1WR6A

Crystal structure of gga3 gat domain in complex with ubiquitin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
90
structure length
90
Chain Sequence
VTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular mechanism of ubiquitin recognition by GGA3 GAT domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/signaling protein
molecule keywords ADP-ribosylation factor binding protein GGA3
total genus 28
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1wr6A00
1X79A 1WR6A 1WRDA 1NAFA 1NWMX 1OXZA 1O3XA 2N2NA 1YD8G 2N9DA
chains in the Genus database with same CATH superfamily
2C5KT 4TNWA 5JDGA 2YKSA 2V1DB 1OWAA 1LVKA 3Q5WA 3SOLA 4X1KE 2LEHA 5KX5E 5L3GB 5LHIB 2E5VA 4CI3B 2ZM0A 4H63V 2WWUA 2WU2A 4AQGA 3QK6A 1XWMA 3FHNA 4YHHT 3PUVF 4IDNA 1HNXT 2LRKA 4IHJE 3B5MA 4PK5A 5IWAT 5FXWA 1LVFA 2PTFA 4QXBB 5AQMB 1NAFA 2D9DA 3K3NA 2N1GA 3C98B 4H9SE 3V5UA 4XBFB 2BKOA 4O8SA 3AE2A 4EEBA 3UQ7A 4FI5A 2XJ7A 2CHOA 3O1IA 3ZMSB 2WWVA 4UELA 4E7SA 2KMFA 4EV6A 3RI5A 3U78A 4EYYR 2WU5A 3AA0B 3C51A 1H7CA 4U72A 4KUMB 1T8BA 2ES0A 2K9AA 3A7MA 3AA1B 2XQ3A 4AISA 1KK7A 2KT9A 1EZ3A 4DV0T 1E1HB 1M7KA 4CQIA 3P50A 2CBIA 2VKHA 3PU8A 5FL0A 2QA7A 5FYMA 4CN1A 4JI0T 2UXDT 1OEDE 5JR9B 2NW8A 1MNDA 2ACZA 4ILBA 1JNRA 4LF8T 2KINB 3PUYF 4IDPA 2WMNA 2BG9B 4JI1T 4MFRA 4ZS2A 4LF4T 4LFCT 1SE7A 3C4XA 3CVRA 3HR0A 4JI7T 2A72A 5DQWA 3RH3A 4WZXA 2PBIA 3H3AA 2VL0A 4ZHQE 3Q5EA 2W00A 5LOVE 4EXTA 1HTJF 4HGAA 3ONXA 3ZJ1A 3KBUA 4TV8E 5FVKA 3EI0A 2YU2A 4J2CA 4PAGA 3KV9A 1CUNA 3C50A 3AEBA 5HXRA 1MIVA 4YFSA 4NUUA 4WYVA 4XZCA 4KI0F 5FP3A 3N2OA 3RYHE 2XAGB 3EAMA 1J5ET 2UUAT 5FXZA 4PNIA 5JH7E 1YD8G 1WFDA 2XAFB 4K0UA 3CX7B 5AQHB 1G73A 2AXDS 4UEMA 2VURA 2XQ7A 4QH5A 4ZS3A 3TLUA 3VHLA 5JDLA 5LNKA 2IDOB 4O2AE 4DMVA 2DWGA 3QNUA 4JUYA 4X66T 4JI8T 2X9WA 2XQ5A 5JDMA 1QUUA 4YTMA 3VRBA 2J4GA 3P4PA 3SWHA 5ABGA 1N34T 5EK4A 4X1IE 3IHRA 2OV9A 3RPUA 4DO0A 1D1AA 3ZMZB 4KX6A 4MBQA 2BZBA 4IT4A 2MBGA 3ZYMA 4DNDA 4PJNA 2W67A 2WB5A 5F3JA 3AEEA 2VL8A 2CRBA 2XAHB 3LBXA 5DABA 3OKQA 3HKDE 3NZQA 3V5SA 5L47A 4IE5A 5LG3A 1XDPA 1I94T 2KWHA 2E9XC 4UF0B 1HFAA 5LHHB 2HPLA 2LOPA 1ZHCA 2WZIA 4LFBT 2PJQA 2B76A 1I6ZA 4PJLA 3BK9A 4F6RC 1Z0PA 2FJEA 3AE7A 3M3ZB 3KINB 4F8HA 2XSBA 4HEAA 4YTPA 3ZYLA 5L3CB 2VASA 4DV6T 5J1GA 1MIWA 5LXTE 4DV7T 2H3RA 1VRBA 2IUBA 4WBNE 2VVSA 3P4WA 3RIFA 3ZSTA 1N33T 2X66A 4WNKA 3LDQB 4AKGA 1KFYA 4DV3T 4AKHA 3CQXC 4DUYT 2WCAA 1X9BA 5HEUA 4P09A 4ADZA 2UXCT 4OK0A 2V7LA 3MA9A 5AQFB 1N32T 3R84B 5LYJE 2DHRA 2W4XA 4E7ZA 4O4HE 5AQLB 2HN1A 1OEDB 4IE4A 5AQRB 5L3FB 2W62A 4MHCA 5L3BB 2ODUA 1J1JA 4UXNB 4DR3T 2CXFA 5AFUL 4A97A 4P0AA 3U3IA 3PUWF 1BR4A 2F4VT 4HKAA 2V7IA 4YTNA 1NEKA 3NKZA 1CHUA 2W0GA 3KDSE 4MLKA 2MPKA 3RYCE 4AIUA 1VOMA 2K3WA 1QSDA 1HNWT 5HCMA 4JI4T 2EHOB 5JRCB 1T98A 2H89A 4O4JE 2XAJB 3ZCIA 1HNZT 3NZPA 2CE7A 2V7MA 4AQFA 4EYUA 2QRXA 3I0QA 5LMUT 4U3CA 2X9XA 3ZYKA 1T72A 3KBTA 4LMKA 4DV2T 3KVAA 4GK0E 3M65A 3O1HA 3ZC1A 3H3MA 4ZXLA 4HFHA 5EK2A 1IBMT 4O4LE 4Z8XA 4Z90A 4JI5T 4HFCA 5HEOA 4GKKT 2LHNA 2WP9A 2YEVC 4NIQA 4TZ4C 5AQKB 2JQKA 3RLFF 1ZEEA 2WQYA 3AEAA 3CIRA 4H9PC 2H88A 3CQGB 5ABFA 2BBHA 2YDQA 5HWXA 5CGMA 2CCQA 4TNVA 4U33A 4X5TA 4C91A 3SS1A 4LF9T 3MJXA 4YXDA 4X64T 3Q5DA 5IUXA 1DU2A 2Y48B 1FMWA 1WCRA 4UVAB 2XTLA 4CI1B 1HX1B 2CEAA 4K0KT 2IMLA 2IIUA 3N2KE 4DV4T 1KEYA 2BS2A 2VWAA 2LSKA 2WBLA 5LJNA 1MIYA 3AE4A 2V5DA 3DTOA 3O9XA 3OYXA 2N2NA 2Q9QA 3T8OA 3RX6A 3KVBA 4EGWA 4H9RC 2CXLA 2XQ9A 3WI3A 3X1DA 1D1CA 2MYSA 2KZ7B 4DR1T 3KV4A 2LHRA 3OBVE 4B3TT 4DMWA 2I59A 1SA0E 3C4ZA 1UUSA 2LSJA 5FY1A 3RKGA 3AAIA 5HEJA 4YY3T 4M1PA 3EABA 3SFEA 2JMHA 5AQQB 3LK42 5M4YA 3RQWA 1KF6A 4QXHB 3ZN1B 3GA8A 2D2SA 3VR9A 5LBQB 3OVUA 2X9HA 2XM1A 4UIGA 3JCFA 3K3QC 4AXPA 3AAAB 3PV0F 4JEUB 2XQ8A 2CXDA 4IE0A 1WLXA 2X0HA 3HKBE 4Q25A 4QX7B 4ASKA 5J2UE 4JI3T 2M67A 1E2AA 4KP3C 1FMVA 3ANWA 3LFMA 4OFZA 4XAXB 2LJLA 3N9PA 5FXXA 5AQTB 5FNVE 3EHZA 3MK7C 3UQ4A 3L3PA 2HH7A 2W63A 2NWBA 2ZMAA 4GYRA 5HEHA 5DJQC 4IL9A 4G63A 3IF8B 5L3DB 2BG9C 4AQYT 4COFA 1J5WA 2BKNA 3N5LA 1KNPA 4HFIA 5HYAA 2PG8A 2DNXA 4HWIB 4DUZT 3LSVA 4EZ4A 3IEEA 4LF7T 2FBWA 2WDRA 4IREA 4JI6T 4UV9B 4EOZB 2NR4A 4A56A 1W0AA 4IIJE 2E2AA 4H9QC 3KV5A 1UURA 4PK4A 4ISTA 3I1AA 1S35A 3ZLIA 4TWHA 2JQQA 1WYBA 3UU6A 2E9XA 1XNQT 3SFDA 4B3ST 3FBZA 2E9XD 1MMGA 4GIWA 2V6YA 2D0UA 3P4QA 1VCSA 3LK3B 2K48A 3H37A 4CI2B 4CN4A 4LF5T 4DR6T 5L2LA 2VKJA 4O2BE 3HI2A 4HWHA 1IBLT 2XQYA 2BS4A 3IBPA 2DI4A 2XQ6A 3GWHA 2BDEA 2Q9QC 3IA3A 3RQUA 3UFEA 2RP4A 3PJAJ 4ILUA 3VU7H 5FKYA 1YKHB 5C8YE 3P4RA 5BR8T 2R6GF 4OHFA 2ZLYA 4AQFC 3UU3A 2VKDA 2VVNA 2XPKA 3KV6A 1MMDA 2W66A 5HEGA 3N9OA 4DBQA 2BG9E 3E0ZA 2YOEA 3F57A 5HXHA 1B7TA 1IJ5A 3FZFB 4DBRA 4LMJA 4TX5A 4EB6E 3J9X1 4P1NA 3D0TA 4DV5T 4PW8A 1W0BA 2Z6EA 2LLYA 4TN7B 4CZZB 5ABHA 1XDOA 2MOZA 5CJ5A 5LBMA 4HE8A 4KHZF 1XNRT 2WAUA 2X51A 2Y6XA 3BQIA 5AQJB 2K24A 3TLTA 2Q9QD 4TV9E 2VB6A 1U5PA 4UVBB 1MMAA 5ABEA 1YW0A 2XAQB 3PU3A 4DR5T 1OXZA 1O3XA 2C5IT 2L9QA 4JEHB 4IL4A 3EDUA 2JRKA 1YKEB 4ZZBA 5JTGA 3EUHA 3AECA 1KNRA 2CHNA 1AJ3A 3OPCA 1WR6A 2PFVA 3FXDB 2A3DA 3PTRB 1OEDC 2FJAA 3NBXX 4TWFA 5AQGB 5AQVB 1JNZA 5JVDE 2WY2A 4JV5T 1US7B 1M62A 3CKDA 3FZHB 1N36T 1HG2A 1UK5A 3RC3A 5BMVE 2JMKA 3QC9A 2WSSV 4UF0A 1BR1A 2V5CA 5A1LA 3ZKRA 3ESLA 4HWDA 3A8YC 4BA9A 3VKHA 4U2ZA 1LRZA 4LMLA 2VK9A 5IHYA 3ZMVB 1IBKT 2E5LT 3HA4A 3VKGA 1FIOA 2NTYA 1UX5A 3ONLC 2WDQA 3O4XE 1IAPA 3UU4A 3DJBA 3FZMB 4EZHA 5C3JA 5HXEA 2JPFA 5L4EA 4KHPT 3RYFE 1YQ3A 5CA0E 3WAJA 2DLRA 2I6HA 4QXCB 2CBJA 4GKJT 5ADXL 2FUPA 4IE7A 2QYWA 3AA6B 3L8RA 3LBXB 3N2GE 4KBMB 1WR0A 2CWOA 2ODVA 4L5GA 4NXMT 3Q5XA 3AE8A 3CWZB 3N9LA 2H7VC 3AEFA 2VQET 3S4UA 5CA1E 1BR2A 1X79A 1WRDA 2FJDA 3O1JA 3QUJA 3TLVA 3EDVA 4EEDA 1D0ZA 3UUNA 5LG4A 1UCUA 1UGOA 4AKLA 3LG7A 2V7JA 3RGLA 4DR2T 5FL1A 3K8PC 2CMRA 2WMOA 2UUBT 2LM9A 2DCFA 2XHEB 4IDQA 4QWNB 4QX8B 3AVSA 2A9UA 4HFVA 3ZCJA 4ERRA 5ABFB 2J1DG 2JQHA 3E08A 1NENA 5AQIB 5GONE 3EVYA 2EHOA 5HAXA 3AE6A 2VQFT 2UXXB 2JIWA 3RKOA 4HWFA 4WBOA 2RA1A 3FXEB 3PDYA 4X20E 4YHJA 2NW7A 2AE9A 2YDRA 4ZI3D 5L4HA 4JYAT 4YT0A 2B1EA 1ZP0A 3GN5A 3RRWA 2ZM2A 2HPJA 2XY8B 4I55E 4YSYA 3AA7B 5LMNT 2LSYA 1HX8A 1XZYA 2XASB 3JAFA 2LKHA 4PK6A 5AQSB 3ZPOA 4P0BA 2JQ9A 2LRLA 2MAWA 2HN2A 5LP6E 4GK5E 1HS7A 5LCYA 4Z91A 2IW5B 3LK2B 4A5XA 4ZI7E 2LOSA 3JC6D 2K5BB 4ZI3C 3ZT5A 3BQLA 3UULA 1GQEA 4U31A 1Y64B 4H9NC 5JRCA 2D5UA 4L0RA 1QLBA 2LKGA 4I50E 3ZT6A 3OTOT 3ZMTB 4MALA 2CWYA 3QB5K 2RPAA 5LJMA 1IZNB 2BS3A 3G06A 1ZOYA 3NWIA 4PFPA 5DQVA 2X68A 4ILCA 3C64A 4PJMA 4UR9A 3R6NA 5H6QB 4CXXA 1VCTA 4DVDA 5FY0A 3QOFA 4ZEYA 4EAHA 2A2FX 5EK3A 2C0SA 2M6IA 1XMOT 2KWIB 4FJOA 4AKIA 3JC6C 3RF1A 4HFDA 5FMNA 3L09A 2JJ9A 3PUAA 1U4QA 5LGUB 2XUEA 4JBWF 4AI6A 2WDVA 3TKLB 2XM2A 3PJAA 2N9DA 1UX4A 4YLHA 2UXNB 3NVOA 4GOUA 2MTQA 2YU1A 2YN6A 3KFWX 2L3LA 3ABVA 3N9QA 5F8PA 2XQAA 3ZN0B 5CFBA 3MACA 4X62T 2BKPA 1YXRA 3ONJA 4HN9A 2W2UA 4U7IA 5HCJA 3AVRA 2LM2A 4HFEA 4YJ3E 2EHOC 5JDFA 1IJ6A 3AAEB 3UU8A 1WYCA 3FZLB 4BJMA 1SUMB 2CLYC 3HKCE 4ZI2D 1Z8UA 1W09A 4O4IE 3I0OA 2BVLA 4PFOA 5IYZE 2J47A 2YDSA 4U2YA 5JR9A 3TLWA 3UUXB 4A98A 3T1HT 3AEDA 3RC8A 5LGNB 5L3EB 5CB4E 5KDMC 2BG9A 2I0MA 2LE8A 2CLYB 3K1SA 5LHGB 4YSZA 1ZKEA 2IC6A 2WS3A 1NWMX 3P8CD 5AQPB 3UTKA 1HR0T 1D0XA 1OEDA 2EHOD 2C5JA 2M6BA 3AB3B 4U7YA 4OYKA 3N9NA 4UV8B 2FJBA 1D1BA 4H9OC 4ZI2C 3E22E 4NUVA 3UUMA 4B3MT 3P4SA 5AQUB 3B57A 2LSIA 1L0VA 4I4TE 2KSRA 3K3OA 4HTEA 5AQNB 2BBJA 4JI2T 5HXSA 3A5XA 3SRZA 4CN6A 2WZHA 3B13A 3JAEA 2V6YB 4QKNA 3CX8B 4BJNA 2V8SV 3VRAA 2LT3A 3WAKA 4DIDB 2L8KA 4KMCA 3HKEE 3MKDA 4UVCB 3FB2A 3AE1A 5FVLA 4JLEA 4BAYB 4C90A 2VKOA 2CA5A 5JDQA 3GN5B 2V26A 3C4WA 4LFAT 4ZZCA 3RIUA 3PURA 5JDHA 1YQ4A 4ANJA 2OA5A 2YINA 4U74A 3AE9A 5LGTB 1MMNA 4NXNT 5AQOB 4CXWA 1T7SA 2P9BA 1E7PA 3PE0A 3MXZA 5KXJA 3F31A 4ZOLE 3RIAA 3HL6A 5FXVA 1Y01A 2KNDA 2KLQA 3AXJA 3QB5A 5JREA 2HHHT 3VR8A 2E9XB 2G0UA 3P7IA 3RIUC 4L9IA 2NW9A 2BVMA 3ZEFB 4YJ2E 3PUZF 3ZMUB 5C2TA 3OYZA 3DP7A 5JR9C 2CPTA 4TUYE 3UUBA 2WM9A 3ZT7A 5JQGE 3F2EA 2ZM6T 3Q2MA 5LA6E 4YSXA 3RRCA 3ETUA 4I43B 3I9WA 3I9YA 1D0YA 3OJAA 2V6XA 1LKXA 3W15B 4EIWA 3L39A 4V1Av 3BQKA 3LJCA 1XMQT 3PUQA 3CX6B 4DV1T 1W9RA 2KXPB 1V9DA 3PUGA 1KNZA 4N78D 2QVAA 1HF8A 1R8IA 1SHZC 3Q9DA 4CXYA 4DR4T 4DR7T 3AE3A 3JADA 4NPPA 4IGUA 4AKRB 2XQ4A 1G8XA 4QHOA 5TAOA 3RHWA 3ETVA 4IE6A 2NP9A 4LF6T 3RYIE 4OX9T 3T1YT 2ZM8A 4GYSA 4QH1A 2YK0A 1FJGT 2NTXA 5H6RB 5E0OA 2X9YA 3PUSA 3PUXF 3CPZA 5JDNA 3FZKB 5J0ZA 2SPCA 2X0YA 5J2TE 3UFGA 3ZJ2A 2IHR1 3N9MA 3TLSA 4X65T 1BR0A 2DWKA 4H63H 1MNEA 3FBLA 3NRXA 3UT5E 3ZC0A 5FY7A 2OLTA 1HCIA 4G2AA 4PJJA 3AE5A 5F5WA 5HWYA 4HWCA 4I0UA 5LB7B 2UUCT 4X1YE 2UU9T 2LSGA 4TWDA 3ZSSA 4B3RT 2IC9A 2IAKA 4IDOA 4IDZA 5HXCA 4HFBA 2D0TA 1ZV4X 2NOXA 2X0LB 4OYJA 2GK9A 2UXBT 5ETWA 2Y8DA 2QGSA 2H7OA 2XZEA 3CQCB 4WW0A 3AEGA 5EZYE 2X67A 3UU5A 3CMLA 3GMIA 5KMGP 4QH4A 3J7Yq 2V7KA 2E8IA 2XSAA 1FEWA 2Q9QB 2ACXA 2W61A 3CK6A 3ANWB 4ILAA 3AXJB 4ISSA 1HG5A 1S94A 2J62A 3NRYA 2DL1A 4B6XA 3MZKB 2CM0A
chains in the Genus database with same CATH topology
2C5KT 5JDGA 3Q5WA 2V1DB 1OWAA 1LVKA 3SOLA 4X1KE 2LEHA 5KX5E 5L3GB 5LHIB 4CI3B 2ZM0A 4H63V 2WWUA 4AQGA 3QK6A 3FHNA 4IHJE 4PK5A 5FXWA 1LVFA 4QXBB 1NAFA 3K3NA 2N1GA 3C98B 4H9SE 3V5UA 4XBFB 4O8SA 4FI5A 3ZMSB 3O1IA 4UELA 4E7SA 2KMFA 3U78A 4EYYR 3AA0B 3C51A 1H7CA 4U72A 4KUMB 2K9AA 2ES0A 3AA1B 1KK7A 2KT9A 1EZ3A 1E1HB 3PU8A 2VKHA 5FYMA 2QA7A 5JR9B 2NW8A 1MNDA 2KINB 2WMNA 4MFRA 4ZS2A 3C4XA 3CVRA 3HR0A 2A72A 5DQWA 3RH3A 2PBIA 3H3AA 4ZHQE 5LOVE 2W00A 4EXTA 1HTJF 4HGAA 3ONXA 3ZJ1A 3KBUA 4TV8E 2YU2A 4J2CA 4PAGA 3KV9A 1CUNA 3C50A 5HXRA 1MIVA 4YFSA 4NUUA 4XZCA 5FP3A 3N2OA 3RYHE 2XAGB 5FXZA 4PNIA 5JH7E 1YD8G 4K0UA 2XAFB 3CX7B 3VHLA 1G73A 4UEMA 4ZS3A 5JDLA 5LNKA 4O2AE 4DMVA 2DWGA 4JUYA 2X9WA 5JDMA 1QUUA 3SWHA 5EK4A 4X1IE 3IHRA 3RPUA 4DO0A 1D1AA 3ZMZB 4MBQA 2BZBA 2MBGA 3ZYMA 4DNDA 4PJNA 5F3JA 2VL8A 2XAHB 3LBXA 5DABA 3V5SA 3OKQA 3HKDE 3NZQA 4IE5A 2KWHA 2E9XC 4UF0B 1HFAA 5LHHB 2HPLA 2LOPA 1ZHCA 2PJQA 4PJLA 3BK9A 1Z0PA 3KINB 5L3CB 4HEAA 3ZYLA 2VASA 5J1GA 1MIWA 5LXTE 2H3RA 1VRBA 4WBNE 2X66A 4WNKA 4AKGA 4AKHA 3CQXC 4P09A 4ADZA 4OK0A 2V7LA 3MA9A 3R84B 5LYJE 2DHRA 4E7ZA 4O4HE 5L3FB 4IE4A 2W62A 4MHCA 5L3BB 2ODUA 4UXNB 2CXFA 5AFUL 4P0AA 3U3IA 1BR4A 4HKAA 2V7IA 2W0GA 3KDSE 4MLKA 3RYCE 1VOMA 1QSDA 2EHOB 5JRCB 1T98A 4O4JE 3ZCIA 2XAJB 3NZPA 2CE7A 2V7MA 4AQFA 4EYUA 3I0QA 3ZYKA 2X9XA 3KBTA 3KVAA 4GK0E 3M65A 3O1HA 3ZC1A 5EK2A 4O4LE 4Z8XA 2LHNA 2YEVC 4TZ4C 1ZEEA 4H9PC 3CQGB 5HWXA 2CCQA 4C91A 3SS1A 3MJXA 2Y48B 1FMWA 4UVAB 2XTLA 4CI1B 2CEAA 3N2KE 2VWAA 2WBLA 2LSKA 5LJNA 1MIYA 3DTOA 3O9XA 3OYXA 2N2NA 2Q9QA 3T8OA 3RX6A 3KVBA 4H9RC 2CXLA 3WI3A 1D1CA 2MYSA 2KZ7B 3KV4A 2LHRA 3OBVE 4DMWA 2I59A 1SA0E 3C4ZA 5FY1A 2LSJA 3AAIA 4M1PA 2JMHA 3LK42 5M4YA 4QXHB 3ZN1B 3GA8A 2D2SA 4AXPA 5LBQB 2X9HA 4UIGA 3K3QC 3AAAB 4JEUB 4IE0A 2CXDA 4QX7B 1WLXA 4ASKA 3HKBE 5J2UE 2M67A 4KP3C 1FMVA 3ANWA 3LFMA 4OFZA 4XAXB 2LJLA 3N9PA 5FXXA 5FNVE 3MK7C 3L3PA 2HH7A 2W63A 2NWBA 2ZMAA 4GYRA 5DJQC 4G63A 3IF8B 5L3DB 5HYAA 3N5LA 2PG8A 2DNXA 4EZ4A 3IEEA 4UV9B 4EOZB 4A56A 4IIJE 4H9QC 3KV5A 4PK4A 4ISTA 3I1AA 1S35A 3ZLIA 2JQQA 1WYBA 2E9XA 3FBZA 2E9XD 1MMGA 4GIWA 2D0UA 3LK3B 2K48A 3H37A 4CI2B 5L2LA 2VKJA 4O2BE 3HI2A 2XQYA 3IBPA 2DI4A 3GWHA 3UFEA 2BDEA 2Q9QC 4CQIA 3VU7H 2RP4A 4ILUA 1YKHB 5C8YE 4OHFA 2ZLYA 4AQFC 4F6RC 2VKDA 4DBQA 3KV6A 1MMDA 5HXHA 3N9OA 3E0ZA 3F57A 1B7TA 1IJ5A 4DBRA 4TX5A 4EB6E 3J9X1 3D0TA 4PW8A 2Z6EA 4TN7B 2MOZA 5LBMA 4HE8A 2WAUA 2X51A 2Y6XA 3BQIA 2K24A 2Q9QD 4TV9E 2VB6A 1U5PA 4UVBB 1MMAA 1YW0A 2XAQB 3PU3A 1OXZA 1O3XA 2C5IT 2L9QA 4JEHB 3EDUA 2JRKA 1YKEB 3EUHA 1AJ3A 1WR6A 2PFVA 3FXDB 2A3DA 3PTRB 3NBXX 5JVDE 1US7B 3CKDA 1HG2A 3RC3A 5BMVE 2JMKA 3QC9A 2WSSV 4UF0A 1BR1A 5A1LA 3ESLA 4BA9A 3VKHA 3ZMVB 1LRZA 2VK9A 5IHYA 3HA4A 3VKGA 1FIOA 2NTYA 1UX5A 3O4XE 1IAPA 3DJBA 4EZHA 5HXEA 2JPFA 3RYFE 5CA0E 3WAJA 2DLRA 4QXCB 5ADXL 4IE7A 3LBXB 3AA6B 4KBMB 3N2GE 2CWOA 2ODVA 4L5GA 3Q5XA 3CWZB 3N9LA 2H7VC 3S4UA 5CA1E 1BR2A 1X79A 1WRDA 3O1JA 3QUJA 5LG4A 3EDVA 1D0ZA 3UUNA 1UCUA 4AKLA 3LG7A 2V7JA 3K8PC 2CMRA 2WMOA 2LM9A 2DCFA 2XHEB 4QWNB 4QX8B 4ERRA 3AVSA 4HFVA 3ZCJA 2J1DG 3E08A 5HAXA 5GONE 3EVYA 2EHOA 2UXXB 3RKOA 4WBOA 2RA1A 3FXEB 3PDYA 4X20E 4YHJA 2NW7A 4ZI3D 2B1EA 3GN5A 3RRWA 2ZM2A 2HPJA 4I55E 3AA7B 2LSYA 1HX8A 2XASB 3ZPOA 4PK6A 4P0BA 5LP6E 4GK5E 1HS7A 5LCYA 2IW5B 3LK2B 4ZI7E 2LOSA 3JC6D 2K5BB 4ZI3C 3BQLA 3UULA 5JRCA 1Y64B 4H9NC 2D5UA 4L0RA 4I50E 3ZMTB 4MALA 2CWYA 5LJMA 1IZNB 4PFPA 5DQVA 2X68A 4PJMA 3C64A 3R6NA 5H6QB 4CXXA 4DVDA 4EAHA 2A2FX 5EK3A 2C0SA 4AKIA 2KWIB 4FJOA 3JC6C 5FMNA 3L09A 2JJ9A 3PUAA 1U4QA 5LGUB 2XUEA 4AI6A 3TKLB 2N9DA 1UX4A 4YLHA 2UXNB 4GOUA 5F8PA 2MTQA 2YU1A 3KFWX 3ZN0B 2L3LA 3N9QA 3MACA 4HN9A 3AVRA 4YJ3E 5JDFA 2EHOC 1IJ6A 3AAEB 1WYCA 4BJMA 4ZI2D 2CLYC 3HKCE 4O4IE 4PFOA 3I0OA 2BVLA 5IYZE 5JR9A 3UUXB 3RC8A 5LGNB 5L3EB 5CB4E 5KDMC 2LE8A 2CLYB 5LHGB 1ZKEA 2IC6A 1NWMX 3P8CD 3UTKA 1D0XA 2EHOD 2C5JA 3AB3B 4OYKA 3N9NA 4UV8B 1D1BA 4H9OC 4ZI2C 3E22E 4NUVA 3UUMA 3B57A 2LSIA 4I4TE 4HTEA 3K3OA 5HXSA 3A5XA 3SRZA 3B13A 4QKNA 3CX8B 4BJNA 2LT3A 3WAKA 2L8KA 4KMCA 3HKEE 3MKDA 4UVCB 3FB2A 4BAYB 5JDQA 4JLEA 4C90A 2VKOA 2CA5A 3GN5B 2V26A 3C4WA 3PURA 5JDHA 4ANJA 2OA5A 2YINA 4U74A 5LGTB 1MMNA 4CXWA 2P9BA 3PE0A 3MXZA 3F31A 4ZOLE 3HL6A 5FXVA 2KNDA 2KLQA 5JREA 2E9XB 2G0UA 3P7IA 4YJ2E 4L9IA 2NW9A 2BVMA 3ZEFB 3ZMUB 3OYZA 3DP7A 5JR9C 4TUYE 5JQGE 2WM9A 3F2EA 3Q2MA 5LA6E 3RRCA 3ETUA 4I43B 3I9WA 3I9YA 1D0YA 3OJAA 1LKXA 3W15B 4EIWA 4V1Av 3BQKA 3LJCA 3PUQA 3CX6B 2KXPB 1V9DA 3PUGA 1KNZA 4N78D 1HF8A 1SHZC 3Q9DA 4CXYA 4IGUA 4AKRB 1G8XA 4QHOA 5TAOA 3ETVA 4IE6A 2NP9A 3RYIE 2ZM8A 4GYSA 2YK0A 2NTXA 5H6RB 5E0OA 2X9YA 3PUSA 3J7Yq 3CPZA 5JDNA 2SPCA 5J2TE 3ZJ2A 3N9MA 1BR0A 2DWKA 4H63H 1MNEA 3FBLA 3NRXA 3UT5E 3ZC0A 5FY7A 1HCIA 4G2AA 4PJJA 5HWYA 4X1YE 2LSGA 2IC9A 2IAKA 4IDZA 5HXCA 2D0TA 1ZV4X 2NOXA 2X0LB 4OYJA 2GK9A 5ETWA 2Y8DA 2QGSA 2H7OA 5EZYE 3CQCB 4WW0A 4CZZB 5KMGP 2X67A 3CMLA 3GMIA 2V7KA 2E8IA 1FEWA 2Q9QB 2ACXA 2W61A 5FY0A 3ANWB 4ISSA 1HG5A 1S94A 3NRYA 4B6XA 3MZKB 2CM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X79 A;  1WR6 A;  1WRD A;  1NAF A;  1NWM X;  1OXZ A;  1O3X A;  2N2N A;  1YD8 G;  2N9D A; 
#chains in the Genus database with same CATH topology
 2C5K T;  4TNW A;  5JDG A;  2YKS A;  2V1D B;  1OWA A;  1LVK A;  3Q5W A;  3SOL A;  4X1K E;  2LEH A;  5KX5 E;  5L3G B;  5LHI B;  2E5V A;  4CI3 B;  2ZM0 A;  4H63 V;  2WWU A;  2WU2 A;  4AQG A;  3QK6 A;  1XWM A;  3FHN A;  4YHH T;  3PUV F;  4IDN A;  1HNX T;  2LRK A;  4IHJ E;  3B5M A;  4PK5 A;  5IWA T;  5FXW A;  1LVF A;  2PTF A;  4QXB B;  5AQM B;  1NAF A;  2D9D A;  3K3N A;  2N1G A;  3C98 B;  4H9S E;  3V5U A;  4XBF B;  2BKO A;  4O8S A;  3AE2 A;  4EEB A;  3UQ7 A;  4FI5 A;  2XJ7 A;  2CHO A;  3O1I A;  3ZMS B;  2WWV A;  4UEL A;  4E7S A;  2KMF A;  4EV6 A;  3RI5 A;  3U78 A;  4EYY R;  2WU5 A;  3AA0 B;  3C51 A;  1H7C A;  4U72 A;  4KUM B;  1T8B A;  2ES0 A;  2K9A A;  3A7M A;  3AA1 B;  2XQ3 A;  4AIS A;  1KK7 A;  2KT9 A;  1EZ3 A;  4DV0 T;  1E1H B;  1M7K A;  4CQI A;  3P50 A;  2CBI A;  2VKH A;  3PU8 A;  5FL0 A;  2QA7 A;  5FYM A;  4CN1 A;  4JI0 T;  2UXD T;  1OED E;  5JR9 B;  2NW8 A;  1MND A;  2ACZ A;  4ILB A;  1JNR A;  4LF8 T;  2KIN B;  3PUY F;  4IDP A;  2WMN A;  2BG9 B;  4JI1 T;  4MFR A;  4ZS2 A;  4LF4 T;  4LFC T;  1SE7 A;  3C4X A;  3CVR A;  3HR0 A;  4JI7 T;  2A72 A;  5DQW A;  3RH3 A;  4WZX A;  2PBI A;  3H3A A;  2VL0 A;  4ZHQ E;  3Q5E A;  2W00 A;  5LOV E;  4EXT A;  1HTJ F;  4HGA A;  3ONX A;  3ZJ1 A;  3KBU A;  4TV8 E;  5FVK A;  3EI0 A;  2YU2 A;  4J2C A;  4PAG A;  3KV9 A;  1CUN A;  3C50 A;  3AEB A;  5HXR A;  1MIV A;  4YFS A;  4NUU A;  4WYV A;  4XZC A;  4KI0 F;  5FP3 A;  3N2O A;  3RYH E;  2XAG B;  3EAM A;  1J5E T;  2UUA T;  5FXZ A;  4PNI A;  5JH7 E;  1YD8 G;  1WFD A;  2XAF B;  4K0U A;  3CX7 B;  5AQH B;  1G73 A;  2AXD S;  4UEM A;  2VUR A;  2XQ7 A;  4QH5 A;  4ZS3 A;  3TLU A;  3VHL A;  5JDL A;  5LNK A;  2IDO B;  4O2A E;  4DMV A;  2DWG A;  3QNU A;  4JUY A;  4X66 T;  4JI8 T;  2X9W A;  2XQ5 A;  5JDM A;  1QUU A;  4YTM A;  3VRB A;  2J4G A;  3P4P A;  3SWH A;  5ABG A;  1N34 T;  5EK4 A;  4X1I E;  3IHR A;  2OV9 A;  3RPU A;  4DO0 A;  1D1A A;  3ZMZ B;  4KX6 A;  4MBQ A;  2BZB A;  4IT4 A;  2MBG A;  3ZYM A;  4DND A;  4PJN A;  2W67 A;  2WB5 A;  5F3J A;  3AEE A;  2VL8 A;  2CRB A;  2XAH B;  3LBX A;  5DAB A;  3OKQ A;  3HKD E;  3NZQ A;  3V5S A;  5L47 A;  4IE5 A;  5LG3 A;  1XDP A;  1I94 T;  2KWH A;  2E9X C;  4UF0 B;  1HFA A;  5LHH B;  2HPL A;  2LOP A;  1ZHC A;  2WZI A;  4LFB T;  2PJQ A;  2B76 A;  1I6Z A;  4PJL A;  3BK9 A;  4F6R C;  1Z0P A;  2FJE A;  3AE7 A;  3M3Z B;  3KIN B;  4F8H A;  2XSB A;  4HEA A;  4YTP A;  3ZYL A;  5L3C B;  2VAS A;  4DV6 T;  5J1G A;  1MIW A;  5LXT E;  4DV7 T;  2H3R A;  1VRB A;  2IUB A;  4WBN E;  2VVS A;  3P4W A;  3RIF A;  3ZST A;  1N33 T;  2X66 A;  4WNK A;  3LDQ B;  4AKG A;  1KFY A;  4DV3 T;  4AKH A;  3CQX C;  4DUY T;  2WCA A;  1X9B A;  5HEU A;  4P09 A;  4ADZ A;  2UXC T;  4OK0 A;  2V7L A;  3MA9 A;  5AQF B;  1N32 T;  3R84 B;  5LYJ E;  2DHR A;  2W4X A;  4E7Z A;  4O4H E;  5AQL B;  2HN1 A;  1OED B;  4IE4 A;  5AQR B;  5L3F B;  2W62 A;  4MHC A;  5L3B B;  2ODU A;  1J1J A;  4UXN B;  4DR3 T;  2CXF A;  5AFU L;  4A97 A;  4P0A A;  3U3I A;  3PUW F;  1BR4 A;  2F4V T;  4HKA A;  2V7I A;  4YTN A;  1NEK A;  3NKZ A;  1CHU A;  2W0G A;  3KDS E;  4MLK A;  2MPK A;  3RYC E;  4AIU A;  1VOM A;  2K3W A;  1QSD A;  1HNW T;  5HCM A;  4JI4 T;  2EHO B;  5JRC B;  1T98 A;  2H89 A;  4O4J E;  2XAJ B;  3ZCI A;  1HNZ T;  3NZP A;  2CE7 A;  2V7M A;  4AQF A;  4EYU A;  2QRX A;  3I0Q A;  5LMU T;  4U3C A;  2X9X A;  3ZYK A;  1T72 A;  3KBT A;  4LMK A;  4DV2 T;  3KVA A;  4GK0 E;  3M65 A;  3O1H A;  3ZC1 A;  3H3M A;  4ZXL A;  4HFH A;  5EK2 A;  1IBM T;  4O4L E;  4Z8X A;  4Z90 A;  4JI5 T;  4HFC A;  5HEO A;  4GKK T;  2LHN A;  2WP9 A;  2YEV C;  4NIQ A;  4TZ4 C;  5AQK B;  2JQK A;  3RLF F;  1ZEE A;  2WQY A;  3AEA A;  3CIR A;  4H9P C;  2H88 A;  3CQG B;  5ABF A;  2BBH A;  2YDQ A;  5HWX A;  5CGM A;  2CCQ A;  4TNV A;  4U33 A;  4X5T A;  4C91 A;  3SS1 A;  4LF9 T;  3MJX A;  4YXD A;  4X64 T;  3Q5D A;  5IUX A;  1DU2 A;  2Y48 B;  1FMW A;  1WCR A;  4UVA B;  2XTL A;  4CI1 B;  1HX1 B;  2CEA A;  4K0K T;  2IML A;  2IIU A;  3N2K E;  4DV4 T;  1KEY A;  2BS2 A;  2VWA A;  2LSK A;  2WBL A;  5LJN A;  1MIY A;  3AE4 A;  2V5D A;  3DTO A;  3O9X A;  3OYX A;  2N2N A;  2Q9Q A;  3T8O A;  3RX6 A;  3KVB A;  4EGW A;  4H9R C;  2CXL A;  2XQ9 A;  3WI3 A;  3X1D A;  1D1C A;  2MYS A;  2KZ7 B;  4DR1 T;  3KV4 A;  2LHR A;  3OBV E;  4B3T T;  4DMW A;  2I59 A;  1SA0 E;  3C4Z A;  1UUS A;  2LSJ A;  5FY1 A;  3RKG A;  3AAI A;  5HEJ A;  4YY3 T;  4M1P A;  3EAB A;  3SFE A;  2JMH A;  5AQQ B;  3LK4 2;  5M4Y A;  3RQW A;  1KF6 A;  4QXH B;  3ZN1 B;  3GA8 A;  2D2S A;  3VR9 A;  5LBQ B;  3OVU A;  2X9H A;  2XM1 A;  4UIG A;  3JCF A;  3K3Q C;  4AXP A;  3AAA B;  3PV0 F;  4JEU B;  2XQ8 A;  2CXD A;  4IE0 A;  1WLX A;  2X0H A;  3HKB E;  4Q25 A;  4QX7 B;  4ASK A;  5J2U E;  4JI3 T;  2M67 A;  1E2A A;  4KP3 C;  1FMV A;  3ANW A;  3LFM A;  4OFZ A;  4XAX B;  2LJL A;  3N9P A;  5FXX A;  5AQT B;  5FNV E;  3EHZ A;  3MK7 C;  3UQ4 A;  3L3P A;  2HH7 A;  2W63 A;  2NWB A;  2ZMA A;  4GYR A;  5HEH A;  5DJQ C;  4IL9 A;  4G63 A;  3IF8 B;  5L3D B;  2BG9 C;  4AQY T;  4COF A;  1J5W A;  2BKN A;  3N5L A;  1KNP A;  4HFI A;  5HYA A;  2PG8 A;  2DNX A;  4HWI B;  4DUZ T;  3LSV A;  4EZ4 A;  3IEE A;  4LF7 T;  2FBW A;  2WDR A;  4IRE A;  4JI6 T;  4UV9 B;  4EOZ B;  2NR4 A;  4A56 A;  1W0A A;  4IIJ E;  2E2A A;  4H9Q C;  3KV5 A;  1UUR A;  4PK4 A;  4IST A;  3I1A A;  1S35 A;  3ZLI A;  4TWH A;  2JQQ A;  1WYB A;  3UU6 A;  2E9X A;  1XNQ T;  3SFD A;  4B3S T;  3FBZ A;  2E9X D;  1MMG A;  4GIW A;  2V6Y A;  2D0U A;  3P4Q A;  1VCS A;  3LK3 B;  2K48 A;  3H37 A;  4CI2 B;  4CN4 A;  4LF5 T;  4DR6 T;  5L2L A;  2VKJ A;  4O2B E;  3HI2 A;  4HWH A;  1IBL T;  2XQY A;  2BS4 A;  3IBP A;  2DI4 A;  2XQ6 A;  3GWH A;  2BDE A;  2Q9Q C;  3IA3 A;  3RQU A;  3UFE A;  2RP4 A;  3PJA J;  4ILU A;  3VU7 H;  5FKY A;  1YKH B;  5C8Y E;  3P4R A;  5BR8 T;  2R6G F;  4OHF A;  2ZLY A;  4AQF C;  3UU3 A;  2VKD A;  2VVN A;  2XPK A;  3KV6 A;  1MMD A;  2W66 A;  5HEG A;  3N9O A;  4DBQ A;  2BG9 E;  3E0Z A;  2YOE A;  3F57 A;  5HXH A;  1B7T A;  1IJ5 A;  3FZF B;  4DBR A;  4LMJ A;  4TX5 A;  4EB6 E;  3J9X 1;  4P1N A;  3D0T A;  4DV5 T;  4PW8 A;  1W0B A;  2Z6E A;  2LLY A;  4TN7 B;  4CZZ B;  5ABH A;  1XDO A;  2MOZ A;  5CJ5 A;  5LBM A;  4HE8 A;  4KHZ F;  1XNR T;  2WAU A;  2X51 A;  2Y6X A;  3BQI A;  5AQJ B;  2K24 A;  3TLT A;  2Q9Q D;  4TV9 E;  2VB6 A;  1U5P A;  4UVB B;  1MMA A;  5ABE A;  1YW0 A;  2XAQ B;  3PU3 A;  4DR5 T;  1OXZ A;  1O3X A;  2C5I T;  2L9Q A;  4JEH B;  4IL4 A;  3EDU A;  2JRK A;  1YKE B;  4ZZB A;  5JTG A;  3EUH A;  3AEC A;  1KNR A;  2CHN A;  1AJ3 A;  3OPC A;  1WR6 A;  2PFV A;  3FXD B;  2A3D A;  3PTR B;  1OED C;  2FJA A;  3NBX X;  4TWF A;  5AQG B;  5AQV B;  1JNZ A;  5JVD E;  2WY2 A;  4JV5 T;  1US7 B;  1M62 A;  3CKD A;  3FZH B;  1N36 T;  1HG2 A;  1UK5 A;  3RC3 A;  5BMV E;  2JMK A;  3QC9 A;  2WSS V;  4UF0 A;  1BR1 A;  2V5C A;  5A1L A;  3ZKR A;  3ESL A;  4HWD A;  3A8Y C;  4BA9 A;  3VKH A;  4U2Z A;  1LRZ A;  4LML A;  2VK9 A;  5IHY A;  3ZMV B;  1IBK T;  2E5L T;  3HA4 A;  3VKG A;  1FIO A;  2NTY A;  1UX5 A;  3ONL C;  2WDQ A;  3O4X E;  1IAP A;  3UU4 A;  3DJB A;  3FZM B;  4EZH A;  5C3J A;  5HXE A;  2JPF A;  5L4E A;  4KHP T;  3RYF E;  1YQ3 A;  5CA0 E;  3WAJ A;  2DLR A;  2I6H A;  4QXC B;  2CBJ A;  4GKJ T;  5ADX L;  2FUP A;  4IE7 A;  2QYW A;  3AA6 B;  3L8R A;  3LBX B;  3N2G E;  4KBM B;  1WR0 A;  2CWO A;  2ODV A;  4L5G A;  4NXM T;  3Q5X A;  3AE8 A;  3CWZ B;  3N9L A;  2H7V C;  3AEF A;  2VQE T;  3S4U A;  5CA1 E;  1BR2 A;  1X79 A;  1WRD A;  2FJD A;  3O1J A;  3QUJ A;  3TLV A;  3EDV A;  4EED A;  1D0Z A;  3UUN A;  5LG4 A;  1UCU A;  1UGO A;  4AKL A;  3LG7 A;  2V7J A;  3RGL A;  4DR2 T;  5FL1 A;  3K8P C;  2CMR A;  2WMO A;  2UUB T;  2LM9 A;  2DCF A;  2XHE B;  4IDQ A;  4QWN B;  4QX8 B;  3AVS A;  2A9U A;  4HFV A;  3ZCJ A;  4ERR A;  5ABF B;  2J1D G;  2JQH A;  3E08 A;  1NEN A;  5AQI B;  5GON E;  3EVY A;  2EHO A;  5HAX A;  3AE6 A;  2VQF T;  2UXX B;  2JIW A;  3RKO A;  4HWF A;  4WBO A;  2RA1 A;  3FXE B;  3PDY A;  4X20 E;  4YHJ A;  2NW7 A;  2AE9 A;  2YDR A;  4ZI3 D;  5L4H A;  4JYA T;  4YT0 A;  2B1E A;  1ZP0 A;  3GN5 A;  3RRW A;  2ZM2 A;  2HPJ A;  2XY8 B;  4I55 E;  4YSY A;  3AA7 B;  5LMN T;  2LSY A;  1HX8 A;  1XZY A;  2XAS B;  3JAF A;  2LKH A;  4PK6 A;  5AQS B;  3ZPO A;  4P0B A;  2JQ9 A;  2LRL A;  2MAW A;  2HN2 A;  5LP6 E;  4GK5 E;  1HS7 A;  5LCY A;  4Z91 A;  2IW5 B;  3LK2 B;  4A5X A;  4ZI7 E;  2LOS A;  3JC6 D;  2K5B B;  4ZI3 C;  3ZT5 A;  3BQL A;  3UUL A;  1GQE A;  4U31 A;  1Y64 B;  4H9N C;  5JRC A;  2D5U A;  4L0R A;  1QLB A;  2LKG A;  4I50 E;  3ZT6 A;  3OTO T;  3ZMT B;  4MAL A;  2CWY A;  3QB5 K;  2RPA A;  5LJM A;  1IZN B;  2BS3 A;  3G06 A;  1ZOY A;  3NWI A;  4PFP A;  5DQV A;  2X68 A;  4ILC A;  3C64 A;  4PJM A;  4UR9 A;  3R6N A;  5H6Q B;  4CXX A;  1VCT A;  4DVD A;  5FY0 A;  3QOF A;  4ZEY A;  4EAH A;  2A2F X;  5EK3 A;  2C0S A;  2M6I A;  1XMO T;  2KWI B;  4FJO A;  4AKI A;  3JC6 C;  3RF1 A;  4HFD A;  5FMN A;  3L09 A;  2JJ9 A;  3PUA A;  1U4Q A;  5LGU B;  2XUE A;  4JBW F;  4AI6 A;  2WDV A;  3TKL B;  2XM2 A;  3PJA A;  2N9D A;  1UX4 A;  4YLH A;  2UXN B;  3NVO A;  4GOU A;  2MTQ A;  2YU1 A;  2YN6 A;  3KFW X;  2L3L A;  3ABV A;  3N9Q A;  5F8P A;  2XQA A;  3ZN0 B;  5CFB A;  3MAC A;  4X62 T;  2BKP A;  1YXR A;  3ONJ A;  4HN9 A;  2W2U A;  4U7I A;  5HCJ A;  3AVR A;  2LM2 A;  4HFE A;  4YJ3 E;  2EHO C;  5JDF A;  1IJ6 A;  3AAE B;  3UU8 A;  1WYC A;  3FZL B;  4BJM A;  1SUM B;  2CLY C;  3HKC E;  4ZI2 D;  1Z8U A;  1W09 A;  4O4I E;  3I0O A;  2BVL A;  4PFO A;  5IYZ E;  2J47 A;  2YDS A;  4U2Y A;  5JR9 A;  3TLW A;  3UUX B;  4A98 A;  3T1H T;  3AED A;  3RC8 A;  5LGN B;  5L3E B;  5CB4 E;  5KDM C;  2BG9 A;  2I0M A;  2LE8 A;  2CLY B;  3K1S A;  5LHG B;  4YSZ A;  1ZKE A;  2IC6 A;  2WS3 A;  1NWM X;  3P8C D;  5AQP B;  3UTK A;  1HR0 T;  1D0X A;  1OED A;  2EHO D;  2C5J A;  2M6B A;  3AB3 B;  4U7Y A;  4OYK A;  3N9N A;  4UV8 B;  2FJB A;  1D1B A;  4H9O C;  4ZI2 C;  3E22 E;  4NUV A;  3UUM A;  4B3M T;  3P4S A;  5AQU B;  3B57 A;  2LSI A;  1L0V A;  4I4T E;  2KSR A;  3K3O A;  4HTE A;  5AQN B;  2BBJ A;  4JI2 T;  5HXS A;  3A5X A;  3SRZ A;  4CN6 A;  2WZH A;  3B13 A;  3JAE A;  2V6Y B;  4QKN A;  3CX8 B;  4BJN A;  2V8S V;  3VRA A;  2LT3 A;  3WAK A;  4DID B;  2L8K A;  4KMC A;  3HKE E;  3MKD A;  4UVC B;  3FB2 A;  3AE1 A;  5FVL A;  4JLE A;  4BAY B;  4C90 A;  2VKO A;  2CA5 A;  5JDQ A;  3GN5 B;  2V26 A;  3C4W A;  4LFA T;  4ZZC A;  3RIU A;  3PUR A;  5JDH A;  1YQ4 A;  4ANJ A;  2OA5 A;  2YIN A;  4U74 A;  3AE9 A;  5LGT B;  1MMN A;  4NXN T;  5AQO B;  4CXW A;  1T7S A;  2P9B A;  1E7P A;  3PE0 A;  3MXZ A;  5KXJ A;  3F31 A;  4ZOL E;  3RIA A;  3HL6 A;  5FXV A;  1Y01 A;  2KND A;  2KLQ A;  3AXJ A;  3QB5 A;  5JRE A;  2HHH T;  3VR8 A;  2E9X B;  2G0U A;  3P7I A;  3RIU C;  4L9I A;  2NW9 A;  2BVM A;  3ZEF B;  4YJ2 E;  3PUZ F;  3ZMU B;  5C2T A;  3OYZ A;  3DP7 A;  5JR9 C;  2CPT A;  4TUY E;  3UUB A;  2WM9 A;  3ZT7 A;  5JQG E;  3F2E A;  2ZM6 T;  3Q2M A;  5LA6 E;  4YSX A;  3RRC A;  3ETU A;  4I43 B;  3I9W A;  3I9Y A;  1D0Y A;  3OJA A;  2V6X A;  1LKX A;  3W15 B;  4EIW A;  3L39 A;  4V1A v;  3BQK A;  3LJC A;  1XMQ T;  3PUQ A;  3CX6 B;  4DV1 T;  1W9R A;  2KXP B;  1V9D A;  3PUG A;  1KNZ A;  4N78 D;  2QVA A;  1HF8 A;  1R8I A;  1SHZ C;  3Q9D A;  4CXY A;  4DR4 T;  4DR7 T;  3AE3 A;  3JAD A;  4NPP A;  4IGU A;  4AKR B;  2XQ4 A;  1G8X A;  4QHO A;  5TAO A;  3RHW A;  3ETV A;  4IE6 A;  2NP9 A;  4LF6 T;  3RYI E;  4OX9 T;  3T1Y T;  2ZM8 A;  4GYS A;  4QH1 A;  2YK0 A;  1FJG T;  2NTX A;  5H6R B;  5E0O A;  2X9Y A;  3PUS A;  3PUX F;  3CPZ A;  5JDN A;  3FZK B;  5J0Z A;  2SPC A;  2X0Y A;  5J2T E;  3UFG A;  3ZJ2 A;  2IHR 1;  3N9M A;  3TLS A;  4X65 T;  1BR0 A;  2DWK A;  4H63 H;  1MNE A;  3FBL A;  3NRX A;  3UT5 E;  3ZC0 A;  5FY7 A;  2OLT A;  1HCI A;  4G2A A;  4PJJ A;  3AE5 A;  5F5W A;  5HWY A;  4HWC A;  4I0U A;  5LB7 B;  2UUC T;  4X1Y E;  2UU9 T;  2LSG A;  4TWD A;  3ZSS A;  4B3R T;  2IC9 A;  2IAK A;  4IDO A;  4IDZ A;  5HXC A;  4HFB A;  2D0T A;  1ZV4 X;  2NOX A;  2X0L B;  4OYJ A;  2GK9 A;  2UXB T;  5ETW A;  2Y8D A;  2QGS A;  2H7O A;  2XZE A;  3CQC B;  4WW0 A;  3AEG A;  5EZY E;  2X67 A;  3UU5 A;  3CML A;  3GMI A;  5KMG P;  4QH4 A;  3J7Y q;  2V7K A;  2E8I A;  2XSA A;  1FEW A;  2Q9Q B;  2ACX A;  2W61 A;  3CK6 A;  3ANW B;  4ILA A;  3AXJ B;  4ISS A;  1HG5 A;  1S94 A;  2J62 A;  3NRY A;  2DL1 A;  4B6X A;  3MZK B;  2CM0 A; 
#chains in the Genus database with same CATH homology
 2C5K T;  5JDG A;  3Q5W A;  2V1D B;  1OWA A;  1LVK A;  3SOL A;  4X1K E;  2LEH A;  5KX5 E;  5L3G B;  5LHI B;  4CI3 B;  2ZM0 A;  4H63 V;  2WWU A;  4AQG A;  3QK6 A;  3FHN A;  4IHJ E;  4PK5 A;  5FXW A;  1LVF A;  4QXB B;  1NAF A;  3K3N A;  2N1G A;  3C98 B;  4H9S E;  3V5U A;  4XBF B;  4O8S A;  4FI5 A;  3ZMS B;  3O1I A;  4UEL A;  4E7S A;  2KMF A;  3U78 A;  4EYY R;  3AA0 B;  3C51 A;  1H7C A;  4U72 A;  4KUM B;  2K9A A;  2ES0 A;  3AA1 B;  1KK7 A;  2KT9 A;  1EZ3 A;  1E1H B;  3PU8 A;  2VKH A;  5FYM A;  2QA7 A;  5JR9 B;  2NW8 A;  1MND A;  2KIN B;  2WMN A;  4MFR A;  4ZS2 A;  3C4X A;  3CVR A;  3HR0 A;  2A72 A;  5DQW A;  3RH3 A;  2PBI A;  3H3A A;  4ZHQ E;  5LOV E;  2W00 A;  4EXT A;  1HTJ F;  4HGA A;  3ONX A;  3ZJ1 A;  3KBU A;  4TV8 E;  2YU2 A;  4J2C A;  4PAG A;  3KV9 A;  1CUN A;  3C50 A;  5HXR A;  1MIV A;  4YFS A;  4NUU A;  4XZC A;  5FP3 A;  3N2O A;  3RYH E;  2XAG B;  5FXZ A;  4PNI A;  5JH7 E;  1YD8 G;  4K0U A;  2XAF B;  3CX7 B;  3VHL A;  1G73 A;  4UEM A;  4ZS3 A;  5JDL A;  5LNK A;  4O2A E;  4DMV A;  2DWG A;  4JUY A;  2X9W A;  5JDM A;  1QUU A;  3SWH A;  5EK4 A;  4X1I E;  3IHR A;  3RPU A;  4DO0 A;  1D1A A;  3ZMZ B;  4MBQ A;  2BZB A;  2MBG A;  3ZYM A;  4DND A;  4PJN A;  5F3J A;  2VL8 A;  2XAH B;  3LBX A;  5DAB A;  3V5S A;  3OKQ A;  3HKD E;  3NZQ A;  4IE5 A;  2KWH A;  2E9X C;  4UF0 B;  1HFA A;  5LHH B;  2HPL A;  2LOP A;  1ZHC A;  2PJQ A;  4PJL A;  3BK9 A;  1Z0P A;  3KIN B;  5L3C B;  4HEA A;  3ZYL A;  2VAS A;  5J1G A;  1MIW A;  5LXT E;  2H3R A;  1VRB A;  4WBN E;  2X66 A;  4WNK A;  4AKG A;  4AKH A;  3CQX C;  4P09 A;  4ADZ A;  4OK0 A;  2V7L A;  3MA9 A;  3R84 B;  5LYJ E;  2DHR A;  4E7Z A;  4O4H E;  5L3F B;  4IE4 A;  2W62 A;  4MHC A;  5L3B B;  2ODU A;  4UXN B;  2CXF A;  5AFU L;  4P0A A;  3U3I A;  1BR4 A;  4HKA A;  2V7I A;  2W0G A;  3KDS E;  4MLK A;  3RYC E;  1VOM A;  1QSD A;  2EHO B;  5JRC B;  1T98 A;  4O4J E;  3ZCI A;  2XAJ B;  3NZP A;  2CE7 A;  2V7M A;  4AQF A;  4EYU A;  3I0Q A;  3ZYK A;  2X9X A;  3KBT A;  3KVA A;  4GK0 E;  3M65 A;  3O1H A;  3ZC1 A;  5EK2 A;  4O4L E;  4Z8X A;  2LHN A;  2YEV C;  4TZ4 C;  1ZEE A;  4H9P C;  3CQG B;  5HWX A;  2CCQ A;  4C91 A;  3SS1 A;  3MJX A;  2Y48 B;  1FMW A;  4UVA B;  2XTL A;  4CI1 B;  2CEA A;  3N2K E;  2VWA A;  2WBL A;  2LSK A;  5LJN A;  1MIY A;  3DTO A;  3O9X A;  3OYX A;  2N2N A;  2Q9Q A;  3T8O A;  3RX6 A;  3KVB A;  4H9R C;  2CXL A;  3WI3 A;  1D1C A;  2MYS A;  2KZ7 B;  3KV4 A;  2LHR A;  3OBV E;  4DMW A;  2I59 A;  1SA0 E;  3C4Z A;  5FY1 A;  2LSJ A;  3AAI A;  4M1P A;  2JMH A;  3LK4 2;  5M4Y A;  4QXH B;  3ZN1 B;  3GA8 A;  2D2S A;  4AXP A;  5LBQ B;  2X9H A;  4UIG A;  3K3Q C;  3AAA B;  4JEU B;  4IE0 A;  2CXD A;  4QX7 B;  1WLX A;  4ASK A;  3HKB E;  5J2U E;  2M67 A;  4KP3 C;  1FMV A;  3ANW A;  3LFM A;  4OFZ A;  4XAX B;  2LJL A;  3N9P A;  5FXX A;  5FNV E;  3MK7 C;  3L3P A;  2HH7 A;  2W63 A;  2NWB A;  2ZMA A;  4GYR A;  5DJQ C;  4G63 A;  3IF8 B;  5L3D B;  5HYA A;  3N5L A;  2PG8 A;  2DNX A;  4EZ4 A;  3IEE A;  4UV9 B;  4EOZ B;  4A56 A;  4IIJ E;  4H9Q C;  3KV5 A;  4PK4 A;  4IST A;  3I1A A;  1S35 A;  3ZLI A;  2JQQ A;  1WYB A;  2E9X A;  3FBZ A;  2E9X D;  1MMG A;  4GIW A;  2D0U A;  3LK3 B;  2K48 A;  3H37 A;  4CI2 B;  5L2L A;  2VKJ A;  4O2B E;  3HI2 A;  2XQY A;  3IBP A;  2DI4 A;  3GWH A;  3UFE A;  2BDE A;  2Q9Q C;  4CQI A;  3VU7 H;  2RP4 A;  4ILU A;  1YKH B;  5C8Y E;  4OHF A;  2ZLY A;  4AQF C;  4F6R C;  2VKD A;  4DBQ A;  3KV6 A;  1MMD A;  5HXH A;  3N9O A;  3E0Z A;  3F57 A;  1B7T A;  1IJ5 A;  4DBR A;  4TX5 A;  4EB6 E;  3J9X 1;  3D0T A;  4PW8 A;  2Z6E A;  4TN7 B;  2MOZ A;  5LBM A;  4HE8 A;  2WAU A;  2X51 A;  2Y6X A;  3BQI A;  2K24 A;  2Q9Q D;  4TV9 E;  2VB6 A;  1U5P A;  4UVB B;  1MMA A;  1YW0 A;  2XAQ B;  3PU3 A;  1OXZ A;  1O3X A;  2C5I T;  2L9Q A;  4JEH B;  3EDU A;  2JRK A;  1YKE B;  3EUH A;  1AJ3 A;  1WR6 A;  2PFV A;  3FXD B;  2A3D A;  3PTR B;  3NBX X;  5JVD E;  1US7 B;  3CKD A;  1HG2 A;  3RC3 A;  5BMV E;  2JMK A;  3QC9 A;  2WSS V;  4UF0 A;  1BR1 A;  5A1L A;  3ESL A;  4BA9 A;  3VKH A;  3ZMV B;  1LRZ A;  2VK9 A;  5IHY A;  3HA4 A;  3VKG A;  1FIO A;  2NTY A;  1UX5 A;  3O4X E;  1IAP A;  3DJB A;  4EZH A;  5HXE A;  2JPF A;  3RYF E;  5CA0 E;  3WAJ A;  2DLR A;  4QXC B;  5ADX L;  4IE7 A;  3LBX B;  3AA6 B;  4KBM B;  3N2G E;  2CWO A;  2ODV A;  4L5G A;  3Q5X A;  3CWZ B;  3N9L A;  2H7V C;  3S4U A;  5CA1 E;  1BR2 A;  1X79 A;  1WRD A;  3O1J A;  3QUJ A;  5LG4 A;  3EDV A;  1D0Z A;  3UUN A;  1UCU A;  4AKL A;  3LG7 A;  2V7J A;  3K8P C;  2CMR A;  2WMO A;  2LM9 A;  2DCF A;  2XHE B;  4QWN B;  4QX8 B;  4ERR A;  3AVS A;  4HFV A;  3ZCJ A;  2J1D G;  3E08 A;  5HAX A;  5GON E;  3EVY A;  2EHO A;  2UXX B;  3RKO A;  4WBO A;  2RA1 A;  3FXE B;  3PDY A;  4X20 E;  4YHJ A;  2NW7 A;  4ZI3 D;  2B1E A;  3GN5 A;  3RRW A;  2ZM2 A;  2HPJ A;  4I55 E;  3AA7 B;  2LSY A;  1HX8 A;  2XAS B;  3ZPO A;  4PK6 A;  4P0B A;  5LP6 E;  4GK5 E;  1HS7 A;  5LCY A;  2IW5 B;  3LK2 B;  4ZI7 E;  2LOS A;  3JC6 D;  2K5B B;  4ZI3 C;  3BQL A;  3UUL A;  5JRC A;  1Y64 B;  4H9N C;  2D5U A;  4L0R A;  4I50 E;  3ZMT B;  4MAL A;  2CWY A;  5LJM A;  1IZN B;  4PFP A;  5DQV A;  2X68 A;  4PJM A;  3C64 A;  3R6N A;  5H6Q B;  4CXX A;  4DVD A;  4EAH A;  2A2F X;  5EK3 A;  2C0S A;  4AKI A;  2KWI B;  4FJO A;  3JC6 C;  5FMN A;  3L09 A;  2JJ9 A;  3PUA A;  1U4Q A;  5LGU B;  2XUE A;  4AI6 A;  3TKL B;  2N9D A;  1UX4 A;  4YLH A;  2UXN B;  4GOU A;  5F8P A;  2MTQ A;  2YU1 A;  3KFW X;  3ZN0 B;  2L3L A;  3N9Q A;  3MAC A;  4HN9 A;  3AVR A;  4YJ3 E;  5JDF A;  2EHO C;  1IJ6 A;  3AAE B;  1WYC A;  4BJM A;  4ZI2 D;  2CLY C;  3HKC E;  4O4I E;  4PFO A;  3I0O A;  2BVL A;  5IYZ E;  5JR9 A;  3UUX B;  3RC8 A;  5LGN B;  5L3E B;  5CB4 E;  5KDM C;  2LE8 A;  2CLY B;  5LHG B;  1ZKE A;  2IC6 A;  1NWM X;  3P8C D;  3UTK A;  1D0X A;  2EHO D;  2C5J A;  3AB3 B;  4OYK A;  3N9N A;  4UV8 B;  1D1B A;  4H9O C;  4ZI2 C;  3E22 E;  4NUV A;  3UUM A;  3B57 A;  2LSI A;  4I4T E;  4HTE A;  3K3O A;  5HXS A;  3A5X A;  3SRZ A;  3B13 A;  4QKN A;  3CX8 B;  4BJN A;  2LT3 A;  3WAK A;  2L8K A;  4KMC A;  3HKE E;  3MKD A;  4UVC B;  3FB2 A;  4BAY B;  5JDQ A;  4JLE A;  4C90 A;  2VKO A;  2CA5 A;  3GN5 B;  2V26 A;  3C4W A;  3PUR A;  5JDH A;  4ANJ A;  2OA5 A;  2YIN A;  4U74 A;  5LGT B;  1MMN A;  4CXW A;  2P9B A;  3PE0 A;  3MXZ A;  3F31 A;  4ZOL E;  3HL6 A;  5FXV A;  2KND A;  2KLQ A;  5JRE A;  2E9X B;  2G0U A;  3P7I A;  4YJ2 E;  4L9I A;  2NW9 A;  2BVM A;  3ZEF B;  3ZMU B;  3OYZ A;  3DP7 A;  5JR9 C;  4TUY E;  5JQG E;  2WM9 A;  3F2E A;  3Q2M A;  5LA6 E;  3RRC A;  3ETU A;  4I43 B;  3I9W A;  3I9Y A;  1D0Y A;  3OJA A;  1LKX A;  3W15 B;  4EIW A;  4V1A v;  3BQK A;  3LJC A;  3PUQ A;  3CX6 B;  2KXP B;  1V9D A;  3PUG A;  1KNZ A;  4N78 D;  1HF8 A;  1SHZ C;  3Q9D A;  4CXY A;  4IGU A;  4AKR B;  1G8X A;  4QHO A;  5TAO A;  3ETV A;  4IE6 A;  2NP9 A;  3RYI E;  2ZM8 A;  4GYS A;  2YK0 A;  2NTX A;  5H6R B;  5E0O A;  2X9Y A;  3PUS A;  3J7Y q;  3CPZ A;  5JDN A;  2SPC A;  5J2T E;  3ZJ2 A;  3N9M A;  1BR0 A;  2DWK A;  4H63 H;  1MNE A;  3FBL A;  3NRX A;  3UT5 E;  3ZC0 A;  5FY7 A;  1HCI A;  4G2A A;  4PJJ A;  5HWY A;  4X1Y E;  2LSG A;  2IC9 A;  2IAK A;  4IDZ A;  5HXC A;  2D0T A;  1ZV4 X;  2NOX A;  2X0L B;  4OYJ A;  2GK9 A;  5ETW A;  2Y8D A;  2QGS A;  2H7O A;  5EZY E;  3CQC B;  4WW0 A;  4CZZ B;  5KMG P;  2X67 A;  3CML A;  3GMI A;  2V7K A;  2E8I A;  1FEW A;  2Q9Q B;  2ACX A;  2W61 A;  5FY0 A;  3ANW B;  4ISS A;  1HG5 A;  1S94 A;  3NRY A;  4B6X A;  3MZK B;  2CM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...