3JADA 4G2AA 3PE0A 2FBWA 3AE5A 4GKJT 1QUUA 3ZMUB 5ABFA 3F31A 4O4JE 1HX8A 2DL1A 4DNDA 4OK0A 1HCIA 5L3EB 2ZM2A 2E9XC 2LM2A 2NTXA 3RC8A 3FHNA 3PDYA 5FVLA 4DV6T 2V5DA 4O4HE 1UK5A 4UVAB 1CUNA 5AQMB 1KF6A 5JDFA 2A2FX 3NBXX 3CKDA 1M7KA 4GKKT 1ZHCA 2VQFT 3UU6A 2WAUA 3RYIE 4YLHA 2NW9A 2CM0A 1ZKEA 1SUMB 5C2TA 5HYAA 3TLVA 2Q9QB 4YFSA 4B3ST 4ZS2A 5FMNA 4DR5T 3AE2A 1I6ZA 1AJ3A 4TZ4C 3M3ZB 5ABGA 4U33A 3OKQA 5AQSB 3AEGA 2LEHA 2UXXB 4JI6T 4O4LE 2VL8A 3KINB 2HHHT 2JIWA 4DR1T 2JMKA 1Z8UA 3TKLB 4ZI2C 4FI5A 1FEWA 1U4QA 2WQYA 1WCRA 2I6HA 4G63A 2IUBA 1VCSA 1KNPA 2WZIA 4U2YA 5E0OA 3FZLB 5F3JA 2Y8DA 5FP3A 2CXLA 5IUXA 2IHR1 2UXNB 2E8IA 3J7Yq 4EZ4A 3VU7H 4AIUA 3VHLA 2CLYC 3PUAA 2V7JA 3EHZA 3EVYA 4DO0A 1E7PA 1D1AA 5FXVA 2J4GA 4EOZB 3VKGA 3GN5B 3ANWB 4DV7T 4DMWA 2WZHA 4F6RC 4PJLA 1JNRA 3UULA 2IC9A 5FY0A 1Y01A 5JVDE 3AVSA 3UU3A 4LMJA 2QA7A 3N5LA 3QB5A 5HEHA 2H88A 2QRXA 3UUNA 1N34T 2LSYA 4YTPA 2BG9C 5KXJA 3P8CD 1DU2A 4JI7T 1D0YA 5L2LA 3ZJ1A 2QVAA 1W9RA 4PK4A 5JDHA 1LVKA 4Z91A 2ZM6T 5IWAT 4HGAA 2N1GA 5A1LA 4HN9A 3MZKB 3Q5WA 5H6RB 3HKBE 4TNVA 2UUBT 2LRLA 5AQUB 4AQFA 2YN6A 3ZT7A 1SHZC 2KWHA 3B57A 5JDQA 2CRBA 4X65T 2XAJB 4UVBB 3HI2A 5FVKA 1KNRA 1S94A 5C8YE 2ODUA 3AE6A 3C4WA 5LCYA 4HFIA 2IAKA 2WMOA 3CK6A 3RYFE 3PU8A 2AE9A 2L3LA 2XUEA 3ZMVB 3PUWF 2E9XB 3NWIA 2V7MA 2I0MA 2DI4A 4IDPA 1WYBA 3WI3A 3UTKA 4H9NC 3ESLA 2BDEA 2F4VT 5J1GA 3IHRA 1XMQT 2B1EA 2XQ4A 3UFEA 3QB5K 2MAWA 3I9WA 3BQIA 2CWYA 4HFEA 3ZSSA 4AKGA 3ZEFB 4LF9T 4LF4T 2YOEA 4PFOA 2Q9QC 4BJMA 1YKEB 3ZYMA 4PK6A 5AQIB 3BK9A 3P4SA 5FNVE 1OEDA 3FZHB 3NRXA 4KHZF 3JCFA 1MIWA 5AQOB 3AA0B 4HE8A 1MNEA 3QK6A 5HEUA 4JI8T 5L3CB 5LMNT 4HTEA 5LJMA 2LSJA 5L3GB 3HL6A 1QLBA 2RPAA 5F5WA 4LFAT 3AEFA 4TNWA 3TLWA 2VKOA 2UXCT 5JRCA 2MOZA 3UUXB 4BJNA 3RYHE 1HTJF 1MMGA 4CXWA 3AE1A 1W0AA 3N9LA 2A3DA 4JUYA 3KV4A 5ADXL 1KNZA 2XQ5A 1HNWT 3ZT5A 3OJAA 5FKYA 3CVRA 4HFCA 2IDOB 3RIUA 1JNZA 3ZYLA 5LBQB 4UF0A 4ANJA 4X64T 3C4ZA 2CEAA 5AQRB 2E5LT 4UR9A 4HKAA 2RP4A 5LHGB 1WYCA 2X0HA 4U7IA 2Y6XA 2C5KT 4EV6A 3PUVF 2V1DB 3OYXA 4O2AE 5HEGA
chains in the Genus database with same CATH topology
4LF9T 4LF4T 4B3RT 4LF8T 4DR6T 4DV2T 2ZM6T 1XMOT 2UUAT 5IWAT 1IBKT 4DV6T 3OTOT 4JI4T 4LF6T 4LF5T 4KHPT 4LFBT 4JV5T 2UU9T 1FJGT 1N33T 4DV0T 4JYAT 4DR2T 4JI8T 1I94T 5LMNT 4JI2T 2UUBT 2UUCT 3T1YT 1XNQT 4GKKT 1HNZT 5LMUT 4NXNT 2VQFT 4LFAT 4K0KT 4YHHT 1HR0T 2UXCT 5BR8T 3T1HT 4X65T 4DV7T 4NXMT 4DV5T 4DUYT 4OX9T 4B3ST 4JI5T 4DR4T 4JI3T 1XNRT 4DUZT 4DR5T 4DV3T 1HNWT 4B3TT 2UXBT 2VQET 4DV1T 4AQYT 4JI6T 4DR7T 4DV4T 1J5ET 1HNXT 1N34T 1N32T 1N36T 4JI0T 4X64T 2UXDT 2E5LT 2HHHT 4B3MT 4JI7T 4X66T 4GKJT 4X62T 4DR1T 4DR3T 4LF7T 4LFCT 2F4VT 1XMQT 4YY3T 4JI1T 1IBLT 1IBMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 T;  4LF4 T;  4B3R T;  4LF8 T;  4DR6 T;  4DV2 T;  2ZM6 T;  1XMO T;  2UUA T;  5IWA T;  1IBK T;  4DV6 T;  3OTO T;  4JI4 T;  4LF6 T;  4LF5 T;  4KHP T;  4LFB T;  4JV5 T;  2UU9 T;  1FJG T;  1N33 T;  4DV0 T;  4JYA T;  4DR2 T;  4JI8 T;  1I94 T;  5LMN T;  4JI2 T;  2UUB T;  2UUC T;  3T1Y T;  1XNQ T;  4GKK T;  1HNZ T;  5LMU T;  4NXN T;  2VQF T;  4LFA T;  4K0K T;  4YHH T;  1HR0 T;  2UXC T;  5BR8 T;  3T1H T;  4X65 T;  4DV7 T;  4NXM T;  4DV5 T;  4DUY T;  4OX9 T;  4B3S T;  4JI5 T;  4DR4 T;  4JI3 T;  1XNR T;  4DUZ T;  4DR5 T;  4DV3 T;  1HNW T;  4B3T T;  2UXB T;  2VQE T;  4DV1 T;  4AQY T;  4JI6 T;  4DR7 T;  4DV4 T;  1J5E T;  1HNX T;  1N34 T;  1N32 T;  1N36 T;  4JI0 T;  4X64 T;  2UXD T;  2E5L T;  2HHH T;  4B3M T;  4JI7 T;  4X66 T;  4GKJ T;  4X62 T;  4DR1 T;  4DR3 T;  4LF7 T;  4LFC T;  2F4V T;  1XMQ T;  4YY3 T;  4JI1 T;  1IBL T;  1IBM T; 
#chains in the Genus database with same CATH topology
 2YU1 A;  3VRB A;  3H37 A;  4GK5 E;  5FL1 A;  2VKH A;  3I0Q A;  2V6Y A;  3KV5 A;  3AEB A;  5DJQ C;  5FL0 A;  1V9D A;  3O4X E;  4DBR A;  2UU9 T;  4A56 A;  2XHE B;  4NPP A;  5HXS A;  3LBX B;  4GK0 E;  3T1Y T;  4C90 A;  4NXN T;  2YIN A;  4P0A A;  3Q5X A;  3PUQ A;  1WR0 A;  3L3P A;  2N9D A;  4L9I A;  3WAJ A;  2VWA A;  2WP9 A;  4NXM T;  4EIW A;  2LHN A;  4JI5 T;  3VKH A;  3N2K E;  5FYM A;  3G06 A;  4K0U A;  4YJ3 E;  5EK2 A;  5AQP B;  3SS1 A;  2WCA A;  3AEC A;  5JTG A;  4HWC A;  1N32 T;  1EZ3 A;  3KVB A;  3C98 B;  4XBF B;  5L3D B;  4MAL A;  2EHO A;  2PBI A;  4X20 E;  4JI1 T;  2W66 A;  2KWI B;  4ZI3 D;  2R6G F;  2KND A;  4QH4 A;  3D0T A;  4HFD A;  4IRE A;  3AVR A;  1IBK T;  3P4W A;  3CIR A;  2VVN A;  1MMD A;  3AXJ B;  4UV9 B;  2HH7 A;  4KHP T;  3PU3 A;  3HKD E;  2OA5 A;  2JQH A;  4HWD A;  3SFE A;  4WBO A;  3PUR A;  3Q9D A;  3JC6 D;  3NRY A;  4DBQ A;  3QC9 A;  1BR1 A;  4EGW A;  2XAG B;  5BR8 T;  3NZP A;  4IDO A;  5AQN B;  5JR9 B;  4B6X A;  4CXX A;  5LG4 A;  2XAS B;  2K9A A;  2VAS A;  4L0R A;  3X1D A;  5ABF B;  2CE7 A;  5FY7 A;  3FXD B;  1G73 A;  3ONL C;  4QXB B;  3N2G E;  1J5E T;  2A72 A;  3QNU A;  3HR0 A;  3CQC B;  1IJ6 A;  2XQA A;  3RRC A;  5L3B B;  2BS2 A;  3E22 E;  5AQL B;  4HFB A;  4PJJ A;  4HWI B;  1YKH B;  2NW7 A;  4DR3 T;  4FJO A;  3ZC0 A;  4QXH B;  3NKZ A;  2YU2 A;  5HEJ A;  2RA1 A;  2BG9 E;  4LF8 T;  4DR6 T;  2ODV A;  2VL0 A;  5AQT B;  2WDR A;  5CB4 E;  3AEA A;  3CML A;  3P4R A;  2OV9 A;  3OTO T;  3PV0 F;  2XM2 A;  4YSZ A;  3EI0 A;  3O1H A;  1MIV A;  4X1K E;  3NZQ A;  4IDN A;  5IYZ E;  5AQG B;  4ZZC A;  5HXE A;  5CGM A;  4AIS A;  5ETW A;  1ZEE A;  3NVO A;  3AA6 B;  2NOX A;  4H9P C;  4O4I E;  5JDG A;  2H7O A;  3Q2M A;  5LG3 A;  1HF8 A;  1D1C A;  2HN2 A;  4TUY E;  3ANW A;  1LKX A;  2LOP A;  4QWN B;  5CFB A;  2WDV A;  2KIN B;  2WBL A;  3CX8 B;  5HCJ A;  4B3T T;  2V7K A;  2FUP A;  1YW0 A;  2WY2 A;  2V6X A;  3TLU A;  2WU2 A;  1R8I A;  1BR2 A;  3UQ7 A;  2HN1 A;  2WM9 A;  4Q25 A;  3WAK A;  3T8O A;  3ZJ2 A;  4X66 T;  3MA9 A;  1MMN A;  3H3M A;  3C4X A;  2LKH A;  3S4U A;  4H63 H;  4YJ2 E;  2MYS A;  2WS3 A;  2ES0 A;  5GON E;  3K3N A;  4Z8X A;  4B3R T;  1WRD A;  5JRE A;  1KFY A;  2XAH B;  4J2C A;  2N2N A;  4IDZ A;  3OVU A;  3RH3 A;  2W63 A;  1UX5 A;  1XZY A;  4TWD A;  4A97 A;  3VR9 A;  5CJ5 A;  2C5I T;  1ZP0 A;  2CXD A;  4ASK A;  4DMV A;  2YDR A;  5H6Q B;  1I94 T;  3LK3 B;  4IE6 A;  5LOV E;  2BKP A;  4WNK A;  3A8Y C;  4WBN E;  1XNQ T;  1HG2 A;  2JQ9 A;  4Z90 A;  1CHU A;  4U2Z A;  4K0K T;  5J2U E;  2B76 A;  4X1I E;  2BKO A;  4ZXL A;  3PUY F;  4DUY T;  2CBI A;  4ILA A;  4HEA A;  4TX5 A;  4F8H A;  2WMN A;  3RRW A;  3VRA A;  2VQE T;  4P1N A;  1U5P A;  1WFD A;  5AQQ B;  5IHY A;  2XQ8 A;  3AAE B;  2LJL A;  4PNI A;  2E9X A;  3F57 A;  4ILB A;  2X9Y A;  3ETV A;  3PUS A;  4QXC B;  3W15 B;  2YDS A;  4KMC A;  2WB5 A;  4QKN A;  3AA7 B;  3C50 A;  4EAH A;  1LVF A;  1IJ5 A;  4YY3 T;  2MPK A;  4WW0 A;  3R84 B;  3UQ4 A;  2BKN A;  5AQJ B;  4ADZ A;  3ZCI A;  1XMO T;  3OPC A;  2M6I A;  2KT9 A;  5JR9 C;  1YQ4 A;  3ZMZ B;  4OYJ A;  3AEE A;  3EAM A;  3ZN1 B;  4ZEY A;  1T98 A;  2YK0 A;  2L8K A;  3O1I A;  4I50 E;  5LGN B;  2X0Y A;  1NEN A;  1IZN B;  1M62 A;  4DV5 T;  1D1B A;  3E0Z A;  1ZOY A;  2MBG A;  2W67 A;  3RC3 A;  3V5U A;  5HXH A;  5HAX A;  2VK9 A;  1VOM A;  2WSS V;  4IE5 A;  4ZS3 A;  4IE7 A;  3N9M A;  4DV4 T;  1HNX T;  2NR4 A;  2ZMA A;  1BR0 A;  5EZY E;  3KV6 A;  4IL4 A;  2H7V C;  2NP9 A;  2X67 A;  4X5T A;  1OED B;  3ZKR A;  3HKE E;  2H3R A;  2JRK A;  3JAF A;  1W09 A;  4X1Y E;  3JC6 C;  1UGO A;  4IGU A;  3EAB A;  4DID B;  3CQX C;  3AE3 A;  4DV2 T;  3ZT6 A;  5KX5 E;  3UUM A;  2X68 A;  1KK7 A;  2LE8 A;  5J2T E;  3SRZ A;  2JJ9 A;  5DAB A;  4LF5 T;  3KBT A;  4GYS A;  3CQG B;  3P50 A;  3LDQ B;  3FZM B;  4H63 V;  2LM9 A;  1FIO A;  1XDP A;  2G0U A;  2J47 A;  5AQV B;  3IA3 A;  3AB3 B;  5L47 A;  3RGL A;  4EYU A;  2CA5 A;  3HA4 A;  1HNZ T;  3LK2 B;  1HR0 T;  5CA0 E;  3C64 A;  5LGU B;  1ZV4 X;  3F2E A;  4BAY B;  2CCQ A;  2MTQ A;  4I43 B;  3UU8 A;  3FZF B;  4EYY R;  1YD8 G;  4UF0 B;  2BG9 A;  2KLQ A;  5FXX A;  4QHO A;  1XNR T;  3ZCJ A;  3Q5E A;  4NUU A;  2EHO D;  4TV9 E;  3LFM A;  4KBM B;  2W0G A;  2ZM0 A;  2KSR A;  5AFU L;  5HCM A;  3PUX F;  3DP7 A;  4C91 A;  4JEU B;  5LHI B;  4E7S A;  4MFR A;  1OXZ A;  4KI0 F;  1QSD A;  3R6N A;  4HWH A;  1G8X A;  2KMF A;  2XJ7 A;  2IW5 B;  3N9Q A;  4ILU A;  3U3I A;  2LSI A;  4CI1 B;  2V6Y B;  4N78 D;  3OYZ A;  3HKC E;  4UVC B;  4LF7 T;  3GMI A;  3K8P C;  2DNX A;  2BVL A;  5LP6 E;  2I59 A;  2LHR A;  1HS7 A;  1WLX A;  4O2B E;  2XAF B;  1VCT A;  1LRZ A;  4ZOL E;  4JEH B;  2CBJ A;  3I1A A;  2LOS A;  2XQY A;  2XQ6 A;  5JDL A;  1WR6 A;  2GK9 A;  4QX8 B;  5AQK B;  1FJG T;  4ERR A;  3MJX A;  4EEB A;  2Z6E A;  2ACX A;  2WDQ A;  2DWK A;  3CPZ A;  4BA9 A;  3N9N A;  3RKG A;  4UXN B;  1GQE A;  4ISS A;  3RLF F;  4EB6 E;  1E1H B;  3ZPO A;  1S35 A;  1SA0 E;  2YKS A;  3ZST A;  5LYJ E;  4IIJ E;  4ZZB A;  3KVA A;  3TLT A;  1T72 A;  2DWG A;  3UFG A;  5ABE A;  2EHO B;  4AQF C;  4KP3 C;  5LXT E;  5BMV E;  5JDM A;  3UT5 E;  3VR8 A;  4DR7 T;  3LJC A;  2J62 A;  2Q9Q A;  3SOL A;  4PJN A;  5F8P A;  5AQH B;  4A5X A;  2XTL A;  4IT4 A;  4GYR A;  1D0X A;  1YQ3 A;  4TWH A;  3AAA B;  4X62 T;  3LSV A;  4XZC A;  4M1P A;  2DHR A;  3P4P A;  5HEO A;  3LK4 2;  4YSY A;  4GOU A;  2D5U A;  3KV9 A;  2D9D A;  2BS3 A;  4AKL A;  2IIU A;  3BQK A;  5FXW A;  5DQW A;  2X0L B;  4EED A;  2JQQ A;  2CWO A;  2HPJ A;  4PAG A;  4CN1 A;  4YHJ A;  2V7I A;  4OFZ A;  3KFW X;  2HPL A;  2E5V A;  1OED C;  3IEE A;  5LNK A;  5M4Y A;  2CMR A;  5JDN A;  3CX6 B;  2DCF A;  5L4H A;  4HWF A;  1NWM X;  2QGS A;  2X9W A;  2IML A;  2UXB T;  2L9Q A;  4I55 E;  3GN5 A;  3MAC A;  4QH5 A;  2VKD A;  2M67 A;  3EDU A;  4CI2 B;  1N36 T;  4JI0 T;  3ZN0 B;  5AQF B;  3L8R A;  4ILC A;  4NIQ A;  4B3M T;  3B13 A;  2ZM8 A;  4ZI7 E;  5ABH A;  2KXP B;  4QX7 B;  1J1J A;  2PG8 A;  3A7M A;  2X9H A;  3DJB A;  5FY1 A;  3O1J A;  3AE8 A;  3RIU C;  3CX7 B;  4OHF A;  2UUA T;  2X51 A;  3K3O A;  4IE4 A;  1YXR A;  2XPK A;  3RIA A;  2CHN A;  4IDQ A;  4YT0 A;  4LFB T;  2BVM A;  1L0V A;  1N33 T;  4ZHQ E;  5HXR A;  3PJA A;  5CA1 E;  4JLE A;  1MMA A;  4PW8 A;  3L39 A;  3ZLI A;  5JH7 E;  4LML A;  4HFV A;  2FJB A;  2UUC T;  3AE4 A;  2W62 A;  5LMU T;  3AAI A;  4H9Q C;  3AE9 A;  4KUM B;  1IAP A;  3V5S A;  2E9X D;  2BBJ A;  1Y64 B;  4CN6 A;  1HX1 B;  4GIW A;  3Q5D A;  1VRB A;  4JI3 T;  2XQ7 A;  1MND A;  5C3J A;  5LJN A;  4UIG A;  3QOF A;  1NEK A;  1MIY A;  4PK5 A;  4OYK A;  3UU5 A;  4AQY T;  4A98 A;  2IC6 A;  2A9U A;  1T8B A;  2VB6 A;  3N2O A;  3GA8 A;  2UXD T;  2LSG A;  2J1D G;  1X79 A;  2K3W A;  3RX6 A;  4YTM A;  4O8S A;  3OBV E;  2P9B A;  1H7C A;  2W2U A;  4AKR B;  2X66 A;  5HXC A;  5L4E A;  4P0B A;  1IBM T;  2V26 A;  4YSX A;  5LA6 E;  4TV8 E;  4EXT A;  2JQK A;  4H9O C;  5FXZ A;  4QH1 A;  2YDQ A;  2JPF A;  2PJQ A;  5EK4 A;  4CN4 A;  5J0Z A;  3PUZ F;  4TWF A;  5L3F B;  4AKH A;  3U78 A;  2K48 A;  2EHO C;  3JAE A;  4LF6 T;  2V5C A;  2XSB A;  4JV5 T;  4U3C A;  4AKI A;  4YXD A;  2LLY A;  2FJD A;  1HG5 A;  1O3X A;  2XY8 B;  2M6B A;  2FJE A;  4L5G A;  4IST A;  2W00 A;  4CXY A;  3FB2 A;  4XAX B;  4V1A v;  4ZI2 D;  5HWY A;  4YHH T;  2Y48 B;  2VKJ A;  1UCU A;  1UUS A;  3FBZ A;  4CQI A;  3RQW A;  1Z0P A;  3ZYK A;  3RI5 A;  4MLK A;  3MK7 C;  4IL9 A;  3K1S A;  3A5X A;  2SPC A;  4YTN A;  3UUB A;  4EZH A;  1HFA A;  2XAQ B;  2PTF A;  3SFD A;  4U74 A;  3AED A;  2KZ7 B;  3BQL A;  4MHC A;  2K5B B;  2XM1 A;  4NUV A;  3RIF A;  4H9R C;  4JBW F;  3ETU A;  3RF1 A;  3ONX A;  4ZI3 C;  2LKG A;  2C0S A;  2JMH A;  4LFC T;  3CWZ B;  5JQG E;  3B5M A;  4IHJ E;  4UEM A;  2WWU A;  4AI6 A;  2BS4 A;  3IF8 B;  1IBL T;  2LRK A;  2XZE A;  2DLR A;  1FMV A;  3O9X A;  3PJA J;  4WZX A;  2OLT A;  3GWH A;  4JI4 T;  1UX4 A;  3RQU A;  4DV0 T;  4JYA T;  4DR2 T;  4UEL A;  2E2A A;  3ZC1 A;  3LG7 A;  2ZLY A;  5DQV A;  1XDO A;  4E7Z A;  1X9B A;  3L09 A;  2XQ3 A;  2X9X A;  5HWX A;  5LBM A;  3EDV A;  2XSA A;  3KDS E;  2W4X A;  2BBH A;  5JRC B;  3FZK B;  3T1H T;  2CPT A;  4KX6 A;  4PJM A;  2H89 A;  3TLS A;  3LBX A;  4DUZ T;  3IBP A;  3MKD A;  2YEV C;  4DV3 T;  3UU4 A;  3FXE B;  2V8S V;  1E2A A;  2WU5 A;  2CHO A;  2NWB A;  3N9P A;  2BZB A;  3EUH A;  3N9O A;  3AA1 B;  1US7 B;  2D0U A;  3C51 A;  4CI3 B;  2LSK A;  4I0U A;  3ZMS B;  3RYC E;  2CLY B;  5LB7 B;  3QUJ A;  2AXD S;  3ABV A;  4U31 A;  3PTR B;  4IE0 A;  4AXP A;  1UUR A;  3I0O A;  4LMK A;  1BR4 A;  3M65 A;  3ZMT B;  2C5J A;  1FMW A;  5LHH B;  4PFP A;  1D0Z A;  2VVS A;  3RPU A;  3E08 A;  2D2S A;  4CZZ B;  4MBQ A;  4COF A;  1KEY A;  3P4Q A;  3J9X 1;  1XWM A;  3FBL A;  1SE7 A;  2BG9 B;  5EK3 A;  1NAF A;  2W61 A;  5KMG P;  5TAO A;  3PUG A;  4DVD A;  4H9S E;  3I9Y A;  4JI2 T;  4P09 A;  3ONJ A;  2VUR A;  4U72 A;  2K24 A;  1B7T A;  3AXJ A;  2V7L A;  2Q9Q D;  2XQ9 A;  2CXF A;  2NW8 A;  4OX9 T;  2D0T A;  2FJA A;  4DR4 T;  3RKO A;  3KBU A;  2ACZ A;  5KDM C;  3AE7 A;  4HFH A;  3P7I A;  3SWH A;  1OWA A;  4I4T E;  2QYW A;  3H3A A;  4AQG A;  1W0B A;  1OED E;  2LT3 A;  4TN7 B;  4DV1 T;  3DTO A;  1J5W A;  3MXZ A;  4UV8 B;  3K3Q C;  2WWV A;  2NTY A;  4U7Y A;  4WYV A;  3RHW A;  1T7S A;  5JR9 A;  2PFV A;  5LGT B;  3JAD A;  4G2A A;  3PE0 A;  2FBW A;  3AE5 A;  4GKJ T;  1QUU A;  3ZMU B;  5ABF A;  3F31 A;  4O4J E;  1HX8 A;  2DL1 A;  4DND A;  4OK0 A;  1HCI A;  5L3E B;  2ZM2 A;  2E9X C;  2LM2 A;  2NTX A;  3RC8 A;  3FHN A;  3PDY A;  5FVL A;  4DV6 T;  2V5D A;  4O4H E;  1UK5 A;  4UVA B;  1CUN A;  5AQM B;  1KF6 A;  5JDF A;  2A2F X;  3NBX X;  3CKD A;  1M7K A;  4GKK T;  1ZHC A;  2VQF T;  3UU6 A;  2WAU A;  3RYI E;  4YLH A;  2NW9 A;  2CM0 A;  1ZKE A;  1SUM B;  5C2T A;  5HYA A;  3TLV A;  2Q9Q B;  4YFS A;  4B3S T;  4ZS2 A;  5FMN A;  4DR5 T;  3AE2 A;  1I6Z A;  1AJ3 A;  4TZ4 C;  3M3Z B;  5ABG A;  4U33 A;  3OKQ A;  5AQS B;  3AEG A;  2LEH A;  2UXX B;  4JI6 T;  4O4L E;  2VL8 A;  3KIN B;  2HHH T;  2JIW A;  4DR1 T;  2JMK A;  1Z8U A;  3TKL B;  4ZI2 C;  4FI5 A;  1FEW A;  1U4Q A;  2WQY A;  1WCR A;  2I6H A;  4G63 A;  2IUB A;  1VCS A;  1KNP A;  2WZI A;  4U2Y A;  5E0O A;  3FZL B;  5F3J A;  2Y8D A;  5FP3 A;  2CXL A;  5IUX A;  2IHR 1;  2UXN B;  2E8I A;  3J7Y q;  4EZ4 A;  3VU7 H;  4AIU A;  3VHL A;  2CLY C;  3PUA A;  2V7J A;  3EHZ A;  3EVY A;  4DO0 A;  1E7P A;  1D1A A;  5FXV A;  2J4G A;  4EOZ B;  3VKG A;  3GN5 B;  3ANW B;  4DV7 T;  4DMW A;  2WZH A;  4F6R C;  4PJL A;  1JNR A;  3UUL A;  2IC9 A;  5FY0 A;  1Y01 A;  5JVD E;  3AVS A;  3UU3 A;  4LMJ A;  2QA7 A;  3N5L A;  3QB5 A;  5HEH A;  2H88 A;  2QRX A;  3UUN A;  1N34 T;  2LSY A;  4YTP A;  2BG9 C;  5KXJ A;  3P8C D;  1DU2 A;  4JI7 T;  1D0Y A;  5L2L A;  3ZJ1 A;  2QVA A;  1W9R A;  4PK4 A;  5JDH A;  1LVK A;  4Z91 A;  2ZM6 T;  5IWA T;  4HGA A;  2N1G A;  5A1L A;  4HN9 A;  3MZK B;  3Q5W A;  5H6R B;  3HKB E;  4TNV A;  2UUB T;  2LRL A;  5AQU B;  4AQF A;  2YN6 A;  3ZT7 A;  1SHZ C;  2KWH A;  3B57 A;  5JDQ A;  2CRB A;  4X65 T;  2XAJ B;  4UVB B;  3HI2 A;  5FVK A;  1KNR A;  1S94 A;  5C8Y E;  2ODU A;  3AE6 A;  3C4W A;  5LCY A;  4HFI A;  2IAK A;  2WMO A;  3CK6 A;  3RYF E;  3PU8 A;  2AE9 A;  2L3L A;  2XUE A;  3ZMV B;  3PUW F;  2E9X B;  3NWI A;  2V7M A;  2I0M A;  2DI4 A;  4IDP A;  1WYB A;  3WI3 A;  3UTK A;  4H9N C;  3ESL A;  2BDE A;  2F4V T;  5J1G A;  3IHR A;  1XMQ T;  2B1E A;  2XQ4 A;  3UFE A;  3QB5 K;  2MAW A;  3I9W A;  3BQI A;  2CWY A;  4HFE A;  3ZSS A;  4AKG A;  3ZEF B;  4LF9 T;  4LF4 T;  2YOE A;  4PFO A;  2Q9Q C;  4BJM A;  1YKE B;  3ZYM A;  4PK6 A;  5AQI B;  3BK9 A;  3P4S A;  5FNV E;  1OED A;  3FZH B;  3NRX A;  4KHZ F;  3JCF A;  1MIW A;  5AQO B;  3AA0 B;  4HE8 A;  1MNE A;  3QK6 A;  5HEU A;  4JI8 T;  5L3C B;  5LMN T;  4HTE A;  5LJM A;  2LSJ A;  5L3G B;  3HL6 A;  1QLB A;  2RPA A;  5F5W A;  4LFA T;  3AEF A;  4TNW A;  3TLW A;  2VKO A;  2UXC T;  5JRC A;  2MOZ A;  3UUX B;  4BJN A;  3RYH E;  1HTJ F;  1MMG A;  4CXW A;  3AE1 A;  1W0A A;  3N9L A;  2A3D A;  4JUY A;  3KV4 A;  5ADX L;  1KNZ A;  2XQ5 A;  1HNW T;  3ZT5 A;  3OJA A;  5FKY A;  3CVR A;  4HFC A;  2IDO B;  3RIU A;  1JNZ A;  3ZYL A;  5LBQ B;  4UF0 A;  4ANJ A;  4X64 T;  3C4Z A;  2CEA A;  5AQR B;  2E5L T;  4UR9 A;  4HKA A;  2RP4 A;  5LHG B;  1WYC A;  2X0H A;  4U7I A;  2Y6X A;  2C5K T;  4EV6 A;  3PUV F;  2V1D B;  3OYX A;  4O2A E;  5HEG A; 
#chains in the Genus database with same CATH homology
 4LF9 T;  4LF4 T;  4B3R T;  4LF8 T;  4DR6 T;  4DV2 T;  2ZM6 T;  1XMO T;  2UUA T;  5IWA T;  1IBK T;  4DV6 T;  3OTO T;  4JI4 T;  4LF6 T;  4LF5 T;  4KHP T;  4LFB T;  4JV5 T;  2UU9 T;  1FJG T;  1N33 T;  4DV0 T;  4JYA T;  4DR2 T;  4JI8 T;  1I94 T;  5LMN T;  4JI2 T;  2UUB T;  2UUC T;  3T1Y T;  1XNQ T;  4GKK T;  1HNZ T;  5LMU T;  4NXN T;  2VQF T;  4LFA T;  4K0K T;  4YHH T;  1HR0 T;  2UXC T;  5BR8 T;  3T1H T;  4X65 T;  4DV7 T;  4NXM T;  4DV5 T;  4DUY T;  4OX9 T;  4B3S T;  4JI5 T;  4DR4 T;  4JI3 T;  1XNR T;  4DUZ T;  4DR5 T;  4DV3 T;  1HNW T;  4B3T T;  2UXB T;  2VQE T;  4DV1 T;  4AQY T;  4JI6 T;  4DR7 T;  4DV4 T;  1J5E T;  1HNX T;  1N34 T;  1N32 T;  1N36 T;  4JI0 T;  4X64 T;  2UXD T;  2E5L T;  2HHH T;  4B3M T;  4JI7 T;  4X66 T;  4GKJ T;  4X62 T;  4DR1 T;  4DR3 T;  4LF7 T;  4LFC T;  2F4V T;  1XMQ T;  4YY3 T;  4JI1 T;  1IBL T;  1IBM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...