3U78A

E67-2 selectively inhibits kiaa1718, a human histone h3 lysine 9 jumonji demethylase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Analog of BIX-01294 Selectively Inhibits a Family of Histone H3 Lysine 9 Jumonji Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7
total genus 108
structure length 366
sequence length 366
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3u78A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u78A01
5FZ1A 3AL5A 5F39A 5IWFA 4QU1A 5IVEA 3KVBA 5FZ8A 5FP4A 3U4SA 5IVCA 4CCLA 5FZ9A 5FP3A 5FPVA 5IVBA 5FZCA 4EYUA 4QWNA 3AL6A 3KV9A 4Y33A 5FYBA 5FZDA 4ASKA 4URAA 5F3IA 2YPDA 4LIUA 2VD7A 5FP9A 5F3CA 5F2SA 2PXJA 5A7OA 4AI9A 3RVHA 5IVJA 4AAPA 5FYHA 5FZGA 5A3PA 5FZ4A 5IVYA 3KVAA 4IGQA 5FYCA 4BISA 1VRBA 3KV5A 3PU3A 5FZLA 4EZHA 4UF0B 5FPAA 4LITA 5FZEA 5LWBA 5F5AA 3KV6A 2OS2A 2XMLA 3OPTA 5FZKA 5A7PA 3AVRA 5A1FA 5FPBA 4BXFA 3N9QA 5FY8A 3K2OA 5FY1A 5IVFA 5FPUA 5LY1A 2W2IA 3PU8A 5A7WA 5F37A 5FPLA 5CEHA 2Q8EA 5A3TA 5IVVA 5FUNA 3K3OA 5FV3A 2GP3A 5FJKA 3N9NA 3N9PA 4CCKA 2OQ6A 5FP8A 2GP5A 5FYSA 5IW0A 4QXBA 5FZBA 5FBJA 3DXUA 4E4HA 3AVSA 5FZFA 5FZHA 2P5BA 5FYTA 5FZOB 5A3WA 5FYUA 2Q8DA 4LIVA 5FYZA 4BU2A 3PUSA 5KR7A 3K3NA 2WWUA 4CCMA 5FZIA 3LD8A 4CCJA 4CSWA 5A1LA 5FY9A 2YBPA 5FYYA 5A7SA 5F2WA 4GD4A 2Q8CA 5ISLA 5FJHA 3N9LA 2XXZA 5FWEA 5F3GA 3PURA 3LDBA 2OT7A 5FWJA 5A7NA 5FXWA 4TN7A 3PDQA 4XDOA 5FXXA 5FZMA 4V2WA 4IGOA 4LXLA 5A7QA 5FY7A 5FYVA 5FY4A 5K4LA 2XDVA 5FP7A 3DXTA 2OQ7A 2YU1A 2YBSA 4XDPA 5FZ6A 5FZ0A 3UYJA 4UF0A 4CCNA 4GAZA 4Y3OA 5FXVA 5F5IA 3PUQA 5FZ3A 4DIQA 4GJZA 3PTRB 4QX8A 5A80A 3KV4A 5LW9A 5FZOA 4QXHA 5FY0A 4DO0A 2OX0A 5E6HA 5FZ7A 5A3NA 5FZAA 5F32A 4CUGA 4D6RA 4IGPA 4C8DA 3N9MA 3ZPOA 3PUAA 2XUEA 4GJYA 5FUPA 5FYMA 4CCOA 5ANQA 5A7WB 4NUBA 4QXCA 3U78A 4HONA 3NJYA 5F5CA 2WWJA 4D6QA 4EZ4A 4D6SA 3OPWA 2YBKA 4V2VA 5FY5A 5FXZA 3N9OA 4Y4RA 5F3EA 5FYIA 4HOOA 2YU2A 3ZLIA 5LY2A 4QX7A
chains in the Genus database with same CATH superfamily
3CWZB 3AB0A 1WCSA 3PTYA 1LEDA 3RI8A 2I6HA 5HXRA 1JI6A 2Z79A 3DYMA 3K48A 2YK0A 5IVEA 4ZZ5A 4AQSA 4NRPA 3ACIA 2XSAA 3PUZF 3AX4A 5IFPA 3MDPA 1H9PA 2UXBT 2VZRA 3NV1A 4HK9A 4XURA 4XJ8A 3EXUA 4Q25A 5K7PA 4Q4W3 3KV9A 3T1MA 2D6MA 1XMQT 3QOFA 2ERFA 3CLPA 2WZIA 3IAPA 3VBSB 5C3RA 1ULDA 2AENA 3RZKA 1JZ6A 5C3QA 5JOXA 1NAFA 2Y6JA 5I0DA 5IVJA 4INDA 1O8PA 4CXYA 4YJ3E 5J37A 3BU0A 3HI2A 4R8HA 4GA9A 1BEV1 1MR5A 1KK7A 2AYHA 1LOGA 1YKEB 4JQTA 4QHZA 5D21A 1CQ9A 4UIGA 5B4XA 1S2KA 3SITA 2NR4A 2D3PA 4IDPA 4Q4V2 2IZWA 5FPVA 1MEC2 1MMDA 3ZN6A 1WCRA 1N47A 2CEAA 2BW8A 2XBO3 3O12A 1HF8A 2MAWA 2ET7A 5FZEA 5CB7A 3WW2A 1DQ4A 4AHYA 5FPXA 3JCIA 2OS2A 2W08A 5JUVA 4F6RC 2HBUA 2CXDA 4X65T 5ABJC 5DABA 2E5LT 2DCJA 1W8FA 2WO7A 3IDAA 5IK5A 1XNBA 2BZBA 4IXLA 1U0AA 2WNOA 2HYXA 4NHLA 2WSSV 3MKDA 5BNNB 3U3IA 4JHZA 3SFEA 1C1LA 3ENRA 3I59A 3UGHA 1BBT2 1CJDA 1NAEA 3FZKB 5HV0A 2JJ6A 1SMVA 1VRH2 2ORZA 3IEEA 1VBD1 2BVVA 2HWB3 2CYFA 4UBGA 3GGLA 1KNPA 5LHGB 2GP3A 4CCCA 3UU8A 4K40A 1QOSA 5FJKA 4JI3T 4A56A 3DYPA 1M06G 4FPGA 4AAXA 1LODA 3B5MA 5GONE 4MHRA 1LGNA 3HNMA 3WP5A 3LEGA 4IL9A 2WN3A 2RJLA 4CTEA 3AE9A 1UQXA 4A3ZA 4LO4B 1PM7A 3LJCA 3P4PA 3N5LA 3O1TA 3O1RA 5AQSB 4TNVA 1CAUA 4CCMA 1AJOA 2P3IA 1ZRIA 2ZGPA 1LOCA 1GP6A 3LZZA 4QPIA 5A7SA 3GA8A 1V70A 3N9LA 4YVWA 4UVAB 5F3GA 1IBMT 3I3QA 3HR0A 4YHHT 1XJAA 2OT7A 1BVVA 4HWFA 4N53C 4BDVB 1W0BA 1I94T 4NJ4A 3U14A 4FXKB 2FDIA 1WD3A 4XJUA 4JUYA 1DFQA 2HLEA 1S2BA 2J1VA 2JQKA 2YROA 4EV0A 4IV3C 2MOZA 2P34A 3RI5A 5ABGA 1NY71 3MBWA 4XJWA 5C9AA 2HWE2 2JDZA 3URFA 2VG9A 3UQ7A 5FMOL 5BNOB 2CWMA 1D4M3 5AQKB 5AQGB 2R6QA 3R4DB 1IS4A 4AG4A 1AR91 2AR6A 3ONJA 4CCNA 1A6CA 4COWA 4YARA 4HWIB 1CPMA 4AIUA 3MF6A 3ZO0B 5H9PA 4XVHA 4Y1UA 3ZYMA 4CEWC 2ZHKA 4FPEA 3OSDA 4NIDA 2FUPA 4JDNA 4QMAA 3G7DA 4IL4A 3I0OA 3NKZA 1W8HA 2QA7A 1OLMA 3AYAA 3F2ZA 4BIFA 3EVYA 4AI8A 5LRSA 2VZOA 3AK0A 3MW3A 5A3NA 4JI6T 5JR9A 2ZX0A 3GZAA 3WSOA 3ZKUA 3E5QA 5EYXA 4K7JA 3GXUA 5KXEA 2D5HA 4TYSA 4HK8A 4PIZA 2F4PA 5A7WB 4L11A 4DXTA 1MS0A 3NJVA 2PLV2 3UFGA 2LOSA 3LDQB 4QHOA 4QM8A 5FTTC 4E4SA 2H7VC 1XRUA 1XB9A 5IWAT 3K77A 3MIGA 4WM7B 1OXCA 1COV3 1V6MA 1RL3A 3AKTA 3AAEB 3OPWA 5DUWA 1RUE3 3ZSMA 5F5WA 4DMVA 5JIAA 1NLQA 3EAMA 3LSDA 2RMU3 3A7QA 3VHLA 3VBOA 2P6CA 2JMHA 2Y6GA 4DV4T 3NQHA 4L0PA 4CP0A 3IHRA 3UJOA 1J59A 5FZ1A 4XF4A 5JCTA 4LF7T 4QU1A 4RS5A 1AXYA 3OGGA 1H1IA 2OA5A 4YZ4A 2A3DA 3UJQA 4F83A 4W6YA 3MXZA 3MI8A 5JTGA 2ZGOA 2R072 3VHOA 4YPJA 4XFFA 1O3RA 5FWJA 1ZYBA 2NMNA 2A9UA 4HE8A 1R1A2 2YPDA 4GWNA 1BHGA 5SV8A 4YJ2E 1QNWA 2D6NA 5FVKA 3I3EA 3WUCA 4AI9A 4AWDA 1G7YA 1RVF3 5I8YA 1VAVA 2BG9A 3SXWA 3I59B 1WGPA 2CM0A 3QD6A 5LBCA 4D7SA 1R1ZA 4FPOB 4ZHNA 3SKVA 1WLWA 4NROA 3RF1A 1XNCA 1JN2P 5FK7A 3OYWB 4PLMA 5FQ0B 2DHRA 4QX5A 4YZ3A 3KV6A 3OKQA 1HNXT 4WBOA 1YWKA 1X82A 2Y26A 4HT1T 3WHUA 4YFZA 2KSRA 2BBJA 2J62A 1FMVA 3AE6A 3NNMA 4JTNA 4RYDA 4K21A 3A23A 2VBBA 4YVSC 4PAGA 5HEJA 2LW8A 2EIBA 1MVQA 1BEV3 3K1SA 1SLIA 5E1RA 3OB8A 1CAVA 3T1HT 2ENRA 2IXIA 1RUG3 3A7MA 2BS2A 2XAHB 1W6QB 1ZBA2 4PF1A 5AFEA 2Y64A 2W3JA 1QJZA 3OD0A 3QOPA 4AFCA 3ZMTB 4FFHA 3LBXA 4TN7B 2GP5A 3ZXLA 5EK2A 1WYCA 3VDDA 2VCCA 4CP1A 5CA0E 4E4HA 2W67A 1J58A 1HRI3 3PJAA 3PV0F 1K45A 2BG9C 3FHIB 5IT6A 4ZXLA 5J2TE 2JDNA 1UCUA 1YQ3A 3A5XA 3HA4A 1A3KA 1RUC2 1O3SA 2V6YA 2VQFT 1J5ET 3P6BA 4L9BA 2D5FA 1HFAA 5KMGP 1WMDA 1ZZBA 2JG9C 4JV4A 3AEGA 5F2WA 1ZKEA 1UCXA 5FJHA 4RS5B 2ZPXA 3PURA 4LPLA 5I91A 4W50A 3I8TA 2CWOA 2W62A 3R84B 4TN7A 1UKRA 4YM1A 3M3CA 3W9AA 1IPJA 1VJ2A 2BNMA 1DYKA 2CMRA 4ZZBA 3RH3A 2ZA9A 4CN6A 3N3HA 2JIJA 4FP3A 4HZFA 4N9HA 3WF0A 4Q4V3 1YQ8A 4NIGA 1MEC3 3BTAA 4HWCA 4O4HE 4Y1YA 1V6OA 3BU7A 1VR3A 4GXLA 3BQIA 1F5FA 4NAOA 3KWVA 3T0DA 4KWKA 2R043 3LAGA 4HANA 2H88A 2PG8A 4XFHA 2XG3A 2VNGA 1SE7A 1G6NA 2C9AA 4HVOA 5FCCA 4AI1A 3HKBE 3PUQA 3LK2B 4O4IE 4HFHA 2VM9A 3PUYF 1S2EA 4HTEA 4A3XA 5HCHA 2EA7A 5C7GA 4FTBA 3E5XA 2XASB 4I0BA 2FBWA 2ORXA 3AJYA 5KHKA 2RS13 4KG8A 4M0NA 4RSUA 1X50A 3ZFGA 2ZGLA 1OH3A 1XYPA 3DPRC 3FLRA 5AQUB 5LZ6A 1W3VA 2FMDA 4IDQA 3Q8EA 1EV12 2ZZQA 5ANQA 5JOZA 1UXZA 4RQPC 3IM0A 4QXCA 4YRDA 2E7TA 2YXSA 4TSVA 4R9CA 3SC7X 1FPN3 2EIDA 3I7DA 4OK0A 2WWJA 3MIFA 4EV6A 4XTPA 1MQTC 3JUUA 4OMCA 2OYZA 3POGA 2XZEA 4IIJE 2XJSA 4AF9A 1J3RA 1WMEA 3FZLB 4U7YA 3BK9A 2RP4A 1QJY3 2K24A 4U2ZA 2J7MA 5C3SA 4GKXA 4CP9B 2WNVA 3D8CA 1R092 4JI8T 4Q8LA 2E9XB 4XW3A 3E1F1 3J8F1 3AKSA 4JTOA 1QJX1 3B13A 2RJKA 1EYBA 1JXNA 5J1GA 5IVCA 5KHJA 2IUBA 2XKOA 3ZDSA 4QM9A 4FQ4A 1JYCA 2L9QA 5J0ZA 3ZXFA 2A7AA 4FPHA 1RUE1 2GU9A 4Y22B 4URAA 1OF4A 4OQ8A 3ZYLA 4IW3A 2IUWA 4QGNA 1WZXA 2PHUA 3O1MA 2VUAA 1JH5A 1WMFA 5KXDA 1NWMX 2WABA 4CUBA 3S5AA 1QJFA 1ASJ2 4Z8XA 5L73A 1DDLA 4UW5A 2XJUA 2ZXQA 1Q8PA 4H9QC 1XMOT 2VMHA 5FZGA 4IGQA 3CO2A 3ZSJA 5F9TA 4WYVA 4CQIA 3UGFA 4BQYA 4OI0A 2KLQA 4BJNA 4Z90A 1DZTA 1V9U2 4B3MT 4KL1A 4XXAA 1RHI2 4MGSA 4PJJA 2UWBA 3H1WA 4QB1A 5HXVA 4ZEYA 3NWIA 4UFMA 3FLPA 4NXMT 4GMP1 4Q4W2 3RZLA 3T08A 2BKNA 3B7MA 3ZFGC 3H50A 3VR8A 2ZX4A 1O7FA 2AEYA 3MIDA 1UYZA 2P9BA 3LBXB 5JAXA 4FI9A 3NRYA 3ROUA 1S0IA 2WNUB 4GQ7A 2Y0IA 4A4AA 2DLRA 2XAFB 2WWVA 2BEOA 2DNXA 4GKJT 2BBHA 4H63V 4DV7T 1OHFA 4OX9T 3RYHE 1W9TA 3CL1A 3DCQA 4K1YA 5FP8A 4LBKA 4Y5Z0 1W6PA 1R091 4H9RC 3OYXA 1KQRA 3ACFA 4JGYB 2DYCA 2BDRA 5DUVA 3I2DA 2KR2A 3JD71 3V56A 1QJX2 4K6BA 3MLLA 4IERA 2FHRA 4B3NA 3EUHA 2RS31 2V72A 2N7GA 3S7IA 3K3NA 3VBHB 1RINA 5ETWA 2VCMA 3W5MA 4U31A 5FNVE 5FYYA 5CG9A 1QGLA 1R1A3 1HG2A 1EY2A 3VBFA 3QC9A 1BVP1 3B9IA 4KWUA 1NCRC 4NVPA 5A7NA 4BQ3A 1UY0A 4HN9A 5EIYB 4XCBA 1ULCA 3ANWA 1OD3A 4Y20A 4XZCA 4CXWA 2X5IA 1ASJ1 3LIGA 4G4FA 1ZREA 2BRTA 3T2OA 1XNTA 4O2AE 2AACA 2PQSA 3BALA 1QUUA 1YLLA 2AH2A 5AVAA 1PGW1 1BXHA 1HB1A 3G6JB 3KGLA 2WO2A 2PLV3 1FMD1 5FMDA 3VHNA 2IIUA 1O59A 1RUI1 3ZFFA 4AEMA 4N78D 2WU5A 2QFEA 2JRKA 5JRCB 3H8UA 4R9AA 4C0HA 4LFAT 4AISA 4NHKA 4AI2A 5E0OA 4AXOA 4FO9A 4IESA 3VB9A 4CCDA 2QQWA 4Q4W1 1O4YA 1R082 2XM1A 4Q4V1 1OPOA 1H2LA 2JE7A 3Q2MA 4GYRA 2I0MA 1HQWA 3LIHA 4EAHA 5FZAA 4WV8A 2CY6A 4CUGA 1SUMB 4OUEA 5IK4A 5JOWA 2XUEA 4GH4B 1BMV2 5JDBA 1HV0A 4TV9E 2OUHA 2XJRA 1QLBA 4AEDB 1ZRDA 2Q1MA 1D4M2 4AEJA 2QBXA 3OF1A 1MS1A 3EO6A 3NJXA 2UU9T 4OZXA 2VKOA 2PHTA 4HEAA 3P1IA 4R4XA 1LAJA 3C64A 3AEBA 4L9IA 5KXCA 3THPA 4BJMA 3DPRA 2GN3A 5CFCB 1W0OA 2D43A 2A6WA 2P6HA 2J42A 4HOOA 1VBC3 1BJQA 5DPNA 4XHBA 2P3JA 5LY2A 4LHKA 4PDWB 3HN3A 3WVJA 4AI0A 5HXCA 3ZM8A 3QH7A 2FJEA 4DUYT 2ARAA 1DYPA 4RR3B 1TME2 1K5MC 5FZ8A 2R041 5L9BA 5FZ9A 1ZZ9A 4IV1C 3RFRA 5FP3A 2QQKA 2G4IA 3TAYA 1HX6A 3HKCE 1ENSA 5KHIA 3GJBA 2IW5B 1EUUA 3BUCA 2CGPA 1LEMA 3E22E 3NV3A 4RR3A 3P3PA 3R4SA 3LA3A 4JEHB 2NPIA 1IZ3A 3NNFA 4TWHA 5DAWA 1AYN2 3GZUC 5GLZA 4AGRA 4CU9A 1RUE2 2H6CA 1CVNA 2PELA 4MYEA 4P9GA 2QKDA 5C9AB 4UFKA 1PX3A 3KT7A 4GMP0 4LF6T 5GJ6A 1PO23 5A33B 3VD7A 4E8DA 1UU4A 4P08A 1Z7S1 4Y24A 4CDWC 2WDVA 2X9YA 2XAQB 5LMNT 3T1YT 1KFXL 1VIWB 2J1DG 1NA1C 2WFF2 2E9XC 4QD2A 1KJLA 4L8QA 4ZXKA 5FKBA 4AEDC 2WLQA 4QPIB 5I0UA 2OKXA 4Z82A 3T4VA 3VLBB 4E4ZA 2G1MA 5C8CA 4ERRA 3UK9A 3HEIA 5GZEA 5LA1A 1EV13 3Q9OA 3ONXA 1CAXA 3HVDA 1BMV1 1RUD3 2EAKA 3RPUA 1UOBA 5JR9C 2FJDA 4BJ0A 2CRBA 5EZYE 2C24A 4A7KA 1ZRFA 1UIKA 3FHQA 3WDWA 2DBNA 4U2YA 1U12A 5JMOA 2LSIA 5EV7A 3WAJA 2E9QA 1ULGA 4FPKA 4MXVA 5E16A 2W92A 2NTXA 4JI0T 2WKKA 5EHDA 3VV1A 2JKXA 4QKFA 5AC91 3W21A 1W0NA 2R32A 4B3TT 1WMXA 1MS5A 2B46X 4OCTA 5D2AA 4QGMA 4KU7A 2ATFA 5LBEA 3T4HB 4DV5T 4QKDA 5LB6A 4I0WB 1MQTA 2CLYC 1N3QA 1DGWX 3M7AA 5A3MA 3PUSA 4J2CA 1IG0A 3VBSC 1IPKA 2W91A 1GWKA 2JX9A 2VZ1A 5T52A 2CWYA 3WQBA 2QYWA 2RS32 3FJSA 4E2SA 3ZEFB 4AKGA 1ALYA 1RUG2 2JDUA 4XBNA 2DBIA 3O4XE 1CX4A 3D4KA 4FCAA 3MV01 5IATA 2EXJA 4HFCA 1LULA 2ZMNA 2RMU1 3TYJA 4XAXB 2B42B 2V7MA 2D6OX 2TNFA 2XDVA 3HNYM 4WVVA 4DUXA 4HFIA 4E27A 3T8OA 4Q2FA 2M67A 4V1PA 1X33A 2CGOA 5JDQA 2UXDT 5HEHA 5HWYA 2FJAA 3V5SA 5BNQA 3RIUA 4DEQA 2CLYB 4C91A 1FMD2 1W6MB 1Q8VA 2VH9A 4IEPA 4XBLA 1APNA 3AE5A 2MPKA 4PT6A 2NP9A 2OPKA 1VBA2 3JB4C 2BUKA 3I2OA 4PHZA 4AGVA 4X6QB 2QRXA 2E7QA 5L2LA 2WP9A 3FHAA 2WA4A 4AK3A 1OA4A 1R093 4BZ4A 1YO8A 3ZR6A 2BQPA 2QGSA 5FZ7A 2BV4A 3S30A 3HKEE 3MW4A 3ETPA 5DMYA 2OIIA 2D98A 3N9MA 2JE8A 2V4AA 3AM2A 1AYM3 3PDYA 3NAPB 4YW1A 1LU1A 1H6YA 3UKVA 1JOPA 3QLQA 5CU1A 3R6SA 2A6VA 2WZR1 3NJYA 4L92A 1US7B 2WUHA 4W6XA 1C5HA 2YZ4A 4NPPA 2F4LA 2W2UA 2W5FA 2XL7A 2IMLA 4XC9A 4QX8B 2MBGA 3B93A 3NNLA 3POJA 4YW6A 2WJSA 2UYAA 2ZMKA 4UXAA 4XPVA 1W9RA 1SA0E 5LXTE 5HCBA 4CZZB 3RZJA 3CZJA 2BGPA 2BGCA 3L09A 1W6PB 3Q8BA 4HBNA 3UUBA 2OLTA 4NUVA 4QPIC 2WNEA 3TBDA 4ZPIA 2HJIA 3VKNA 3ZYHA 4RL7A 4AQ2A 1A34A 3BVCA 5CADA 3P3NA 4KGGA 1Q56A 1RUG1 3CIRA 4Y22A 3IAQA 5LMUT 3LOIA 2CDOA 4CCLA 1OWAA 4H3WA 4LMKA 3NVCA 5DJQC 2PHWA 3BN6A 4KH9A 1DQ2A 1JODA 4OHFA 4A7ZA 4BQ5A 3AEFA 2V4VA 2R49A 4QWNA 2FDHA 4XBFB 4HGAA 4Y26A 2W0XA 1GV9A 3JBG2 3KF3A 1D4VB 4LMLA 4NOTA 1JZ4A 4NRQA 4HFVA 5F2SA 3AE1A 5DQ0A 5J1XA 1KXGA 1JYNA 1UYPA 3A0KA 4X62T 2IXJA 4PBPA 1HG5A 2EHOD 3RIFA 1EZ3A 1AYN1 3M2MA 5FYHA 3TN91 2DF7A 4ISQA 3ZXEA 2QUOA 2IXKA 1W6OA 4LBMA 3SEPA 3FZFB 4CXXA 1DHKB 3O0WA 3VHRA 1DQ0A 3ZCIA 4FT8A 5JSRA 1GBGA 5T3NA 4LITA 4LMFA 1G9AA 3DPRB 4QPYA 1LNSA 4JGYC 5EPAA 3OJBA 3BCWA 1CN1A 4KI0F 1WW6A 1GQGA 4GWMA 2WNVC 1MEC1 3D0TA 4R9BA 4B3RT 5C8CC 5ABFB 2ZMLA 3WOGA 1WW4A 1ND2B 5J98B 1REFA 3AE2A 4AEDA 2VVDA 5J3UA 1D1AA 2Q9QB 1HXS2 3FUOA 2ZBJA 4I55E 3S57A 1MMGA 3RQWA 5FOJB 1ACCA 3KS7A 5FUNA 3K3OA 3TLUA 1W8OA 1AF9A 2ACXA 2IC6A 1JS9A 1QQP3 5E8AA 5LEJA 3VBUB 1KEXA 1XYOA 1QDOA 4PQQA 1PGL2 3JB8A 4AHXA 1RUF1 5EZWA 2NZ9A 3AJZA 4DMWA 5ABFA 3T0BA 3ZN1B 4A6OA 5JXIA 3TNPB 4EN0A 5FYTA 4LKFA 1KNZA 4B6XA 3FHNA 2DUQA 2HHHT 1QJU2 3NRUA 5I0TA 1OEDE 5H6RB 2ES3A 3K3QC 3ACGA 1DBNA 3ORJA 4OYUA 5FZIA 1JOJA 2LRKA 4AHZA 4CSWA 1K42A 2J4GA 4K0KT 1US2A 1PVC3 4I0AA 1AX0A 1XC6A 5LASA 5LBBA 5HCMA 2LHRA 1AR82 4ILBA 1I6ZA 3ZYJB 2JIWA 3JBG1 1UU5A 3PDQA 5SV5A 4IE0A 1UY1A 1L7QA 4DZGA 2E31A 4HFDA 1R64A 3UUXB 1UUSA 1V0AA 2IXCA 1IPSA 4KQ7A 3ZR5A 1ZHCA 1W9SA 2F17A 2WT0A 4CEYA 1K3IA 1V6IA 2UYBA 3B3QE 3X1DA 1GNZA 1SPPA 3UU6A 3M3OA 3QCWA 2ZX3A 1WRDA 2X53S 1HN1A 4Z2WA 4NHMA 3CBNA 2Y6FA 2PMWB 1GWMA 4H14A 1CUNA 4UF0A 5T5JA 4Z2AA 4B4QA 5C3PA 3QUJA 2EIGA 2GALA 4LE3A 5F5IA 5AQMB 2H0BA 3O0VA 1JW6A 1MVEA 2BGOA 3IWZA 3LG7A 4QQHA 3ZMNA 2HWF2 3IDBB 1CZVA 4COZA 3H8OA 2YV8A 2Z42A 4QX8A 4JBWF 3SQOA 2WS3A 4J1XA 2KZ7B 1Y4WA 4OYKA 5LK5A 3V0BB 1DYOA 3ZJ1A 2HWD1 5E6HA 4X20E 1V9DA 3AZVA 4FFIA 3ITQA 4XACA 5CB4E 4ILAA 5AQHB 5LGTB 4EWEA 1UMZA 4LKEA 5FYMA 5LYJE 2E26A 3WZ1A 1B35C 2JDMA 1OBNA 3J8F3 1CZSA 1XZYA 3AFKA 4L99A 3USUB 3VL8A 3RIAA 2Y6KA 4XUOA 2VW2A 4I2OA 3RLFF 1OSGA 1RJ8A 4D6QA 2RS53 3NAPA 4NMIA 1NG0A 1KJRA 3CX8B 1URXA 2DCZA 3U11A 4AFMA 5ACA1 4DV1T 5AQPB 3ABVA 3L8RA 4DNDA 4CU7A 1J1JA 4E2QA 3RYKA 3ZSEA 3O7OA 3D6EA 2ARBA 1NA1B 1JUHA 2OZ6A 4IV3B 5IWFA 2YN6A 3O1VA 5FMCA 3U1XA 1GQEA 4GYSA 3FBYA 4EE2A 4HKWA 2D5UA 4OHZA 4ASMB 1ULEA 2QQPA 2YHJA 4K8FA 4CDWA 1WLCA 4QH1A 4AQFC 1DU2A 1FNYA 2I74A 2R0HA 3HT2A 5FZCA 3UESA 1T2XA 3ZN4A 1XPWA 2VWAA 1YFYA 4RFRB 4Y33A 4M3CB 3IMNA 4OULA 4OUMA 5J48A 2LRLA 2DWGA 2RS11 3PJYA 5K8SA 4DR5T 3W59A 1YYNA 3AEDA 4TWDA 1Y01A 3ONLC 2YDEA 3H3ZA 4WVZA 4E4DX 3RNSA 4TV8E 2Q30A 1AYM1 1PIV2 3MFAA 4U36A 1MQTB 1FV2A 4XF0A 3WDXA 1JTZX 2KD7A 2PAEA 4ZY9A 1WD4A 4OHWA 2J47A 4WBNE 1J83A 4P9YA 4QH4A 2KINB 3HT1A 2X05A 2D93A 4COYA 4EXTA 1AL21 3BB6A 2G0UA 1QF3A 1OXZA 4TWTA 1RB8G 4A41A 3WG4A 3HQXA 1FATA 3CEWA 2W87A 2XONA 4EB6E 1J3PA 1RITA 1BK0A 2X5IC 2FBEA 3KF5A 4OZOA 3RS6A 4XCAA 5LY1A 2GC1A 2ETEA 1AYN3 2BJSA 4CEYB 3TLTA 2VVNA 3UU4A 2K46A 1ZOYA 2RS33 3VGIA 5C70A 2MEV1 4XQDA 1PO22 3AA0B 3JQWA 5L4EA 2WO3A 5JZGA 5FV3A 3PNAA 1RGSA 2LT3A 3S4UA 2A71A 3J7NA 1TEIA 2CL2A 3H42B 3OUHA 2UY9A 2XY8B 2A5ZA 2OQ6A 4CCKA 4EJRA 5C4WC 3P4RA 4QXBA 2VZSA 1YC61 2VZPA 4MXWB 2RR12 5LB7B 2ZHMA 1VAMA 5B2GB 3A21A 4XABA 4BOWA 3GHNA 4DB5A 2BU9A 2DU0A 2JJ9A 3PE0A 1HR0T 1ND3C 5DQWA 3NMBA 3CKHA 3PIJA 5DAXA 4CI1B 3T2TA 4BQXA 5HXMA 4CDUA 2E63A 2FCUA 3J4UH 5ISLA 4YXDA 5L3DB 3OJAA 1PMJX 1TMF3 3A0NA 4RHV2 3VBUA 4P0AA 3WDUA 2BP6A 5FZMA 2Q0AA 2VQTA 1XSQA 2RS12 1NZIA 4JGZC 1RMU2 4LORA 4YGDA 3F95A 1JBCA 1WBFA 1DQ5A 2R0FA 2VXJA 5LCWL 2AZ5A 4MX3A 4LFCT 2XBO2 3GZTB 3ZXKA 1YEWA 4L2NA 3X29B 1WYBA 3BQKA 3CX6B 5AQRB 2CA5A 1V6KA 3ZN0B 1ZA4A 2HBTA 3GBWA 3VBFC 4QPGC 5IK8A 1O3QA 1FEWA 3V65A 1PVC1 4A6SA 4RFT0 5FXVA 2LSJA 3IBPA 1MS9A 2LKGA 1XDOA 5IHRA 3UUNA 3FBZA 1NCQA 1YQCA 1BBT3 1X79A 1QKQA 1VBE2 1KDMA 2A72A 4UV9B 1UZVA 1M4WA 3DV8A 4DIDB 1RC6A 1WWYA 1W09A 1D2SA 4WM8C 1VBC1 4KG0A 4RGAA 2WAUA 2PFVA 4BMBA 1CESA 3RGBA 5F8PA 2VQUA 5AFBA 4NUBA 1FAYA 5GZGA 5JQGE 3OUIA 5ADXL 3DKQA 5JPNB 1I5ZA 3O1OA 4M1PA 1E5SA 3NNJA 3JBG3 1SBFA 1D1CA 1KF6A 1GZ9A 5FFOC 3L39A 1MACA 1EV11 2IFRA 3RG0A 5FLJA 4XHXA 1YW0A 3WW4A 3DL3A 3K4DA 1RUD1 1ASJ3 1W90A 4N7UA 2YU2A 3ZLIA 4QPWA 4QX3A 1OURA 3OGRA 2VOXA 5T5PA 3OPCA 3AAAB 4CDWB 4DMIA 5A32A 4Q1RA 4OMDA 3PUWF 2XJ7A 2QQUA 2X9XA 3ZMSB 2PLV1 2QVSB 4N53B 3EMRA 1KRIA 4AEKA 2L9LA 2DCFA 1HRI2 1VBB1 4JRLA 4OQ9A 1JYTA 5L36A 5I8TA 1YFXA 3H0OA 1UY3A 4CVUA 2LM3A 2JMKA 2RS51 3GDBA 1RMU1 2DCKA 3RYRA 1VRH1 2BYVE 4RA0A 3THDA 2VGDA 5ACA3 1N3OA 3T09A 4ASKA 5JPMB 5F6KA 1SDWA 3AZWA 4DR4T 1EAH3 2NMOA 3EQEA 2W46A 5F3CA 2EHOC 4N53A 4CDXB 1Z0HA 4QHBA 1FOD2 3RRWA 2O1QA 3RVHA 1QU0A 2VVSA 2EVXA 3B57A 3ZKRA 2WB5A 2JXAA 3LPFA 4M3CA 4P9WA 1VRBA 5JXHA 1PZ9A 1US3A 2Q4SA 3MEPA 3R6NA 1S4CA 5EP9A 2ZEZA 4YWAA 1W6QA 2E5VA 3QB5K 2AEZA 2WS93 5F5AA 4IT4A 1W6MA 2XMLA 3RZGA 1CAVB 4C90A 2XTLA 3AVRA 2CNAA 1YD8G 1G8WA 2YOEA 2PTMA 4Q4Y3 1PVXA 2ARCA 4BQ4A 3C7EA 2IXHA 4YGEA 1IBKT 4PFPA 4QXHB 3WNOA 3IPVA 4CCEA 1XWMA 4LMJA 3QH6A 1Y3TA 5A7WA 4TZDA 5I0RA 4KU8A 3P4QA 3OD4A 1XSRA 2EF6A 3E6DA 1KITA 3ZMUB 2Q8EA 5IVVA 2A3YA 5KXBA 4GK5E 3O0XA 4PK5A 3RYPA 3N7MA 2NW7A 1SDDB 4F8AA 2PA7A 4IL7A 3SEEA 2V7LA 4MLKA 2Y48B 1J1LA 2JD9A 4QPGB 1UN1A 3TOJA 4A5XA 1J5WA 1KNRA 2XKPA 1W6NB 4O4JE 1FPN2 1H2NA 1MZFA 3C7HA 3HWJA 4M0HA 4QX0A 4P0BA 3J7Yq 4D7TA 1JZ8A 4COFA 4RGKA 3ZSSA 3VKOA 1IS5A 5EJ1B 1G9DA 5BNOA 1SHWB 4HXCA 4G3YC 4RS5C 1Z7S3 3ELNA 3O1UA 1JYWA 3FBLA 3PUHA 5AQFB 2VO5A 2VZTA 4L97A 4UYBA 3UV9A 5M0TA 2IVIB 5IYZE 3HIFA 3LDBA 4ISTA 4JYAT 2VC9A 2ZLYA 3U75A 4XDOA 5KXJA 2PTFA 3O1JA 5FRAA 2VCBA 3HMYA 4ZZCA 2VZVA 1FOD1 3BYWA 4K20A 3ZKYA 4K0UA 4X1YE 4MGQA 1CIWA 3WINE 4AVAA 3CDZB 4LBLA 4B7EA 3V0AA 2VBDA 1O4ZA 1MNEA 1PNGA 1MS3A 1UZWA 3DXTA 1RUJ1 1HN0A 4G2AA 4XDPA 1O3XA 2O14A 2IAKA 5DAQA 1ZV4X 5K0UA 3KM5A 2FCVA 2WA3A 2KXLA 2I59A 4NPRA 1FT9A 1K5MA 5FVLA 2K0GA 1LB2A 4NIQA 1E1HB 4H9NC 3UT5E 2VTFA 2YYOA 2ZAHA 2WC2A 1X8MA 1PGW2 3RSJA 2XQ6A 1OOPA 3L9JT 5FKCA 4IUGA 4XBQA 4META 2QQLA 3ME2A 3B94A 2VNOA 3BTZA 1O4TA 2X29A 4URTA 2XQ8A 1OUXA 4N8MA 2VU9A 3K4AA 1BR4A 3OG2A 4GH4C 5J09A 4M3CF 2XSBA 1P8JA 5DXDA 2C0SA 1BZWA 2EXIA 4GJYA 4HKOA 1Q8SA 4I3PA 3WDVA 4A44A 4B7KA 4D3WA 2W1WA 1U5XA 2ZS6B 1ULPA 2D2SA 3RJRA 3ZCJA 4AQ6A 1JMUB 4DRVA 1MMAA 3T2QA 1OOPB 1Z78A 3UT0A 3OBTA 1X9TA 2NQYA 2SLIA 3M3IA 3ZMZB 1H30A 1RXGA 1QIQA 3S5QA 3E5UA 5CISA 2XR4A 2WBKA 5JVVA 5KHHA 4YZ2A 2BG9E 1MNDA 2ADEA 3IN9A 4I09A 3OTFA 5C8YE 4CDXC 2XQ3A 4ZI3D 3V64A 4YFWA 3MLKA 4CDUB 5HCAA 3FXEB 5FMBA 4LOTA 5CFCA 1NXMA 2VR4A 3SISA 3UETA 3BPZA 3I2HA 3DP7A 1SCSA 2PQQA 3PLQA 3Q8AA 5JDHA 4JKMA 3RRDA 2MNGA 4BB3A 4D7YA 4PW8A 1S0GA 4X1KE 3J9X1 4YVWB 1MPXA 2G9GA 3WNMA 4DR1T 1F5JA 2VMFA 1JZ7A 2JDHA 3AL6A 4QQLA 3UNPA 2I2SA 2R042 3INAA 1ZBA1 4LQRA 3ZYRA 1ZBE2 1JNZA 2L3LA 1C1FA 4A98A 4XOGA 1E7PA 1S0FA 4MGKE 4NHYA 5C71A 2FMYA 3OBZA 1TG7A 1ZX5A 4COVA 4YSYA 4DV0T 4EN9B 4UBHA 4FVVA 4AQFA 4JI4T 2WYFA 4LJHA 4N43C 4RQPA 1H2MA 5IVYA 3N4MA 4A7YA 1ONAA 3VKGA 4BISA 5L3BB 3RC8A 2H0VA 3AP5A 4YTMA 3I2FA 4BLIA 1GP4A 2J1UA 3H7YA 2RE9A 3VZJA 5C4WB 3RHWA 1XNRT 3NWKA 1O5LA 2LUWA 2DFBA 3IT8A 3JAFA 3Q5WA 3AMHA 4J1WA 4JHTA 3WCSA 4HLTA 1NY72 1OI6A 3KBTA 4AVCA 1XNQT 3GM8A 5JMCA 2YC2A 3ZC0A 2WFF1 2GNMA 4LE4A 3VHPA 2G9ZA 1T8BA 1KDKA 1G9CA 4NE9A 2B9UA 4ZI2C 4OYJA 1LOFC 3SKJE 4MHUA 2GZWA 2GNTA 3QACA 4MOAA 2WRAA 3MW2A 4Q26A 2X9HA 2RDSA 1UF2C 4XJZA 4FSJA 4COUA 1J1TA 4OFGA 3O1SA 3LWCA 4BK5A 4MXWA 2OVUA 3MUY1 1QSDA 1CD3G 1UURA 3POIA 3I2JA 4HMZA 1G9FA 1XQNA 2UUCT 4N43B 3D5OA 4QXKA 3TWIA 1CZTA 1RMU3 1XU2A 4LF8T 1PHMA 2QQJA 4O61A 4GKKT 3TB0A 1ULOA 4BQ2A 2OW4A 4Z8BA 1W2AX 5DZEA 3QBQA 2W1QA 4QX7B 4HFEA 2ZCWA 3TEYA 1C8M2 5FZFA 5T5OA 2VKJA 1WA6X 5CA6A 4IGUA 4N43A 1IGOA 3U4XA 2VVEA 2MTQA 1F35A 1PZ7A 2JG8A 3IIAA 4UV8B 2JQ9A 2VL8A 2FDJA 5FYZA 3MO4A 2W61A 5T50A 2K3WA 2WIIB 3LDKA 2B4KA 5FAXA 1FMD3 3RMYA 4B29A 5C9AC 5EWSA 2Q5TA 1OA3A 3HN1A 1QXPA 2VUDA 2Z5WA 2DTWA 3CPZA 4U2AA 4XFIA 3RWNA 4AI6A 2VVFA 3HKDE 2XLAA 3VZOA 2YKSA 1B09A 2WS91 3J26N 4LLOA 5C33A 1T6GC 1NT0A 4WZCA 1H8TC 3AE3A 4AXPA 3FBMA 2UUBT 1NCQC 3NJZA 4P02B 3SH4A 2ZHNA 1C28A 5FY4A 2H6BA 2VNRA 3M1HA 2P3KA 2W1UA 1LHWA 4QQ2A 1TQ5A 2B39A 4LBQD 3CJXA 2PN5A 3KHBA 3RZHA 1RHI3 2DUOA 3G06A 4HN0A 3B5LB 1GZWB 1DZRA 1GOHA 1ND3B 4X8PA 2R071 5EFUA 1GZCA 3WD5A 3KHCA 4GULA 3ZDVA 1UW8A 3C8XA 2XH6A 5GZCA 2XQ9A 5FZ3A 4KHZF 4ORFA 4GJZA 1XYNA 2G19A 3MYXA 1FXZA 1VALA 2YFUA 4D94A 1HCIA 1FIOA 4QXHA 2VZUA 4IEOA 4BPZA 2WDRA 2RDRA 2ZMAA 2BS4A 3N7JA 3O9XA 1RUJ3 4YZ1A 2VTXJ 2V5DA 2DFCA 4QB6A 4AR2A 3CQOA 4OVEA 4WM7A 1XNAA 2DU1A 2VULA 2VASA 2BKOA 3ZC1A 3J9SA 1HJFA 3I3DA 4LTAA 5CGMA 2BKPA 1HIXA 1PZ8A 4X64T 4ARXA 4EN7B 3RJ2X 3B9CA 3C7GA 4IHJE 5L4HA 1N36T 4BQ1A 4GWJA 2D97A 3K46A 5C4WA 2EHOB 3ZYFA 2BNNA 4B1MA 2WZEA 4M3CE 1LOBA 2UWAA 3ZYBA 1YKHB 4Y4RA 5FYIA 1AJKA 2NP0A 3P8CD 1QJEA 2OUJA 3THCA 4GIQA 4AVVA 1UOFA 2R1DA 1D4M1 3M65A 3WNXA 4IV1B 2Z6EA 3LKJA 2ADDA 5FO8B 4NN0A 2DVFA 2A73B 1YIFA 3PMSA 5CAZA 3VDBA 3IKWA 4JDMA 3UULA 4LK7A 3CKDA 1ZA7A 2HWC3 1FNZA 2LM9A 2C5DA 2RDQA 4CI3B 5M4YA 1L3JA 1NE4A 3D3AA 3KT4A 3ZIWA 4ARYA 5F3IA 2ET1A 1KFYA 2VL0A 1X8EA 4L5GA 1H4GA 1CAWA 3AA6B 2W63A 2DVBA 1Q8QA 1KD7A 3CJIC 5L9RA 4DUWA 3TLSA 4AKHA 5L47A 3WY6A 1K5JA 4UW6A 4LUKA 4MUVA 3AXJA 1WUVA 4A97A 4Q4X3 4CYDA 3KVAA 1UU6A 3E6CC 3JADA 2N2NA 4YLHA 1QQP2 4PIYA 2BVMA 4PIXA 5FYCA 5I8SA 4CDUC 4ZU7A 1LHNA 1YCIA 2P2KA 4BYYA 5CKNA 1GZWA 3C7FA 4FPFA 4FPJA 5IJRA 1UX6A 1TE1B 3FXDB 5C5UA 4NIIA 2WZPP 4Z92B 1F4HA 1H0BA 2Y33A 4KBZA 4QQPA 4S2HA 4BXFA 3WUDA 3AYEA 1I6XA 1SFPA 3VKHA 3RZZA 2Z4FA 1VBA3 4CDQB 1LOAA 2WSUA 3VZLA 1I5PA 2NTYA 3VD9A 4LEJA 1UKGA 2GSYA 5A6ZA 1NQDA 1SLLA 5L7OA 1H6XA 2JICA 2P17A 1YXWA 2V09A 3FX3A 2JG8C 4CN4A 3CJIA 3GBFA 3H1YA 3I2GA 4ZZ8A 1HTJF 2ZGQA 4EWAA 2XLGA 4FTSA 5J7MA 2XHEB 3KCYA 4I02A 2ZEWA 3AZYA 4FOQA 5AQTB 2GNBA 1F31A 1D0HA 2HWE3 2YUEA 3AP9A 5IW0A 1SQ4A 4KI5M 3VBFB 2YFZA 4JV5T 4FTEA 2VBPA 4YM2A 4YVWC 3T1LA 2QZ2A 3POYA 2WWUA 3WF3A 5IAVA 2BOJA 4BQWA 2C26A 1OVSA 2BTVC 2GK9A 1W8UA 4IETA 4K9SA 5FO7B 2HPLA 1PMIA 1HS7A 4LULA 4QX1A 5AC92 4YSFA 2YDQA 4IE6A 2UXXB 5HEOA 1RVF2 2EXHA 3SCFA 4AVBA 2X66A 4UELA 1DGLA 1DLLA 2D6PA 2X51A 2DDUA 2W9XA 4I30A 2JD4A 4AKLA 4CZSA 5FY7A 4X66T 1IBLT 4P9JA 4WVMB 3I9YA 5LA6E 3F31A 2QQIA 1BR2A 2QE3A 3R05A 2X67A 1SFNA 5K4LA 1HW5A 2H3RA 4FPCA 4DY5A 2YBSA 2GMEA 3A4UA 2CBIA 4WVWA 2NWBA 4O65A 3C4ZA 5J2UE 2G9FA 5AQQB 3WQ0A 2RG4A 2WZR3 3RRCA 4DEVA 3KD4A 4BHPA 2XQ7A 1G86A 3OUJA 5FY9A 1TME1 1UY4A 3M3ZB 3U10A 2RMU2 2A1XA 2SBAA 1OQDA 2JKBA 3HQRA 2WNUC 2OX0A 3IDEA 1BLZA 3QK6A 4LBQA 1LOEA 3VD4A 4IGPA 1SBDA 2ODVA 4C8DA 3I3MA 4AFAA 2VPVA 4DPNA 2XQ5A 2B45X 4QKNA 5JSPA 2LSYA 3MA9A 1GP5A 3MK7C 1NLSA 2R073 4FXGB 5AQNB 2YGLA 1QXRA 5JVDE 5LGUB 2J1EA 3H3LA 3ZSKA 1J3QA 1SEFA 2YB7A 2W0GA 5AQOB 3LGRA 4R9DA 4BK4A 4EROA 1O8SA 2ZM8A 1GR3A 3ON7A 4B1LA 4HL0A 4A42A 4D6SA 3CIHA 4O4LE 5FO9B 4JI1T 2GMPA 5IUXA 1HX8A 2GH8A 4XMAA 5HPOA 2OZJA 4CPBA 2F4VT 4RGGA 1NLRA 2WDQA 1QH7A 1VAKA 3N2OA 3NSTA 3ZSTA 4Q0QA 2Z2SB 3NL1A 1IJ6A 1UGOA 2R061 4YG3A 3ZYPA 1X9BA 4O8SA 1AR72 3MFCA 4K8RB 3KVBA 3EYPA 2LEHA 1NEKA 3U4SA 2QQNA 4JGZA 1J84A 1N1YA 3ZOIA 1PM4A 2CPTA 2V1DB 4DXRA 3Q8CA 5D8AB 2WMNA 3AMNA 5FYBA 5FZDA 1BBT1 3POEA 1WCUA 4O2BE 4P09A 4DBQA 2HEWF 2VAUA 5H9QA 1COV2 5FP9A 3HAGA 4YW3A 1AR83 2XPJA 2CWSA 4N9IA 1BR1A 1S35A 1ZRCA 4YT0A 2XJTA 3EDVA 1D0GA 1H8TA 1S0CA 2PAKA 5A3PA 3WEZA 4KUMB 4XDQA 1CR7A 5BNPC 1DF0A 3ZN5A 2GMMA 2YDSA 3KV5A 3IB3A 1JYXA 1H7CA 2RVAA 1QQP1 2JPFA 4DUZT 1UZ0A 2RM23 2HH7A 4B3ST 3KT1A 5GZFA 1XU1A 3DN7A 5EJ3A 4EEDA 1W99A 2QQVA 3KQRA 3LEIA 1D0YA 1U5YA 5FY1A 2W47A 1JZ2A 1SLAA 4XF3A 1YQ4A 4MHCA 3TN92 3PU8A 1GSLA 1PK6A 5JDFA 2J1TA 5DAVA 4R4ZA 1D2QA 1N33T 4E9KA 1TNFA 3AXEA 5A70A 3ETUA 2AREA 1QJY2 3FFZA 3P50A 3BQLA 2X9WA 1MIYA 3C98B 4H9PC 2A3WA 3LSEA 4GIWA 2HWC1 1YQ6A 1Z0PA 3ZT6A 3TKLB 4TZ4C 2GDFA 4ISSA 4BA9A 2TUNA 4HSJA 3LK42 2XQAA 1VBA1 1W8ZA 4Q0UA 5FYUA 3SH3A 2FJBA 4FAHA 5KR7A 1MZ6A 3SCHA 2YBPA 3F57A 2XXZA 2LM2A 3WF2A 3S0MA 4TX5A 3TEWA 4BIOA 1OLQA 3RYFE 3AXDA 5JDNA 1MIWA 1S0JA 3ZSLA 4CU8A 3POBA 4BXSV 5BV6A 2QTWB 3TEZA 1T7SA 4UEMA 1L0VA 3C4XA 1AZDA 1ZM1A 3AB3B 2VMEA 3MGUA 1OEDA 1QOTA 1TVGA 2PHFA 4OHXA 5A33A 1DGWA 3OY8B 2GC3A 2OQ7A 4NUUA 3FC0A 4CUCA 2GC2A 3CNAA 1WFDA 4GH4A 4H2AA 1EUTA 4UWDA 3ZPYA 1YHFA 5DUXA 5E89A 1FYUA 2D0UA 2HH9A 3GYDA 1OH4A 3H8XA 4Y4YA 4OI2A 5GM0A 5BUVA 4DIQA 2LSGA 4IEYA 3NNGA 5JIUA 2WQ4A 3AKQA 1PX4A 2WQZC 3TNQA 3VD5A 5CVRA 2M6BA 4Z91A 4LBOA 5KX5E 5EYYA 4DO0A 4BE3A 3M70A 2VURA 4ZI2D 1B35A 4MGIE 3ZFEA 2EICA 1GKBA 4FFGA 4D6RA 1KS5A 4PK6A 1JU4A 4PDWA 4ZKTB 1ST8A 3PUAA 1GFF2 2CDPA 4LHNA 4FPLA 5FUPA 3WHTA 4CCOA 4DXZA 5FDBA 3H8RA 2VKHA 1VCTA 5LBMA 4XTMA 3RQ0A 4HONA 2HWC2 4YVSB 5HV4A 3JU9A 4LBQB 3ZYKA 1WW5A 4MBQA 2ZZJA 1HX1B 3L2HA 3ILRA 4XXPA 4CUAA 5L7OC 3WAKA 4AE2A 4BMEA 4DR2T 4V2VA 4UFHA 5FY5A 4CN1A 2OPWA 2CHHA 1W9WA 1ZBA3 2V7KA 2DV9A 2W1SA 1ZZCA 4JGZB 1JZ5A 4LLFA 4QX7A 2BBVA 1WA4A 2N9DA 5DDJ1 2XWBB 3AL5A 3MZKB 4MO3M 3I97A 1RUI3 3JC6D 1L7LA 2VW1A 4XETA 1C8M1 4X8NA 4RR3C 4L0RA 1AR92 3IDCB 1RUC3 1WR0A 5TAOA 3M3QA 1NYWA 3B01A 4Q0PA 3F2EA 1Y9MA 3K51A 2XB6C 4HSLA 4O7XA 5LK7B 1AL23 3AXJB 3Q5XA 3I1AA 1G73A 3PVBB 2V7JA 5CFDB 2VD7A 4ZI3C 5AQVB 3KQ4B 4I50E 5CKMA 4AI3A 1NA1A 4E7ZA 4UFIA 5JOYA 1ZZ8A 3RMXA 2JIGA 1HB2A 4I43B 1LVKA 4JZRA 1W9FA 2HWF3 4XFAA 4CI2B 4EQVA 1R083 1SCRA 3O1HA 2MEV3 4P14A 1MS4A 5BYNA 2MPFA 4NHXA 5F1RA 4IE7A 2CBJA 2W39A 2BOIA 2WNUA 5GZDA 5FPZA 4XQWA 5CFDA 5JDLA 4OHYA 2VTXA 2IDOB 3FE5A 4NR1A 4RQPB 3VDDB 1GYKA 4BWOA 1B35B 4IE5A 4LBNA 3FL7A 1ZNPA 4AHWA 1AR81 3OGSA 3N9QA 4NXNT 3H3MA 1VMFA 3P5BA 3WDYA 4ES9A 4OFZA 4C1XA 4CRQA 2W2IA 3ASIA 5G05L 4Z1VA 1ZRRA 1YI7A 4KHPT 1VBE3 4PLOA 4MH0E 4XMIA 3UU3A 4GB31 3H9AA 3MPPG 3JAEA 3POSA 4GWIA 3ES1A 4AFBA 3I54A 5BNPB 1F2NA 2B5HA 1LHUA 3WP6A 3OBVE 2OA2A 4JAAA 4S2GA 3FN9A 3CQGB 5FREA 2EIEA 4V1Av 1F4AA 1E5IA 4NPMA 1HKDA 4IEUA 1OKOA 5JH7E 2E51A 4AKIA 2P1BA 2WDBA 4XUNA 2WZ8A 1GOFA 2TEPA 4XIKA 2E2AA 1F9KA 1PO21 2WZR2 2E9XA 1N1SA 4MSVA 2O0OA 3VZNA 5C5TA 4Y1VA 4JVAA 4ASLA 1STMA 5KHGA 2X09A 3FLTA 5AQLB 1HRV1 2RR11 4LK6A 4C1WA 4GKYA 4Q0SA 1PIV3 1S1AA 1W9YA 1F8VA 4IREA 1IHMA 2VY0A 2JENA 2EHOA 3KCCA 5L3FB 2UWCA 2V6XA 2WN2A 4QX2A 3VUOA 5L7OB 3QNUA 1BR0A 3H7JA 4DV3T 2WT1A 1ZVFA 1QJX3 1FV3A 3LB9A 3AEEA 1LHOA 5FZ6A 2DTYA 5JR7B 1QOOA 3UKTA 1DGRN 3WR0A 4BM8A 4GAZA 3AE7A 4WBBA 1KFUL 2RDNA 1LVFA 2A2FX 5A3OA 5T54A 5A6XA 2EALA 4YSZA 3BTYA 3M3EA 3WDTA 1MZ5A 5AC93 5LATA 3KV4A 4IDNA 2C6SA 5A3LA 1RIRA 1SG3A 4P9LA 2JG8B 4KMCA 1VB4A 2VNVA 2BFUL 3LDRA 2ZKLA 4DVDA 1LTEA 2A70A 1CAUB 4TLGA 4AZZA 3BGAA 2Q9QA 3SOLA 1AR73 3IF8B 2PBIA 4ZHQE 3CZUA 4P9XA 1NZCA 2WNVB 4D8MA 4PBOA 3FZ3A 1W04A 3QB5A 2QJVA 1I3HA 2YMZA 2Q1FA 3PVEA 2X0LB 5DG1A 3UTKA 1RUNA 3VBRC 4YTNA 3VU7H 1GNYA 1R8IA 2XQYA 3RX6A 4IEVA 1ZBE3 2D44A 3OBAA 1IZNB 4IV3A 4PJNA 2AGSA 4PQ9A 2YBKA 2WO1A 5FMOS 4HVQA 5JXGA 1MMNA 2HWB2 2UURA 3MIBA 3S7EA 3VRBA 3H3AA 1EAH1 1YRZA 2C1FA 1W2TA 2UU8A 4UVBB 2ZX1A 3AA1B 4H9SE 1W6NA 3OEAA 4RHV3 5GLTA 3ZFFB 1ND3A 1DIWA 4LR4A 3Q9DA 4I0UA 2V6YB 4XF1A 1PGL1 2MHFA 4XJ9A 2VE1A 4DXSA 4MADA 3GWHA 2RM22 3LOBA 2FD8A 2KWHA 2WZHA 2F6BA 3RWKX 2QZ3A 4HWHA 1DQ6A 3PUIA 2LKHA 4I3GA 3LE0A 5DQVA 1TNRA 1XDPA 1LKXA 2YC4A 2GNDA 4LIUA 5C6CA 4QDSA 2RPAA 4FP2A 4GMP3 4YYOA 1OPMA 4WVMA 4QGLA 4UXNB 1MZEA 3VD3A 1JHJA 3RI9A 3ZXDA 2NOXA 4IDOA 3Q5DA 4YTPA 3N35A 1UL9A 2IFWA 4XAAA 2O8QA 2VMCA 3BKZA 3RKGA 1OD5A 4UW4A 1WLXA 1W39A 2D6KA 1VBD2 2QDRA 4UF0B 2ZGNA 3OEBA 4KGQA 2ZEXA 4Q0VA 4YW7A 3VKFC 4DQAA 1OQ1A 1WCDJ 5LWBA 1O3TA 3W5NA 3SFDA 1H1AA 2A75A 4AKRB 1NOVA 2EXKA 4QDRA 1C57A 1AHSA 1D0XA 3PL0A 4CDXA 3OYZA 1WW7A 1SHZC 4ZS2A 1UZYA 4U7IA 2VQET 1OC1A 2W66A 3AKPA 2WY2A 4KWJA 4NO4A 4LNVA 5DDJ3 3WNPA 5JI9A 1HDKA 2ZX2A 2ZABA 1RUOA 1EPWA 5AQJB 3I0QA 1N3PA 1DCSA 4LUMA 1W8NA 4Y1XA 1R1A1 1GQHA 1M7KA 3H3UA 3DYOA 3OCPA 3GCXA 2UXCT 5JRCA 4DV2T 4FPYA 1GANA 4A45A 2YDRA 2AC1A 3ZXAC 4AYUA 4ET7A 1OVPA 2ARXA 2CV6A 3RKOA 2HWD2 3WQ7A 2MYSA 5G04L 4ITCA 4JX0A 2XWJB 1RUI2 1QH6A 3LEMA 5FZHA 3SCGA 2X10A 3ALQA 5A3WA 3OOXA 2C5KT 4UVCB 4YY3T 2ZACA 4Y5SA 3WF4A 4EOZB 1JU3A 1HJGA 1QEXA 4TXWA 3LD8A 5A32B 3TN93 3LFIA 2GN7A 2KWIB 3PVOA 4IQPA 1R081 3R4UA 5HXSA 5HEGA 3EHZA 1REEA 1WKYA 2QQMA 4N90A 1Q8OA 3AKRA 1IAPA 1XXNA 4PDWC 3VR9A 1RYYA 3IBMA 3R0RA 1U5PA 1TME3 4NWVA 1H9WA 3MF9A 1ND2A 1YJLA 1OQEA 4YGBA 5F5QA 4BH9A 1U4QA 1HRV2 2ZGMA 1M62A 2BG9B 2M6IA 1SLBA 4HKAA 1TZOA 2B76A 1FJGT 1UIJA 2E33A 4XZPA 5D1IA 4CA9A 5KC5A 2VXRA 4QH5A 2JDAA 1ENXA 2YEVC 4UR9A 2JECA 2K5BB 4EWDA 5CJ5A 1BQPA 1GOGA 1Q3EA 1OEDB 5LJMA 1POV1 1PO13 3GMIA 5LP6E 1CONA 4PJYA 2PAMA 1UK5A 4YHJA 3ZMVB 2WL1A 2C5JA 3OVUA 1QNYA 3NZPA 3AP7A 3WQ1A 1LGBA 4CEWB 5HBAA 1WBLA 3BIEA 5FY0A 4OI4A 1VCSA 1EPZA 5IUQA 2B9VA 1OF3A 3VBUC 5JWPA 3JD72 2XOMA 3HL6A 1YQ5A 2JG9A 1OFSA 1QHDA 1AR61 2A3XA 4K1ZA 3ILFA 2Q9QD 1DP0A 5CIRA 1AR93 4KBMB 2UY8A 2LRPA 5L3EB 5H9RA 4JDOA 3PJAJ 1X9PA 2R30A 3MIHA 3T0AA 3SLIA 3SRZA 5FUIA 1AJ3A 3AEAA 5KDMC 1C8NA 1XE0A 4XUPA 4W4ZA 1YJKA 5A6QA 3V0AB 1CGPA 3POFA 2BWCA 5GKAC 3ZMOA 3N9OA 1Z7S2 2Y6LA 3P7IA 2XAJB 1HQNA 4U74A 1S55A 5CNAA 3CQCB 4DR3T 4LF9T 3GJAA 4W6WA 4GZ9A 3ZVXA 5KWRA 1I1EA 3W15B 4WW0A 3U0ZA 4FI5A 1QWRA 1KEYA 1VB2A 5HYAA 5LCYA 1Q43A 1W06A 2W94A 2VKDA 5DZFA 5EQUA 2WQ8A 4W65A 4CPBD 4SBVA 2X8KA 2HEVF 5FL0A 2JE9A 1DZQA 4QB2A 4KBBA 1CHUA 4FJOA 3CK6A 1XE8A 2Q1ZB 3KINB 2RHPA 2YG0A 4AGGA 2RM21 3J7LA 5DAPA 3O1IA 2WMOA 1XNDA 3ZYGA 4CE8A 1GICA 4PI0A 2JB4A 2WQYA 2C5IT 4EYYR 3TRSB 1N32T 2VOVA 4F7ZA 2PXJA 2BERA 2HPJA 4QQOA 1O5UA 4Q8KA 3ETVA 3LF7A 2NM1A 5JDGA 5FZ4A 4AVTA 2Y38A 3I3BA 5ANNA 3EDUA 1YXRA 2DVDA 2WYSA 3VN4A 5I0SA 1X7NA 3NAPC 3VBRB 2WR9A 3AMPA 4NWWA 2LJLA 3GN5B 3IPVB 1OOPC 3N36A 4FOYA 2H89A 5CFBA 2ZGSA 5HCFA 3ACLA 2J1RA 2J1AA 4HETA 3RDIA 2A6XA 4AFDA 4CU6A 3JCFA 5HAXA 5A1FA 1AR62 3VDDC 2PJQA 1ND2C 3VZMA 3K2OA 2DVGA 3ATGA 2EAAA 5FPUA 3CMGA 5HXHA 4KMQA 2LROA 2R063 5TSWA 1PVC2 3NKTA 4NAMA 3D0SA 3VBHA 5FL1A 1KGYA 1LCLA 2CHNA 4E2GA 4JEUB 2PYTA 1RUJ2 1A78A 1IKPA 4M00A 5LA0A 1AYM2 2AXDS 1LECA 2BS3A 2YINA 1NCRA 4LBJA 5JREA 5FBJA 3T30A 5ABJB 2NN8A 1IJ5A 2VCAA 3DXUA 3AVSA 1VMJA 3N7KA 4IE4A 4H55A 3WX5A 2LOPA 1IQAA 4J6GA 5FZOB 2X68A 4D69A 3BOPA 2DVAA 2GAUA 4S2FA 5JR2A 3LA2A 5C8WA 4MZUA 1RHI1 2KA3A 1K12A 4CP2A 5BY5A 5IK7A 4GD4A 1HXS3 3EHKA 5HXEA 1UXXX 3NVOA 2Y60A 5GLVA 1D7PM 4QPGA 1N1VA 4NPLA 1Y7BA 4LXLA 1UX4A 4XE9A 1VOMA 4UI9L 2W00A 1LU2A 1W8TA 3I4IA 4Y1ZA 4U72A 4Q27A 5FYVA 1IQDC 1RUH2 2R6GF 3CVRA 1UMHA 3NW4A 4YW4A 2FZ2A 2D40A 2R1BA 3E08A 1T98A 3NV2A 4PLNA 1HNZT 1W0PA 1SFYA 3D0JA 1RXFA 5CYYA 5C2TA 2IWGB 1NQJA 3GBGA 3NKGA 5FZ0A 1SBEA 2E6VA 1H8VA 2WM9A 4Y3OA 3WG3A 2RS52 5H6QB 2XVGA 1VLNA 4G9SB 4OUSA 4DOUA 3V0BA 4B8EA 3WW1A 5HEUA 3K75B 4AW7A 2D3RA 2VL4A 3GHMA 1S0EA 1JZ3A 1CPNA 4LO7A 4LO8A 4ILUA 3OTOT 3IA3A 3D82A 4YZ5A 1V9U3 5LA9A 5F32A 3DTOA 2ZM6T 5ABEA 2GH2A 1HLCA 3IIIA 3WLUA 1AL0G 5A6YA 3M4FA 2Q8OA 1Y43B 2B8MA 5HCJA 4JI7T 2J22A 2ZEYA 3HJRA 2BVLA 2XBO1 2V7IA 3NBXX 2I07B 3P4WA 3WT3A 3ZX7A 4MGTA 2PHRA 2PHXA 2JDPA 3CHXA 1LESA 2RJ2A 2XJPA 4UW3A 4FAGA 4PF5A 2CU5A 3KGZA 5EXOA 1W03A 3WG1A 5F3EA 3OBRA 3VRAA 4DRRA 2ZTNA 5JLVA 1W28A 1BK1A 4KNCA 4ZI7E 5ABHA 5JI7A 2W4XA 4LF5T 4U3CA 2DWRA 3B02A 3GF6A 1VBE1 3ABZA 5AVPA 4JQRA 5F39A 4MVTA 2IC1A 2XUMA 1VBD3 5A1AA 5BR8T 4LFBT 3VDCA 4ES8A 5B4NA 1UOGA 1W0AA 1QXJA 5FIXA 5JSOA 4G63A 4EGWA 3VBHC 1LHVA 1POV3 4A2UA 4C0BA 2FDKA 3NZQA 4O9GA 1OLRA 5FK8A 3HPNA 1VP6A 3JQXA 1WCKA 4HN1A 3PUXF 3VL9A 2KNDA 3C7OA 2V5CA 1BKZA 1Y9GA 2H7OA 3ESLA 3E0ZA 5LNKA 3VBOB 2FDGA 2CAUA 1GZTA 2XVKA 3ILNA 4HG6B 4XILA 4XQ4A 1W2OA 4FBFA 4AAPA 1ZP0A 2DI4A 3VKLA 3JC6C 1ENQA 4ATFA 4DUVA 2VUCA 3ZFFC 2Y8DA 2BNOA 4XEZA 4ATEA 2OV9A 1ULFA 1UYXA 3ECQA 4M4PA 1GQPA 1GWLA 3C4WA 4DV6T 4GK0E 4PJLA 2E53A 1V6NA 2A6YA 2K9ZA 2P3YA 2RR13 2XLFA 3PMEA 2X0HA 1ODNA 1QJU1 3VBSA 2P4EA 1UNBA 2K2SA 3FB2A 3JZVA 3C51A 1RUF3 4BAYB 1FI2A 1QDCA 5EK4A 1SZBA 2C0ZA 1JHNA 4LO5B 4ONUA 2BFUS 5FY8A 4P00B 5GLWA 5T5LA 2X5IB 1OT5A 2Q9QC 4W8JA 2IC9A 4X5TA 3H1MA 4XIOA 1QMJA 2DWKA 2X0YA 3WV6A 5F37A 3ZFGB 3AYCA 5FPLA 1OLME 1TMF2 2UUAT 5GLUA 4EN8B 4TNWA 2J1SA 3MICA 2L8KA 1X36A 4R52A 3KDSE 5L3CB 2OXBA 1VBB3 3E6BA 3MV11 4GOUA 1YFUA 3VDAA 4XUTA 4AQGA 3WCRA 3NRXA 5K0UB 5BNOC 1Q5OA 5GALA 2VOWA 2LTNA 3GCWA 3AP4A 3FZMB 1GMMA 3K8PC 3HNBM 2ZGTA 3ES4A 4HFSA 3BODA 1MS8A 1HRV3 5FYSA 4AOCA 1LJ7A 1V00A 2XGXA 5LBQB 1LOFA 1UPSA 3J7HA 4KX6A 3DEMA 3MZHA 2WBLA 3SS1A 4Q29A 3WW3A 3KB5A 4ISRA 3BTXA 4AL9A 2WSVA 1Y9QA 3AP6A 4XJAA 1OKQA 3RYIE 3UFEA 3WP4A 4PK4A 3U07A 4FOWA 4U33A 4IEQA 5C3JA 5IHYA 1XBFA 4YSXA 1EAH2 1OA2A 2B7YA 5EJZB 5FWEA 3SMHA 4B4PA 1JYVA 3ST7A 5J36A 2QVAA 2XJVA 3WNLA 5IFTA 4KP3C 1WLTA 5FXWA 5HWXA 1HQLA 5FXXA 1Y64B 4HPKA 4JKKA 4RD7A 2XQRA 1C3HA 3TLVA 2VMDA 4FFFA 4IGOA 4UOJA 3AECA 2WAAA 4QAWA 3EBRA 5A7QA 1VMHA 3DF0A 3I9WA 1LENA 2HWD3 5AQIB 3RIUC 1WCQA 5LHIB 2YU1A 4XFBA 3CQXC 1RUH1 4ZU4A 1HXS1 2K48A 2V5YA 3USUA 4YM3A 4GB33 3GN5A 4PJMA 5I93A 1CX1A 1GUIA 4HPKB 4RN5A 2CSGA 2D6LX 5A3UA 4CDQC 2BZDA 3DUIA 1A8DA 1ZBE1 1GU3A 5CKQA 5A80A 4LHSA 4QDQA 5FZOA 3RPQA 5LW9A 4D0QA 2VECA 3T2PA 4CDQA 1H4HA 1NE6A 1VPHA 2ZM0A 1IG3A 3GALA 5C3OA 4X6RB 4S2DA 1RJ7A 3IZOA 5DUUA 5J96B 3P4SA 3ZPOA 1HB3A 3FMGA 3KCXA 4UFLA 3VKMA 5CG8A 4SLIA 3UGGA 5LEKA 4BCUA 2XM2A 1ZZ7A 3LPGA 3HOBA 3HR9A 2D7FA 5CZKA 1T6BX 4H7MA 4J25A 1GNHA 5F5CA 1IS6A 3ZN6B 2WINB 2XPKA 3AA7B 3ZYIB 2YGMA 5FQ0A 1B7TA 1H2KA 4NIHA 2ZJCA 1FOD3 1UWWA 3N7LA 1PIV1 3OY8A 4YM0A 3Q5EA 3KBUA 3AE8A 4E7SA 2A6ZA 3WF1A 2XHNA 2CCQA 2RV9A 1H8TB 2ZKNA 4ZU5A 4Y5TA 3ZXJA 5FP4A 2C4XA 4ZOLE 1MIVA 4AVSA 3PJQA 3C2UA 4Z07A 3B00A 3KZ4C 1NX9A 3E97A 3UKNA 2ZAAA 3POWA 4BLJA 1YI9A 4UFJA 5IVBA 4YG0A 4QT6A 2WFPA 5ERLA 2JEMA 4Q4Y2 4IV1A 5BNNA 3BI3A 1FX5A 4O9EA 3ZFEC 4UT5A 1BYHA 2ILMA 5BNNC 2JG9B 2VQAA 5LGNB 2R062 5LG4A 3MJXA 3EB7A 5BMVE 1NXD1 4WNKA 4LT5A 4XUQA 5LA2A 4F3JA 2DURA 4TLFA 3N2KE 2CTVA 4YG6A 5LOVE 1PK6C 3KSCA 3EI0A 2ID4A 5FZLA 2FDFA 2VJXA 5DN2A 5LRRA 3AE4A 2BVBA 4TUYE 2LHNA 5FPAA 2WU2A 4DS0A 5JZGC 1W2NA 4ZXEA 4KWLA 3USSA 2DL1A 2LALA 1UMIA 2ZGKA 3OPTA 1AXKA 4LA3A 2VOKA 4PCRA 5A7PA 1O6UA 3LFMA 3UU5A 1UAIA 3GNEA 5FMNA 3MIEA 4XZUG 4YGCA 3ZXGA 5ACA2 5HI0A 1ODMA 1REDA 3MPBA 4RHV1 2P37A 4LOSA 5BNPA 3L2YA 5JR9B 3J7MA 1SPPB 3VBRA 3A8YC 2VB6A 2W52A 2W68A 3IMMA 3LA7A 5KC6A 5CFCC 3SWHA 4TTGA 2LSKA 1HNWT 1G8XA 1DGRA 1TMF1 3N9NA 3ZJ2A 5L3GB 3C50A 2DCYA 4P5HA 1XE7A 4EN6B 2D3SA 2BPA2 3RYCE 5FZBA 4XFCA 2WWSA 2LLYA 1AXZA 3K4ZA 4PI2A 3SH5A 4ILCA 2VMGA 5JZGB 5ABJA 2Y34A 3AAIA 1SLTA 1GLHA 5FR3A 1UOJA 1YNAA 2HN1A 2VQ0A 2D9DA 1S94A 5JDMA 1AR63 1OEDC 2BWAA 2ACZA 2IVJA 1W6OB 2TBVA 2VW0A 5D8AC 4OI1A 5A1LA 2XL9A 5CFDC 5LG3A 2QCSB 3LCPA 4YLZA 1ZEEA 3AYDA 4YNIA 5KBFA 3LSVA 2XQ4A 5D8AA 3KFWX 4UAPA 3W20A 3MHZA 4MG2A 4YVSA 1NCRB 2LS6A 4GALA 2XAGB 2CHOA 4JKLA 4P9IA 1JUIA 1N1TA 4V2WA 4YW2A 3LQCA 4QU2A 1I9RA 4QWNB 1O91A 1UX5A 3FZHB 5CA1E 2XHKA 4XAEA 1E2AA 1XNKA 2LE8A 2AE9A 2B1EA 5F3JA 1AX1A 1K5MB 2QNKA 2WFF3 2ZHLA 3PIGA 4FOVA 4H7LA 4LKSA 5FP7A 3HQUA 3FFQA 1RTVA 2HKXA 3MUZ1 3C3VA 2ZGRA 4IEWA 3UYJA 2CAVA 3DGTA 4QKBA 3OYWA 3HD8B 1RUF2 4WM8A 2CXFA 2VOTA 4I4TE 1HV1A 1RUD2 2FZ1A 5K0UC 3CU7A 3WNKA 4AQTA 1LRZA 1IOAA 4DR6T 4JGYA 4E8CA 3KLSA 3PTRB 3WNNA 4P5YA 3PUVF 3O5SA 4H9OC 4NIAA 1UZZA 5FBZA 5L19A 3PVNA 4PNIA 2KXPB 1HRI1 1VBB2 1AVBA 3ZT5A 2WS92 4MLOA 4XF9A 3EABA 5LHHB 5K9YA 1RUH3 4HFBA 4P1NA 3L3PA 2N1GA 3RZMA 2JWPA 2R7EB 3ZIXA 4I01A 1FMWA 1W05A 4LHLA 4YFSA 2YC0A 4ANJA 4DR7T 2RA1A 1C8M3 3KMHA 3WXPA 1LGCA 1S0BA 4EZ4A 1RUC1 4DNYA 4MGZE 1AUYA 3H37A 4PFOA 4F8HA 1E5RA 1VRH3 1JOBA 4JCKA 2KM2A 2NLRA 4K3UA 4NRMA 4DFSA 2E8IA 2PHDA 2ZGUA 3OPZA 4DBRA 3ZFEB 5FOBB 1DQ1A 5A3TA 3O14A 2JDYA 1CAXB 2ZOEB 2AUYA 1T72A 3BOWA 1N34T 1YUDA 1IKQA 1PNFA 2WT2A 1S0DA 2HWF1 4BU2A 1W3XA 2VK9A 2HWB1 2Y8KA 4ZONA 4Q5OA 1UYYA 3RGLA 1CAWB 3FUQA 4AQYT 2Y0OA 1PO11 4EYUA 4IEZA 2CE7A 2PFWA 3LK3B 1CWPA 4WZFA 4MFRA 2JQHA 4FQZA 5JXJA 1KS4A 1QJY1 3MLJA 1E57A 1BEV2 1OMIA 1BCXA 4Q4Y1 5DDJ2 4JC1A 3RC3A 5A7OA 2KMFA 5F6LB 5FLIA 3AC0A 3PHMA 2NW8A 3DECA 4Q1PA 1VBC2 1H1MA 3CMLA 5FKYA 2NYYA 2E9XD 2XQXA 3EJKA 3PU3A 4LA2A 4EZHA 1F15A 1FPN1 1LR5A 4MGYE 2NW9A 4CEWA 1IS3A 1UPIA 4EEBA 2C9KA 4XFGA 1V6LA 3A22A 5FZKA 1SLCA 5FPBA 3Q8FA 5EK3A 1HB4A 3VZKA 4B4RA 1YFWA 1D0ZA 2Y6HA 5C8CB 2D0TA 3WI3A 4ADZA 3DKWA 3WG2A 4QXCB 2JB8A 3THTA 5DG2A 3I2KA 1OFNA 3AMMA 2FQPA 1ZZ6A 2XJQA 4N7IA 1POQA 5CEHA 4BA6A 3B69A 2V73A 1C5IA 1YIPA 3RQUA 2E7AA 4MV2A 5H9SA 4DY3A 1ENRA 4WM8B 1DU3D 1E5HA 1PK6B 3N9PA 1PMHX 2UXNB 1DLCA 3J8F2 2GC0A 3GZEA 1NENA 3SNMA 1NUKA 3UQ4A 3OGVA 2HN2A 3UL2A 4CP9A 1JNRA 3N2GE 4HWDA 3TEXA 2P5BA 5F7UA 3S6PA 3AMQA 3ZT7A 4ZS3A 1POV0 3ACHA 4HVRA 2PHLA 2O8OA 4LKDA 4LIVA 4JRAA 5LBFA 2Q8DA 1JYIA 5IVFA 5DZGA 1U5IA 4GB32 4CCJA 1VE0A 1AL22 1PO12 2W95A 2WLPA 1SACA 3CJIB 4Q4X1 1Z8UA 2Q8CA 3AZXA 1UX7A 3VBOC 5IAXA 3HBZA 2V8SV 2I45A 5L9VA 2SPCA 2BDEA 1L7RA 2HEYF 1G9BA 2ZM2A 1UD1A 1W2UA 1XOYA 2HWE1 1NCQB 4M4RA 3PUGA 3V5UA 5LJNA 2VZ3A 2QDNA 2WCAA 1UY2A 2MEV2 3MACA 3CF6E 2JQQA 1V6JA 3JD73 4IEXA 3T3YA 1V9U1 3TLWA 3M8LA 1UO9A 1AR71 2KT9A 3ETQA 3LEKA 4HKLA 3ANWB 2IXLA 2WAOA 2Z69A 4JI2T 4JLEA 3NV4A 4OLLA 4Y20B 5E88A 2JDKA 1WLDA 5FLHA 1NKGA 4WM7C 1AX2A 2IHR1 1PGSA 1QY4A 1U5ZA 2DUPA 2QQOA 1EP0A 5T55A 1CJPA 1D1BA 1C4RA 4H63H 1DG6A 2VZQA 3W58A 5IYYA 4JI5T 1CIYA 3I49A 2XVLA 4TWFA 1A8MA 1COV1 2K9AA 4M01A 2E32A 5BXXA 3JXSA 1W8WA 3FWEA 4YW5A 5AFUL 2V26A 1RVF1 2VUJA 5APAA 1WR6A 3HBKA 2DCTA 3O1PA 2FCTA 3OGJA 4IDZA 2Y6XA 3NO8A 2CXLA 3I2IA 4LO6B 3U78A 5BPXA 4CEYC 1OUSA 3BPSA 3WP3A 4DINB 2BBAA 4QXBB 3SHRA 3AFGA 1QJU3 3U37A 5CBLA 3UUMA 3BIWE 2ES0A 1LRHA 2ODUA 2CGNA 2HYKA 2YPJA 3CX7B 5FXZA 4EIWA 3DJBA 2VMIA 2YY1A 3AZZA 4OHVA 4XYXA 4X1IE 4MALA 1YQ2A 2R16A 3APBA 4WZXA 1LKNA 4LF4T 4Q4X2
chains in the Genus database with same CATH topology
3CWZB 3P8CD 3W15B 4WW0A 4FI5A 5HXRA 5HYAA 2YK0A 3M65A 5LCYA 2Z6EA 2VKDA 5IVEA 4CCLA 1OWAA 5DJQC 3UULA 4OHFA 3CKDA 4FJOA 2LM9A 3KINB 4CI3B 5M4YA 4QWNA 3KV9A 4XBFB 3O1IA 4HGAA 2WMOA 5F3IA 4L5GA 2C5IT 3AA6B 2W63A 4HFVA 4EYYR 1NAFA 5F2SA 2PXJA 4AKHA 2HPJA 5IVJA 4CXYA 4YJ3E 3ETVA 3HI2A 1HG5A 2EHOD 1EZ3A 5FYHA 1KK7A 5JDGA 1YKEB 5FZ4A 3KVAA 4UIGA 3EDUA 4YLHA 2N2NA 5FYCA 2BVMA 1MMDA 4CXXA 2CEAA 3ZCIA 1HF8A 4LITA 5FZEA 2LJLA 3GN5B 2OS2A 4F6RC 2CXDA 3FXDB 5DABA 5A1FA 5HAXA 2BZBA 3D0TA 4BXFA 2PJQA 2WSSV 3MKDA 3K2OA 3U3IA 3VKHA 5FPUA 5HXHA 2NTYA 1D1AA 2Q9QB 4I55E 1MMGA 3IEEA 5FUNA 3K3OA 4JEUB 2ACXA 5LHGB 2GP3A 2IC6A 1HTJF 5FJKA 4A56A 2XHEB 2YINA 5IW0A 5GONE 5JREA 5FBJA 3DXUA 1IJ5A 4DMWA 3AVSA 3ZN1B 4IE4A 2LOPA 5FYTA 1KNZA 4B6XA 3FHNA 5FZOB 3LJCA 2X68A 3N5LA 5H6RB 3K3QC 2WWUA 4CCMA 5FZIA 4CSWA 5A7SA 4GD4A 2GK9A 3GA8A 3N9LA 2HPLA 4UVAB 5F3GA 2LHRA 5HXEA 3HR0A 1HS7A 2OT7A 4IE6A 2UXXB 3PDQA 4IE0A 2X66A 4JUYA 4UELA 4LXLA 1UX4A 2X51A 1VOMA 2W00A 4AKLA 2MOZA 5FY7A 3UUXB 4U72A 5FYVA 3I9YA 3CVRA 3F31A 1ZHCA 1BR2A 5LA6E 5K4LA 2X67A 3E08A 1T98A 2H3RA 2YBSA 1WRDA 2NWBA 5FZ0A 3C4ZA 5J2UE 1CUNA 4UF0A 2WM9A 4Y3OA 4CCNA 5H6QB 3QUJA 3RRCA 5F5IA 3ZYMA 3LG7A 4QX8A 3I0OA 2KZ7B 4ILUA 2QA7A 4OYKA 2OX0A 3EVYA 3ZJ1A 5E6HA 4X20E 1V9DA 3QK6A 5A3NA 5JR9A 3DTOA 5CB4E 5LGTB 4IGPA 5F32A 2ODVA 4C8DA 5FYMA 5LYJE 4CCKA 4QKNA 5A7WB 2LSYA 3MA9A 3MK7C 2BVLA 5JVDE 2LOSA 2V7IA 3NBXX 5LGUB 4QHOA 4D6QA 2W0GA 2H7VC 2ZM8A 4D6SA 3AAEB 3CX8B 4O4LE 3OPWA 1HX8A 4DMVA 5F3EA 4DNDA 3VHLA 2JMHA 4ZI7E 3N2OA 3IHRA 1IJ6A 5FZ1A 4O8SA 5F39A 5IWFA 4QU1A 4GYSA 3KVBA 2OA5A 2LEHA 2A3DA 2D5UA 3U4SA 3MXZA 4G63A 2V1DB 4AQFC 3NZQA 5FZCA 2WMNA 4NUVA 4Y33A 2VWAA 5FYBA 4HE8A 5FZDA 2KNDA 4O2BE 4P09A 4DBQA 2YPDA 2H7OA 3ESLA 3E0ZA 4YJ2E 5LNKA 5FP9A 1BR1A 2DWGA 1S35A 4AI9A 3EDVA 4AAPA 2DI4A 3JC6C 4TV8E 5A3PA 2CM0A 4KUMB 2Y8DA 3KV5A 3C4WA 1H7CA 4WBNE 2DHRA 4GK0E 2JPFA 2KINB 3KV6A 3OKQA 4PJLA 2HH7A 4WBOA 4EXTA 2G0UA 1OXZA 3FB2A 3C51A 1FMVA 4BAYB 5EK4A 4PAGA 4EB6E 1D0YA 5FY1A 5FY8A 2Q9QC 5LY1A 2IC9A 4MHCA 3PU8A 2DWKA 5F37A 5JDFA 5FPLA 2L8KA 3AA0B 3KDSE 5L3CB 3ETUA 2XAHB 4GOUA 5FV3A 4AQGA 2LT3A 2X9WA 1MIYA 3BQLA 3NRXA 3C98B 4H9PC 3S4UA 3ZMTB 4GIWA 2OQ6A 3K8PC 3LBXA 4TN7B 2GP5A 5EK2A 5FYSA 1WYCA 1Z0PA 3TKLB 4TZ4C 4QXBA 4ISSA 4BA9A 5CA0E 5LBQB 4E4HA 3LK42 2WBLA 3SS1A 5J2TE 1UCUA 3A5XA 3HA4A 5FYUA 2JJ9A 3PE0A 5KR7A 5DQWA 3RYIE 3UFEA 4PK4A 4CI1B 1HFAA 5KMGP 2YBPA 3F57A 5IHYA 5F2WA 5FY9A 5ISLA 1ZKEA 5FJHA 5FWEA 2XXZA 5L3DB 3OJAA 4TX5A 3PURA 3RYFE 4KP3C 4P0AA 2CWOA 1MIWA 2W62A 5FXXA 1Y64B 5FXWA 3R84B 5HWXA 5JDNA 4TN7A 5FZMA 4IGOA 2CMRA 3RH3A 5A7QA 4UEMA 3C4XA 3AB3B 3I9WA 4O4HE 2OQ7A 2YU1A 3BQIA 4NUUA 3CQXC 3BQKA 3CX6B 1WYBA 2CA5A 5LHIB 3ZN0B 1FEWA 2PG8A 2K48A 2D0UA 3GN5A 4PJMA 5FXVA 2LSJA 3IBPA 3HKBE 3PUQA 3LK2B 4O4IE 4DIQA 2LSGA 3FBZA 3UUNA 4HTEA 1X79A 5A80A 5LW9A 5FZOA 5KX5E 2A72A 4UV9B 2XASB 4DO0A 4ZI2D 2ZM0A 4D6RA 2WAUA 2PFVA 4PK6A 5F8PA 3ZPOA 3PUAA 5FUPA 4CCOA 5ANQA 2VKHA 5LBMA 4NUBA 4QXCA 4HONA 5F5CA 5JQGE 4OK0A 5ADXL 2WWJA 3ZYKA 4MBQA 4M1PA 3AA7B 1D1CA 3WAKA 1B7TA 4IIJE 4V2VA 5FY5A 1YW0A 3BK9A 2RP4A 2V7KA 2YU2A 2K24A 3ZLIA 3KBUA 4QX7A 3AAAB 2N9DA 4E7SA 2E9XB 2CCQA 3MZKB 2X9XA 3ZMSB 3AL5A 3B13A 3JC6D 5FP4A 5IVCA 2DCFA 4ZOLE 5J1GA 1MIVA 4L0RA 5TAOA 2JMKA 5FPVA 5IVBA 2L9QA 3F2EA 3Q5XA 4ASKA 3I1AA 4URAA 1G73A 2V7JA 3ZYLA 2VD7A 4ZI3C 5F3CA 2EHOC 5LGNB 4I50E 1NWMX 5LG4A 3RRWA 3MJXA 3RVHA 5BMVE 4E7ZA 4WNKA 4Z8XA 4I43B 1LVKA 3B57A 5FZGA 4H9QC 4CI2B 3N2KE 4IGQA 3O1HA 5LOVE 4CQIA 1VRBA 5FZLA 4IE7A 2KLQA 3R6NA 4BJNA 5FPAA 4TUYE 2LHNA 5JDLA 5F5AA 2XMLA 4PJJA 3OPTA 4C90A 2XTLA 3AVRA 3LFMA 4IE5A 5A7PA 1YD8G 5FMNA 3N9QA 4PFPA 4QXHB 4OFZA 2W2IA 5A7WA 5JR9B 2P9BA 3LBXB 2VB6A 3NRYA 2Q8EA 3ZMUB 5IVVA 3SWHA 2DLRA 2XAFB 2LSKA 4GK5E 4PK5A 1G8XA 2NW7A 3N9NA 3ZJ2A 2DNXA 3C50A 5L3GB 2V7LA 4H63V 2Y48B 4MLKA 3RYHE 5FP8A 3RYCE 3OBVE 5FZBA 3CQGB 4H9RC 4V1Av 3OYXA 4O4JE 3AAIA 5JH7E 4P0BA 5JDMA 1S94A 3J7Yq 4AKIA 3EUHA 4BU2A 3K3NA 5ETWA 5A1LA 5FNVE 2E9XA 5FYYA 1ZEEA 3FBLA 1HG2A 3KFWX 3QC9A 5IYZE 3LDBA 4ISTA 5FWJA 5A7NA 2ZLYA 4XDOA 3O1JA 4HN9A 4V2WA 2XAGB 3ANWA 4XZCA 4K0UA 4X1YE 4CXWA 4QWNB 1UX5A 5CA1E 2EHOA 2LE8A 2B1EA 1MNEA 4O2AE 1QUUA 5F3JA 5L3FB 5FP7A 3DXTA 4G2AA 1BR0A 1O3XA 4XDPA 2IAKA 5FZ6A 1ZV4X 3UYJA 4N78D 2JRKA 5JRCB 2I59A 4GAZA 2CXFA 1E1HB 4H9NC 4I4TE 1LVFA 2A2FX 3UT5E 5E0OA 1LRZA 3PTRB 3KV4A 4H9OC 4KMCA 3Q2MA 4GYRA 4PNIA 2KXPB 4DVDA 4EAHA 5FZAA 1BR4A 2Q9QA 3SOLA 3IF8B 4ZHQE 2PBIA 5LHHB 4CUGA