4H9OC

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9oC00
4H9PC 5KDMC 4H9QC 4H9SE 4H9NC 4HGAA 4H9OC 4H9RC
chains in the Genus database with same CATH superfamily
1SA0E 2XQ3A 4IDNA 3IF8B 2GK9A 4IREA 2FJBA 3C4ZA 4HE8A 2W62A 1U5PA 3ZEFB 4JLEA 4NIQA 2UU9T 2CCQA 4TWHA 4DR5T 3RPUA 2CXFA 2PG8A 2WM9A 2M6IA 4IL9A 1KNRA 4JV5T 3LFMA 1HG2A 2ODVA 2Q9QA 4DV7T 5L3EB 4GYRA 3FHNA 1OEDC 2WWVA 1MMNA 2CBJA 2X51A 3FBLA 4QXHB 2MYSA 1LRZA 4EEDA 3CX6B 3I9YA 5EK4A 3AAEB 2PBIA 1Z0PA 3EAMA 3PURA 4AQGA 3JAEA 4UV8B 4E7SA 4CXYA 4AKLA 4UIGA 2WDQA 5L3DB 5CJ5A 2DWGA 3ONJA 1Y01A 2XASB 3BQLA 4U33A 1HNXT 2JPFA 2LE8A 3AXJB 2HPLA 5AQNB 2JMHA 4UF0B 3LG7A 4O2BE 3ANWA 3M65A 5FL0A 1YXRA 3ZKRA 3V5SA 4AIUA 2WP9A 3AE6A 1R8IA 5FVKA 2WWUA 3KFWX 3O1JA 3AE5A 5C3JA 1MNEA 2CWOA 2VKOA 3CQCB 3LBXB 2YDSA 3PUGA 4GIWA 2KNDA 3A7MA 3C50A 2XQAA 3MKDA 3TLTA 4DV6T 3L8RA 4YLHA 3P4RA 2LSGA 4G2AA 2ZM6T 3RIUC 1J1JA 3NZPA 4EEBA 3ESLA 3AVRA 5FY1A 4M1PA 4EYUA 3AA7B 5HWXA 1W0BA 4DO0A 2NTXA 5JR9B 2CBIA 3AVSA 3I1AA 2E9XB 3TLSA 2X9HA 5JH7E 2J1DG 2X9XA 4U31A 3ZMTB 5BMVE 1WRDA 3SFDA 3MXZA 2W0GA 2IC9A 5AQQB 3UTKA 1VCTA 3SOLA 3KV5A 2CE7A 4BJNA 4EOZB 3K8PC 1S35A 2MTQA 3RIUA 5JDQA 3P7IA 3H3AA 3EVYA 2DHRA 4KUMB 4IDOA 4CQIA 2SPCA 3F2EA 4IE6A 2BS4A 4OX9T 2W66A 4H9SE 1D1CA 4NPPA 5FKYA 2FJEA 5HEOA 2I6HA 3ZYMA 2NW7A 3PUXF 3UFGA 1IBLT 1YKEB 3CMLA 5LBQB 4H9QC 2LOSA 2CXLA 1XMQT 3RI5A 4ZEYA 5LA6E 3AEBA 3ZMUB 3N9QA 1OWAA 3NRXA 4ZZCA 2EHOB 2NOXA 3PDYA 4H63V 4DMWA 4H9RC 2BKOA 3PUSA 4HWHA 2ZMAA 1FEWA 3PUZF 5AQKB 2VASA 5HXRA 2IUBA 5LHGB 4JI0T 3O4XE 4IDPA 5L3GB 1HTJF 2RPAA 5HEUA 3ZCIA 4DBRA 2WB5A 2ODUA 4QHOA 1MMDA 4ILAA 4I4TE 2W67A 3AAAB 3Q5EA 3HKBE 2YN6A 2LSKA 3PUVF 1U4QA 2ACZA 1ZHCA 4JI7T 3Q9DA 3PUWF 5AFUL 3P4SA 3RLFF 3L09A 4ZZBA 2AXDS 4B3RT 2KLQA 4LMJA 4PK4A 5AQHB 2N9DA 4ILUA 2LSIA 4B3TT 1WLXA 4IHJE 1YW0A 5FMNA 2NW9A 2V7JA 3ZJ1A 3LDQB 2UUCT 4OHFA 3HKCE 3HI2A 5LHIB 3VKHA 4ZXLA 2ZM0A 1HFAA 3WI3A 4DIDB 2ZLYA 5H6RB 1H7CA 5DJQC 3HL6A 4HN9A 3VHLA 3QB5A 4HEAA 4CN6A 2KWIB 4X66T 4MALA 3ZC0A 1XZYA 4ANJA 4YY3T 3UQ7A 5LJMA 4AQFC 5LCYA 3NWIA 2HH7A 2LEHA 4AI6A 3PU8A 2ZM2A 5J2TE 1KFYA 1X79A 1G8XA 2XJ7A 1IAPA 2X0HA 2VKDA 2XPKA 4N78D 3C4WA 3EI0A 5LGUB 2BS2A 3IA3A 1IJ5A 2V5DA 1HR0T 2I0MA 2J47A 3UUMA 2K3WA 5C8YE 1UCUA 4L9IA 3PE0A 3AECA 2WY2A 3RF1A 2X0LB 1QUUA 2OLTA 4AKHA 5JRCB 4GK0E 4I0UA 2QGSA 4TV8E 2FJAA 2KXPB 4AQFA 4LMLA 1FIOA 2BBJA 4KI0F 3GWHA 5DQVA 2LKHA 3FB2A 2UXDT 4DUZT 2XHEB 4TZ4C 2DCFA 4QH4A 3Q5WA 2QVAA 2VURA 4QH1A 3TLVA 4HFVA 2E9XD 2IIUA 2NW8A 1D1BA 5L4EA 2BKPA 5AQOB 2VQET 2W2UA 4GOUA 3EHZA 5EZYE 4LFCT 5L3FB 3CX7B 4X1YE 5ETWA 1US7B 3JC6D 1MIWA 5JDMA 3OVUA 3E08A 1JNRA 4UVCB 1L0VA 4ZI2D 4DMVA 3GN5B 5HEHA 3T1HT 5AQGB 3V5UA 4IT4A 3CX8B 3AE1A 4F6RC 1N34T 2E8IA 2LLYA 2UXNB 5J2UE 3WAJA 3AXJA 3N9OA 2CA5A 3LK3B 3RIFA 1HX8A 4UF0A 1E7PA 4C90A 2BKNA 4H63H 4O4IE 5LGTB 5JR9C 5BR8T 2E9XC 1SHZC 5JDLA 1SE7A 4IE7A 3JADA 2JIWA 3K3NA 4QKNA 2EHOD 2E2AA 3ZMSB 1QLBA 1LKXA 3B57A 2VVSA 3AAIA 4HWCA 3LBXA 4LF8T 4LFBT 3ZYKA 2XY8B 1D1AA 4EB6E 2C5JA 1OEDE 3AE9A 2WCAA 4U72A 3JC6C 4E7ZA 4B3ST 2XZEA 4Q25A 3A8YC 3AEGA 4K0UA 4ZI2C 2YU2A 3EDVA 5EK2A 3LJCA 2KZ7B 3ZPOA 4PJLA 2WU2A 3PU3A 5F5WA 2Y6XA 5CGMA 2UXXB 3P4PA 2V7IA 2JQ9A 5IHYA 4O4HE 4KHZF 5JR9A 4V1Av 4HFHA 4GKKT 1HF8A 1XDPA 2E9XA 1FMWA 4YSZA 3P8CD 2VWAA 3CVRA 3RH3A 3N9LA 2LRLA 1YQ3A 4DBQA 4UEMA 2YDRA 5CA0E 5KX5E 2UUAT 2G0UA 3VRBA 2BVMA 5IWAT 5HXEA 4U3CA 5ABGA 3RGLA 2VKJA 3T8OA 2A3DA 4GYSA 2LM2A 2CHNA 3B13A 4IL4A 5LNKA 4ISTA 2HHHT 2EHOC 4PNIA 2C5KT 5LGNB 4AKRB 4EIWA 1IBMT 2KSRA 2XQ4A 5FVLA 2CHOA 4ZI3C 4ADZA 4HFIA 1MNDA 1OEDA 2D5UA 4JEUB 3LSVA 4LF7T 2K24A 3R84B 2BG9B 3KINB 2VL0A 1OXZA 4QXCB 2ACXA 4JYAT 5LHHB 1W9RA 2WZHA 4YT0A 3ONXA 1WYBA 3UU5A 2X9YA 3AE3A 2D0TA 2J4GA 3VR8A 2EHOA 4WW0A 2CPTA 4U7IA 4PJJA 2VVNA 4PK5A 4EGWA 5AQFB 4LFAT 4P1NA 5JDFA 1BR0A 4IE4A 2IMLA 3SFEA 1VOMA 4LMKA 3ETVA 5LG3A 5LP6E 2C5IT 3G06A 4XZCA 2NWBA 4QWNB 3AE4A 5ABFB 4C91A 3QK6A 2WMNA 4LF9T 3AEFA 1MIVA 4O8SA 1MMAA 3K3OA 1UK5A 4CI2B 2I59A 2XQ6A 4U7YA 5CB4E 3SWHA 2JJ9A 4DVDA 5AQMB 3EUHA 5HXHA 1N36T 3IEEA 3NRYA 2IAKA 2CM0A 5L3CB 3RHWA 4X5TA 2XSAA 5FP3A 5E0OA 4OYJA 4CN4A 2V6XA 3UU6A 1XMOT 5FXWA 4DV5T 1XWMA 2QA7A 2MPKA 5C2TA 3GMIA 4GK5E 2NP9A 3E0ZA 2HN2A 2XQYA 2VK9A 1VRBA 2YDQA 4X64T 3PTRB 3R6NA 1J5WA 2N1GA 3NBXX 3AA1B 2KINB 2JQHA 2WU5A 4ILCA 4NUVA 4UVAB 3RYCE 1QSDA 3KV9A 3N9PA 5J0ZA 3ZN1B 1LVFA 3N5LA 1D0ZA 1NEKA 4IGUA 4L5GA 4EYYR 2M67A 2W00A 1BR1A 2LSJA 3UFEA 3P50A 2LOPA 4LF4T 2XQ7A 4X1IE 2K48A 5JDNA 3ZT6A 2LKGA 2HN1A 3MJXA 2V7KA 2WAUA 3C98B 2FJDA 4TWFA 4U2ZA 2MOZA 1JNZA 2XQ9A 2YOEA 1CHUA 1E1HB 4PK6A 3ZT7A 4DR4T 2XM1A 2LJLA 5ABEA 4H9NC 1MMGA 1WCRA 2X9WA 2PTFA 2AE9A 4YHJA 3ETUA 3TLWA 4ISSA 2X0YA 4KBMB 2WZIA 4UELA 2Y48B 1LVKA 4DR2T 3DTOA 3VKGA 3SS1A 3RYFE 2IW5B 3AE2A 4IIJE 4YXDA 1WR6A 2UXBT 4DR7T 2BDEA 2HPJA 3CPZA 4JI5T 4A98A 2WQYA 3JAFA 4I43B 2X67A 1I94T 4Z90A 2FBWA 4TNVA 2YINA 2V7LA 2XAHB 4MHCA 4H9PC 3OPCA 4CZZB 1UURA 2CWYA 4IDZA 2OV9A 4ASKA 5AQIB 2CXDA 2XAQB 2D0UA 4EXTA 3PV0F 4X1KE 1UX4A 4OFZA 4TX5A 5FXVA 2UUBT 3N9NA 5AQJB 3FZMB 2BVLA 3HR0A 3FZHB 4YTPA 4WBNE 3RKGA 4X20E 4ERRA 4O2AE 3NZQA 4YHHT 3NVOA 3QUJA 4HKAA 2V6YB 1M7KA 3FXDB 3UU8A 5FXZA 2CEAA 1VCSA 2XAJB 5HCMA 3T1YT 4JEHB 2H88A 3E22E 1CUNA 4ZHQE 1BR4A 2WBLA 3KBTA 4I55E 2FUPA 2L3LA 5AQUB 2K5BB 4PFOA 1Z8UA 3K3QC 5L2LA 4P0BA 5LYJE 1WYCA 5IYZE 3NKZA 2YKSA 3RRCA 3AEAA 3KVAA 3L3PA 2A72A 4PAGA 2BG9C 4HFEA 3MK7C 2IHR1 5AQTB 5FL1A 3KV6A 1HS7A 3ZMVB 3CK6A 2CRBA 5HCJA 5F8PA 5LJNA 2MAWA 4JBWF 3QNUA 4WYVA 1HCIA 4UXNB 3DP7A 5HEJA 3CQGB 4FJOA 5HXCA 1AJ3A 4YFSA 3KVBA 2CLYB 1FMVA 4PJMA 4HWIB 2WDVA 3K1SA 5LG4A 5JREA 2E5VA 5AQLB 4HWFA 2BG9A 1O3XA 2UXCT 1ZP0A 4CI1B 3UU3A 3BQKA 4NXMT 2XQ5A 3P4WA 3OYXA 3BQIA 1T8BA 4ZI7E 5LXTE 2OA5A 5IUXA 2N2NA 3PUQA 2H89A 4PJNA 4XBFB 4KP3C 4AKIA 4DR6T 3HA4A 3OJAA 2B76A 3IBPA 2VB6A 3UQ4A 4ZI3D 3N2OA 1NWMX 1W09A 4QXBB 3RC3A 2PFVA 2C0SA 2WSSV 2XM2A 3H3MA 2LM9A 3AE8A 3CKDA 3RIAA 1I6ZA 4JI8T 4TN7B 4U2YA 3H37A 2YK0A 4I50E 1UX5A 3KV4A 5ABFA 3N9MA 3O1HA 3PJAJ 3S4UA 4HFBA 4LF6T 2JQQA 4DR3T 3LK42 2JRKA 3Q2MA 5KDMC 4HTEA 5GONE 3BK9A 3ZC1A 4JI1T 1W0AA 4BA9A 5LBMA 4TWDA 4YSXA 1KNPA 3OYZA 4DR1T 3I0OA 1XNQT 4TNWA 2M6BA 2XAGB 3UULA 3FZKB 5A1LA 4PW8A 3EABA 1HG5A 4YJ3E 4U74A 3UUNA 4TV9E 4ZS2A 3KBUA 4YSYA 3OTOT 1T72A 4YTNA 4PFPA 3CIRA 2BZBA 2Y8DA 4X65T 3O1IA 3UUBA 1X9BA 3RX6A 4YJ2E 5L47A 4AQYT 1Y64B 5FY0A 3PUAA 3UUXB 2H3RA 2K9AA 4MFRA 3UU4A 3F57A 3DJBA 2YEVC 2D2SA 3O9XA 2BBHA 1D0YA 2H7OA 4DV2T 4EV6A 1KNZA 4JI6T 4TUYE 4CXWA 3I9WA 3ZT5A 4IE5A 5L4HA 2LRKA 5HWYA 3C4XA 3RYIE 2DLRA 1IJ6A 3RYHE 3FZLB 2Q9QB 2L8KA 5KXJA 3CQXC 5AQSB 3AEDA 2XTLA 2KWHA 4MBQA 5LB7B 3RC8A 2H7VC 3D0TA 5LMNT 1HNZT 2J62A 5EK3A 2IDOB 4QX7B 1DU2A 2A9UA 5FY7A 3ZJ2A 3TKLB 5FNVE 1GQEA 3EDUA 4WZXA 5AQPB 2WMOA 2XQ8A 2ES0A 1NENA 2WDRA 4DUYT 5AQRB 5ADXL 4A5XA 4DV3T 3FZFB 5H6QB 1M62A 3MA9A 1S94A 3HKDE 3ANWB 1OEDB 1WFDA 2RP4A 3J9X1 3ZSSA 4P0AA 1IBKT 5JTGA 1YKHB 4UV9B 2X66A 2YU1A 3AB3B 3AE7A 4YTMA 2XAFB 3RQWA 3AEEA 1SUMB 1J5ET 3MACA 3FBZA 4G63A 4A56A 3L39A 4HWDA 2LHNA 1WR0A 4LF5T 4CXXA 2W4XA 3UT5E 5JQGE 3IHRA 3ZMZB 3W15B 5JDGA 4Z91A 3RKOA 4A97A 3N2KE 1N33T 3QOFA 2QYWA 2V7MA 4O4JE 3ZYLA 3HKEE 5HAXA 1KF6A 4NUUA 3RRWA 4L0RA 4WBOA 2DNXA 2V6YA 3C64A 5JRCA 5FXXA 3TLUA 4CI3B 4AISA 4K0KT 5TAOA 5JVDE 3X1DA 2X68A 5DQWA 2V8SV 4EAHA 1NAFA 1ZV4X 1ZKEA 2W63A 3J7Yq 2CLYC 3F31A 2XSBA 3VU7H 3ABVA 4AKGA 1HX1B 5LMUT 3OBVE 3U78A 2QRXA 1KK7A 3ZSTA 1ZOYA 4OYKA 3GN5A 3ONLC 4HFCA 2LHRA 3WAKA 3CWZB 3ZCJA 1E2AA 2V1DB 4WNKA 4F8HA 1MIYA 2NR4A 4UVBB 3RQUA 1V9DA 2B1EA 4Z8XA 5L3BB 4ZOLE 5DABA 1BR2A 5AQVB 4EZ4A 4JUYA 1YD8G 5HEGA 2JQKA 3I0QA 1UGOA 4GKJT 4KX6A 4DV1T 2WS3A 2R6GF 4O4LE 3AA0B 3MZKB 1IZNB 2V5CA 1XDOA 5JDHA 4KHPT 4DV4T 2CMRA 1N32T 4OK0A 1HNWT 2MBGA 3Q5XA 4CN1A 2BG9E 4J2CA 3QB5K 4B3MT 3M3ZB 3VR9A 4BAYB 3U3IA 5ABHA 5LOVE 4KMCA 2KMFA 1KEYA 4AXPA 4JI3T 4FI5A 4NXNT 4ZS3A 3N2GE 5CA1E 2ZM8A 2Q9QD 1T98A 2P9BA 2PJQA 4JI2T 4H9OC 1FJGT 4B6XA 2A2FX 2DI4A 3AA6B 5CFBA 2W61A 3JCFA 3ZN0B 1UUSA 2E5LT 4QH5A 1D0XA 4HGAA 4HFDA 4BJMA 3GA8A 1ZEEA 1XNRT 2RA1A 4COFA 1EZ3A 2VKHA 5HXSA 3LK2B 3P4QA 4QX8B 4IDQA 2F4VT 4DV0T 3VRAA 5KMGP 2LSYA 2L9QA 5HYAA 3PJAA 3QC9A 3PUYF 2KT9A 4MLKA 2BS3A 2V26A 4ILBA 2IC6A 4DNDA 3SRZA 5F3JA 2VL8A 2DL1A 2LT3A 3C51A 3Q5DA 4X62T 4EZHA 3OKQA 2XUEA 5J1GA 5M4YA 1G73A 2Q9QC 3B5MA 4P09A 3ZLIA 3FXEB 2JMKA 2D9DA 3KDSE 1B7TA 2Z6EA 1T7SA 1YQ4A 2NTYA 4XAXB 5FYMA 2DWKA 4UR9A 3A5XA 4IE0A 2VQFT 4JI4T
chains in the Genus database with same CATH topology
1SA0E 3MJXA 4TUYE 4CXWA 2V7KA 2WAUA 3UUMA 3C98B 5C8YE 1UCUA 3IF8B 4L9IA 3I9WA 3PE0A 2GK9A 4IE5A 2MOZA 3C4ZA 2X0LB 1QUUA 5HWYA 4HE8A 3C4XA 4AKHA 5JRCB 2W62A 1E1HB 4GK0E 4PK6A 3RYIE 1U5PA 2QGSA 2DLRA 4TV8E 3ZEFB 2KXPB 1IJ6A 4JLEA 4AQFA 2LJLA 3RYHE 1FIOA 2Q9QB 2L8KA 3GWHA 5DQVA 3CQXC 3FB2A 2CCQA 2XTLA 2KWHA 4H9NC 1MMGA 2CXFA 2PG8A 2XHEB 4MBQA 3RPUA 4TZ4C 2WM9A 2X9WA 2DCFA 3RC8A 2H7VC 3D0TA 3LFMA 1HG2A 3Q5WA 2ODVA 2Q9QA 5L3EB 4HFVA 2E9XD 4GYRA 4YHJA 3FHNA 3ETUA 2NW8A 1D1BA 4ISSA 5EK3A 4KBMB 4UELA 2Y48B 1MMNA 1LVKA 4QX7B 2X51A 3DTOA 3VKGA 4GOUA 3FBLA 5FY7A 4QXHB 3SS1A 2MYSA 1LRZA 5EZYE 2IW5B 3CX6B 3RYFE 3I9YA 4IIJE 3TKLB 5EK4A 3ZJ2A 5L3FB 5FNVE 1WR6A 3AAEB 2PBIA 3CX7B 4X1YE 2BDEA 5ETWA 1Z0PA 2HPJA 3CPZA 3PURA 4AQGA 1US7B 3EDUA 4UV8B 4E7SA 3JC6D 1MIWA 5JDMA 4CXYA 4AKLA 2WMOA 3E08A 4I43B 4UIGA 2ES0A 4UVCB 5L3DB 2X67A 2DWGA 4ZI2D 4DMVA 2XASB 3BQLA 3GN5B 5ADXL 5H6QB 2YINA 2JPFA 3MA9A 2LE8A 1S94A 3V5UA 2HPLA 3CX8B 3HKDE 3ANWB 2V7LA 2XAHB 4F6RC 4MHCA 2JMHA 2RP4A 3J9X1 4H9PC 2E8IA 4CZZB 4UF0B 4P0AA 2UXNB 5J2UE 3WAJA 2CWYA 3N9OA 4IDZA 1YKHB 2CA5A 3LG7A 4O2BE 3ANWA 3M65A 4UV9B 2X66A 3LK3B 1HX8A 4ASKA 2CXDA 2YU1A 2XAQB 2D0UA 3AB3B 4UF0A 4C90A 4EXTA 4X1KE 1UX4A 4OFZA 4H63H 2XAFB 4TX5A 4O4IE 5LGTB 3V5SA 5JR9C 5FXVA 3MACA 2WWUA 3N9NA 3FBZA 4G63A 4A56A 2E9XC 3KFWX 3O1JA 2BVLA 1SHZC 5JDLA 1MNEA 2CWOA 2LHNA 2VKOA 3HR0A 4IE7A 3CQCB 4CXXA 3LBXB 3UT5E 3K3NA 4WBNE 3PUGA 5JQGE 4QKNA 2EHOD 3IHRA 4GIWA 3ZMZB 2KNDA 3MKDA 3C50A 3ZMSB 4YLHA 4X20E 1LKXA 3B57A 4ERRA 3W15B 4O2AE 3NZQA 3AAIA 5JDGA 2LSGA 3LBXA 4G2AA 3RKOA 3ZYKA 1D1AA 3N2KE 3QUJA 2C5JA 4EB6E 4U72A 4HKAA 3JC6C 4E7ZA 2V7MA 3NZPA 4O4JE 3ZYLA 3FXDB 3ESLA 3HKEE 5HAXA 3AVRA 5FY1A 5FXZA 2CEAA 4NUUA 3RRWA 4M1PA 4EYUA 2XAJB 4L0RA 3AA7B 5HWXA 4DO0A 2NTXA 4JEHB 4WBOA 4K0UA 2DNXA 4ZI2C 2YU2A 3EDVA 5EK2A 3LJCA 2KZ7B 3ZPOA 3E22E 4PJLA 3C64A 5JR9B 1CUNA 3AVSA 4ZHQE 5JRCA 1BR4A 3PU3A 5FXXA 4CI3B 2WBLA 3KBTA 3I1AA 2Y6XA 2E9XB 2X9HA 5TAOA 4I55E 5JVDE 2L3LA 2UXXB 2J1DG 2X68A 5IHYA 2V7IA 5JH7E 2K5BB 4O4HE 5DQWA 5JR9A 2X9XA 4V1Av 4PFOA 3ZMTB 4EAHA 5L2LA 3K3QC 5BMVE 1NAFA 4P0BA 1HF8A 5LYJE 2E9XA 1WRDA 1FMWA 3MXZA 2W0GA 2IC9A 1WYCA 3P8CD 5IYZE 2VWAA 3UTKA 3CVRA 3RH3A 3RRCA 3N9LA 1ZV4X 1ZKEA 3KVAA 3SOLA 3L3PA 2W63A 2A72A 3KV5A 4PAGA 3J7Yq 2CE7A 2CLYC 4DBQA 4BJNA 3F31A 4EOZB 4UEMA 3VU7H 3K8PC 1S35A 3MK7C 5CA0E 2MTQA 5KX5E 2G0UA 3KV6A 1HS7A 2BVMA 3ZMVB 5HXEA 5JDQA 4AKGA 3P7IA 2VKJA 3H3AA 3T8OA 2A3DA 3EVYA 4GYSA 5F8PA 3B13A 5LJNA 5LNKA 4ISTA 2EHOC 4PNIA 2DHRA 4KUMB 3OBVE 3U78A 2C5KT 1KK7A 4CQIA 5LGNB 2SPCA 3F2EA 4IE6A 1HCIA 4UXNB 4AKRB 4OYKA 3DP7A 3GN5A 4EIWA 4H9SE 1D1CA 4ZI3C 4ADZA 1MNDA 2D5UA 4JEUB 3CQGB 4FJOA 5HXCA 1AJ3A 4YFSA 3KVBA 2K24A 3ZYMA 3R84B 2CLYB 2LHRA 2NW7A 3WAKA 3CWZB 3ZCJA 3KINB 1FMVA 1YKEB 2V1DB 3CMLA 1OXZA 4PJMA 5LBQB 4QXCB 2ACXA 4H9QC 4WNKA 2LOSA 1MIYA 5LG4A 5JREA 2CXLA 5LHHB 4UVBB 1O3XA 5LA6E 4CI1B 1V9DA 2B1EA 3ZMUB 3BQKA 3N9QA 3ONXA 3OYXA 3BQIA 4Z8XA 5L3BB 1OWAA 4ZI7E 1WYBA 3NRXA 5LXTE 2OA5A 2EHOB 2NOXA 4ZOLE 5DABA 2X9YA 1BR2A 2D0TA 2N2NA 4EZ4A 3PUQA 4JUYA 3PDYA 4PJNA 1YD8G 4H63V 4XBFB 4DMWA 4H9RC 3I0QA 4KP3C 4AKIA 3PUSA 3HA4A 2EHOA 2ZMAA 3OJAA 1FEWA 5HXRA 2VASA 4WW0A 4O4LE 3AA0B 5LHGB 3MZKB 1IZNB 5JDHA 3IBPA 4PJJA 2VB6A 4PK5A 4ZI3D 2CMRA 3N2OA 1NWMX 3O4XE 5JDFA 5L3GB 1BR0A 1HTJF 4QXBB 3RC3A 4DBRA 4OK0A 3ZCIA 4IE4A 2PFVA 2ODUA 2MBGA 3Q5XA 4J2CA 4QHOA 1VOMA 2C0SA 1MMDA 2WSSV 4I4TE 4BAYB 3AAAB 3ETVA 3HKBE 5LP6E 3U3IA 2C5IT 2LM9A 2LSKA 4XZCA 2NWBA 4QWNB 3CKDA 5LOVE 1U4QA 4KMCA 2KMFA 4C91A 1ZHCA 4AXPA 3Q9DA 3QK6A 2WMNA 4TN7B 3H37A 1MIVA 5AFUL 4FI5A 4O8SA 4ZS3A 2YK0A 3N2GE 5CA1E 2ZM8A 1UX5A 2Q9QD 3KV4A 4I50E 1MMAA 1T98A 3K3OA 3L09A 3N9MA 4CI2B 2I59A 2P9BA 3SWHA 2PJQA 5CB4E 4H9OC 2JJ9A 2KLQA 4DVDA 4B6XA 2A2FX 2DI4A 3O1HA 3S4UA 3AA6B 4PK4A 3EUHA 2N9DA 2JQQA 5HXHA 3IEEA 2W61A 3ZN0B 4ILUA 3NRYA 2IAKA 2CM0A 2LSIA 3LK42 5L3CB 1D0XA 4HGAA 1WLXA 2JRKA 4BJMA 3Q2MA 5KDMC 4HTEA 4IHJE 1YW0A 3BK9A 5FP3A 3GA8A 5E0OA 5GONE 3ZC1A 4OYJA 5FMNA 2NW9A 4BA9A 1ZEEA 5LBMA 2RA1A 2V7JA 3ZJ1A 1EZ3A 3OYZA 2VKHA 4OHFA 5FXWA 5HXSA 3LK2B 3I0OA 4QX8B 3HKCE 2QA7A 3HI2A 5KMGP 2LSYA 3GMIA 5LHIB 3VKHA 2L9QA 2XAGB 3UULA 2ZM0A 4GK5E 5HYAA 1HFAA 2NP9A 3QC9A 3WI3A 3E0ZA 2ZLYA 5A1LA 2XQYA 4PW8A 4MLKA 2KT9A 2VK9A 1H7CA 5H6RB 2V26A 5DJQC 1VRBA 3HL6A 2IC6A 4DNDA 1HG5A 4YJ3E 3PTRB 4HN9A 3VHLA 4U74A 4HEAA 3SRZA 5F3JA 3UUNA 3R6NA 4TV9E 2VL8A 2KWIB 4ZS2A 3KBUA 2LT3A 4MALA 3ZC0A 3C51A 4ANJA 2N1GA 4PFPA 3NBXX 4EZHA 3OKQA 3AA1B 2XUEA 5J1GA 2BZBA 2KINB 5LJMA 5M4YA 4AQFC 5LCYA 2Y8DA 4NUVA 4UVAB 3RYCE 3O1IA 1QSDA 2HH7A 1G73A 3RX6A 4YJ2E 3KV9A 2LEHA 3N9PA 3ZN1B 1LVFA 4AI6A 3N5LA 1D0ZA 3PU8A 2Q9QC 2ZM2A 1Y64B 5J2TE 5FY0A 4P09A 1X79A 4IGUA 3PUAA 4L5GA 4EYYR 1G8XA 2M67A 3ZLIA 2W00A 1BR1A 1IAPA 2LSJA 3FXEB 3UUXB 2H3RA 2VKDA 2K9AA 3UFEA 4MFRA 2LOPA 3F57A 2JMKA 3DJBA 3KDSE 2YEVC 2D2SA 4X1IE 1B7TA 4N78D 3C4WA 2K48A 2Z6EA 2NTYA 5LGUB 3O9XA 4XAXB 1D0YA 2H7OA 5FYMA 2DWKA 3A5XA 4IE0A 1IJ5A 5JDNA 1KNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P C;  5KDM C;  4H9Q C;  4H9S E;  4H9N C;  4HGA A;  4H9O C;  4H9R C; 
#chains in the Genus database with same CATH topology
 1SA0 E;  2XQ3 A;  4IDN A;  3IF8 B;  2GK9 A;  4IRE A;  2FJB A;  3C4Z A;  4HE8 A;  2W62 A;  1U5P A;  3ZEF B;  4JLE A;  4NIQ A;  2UU9 T;  2CCQ A;  4TWH A;  4DR5 T;  3RPU A;  2CXF A;  2PG8 A;  2WM9 A;  2M6I A;  4IL9 A;  1KNR A;  4JV5 T;  3LFM A;  1HG2 A;  2ODV A;  2Q9Q A;  4DV7 T;  5L3E B;  4GYR A;  3FHN A;  1OED C;  2WWV A;  1MMN A;  2CBJ A;  2X51 A;  3FBL A;  4QXH B;  2MYS A;  1LRZ A;  4EED A;  3CX6 B;  3I9Y A;  5EK4 A;  3AAE B;  2PBI A;  1Z0P A;  3EAM A;  3PUR A;  4AQG A;  3JAE A;  4UV8 B;  4E7S A;  4CXY A;  4AKL A;  4UIG A;  2WDQ A;  5L3D B;  5CJ5 A;  2DWG A;  3ONJ A;  1Y01 A;  2XAS B;  3BQL A;  4U33 A;  1HNX T;  2JPF A;  2LE8 A;  3AXJ B;  2HPL A;  5AQN B;  2JMH A;  4UF0 B;  3LG7 A;  4O2B E;  3ANW A;  3M65 A;  5FL0 A;  1YXR A;  3ZKR A;  3V5S A;  4AIU A;  2WP9 A;  3AE6 A;  1R8I A;  5FVK A;  2WWU A;  3KFW X;  3O1J A;  3AE5 A;  5C3J A;  1MNE A;  2CWO A;  2VKO A;  3CQC B;  3LBX B;  2YDS A;  3PUG A;  4GIW A;  2KND A;  3A7M A;  3C50 A;  2XQA A;  3MKD A;  3TLT A;  4DV6 T;  3L8R A;  4YLH A;  3P4R A;  2LSG A;  4G2A A;  2ZM6 T;  3RIU C;  1J1J A;  3NZP A;  4EEB A;  3ESL A;  3AVR A;  5FY1 A;  4M1P A;  4EYU A;  3AA7 B;  5HWX A;  1W0B A;  4DO0 A;  2NTX A;  5JR9 B;  2CBI A;  3AVS A;  3I1A A;  2E9X B;  3TLS A;  2X9H A;  5JH7 E;  2J1D G;  2X9X A;  4U31 A;  3ZMT B;  5BMV E;  1WRD A;  3SFD A;  3MXZ A;  2W0G A;  2IC9 A;  5AQQ B;  3UTK A;  1VCT A;  3SOL A;  3KV5 A;  2CE7 A;  4BJN A;  4EOZ B;  3K8P C;  1S35 A;  2MTQ A;  3RIU A;  5JDQ A;  3P7I A;  3H3A A;  3EVY A;  2DHR A;  4KUM B;  4IDO A;  4CQI A;  2SPC A;  3F2E A;  4IE6 A;  2BS4 A;  4OX9 T;  2W66 A;  4H9S E;  1D1C A;  4NPP A;  5FKY A;  2FJE A;  5HEO A;  2I6H A;  3ZYM A;  2NW7 A;  3PUX F;  3UFG A;  1IBL T;  1YKE B;  3CML A;  5LBQ B;  4H9Q C;  2LOS A;  2CXL A;  1XMQ T;  3RI5 A;  4ZEY A;  5LA6 E;  3AEB A;  3ZMU B;  3N9Q A;  1OWA A;  3NRX A;  4ZZC A;  2EHO B;  2NOX A;  3PDY A;  4H63 V;  4DMW A;  4H9R C;  2BKO A;  3PUS A;  4HWH A;  2ZMA A;  1FEW A;  3PUZ F;  5AQK B;  2VAS A;  5HXR A;  2IUB A;  5LHG B;  4JI0 T;  3O4X E;  4IDP A;  5L3G B;  1HTJ F;  2RPA A;  5HEU A;  3ZCI A;  4DBR A;  2WB5 A;  2ODU A;  4QHO A;  1MMD A;  4ILA A;  4I4T E;  2W67 A;  3AAA B;  3Q5E A;  3HKB E;  2YN6 A;  2LSK A;  3PUV F;  1U4Q A;  2ACZ A;  1ZHC A;  4JI7 T;  3Q9D A;  3PUW F;  5AFU L;  3P4S A;  3RLF F;  3L09 A;  4ZZB A;  2AXD S;  4B3R T;  2KLQ A;  4LMJ A;  4PK4 A;  5AQH B;  2N9D A;  4ILU A;  2LSI A;  4B3T T;  1WLX A;  4IHJ E;  1YW0 A;  5FMN A;  2NW9 A;  2V7J A;  3ZJ1 A;  3LDQ B;  2UUC T;  4OHF A;  3HKC E;  3HI2 A;  5LHI B;  3VKH A;  4ZXL A;  2ZM0 A;  1HFA A;  3WI3 A;  4DID B;  2ZLY A;  5H6R B;  1H7C A;  5DJQ C;  3HL6 A;  4HN9 A;  3VHL A;  3QB5 A;  4HEA A;  4CN6 A;  2KWI B;  4X66 T;  4MAL A;  3ZC0 A;  1XZY A;  4ANJ A;  4YY3 T;  3UQ7 A;  5LJM A;  4AQF C;  5LCY A;  3NWI A;  2HH7 A;  2LEH A;  4AI6 A;  3PU8 A;  2ZM2 A;  5J2T E;  1KFY A;  1X79 A;  1G8X A;  2XJ7 A;  1IAP A;  2X0H A;  2VKD A;  2XPK A;  4N78 D;  3C4W A;  3EI0 A;  5LGU B;  2BS2 A;  3IA3 A;  1IJ5 A;  2V5D A;  1HR0 T;  2I0M A;  2J47 A;  3UUM A;  2K3W A;  5C8Y E;  1UCU A;  4L9I A;  3PE0 A;  3AEC A;  2WY2 A;  3RF1 A;  2X0L B;  1QUU A;  2OLT A;  4AKH A;  5JRC B;  4GK0 E;  4I0U A;  2QGS A;  4TV8 E;  2FJA A;  2KXP B;  4AQF A;  4LML A;  1FIO A;  2BBJ A;  4KI0 F;  3GWH A;  5DQV A;  2LKH A;  3FB2 A;  2UXD T;  4DUZ T;  2XHE B;  4TZ4 C;  2DCF A;  4QH4 A;  3Q5W A;  2QVA A;  2VUR A;  4QH1 A;  3TLV A;  4HFV A;  2E9X D;  2IIU A;  2NW8 A;  1D1B A;  5L4E A;  2BKP A;  5AQO B;  2VQE T;  2W2U A;  4GOU A;  3EHZ A;  5EZY E;  4LFC T;  5L3F B;  3CX7 B;  4X1Y E;  5ETW A;  1US7 B;  3JC6 D;  1MIW A;  5JDM A;  3OVU A;  3E08 A;  1JNR A;  4UVC B;  1L0V A;  4ZI2 D;  4DMV A;  3GN5 B;  5HEH A;  3T1H T;  5AQG B;  3V5U A;  4IT4 A;  3CX8 B;  3AE1 A;  4F6R C;  1N34 T;  2E8I A;  2LLY A;  2UXN B;  5J2U E;  3WAJ A;  3AXJ A;  3N9O A;  2CA5 A;  3LK3 B;  3RIF A;  1HX8 A;  4UF0 A;  1E7P A;  4C90 A;  2BKN A;  4H63 H;  4O4I E;  5LGT B;  5JR9 C;  5BR8 T;  2E9X C;  1SHZ C;  5JDL A;  1SE7 A;  4IE7 A;  3JAD A;  2JIW A;  3K3N A;  4QKN A;  2EHO D;  2E2A A;  3ZMS B;  1QLB A;  1LKX A;  3B57 A;  2VVS A;  3AAI A;  4HWC A;  3LBX A;  4LF8 T;  4LFB T;  3ZYK A;  2XY8 B;  1D1A A;  4EB6 E;  2C5J A;  1OED E;  3AE9 A;  2WCA A;  4U72 A;  3JC6 C;  4E7Z A;  4B3S T;  2XZE A;  4Q25 A;  3A8Y C;  3AEG A;  4K0U A;  4ZI2 C;  2YU2 A;  3EDV A;  5EK2 A;  3LJC A;  2KZ7 B;  3ZPO A;  4PJL A;  2WU2 A;  3PU3 A;  5F5W A;  2Y6X A;  5CGM A;  2UXX B;  3P4P A;  2V7I A;  2JQ9 A;  5IHY A;  4O4H E;  4KHZ F;  5JR9 A;  4V1A v;  4HFH A;  4GKK T;  1HF8 A;  1XDP A;  2E9X A;  1FMW A;  4YSZ A;  3P8C D;  2VWA A;  3CVR A;  3RH3 A;  3N9L A;  2LRL A;  1YQ3 A;  4DBQ A;  4UEM A;  2YDR A;  5CA0 E;  5KX5 E;  2UUA T;  2G0U A;  3VRB A;  2BVM A;  5IWA T;  5HXE A;  4U3C A;  5ABG A;  3RGL A;  2VKJ A;  3T8O A;  2A3D A;  4GYS A;  2LM2 A;  2CHN A;  3B13 A;  4IL4 A;  5LNK A;  4IST A;  2HHH T;  2EHO C;  4PNI A;  2C5K T;  5LGN B;  4AKR B;  4EIW A;  1IBM T;  2KSR A;  2XQ4 A;  5FVL A;  2CHO A;  4ZI3 C;  4ADZ A;  4HFI A;  1MND A;  1OED A;  2D5U A;  4JEU B;  3LSV A;  4LF7 T;  2K24 A;  3R84 B;  2BG9 B;  3KIN B;  2VL0 A;  1OXZ A;  4QXC B;  2ACX A;  4JYA T;  5LHH B;  1W9R A;  2WZH A;  4YT0 A;  3ONX A;  1WYB A;  3UU5 A;  2X9Y A;  3AE3 A;  2D0T A;  2J4G A;  3VR8 A;  2EHO A;  4WW0 A;  2CPT A;  4U7I A;  4PJJ A;  2VVN A;  4PK5 A;  4EGW A;  5AQF B;  4LFA T;  4P1N A;  5JDF A;  1BR0 A;  4IE4 A;  2IML A;  3SFE A;  1VOM A;  4LMK A;  3ETV A;  5LG3 A;  5LP6 E;  2C5I T;  3G06 A;  4XZC A;  2NWB A;  4QWN B;  3AE4 A;  5ABF B;  4C91 A;  3QK6 A;  2WMN A;  4LF9 T;  3AEF A;  1MIV A;  4O8S A;  1MMA A;  3K3O A;  1UK5 A;  4CI2 B;  2I59 A;  2XQ6 A;  4U7Y A;  5CB4 E;  3SWH A;  2JJ9 A;  4DVD A;  5AQM B;  3EUH A;  5HXH A;  1N36 T;  3IEE A;  3NRY A;  2IAK A;  2CM0 A;  5L3C B;  3RHW A;  4X5T A;  2XSA A;  5FP3 A;  5E0O A;  4OYJ A;  4CN4 A;  2V6X A;  3UU6 A;  1XMO T;  5FXW A;  4DV5 T;  1XWM A;  2QA7 A;  2MPK A;  5C2T A;  3GMI A;  4GK5 E;  2NP9 A;  3E0Z A;  2HN2 A;  2XQY A;  2VK9 A;  1VRB A;  2YDQ A;  4X64 T;  3PTR B;  3R6N A;  1J5W A;  2N1G A;  3NBX X;  3AA1 B;  2KIN B;  2JQH A;  2WU5 A;  4ILC A;  4NUV A;  4UVA B;  3RYC E;  1QSD A;  3KV9 A;  3N9P A;  5J0Z A;  3ZN1 B;  1LVF A;  3N5L A;  1D0Z A;  1NEK A;  4IGU A;  4L5G A;  4EYY R;  2M67 A;  2W00 A;  1BR1 A;  2LSJ A;  3UFE A;  3P50 A;  2LOP A;  4LF4 T;  2XQ7 A;  4X1I E;  2K48 A;  5JDN A;  3ZT6 A;  2LKG A;  2HN1 A;  3MJX A;  2V7K A;  2WAU A;  3C98 B;  2FJD A;  4TWF A;  4U2Z A;  2MOZ A;  1JNZ A;  2XQ9 A;  2YOE A;  1CHU A;  1E1H B;  4PK6 A;  3ZT7 A;  4DR4 T;  2XM1 A;  2LJL A;  5ABE A;  4H9N C;  1MMG A;  1WCR A;  2X9W A;  2PTF A;  2AE9 A;  4YHJ A;  3ETU A;  3TLW A;  4ISS A;  2X0Y A;  4KBM B;  2WZI A;  4UEL A;  2Y48 B;  1LVK A;  4DR2 T;  3DTO A;  3VKG A;  3SS1 A;  3RYF E;  2IW5 B;  3AE2 A;  4IIJ E;  4YXD A;  1WR6 A;  2UXB T;  4DR7 T;  2BDE A;  2HPJ A;  3CPZ A;  4JI5 T;  4A98 A;  2WQY A;  3JAF A;  4I43 B;  2X67 A;  1I94 T;  4Z90 A;  2FBW A;  4TNV A;  2YIN A;  2V7L A;  2XAH B;  4MHC A;  4H9P C;  3OPC A;  4CZZ B;  1UUR A;  2CWY A;  4IDZ A;  2OV9 A;  4ASK A;  5AQI B;  2CXD A;  2XAQ B;  2D0U A;  4EXT A;  3PV0 F;  4X1K E;  1UX4 A;  4OFZ A;  4TX5 A;  5FXV A;  2UUB T;  3N9N A;  5AQJ B;  3FZM B;  2BVL A;  3HR0 A;  3FZH B;  4YTP A;  4WBN E;  3RKG A;  4X20 E;  4ERR A;  4O2A E;  3NZQ A;  4YHH T;  3NVO A;  3QUJ A;  4HKA A;  2V6Y B;  1M7K A;  3FXD B;  3UU8 A;  5FXZ A;  2CEA A;  1VCS A;  2XAJ B;  5HCM A;  3T1Y T;  4JEH B;  2H88 A;  3E22 E;  1CUN A;  4ZHQ E;  1BR4 A;  2WBL A;  3KBT A;  4I55 E;  2FUP A;  2L3L A;  5AQU B;  2K5B B;  4PFO A;  1Z8U A;  3K3Q C;  5L2L A;  4P0B A;  5LYJ E;  1WYC A;  5IYZ E;  3NKZ A;  2YKS A;  3RRC A;  3AEA A;  3KVA A;  3L3P A;  2A72 A;  4PAG A;  2BG9 C;  4HFE A;  3MK7 C;  2IHR 1;  5AQT B;  5FL1 A;  3KV6 A;  1HS7 A;  3ZMV B;  3CK6 A;  2CRB A;  5HCJ A;  5F8P A;  5LJN A;  2MAW A;  4JBW F;  3QNU A;  4WYV A;  1HCI A;  4UXN B;  3DP7 A;  5HEJ A;  3CQG B;  4FJO A;  5HXC A;  1AJ3 A;  4YFS A;  3KVB A;  2CLY B;  1FMV A;  4PJM A;  4HWI B;  2WDV A;  3K1S A;  5LG4 A;  5JRE A;  2E5V A;  5AQL B;  4HWF A;  2BG9 A;  1O3X A;  2UXC T;  1ZP0 A;  4CI1 B;  3UU3 A;  3BQK A;  4NXM T;  2XQ5 A;  3P4W A;  3OYX A;  3BQI A;  1T8B A;  4ZI7 E;  5LXT E;  2OA5 A;  5IUX A;  2N2N A;  3PUQ A;  2H89 A;  4PJN A;  4XBF B;  4KP3 C;  4AKI A;  4DR6 T;  3HA4 A;  3OJA A;  2B76 A;  3IBP A;  2VB6 A;  3UQ4 A;  4ZI3 D;  3N2O A;  1NWM X;  1W09 A;  4QXB B;  3RC3 A;  2PFV A;  2C0S A;  2WSS V;  2XM2 A;  3H3M A;  2LM9 A;  3AE8 A;  3CKD A;  3RIA A;  1I6Z A;  4JI8 T;  4TN7 B;  4U2Y A;  3H37 A;  2YK0 A;  4I50 E;  1UX5 A;  3KV4 A;  5ABF A;  3N9M A;  3O1H A;  3PJA J;  3S4U A;  4HFB A;  4LF6 T;  2JQQ A;  4DR3 T;  3LK4 2;  2JRK A;  3Q2M A;  5KDM C;  4HTE A;  5GON E;  3BK9 A;  3ZC1 A;  4JI1 T;  1W0A A;  4BA9 A;  5LBM A;  4TWD A;  4YSX A;  1KNP A;  3OYZ A;  4DR1 T;  3I0O A;  1XNQ T;  4TNW A;  2M6B A;  2XAG B;  3UUL A;  3FZK B;  5A1L A;  4PW8 A;  3EAB A;  1HG5 A;  4YJ3 E;  4U74 A;  3UUN A;  4TV9 E;  4ZS2 A;  3KBU A;  4YSY A;  3OTO T;  1T72 A;  4YTN A;  4PFP A;  3CIR A;  2BZB A;  2Y8D A;  4X65 T;  3O1I A;  3UUB A;  1X9B A;  3RX6 A;  4YJ2 E;  5L47 A;  4AQY T;  1Y64 B;  5FY0 A;  3PUA A;  3UUX B;  2H3R A;  2K9A A;  4MFR A;  3UU4 A;  3F57 A;  3DJB A;  2YEV C;  2D2S A;  3O9X A;  2BBH A;  1D0Y A;  2H7O A;  4DV2 T;  4EV6 A;  1KNZ A;  4JI6 T;  4TUY E;  4CXW A;  3I9W A;  3ZT5 A;  4IE5 A;  5L4H A;  2LRK A;  5HWY A;  3C4X A;  3RYI E;  2DLR A;  1IJ6 A;  3RYH E;  3FZL B;  2Q9Q B;  2L8K A;  5KXJ A;  3CQX C;  5AQS B;  3AED A;  2XTL A;  2KWH A;  4MBQ A;  5LB7 B;  3RC8 A;  2H7V C;  3D0T A;  5LMN T;  1HNZ T;  2J62 A;  5EK3 A;  2IDO B;  4QX7 B;  1DU2 A;  2A9U A;  5FY7 A;  3ZJ2 A;  3TKL B;  5FNV E;  1GQE A;  3EDU A;  4WZX A;  5AQP B;  2WMO A;  2XQ8 A;  2ES0 A;  1NEN A;  2WDR A;  4DUY T;  5AQR B;  5ADX L;  4A5X A;  4DV3 T;  3FZF B;  5H6Q B;  1M62 A;  3MA9 A;  1S94 A;  3HKD E;  3ANW B;  1OED B;  1WFD A;  2RP4 A;  3J9X 1;  3ZSS A;  4P0A A;  1IBK T;  5JTG A;  1YKH B;  4UV9 B;  2X66 A;  2YU1 A;  3AB3 B;  3AE7 A;  4YTM A;  2XAF B;  3RQW A;  3AEE A;  1SUM B;  1J5E T;  3MAC A;  3FBZ A;  4G63 A;  4A56 A;  3L39 A;  4HWD A;  2LHN A;  1WR0 A;  4LF5 T;  4CXX A;  2W4X A;  3UT5 E;  5JQG E;  3IHR A;  3ZMZ B;  3W15 B;  5JDG A;  4Z91 A;  3RKO A;  4A97 A;  3N2K E;  1N33 T;  3QOF A;  2QYW A;  2V7M A;  4O4J E;  3ZYL A;  3HKE E;  5HAX A;  1KF6 A;  4NUU A;  3RRW A;  4L0R A;  4WBO A;  2DNX A;  2V6Y A;  3C64 A;  5JRC A;  5FXX A;  3TLU A;  4CI3 B;  4AIS A;  4K0K T;  5TAO A;  5JVD E;  3X1D A;  2X68 A;  5DQW A;  2V8S V;  4EAH A;  1NAF A;  1ZV4 X;  1ZKE A;  2W63 A;  3J7Y q;  2CLY C;  3F31 A;  2XSB A;  3VU7 H;  3ABV A;  4AKG A;  1HX1 B;  5LMU T;  3OBV E;  3U78 A;  2QRX A;  1KK7 A;  3ZST A;  1ZOY A;  4OYK A;  3GN5 A;  3ONL C;  4HFC A;  2LHR A;  3WAK A;  3CWZ B;  3ZCJ A;  1E2A A;  2V1D B;  4WNK A;  4F8H A;  1MIY A;  2NR4 A;  4UVB B;  3RQU A;  1V9D A;  2B1E A;  4Z8X A;  5L3B B;  4ZOL E;  5DAB A;  1BR2 A;  5AQV B;  4EZ4 A;  4JUY A;  1YD8 G;  5HEG A;  2JQK A;  3I0Q A;  1UGO A;  4GKJ T;  4KX6 A;  4DV1 T;  2WS3 A;  2R6G F;  4O4L E;  3AA0 B;  3MZK B;  1IZN B;  2V5C A;  1XDO A;  5JDH A;  4KHP T;  4DV4 T;  2CMR A;  1N32 T;  4OK0 A;  1HNW T;  2MBG A;  3Q5X A;  4CN1 A;  2BG9 E;  4J2C A;  3QB5 K;  4B3M T;  3M3Z B;  3VR9 A;  4BAY B;  3U3I A;  5ABH A;  5LOV E;  4KMC A;  2KMF A;  1KEY A;  4AXP A;  4JI3 T;  4FI5 A;  4NXN T;  4ZS3 A;  3N2G E;  5CA1 E;  2ZM8 A;  2Q9Q D;  1T98 A;  2P9B A;  2PJQ A;  4JI2 T;  4H9O C;  1FJG T;  4B6X A;  2A2F X;  2DI4 A;  3AA6 B;  5CFB A;  2W61 A;  3JCF A;  3ZN0 B;  1UUS A;  2E5L T;  4QH5 A;  1D0X A;  4HGA A;  4HFD A;  4BJM A;  3GA8 A;  1ZEE A;  1XNR T;  2RA1 A;  4COF A;  1EZ3 A;  2VKH A;  5HXS A;  3LK2 B;  3P4Q A;  4QX8 B;  4IDQ A;  2F4V T;  4DV0 T;  3VRA A;  5KMG P;  2LSY A;  2L9Q A;  5HYA A;  3PJA A;  3QC9 A;  3PUY F;  2KT9 A;  4MLK A;  2BS3 A;  2V26 A;  4ILB A;  2IC6 A;  4DND A;  3SRZ A;  5F3J A;  2VL8 A;  2DL1 A;  2LT3 A;  3C51 A;  3Q5D A;  4X62 T;  4EZH A;  3OKQ A;  2XUE A;  5J1G A;  5M4Y A;  1G73 A;  2Q9Q C;  3B5M A;  4P09 A;  3ZLI A;  3FXE B;  2JMK A;  2D9D A;  3KDS E;  1B7T A;  2Z6E A;  1T7S A;  1YQ4 A;  2NTY A;  4XAX B;  5FYM A;  2DWK A;  4UR9 A;  3A5X A;  4IE0 A;  2VQF T;  4JI4 T; 
#chains in the Genus database with same CATH homology
 1SA0 E;  3MJX A;  4TUY E;  4CXW A;  2V7K A;  2WAU A;  3UUM A;  3C98 B;  5C8Y E;  1UCU A;  3IF8 B;  4L9I A;  3I9W A;  3PE0 A;  2GK9 A;  4IE5 A;  2MOZ A;  3C4Z A;  2X0L B;  1QUU A;  5HWY A;  4HE8 A;  3C4X A;  4AKH A;  5JRC B;  2W62 A;  1E1H B;  4GK0 E;  4PK6 A;  3RYI E;  1U5P A;  2QGS A;  2DLR A;  4TV8 E;  3ZEF B;  2KXP B;  1IJ6 A;  4JLE A;  4AQF A;  2LJL A;  3RYH E;  1FIO A;  2Q9Q B;  2L8K A;  3GWH A;  5DQV A;  3CQX C;  3FB2 A;  2CCQ A;  2XTL A;  2KWH A;  4H9N C;  1MMG A;  2CXF A;  2PG8 A;  2XHE B;  4MBQ A;  3RPU A;  4TZ4 C;  2WM9 A;  2X9W A;  2DCF A;  3RC8 A;  2H7V C;  3D0T A;  3LFM A;  1HG2 A;  3Q5W A;  2ODV A;  2Q9Q A;  5L3E B;  4HFV A;  2E9X D;  4GYR A;  4YHJ A;  3FHN A;  3ETU A;  2NW8 A;  1D1B A;  4ISS A;  5EK3 A;  4KBM B;  4UEL A;  2Y48 B;  1MMN A;  1LVK A;  4QX7 B;  2X51 A;  3DTO A;  3VKG A;  4GOU A;  3FBL A;  5FY7 A;  4QXH B;  3SS1 A;  2MYS A;  1LRZ A;  5EZY E;  2IW5 B;  3CX6 B;  3RYF E;  3I9Y A;  4IIJ E;  3TKL B;  5EK4 A;  3ZJ2 A;  5L3F B;  5FNV E;  1WR6 A;  3AAE B;  2PBI A;  3CX7 B;  4X1Y E;  2BDE A;  5ETW A;  1Z0P A;  2HPJ A;  3CPZ A;  3PUR A;  4AQG A;  1US7 B;  3EDU A;  4UV8 B;  4E7S A;  3JC6 D;  1MIW A;  5JDM A;  4CXY A;  4AKL A;  2WMO A;  3E08 A;  4I43 B;  4UIG A;  2ES0 A;  4UVC B;  5L3D B;  2X67 A;  2DWG A;  4ZI2 D;  4DMV A;  2XAS B;  3BQL A;  3GN5 B;  5ADX L;  5H6Q B;  2YIN A;  2JPF A;  3MA9 A;  2LE8 A;  1S94 A;  3V5U A;  2HPL A;  3CX8 B;  3HKD E;  3ANW B;  2V7L A;  2XAH B;  4F6R C;  4MHC A;  2JMH A;  2RP4 A;  3J9X 1;  4H9P C;  2E8I A;  4CZZ B;  4UF0 B;  4P0A A;  2UXN B;  5J2U E;  3WAJ A;  2CWY A;  3N9O A;  4IDZ A;  1YKH B;  2CA5 A;  3LG7 A;  4O2B E;  3ANW A;  3M65 A;  4UV9 B;  2X66 A;  3LK3 B;  1HX8 A;  4ASK A;  2CXD A;  2YU1 A;  2XAQ B;  2D0U A;  3AB3 B;  4UF0 A;  4C90 A;  4EXT A;  4X1K E;  1UX4 A;  4OFZ A;  4H63 H;  2XAF B;  4TX5 A;  4O4I E;  5LGT B;  3V5S A;  5JR9 C;  5FXV A;  3MAC A;  2WWU A;  3N9N A;  3FBZ A;  4G63 A;  4A56 A;  2E9X C;  3KFW X;  3O1J A;  2BVL A;  1SHZ C;  5JDL A;  1MNE A;  2CWO A;  2LHN A;  2VKO A;  3HR0 A;  4IE7 A;  3CQC B;  4CXX A;  3LBX B;  3UT5 E;  3K3N A;  4WBN E;  3PUG A;  5JQG E;  4QKN A;  2EHO D;  3IHR A;  4GIW A;  3ZMZ B;  2KND A;  3MKD A;  3C50 A;  3ZMS B;  4YLH A;  4X20 E;  1LKX A;  3B57 A;  4ERR A;  3W15 B;  4O2A E;  3NZQ A;  3AAI A;  5JDG A;  2LSG A;  3LBX A;  4G2A A;  3RKO A;  3ZYK A;  1D1A A;  3N2K E;  3QUJ A;  2C5J A;  4EB6 E;  4U72 A;  4HKA A;  3JC6 C;  4E7Z A;  2V7M A;  3NZP A;  4O4J E;  3ZYL A;  3FXD B;  3ESL A;  3HKE E;  5HAX A;  3AVR A;  5FY1 A;  5FXZ A;  2CEA A;  4NUU A;  3RRW A;  4M1P A;  4EYU A;  2XAJ B;  4L0R A;  3AA7 B;  5HWX A;  4DO0 A;  2NTX A;  4JEH B;  4WBO A;  4K0U A;  2DNX A;  4ZI2 C;  2YU2 A;  3EDV A;  5EK2 A;  3LJC A;  2KZ7 B;  3ZPO A;  3E22 E;  4PJL A;  3C64 A;  5JR9 B;  1CUN A;  3AVS A;  4ZHQ E;  5JRC A;  1BR4 A;  3PU3 A;  5FXX A;  4CI3 B;  2WBL A;  3KBT A;  3I1A A;  2Y6X A;  2E9X B;  2X9H A;  5TAO A;  4I55 E;  5JVD E;  2L3L A;  2UXX B;  2J1D G;  2X68 A;  5IHY A;  2V7I A;  5JH7 E;  2K5B B;  4O4H E;  5DQW A;  5JR9 A;  2X9X A;  4V1A v;  4PFO A;  3ZMT B;  4EAH A;  5L2L A;  3K3Q C;  5BMV E;  1NAF A;  4P0B A;  1HF8 A;  5LYJ E;  2E9X A;  1WRD A;  1FMW A;  3MXZ A;  2W0G A;  2IC9 A;  1WYC A;  3P8C D;  5IYZ E;  2VWA A;  3UTK A;  3CVR A;  3RH3 A;  3RRC A;  3N9L A;  1ZV4 X;  1ZKE A;  3KVA A;  3SOL A;  3L3P A;  2W63 A;  2A72 A;  3KV5 A;  4PAG A;  3J7Y q;  2CE7 A;  2CLY C;  4DBQ A;  4BJN A;  3F31 A;  4EOZ B;  4UEM A;  3VU7 H;  3K8P C;  1S35 A;  3MK7 C;  5CA0 E;  2MTQ A;  5KX5 E;  2G0U A;  3KV6 A;  1HS7 A;  2BVM A;  3ZMV B;  5HXE A;  5JDQ A;  4AKG A;  3P7I A;  2VKJ A;  3H3A A;  3T8O A;  2A3D A;  3EVY A;  4GYS A;  5F8P A;  3B13 A;  5LJN A;  5LNK A;  4IST A;  2EHO C;  4PNI A;  2DHR A;  4KUM B;  3OBV E;  3U78 A;  2C5K T;  1KK7 A;  4CQI A;  5LGN B;  2SPC A;  3F2E A;  4IE6 A;  1HCI A;  4UXN B;  4AKR B;  4OYK A;  3DP7 A;  3GN5 A;  4EIW A;  4H9S E;  1D1C A;  4ZI3 C;  4ADZ A;  1MND A;  2D5U A;  4JEU B;  3CQG B;  4FJO A;  5HXC A;  1AJ3 A;  4YFS A;  3KVB A;  2K24 A;  3ZYM A;  3R84 B;  2CLY B;  2LHR A;  2NW7 A;  3WAK A;  3CWZ B;  3ZCJ A;  3KIN B;  1FMV A;  1YKE B;  2V1D B;  3CML A;  1OXZ A;  4PJM A;  5LBQ B;  4QXC B;  2ACX A;  4H9Q C;  4WNK A;  2LOS A;  1MIY A;  5LG4 A;  5JRE A;  2CXL A;  5LHH B;  4UVB B;  1O3X A;  5LA6 E;  4CI1 B;  1V9D A;  2B1E A;  3ZMU B;  3BQK A;  3N9Q A;  3ONX A;  3OYX A;  3BQI A;  4Z8X A;  5L3B B;  1OWA A;  4ZI7 E;  1WYB A;  3NRX A;  5LXT E;  2OA5 A;  2EHO B;  2NOX A;  4ZOL E;  5DAB A;  2X9Y A;  1BR2 A;  2D0T A;  2N2N A;  4EZ4 A;  3PUQ A;  4JUY A;  3PDY A;  4PJN A;  1YD8 G;  4H63 V;  4XBF B;  4DMW A;  4H9R C;  3I0Q A;  4KP3 C;  4AKI A;  3PUS A;  3HA4 A;  2EHO A;  2ZMA A;  3OJA A;  1FEW A;  5HXR A;  2VAS A;  4WW0 A;  4O4L E;  3AA0 B;  5LHG B;  3MZK B;  1IZN B;  5JDH A;  3IBP A;  4PJJ A;  2VB6 A;  4PK5 A;  4ZI3 D;  2CMR A;  3N2O A;  1NWM X;  3O4X E;  5JDF A;  5L3G B;  1BR0 A;  1HTJ F;  4QXB B;  3RC3 A;  4DBR A;  4OK0 A;  3ZCI A;  4IE4 A;  2PFV A;  2ODU A;  2MBG A;  3Q5X A;  4J2C A;  4QHO A;  1VOM A;  2C0S A;  1MMD A;  2WSS V;  4I4T E;  4BAY B;  3AAA B;  3ETV A;  3HKB E;  5LP6 E;  3U3I A;  2C5I T;  2LM9 A;  2LSK A;  4XZC A;  2NWB A;  4QWN B;  3CKD A;  5LOV E;  1U4Q A;  4KMC A;  2KMF A;  4C91 A;  1ZHC A;  4AXP A;  3Q9D A;  3QK6 A;  2WMN A;  4TN7 B;  3H37 A;  1MIV A;  5AFU L;  4FI5 A;  4O8S A;  4ZS3 A;  2YK0 A;  3N2G E;  5CA1 E;  2ZM8 A;  1UX5 A;  2Q9Q D;  3KV4 A;  4I50 E;  1MMA A;  1T98 A;  3K3O A;  3L09 A;  3N9M A;  4CI2 B;  2I59 A;  2P9B A;  3SWH A;  2PJQ A;  5CB4 E;  4H9O C;  2JJ9 A;  2KLQ A;  4DVD A;  4B6X A;  2A2F X;  2DI4 A;  3O1H A;  3S4U A;  3AA6 B;  4PK4 A;  3EUH A;  2N9D A;  2JQQ A;  5HXH A;  3IEE A;  2W61 A;  3ZN0 B;  4ILU A;  3NRY A;  2IAK A;  2CM0 A;  2LSI A;  3LK4 2;  5L3C B;  1D0X A;  4HGA A;  1WLX A;  2JRK A;  4BJM A;  3Q2M A;  5KDM C;  4HTE A;  4IHJ E;  1YW0 A;  3BK9 A;  5FP3 A;  3GA8 A;  5E0O A;  5GON E;  3ZC1 A;  4OYJ A;  5FMN A;  2NW9 A;  4BA9 A;  1ZEE A;  5LBM A;  2RA1 A;  2V7J A;  3ZJ1 A;  1EZ3 A;  3OYZ A;  2VKH A;  4OHF A;  5FXW A;  5HXS A;  3LK2 B;  3I0O A;  4QX8 B;  3HKC E;  2QA7 A;  3HI2 A;  5KMG P;  2LSY A;  3GMI A;  5LHI B;  3VKH A;  2L9Q A;  2XAG B;  3UUL A;  2ZM0 A;  4GK5 E;  5HYA A;  1HFA A;  2NP9 A;  3QC9 A;  3WI3 A;  3E0Z A;  2ZLY A;  5A1L A;  2XQY A;  4PW8 A;  4MLK A;  2KT9 A;  2VK9 A;  1H7C A;  5H6R B;  2V26 A;  5DJQ C;  1VRB A;  3HL6 A;  2IC6 A;  4DND A;  1HG5 A;  4YJ3 E;  3PTR B;  4HN9 A;  3VHL A;  4U74 A;  4HEA A;  3SRZ A;  5F3J A;  3UUN A;  3R6N A;  4TV9 E;  2VL8 A;  2KWI B;  4ZS2 A;  3KBU A;  2LT3 A;  4MAL A;  3ZC0 A;  3C51 A;  4ANJ A;  2N1G A;  4PFP A;  3NBX X;  4EZH A;  3OKQ A;  3AA1 B;  2XUE A;  5J1G A;  2BZB A;  2KIN B;  5LJM A;  5M4Y A;  4AQF C;  5LCY A;  2Y8D A;  4NUV A;  4UVA B;  3RYC E;  3O1I A;  1QSD A;  2HH7 A;  1G73 A;  3RX6 A;  4YJ2 E;  3KV9 A;  2LEH A;  3N9P A;  3ZN1 B;  1LVF A;  4AI6 A;  3N5L A;  1D0Z A;  3PU8 A;  2Q9Q C;  2ZM2 A;  1Y64 B;  5J2T E;  5FY0 A;  4P09 A;  1X79 A;  4IGU A;  3PUA A;  4L5G A;  4EYY R;  1G8X A;  2M67 A;  3ZLI A;  2W00 A;  1BR1 A;  1IAP A;  2LSJ A;  3FXE B;  3UUX B;  2H3R A;  2VKD A;  2K9A A;  3UFE A;  4MFR A;  2LOP A;  3F57 A;  2JMK A;  3DJB A;  3KDS E;  2YEV C;  2D2S A;  4X1I E;  1B7T A;  4N78 D;  3C4W A;  2K48 A;  2Z6E A;  2NTY A;  5LGU B;  3O9X A;  4XAX B;  1D0Y A;  2H7O A;  5FYM A;  2DWK A;  3A5X A;  4IE0 A;  1IJ5 A;  5JDN A;  1KNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...