4H9OC

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9oC00
5KDMC 4H9QC 4H9OC 4HGAA 4H9PC 4H9RC 4H9NC 4H9SE
chains in the Genus database with same CATH superfamily
2IC6A 3L3PA 4QWNB 4A98A 3O4XE 3QOFA 4CI1B 2W0GA 4LFCT 2WAUA 1T72A 1UGOA 4L0RA 4EEDA 5AQRB 3PURA 2CMRA 4IHJE 4YSXA 2XUEA 2DWGA 2CEAA 5A1LA 1HNXT 1ZKEA 5L3CB 1YD8G 3PUZF 5HEJA 3CX7B 1D1CA 5HEGA 5BMVE 2WWVA 4ZI2C 2EHOD 4U2YA 2C0SA 3M65A 5HXCA 3F2EA 3N9NA 3JAFA 2B1EA 2XAJB 2C5JA 2I59A 3LK2B 4ILBA 1LRZA 2WBLA 4IE5A 2BZBA 2ES0A 3ZC0A 1WYCA 4IE4A 4AKIA 2A9UA 4U33A 1XMOT 4K0UA 2XTLA 5JDMA 2V6XA 4DIDB 2DI4A 1XZYA 5LP6E 5AQPB 4U7YA 1NEKA 5H6RB 2PJQA 4X1IE 3WAKA 2MOZA 2VVNA 3HL6A 2N9DA 1UCUA 4OX9T 2X9XA 4MBQA 2LHNA 4WW0A 1T7SA 1T98A 3ZT6A 4ILCA 3ONJA 4GKKT 2CWYA 3IF8B 2V6YA 1H7CA 2X51A 4QXBB 3O9XA 2LHRA 2VB6A 2W66A 2W67A 3LJCA 4ZS2A 3UU3A 5LBQB 4EYYR 1VCTA 5AQJB 2BG9A 3AAIA 5IHYA 2I6HA 4GOUA 3AEBA 3OVUA 4B3MT 2MYSA 3LFMA 4C91A 2BS3A 1XWMA 3K8PC 1HCIA 1MMGA 3AVRA 3PV0F 2DCFA 2X68A 2VKDA 2WB5A 1ZEEA 3ANWB 5KXJA 5CGMA 5L3BB 3RQWA 2NTYA 3KBTA 4A97A 5JQGE 5HAXA 2V7KA 2UXDT 1KEYA 1R8IA 3L39A 4TV9E 2YDSA 2Q9QC 4AKRB 4YT0A 2FJEA 2FUPA 2IW5B 4V1Av 4ZEYA 1FEWA 4U2ZA 3I0QA 3AE8A 5FXZA 4YFSA 5AQHB 2UXBT 3NZPA 1VCSA 2KZ7B 3RC8A 1B7TA 2L3LA 4U31A 4JLEA 4G2AA 3I9WA 3N9PA 5AQTB 3L09A 2X0HA 3AEAA 3LK42 4AQYT 5KMGP 4P0AA 1E2AA 4UVBB 3NWIA 1FMWA 3I0OA 5FVKA 5M4YA 1HF8A 2XSBA 4JEUB 2BKOA 3IA3A 4KI0F 4KX6A 3ABVA 2LLYA 1HG5A 1XNQT 4F8HA 4EZHA 3CX8B 2FJDA 3FB2A 2WU2A 4P1NA 2LRKA 2CWOA 4LF6T 4EIWA 4H9SE 3NZQA 3CQCB 2D9DA 4YTPA 3ONLC 3AE4A 1X79A 4ILAA 4DR1T 5AQOB 1MNDA 2XQYA 3ZSTA 4ZOLE 2LRLA 5HXRA 3EUHA 5ABHA 2W61A 3S4UA 2K5BB 4EGWA 3MKDA 2W62A 3QB5A 3RC3A 3N2GE 4ZI3D 2V6YB 4CZZB 4QXHB 3BQLA 5KDMC 4E7ZA 2YOEA 4UR9A 5LJMA 3UQ7A 2RPAA 2BBJA 4TNWA 2OA5A 2BG9B 3NRXA 2W2UA 3FHNA 4YLHA 4HE8A 4EOZB 4DBQA 2C5KT 4PK5A 4FI5A 3TLVA 1IBMT 4OK0A 1HFAA 1SHZC 1IZNB 5AQFB 2OV9A 4TUYE 5JDLA 2CCQA 4JI6T 4I4TE 4IDNA 4TWDA 5LHIB 2NWBA 2ZM0A 3KBUA 2SPCA 1YXRA 4DR2T 3NVOA 4IGUA 2CA5A 4HFHA 1LVKA 1QLBA 4YTNA 1SUMB 1MIYA 4QX7B 3RKOA 4AKHA 4JI7T 1KK7A 2CLYB 3C4ZA 4HKAA 4JI8T 2G0UA 4KHZF 3AE6A 2D0TA 2A3DA 1AJ3A 3ZEFB 5HCJA 2NW9A 2XM1A 2IC9A 4CXYA 2VKJA 3N2KE 1W9RA 3VKHA 2LSYA 4ERRA 2J62A 2XSAA 5AQGB 3OJAA 4KMCA 1N34T 5DABA 2ZM6T 3PUYF 5LB7B 3T1HT 2XAHB 2DL1A 3SOLA 5JR9B 4IIJE 2FJAA 1UUSA 1N33T 4TNVA 2CE7A 5GONE 2E9XA 3PJAJ 1X9BA 2M67A 2WU5A 4B6XA 4DV3T 4HWHA 4IE6A 1IBLT 3HA4A 3HR0A 1D0ZA 1MMDA 1OEDA 1Y64B 1SA0E 2KXPB 3U78A 4Z91A 5ETWA 2VURA 3KV4A 5LGTB 1MNEA 2RP4A 4MHCA 4DV5T 4LF8T 1QSDA 1N36T 2DLRA 2WZHA 2X9HA 3F57A 4U7IA 5L3DB 4O8SA 3MJXA 2JQ9A 3ZKRA 2CXFA 4HFVA 3UT5E 2UUCT 4L5GA 2V8SV 4CI3B 1EZ3A 4X5TA 4QH1A 2CHOA 1J5WA 5LMUT 3Q2MA 2KNDA 2YN6A 2P9BA 2WWUA 3VR9A 1UX4A 2NR4A 3LDQB 3ZC1A 3UFEA 3K1SA 1BR0A 3O1IA 5LBMA 3VR8A 4DV4T 2X0LB 2VKHA 2WSSV 2XM2A 4IDQA 3CVRA 3AE2A 2KT9A 1O3XA 1M62A 2CLYC 2MPKA 4C90A 3AXJB 5L4HA 2YDRA 1V9DA 3Q9DA 3AEFA 4X1YE 1IBKT 2Q9QD 3C4XA 3R6NA 1ZP0A 2C5IT 2EHOB 3PJAA 4X65T 4BJMA 3SFDA 3GMIA 5C2TA 4QKNA 2X9WA 2VL0A 3JC6D 2ZM8A 3MXZA 3UUXB 2CPTA 2UUBT 2J47A 5AQQB 5AQKB 3AAEB 2WS3A 4X1KE 1M7KA 2H3RA 3ZPOA 4PFOA 1HNWT 3NRYA 5AFUL 2UXCT 5FY1A 4CN6A 2VASA 3UU8A 1OWAA 3BQKA 2BS2A 5J2TE 3SWHA 5HYAA 3N9QA 3K3QC 5F3JA 3VRBA 2E9XB 2V5CA 5DQVA 2KLQA 1Z0PA 2BS4A 4X64T 2E9XD 3PUSA 2VQFT 4LMLA 3PUAA 3DJBA 2UUAT 2LKGA 2HPLA 2ZLYA 4IDOA 2XQ5A 4O2BE 2PG8A 1OEDB 4ILUA 3EAMA 4LMJA 4EZ4A 2FJBA 5C3JA 4ZZCA 4NUVA 1N32T 4MLKA 3N9MA 5FP3A 1ZV4X 1FJGT 1HTJF 3ZYMA 2X67A 5FY7A 1L0VA 4HFIA 1HR0T 2WDVA 2BBHA 4EXTA 5KX5E 1WYBA 3ZMUB 3T8OA 5J0ZA 4UIGA 4PJLA 4CQIA 4JI5T 3AA1B 1U5PA 4WZXA 1J1JA 1U4QA 2QYWA 3OPCA 4IL9A 4CXXA 1SE7A 1OXZA 3A8YC 3O1JA 3FZMB 2WY2A 3UUNA 2E8IA 3OTOT 5JRCB 3UUBA 1WR0A 3QUJA 4JI4T 3FZKB 1BR4A 3RIUA 2XQ8A 1XDPA 2UXXB 3RYFE 4H63H 3AA6B 3MK7C 1KF6A 4NPPA 2LT3A 3P4RA 3C4WA 3ZMSB 3RQUA 3UU4A 3LBXA 5IUXA 1J5ET 3BQIA 2JRKA 4PK6A 4U3CA 5LMNT 4GYRA 2JMKA 2EHOC 4HFDA 3CQGB 3Q5WA 4NXNT 4YHJA 2HH7A 4ANJA 3HKCE 5LGNB 3FBLA 3RI5A 2QRXA 1YQ4A 4WYVA 2Y6XA 3KV5A 2KWHA 2E2AA 4IDPA 3H37A 3P8CD 2XQ9A 3ETVA 2J1DG 1CUNA 4LFAT 4L9IA 4KHPT 2WDRA 4PNIA 2GK9A 2CM0A 3FXDB 3PUQA 4H63V 5EK4A 2BKPA 4Q25A 5EK3A 2WMNA 3HKBE 1WCRA 4DV2T 3E22E 3WAJA 1NENA 2JQHA 3M3ZB 4I50E 1KNPA 3CX6B 2CHNA 4G63A 5AQNB 2YINA 4UVCB 3DP7A 5J2UE 3QB5K 3PU3A 5H6QB 5ABEA 2VK9A 3RYIE 5LXTE 4DVDA 1D1AA 4TX5A 5ABFA 2YKSA 2BG9E 2XQ7A 5LG3A 3V5UA 3HKDE 2X0YA 5LOVE 4F6RC 3UULA 1BR1A 3C64A 5LJNA 5JDFA 2XASB 4BAYB 1I6ZA 4UV9B 5AQVB 5FXXA 1XNRT 5CA0E 4UEMA 2WZIA 5LHHB 3T1YT 2JQQA 4MALA 3EDUA 4PW8A 5FYMA 2F4VT 1KNRA 4EEBA 2ZM2A 4JEHB 4YSZA 3R84B 2LSIA 1D0YA 2WP9A 2V7IA 3RH3A 2LE8A 4AQFC 4O4IE 2BKNA 2NW8A 4BA9A 3AE3A 4UF0A 4LF5T 2ACZA 3EI0A 2X66A 4I55E 1ZHCA 3RF1A 1S94A 3E08A 2W00A 4YJ3E 5AQLB 4XZCA 4CXWA 3CKDA 2N1GA 4TWFA 4ZI7E 5F8PA 4JI3T 3AB3B 4U74A 5HCMA 4UV8B 2V7MA 4HFCA 3RRCA 2Q9QA 1KNZA 3LBXB 4DV6T 4B3ST 2YEVC 3EHZA 3KV9A 1MIVA 3H3MA 3A7MA 3AE7A 4Z90A 3FZHB 3N5LA 4TZ4C 3NBXX 1UK5A 2LSKA 3ZMZB 5IWAT 5HEHA 2ODVA 1KFYA 2JPFA 3IBPA 2QGSA 5JVDE 4HGAA 4X62T 4HFEA 2V1DB 4O4HE 3VRAA 4GKJT 2L8KA 4LF9T 1YKHB 3CQXC 2JMHA 2KMFA 2VL8A 4ZI2D 3A5XA 5JH7E 4GYSA 3N9LA 3PUGA 3B5MA 3O1HA 3OYXA 3H3AA 4AI6A 1Z8UA 1HNZT 2XQ3A 2ODUA 5FY0A 2K3WA 1MIWA 1HS7A 3E0ZA 4YTMA 4H9OC 4ZI3C 5JTGA 2HHHT 5LCYA 3RRWA 3RIFA 5F5WA 5LGUB 2I0MA 4KBMB 4XAXB 3CMLA 2B76A 3RLFF 2Z6EA 2D5UA 4Z8XA 3N9OA 2PFVA 3QK6A 2BG9C 4DMVA 3RYHE 4CN1A 2DHRA 2V7LA 1WR6A 2N2NA 5JDNA 3PE0A 5HWYA 4HEAA 3ZN1B 1JNZA 4OFZA 3P4SA 4LMKA 1IJ6A 2HN1A 5C8YE 2YDQA 4JI0T 5JREA 3EDVA 2K24A 1DU2A 5DQWA 3LG7A 3TLSA 4IL4A 2VQET 4JI1T 2IUBA 4YSYA 4B3TT 2VWAA 4CI2B 1W0BA 4JV5T 3I1AA 3AAAB 3HI2A 3JCFA 4EV6A 5HWXA 3TLUA 4DMWA 3OBVE 3UFGA 1NAFA 4NXMT 4X20E 1ZOYA 2HN2A 2XAGB 2YU2A 3C50A 2Q9QB 3RGLA 4IE0A 3ZCIA 1HG2A 4E7SA 3KV6A 2LM9A 2MBGA 2NP9A 4O4JE 4DR4T 5FNVE 2LSJA 2KWIB 3U3IA 5HEUA 4PK4A 1US7B 3AEGA 3W15B 2RA1A 4BJNA 2VVSA 2XY8B 5DJQC 4DNDA 1IAPA 4EB6E 4AISA 3GA8A 5CFBA 3ZSSA 2D2SA 1XDOA 5JR9C 3ZJ2A 1Y01A 4HWIB 3FZFB 5L3FB 1OEDE 2CXLA 2IAKA 3HKEE 3NKZA 3P4WA 3FBZA 2ACXA 2L9QA 3QNUA 4YY3T 2KINB 5L3EB 3PUWF 2BVMA 2H89A 1UURA 1W09A 2WCAA 3UUMA 2H88A 2UU9T 4QXCB 1JNRA 3PUVF 3Q5DA 1HX8A 4NUUA 3P50A 2LJLA 3IEEA 3ZT7A 4PFPA 3GN5A 2XJ7A 4ISSA 2MAWA 1FIOA 4UXNB 3OYZA 3D0TA 5AQSB 4QH5A 4ASKA 5LG4A 5JDGA 2XQ6A 2XQ4A 2IDOB 2JQKA 2XQAA 4X66T 3PUXF 3CWZB 2H7OA 4TV8E 2XZEA 2AE9A 5L4EA 4M1PA 4PJNA 3B57A 3V5SA 3RX6A 3SS1A 2BVLA 3ZMTB 2K9AA 3AECA 4HWCA 3TLTA 2CBIA 2V5DA 1E1HB 5HXEA 4AKGA 2AXDS 4LFBT 5LYJE 5JDQA 3ZYLA 4IE7A 4DV0T 4DR3T 2DNXA 4UVAB 2CXDA 2IIUA 1WFDA 2W4XA 4N78D 5FL0A 2WDQA 5E0OA 4NIQA 3JC6C 2LSGA 3ETUA 4WNKA 1IJ5A 4EYUA 1HX1B 2YU1A 2YK0A 3TKLB 4A56A 3G06A 3UU6A 3AEDA 3KINB 2JIWA 5JDHA 1W0AA 4QHOA 2H7VC 2ZMAA 2BDEA 1UX5A 1T8BA 4H9RC 5CA1E 4IT4A 2WMOA 1YQ3A 5TAOA 1WRDA 3PTRB 1VOMA 3JAEA 5LHGB 5ABGA 1E7PA 3VU7H 4OHFA 3UU5A 4WBNE 3MA9A 3RYCE 2WQYA 3ESLA 4HN9A 3ZN0B 4IDZA 1LKXA 2E9XC 4GIWA 3IHRA 4WBOA 5HXSA 4OYKA 5JR9A 4PJJA 3C51A 4DR7T 5EK2A 2E5LT 3PU8A 2OLTA 3P7IA 1OEDC 1QUUA 2W63A 3CIRA 3AE9A 3ZCJA 1S35A 3OKQA 4H9NC 2NW7A 3AE1A 1BR2A 3SRZA 1NWMX 1WLXA 4MFRA 2KSRA 2M6IA 3PDYA 3KVAA 4AKLA 2PTFA 2IHR1 4DV1T 1D0XA 4HFBA 4AXPA 4J2CA 3GN5B 2E5VA 4TWHA 4O2AE 3N2OA 2IMLA 3SFEA 1XMQT 4DR5T 4OYJA 4JBWF 3FXEB 2LOPA 3VHLA 4DR6T 4DUYT 3JADA 1MMAA 5L47A 3ZMVB 3RIAA 4ZZBA 3DTOA 4CN4A 3GWHA 4YXDA 1YKEB 5AQIB 3KDSE 4KP3C 2NTXA 2VKOA 3Q5EA 3AE5A 1D1BA 5J1GA 4HWFA 3F31A 2XPKA 1G73A 3K3OA 2LEHA 3KVBA 3MZKB 2NOXA 4H9QC 4KUMB 3RHWA 5L3GB 3TLWA 4TN7B 2JJ9A 3B13A 1GQEA 1YW0A 4IREA 3AEEA 5L2LA 3ZT5A 4DBRA 3AVSA 4ISTA 3J9X1 1VRBA 4HTEA 4JI2T 4DO0A 2WM9A 2Y48B 4ZXLA 3EABA 2R6GF 5FXVA 4AQGA 3AXJA 3C98B 4ADZA 3LK3B 3UQ4A 3ZYKA 4COFA 3VKGA 3J7Yq 4ZHQE 5LA6E 5LNKA 3AA0B 3CK6A 2EHOA 5CB4E 3KFWX 3K3NA 3ZJ1A 5CJ5A 1I94T 2A2FX 4P0BA 2LOSA 4DUZT 4A5XA 3CPZA 4P09A 4XBFB 3ZLIA 5EZYE 5FMNA 4GK5E 2FBWA 5FVLA 2PBIA 5ADXL 5HEOA 3FZLB 4ZS3A 4HWDA 1MMNA 4UELA 3X1DA 2QVAA 2V7JA 2QA7A 5ABFB 2XHEB 2M6BA 4I0UA 5AQMB 1FMVA 3RPUA 4I43B 3AA7B 3RKGA 4O4LE 4PJMA 2XAFB 4YHHT 2A72A 2K48A 4U72A 2MTQA 3BK9A 5IYZE 4QX8B 5AQUB 2HPJA 3P4QA 2D0UA 3MACA 5FKYA 2X9YA 4GK0E 4QH4A 4B3RT 4JUYA 2LKHA 3UTKA 4DV7T 3WI3A 3ONXA 4YJ2E 1LVFA 4JYAT 4LF4T 3L8RA 4PAGA 2DWKA 4UF0B 4EAHA 2XAQB 3RIUC 2V26A 2Y8DA 4K0KT 3ANWA 5HXHA 3P4PA 3EVYA 5FL1A 2UXNB 1CHUA 3Q5XA 4AIUA 5BR8T 2LM2A 5FXWA 4FJOA 3QC9A 2CBJA 4AQFA 4H9PC 2J4GA 5JRCA 3I9YA 2CRBA 1G8XA 4LF7T 3LSVA
chains in the Genus database with same CATH topology
2IC6A 3PU3A 2IC9A 5H6QB 3L3PA 2VK9A 4QWNB 4CXYA 3RYIE 5LXTE 4DVDA 2VKJA 3O4XE 3N2KE 1D1AA 4TX5A 3VKHA 2LSYA 4ERRA 3CWZB 4CI1B 2H7OA 4TV8E 2W0GA 2WAUA 3OJAA 4KMCA 4M1PA 5DABA 3V5UA 3HKDE 4L0RA 3PURA 5LOVE 2CMRA 4PJNA 4IHJE 3B57A 3V5SA 4F6RC 3RX6A 3SS1A 3UULA 1BR1A 2XUEA 3C64A 2BVLA 2XAHB 5LJNA 2DWGA 5JDFA 2XASB 2CEAA 3ZMTB 2K9AA 4BAYB 3SOLA 4UV9B 5A1LA 5JR9B 1ZKEA 5L3CB 1YD8G 1E1HB 5FXXA 4IIJE 5HXEA 3CX7B 5CA0E 4UEMA 4AKGA 1D1CA 5BMVE 5LHHB 5LYJE 2JQQA 5JDQA 3ZYLA 2CE7A 4IE7A 4MALA 4ZI2C 2EHOD 5GONE 2E9XA 2M67A 3EDUA 2DNXA 4PW8A 2C0SA 3M65A 4UVAB 5FYMA 5HXCA 4B6XA 3F2EA 3N9NA 2B1EA 2CXDA 2XAJB 2C5JA 2I59A 4IE6A 2ZM2A 4JEHB 3LK2B 4N78D 3HA4A 1LRZA 2WBLA 1D0ZA 3HR0A 4IE5A 1MMDA 3R84B 2BZBA 1Y64B 2LSIA 1D0YA 1SA0E 2ES0A 2KXPB 2V7IA 1WYCA 2LE8A 4IE4A 3RH3A 3U78A 4AQFC 3ZC0A 5ETWA 4O4IE 4AKIA 5E0OA 2NW8A 3JC6C 2LSGA 4BA9A 3ETUA 4UF0A 4WNKA 1IJ5A 4K0UA 3KV4A 4EYUA 5LGTB 2YU1A 1MNEA 2XTLA 2RP4A 2X66A 2YK0A 4MHCA 3TKLB 4A56A 5JDMA 4I55E 1QSDA 1ZHCA 3KINB 1S94A 3E08A 2DI4A 2W00A 4YJ3E 5JDHA 4XZCA 2DLRA 4CXWA 5LP6E 3CKDA 2N1GA 2X9HA 5H6RB 4ZI7E 2PJQA 5F8PA 3AB3B 4X1IE 4QHOA 2H7VC 2ZMAA 3F57A 3WAKA 2MOZA 2BDEA 1UX5A 3HL6A 4H9RC 2N9DA 4U74A 5CA1E 5L3DB 1UCUA 4O8SA 2WMOA 3MJXA 5TAOA 2CXFA 1WRDA 2X9XA 4HFVA 3PTRB 1VOMA 4UV8B 2V7MA 5LHGB 3UT5E 3RRCA 4L5GA 4MBQA 2Q9QA 2LHNA 3LBXB 1KNZA 3VU7H 4CI3B 1EZ3A 4OHFA 4WW0A 2YEVC 3KV9A 1T98A 3Q2MA 1MIVA 2KNDA 2CWYA 4WBNE 3IF8B 2P9BA 2WWUA 1H7CA 3MA9A 1UX4A 3RYCE 3ZC1A 2X51A 3N5LA 4QXBB 3ESLA 3O9XA 2LHRA 4TZ4C 3NBXX 4HN9A 3UFEA 3ZN0B 4IDZA 1LKXA 2VB6A 2E9XC 2LSKA 3ZMZB 1BR0A 4GIWA 3O1IA 5LBMA 3IHRA 3LJCA 4WBOA 2ODVA 4OYKA 5HXSA 4ZS2A 5JR9A 2X0LB 2JPFA 5LBQB 4EYYR 4PJJA 3C51A 3IBPA 2VKHA 5EK2A 2QGSA 5JVDE 4HGAA 3AAIA 5IHYA 3PU8A 2WSSV 4GOUA 3P7IA 3CVRA 1QUUA 2W63A 2MYSA 2V1DB 2KT9A 4O4HE 1O3XA 1S35A 3ZCJA 3OKQA 3LFMA 4C91A 2CLYC 2L8KA 4H9NC 2NW7A 3K8PC 4C90A 1HCIA 3CQXC 1MMGA 1YKHB 3AVRA 1BR2A 2JMHA 2KMFA 2X68A 2DCFA 1NWMX 1WLXA 2VKDA 4MFRA 3SRZA 1V9DA 2VL8A 4ZI2D 3A5XA 3Q9DA 5JH7E 4X1YE 4GYSA 3N9LA 1ZEEA 3PDYA 3ANWB 3KVAA 4AKLA 3PUGA 5L3BB 2Q9QD 1D0XA 4AXPA 3C4XA 4J2CA 2NTYA 3GN5B 3KBTA 3R6NA 2C5IT 5JQGE 4O2AE 3N2OA 5HAXA 2EHOB 2V7KA 3O1HA 4BJMA 3OYXA 3H3AA 4AI6A 4OYJA 3GMIA 4TV9E 3FXEB 2ODUA 5FY0A 2LOPA 4QKNA 2X9WA 3VHLA 2Q9QC 3JC6D 1MIWA 2ZM8A 4AKRB 1HS7A 3E0ZA 2IW5B 4V1Av 3MXZA 1MMAA 4H9OC 1FEWA 4ZI3C 3UUXB 3ZMVB 5LCYA 3RRWA 3I0QA 3AAEB 5LGUB 5FXZA 4YFSA 3DTOA 3NZPA 4X1KE 4KBMB 2H3RA 3ZPOA 2KZ7B 4XAXB 3RC8A 3GWHA 4PFOA 3NRYA 5AFUL 1B7TA 2L3LA 3CMLA 1YKEB 3KDSE 2Z6EA 5FY1A 2D5UA 4Z8XA 4JLEA 4KP3C 4G2AA 3N9OA 2NTXA 2PFVA 3I9WA 2VKOA 3N9PA 3QK6A 2VASA 3L09A 4DMVA 3RYHE 1D1BA 1OWAA 2DHRA 3BQKA 5J1GA 2V7LA 1WR6A 5J2TE 2N2NA 3F31A 3LK42 3SWHA 1G73A 3K3OA 5HYAA 2LEHA 3KVBA 3MZKB 5JDNA 2NOXA 3PE0A 5KMGP 5HWYA 4P0AA 4H9QC 3N9QA 4KUMB 4HEAA 3ZN1B 5L3GB 4UVBB 3K3QC 4TN7B 2JJ9A 5F3JA 3B13A 4OFZA 1YW0A 2E9XB 5DQVA 2KLQA 1Z0PA 1IJ6A 1FMWA 5L2LA 3I0OA 4DBRA 3AVSA 5C8YE 2E9XD 5M4YA 1HF8A 3PUSA 4ISTA 4JEUB 3J9X1 5JREA 1VRBA 3PUAA 3DJBA 4HTEA 4DO0A 2HPLA 2ZLYA 2WM9A 2Y48B 4O2BE 2PG8A 1HG5A 3EDVA 4ILUA 2K24A 5FXVA 5DQWA 4AQGA 4EZHA 3CX8B 3C98B 4EZ4A 3FB2A 4ADZA 3LG7A 3LK3B 3ZYKA 3VKGA 3J7Yq 4NUVA 4ZHQE 4MLKA 2CWOA 5LA6E 3N9MA 5FP3A 4EIWA 1ZV4X 4H9SE 5LNKA 3NZQA 3AA0B 3CQCB 2VWAA 4CI2B 1HTJF 3ZYMA 2EHOA 3I1AA 2X67A 5FY7A 3AAAB 3HI2A 5CB4E 5HWXA 1X79A 4EXTA 5KX5E 4DMWA 1WYBA 3ZMUB 3OBVE 1MNDA 2XQYA 3KFWX 1NAFA 3T8OA 3K3NA 4X20E 3ZJ1A 2XAGB 2YU2A 2A2FX 4ZOLE 3C50A 4P0BA 2Q9QB 2LOSA 5HXRA 3CPZA 4P09A 4IE0A 3EUHA 1HG2A 3ZCIA 4E7SA 2W61A 3KV6A 3S4UA 2K5BB 2LM9A 3ZLIA 4XBFB 4UIGA 3MKDA 4PJLA 2W62A 4GK5E 5EZYE 5FMNA 4CQIA 2MBGA 3AA1B 2NP9A 3RC3A 1U5PA 3N2GE 4O4JE 1U4QA 2PBIA 4ZI3D 4CZZB 4CXXA 1OXZA 5ADXL 4QXHB 5FNVE 2LSJA 3BQLA 2KWIB 3O1JA 3UUNA 2E8IA 5JRCB 3U3IA 5KDMC 3QUJA 4ZS3A 4E7ZA 1MMNA 1BR4A 2UXXB 5LJMA 3RYFE 4H63H 4PK4A 1US7B 3AA6B 3MK7C 4UELA 3W15B 2RA1A 2OA5A 2V7JA 2QA7A 3NRXA 2XHEB 4BJNA 5DJQC 3FHNA 2LT3A 1FMVA 3RPUA 3C4WA 4YLHA 4DNDA 4HE8A 1IAPA 4EOZB 3ZMSB 4DBQA 2C5KT 4PK5A 4EB6E 3GA8A 4FI5A 4I43B 3AA7B 4O4LE 3LBXA 4OK0A 1HFAA 4PJMA 2XAFB 2D2SA 3BQIA 2JRKA 2A72A 1SHZC 5JR9C 1IZNB 4PK6A 3ZJ2A 5L3FB 4GYRA 4TUYE 2K48A 2JMKA 4U72A 2EHOC 2MTQA 5JDLA 3BK9A 5IYZE 2CCQA 4I4TE 2CXLA 2IAKA 3CQGB 3Q5WA 5LHIB 4YHJA 2HH7A 3HKEE 4ANJA 3FBZA 3HKCE 4QX8B 5LGNB 2NWBA 2ACXA 2HPJA 2ZM0A 2L9QA 3FBLA 3KBUA 2SPCA 2Y6XA 3KV5A 2D0UA 2KWHA 3MACA 2KINB 3H37A 2X9YA 5L3EB 3P8CD 2BVMA 3ETVA 4IGUA 2J1DG 2CA5A 1CUNA 4L9IA 4GK0E 4PNIA 1LVKA 4JUYA 3UTKA 3UUMA 1MIYA 3WI3A 2GK9A 4QX7B 3RKOA 3ONXA 4YJ2E 1LVFA 4AKHA 2CM0A 3FXDB 3PUQA 1KK7A 4H63V 2CLYB 4PAGA 5EK4A 2DWKA 3C4ZA 4QXCB 4HKAA 5EK3A 4UF0B 4EAHA 2XAQB 2G0UA 2WMNA 1HX8A 2V26A 3HKBE 4NUUA 2D0TA 2Y8DA 2LJLA 3ANWA 5HXHA 3IEEA 2A3DA 3EVYA 2UXNB 4PFPA 1AJ3A 3E22E 3GN5A 3Q5XA 3WAJA 5FXWA 3ZEFB 4FJOA 3QC9A 4ISSA 4AQFA 1FIOA 4I50E 4UXNB 3OYZA 3CX6B 3D0TA 4H9PC 4G63A 4ASKA 5JRCA 5LG4A 2YINA 2NW9A 5JDGA 4UVCB 3I9YA 3DP7A 1G8XA 5J2UE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM C;  4H9Q C;  4H9O C;  4HGA A;  4H9P C;  4H9R C;  4H9N C;  4H9S E; 
#chains in the Genus database with same CATH topology
 2IC6 A;  3L3P A;  4QWN B;  4A98 A;  3O4X E;  3QOF A;  4CI1 B;  2W0G A;  4LFC T;  2WAU A;  1T72 A;  1UGO A;  4L0R A;  4EED A;  5AQR B;  3PUR A;  2CMR A;  4IHJ E;  4YSX A;  2XUE A;  2DWG A;  2CEA A;  5A1L A;  1HNX T;  1ZKE A;  5L3C B;  1YD8 G;  3PUZ F;  5HEJ A;  3CX7 B;  1D1C A;  5HEG A;  5BMV E;  2WWV A;  4ZI2 C;  2EHO D;  4U2Y A;  2C0S A;  3M65 A;  5HXC A;  3F2E A;  3N9N A;  3JAF A;  2B1E A;  2XAJ B;  2C5J A;  2I59 A;  3LK2 B;  4ILB A;  1LRZ A;  2WBL A;  4IE5 A;  2BZB A;  2ES0 A;  3ZC0 A;  1WYC A;  4IE4 A;  4AKI A;  2A9U A;  4U33 A;  1XMO T;  4K0U A;  2XTL A;  5JDM A;  2V6X A;  4DID B;  2DI4 A;  1XZY A;  5LP6 E;  5AQP B;  4U7Y A;  1NEK A;  5H6R B;  2PJQ A;  4X1I E;  3WAK A;  2MOZ A;  2VVN A;  3HL6 A;  2N9D A;  1UCU A;  4OX9 T;  2X9X A;  4MBQ A;  2LHN A;  4WW0 A;  1T7S A;  1T98 A;  3ZT6 A;  4ILC A;  3ONJ A;  4GKK T;  2CWY A;  3IF8 B;  2V6Y A;  1H7C A;  2X51 A;  4QXB B;  3O9X A;  2LHR A;  2VB6 A;  2W66 A;  2W67 A;  3LJC A;  4ZS2 A;  3UU3 A;  5LBQ B;  4EYY R;  1VCT A;  5AQJ B;  2BG9 A;  3AAI A;  5IHY A;  2I6H A;  4GOU A;  3AEB A;  3OVU A;  4B3M T;  2MYS A;  3LFM A;  4C91 A;  2BS3 A;  1XWM A;  3K8P C;  1HCI A;  1MMG A;  3AVR A;  3PV0 F;  2DCF A;  2X68 A;  2VKD A;  2WB5 A;  1ZEE A;  3ANW B;  5KXJ A;  5CGM A;  5L3B B;  3RQW A;  2NTY A;  3KBT A;  4A97 A;  5JQG E;  5HAX A;  2V7K A;  2UXD T;  1KEY A;  1R8I A;  3L39 A;  4TV9 E;  2YDS A;  2Q9Q C;  4AKR B;  4YT0 A;  2FJE A;  2FUP A;  2IW5 B;  4V1A v;  4ZEY A;  1FEW A;  4U2Z A;  3I0Q A;  3AE8 A;  5FXZ A;  4YFS A;  5AQH B;  2UXB T;  3NZP A;  1VCS A;  2KZ7 B;  3RC8 A;  1B7T A;  2L3L A;  4U31 A;  4JLE A;  4G2A A;  3I9W A;  3N9P A;  5AQT B;  3L09 A;  2X0H A;  3AEA A;  3LK4 2;  4AQY T;  5KMG P;  4P0A A;  1E2A A;  4UVB B;  3NWI A;  1FMW A;  3I0O A;  5FVK A;  5M4Y A;  1HF8 A;  2XSB A;  4JEU B;  2BKO A;  3IA3 A;  4KI0 F;  4KX6 A;  3ABV A;  2LLY A;  1HG5 A;  1XNQ T;  4F8H A;  4EZH A;  3CX8 B;  2FJD A;  3FB2 A;  2WU2 A;  4P1N A;  2LRK A;  2CWO A;  4LF6 T;  4EIW A;  4H9S E;  3NZQ A;  3CQC B;  2D9D A;  4YTP A;  3ONL C;  3AE4 A;  1X79 A;  4ILA A;  4DR1 T;  5AQO B;  1MND A;  2XQY A;  3ZST A;  4ZOL E;  2LRL A;  5HXR A;  3EUH A;  5ABH A;  2W61 A;  3S4U A;  2K5B B;  4EGW A;  3MKD A;  2W62 A;  3QB5 A;  3RC3 A;  3N2G E;  4ZI3 D;  2V6Y B;  4CZZ B;  4QXH B;  3BQL A;  5KDM C;  4E7Z A;  2YOE A;  4UR9 A;  5LJM A;  3UQ7 A;  2RPA A;  2BBJ A;  4TNW A;  2OA5 A;  2BG9 B;  3NRX A;  2W2U A;  3FHN A;  4YLH A;  4HE8 A;  4EOZ B;  4DBQ A;  2C5K T;  4PK5 A;  4FI5 A;  3TLV A;  1IBM T;  4OK0 A;  1HFA A;  1SHZ C;  1IZN B;  5AQF B;  2OV9 A;  4TUY E;  5JDL A;  2CCQ A;  4JI6 T;  4I4T E;  4IDN A;  4TWD A;  5LHI B;  2NWB A;  2ZM0 A;  3KBU A;  2SPC A;  1YXR A;  4DR2 T;  3NVO A;  4IGU A;  2CA5 A;  4HFH A;  1LVK A;  1QLB A;  4YTN A;  1SUM B;  1MIY A;  4QX7 B;  3RKO A;  4AKH A;  4JI7 T;  1KK7 A;  2CLY B;  3C4Z A;  4HKA A;  4JI8 T;  2G0U A;  4KHZ F;  3AE6 A;  2D0T A;  2A3D A;  1AJ3 A;  3ZEF B;  5HCJ A;  2NW9 A;  2XM1 A;  2IC9 A;  4CXY A;  2VKJ A;  3N2K E;  1W9R A;  3VKH A;  2LSY A;  4ERR A;  2J62 A;  2XSA A;  5AQG B;  3OJA A;  4KMC A;  1N34 T;  5DAB A;  2ZM6 T;  3PUY F;  5LB7 B;  3T1H T;  2XAH B;  2DL1 A;  3SOL A;  5JR9 B;  4IIJ E;  2FJA A;  1UUS A;  1N33 T;  4TNV A;  2CE7 A;  5GON E;  2E9X A;  3PJA J;  1X9B A;  2M67 A;  2WU5 A;  4B6X A;  4DV3 T;  4HWH A;  4IE6 A;  1IBL T;  3HA4 A;  3HR0 A;  1D0Z A;  1MMD A;  1OED A;  1Y64 B;  1SA0 E;  2KXP B;  3U78 A;  4Z91 A;  5ETW A;  2VUR A;  3KV4 A;  5LGT B;  1MNE A;  2RP4 A;  4MHC A;  4DV5 T;  4LF8 T;  1QSD A;  1N36 T;  2DLR A;  2WZH A;  2X9H A;  3F57 A;  4U7I A;  5L3D B;  4O8S A;  3MJX A;  2JQ9 A;  3ZKR A;  2CXF A;  4HFV A;  3UT5 E;  2UUC T;  4L5G A;  2V8S V;  4CI3 B;  1EZ3 A;  4X5T A;  4QH1 A;  2CHO A;  1J5W A;  5LMU T;  3Q2M A;  2KND A;  2YN6 A;  2P9B A;  2WWU A;  3VR9 A;  1UX4 A;  2NR4 A;  3LDQ B;  3ZC1 A;  3UFE A;  3K1S A;  1BR0 A;  3O1I A;  5LBM A;  3VR8 A;  4DV4 T;  2X0L B;  2VKH A;  2WSS V;  2XM2 A;  4IDQ A;  3CVR A;  3AE2 A;  2KT9 A;  1O3X A;  1M62 A;  2CLY C;  2MPK A;  4C90 A;  3AXJ B;  5L4H A;  2YDR A;  1V9D A;  3Q9D A;  3AEF A;  4X1Y E;  1IBK T;  2Q9Q D;  3C4X A;  3R6N A;  1ZP0 A;  2C5I T;  2EHO B;  3PJA A;  4X65 T;  4BJM A;  3SFD A;  3GMI A;  5C2T A;  4QKN A;  2X9W A;  2VL0 A;  3JC6 D;  2ZM8 A;  3MXZ A;  3UUX B;  2CPT A;  2UUB T;  2J47 A;  5AQQ B;  5AQK B;  3AAE B;  2WS3 A;  4X1K E;  1M7K A;  2H3R A;  3ZPO A;  4PFO A;  1HNW T;  3NRY A;  5AFU L;  2UXC T;  5FY1 A;  4CN6 A;  2VAS A;  3UU8 A;  1OWA A;  3BQK A;  2BS2 A;  5J2T E;  3SWH A;  5HYA A;  3N9Q A;  3K3Q C;  5F3J A;  3VRB A;  2E9X B;  2V5C A;  5DQV A;  2KLQ A;  1Z0P A;  2BS4 A;  4X64 T;  2E9X D;  3PUS A;  2VQF T;  4LML A;  3PUA A;  3DJB A;  2UUA T;  2LKG A;  2HPL A;  2ZLY A;  4IDO A;  2XQ5 A;  4O2B E;  2PG8 A;  1OED B;  4ILU A;  3EAM A;  4LMJ A;  4EZ4 A;  2FJB A;  5C3J A;  4ZZC A;  4NUV A;  1N32 T;  4MLK A;  3N9M A;  5FP3 A;  1ZV4 X;  1FJG T;  1HTJ F;  3ZYM A;  2X67 A;  5FY7 A;  1L0V A;  4HFI A;  1HR0 T;  2WDV A;  2BBH A;  4EXT A;  5KX5 E;  1WYB A;  3ZMU B;  3T8O A;  5J0Z A;  4UIG A;  4PJL A;  4CQI A;  4JI5 T;  3AA1 B;  1U5P A;  4WZX A;  1J1J A;  1U4Q A;  2QYW A;  3OPC A;  4IL9 A;  4CXX A;  1SE7 A;  1OXZ A;  3A8Y C;  3O1J A;  3FZM B;  2WY2 A;  3UUN A;  2E8I A;  3OTO T;  5JRC B;  3UUB A;  1WR0 A;  3QUJ A;  4JI4 T;  3FZK B;  1BR4 A;  3RIU A;  2XQ8 A;  1XDP A;  2UXX B;  3RYF E;  4H63 H;  3AA6 B;  3MK7 C;  1KF6 A;  4NPP A;  2LT3 A;  3P4R A;  3C4W A;  3ZMS B;  3RQU A;  3UU4 A;  3LBX A;  5IUX A;  1J5E T;  3BQI A;  2JRK A;  4PK6 A;  4U3C A;  5LMN T;  4GYR A;  2JMK A;  2EHO C;  4HFD A;  3CQG B;  3Q5W A;  4NXN T;  4YHJ A;  2HH7 A;  4ANJ A;  3HKC E;  5LGN B;  3FBL A;  3RI5 A;  2QRX A;  1YQ4 A;  4WYV A;  2Y6X A;  3KV5 A;  2KWH A;  2E2A A;  4IDP A;  3H37 A;  3P8C D;  2XQ9 A;  3ETV A;  2J1D G;  1CUN A;  4LFA T;  4L9I A;  4KHP T;  2WDR A;  4PNI A;  2GK9 A;  2CM0 A;  3FXD B;  3PUQ A;  4H63 V;  5EK4 A;  2BKP A;  4Q25 A;  5EK3 A;  2WMN A;  3HKB E;  1WCR A;  4DV2 T;  3E22 E;  3WAJ A;  1NEN A;  2JQH A;  3M3Z B;  4I50 E;  1KNP A;  3CX6 B;  2CHN A;  4G63 A;  5AQN B;  2YIN A;  4UVC B;  3DP7 A;  5J2U E;  3QB5 K;  3PU3 A;  5H6Q B;  5ABE A;  2VK9 A;  3RYI E;  5LXT E;  4DVD A;  1D1A A;  4TX5 A;  5ABF A;  2YKS A;  2BG9 E;  2XQ7 A;  5LG3 A;  3V5U A;  3HKD E;  2X0Y A;  5LOV E;  4F6R C;  3UUL A;  1BR1 A;  3C64 A;  5LJN A;  5JDF A;  2XAS B;  4BAY B;  1I6Z A;  4UV9 B;  5AQV B;  5FXX A;  1XNR T;  5CA0 E;  4UEM A;  2WZI A;  5LHH B;  3T1Y T;  2JQQ A;  4MAL A;  3EDU A;  4PW8 A;  5FYM A;  2F4V T;  1KNR A;  4EEB A;  2ZM2 A;  4JEH B;  4YSZ A;  3R84 B;  2LSI A;  1D0Y A;  2WP9 A;  2V7I A;  3RH3 A;  2LE8 A;  4AQF C;  4O4I E;  2BKN A;  2NW8 A;  4BA9 A;  3AE3 A;  4UF0 A;  4LF5 T;  2ACZ A;  3EI0 A;  2X66 A;  4I55 E;  1ZHC A;  3RF1 A;  1S94 A;  3E08 A;  2W00 A;  4YJ3 E;  5AQL B;  4XZC A;  4CXW A;  3CKD A;  2N1G A;  4TWF A;  4ZI7 E;  5F8P A;  4JI3 T;  3AB3 B;  4U74 A;  5HCM A;  4UV8 B;  2V7M A;  4HFC A;  3RRC A;  2Q9Q A;  1KNZ A;  3LBX B;  4DV6 T;  4B3S T;  2YEV C;  3EHZ A;  3KV9 A;  1MIV A;  3H3M A;  3A7M A;  3AE7 A;  4Z90 A;  3FZH B;  3N5L A;  4TZ4 C;  3NBX X;  1UK5 A;  2LSK A;  3ZMZ B;  5IWA T;  5HEH A;  2ODV A;  1KFY A;  2JPF A;  3IBP A;  2QGS A;  5JVD E;  4HGA A;  4X62 T;  4HFE A;  2V1D B;  4O4H E;  3VRA A;  4GKJ T;  2L8K A;  4LF9 T;  1YKH B;  3CQX C;  2JMH A;  2KMF A;  2VL8 A;  4ZI2 D;  3A5X A;  5JH7 E;  4GYS A;  3N9L A;  3PUG A;  3B5M A;  3O1H A;  3OYX A;  3H3A A;  4AI6 A;  1Z8U A;  1HNZ T;  2XQ3 A;  2ODU A;  5FY0 A;  2K3W A;  1MIW A;  1HS7 A;  3E0Z A;  4YTM A;  4H9O C;  4ZI3 C;  5JTG A;  2HHH T;  5LCY A;  3RRW A;  3RIF A;  5F5W A;  5LGU B;  2I0M A;  4KBM B;  4XAX B;  3CML A;  2B76 A;  3RLF F;  2Z6E A;  2D5U A;  4Z8X A;  3N9O A;  2PFV A;  3QK6 A;  2BG9 C;  4DMV A;  3RYH E;  4CN1 A;  2DHR A;  2V7L A;  1WR6 A;  2N2N A;  5JDN A;  3PE0 A;  5HWY A;  4HEA A;  3ZN1 B;  1JNZ A;  4OFZ A;  3P4S A;  4LMK A;  1IJ6 A;  2HN1 A;  5C8Y E;  2YDQ A;  4JI0 T;  5JRE A;  3EDV A;  2K24 A;  1DU2 A;  5DQW A;  3LG7 A;  3TLS A;  4IL4 A;  2VQE T;  4JI1 T;  2IUB A;  4YSY A;  4B3T T;  2VWA A;  4CI2 B;  1W0B A;  4JV5 T;  3I1A A;  3AAA B;  3HI2 A;  3JCF A;  4EV6 A;  5HWX A;  3TLU A;  4DMW A;  3OBV E;  3UFG A;  1NAF A;  4NXM T;  4X20 E;  1ZOY A;  2HN2 A;  2XAG B;  2YU2 A;  3C50 A;  2Q9Q B;  3RGL A;  4IE0 A;  3ZCI A;  1HG2 A;  4E7S A;  3KV6 A;  2LM9 A;  2MBG A;  2NP9 A;  4O4J E;  4DR4 T;  5FNV E;  2LSJ A;  2KWI B;  3U3I A;  5HEU A;  4PK4 A;  1US7 B;  3AEG A;  3W15 B;  2RA1 A;  4BJN A;  2VVS A;  2XY8 B;  5DJQ C;  4DND A;  1IAP A;  4EB6 E;  4AIS A;  3GA8 A;  5CFB A;  3ZSS A;  2D2S A;  1XDO A;  5JR9 C;  3ZJ2 A;  1Y01 A;  4HWI B;  3FZF B;  5L3F B;  1OED E;  2CXL A;  2IAK A;  3HKE E;  3NKZ A;  3P4W A;  3FBZ A;  2ACX A;  2L9Q A;  3QNU A;  4YY3 T;  2KIN B;  5L3E B;  3PUW F;  2BVM A;  2H89 A;  1UUR A;  1W09 A;  2WCA A;  3UUM A;  2H88 A;  2UU9 T;  4QXC B;  1JNR A;  3PUV F;  3Q5D A;  1HX8 A;  4NUU A;  3P50 A;  2LJL A;  3IEE A;  3ZT7 A;  4PFP A;  3GN5 A;  2XJ7 A;  4ISS A;  2MAW A;  1FIO A;  4UXN B;  3OYZ A;  3D0T A;  5AQS B;  4QH5 A;  4ASK A;  5LG4 A;  5JDG A;  2XQ6 A;  2XQ4 A;  2IDO B;  2JQK A;  2XQA A;  4X66 T;  3PUX F;  3CWZ B;  2H7O A;  4TV8 E;  2XZE A;  2AE9 A;  5L4E A;  4M1P A;  4PJN A;  3B57 A;  3V5S A;  3RX6 A;  3SS1 A;  2BVL A;  3ZMT B;  2K9A A;  3AEC A;  4HWC A;  3TLT A;  2CBI A;  2V5D A;  1E1H B;  5HXE A;  4AKG A;  2AXD S;  4LFB T;  5LYJ E;  5JDQ A;  3ZYL A;  4IE7 A;  4DV0 T;  4DR3 T;  2DNX A;  4UVA B;  2CXD A;  2IIU A;  1WFD A;  2W4X A;  4N78 D;  5FL0 A;  2WDQ A;  5E0O A;  4NIQ A;  3JC6 C;  2LSG A;  3ETU A;  4WNK A;  1IJ5 A;  4EYU A;  1HX1 B;  2YU1 A;  2YK0 A;  3TKL B;  4A56 A;  3G06 A;  3UU6 A;  3AED A;  3KIN B;  2JIW A;  5JDH A;  1W0A A;  4QHO A;  2H7V C;  2ZMA A;  2BDE A;  1UX5 A;  1T8B A;  4H9R C;  5CA1 E;  4IT4 A;  2WMO A;  1YQ3 A;  5TAO A;  1WRD A;  3PTR B;  1VOM A;  3JAE A;  5LHG B;  5ABG A;  1E7P A;  3VU7 H;  4OHF A;  3UU5 A;  4WBN E;  3MA9 A;  3RYC E;  2WQY A;  3ESL A;  4HN9 A;  3ZN0 B;  4IDZ A;  1LKX A;  2E9X C;  4GIW A;  3IHR A;  4WBO A;  5HXS A;  4OYK A;  5JR9 A;  4PJJ A;  3C51 A;  4DR7 T;  5EK2 A;  2E5L T;  3PU8 A;  2OLT A;  3P7I A;  1OED C;  1QUU A;  2W63 A;  3CIR A;  3AE9 A;  3ZCJ A;  1S35 A;  3OKQ A;  4H9N C;  2NW7 A;  3AE1 A;  1BR2 A;  3SRZ A;  1NWM X;  1WLX A;  4MFR A;  2KSR A;  2M6I A;  3PDY A;  3KVA A;  4AKL A;  2PTF A;  2IHR 1;  4DV1 T;  1D0X A;  4HFB A;  4AXP A;  4J2C A;  3GN5 B;  2E5V A;  4TWH A;  4O2A E;  3N2O A;  2IML A;  3SFE A;  1XMQ T;  4DR5 T;  4OYJ A;  4JBW F;  3FXE B;  2LOP A;  3VHL A;  4DR6 T;  4DUY T;  3JAD A;  1MMA A;  5L47 A;  3ZMV B;  3RIA A;  4ZZB A;  3DTO A;  4CN4 A;  3GWH A;  4YXD A;  1YKE B;  5AQI B;  3KDS E;  4KP3 C;  2NTX A;  2VKO A;  3Q5E A;  3AE5 A;  1D1B A;  5J1G A;  4HWF A;  3F31 A;  2XPK A;  1G73 A;  3K3O A;  2LEH A;  3KVB A;  3MZK B;  2NOX A;  4H9Q C;  4KUM B;  3RHW A;  5L3G B;  3TLW A;  4TN7 B;  2JJ9 A;  3B13 A;  1GQE A;  1YW0 A;  4IRE A;  3AEE A;  5L2L A;  3ZT5 A;  4DBR A;  3AVS A;  4IST A;  3J9X 1;  1VRB A;  4HTE A;  4JI2 T;  4DO0 A;  2WM9 A;  2Y48 B;  4ZXL A;  3EAB A;  2R6G F;  5FXV A;  4AQG A;  3AXJ A;  3C98 B;  4ADZ A;  3LK3 B;  3UQ4 A;  3ZYK A;  4COF A;  3VKG A;  3J7Y q;  4ZHQ E;  5LA6 E;  5LNK A;  3AA0 B;  3CK6 A;  2EHO A;  5CB4 E;  3KFW X;  3K3N A;  3ZJ1 A;  5CJ5 A;  1I94 T;  2A2F X;  4P0B A;  2LOS A;  4DUZ T;  4A5X A;  3CPZ A;  4P09 A;  4XBF B;  3ZLI A;  5EZY E;  5FMN A;  4GK5 E;  2FBW A;  5FVL A;  2PBI A;  5ADX L;  5HEO A;  3FZL B;  4ZS3 A;  4HWD A;  1MMN A;  4UEL A;  3X1D A;  2QVA A;  2V7J A;  2QA7 A;  5ABF B;  2XHE B;  2M6B A;  4I0U A;  5AQM B;  1FMV A;  3RPU A;  4I43 B;  3AA7 B;  3RKG A;  4O4L E;  4PJM A;  2XAF B;  4YHH T;  2A72 A;  2K48 A;  4U72 A;  2MTQ A;  3BK9 A;  5IYZ E;  4QX8 B;  5AQU B;  2HPJ A;  3P4Q A;  2D0U A;  3MAC A;  5FKY A;  2X9Y A;  4GK0 E;  4QH4 A;  4B3R T;  4JUY A;  2LKH A;  3UTK A;  4DV7 T;  3WI3 A;  3ONX A;  4YJ2 E;  1LVF A;  4JYA T;  4LF4 T;  3L8R A;  4PAG A;  2DWK A;  4UF0 B;  4EAH A;  2XAQ B;  3RIU C;  2V26 A;  2Y8D A;  4K0K T;  3ANW A;  5HXH A;  3P4P A;  3EVY A;  5FL1 A;  2UXN B;  1CHU A;  3Q5X A;  4AIU A;  5BR8 T;  2LM2 A;  5FXW A;  4FJO A;  3QC9 A;  2CBJ A;  4AQF A;  4H9P C;  2J4G A;  5JRC A;  3I9Y A;  2CRB A;  1G8X A;  4LF7 T;  3LSV A; 
#chains in the Genus database with same CATH homology
 2IC6 A;  3PU3 A;  2IC9 A;  5H6Q B;  3L3P A;  2VK9 A;  4QWN B;  4CXY A;  3RYI E;  5LXT E;  4DVD A;  2VKJ A;  3O4X E;  3N2K E;  1D1A A;  4TX5 A;  3VKH A;  2LSY A;  4ERR A;  3CWZ B;  4CI1 B;  2H7O A;  4TV8 E;  2W0G A;  2WAU A;  3OJA A;  4KMC A;  4M1P A;  5DAB A;  3V5U A;  3HKD E;  4L0R A;  3PUR A;  5LOV E;  2CMR A;  4PJN A;  4IHJ E;  3B57 A;  3V5S A;  4F6R C;  3RX6 A;  3SS1 A;  3UUL A;  1BR1 A;  2XUE A;  3C64 A;  2BVL A;  2XAH B;  5LJN A;  2DWG A;  5JDF A;  2XAS B;  2CEA A;  3ZMT B;  2K9A A;  4BAY B;  3SOL A;  4UV9 B;  5A1L A;  5JR9 B;  1ZKE A;  5L3C B;  1YD8 G;  1E1H B;  5FXX A;  4IIJ E;  5HXE A;  3CX7 B;  5CA0 E;  4UEM A;  4AKG A;  1D1C A;  5BMV E;  5LHH B;  5LYJ E;  2JQQ A;  5JDQ A;  3ZYL A;  2CE7 A;  4IE7 A;  4MAL A;  4ZI2 C;  2EHO D;  5GON E;  2E9X A;  2M67 A;  3EDU A;  2DNX A;  4PW8 A;  2C0S A;  3M65 A;  4UVA B;  5FYM A;  5HXC A;  4B6X A;  3F2E A;  3N9N A;  2B1E A;  2CXD A;  2XAJ B;  2C5J A;  2I59 A;  4IE6 A;  2ZM2 A;  4JEH B;  3LK2 B;  4N78 D;  3HA4 A;  1LRZ A;  2WBL A;  1D0Z A;  3HR0 A;  4IE5 A;  1MMD A;  3R84 B;  2BZB A;  1Y64 B;  2LSI A;  1D0Y A;  1SA0 E;  2ES0 A;  2KXP B;  2V7I A;  1WYC A;  2LE8 A;  4IE4 A;  3RH3 A;  3U78 A;  4AQF C;  3ZC0 A;  5ETW A;  4O4I E;  4AKI A;  5E0O A;  2NW8 A;  3JC6 C;  2LSG A;  4BA9 A;  3ETU A;  4UF0 A;  4WNK A;  1IJ5 A;  4K0U A;  3KV4 A;  4EYU A;  5LGT B;  2YU1 A;  1MNE A;  2XTL A;  2RP4 A;  2X66 A;  2YK0 A;  4MHC A;  3TKL B;  4A56 A;  5JDM A;  4I55 E;  1QSD A;  1ZHC A;  3KIN B;  1S94 A;  3E08 A;  2DI4 A;  2W00 A;  4YJ3 E;  5JDH A;  4XZC A;  2DLR A;  4CXW A;  5LP6 E;  3CKD A;  2N1G A;  2X9H A;  5H6R B;  4ZI7 E;  2PJQ A;  5F8P A;  3AB3 B;  4X1I E;  4QHO A;  2H7V C;  2ZMA A;  3F57 A;  3WAK A;  2MOZ A;  2BDE A;  1UX5 A;  3HL6 A;  4H9R C;  2N9D A;  4U74 A;  5CA1 E;  5L3D B;  1UCU A;  4O8S A;  2WMO A;  3MJX A;  5TAO A;  2CXF A;  1WRD A;  2X9X A;  4HFV A;  3PTR B;  1VOM A;  4UV8 B;  2V7M A;  5LHG B;  3UT5 E;  3RRC A;  4L5G A;  4MBQ A;  2Q9Q A;  2LHN A;  3LBX B;  1KNZ A;  3VU7 H;  4CI3 B;  1EZ3 A;  4OHF A;  4WW0 A;  2YEV C;  3KV9 A;  1T98 A;  3Q2M A;  1MIV A;  2KND A;  2CWY A;  4WBN E;  3IF8 B;  2P9B A;  2WWU A;  1H7C A;  3MA9 A;  1UX4 A;  3RYC E;  3ZC1 A;  2X51 A;  3N5L A;  4QXB B;  3ESL A;  3O9X A;  2LHR A;  4TZ4 C;  3NBX X;  4HN9 A;  3UFE A;  3ZN0 B;  4IDZ A;  1LKX A;  2VB6 A;  2E9X C;  2LSK A;  3ZMZ B;  1BR0 A;  4GIW A;  3O1I A;  5LBM A;  3IHR A;  3LJC A;  4WBO A;  2ODV A;  4OYK A;  5HXS A;  4ZS2 A;  5JR9 A;  2X0L B;  2JPF A;  5LBQ B;  4EYY R;  4PJJ A;  3C51 A;  3IBP A;  2VKH A;  5EK2 A;  2QGS A;  5JVD E;  4HGA A;  3AAI A;  5IHY A;  3PU8 A;  2WSS V;  4GOU A;  3P7I A;  3CVR A;  1QUU A;  2W63 A;  2MYS A;  2V1D B;  2KT9 A;  4O4H E;  1O3X A;  1S35 A;  3ZCJ A;  3OKQ A;  3LFM A;  4C91 A;  2CLY C;  2L8K A;  4H9N C;  2NW7 A;  3K8P C;  4C90 A;  1HCI A;  3CQX C;  1MMG A;  1YKH B;  3AVR A;  1BR2 A;  2JMH A;  2KMF A;  2X68 A;  2DCF A;  1NWM X;  1WLX A;  2VKD A;  4MFR A;  3SRZ A;  1V9D A;  2VL8 A;  4ZI2 D;  3A5X A;  3Q9D A;  5JH7 E;  4X1Y E;  4GYS A;  3N9L A;  1ZEE A;  3PDY A;  3ANW B;  3KVA A;  4AKL A;  3PUG A;  5L3B B;  2Q9Q D;  1D0X A;  4AXP A;  3C4X A;  4J2C A;  2NTY A;  3GN5 B;  3KBT A;  3R6N A;  2C5I T;  5JQG E;  4O2A E;  3N2O A;  5HAX A;  2EHO B;  2V7K A;  3O1H A;  4BJM A;  3OYX A;  3H3A A;  4AI6 A;  4OYJ A;  3GMI A;  4TV9 E;  3FXE B;  2ODU A;  5FY0 A;  2LOP A;  4QKN A;  2X9W A;  3VHL A;  2Q9Q C;  3JC6 D;  1MIW A;  2ZM8 A;  4AKR B;  1HS7 A;  3E0Z A;  2IW5 B;  4V1A v;  3MXZ A;  1MMA A;  4H9O C;  1FEW A;  4ZI3 C;  3UUX B;  3ZMV B;  5LCY A;  3RRW A;  3I0Q A;  3AAE B;  5LGU B;  5FXZ A;  4YFS A;  3DTO A;  3NZP A;  4X1K E;  4KBM B;  2H3R A;  3ZPO A;  2KZ7 B;  4XAX B;  3RC8 A;  3GWH A;  4PFO A;  3NRY A;  5AFU L;  1B7T A;  2L3L A;  3CML A;  1YKE B;  3KDS E;  2Z6E A;  5FY1 A;  2D5U A;  4Z8X A;  4JLE A;  4KP3 C;  4G2A A;  3N9O A;  2NTX A;  2PFV A;  3I9W A;  2VKO A;  3N9P A;  3QK6 A;  2VAS A;  3L09 A;  4DMV A;  3RYH E;  1D1B A;  1OWA A;  2DHR A;  3BQK A;  5J1G A;  2V7L A;  1WR6 A;  5J2T E;  2N2N A;  3F31 A;  3LK4 2;  3SWH A;  1G73 A;  3K3O A;  5HYA A;  2LEH A;  3KVB A;  3MZK B;  5JDN A;  2NOX A;  3PE0 A;  5KMG P;  5HWY A;  4P0A A;  4H9Q C;  3N9Q A;  4KUM B;  4HEA A;  3ZN1 B;  5L3G B;  4UVB B;  3K3Q C;  4TN7 B;  2JJ9 A;  5F3J A;  3B13 A;  4OFZ A;  1YW0 A;  2E9X B;  5DQV A;  2KLQ A;  1Z0P A;  1IJ6 A;  1FMW A;  5L2L A;  3I0O A;  4DBR A;  3AVS A;  5C8Y E;  2E9X D;  5M4Y A;  1HF8 A;  3PUS A;  4IST A;  4JEU B;  3J9X 1;  5JRE A;  1VRB A;  3PUA A;  3DJB A;  4HTE A;  4DO0 A;  2HPL A;  2ZLY A;  2WM9 A;  2Y48 B;  4O2B E;  2PG8 A;  1HG5 A;  3EDV A;  4ILU A;  2K24 A;  5FXV A;  5DQW A;  4AQG A;  4EZH A;  3CX8 B;  3C98 B;  4EZ4 A;  3FB2 A;  4ADZ A;  3LG7 A;  3LK3 B;  3ZYK A;  3VKG A;  3J7Y q;  4NUV A;  4ZHQ E;  4MLK A;  2CWO A;  5LA6 E;  3N9M A;  5FP3 A;  4EIW A;  1ZV4 X;  4H9S E;  5LNK A;  3NZQ A;  3AA0 B;  3CQC B;  2VWA A;  4CI2 B;  1HTJ F;  3ZYM A;  2EHO A;  3I1A A;  2X67 A;  5FY7 A;  3AAA B;  3HI2 A;  5CB4 E;  5HWX A;  1X79 A;  4EXT A;  5KX5 E;  4DMW A;  1WYB A;  3ZMU B;  3OBV E;  1MND A;  2XQY A;  3KFW X;  1NAF A;  3T8O A;  3K3N A;  4X20 E;  3ZJ1 A;  2XAG B;  2YU2 A;  2A2F X;  4ZOL E;  3C50 A;  4P0B A;  2Q9Q B;  2LOS A;  5HXR A;  3CPZ A;  4P09 A;  4IE0 A;  3EUH A;  1HG2 A;  3ZCI A;  4E7S A;  2W61 A;  3KV6 A;  3S4U A;  2K5B B;  2LM9 A;  3ZLI A;  4XBF B;  4UIG A;  3MKD A;  4PJL A;  2W62 A;  4GK5 E;  5EZY E;  5FMN A;  4CQI A;  2MBG A;  3AA1 B;  2NP9 A;  3RC3 A;  1U5P A;  3N2G E;  4O4J E;  1U4Q A;  2PBI A;  4ZI3 D;  4CZZ B;  4CXX A;  1OXZ A;  5ADX L;  4QXH B;  5FNV E;  2LSJ A;  3BQL A;  2KWI B;  3O1J A;  3UUN A;  2E8I A;  5JRC B;  3U3I A;  5KDM C;  3QUJ A;  4ZS3 A;  4E7Z A;  1MMN A;  1BR4 A;  2UXX B;  5LJM A;  3RYF E;  4H63 H;  4PK4 A;  1US7 B;  3AA6 B;  3MK7 C;  4UEL A;  3W15 B;  2RA1 A;  2OA5 A;  2V7J A;  2QA7 A;  3NRX A;  2XHE B;  4BJN A;  5DJQ C;  3FHN A;  2LT3 A;  1FMV A;  3RPU A;  3C4W A;  4YLH A;  4DND A;  4HE8 A;  1IAP A;  4EOZ B;  3ZMS B;  4DBQ A;  2C5K T;  4PK5 A;  4EB6 E;  3GA8 A;  4FI5 A;  4I43 B;  3AA7 B;  4O4L E;  3LBX A;  4OK0 A;  1HFA A;  4PJM A;  2XAF B;  2D2S A;  3BQI A;  2JRK A;  2A72 A;  1SHZ C;  5JR9 C;  1IZN B;  4PK6 A;  3ZJ2 A;  5L3F B;  4GYR A;  4TUY E;  2K48 A;  2JMK A;  4U72 A;  2EHO C;  2MTQ A;  5JDL A;  3BK9 A;  5IYZ E;  2CCQ A;  4I4T E;  2CXL A;  2IAK A;  3CQG B;  3Q5W A;  5LHI B;  4YHJ A;  2HH7 A;  3HKE E;  4ANJ A;  3FBZ A;  3HKC E;  4QX8 B;  5LGN B;  2NWB A;  2ACX A;  2HPJ A;  2ZM0 A;  2L9Q A;  3FBL A;  3KBU A;  2SPC A;  2Y6X A;  3KV5 A;  2D0U A;  2KWH A;  3MAC A;  2KIN B;  3H37 A;  2X9Y A;  5L3E B;  3P8C D;  2BVM A;  3ETV A;  4IGU A;  2J1D G;  2CA5 A;  1CUN A;  4L9I A;  4GK0 E;  4PNI A;  1LVK A;  4JUY A;  3UTK A;  3UUM A;  1MIY A;  3WI3 A;  2GK9 A;  4QX7 B;  3RKO A;  3ONX A;  4YJ2 E;  1LVF A;  4AKH A;  2CM0 A;  3FXD B;  3PUQ A;  1KK7 A;  4H63 V;  2CLY B;  4PAG A;  5EK4 A;  2DWK A;  3C4Z A;  4QXC B;  4HKA A;  5EK3 A;  4UF0 B;  4EAH A;  2XAQ B;  2G0U A;  2WMN A;  1HX8 A;  2V26 A;  3HKB E;  4NUU A;  2D0T A;  2Y8D A;  2LJL A;  3ANW A;  5HXH A;  3IEE A;  2A3D A;  3EVY A;  2UXN B;  4PFP A;  1AJ3 A;  3E22 E;  3GN5 A;  3Q5X A;  3WAJ A;  5FXW A;  3ZEF B;  4FJO A;  3QC9 A;  4ISS A;  4AQF A;  1FIO A;  4I50 E;  4UXN B;  3OYZ A;  3CX6 B;  3D0T A;  4H9P C;  4G63 A;  4ASK A;  5JRC A;  5LG4 A;  2YIN A;  2NW9 A;  5JDG A;  4UVC B;  3I9Y A;  3DP7 A;  1G8X A;  5J2U E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...