4H9OC

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9oC00
4H9PC 4H9NC 4H9RC 5KDMC 4H9SE 4H9OC 4HGAA 4H9QC
chains in the Genus database with same CATH superfamily
5IWAT 4AKLA 2LJLA 3A7MA 1E7PA 5AQPB 3KBTA 4B6XA 5JQGE 3PE0A 4ZS2A 3EI0A 4H9RC 3ZMUB 2AE9A 4Q25A 4AKHA 4LF8T 2IMLA 2SPCA 3KV4A 2QA7A 4PJJA 4DBRA 5DQVA 2YINA 2H7VC 2IW5B 4TNWA 4GOUA 3Q5DA 4QH4A 2CHNA 1XNQT 4HGAA 5JVDE 1WRDA 4YTMA 3N9QA 4YSYA 4TWHA 4YSXA 3PUZF 4G2AA 3KVBA 3R6NA 2OV9A 3FZFB 4U72A 4DV0T 1XDPA 2W4XA 2C5IT 2W00A 4EZ4A 2LKHA 3L8RA 3ZSTA 4GK0E 5AQHB 3PU3A 2NP9A 3TKLB 3K3OA 5HXHA 1XMQT 2VQFT 4Z91A 2YOEA 2WU5A 3AEEA 2WY2A 2GK9A 4DMVA 4JI5T 2LOSA 2W0GA 3AE3A 3P8CD 2F4VT 5FYMA 5BMVE 4MLKA 4TX5A 2BS3A 1BR2A 4ZZBA 1ZKEA 3LFMA 5J0ZA 2HPJA 3UUMA 5FXXA 3N2GE 4ILCA 2KWIB 4DBQA 4ZEYA 2V7JA 2OLTA 4A5XA 1UX5A 4LFAT 3AVSA 4QX8B 1N33T 3AE1A 3AEBA 1KNZA 2I6HA 3TLTA 3F57A 2ZM8A 3HI2A 3R84B 3UTKA 3E08A 3PUXF 2VK9A 3RHWA 4AQFC 2LSGA 2B76A 4YY3T 2CXLA 3PUVF 4QH1A 1M62A 3HA4A 2XSBA 2M67A 4WBOA 2LSKA 1BR0A 3U78A 4L9IA 3ZC0A 3UULA 4WBNE 4ISSA 2K24A 4I50E 2PFVA 3JC6C 1YD8G 4JI2T 4G63A 4JI7T 3FB2A 4I0UA 4L0RA 3AA1B 3VRAA 4GYSA 5AQLB 3PJAA 5C3JA 2PG8A 2B1EA 2VVSA 1N32T 4PJMA 5FY1A 2ES0A 5HWXA 1FMVA 3C64A 5FY7A 3KV5A 4HEAA 2EHOD 1E1HB 4NUVA 4X62T 1WR6A 2OA5A 2WZIA 3ZCIA 3ZMTB 2JQKA 2UXXB 4E7SA 2CMRA 2X0HA 4PAGA 3C4WA 3RX6A 3FZLB 5FP3A 3RRWA 4QWNB 4B3ST 2A72A 4DR3T 4MBQA 1XMOT 3FBLA 2JQQA 3BQKA 5JDNA 3OKQA 2BKNA 2CBIA 3HR0A 3RIAA 1MNEA 3MKDA 3V5SA 3RIUC 2NTYA 3ZT5A 2D0UA 2BVMA 1LRZA 2CEAA 2K48A 3P4WA 4X1YE 3UUBA 4AKGA 4LFBT 4YJ2E 4LF7T 5FL1A 2VURA 4ZI7E 1HTJF 1UK5A 4DV4T 3SRZA 4LF6T 2MAWA 3H3AA 2WMNA 5F3JA 4F8HA 4O2BE 2V7MA 1WFDA 4UELA 5AQQB 4C91A 3WI3A 3EVYA 4XBFB 1N34T 3VKHA 3ONLC 3ZJ1A 5L3EB 2ACZA 5L4HA 2LRLA 3OVUA 4UF0A 3SS1A 1XZYA 1VCTA 3TLUA 4KMCA 4JI3T 1MIVA 4HFIA 2IIUA 3UFEA 5L3GB 3ZMVB 3D0TA 2XM2A 3RC3A 4AQFA 1X9BA 2QRXA 2MYSA 4LF4T 1Z0PA 1UX4A 3H3MA 2W2UA 1HG2A 3KV6A 4O4HE 3AAAB 2W66A 3TLWA 5BR8T 2PTFA 4WW0A 3ETUA 3P7IA 4IE0A 4P0AA 2J62A 1T7SA 2LSYA 4UR9A 1ZEEA 3P4QA 1YKHB 4LMLA 2DLRA 2JQHA 2V6XA 4IL9A 2LM9A 3AEDA 4IIJE 2X0LB 5LGTB 5H6RB 3C51A 1IAPA 3CK6A 2E9XB 2CLYC 2QGSA 4LF9T 5HEUA 5DJQC 4B3RT 4TWFA 2XPKA 4EEDA 4TV9E 3SFEA 4EAHA 4AXPA 4EV6A 4JI4T 1HF8A 2V5CA 4JI1T 2WBLA 4YHJA 4ZI3D 4YTPA 3FXEB 3M65A 2XAQB 5A1LA 1CUNA 3W15B 1ZHCA 1XDOA 3T8OA 4IDOA 3QK6A 2X9YA 3N9MA 3FZMB 2KWHA 2MOZA 2UUAT 4JI6T 1T72A 2DWKA 4DR1T 1D0XA 3TLSA 4BAYB 5JR9B 5HXEA 5LJNA 3C98B 2BKOA 2VL0A 1LVFA 5AQJB 3O1JA 1H7CA 2XQ9A 5JDFA 4YJ3E 4ANJA 5HWYA 2CCQA 3ETVA 3AXJB 4HN9A 1HX8A 3DJBA 3ZN1B 4P09A 3OYZA 3ZSSA 3I0OA 5JTGA 4DNDA 3K3QC 2K5BB 3I0QA 2Z6EA 2CWOA 5GONE 2UXNB 2DI4A 3U3IA 3LSVA 2VKJA 2PJQA 4K0KT 5CA1E 2K9AA 4JUYA 3UQ4A 4JI0T 4AKRB 5EK2A 2XQ4A 3ABVA 3I9YA 2ZMAA 4AIUA 1J1JA 3AE2A 4HWFA 1HNWT 1JNZA 1D1CA 2NTXA 4HFVA 3LK3B 3IA3A 5HCJA 5E0OA 2Y6XA 2DHRA 3CIRA 2NR4A 2FJEA 4DR2T 3PUWF 1W9RA 2ODUA 4TZ4C 3AA7B 2AXDS 2UUCT 3PJAJ 3AEGA 5C8YE 2M6BA 5LB7B 2J47A 5DABA 3RQUA 1S94A 4E7ZA 2CPTA 1IBLT 4P0BA 3UUNA 2CHOA 3L39A 3ZYKA 3IF8B 3P4SA 4X20E 1MMAA 2J4GA 5HEOA 2KNDA 4GKJT 4H9SE 3EHZA 5L3BB 2H3RA 2XQYA 3UU8A 4CI3B 4EYYR 1FMWA 3FXDB 1KK7A 1G8XA 1FEWA 2LE8A 2KSRA 3KBUA 5LYJE 1G73A 2WU2A 4IE7A 2A2FX 3AE5A 5H6QB 3AB3B 5JR9C 2XY8B 3J7Yq 2UXBT 2W63A 2QVAA 3MK7C 4ZI2D 3PUGA 3SOLA 4XZCA 3NKZA 4ASKA 4PFOA 2JRKA 3K1SA 4HFDA 5EK4A 2YKSA 3T1YT 4JEUB 3AE9A 4HKAA 4WYVA 4ZHQE 4ILAA 1QSDA 2BBJA 4HWCA 2KMFA 5HAXA 3O1HA 4KX6A 5JRCB 4QH5A 2NW7A 5KMGP 2XJ7A 5EK3A 2WP9A 1I94T 1XNRT 3RGLA 3K3NA 3K8PC 1YQ4A 2XAJB 3LK42 4H9QC 4DR5T 1SUMB 4GKKT 3MA9A 2FJDA 4HTEA 2WDQA 1MMNA 4U7YA 4OX9T 1QLBA 2XSAA 2W61A 3RLFF 2HPLA 2HHHT 3IBPA 2JMHA 3N9LA 4I4TE 1OEDC 3UQ7A 2VB6A 4HFBA 1NWMX 4ZOLE 5FXWA 3JCFA 2VWAA 4U74A 5FVLA 3RQWA 3J9X1 2NW9A 2LLYA 1OWAA 2KXPB 4AKIA 4A97A 2FJBA 1SE7A 3NVOA 3BQIA 2E9XA 3KINB 1W0AA 3RIFA 4MALA 4A56A 5FVKA 2Q9QD 3LBXB 3VU7H 4B3MT 4Z8XA 4O4IE 5AQNB 1WR0A 2WMOA 3B57A 3OBVE 3N9NA 1WLXA 4AISA 3KDSE 4CXXA 2X9HA 1I6ZA 3IEEA 4DVDA 2K3WA 1MMDA 4ZI3C 1VOMA 5JREA 5ABEA 2KINB 4JYAT 4EIWA 2LRKA 3RYFE 2V6YB 5FY0A 4ZZCA 2A3DA 4LFCT 2M6IA 3AE8A 3P4PA 2LT3A 1UGOA 1YKEB 4IGUA 3HL6A 2D5UA 3AEAA 5AQMB 2RPAA 2X66A 1VCSA 3DP7A 3NZQA 5JR9A 2X9WA 4PNIA 4U3CA 1ZOYA 3RKOA 3ZPOA 1D0YA 4LMJA 3OTOT 2CLYB 2E8IA 4DV7T 5FL0A 3O4XE 2FBWA 3LJCA 4X66T 3AVRA 3AXJA 3HKBE 4KBMB 4DV2T 2VQET 2DNXA 2N9DA 3BK9A 4X65T 5HEGA 5F5WA 1IBMT 4I43B 4PK5A 4UXNB 3AE6A 3CQXC 3ZN0B 4OFZA 3I1AA 2H89A 5ABHA 2XHEB 2LSJA 2I59A 1UURA 5AQTB 4U2ZA 4QX7B 4NUUA 1YXRA 3A8YC 5HEJA 4CN6A 5LHGB 2ODVA 4PK4A 3GA8A 4IHJE 3ZMZB 2V5DA 1YQ3A 2WM9A 3CPZA 2VL8A 3ANWA 1L0VA 3LG7A 3BQLA 4EZHA 4GK5E 5LBMA 2FJAA 2CXFA 5KXJA 2ZLYA 3JAEA 2JPFA 2PBIA 1UUSA 4DMWA 1US7B 2LM2A 1NEKA 3T1HT 4ISTA 4H9NC 3PUSA 3SFDA 4CZZB 3GN5B 2P9BA 3F31A 4OK0A 5HXRA 4UV8B 3B13A 2NOXA 3ZYLA 2DCFA 2Q9QB 1SHZC 5J2UE 1HR0T 4UVCB 3RI5A 4DIDB 3RYIE 4IREA 2V7IA 4YSZA 4Z90A 3ESLA 2V1DB 4L5GA 2UU9T 4CXWA 2XQ3A 2V26A 4ZI2C 5KDMC 3FHNA 3UU3A 2BG9B 1AJ3A 5AQKB 2D9DA 4CQIA 4EEBA 4GIWA 2N2NA 4YHHT 2EHOB 1T98A 3RRCA 3PUQA 4GYRA 2IAKA 5L3DB 3V5UA 1HNZT 5JDLA 4FI5A 4H63V 1VRBA 5M4YA 2XTLA 5JRCA 2HH7A 5JDMA 1N36T 2CWYA 1J5ET 1Z8UA 2JMKA 1YW0A 2MBGA 4TN7B 5CGMA 4IE6A 4V1Av 2C0SA 3CQGB 4EGWA 3RIUA 4PK6A 2WDVA 3LK2B 4LMKA 4HWHA 3RC8A 2BVLA 3RPUA 3IHRA 4PFPA 3A5XA 3ONJA 4IDPA 4IE4A 3CVRA 5JDHA 5ABGA 4JLEA 1HG5A 3Q2MA 2VKHA 1WYBA 2IHR1 4PJNA 4H9OC 3ONXA 3X1DA 2LHRA 3KVAA 2HN2A 2L3LA 5EZYE 4IE5A 1IJ6A 2XQ6A 5LMUT 4OHFA 5LOVE 4EXTA 1U4QA 1X79A 2QYWA 2BZBA 2WAUA 3M3ZB 5LBQB 1KNPA 4EYUA 3QB5K 2Q9QC 2MTQA 3AE7A 5LA6E 3Q9DA 1HCIA 1HS7A 3PV0F 1MNDA 4QHOA 4OYKA 3LBXA 1KNRA 2CRBA 3OPCA 5J2TE 2C5JA 4KHPT 1HX1B 4BJMA 3N9OA 1T8BA 3H37A 3ZC1A 3ANWB 1W0BA 2CA5A 4X1IE 3C50A 3B5MA 1W09A 4K0UA 3GWHA 3UT5E 2XASB 3QB5A 4N78D 1KEYA 1OEDB 2BG9C 1MMGA 2V6YA 2XM1A 3CX7B 2EHOC 2NWBA 3F2EA 2FUPA 2A9UA 5FXZA 4ZXLA 3UU5A 1M7KA 2ZM6T 2VKOA 4ZS3A 3TLVA 2W62A 3AEFA 4UVBB 2C5KT 1BR4A 1UCUA 3ZT6A 1R8IA 2LOPA 1GQEA 3OYXA 3L3PA 3E22E 4DUZT 5KX5E 3HKCE 4PW8A 3ZEFB 3ZT7A 4DO0A 2X51A 4I55E 5ETWA 3SWHA 3MJXA 3PUAA 4LF5T 3E0ZA 5HXSA 2W67A 5LGUB 3EAMA 3HKDE 4CXYA 1QUUA 2X0YA 3N2KE 4JBWF 3RYHE 4P1NA 1ZV4X 4TWDA 1EZ3A 2BDEA 1O3XA 5L3CB 1HFAA 3O9XA 3ZJ2A 3FBZA 2NW8A 2XQ8A 1KFYA 2XQ5A 4HFCA 5L4EA 3JADA 2N1GA 3PDYA 1MIYA 4X1KE 2VVNA 3RYCE 2CE7A 4J2CA 4MHCA 1DU2A 3WAJA 3CX6B 2RA1A 1NENA 3S4UA 1LVKA 2X9XA 1JNRA 3NZPA 3GN5A 4YT0A 3NRXA 2WB5A 1IZNB 2YU2A 2Q9QA 5IYZE 5LG4A 5JDQA 2I0MA 2YDQA 2WCAA 3VR8A 1CHUA 2YK0A 1SA0E 1IBKT 4A98A 5CJ5A 2YDSA 2V7LA 2VASA 3QUJA 2LKGA 3I9WA 5C2TA 2JIWA 1Y64B 2BG9A 4CI1B 1E2AA 3G06A 2ACXA 5CB4E 3CQCB 2BBHA 4B3TT 1WCRA 2CXDA 4YXDA 4BJNA 2EHOA 2CBJA 2X68A 2JQ9A 5IHYA 4KHZF 3FZHB 3PTRB 3AA0B 5AFUL 2V7KA 4DR4T 2XAGB 5JDGA 3ZCJA 3O1IA 2KLQA 4NPPA 5ADXL 5LHIB 4QXBB 5CFBA 1FIOA 3EUHA 4TV8E 3EABA 1U5PA 2XAHB 3QOFA 3CMLA 2XZEA 1D0ZA 3Q5EA 5ABFB 1WYCA 3AAIA 3Q5WA 2UXCT 4EOZB 2WSSV 2ZM2A 5LMNT 2WDRA 2YEVC 3UU4A 2BKPA 3UFGA 1S35A 2E9XD 3MZKB 2WWVA 4YTNA 4QXCB 4IL4A 3QNUA 3VR9A 4IT4A 3ZLIA 3DTOA 4NXNT 2R6GF 4YLHA 4AQGA 3PURA 3AE4A 2D0TA 3GMIA 4ADZA 5FXVA 1Y01A 1V9DA 3PUYF 1FJGT 2BG9E 2UUBT 5AQSB 3N9PA 4TNVA 4HWIB 4O8SA 1HNXT 5L3FB 4UIGA 4KI0F 3RF1A 3P50A 3UUXB 5L47A 4JI8T 3HKEE 5FMNA 3QC9A 1ZP0A 4FJOA 4MFRA 5AQFB 4COFA 4CN1A 4U2YA 2JJ9A 3ZYMA 4YFSA 2H88A 4JV5T 5HXCA 2IC6A 4PJLA 1NAFA 5AQRB 1OEDA 1OXZA 2IUBA 5HYAA 3VHLA 4EB6E 3AAEB 1IJ5A 4C90A 5LG3A 1BR1A 2XAFB 3L09A 4NIQA 2HN1A 4OYJA 3OJAA 2Y48B 2IDOB 2CM0A 2LSIA 1D1AA 3C4XA 5IUXA 2VKDA 2XUEA 1LKXA 2UXDT 3VKGA 1D1BA 2E5VA 2WZHA 3C4ZA 4IDNA 3PU8A 4M1PA 3CWZB 2G0UA 2H7OA 2YDRA 4XAXB 2DWGA 4DV6T 4JEHB 4DR7T 2MPKA 4WZXA 3EDVA 3RH3A 4X64T 3CX8B 3EDUA 2XQAA 5AQOB 2DL1A 5F8PA 4DUYT 4H63H 4UEMA 2LHNA 3LDQB 2YU1A 2WQYA 2LEHA 1MIWA 3AA6B 4KP3C 3MXZA 4O4LE 1OEDE 4IDQA 5LNKA 5LCYA 2X67A 4WNKA 4TUYE 2YN6A 4DV5T 3VRBA 2KZ7B 2RP4A 3NBXX 3ZKRA 4DV3T 2IC9A 2E5LT 5J1GA 2E2AA 5L2LA 4U7IA 3JC6D 4HFEA 3FZKB 4AQYT 4HWDA 5LJMA 3WAKA 4O2AE 2KT9A 5HCMA 3NRYA 1XWMA 2J1DG 3CKDA 5AQUB 3KV9A 2Y8DA 3MACA 3JAFA 3ZMSB 4BA9A 2WS3A 1J5WA 4DV1T 5CA0E 5FNVE 2D2SA 5AQIB 5LGNB 4QKNA 5HEHA 2V8SV 2L8KA 4QXHB 5LXTE 3NWIA 4CN4A 4X5TA 5DQWA 5AQVB 2BS4A 5LHHB 4UVAB 3UU6A 2BS2A 1KF6A 4H9PC 3AECA 4U33A 1B7TA 3KFWX 4O4JE 4DR6T 4CI2B 5TAOA 2WWUA 2ZM0A 3N5LA 5ABFA 3RKGA 5FKYA 4ILUA 4U31A 4NXMT 4KUMB 4AI6A 4F6RC 5AQGB 4IDZA 4ILBA 5LP6E 2XQ7A 4UV9B 3Q5XA 4ERRA 2L9QA 3P4RA 4UF0B 3N2OA 2E9XC 4HE8A 5JH7E 4HFHA
chains in the Genus database with same CATH topology
4AKLA 3I9WA 5LHGB 2ODVA 1HF8A 3GA8A 4PK4A 4IHJE 3ZMZB 2LJLA 2WBLA 3KBTA 4YHJA 4ZI3D 1Y64B 4B6XA 2WM9A 3FXEB 4CI1B 3M65A 3PE0A 5JQGE 3CPZA 4ZS2A 2VL8A 2ACXA 4H9RC 5CB4E 2XAQB 3CQCB 3ANWA 2CXDA 3ZMUB 1CUNA 5A1LA 3W15B 3LG7A 4AKHA 3BQLA 1ZHCA 4BJNA 2EHOA 3T8OA 2X68A 4EZHA 5IHYA 4GK5E 3QK6A 2X9YA 3N9MA 2SPCA 5LBMA 3KV4A 3PTRB 2QA7A 4PJJA 2KWHA 2MOZA 3AA0B 5AFUL 2CXFA 2V7KA 4DBRA 2DWKA 1D0XA 2XAGB 2ZLYA 5JDGA 4BAYB 3ZCJA 3O1IA 5DQVA 5JR9B 2JPFA 2PBIA 5HXEA 5LJNA 3C98B 4DMWA 2KLQA 1US7B 2YINA 2H7VC 2IW5B 1LVFA 4GOUA 5ADXL 3O1JA 5LHIB 4QXBB 4ISTA 4H9NC 1FIOA 1H7CA 3EUHA 4TV8E 3PUSA 5JDFA 1U5PA 4HGAA 2XAHB 4YJ3E 4ANJA 4CZZB 3CMLA 3GN5B 5HWYA 2P9BA 5JVDE 3F31A 1WRDA 4OK0A 2CCQA 3N9QA 3ETVA 5HXRA 1D0ZA 4HN9A 1HX8A 1WYCA 3AAIA 4UV8B 3DJBA 3Q5WA 3ZN1B 3B13A 2NOXA 4G2AA 4P09A 3KVBA 3R6NA 3OYZA 4U72A 3ZYLA 3I0OA 2DCFA 2Q9QB 2C5IT 2W00A 4DNDA 1SHZC 5J2UE 4EZ4A 4EOZB 3K3QC 2WSSV 2K5BB 2ZM2A 3I0QA 4UVCB 2Z6EA 4GK0E 2CWOA 3RYIE 3PU3A 5GONE 2NP9A 2UXNB 2DI4A 3U3IA 2YEVC 2V7IA 3TKLB 2VKJA 2PJQA 3ESLA 3K3OA 5HXHA 1S35A 2V1DB 5CA1E 4L5GA 2E9XD 2K9AA 3MZKB 4JUYA 4QXCB 3ZLIA 3DTOA 4AKRB 4CXWA 5EK2A 2V26A 4ZI2C 3I9YA 4YLHA 2ZMAA 5KDMC 3FHNA 4AQGA 1AJ3A 3PURA 2GK9A 4DMVA 2LOSA 4CQIA 1D1CA 2D0TA 2NTXA 2W0GA 3GMIA 4ADZA 5FXVA 4GIWA 2N2NA 3P8CD 1V9DA 2EHOB 4HFVA 1T98A 5FYMA 3RRCA 3PUQA 4GYRA 3LK3B 2IAKA 5BMVE 4MLKA 5L3DB 4TX5A 3V5UA 1BR2A 5E0OA 2Y6XA 2DHRA 1ZKEA 3LFMA 5JDLA 2HPJA 3UUMA 4FI5A 5FXXA 3N2GE 3N9PA 2KWIB 4O8SA 4DBQA 4H63V 2V7JA 5L3FB 1VRBA 5M4YA 4UIGA 2XTLA 2ODUA 5JRCA 4TZ4C 2HH7A 3AA7B 5JDMA 1UX5A 2CWYA 3UUXB 3AVSA 4QX8B 2JMKA 1YW0A 2MBGA 4TN7B 3HKEE 4IE6A 5FMNA 5C8YE 3QC9A 5DABA 4V1Av 1KNZA 1S94A 4E7ZA 4FJOA 2C0SA 3CQGB 4MFRA 3F57A 2JJ9A 2ZM8A 3HI2A 4PK6A 4P0BA 3R84B 4YFSA 3LK2B 3UTKA 3E08A 3UUNA 3ZYMA 5HXCA 2IC6A 3ZYKA 3IF8B 2VK9A 4PJLA 3RC8A 2BVLA 3RPUA 4AQFC 3IHRA 4X20E 1NAFA 4PFPA 2LSGA 1MMAA 3A5XA 1OXZA 2KNDA 4IE4A 3CVRA 2CXLA 5JDHA 4H9SE 4JLEA 1HG5A 5HYAA 3VHLA 3Q2MA 2H3RA 5L3BB 2XQYA 4CI3B 4EYYR 1FMWA 3FXDB 1KK7A 1G8XA 3HA4A 4EB6E 1FEWA 3AAEB 2M67A 2LE8A 2VKHA 1IJ5A 3KBUA 5LYJE 4WBOA 1WYBA 4C90A 1G73A 2LSKA 1BR0A 4PJNA 3U78A 4H9OC 4L9IA 3ZC0A 1BR1A 2XAFB 3UULA 3ONXA 4IE7A 3L09A 2A2FX 4WBNE 4ISSA 5H6QB 4OYJA 3AB3B 2K24A 5JR9C 3OJAA 2Y48B 4I50E 3J7Yq 2W63A 2LHRA 2PFVA 3JC6C 3KVAA 3MK7C 1YD8G 4ZI2D 4G63A 3PUGA 2L3LA 5EZYE 2CM0A 2LSIA 1D1AA 3C4XA 3FB2A 3SOLA 4IE5A 4XZCA 2VKDA 2XUEA 1IJ6A 4ASKA 4PFOA 2JRKA 1LKXA 4L0RA 5EK4A 3VKGA 3AA1B 4GYSA 1D1BA 4OHFA 5LOVE 4EXTA 1U4QA 1X79A 3C4ZA 2PG8A 4JEUB 2B1EA 2BZBA 3PU8A 4HKAA 2WAUA 5LBQB 4M1PA 3CWZB 4ZHQE 4PJMA 5FY1A 2ES0A 5HWXA 1FMVA 3C64A 4EYUA 1QSDA 2G0UA 2H7OA 3KV5A 2Q9QC 2KMFA 2MTQA 5FY7A 5LA6E 3Q9DA 4XAXB 5HAXA 1HCIA 2DWGA 3O1HA 1HS7A 1MNDA 4QHOA 5JRCB 4OYKA 3LBXA 4HEAA 2EHOD 1E1HB 5J2TE 4NUVA 4JEHB 2C5JA 2NW7A 5KMGP 1WR6A 2OA5A 4BJMA 3ZCIA 3ZMTB 5EK3A 3N9OA 2UXXB 4E7SA 2CMRA 3EDVA 3RH3A 4PAGA 3H37A 3C4WA 3ZC1A 3K3NA 3ANWB 3K8PC 3RX6A 2XAJB 5FP3A 3LK42 3CX8B 3RRWA 2CA5A 4QWNB 4H9QC 2A72A 4X1IE 3C50A 3EDUA 4MBQA 3MA9A 4K0UA 3GWHA 3UT5E 3FBLA 2JQQA 3BQKA 4HTEA 5JDNA 1MMNA 2XASB 3OKQA 4N78D 5F8PA 1MMGA 2W61A 4H63H 3HR0A 1MNEA 3MKDA 3V5SA 4UEMA 2HPLA 3CX7B 2NTYA 2LHNA 2YU1A 2EHOC 2LEHA 1MIWA 2D0UA 2NWBA 3F2EA 5FXZA 3IBPA 2JMHA 2BVMA 1LRZA 3AA6B 2CEAA 2K48A 4KP3C 3MXZA 3N9LA 4O4LE 4I4TE 4X1YE 5LCYA 2X67A 4WNKA 4TUYE 5LNKA 4AKGA 4YJ2E 2KZ7B 2RP4A 2VB6A 3NBXX 2VKOA 4ZS3A 2W62A 2IC9A 4UVBB 1NWMX 4ZOLE 4ZI7E 2C5KT 1HTJF 5FXWA 5J1GA 2VWAA 1BR4A 1UCUA 4U74A 5L2LA 3JC6D 3J9X1 3SRZA 2LOPA 2NW9A 1OWAA 3H3AA 2WMNA 5F3JA 3OYXA 3L3PA 2KXPB 3E22E 4AKIA 4O2BE 5KX5E 3HKCE 5LJMA 2V7MA 4UELA 4PW8A 3WAKA 3BQIA 4O2AE 2KT9A 4C91A 3ZEFB 3NRYA 3WI3A 3EVYA 4XBFB 2E9XA 3KINB 4DO0A 2J1DG 3CKDA 4MALA 3KV9A 2X51A 2Y8DA 4I55E 5ETWA 4A56A 3MACA 3VKHA 3SWHA 2Q9QD 3MJXA 3LBXB 3VU7H 3PUAA 3ZJ1A 3ZMSB 3E0ZA 5L3EB 4Z8XA 4O4IE 4BA9A 5HXSA 5LGUB 4UF0A 3SS1A 5CA0E 3HKDE 5FNVE 2D2SA 2WMOA 4KMCA 5LGNB 4CXYA 1MIVA 3B57A 3N9NA 3OBVE 1WLXA 4QKNA 1QUUA 3N2KE 3KDSE 4CXXA 2X9HA 3RYHE 3IEEA 3UFEA 1ZV4X 4DVDA 1MMDA 5L3GB 2L8KA 3D0TA 4QXHB 3ZMVB 3RC3A 1EZ3A 4ZI3C 1VOMA 2BDEA 1O3XA 4AQFA 5LXTE 5JREA 2KINB 5L3CB 1HFAA 4EIWA 3O9XA 3ZJ2A 3FBZA 3RYFE 2MYSA 5FY0A 5DQWA 2NW8A 2A3DA 1Z0PA 1UX4A 2LT3A 5LHHB 1HG2A 3KV6A 4O4HE 2N1GA 4UVAB 3PDYA 1YKEB 1MIYA 3AAAB 4IGUA 3HL6A 2D5UA 4H9PC 4X1KE 2X66A 3DP7A 3NZQA 3ETUA 4WW0A 3RYCE 2CE7A 4J2CA 4MHCA 3P7IA 5JR9A 2X9WA 4IE0A 4PNIA 3RKOA 4P0AA 3ZPOA 3WAJA 2LSYA 1D0YA 2RA1A 3CX6B 3S4UA 1ZEEA 1B7TA 1YKHB 2CLYB 3KFWX 4O4JE 2E8IA 1LVKA 2DLRA 2X9XA 3NZPA 5TAOA 4CI2B 3GN5A 3O4XE 2LM9A 2WWUA 3LJCA 2ZM0A 3NRXA 3N5LA 4IIJE 2X0LB 3AVRA 5LGTB 3HKBE 4KBMB 1IZNB 4ILUA 5H6RB 2YU2A 3C51A 1IAPA 2DNXA 2N9DA 3BK9A 2E9XB 2CLYC 2QGSA 2Q9QA 4I43B 4KUMB 4AI6A 4F6RC 4PK5A 4UXNB 4IDZA 5IYZE 3CQXC 3ZN0B 5LG4A 5LP6E 5JDQA 4OFZA 3I1AA 4UV9B 5DJQC 2XHEB 2LSJA 3Q5XA 4ERRA 2YK0A 2L9QA 1SA0E 2I59A 4UF0B 4TV9E 2V7LA 3N2OA 2E9XC 2VASA 4QX7B 3QUJA 4EAHA 4HE8A 4NUUA 4AXPA 5JH7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P C;  4H9N C;  4H9R C;  5KDM C;  4H9S E;  4H9O C;  4HGA A;  4H9Q C; 
#chains in the Genus database with same CATH topology
 5IWA T;  4AKL A;  2LJL A;  3A7M A;  1E7P A;  5AQP B;  3KBT A;  4B6X A;  5JQG E;  3PE0 A;  4ZS2 A;  3EI0 A;  4H9R C;  3ZMU B;  2AE9 A;  4Q25 A;  4AKH A;  4LF8 T;  2IML A;  2SPC A;  3KV4 A;  2QA7 A;  4PJJ A;  4DBR A;  5DQV A;  2YIN A;  2H7V C;  2IW5 B;  4TNW A;  4GOU A;  3Q5D A;  4QH4 A;  2CHN A;  1XNQ T;  4HGA A;  5JVD E;  1WRD A;  4YTM A;  3N9Q A;  4YSY A;  4TWH A;  4YSX A;  3PUZ F;  4G2A A;  3KVB A;  3R6N A;  2OV9 A;  3FZF B;  4U72 A;  4DV0 T;  1XDP A;  2W4X A;  2C5I T;  2W00 A;  4EZ4 A;  2LKH A;  3L8R A;  3ZST A;  4GK0 E;  5AQH B;  3PU3 A;  2NP9 A;  3TKL B;  3K3O A;  5HXH A;  1XMQ T;  2VQF T;  4Z91 A;  2YOE A;  2WU5 A;  3AEE A;  2WY2 A;  2GK9 A;  4DMV A;  4JI5 T;  2LOS A;  2W0G A;  3AE3 A;  3P8C D;  2F4V T;  5FYM A;  5BMV E;  4MLK A;  4TX5 A;  2BS3 A;  1BR2 A;  4ZZB A;  1ZKE A;  3LFM A;  5J0Z A;  2HPJ A;  3UUM A;  5FXX A;  3N2G E;  4ILC A;  2KWI B;  4DBQ A;  4ZEY A;  2V7J A;  2OLT A;  4A5X A;  1UX5 A;  4LFA T;  3AVS A;  4QX8 B;  1N33 T;  3AE1 A;  3AEB A;  1KNZ A;  2I6H A;  3TLT A;  3F57 A;  2ZM8 A;  3HI2 A;  3R84 B;  3UTK A;  3E08 A;  3PUX F;  2VK9 A;  3RHW A;  4AQF C;  2LSG A;  2B76 A;  4YY3 T;  2CXL A;  3PUV F;  4QH1 A;  1M62 A;  3HA4 A;  2XSB A;  2M67 A;  4WBO A;  2LSK A;  1BR0 A;  3U78 A;  4L9I A;  3ZC0 A;  3UUL A;  4WBN E;  4ISS A;  2K24 A;  4I50 E;  2PFV A;  3JC6 C;  1YD8 G;  4JI2 T;  4G63 A;  4JI7 T;  3FB2 A;  4I0U A;  4L0R A;  3AA1 B;  3VRA A;  4GYS A;  5AQL B;  3PJA A;  5C3J A;  2PG8 A;  2B1E A;  2VVS A;  1N32 T;  4PJM A;  5FY1 A;  2ES0 A;  5HWX A;  1FMV A;  3C64 A;  5FY7 A;  3KV5 A;  4HEA A;  2EHO D;  1E1H B;  4NUV A;  4X62 T;  1WR6 A;  2OA5 A;  2WZI A;  3ZCI A;  3ZMT B;  2JQK A;  2UXX B;  4E7S A;  2CMR A;  2X0H A;  4PAG A;  3C4W A;  3RX6 A;  3FZL B;  5FP3 A;  3RRW A;  4QWN B;  4B3S T;  2A72 A;  4DR3 T;  4MBQ A;  1XMO T;  3FBL A;  2JQQ A;  3BQK A;  5JDN A;  3OKQ A;  2BKN A;  2CBI A;  3HR0 A;  3RIA A;  1MNE A;  3MKD A;  3V5S A;  3RIU C;  2NTY A;  3ZT5 A;  2D0U A;  2BVM A;  1LRZ A;  2CEA A;  2K48 A;  3P4W A;  4X1Y E;  3UUB A;  4AKG A;  4LFB T;  4YJ2 E;  4LF7 T;  5FL1 A;  2VUR A;  4ZI7 E;  1HTJ F;  1UK5 A;  4DV4 T;  3SRZ A;  4LF6 T;  2MAW A;  3H3A A;  2WMN A;  5F3J A;  4F8H A;  4O2B E;  2V7M A;  1WFD A;  4UEL A;  5AQQ B;  4C91 A;  3WI3 A;  3EVY A;  4XBF B;  1N34 T;  3VKH A;  3ONL C;  3ZJ1 A;  5L3E B;  2ACZ A;  5L4H A;  2LRL A;  3OVU A;  4UF0 A;  3SS1 A;  1XZY A;  1VCT A;  3TLU A;  4KMC A;  4JI3 T;  1MIV A;  4HFI A;  2IIU A;  3UFE A;  5L3G B;  3ZMV B;  3D0T A;  2XM2 A;  3RC3 A;  4AQF A;  1X9B A;  2QRX A;  2MYS A;  4LF4 T;  1Z0P A;  1UX4 A;  3H3M A;  2W2U A;  1HG2 A;  3KV6 A;  4O4H E;  3AAA B;  2W66 A;  3TLW A;  5BR8 T;  2PTF A;  4WW0 A;  3ETU A;  3P7I A;  4IE0 A;  4P0A A;  2J62 A;  1T7S A;  2LSY A;  4UR9 A;  1ZEE A;  3P4Q A;  1YKH B;  4LML A;  2DLR A;  2JQH A;  2V6X A;  4IL9 A;  2LM9 A;  3AED A;  4IIJ E;  2X0L B;  5LGT B;  5H6R B;  3C51 A;  1IAP A;  3CK6 A;  2E9X B;  2CLY C;  2QGS A;  4LF9 T;  5HEU A;  5DJQ C;  4B3R T;  4TWF A;  2XPK A;  4EED A;  4TV9 E;  3SFE A;  4EAH A;  4AXP A;  4EV6 A;  4JI4 T;  1HF8 A;  2V5C A;  4JI1 T;  2WBL A;  4YHJ A;  4ZI3 D;  4YTP A;  3FXE B;  3M65 A;  2XAQ B;  5A1L A;  1CUN A;  3W15 B;  1ZHC A;  1XDO A;  3T8O A;  4IDO A;  3QK6 A;  2X9Y A;  3N9M A;  3FZM B;  2KWH A;  2MOZ A;  2UUA T;  4JI6 T;  1T72 A;  2DWK A;  4DR1 T;  1D0X A;  3TLS A;  4BAY B;  5JR9 B;  5HXE A;  5LJN A;  3C98 B;  2BKO A;  2VL0 A;  1LVF A;  5AQJ B;  3O1J A;  1H7C A;  2XQ9 A;  5JDF A;  4YJ3 E;  4ANJ A;  5HWY A;  2CCQ A;  3ETV A;  3AXJ B;  4HN9 A;  1HX8 A;  3DJB A;  3ZN1 B;  4P09 A;  3OYZ A;  3ZSS A;  3I0O A;  5JTG A;  4DND A;  3K3Q C;  2K5B B;  3I0Q A;  2Z6E A;  2CWO A;  5GON E;  2UXN B;  2DI4 A;  3U3I A;  3LSV A;  2VKJ A;  2PJQ A;  4K0K T;  5CA1 E;  2K9A A;  4JUY A;  3UQ4 A;  4JI0 T;  4AKR B;  5EK2 A;  2XQ4 A;  3ABV A;  3I9Y A;  2ZMA A;  4AIU A;  1J1J A;  3AE2 A;  4HWF A;  1HNW T;  1JNZ A;  1D1C A;  2NTX A;  4HFV A;  3LK3 B;  3IA3 A;  5HCJ A;  5E0O A;  2Y6X A;  2DHR A;  3CIR A;  2NR4 A;  2FJE A;  4DR2 T;  3PUW F;  1W9R A;  2ODU A;  4TZ4 C;  3AA7 B;  2AXD S;  2UUC T;  3PJA J;  3AEG A;  5C8Y E;  2M6B A;  5LB7 B;  2J47 A;  5DAB A;  3RQU A;  1S94 A;  4E7Z A;  2CPT A;  1IBL T;  4P0B A;  3UUN A;  2CHO A;  3L39 A;  3ZYK A;  3IF8 B;  3P4S A;  4X20 E;  1MMA A;  2J4G A;  5HEO A;  2KND A;  4GKJ T;  4H9S E;  3EHZ A;  5L3B B;  2H3R A;  2XQY A;  3UU8 A;  4CI3 B;  4EYY R;  1FMW A;  3FXD B;  1KK7 A;  1G8X A;  1FEW A;  2LE8 A;  2KSR A;  3KBU A;  5LYJ E;  1G73 A;  2WU2 A;  4IE7 A;  2A2F X;  3AE5 A;  5H6Q B;  3AB3 B;  5JR9 C;  2XY8 B;  3J7Y q;  2UXB T;  2W63 A;  2QVA A;  3MK7 C;  4ZI2 D;  3PUG A;  3SOL A;  4XZC A;  3NKZ A;  4ASK A;  4PFO A;  2JRK A;  3K1S A;  4HFD A;  5EK4 A;  2YKS A;  3T1Y T;  4JEU B;  3AE9 A;  4HKA A;  4WYV A;  4ZHQ E;  4ILA A;  1QSD A;  2BBJ A;  4HWC A;  2KMF A;  5HAX A;  3O1H A;  4KX6 A;  5JRC B;  4QH5 A;  2NW7 A;  5KMG P;  2XJ7 A;  5EK3 A;  2WP9 A;  1I94 T;  1XNR T;  3RGL A;  3K3N A;  3K8P C;  1YQ4 A;  2XAJ B;  3LK4 2;  4H9Q C;  4DR5 T;  1SUM B;  4GKK T;  3MA9 A;  2FJD A;  4HTE A;  2WDQ A;  1MMN A;  4U7Y A;  4OX9 T;  1QLB A;  2XSA A;  2W61 A;  3RLF F;  2HPL A;  2HHH T;  3IBP A;  2JMH A;  3N9L A;  4I4T E;  1OED C;  3UQ7 A;  2VB6 A;  4HFB A;  1NWM X;  4ZOL E;  5FXW A;  3JCF A;  2VWA A;  4U74 A;  5FVL A;  3RQW A;  3J9X 1;  2NW9 A;  2LLY A;  1OWA A;  2KXP B;  4AKI A;  4A97 A;  2FJB A;  1SE7 A;  3NVO A;  3BQI A;  2E9X A;  3KIN B;  1W0A A;  3RIF A;  4MAL A;  4A56 A;  5FVK A;  2Q9Q D;  3LBX B;  3VU7 H;  4B3M T;  4Z8X A;  4O4I E;  5AQN B;  1WR0 A;  2WMO A;  3B57 A;  3OBV E;  3N9N A;  1WLX A;  4AIS A;  3KDS E;  4CXX A;  2X9H A;  1I6Z A;  3IEE A;  4DVD A;  2K3W A;  1MMD A;  4ZI3 C;  1VOM A;  5JRE A;  5ABE A;  2KIN B;  4JYA T;  4EIW A;  2LRK A;  3RYF E;  2V6Y B;  5FY0 A;  4ZZC A;  2A3D A;  4LFC T;  2M6I A;  3AE8 A;  3P4P A;  2LT3 A;  1UGO A;  1YKE B;  4IGU A;  3HL6 A;  2D5U A;  3AEA A;  5AQM B;  2RPA A;  2X66 A;  1VCS A;  3DP7 A;  3NZQ A;  5JR9 A;  2X9W A;  4PNI A;  4U3C A;  1ZOY A;  3RKO A;  3ZPO A;  1D0Y A;  4LMJ A;  3OTO T;  2CLY B;  2E8I A;  4DV7 T;  5FL0 A;  3O4X E;  2FBW A;  3LJC A;  4X66 T;  3AVR A;  3AXJ A;  3HKB E;  4KBM B;  4DV2 T;  2VQE T;  2DNX A;  2N9D A;  3BK9 A;  4X65 T;  5HEG A;  5F5W A;  1IBM T;  4I43 B;  4PK5 A;  4UXN B;  3AE6 A;  3CQX C;  3ZN0 B;  4OFZ A;  3I1A A;  2H89 A;  5ABH A;  2XHE B;  2LSJ A;  2I59 A;  1UUR A;  5AQT B;  4U2Z A;  4QX7 B;  4NUU A;  1YXR A;  3A8Y C;  5HEJ A;  4CN6 A;  5LHG B;  2ODV A;  4PK4 A;  3GA8 A;  4IHJ E;  3ZMZ B;  2V5D A;  1YQ3 A;  2WM9 A;  3CPZ A;  2VL8 A;  3ANW A;  1L0V A;  3LG7 A;  3BQL A;  4EZH A;  4GK5 E;  5LBM A;  2FJA A;  2CXF A;  5KXJ A;  2ZLY A;  3JAE A;  2JPF A;  2PBI A;  1UUS A;  4DMW A;  1US7 B;  2LM2 A;  1NEK A;  3T1H T;  4IST A;  4H9N C;  3PUS A;  3SFD A;  4CZZ B;  3GN5 B;  2P9B A;  3F31 A;  4OK0 A;  5HXR A;  4UV8 B;  3B13 A;  2NOX A;  3ZYL A;  2DCF A;  2Q9Q B;  1SHZ C;  5J2U E;  1HR0 T;  4UVC B;  3RI5 A;  4DID B;  3RYI E;  4IRE A;  2V7I A;  4YSZ A;  4Z90 A;  3ESL A;  2V1D B;  4L5G A;  2UU9 T;  4CXW A;  2XQ3 A;  2V26 A;  4ZI2 C;  5KDM C;  3FHN A;  3UU3 A;  2BG9 B;  1AJ3 A;  5AQK B;  2D9D A;  4CQI A;  4EEB A;  4GIW A;  2N2N A;  4YHH T;  2EHO B;  1T98 A;  3RRC A;  3PUQ A;  4GYR A;  2IAK A;  5L3D B;  3V5U A;  1HNZ T;  5JDL A;  4FI5 A;  4H63 V;  1VRB A;  5M4Y A;  2XTL A;  5JRC A;  2HH7 A;  5JDM A;  1N36 T;  2CWY A;  1J5E T;  1Z8U A;  2JMK A;  1YW0 A;  2MBG A;  4TN7 B;  5CGM A;  4IE6 A;  4V1A v;  2C0S A;  3CQG B;  4EGW A;  3RIU A;  4PK6 A;  2WDV A;  3LK2 B;  4LMK A;  4HWH A;  3RC8 A;  2BVL A;  3RPU A;  3IHR A;  4PFP A;  3A5X A;  3ONJ A;  4IDP A;  4IE4 A;  3CVR A;  5JDH A;  5ABG A;  4JLE A;  1HG5 A;  3Q2M A;  2VKH A;  1WYB A;  2IHR 1;  4PJN A;  4H9O C;  3ONX A;  3X1D A;  2LHR A;  3KVA A;  2HN2 A;  2L3L A;  5EZY E;  4IE5 A;  1IJ6 A;  2XQ6 A;  5LMU T;  4OHF A;  5LOV E;  4EXT A;  1U4Q A;  1X79 A;  2QYW A;  2BZB A;  2WAU A;  3M3Z B;  5LBQ B;  1KNP A;  4EYU A;  3QB5 K;  2Q9Q C;  2MTQ A;  3AE7 A;  5LA6 E;  3Q9D A;  1HCI A;  1HS7 A;  3PV0 F;  1MND A;  4QHO A;  4OYK A;  3LBX A;  1KNR A;  2CRB A;  3OPC A;  5J2T E;  2C5J A;  4KHP T;  1HX1 B;  4BJM A;  3N9O A;  1T8B A;  3H37 A;  3ZC1 A;  3ANW B;  1W0B A;  2CA5 A;  4X1I E;  3C50 A;  3B5M A;  1W09 A;  4K0U A;  3GWH A;  3UT5 E;  2XAS B;  3QB5 A;  4N78 D;  1KEY A;  1OED B;  2BG9 C;  1MMG A;  2V6Y A;  2XM1 A;  3CX7 B;  2EHO C;  2NWB A;  3F2E A;  2FUP A;  2A9U A;  5FXZ A;  4ZXL A;  3UU5 A;  1M7K A;  2ZM6 T;  2VKO A;  4ZS3 A;  3TLV A;  2W62 A;  3AEF A;  4UVB B;  2C5K T;  1BR4 A;  1UCU A;  3ZT6 A;  1R8I A;  2LOP A;  1GQE A;  3OYX A;  3L3P A;  3E22 E;  4DUZ T;  5KX5 E;  3HKC E;  4PW8 A;  3ZEF B;  3ZT7 A;  4DO0 A;  2X51 A;  4I55 E;  5ETW A;  3SWH A;  3MJX A;  3PUA A;  4LF5 T;  3E0Z A;  5HXS A;  2W67 A;  5LGU B;  3EAM A;  3HKD E;  4CXY A;  1QUU A;  2X0Y A;  3N2K E;  4JBW F;  3RYH E;  4P1N A;  1ZV4 X;  4TWD A;  1EZ3 A;  2BDE A;  1O3X A;  5L3C B;  1HFA A;  3O9X A;  3ZJ2 A;  3FBZ A;  2NW8 A;  2XQ8 A;  1KFY A;  2XQ5 A;  4HFC A;  5L4E A;  3JAD A;  2N1G A;  3PDY A;  1MIY A;  4X1K E;  2VVN A;  3RYC E;  2CE7 A;  4J2C A;  4MHC A;  1DU2 A;  3WAJ A;  3CX6 B;  2RA1 A;  1NEN A;  3S4U A;  1LVK A;  2X9X A;  1JNR A;  3NZP A;  3GN5 A;  4YT0 A;  3NRX A;  2WB5 A;  1IZN B;  2YU2 A;  2Q9Q A;  5IYZ E;  5LG4 A;  5JDQ A;  2I0M A;  2YDQ A;  2WCA A;  3VR8 A;  1CHU A;  2YK0 A;  1SA0 E;  1IBK T;  4A98 A;  5CJ5 A;  2YDS A;  2V7L A;  2VAS A;  3QUJ A;  2LKG A;  3I9W A;  5C2T A;  2JIW A;  1Y64 B;  2BG9 A;  4CI1 B;  1E2A A;  3G06 A;  2ACX A;  5CB4 E;  3CQC B;  2BBH A;  4B3T T;  1WCR A;  2CXD A;  4YXD A;  4BJN A;  2EHO A;  2CBJ A;  2X68 A;  2JQ9 A;  5IHY A;  4KHZ F;  3FZH B;  3PTR B;  3AA0 B;  5AFU L;  2V7K A;  4DR4 T;  2XAG B;  5JDG A;  3ZCJ A;  3O1I A;  2KLQ A;  4NPP A;  5ADX L;  5LHI B;  4QXB B;  5CFB A;  1FIO A;  3EUH A;  4TV8 E;  3EAB A;  1U5P A;  2XAH B;  3QOF A;  3CML A;  2XZE A;  1D0Z A;  3Q5E A;  5ABF B;  1WYC A;  3AAI A;  3Q5W A;  2UXC T;  4EOZ B;  2WSS V;  2ZM2 A;  5LMN T;  2WDR A;  2YEV C;  3UU4 A;  2BKP A;  3UFG A;  1S35 A;  2E9X D;  3MZK B;  2WWV A;  4YTN A;  4QXC B;  4IL4 A;  3QNU A;  3VR9 A;  4IT4 A;  3ZLI A;  3DTO A;  4NXN T;  2R6G F;  4YLH A;  4AQG A;  3PUR A;  3AE4 A;  2D0T A;  3GMI A;  4ADZ A;  5FXV A;  1Y01 A;  1V9D A;  3PUY F;  1FJG T;  2BG9 E;  2UUB T;  5AQS B;  3N9P A;  4TNV A;  4HWI B;  4O8S A;  1HNX T;  5L3F B;  4UIG A;  4KI0 F;  3RF1 A;  3P50 A;  3UUX B;  5L47 A;  4JI8 T;  3HKE E;  5FMN A;  3QC9 A;  1ZP0 A;  4FJO A;  4MFR A;  5AQF B;  4COF A;  4CN1 A;  4U2Y A;  2JJ9 A;  3ZYM A;  4YFS A;  2H88 A;  4JV5 T;  5HXC A;  2IC6 A;  4PJL A;  1NAF A;  5AQR B;  1OED A;  1OXZ A;  2IUB A;  5HYA A;  3VHL A;  4EB6 E;  3AAE B;  1IJ5 A;  4C90 A;  5LG3 A;  1BR1 A;  2XAF B;  3L09 A;  4NIQ A;  2HN1 A;  4OYJ A;  3OJA A;  2Y48 B;  2IDO B;  2CM0 A;  2LSI A;  1D1A A;  3C4X A;  5IUX A;  2VKD A;  2XUE A;  1LKX A;  2UXD T;  3VKG A;  1D1B A;  2E5V A;  2WZH A;  3C4Z A;  4IDN A;  3PU8 A;  4M1P A;  3CWZ B;  2G0U A;  2H7O A;  2YDR A;  4XAX B;  2DWG A;  4DV6 T;  4JEH B;  4DR7 T;  2MPK A;  4WZX A;  3EDV A;  3RH3 A;  4X64 T;  3CX8 B;  3EDU A;  2XQA A;  5AQO B;  2DL1 A;  5F8P A;  4DUY T;  4H63 H;  4UEM A;  2LHN A;  3LDQ B;  2YU1 A;  2WQY A;  2LEH A;  1MIW A;  3AA6 B;  4KP3 C;  3MXZ A;  4O4L E;  1OED E;  4IDQ A;  5LNK A;  5LCY A;  2X67 A;  4WNK A;  4TUY E;  2YN6 A;  4DV5 T;  3VRB A;  2KZ7 B;  2RP4 A;  3NBX X;  3ZKR A;  4DV3 T;  2IC9 A;  2E5L T;  5J1G A;  2E2A A;  5L2L A;  4U7I A;  3JC6 D;  4HFE A;  3FZK B;  4AQY T;  4HWD A;  5LJM A;  3WAK A;  4O2A E;  2KT9 A;  5HCM A;  3NRY A;  1XWM A;  2J1D G;  3CKD A;  5AQU B;  3KV9 A;  2Y8D A;  3MAC A;  3JAF A;  3ZMS B;  4BA9 A;  2WS3 A;  1J5W A;  4DV1 T;  5CA0 E;  5FNV E;  2D2S A;  5AQI B;  5LGN B;  4QKN A;  5HEH A;  2V8S V;  2L8K A;  4QXH B;  5LXT E;  3NWI A;  4CN4 A;  4X5T A;  5DQW A;  5AQV B;  2BS4 A;  5LHH B;  4UVA B;  3UU6 A;  2BS2 A;  1KF6 A;  4H9P C;  3AEC A;  4U33 A;  1B7T A;  3KFW X;  4O4J E;  4DR6 T;  4CI2 B;  5TAO A;  2WWU A;  2ZM0 A;  3N5L A;  5ABF A;  3RKG A;  5FKY A;  4ILU A;  4U31 A;  4NXM T;  4KUM B;  4AI6 A;  4F6R C;  5AQG B;  4IDZ A;  4ILB A;  5LP6 E;  2XQ7 A;  4UV9 B;  3Q5X A;  4ERR A;  2L9Q A;  3P4R A;  4UF0 B;  3N2O A;  2E9X C;  4HE8 A;  5JH7 E;  4HFH A; 
#chains in the Genus database with same CATH homology
 4AKL A;  3I9W A;  5LHG B;  2ODV A;  1HF8 A;  3GA8 A;  4PK4 A;  4IHJ E;  3ZMZ B;  2LJL A;  2WBL A;  3KBT A;  4YHJ A;  4ZI3 D;  1Y64 B;  4B6X A;  2WM9 A;  3FXE B;  4CI1 B;  3M65 A;  3PE0 A;  5JQG E;  3CPZ A;  4ZS2 A;  2VL8 A;  2ACX A;  4H9R C;  5CB4 E;  2XAQ B;  3CQC B;  3ANW A;  2CXD A;  3ZMU B;  1CUN A;  5A1L A;  3W15 B;  3LG7 A;  4AKH A;  3BQL A;  1ZHC A;  4BJN A;  2EHO A;  3T8O A;  2X68 A;  4EZH A;  5IHY A;  4GK5 E;  3QK6 A;  2X9Y A;  3N9M A;  2SPC A;  5LBM A;  3KV4 A;  3PTR B;  2QA7 A;  4PJJ A;  2KWH A;  2MOZ A;  3AA0 B;  5AFU L;  2CXF A;  2V7K A;  4DBR A;  2DWK A;  1D0X A;  2XAG B;  2ZLY A;  5JDG A;  4BAY B;  3ZCJ A;  3O1I A;  5DQV A;  5JR9 B;  2JPF A;  2PBI A;  5HXE A;  5LJN A;  3C98 B;  4DMW A;  2KLQ A;  1US7 B;  2YIN A;  2H7V C;  2IW5 B;  1LVF A;  4GOU A;  5ADX L;  3O1J A;  5LHI B;  4QXB B;  4IST A;  4H9N C;  1FIO A;  1H7C A;  3EUH A;  4TV8 E;  3PUS A;  5JDF A;  1U5P A;  4HGA A;  2XAH B;  4YJ3 E;  4ANJ A;  4CZZ B;  3CML A;  3GN5 B;  5HWY A;  2P9B A;  5JVD E;  3F31 A;  1WRD A;  4OK0 A;  2CCQ A;  3N9Q A;  3ETV A;  5HXR A;  1D0Z A;  4HN9 A;  1HX8 A;  1WYC A;  3AAI A;  4UV8 B;  3DJB A;  3Q5W A;  3ZN1 B;  3B13 A;  2NOX A;  4G2A A;  4P09 A;  3KVB A;  3R6N A;  3OYZ A;  4U72 A;  3ZYL A;  3I0O A;  2DCF A;  2Q9Q B;  2C5I T;  2W00 A;  4DND A;  1SHZ C;  5J2U E;  4EZ4 A;  4EOZ B;  3K3Q C;  2WSS V;  2K5B B;  2ZM2 A;  3I0Q A;  4UVC B;  2Z6E A;  4GK0 E;  2CWO A;  3RYI E;  3PU3 A;  5GON E;  2NP9 A;  2UXN B;  2DI4 A;  3U3I A;  2YEV C;  2V7I A;  3TKL B;  2VKJ A;  2PJQ A;  3ESL A;  3K3O A;  5HXH A;  1S35 A;  2V1D B;  5CA1 E;  4L5G A;  2E9X D;  2K9A A;  3MZK B;  4JUY A;  4QXC B;  3ZLI A;  3DTO A;  4AKR B;  4CXW A;  5EK2 A;  2V26 A;  4ZI2 C;  3I9Y A;  4YLH A;  2ZMA A;  5KDM C;  3FHN A;  4AQG A;  1AJ3 A;  3PUR A;  2GK9 A;  4DMV A;  2LOS A;  4CQI A;  1D1C A;  2D0T A;  2NTX A;  2W0G A;  3GMI A;  4ADZ A;  5FXV A;  4GIW A;  2N2N A;  3P8C D;  1V9D A;  2EHO B;  4HFV A;  1T98 A;  5FYM A;  3RRC A;  3PUQ A;  4GYR A;  3LK3 B;  2IAK A;  5BMV E;  4MLK A;  5L3D B;  4TX5 A;  3V5U A;  1BR2 A;  5E0O A;  2Y6X A;  2DHR A;  1ZKE A;  3LFM A;  5JDL A;  2HPJ A;  3UUM A;  4FI5 A;  5FXX A;  3N2G E;  3N9P A;  2KWI B;  4O8S A;  4DBQ A;  4H63 V;  2V7J A;  5L3F B;  1VRB A;  5M4Y A;  4UIG A;  2XTL A;  2ODU A;  5JRC A;  4TZ4 C;  2HH7 A;  3AA7 B;  5JDM A;  1UX5 A;  2CWY A;  3UUX B;  3AVS A;  4QX8 B;  2JMK A;  1YW0 A;  2MBG A;  4TN7 B;  3HKE E;  4IE6 A;  5FMN A;  5C8Y E;  3QC9 A;  5DAB A;  4V1A v;  1KNZ A;  1S94 A;  4E7Z A;  4FJO A;  2C0S A;  3CQG B;  4MFR A;  3F57 A;  2JJ9 A;  2ZM8 A;  3HI2 A;  4PK6 A;  4P0B A;  3R84 B;  4YFS A;  3LK2 B;  3UTK A;  3E08 A;  3UUN A;  3ZYM A;  5HXC A;  2IC6 A;  3ZYK A;  3IF8 B;  2VK9 A;  4PJL A;  3RC8 A;  2BVL A;  3RPU A;  4AQF C;  3IHR A;  4X20 E;  1NAF A;  4PFP A;  2LSG A;  1MMA A;  3A5X A;  1OXZ A;  2KND A;  4IE4 A;  3CVR A;  2CXL A;  5JDH A;  4H9S E;  4JLE A;  1HG5 A;  5HYA A;  3VHL A;  3Q2M A;  2H3R A;  5L3B B;  2XQY A;  4CI3 B;  4EYY R;  1FMW A;  3FXD B;  1KK7 A;  1G8X A;  3HA4 A;  4EB6 E;  1FEW A;  3AAE B;  2M67 A;  2LE8 A;  2VKH A;  1IJ5 A;  3KBU A;  5LYJ E;  4WBO A;  1WYB A;  4C90 A;  1G73 A;  2LSK A;  1BR0 A;  4PJN A;  3U78 A;  4H9O C;  4L9I A;  3ZC0 A;  1BR1 A;  2XAF B;  3UUL A;  3ONX A;  4IE7 A;  3L09 A;  2A2F X;  4WBN E;  4ISS A;  5H6Q B;  4OYJ A;  3AB3 B;  2K24 A;  5JR9 C;  3OJA A;  2Y48 B;  4I50 E;  3J7Y q;  2W63 A;  2LHR A;  2PFV A;  3JC6 C;  3KVA A;  3MK7 C;  1YD8 G;  4ZI2 D;  4G63 A;  3PUG A;  2L3L A;  5EZY E;  2CM0 A;  2LSI A;  1D1A A;  3C4X A;  3FB2 A;  3SOL A;  4IE5 A;  4XZC A;  2VKD A;  2XUE A;  1IJ6 A;  4ASK A;  4PFO A;  2JRK A;  1LKX A;  4L0R A;  5EK4 A;  3VKG A;  3AA1 B;  4GYS A;  1D1B A;  4OHF A;  5LOV E;  4EXT A;  1U4Q A;  1X79 A;  3C4Z A;  2PG8 A;  4JEU B;  2B1E A;  2BZB A;  3PU8 A;  4HKA A;  2WAU A;  5LBQ B;  4M1P A;  3CWZ B;  4ZHQ E;  4PJM A;  5FY1 A;  2ES0 A;  5HWX A;  1FMV A;  3C64 A;  4EYU A;  1QSD A;  2G0U A;  2H7O A;  3KV5 A;  2Q9Q C;  2KMF A;  2MTQ A;  5FY7 A;  5LA6 E;  3Q9D A;  4XAX B;  5HAX A;  1HCI A;  2DWG A;  3O1H A;  1HS7 A;  1MND A;  4QHO A;  5JRC B;  4OYK A;  3LBX A;  4HEA A;  2EHO D;  1E1H B;  5J2T E;  4NUV A;  4JEH B;  2C5J A;  2NW7 A;  5KMG P;  1WR6 A;  2OA5 A;  4BJM A;  3ZCI A;  3ZMT B;  5EK3 A;  3N9O A;  2UXX B;  4E7S A;  2CMR A;  3EDV A;  3RH3 A;  4PAG A;  3H37 A;  3C4W A;  3ZC1 A;  3K3N A;  3ANW B;  3K8P C;  3RX6 A;  2XAJ B;  5FP3 A;  3LK4 2;  3CX8 B;  3RRW A;  2CA5 A;  4QWN B;  4H9Q C;  2A72 A;  4X1I E;  3C50 A;  3EDU A;  4MBQ A;  3MA9 A;  4K0U A;  3GWH A;  3UT5 E;  3FBL A;  2JQQ A;  3BQK A;  4HTE A;  5JDN A;  1MMN A;  2XAS B;  3OKQ A;  4N78 D;  5F8P A;  1MMG A;  2W61 A;  4H63 H;  3HR0 A;  1MNE A;  3MKD A;  3V5S A;  4UEM A;  2HPL A;  3CX7 B;  2NTY A;  2LHN A;  2YU1 A;  2EHO C;  2LEH A;  1MIW A;  2D0U A;  2NWB A;  3F2E A;  5FXZ A;  3IBP A;  2JMH A;  2BVM A;  1LRZ A;  3AA6 B;  2CEA A;  2K48 A;  4KP3 C;  3MXZ A;  3N9L A;  4O4L E;  4I4T E;  4X1Y E;  5LCY A;  2X67 A;  4WNK A;  4TUY E;  5LNK A;  4AKG A;  4YJ2 E;  2KZ7 B;  2RP4 A;  2VB6 A;  3NBX X;  2VKO A;  4ZS3 A;  2W62 A;  2IC9 A;  4UVB B;  1NWM X;  4ZOL E;  4ZI7 E;  2C5K T;  1HTJ F;  5FXW A;  5J1G A;  2VWA A;  1BR4 A;  1UCU A;  4U74 A;  5L2L A;  3JC6 D;  3J9X 1;  3SRZ A;  2LOP A;  2NW9 A;  1OWA A;  3H3A A;  2WMN A;  5F3J A;  3OYX A;  3L3P A;  2KXP B;  3E22 E;  4AKI A;  4O2B E;  5KX5 E;  3HKC E;  5LJM A;  2V7M A;  4UEL A;  4PW8 A;  3WAK A;  3BQI A;  4O2A E;  2KT9 A;  4C91 A;  3ZEF B;  3NRY A;  3WI3 A;  3EVY A;  4XBF B;  2E9X A;  3KIN B;  4DO0 A;  2J1D G;  3CKD A;  4MAL A;  3KV9 A;  2X51 A;  2Y8D A;  4I55 E;  5ETW A;  4A56 A;  3MAC A;  3VKH A;  3SWH A;  2Q9Q D;  3MJX A;  3LBX B;  3VU7 H;  3PUA A;  3ZJ1 A;  3ZMS B;  3E0Z A;  5L3E B;  4Z8X A;  4O4I E;  4BA9 A;  5HXS A;  5LGU B;  4UF0 A;  3SS1 A;  5CA0 E;  3HKD E;  5FNV E;  2D2S A;  2WMO A;  4KMC A;  5LGN B;  4CXY A;  1MIV A;  3B57 A;  3N9N A;  3OBV E;  1WLX A;  4QKN A;  1QUU A;  3N2K E;  3KDS E;  4CXX A;  2X9H A;  3RYH E;  3IEE A;  3UFE A;  1ZV4 X;  4DVD A;  1MMD A;  5L3G B;  2L8K A;  3D0T A;  4QXH B;  3ZMV B;  3RC3 A;  1EZ3 A;  4ZI3 C;  1VOM A;  2BDE A;  1O3X A;  4AQF A;  5LXT E;  5JRE A;  2KIN B;  5L3C B;  1HFA A;  4EIW A;  3O9X A;  3ZJ2 A;  3FBZ A;  3RYF E;  2MYS A;  5FY0 A;  5DQW A;  2NW8 A;  2A3D A;  1Z0P A;  1UX4 A;  2LT3 A;  5LHH B;  1HG2 A;  3KV6 A;  4O4H E;  2N1G A;  4UVA B;  3PDY A;  1YKE B;  1MIY A;  3AAA B;  4IGU A;  3HL6 A;  2D5U A;  4H9P C;  4X1K E;  2X66 A;  3DP7 A;  3NZQ A;  3ETU A;  4WW0 A;  3RYC E;  2CE7 A;  4J2C A;  4MHC A;  3P7I A;  5JR9 A;  2X9W A;  4IE0 A;  4PNI A;  3RKO A;  4P0A A;  3ZPO A;  3WAJ A;  2LSY A;  1D0Y A;  2RA1 A;  3CX6 B;  3S4U A;  1ZEE A;  1B7T A;  1YKH B;  2CLY B;  3KFW X;  4O4J E;  2E8I A;  1LVK A;  2DLR A;  2X9X A;  3NZP A;  5TAO A;  4CI2 B;  3GN5 A;  3O4X E;  2LM9 A;  2WWU A;  3LJC A;  2ZM0 A;  3NRX A;  3N5L A;  4IIJ E;  2X0L B;  3AVR A;  5LGT B;  3HKB E;  4KBM B;  1IZN B;  4ILU A;  5H6R B;  2YU2 A;  3C51 A;  1IAP A;  2DNX A;  2N9D A;  3BK9 A;  2E9X B;  2CLY C;  2QGS A;  2Q9Q A;  4I43 B;  4KUM B;  4AI6 A;  4F6R C;  4PK5 A;  4UXN B;  4IDZ A;  5IYZ E;  3CQX C;  3ZN0 B;  5LG4 A;  5LP6 E;  5JDQ A;  4OFZ A;  3I1A A;  4UV9 B;  5DJQ C;  2XHE B;  2LSJ A;  3Q5X A;  4ERR A;  2YK0 A;  2L9Q A;  1SA0 E;  2I59 A;  4UF0 B;  4TV9 E;  2V7L A;  3N2O A;  2E9X C;  2VAS A;  4QX7 B;  3QUJ A;  4EAH A;  4HE8 A;  4NUU A;  4AXP A;  5JH7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...