3U78A

E67-2 selectively inhibits kiaa1718, a human histone h3 lysine 9 jumonji demethylase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 7
publication title An Analog of BIX-01294 Selectively Inhibits a Family of Histone H3 Lysine 9 Jumonji Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 366
sequence length 366
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3u78A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u78A01
5FZDA 2GP3A 4ASKA 3ZPOA 4D6SA 5FYVA 4D6QA 5K4LA 5LY1A 4EZHA 5FYTA 5FYUA 5IW0A 4CCNA 5F37A 5F5AA 3KV5A 5FWJA 5FZGA 2YBKA 4Y3OA 5A3WA 5LY2A 3KVBA 4LXLA 4EZ4A 3N9OA 5FYIA 3AVSA 5A7PA 5FYBA 5IWFA 3PUAA 5FZ4A 3AL6A 4UF0B 3N9QA 2YBPA 4QXBA 4V2VA 5IVVA 5A7OA 5FZ6A 3NJYA 3K2OA 5IVBA 5FYZA 4CCLA 3N9NA 4D6RA 4CCOA 5CEHA 5FZOB 5LWBA 5FY9A 5FZLA 3PUSA 4QXCA 5FZ8A 5A3PA 4QWNA 5F39A 2Q8CA 5IVFA 4HOOA 5FZKA 3N9LA 2XXZA 2YU1A 3U78A 5FPVA 2XDVA 5FYYA 5A1FA 3KVAA 3OPWA 3PURA 5FZEA 5FPLA 2OQ7A 4QXHA 4LIUA 4CCJA 4GD4A 4TN7A 3N9MA 5FZFA 3K3OA 5IVEA 5F3IA 2YPDA 4NUBA 5A3NA 2Q8EA 5FPAA 2XMLA 4QU1A 3UYJA 2XUEA 3KV9A 4CSWA 5FXWA 4CCKA 5F2SA 3PTRB 5FZCA 5FY4A 4DO0A 5FYSA 5FJHA 3OPTA 3RVHA 5FP7A 5FY1A 5FP8A 2WWJA 4XDOA 4GJYA 5A7QA 5FWEA 5F32A 3U4SA 5ANQA 5FUPA 5FZBA 3AL5A 2VD7A 4QX8A 3ZLIA 5IVJA 4E4HA 5LW9A 5FZAA 5FXXA 5IVYA 4EYUA 5A3TA 3N9PA 2YBSA 4LITA 5A7WB 5FY8A 5FYMA 4CUGA 5FP3A 4DIQA 5FYHA 3AVRA 4CCMA 5FP9A 5FZ7A 5F2WA 2OS2A 5F3EA 4URAA 2OX0A 4GAZA 5FZ3A 5FZIA 4UF0A 2OQ6A 5FBJA 3LDBA 5FJKA 5FYCA 5FZ0A 4AAPA 2GP5A 1VRBA 2WWUA 4Y33A 5A80A 3PU8A 5FXVA 3LD8A 2YU2A 5FP4A 3K3NA 5FZOA 5FUNA 4BU2A 4IGPA 4BISA 5FZMA 4Y4RA 4BXFA 5E6HA 2OT7A 5IVCA 5A7NA 3KV6A 5F3CA 3PDQA 5A1LA 5F5CA 4XDPA 5FV3A 2PXJA 3PU3A 4C8DA 3DXUA 5FZ9A 2Q8DA 5F5IA 5FZHA 5ISLA 4GJZA 4IGQA 5FXZA 5KR7A 5FPBA 4QX7A 4IGOA 4V2WA 5FY0A 5A7WA 4AI9A 5FY5A 3PUQA 2W2IA 4HONA 5FY7A 2P5BA 5FZ1A 5F3GA 5A7SA 4LIVA 5FPUA 3DXTA 3KV4A
chains in the Genus database with same CATH superfamily
1FI2A 3ZPOA 3BQKA 2RPAA 2JD4A 4LUKA 2RG4A 4WBBA 4CDXA 4ZI7E 1NOVA 3ZFFA 3ILNA 3ZVXA 3S57A 2CTVA 4EIWA 4AF9A 1HRI3 2K9AA 5D21A 1CAWB 3M4FA 3WQ1A 4RGGA 4R9AA 3PIGA 3NV4A 1H1AA 4UEMA 3ES4A 2RS32 5IHYA 2OZJA 2EXIA 3DJBA 3V56A 4META 1IS6A 5FZFA 4LF5T 3OJBA 3CNAA 4Q0PA 1UCXA 2D5HA 4I0AA 4KWLA 2VZ1A 3ILFA 1H6YA 4DR2T 3VHNA 4JGZC 5FY1A 4OI2A 3MLJA 4K0KT 1FV3A 3DN7A 3FB2A 3AL5A 3ZLIA 2W5FA 1UZ0A 2LUWA 1UIKA 3O9XA 2Y6FA 3NKTA 4CCMA 3RYFE 1RMU3 2HWE1 5IJRA 2LALA 1OQEA 5CFBA 1W0OA 3KFWX 2N1GA 2QJVA 1AR63 2P5BA 5FZDA 4X1YE 4TN7B 2OA2A 5LY1A 3MUY1 1LOGA 1O4ZA 4AXPA 5AQRB 5FRAA 4WZFA 4IHJE 1RUJ3 2YBPA 4HWHA 1MS0A 1HV1A 5FMDA 3IDAA 4FT8A 3LBXA 3AP4A 2FDHA 1Z7S1 1FV2A 3B5LB 1WCRA 4YHHT 4FQ4A 5FPAA 4CP0A 1Y64B 3M3EA 1UZWA 4QU1A 2XUEA 2NTYA 1WRDA 1DGWX 4WYVA 5I8SA 2FDFA 3KBUA 3MBWA 2WY2A 1IKQA 4V1PA 5F9TA 3U4SA 3H42B 2VTXJ 2C5DA 4LFAT 1MIWA 3ACHA 1ZA7A 3MIFA 4U33A 5FZ0A 4BIOA 2KWIB 2VKDA 4HBNA 2FBEA 2D2SA 2FJAA 3H3UA 2JWPA 4Z91A 5L4EA 2CWMA 3RWNA 3WF2A 1QJU3 4QH4A 1MR5A 5FBZA 3IAQA 1FAYA 1R64A 2YC0A 2BBVA 1NYWA 5CYYA 3K75B 3OPCA 2Q1ZB 4A6SA 1N32T 4EWDA 2CLYC 3LFMA 3ZYIB 5A3PA 1LOBA 4BPZA 2IXHA 4IE0A 5LMNT 2BYVE 2Q8EA 2UY8A 4H9QC 5FL0A 2DVFA 5JR2A 2PLV1 3I0OA 3C64A 2HWC1 4ERRA 4GJYA 4AEMA 4GKJT 4H2AA 1QJY3 3LEIA 4A6OA 1YFXA 1OBNA 2QQPA 4IDOA 3RWKX 4UBHA 2R30A 3RQ0A 3T4VA 4E4DX 1BYHA 5JH7E 2XM1A 2WO7A 3BTAA 4I09A 5A7NA 4G4FA 1PK6B 4XTPA 2R0FA 1ZBA3 4EE2A 3PU3A 1TE1B 4W4ZA 4TYSA 5ABFA 5IYYA 1FIOA 1RUI2 1T7SA 2G1MA 2JENA 2XAFB 1AR83 2JQKA 4AR2A 2DURA 3VHLA 4ASMB 3AJYA 2A2FX 4JI3T 4I50E 2YU1A 3TLTA 1V9DA 1RUF3 4GMP0 1YIPA 3AFGA 3T09A 3VDDB 1TNRA 1AR73 2QQWA 3ABVA 2JQ9A 4UFHA 1IZNB 1YHFA 4L92A 2PHUA 2WS3A 1M7KA 5HEGA 1O5LA 2Y33A 2BFUL 2RS51 2XQYA 1DDLA 2CMRA 1XXNA 1N47A 1JNRA 3GBFA 2RM23 3T1YT 2CSGA 3UU4A 4QX7A 5AQHB 3GALA 1PGL1 2R062 3HR0A 1QXPA 4HKWA 3OGVA 3RFRA 1KNRA 5LA2A 5C3SA 4BOWA 3AZXA 2CHHA 3ZCJA 2AGSA 1NCRA 2HWB3 2WUHA 5LK7B 2X05A 3ZC1A 3CHXA 3ZSKA 4DR5T 1ZBE2 2ET7A 5C70A 3AP9A 3JUUA 1DZRA 4BQ1A 4JKMA 1X9PA 4DMWA 4NRMA 2X10A 3EUHA 4H7LA 4ZHNA 3ACFA 5J2UE 1B35B 1C1LA 3OBTA 3T2OA 1J5WA 1H7CA 2F4PA 1D2QA 2GH2A 4Q4Y3 2A9UA 1KGYA 4KHZF 1RUH2 3ZSJA 3E5XA 4MXWB 3VBHC 4AVAA 4ZU7A 4XBLA 2Y8DA 1QSDA 1KD7A 2W3JA 4Q0UA 5AVPA 3HQUA 3MUZ1 4XUNA 1PM4A 5JQGE 4O7XA 1EPZA 4OLLA 5T55A 4S2GA 3JBG2 4AVVA 1RVF1 4C8DA 2MNGA 1MZ5A 5KHKA 4D7SA 5ISLA 1C8M2 3DECA 2J1EA 4ILBA 4HONA 4JC1A 1YUDA 4N7IA 4O9GA 4GA9A 1KXGA 5LEJA 4MH0E 2IC9A 3EQEA 3RYCE 3TN93 1XC6A 4LFBT 4M3CF 1ND3B 3PHMA 4R9BA 3N9NA 4ZZCA 3QH7A 5AFEA 4OZOA 4D3WA 3FZLB 2WINB 4DR3T 2OZ6A 4LBNA 1VMHA 1XNKA 4U74A 3AA1B 4JI0T 4UOJA 1CQ9A 1OLME 2HWD3 2B42B 4YVWC 2KLQA 5I93A 5ABGA 4IEXA 5ABJB 3WINE 4QX8A 2ZMNA 1LKXA 4LBKA 2XPKA 4K8FA 2KT9A 1UD1A 5F6LB 3T2PA 4DIQA 4LK7A 1ZZBA 1CZVA 1OFSA 3F57A 4XZCA 2FCUA 1TME2 1KFXL 4DIDB 1AL0G 1NZCA 1QQP3 3ANWA 3AKQA 2KINB 3KV4A 4Z1VA 1NLSA 5EK2A 3D3AA 2WWVA 4B6XA 1ND2C 1M4WA 4JRAA 1LENA 4QB6A 5A3WA 4HFIA 2TUNA 2JIWA 1VR3A 2BNMA 1YQ6A 1FX5A 4PQQA 5CB7A 1OLQA 1T6GC 4QGMA 4FPHA 2RP4A 2WSSV 2UWAA 5BPXA 4LMKA 4HTEA 2JG9C 2WM9A 5BNOB 1PVC2 3H7JA 1JYIA 4V1Av 3PJAA 3TAYA 2LT3A 3QB5A 4MHCA 1OXCA 4UT5A 4GWNA 5D1IA 4Q0QA 2KXPB 3VD4A 4Z07A 3IDCB 4Q4X3 3KWVA 2LROA 1XYOA 5FP3A 2XL7A 3WF0A 4KUMB 5LA1A 3IZOA 2V1DB 4I43B 3H1MA 2K48A 3AE2A 4IGPA 3ZMOA 3N2OA 1RUE2 4RQPA 5FZ9A 3TLVA 5F3JA 5L3CB 2Y8KA 1MS5A 1YQ3A 1GMMA 4WVWA 1GNHA 1MS4A 3LEMA 3RLFF 2CV6A 2VNOA 3CLPA 1GICA 4P09A 2GNDA 1JN2P 2X09A 2D44A 4L99A 1DCSA 3AMQA 1H4GA 5FYBA 2M67A 1CESA 4MG2A 1R081 2WKKA 5JR9B 4OUSA 2BERA 2J1RA 2PHLA 4EEDA 1E5RA 3CIHA 2XQXA 1JZ6A 4ATFA 2FDIA 3HNYM 3CJIC 4ZS2A 1SA0E 3UJOA 3U14A 2ZTNA 3CWZB 3UQ4A 3EMRA 4HANA 3H9AA 3VUOA 4QHZA 5C5UA 1AYM1 4YTNA 4B3RT 2YV8A 1ZYBA 2RS12 4O61A 4S2FA 3MFCA 4OFGA 1YD8G 4BQYA 1RUG1 3LK3B 3K77A 5JR7B 1JXNA 2EXJA 2PYTA 4B4RA 5C4WA 4YHJA 3ZKRA 3QB5K 4KQ7A 1AVBA 1ENQA 4P1NA 3GWHA 1O3QA 5HYAA 3EHKA 1YJKA 4JHTA 2QQMA 1UK5A 2JG8A 1JOBA 4YW3A 3NRXA 1MPXA 3H7YA 3AKRA 1C28A 3CMGA 4O9EA 2PQQA 1OA2A 4A56A 1VAVA 1J83A 3AEBA 5FQ0A 3ZEFB 3N35A 4E9KA 2DTWA 4ES9A 3ZFGA 1NXMA 3D8CA 4K7JA 4AKLA 4LKDA 4TSVA 2JJ9A 1DQ1A 1FXZA 3WW4A 1SFYA 1WCQA 4FPGA 3OD4A 2WA3A 2MEV2 3FZMB 2HWF3 2DUOA 5CU1A 3OGJA 3AYEA 2IWGB 2HHHT 2X5IB 4LE3A 5FKCA 3M65A 2X5IC 5CFCB 3WCRA 3WAJA 4BE3A 3JC6D 2IDOB 2F4VT 1Z8UA 5T5OA 4LF7T 3A22A 5F1RA 3KQRA 1RMU2 3NAPB 5TSWA 4N78D 2WFPA 2EXHA 3UUBA 5APAA 2V72A 1YXWA 5JIAA 4QPGB 1AR62 2VZRA 4QPGC 1RUC2 5FPUA 4AYUA 1PIV3 2VNVA 3C98B 5EV7A 2W00A 3HMYA 5KWRA 2Q8OA 3AX4A 2QDNA 1RUJ2 1H2NA 4P9WA 4NROA 3WP6A 3N9LA 2ZOEB 4AVBA 2JDKA 4QX0A 2ZM6T 2ZEXA 2Y6XA 2XAJB 4WM7C 3FXEB 5A3LA 4DUWA 5LXTE 1UKRA 3ZN6A 1WMEA 3VV1A 2Z4FA 3ZN1B 2VZQA 4E7ZA 4MX3A 4YZ2A 4CP1A 1G9DA 4L9IA 2D6LX 5LBBA 4QWNB 3QUJA 5A80A 1RJ8A 1LRHA 1OMIA 2WSVA 4H9OC 1W0BA 2Y6GA 2BJSA 3HN3A 3O1MA 5LG3A 4JCKA 4N53B 1XWMA 3GXUA 3H8XA 4XQDA 1JZ4A 1XMOT 2BG9B 1QJU2 3BYWA 4TV8E 1UXXX 2BG9C 2R042 3AYDA 2CWYA 5T54A 1QH7A 4PLOA 1DG6A 5JVDE 1XYPA 1SBFA 1JYXA 5JSPA 2XHEB 2IVJA 3I2IA 3EYPA 2FMYA 5AQSB 2HBUA 1FOD2 4AZZA 1UPSA 1QXJA 5FZ8A 3EBRA 2G9ZA 3U78A 1SBDA 3LIHA 4IW3A 2PMWB 1W3VA 3POSA 3NRYA 2KD7A 3D5OA 4HEAA 4UV9B 1JZ2A 1XB9A 1DGWA 1DF0A 1HQNA 3HD8B 2CXDA 4ES8A 3ABZA 3RI8A 5LGTB 4JGYC 3P1IA 1QJY2 2UU8A 1JHNA 3Q8AA 1ALYA 4R4ZA 2A3WA 2UXXB 3INAA 3KLSA 4GWIA 3NL1A 1OVPA 3GN5B 4E27A 1US7B 1VRH3 4GZ9A 3ZYGA 2WFF3 4GWJA 4JVAA 1C3HA 1VBA1 4EB6E 3MJXA 1O3TA 3ZYJB 3MLKA 1ZRIA 2YGLA 1ULGA 4LIVA 2D5FA 1AR82 1LAJA 1NY72 4EZHA 5F5AA 5A6YA 5GLUA 2ZEYA 1V70A 3WNOA 4KG0A 2Z42A 1FT9A 1WLXA 2RDNA 1K5MA 2W66A 3FUOA 4LBQA 5EK3A 3FJSA 4DOUA 4QPYA 4HFEA 2CL2A 2DWGA 1CIYA 1NEKA 4FTEA 1VE0A 2DVAA 1NQDA 4YGBA 5F2SA 1AR72 3O0WA 3ZIWA 4YFZA 3HR9A 2GNMA 2AH2A 3RZJA 2CDOA 1KF6A 2N2NA 3A5XA 3NWKA 3MA9A 2J7MA 4FAGA 3I3DA 4NPPA 1RC6A 4AQFA 3BGAA 2QVSB 3FN9A 4A7YA 4CUAA 4OHYA 1JI6A 5FBJA 1BEV3 3LCPA 4M1PA 3ZYRA 1S35A 3KB5A 4OYUA 3ILRA 2LRLA 4LBJA 4CDUC 2J1TA 2DFCA 3AZWA 3OBZA 2UXBT 1R1A1 1KNZA 4KGQA 1LB2A 4GK0E 3NJVA 3DXTA 3FHAA 3HBZA 2XSAA 2QQVA 3I3QA 3PUZF 5CA0E 4QAWA 2VQ0A 5FVKA 3SXWA 4HFDA 2VBPA 3K2OA 3CF6E 2BS2A 1D4M3 2B8MA 2VMIA 4K21A 4CDXC 3ZFFC 4TWTA 5CJ5A 2WWSA 1BR0A 1H8TA 4ASLA 3AE4A 4CU8A 4YZ3A 5L36A 5JOYA 3PUVF 2XQ4A 4R8HA 2XL9A 2Z69A 1W9YA 3UULA 4KBZA 4AE2A 1VOMA 5H9QA 4HWCA 2VVEA 1AZDA 3M3ZB 3RZZA 3EHZA 4YLZA 5LGUB 5SV5A 3C7FA 2LKHA 1UOBA 1JMUB 2FUPA 1S0IA 1Y4WA 3POIA 3IEEA 1C8M1 1W8HA 5AQMB 1NA1A 3V0BB 5KHJA 5LATA 4OYKA 3SFEA 4PK4A 3AEAA 4ZZ8A 4IIJE 3TN92 3WQBA 1LEDA 2VZUA 4ZZ5A 3PUYF 2VQUA 1ODMA 2VOKA 4PLNA 5A6XA 3I4IA 4CCOA 1M06G 3AP6A 5L9VA 3PUSA 3FWEA 3KF5A 4BLIA 4AI1A 2PQSA 4CRQA 3EDUA 4GMP1 5C3JA 4P0BA 4I01A 1CHUA 4FCAA 3ZJ1A 3U10A 4BMBA 4WM8B 1QMJA 2YINA 3HJRA 2WWJA 1CZTA 4X6RB 2PHRA 2VL8A 2JD9A 2Q9QB 4NVPA 4AEDB 2Q9QC 4AEDC 1G8XA 4N90A 5BYNA 1AR93 2WZR1 3LA2A 4XF9A 4GQ7A 3VBFB 3JAFA 2IC1A 4CEWC 2W61A 2WMNA 1QJZA 3J9X1 3USUA 4QPIA 1QQP2 4OMCA 3UFGA 1NKGA 1WUVA 4ZY9A 2JX9A 2FZ1A 1SLIA 1MMGA 2XJSA 3OUJA 4HN9A 2IIUA 1VLNA 1ZX5A 5LCYA 5DUXA 3LSEA 4CCNA 1C8NA 1FPN2 2D6OX 2KA3A 1K45A 3L3PA 3AVSA 4NOTA 4AI2A 4F83A 3FE5A 4LOTA 4HFBA 2O8QA 4KGGA 2VCBA 5I8TA 3BPZA 2JMHA 3SOLA 2VC9A 4F8HA 4A7ZA 2XLFA 4C0BA 3B69A 3RRCA 1UX5A 4D94A 4U7YA 3MICA 3M3IA 3NNLA 1BBT2 2P3KA 3U4XA 5F8PA 3U37A 2EHOD 2DBIA 1SDDB 2BG9E 3NV3A 4ARYA 2ZEWA 2UUAT 4BH9A 1AXKA 2I59A 2O0OA 4LF6T 2B39A 5FZ7A 5CBLA 5IK7A 5IYZE 3VGIA 1DGLA 4URTA 4UBGA 4XQWA 4Y5SA 1GFF2 2LOPA 4HWDA 4FSJA 3POBA 1VBC3 1CAWA 2ZJCA 1WR0A 1W8NA 2GAUA 2X9WA 2XBO3 4HPKA 3VZKA 2WO3A 2ET1A 1LU2A 3OOXA 4KU8A 4WVVA 4CUCA 4CPBD 3Q5XA 2XB6C 3J8F1 5DUUA 4IDNA 4JGZA 2H7VC 2G9FA 2H89A 5ERLA 2XUMA 3KVBA 1J84A 2AR6A 1FATA 5T5LA 3HKCE 1RHI1 1COV1 1J3RA 1U5XA 5A6ZA 1OVSA 5ETWA 2BOJA 3UGFA 4CDWB 2Q8CA 1UU6A 4YW5A 3C7HA 4FPJA 2QA7A 1MNDA 3DTOA 3O1RA 2DU1A 3GNEA 1NZIA 3V64A 5DXDA 2W1QA 4ZPIA 1R092 3CPZA 3ZMZB 4YSZA 3OEBA 1TQ5A 3ZKYA 4LF8T 2RJ2A 1R8IA 1RUD3 3JD73 4X64T 3ZYMA 3WR0A 4DV6T 3FXDB 3O0VA 3GGLA 1EYBA 2D98A 4Y5Z0 4QH5A 2Y34A 1E5IA 5CG9A 4L2NA 4EGWA 1MQTB 2OT7A 2Z2SB 1WA4A 4D7YA 2ZXQA 4BAYB 1PGSA 2YG0A 3THDA 3QK6A 5EQUA 1X8MA 1MVQA 4PNIA 5FYTA 3IPVB 4XBNA 5F37A 3EAMA 1ENSA 4HKOA 1H1IA 2ZACA 4DXTA 1W6MB 3N3HA 2LW8A 1HRI1 1KK7A 4MGSA 2CHOA 2OLTA 4XTMA 3WG2A 3BKZA 2VTXA 1OA3A 3HNBM 1NCRC 1RGSA 1Y7BA 1I1EA 2ZX1A 2WO1A 3R6NA 5JXIA 1AXZA 5KHGA 1S2BA 4KHPT 2ZPXA 2B1EA 3JB8A 5JMOA 2BKOA 3GJAA 1MS8A 2ZX0A 4ZXKA 4XHXA 1RXFA 3DKQA 2ZGSA 3WXPA 1PO23 1ZKEA 3T2QA 2JDZA 2JDMA 1SLBA 2R0HA 5L7OB 3VB9A 1OH4A 1N3OA 4KBMB 2WQZC 1STMA 3VD5A 4ORFA 3ZDSA 2FCVA 3G06A 5K8SA 4OCTA 1HRV3 1CD3G 5EJ3A 4OZXA 4Q29A 3C4ZA 1VBE2 1GP6A 1AR61 4EN6B 1C5HA 5FMOS 2EALA 2ORXA 1OSGA 5FZGA 1MMAA 2PJQA 3SNMA 3H8OA 5HCMA 1YQCA 3WNLA 4Y1YA 3FLPA 1H4HA 4AQGA 3UJQA 2D7FA 1VPHA 4NMIA 3SRZA 2OPWA 3M70A 4E4SA 4OYJA 1T98A 5FPVA 2XAQB 4UXAA 2O14A 3APBA 1HXS2 3MW2A 3H0OA 3JCFA 3RRDA 1BK0A 2VKJA 5FZCA 4QMAA 1LESA 1KNPA 3CX8B 3K8PC 4QGLA 3WX5A 3ST7A 2VZSA 2DWRA 1O59A 2BS3A 2A1XA 1IS3A 3CZUA 4ZXEA 4UW6A 1IJ6A 1SE7A 3GZUC 5B2GB 1WCKA 3NNGA 3GZAA 1HNWT 2X29A 2NOXA 1X9TA 3LDBA 2X66A 1G6NA 3BODA 1N1SA 2BWAA 3SISA 4J25A 2WDBA 3VBRB 1OURA 4HSJA 2K46A 4F7ZA 2XQ7A 1BR2A 1OUSA 3AZVA 4AI9A 3MFAA 4CI2B 4IEZA 1DQ6A 2PHFA 1V9U2 2J22A 5LRRA 3H1YA 3VDDA 5IHRA 1JYNA 2W68A 4YGEA 5JOWA 2ADDA 1CX1A 4XVHA 3HEIA 3HQXA 2V26A 4AQYT 4XOGA 2V5DA 2VUCA 1GR3A 2ZGMA 2VZPA 4UV8B 3ZXDA 2OA5A 1W2UA 3PE0A 3W5MA 4TLGA 2YMZA 5JDHA 4GD4A 2H3RA 3K3OA 4CP9B 4XIKA 5AC93 2E9QA 4AKIA 3BN6A 2W39A 1DIWA 3KQ4B 2NLRA 3RVHA 1P8JA 2UWBA 2WN3A 1QJY1 4Z2WA 3VZNA 2JDHA 5GALA 1AYN3 2H88A 4GIQA 1A8MA 1WW6A 4JYAT 2Y6HA 4GALA 2WZ8A 1UU5A 2LSJA 2QQLA 1DYPA 4GH4C 3OKQA 3C7EA 2VTFA 1SLTA 2R071 4AHWA 1MMNA 3K3NA 2A73B 3SITA 4BQWA 1ZBA1 1UIJA 1LGBA 4FP2A 1TZOA 3WF1A 4AKGA 1W8ZA 1CPNA 3T0AA 3LJCA 1B35A 5FNVE 4OFZA 3JQXA 3B00A 3IIIA 3VRAA 4XFAA 1NY71 1T2XA 1ST8A 5LGNB 2RS33 3EJKA 3S7IA 4RQPC 3VBHA 4MXWA 3HN1A 2P37A 5FYZA 3ZMSB 3FLTA 4XFHA 4MLKA 1IOAA 5L9RA 2PA7A 4DMVA 1GYKA 2VY0A 3WW1A 2XKOA 3WQ0A 1OOPC 1RUF1 2C0ZA 3FC0A 5FR3A 4OI0A 4B3NA 3RZGA 4YG6A 2FD8A 1AR71 4I2OA 1O3SA 5IAXA 4EN8B 4PF5A 3U07A 5JXGA 2WS93 1LU1A 1ULOA 1CN1A 4XAAA 5FZAA 5FXXA 5JZGB 4EYUA 2YBSA 2RV9A 2I2SA 3CX6B 2ZM8A 3UETA 3MEPA 5J48A 1ND3A 1BEV2 3V0AB 3GZEA 3TEWA 4X8PA 2RM21 2VZOA 3PDYA 2XJUA 2VOTA 4CTEA 3FL7A 5FLJA 4LA2A 4LO6B 5FZ1A 3POYA 1W8OA 2RE9A 1GQPA 5C4WC 3WG1A 2P6CA 5FWJA 1D7PM 4OUEA 2HWB1 3SS1A 2JKBA 5ABJA 2NP9A 1EUTA 1TEIA 1UO9A 2VBDA 5FMCA 1KEXA 4I55E 1W6QA 3EI0A 2Z5WA 1JZ7A 5FO9B 3P3NA 5DG2A 1D4M2 5C3OA 4D69A 5DN2A 4DY3A 4O4JE 2VASA 5H6QB 4Q4Y1 1RINA 1W0AA 5LRSA 5LBMA 3NO8A 1ND2A 4N9IA 2VOWA 3P4RA 2HEYF 5EXOA 5A7WB 3USSA 4A5XA 3TKLB 5JREA 2WNVB 3U3IA 2WZPP 2UUBT 3S4UA 4E2QA 4PFOA 3ZMTB 2QZ3A 4QM9A 4H63V 3RDIA 4IDPA 1LOFC 2CAVA 2C9AA 3UUNA 3KV6A 3LGRA 2XHKA 2DTYA 1VAKA 1LEMA 3HIFA 1RUOA 5BNOA 1O6UA 4HLTA 5GLWA 1TMF1 3OUHA 4JV4A 4YJ3E 5A70A 3UKVA 3CEWA 1YQ2A 3FBMA 3TN91 2J4GA 2JDAA 1LOCA 5I8YA 1LR5A 4N43B 4OHWA 3ZN4A 5IWFA 4LO8A 1W09A 5EK4A 2KNDA 1DQ2A 2VB6A 3OPZA 3BTZA 3A0KA 3ZXLA 5HXVA 4AIUA 2OUHA 2DV9A 1A6CA 1C1FA 4AI0A 1UY2A 1W9SA 3MPBA 1W2TA 3U0ZA 1X33A 2WR9A 3JADA 1ULEA 2ZA9A 5JRCA 4RS5B 3L9JT 4BQXA 3OJAA 1UOGA 3UK9A 2HWD1 4XFIA 2M6IA 5LBEA 4TWFA 2ES0A 2E32A 4C90A 3ZKUA 2DF7A 1GBGA 4EJRA 4GB33 1AR92 5I0TA 3HT1A 5DUWA 4LHKA 3CL1A 2DCTA 2V7IA 3I9WA 3WNXA 2CXLA 5GONE 2YEVC 1MZ6A 3I3EA 3VR8A 2BOIA 2VVNA 2DWKA 1QQP1 4KH9A 5AFBA 2J1VA 1D0XA 1Q8SA 1X7NA 5FXZA 3X1DA 3I59B 1X50A 1BCXA 5LA6E 1PMHX 3TEXA 3NWIA 3CJIA 3OTFA 1V6MA 2DI4A 4FOVA 4JKLA 1YI9A 4QX3A 4XBQA 1J3PA 5LBCA 2IXJA 1GZ9A 3R4SA 1RXGA 1XZYA 3ACLA 2CBJA 1I94T 5DAWA 3IDEA 2VZTA 1ZZCA 1POV0 4EOZB 3ELNA 4PLMA 4AG4A 1DYOA 2WDQA 1IQDC 3TLUA 3QD6A 2WAUA 2DVDA 3RQWA 4CA9A 5BNQA 4BK5A 2W92A 1XE7A 3SMHA 5F32A 4Q4X1 1GP4A 3VL9A 1Y43B 5LBQB 4CN6A 5JUVA 5KMGP 3O1JA 2M6BA 2R063 2VJXA 4ANJA 3ZYKA 2JRKA 1VBC2 3HKEE 3AE3A 2XBO2 3P4QA 1S55A 5H6RB 4H9SE 1PGW2 2UWCA 1YFUA 1OXZA 2BPA2 2VMCA 3ZCIA 1JS9A 1ZBE3 5H9PA 4EYYR 2VQFT 5JCTA 1XJAA 4TZ4C 4D6SA 4XILA 1OEDB 2VW0A 5FYUA 3Q9OA 2QUOA 3RRWA 1W9FA 5GKAC 2X5IA 4XXAA 5CFCA 1WLWA 3TEYA 4AQTA 1UGOA 2NMOA 1QDCA 3P50A 5A3OA 3Q5WA 2FJBA 1W05A 1DLCA 3NAPA 3P4PA 1MNEA 1VBD1 4O4IE 1D0ZA 2QDRA 3R4UA 4YTPA 1KRIA 5C7GA 1O91A 5HV4A 4BIFA 3BOPA 5E88A 1W6OB 3P4SA 3O1OA 2CGNA 4A41A 4QX1A 4QPGA 4NO4A 3PMEA 4DBQA 3ZYPA 3OY8B 2CXFA 3M7AA 1WMXA 2LRKA 1RUD2 3JBG3 3JD72 2BBHA 3VDCA 3KHCA 5L9BA 5EYYA 5FYMA 5LCWL 3VBSC 4ZOLE 4IUGA 3POGA 2LJLA 4RR3B 2D6PA 4AQFC 3ZFEB 4RR3C 2PHXA 4DS0A 3ZFEC 2ARXA 1Y9GA 3I3BA 1S94A 1YFWA 3C3VA 3PLQA 2CDPA 4Q4V2 5B4NA 5FPBA 2VW1A 3AKPA 3AMNA 4HK8A 4TWDA 3RPUA 3NV1A 1HTJF 3FBLA 4ZI2C 1NT0A 3N9OA 2F4LA 4FOQA 4AFBA 1HX1B 3ZC0A 4IL7A 1YI7A 4V2VA 1F31A 1UF2C 1UY1A 4D6RA 2NWBA 2EHOB 2IVIB 5IUQA 4QWNA 5L19A 2W9XA 4IEQA 3NKGA 4Z90A 4LBQD 3ZT7A 4ONUA 5L3EB 3R0RA 1ZOYA 2GMEA 3NJZA 3O7OA 3RF1A 2HWF1 4AW7A 1GZCA 2KM2A 5J1GA 3KHBA 4N53A 4S2DA 4BM8A 1DFQA 3SKVA 1UY0A 3IAPA 2BG9A 3WF3A 4HN1A 2W0GA 4DFSA 4RN5A 2IUBA 2V7MA 1L0VA 2W0XA 4PAGA 3MO4A 3LDKA 3UFEA 4A98A 1LOEA 2BZDA 4AGGA 2XLGA 4XABA 3MIEA 4Z8BA 4CU6A 2ZGKA 2GC2A 2W1UA 3J26N 2VMEA 1W28A 1F5FA 1H9PA 5L3GB 1NAFA 2QQIA 1NAEA 1PIV1 3T1HT 2E63A 2IUWA 2NN8A 3DYOA 1M62A 1YC61 4EN7B 2RS53 4LPLA 3NV2A 1ZA4A 3CU7A 1NA1C 1QLBA 2FJDA 2XQAA 2VUJA 1N1YA 4DPNA 3B02A 3J7NA 3UUMA 3EB7A 1SLLA 4IETA 1UOJA 5C8CB 3GN5A 3ZO0B 2ZGRA 1WLDA 3POEA 1MZFA 4OMDA 2KZ7B 2ZGTA 2XMLA 5FXWA 1O4TA 2AC1A 1YRZA 3RX6A 3WHUA 2CEAA 4PCRA 4LOSA 5A7QA 5FTTC 4HWIB 4IE5A 4MGIE 1HF8A 4EQVA 2CPTA 4LBOA 4U2ZA 4Q0SA 2ZHLA 4NUUA 1RUE3 4HVRA 1W39A 1W2NA 1JUIA 4N7UA 5FZIA 3O1HA 3MIBA 1DU3D 3LDRA 3D0TA 2W1WA 1MIYA 5BNPB 2C5IT 4C91A 2VZVA 4KP3C 5F5CA 3Q8BA 2IFRA 2PXJA 3SCGA 2E7AA 3D6EA 1RL3A 4CXYA 1HN1A 4U7IA 1YNAA 2NR4A 4ASKA 4QPIC 1C57A 2XJQA 4QHBA 4O8SA 5LP6E 2N7GA 2W52A 2ZKLA 4I0BA 4GOUA 1RVF3 4KI5M 1TG7A 5D2AA 5FZLA 4LHNA 1GOGA 2DBNA 5IVFA 3P4WA 2WRAA 4QT6A 2A75A 5AC92 1HB2A 5DZEA 2E26A 4PI2A 3UYJA 2RS13 1JOJA 5FY4A 3OPTA 5FP8A 4XFBA 2E9XB 2GC1A 3VRBA 2K5BB 2E9XC 1AYN2 2MAWA 2LHRA 3HPNA 4I4TE 4U31A 3PVOA 3LA3A 1EUUA 4OHZA 1JBCA 1VRH1 5IK8A 3AXDA 2WFF1 5FVLA 4K0UA 5FUNA 1XNTA 3ASIA 3FZFB 1VP6A 2QFEA 2DVBA 3UL2A 1YQ8A 2WU2A 4QB2A 1AF9A 3I1AA 3J9SA 3ZSEA 1W2AX 2VE1A 1E5HA 4NHYA 1F4AA 3K46A 5FKBA 2OW4A 1DQ4A 2MEV3 2FQPA 1NCQB 1MACA 3WQ7A 1L3JA 2ATFA 1WCUA 3KD4A 4XZUG 3OPWA 5FCCA 2FHRA 3GM8A 4J1XA 4P5HA 4LHSA 3VD7A 3VHPA 4FTSA 4XCAA 2QCSB 5FJHA 3ZX7A 3V0BA 3OB8A 2WS92 5DDJ1 3ETQA 3AEDA 1QU0A 4M4RA 2DUPA 3FX3A 2VCAA 5T5JA 4LITA 3E6CC 4OHVA 1BLZA 2OKXA 1OEDE 4U3CA 4GKKT 1HR0T 1PO12 1RUC3 1BEV1 3RYHE 1WW5A 5K0UB 2JE8A 4LO4B 2Q1FA 1LECA 4EN9B 4YGCA 2WYSA 4YW7A 1CIWA 3ZMNA 4E8CA 4YFSA 2YOEA 2K3WA 4YM0A 3FFZA 3BIWE 4COWA 3JAEA 2UXDT 2H0BA 4PJYA 4WM8A 1W06A 5K4LA 1MZEA 1BMV1 1JZ8A 4MYEA 1WGPA 2ID4A 3M2MA 2ZGNA 3UNPA 3KT4A 3N9QA 2Q9QA 4AEDA 1AL22 5FZ6A 2C1FA 1SMVA 3UTKA 2NYYA 3NJXA 3VBFA 4CEWA 3AMPA 4M01A 1Q56A 1EV13 1O7FA 3ONLC 3GYDA 5A3NA 3OGSA 5C3RA 1HNXT 3RC8A 2JJ6A 2VKOA 3ETUA 1IS5A 1FNYA 1QOSA 4NIGA 4FBFA 1JTZX 4COVA 4W6WA 1R083 1UX6A 4PW8A 5KDMC 2XM2A 3VDBA 4DUYT 1ODNA 2IC6A 4XFGA 4YSYA 4XYXA 3L39A 2B7YA 1W8FA 1CGPA 4KU7A 3NZPA 2R043 3UU6A 1CJDA 2Y0OA 3OTOT 1EP0A 3LD8A 1NG0A 5K9YA 3SH5A 4IV1B 3WOGA 5IVCA 5T50A 3BI3A 3ETVA 1DYKA 4YPJA 2XVLA 1FOD3 3A0NA 5BNNB 5FY0A 4JI6T 1AYM3 4Q4W2 5FY7A 2W2IA 1QWRA 3ESLA 3BQLA 2XVGA 3BB6A 1G7YA 5H9SA 1QJX1 1RUG3 5ABEA 2WDVA 4BHPA 2YGMA 4XF1A 4HT1T 1OQ1A 3OG2A 1FYUA 1EAH2 3RYPA 2X0HA 4DV2T 5AQUB 3KDSE 4AGVA 4NAMA 1X82A 4K20A 4KBBA 4MGZE 4H55A 3T30A 4AKHA 4P9GA 2LSGA 5L3FB 1SDWA 4JQTA 3ZPYA 5FLHA 2XG3A 1VCSA 2E7TA 1XNAA 2LOSA 5ANQA 3PJYA 2BVVA 3NRUA 4GB32 1ZREA 1PK6C 2OUJA 5KXDA 3I54A 3ZYBA 4QXCB 4BZ4A 4JI5T 2JXAA 4OULA 4YM1A 3LKJA 3NVOA 3PU8A 4TX5A 2ILMA 1Z0PA 4ZI3C 4PFPA 4CDWA 1D0YA 5L3BB 2Q8DA 2JB4A 1KFYA 1UAIA 1XSQA 5EHDA 3S5QA 1U0AA 4HL0A 1SACA 2CA5A 2HWE2 4NIHA 1QNWA 4MALA 1GKBA 1V6JA 4XDQA 4AFMA 2ZAHA 3PNAA 2D5UA 2QGSA 4DR6T 5BXXA 3VBOB 4ISSA 1GZWB 4W8JA 2KR2A 3VBOC 4CEYB 3VDDC 4CEYC 2HPJA 1GQHA 3LSVA 3MACA 4JV5T 1IHMA 3PURA 3VLBB 4QXHA 4CVUA 5AQGB 4Q8KA 3N2GE 1GNYA 1MQTA 1D1AA 1CAXB 3U1XA 5ANNA 4IT4A 3ECQA 5J0ZA 3LWCA 4KMQA 2L9QA 5T52A 5IVYA 2A5ZA 4X66T 3MKDA 5A3TA 1U4QA 3IPVA 4X8NA 1IG0A 3OBVE 1IPJA 1UX4A 2WZHA 4BQ3A 5LA9A 3UT0A 5A33B 4BQ4A 5F3EA 1W6MA 5DAVA 3E6DA 3T3YA 3D0SA 5HI0A 3UV9A 2Y6LA 3TEZA 1BR1A 4Y4RA 4KL1A 5JDFA 5FMOL 3KM5A 3GCXA 2JIJA 5FQ0B 3DL3A 5CNAA 3SWHA 3RJ2X 1WCSA 2HH9A 4ISTA 4Q1RA 5KC5A 4CUBA 1ONAA 4ZHQE 4QKBA 2VURA 3V5UA 2BS4A 2BEOA 2DCZA 4NPLA 4QX2A 3L09A 1B35C 5KHHA 4O2BE 4RL7A 4KG8A 2W63A 5KHIA 3EABA 3ZXFA 5L7OA 2G4IA 3WDTA 3DPRB 4XF3A 4PBOA 4W65A 1W90A 2VL0A 1V0AA 4QDQA 4OHXA 3LOIA 1W0PA 3RYRA 2I6HA 4ATEA 5AQJB 4DXZA 1F9KA 3WG3A 2WNOA 3AB0A 1SZBA 4F8AA 2IXKA 3HWJA 1RUD1 5HPOA 3C51A 4CUGA 3KCYA 1DZQA 3DP7A 4URAA 2HWC2 1FJGT 3O14A 4E8DA 1G9AA 4BK4A 3O1TA 2C6SA 2DCJA 1W9RA 4UW4A 3ZYLA 2VU9A 5J98B 1YO8A 1HB4A 2MOZA 1DQ5A 1ND3C 3TBDA 2VXRA 3JCIA 3R4DB 2VWAA 4DV0T 2B5HA 2GP3A 2VR4A 4AQSA 2DVGA 4EWEA 3CQOA 4D7TA 1UNBA 1VBB1 3RGLA 4JDNA 3A8YC 2X0LB 4ILAA 4ADZA 4RFT0 2WNEA 3VBUB 3PVEA 2ZM0A 5CEHA 1V6NA 2GMPA 3HAGA 1AHSA 2XWBB 3LPFA 1HIXA 5C2TA 5ABJC 5FOJB 4MADA 2WSUA 2XONA 1HB3A 5EJZB 3S0MA 3EDVA 3F95A 1FMD1 3UKNA 3VBRA 3K48A 4IXLA 4AXOA 2JDPA 4ISRA 1AJOA 2XSBA 2VQTA 4H63H 1NLQA 5FWEA 1PO21 1F8VA 5KXCA 3I8TA 4XUPA 5GZGA 4UI9L 4IV3B 2TBVA 3T1MA 4IV3C 2K2SA 2ARBA 4B3ST 3NNMA 1IBMT 5GZFA 5FKYA 3MXZA 4XW3A 1IZ3A 1G9BA 1UX7A 1UWWA 1HRV1 4J1WA 5DZFA 2AENA 4PJJA 3DKWA 4O4HE 2Z79A 4DV1T 1FPN3 3FZKB 3H8RA 4N8MA 1SPPB 3DXUA 5FK8A 4AWDA 4CP9A 1YWKA 4NE9A 3UGGA 2ORZA 1US2A 2RDRA 2BBAA 4AHYA 3QOFA 2JQQA 3S6PA 3ZM8A 1OI6A 3KZ4C 2RS52 4G9SB 4QKNA 5ACA1 2GC0A 2UU9T 1JU4A 2I74A 3WLUA 4ZU5A 5L3DB 5BNOC 2AZ5A 5CVRA 3N7KA 1D4VB 1BBT3 5IVVA 3IMNA 5DQWA 4MO3M 3NNJA 2XZEA 1UZVA 5FY9A 1PGL2 3PUHA 4GH4A 5L4HA 5C8YE 2W4XA 3ROUA 2GN3A 2LRPA 4MUVA 1CZSA 4O4LE 1WWYA 5CISA 2V6YB 2OPKA 5GLZA 3SEPA 2VMHA 3NMBA 4X62T 1H2KA 3MPPG 1HNZT 4XJAA 5D8AB 5D8AC 1QJEA 3O0XA 4IEPA 4BYYA 1VRBA 4JI8T 4AAXA 5FPZA 3ME2A 3T0DA 1UMZA 2V73A 4P02B 1OOPA 3HNMA 1IAPA 5C33A 4IGOA 4U2YA 1K5MB 1NXD1 4QGNA 2D6KA 5CB4E 3B9IA 1FNZA 1JYCA 3WDUA 5JR9C 2BP6A 1GV9A 2DDUA 4ZKTB 1WLTA 4JZRA 4M4PA 1RVF2 2BNNA 1BHGA 3E0ZA 5A32A 5FZOB 3RIUA 1G73A 1R093 1ENRA 3W20A 2HN1A 2D3PA 4AVTA 3V0AA 5AQNB 5AC91 5EJ1B 4ZU4A 3THPA 4WZXA 2N9DA 1GWKA 2PTFA 2D97A 2QBXA 4KWUA 3OYWB 4YSXA 5CKQA 3VZLA 3VR9A 4YARA 4DZGA 4IDQA 3CQCB 5LHGB 2DUQA 4FPLA 4HWFA 5EZWA 5DZGA 4IGUA 2E5LT 5HXEA 4XXPA 3THCA 4L0RA 1POQA 4YY3T 4YJ2E 1J3QA 2KXLA 4AVCA 3MIGA 2RS31 5DQVA 4N9HA 3N4MA 3RPQA 1CX4A 3QNUA 4HVOA 1NUKA 3AEGA 4YRDA 1H8TB 4GIWA 4C0HA 3ZN0B 5HCAA 3HKBE 2LM3A 4XF4A 4KI0F 5FFOC 5LBFA 4K8RB 4FFGA 1VB4A 3ZXJA 2XXZA 4UFMA 3WSOA 4CZSA 2YXSA 5CFCC 1ACCA 1LOFA 4BA6A 4BCUA 2C4XA 1X36A 3MW3A 1UMHA 2W91A 3ZXAC 4QQHA 1CR7A 5G04L 4UXNB 3MW4A 1X8EA 1SHZC 2WS91 4MLOA 1O4YA 4DR7T 3CDZB 3NAPC 3VKLA 4IQPA 2AEZA 4CXXA 4BJ0A 4G2AA 3JZVA 1OPOA 4UW3A 3LA7A 4COYA 2WC2A 4DUVA 1VBE3 2BU9A 3P5BA 3WUDA 4N43A 2WCAA 1WLCA 3GJBA 4FFHA 2YDRA 2MPKA 4NRPA 2XQ5A 4FPFA 3AAAB 5M0TA 2A6XA 1UYPA 2ZM2A 3RGBA 2BQPA 3AA6B 2LSIA 4XJZA 2WZIA 1LHOA 4GYRA 4RS5A 3C4WA 4RD7A 3I9YA 1KQRA 2LE8A 2W95A 5T3NA 4PF1A 3KV5A 3MF6A 2R6GF 4PIYA 4LEJA 2EICA 1HXS3 1QOOA 4FFIA 4XJUA 2BRTA 5IT6A 3MV11 5CFDB 4HVQA 1J1LA 3OYXA 2LM2A 2GDFA 2W46A 3ORJA 4DXRA 1G86A 1QGLA 2Y0IA 4C1XA 1EV12 4EV0A 1ULCA 3KV9A 3ATGA 4FI5A 1SLCA 1Q3EA 1RHI3 1COV3 1GNZA 1LVFA 3I59A 1R082 4NHXA 4CE8A 1G8WA 1XPWA 4ZONA 3FHIB 4Q2FA 3DF0A 4N53C 3C50A 4R4XA 1CJPA 2FZ2A 4CU7A 4OUMA 4BMEA 1V9U3 4AAPA 5FYCA 3KBTA 4UFKA 1GQGA 2Y60A 5KX5E 1JNZA 2UYBA 1EY2A 1WMDA 2RMU3 2E6VA 5KBFA 4K9SA 1U5YA 2HN2A 1AYM2 2XAHB 4LMLA 3I0QA 4ZEYA 3LDQB 2C5KT 4YG3A 2DCYA 4FAHA 1DLLA 4HE8A 1RUG2 2VOVA 3ZYFA 3KF3A 3ZIXA 4DY5A 4Y3OA 5FK7A 4ARXA 3TLSA 2EA7A 5GLVA 5AQFB 5HEOA 3NBXX 5A7OA 1CAUB 3AEFA 4X1KE 4Y20B 2BW8A 5LJMA 4MHUA 1B7TA 5CA1E 2EVXA 3FMGA 1PVXA 4P9IA 3B9CA 4FI9A 4BQ5A 2WU5A 4NIQA 3SQOA 4P9JA 4HPKB 5C9AB 5FZBA 4Y5TA 3WW2A 2L9LA 4GB31 5C9AC 1OEDA 2P3JA 2CNAA 2YZ4A 2VVDA 2LEHA 2VM9A 3EO6A 4NHMA 3CX7B 4CZZB 1RUI1 3WP4A 4X1IE 4LR4A 4JGZB 1QOTA 1BZWA 3K4ZA 5AQLB 3MI8A 4RHV3 2BVLA 4BJNA 3E08A 3K51A 3QOPA 3GZTB 2Y48B 3IHRA 2YFUA 3LSDA 5SV8A 2SPCA 1WKYA 1FMWA 4DB5A 4LO5B 3SEEA 1WCDJ 3WDYA 3R84B 1W6OA 2VVSA 3ZYHA 4KWKA 1Y3TA 3KS7A 3OY8A 4DINB 4LLOA 2OIIA 4NHKA 3AAIA 1GWMA 1UXZA 3VBSA 3ZN5A 5IVBA 3WZ1A 3GHNA 3GCWA 3O1IA 5DQ0A 3AE5A 4Y22B 4AISA 4TZDA 3RJRA 2FDKA 1ZRRA 1IQAA 2WNUB 1LKNA 4YTMA 1N1TA 1S0BA 3AKSA 4RR3A 1EZ3A 2WNUC 3ZFEA 4YYOA 4LBLA 3PTRB 4JLEA 2FDJA 3GF6A 4HFVA 3AECA 2V7JA 1Q8PA 1DQ0A 3OYZA 4XC9A 3R6SA 2YKSA 5FY8A 2XVKA 5GZCA 4XJ9A 2YFZA 1ZRDA 2ZMKA 2R061 1MVEA 4GWMA 2OQ6A 4GK5E 3W58A 4QHOA 3CKDA 4D0QA 2EHOA 4LORA 3AXJB 1IPKA 1E57A 1W03A 1XBFA 4P0AA 4MXVA 5JPNB 1RTVA 1ZBE1 2R32A 1H1MA 2Y6KA 1OFNA 2BNOA 3JB4C 4IE7A 4J6GA 4KWJA 1UYXA 4MZUA 1UURA 3P7IA 1V00A 4RGKA 4CDQB 3L2HA 4MGQA 2J1DG 1RIRA 4CDQC 5DG1A 5A7PA 1LULA 2ERFA 1SCRA 5HXSA 2LS6A 4QU2A 4CPBA 4NPRA 2H7OA 2GNBA 3A21A 1RUH1 1AUYA 3KVAA 2IAKA 1IBLT 4BQ2A 2A3XA 2I0MA 2Q0AA 3QCWA 2V4VA 1VALA 2CLYB 1YYNA 4XUOA 3BALA 2QQJA 4YM2A 2X53S 4H9PC 1UZYA 1HB1A 5IUXA 2VK9A 2D9DA 3B01A 2MYSA 4NR1A 3JBG1 2ARCA 3H3ZA 3Q8CA 4MGTA 4EROA 2GH8A 2P9BA 4XUQA 2Y38A 4DQAA 4XZPA 1WMFA 1JYVA 3WY6A 3PV0F 3WUCA 2NW7A 1XQNA 3C2UA 2BVMA 4X6QB 1FMVA 4XE9A 2V8SV 2YY1A 2QRXA 1DBNA 2XHNA 5C8CA 2XAGB 3CKHA 1ZZ8A 4B4QA 1LTEA 5GM0A 3NKZA 3ZOIA 3Q5EA 4LMFA 2WBKA 2YC2A 3F2EA 2R073 3RZMA 4OVEA 1Q43A 2YUEA 3N2KE 1VBA2 2BTVC 2IFWA 5FZ4A 1SUMB 2WLPA 2BVBA 1JHJA 3DCQA 3MK7C 2WMOA 5HXRA 4WM8C 2ZGPA 1JU3A 5LB7B 3TWIA 3UKTA 2ZHKA 5IWAT 5HXMA 5FPLA 3LF7A 2IHR1 3URFA 1WZXA 5BNPA 1BR4A 2YDSA 1LJ7A 3J7HA 2WB5A 1X79A 2RR13 4G3YC 4PIZA 3VBFC 1D2SA 2EAAA 2Q5TA 1NLRA 1V6KA 4EEBA 3OF1A 5LJNA 5HWXA 1TME1 4JTNA 1IGOA 4NN0A 5I0SA 2VL4A 1OHFA 4IEOA 3HI2A 3H50A 2VH9A 1NX9A 2CRBA 4M3CB 3E5QA 2P17A 1RB8G 5FL1A 5KC6A 1BJQA 3U75A 5J7MA 4YM3A 1PVC1 4EZ4A 1PNFA 5C5TA 2E9XA 1JYWA 2AXDS 4CN4A 2V4AA 4DV4T 5L2LA 2Q9QD 1R1A2 3W9AA 5HXHA 2C9KA 2XPJA 1OA4A 3C7OA 2RA1A 1KS4A 5A6QA 1LHUA 5FYYA 3ACGA 4AGRA 2EIGA 3KSCA 4NAOA 3A23A 4K1YA 4DR1T 4FO9A 2V7LA 4Y1VA 1J1TA 1PZ8A 5AQIB 1NE6A 4PBPA 4DNDA 1GUIA 1BQPA 2QQOA 1RUE1 2VECA 2K0GA 4MSVA 2NP0A 2O1QA 2A3DA 2WJSA 2XQ9A 1NCQA 4QQPA 3FHNA 1UCUA 1T6BX 2Q4SA 1GP5A 1IKPA 3M1HA 4DEVA 5E6HA 3MLLA 3VBHB 5ADXL 2ODVA 2W62A 2BKPA 5GJ6A 3ZR6A 4YG0A 5FY5A 3DYMA 4DBRA 3IA3A 3FBZA 3J4UH 4CDWC 2WL1A 3ES1A 5JSRA 1VB2A 2JMKA 5JOZA 1OLMA 2CM0A 1D1BA 2G0UA 1HV0A 4XMIA 1H0BA 2ZLYA 2HYXA 4NRQA 1XDOA 2WN2A 1TMF3 1BKZA 5F39A 4L5GA 4HOOA 3POFA 5A1FA 5FZEA 3LK42 4PI0A 5K0UA 3M8LA 4TN7A 5LG4A 2ZGUA 1GQEA 3AMHA 3AKTA 4INDA 1HG5A 2RS11 4BB3A 5B4XA 1MQTC 3MV01 2ZGQA 4AL9A 5I91A 1CWPA 4Q4V3 4YZ4A 2UXCT 3AVRA 3SC7X 4MGYE 1CAVB 4YVWB 2HLEA 1OH3A 3POJA 1CUNA 1ZHCA 4HXCA 5LB6A 5AFUL 1WBLA 3SH4A 2PHDA 3BCWA 4R9DA 1W6QB 1V6LA 4CCDA 4YVSB 1O3RA 2WZR2 4Z92B 4YVSC 5LA0A 2LSKA 1REEA 3BU7A 2D6NA 2GK9A 4XEZA 5IW0A 3B94A 1DZTA 1UMIA 2AEYA 2MEV1 4MOAA 2CWSA 1POV3 1DGRN 2P3YA 3TB0A 4TV9E 4B1MA 1K12A 2EXKA 4YXDA 3PUXF 2XTLA 3T2TA 4PDWB 1ND2B 3LB9A 4PDWC 2EIEA 4UAPA 1ZM1A 2MTQA 5L47A 5F3IA 2EIBA 2NW9A 3AJZA 1US3A 1PMIA 4IV1A 4E2GA 3U11A 5L7OC 2A3YA 5AQVB 3ZT5A 1RMU1 2D6MA 4UIGA 2X9YA 4L0PA 5BNNA 2D43A 4F6RC 1Q8OA 5FUPA 5JDQA 1CVNA 1HQLA 2NQYA 4M00A 2JG9B 4YW4A 5HAXA 2B46X 2A6YA 4WBOA 2J42A 4LLFA 4P9LA 4IEYA 2WIIB 1RUC1 2HH7A 5HCHA 4EV6A 1Q8QA 2UYAA 1XYNA 2AYHA 5ABHA 1DU2A 2JQHA 1JH5A 1NENA 3PDQA 5AVAA 3MZHA 4Y4YA 1RUJ1 2MBGA 4A44A 4A42A 2DFBA 3ZJ2A 4Z2AA 3AE7A 1BK1A 3RH3A 4GKXA 3ZR5A 3JXSA 2F17A 1KJLA 2IW5B 5HCFA 2D0TA 2ZZQA 2YBKA 3GMIA 5JRCB 3ACIA 3PTYA 1PK6A 4UVBB 3UGHA 5JDGA 3WNPA 1H6XA 3RIAA 4QXCA 2FBWA 2GSYA 4UFLA 4A2UA 3J8F2 3ZSSA 3UESA 5HEUA 4CI3B 2JDNA 3WD5A 1EV11 4UYBA 4YZ1A 3ZXEA 4TTGA 2P2KA 4GYSA 2ENRA 4COFA 4CCKA 1RHI2 4UVCB 1COV2 2ZGLA 5FYSA 2VZ3A 2XY8B 3B5MA 5T5PA 2R1BA 2JKXA 5CADA 5CKMA 1ZNPA 4LO7A 1PZ9A 5IVJA 1GLHA 3IBMA 1J5ET 1VBD3 3O1PA 2X9HA 3VBRC 2A7AA 1QJU1 5IK5A 2OYZA 2R041 2VUDA 1KDMA 3CJIB 4GAZA 3OSDA 3VBOA 1C5IA 1GZWA 2GALA 4CEYA 5FXVA 2X0YA 4FJOA 4B3TT 3MZKB 4CN1A 1XNDA 2SBAA 1BXHA 2DHRA 2X67A 4IL9A 3HOBA 1F15A 2RMU2 5HEHA 2WQ4A 1FOD1 4YW2A 1PX3A 2BKNA 5J3UA 4V2WA 4Q0VA 2BUKA 5EP9A 2WABA 1H9WA 5C8WA 3WF4A 1CAXA 5J1XA 3O5SA 3ZDVA 3JC6C 3J7LA 3S5AA 4IDZA 3VKFC 2BWCA 1YKEB 3UU3A 3AP7A 1VMFA 2V09A 2CHNA 2L3LA 2DLRA 5A33A 1LGCA 4H9RC 5J37A 3LE0A 3P6BA 2YDQA 1A78A 4M3CE 1VIWB 3AC0A 5HEJA 4HK9A 2YN6A 1HRI2 4B3MT 1MS9A 4LKSA 1MS1A 3WDVA 4O2AE 4FTBA 3H8UA 3HKDE 3VD3A 4FVVA 4HSLA 3PVBB 4XPVA 4E7SA 3Q8EA 1S4CA 5LHIB 1W6PB 2OX0A 3SCFA 5DABA 1XE8A 5CZKA 1AR81 3BPSA 4J2CA 1QUUA 3MHZA 2D3SA 4I02A 3DPRA 4RHV2 4X5TA 4LF4T 4HETA 1ASJ3 3BOWA 2E31A 1OLRA 4LFCT 2B45X 4B7EA 2QQKA 5A7SA 4JI7T 4XBFB 3LPGA 3CK6A 5DAQA 3KCXA 4H14A 5JDBA 3OBAA 2OVUA 1LNSA 1H2LA 3UU5A 2W67A 3LOBA 4WVMB 3NJYA 1J1JA 4AHXA 1N36T 5AQPB 4U2AA 2VAUA 5JZGC 4WBNE 2LKGA 3RIUC 3GBGA 5FAXA 3I3MA 3B57A 1PO13 4MGKE 3T0BA 2F6BA 1QKQA 1N3PA 2JDUA 4WM7B 2QVAA 3OBRA 4ILCA 2P1BA 3K1SA 2Q30A 4WNKA 4GKYA 5JXJA 5FJKA 4TLFA 2ZZJA 3VBUA 3VHOA 4DV3T 2B76A 3CMLA 4IL4A 4LT5A 2XJTA 1AL23 2JECA 1N34T 3C8XA 3H3LA 2ACXA 4Q26A 1WYBA 3VHRA 5JMCA 1MIVA 1L7RA 3AK0A 3BTYA 5E1RA 2ZHNA 4UF0B 2X9XA 4IV3A 1KJRA 4TUYE 1HLCA 2WP9A 1HJFA 5LWBA 1UN1A 5G05L 2E53A 3AAEB 3B3QE 3TLWA 3QLQA 2VO5A 1YEWA 4ITCA 1XDPA 1SHWB 4CCCA 3ZMVB 1A3KA 1UZZA 1SPPA 3AFKA 4XAXB 2WNVC 3RZKA 4DO0A 4BLJA 4OK0A 2G19A 4D8MA 4QXBB 1OF4A 2PBIA 1YCIA 4Q4W3 4XFFA 2WYFA 2RDQA 2W87A 3H1WA 2X51A 4JGYB 4Y24A 2KSRA 2J1UA 3V65A 3MIDA 1LHVA 2PN5A 3WHTA 4YW1A 3VD9A 2VMFA 4N43C 2JE7A 5IFPA 4OX9T 1I5PA 3BUCA 4QDRA 3PUQA 1EAH3 1MEC3 4KNCA 2V6YA 2I07B 4F3JA 4AQ6A 3E22E 3ENRA 4IREA 2R072 1WW4A 4TWHA 1KEYA 1SG3A 4BA9A 1S0CA 1MMDA 3ETPA 5D8AA 3KINB 1ZBA2 1XNRT 1O3XA 4JI1T 2C0SA 3A7MA 1TNFA 3F2ZA 3AL6A 1GZTA 2ZABA 4RS5C 3WG4A 4DR4T 2XQ3A 3LK2B 3FHQA 2R6QA 5JAXA 3IM0A 3WNMA 2QQNA 1GOFA 1W6NB 5C3PA 3VKGA 2B9VA 3RMXA 4L8QA 5EPAA 4JBWF 2XJPA 4DEQA 2RR12 1W0NA 2V7KA 1KITA 2R1DA 1HKDA 1S0GA 2QKDA 5CIRA 1UOFA 4QB1A 4XCBA 5A1AA 1E1HB 2HKXA 3TOJA 5I0UA 4UVAB 5JR9A 5CA6A 1RUF2 4I0WB 5FMBA 1AX1A 5E16A 3J7MA 4COZA 3KT7A 2XQ6A 2VW2A 3Q8FA 1T8BA 1OUXA 2MPFA 5TAOA 4W6XA 5C3QA 2HWE3 2E5VA 5DDJ3 5FZOA 1FPN1 3RNSA 1DGRA 2YC4A 4XFCA 5E89A 4IEWA 5IAVA 4MHRA 1KDKA 3R05A 2XJ7A 4H9NC 4YWAA 5CKNA 1I9RA 3K4DA 4A97A 4CDUB 4ILUA 1REFA 5FO7B 3AZYA 3OYWA 2RM22 2WAOA 1BBT1 1Y01A 3ALQA 3EXUA 4LHLA 3AM2A 3WNNA 4JI4T 4LK6A 5GLTA 4RSUA 1YQ5A 4A3XA 3NSTA 2JB8A 1Z7S3 2HWB2 2XASB 4L9BA 4IEVA 5BR8T 1HDKA 1WD4A 4NHLA 4W6YA 3AYCA 1OKOA 2DCKA 4LQRA 4CDXB 4LUMA 3ZFFB 1W3XA 3WW3A 4PIXA 3WI3A 2AUYA 3POWA 5F5QA 2VVFA 2ZX2A 4W50A 1H2MA 2TEPA 4Q4Y2 4LE4A 4DNYA 2ZCWA 1OEDC 1Z78A 3OVUA 2I45A 2CGOA 2SLIA 4XDPA 5FV3A 1YXRA 4CU9A 5F5IA 2PG8A 3ZSTA 3GDBA 4I3GA 3UUXB 4SBVA 1K3IA 4PT6A 3HQRA 3W21A 3LZZA 1Q5OA 1UKGA 2FMDA 2Y26A 1B09A 1R091 1TMF2 3SH3A 4GULA 3HL6A 4Q5OA 4AHZA 2CU5A 3E5UA 2XDVA 2C5JA 5EZYE 2J1AA 1QJX3 5BMVE 1ENXA 1I6XA 3Q9DA 4QH1A 4MVTA 2NMNA 2PLV3 1LVKA 1UW8A 5BY5A 5EIYB 1I3HA 2HWC3 2YHJA 2HEWF 1WBFA 1GU3A 1HS7A 1ZZ6A 3LBXB 2HWD2 1Y9MA 4X20E 3J7Yq 5CFDA 4BISA 5LNKA 4CXWA 2VUAA 4XJWA 2IMLA 4FP3A 1IJ5A 3RKGA 2VGDA 2DCFA 3RQUA 4M0HA 4B1LA 4AVSA 4CEWB 3ON7A 2EHOC 1N3QA 4ISQA 3OCPA 4I0UA 4D6QA 1QDOA 3QC9A 2O8OA 1F2NA 4Q1PA 3I2OA 1HG2A 3CZJA 3BU0A 3WP5A 4I30A 2ZS6B 4PK5A 1UY4A 3IKWA 3H3AA 4UW5A 2GMMA 4OQ8A 1UYZA 3VDAA 1LRZA 4JUYA 3KGLA 5AQTB 2A6VA 2VXJA 4FPCA 4XF0A 4XJ8A 4NWWA 4BJMA 2P3IA 4E4HA 1H8VA 4QKDA 1L7QA 1VBE1 3OUIA 4ZI2D 1SBEA 3VKHA 3UQ7A 2IXLA 1IPSA 2WO2A 4DMIA 5A3MA 2A72A 3LAGA 2WWUA 1CAUA 3BQIA 5I0RA 2XWJB 4Y20A 3RG0A 2LSYA 3PMSA 4Q4X2 3ZXGA 4GJZA 1QHDA 1XNQT 4SLIA 1OWAA 3C7GA 3RI5A 1RJ7A 3Q2MA 3RIFA 5C8CC 2RJLA 1HXS1 2YK0A 1W04A 5C9AA 2QYWA 5C71A 2WT1A 4EWAA 4Y1UA 1TVGA 2L8KA 2C26A 4U72A 3WDWA 3FLRA 5K7PA 3AE6A 5KXJA 4L97A 5EYXA 5LEKA 4A4AA 5ABFB 2YPDA 1YJLA 3RYKA 1RYYA 4GXLA 4AFDA 2GU9A 3FUQA 3O1VA 4DV5T 3DUIA 4CQIA 4QQOA 1RUNA 2P6HA 5BNPC 3WAKA 5F7UA 1VBD2 4LF9T 5JLVA 3OGGA 2PAMA 3G6JB 4FOYA 3MF9A 4YW6A 4LMJA 1L7LA 1V9U1 1U5IA 2GP5A 1QH6A 2XQRA 1ZV4X 4DXSA 3I2FA 2AE9A 4NUVA 1W8WA 2RMU1 1SFNA 3HBKA 2PHWA 2E7QA 4Y22A 2NPIA 5FZHA 4IGQA 3LIGA 2WNUA 2P34A 4NJ4A 3P8CD 5J2TE 4CP2A 3T8OA 4QXHB 1LHWA 5FYVA 5DUVA 5JTGA 3NQHA 1YW0A 3PUIA 2GN7A 4C1WA 3W5NA 5C6CA 2VNGA 1DP0A 1F4HA 4Q8LA 5F5WA 4CYDA 4XHBA 3AE8A 5IVEA 4QX7B 2V5CA 3PVNA 1S0EA 5FOBB 1EPWA 1VBB3 3AXJA 2EF6A 4UFIA 3AEEA 1WD3A 5JDNA 3ZSLA 5FP7A 1NCRB 4RFRB 3RMYA 4FFFA 1BVP1 4IEUA 1OD5A 5FO8B 3WVJA 4CDQA 2HYKA 2Y6JA 2ZMLA 4FPKA 2HWF2 2E51A 4LBMA 3TNPB 1S0FA 2QZ2A 1FMD3 2BDRA 1W9WA 2WZEA 2JPFA 3PUWF 3AA7B 3W15B 1S2KA 4RHV1 1OT5A 1RITA 2DU0A 3C4XA 1XE0A 1W9TA 1ASJ2 2QQUA 1NCQC 4Y26A 2BFUS 1XU2A 2ZGOA 4Z82A 1ULDA 1ZZ7A 4FPYA 2ZBJA 2E8IA 2E9XD 4IESA 4JRLA 2LLYA 4B8EA 3FZHB 3T4HB 4QQLA 4HZFA 1IG3A 4UWDA 2YB7A 1ZEEA 1U12A 4XUTA 4FPEA 2A6WA 2FDGA 1PIV2 3UT5E 5KXEA 2PAKA 3RZHA 3CVRA 2B4KA 2CAUA 4P9XA 1HX6A 1JW6A 5ACA3 3CBNA 1UY3A 1SEFA 3ONJA 4KX6A 5J36A 4BXSV 5FUIA 2DYCA 4HMZA 3B13A 2CCQA 5JIUA 5K0UC 3TRSB 4K40A 4R52A 3HT2A 4AI6A 1W99A 3AE9A 4E4ZA 4AFCA 3N9PA 3N7MA 3KGZA 3AZZA 2EAKA 2VULA 2VPVA 1S2EA 1JYTA 4NIAA 2BGCA 4K6BA 2YU2A 4AEJA 3AE1A 1W8UA 2PTMA 1SQ4A 3MGUA 2JDYA 4XMAA 4MBQA 1D4M1 3BIEA 4QX8B 2PHTA 2NM1A 2W94A 3DGTA 4QQ2A 4IE4A 4QX5A 3THTA 4QXKA 4B7KA 3ZMUB 2LHNA 3CJXA 2ZX4A 1D0GA 2J1SA 1XRUA 2VMDA 1LGNA 1URXA 1QF3A 5F6KA 1H30A 2ZHMA 3I97A 3ANWB 1OQDA 1JZ3A 4M3CA 3ITQA 2AREA 2XQ8A 3A4UA 3WNKA 1DHKB 5E8AA 3QACA 4FXGB 2XH6A 1S0DA 4LTAA 4IV1C 4JX0A 2CY6A 3P3PA 3SFDA 2C24A 1OF3A 2XGXA 3JU9A 3DYPA 3S30A 5BNNC 3PJAJ 3LEKA 3DV8A 1HQWA 3G7DA 4RA0A 3WP3A 1ULFA 5DMYA 4AKRB 4P9YA 5JSOA 1HCIA 4M0NA 2W1SA 4P08A 1JZ5A 5FMNA 1MEC2 3I2KA 2PFVA 4GH4B 5IATA 4PHZA 1ZRFA 3V5SA 1U5ZA 1VRH2 3K3QC 1K5JA 2Y64A 2WFF2 2XLAA 4JHZA 1YFYA 1LODA 2BZBA 4P14A 4XAEA 1J58A 4G63A 3VU7H 2J62A 4AK3A 2CYFA 3PIJA 2GZWA 4EAHA 4R9CA 3GA8A 1YIFA 4BWOA 4TNVA 4RQPB 4LIUA 5JOXA 4YZ5A 3NZQA 1AR91 2RR11 3MDPA 3VZOA 4CSWA 4OI4A 4HKAA 3H3MA 5LASA 4JEUB 1CPMA 2IZWA 4E2SA 2D3RA 1OOPB 3I2GA 1WW7A 5LW9A 1KFUL 3OD0A 5LHHB 1OD3A 2R7EB 3IT8A 1I5ZA 2UUCT 2PFWA 5FP9A 4FOWA 3D0JA 3JQWA 4JQRA 5DDJ2 3D4KA 1ZRCA 2QE3A 2D0UA 1C4RA 2E33A 3X29B 4HG6B 3B93A 4P00B 4BDVB 3FBYA 2K24A 5A32B 2HBTA 2A71A 5J96B 3NNFA 2MHFA 2X8KA 4OQ9A 3IIAA 1REDA 4NXNT 4LXLA 2WT0A 5CGMA 4AQ2A 2WQYA 2P4EA 1Z0HA 3WEZA 2IXIA 2WT2A 5C4WB 1E2AA 3HA4A 5LOVE 4NXMT 1CAVA 4RYDA 4YVWA 2AACA 2OQ7A 1Z7S2 1BMV2 1UPIA 2WLQA 4ZI3D 5LK5A 3O1UA 4HFHA 4AI3A 1XNCA 2NZ9A 4JDOA 2JG8B 3L2YA 3IWZA 5AQQB 3SLIA 3ZXKA 3AB3B 4S2HA 2JG8C 2X68A 5JI7A 4LNVA 4YVSA 4XDOA 1VBC1 1NQJA 4AI8A 4FPOB 3AP5A 2XBO1 1R1ZA 4EXTA 1PGW1 5DPNA 4H7MA 3B7MA 3PUGA 3E1F1 3ZFGB 3AMMA 3BTXA 4XETA 3ZFGC 2XOMA 3MIHA 2VKHA 2IXCA 4RGAA 5E0OA 4B4PA 4Y33A 2FJEA 4JEHB 2VMGA 3SKJE 4BU2A 3IBPA 4PDWA 4HFCA 1CONA 3RS6A 4ZXLA 1O5UA 1UYYA 5HBAA 2ETEA 3A7QA 5KR7A 3RKOA 1HW5A 2VQET 1XSRA 2ODUA 2QTWB 3O12A 3O4XE 3DPRC 3BK9A 3RYIE 4XQ4A 2VBBA 1PX4A 4MFRA 5JI9A 5FDBA 3VKMA 2JG9A 1JOPA 5FIXA 1QXRA 1Y9QA 3LFIA 5FZKA 5DJQC 4UFJA 1OC1A 1QJX2 3JD71 4AEKA 4P5YA 5CG8A 4DUZT 1HJGA 4XIOA 2PLV2 2DL1A 2E2AA 1V6IA 3GHMA 4JAAA 1SFPA 4IE6A 2ZAAA 2K9ZA 3T08A 5CAZA 1A8DA 2VD7A 1XNBA 2BDEA 1VJ2A 4Q4V1 1JUHA 4YT0A 5FYHA 4WVZA 1WA6X 1X9BA 2H0VA 2BV4A 1G9FA 4Y1XA 1GWLA 3FFQA 5EWSA 4YSFA 3ZN6B 4DRRA 2KWHA 2JEMA 2VQAA 1VBA3 4DV7T 2ES3A 4I3PA 4DUXA 2YROA 3BVCA 2ADEA 2VCCA 3VBUC 1RUI3 5JWPA 4HKLA 5LY2A 2RJKA 4HFSA 1POV1 1D0HA 5GZDA 4L11A 3M3QA 1W2OA 4K3UA 1V6OA 1T72A 2HPLA 5HV0A 4TNWA 4OI1A 1VCTA 2XJRA 3N9MA 2CE7A 5KXBA 1GSLA 2DNXA 2JIGA 2HEVF 4UR9A 2J47A 2PELA 2D93A 3W59A 5HWYA 3IF8B 2YPJA 4YGDA 3WV6A 3N5LA 2H6BA 4COUA 3ZT6A 1VAMA 4EN0A 1PNGA 2VG9A 2BGOA 3L8RA 4Z8XA 4PJLA 3CQGB 3RHWA 2A6ZA 3I2JA 4XURA 2LTNA 4FQZA 3QH6A 2G9GA 1XMQT 3AA0B 2UXNB 1R1A3 2YDEA 4UELA 4JKKA 1LCLA 1A34A 5F3CA 5LYJE 3LQCA 3CO2A 1AX2A 1APNA 2UURA 4OHFA 1SCSA 4HGAA 3RC3A 1AJ3A 3I2HA 3WDXA 2WDRA 5H9RA 3N36A 4QDSA 3SCHA 4A45A 1OPMA 1W6PA 5L73A 1HFAA 3IMMA 4ET7A 4U36A 2XJVA 3VKOA 4AOCA 3UU8A 1YQ4A 3N7LA 4NPMA 3K4AA 3HVDA 4K1ZA 3ONXA 4HN0A 2NTXA 4DVDA 1YLLA 2CWOA 5HXCA 1Q8VA 1ZZ9A 1O8PA 3PL0A 1RUH3 3H37A 3FZ3A 4X65T 4WZCA 1PZ7A 1LOAA 1O8SA 2Z6EA 5F2WA 4ZS3A 4QKFA 1K5MC 4LBQB 1IBKT 2JE9A 4NWVA 1E7PA 1XOYA 4WVMA 1QEXA 4NIIA 3WT3A 3OEAA 5JDMA 5FP4A 2BBJA 3D82A 5M4YA 1IS4A 2ZEZA 4JTOA 2XKPA 3VBSB 1J59A 1D1CA 5JZGA 3WCSA 5IK4A 1C8M3 5BUVA 3E97A 2ARAA 2CGPA 2ZMAA 5F3GA 1JODA 3DEMA 2VNRA 3EVYA 3OGRA 5FYIA 3PUAA 3RZLA 2QNKA 4Q27A 5LMUT 1F35A 4WM7A 4CCLA 3S7EA 3LEGA 4YFWA 2BGPA 1QNYA 4FXKB 2W2UA 1AYN1 2R49A 3VL8A 4CCJA 4B29A 5JPMB 1VBB2 4GMP3 4LJHA 4A7KA 3VZJA 1ZVFA 1I6ZA 3QBQA 3MYXA 4NIDA 2LM9A 3VN4A 2H6CA 2PAEA 1UQXA 1LHNA 1HN0A 4JI2T 1N33T 3RSJA 3KT1A 1XU1A 2UY9A 1OKQA 1ULPA 1NE4A 2HJIA 2CBIA 1FMD2 2WZR3 3O1SA 2ZKNA 5FZ3A 4UF0A 1KS5A 4ZZBA 2V6XA 4PQ9A 2A70A 1PO22 1WFDA 5HCJA 2R16A 3AYAA 5FREA 2GNTA 1G9CA 1TME3 3PJQA 1ASJ1 1H8TC 3Q5DA 5A3UA 2WBLA 5A7WA 4QD2A 3I2DA 2WNVA 3CIRA 4PK6A 4LKFA 3TNQA 1PHMA 5BV6A 2NW8A 4LA3A 1HRV2 2WA4A 3M3CA 4H3WA 2W08A 5GZEA 5DAPA 4WV8A 5J09A 3RI9A 4QXBA 1SLAA 2EIDA 3IN9A 4XACA 5LZ6A 4O65A 3I49A 4LKEA 1GANA 1WR6A 1F5JA 4JGYA 4YNIA 4PJMA 1ZP0A 1NA1B 2FCTA 4QPWA 1QIQA 4NUBA 1PVC3 5ACA2 3N7JA 1S1AA 2WQ8A 3LG7A 3IDBB 1QY4A 1PO11 2ZX3A 5HCBA 3ZSMA 4TXWA 4JDMA 2GC3A 2YYOA 1UL9A 1FEWA 3TYJA 3M3OA 1UUSA 1S0JA 1VMJA 5JVVA 1PMJX 2VCMA 1W8TA 4DRVA 3KCCA 2D40A 1GOHA 1AXYA 2B9UA 5AQKB 2RVAA 1W6NA 1HX8A 1AL21 3NW4A 4MV2A 3T1LA 4LULA 5CFDC 2OXBA 3J8F3 3F31A 4AFAA 4YLHA 1WYCA 3VKNA 4WW0A 1MS3A 2WAAA 2JICA 2VOXA 5FLIA 2Q1MA 2ACZA 1U5PA 3NVCA 4A3ZA 2TNFA 3USUB 4QPIB 2RDSA 2W47A 3AXEA 1PM7A 5DAXA 1AX0A 3VZMA 4CCEA 2XR4A 3IB3A 1N1VA 2RHPA 1BVVA 4CI1B 5JXHA 3KMHA 2OV9A 4Q25A 1NWMX 4Q4W1 4CDUA 2V5YA 1K42A 1AJKA 4Y1ZA 3I7DA 2OS2A 5IFTA 4PJNA 2KMFA 1UU4A 3GBWA 1YKHB 3CQXC 5I0DA 4QM8A 4BXFA 5FZMA 5AQOB 5A1LA 1QJFA 5EFUA 5FPXA 4IERA 3E6BA 1EAH1 1MEC1 4KMCA 1E5SA 3SHRA 5JDLA
chains in the Genus database with same CATH topology
1OWAA 3NRXA 2GP3A 3V5SA 3ZPOA 3I9YA 3F2EA 1HTJF 2LE8A 3K3QC 4PNIA 2D0TA 3FBLA 3Q2MA 2IW5B 3KV5A 3ZCJA 5FYTA 5F37A 5FWJA 3BQKA 4OHFA 4BA9A 3GMIA 5JRCB 2YBKA 4HGAA 3RC3A 1MMDA 3SS1A 4ZI2C 5CA0E 1AJ3A 3KINB 3N9OA 1O3XA 2YK0A 4ZI7E 3ZC1A 2NP9A 2BZBA 2C0SA 3N2KE 4A56A 5FZ4A 2X0LB 3AL6A 3N9QA 2Q9QA 4UVBB 3ZC0A 5JDGA 4V2VA 4ADZA 4EIWA 5FZ6A 4G63A 2L8KA 3VU7H 1KK7A 2ZM0A 3LK2B 3UTKA 4I55E 3ZEFB 3K2OA 4D6RA 4U72A 2NWBA 3MK7C 2EHOB 2WMOA 5CEHA 2K9AA 5HXRA 4EAHA 4QXCA 4QWNA 3GA8A 4AKLA 1HFAA 4DMWA 3OYXA 3EUHA 4UEMA 2JJ9A 5IHYA 5L3EB 3DJBA 4CI3B 5FPLA 4LIUA 3R6NA 4O4JE 5FZFA 5J2UE 3VKGA 3NZQA 2YPDA 1BR4A 3EDVA 5A3NA 5J1GA 2VASA 3ONXA 5H6QB 2B1EA 2NTXA 4DVDA 4GYSA 1X79A 3KV9A 3RC8A 4CSWA 4CCKA 1BR0A 4FI5A 1H7CA 2VKOA 3ETUA 4UVCB 2CWOA 2V7KA 4HKAA 5FYSA 5FY1A 1LVFA 4JEUB 5HXCA 4H63H 3M65A 2W0GA 5FWEA 4CQIA 5LBMA 1E1HB 3H37A 4PW8A 5KDMC 5LJNA 3FB2A 3AL5A 5HWXA 2V7MA 1ZKEA 3ZLIA 5IVJA 3WAKA 4UVAB 5JR9A 3WAJA 5LW9A 4PAGA 2IC6A 2X9HA 5A7WB 3JC6D 3C50A 3UULA 5LHHB 3HI2A 3O9XA 3TKLB 3UFEA 2Z6EA 5JREA 4CCMA 2Y8DA 3U3IA 4KBMB 5FP9A 3NZPA 1VOMA 5F2WA 1QSDA 3S4UA 4ZS3A 4GAZA 3MXZA 4AAPA 5FYCA 3KBTA 5TAOA 4PFOA 3RYFE 3ZMTB 2GP5A 4N78D 4H63V 5FXVA 5KX5E 3LD8A 5JDMA 5FP4A 5LGUB 5FZOA 5JQGE 1ZV4X 4FJOA 4PJJA 3MZKB 4O4HE 2D0UA 5M4YA 5IVCA 3UUNA 3KV6A 4NUVA 2DHRA 2X67A 3ETVA 3C4ZA 3KFWX 4C8DA 3DXUA 3IEEA 2K24A 5L3GB 5FZHA 5ISLA 1D1CA 2N1GA 4IGQA 1NAFA 5FY0A 4V2WA 2XAHB 5FY7A 2W2IA 4HONA 2ZMAA 3ESLA 3I0QA 2C5KT 4YJ3E 5F3GA 3BQLA 2P5BA 3P8CD 2JQQA 4OYKA 5J2TE 5FPUA 4H9NC 3T8OA 5FZDA 4QXHB 4PK4A 5K4LA 4X1YE 4HE8A 4TN7B 5FYVA 5LY1A 4IIJE 3C98B 5FZGA 1MMAA 2IC9A 1YW0A 2PJQA 3EVYA 4ILUA 3RYCE 4QKNA 4Y3OA 3JC6C 4AXPA 4EZ4A 4LXLA 5FYIA 2E9XA 2W00A 4IDZA 5L3DB 5IWFA 3PUAA 4AQGA 1YKEB 4IHJE 2YBPA 5L2LA 2Q9QD 5IVVA 3NBXX 5DQWA 5EK4A 3UUMA 5A7OA 2KNDA 4X1KE 2VB6A 5HXHA 3N9NA 4CCLA 4CCOA 2L3LA 2DLRA 5FY9A 3SRZA 3PUSA 3HA4A 2RA1A 5C8YE 4H9RC 1T98A 3KDSE 3N9LA 4OYJA 5LOVE 5LJMA 3LBXA 5FPVA 5FYYA 2XAQB 1B7TA 2OQ7A 5CA1E 3GN5A 4CCJA 5IVEA 4QX7B 4ZI3D 2XASB 2Y6XA 2XAJB 4O4LE 3EDUA 3FXEB 4AKHA 5JRCA 2KZ7B 5FPAA 1Y64B 4P0BA 2XMLA 4QU1A 2XUEA 3OJAA 2NTYA 1WRDA 4U74A 3AA1B 5LXTE 5FXWA 2V7LA 3AB3B 3ZJ1A 2LSGA 3RX6A 2VKJA 5L3FB 5FZCA 3KBUA 2CEAA 2LM9A 5JDNA 2X68A 2YINA 3ZN1B 5FP7A 2ES0A 2WWJA 2KLQA 4O2AE 4E7ZA 4XDOA 2LOSA 4DNDA 4C90A 5A7QA 4IE5A 3HKDE 1HF8A 3CX8B 5ANQA 3U4SA 3K8PC 5FZBA 4QX8A 2VL8A 1LKXA 4EXTA 2Q9QB 4L9IA 2KT9A 1IJ6A 4NUUA 2Q9QC 3WI3A 3PUGA 1MIWA 4E7SA 1G8XA 4DIQA 2LEHA 2A3DA 4QXCB 5LHIB 4QWNB 2NOXA 3CX7B 4CZZB 4X1IE 2VKHA 2OX0A 5FZ3A 5FZIA 4UF0A 3FHNA 3O1HA 3QUJA 1UCUA 5DABA 3LDBA 5FZ0A 2X66A 1VRBA 2V7IA 2KWIB 5E0OA 2VKDA 2JPFA 3F57A 3I9WA 3D0TA 4J2CA 4Y33A 1MIYA 3PU8A 5A80A 2CXLA 2W61A 4JEHB 4XZCA 1QUUA 5GONE 3AA7B 3W15B 4TX5A 2YEVC 2WMNA 2C5IT 4C91A 1Z0PA 4H9OC 3IBPA 4ZI3C 2D2SA 3J9X1 4PFPA 4BU2A 5E6HA 4KP3C 3C4XA 5F5CA 2DWKA 4XDPA 5ADXL 2BVLA 4BJNA 5FV3A 2ODVA 2PXJA 1D0YA 5L3BB 1D0XA 1IAPA 2Q8DA 3E08A 5F5IA 1BR2A 2W62A 3ANWA 2WBLA 5FXZA 5KR7A 3RKOA 4IGOA 4AI9A 5A7WA 2Y48B 2KINB 4TV8E 2PG8A 5FY5A 3IHRA 4CI2B 1MMGA 2SPCA 1FMWA 5LA6E 4CXYA 4DBRA 5CB4E 4PK6A 5A7SA 2ODUA 2CWYA 3FBZA 4HN9A 3KV4A 3UUXB 2CA5A 3R84B 4ASKA 4XBFB 5EK2A 3O4XE 2NW8A 4B6XA 5JR9C 5LCYA 2DI4A 4CCNA 5JVDE 3BK9A 3RYIE 4O8SA 4MALA 5A3WA 2XHEB 5LP6E 3L3PA 3AVSA 2JMKA 2E8IA 2E9XD 2D5UA 2QGSA 4MFRA 2CM0A 4GOUA 2V26A 1D1BA 4QXBA 3AAIA 4ISSA 2G0UA 3NJYA 3E0ZA 5IVBA 1ZEEA 2CLYC 2ZLYA 5FZOB 1G73A 2RP4A 2WSSV 3LFMA 5FZLA 2JMHA 3O1IA 5FZ8A 2HPJA 5A3PA 4UV8B 5F39A 3SOLA 4L5GA 5IVFA 4HOOA 5FZKA 2OA5A 3HL6A 3PE0A 5DJQC 1WR6A 3U78A 3UT5E 2XDVA 5A1FA 3MACA 2C5JA 4IE0A 3PURA 3LK42 3CVRA 5FZEA 5EZYE 5JDHA 4QXHA 4PJMA 3RRCA 4GD4A 2H3RA 4HTEA 1UX5A 5BMVE 3K3OA 4TN7A 5LG4A 2WM9A 3NRYA 4EOZB 4NUBA 4HEAA 4V1Av 2Q8EA 3N2GE 3Q9DA 4WBNE 4UV9B 4H9QC 4AKIA 1EZ3A 2N9DA 1D1AA 1HG5A 3LG7A 3UYJA 3I0OA 1LVKA 3C64A 2LT3A 3PTRB 3B57A 2WAUA 2CXDA 5FY4A 4JLEA 5F8PA 4MHCA 4ERRA 3RVHA 3OPTA 3B13A 5LGTB 5FP8A 2CCQA 4IE6A 4HFVA 4GJYA 2EHOD 5F32A 2E9XB 2KXPB 2VD7A 2K5BB 2E9XC 2L9QA 1HS7A 4AI6A 2V7JA 5IVYA 2BDEA 3MKDA 3N9PA 2LHRA 1U4QA 3OYZA 5A3TA 5LBQB 3OBVE 5FY8A 1UX4A 2I59A 4I4TE 5FP3A 5FYHA 5KMGP 3O1JA 2UXXB 3AVRA 1FEWA 4WNKA 5JH7E 5FZ7A 5F3EA 5IYZE 2LSJA 3LBXB 2OQ6A 5FJKA 3OKQA 4GK5E 4ANJA 4KUMB 3ZYKA 3CQCB 3GN5B 2V1DB 4QHOA 2LOPA 5LHGB 4X20E 4I43B 3CKDA 1US7B 2YU2A 2JRKA 3J7Yq 2EHOA 1MMNA 1CUNA 3K3NA 4K0UA 3HKEE 5FUNA 1ZHCA 2K48A 1BR1A 4IGPA 4BISA 4Y4RA 5LNKA 5JDFA 4CXWA 2X9WA 5A7NA 5AFUL