4H9OC

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9oC00
4H9OC 4H9SE 5KDMC 4H9PC 4H9RC 4H9NC 4HGAA 4H9QC
chains in the Genus database with same CATH superfamily
4ZI2D 2FJBA 1NENA 4JI1T 1MIVA 4QXCB 3P50A 5FXWA 4U72A 3ZJ1A 4WBNE 5FXVA 1D1BA 2KT9A 3PUSA 3ZT7A 5L4EA 5JRCB 4QHOA 4X65T 1LVFA 5AQTB 3C64A 4PW8A 2ODUA 3FBLA 2LSGA 4ASKA 1N36T 1W0BA 4Z91A 4Z90A 2K9AA 2NW7A 2W66A 4PFPA 2Q9QC 2E9XD 2KSRA 3DTOA 2XQ7A 2SPCA 4Z8XA 3RGLA 4IL9A 4EIWA 1HNZT 3ZLIA 5JRCA 4X1IE 2YEVC 5C3JA 2LHRA 2Z6EA 2LT3A 3EHZA 3AE6A 3IF8B 5HWYA 5LJMA 5LMNT 4TX5A 3H3AA 3K3QC 5LCYA 1LVKA 2WU5A 3RIUA 3EDVA 2LJLA 3UT5E 2GK9A 3GWHA 2BKPA 3PUGA 2CE7A 1FIOA 3A7MA 1XNQT 3I9YA 4JLEA 1UUSA 2I59A 3ZYKA 3EI0A 1WR6A 3P4SA 4KMCA 3OJAA 2HPLA 5JREA 4AI6A 2LE8A 4EAHA 4LF5T 3QUJA 4FJOA 3C4XA 1B7TA 4OHFA 1ZV4X 4U3CA 2XSAA 4IL4A 1OEDB 2NTXA 2J4GA 3ZCJA 2PFVA 4EZHA 1HNXT 3LDQB 2UXNB 5FVKA 2XQ6A 5CFBA 3OVUA 3AEEA 5JDGA 1I94T 3GMIA 4ILBA 2BKNA 5HXRA 2BVLA 2LLYA 3P4PA 1OEDA 4F8HA 5F3JA 2WWUA 1WR0A 5HCMA 3HR0A 5AQFB 2D0UA 5FVLA 4ZXLA 4HWDA 4JI3T 5A1LA 2VK9A 3C98B 5LGTB 4GKKT 1H7CA 4FI5A 5LYJE 1WYCA 2E2AA 3PU8A 1US7B 4A5XA 2AE9A 4DR4T 2KWIB 4AQFA 5AQIB 2LRLA 4U31A 4E7ZA 3Q5DA 1Z0PA 4ISTA 3ZMZB 3T1YT 2C5IT 1MNDA 4AKLA 3Q2MA 2KINB 4H9RC 3MACA 4IE4A 1N33T 4P0AA 4O2BE 3AEDA 3AA7B 1ZP0A 4X62T 2CRBA 3PUVF 5JQGE 4YHHT 1JNRA 3AE2A 1CHUA 2NOXA 3RIUC 5ABHA 1KFYA 4KHPT 4QH4A 4HE8A 4HWCA 1NAFA 1EZ3A 3TLVA 5AQJB 1XNRT 4L9IA 4MALA 4YSYA 3VKHA 2XJ7A 4KI0F 2ZM0A 4YSXA 3KVAA 3J9X1 2V7KA 1XMOT 2Q9QD 3WI3A 4U74A 1VRBA 5AQGB 2IC9A 1UX5A 1Y64B 3IA3A 2WAUA 1OXZA 2CHNA 3FZMB 3PE0A 5JDFA 2HH7A 1YQ3A 5L47A 1SUMB 2PBIA 4BJMA 2D2SA 2Y8DA 1KEYA 3FXDB 4TV9E 1S35A 5LA6E 4HFBA 1OWAA 2IIUA 4O4IE 4DR7T 3GA8A 5AQSB 2IW5B 4NPPA 2WSSV 3DJBA 3LK2B 2MOZA 4A97A 4UIGA 4IGUA 5FY0A 5F8PA 1OEDC 1W09A 2UXBT 3BQKA 2BS4A 2UXXB 2VURA 2X51A 2BBJA 4HFDA 5L2LA 2V1DB 1Z8UA 4I55E 4AIUA 4AQGA 5AFUL 3SFEA 2MTQA 4UV9B 3AEFA 1YXRA 5J1GA 4QX8B 2FBWA 3RPUA 4KUMB 5EK3A 3LJCA 2XAHB 1YKHB 4YTMA 4TNVA 5HYAA 4YHJA 2WDVA 3AE5A 3RYFE 2VQFT 1X9BA 1D1AA 4YSZA 2W62A 3SFDA 3I0QA 4BA9A 5F5WA 4JI6T 2XPKA 4CI1B 2V7LA 4LMLA 1IBMT 4ILUA 1XWMA 1FEWA 2KMFA 2XAJB 5KDMC 3EAMA 3X1DA 5AQKB 4WYVA 3ZSTA 3N2GE 5HAXA 3VHLA 1ZOYA 4M1PA 5CGMA 4YY3T 4DNDA 2CCQA 2KNDA 4P0BA 2OA5A 3N9NA 4JYAT 4YTNA 5ABFA 3UU6A 3T1HT 3PUAA 4DV6T 5LGNB 3NRXA 2CM0A 2VASA 3LG7A 5JR9B 1D0XA 1WCRA 4WW0A 5KMGP 4C90A 5TAOA 2WWVA 2XAFB 2NP9A 1UURA 4PJLA 5LG4A 2YDRA 5FKYA 3ZC1A 3M3ZB 4TWHA 2LM2A 2OLTA 3MA9A 3L09A 2NWBA 3BK9A 3C4ZA 2YOEA 4L5GA 1MIYA 4BAYB 5JR9A 4CN1A 3HI2A 2CHOA 3I1AA 5DABA 3PUWF 3CX7B 3JADA 2WY2A 3QK6A 4GKJT 2V5CA 4AXPA 5AQQB 3PU3A 4I0UA 5IYZE 4GK0E 4IIJE 3JCFA 2CLYB 3BQLA 4JI0T 5LHGB 1UGOA 2XHEB 3RF1A 5EK2A 1IAPA 4TNWA 4B3RT 4AKHA 3OYXA 2WDQA 5EK4A 5LP6E 4E7SA 4ZZCA 5FL1A 3KINB 4ZOLE 2LSJA 4PK6A 2KXPB 5J0ZA 3AE1A 3PJAJ 5HEGA 2W63A 3HKEE 1IBLT 2K5BB 2JMKA 4YJ3E 5LOVE 5LMUT 3H37A 5AQNB 3AE3A 2XM1A 1DU2A 4EGWA 1FJGT 3ETVA 5FP3A 2ZM6T 4U33A 4LMKA 1KF6A 4CXXA 4CQIA 2BDEA 4LFCT 2V6XA 4H9NC 4DV7T 3RH3A 4YFSA 2ZMAA 3ZMUB 1HX8A 4B3TT 1QLBA 4G63A 4PAGA 5AQRB 2XQ8A 3CPZA 4EEBA 2XY8B 3RYHE 3Q5XA 4BJNA 5L3GB 4ZZBA 2CXFA 5FNVE 2DLRA 2E8IA 4DUYT 4NIQA 3KV4A 4TV8E 3FBZA 4ZI7E 3ZMTB 2B1EA 3KFWX 4IE6A 2FUPA 1NWMX 1AJ3A 3J7Yq 4HTEA 2LOPA 4AKIA 1IBKT 2XQ5A 3UUNA 2NW8A 5LB7B 3AVRA 4H9OC 4C91A 3AA0B 5FMNA 4PJNA 4GK5E 2WP9A 1FMVA 4B6XA 4ZS3A 2YDQA 1T98A 5LJNA 2UUAT 3G06A 4DV3T 1KK7A 3PUYF 1XZYA 2EHOB 2W0GA 3CK6A 4WZXA 4DR1T 4JEHB 5JTGA 4ERRA 4YLHA 2X9XA 4PK5A 2IAKA 3F31A 5HXCA 4QX7B 3SRZA 1J5ET 2PJQA 4I43B 4LMJA 5JH7E 4DV5T 4DIDB 2IUBA 4NXMT 3F2EA 3CKDA 4DV0T 2EHOA 3N2KE 4HFIA 4UV8B 4ZS2A 2HN2A 3FB2A 2CXDA 4PK4A 3UULA 5CB4E 4U2ZA 3IBPA 3K3OA 3KV9A 2CLYC 3S4UA 2XQ4A 3O4XE 3RQWA 1YQ4A 3FZKB 4G2AA 3FHNA 2NTYA 4A98A 3RIFA 4HGAA 4B3MT 3M65A 2VL0A 4HFEA 5CA1E 2V7JA 2XM2A 3P4WA 2HN1A 4I50E 3SS1A 2H7VC 3FZFB 2JQ9A 3TLWA 3AE8A 2X9WA 3EVYA 1S94A 3ONXA 4O8SA 3N2OA 2A9UA 2NR4A 1HTJF 2CWOA 2H7OA 4DMVA 5AQMB 5HWXA 1HF8A 1YKEB 2WU2A 3RRWA 3ZN1B 4DUZT 2JQKA 2QA7A 2XQAA 3A5XA 3ZN0B 2VVNA 4UR9A 2HHHT 3C4WA 3UUMA 5L3EB 3N9QA 4ZHQE 4HFCA 2W00A 2E9XB 2CMRA 4IDOA 3RRCA 1W9RA 1U5PA 3MXZA 1N34T 2UXCT 1BR2A 3VRBA 5IWAT 1XDPA 2IHR1 3SWHA 2YKSA 3HKDE 3MJXA 4LF7T 2I0MA 1CUNA 4DO0A 5HEUA 2JRKA 2C5KT 3NZPA 2E9XA 4CN6A 4JV5T 2D5UA 2WM9A 4GIWA 2JQHA 2W67A 3T8OA 4TN7B 3CIRA 2CEAA 5L3BB 2Y48B 3LSVA 1HG2A 3ETUA 3QB5A 3UFEA 2V6YB 4DBQA 3AE4A 3OTOT 3AEAA 5KX5E 5IHYA 3FZLB 2BZBA 4JBWF 2X66A 1IJ6A 4AISA 4PJMA 4KP3C 2UUCT 2CPTA 4H63V 4P1NA 2YU1A 3A8YC 2C5JA 2EHOC 4ILCA 3AXJB 3Q9DA 4MBQA 2V7MA 1E2AA 4H9SE 4OFZA 4MFRA 3O1HA 4CXWA 2JIWA 2UU9T 2VVSA 2BVMA 3WAJA 2VKOA 5HEJA 1WLXA 2XTLA 1M7KA 4LFAT 2QRXA 1MNEA 2X0LB 3AXJA 5EZYE 2ACZA 2JPFA 3P4QA 4J2CA 3DP7A 4TUYE 2MBGA 2BG9E 4ILAA 5C8YE 1HS7A 4O4LE 2ZLYA 1SHZC 3KV6A 5L3CB 5GONE 4U7IA 3N9PA 3R84B 4AKGA 3LK3B 3ONJA 5AQVB 3KBUA 4ZI2C 2V26A 3U3IA 2XQ3A 5LBMA 4F6RC 3W15B 3NVOA 2BS2A 3E08A 4AQFC 2KLQA 4UEMA 3UQ7A 1NEKA 5DQVA 5H6RB 2DWGA 4DR6T 1T72A 2H3RA 3AECA 2BS3A 3GN5B 2D9DA 2FJAA 4K0UA 4OX9T 3ZT5A 2CA5A 4HFVA 4IDPA 5BMVE 2YU2A 5AQOB 2X68A 5HXEA 2E9XC 3CQGB 3E0ZA 2XZEA 4YT0A 3PTRB 2CBIA 1UX4A 3R6NA 3CX8B 2KZ7B 3UTKA 3SOLA 2VKJA 4H63H 3UU8A 3GN5A 3P4RA 4UVAB 4HWIB 4X20E 4ANJA 1IJ5A 3EDUA 2K24A 3C50A 5JDHA 3O1IA 4LF8T 2V8SV 3MZKB 5H6QB 2UUBT 3P7IA 4TWFA 3ZCIA 2DHRA 2WQYA 5LHHB 1KNRA 4TWDA 2C0SA 2DCFA 1VCTA 4COFA 3ZYLA 1BR1A 5ADXL 2N2NA 4HKAA 4EYYR 2LHNA 1FMWA 2F4VT 2VKDA 4NUUA 4DV2T 2L8KA 2J62A 3F57A 4NUVA 1KNPA 3RLFF 3D0TA 5HEHA 1I6ZA 3RYIE 1T7SA 4DV1T 2EHOD 2ZM2A 4JI2T 5HCJA 4JI8T 2KWHA 3N9LA 3N9OA 3KVBA 2N1GA 3I9WA 2IC6A 4EYUA 3ZKRA 3HL6A 1J1JA 3KBTA 3JC6C 2XQ9A 4EZ4A 1MMGA 3JAEA 4OYKA 4YJ2E 2W4XA 5LNKA 3U78A 3RKOA 4IE7A 4JI4T 3O9XA 4QKNA 3RKGA 3CQXC 2LRKA 2IDOB 1MIWA 5L3DB 2A72A 3TKLB 3VRAA 2MYSA 2LKHA 4WNKA 3V5SA 1D0YA 3P8CD 4ZI3C 3NBXX 3UFGA 2H89A 1L0VA 4DMWA 5JDNA 4DR2T 3ESLA 4QH5A 4EV6A 3AA6B 3BQIA 4YTPA 3LBXB 5IUXA 3I0OA 1G73A 4A56A 2QVAA 1GQEA 5LGUB 5L3FB 2X9HA 3QNUA 2VQET 3ZSSA 3RC3A 1G8XA 5C2TA 3RQUA 3UQ4A 4EB6E 3L8RA 4PNIA 3PJAA 5ABEA 2ZM8A 4V1Av 2YN6A 4CN4A 1YD8G 4KBMB 2VKHA 1T8BA 4XAXB 4UXNB 4IDQA 3LBXA 1VCSA 5AQHB 3IHRA 4HWFA 2H88A 5JR9C 2X0YA 5LBQB 4OYJA 4GOUA 4O4HE 3L3PA 3ABVA 2VWAA 3NWIA 3RYCE 1ZKEA 2JQQA 3PUXF 2WZIA 4HWHA 1R8IA 1M62A 4PJJA 3AVSA 2LSKA 3EABA 3KV5A 2BBHA 4HEAA 4HN9A 1HX1B 2NW9A 2BG9B 5LHIB 3JAFA 2WS3A 3UUXB 4JUYA 1VOMA 3CMLA 1IZNB 5FXXA 4WBOA 5DJQC 2LSIA 2MPKA 4LFBT 1E7PA 4X1KE 1WRDA 3VKGA 3CWZB 3OPCA 3QC9A 3LK42 3ZMSB 5M4YA 5CJ5A 2BG9A 3PURA 1XMQT 3CVRA 1V9DA 2CXLA 4XBFB 4CI3B 3PUQA 5JDMA 1QSDA 2IMLA 2ACXA 5HXHA 2LSYA 2J47A 4X64T 2XAGB 1WFDA 5FXZA 4MHCA 4EEDA 4IREA 2QYWA 4U2YA 1D0ZA 3B13A 1HFAA 3RHWA 3ZMVB 5JDQA 4Q25A 2FJEA 3H3MA 2MAWA 2XAQB 4O2AE 3TLTA 4IDNA 3JC6D 3IEEA 2E5VA 1ZEEA 4EXTA 2DWKA 5AQUB 5BR8T 3NKZA 2OV9A 2RPAA 1UCUA 4ZI3D 1MMNA 4X5TA 1BR4A 4ISSA 3UUBA 3V5UA 4NXNT 3CX6B 4GYRA 4QXHB 2X0HA 3RC8A 3VU7H 2HPJA 3B5MA 4DV4T 2XASB 4DBRA 3AAAB 1Y01A 3AEBA 3NZQA 2N9DA 3K1SA 1QUUA 2V6YA 1XDOA 3AAIA 4HFHA 3TLUA 2M67A 4X1YE 1HCIA 2XUEA 3OBVE 2G0UA 4K0KT 4LF9T 3AE9A 5AQLB 2RP4A 3K8PC 3PV0F 2BG9C 1W0AA 3Q5EA 4JI5T 4UELA 4O4JE 4UF0B 4CI2B 1ZHCA 3RI5A 4CXYA 4QXBB 3N5LA 2K3WA 1E1HB 3AA1B 2J1DG 3AE7A 3FZHB 4UVCB 3C51A 2UXDT 3Q5WA 2VB6A 2D0TA 2L3LA 4N78D 2YK0A 4IDZA 3ZYMA 2ODVA 2JMHA 1UK5A 4UF0A 3E22E 4QH1A 4DR5T 5ETWA 4B3ST 3WAKA 4U7YA 4I4TE 4XZCA 4UVBB 2ES0A 4L0RA 4ADZA 2DI4A 1OEDE 3N9MA 3B57A 5JVDE 4X66T 2R6GF 4EOZB 4YXDA 2X67A 3AB3B 2LOSA 4PFOA 1BR0A 3ANWB 2DL1A 2DNXA 4IT4A 1JNZA 2Y6XA 2CWYA 5JDLA 2A3DA 2I6HA 3VR8A 4P09A 2X9YA 1HG5A 1SE7A 2V7IA 3K3NA 5FY1A 2M6IA 3ONLC 5CA0E 2WB5A 2WDRA 4QWNB 5ABFB 5KXJA 3QOFA 5ABGA 3ZT6A 1MMDA 2CBJA 3ANWA 4ZEYA 2Q9QB 4H9PC 3AEGA 4JI7T 3QB5K 1MMAA 2V5DA 3NRYA 1WYBA 3RX6A 3MK7C 1O3XA 5HXSA 2BKOA 3ZJ2A 3CQCB 3TLSA 2WBLA 3FXEB 2PG8A 1YW0A 2W2UA 4KHZF 3PUZF 2Q9QA 4DVDA 4OK0A 1LRZA 2PTFA 3L39A 2WMOA 1N32T 3UU3A 5L4HA 2M6BA 4IHJE 2LM9A 3O1JA 5DQWA 3HKBE 3ZPOA 1X79A 4DR3T 2A2FX 1HR0T 1HNWT 2XSBA 4JEUB 1SA0E 2L9QA 1J5WA 4AKRB 4AQYT 5AQPB 2WMNA 5HEOA 4LF6T 2QGSA 3OYZA 2XQYA 4LF4T 3ZEFB 2LEHA 3RIAA 2JJ9A 4IE5A 5LG3A 4H9QC 3PDYA 2VL8A 3HKCE 5E0OA 2RA1A 1LKXA 5J2TE 2K48A 3UU5A 2AXDS 3VR9A 3AAEB 2YINA 4IE0A 3UU4A 4GYSA 5J2UE 2YDSA 4MLKA 3HA4A 3MKDA 2W61A 2WZHA 3EUHA 5FY7A 3LFMA 4CZZB 2FJDA 3ZC0A 5FL0A 2P9BA 5FYMA 1U4QA 5LXTE 2WCAA 2B76A 2E5LT 4TZ4C 1KNZA 2LKGA 4KX6A 1D1CA 3KDSE 3OKQA
chains in the Genus database with same CATH topology
2OA5A 3N9NA 4ZI2D 4H9SE 4XBFB 4CI3B 3PUQA 5JDMA 1QSDA 3PUAA 4OFZA 4MFRA 5LGNB 3NRXA 3O1HA 1MIVA 2ACXA 2CM0A 4CXWA 4QXCB 5HXHA 2VASA 2BVMA 3WAJA 5FXWA 2LSYA 3LG7A 5JR9B 4U72A 3ZJ1A 1D0XA 2VKOA 2XAGB 4WW0A 5FXZA 4WBNE 5FXVA 5KMGP 1WLXA 4MHCA 1D1BA 2KT9A 3PUSA 4C90A 5JRCB 2XTLA 5TAOA 4QHOA 1LVFA 2XAFB 1MNEA 2NP9A 2X0LB 3C64A 4PW8A 5EZYE 4PJLA 5LG4A 2JPFA 2ODUA 3FBLA 2LSGA 4J2CA 4ASKA 1D0ZA 3DP7A 4TUYE 2MBGA 3ZC1A 2K9AA 2NW7A 3B13A 1HFAA 3ZMVB 3MA9A 3L09A 2NWBA 5JDQA 4PFPA 2Q9QC 3BK9A 3C4ZA 5C8YE 2E9XD 1HS7A 4L5GA 1MIYA 4O4LE 2ZLYA 4BAYB 5JR9A 3DTOA 2XAQB 1SHZC 4O2AE 3HI2A 3KV6A 2SPCA 3I1AA 4Z8XA 5DABA 5L3CB 5GONE 3CX7B 3N9PA 3R84B 4EIWA 3JC6D 3ZLIA 3IEEA 5JRCA 3QK6A 4AKGA 3LK3B 4AXPA 4X1IE 1ZEEA 4EXTA 2YEVC 3KBUA 4ZI2C 2V26A 3U3IA 3PU3A 2DWKA 5IYZE 2LHRA 2Z6EA 4GK0E 2LT3A 5LBMA 4IIJE 4F6RC 2CLYB 3BQLA 5LHGB 3W15B 2XHEB 3IF8B 5HWYA 5LJMA 3E08A 5EK2A 4AQFC 4TX5A 1IAPA 2KLQA 3H3AA 3K3QC 4UEMA 1UCUA 5LCYA 5DQVA 5H6RB 2DWGA 4AKHA 1LVKA 4ZI3D 3OYXA 5LP6E 5EK4A 2H3RA 3EDVA 2LJLA 1MMNA 3UT5E 4E7SA 3GN5B 2GK9A 3GWHA 1BR4A 4K0UA 3PUGA 4ISSA 3V5UA 2CA5A 2CE7A 3CX6B 4HFVA 4GYRA 5BMVE 1FIOA 3KINB 4QXHB 4ZOLE 2YU2A 3RC8A 2X68A 2LSJA 3VU7H 5HXEA 2HPJA 3OKQA 2E9XC 2KXPB 4JLEA 4PK6A 3CQGB 3E0ZA 2I59A 3ZYKA 2XASB 3PTRB 4DBRA 2W63A 3HKEE 1WR6A 2K5BB 2JMKA 4YJ3E 3AAAB 4KMCA 5LOVE 1UX4A 2HPLA 3OJAA 3H37A 3R6NA 5JREA 3CX8B 4AI6A 2LE8A 2KZ7B 3UTKA 3SOLA 2VKJA 3NZQA 4H63H 3ETVA 4EAHA 5FP3A 2N9DA 3QUJA 3GN5A 4FJOA 1QUUA 4CXXA 3C4XA 1B7TA 4OHFA 4CQIA 2BDEA 1ZV4X 3AAIA 4H9NC 2M67A 4X1YE 4UVAB 3RH3A 4YFSA 2NTXA 4X20E 1HCIA 2XUEA 3OBVE 3ZCJA 4ANJA 2G0UA 2ZMAA 3ZMUB 1HX8A 2PFVA 4EZHA 1IJ5A 2RP4A 3EDUA 3K8PC 4G63A 4PAGA 2UXNB 2K24A 3C50A 5JDHA 5JDGA 3O1IA 3CPZA 4UELA 3MZKB 3GMIA 3RYHE 4O4JE 4UF0B 3Q5XA 5H6QB 5HXRA 4BJNA 5L3GB 4CI2B 2CXFA 1ZHCA 3P7IA 5FNVE 4CXYA 2DLRA 4QXBB 2BVLA 2E8IA 3ZCIA 3N5LA 2DHRA 5LHHB 5F3JA 2WWUA 3HR0A 3KV4A 2D0UA 4TV8E 3FBZA 4ZI7E 2C0SA 2DCFA 5A1LA 3ZMTB 2VK9A 1E1HB 3AA1B 2J1DG 2B1EA 3KFWX 4IE6A 3C51A 4UVCB 3C98B 5LGTB 1NWMX 1AJ3A 3J7Yq 4HTEA 1H7CA 2LOPA 3Q5WA 4FI5A 2VB6A 3ZYLA 4AKIA 1BR1A 2D0TA 5ADXL 2L3LA 4N78D 2YK0A 4IDZA 5LYJE 3UUNA 2NW8A 3ZYMA 2ODVA 2JMHA 2N2NA 1WYCA 4HKAA 3AVRA 4UF0A 3E22E 4H9OC 4C91A 3AA0B 3PU8A 4EYYR 2LHNA 1FMWA 5FMNA 5ETWA 2VKDA 4PJNA 4GK5E 4NUUA 1FMVA 1US7B 4B6XA 2KWIB 3WAKA 4ZS3A 4AQFA 1T98A 4I4TE 2L8KA 4E7ZA 5LJNA 1Z0PA 4ISTA 3ZMZB 3F57A 2C5IT 1MNDA 4AKLA 4XZCA 1KK7A 3Q2MA 2ES0A 4UVBB 2KINB 4NUVA 4H9RC 3MACA 3D0TA 2EHOB 4IE4A 4L0RA 3RYIE 2DI4A 4ADZA 4P0AA 2W0GA 4O2BE 2EHOD 2ZM2A 4JEHB 3AA7B 3N9MA 3B57A 5JVDE 4ERRA 4YLHA 2KWHA 2X9XA 3N9LA 4PK5A 4EOZB 2X67A 3N9OA 3AB3B 2IAKA 3F31A 2LOSA 3KVBA 5HXCA 4PFOA 2N1GA 3I9WA 4QX7B 3SRZA 5JQGE 1BR0A 2IC6A 3ANWB 4EYUA 2PJQA 4I43B 2DNXA 3HL6A 5JH7E 2Y6XA 3KBTA 2NOXA 3JC6C 2CWYA 4EZ4A 5JDLA 1MMGA 4HE8A 2A3DA 1NAFA 1EZ3A 4P09A 3F2EA 2X9YA 3CKDA 2EHOA 4OYKA 4YJ2E 1HG5A 3N2KE 4UV8B 2V7IA 3U78A 4ZS2A 5LNKA 3RKOA 3FB2A 3K3NA 4IE7A 5FY1A 2CXDA 4PK4A 3O9XA 5CA0E 4L9IA 4MALA 4QKNA 4QWNB 5CB4E 3UULA 3VKHA 3IBPA 3K3OA 3KV9A 3CQXC 2CLYC 3S4UA 1MIWA 3O4XE 5L3DB 2A72A 2ZM0A 1MMDA 4G2AA 3FHNA 3KVAA 3TKLB 3ANWA 3J9X1 2MYSA 2V7KA 2Q9QB 4WNKA 2NTYA 3V5SA 1D0YA 2Q9QD 3P8CD 4H9PC 3NBXX 4U74A 4ZI3C 3WI3A 1VRBA 4HGAA 2IC9A 1UX5A 4DMWA 5JDNA 3M65A 1Y64B 1MMAA 5CA1E 3ESLA 3NRYA 1WYBA 3RX6A 2V7JA 2WAUA 1OXZA 3MK7C 4MBQA 1O3XA 3AA6B 3BQIA 5HXSA 3PE0A 4I50E 3SS1A 3ZJ2A 5JDFA 2H7VC 2HH7A 3LBXB 2PBIA 1G73A 3I0OA 4BJMA 3CQCB 2X9WA 4A56A 3EVYA 1S94A 2WBLA 3ONXA 3FXEB 4O8SA 5LGUB 3N2OA 2PG8A 1YW0A 2D2SA 2Y8DA 5L3FB 2X9HA 1HTJF 2CWOA 2Q9QA 4DVDA 3FXDB 2H7OA 4DMVA 4TV9E 4OK0A 1S35A 1HF8A 3RC3A 5HWXA 1LRZA 5LA6E 1G8XA 1YKEB 1OWAA 3RRWA 4O4IE 3ZN1B 3GA8A 2WMOA 4EB6E 2QA7A 2IW5B 4PNIA 4IHJE 2WSSV 2ZM8A 3A5XA 2LM9A 3O1JA 4V1Av 3DJBA 5DQWA 3ZN0B 3HKBE 1YD8G 1X79A 2VKHA 2A2FX 3LK2B 4KBMB 3ZPOA 3C4WA 2MOZA 4JEUB 3UUMA 5L3EB 4XAXB 4UIGA 4IGUA 5FY0A 3N9QA 1SA0E 2L9QA 4UXNB 5F8PA 4ZHQE 3LBXA 2W00A 2E9XB 2CMRA 4AKRB 3BQKA 3RRCA 2UXXB 2X51A 3IHRA 1U5PA 3MXZA 5L2LA 2V1DB 2WMNA 1BR2A 5JR9C 5LBQB 4I55E 4OYJA 4GOUA 4O4HE 4AQGA 2QGSA 3OYZA 3SWHA 2XQYA 3L3PA 5AFUL 3HKDE 2MTQA 4UV9B 3MJXA 2VWAA 3RYCE 5J1GA 1CUNA 1ZKEA 2JQQA 4QX8B 3ZEFB 2LEHA 4DO0A 3RPUA 2JRKA 2JJ9A 4IE5A 2C5KT 4KUMB 3NZPA 5EK3A 4H9QC 2E9XA 3LJCA 3PDYA 4PJJA 2VL8A 3AVSA 2XAHB 3HKCE 1YKHB 5E0OA 2RA1A 2D5UA 2WM9A 2LSKA 4GIWA 1LKXA 3T8OA 4TN7B 3KV5A 5J2TE 5HYAA 4YHJA 2K48A 4HEAA 4HN9A 2CEAA 3RYFE 5L3BB 2Y48B 1D1AA 2NW9A 1HG2A 2W62A 5LHIB 3ETUA 3UUXB 3AAEB 3I0QA 3UFEA 4BA9A 2YINA 4JUYA 4IE0A 4CI1B 4DBQA 2V7LA 1VOMA 3CMLA 4GYSA 1IZNB 5KX5E 5J2UE 5FXXA 5IHYA 4MLKA 2BZBA 3HA4A 4WBOA 5DJQC 3MKDA 2X66A 2LSIA 2W61A 1IJ6A 4PJMA 4KP3C 4ILUA 1FEWA 2KMFA 2XAJB 3EUHA 5KDMC 4X1KE 1WRDA 5FY7A 3VKGA 4H63V 3CWZB 3LFMA 3QC9A 4CZZB 3ZC0A 3LK42 2YU1A 2C5JA 3ZMSB 2P9BA 5FYMA 5M4YA 2EHOC 1U4QA 5LXTE 3N2GE 5HAXA 3VHLA 3PURA 4M1PA 4TZ4C 3Q9DA 1KNZA 4DNDA 3CVRA 2CCQA 1V9DA 1D1CA 2KNDA 3KDSE 2CXLA 3I9YA 4P0BA 2V7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O C;  4H9S E;  5KDM C;  4H9P C;  4H9R C;  4H9N C;  4HGA A;  4H9Q C; 
#chains in the Genus database with same CATH topology
 4ZI2 D;  2FJB A;  1NEN A;  4JI1 T;  1MIV A;  4QXC B;  3P50 A;  5FXW A;  4U72 A;  3ZJ1 A;  4WBN E;  5FXV A;  1D1B A;  2KT9 A;  3PUS A;  3ZT7 A;  5L4E A;  5JRC B;  4QHO A;  4X65 T;  1LVF A;  5AQT B;  3C64 A;  4PW8 A;  2ODU A;  3FBL A;  2LSG A;  4ASK A;  1N36 T;  1W0B A;  4Z91 A;  4Z90 A;  2K9A A;  2NW7 A;  2W66 A;  4PFP A;  2Q9Q C;  2E9X D;  2KSR A;  3DTO A;  2XQ7 A;  2SPC A;  4Z8X A;  3RGL A;  4IL9 A;  4EIW A;  1HNZ T;  3ZLI A;  5JRC A;  4X1I E;  2YEV C;  5C3J A;  2LHR A;  2Z6E A;  2LT3 A;  3EHZ A;  3AE6 A;  3IF8 B;  5HWY A;  5LJM A;  5LMN T;  4TX5 A;  3H3A A;  3K3Q C;  5LCY A;  1LVK A;  2WU5 A;  3RIU A;  3EDV A;  2LJL A;  3UT5 E;  2GK9 A;  3GWH A;  2BKP A;  3PUG A;  2CE7 A;  1FIO A;  3A7M A;  1XNQ T;  3I9Y A;  4JLE A;  1UUS A;  2I59 A;  3ZYK A;  3EI0 A;  1WR6 A;  3P4S A;  4KMC A;  3OJA A;  2HPL A;  5JRE A;  4AI6 A;  2LE8 A;  4EAH A;  4LF5 T;  3QUJ A;  4FJO A;  3C4X A;  1B7T A;  4OHF A;  1ZV4 X;  4U3C A;  2XSA A;  4IL4 A;  1OED B;  2NTX A;  2J4G A;  3ZCJ A;  2PFV A;  4EZH A;  1HNX T;  3LDQ B;  2UXN B;  5FVK A;  2XQ6 A;  5CFB A;  3OVU A;  3AEE A;  5JDG A;  1I94 T;  3GMI A;  4ILB A;  2BKN A;  5HXR A;  2BVL A;  2LLY A;  3P4P A;  1OED A;  4F8H A;  5F3J A;  2WWU A;  1WR0 A;  5HCM A;  3HR0 A;  5AQF B;  2D0U A;  5FVL A;  4ZXL A;  4HWD A;  4JI3 T;  5A1L A;  2VK9 A;  3C98 B;  5LGT B;  4GKK T;  1H7C A;  4FI5 A;  5LYJ E;  1WYC A;  2E2A A;  3PU8 A;  1US7 B;  4A5X A;  2AE9 A;  4DR4 T;  2KWI B;  4AQF A;  5AQI B;  2LRL A;  4U31 A;  4E7Z A;  3Q5D A;  1Z0P A;  4IST A;  3ZMZ B;  3T1Y T;  2C5I T;  1MND A;  4AKL A;  3Q2M A;  2KIN B;  4H9R C;  3MAC A;  4IE4 A;  1N33 T;  4P0A A;  4O2B E;  3AED A;  3AA7 B;  1ZP0 A;  4X62 T;  2CRB A;  3PUV F;  5JQG E;  4YHH T;  1JNR A;  3AE2 A;  1CHU A;  2NOX A;  3RIU C;  5ABH A;  1KFY A;  4KHP T;  4QH4 A;  4HE8 A;  4HWC A;  1NAF A;  1EZ3 A;  3TLV A;  5AQJ B;  1XNR T;  4L9I A;  4MAL A;  4YSY A;  3VKH A;  2XJ7 A;  4KI0 F;  2ZM0 A;  4YSX A;  3KVA A;  3J9X 1;  2V7K A;  1XMO T;  2Q9Q D;  3WI3 A;  4U74 A;  1VRB A;  5AQG B;  2IC9 A;  1UX5 A;  1Y64 B;  3IA3 A;  2WAU A;  1OXZ A;  2CHN A;  3FZM B;  3PE0 A;  5JDF A;  2HH7 A;  1YQ3 A;  5L47 A;  1SUM B;  2PBI A;  4BJM A;  2D2S A;  2Y8D A;  1KEY A;  3FXD B;  4TV9 E;  1S35 A;  5LA6 E;  4HFB A;  1OWA A;  2IIU A;  4O4I E;  4DR7 T;  3GA8 A;  5AQS B;  2IW5 B;  4NPP A;  2WSS V;  3DJB A;  3LK2 B;  2MOZ A;  4A97 A;  4UIG A;  4IGU A;  5FY0 A;  5F8P A;  1OED C;  1W09 A;  2UXB T;  3BQK A;  2BS4 A;  2UXX B;  2VUR A;  2X51 A;  2BBJ A;  4HFD A;  5L2L A;  2V1D B;  1Z8U A;  4I55 E;  4AIU A;  4AQG A;  5AFU L;  3SFE A;  2MTQ A;  4UV9 B;  3AEF A;  1YXR A;  5J1G A;  4QX8 B;  2FBW A;  3RPU A;  4KUM B;  5EK3 A;  3LJC A;  2XAH B;  1YKH B;  4YTM A;  4TNV A;  5HYA A;  4YHJ A;  2WDV A;  3AE5 A;  3RYF E;  2VQF T;  1X9B A;  1D1A A;  4YSZ A;  2W62 A;  3SFD A;  3I0Q A;  4BA9 A;  5F5W A;  4JI6 T;  2XPK A;  4CI1 B;  2V7L A;  4LML A;  1IBM T;  4ILU A;  1XWM A;  1FEW A;  2KMF A;  2XAJ B;  5KDM C;  3EAM A;  3X1D A;  5AQK B;  4WYV A;  3ZST A;  3N2G E;  5HAX A;  3VHL A;  1ZOY A;  4M1P A;  5CGM A;  4YY3 T;  4DND A;  2CCQ A;  2KND A;  4P0B A;  2OA5 A;  3N9N A;  4JYA T;  4YTN A;  5ABF A;  3UU6 A;  3T1H T;  3PUA A;  4DV6 T;  5LGN B;  3NRX A;  2CM0 A;  2VAS A;  3LG7 A;  5JR9 B;  1D0X A;  1WCR A;  4WW0 A;  5KMG P;  4C90 A;  5TAO A;  2WWV A;  2XAF B;  2NP9 A;  1UUR A;  4PJL A;  5LG4 A;  2YDR A;  5FKY A;  3ZC1 A;  3M3Z B;  4TWH A;  2LM2 A;  2OLT A;  3MA9 A;  3L09 A;  2NWB A;  3BK9 A;  3C4Z A;  2YOE A;  4L5G A;  1MIY A;  4BAY B;  5JR9 A;  4CN1 A;  3HI2 A;  2CHO A;  3I1A A;  5DAB A;  3PUW F;  3CX7 B;  3JAD A;  2WY2 A;  3QK6 A;  4GKJ T;  2V5C A;  4AXP A;  5AQQ B;  3PU3 A;  4I0U A;  5IYZ E;  4GK0 E;  4IIJ E;  3JCF A;  2CLY B;  3BQL A;  4JI0 T;  5LHG B;  1UGO A;  2XHE B;  3RF1 A;  5EK2 A;  1IAP A;  4TNW A;  4B3R T;  4AKH A;  3OYX A;  2WDQ A;  5EK4 A;  5LP6 E;  4E7S A;  4ZZC A;  5FL1 A;  3KIN B;  4ZOL E;  2LSJ A;  4PK6 A;  2KXP B;  5J0Z A;  3AE1 A;  3PJA J;  5HEG A;  2W63 A;  3HKE E;  1IBL T;  2K5B B;  2JMK A;  4YJ3 E;  5LOV E;  5LMU T;  3H37 A;  5AQN B;  3AE3 A;  2XM1 A;  1DU2 A;  4EGW A;  1FJG T;  3ETV A;  5FP3 A;  2ZM6 T;  4U33 A;  4LMK A;  1KF6 A;  4CXX A;  4CQI A;  2BDE A;  4LFC T;  2V6X A;  4H9N C;  4DV7 T;  3RH3 A;  4YFS A;  2ZMA A;  3ZMU B;  1HX8 A;  4B3T T;  1QLB A;  4G63 A;  4PAG A;  5AQR B;  2XQ8 A;  3CPZ A;  4EEB A;  2XY8 B;  3RYH E;  3Q5X A;  4BJN A;  5L3G B;  4ZZB A;  2CXF A;  5FNV E;  2DLR A;  2E8I A;  4DUY T;  4NIQ A;  3KV4 A;  4TV8 E;  3FBZ A;  4ZI7 E;  3ZMT B;  2B1E A;  3KFW X;  4IE6 A;  2FUP A;  1NWM X;  1AJ3 A;  3J7Y q;  4HTE A;  2LOP A;  4AKI A;  1IBK T;  2XQ5 A;  3UUN A;  2NW8 A;  5LB7 B;  3AVR A;  4H9O C;  4C91 A;  3AA0 B;  5FMN A;  4PJN A;  4GK5 E;  2WP9 A;  1FMV A;  4B6X A;  4ZS3 A;  2YDQ A;  1T98 A;  5LJN A;  2UUA T;  3G06 A;  4DV3 T;  1KK7 A;  3PUY F;  1XZY A;  2EHO B;  2W0G A;  3CK6 A;  4WZX A;  4DR1 T;  4JEH B;  5JTG A;  4ERR A;  4YLH A;  2X9X A;  4PK5 A;  2IAK A;  3F31 A;  5HXC A;  4QX7 B;  3SRZ A;  1J5E T;  2PJQ A;  4I43 B;  4LMJ A;  5JH7 E;  4DV5 T;  4DID B;  2IUB A;  4NXM T;  3F2E A;  3CKD A;  4DV0 T;  2EHO A;  3N2K E;  4HFI A;  4UV8 B;  4ZS2 A;  2HN2 A;  3FB2 A;  2CXD A;  4PK4 A;  3UUL A;  5CB4 E;  4U2Z A;  3IBP A;  3K3O A;  3KV9 A;  2CLY C;  3S4U A;  2XQ4 A;  3O4X E;  3RQW A;  1YQ4 A;  3FZK B;  4G2A A;  3FHN A;  2NTY A;  4A98 A;  3RIF A;  4HGA A;  4B3M T;  3M65 A;  2VL0 A;  4HFE A;  5CA1 E;  2V7J A;  2XM2 A;  3P4W A;  2HN1 A;  4I50 E;  3SS1 A;  2H7V C;  3FZF B;  2JQ9 A;  3TLW A;  3AE8 A;  2X9W A;  3EVY A;  1S94 A;  3ONX A;  4O8S A;  3N2O A;  2A9U A;  2NR4 A;  1HTJ F;  2CWO A;  2H7O A;  4DMV A;  5AQM B;  5HWX A;  1HF8 A;  1YKE B;  2WU2 A;  3RRW A;  3ZN1 B;  4DUZ T;  2JQK A;  2QA7 A;  2XQA A;  3A5X A;  3ZN0 B;  2VVN A;  4UR9 A;  2HHH T;  3C4W A;  3UUM A;  5L3E B;  3N9Q A;  4ZHQ E;  4HFC A;  2W00 A;  2E9X B;  2CMR A;  4IDO A;  3RRC A;  1W9R A;  1U5P A;  3MXZ A;  1N34 T;  2UXC T;  1BR2 A;  3VRB A;  5IWA T;  1XDP A;  2IHR 1;  3SWH A;  2YKS A;  3HKD E;  3MJX A;  4LF7 T;  2I0M A;  1CUN A;  4DO0 A;  5HEU A;  2JRK A;  2C5K T;  3NZP A;  2E9X A;  4CN6 A;  4JV5 T;  2D5U A;  2WM9 A;  4GIW A;  2JQH A;  2W67 A;  3T8O A;  4TN7 B;  3CIR A;  2CEA A;  5L3B B;  2Y48 B;  3LSV A;  1HG2 A;  3ETU A;  3QB5 A;  3UFE A;  2V6Y B;  4DBQ A;  3AE4 A;  3OTO T;  3AEA A;  5KX5 E;  5IHY A;  3FZL B;  2BZB A;  4JBW F;  2X66 A;  1IJ6 A;  4AIS A;  4PJM A;  4KP3 C;  2UUC T;  2CPT A;  4H63 V;  4P1N A;  2YU1 A;  3A8Y C;  2C5J A;  2EHO C;  4ILC A;  3AXJ B;  3Q9D A;  4MBQ A;  2V7M A;  1E2A A;  4H9S E;  4OFZ A;  4MFR A;  3O1H A;  4CXW A;  2JIW A;  2UU9 T;  2VVS A;  2BVM A;  3WAJ A;  2VKO A;  5HEJ A;  1WLX A;  2XTL A;  1M7K A;  4LFA T;  2QRX A;  1MNE A;  2X0L B;  3AXJ A;  5EZY E;  2ACZ A;  2JPF A;  3P4Q A;  4J2C A;  3DP7 A;  4TUY E;  2MBG A;  2BG9 E;  4ILA A;  5C8Y E;  1HS7 A;  4O4L E;  2ZLY A;  1SHZ C;  3KV6 A;  5L3C B;  5GON E;  4U7I A;  3N9P A;  3R84 B;  4AKG A;  3LK3 B;  3ONJ A;  5AQV B;  3KBU A;  4ZI2 C;  2V26 A;  3U3I A;  2XQ3 A;  5LBM A;  4F6R C;  3W15 B;  3NVO A;  2BS2 A;  3E08 A;  4AQF C;  2KLQ A;  4UEM A;  3UQ7 A;  1NEK A;  5DQV A;  5H6R B;  2DWG A;  4DR6 T;  1T72 A;  2H3R A;  3AEC A;  2BS3 A;  3GN5 B;  2D9D A;  2FJA A;  4K0U A;  4OX9 T;  3ZT5 A;  2CA5 A;  4HFV A;  4IDP A;  5BMV E;  2YU2 A;  5AQO B;  2X68 A;  5HXE A;  2E9X C;  3CQG B;  3E0Z A;  2XZE A;  4YT0 A;  3PTR B;  2CBI A;  1UX4 A;  3R6N A;  3CX8 B;  2KZ7 B;  3UTK A;  3SOL A;  2VKJ A;  4H63 H;  3UU8 A;  3GN5 A;  3P4R A;  4UVA B;  4HWI B;  4X20 E;  4ANJ A;  1IJ5 A;  3EDU A;  2K24 A;  3C50 A;  5JDH A;  3O1I A;  4LF8 T;  2V8S V;  3MZK B;  5H6Q B;  2UUB T;  3P7I A;  4TWF A;  3ZCI A;  2DHR A;  2WQY A;  5LHH B;  1KNR A;  4TWD A;  2C0S A;  2DCF A;  1VCT A;  4COF A;  3ZYL A;  1BR1 A;  5ADX L;  2N2N A;  4HKA A;  4EYY R;  2LHN A;  1FMW A;  2F4V T;  2VKD A;  4NUU A;  4DV2 T;  2L8K A;  2J62 A;  3F57 A;  4NUV A;  1KNP A;  3RLF F;  3D0T A;  5HEH A;  1I6Z A;  3RYI E;  1T7S A;  4DV1 T;  2EHO D;  2ZM2 A;  4JI2 T;  5HCJ A;  4JI8 T;  2KWH A;  3N9L A;  3N9O A;  3KVB A;  2N1G A;  3I9W A;  2IC6 A;  4EYU A;  3ZKR A;  3HL6 A;  1J1J A;  3KBT A;  3JC6 C;  2XQ9 A;  4EZ4 A;  1MMG A;  3JAE A;  4OYK A;  4YJ2 E;  2W4X A;  5LNK A;  3U78 A;  3RKO A;  4IE7 A;  4JI4 T;  3O9X A;  4QKN A;  3RKG A;  3CQX C;  2LRK A;  2IDO B;  1MIW A;  5L3D B;  2A72 A;  3TKL B;  3VRA A;  2MYS A;  2LKH A;  4WNK A;  3V5S A;  1D0Y A;  3P8C D;  4ZI3 C;  3NBX X;  3UFG A;  2H89 A;  1L0V A;  4DMW A;  5JDN A;  4DR2 T;  3ESL A;  4QH5 A;  4EV6 A;  3AA6 B;  3BQI A;  4YTP A;  3LBX B;  5IUX A;  3I0O A;  1G73 A;  4A56 A;  2QVA A;  1GQE A;  5LGU B;  5L3F B;  2X9H A;  3QNU A;  2VQE T;  3ZSS A;  3RC3 A;  1G8X A;  5C2T A;  3RQU A;  3UQ4 A;  4EB6 E;  3L8R A;  4PNI A;  3PJA A;  5ABE A;  2ZM8 A;  4V1A v;  2YN6 A;  4CN4 A;  1YD8 G;  4KBM B;  2VKH A;  1T8B A;  4XAX B;  4UXN B;  4IDQ A;  3LBX A;  1VCS A;  5AQH B;  3IHR A;  4HWF A;  2H88 A;  5JR9 C;  2X0Y A;  5LBQ B;  4OYJ A;  4GOU A;  4O4H E;  3L3P A;  3ABV A;  2VWA A;  3NWI A;  3RYC E;  1ZKE A;  2JQQ A;  3PUX F;  2WZI A;  4HWH A;  1R8I A;  1M62 A;  4PJJ A;  3AVS A;  2LSK A;  3EAB A;  3KV5 A;  2BBH A;  4HEA A;  4HN9 A;  1HX1 B;  2NW9 A;  2BG9 B;  5LHI B;  3JAF A;  2WS3 A;  3UUX B;  4JUY A;  1VOM A;  3CML A;  1IZN B;  5FXX A;  4WBO A;  5DJQ C;  2LSI A;  2MPK A;  4LFB T;  1E7P A;  4X1K E;  1WRD A;  3VKG A;  3CWZ B;  3OPC A;  3QC9 A;  3LK4 2;  3ZMS B;  5M4Y A;  5CJ5 A;  2BG9 A;  3PUR A;  1XMQ T;  3CVR A;  1V9D A;  2CXL A;  4XBF B;  4CI3 B;  3PUQ A;  5JDM A;  1QSD A;  2IML A;  2ACX A;  5HXH A;  2LSY A;  2J47 A;  4X64 T;  2XAG B;  1WFD A;  5FXZ A;  4MHC A;  4EED A;  4IRE A;  2QYW A;  4U2Y A;  1D0Z A;  3B13 A;  1HFA A;  3RHW A;  3ZMV B;  5JDQ A;  4Q25 A;  2FJE A;  3H3M A;  2MAW A;  2XAQ B;  4O2A E;  3TLT A;  4IDN A;  3JC6 D;  3IEE A;  2E5V A;  1ZEE A;  4EXT A;  2DWK A;  5AQU B;  5BR8 T;  3NKZ A;  2OV9 A;  2RPA A;  1UCU A;  4ZI3 D;  1MMN A;  4X5T A;  1BR4 A;  4ISS A;  3UUB A;  3V5U A;  4NXN T;  3CX6 B;  4GYR A;  4QXH B;  2X0H A;  3RC8 A;  3VU7 H;  2HPJ A;  3B5M A;  4DV4 T;  2XAS B;  4DBR A;  3AAA B;  1Y01 A;  3AEB A;  3NZQ A;  2N9D A;  3K1S A;  1QUU A;  2V6Y A;  1XDO A;  3AAI A;  4HFH A;  3TLU A;  2M67 A;  4X1Y E;  1HCI A;  2XUE A;  3OBV E;  2G0U A;  4K0K T;  4LF9 T;  3AE9 A;  5AQL B;  2RP4 A;  3K8P C;  3PV0 F;  2BG9 C;  1W0A A;  3Q5E A;  4JI5 T;  4UEL A;  4O4J E;  4UF0 B;  4CI2 B;  1ZHC A;  3RI5 A;  4CXY A;  4QXB B;  3N5L A;  2K3W A;  1E1H B;  3AA1 B;  2J1D G;  3AE7 A;  3FZH B;  4UVC B;  3C51 A;  2UXD T;  3Q5W A;  2VB6 A;  2D0T A;  2L3L A;  4N78 D;  2YK0 A;  4IDZ A;  3ZYM A;  2ODV A;  2JMH A;  1UK5 A;  4UF0 A;  3E22 E;  4QH1 A;  4DR5 T;  5ETW A;  4B3S T;  3WAK A;  4U7Y A;  4I4T E;  4XZC A;  4UVB B;  2ES0 A;  4L0R A;  4ADZ A;  2DI4 A;  1OED E;  3N9M A;  3B57 A;  5JVD E;  4X66 T;  2R6G F;  4EOZ B;  4YXD A;  2X67 A;  3AB3 B;  2LOS A;  4PFO A;  1BR0 A;  3ANW B;  2DL1 A;  2DNX A;  4IT4 A;  1JNZ A;  2Y6X A;  2CWY A;  5JDL A;  2A3D A;  2I6H A;  3VR8 A;  4P09 A;  2X9Y A;  1HG5 A;  1SE7 A;  2V7I A;  3K3N A;  5FY1 A;  2M6I A;  3ONL C;  5CA0 E;  2WB5 A;  2WDR A;  4QWN B;  5ABF B;  5KXJ A;  3QOF A;  5ABG A;  3ZT6 A;  1MMD A;  2CBJ A;  3ANW A;  4ZEY A;  2Q9Q B;  4H9P C;  3AEG A;  4JI7 T;  3QB5 K;  1MMA A;  2V5D A;  3NRY A;  1WYB A;  3RX6 A;  3MK7 C;  1O3X A;  5HXS A;  2BKO A;  3ZJ2 A;  3CQC B;  3TLS A;  2WBL A;  3FXE B;  2PG8 A;  1YW0 A;  2W2U A;  4KHZ F;  3PUZ F;  2Q9Q A;  4DVD A;  4OK0 A;  1LRZ A;  2PTF A;  3L39 A;  2WMO A;  1N32 T;  3UU3 A;  5L4H A;  2M6B A;  4IHJ E;  2LM9 A;  3O1J A;  5DQW A;  3HKB E;  3ZPO A;  1X79 A;  4DR3 T;  2A2F X;  1HR0 T;  1HNW T;  2XSB A;  4JEU B;  1SA0 E;  2L9Q A;  1J5W A;  4AKR B;  4AQY T;  5AQP B;  2WMN A;  5HEO A;  4LF6 T;  2QGS A;  3OYZ A;  2XQY A;  4LF4 T;  3ZEF B;  2LEH A;  3RIA A;  2JJ9 A;  4IE5 A;  5LG3 A;  4H9Q C;  3PDY A;  2VL8 A;  3HKC E;  5E0O A;  2RA1 A;  1LKX A;  5J2T E;  2K48 A;  3UU5 A;  2AXD S;  3VR9 A;  3AAE B;  2YIN A;  4IE0 A;  3UU4 A;  4GYS A;  5J2U E;  2YDS A;  4MLK A;  3HA4 A;  3MKD A;  2W61 A;  2WZH A;  3EUH A;  5FY7 A;  3LFM A;  4CZZ B;  2FJD A;  3ZC0 A;  5FL0 A;  2P9B A;  5FYM A;  1U4Q A;  5LXT E;  2WCA A;  2B76 A;  2E5L T;  4TZ4 C;  1KNZ A;  2LKG A;  4KX6 A;  1D1C A;  3KDS E;  3OKQ A; 
#chains in the Genus database with same CATH homology
 2OA5 A;  3N9N A;  4ZI2 D;  4H9S E;  4XBF B;  4CI3 B;  3PUQ A;  5JDM A;  1QSD A;  3PUA A;  4OFZ A;  4MFR A;  5LGN B;  3NRX A;  3O1H A;  1MIV A;  2ACX A;  2CM0 A;  4CXW A;  4QXC B;  5HXH A;  2VAS A;  2BVM A;  3WAJ A;  5FXW A;  2LSY A;  3LG7 A;  5JR9 B;  4U72 A;  3ZJ1 A;  1D0X A;  2VKO A;  2XAG B;  4WW0 A;  5FXZ A;  4WBN E;  5FXV A;  5KMG P;  1WLX A;  4MHC A;  1D1B A;  2KT9 A;  3PUS A;  4C90 A;  5JRC B;  2XTL A;  5TAO A;  4QHO A;  1LVF A;  2XAF B;  1MNE A;  2NP9 A;  2X0L B;  3C64 A;  4PW8 A;  5EZY E;  4PJL A;  5LG4 A;  2JPF A;  2ODU A;  3FBL A;  2LSG A;  4J2C A;  4ASK A;  1D0Z A;  3DP7 A;  4TUY E;  2MBG A;  3ZC1 A;  2K9A A;  2NW7 A;  3B13 A;  1HFA A;  3ZMV B;  3MA9 A;  3L09 A;  2NWB A;  5JDQ A;  4PFP A;  2Q9Q C;  3BK9 A;  3C4Z A;  5C8Y E;  2E9X D;  1HS7 A;  4L5G A;  1MIY A;  4O4L E;  2ZLY A;  4BAY B;  5JR9 A;  3DTO A;  2XAQ B;  1SHZ C;  4O2A E;  3HI2 A;  3KV6 A;  2SPC A;  3I1A A;  4Z8X A;  5DAB A;  5L3C B;  5GON E;  3CX7 B;  3N9P A;  3R84 B;  4EIW A;  3JC6 D;  3ZLI A;  3IEE A;  5JRC A;  3QK6 A;  4AKG A;  3LK3 B;  4AXP A;  4X1I E;  1ZEE A;  4EXT A;  2YEV C;  3KBU A;  4ZI2 C;  2V26 A;  3U3I A;  3PU3 A;  2DWK A;  5IYZ E;  2LHR A;  2Z6E A;  4GK0 E;  2LT3 A;  5LBM A;  4IIJ E;  4F6R C;  2CLY B;  3BQL A;  5LHG B;  3W15 B;  2XHE B;  3IF8 B;  5HWY A;  5LJM A;  3E08 A;  5EK2 A;  4AQF C;  4TX5 A;  1IAP A;  2KLQ A;  3H3A A;  3K3Q C;  4UEM A;  1UCU A;  5LCY A;  5DQV A;  5H6R B;  2DWG A;  4AKH A;  1LVK A;  4ZI3 D;  3OYX A;  5LP6 E;  5EK4 A;  2H3R A;  3EDV A;  2LJL A;  1MMN A;  3UT5 E;  4E7S A;  3GN5 B;  2GK9 A;  3GWH A;  1BR4 A;  4K0U A;  3PUG A;  4ISS A;  3V5U A;  2CA5 A;  2CE7 A;  3CX6 B;  4HFV A;  4GYR A;  5BMV E;  1FIO A;  3KIN B;  4QXH B;  4ZOL E;  2YU2 A;  3RC8 A;  2X68 A;  2LSJ A;  3VU7 H;  5HXE A;  2HPJ A;  3OKQ A;  2E9X C;  2KXP B;  4JLE A;  4PK6 A;  3CQG B;  3E0Z A;  2I59 A;  3ZYK A;  2XAS B;  3PTR B;  4DBR A;  2W63 A;  3HKE E;  1WR6 A;  2K5B B;  2JMK A;  4YJ3 E;  3AAA B;  4KMC A;  5LOV E;  1UX4 A;  2HPL A;  3OJA A;  3H37 A;  3R6N A;  5JRE A;  3CX8 B;  4AI6 A;  2LE8 A;  2KZ7 B;  3UTK A;  3SOL A;  2VKJ A;  3NZQ A;  4H63 H;  3ETV A;  4EAH A;  5FP3 A;  2N9D A;  3QUJ A;  3GN5 A;  4FJO A;  1QUU A;  4CXX A;  3C4X A;  1B7T A;  4OHF A;  4CQI A;  2BDE A;  1ZV4 X;  3AAI A;  4H9N C;  2M67 A;  4X1Y E;  4UVA B;  3RH3 A;  4YFS A;  2NTX A;  4X20 E;  1HCI A;  2XUE A;  3OBV E;  3ZCJ A;  4ANJ A;  2G0U A;  2ZMA A;  3ZMU B;  1HX8 A;  2PFV A;  4EZH A;  1IJ5 A;  2RP4 A;  3EDU A;  3K8P C;  4G63 A;  4PAG A;  2UXN B;  2K24 A;  3C50 A;  5JDH A;  5JDG A;  3O1I A;  3CPZ A;  4UEL A;  3MZK B;  3GMI A;  3RYH E;  4O4J E;  4UF0 B;  3Q5X A;  5H6Q B;  5HXR A;  4BJN A;  5L3G B;  4CI2 B;  2CXF A;  1ZHC A;  3P7I A;  5FNV E;  4CXY A;  2DLR A;  4QXB B;  2BVL A;  2E8I A;  3ZCI A;  3N5L A;  2DHR A;  5LHH B;  5F3J A;  2WWU A;  3HR0 A;  3KV4 A;  2D0U A;  4TV8 E;  3FBZ A;  4ZI7 E;  2C0S A;  2DCF A;  5A1L A;  3ZMT B;  2VK9 A;  1E1H B;  3AA1 B;  2J1D G;  2B1E A;  3KFW X;  4IE6 A;  3C51 A;  4UVC B;  3C98 B;  5LGT B;  1NWM X;  1AJ3 A;  3J7Y q;  4HTE A;  1H7C A;  2LOP A;  3Q5W A;  4FI5 A;  2VB6 A;  3ZYL A;  4AKI A;  1BR1 A;  2D0T A;  5ADX L;  2L3L A;  4N78 D;  2YK0 A;  4IDZ A;  5LYJ E;  3UUN A;  2NW8 A;  3ZYM A;  2ODV A;  2JMH A;  2N2N A;  1WYC A;  4HKA A;  3AVR A;  4UF0 A;  3E22 E;  4H9O C;  4C91 A;  3AA0 B;  3PU8 A;  4EYY R;  2LHN A;  1FMW A;  5FMN A;  5ETW A;  2VKD A;  4PJN A;  4GK5 E;  4NUU A;  1FMV A;  1US7 B;  4B6X A;  2KWI B;  3WAK A;  4ZS3 A;  4AQF A;  1T98 A;  4I4T E;  2L8K A;  4E7Z A;  5LJN A;  1Z0P A;  4IST A;  3ZMZ B;  3F57 A;  2C5I T;  1MND A;  4AKL A;  4XZC A;  1KK7 A;  3Q2M A;  2ES0 A;  4UVB B;  2KIN B;  4NUV A;  4H9R C;  3MAC A;  3D0T A;  2EHO B;  4IE4 A;  4L0R A;  3RYI E;  2DI4 A;  4ADZ A;  4P0A A;  2W0G A;  4O2B E;  2EHO D;  2ZM2 A;  4JEH B;  3AA7 B;  3N9M A;  3B57 A;  5JVD E;  4ERR A;  4YLH A;  2KWH A;  2X9X A;  3N9L A;  4PK5 A;  4EOZ B;  2X67 A;  3N9O A;  3AB3 B;  2IAK A;  3F31 A;  2LOS A;  3KVB A;  5HXC A;  4PFO A;  2N1G A;  3I9W A;  4QX7 B;  3SRZ A;  5JQG E;  1BR0 A;  2IC6 A;  3ANW B;  4EYU A;  2PJQ A;  4I43 B;  2DNX A;  3HL6 A;  5JH7 E;  2Y6X A;  3KBT A;  2NOX A;  3JC6 C;  2CWY A;  4EZ4 A;  5JDL A;  1MMG A;  4HE8 A;  2A3D A;  1NAF A;  1EZ3 A;  4P09 A;  3F2E A;  2X9Y A;  3CKD A;  2EHO A;  4OYK A;  4YJ2 E;  1HG5 A;  3N2K E;  4UV8 B;  2V7I A;  3U78 A;  4ZS2 A;  5LNK A;  3RKO A;  3FB2 A;  3K3N A;  4IE7 A;  5FY1 A;  2CXD A;  4PK4 A;  3O9X A;  5CA0 E;  4L9I A;  4MAL A;  4QKN A;  4QWN B;  5CB4 E;  3UUL A;  3VKH A;  3IBP A;  3K3O A;  3KV9 A;  3CQX C;  2CLY C;  3S4U A;  1MIW A;  3O4X E;  5L3D B;  2A72 A;  2ZM0 A;  1MMD A;  4G2A A;  3FHN A;  3KVA A;  3TKL B;  3ANW A;  3J9X 1;  2MYS A;  2V7K A;  2Q9Q B;  4WNK A;  2NTY A;  3V5S A;  1D0Y A;  2Q9Q D;  3P8C D;  4H9P C;  3NBX X;  4U74 A;  4ZI3 C;  3WI3 A;  1VRB A;  4HGA A;  2IC9 A;  1UX5 A;  4DMW A;  5JDN A;  3M65 A;  1Y64 B;  1MMA A;  5CA1 E;  3ESL A;  3NRY A;  1WYB A;  3RX6 A;  2V7J A;  2WAU A;  1OXZ A;  3MK7 C;  4MBQ A;  1O3X A;  3AA6 B;  3BQI A;  5HXS A;  3PE0 A;  4I50 E;  3SS1 A;  3ZJ2 A;  5JDF A;  2H7V C;  2HH7 A;  3LBX B;  2PBI A;  1G73 A;  3I0O A;  4BJM A;  3CQC B;  2X9W A;  4A56 A;  3EVY A;  1S94 A;  2WBL A;  3ONX A;  3FXE B;  4O8S A;  5LGU B;  3N2O A;  2PG8 A;  1YW0 A;  2D2S A;  2Y8D A;  5L3F B;  2X9H A;  1HTJ F;  2CWO A;  2Q9Q A;  4DVD A;  3FXD B;  2H7O A;  4DMV A;  4TV9 E;  4OK0 A;  1S35 A;  1HF8 A;  3RC3 A;  5HWX A;  1LRZ A;  5LA6 E;  1G8X A;  1YKE B;  1OWA A;  3RRW A;  4O4I E;  3ZN1 B;  3GA8 A;  2WMO A;  4EB6 E;  2QA7 A;  2IW5 B;  4PNI A;  4IHJ E;  2WSS V;  2ZM8 A;  3A5X A;  2LM9 A;  3O1J A;  4V1A v;  3DJB A;  5DQW A;  3ZN0 B;  3HKB E;  1YD8 G;  1X79 A;  2VKH A;  2A2F X;  3LK2 B;  4KBM B;  3ZPO A;  3C4W A;  2MOZ A;  4JEU B;  3UUM A;  5L3E B;  4XAX B;  4UIG A;  4IGU A;  5FY0 A;  3N9Q A;  1SA0 E;  2L9Q A;  4UXN B;  5F8P A;  4ZHQ E;  3LBX A;  2W00 A;  2E9X B;  2CMR A;  4AKR B;  3BQK A;  3RRC A;  2UXX B;  2X51 A;  3IHR A;  1U5P A;  3MXZ A;  5L2L A;  2V1D B;  2WMN A;  1BR2 A;  5JR9 C;  5LBQ B;  4I55 E;  4OYJ A;  4GOU A;  4O4H E;  4AQG A;  2QGS A;  3OYZ A;  3SWH A;  2XQY A;  3L3P A;  5AFU L;  3HKD E;  2MTQ A;  4UV9 B;  3MJX A;  2VWA A;  3RYC E;  5J1G A;  1CUN A;  1ZKE A;  2JQQ A;  4QX8 B;  3ZEF B;  2LEH A;  4DO0 A;  3RPU A;  2JRK A;  2JJ9 A;  4IE5 A;  2C5K T;  4KUM B;  3NZP A;  5EK3 A;  4H9Q C;  2E9X A;  3LJC A;  3PDY A;  4PJJ A;  2VL8 A;  3AVS A;  2XAH B;  3HKC E;  1YKH B;  5E0O A;  2RA1 A;  2D5U A;  2WM9 A;  2LSK A;  4GIW A;  1LKX A;  3T8O A;  4TN7 B;  3KV5 A;  5J2T E;  5HYA A;  4YHJ A;  2K48 A;  4HEA A;  4HN9 A;  2CEA A;  3RYF E;  5L3B B;  2Y48 B;  1D1A A;  2NW9 A;  1HG2 A;  2W62 A;  5LHI B;  3ETU A;  3UUX B;  3AAE B;  3I0Q A;  3UFE A;  4BA9 A;  2YIN A;  4JUY A;  4IE0 A;  4CI1 B;  4DBQ A;  2V7L A;  1VOM A;  3CML A;  4GYS A;  1IZN B;  5KX5 E;  5J2U E;  5FXX A;  5IHY A;  4MLK A;  2BZB A;  3HA4 A;  4WBO A;  5DJQ C;  3MKD A;  2X66 A;  2LSI A;  2W61 A;  1IJ6 A;  4PJM A;  4KP3 C;  4ILU A;  1FEW A;  2KMF A;  2XAJ B;  3EUH A;  5KDM C;  4X1K E;  1WRD A;  5FY7 A;  3VKG A;  4H63 V;  3CWZ B;  3LFM A;  3QC9 A;  4CZZ B;  3ZC0 A;  3LK4 2;  2YU1 A;  2C5J A;  3ZMS B;  2P9B A;  5FYM A;  5M4Y A;  2EHO C;  1U4Q A;  5LXT E;  3N2G E;  5HAX A;  3VHL A;  3PUR A;  4M1P A;  4TZ4 C;  3Q9D A;  1KNZ A;  4DND A;  3CVR A;  2CCQ A;  1V9D A;  1D1C A;  2KND A;  3KDS E;  2CXL A;  3I9Y A;  4P0B A;  2V7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...