4LF7T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf7T00
4JV5T 3OTOT 2UUBT 4LF6T 4JI4T 4X65T 2E5LT 1IBLT 4DV3T 4X64T 4DV1T 4LFAT 4OX9T 2UXCT 1I94T 4NXMT 4JI2T 4GKJT 2F4VT 4DV2T 5LMNT 4DR1T 4LFBT 4B3MT 4K0KT 4X62T 4DR5T 4DV4T 2HHHT 4DR6T 1IBKT 3T1YT 4GKKT 4LF5T 2ZM6T 4LFCT 1IBMT 4JI8T 1XMOT 1N36T 4B3TT 4JYAT 4YY3T 1J5ET 2UXBT 1HNZT 2VQFT 2UUAT 4LF4T 4DR2T 5BR8T 4LF9T 4LF7T 4DUYT 4DV6T 4JI6T 3T1HT 5LMUT 1HR0T 1XNRT 4DR7T 1HNWT 1XNQT 4JI5T 4DV5T 1HNXT 4DR3T 4X66T 1XMQT 4NXNT 2UU9T 4DV0T 4AQYT 1N32T 4B3ST 5IWAT 4DV7T 4DUZT 1FJGT 2UXDT 1N34T 2UUCT 4DR4T 4JI7T 4JI3T 2VQET 4KHPT 4B3RT 4JI1T 4LF8T 4YHHT 4JI0T 1N33T
chains in the Genus database with same CATH superfamily
3OTOT 3IA3A 4QKNA 3AEEA 3GA8A 3P4RA 1JNRA 1MMGA 1W0BA 3CWZB 3RGLA 4ZXLA 5E0OA 3PUWF 5AQGB 4TV9E 1IJ5A 4QH5A 2KWIB 4GKJT 3AAIA 1D1BA 1DU2A 3AAEB 1V9DA 4Q25A 2HHHT 3ZCJA 4H9NC 2D9DA 4I43B 1ZEEA 2YDRA 5HEUA 1XWMA 2OLTA 3GMIA 2MPKA 1CUNA 2V26A 5LGTB 3HKBE 1MIYA 2BG9C 5FVLA 5JR9B 5HWXA 2UXBT 2XM2A 4U7IA 3ZYMA 2BKOA 4LF4T 3RIUA 3PE0A 3NVOA 4O8SA 3T1HT 1SA0E 2PFVA 3O1JA 1HR0T 4O4JE 3ZCIA 2EHOB 1MNDA 3F57A 4J2CA 5ABFB 1GQEA 1N32T 3D0TA 5JDLA 2VVSA 2WDQA 2N1GA 4E7SA 1BR4A 4YSXA 1HF8A 3N9LA 5FXVA 2IW5B 5TAOA 4I50E 3DTOA 3RF1A 4IGUA 5FKYA 5AQUB 1FMWA 4JV5T 3DJBA 2H88A 2A9UA 1MNEA 3LK2B 3PV0F 3QK6A 3I0QA 3IBPA 3M3ZB 3FXEB 3H3MA 5L2LA 3C98B 5LGNB 5LMNT 5HXCA 4LFBT 3N9NA 4X20E 3KDSE 2JQQA 2BVLA 2WQYA 3UU5A 4ZOLE 1HX1B 5JTGA 4HKAA 5AQOB 1HG5A 4BJNA 3F2EA 5IHYA 1XDOA 5AQSB 4M1PA 5AQTB 4GIWA 2ACXA 4DVDA 3KV9A 3ZSTA 4LF9T 2V5DA 3UU6A 2CBIA 2VKOA 2FUPA 4H9RC 2C5JA 3AE4A 3FZMB 4EZHA 2M6BA 4GYRA 1ZV4X 4TV8E 5AQKB 1US7B 1MMNA 5FMNA 4LMLA 3AE6A 2P9BA 5LHIB 3N9OA 4H9OC 3ETUA 3RYCE 4ADZA 1LRZA 3CX6B 2X9WA 2W66A 2FBWA 3UUBA 3H37A 2DWKA 2UXCT 1NENA 5HXHA 1CHUA 3UQ4A 2JRKA 1L0VA 3P4QA 1MIVA 3HL6A 5EZYE 2CRBA 3EAMA 3AE9A 2XQ3A 5KX5E 2J1DG 3ZT7A 1QSDA 3PUGA 2YK0A 2C5KT 4AI6A 5CA0E 3RIFA 4NIQA 1WRDA 4GKKT 2LSJA 3FB2A 4ISTA 4NPPA 3NKZA 3CK6A 4N78D 2E9XD 3ZN0B 2LRLA 4IDPA 5FXWA 1HNZT 5JDQA 4EZ4A 2VWAA 4IE5A 3MZKB 4CQIA 2LSIA 2PJQA 4TN7B 3BQIA 2KMFA 2IMLA 1KNRA 5HEGA 4COFA 3E0ZA 3UUMA 3PU8A 2MTQA 3BQKA 5FL1A 2LOSA 2IAKA 1XMQT 2L3LA 4AQYT 3AEAA 3U78A 3ZYKA 3ABVA 4HWCA 3K3QC 4JI3T 2WM9A 2WZIA 2V7LA 2XTLA 5HCJA 3MKDA 3AEFA 5C2TA 4MHCA 3ZJ1A 3ZPOA 3QB5A 4Z8XA 3L8RA 2LM9A 3N2GE 3RLFF 3TLSA 5FY7A 3UUNA 2AE9A 3ZT5A 3CKDA 3AECA 4I4TE 2L9QA 4NXMT 1U5PA 4HTEA 4WW0A 4H9SE 4DR1T 1YQ4A 4HGAA 4U74A 1D0ZA 3RRWA 1YW0A 2WBLA 5H6QB 2LJLA 2DCFA 2BDEA 5HXRA 1R8IA 4PNIA 3PTRB 3C4XA 1HFAA 3K8PC 4IDNA 4AQFC 3AE8A 5ABGA 1XMOT 3J7Yq 2LHRA 2XQ4A 2X66A 2RP4A 4ZI3D 3B5MA 2VKJA 3ZEFB 2V1DB 4TWFA 5HEJA 2DI4A 2XQAA 3LK42 3P4PA 1YKEB 2PTFA 4O2AE 2H89A 5FYMA 4HFEA 5FL0A 5AFUL 2V5CA 3L3PA 3KV5A 2G0UA 2Q9QA 5L3BB 4Z91A 4EEDA 1IZNB 2LRKA 5AQFB 5ADXL 3HKEE 1D0YA 2CEAA 2HPJA 4YSYA 3ZSSA 2C5IT 3FZFB 3NZQA 2JMKA 4PJJA 4EAHA 2D2SA 1I6ZA 1YKHB 3LG7A 3C4WA 2VK9A 2A72A 2Y6XA 3PUXF 5JVDE 2CLYC 2XAFB 2JQKA 2BS4A 1Y64B 1I94T 3IEEA 4AQGA 3RQUA 1KEYA 3U3IA 4K0KT 4NUVA 3ZMTB 4IE4A 1IBKT 4GYSA 2XQYA 2NOXA 3SWHA 2YU1A 2IC9A 4C90A 2X9YA 4EGWA 3O4XE 4B3TT 4KX6A 4NUUA 1J5ET 5C3JA 3PDYA 4UR9A 2LHNA 2C0SA 5HYAA 3CX7B 5F3JA 4UV8B 3Q5EA 3A7MA 3Q5DA 5JR9A 5LMUT 3ZT6A 4FI5A 2OV9A 4EB6E 2ODVA 4U31A 4YTPA 3RKOA 1LKXA 2M6IA 4EV6A 2E5VA 5LG4A 5L4HA 1VCSA 2Q9QB 4KHPT 4HN9A 1ZKEA 3RIAA 2K3WA 3EDVA 2YU2A 3KBTA 3LJCA 1T98A 2XJ7A 4TNVA 3QB5K 1X79A 4YJ3E 3CQCB 3N9PA 2CMRA 4LF6T 2XQ8A 4YT0A 5L3GB 2E5LT 2ACZA 4X64T 4OX9T 3TLUA 4CN4A 5J2UE 4F6RC 2LEHA 3FXDB 3SRZA 4YFSA 4TNWA 4DV4T 4HFCA 1OXZA 3MA9A 3VHLA 1FMVA 3L39A 2KINB 3N9MA 4IHJE 2H7OA 3SFDA 4IDZA 3UFEA 4PJNA 1S94A 2X0YA 1G8XA 4O4HE 2SPCA 2VKHA 4UV9B 2W0GA 5JR9C 5HWYA 3AAAB 3TLWA 2RPAA 3JCFA 4CI2B 2IC6A 4U3CA 5AQRB 4X1KE 4DO0A 2NW8A 3ZC1A 1UUSA 4DV0T 5HAXA 2WY2A 3KVAA 2JJ9A 5IWAT 2EHOC 1MMAA 3KV4A 4P0BA 2VQET 2AXDS 4EIWA 4HFHA 3PUQA 4YHHT 3VU7H 2ZM2A 4ZS3A 3CPZA 2K9AA 5AQJB 1XDPA 4QXCB 4CI1B 4AKIA 2BS3A 4QXBB 2VL8A 3ZLIA 1VRBA 1IBLT 1UX5A 3FBLA 1MIWA 4YHJA 2MOZA 3RYFE 1MMDA 2WWVA 1UURA 2WCAA 4DMWA 2IIUA 4O4IE 2J47A 4HWIB 3ESLA 3ANWB 5F8PA 3E08A 4JI8T 4ILBA 2BKPA 1BR1A 1X9BA 3CX8B 3AVSA 2LE8A 2XAQB 3NRYA 4UXNB 4LF7T 3N2KE 2LSGA 2W63A 3DP7A 3JC6C 4H9QC 1D0XA 4DBQA 2E9XB 2WAUA 5KXJA 4DV5T 4U2YA 2OA5A 4NXNT 3RIUC 4UELA 2JQHA 3LDQB 3RI5A 3G06A 2JMHA 2WMNA 4JI1T 3I1AA 3C50A 2JQ9A 2K48A 4AXPA 2ES0A 2WZHA 5EK3A 4UEMA 2LM2A 4PK5A 4CN1A 2CCQA 4CXXA 1KF6A 1U4QA 2FJBA 2LT3A 2W62A 2NW7A 3TLVA 1O3XA 4B6XA 1YXRA 2EHOD 4HFDA 1E1HB 1LVKA 4MBQA 4CXWA 1W0AA 5LA6E 4PJMA 5FY0A 3RPUA 3ETVA 3AE7A 2R6GF 3ZMUB 2V7IA 5AQLB 3AE3A 2YN6A 2LOPA 4AKLA 5ABHA 1UX4A 5FP3A 2I59A 2KZ7B 2YEVC 4IIJE 4JEUB 4DR7T 4KUMB 3OBVE 5CGMA 4DMVA 3UU4A 3CVRA 4JI7T 4JLEA 3O1IA 3C51A 1ZHCA 4LF8T 2XAJB 2NTXA 5LHHB 1OWAA 3K3OA 3V5UA 5BMVE 3QUJA 4YSZA 3IHRA 5CA1E 3PUSA 5LCYA 4LMJA 4G63A 1NAFA 1KNPA 4CXYA 2IHR1 1H7CA 3ONLC 3MACA 2X51A 4IL4A 1ZP0A 3QOFA 3UTKA 4KHZF 4TWDA 4QH4A 3KINB 2X0HA 5LG3A 4WBOA 5HEOA 1HCIA 3ZN1B 2D0TA 1B7TA 1EZ3A 5AQQB 4JYAT 4OFZA 3HKCE 5AQPB 2NP9A 2XSAA 3C4ZA 4IE0A 3C64A 3LFMA 1OEDB 2RA1A 2KLQA 3A8YC 3FZLB 2WP9A 4U72A 3JAEA 2XPKA 3GN5B 4H63V 3QNUA 3V5SA 5HXSA 2YDSA 2LSYA 5LJNA 1WR0A 3CIRA 2QRXA 2UUCT 2XAGB 3WI3A 1T7SA 1G73A 2B1EA 2ODUA 2LLYA 2VASA 4YXDA 2WU5A 3AA6B 4AIUA 1S35A 2FJAA 3VRAA 2PBIA 3FBZA 4MALA 4QXHB 2XQ9A 2UUBT 3L09A 3ZC0A 4UVBB 1UK5A 5AQNB 5JDFA 4A97A 2KT9A 4IREA 1J5WA 2X68A 5LGUB 4DV1T 3PUAA 2FJEA 2DLRA 1ZOYA 2ZMAA 1WR6A 4X5TA 4KI0F 3UU3A 4HEAA 3PUVF 3RHWA 5ABEA 3CQGB 1SUMB 2WWUA 1BR2A 4K0UA 4LF5T 2Y48B 4DNDA 3MK7C 5CFBA 3UUXB 2N9DA 5H6RB 3HKDE 1Z0PA 3UT5E 1WCRA 1W09A 4IE7A 4HWFA 4DV6T 4IT4A 2LKGA 1HX8A 2JIWA 1KK7A 1XNRT 3RX6A 1HNWT 3ZJ2A 4AKHA 4JI5T 4X1IE 4JEHB 2V6XA 3Q2MA 3E22E 1HNXT 5DQVA 3AA1B 2I0MA 4B3ST 5FY1A 3HI2A 1N34T 5DJQC 3ZMVB 4KMCA 5FNVE 4HE8A 3NBXX 2Q9QC 4HFIA 3EHZA 3OVUA 2WU2A 2ZM0A 4HFVA 2UXXB 4FJOA 4G2AA 5FXZA 3X1DA 5HCMA 1AJ3A 2HH7A 2B76A 2E2AA 3LBXB 5LHGB 3PJAJ 3JADA 2ZM8A 4XZCA 4WBNE 5L3DB 4P1NA 3N2OA 4HFBA 4TUYE 3T1YT 3F31A 2XZEA 4ZS2A 3AEDA 4PK6A 5KMGP 2ZM6T 3Q9DA 4ILUA 2I6HA 3NRXA 1XZYA 3N5LA 1FEWA 2KNDA 4YY3T 3QC9A 3VKGA 4OHFA 4YTMA 2W67A 3JAFA 3PU3A 5JRCB 3FHNA 3ANWA 4UF0A 5L47A 4DR2T 2XQ6A 5LP6E 4JI6T 2VVNA 2H3RA 4ILAA 3AEBA 2J62A 3KVBA 2KXPB 4EYYR 1FIOA 2Z6EA 5CB4E 3S4UA 2E9XA 1E7PA 3RC8A 3K1SA 1HG2A 4U7YA 1NWMX 4PFOA 5L3FB 2DHRA 4EYUA 4JUYA 1M7KA 2NWBA 4JI4T 2X9XA 4ZI2C 4TWHA 4BJMA 5L4EA 2XHEB 1QUUA 3NZPA 3RH3A 2WB5A 5AQVB 2F4VT 4UIGA 3M65A 2CXLA 2DL1A 2VB6A 5EK4A 4DR5T 1UCUA 4IDQA 4DIDB 3WAJA 3SFEA 4OYJA 1IBMT 3UQ7A 2BG9B 2Q9QD 5DQWA 2W4XA 3P7IA 4L9IA 2DWGA 2NR4A 3BQLA 4BAYB 2CA5A 5LJMA 3ONJA 2UXNB 2ZLYA 5AQHB 1HTJF 3AA0B 4ASKA 1NEKA 1SHZC 3TLTA 4DUYT 2CHOA 1W9RA 3OYXA 2H7VC 2IUBA 3AEGA 3GWHA 5FXXA 4UF0B 2NTYA 3SS1A 5LYJE 2E9XC 4I55E 1FJGT 3EABA 3ONXA 2HN1A 2WMOA 4GOUA 4PJLA 2CXFA 3H3AA 3UFGA 3J9X1 1KNZA 5LBQB 3PUZF 3RC3A 5JREA 1SE7A 1WYCA 5HXEA 1Y01A 3ZYLA 3A5XA 5AQMB 2QA7A 4YLHA 2MYSA 3AVRA 4WNKA 5JH7E 5J0ZA 4DV2T 3PURA 2V7KA 2IDOB 4QH1A 1IJ6A 1LVFA 2PG8A 2QGSA 2X9HA 2J4GA 4UVCB 5AQIB 1E2AA 3P50A 1T72A 1YD8G 2W61A 4QX7B 5JDGA 2YDQA 5LBMA 2VL0A 4LFCT 3VR8A 4L5GA 3AE2A 3I9WA 2M67A 3FZHB 4YJ2E 3BK9A 4QX8B 4ZI2D 4F8HA 1D1CA 4PW8A 3AE5A 4KP3C 4P0AA 4C91A 4LMKA 5BR8T 1QLBA 4MFRA 3R6NA 3Q5XA 2CE7A 2CHNA 2CPTA 2JPFA 5A1LA 2CXDA 3KV6A 1OEDA 3CMLA 5LOVE 2CM0A 5JDNA 2UU9T 3CQXC 4DV7T 4QHOA 4ZI3C 3VRBA 2WS3A 2BVMA 2XY8B 4OYKA 2V6YA 3GN5A 3P4WA 4IE6A 3N9QA 2KWHA 2YOEA 5LB7B 5DABA 2QVAA 2CWOA 4ZZCA 2HPLA 4ZZBA 2N2NA 3AE1A 2XM1A 1OEDE 2XQ5A 1WFDA 5J2TE 3ZMSB 4GK0E 2FJDA 1UGOA 4JI2T 2KSRA 2K5BB 3RKGA 2XAHB 4AQFA 4B3MT 3MJXA 5LNKA 2YKSA 3TKLB 4L0RA 4PAGA 3JC6D 1WLXA 2XSBA 2HN2A 2VURA 3B57A 2E8IA 1D1AA 2CBJA 2V7JA 1JNZA 4TX5A 1N36T 2D0UA 2VKDA 3AB3B 5IUXA 5J1GA 3EDUA 4AKGA 2VQFT 2MAWA 3VR9A 1J1JA 5M4YA 3EUHA 2MBGA 2D5UA 3NWIA 1OEDC 1XNQT 4BA9A 4ISSA 1IAPA 4U2ZA 4X66T 3RRCA 3VKHA 2W00A 4DUZT 4U33A 3LK3B 3O9XA 1Z8UA 4TZ4C 5JDMA 4DR4T 2CWYA 4ZHQE 3I9YA 4O2BE 4B3RT 2L8KA 5JQGE 4HWHA 5L3EB 2XQ7A 3W15B 4CN6A 4JI0T 2V6YB 4ANJA 3T8OA 3PUYF 4EOZB 4UVAB 3OJAA 2XASB 3PJAA 2QYWA 4YTNA 4P09A 4JBWF 5HEHA 4X65T 2K24A 3UU8A 3P8CD 2BKNA 2WDRA 3B13A 3LBXA 2YINA 2W2UA 4DBRA 4A98A 1VCTA 1T8BA 4DR6T 4ZI7E 3RYIE 2BBJA 3IF8B 5L3CB 5C8YE 3OYZA 4H63H 2XUEA 4H9PC 4PK4A 4Z90A 4GK5E 5KDMC 1KFYA 4EEBA 5IYZE 3AXJA 2LKHA 3P4SA 4QWNB 2X67A 2V8SV 1VOMA 4MLKA 2Y8DA 3EVYA 5CJ5A 4WZXA 5JRCA 3MXZA 2NW9A 4OK0A 3AA7B 2UXDT 3ZMZB 4V1Av 2V7MA 3R84B 2A2FX 1YQ3A 3EI0A 3WAKA 4CI3B 4AISA 4ZEYA 4ERRA 4IL9A 2GK9A 4WYVA 1N33T 2CLYB 5ETWA 3OKQA 4A56A 5LXTE 4KBMB 4PFPA 4X1YE 3O1HA 4DV3T 4LFAT 4O4LE 4CZZB 1WYBA 4X62T 4AKRB 4ILCA 2LSKA 4HWDA 3HA4A 4I0UA 4IDOA 2DNXA 3Q5WA 3LSVA 3RYHE 3I0OA 2BS2A 3KFWX 2UUAT 2X0LB 2BG9A 5EK2A 4XBFB 3FZKB 2EHOA 2WDVA 3RQWA 2A3DA 5ABFA 3AXJB 4XAXB 1M62A 3HR0A 5JDHA 4A5XA 4DR3T 5F5WA 5GONE 3OPCA 3ZKRA 3KBUA 3UULA 1HS7A 2BG9E 4E7ZA 3SOLA 4EXTA 1BR0A 2BBHA 2BZBA 2WSSV 3K3NA 5FVKA
chains in the Genus database with same CATH topology
4JV5T 3OTOT 2UUBT 4LF6T 4JI4T 4X65T 2E5LT 1IBLT 4DV3T 4X64T 4DV1T 4LFAT 4OX9T 2UXCT 1I94T 4NXMT 4JI2T 4GKJT 2F4VT 4DV2T 5LMNT 4DR1T 4LFBT 4B3MT 4K0KT 4X62T 4DR5T 4DV4T 2HHHT 4DR6T 1IBKT 3T1YT 4GKKT 4LF5T 2ZM6T 4LFCT 1IBMT 4JI8T 1XMOT 1N36T 4B3TT 4JYAT 4YY3T 1J5ET 2UXBT 1HNZT 2VQFT 2UUAT 4LF4T 4DR2T 5BR8T 4LF9T 4LF7T 4DUYT 4DV6T 4JI6T 3T1HT 5LMUT 1HR0T 1XNRT 4DR7T 1HNWT 1XNQT 4JI5T 4DV5T 1HNXT 4DR3T 4X66T 1XMQT 4NXNT 2UU9T 4DV0T 4AQYT 1N32T 4B3ST 5IWAT 4DV7T 4DUZT 1FJGT 2UXDT 1N34T 2UUCT 4DR4T 4JI7T 4JI3T 2VQET 4KHPT 4B3RT 4JI1T 4LF8T 4YHHT 4JI0T 1N33T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 T;  3OTO T;  2UUB T;  4LF6 T;  4JI4 T;  4X65 T;  2E5L T;  1IBL T;  4DV3 T;  4X64 T;  4DV1 T;  4LFA T;  4OX9 T;  2UXC T;  1I94 T;  4NXM T;  4JI2 T;  4GKJ T;  2F4V T;  4DV2 T;  5LMN T;  4DR1 T;  4LFB T;  4B3M T;  4K0K T;  4X62 T;  4DR5 T;  4DV4 T;  2HHH T;  4DR6 T;  1IBK T;  3T1Y T;  4GKK T;  4LF5 T;  2ZM6 T;  4LFC T;  1IBM T;  4JI8 T;  1XMO T;  1N36 T;  4B3T T;  4JYA T;  4YY3 T;  1J5E T;  2UXB T;  1HNZ T;  2VQF T;  2UUA T;  4LF4 T;  4DR2 T;  5BR8 T;  4LF9 T;  4LF7 T;  4DUY T;  4DV6 T;  4JI6 T;  3T1H T;  5LMU T;  1HR0 T;  1XNR T;  4DR7 T;  1HNW T;  1XNQ T;  4JI5 T;  4DV5 T;  1HNX T;  4DR3 T;  4X66 T;  1XMQ T;  4NXN T;  2UU9 T;  4DV0 T;  4AQY T;  1N32 T;  4B3S T;  5IWA T;  4DV7 T;  4DUZ T;  1FJG T;  2UXD T;  1N34 T;  2UUC T;  4DR4 T;  4JI7 T;  4JI3 T;  2VQE T;  4KHP T;  4B3R T;  4JI1 T;  4LF8 T;  4YHH T;  4JI0 T;  1N33 T; 
#chains in the Genus database with same CATH topology
 3OTO T;  3IA3 A;  4QKN A;  3AEE A;  3GA8 A;  3P4R A;  1JNR A;  1MMG A;  1W0B A;  3CWZ B;  3RGL A;  4ZXL A;  5E0O A;  3PUW F;  5AQG B;  4TV9 E;  1IJ5 A;  4QH5 A;  2KWI B;  4GKJ T;  3AAI A;  1D1B A;  1DU2 A;  3AAE B;  1V9D A;  4Q25 A;  2HHH T;  3ZCJ A;  4H9N C;  2D9D A;  4I43 B;  1ZEE A;  2YDR A;  5HEU A;  1XWM A;  2OLT A;  3GMI A;  2MPK A;  1CUN A;  2V26 A;  5LGT B;  3HKB E;  1MIY A;  2BG9 C;  5FVL A;  5JR9 B;  5HWX A;  2UXB T;  2XM2 A;  4U7I A;  3ZYM A;  2BKO A;  4LF4 T;  3RIU A;  3PE0 A;  3NVO A;  4O8S A;  3T1H T;  1SA0 E;  2PFV A;  3O1J A;  1HR0 T;  4O4J E;  3ZCI A;  2EHO B;  1MND A;  3F57 A;  4J2C A;  5ABF B;  1GQE A;  1N32 T;  3D0T A;  5JDL A;  2VVS A;  2WDQ A;  2N1G A;  4E7S A;  1BR4 A;  4YSX A;  1HF8 A;  3N9L A;  5FXV A;  2IW5 B;  5TAO A;  4I50 E;  3DTO A;  3RF1 A;  4IGU A;  5FKY A;  5AQU B;  1FMW A;  4JV5 T;  3DJB A;  2H88 A;  2A9U A;  1MNE A;  3LK2 B;  3PV0 F;  3QK6 A;  3I0Q A;  3IBP A;  3M3Z B;  3FXE B;  3H3M A;  5L2L A;  3C98 B;  5LGN B;  5LMN T;  5HXC A;  4LFB T;  3N9N A;  4X20 E;  3KDS E;  2JQQ A;  2BVL A;  2WQY A;  3UU5 A;  4ZOL E;  1HX1 B;  5JTG A;  4HKA A;  5AQO B;  1HG5 A;  4BJN A;  3F2E A;  5IHY A;  1XDO A;  5AQS B;  4M1P A;  5AQT B;  4GIW A;  2ACX A;  4DVD A;  3KV9 A;  3ZST A;  4LF9 T;  2V5D A;  3UU6 A;  2CBI A;  2VKO A;  2FUP A;  4H9R C;  2C5J A;  3AE4 A;  3FZM B;  4EZH A;  2M6B A;  4GYR A;  1ZV4 X;  4TV8 E;  5AQK B;  1US7 B;  1MMN A;  5FMN A;  4LML A;  3AE6 A;  2P9B A;  5LHI B;  3N9O A;  4H9O C;  3ETU A;  3RYC E;  4ADZ A;  1LRZ A;  3CX6 B;  2X9W A;  2W66 A;  2FBW A;  3UUB A;  3H37 A;  2DWK A;  2UXC T;  1NEN A;  5HXH A;  1CHU A;  3UQ4 A;  2JRK A;  1L0V A;  3P4Q A;  1MIV A;  3HL6 A;  5EZY E;  2CRB A;  3EAM A;  3AE9 A;  2XQ3 A;  5KX5 E;  2J1D G;  3ZT7 A;  1QSD A;  3PUG A;  2YK0 A;  2C5K T;  4AI6 A;  5CA0 E;  3RIF A;  4NIQ A;  1WRD A;  4GKK T;  2LSJ A;  3FB2 A;  4IST A;  4NPP A;  3NKZ A;  3CK6 A;  4N78 D;  2E9X D;  3ZN0 B;  2LRL A;  4IDP A;  5FXW A;  1HNZ T;  5JDQ A;  4EZ4 A;  2VWA A;  4IE5 A;  3MZK B;  4CQI A;  2LSI A;  2PJQ A;  4TN7 B;  3BQI A;  2KMF A;  2IML A;  1KNR A;  5HEG A;  4COF A;  3E0Z A;  3UUM A;  3PU8 A;  2MTQ A;  3BQK A;  5FL1 A;  2LOS A;  2IAK A;  1XMQ T;  2L3L A;  4AQY T;  3AEA A;  3U78 A;  3ZYK A;  3ABV A;  4HWC A;  3K3Q C;  4JI3 T;  2WM9 A;  2WZI A;  2V7L A;  2XTL A;  5HCJ A;  3MKD A;  3AEF A;  5C2T A;  4MHC A;  3ZJ1 A;  3ZPO A;  3QB5 A;  4Z8X A;  3L8R A;  2LM9 A;  3N2G E;  3RLF F;  3TLS A;  5FY7 A;  3UUN A;  2AE9 A;  3ZT5 A;  3CKD A;  3AEC A;  4I4T E;  2L9Q A;  4NXM T;  1U5P A;  4HTE A;  4WW0 A;  4H9S E;  4DR1 T;  1YQ4 A;  4HGA A;  4U74 A;  1D0Z A;  3RRW A;  1YW0 A;  2WBL A;  5H6Q B;  2LJL A;  2DCF A;  2BDE A;  5HXR A;  1R8I A;  4PNI A;  3PTR B;  3C4X A;  1HFA A;  3K8P C;  4IDN A;  4AQF C;  3AE8 A;  5ABG A;  1XMO T;  3J7Y q;  2LHR A;  2XQ4 A;  2X66 A;  2RP4 A;  4ZI3 D;  3B5M A;  2VKJ A;  3ZEF B;  2V1D B;  4TWF A;  5HEJ A;  2DI4 A;  2XQA A;  3LK4 2;  3P4P A;  1YKE B;  2PTF A;  4O2A E;  2H89 A;  5FYM A;  4HFE A;  5FL0 A;  5AFU L;  2V5C A;  3L3P A;  3KV5 A;  2G0U A;  2Q9Q A;  5L3B B;  4Z91 A;  4EED A;  1IZN B;  2LRK A;  5AQF B;  5ADX L;  3HKE E;  1D0Y A;  2CEA A;  2HPJ A;  4YSY A;  3ZSS A;  2C5I T;  3FZF B;  3NZQ A;  2JMK A;  4PJJ A;  4EAH A;  2D2S A;  1I6Z A;  1YKH B;  3LG7 A;  3C4W A;  2VK9 A;  2A72 A;  2Y6X A;  3PUX F;  5JVD E;  2CLY C;  2XAF B;  2JQK A;  2BS4 A;  1Y64 B;  1I94 T;  3IEE A;  4AQG A;  3RQU A;  1KEY A;  3U3I A;  4K0K T;  4NUV A;  3ZMT B;  4IE4 A;  1IBK T;  4GYS A;  2XQY A;  2NOX A;  3SWH A;  2YU1 A;  2IC9 A;  4C90 A;  2X9Y A;  4EGW A;  3O4X E;  4B3T T;  4KX6 A;  4NUU A;  1J5E T;  5C3J A;  3PDY A;  4UR9 A;  2LHN A;  2C0S A;  5HYA A;  3CX7 B;  5F3J A;  4UV8 B;  3Q5E A;  3A7M A;  3Q5D A;  5JR9 A;  5LMU T;  3ZT6 A;  4FI5 A;  2OV9 A;  4EB6 E;  2ODV A;  4U31 A;  4YTP A;  3RKO A;  1LKX A;  2M6I A;  4EV6 A;  2E5V A;  5LG4 A;  5L4H A;  1VCS A;  2Q9Q B;  4KHP T;  4HN9 A;  1ZKE A;  3RIA A;  2K3W A;  3EDV A;  2YU2 A;  3KBT A;  3LJC A;  1T98 A;  2XJ7 A;  4TNV A;  3QB5 K;  1X79 A;  4YJ3 E;  3CQC B;  3N9P A;  2CMR A;  4LF6 T;  2XQ8 A;  4YT0 A;  5L3G B;  2E5L T;  2ACZ A;  4X64 T;  4OX9 T;  3TLU A;  4CN4 A;  5J2U E;  4F6R C;  2LEH A;  3FXD B;  3SRZ A;  4YFS A;  4TNW A;  4DV4 T;  4HFC A;  1OXZ A;  3MA9 A;  3VHL A;  1FMV A;  3L39 A;  2KIN B;  3N9M A;  4IHJ E;  2H7O A;  3SFD A;  4IDZ A;  3UFE A;  4PJN A;  1S94 A;  2X0Y A;  1G8X A;  4O4H E;  2SPC A;  2VKH A;  4UV9 B;  2W0G A;  5JR9 C;  5HWY A;  3AAA B;  3TLW A;  2RPA A;  3JCF A;  4CI2 B;  2IC6 A;  4U3C A;  5AQR B;  4X1K E;  4DO0 A;  2NW8 A;  3ZC1 A;  1UUS A;  4DV0 T;  5HAX A;  2WY2 A;  3KVA A;  2JJ9 A;  5IWA T;  2EHO C;  1MMA A;  3KV4 A;  4P0B A;  2VQE T;  2AXD S;  4EIW A;  4HFH A;  3PUQ A;  4YHH T;  3VU7 H;  2ZM2 A;  4ZS3 A;  3CPZ A;  2K9A A;  5AQJ B;  1XDP A;  4QXC B;  4CI1 B;  4AKI A;  2BS3 A;  4QXB B;  2VL8 A;  3ZLI A;  1VRB A;  1IBL T;  1UX5 A;  3FBL A;  1MIW A;  4YHJ A;  2MOZ A;  3RYF E;  1MMD A;  2WWV A;  1UUR A;  2WCA A;  4DMW A;  2IIU A;  4O4I E;  2J47 A;  4HWI B;  3ESL A;  3ANW B;  5F8P A;  3E08 A;  4JI8 T;  4ILB A;  2BKP A;  1BR1 A;  1X9B A;  3CX8 B;  3AVS A;  2LE8 A;  2XAQ B;  3NRY A;  4UXN B;  4LF7 T;  3N2K E;  2LSG A;  2W63 A;  3DP7 A;  3JC6 C;  4H9Q C;  1D0X A;  4DBQ A;  2E9X B;  2WAU A;  5KXJ A;  4DV5 T;  4U2Y A;  2OA5 A;  4NXN T;  3RIU C;  4UEL A;  2JQH A;  3LDQ B;  3RI5 A;  3G06 A;  2JMH A;  2WMN A;  4JI1 T;  3I1A A;  3C50 A;  2JQ9 A;  2K48 A;  4AXP A;  2ES0 A;  2WZH A;  5EK3 A;  4UEM A;  2LM2 A;  4PK5 A;  4CN1 A;  2CCQ A;  4CXX A;  1KF6 A;  1U4Q A;  2FJB A;  2LT3 A;  2W62 A;  2NW7 A;  3TLV A;  1O3X A;  4B6X A;  1YXR A;  2EHO D;  4HFD A;  1E1H B;  1LVK A;  4MBQ A;  4CXW A;  1W0A A;  5LA6 E;  4PJM A;  5FY0 A;  3RPU A;  3ETV A;  3AE7 A;  2R6G F;  3ZMU B;  2V7I A;  5AQL B;  3AE3 A;  2YN6 A;  2LOP A;  4AKL A;  5ABH A;  1UX4 A;  5FP3 A;  2I59 A;  2KZ7 B;  2YEV C;  4IIJ E;  4JEU B;  4DR7 T;  4KUM B;  3OBV E;  5CGM A;  4DMV A;  3UU4 A;  3CVR A;  4JI7 T;  4JLE A;  3O1I A;  3C51 A;  1ZHC A;  4LF8 T;  2XAJ B;  2NTX A;  5LHH B;  1OWA A;  3K3O A;  3V5U A;  5BMV E;  3QUJ A;  4YSZ A;  3IHR A;  5CA1 E;  3PUS A;  5LCY A;  4LMJ A;  4G63 A;  1NAF A;  1KNP A;  4CXY A;  2IHR 1;  1H7C A;  3ONL C;  3MAC A;  2X51 A;  4IL4 A;  1ZP0 A;  3QOF A;  3UTK A;  4KHZ F;  4TWD A;  4QH4 A;  3KIN B;  2X0H A;  5LG3 A;  4WBO A;  5HEO A;  1HCI A;  3ZN1 B;  2D0T A;  1B7T A;  1EZ3 A;  5AQQ B;  4JYA T;  4OFZ A;  3HKC E;  5AQP B;  2NP9 A;  2XSA A;  3C4Z A;  4IE0 A;  3C64 A;  3LFM A;  1OED B;  2RA1 A;  2KLQ A;  3A8Y C;  3FZL B;  2WP9 A;  4U72 A;  3JAE A;  2XPK A;  3GN5 B;  4H63 V;  3QNU A;  3V5S A;  5HXS A;  2YDS A;  2LSY A;  5LJN A;  1WR0 A;  3CIR A;  2QRX A;  2UUC T;  2XAG B;  3WI3 A;  1T7S A;  1G73 A;  2B1E A;  2ODU A;  2LLY A;  2VAS A;  4YXD A;  2WU5 A;  3AA6 B;  4AIU A;  1S35 A;  2FJA A;  3VRA A;  2PBI A;  3FBZ A;  4MAL A;  4QXH B;  2XQ9 A;  2UUB T;  3L09 A;  3ZC0 A;  4UVB B;  1UK5 A;  5AQN B;  5JDF A;  4A97 A;  2KT9 A;  4IRE A;  1J5W A;  2X68 A;  5LGU B;  4DV1 T;  3PUA A;  2FJE A;  2DLR A;  1ZOY A;  2ZMA A;  1WR6 A;  4X5T A;  4KI0 F;  3UU3 A;  4HEA A;  3PUV F;  3RHW A;  5ABE A;  3CQG B;  1SUM B;  2WWU A;  1BR2 A;  4K0U A;  4LF5 T;  2Y48 B;  4DND A;  3MK7 C;  5CFB A;  3UUX B;  2N9D A;  5H6R B;  3HKD E;  1Z0P A;  3UT5 E;  1WCR A;  1W09 A;  4IE7 A;  4HWF A;  4DV6 T;  4IT4 A;  2LKG A;  1HX8 A;  2JIW A;  1KK7 A;  1XNR T;  3RX6 A;  1HNW T;  3ZJ2 A;  4AKH A;  4JI5 T;  4X1I E;  4JEH B;  2V6X A;  3Q2M A;  3E22 E;  1HNX T;  5DQV A;  3AA1 B;  2I0M A;  4B3S T;  5FY1 A;  3HI2 A;  1N34 T;  5DJQ C;  3ZMV B;  4KMC A;  5FNV E;  4HE8 A;  3NBX X;  2Q9Q C;  4HFI A;  3EHZ A;  3OVU A;  2WU2 A;  2ZM0 A;  4HFV A;  2UXX B;  4FJO A;  4G2A A;  5FXZ A;  3X1D A;  5HCM A;  1AJ3 A;  2HH7 A;  2B76 A;  2E2A A;  3LBX B;  5LHG B;  3PJA J;  3JAD A;  2ZM8 A;  4XZC A;  4WBN E;  5L3D B;  4P1N A;  3N2O A;  4HFB A;  4TUY E;  3T1Y T;  3F31 A;  2XZE A;  4ZS2 A;  3AED A;  4PK6 A;  5KMG P;  2ZM6 T;  3Q9D A;  4ILU A;  2I6H A;  3NRX A;  1XZY A;  3N5L A;  1FEW A;  2KND A;  4YY3 T;  3QC9 A;  3VKG A;  4OHF A;  4YTM A;  2W67 A;  3JAF A;  3PU3 A;  5JRC B;  3FHN A;  3ANW A;  4UF0 A;  5L47 A;  4DR2 T;  2XQ6 A;  5LP6 E;  4JI6 T;  2VVN A;  2H3R A;  4ILA A;  3AEB A;  2J62 A;  3KVB A;  2KXP B;  4EYY R;  1FIO A;  2Z6E A;  5CB4 E;  3S4U A;  2E9X A;  1E7P A;  3RC8 A;  3K1S A;  1HG2 A;  4U7Y A;  1NWM X;  4PFO A;  5L3F B;  2DHR A;  4EYU A;  4JUY A;  1M7K A;  2NWB A;  4JI4 T;  2X9X A;  4ZI2 C;  4TWH A;  4BJM A;  5L4E A;  2XHE B;  1QUU A;  3NZP A;  3RH3 A;  2WB5 A;  5AQV B;  2F4V T;  4UIG A;  3M65 A;  2CXL A;  2DL1 A;  2VB6 A;  5EK4 A;  4DR5 T;  1UCU A;  4IDQ A;  4DID B;  3WAJ A;  3SFE A;  4OYJ A;  1IBM T;  3UQ7 A;  2BG9 B;  2Q9Q D;  5DQW A;  2W4X A;  3P7I A;  4L9I A;  2DWG A;  2NR4 A;  3BQL A;  4BAY B;  2CA5 A;  5LJM A;  3ONJ A;  2UXN B;  2ZLY A;  5AQH B;  1HTJ F;  3AA0 B;  4ASK A;  1NEK A;  1SHZ C;  3TLT A;  4DUY T;  2CHO A;  1W9R A;  3OYX A;  2H7V C;  2IUB A;  3AEG A;  3GWH A;  5FXX A;  4UF0 B;  2NTY A;  3SS1 A;  5LYJ E;  2E9X C;  4I55 E;  1FJG T;  3EAB A;  3ONX A;  2HN1 A;  2WMO A;  4GOU A;  4PJL A;  2CXF A;  3H3A A;  3UFG A;  3J9X 1;  1KNZ A;  5LBQ B;  3PUZ F;  3RC3 A;  5JRE A;  1SE7 A;  1WYC A;  5HXE A;  1Y01 A;  3ZYL A;  3A5X A;  5AQM B;  2QA7 A;  4YLH A;  2MYS A;  3AVR A;  4WNK A;  5JH7 E;  5J0Z A;  4DV2 T;  3PUR A;  2V7K A;  2IDO B;  4QH1 A;  1IJ6 A;  1LVF A;  2PG8 A;  2QGS A;  2X9H A;  2J4G A;  4UVC B;  5AQI B;  1E2A A;  3P50 A;  1T72 A;  1YD8 G;  2W61 A;  4QX7 B;  5JDG A;  2YDQ A;  5LBM A;  2VL0 A;  4LFC T;  3VR8 A;  4L5G A;  3AE2 A;  3I9W A;  2M67 A;  3FZH B;  4YJ2 E;  3BK9 A;  4QX8 B;  4ZI2 D;  4F8H A;  1D1C A;  4PW8 A;  3AE5 A;  4KP3 C;  4P0A A;  4C91 A;  4LMK A;  5BR8 T;  1QLB A;  4MFR A;  3R6N A;  3Q5X A;  2CE7 A;  2CHN A;  2CPT A;  2JPF A;  5A1L A;  2CXD A;  3KV6 A;  1OED A;  3CML A;  5LOV E;  2CM0 A;  5JDN A;  2UU9 T;  3CQX C;  4DV7 T;  4QHO A;  4ZI3 C;  3VRB A;  2WS3 A;  2BVM A;  2XY8 B;  4OYK A;  2V6Y A;  3GN5 A;  3P4W A;  4IE6 A;  3N9Q A;  2KWH A;  2YOE A;  5LB7 B;  5DAB A;  2QVA A;  2CWO A;  4ZZC A;  2HPL A;  4ZZB A;  2N2N A;  3AE1 A;  2XM1 A;  1OED E;  2XQ5 A;  1WFD A;  5J2T E;  3ZMS B;  4GK0 E;  2FJD A;  1UGO A;  4JI2 T;  2KSR A;  2K5B B;  3RKG A;  2XAH B;  4AQF A;  4B3M T;  3MJX A;  5LNK A;  2YKS A;  3TKL B;  4L0R A;  4PAG A;  3JC6 D;  1WLX A;  2XSB A;  2HN2 A;  2VUR A;  3B57 A;  2E8I A;  1D1A A;  2CBJ A;  2V7J A;  1JNZ A;  4TX5 A;  1N36 T;  2D0U A;  2VKD A;  3AB3 B;  5IUX A;  5J1G A;  3EDU A;  4AKG A;  2VQF T;  2MAW A;  3VR9 A;  1J1J A;  5M4Y A;  3EUH A;  2MBG A;  2D5U A;  3NWI A;  1OED C;  1XNQ T;  4BA9 A;  4ISS A;  1IAP A;  4U2Z A;  4X66 T;  3RRC A;  3VKH A;  2W00 A;  4DUZ T;  4U33 A;  3LK3 B;  3O9X A;  1Z8U A;  4TZ4 C;  5JDM A;  4DR4 T;  2CWY A;  4ZHQ E;  3I9Y A;  4O2B E;  4B3R T;  2L8K A;  5JQG E;  4HWH A;  5L3E B;  2XQ7 A;  3W15 B;  4CN6 A;  4JI0 T;  2V6Y B;  4ANJ A;  3T8O A;  3PUY F;  4EOZ B;  4UVA B;  3OJA A;  2XAS B;  3PJA A;  2QYW A;  4YTN A;  4P09 A;  4JBW F;  5HEH A;  4X65 T;  2K24 A;  3UU8 A;  3P8C D;  2BKN A;  2WDR A;  3B13 A;  3LBX A;  2YIN A;  2W2U A;  4DBR A;  4A98 A;  1VCT A;  1T8B A;  4DR6 T;  4ZI7 E;  3RYI E;  2BBJ A;  3IF8 B;  5L3C B;  5C8Y E;  3OYZ A;  4H63 H;  2XUE A;  4H9P C;  4PK4 A;  4Z90 A;  4GK5 E;  5KDM C;  1KFY A;  4EEB A;  5IYZ E;  3AXJ A;  2LKH A;  3P4S A;  4QWN B;  2X67 A;  2V8S V;  1VOM A;  4MLK A;  2Y8D A;  3EVY A;  5CJ5 A;  4WZX A;  5JRC A;  3MXZ A;  2NW9 A;  4OK0 A;  3AA7 B;  2UXD T;  3ZMZ B;  4V1A v;  2V7M A;  3R84 B;  2A2F X;  1YQ3 A;  3EI0 A;  3WAK A;  4CI3 B;  4AIS A;  4ZEY A;  4ERR A;  4IL9 A;  2GK9 A;  4WYV A;  1N33 T;  2CLY B;  5ETW A;  3OKQ A;  4A56 A;  5LXT E;  4KBM B;  4PFP A;  4X1Y E;  3O1H A;  4DV3 T;  4LFA T;  4O4L E;  4CZZ B;  1WYB A;  4X62 T;  4AKR B;  4ILC A;  2LSK A;  4HWD A;  3HA4 A;  4I0U A;  4IDO A;  2DNX A;  3Q5W A;  3LSV A;  3RYH E;  3I0O A;  2BS2 A;  3KFW X;  2UUA T;  2X0L B;  2BG9 A;  5EK2 A;  4XBF B;  3FZK B;  2EHO A;  2WDV A;  3RQW A;  2A3D A;  5ABF A;  3AXJ B;  4XAX B;  1M62 A;  3HR0 A;  5JDH A;  4A5X A;  4DR3 T;  5F5W A;  5GON E;  3OPC A;  3ZKR A;  3KBU A;  3UUL A;  1HS7 A;  2BG9 E;  4E7Z A;  3SOL A;  4EXT A;  1BR0 A;  2BBH A;  2BZB A;  2WSS V;  3K3N A;  5FVK A; 
#chains in the Genus database with same CATH homology
 4JV5 T;  3OTO T;  2UUB T;  4LF6 T;  4JI4 T;  4X65 T;  2E5L T;  1IBL T;  4DV3 T;  4X64 T;  4DV1 T;  4LFA T;  4OX9 T;  2UXC T;  1I94 T;  4NXM T;  4JI2 T;  4GKJ T;  2F4V T;  4DV2 T;  5LMN T;  4DR1 T;  4LFB T;  4B3M T;  4K0K T;  4X62 T;  4DR5 T;  4DV4 T;  2HHH T;  4DR6 T;  1IBK T;  3T1Y T;  4GKK T;  4LF5 T;  2ZM6 T;  4LFC T;  1IBM T;  4JI8 T;  1XMO T;  1N36 T;  4B3T T;  4JYA T;  4YY3 T;  1J5E T;  2UXB T;  1HNZ T;  2VQF T;  2UUA T;  4LF4 T;  4DR2 T;  5BR8 T;  4LF9 T;  4LF7 T;  4DUY T;  4DV6 T;  4JI6 T;  3T1H T;  5LMU T;  1HR0 T;  1XNR T;  4DR7 T;  1HNW T;  1XNQ T;  4JI5 T;  4DV5 T;  1HNX T;  4DR3 T;  4X66 T;  1XMQ T;  4NXN T;  2UU9 T;  4DV0 T;  4AQY T;  1N32 T;  4B3S T;  5IWA T;  4DV7 T;  4DUZ T;  1FJG T;  2UXD T;  1N34 T;  2UUC T;  4DR4 T;  4JI7 T;  4JI3 T;  2VQE T;  4KHP T;  4B3R T;  4JI1 T;  4LF8 T;  4YHH T;  4JI0 T;  1N33 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...