4H9OC

Complex structure 2 of daxx/h3.3(sub5,g90m)/h4
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
total genus 77
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2012-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h9oC00
4H9RC 4H9QC 5KDMC 4H9SE 4H9PC 4H9OC 4HGAA 4H9NC
chains in the Genus database with same CATH superfamily
2I59A 3AEGA 3U78A 3Q9DA 5JREA 5AQUB 2JJ9A 4P0AA 2XHEB 1S94A 4UR9A 4V1Av 1D0ZA 2LT3A 3ZT5A 4XAXB 4OYKA 5HCJA 2E9XD 2V6XA 3OKQA 1ZEEA 4IE5A 4O4IE 2DWKA 4ASKA 3RI5A 2WS3A 3ETVA 3OTOT 3QC9A 2WB5A 3CPZA 3AA0B 1WLXA 4IE0A 4JI4T 1M62A 3PU3A 2BBJA 2SPCA 2DL1A 5AQPB 4UVBB 3FZKB 5A1LA 1WR6A 4NUVA 5AQSB 4CI1B 4DV1T 4N78D 1MNDA 3E22E 3NRYA 2J1DG 3KINB 2XQYA 5HEOA 3UQ4A 4ZI3D 1HCIA 4JI2T 2IC9A 2W67A 5FXXA 1ZOYA 2IMLA 2WWUA 3R84B 2CLYB 4O4LE 3ZSSA 5JDFA 4QXCB 1OWAA 1EZ3A 4HFIA 1SUMB 2OLTA 4KUMB 2WZIA 4X1IE 4ZOLE 2XPKA 4PK4A 4AXPA 4ZI2C 5JDNA 5LMUT 4GOUA 1XMOT 1N36T 4IDNA 3UU8A 3I0OA 3ZMZB 2LRLA 2BS2A 2Y6XA 2BKPA 2KWIB 4L0RA 2WMNA 4TN7B 2BG9E 5AQTB 4YHHT 1KF6A 1U5PA 2YK0A 4Z8XA 3LFMA 5H6RB 2X67A 4DV2T 3KV4A 4B3RT 4L5GA 2KWHA 3F31A 3TLWA 4JYAT 3RIUC 5J0ZA 3CWZB 1KNPA 5JR9C 3P4SA 3CIRA 4MFRA 3LK2B 2XY8B 4UV8B 1J5ET 1D0XA 1OEDA 3D0TA 4QH4A 3PUYF 1FEWA 2EHOD 5F8PA 3TLUA 4F8HA 5HAXA 4O2BE 5LOVE 3RIUA 5FL1A 5ETWA 4AQYT 4YHJA 2XTLA 2YDSA 2FBWA 1L0VA 3N9LA 4NIQA 5KDMC 3KVBA 5EK3A 1I6ZA 3PUGA 4EAHA 2X0YA 3OJAA 3K3QC 1QUUA 4IE4A 5L3CB 4OHFA 4ILBA 3RC3A 2LKGA 2YKSA 3UQ7A 5AQIB 1XDOA 5AQGB 5AQVB 5FVLA 3ZMVB 4CZZB 4LFBT 1GQEA 1E7PA 1MIVA 2UXDT 5HXRA 2RA1A 3AEFA 3AEEA 1HG5A 2CMRA 2DNXA 4UF0B 4ZEYA 5LBQB 5LHGB 4YY3T 4DV5T 5KX5E 3RPUA 2E5LT 2J47A 3RQUA 4EZHA 2CEAA 4ZI7E 2PFVA 4ILUA 5CA0E 3Q5WA 2FUPA 3RYCE 3UU6A 5LG3A 4NUUA 4UVCB 3ZYLA 4EYYR 1X79A 1YKHB 4YSXA 2QA7A 3AE7A 2HN1A 2ZMAA 3HR0A 4H9OC 1I94T 2DCFA 2V7LA 1FMVA 1QSDA 5ABEA 3CQGB 3N9OA 3FZLB 5LHIB 4B3ST 4CN1A 2JRKA 2KXPB 1UK5A 2LHRA 2XSAA 2Z6EA 3H3MA 1ZV4X 1MMAA 3H3AA 4HWDA 2VL0A 4PW8A 5EK4A 4JI3T 1BR0A 3PV0F 2RPAA 3UT5E 5IUXA 2JPFA 2QGSA 4GK5E 3L39A 4U7IA 4KMCA 4UELA 5ABGA 3P50A 2E9XC 3PUWF 3UUMA 4KP3C 1VRBA 4ZHQE 3PTRB 3K3OA 2LOSA 4O8SA 4YJ3E 2YDQA 3SOLA 2MTQA 1HX8A 2W2UA 4H9PC 2H88A 3LK3B 4ERRA 4DR6T 2IHR1 3UFEA 2CXLA 5LYJE 3AAEB 4MALA 4H9RC 5HWYA 3PUXF 4DVDA 3G06A 2NOXA 5LGNB 3C64A 4MHCA 5LBMA 3I9YA 3HI2A 2N2NA 2YDRA 3C4WA 4DMVA 3AE5A 3P4QA 3FXDB 3T8OA 5DQWA 2WM9A 2CE7A 3L8RA 2K3WA 1FMWA 4DUYT 3UU5A 3UUXB 4X1YE 1BR1A 4AKRB 2YINA 1QLBA 1NEKA 4IE6A 3CX8B 5AQFB 4CN6A 2WSSV 5LA6E 3EI0A 4IGUA 2CCQA 4HFCA 4A56A 3RYHE 3ZYMA 4ZI2D 5L3EB 2A2FX 3ONXA 4B6XA 4X62T 3ZN0B 3O1IA 2A9UA 5JVDE 4I4TE 3AVRA 1KK7A 5FL0A 1MMGA 4I0UA 4WW0A 4CXWA 4E7ZA 2XAHB 3MA9A 5LHHB 2PJQA 3AEBA 1E2AA 3ONLC 4HTEA 4BA9A 1YKEB 2UUAT 2NP9A 4AI6A 3K1SA 5CB4E 2WU2A 3AE3A 3ZJ2A 5ABHA 4PNIA 5JDHA 1T8BA 3CX7B 4NXNT 2BVMA 1KEYA 1E1HB 2XQ7A 5ABFA 4B3TT 4NXMT 1DU2A 2OV9A 2A3DA 4TWHA 5AQMB 1H7CA 4CXXA 3J7Yq 1IBKT 2HPLA 1HNWT 3ZT6A 5BR8T 1N34T 4DR4T 1LVKA 4CI2B 2XQ4A 2PBIA 4YXDA 2A72A 2E2AA 1HF8A 2MAWA 2JMKA 2XAGB 1KNRA 3SRZA 3AAIA 2WDQA 4UVAB 4YFSA 1NENA 3VRAA 1UCUA 2ODVA 3AA7B 4U3CA 3ONJA 4A97A 4COFA 4LFCT 1UURA 3C4XA 4QH5A 5JR9A 3ZC1A 3V5UA 3ZCJA 4AKIA 2BZBA 3PU8A 2MOZA 3I9WA 3F2EA 1IJ5A 4EZ4A 4X1KE 1UX5A 2V8SV 3C98B 2X9WA 2ACZA 3NWIA 4U31A 2D9DA 4LF8T 1UX4A 2C0SA 1KFYA 5L4EA 2DLRA 2NR4A 3O1HA 2JQ9A 2KZ7B 4CN4A 3LBXA 2VB6A 2WDRA 2FJEA 5HXCA 4JI0T 3UULA 1XDPA 2E9XA 1OEDC 4YTMA 4OX9T 2Y48B 1Z0PA 5FXZA 4PFOA 2D0TA 5LG4A 3P4PA 3DJBA 4FJOA 4Q25A 5HEGA 3CK6A 2MBGA 3RIAA 4EOZB 2LSJA 4LFAT 5AQHB 2LRKA 1SE7A 4LMJA 2LEHA 3JAFA 4U74A 2VK9A 4MBQA 4U2YA 1JNZA 1SHZC 2VVSA 4I55E 2VKDA 2K24A 4GYRA 4QWNB 3RIFA 4EEDA 1XMQT 3K8PC 5L3BB 2X9YA 3A8YC 3PUAA 4IDZA 1UGOA 3PURA 4HFBA 3ZYKA 4BJMA 4DR1T 2XM2A 4EXTA 2XAJB 1FIOA 1G8XA 2L9QA 2BKOA 2CLYC 4HFHA 5AQLB 3DP7A 3IHRA 4BJNA 3HKEE 1VCTA 2CXDA 5JTGA 3JADA 2CXFA 2XQ3A 2BBHA 2V7KA 2LSGA 3A5XA 2V5CA 1BR4A 2IDOB 3UUBA 5C3JA 3LG7A 4DR7T 2Q9QD 3VR8A 5M4YA 5ADXL 3I1AA 5FNVE 1YXRA 2ODUA 4TZ4C 4IL4A 2WBLA 1VCSA 1XNQT 5DQVA 2UXBT 5JRCB 2CWOA 2X0LB 1MMDA 2I0MA 2H7OA 4EYUA 2BG9A 5FMNA 5JR9B 4PJLA 2VQET 1HTJF 1T7SA 2IC6A 2LSIA 4DV7T 2X68A 2AE9A 2YN6A 1Y64B 3JCFA 5AQQB 3RHWA 2LM2A 2JMHA 2VASA 3EVYA 3SS1A 2Q9QA 4A5XA 4IHJE 1AJ3A 2H89A 4H9SE 3KV5A 3B5MA 1WYCA 3OBVE 3E08A 4IL9A 2XAFB 1IBLT 2XJ7A 1N32T 3QB5A 5TAOA 4P0BA 3C4ZA 1YQ4A 3IEEA 4JLEA 1N33T 2KLQA 2QYWA 4LF6T 4PJNA 2IUBA 2K5BB 4IDPA 4IT4A 4EGWA 4PFPA 2W61A 4YJ2E 2JQKA 4PK5A 4LF7T 4TV9E 3N9QA 4KX6A 5HEUA 4DBRA 3RH3A 3P4WA 3C51A 2FJBA 2WMOA 4WNKA 2CHNA 1MMNA 3AE4A 3TLSA 2BVLA 4JI6T 3ZMTB 2XQ8A 3ZMSB 4OYJA 1D1AA 5FVKA 5IWAT 2JIWA 2W66A 3N9NA 5J2UE 3TLTA 2J62A 2YU2A 2ZM0A 2XQ5A 1LRZA 1W0AA 3OPCA 4M1PA 2C5IT 1YW0A 3SFDA 2B1EA 1XWMA 4HWHA 1T98A 2IAKA 3GWHA 1B7TA 3MXZA 2XASB 3AA1B 4HFVA 1MIWA 5L3FB 3SWHA 4EIWA 3OVUA 2L8KA 4DV0T 4YT0A 1M7KA 2VURA 2BDEA 2J4GA 3AB3B 3CMLA 5LJNA 4X5TA 2G0UA 3PE0A 3RRWA 2WQYA 5FY0A 2K48A 4HE8A 5L3DB 2N9DA 2ZM6T 4DR3T 1UUSA 3ETUA 3MKDA 3O4XE 4O4JE 4X66T 4TUYE 4I43B 2CA5A 2XQAA 4P1NA 2EHOA 5IYZE 4ZZBA 4HWCA 2HHHT 2VQFT 2Q9QC 3BQKA 5F3JA 1V9DA 4QHOA 1YD8G 5KMGP 3IA3A 4DV3T 4MLKA 5GONE 4K0KT 4G2AA 4L9IA 2N1GA 2QRXA 3NZQA 3RF1A 3IF8B 2D5UA 2MYSA 3E0ZA 4AISA 5FP3A 5JDLA 3T1YT 3RX6A 4PAGA 1FJGT 1X9BA 3RGLA 1Y01A 2ZM2A 2NW9A 4ZS3A 5CJ5A 2BG9B 3LSVA 4LF4T 2C5JA 2V6YB 4IIJE 5L4HA 3LK42 2DHRA 3UU3A 5LGTB 4AQFC 5HEHA 3ZSTA 2Q9QB 5LP6E 3VKHA 1W09A 2NW7A 2ZLYA 1KNZA 4ANJA 3UUNA 3PUQA 2V26A 2E8IA 3AE6A 5CGMA 3P4RA 2X0HA 3NVOA 1OXZA 5FKYA 5LB7B 3PJAJ 3NKZA 3MACA 4QXHB 3R6NA 1D0YA 3PUSA 5LXTE 2KINB 2JQQA 2WP9A 2C5KT 2ACXA 3N2OA 3AA6B 4TNWA 4UF0A 4IDQA 5FY1A 2KMFA 2LLYA 3KV9A 3ZT7A 3RKOA 4ADZA 4HGAA 4QKNA 1J1JA 5J1GA 3S4UA 2X9XA 3CQCB 2I6HA 3GMIA 3MJXA 4DIDB 1LKXA 4YTPA 4AQFA 5L3GB 1OEDE 4DV6T 1IZNB 5HWXA 2XZEA 4CQIA 2VKJA 2X51A 5BMVE 3FZFB 2CPTA 1NWMX 2CBJA 2VKOA 1WCRA 5LMNT 4LMLA 4TWFA 5E0OA 5HXEA 1ZKEA 4TNVA 4HEAA 3Q5EA 4X20E 2OA5A 4GYSA 2IIUA 2KNDA 3T1HT 3EDUA 3MZKB 3FXEB 3FZHB 4JUYA 3KFWX 5FY7A 4X64T 3JAEA 4IE7A 3QNUA 5HEJA 3GA8A 2MPKA 3GN5A 4GKKT 4ZI3C 4JBWF 4EEBA 4CXYA 2UXCT 2XUEA 5C2TA 4K0UA 4DNDA 5ABFB 4LF9T 2YEVC 4TX5A 3VHLA 3N2GE 2XQ6A 3GN5B 3N2KE 5CFBA 2V6YA 3ANWB 3ESLA 3P8CD 3OYXA 3B57A 3C50A 1SA0E 1YQ3A 3F57A 4UV9B 2ZM8A 4YLHA 4JI1T 1JNRA 3JC6D 1OEDB 5F5WA 4KBMB 4QH1A 2W62A 2XSBA 4EV6A 4JI8T 4X65T 4OFZA 3RYFE 2HPJA 3LBXB 2LKHA 2LJLA 3FBLA 5AQKB 5EZYE 3PUVF 4ISSA 2WZHA 2CHOA 2HN2A 2AXDS 3IBPA 3M65A 4WYVA 1US7B 3QUJA 3ZLIA 4CI3B 2ES0A 2H7VC 4DO0A 3Q5DA 5LJMA 3RC8A 2W4XA 4XZCA 1MNEA 3AAAB 4OK0A 3RYIE 4Z90A 3CX6B 4YTNA 2F4VT 2WY2A 4QX8B 5DJQC 2DWGA 3KBTA 1WRDA 4F6RC 5AFUL 3UTKA 4XBFB 2LHNA 2B76A 2YOEA 3EABA 4O2AE 2K9AA 1XZYA 2VWAA 3KVAA 1IAPA 4KHZF 4NPPA 4C91A 2W0GA 4DMWA 4B3MT 2W63A 4WBOA 2V7IA 4Z91A 3VRBA 4FI5A 3RLFF 3ABVA 3WI3A 5HYAA 2UUBT 2QVAA 5AQRB 2CWYA 4PK6A 2X9HA 3CVRA 3EAMA 3P7IA 5AQJB 1ZHCA 3AEAA 2NWBA 3QOFA 1VOMA 4U2ZA 3WAKA 4PJMA 2FJAA 2HH7A 3A7MA 3JC6C 3N9PA 5AQNB 1HNZT 1XNRT 5JRCA 3AVSA 5JQGE 3HKBE 5EK2A 3PJAA 3ZJ1A 1BR2A 4U72A 3HKCE 5FXVA 1WYBA 4HFEA 3EDVA 5L47A 4O4HE 2D0UA 3Q2MA 4UEMA 3UFGA 3I0QA 4YSZA 5JDMA 4AKHA 2WDVA 2IW5B 3AXJA 4IREA 4AKGA 1ZP0A 3OYZA 3VU7H 3VKGA 2WU5A 3AECA 3AEDA 3BK9A 3L09A 2V1DB 1WFDA 2V7JA 3BQLA 4JEUB 4JI7T 3QK6A 4ZZCA 2X66A 4LMKA 2M6BA 3B13A 3WAJA 5H6QB 2NW8A 3RQWA 3CQXC 2LM9A 3H37A 4E7SA 5JH7E 4J2CA 1WR0A 5HXHA 4TWDA 2XM1A 2M6IA 2E9XB 4DR5T 4KI0F 1IJ6A 3EHZA 2VKHA 2CM0A 5HXSA 2LSKA 2KSRA 2WAUA 3HL6A 3KV6A 3L3PA 3LDQB 4ZS2A 3PDYA 3TLVA 3ZEFB 4WBNE 2CRBA 1U4QA 2LOPA 3FBZA 3FZMB 4QX7B 4AKLA 4BAYB 5J2TE 4DV4T 2RP4A 1HR0T 4GK0E 2Y8DA 4G63A 2EHOC 3PUZF 3ZC0A 2VVNA 3AE2A 3FHNA 3RKGA 3RRCA 3NRXA 5KXJA 2UXXB 2V5DA 5LNKA 1NAFA 2JQHA 2L3LA 3FB2A 3Q5XA 2PG8A 4TV8E 3ZN1B 3N5LA 1HNXT 3UU4A 5DABA 1HFAA 1IBMT 3ZPOA 2UUCT 4ISTA 2GK9A 5CA1E 4WZXA 2FJDA 2H3RA 4JV5T 4PJJA 3V5SA 1HS7A 4HN9A 2V7MA 4ILAA 3X1DA 1D1BA 2BS3A 2NTYA 1MIYA 1G73A 2EHOB 2DI4A 2XQ9A 2YU1A 3NZPA 3QB5K 1CHUA 4QXBB 5FYMA 4A98A 3AE1A 4IDOA 1W0BA 3ZKRA 3SFEA 4UXNB 4EB6E 2WCAA 3HKDE 3M3ZB 2P9BA 4H63V 4C90A 2BG9C 1S35A 5C8YE 2UXNB 3ANWA 2PTFA 3MK7C 5IHYA 3TKLB 3J9X1 4HWIB 3ZMUB 3N9MA 1CUNA 1J5WA 4GKJT 3LJCA 3HA4A 2NTXA 3VR9A 5L2LA 4JI5T 3AE9A 4HKAA 4ILCA 5FXWA 5HCMA 2E5VA 3AE8A 4U33A 4H9NC 3W15B 2KT9A 4ZXLA 5LCYA 3KDSE 3AXJB 4JEHB 5JDQA 1HX1B 2BKNA 2M67A 3DTOA 4H63H 4P09A 4U7YA 1T72A 4KHPT 3CKDA 3ZCIA 4I50E 2W00A 1W9RA 2LSYA 3BQIA 3KBUA 3NBXX 2LE8A 4AQGA 5JDGA 1R8IA 4DR2T 3K3NA 5AQOB 2BS4A 4H9QC 1Z8UA 1O3XA 1LVFA 2CBIA 4DUZT 2D2SA 4GIWA 4UIGA 3O9XA 2VL8A 2WWVA 1HG2A 4YSYA 5LGUB 4DBQA 1D1CA 2R6GF 4HFDA 3U3IA 4HWFA 3EUHA 4AIUA 2UU9T 3O1JA 2XAQB 4LF5T
chains in the Genus database with same CATH topology
2I59A 3U78A 3Q9DA 5JREA 4P0AA 2JJ9A 2XHEB 1S94A 4V1Av 1D0ZA 2LT3A 4XAXB 4OYKA 4ASKA 2E9XD 4IE5A 3OKQA 1ZEEA 4O4IE 2DWKA 3ETVA 3QC9A 3CPZA 3AA0B 1WLXA 4IE0A 3PU3A 2SPCA 4UVBB 1WR6A 4NUVA 4CI1B 4N78D 1MNDA 3E22E 3NRYA 2J1DG 3KINB 2XQYA 4ZI3D 1HCIA 2IC9A 5FXXA 2WWUA 3R84B 2CLYB 4O4LE 5JDFA 4QXCB 1OWAA 1EZ3A 4KUMB 4X1IE 4ZOLE 4PK4A 4AXPA 5JDNA 4GOUA 3I0OA 3ZMZB 2Y6XA 2KWIB 4L0RA 2WMNA 4TN7B 4Z8XA 1U5PA 2YK0A 3LFMA 5H6RB 2X67A 3KV4A 4L5GA 2KWHA 3F31A 3CWZB 5JR9C 4MFRA 3LK2B 4UV8B 1D0XA 3D0TA 1FEWA 2EHOD 5F8PA 5HAXA 4O2BE 5LOVE 5ETWA 4YHJA 2XTLA 3N9LA 5KDMC 3KVBA 5EK3A 3PUGA 4EAHA 3OJAA 3K3QC 1QUUA 4IE4A 5L3CB 4OHFA 3RC3A 3ZMVB 4CZZB 1MIVA 5HXRA 2RA1A 5LHGB 1HG5A 2CMRA 2DNXA 4UF0B 5LBQB 5KX5E 3RPUA 4EZHA 2CEAA 4ZI7E 2PFVA 4ILUA 5CA0E 3Q5WA 3RYCE 4NUUA 4UVCB 3ZYLA 4EYYR 1X79A 1YKHB 2QA7A 2ZMAA 3HR0A 4H9OC 2DCFA 2V7LA 1FMVA 1QSDA 3CQGB 3N9OA 2JRKA 2KXPB 2LHRA 2Z6EA 1ZV4X 1MMAA 3H3AA 4PW8A 1BR0A 5EK4A 3UT5E 2JPFA 2QGSA 4GK5E 4UELA 4KMCA 2E9XC 3UUMA 4KP3C 1VRBA 4ZHQE 3PTRB 3K3OA 2LOSA 4O8SA 4YJ3E 3SOLA 2MTQA 1HX8A 4H9PC 3LK3B 4ERRA 3UFEA 2CXLA 5LYJE 3AAEB 4MALA 4H9RC 5HWYA 4DVDA 5LGNB 2NOXA 3C64A 4MHCA 5LBMA 3I9YA 3HI2A 2N2NA 3C4WA 4DMVA 5LHIB 3FXDB 3T8OA 5DQWA 2WM9A 2CE7A 1FMWA 3UUXB 4X1YE 1BR1A 4AKRB 2YINA 4IE6A 3CX8B 2WSSV 5LA6E 4IGUA 2CCQA 4A56A 3RYHE 3ZYMA 4ZI2D 5L3EB 2A2FX 3ONXA 4B6XA 3ZN0B 3O1IA 5JVDE 4I4TE 3AVRA 1KK7A 1MMGA 4WW0A 4CXWA 4E7ZA 2XAHB 3MA9A 5LHHB 2PJQA 4HTEA 4BA9A 1YKEB 4AI6A 2NP9A 5CB4E 3ZJ2A 5JDHA 4PNIA 3CX7B 2BVMA 1E1HB 2A3DA 4CXXA 3J7Yq 1H7CA 2HPLA 1LVKA 4CI2B 2PBIA 2A72A 1HF8A 2JMKA 2XAGB 3SRZA 3AAIA 4YFSA 4UVAB 5L3GB 1UCUA 2ODVA 3AA7B 3C4XA 5JR9A 4AKIA 3V5UA 3ZCJA 2BZBA 3PU8A 2MOZA 3I9WA 3F2EA 1IJ5A 4EZ4A 4X1KE 1UX5A 3C98B 2X9WA 1UX4A 2C0SA 2DLRA 3O1HA 2KZ7B 3LBXA 2VB6A 5HXCA 3UULA 2E9XA 2Y48B 1Z0PA 5FXZA 4PFOA 2D0TA 5LG4A 3DJBA 4FJOA 2MBGA 4EOZB 2LSJA 2LEHA 4U74A 2VK9A 4MBQA 5J2TE 1SHZC 4I55E 2VKDA 2K24A 4GYRA 4QWNB 3K8PC 5L3BB 2X9YA 3PUAA 4IDZA 3PURA 3ZYKA 4BJMA 4EXTA 2XAJB 1FIOA 1G8XA 2L9QA 2CLYC 4BJNA 3DP7A 3IHRA 3HKEE 2CXDA 2CXFA 2V7KA 2LSGA 3A5XA 1BR4A 3LG7A 2Q9QD 5M4YA 5ADXL 3I1AA 5FNVE 2ODUA 4TZ4C 2WBLA 5JRCB 5DQVA 2CWOA 2X0LB 1MMDA 2H7OA 4EYUA 5FMNA 5JR9B 4PJLA 1HTJF 2IC6A 2LSIA 2X68A 1Y64B 3EVYA 2JMHA 2VASA 3SS1A 2Q9QA 4IHJE 4H9SE 3KV5A 1WYCA 3OBVE 3E08A 2XAFB 5TAOA 4P0BA 3C4ZA 3IEEA 4JLEA 2KLQA 4PJNA 2K5BB 4PFPA 2W61A 4YJ2E 4PK5A 4TV9E 3N9QA 4DBRA 3RH3A 3C51A 2WMOA 4WNKA 1MMNA 2BVLA 3ZMTB 3ZMSB 4OYJA 1D1AA 3N9NA 5J2UE 2YU2A 2ZM0A 4M1PA 1LRZA 2C5IT 1YW0A 2B1EA 1T98A 2IAKA 3GWHA 1B7TA 3MXZA 2XASB 3AA1B 4HFVA 1MIWA 5L3FB 3SWHA 4EIWA 2L8KA 3CMLA 2BDEA 3AB3B 5LJNA 2G0UA 3PE0A 3RRWA 5FY0A 5L3DB 2K48A 4HE8A 2N9DA 3ETUA 3MKDA 3O4XE 4O4JE 4TUYE 4I43B 2CA5A 2EHOA 5IYZE 2Q9QC 3BQKA 5F3JA 1V9DA 4QHOA 1YD8G 5KMGP 4MLKA 5GONE 4G2AA 4L9IA 2N1GA 3NZQA 3IF8B 2D5UA 2MYSA 3E0ZA 5JDLA 5FP3A 3RX6A 4PAGA 2ZM2A 2NW9A 4ZS3A 2C5JA 4IIJE 3LK42 2DHRA 5LGTB 4AQFC 2Q9QB 5LP6E 3VKHA 2NW7A 2ZLYA 1KNZA 4ANJA 3UUNA 3PUQA 2V26A 2E8IA 1OXZA 4QXHB 3MACA 3R6NA 1D0YA 3PUSA 5LXTE 2KINB 2JQQA 2C5KT 2ACXA 3N2OA 3AA6B 4UF0A 5FY1A 2KMFA 3KV9A 3RKOA 4ADZA 4HGAA 4QKNA 5J1GA 3S4UA 2X9XA 3CQCB 3GMIA 3MJXA 1LKXA 4AQFA 1IZNB 5HWXA 4CQIA 5BMVE 2VKJA 2X51A 1NWMX 2VKOA 5HXEA 5E0OA 1ZKEA 4HEAA 4X20E 2OA5A 4GYSA 2KNDA 3EDUA 3MZKB 3FXEB 4JUYA 5FY7A 3KFWX 4IE7A 3GA8A 3GN5A 4ZI3C 4CXYA 2XUEA 4K0UA 4DNDA 2YEVC 4TX5A 3VHLA 3N2GE 3GN5B 3N2KE 3ANWB 3ESLA 3P8CD 3OYXA 3B57A 3C50A 1SA0E 3F57A 4UV9B 2ZM8A 4YLHA 3JC6D 4KBMB 2W62A 4OFZA 3RYFE 2HPJA 3LBXB 3FBLA 2LJLA 1AJ3A 5EZYE 4ZI2C 4ISSA 5A1LA 3M65A 3IBPA 4CI3B 1US7B 3QUJA 3ZLIA 2ES0A 2H7VC 4DO0A 5LJMA 3RC8A 4XZCA 1MNEA 3AAAB 4OK0A 3RYIE 3CX6B 4QX8B 5DJQC 4F6RC 2DWGA 3KBTA 1WRDA 5AFUL 3UTKA 4XBFB 2LHNA 3ZC1A 4O2AE 2K9AA 2VWAA 3KVAA 1IAPA 4C91A 2W0GA 4DMWA 2W63A 4WBOA 2V7IA 4FI5A 3WI3A 5HYAA 2CWYA 4PK6A 2X9HA 3CVRA 3P7IA 1ZHCA 2NWBA 1VOMA 3WAKA 4PJMA 2HH7A 3JC6C 3N9PA 5JRCA 3AVSA 5JQGE 3HKBE 5EK2A 3ZJ1A 1BR2A 4U72A 3HKCE 5FXVA 1WYBA 3EDVA 4O4HE 2D0UA 3Q2MA 4UEMA 3I0QA 5JDMA 4AKHA 2IW5B 4AKGA 3OYZA 3VU7H 3VKGA 3BK9A 3L09A 2V1DB 3BQLA 2V7JA 4JEUB 3QK6A 2X66A 3B13A 3WAJA 5H6QB 2NW8A 3CQXC 2LM9A 3H37A 4E7SA 5JH7E 4J2CA 5HXHA 2E9XB 1IJ6A 2VKHA 2CM0A 5HXSA 2LSKA 2WAUA 3HL6A 3KV6A 3L3PA 4ZS2A 4WBNE 3PDYA 3ZEFB 3FBZA 1U4QA 2LOPA 4BAYB 4AKLA 4QX7B 2RP4A 4GK0E 2Y8DA 4G63A 2EHOC 3ZC0A 3FHNA 3RRCA 3NRXA 2UXXB 5LNKA 1NAFA 2L3LA 3FB2A 4TV8E 3Q5XA 2PG8A 3ZN1B 3N5LA 5DABA 1HFAA 3ZPOA 4ISTA 2GK9A 5CA1E 2H3RA 4PJJA 3V5SA 1HS7A 4HN9A 2V7MA 1D1BA 3NZPA 2DI4A 1MIYA 1G73A 2EHOB 2NTYA 2YU1A 4QXBB 5FYMA 4UXNB 4EB6E 4H63V 3HKDE 4C90A 2P9BA 1S35A 5C8YE 2UXNB 3ANWA 3MK7C 5IHYA 3TKLB 3ZMUB 3J9X1 3N9MA 1CUNA 3LJCA 3HA4A 2NTXA 5L2LA 4HKAA 5FXWA 4H9NC 3W15B 2KT9A 5LCYA 3KDSE 4JEHB 5JDQA 2M67A 3DTOA 4H63H 4P09A 3CKDA 3ZCIA 4I50E 2W00A 2LSYA 3BQIA 3KBUA 3NBXX 4AQGA 2LE8A 5JDGA 3K3NA 4H9QC 1O3XA 1LVFA 2D2SA 4GIWA 4UIGA 3O9XA 2VL8A 5LGUB 1HG2A 4DBQA 1D1CA 3U3IA 3EUHA 3O1JA 2XAQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9R C;  4H9Q C;  5KDM C;  4H9S E;  4H9P C;  4H9O C;  4HGA A;  4H9N C; 
#chains in the Genus database with same CATH topology
 2I59 A;  3AEG A;  3U78 A;  3Q9D A;  5JRE A;  5AQU B;  2JJ9 A;  4P0A A;  2XHE B;  1S94 A;  4UR9 A;  4V1A v;  1D0Z A;  2LT3 A;  3ZT5 A;  4XAX B;  4OYK A;  5HCJ A;  2E9X D;  2V6X A;  3OKQ A;  1ZEE A;  4IE5 A;  4O4I E;  2DWK A;  4ASK A;  3RI5 A;  2WS3 A;  3ETV A;  3OTO T;  3QC9 A;  2WB5 A;  3CPZ A;  3AA0 B;  1WLX A;  4IE0 A;  4JI4 T;  1M62 A;  3PU3 A;  2BBJ A;  2SPC A;  2DL1 A;  5AQP B;  4UVB B;  3FZK B;  5A1L A;  1WR6 A;  4NUV A;  5AQS B;  4CI1 B;  4DV1 T;  4N78 D;  1MND A;  3E22 E;  3NRY A;  2J1D G;  3KIN B;  2XQY A;  5HEO A;  3UQ4 A;  4ZI3 D;  1HCI A;  4JI2 T;  2IC9 A;  2W67 A;  5FXX A;  1ZOY A;  2IML A;  2WWU A;  3R84 B;  2CLY B;  4O4L E;  3ZSS A;  5JDF A;  4QXC B;  1OWA A;  1EZ3 A;  4HFI A;  1SUM B;  2OLT A;  4KUM B;  2WZI A;  4X1I E;  4ZOL E;  2XPK A;  4PK4 A;  4AXP A;  4ZI2 C;  5JDN A;  5LMU T;  4GOU A;  1XMO T;  1N36 T;  4IDN A;  3UU8 A;  3I0O A;  3ZMZ B;  2LRL A;  2BS2 A;  2Y6X A;  2BKP A;  2KWI B;  4L0R A;  2WMN A;  4TN7 B;  2BG9 E;  5AQT B;  4YHH T;  1KF6 A;  1U5P A;  2YK0 A;  4Z8X A;  3LFM A;  5H6R B;  2X67 A;  4DV2 T;  3KV4 A;  4B3R T;  4L5G A;  2KWH A;  3F31 A;  3TLW A;  4JYA T;  3RIU C;  5J0Z A;  3CWZ B;  1KNP A;  5JR9 C;  3P4S A;  3CIR A;  4MFR A;  3LK2 B;  2XY8 B;  4UV8 B;  1J5E T;  1D0X A;  1OED A;  3D0T A;  4QH4 A;  3PUY F;  1FEW A;  2EHO D;  5F8P A;  3TLU A;  4F8H A;  5HAX A;  4O2B E;  5LOV E;  3RIU A;  5FL1 A;  5ETW A;  4AQY T;  4YHJ A;  2XTL A;  2YDS A;  2FBW A;  1L0V A;  3N9L A;  4NIQ A;  5KDM C;  3KVB A;  5EK3 A;  1I6Z A;  3PUG A;  4EAH A;  2X0Y A;  3OJA A;  3K3Q C;  1QUU A;  4IE4 A;  5L3C B;  4OHF A;  4ILB A;  3RC3 A;  2LKG A;  2YKS A;  3UQ7 A;  5AQI B;  1XDO A;  5AQG B;  5AQV B;  5FVL A;  3ZMV B;  4CZZ B;  4LFB T;  1GQE A;  1E7P A;  1MIV A;  2UXD T;  5HXR A;  2RA1 A;  3AEF A;  3AEE A;  1HG5 A;  2CMR A;  2DNX A;  4UF0 B;  4ZEY A;  5LBQ B;  5LHG B;  4YY3 T;  4DV5 T;  5KX5 E;  3RPU A;  2E5L T;  2J47 A;  3RQU A;  4EZH A;  2CEA A;  4ZI7 E;  2PFV A;  4ILU A;  5CA0 E;  3Q5W A;  2FUP A;  3RYC E;  3UU6 A;  5LG3 A;  4NUU A;  4UVC B;  3ZYL A;  4EYY R;  1X79 A;  1YKH B;  4YSX A;  2QA7 A;  3AE7 A;  2HN1 A;  2ZMA A;  3HR0 A;  4H9O C;  1I94 T;  2DCF A;  2V7L A;  1FMV A;  1QSD A;  5ABE A;  3CQG B;  3N9O A;  3FZL B;  5LHI B;  4B3S T;  4CN1 A;  2JRK A;  2KXP B;  1UK5 A;  2LHR A;  2XSA A;  2Z6E A;  3H3M A;  1ZV4 X;  1MMA A;  3H3A A;  4HWD A;  2VL0 A;  4PW8 A;  5EK4 A;  4JI3 T;  1BR0 A;  3PV0 F;  2RPA A;  3UT5 E;  5IUX A;  2JPF A;  2QGS A;  4GK5 E;  3L39 A;  4U7I A;  4KMC A;  4UEL A;  5ABG A;  3P50 A;  2E9X C;  3PUW F;  3UUM A;  4KP3 C;  1VRB A;  4ZHQ E;  3PTR B;  3K3O A;  2LOS A;  4O8S A;  4YJ3 E;  2YDQ A;  3SOL A;  2MTQ A;  1HX8 A;  2W2U A;  4H9P C;  2H88 A;  3LK3 B;  4ERR A;  4DR6 T;  2IHR 1;  3UFE A;  2CXL A;  5LYJ E;  3AAE B;  4MAL A;  4H9R C;  5HWY A;  3PUX F;  4DVD A;  3G06 A;  2NOX A;  5LGN B;  3C64 A;  4MHC A;  5LBM A;  3I9Y A;  3HI2 A;  2N2N A;  2YDR A;  3C4W A;  4DMV A;  3AE5 A;  3P4Q A;  3FXD B;  3T8O A;  5DQW A;  2WM9 A;  2CE7 A;  3L8R A;  2K3W A;  1FMW A;  4DUY T;  3UU5 A;  3UUX B;  4X1Y E;  1BR1 A;  4AKR B;  2YIN A;  1QLB A;  1NEK A;  4IE6 A;  3CX8 B;  5AQF B;  4CN6 A;  2WSS V;  5LA6 E;  3EI0 A;  4IGU A;  2CCQ A;  4HFC A;  4A56 A;  3RYH E;  3ZYM A;  4ZI2 D;  5L3E B;  2A2F X;  3ONX A;  4B6X A;  4X62 T;  3ZN0 B;  3O1I A;  2A9U A;  5JVD E;  4I4T E;  3AVR A;  1KK7 A;  5FL0 A;  1MMG A;  4I0U A;  4WW0 A;  4CXW A;  4E7Z A;  2XAH B;  3MA9 A;  5LHH B;  2PJQ A;  3AEB A;  1E2A A;  3ONL C;  4HTE A;  4BA9 A;  1YKE B;  2UUA T;  2NP9 A;  4AI6 A;  3K1S A;  5CB4 E;  2WU2 A;  3AE3 A;  3ZJ2 A;  5ABH A;  4PNI A;  5JDH A;  1T8B A;  3CX7 B;  4NXN T;  2BVM A;  1KEY A;  1E1H B;  2XQ7 A;  5ABF A;  4B3T T;  4NXM T;  1DU2 A;  2OV9 A;  2A3D A;  4TWH A;  5AQM B;  1H7C A;  4CXX A;  3J7Y q;  1IBK T;  2HPL A;  1HNW T;  3ZT6 A;  5BR8 T;  1N34 T;  4DR4 T;  1LVK A;  4CI2 B;  2XQ4 A;  2PBI A;  4YXD A;  2A72 A;  2E2A A;  1HF8 A;  2MAW A;  2JMK A;  2XAG B;  1KNR A;  3SRZ A;  3AAI A;  2WDQ A;  4UVA B;  4YFS A;  1NEN A;  3VRA A;  1UCU A;  2ODV A;  3AA7 B;  4U3C A;  3ONJ A;  4A97 A;  4COF A;  4LFC T;  1UUR A;  3C4X A;  4QH5 A;  5JR9 A;  3ZC1 A;  3V5U A;  3ZCJ A;  4AKI A;  2BZB A;  3PU8 A;  2MOZ A;  3I9W A;  3F2E A;  1IJ5 A;  4EZ4 A;  4X1K E;  1UX5 A;  2V8S V;  3C98 B;  2X9W A;  2ACZ A;  3NWI A;  4U31 A;  2D9D A;  4LF8 T;  1UX4 A;  2C0S A;  1KFY A;  5L4E A;  2DLR A;  2NR4 A;  3O1H A;  2JQ9 A;  2KZ7 B;  4CN4 A;  3LBX A;  2VB6 A;  2WDR A;  2FJE A;  5HXC A;  4JI0 T;  3UUL A;  1XDP A;  2E9X A;  1OED C;  4YTM A;  4OX9 T;  2Y48 B;  1Z0P A;  5FXZ A;  4PFO A;  2D0T A;  5LG4 A;  3P4P A;  3DJB A;  4FJO A;  4Q25 A;  5HEG A;  3CK6 A;  2MBG A;  3RIA A;  4EOZ B;  2LSJ A;  4LFA T;  5AQH B;  2LRK A;  1SE7 A;  4LMJ A;  2LEH A;  3JAF A;  4U74 A;  2VK9 A;  4MBQ A;  4U2Y A;  1JNZ A;  1SHZ C;  2VVS A;  4I55 E;  2VKD A;  2K24 A;  4GYR A;  4QWN B;  3RIF A;  4EED A;  1XMQ T;  3K8P C;  5L3B B;  2X9Y A;  3A8Y C;  3PUA A;  4IDZ A;  1UGO A;  3PUR A;  4HFB A;  3ZYK A;  4BJM A;  4DR1 T;  2XM2 A;  4EXT A;  2XAJ B;  1FIO A;  1G8X A;  2L9Q A;  2BKO A;  2CLY C;  4HFH A;  5AQL B;  3DP7 A;  3IHR A;  4BJN A;  3HKE E;  1VCT A;  2CXD A;  5JTG A;  3JAD A;  2CXF A;  2XQ3 A;  2BBH A;  2V7K A;  2LSG A;  3A5X A;  2V5C A;  1BR4 A;  2IDO B;  3UUB A;  5C3J A;  3LG7 A;  4DR7 T;  2Q9Q D;  3VR8 A;  5M4Y A;  5ADX L;  3I1A A;  5FNV E;  1YXR A;  2ODU A;  4TZ4 C;  4IL4 A;  2WBL A;  1VCS A;  1XNQ T;  5DQV A;  2UXB T;  5JRC B;  2CWO A;  2X0L B;  1MMD A;  2I0M A;  2H7O A;  4EYU A;  2BG9 A;  5FMN A;  5JR9 B;  4PJL A;  2VQE T;  1HTJ F;  1T7S A;  2IC6 A;  2LSI A;  4DV7 T;  2X68 A;  2AE9 A;  2YN6 A;  1Y64 B;  3JCF A;  5AQQ B;  3RHW A;  2LM2 A;  2JMH A;  2VAS A;  3EVY A;  3SS1 A;  2Q9Q A;  4A5X A;  4IHJ E;  1AJ3 A;  2H89 A;  4H9S E;  3KV5 A;  3B5M A;  1WYC A;  3OBV E;  3E08 A;  4IL9 A;  2XAF B;  1IBL T;  2XJ7 A;  1N32 T;  3QB5 A;  5TAO A;  4P0B A;  3C4Z A;  1YQ4 A;  3IEE A;  4JLE A;  1N33 T;  2KLQ A;  2QYW A;  4LF6 T;  4PJN A;  2IUB A;  2K5B B;  4IDP A;  4IT4 A;  4EGW A;  4PFP A;  2W61 A;  4YJ2 E;  2JQK A;  4PK5 A;  4LF7 T;  4TV9 E;  3N9Q A;  4KX6 A;  5HEU A;  4DBR A;  3RH3 A;  3P4W A;  3C51 A;  2FJB A;  2WMO A;  4WNK A;  2CHN A;  1MMN A;  3AE4 A;  3TLS A;  2BVL A;  4JI6 T;  3ZMT B;  2XQ8 A;  3ZMS B;  4OYJ A;  1D1A A;  5FVK A;  5IWA T;  2JIW A;  2W66 A;  3N9N A;  5J2U E;  3TLT A;  2J62 A;  2YU2 A;  2ZM0 A;  2XQ5 A;  1LRZ A;  1W0A A;  3OPC A;  4M1P A;  2C5I T;  1YW0 A;  3SFD A;  2B1E A;  1XWM A;  4HWH A;  1T98 A;  2IAK A;  3GWH A;  1B7T A;  3MXZ A;  2XAS B;  3AA1 B;  4HFV A;  1MIW A;  5L3F B;  3SWH A;  4EIW A;  3OVU A;  2L8K A;  4DV0 T;  4YT0 A;  1M7K A;  2VUR A;  2BDE A;  2J4G A;  3AB3 B;  3CML A;  5LJN A;  4X5T A;  2G0U A;  3PE0 A;  3RRW A;  2WQY A;  5FY0 A;  2K48 A;  4HE8 A;  5L3D B;  2N9D A;  2ZM6 T;  4DR3 T;  1UUS A;  3ETU A;  3MKD A;  3O4X E;  4O4J E;  4X66 T;  4TUY E;  4I43 B;  2CA5 A;  2XQA A;  4P1N A;  2EHO A;  5IYZ E;  4ZZB A;  4HWC A;  2HHH T;  2VQF T;  2Q9Q C;  3BQK A;  5F3J A;  1V9D A;  4QHO A;  1YD8 G;  5KMG P;  3IA3 A;  4DV3 T;  4MLK A;  5GON E;  4K0K T;  4G2A A;  4L9I A;  2N1G A;  2QRX A;  3NZQ A;  3RF1 A;  3IF8 B;  2D5U A;  2MYS A;  3E0Z A;  4AIS A;  5FP3 A;  5JDL A;  3T1Y T;  3RX6 A;  4PAG A;  1FJG T;  1X9B A;  3RGL A;  1Y01 A;  2ZM2 A;  2NW9 A;  4ZS3 A;  5CJ5 A;  2BG9 B;  3LSV A;  4LF4 T;  2C5J A;  2V6Y B;  4IIJ E;  5L4H A;  3LK4 2;  2DHR A;  3UU3 A;  5LGT B;  4AQF C;  5HEH A;  3ZST A;  2Q9Q B;  5LP6 E;  3VKH A;  1W09 A;  2NW7 A;  2ZLY A;  1KNZ A;  4ANJ A;  3UUN A;  3PUQ A;  2V26 A;  2E8I A;  3AE6 A;  5CGM A;  3P4R A;  2X0H A;  3NVO A;  1OXZ A;  5FKY A;  5LB7 B;  3PJA J;  3NKZ A;  3MAC A;  4QXH B;  3R6N A;  1D0Y A;  3PUS A;  5LXT E;  2KIN B;  2JQQ A;  2WP9 A;  2C5K T;  2ACX A;  3N2O A;  3AA6 B;  4TNW A;  4UF0 A;  4IDQ A;  5FY1 A;  2KMF A;  2LLY A;  3KV9 A;  3ZT7 A;  3RKO A;  4ADZ A;  4HGA A;  4QKN A;  1J1J A;  5J1G A;  3S4U A;  2X9X A;  3CQC B;  2I6H A;  3GMI A;  3MJX A;  4DID B;  1LKX A;  4YTP A;  4AQF A;  5L3G B;  1OED E;  4DV6 T;  1IZN B;  5HWX A;  2XZE A;  4CQI A;  2VKJ A;  2X51 A;  5BMV E;  3FZF B;  2CPT A;  1NWM X;  2CBJ A;  2VKO A;  1WCR A;  5LMN T;  4LML A;  4TWF A;  5E0O A;  5HXE A;  1ZKE A;  4TNV A;  4HEA A;  3Q5E A;  4X20 E;  2OA5 A;  4GYS A;  2IIU A;  2KND A;  3T1H T;  3EDU A;  3MZK B;  3FXE B;  3FZH B;  4JUY A;  3KFW X;  5FY7 A;  4X64 T;  3JAE A;  4IE7 A;  3QNU A;  5HEJ A;  3GA8 A;  2MPK A;  3GN5 A;  4GKK T;  4ZI3 C;  4JBW F;  4EEB A;  4CXY A;  2UXC T;  2XUE A;  5C2T A;  4K0U A;  4DND A;  5ABF B;  4LF9 T;  2YEV C;  4TX5 A;  3VHL A;  3N2G E;  2XQ6 A;  3GN5 B;  3N2K E;  5CFB A;  2V6Y A;  3ANW B;  3ESL A;  3P8C D;  3OYX A;  3B57 A;  3C50 A;  1SA0 E;  1YQ3 A;  3F57 A;  4UV9 B;  2ZM8 A;  4YLH A;  4JI1 T;  1JNR A;  3JC6 D;  1OED B;  5F5W A;  4KBM B;  4QH1 A;  2W62 A;  2XSB A;  4EV6 A;  4JI8 T;  4X65 T;  4OFZ A;  3RYF E;  2HPJ A;  3LBX B;  2LKH A;  2LJL A;  3FBL A;  5AQK B;  5EZY E;  3PUV F;  4ISS A;  2WZH A;  2CHO A;  2HN2 A;  2AXD S;  3IBP A;  3M65 A;  4WYV A;  1US7 B;  3QUJ A;  3ZLI A;  4CI3 B;  2ES0 A;  2H7V C;  4DO0 A;  3Q5D A;  5LJM A;  3RC8 A;  2W4X A;  4XZC A;  1MNE A;  3AAA B;  4OK0 A;  3RYI E;  4Z90 A;  3CX6 B;  4YTN A;  2F4V T;  2WY2 A;  4QX8 B;  5DJQ C;  2DWG A;  3KBT A;  1WRD A;  4F6R C;  5AFU L;  3UTK A;  4XBF B;  2LHN A;  2B76 A;  2YOE A;  3EAB A;  4O2A E;  2K9A A;  1XZY A;  2VWA A;  3KVA A;  1IAP A;  4KHZ F;  4NPP A;  4C91 A;  2W0G A;  4DMW A;  4B3M T;  2W63 A;  4WBO A;  2V7I A;  4Z91 A;  3VRB A;  4FI5 A;  3RLF F;  3ABV A;  3WI3 A;  5HYA A;  2UUB T;  2QVA A;  5AQR B;  2CWY A;  4PK6 A;  2X9H A;  3CVR A;  3EAM A;  3P7I A;  5AQJ B;  1ZHC A;  3AEA A;  2NWB A;  3QOF A;  1VOM A;  4U2Z A;  3WAK A;  4PJM A;  2FJA A;  2HH7 A;  3A7M A;  3JC6 C;  3N9P A;  5AQN B;  1HNZ T;  1XNR T;  5JRC A;  3AVS A;  5JQG E;  3HKB E;  5EK2 A;  3PJA A;  3ZJ1 A;  1BR2 A;  4U72 A;  3HKC E;  5FXV A;  1WYB A;  4HFE A;  3EDV A;  5L47 A;  4O4H E;  2D0U A;  3Q2M A;  4UEM A;  3UFG A;  3I0Q A;  4YSZ A;  5JDM A;  4AKH A;  2WDV A;  2IW5 B;  3AXJ A;  4IRE A;  4AKG A;  1ZP0 A;  3OYZ A;  3VU7 H;  3VKG A;  2WU5 A;  3AEC A;  3AED A;  3BK9 A;  3L09 A;  2V1D B;  1WFD A;  2V7J A;  3BQL A;  4JEU B;  4JI7 T;  3QK6 A;  4ZZC A;  2X66 A;  4LMK A;  2M6B A;  3B13 A;  3WAJ A;  5H6Q B;  2NW8 A;  3RQW A;  3CQX C;  2LM9 A;  3H37 A;  4E7S A;  5JH7 E;  4J2C A;  1WR0 A;  5HXH A;  4TWD A;  2XM1 A;  2M6I A;  2E9X B;  4DR5 T;  4KI0 F;  1IJ6 A;  3EHZ A;  2VKH A;  2CM0 A;  5HXS A;  2LSK A;  2KSR A;  2WAU A;  3HL6 A;  3KV6 A;  3L3P A;  3LDQ B;  4ZS2 A;  3PDY A;  3TLV A;  3ZEF B;  4WBN E;  2CRB A;  1U4Q A;  2LOP A;  3FBZ A;  3FZM B;  4QX7 B;  4AKL A;  4BAY B;  5J2T E;  4DV4 T;  2RP4 A;  1HR0 T;  4GK0 E;  2Y8D A;  4G63 A;  2EHO C;  3PUZ F;  3ZC0 A;  2VVN A;  3AE2 A;  3FHN A;  3RKG A;  3RRC A;  3NRX A;  5KXJ A;  2UXX B;  2V5D A;  5LNK A;  1NAF A;  2JQH A;  2L3L A;  3FB2 A;  3Q5X A;  2PG8 A;  4TV8 E;  3ZN1 B;  3N5L A;  1HNX T;  3UU4 A;  5DAB A;  1HFA A;  1IBM T;  3ZPO A;  2UUC T;  4IST A;  2GK9 A;  5CA1 E;  4WZX A;  2FJD A;  2H3R A;  4JV5 T;  4PJJ A;  3V5S A;  1HS7 A;  4HN9 A;  2V7M A;  4ILA A;  3X1D A;  1D1B A;  2BS3 A;  2NTY A;  1MIY A;  1G73 A;  2EHO B;  2DI4 A;  2XQ9 A;  2YU1 A;  3NZP A;  3QB5 K;  1CHU A;  4QXB B;  5FYM A;  4A98 A;  3AE1 A;  4IDO A;  1W0B A;  3ZKR A;  3SFE A;  4UXN B;  4EB6 E;  2WCA A;  3HKD E;  3M3Z B;  2P9B A;  4H63 V;  4C90 A;  2BG9 C;  1S35 A;  5C8Y E;  2UXN B;  3ANW A;  2PTF A;  3MK7 C;  5IHY A;  3TKL B;  3J9X 1;  4HWI B;  3ZMU B;  3N9M A;  1CUN A;  1J5W A;  4GKJ T;  3LJC A;  3HA4 A;  2NTX A;  3VR9 A;  5L2L A;  4JI5 T;  3AE9 A;  4HKA A;  4ILC A;  5FXW A;  5HCM A;  2E5V A;  3AE8 A;  4U33 A;  4H9N C;  3W15 B;  2KT9 A;  4ZXL A;  5LCY A;  3KDS E;  3AXJ B;  4JEH B;  5JDQ A;  1HX1 B;  2BKN A;  2M67 A;  3DTO A;  4H63 H;  4P09 A;  4U7Y A;  1T72 A;  4KHP T;  3CKD A;  3ZCI A;  4I50 E;  2W00 A;  1W9R A;  2LSY A;  3BQI A;  3KBU A;  3NBX X;  2LE8 A;  4AQG A;  5JDG A;  1R8I A;  4DR2 T;  3K3N A;  5AQO B;  2BS4 A;  4H9Q C;  1Z8U A;  1O3X A;  1LVF A;  2CBI A;  4DUZ T;  2D2S A;  4GIW A;  4UIG A;  3O9X A;  2VL8 A;  2WWV A;  1HG2 A;  4YSY A;  5LGU B;  4DBQ A;  1D1C A;  2R6G F;  4HFD A;  3U3I A;  4HWF A;  3EUH A;  4AIU A;  2UU9 T;  3O1J A;  2XAQ B;  4LF5 T; 
#chains in the Genus database with same CATH homology
 2I59 A;  3U78 A;  3Q9D A;  5JRE A;  4P0A A;  2JJ9 A;  2XHE B;  1S94 A;  4V1A v;  1D0Z A;  2LT3 A;  4XAX B;  4OYK A;  4ASK A;  2E9X D;  4IE5 A;  3OKQ A;  1ZEE A;  4O4I E;  2DWK A;  3ETV A;  3QC9 A;  3CPZ A;  3AA0 B;  1WLX A;  4IE0 A;  3PU3 A;  2SPC A;  4UVB B;  1WR6 A;  4NUV A;  4CI1 B;  4N78 D;  1MND A;  3E22 E;  3NRY A;  2J1D G;  3KIN B;  2XQY A;  4ZI3 D;  1HCI A;  2IC9 A;  5FXX A;  2WWU A;  3R84 B;  2CLY B;  4O4L E;  5JDF A;  4QXC B;  1OWA A;  1EZ3 A;  4KUM B;  4X1I E;  4ZOL E;  4PK4 A;  4AXP A;  5JDN A;  4GOU A;  3I0O A;  3ZMZ B;  2Y6X A;  2KWI B;  4L0R A;  2WMN A;  4TN7 B;  4Z8X A;  1U5P A;  2YK0 A;  3LFM A;  5H6R B;  2X67 A;  3KV4 A;  4L5G A;  2KWH A;  3F31 A;  3CWZ B;  5JR9 C;  4MFR A;  3LK2 B;  4UV8 B;  1D0X A;  3D0T A;  1FEW A;  2EHO D;  5F8P A;  5HAX A;  4O2B E;  5LOV E;  5ETW A;  4YHJ A;  2XTL A;  3N9L A;  5KDM C;  3KVB A;  5EK3 A;  3PUG A;  4EAH A;  3OJA A;  3K3Q C;  1QUU A;  4IE4 A;  5L3C B;  4OHF A;  3RC3 A;  3ZMV B;  4CZZ B;  1MIV A;  5HXR A;  2RA1 A;  5LHG B;  1HG5 A;  2CMR A;  2DNX A;  4UF0 B;  5LBQ B;  5KX5 E;  3RPU A;  4EZH A;  2CEA A;  4ZI7 E;  2PFV A;  4ILU A;  5CA0 E;  3Q5W A;  3RYC E;  4NUU A;  4UVC B;  3ZYL A;  4EYY R;  1X79 A;  1YKH B;  2QA7 A;  2ZMA A;  3HR0 A;  4H9O C;  2DCF A;  2V7L A;  1FMV A;  1QSD A;  3CQG B;  3N9O A;  2JRK A;  2KXP B;  2LHR A;  2Z6E A;  1ZV4 X;  1MMA A;  3H3A A;  4PW8 A;  1BR0 A;  5EK4 A;  3UT5 E;  2JPF A;  2QGS A;  4GK5 E;  4UEL A;  4KMC A;  2E9X C;  3UUM A;  4KP3 C;  1VRB A;  4ZHQ E;  3PTR B;  3K3O A;  2LOS A;  4O8S A;  4YJ3 E;  3SOL A;  2MTQ A;  1HX8 A;  4H9P C;  3LK3 B;  4ERR A;  3UFE A;  2CXL A;  5LYJ E;  3AAE B;  4MAL A;  4H9R C;  5HWY A;  4DVD A;  5LGN B;  2NOX A;  3C64 A;  4MHC A;  5LBM A;  3I9Y A;  3HI2 A;  2N2N A;  3C4W A;  4DMV A;  5LHI B;  3FXD B;  3T8O A;  5DQW A;  2WM9 A;  2CE7 A;  1FMW A;  3UUX B;  4X1Y E;  1BR1 A;  4AKR B;  2YIN A;  4IE6 A;  3CX8 B;  2WSS V;  5LA6 E;  4IGU A;  2CCQ A;  4A56 A;  3RYH E;  3ZYM A;  4ZI2 D;  5L3E B;  2A2F X;  3ONX A;  4B6X A;  3ZN0 B;  3O1I A;  5JVD E;  4I4T E;  3AVR A;  1KK7 A;  1MMG A;  4WW0 A;  4CXW A;  4E7Z A;  2XAH B;  3MA9 A;  5LHH B;  2PJQ A;  4HTE A;  4BA9 A;  1YKE B;  4AI6 A;  2NP9 A;  5CB4 E;  3ZJ2 A;  5JDH A;  4PNI A;  3CX7 B;  2BVM A;  1E1H B;  2A3D A;  4CXX A;  3J7Y q;  1H7C A;  2HPL A;  1LVK A;  4CI2 B;  2PBI A;  2A72 A;  1HF8 A;  2JMK A;  2XAG B;  3SRZ A;  3AAI A;  4YFS A;  4UVA B;  5L3G B;  1UCU A;  2ODV A;  3AA7 B;  3C4X A;  5JR9 A;  4AKI A;  3V5U A;  3ZCJ A;  2BZB A;  3PU8 A;  2MOZ A;  3I9W A;  3F2E A;  1IJ5 A;  4EZ4 A;  4X1K E;  1UX5 A;  3C98 B;  2X9W A;  1UX4 A;  2C0S A;  2DLR A;  3O1H A;  2KZ7 B;  3LBX A;  2VB6 A;  5HXC A;  3UUL A;  2E9X A;  2Y48 B;  1Z0P A;  5FXZ A;  4PFO A;  2D0T A;  5LG4 A;  3DJB A;  4FJO A;  2MBG A;  4EOZ B;  2LSJ A;  2LEH A;  4U74 A;  2VK9 A;  4MBQ A;  5J2T E;  1SHZ C;  4I55 E;  2VKD A;  2K24 A;  4GYR A;  4QWN B;  3K8P C;  5L3B B;  2X9Y A;  3PUA A;  4IDZ A;  3PUR A;  3ZYK A;  4BJM A;  4EXT A;  2XAJ B;  1FIO A;  1G8X A;  2L9Q A;  2CLY C;  4BJN A;  3DP7 A;  3IHR A;  3HKE E;  2CXD A;  2CXF A;  2V7K A;  2LSG A;  3A5X A;  1BR4 A;  3LG7 A;  2Q9Q D;  5M4Y A;  5ADX L;  3I1A A;  5FNV E;  2ODU A;  4TZ4 C;  2WBL A;  5JRC B;  5DQV A;  2CWO A;  2X0L B;  1MMD A;  2H7O A;  4EYU A;  5FMN A;  5JR9 B;  4PJL A;  1HTJ F;  2IC6 A;  2LSI A;  2X68 A;  1Y64 B;  3EVY A;  2JMH A;  2VAS A;  3SS1 A;  2Q9Q A;  4IHJ E;  4H9S E;  3KV5 A;  1WYC A;  3OBV E;  3E08 A;  2XAF B;  5TAO A;  4P0B A;  3C4Z A;  3IEE A;  4JLE A;  2KLQ A;  4PJN A;  2K5B B;  4PFP A;  2W61 A;  4YJ2 E;  4PK5 A;  4TV9 E;  3N9Q A;  4DBR A;  3RH3 A;  3C51 A;  2WMO A;  4WNK A;  1MMN A;  2BVL A;  3ZMT B;  3ZMS B;  4OYJ A;  1D1A A;  3N9N A;  5J2U E;  2YU2 A;  2ZM0 A;  4M1P A;  1LRZ A;  2C5I T;  1YW0 A;  2B1E A;  1T98 A;  2IAK A;  3GWH A;  1B7T A;  3MXZ A;  2XAS B;  3AA1 B;  4HFV A;  1MIW A;  5L3F B;  3SWH A;  4EIW A;  2L8K A;  3CML A;  2BDE A;  3AB3 B;  5LJN A;  2G0U A;  3PE0 A;  3RRW A;  5FY0 A;  5L3D B;  2K48 A;  4HE8 A;  2N9D A;  3ETU A;  3MKD A;  3O4X E;  4O4J E;  4TUY E;  4I43 B;  2CA5 A;  2EHO A;  5IYZ E;  2Q9Q C;  3BQK A;  5F3J A;  1V9D A;  4QHO A;  1YD8 G;  5KMG P;  4MLK A;  5GON E;  4G2A A;  4L9I A;  2N1G A;  3NZQ A;  3IF8 B;  2D5U A;  2MYS A;  3E0Z A;  5JDL A;  5FP3 A;  3RX6 A;  4PAG A;  2ZM2 A;  2NW9 A;  4ZS3 A;  2C5J A;  4IIJ E;  3LK4 2;  2DHR A;  5LGT B;  4AQF C;  2Q9Q B;  5LP6 E;  3VKH A;  2NW7 A;  2ZLY A;  1KNZ A;  4ANJ A;  3UUN A;  3PUQ A;  2V26 A;  2E8I A;  1OXZ A;  4QXH B;  3MAC A;  3R6N A;  1D0Y A;  3PUS A;  5LXT E;  2KIN B;  2JQQ A;  2C5K T;  2ACX A;  3N2O A;  3AA6 B;  4UF0 A;  5FY1 A;  2KMF A;  3KV9 A;  3RKO A;  4ADZ A;  4HGA A;  4QKN A;  5J1G A;  3S4U A;  2X9X A;  3CQC B;  3GMI A;  3MJX A;  1LKX A;  4AQF A;  1IZN B;  5HWX A;  4CQI A;  5BMV E;  2VKJ A;  2X51 A;  1NWM X;  2VKO A;  5HXE A;  5E0O A;  1ZKE A;  4HEA A;  4X20 E;  2OA5 A;  4GYS A;  2KND A;  3EDU A;  3MZK B;  3FXE B;  4JUY A;  5FY7 A;  3KFW X;  4IE7 A;  3GA8 A;  3GN5 A;  4ZI3 C;  4CXY A;  2XUE A;  4K0U A;  4DND A;  2YEV C;  4TX5 A;  3VHL A;  3N2G E;  3GN5 B;  3N2K E;  3ANW B;  3ESL A;  3P8C D;  3OYX A;  3B57 A;  3C50 A;  1SA0 E;  3F57 A;  4UV9 B;  2ZM8 A;  4YLH A;  3JC6 D;  4KBM B;  2W62 A;  4OFZ A;  3RYF E;  2HPJ A;  3LBX B;  3FBL A;  2LJL A;  1AJ3 A;  5EZY E;  4ZI2 C;  4ISS A;  5A1L A;  3M65 A;  3IBP A;  4CI3 B;  1US7 B;  3QUJ A;  3ZLI A;  2ES0 A;  2H7V C;  4DO0 A;  5LJM A;  3RC8 A;  4XZC A;  1MNE A;  3AAA B;  4OK0 A;  3RYI E;  3CX6 B;  4QX8 B;  5DJQ C;  4F6R C;  2DWG A;  3KBT A;  1WRD A;  5AFU L;  3UTK A;  4XBF B;  2LHN A;  3ZC1 A;  4O2A E;  2K9A A;  2VWA A;  3KVA A;  1IAP A;  4C91 A;  2W0G A;  4DMW A;  2W63 A;  4WBO A;  2V7I A;  4FI5 A;  3WI3 A;  5HYA A;  2CWY A;  4PK6 A;  2X9H A;  3CVR A;  3P7I A;  1ZHC A;  2NWB A;  1VOM A;  3WAK A;  4PJM A;  2HH7 A;  3JC6 C;  3N9P A;  5JRC A;  3AVS A;  5JQG E;  3HKB E;  5EK2 A;  3ZJ1 A;  1BR2 A;  4U72 A;  3HKC E;  5FXV A;  1WYB A;  3EDV A;  4O4H E;  2D0U A;  3Q2M A;  4UEM A;  3I0Q A;  5JDM A;  4AKH A;  2IW5 B;  4AKG A;  3OYZ A;  3VU7 H;  3VKG A;  3BK9 A;  3L09 A;  2V1D B;  3BQL A;  2V7J A;  4JEU B;  3QK6 A;  2X66 A;  3B13 A;  3WAJ A;  5H6Q B;  2NW8 A;  3CQX C;  2LM9 A;  3H37 A;  4E7S A;  5JH7 E;  4J2C A;  5HXH A;  2E9X B;  1IJ6 A;  2VKH A;  2CM0 A;  5HXS A;  2LSK A;  2WAU A;  3HL6 A;  3KV6 A;  3L3P A;  4ZS2 A;  4WBN E;  3PDY A;  3ZEF B;  3FBZ A;  1U4Q A;  2LOP A;  4BAY B;  4AKL A;  4QX7 B;  2RP4 A;  4GK0 E;  2Y8D A;  4G63 A;  2EHO C;  3ZC0 A;  3FHN A;  3RRC A;  3NRX A;  2UXX B;  5LNK A;  1NAF A;  2L3L A;  3FB2 A;  4TV8 E;  3Q5X A;  2PG8 A;  3ZN1 B;  3N5L A;  5DAB A;  1HFA A;  3ZPO A;  4IST A;  2GK9 A;  5CA1 E;  2H3R A;  4PJJ A;  3V5S A;  1HS7 A;  4HN9 A;  2V7M A;  1D1B A;  3NZP A;  2DI4 A;  1MIY A;  1G73 A;  2EHO B;  2NTY A;  2YU1 A;  4QXB B;  5FYM A;  4UXN B;  4EB6 E;  4H63 V;  3HKD E;  4C90 A;  2P9B A;  1S35 A;  5C8Y E;  2UXN B;  3ANW A;  3MK7 C;  5IHY A;  3TKL B;  3ZMU B;  3J9X 1;  3N9M A;  1CUN A;  3LJC A;  3HA4 A;  2NTX A;  5L2L A;  4HKA A;  5FXW A;  4H9N C;  3W15 B;  2KT9 A;  5LCY A;  3KDS E;  4JEH B;  5JDQ A;  2M67 A;  3DTO A;  4H63 H;  4P09 A;  3CKD A;  3ZCI A;  4I50 E;  2W00 A;  2LSY A;  3BQI A;  3KBU A;  3NBX X;  4AQG A;  2LE8 A;  5JDG A;  3K3N A;  4H9Q C;  1O3X A;  1LVF A;  2D2S A;  4GIW A;  4UIG A;  3O9X A;  2VL8 A;  5LGU B;  1HG2 A;  4DBQ A;  1D1C A;  3U3I A;  3EUH A;  3O1J A;  2XAQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...