3U78A

E67-2 selectively inhibits kiaa1718, a human histone h3 lysine 9 jumonji demethylase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
366
structure length
366
Chain Sequence
b'PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 7
publication title An Analog of BIX-01294 Selectively Inhibits a Family of Histone H3 Lysine 9 Jumonji Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 366
sequence length 366
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3u78A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u78A01
3LDBA 4Y4RA 5FXVA 3KV6A 5F2SA 5K4LA 3K3OA 4DO0A 4DIQA 4QWNA 5A1FA 5FJKA 5FYMA 4QX7A 5E6HA 5FYYA 5LY1A 4EYUA 5FXZA 5FPLA 5FYCA 3ZLIA 5IW0A 5ISLA 5A80A 3N9MA 3RVHA 2GP5A 2XMLA 5F5CA 5A7WB 2XXZA 5FY9A 2W2IA 5FPUA 4EZ4A 4LIVA 4V2VA 5FP7A 3PTRB 2YBPA 2YPDA 4BXFA 5F5IA 4EZHA 5FP8A 5FZ9A 5FXXA 5A1LA 5F32A 3UYJA 4BISA 2YU1A 5FZHA 5A3NA 4CCLA 2XDVA 4TN7A 5FYIA 3KV4A 3NJYA 4Y3OA 2OX0A 4HONA 3PU8A 5F3IA 4CSWA 5FZKA 2OQ6A 5F3GA 4CCMA 5A3WA 5LY2A 5FWJA 5IVFA 4LITA 2OT7A 5IVEA 5FYHA 5FZ4A 5FZOA 5FY8A 4AI9A 2GP3A 3AVRA 5FZEA 4QXBA 5FZ1A 5FY7A 5LWBA 2OQ7A 4LIUA 5FZBA 5F37A 2OS2A 5FP4A 4CUGA 5F2WA 4V2WA 5A7PA 5FZMA 5A7NA 3OPWA 3U78A 5FZOB 5FXWA 5FZ0A 3N9LA 5FZ8A 4AAPA 4D6QA 5FPVA 5FBJA 3KVAA 2YBSA 4URAA 5FZ7A 5FY4A 4C8DA 5FWEA 5FUNA 1VRBA 5FV3A 4GAZA 5FP3A 5A7OA 2Q8CA 2Q8DA 4IGPA 3N9PA 5IVBA 4CCKA 5IVJA 5FYSA 5FZCA 5FPAA 5FY0A 3KV9A 3OPTA 5FZGA 5KR7A 3U4SA 5FUPA 3PUAA 5FYBA 4GJZA 3K2OA 4QX8A 5FZ3A 5FZDA 3AL5A 5FZAA 3AL6A 3K3NA 4GD4A 2Q8EA 2P5BA 5A7WA 4BU2A 2XUEA 5A7SA 4UF0A 5IVYA 4D6RA 4D6SA 5IVVA 4XDOA 5IVCA 4E4HA 5IWFA 2YBKA 3LD8A 3KV5A 3PDQA 4CCOA 5A3TA 4QXHA 3PUQA 5FZ6A 4IGOA 2VD7A 5F39A 5FZFA 5F3EA 4IGQA 5ANQA 4CCJA 5FZIA 2YU2A 5FYUA 5FYZA 5F3CA 2WWUA 4Y33A 4UF0B 5A7QA 5FZLA 5A3PA 5F5AA 3AVSA 5FYTA 5FY5A 4ASKA 3PU3A 2WWJA 3PURA 5FYVA 5LW9A 5FPBA 4LXLA 3N9OA 4HOOA 3KVBA 5FP9A 4CCNA 4GJYA 4NUBA 4XDPA 5CEHA 3DXUA 2PXJA 3DXTA 5FJHA 3N9QA 3N9NA 4QXCA 5FY1A 4QU1A 3ZPOA 3PUSA
chains in the Genus database with same CATH superfamily
2A6YA 2YDRA 4NPMA 1YYNA 1HV1A 3DTOA 3C51A 3M65A 2ZAAA 1G86A 4ILAA 1KJLA 4L2NA 2YPDA 4FCAA 1YFUA 4PIYA 2VOTA 2A6WA 5E1RA 2QA7A 4QB2A 2IAKA 3VR8A 1DQ1A 3B9CA 1NYWA 4RS5A 4O61A 3RJRA 2WS3A 5CB7A 4RFT0 4YZ1A 1V6LA 4S2DA 5LWBA 1O4TA 3ENRA 2P34A 2Y6FA 3QCWA 3Q5XA 4CUGA 2V5DA 3CIRA 4B8EA 3A0NA 2AZ5A 1W2NA 2XLGA 3NKGA 3UUXB 2Q8CA 2A70A 2X9YA 2XM1A 4XZCA 1LCLA 5FY0A 1FV3A 1XU2A 1F35A 3ZT7A 4GJZA 5L3DB 2HWC2 4IT4A 1CZSA 3CHXA 3P1IA 5C8CA 4LF4T 5B4XA 2GH2A 2MOZA 4P9GA 4YVSA 1ENRA 5HCFA 1ZX5A 4LO7A 2ZGUA 1UOJA 1T8BA 3HJRA 2ORZA 2ZXQA 4FPLA 2OA2A 1H6YA 2ZM2A 3BGAA 4DY5A 4LEJA 2WNVB 2BG9A 3ZSSA 1ZHCA 2XJUA 5HXSA 3LPGA 5FY9A 5HYAA 4ASMB 4P08A 3JD71 1UO9A 2VG9A 5FXXA 2LM9A 1RHI2 2O1QA 3WSOA 4YW7A 2GC0A 4AGGA 2DBIA 2QQNA 2CDOA 3WDYA 4PW8A 3T09A 1SFPA 2XSBA 2A71A 2XJTA 2QQWA 4IV3C 4Q4V1 4XF0A 5DUXA 3AEGA 2WS92 1CGPA 3M3IA 4PLMA 1K5MB 4OI2A 1C8M2 1XB9A 5HV4A 1POV3 4D94A 1X50A 5KXCA 4NPPA 2PMWB 3UT0A 2X0LB 3ABZA 1TZOA 2O14A 2LALA 1UPSA 1MS9A 2CMRA 4NAMA 2UUBT 2H0VA 1ULEA 3I2JA 5A3UA 1MMAA 4TUYE 1C28A 5T5OA 4NAOA 3ITQA 5IUQA 5T54A 3AYAA 1ZP0A 3TOJA 4WBBA 4U33A 2KT9A 4UVBB 3M4FA 4FOVA 2FDIA 5EZYE 1I9RA 3WQ1A 1ENXA 1EZ3A 3ZMVB 1QOOA 4KNCA 4YG0A 4PI2A 5DQVA 1NCQB 2XQ9A 1R082 5FZOA 3W9AA 2BVMA 1POV0 3IPVB 1A3KA 3POYA 2DV9A 5GZEA 4IV1B 2YZ4A 1WR6A 3WXPA 5DAXA 3IB3A 1VAMA 4DNYA 5FPAA 1FXZA 5APAA 4ATEA 4COZA 4FT8A 3WQ0A 3AMPA 3CKHA 1IG0A 4Y22A 3RYPA 1DYOA 3R4SA 5A3MA 3WV6A 5IVCA 4JRAA 3ILRA 4AG4A 1MS4A 2WWVA 5F3CA 1B35B 3TBDA 4HFHA 2HPJA 3F2ZA 4QHZA 3ZMOA 1LOCA 1T72A 2F17A 1RC6A 4XJ8A 4NUUA 3Q5WA 1WCUA 4NWWA 1MIYA 1AR61 4IEOA 3ZM8A 1SLTA 5C4WC 2W52A 4QHOA 4XUNA 1ND3A 1GNYA 5LASA 1KJRA 4R9AA 3DUIA 1LOBA 3EJKA 5DUWA 2YV8A 2R072 4MGYE 3POJA 3ZKRA 2DTYA 2WABA 5BV6A 5KHIA 2JD4A 4ARYA 2WU5A 3Q8AA 2PAMA 3B13A 4QKBA 3P50A 4I09A 4FBFA 1RMU1 4KI0F 4K0KT 1AJOA 4EEBA 2Y0OA 2AR6A 5DAPA 5FO8B 4ILUA 1XC6A 1K5JA 1WYBA 2ZX0A 4HWDA 4QPYA 2RM21 2VZOA 3O1HA 4QM9A 3POBA 3DYOA 4COWA 4COYA 2JWPA 4IE4A 2VQUA 3RIUC 3JUUA 3VBFB 4LE3A 3MZKB 4F3JA 1I3HA 5JZGA 2UXBT 3I3BA 5CKQA 1Z78A 4M00A 5FYMA 4NRQA 2LM2A 4QX8B 1U0AA 5BNQA 4A97A 3GBGA 1W05A 1W8NA 4AR2A 3JU9A 1UN1A 2FDKA 1RUE3 5FP8A 2Q4SA 3B01A 3GN5A 3H50A 4N53B 2WZR1 4HZFA 1EY2A 4LF9T 2XOMA 2JG8B 2JQ9A 3U14A 4JEUB 5J0ZA 3D5OA 4O4HE 4RQPA 2XQ8A 2LSGA 2OUJA 1FOD2 5A7PA 3CKDA 1J1TA 3EVYA 1QJZA 1IZ3A 3THCA 4QPIA 1XDOA 1LTEA 3UQ4A 5IK7A 1U12A 1IPSA 1UKGA 2ARCA 2ET7A 2MYSA 4Y1XA 1VBB2 5CGMA 3K75B 4NXNT 3KZ4C 4NHMA 2N7GA 4A2UA 4H3WA 1JZ2A 3FBZA 1VLNA 2IXLA 4O9GA 1BEV2 5L3GB 3VRAA 1W6MB 1IS6A 4FPJA 4H9SE 1Q43A 3WG1A 3R84B 3ZFEC 1OPOA 2FQPA 3ZXLA 4HN1A 3ZMNA 5CG9A 1OH4A 2BBJA 4LF7T 2NMOA 3KHBA 3AAAB 2X5IB 4E2SA 4JI4T 3KQRA 3R6SA 4TLFA 4JI7T 4MX3A 1MZFA 1EV11 4EROA 1HRV3 1LHUA 3RH3A 5D8AA 2XVKA 1HB2A 1W0NA 2E7TA 3M7AA 4GH4A 1J84A 5L3CB 1LOAA 4MGSA 4PF5A 5B4NA 1SBFA 3FJSA 5J09A 3I3EA 4O4IE 4KBBA 2Q8DA 1WA4A 2NLRA 4YFSA 3MF6A 2LKGA 2AC1A 3WP3A 3UESA 2E51A 3ZC1A 3ASIA 3AP6A 3IT8A 3B3QE 3TEXA 2GALA 2E26A 1NCRA 2HWE2 1A34A 4XPVA 3VD7A 4M1PA 5AQTB 2F6BA 4XAXB 3I2GA 2HWB2 4UELA 1RVF1 1AYN2 1W0PA 4QB6A 3POIA 1ZKEA 1W8TA 3DF0A 3N9QA 2D6MA 3AA0B 4CUAA 5HAXA 2DCFA 2WFPA 5FPLA 3G06A 5ISLA 4AFBA 4Y20A 4QXCB 1YI7A 5LATA 2G9ZA 5C8CB 3ON7A 3F2EA 3UUBA 2YFZA 4YVSB 1PO12 3PMSA 3HT1A 5JREA 2OUHA 2IXIA 1A8DA 2WN2A 1IJ6A 4FP2A 2XSAA 2UWAA 3GA8A 1ENSA 1VBA1 4A4AA 4HKAA 4KHZF 4XUPA 3BTAA 1YJLA 3MA9A 2BNMA 3K51A 2BG9B 2FMYA 1TVGA 3EI0A 2CGNA 3FUQA 4TYSA 3FZFB 4DEVA 1JZ5A 1RJ7A 2VCBA 1UY0A 2HYXA 3TLWA 4XFBA 3U0ZA 4ZHNA 1V00A 4BQYA 3U75A 2GAUA 1HXS2 3JD73 4AW7A 3I2HA 3ZYFA 5L9RA 3X29B 4XJAA 3ORJA 4QB1A 1SMVA 3DP7A 2JJ9A 4ASKA 5GZDA 2WWJA 4H9NC 2BBVA 3EBRA 4YYOA 5HCJA 2Y6JA 5LRSA 2XZEA 2P17A 1VRH2 5CKMA 2EIGA 2AACA 4L9IA 4XBFB 5A1FA 4Q4V3 4AISA 3HN3A 2Z4FA 4LIVA 5JAXA 4KBZA 4ISTA 2XQ6A 3KV4A 2OX0A 1B7TA 4F7ZA 5CFCB 3QUJA 2B46X 1M4WA 1DCSA 1XYPA 1CAUA 4AVSA 4WM7A 4WVWA 5K8SA 4E2GA 3OYZA 4ZXLA 4OK0A 3ZMSB 2JDAA 2V72A 4TTGA 4TNWA 5IHRA 3H7YA 1HB3A 5LA1A 5L36A 5CU1A 1MZ5A 4E4SA 2VURA 5FO9B 4BWOA 3AECA 2XGXA 2E31A 1VMJA 5CVRA 4U72A 5DUVA 4LULA 1ZBA2 3ZPYA 5AQUB 2IHR1 1KFUL 1VBD2 3UFGA 3FZKB 5LGNB 1RITA 3UU3A 1BR0A 2RMU1 4LLOA 2WO1A 1GBGA 2EHOC 2GC3A 4EGWA 4EE2A 1SCSA 4W6YA 3D0JA 4Y22B 2DWKA 4PJLA 1VAKA 5LBFA 5FBZA 5GKAC 5F32A 4K9SA 1XXNA 1BBT1 4NPLA 2CWYA 5KXJA 1E5RA 3UULA 3O12A 3AFKA 1NKGA 3AZYA 3AJYA 2E9XC 3TN91 3I8TA 5JVDE 4J1XA 5KDMC 5F37A 4CN1A 3HR0A 5AQFB 4I43B 3HBZA 1ND3B 4X6RB 4UFHA 3IA3A 1AR63 3HVDA 3WCSA 1HIXA 3H37A 3NKZA 2LOPA 4Q0QA 3AAIA 3MV11 4WYVA 4KWKA 1ODNA 2HWD1 4MGZE 1MQTA 4LUMA 2VZUA 5L4HA 2QE3A 2P3IA 3PJAJ 4UAPA 5JIUA 1QUUA 4IGUA 1RXFA 3PUVF 3WNXA 1RMU3 4QX1A 2XTLA 2DU0A 2VZ1A 2ZM8A 4QT6A 5FZ9A 4AVTA 2RM23 4G4FA 5DZEA 5GZFA 5JZGB 2G1MA 2F4VT 2W2UA 1NY72 2RV9A 3RQWA 4O65A 3NZPA 3R6NA 3I0OA 3Q8CA 2CBIA 5A3OA 4I50E 3V0BA 2RS32 1NWMX 4K7JA 4M3CE 2YDSA 2KSRA 1HX1B 2XQRA 1QXRA 4UEMA 4LBLA 1S0FA 2Q1MA 3GN5B 3T1HT 2W87A 4RYDA 1V0AA 5LOVE 2X66A 2JKXA 4RQPB 2F4LA 3C4WA 4HPKA 5C3JA 5KBFA 1NLQA 4DVDA 1UAIA 1UX7A 3VBHA 1RUJ2 1TMF2 5A3PA 5DN2A 4QPIB 1G7YA 2WZR3 1RUC2 2WQ4A 1KDKA 5C3SA 3V5SA 4D69A 1MMDA 3RHWA 3R05A 4ATFA 4GWNA 4CDQC 2C5JA 3AXEA 3CQGB 4XOGA 4FTEA 1QDOA 5IW0A 4B1MA 1YQCA 1RUD2 4OUMA 4H9PC 5EPAA 4XMAA 2LSKA 1G9BA 3ILNA 1ZRRA 2XDVA 2PHTA 3AXJA 4DV5T 3I2DA 1OA2A 2VZQA 2FDFA 1T6BX 2PJQA 5LYJE 2HWC1 2A6XA 3HEIA 5C8YE 2VK9A 3PV0F 4PIXA 4B4RA 3MIHA 2NMNA 1J5WA 4PJMA 2VZTA 3BPSA 1PVC2 4AIUA 2VE1A 4J25A 1SQ4A 3UJQA 4NMIA 4MSVA 4YM3A 5F7UA 3ZFFC 1TNFA 1BR4A 1YRZA 5LEJA 5AQHB 3POEA 4GH4B 1J5ET 2YY1A 3SEPA 3PUXF 4DR2T 5ABHA 4LBJA 4LQRA 2XHKA 3WNOA 4NIHA 1EV13 5AVPA 3O7OA 1ZV4X 4DXTA 2W63A 3KM5A 1DIWA 4FFGA 2PA7A 2XQ4A 4YSXA 3IDBB 1E57A 4I0AA 1WWYA 3H3MA 1OA3A 1RTVA 2WS91 3H8XA 5JH7E 4P1NA 2RG4A 2H89A 3ES4A 1J59A 3V56A 4EIWA 4FPHA 4N9IA 1MIWA 1VR3A 1C8M1 3AEEA 1W8FA 3ZR5A 1OMIA 1IKQA 3VDDC 4XZPA 3HR9A 3QACA 5LBEA 2A3XA 4QXBA 4LF8T 4IDPA 3LAGA 1EPWA 4JRLA 1YO8A 3GHNA 1OPMA 3VKNA 2IFWA 2IVJA 2RJ2A 2WC2A 4URAA 1RVF3 3VB9A 4CDUB 3RJ2X 5FKYA 2V8SV 3SOLA 1W8ZA 4COFA 3IEEA 5ABJA 3FXEB 4KGQA 1PVXA 4EWEA 5BNPC 3VZMA 1D0HA 3RG0A 3WG4A 3RYHE 2W1WA 4D3WA 3MW2A 2R0FA 4OHZA 2FZ1A 3M3OA 3B57A 4PCRA 1UU6A 4AHZA 1MZ6A 4BM8A 2GNMA 4CN6A 1VBA3 4CXWA 2VNOA 3CF6E 4QXKA 4DO0A 5CISA 2NP0A 2JIWA 5J2UE 1W2OA 3CDZB 4X1IE 2OYZA 1HFAA 4R8HA 2EIDA 1PGL2 2DCKA 2ZHMA 1ULGA 4UW5A 2KXPB 5J96B 3QB5A 2GZWA 4PLOA 4ERRA 5DJQC 1QWRA 4NIIA 2Z42A 5FYIA 3MFCA 5JOZA 5FL0A 1LESA 4Q8LA 3RYRA 1H7CA 1OKOA 4XUTA 2C1FA 5A32A 1PX3A 5BNNA 1CWPA 3BTZA 1Z0PA 3ZMZB 1A6CA 4CUCA 2JDHA 4LBKA 4CP0A 4BH9A 1I5ZA 4I0WB 2GN7A 4G63A 3RI8A 1QY4A 5LBMA 3MEPA 4MOAA 1UCUA 2D2SA 3BOWA 3WNLA 5JDBA 4YFZA 1OBNA 4TSVA 3VBOB 2CWMA 1CAUB 4AGVA 4FPEA 3DPRC 3ZKYA 2O8OA 2QQOA 4B3RT 5LBQB 1LOFA 3UGHA 2ZMLA 5K0UA 1OHFA 3UU6A 1C4RA 1XDPA 3ZPOA 4ZHQE 2R071 5I0TA 2W95A 3E6DA 3MKDA 1AR92 1R1A2 2DFBA 2K0GA 4EZ4A 2IXJA 2EVXA 4GOUA 4MG2A 3B5LB 1GSLA 1J83A 1O3XA 3D3AA 2IUWA 3ES1A 2EF6A 2CWSA 5I93A 2V09A 2D44A 4R4XA 3E5UA 1DF0A 4YSFA 4NPRA 3EHKA 1UYPA 3J4UH 5AQSB 1U4QA 3UGFA 1JZ7A 1GZTA 2ZX2A 5JR2A 3OPWA 4MHUA 4JGZC 4CCDA 3T0DA 4DY3A 3EAMA 1UXXX 2YBSA 2YHJA 4M4RA 2L8KA 1XRUA 3JCFA 3WHTA 1JUIA 2CRBA 2N9DA 1H4GA 2RMU3 1HNZT 1GFF2 1WCDJ 1ULPA 1VPHA 3H42B 3MPBA 2J1RA 1KNZA 3ATGA 2Z2SB 3HKDE 2DF7A 2D0UA 2Y34A 1D7PM 2JJ6A 4IQPA 3PDYA 1YQ8A 3AAEB 2XASB 2LM3A 1HX6A 4KX6A 3B7MA 4CVUA 2B7YA 4CYDA 5A7QA 3J7LA 1V9U2 1DGRA 4RR3A 1XNAA 5JR9B 1BBT3 3ZIWA 2QVAA 2PXJA 2LUWA 1IS4A 3CO2A 2F4PA 2YDEA 3TN93 2SPCA 4WBOA 3O9XA 3DEMA 3N2KE 1DHKB 2Q0AA 1KGYA 3WUDA 3RYIE 1FOD1 4ES9A 1VP6A 1XWMA 1UZZA 1AR73 5DZFA 1UPIA 4BISA 2BRTA 3P4PA 3ZFGA 3SH3A 2DHRA 4X64T 4HONA 3OJBA 1VBB1 2A1XA 3BOPA 5FVLA 1DGLA 2AREA 1ULCA 2D5FA 3KBTA 4Q0VA 1D4M1 1FATA 4FPOB 3ZKUA 1XNKA 2BNOA 1ZYBA 1QDCA 2VR4A 2VUCA 4XZUG 2HWD3 2Q1FA 1UY2A 1COV1 5M0TA 1BEV1 4IGPA 2NR4A 4QGLA 4B4QA 1Z7S2 2EAAA 5FZGA 5FQ0B 2FD8A 2CXFA 5T55A 3BVCA 5HXVA 3LK3B 1HCIA 4UFJA 4O4JE 5AQJB 1U5ZA 4QPGC 5FZFA 1LRZA 3GCXA 3V0BB 4DR7T 3POGA 1WD4A 4M3CF 1YQ6A 2JENA 5LW9A 3AX4A 1LNSA 1F15A 2ZGTA 2WAUA 1MACA 4Z82A 4DBRA 2D6PA 5D1IA 1C3HA 3LKJA 3M3QA 1H0BA 4HPKB 2VB6A 1HB4A 1H2KA 3VBHB 2EHOD 4QDRA 4G2AA 4OUSA 3CJIC 1W6PA 2OZJA 2WBKA 2PBIA 1H8VA 4YTPA 3UTKA 1X82A 5AC91 3HD8B 3MLLA 4WM7C 4XAAA 1A78A 4GWJA 4EN7B 3RKGA 2CEAA 5FY4A 1NCQC 2GNBA 4PNIA 1SG3A 1W03A 4QHBA 2WYFA 1AYN1 5FYSA 2PAEA 2V1DB 3PUAA 3ZX7A 3R4UA 4U2YA 2E9XD 1YUDA 1OLMA 4NRMA 2BERA 2R042 4NN0A 3WDWA 4XCAA 4A41A 4CUBA 2ZX1A 5A6ZA 4H9QC 4G9SB 1CAWB 1OURA 1S55A 1UCXA 4OHXA 5A3TA 5FFOC 4MLOA 2X09A 4D7SA 2XAQB 3UL2A 5LA9A 4IEPA 3AM2A 4IDOA 1UWWA 3AKSA 2FUPA 1G6NA 4H63V 3I2OA 4BQ5A 2HWC3 2HEYF 4Q29A 1W6QA 4XEZA 3ZYLA 1QOSA 3BTXA 4META 5FREA 2E5LT 4ZU5A 2L9LA 5EWSA 1NQDA 3M1HA 3WI3A 2JE7A 4IW3A 4OHVA 2VUJA 1RJ8A 2AE9A 1HNWT 4WM8B 4AL9A 2I74A 1ZRIA 5AQLB 1XNDA 4S2FA 4NVPA 4PIZA 4F83A 1HXS1 3GXUA 2RJKA 4L0RA 4YSYA 1ULOA 4HSJA 1W3VA 3VBSA 5GLTA 1RHI3 1MS8A 1E1HB 5ADXL 3NSTA 1KF6A 5JXJA 2M67A 5CADA 3TKLB 5IAVA 1BR1A 5L7OC 1UD1A 2EXIA 1Q8OA 4KMCA 1BHGA 4ZS3A 4QPWA 2WS93 1OEDE 4Y33A 1H4HA 1D0XA 1C8M3 2D6LX 5C71A 2YB7A 2VMDA 3IBPA 5FOJB 3VL9A 5A70A 5F2SA 3K3OA 1H1AA 1VMFA 1MQTC 3TLUA 5ABJB 4AKHA 4P9IA 2CV6A 3ZCJA 5K7PA 3ZDVA 3GMIA 1LHVA 1WMFA 3AZXA 1SA0E 4YZ5A 2A75A 5A3LA 3TWIA 4CDWB 4U3CA 4OYJA 5AQRB 3U10A 4YZ2A 4CTEA 2W3JA 3MACA 1MNDA 3VD3A 2G9GA 3K8PC 1QOTA 2VZ3A 3VDBA 1S0IA 2XJSA 1CZVA 1ZBA1 1QSDA 3MLKA 4EYYR 1ZM1A 1S4CA 4DQAA 1VBD1 4M0HA 5FUNA 5JDQA 1S2BA 3AXDA 4ARXA 1L7QA 2VCCA 5FPXA 3MV01 3RGLA 1AHSA 2CU5A 2VL4A 3H1YA 3I7DA 5L19A 3F57A 1R083 4KL1A 2P6HA 3KD4A 1I94T 3W15B 3WDXA 5HEOA 5A32B 4FPFA 5F3EA 2WIIB 2VU9A 3UUNA 5IYZE 4NHYA 3WLUA 5A33A 1UOGA 5HXCA 1G9AA 1HQNA 3NL1A 4XETA 5FJHA 4AFCA 3ZN6A 4LT5A 1Y9MA 1OLME 2VBBA 2ZGNA 3KB5A 1SACA 1TEIA 3VD5A 4DBQA 1FMD2 4YM2A 5AQVB 4WW0A 3FE5A 1D1AA 4OQ8A 2W47A 3CIHA 3A0KA 3OEAA 4ZS2A 1UY3A 4UVCB 3DKWA 3AMHA 4YSZA 4XIKA 5K0UB 3OBZA 1NZCA 2TUNA 2W1UA 5IK5A 5A7NA 3I2IA 3BIEA 2RA1A 3ZYHA 4UYBA 4N43B 3T30A 1LU2A 2WLQA 2FBEA 2VCAA 1DQ2A 3CX7B 3K1SA 2HJIA 2R073 1F8VA 2JDNA 4A42A 2HLEA 3NV1A 1QNWA 1ACCA 4HWIB 4B7KA 3I2FA 2C4XA 2IC1A 2ES0A 3AE9A 1WZXA 3LJCA 5C5UA 3C7GA 2XAHB 3U07A 4QKFA 4J2CA 5EK2A 2UU8A 5JRCA 1OSGA 2YOEA 4WNKA 4FAHA 3IWZA 4MHRA 5CEHA 1JZ8A 1NY71 2GMPA 2WY2A 1VBC1 3LDBA 3O1MA 2LSYA 3E08A 1N3QA 5LG3A 2BGCA 2RS31 4LHNA 3ZXFA 1ZOYA 4RR3B 1I6ZA 3DGTA 2YUEA 3WDUA 1WMEA 4A45A 2DTWA 1W0OA 5IATA 2M6IA 4GKYA 4A6SA 4NHLA 5BXXA 3ZN1B 4BHPA 1PZ9A 2JKBA 3WNNA 2W0GA 3THTA 2P3JA 1DZRA 4LTAA 1RUJ1 2CNAA 3LEKA 3ILFA 3IHRA 1RUC1 1CIYA 4YJ2E 5K9YA 3ZEFB 5CA0E 2W1QA 5CFDA 2E7QA 4IEZA 1JI6A 4N7IA 3BU7A 1YWKA 5GONE 1FOD3 1RUD1 1QGLA 4YGDA 2E63A 2YK0A 4JI3T 4CU8A 3OF1A 5FYTA 1KD7A 1CD3G 4XIOA 3BQIA 2JG9A 3ZVXA 1VBB3 2XPKA 4CEYC 4I30A 4A6OA 2VH9A 1BLZA 1WR0A 3KT7A 1AX0A 4BE3A 4EN8B 4DV6T 3LDKA 3CVRA 1DP0A 4JVAA 4BXFA 2VNRA 1COV3 3J7HA 4XC9A 1BEV3 4CU9A 2YU1A 5HWXA 1PVC1 1US3A 2R16A 2JDZA 5I0UA 1Y01A 5FIXA 5C3QA 2LE8A 2HEWF 2G4IA 3ZSMA 5FZEA 1PO22 4CP9A 2ET1A 1W04A 2J47A 3UKVA 3FZMB 2WO7A 5JOYA 4FQZA 4DOUA 4HWFA 3S0MA 4DV3T 4CCKA 4AVCA 4NWVA 4LHSA 3ZSKA 4MXWA 2WT1A 3LBXA 1Y9QA 5GALA 4BU2A 1W6PB 4AEJA 5J98B 1APNA 4X8NA 4HFVA 1QJU2 1KQRA 3WDVA 2R1DA 2B4KA 1GMMA 4XUOA 3PJAA 1LGNA 4GMP1 5HCMA 4GJYA 1D4VB 3HNBM 1TME2 3APBA 4FTSA 1W9SA 2DBNA 2CPTA 4CE8A 5AC93 4QX7A 2GH8A 4HEAA 3VL8A 4BQ2A 3T1LA 2XJRA 3VD9A 2A2FX 1UU5A 4EB6E 2HWE3 3HL6A 5DAQA 4KG0A 1VCTA 4PQ9A 3PTRB 1UY4A 1PK6B 3T1MA 1X9BA 5DDJ2 4YW1A 3AZWA 1AYN3 3JB8A 4MZUA 4DB5A 1LENA 1GOFA 4TWTA 1KXGA 1IPKA 4BLJA 2B76A 1SLBA 5CG8A 2W1SA 3ONJA 4NXMT 2GP3A 3F31A 5FZ1A 3M3CA 3KBUA 2PHWA 3TNPB 4QQ2A 4JGYA 3UK9A 4D8MA 4Z92B 2VASA 3VR9A 1QJX2 4OI0A 1PMHX 4PF1A 1PO13 3WF1A 3N3HA 1HNXT 3ROUA 2C9KA 2Y8KA 3LK42 5F8PA 4QD2A 3D8CA 4HE8A 1OKQA 2NZ9A 4YW3A 3ONLC 2SLIA 5C4WA 2CXDA 3JBG2 4D6SA 1SPPB 5G05L 2XJVA 3PDQA 2ZS6B 3SFEA 5ANQA 2WSSV 3A4UA 2CY6A 2WQYA 2XKPA 1Y4WA 2ZGMA 3W58A 3PURA 1JYTA 3VBSB 1QU0A 4XCBA 1EAH1 4KU7A 2J1DG 1BQPA 3N9NA 5A6XA 1IBKT 1OQEA 3FLRA 3HN1A 1W28A 2WZ8A 2Y64A 2WT2A 2GK9A 5EXOA 1HXS3 2OZ6A 4PFOA 1N3PA 1VMHA 1ASJ2 2CGPA 4EZHA 4MADA 4X1YE 3ZR6A 2XLFA 1X8MA 1AYM2 3O1JA 4GZ9A 1VRH3 3VBUA 4HKLA 1OQ1A 3ZFGC 1NT0A 4LMLA 1SDDB 1RUI2 5FCCA 4JEHB 4Y5TA 1CX1A 2A9UA 4XF1A 2WA4A 3RIUA 2W91A 1G8XA 3O1SA 3AP7A 1N34T 1UIKA 1S0GA 2YC2A 3FZHB 1OEDC 5T52A 4XILA 3KV9A 2IC6A 1O4YA 2BGPA 1JYVA 2ZM6T 3JC6C 2Y33A 1YKHB 4DV4T 5BR8T 2JMKA 5LBCA 2WL1A 3FL7A 2VQTA 1IPJA 2TEPA 5ABEA 4IEWA 2V7KA 5BMVE 1CUNA 2W5FA 1BJQA 2ERFA 4LKSA 3GGLA 1CHUA 3LB9A 1NX9A 5JSPA 3WHUA 2MEV2 1WMDA 1FNYA 1ZBA3 3B69A 3O0WA 4FFIA 3NV2A 3H7JA 1DQ6A 4YHHT 2PHFA 2QQIA 2VULA 1KEXA 2XHNA 1VBD3 2WM9A 2XM2A 3I49A 4IE0A 5EP9A 5J3UA 2YG0A 3J26N 5DAVA 4IEVA 4N78D 3OCPA 4XXPA 4EEDA 3ZN6B 2WZHA 2E7AA 4Z91A 2VKHA 2R30A 5KHKA 3WW2A 4EN0A 3UNPA 4U2AA 3TLTA 4E7SA 4Y4YA 3H8RA 2JIJA 3MI8A 1V9U1 5FMNA 4ISSA 1X9TA 1DQ4A 1JS9A 3HKBE 4YW2A 2DFCA 1VAVA 2ADEA 2Q8EA 4Z1VA 2QFEA 4UF0A 1J3QA 4XDOA 4A7ZA 1NLRA 4J1WA 4LBQB 4Q0PA 1FMVA 1YEWA 2HN1A 3RC8A 4IE6A 2IIUA 5DUUA 4HOOA 3AA7B 2CCQA 1WLXA 4MGQA 3ZT5A 5FY1A 5LK7B 3WG2A 3DKQA 2UUCT 5C33A 2JXAA 2FJDA 2V6XA 3E6BA 3OYWB 5L73A 3KQ4B 4P09A 4RSUA 4X20E 5LA0A 2FDHA 2GMMA 5IT6A 3FX3A 4AWDA 5JRCB 3FHQA 4ZZ5A 4Z8BA 3VKHA 5FZ4A 3S7IA 1ST8A 3PLQA 4JAAA 1C8NA 4KBMB 2IWGB 4E4DX 1JHJA 2R49A 3KT4A 5JOWA 5FZMA 5ABGA 3FXDB 1AL0G 4QAWA 3Q8EA 3RRDA 2BPA2 2LT3A 2VUAA 1AR82 5JLVA 5FZDA 4TZ4C 2VL0A 3GZEA 1DYKA 1WLCA 3KINB 3K3QC 1IZNB 2J42A 1GQHA 2RS33 1Y7BA 4BMBA 3CBNA 1LB2A 1MS3A 3PE0A 3ZXEA 3NV4A 2E5VA 1IQDC 1UQXA 2YC4A 2DUOA 1ZZ9A 5TAOA 2ZX4A 1RUH2 3WQBA 2HKXA 3BQLA 2LHNA 1JYIA 5C5TA 1UXZA 3N9MA 1XE8A 2JDPA 2K9ZA 3GALA 1RUJ3 1TMF3 3M8LA 3C4ZA 3L9JT 4NJ4A 2GMEA 1ZRDA 1RUC3 1OI6A 1WLTA 2PHXA 4TZDA 3QLQA 2CHOA 3TEZA 3M2MA 4ZZCA 3RWKX 2WWSA 3U3IA 4BK4A 4OHYA 1CAVA 2E2AA 5FNVE 1RUD3 4IV3B 4V2WA 4ILCA 1JNZA 3U78A 5DG2A 3UV9A 5JXIA 4XW3A 1VRBA 1LODA 1UURA 4Q5OA 1MVEA 2ZHNA 4CXXA 4ZI2C 4DR3T 3N2GE 3OD4A 3UU4A 5HXEA 1YW0A 3W5MA 2XQXA 3T2QA 3AE3A 4I0UA 2DUPA 3VRBA 1PVC3 5ABFA 2JDUA 3ZCIA 3VBOC 2ODUA 3O0VA 4MO3M 1UZYA 1CONA 1H9PA 1DU2A 1YNAA 1WLDA 4A7KA 3MIBA 2EXJA 1S0JA 4HK8A 3POWA 4IREA 1J1LA 5CIRA 3WR0A 4DUVA 1V6OA 3THPA 1X9PA 2LRPA 2YGMA 2Q9QC 2X9XA 1MVQA 2VUDA 5CZKA 1X8EA 5FOBB 3POFA 4LR4A 4HANA 3J7Yq 1RXGA 4P9YA 3S7EA 5KXBA 4HFEA 4QX7B 2KMFA 1HRV1 2O8QA 4YWAA 2GNDA 4GMP3 2BZDA 4TWFA 3OTFA 3ACGA 2YGLA 4BLIA 1E5IA 3WOGA 2DCZA 2ACXA 4Y24A 4QX3A 4UFKA 1YKEB 2MTQA 3SCFA 4BA9A 2HPLA 3C7OA 2I59A 4DRRA 4BPZA 2IXCA 2Y6LA 4MV2A 1TNRA 2XVGA 4R9CA 1OVSA 3X1DA 1WW6A 3UU8A 3DYMA 5BPXA 3H0OA 4Z8XA 5SV5A 3H8OA 2X9WA 2ZJCA 3IIIA 2CLYC 3HPNA 2E9XA 4BDVB 2VZSA 4P5HA 4AKGA 5ANNA 5C4WB 1NUKA 4HKWA 1DLLA 5E89A 2W4XA 1XPWA 1OD3A 4XJWA 5F5IA 4XURA 2Y6GA 4AI1A 3NRUA 2WDBA 2WT0A 1H2LA 4GMP0 5F3IA 3GM8A 3LOIA 3PUHA 4I2OA 5JSOA 3K77A 3VGIA 4YXDA 4ZU4A 5EHDA 5JMCA 4IEYA 1AJKA 4AI0A 1GQPA 2RS52 2NW9A 1GR3A 3RRCA 2VQ0A 2B39A 3N35A 4GAZA 1EAH3 4KMQA 1X7NA 3I3QA 3QH7A 3NNLA 3MK7C 1HF8A 3P7IA 4AYUA 2PFVA 5JI7A 3VBRC 4XE9A 4LFBT 4DFSA 2ZABA 5CFDC 1FMD1 3S30A 1WUVA 5C7GA 4XABA 3URFA 1HG2A 1NQJA 3WF2A 1H8TC 2Y26A 4DS0A 2WINB 4UI9L 2OLTA 1D1BA 5KHGA 2JG9C 4QQLA 4Q2FA 1QKQA 3B02A 1N1VA 4PT6A 1MS0A 3LOBA 5HBAA 4LKEA 5FMOL 2D98A 4CEWB 3OGVA 3WUCA 3EO6A 2JE8A 3QNUA 4ZONA 3A21A 2YN6A 2GNTA 1UOBA 2FMDA 1WBFA 2XLAA 2V5CA 4NOTA 4BOWA 2E6VA 2GDFA 4Q27A 1HS7A 1FMWA 2QRXA 3NO8A 4LMFA 4A98A 2BUKA 1ZZBA 5FL1A 2UU9T 2BV4A 4NROA 2ZX3A 1AR93 1OOPB 4IL9A 2CXLA 2QZ2A 3NVOA 1XNQT 2RS12 2HH9A 2ADDA 1GKBA 2D6KA 2D3SA 2V7LA 4A3XA 3T0AA 2L3LA 5LNKA 4RD7A 3AL5A 1W2UA 2XBO2 4CDQA 1JU3A 4LO5B 4UWDA 2R062 5FAXA 2A6VA 4XHBA 4JQRA 1X36A 3V0AA 2I0MA 1X33A 1AL22 4IGOA 2BYVE 4YW6A 1BK0A 2PAKA 3BYWA 4H7MA 1UK5A 5TSWA 1STMA 3EUHA 5IYYA 1D0GA 4Q4V2 3VHPA 4QWNA 1FI2A 2I6HA 2V7IA 4BQ1A 2HBTA 5E6HA 5FKCA 3SXWA 2VKOA 3JADA 3ZFEB 4ZOLE 1OQDA 3HWJA 2KNDA 4X8PA 4LKDA 3RZKA 2VNGA 3C7EA 3WY6A 1V9U3 4JI0T 5KXEA 1W90A 5C9AB 1FNZA 3GZTB 4DR6T 2BFUS 2CHHA 4X66T 3IMMA 4Y1VA 3ZFFA 1N1TA 5GLVA 3QBQA 4AI9A 1IBMT 2NN8A 4WZCA 1SLAA 2ILMA 3SMHA 4L92A 4HMZA 1CAXA 4Y5Z0 2VVEA 5FPVA 3KVAA 4JGYC 4J6GA 2KWHA 1A8MA 4I55E 4LMKA 4FPYA 4XF9A 1UOFA 1UW8A 2QKDA 4E4HA 3MBWA 3PUZF 4XHXA 4AQFC 4HGAA 4IEXA 4YPJA 4OULA 3OUJA 4L11A 1LR5A 1S2EA 3JAFA 1Q8QA 5FP9A 3IIAA 4LA2A 3OGJA 2NW8A 3VDDA 3JC6D 2BVLA 2C5KT 4K1ZA 5DMYA 3TLVA 4W4ZA 3NJXA 3CQOA 4DMVA 3SH4A 1WCKA 3VZOA 5GM0A 5FMDA 4BK5A 2BBHA 1WCRA 1UIJA 1PZ7A 1JZ6A 2XJPA 3SITA 1V70A 5HEUA 3O0XA 3SCGA 3H3LA 3GZUC 1V9DA 2WMNA 4E4ZA 3I9WA 5BNPA 3O1OA 3VBUC 4CP2A 2MNGA 4C91A 3IDCB 3HOBA 1VB4A 1NAEA 4JI8T 4AFAA 1FJGT 3EMRA 1GQEA 1QJU1 1TQ5A 4CA9A 2ATFA 5FBJA 2TNFA 3N5LA 4CZZB 1VJ2A 1T6GC 4UW6A 1AR62 2WNUC 4C0BA 1RUG2 4L99A 5LJNA 1TME1 2BVVA 2P5BA 1UL9A 3KF5A 3E0ZA 3PIJA 2DI4A 5IWFA 3LSEA 2DCTA 4MUVA 2J1EA 3NBXX 2R1BA 1Q8VA 2H7OA 2WFF2 3G7DA 5F5WA 1GZ9A 5DDJ1 4QXHB 2A72A 4CI1B 2PG8A 5T3NA 2CBJA 4PJNA 2R043 3C3VA 1J3PA 4X1KE 1JYCA 4YZ4A 4PK6A 1QJX1 3RNSA 3FUOA 4YVWC 1H2NA 2BWAA 4D7TA 3PHMA 1MR5A 5DQ0A 1W0BA 4QGMA 3MW4A 2ZAHA 2XL7A 1XNTA 1YI9A 1GANA 2C0ZA 1I1EA 3USUB 3DPRA 4Q4W2 3I9YA 4XTMA 3FHNA 1HB1A 5DPNA 2W66A 1P8JA 5D21A 4BZ4A 1V6IA 1DZQA 3AEBA 3GF6A 4AVBA 1FAYA 2I2SA 1F2NA 4TNVA 3AKQA 4X6QB 4LO6B 2OIIA 2LRKA 1XNRT 1ULFA 4GIWA 4LJHA 1WW7A 1AXYA 1KRIA 2NQYA 2ENRA 1W6OA 2ZPXA 1SE7A 3RIFA 1AYM1 2A3WA 2KINB 4FQ4A 4JCKA 1S0DA 1LKXA 3GBFA 4OI1A 3KV6A 2EHOB 2O0OA 1YJKA 1RUI1 1T2XA 3MJXA 1US7B 2YC0A 5FXZA 4KGGA 5JR7B 4UT5A 2YEVC 4XF3A 2RE9A 3J7NA 4JGZA 5KC5A 3MGUA 5HEJA 4AOCA 4QH4A 4AI6A 3A23A 3PU8A 3ESLA 2CM0A 4U7YA 4XJ9A 3WW1A 4TWHA 2W67A 3NMBA 5JDHA 2G9FA 3DECA 3RI5A 3NAPC 4RS5B 4MBQA 4H2AA 4M4PA 3UUMA 3D4KA 2DYCA 1ND2C 1PGSA 3RRWA 3SCHA 4XFAA 3VZJA 5HEHA 3N36A 3NRYA 1SUMB 5A7WA 2MEV1 3T1YT 1VB2A 3GZAA 1WW5A 3LD8A 4HFCA 4UW3A 3WF3A 5FZ6A 4MHCA 4M01A 3BI3A 5FZIA 2WZPP 2CGOA 4AEDC 1R1ZA 3AVSA 5JTGA 5FYVA 1BYHA 1URXA 1RUOA 3DYPA 1GLHA 3QOPA 2ACZA 4ZI2D 4RA0A 2BQPA 4ZXEA 2AXDS 4OMDA 2XAFB 3ETPA 1MNEA 2BDEA 3KHCA 4Q4X2 3GCWA 3AP5A 3S5AA 5A3NA 2Y8DA 2IFRA 4XTPA 2ZMKA 2GU9A 5LY2A 2LROA 4A5XA 1N33T 2XAJB 4UV8B 1FMD3 4QPGA 4XQWA 4XF4A 4YFWA 2ZEXA 5FZ8A 4KH9A 2WO2A 3LA3A 2Q9QD 5FZCA 2BS2A 4BXSV 4AQ6A 3Q9OA 1YXWA 3AKTA 2D9DA 1XOYA 1BKZA 5LRRA 4AKRB 1D2SA 1G9DA 4HFDA 4XBQA 4M3CA 1VE0A 4NIQA 5I0RA 2VW2A 2B1EA 3SS1A 2OPKA 3CJIA 3TB0A 4WV8A 4CPBA 2HH7A 4HTEA 4CDQB 3TAYA 4L9BA 3ZN4A 3V0AB 3CMGA 5LG4A 2QDRA 1NCQA 2WR9A 4I01A 5JXHA 2DVFA 1UMHA 2ETEA 2UWBA 1AR81 3FHAA 3E5XA 1AJ3A 3I4IA 5EIYB 3OB8A 4AQGA 1OVPA 1PK6C 3AE8A 4QU2A 1NE6A 4QWNB 2N1GA 1W8UA 3OBRA 2A73B 5FZOB 5L9VA 4D6QA 1MEC2 4XFFA 3LEIA 4C8DA 5AQGB 2ZEWA 1PIV2 2PHLA 1ZRCA 1F4AA 3P8CD 3MZHA 3AEDA 4A56A 3MW3A 1RUH1 2VW1A 3ZFFB 2E9QA 4CU6A 3CX6B 1F31A 4PDWC 4JKMA 4DUYT 4E27A 3WQ7A 4MGKE 1N47A 3NWKA 4DR1T 1CAXB 1LHNA 1AZDA 4OQ9A 5FMBA 3T3YA 4BA6A 5JCTA 3P4SA 2VZRA 4YRDA 1KITA 4HG6B 2R7EB 2ZHLA 1XJAA 4DUXA 1S2KA 3KCYA 2XMLA 2ZTNA 2GSYA 5JDLA 2FZ2A 3TNQA 1UZ0A 4XBLA 1CJPA 2DVBA 4DV0T 2QCSB 4CCLA 4PBOA 1AR71 2XKOA 5A3WA 1LOGA 1BR2A 4LUKA 5JUVA 5L7OA 2RJLA 5HCBA 1L0VA 3T2PA 3GBWA 1JBCA 3VDDB 2OQ7A 4P9JA 2ZKLA 3QD6A 4Q1RA 4Q0SA 2UXDT 2XVLA 1MS5A 5KHJA 2P1BA 4P00B 4OVEA 4YZ3A 5IVJA 3SHRA 4LFCT 5AFUL 1F5FA 2CDPA 2EA7A 2R6QA 2P9BA 2JDMA 2ID4A 2Y0IA 4XDQA 3K4AA 4JZRA 1VBE2 3ZO0B 5C8WA 1ULDA 1YQ5A 3OUIA 4EWAA 3RS6A 1XMOT 4CU7A 4NUBA 2ES3A 4FAGA 1NA1C 1ZEEA 4OI4A 4AQYT 2JECA 3A7MA 2ORXA 1QJU3 3ZMTB 1GUIA 3IF8B 4HWHA 4PHZA 5AFEA 2LSIA 2QQPA 4PBPA 3E97A 4HXCA 2BGOA 1WKYA 2M6BA 3WP5A 2BS4A 2HHHT 1YFXA 1Q8SA 1RIRA 4P0AA 1TME3 4XYXA 1AXKA 4P14A 4MFRA 5JMOA 2MBGA 2W0XA 4CN4A 2HWD2 4A7YA 4BYYA 5DDJ3 3LCPA 3NVCA 2JD9A 2E33A 2Y6HA 1NG0A 4GWIA 1PNGA 2HWF2 1SHZC 2JB4A 3WF0A 3J9X1 4Y1ZA 4PI0A 2X29A 3OSDA 3E1F1 2K5BB 4HKOA 3I2KA 3IDAA 1BCXA 5F39A 2ARAA 4HBNA 5LB6A 5I0DA 4DIDB 1QJX3 1W3XA 2FDGA 1XQNA 3DPRB 4Z2WA 2YYOA 3LIHA 2R32A 4Y1YA 4W65A 2VL8A 4WZFA 4CCEA 2PLV2 2LKHA 4MLKA 5CYYA 3PUIA 3WAKA 1U5PA 4ADZA 2DNXA 3BQKA 2ZEZA 1OF4A 4Z2AA 1DGWX 1CN1A 2BTVC 3UGGA 2BKPA 3AP4A 1W6OB 4LF5T 4GYSA 2B8MA 1LRHA 3GDBA 3J9SA 3THDA 1L7LA 4OLLA 3AK0A 4FPKA 2JPFA 2PTFA 3AMQA 4ZI7E 4JV5T 5L4EA 2IDOB 5L2LA 3PIGA 3FFZA 3K46A 5AQKB 4OX9T 4Z90A 3H3UA 4AAPA 1ASJ3 2VOKA 3CZJA 3VHNA 5D8AB 4LMJA 4JGZB 5HI0A 5FWEA 5FV3A 5GLWA 1AYM3 1W9WA 4FP3A 5GJ6A 5FUPA 1RHI1 1RUI3 1R64A 4CDXC 1MZEA 1I5PA 3ANWA 4YNIA 1ZBE2 4W8JA 2XY8B 5FK7A 2VC9A 2JQQA 2VKJA 1FV2A 3P6BA 4TWDA 2G19A 3WINE 2W00A 1JYNA 4YARA 1SLIA 1NCRB 4QXCA 3VU7H 1MPXA 1OF3A 5A7WB 3MICA 4KWUA 2EIEA 1IOAA 1XYNA 3C2UA 4URTA 3E6CC 4H7LA 2VWAA 2RS11 2WQZC 4Y20B 2ARXA 2R6GF 2WLPA 5FUIA 5JPNB 3O1UA 4IERA 3JCIA 3BKZA 1HV0A 3R0RA 1LHOA 4QH5A 5A6YA 5IVEA 2MEV3 3K4ZA 2QQLA 3PVNA 4XUQA 1N1YA 2XBO1 4K6BA 2R061 3ZN5A 3VDCA 2D3RA 3LZZA 1DZTA 2A3DA 1AL21 1UYXA 2ZEYA 4K8RB 3WCRA 1Q8PA 1CVNA 1EUUA 4Q25A 4HSLA 4CEYA 3ZSTA 3B9IA 3OVUA 3RZHA 4HK9A 3MIFA 5F6KA 1KNRA 5BNOC 4BQWA 2Q30A 3HT2A 1QJY2 4HN0A 2QDNA 1R081 3PUQA 4DMIA 4I3GA 2VGDA 4QPGB 5M4YA 4U2ZA 1GV9A 3PVBB 4JI5T 4GB32 4AQTA 3O1VA 2RR12 4GA9A 3USSA 4H63H 3AE2A 3UQ7A 2RHPA 3BK9A 3WNKA 5CFCA 5C3OA 4YW5A 5C3PA 3LEGA 3ZXJA 3MLJA 4M3CB 3LSDA 4U31A 4LITA 4JI1T 2ZCWA 3CJIB 4XJZA 4EV0A 4IESA 1WFDA 2BNNA 1I6XA 2X0YA 2X05A 1FYUA 3VKLA 1EPZA 4WM7B 1S1AA 5E16A 3L39A 4MYEA 1XZYA 4IDNA 1SEFA 1NAFA 2KZ7B 1QXPA 2K9AA 4HN9A 1GYKA 3N7JA 3AE5A 3KWVA 3AMNA 2V6YA 4B3ST 3I54A 5KHHA 4DR4T 3H3AA 4FXGB 4CXYA 2UY9A 4XFHA 1OXZA 2H3RA 1CPMA 4BAYB 4QX0A 3P4WA 3NJVA 2WZIA 3WZ1A 1V6KA 3JQXA 1AR83 3FN9A 4CI3B 3ETQA 5FZHA 2AEZA 1ZA4A 2LHRA 4BB3A 1XYOA 2EALA 3RMYA 3T08A 3WW3A 1SDWA 4YM0A 5C70A 4YLZA 3MIGA 4FJOA 4PJJA 2B9UA 3J8F2 1WD3A 3W59A 4OCTA 2J7MA 2J4GA 2FJEA 1CX4A 3GWHA 3KT1A 1IHMA 5JQGE 1RUH3 5IVFA 1XSQA 3NNJA 1RUG1 4QQHA 2FHRA 1US2A 3AB3B 4R52A 5H9PA 5C6CA 2WFF1 4JV4A 4ZI3C 4K0UA 2BG9E 4B1LA 5FK8A 2QYWA 1REDA 4UFLA 2XQ3A 3OOXA 5L7OB 2YBKA 3ZMUB 1YIPA 1Y3TA 4MXVA 1G9FA 2C9AA 4WVMA 2XQYA 5KC6A 3JQWA 2QUOA 3L8RA 3WEZA 4BQ3A 2XAGB 3HNYM 1JZ3A 2WAOA 3NQHA 1H1IA 2WNVC 2XWBB 3OG2A 1V6JA 4I3PA 5DABA 5AQQB 3KMHA 1HG5A 1S0BA 1MQTB 4MALA 1HQWA 2VO5A 3AE4A 5DAWA 1PGW2 2L9QA 4K21A 4ZPIA 1YQ4A 3SNMA 4Q4W1 3SQOA 2IXHA 1OEDA 4XACA 3ACLA 4AFMA 1TG7A 2ZLYA 2AENA 3RQUA 1HKDA 2Y48B 2J1TA 4KWJA 4CEWC 3MHZA 1XBFA 3UFEA 1YLLA 2W68A 1DYPA 1UMZA 5EFUA 1CR7A 2LOSA 4HETA 4BIOA 4DV2T 1JOJA 3PUGA 1JW6A 1K5MC 1QMJA 4QDSA 1JZ4A 4QQPA 3VV1A 1UY1A 3AKRA 3CZUA 4OMCA 1S35A 3MUY1 3VUOA 1OOPC 2TBVA 2XHEB 5A7SA 2R0HA 2ZA9A 1LVFA 5E0OA 5EJ3A 1YHFA 2DURA 4DXZA 3F95A 3P5BA 3C98B 2X10A 1O3TA 1R092 1JNRA 2A6ZA 1QF3A 4IE5A 4XJUA 1W9FA 5H6RB 1E2AA 4IDZA 3ZYIB 1D4M2 5I8SA 1GOHA 2ZKNA 4NIAA 2GC1A 1SLCA 3IM0A 5LK5A 1ZREA 1OD5A 1COV2 5FLIA 3B94A 4PJYA 3HQUA 4E9KA 5AQMB 1WMXA 2HWE1 2VAUA 2C6SA 3P4RA 2KLQA 1O91A 4HFBA 3EDUA 1CZTA 3FLTA 2HWB1 3O14A 2NP9A 2LLYA 4MH0E 3AYCA 1W0AA 2QQKA 3ELNA 1DGRN 2Z69A 3AXJB 2ZGLA 2WDRA 2OS2A 3WP4A 2H6CA 4IV1C 5C9AC 3OPCA 2K48A 3MXZA 2VTXJ 1Y43B 3T8OA 3POSA 4HVRA 4KHPT 5IFTA 1PO11 4IL7A 2Y6KA 1OLRA 4GIQA 3ZXAC 4KI5M 2BOJA 2RS53 3RMXA 4GKKT 4CCJA 1B35C 4JDNA 1HRI2 4Q4X1 5CA1E 3AA6B 5FPBA 2V7JA 3IMNA 5GLZA 5AC92 1OLQA 4U36A 4LK6A 2J1AA 5I91A 5CJ5A 1IBLT 2XQ7A 3ANWB 1QQP2 3KDSE 1ALYA 2JQKA 3NKTA 4JKLA 4GKXA 1UGOA 3NZQA 2VOXA 3OY8A 1J58A 3M3ZB 3OBAA 4HVQA 1VIWB 4Z07A 2VW0A 5JI9A 1VRH1 5DZGA 4ES8A 1DQ5A 3I97A 4CDUA 4B6XA 2WAAA 4XQDA 4IE7A 5FVKA 5LMUT 4AI2A 3MYXA 3CPZA 1ZZCA 4XMIA 5FLJA 4QXBB 1ZZ6A 3WP6A 2X51A 1KFXL 5I8TA 5JXGA 1M06G 5JSRA 2IUBA 2D7FA 3VBFC 3SKJE 1QEXA 1TE1B 3DJBA 2RS13 4F6RC 5T5PA 3HNMA 5H9QA 4LXLA 2WMOA 1QHDA 4OUEA 4XFGA 1PMIA 1AX1A 5FXVA 2XBO3 4CEYB 3ACIA 2K2SA 2R063 5EJ1B 2MPKA 1E7PA 1AL23 4DRVA 4HT1T 3RWNA 4AEMA 2WSUA 1MEC1 4N53C 3H1WA 2J1VA 2VVSA 1HW5A 5EK4A 2K46A 3UJOA 2JG8C 1LEMA 1PIV1 4LLFA 4LBQD 1GP5A 5LCWL 2PELA 2OV9A 3MUZ1 1G8WA 3RSJA 5KX5E 3LA7A 3A22A 3OBTA 3CU7A 4X5TA 3Q8FA 5GZGA 5JOXA 3ZXDA 2YPJA 3K4DA 3PTYA 5BNNB 3N7LA 4DINB 1CIWA 3VBOA 3OPTA 1SBDA 5EYYA 4FI9A 2RVAA 2WB5A 1WGPA 1GZCA 1BK1A 1HX8A 3I1AA 4D7YA 4YM1A 5EQUA 1XMQT 2CE7A 2IW5B 1XU1A 4O2AE 2I45A 2Q9QA 3DXTA 1C57A 5HXMA 1LAJA 5G04L 3LQCA 4BJ0A 4HLTA 4O7XA 2HEVF 3ZLIA 2FCVA 4ILBA 2V6YB 3LIGA 2X5IC 5H9RA 1VCSA 2VQET 2P2KA 4OYKA 4D0QA 1U5YA 1QJFA 5FR3A 1HQLA 1LVKA 2YXSA 4XQ4A 1L3JA 3Q2MA 2B45X 4UXNB 1Y64B 3EDVA 3CK6A 4ONUA 3W5NA 2D40A 2JDKA 3S4UA 1O5LA 1PHMA 1Q5OA 2VVDA 5IFPA 1LOEA 1VBE1 4L97A 4QM8A 5FZ7A 4EV6A 3SC7X 5JDNA 5IHYA 1HJFA 3HQXA 3OEBA 1O3RA 5FKBA 2RP4A 2P4EA 2JEMA 3MIEA 5HXRA 5FPZA 5ACA2 4DR5T 1UZWA 4RS5C 1W6NA 2BKNA 3OUHA 1LGCA 2V4VA 4DUZT 1T7SA 1IGOA 5JR9A 4RHV2 4HL0A 3U4XA 2VJXA 4FOQA 4OFGA 4JUYA 4FPCA 5CB4E 3KSCA 2ZGKA 3O1PA 3EXUA 1RUG3 2WNOA 1W9RA 1H30A 3ST7A 4EOZB 4DXRA 2NPIA 4PLNA 5C8CC 2QGSA 4CI2B 3KCCA 2QQVA 3RPUA 2XPJA 4YVSC 4FVVA 4LOSA 2WFF3 1AUYA 2PTMA 3CQCB 4WVMB 3ZT6A 1TMF1 1EP0A 2ZZJA 5FMCA 4OFZA 3AE1A 4QQOA 3ZFGB 2HWF1 3VBRA 4OHWA 3SRZA 2BG9C 5D2AA 3TEYA 2UY8A 4NIGA 4DV7T 3INAA 2WZEA 3N9LA 5EV7A 4P9LA 5AQOB 5FQ0A 1AXZA 2N2NA 1H8TA 1VBC2 3N9PA 4FTBA 3WX5A 1OEDB 1W09A 4UOJA 1U5IA 5KR7A 1DG6A 2PLV1 1WRDA 1WCQA 2E32A 3FZ3A 4YG6A 1JODA 2BWCA 2RDNA 4JC1A 4CP1A 3U1XA 1GWKA 4Q4W3 1OXCA 4S2HA 4GXLA 4P0BA 2FDJA 4TV8E 4O2BE 4Q4Y2 2Z79A 3PU3A 5I0SA 5C3RA 4E2QA 1KFYA 2VMCA 3H8UA 3FB2A 4UBGA 2DCYA 1CPNA 3CJXA 4OZXA 4BJNA 3MDPA 4FOYA 1ONAA 3BODA 3GJBA 1QH7A 3I3DA 5HEGA 2P37A 2RPAA 1YC61 1G9CA 2XR4A 5CFCC 1E5HA 2Q1ZB 4AI8A 1RUF2 3RX6A 1FT9A 4X65T 1RINA 2ZMAA 1JU4A 2DU1A 4XFCA 1ZBE1 4S2GA 3FMGA 1CAWA 3D0SA 3KGZA 5IVYA 3BCWA 3OKQA 4YGCA 3PVOA 1O8PA 5LXTE 4WVVA 1UMIA 4G3YC 4ZKTB 1Z8UA 2JE9A 4ZI3D 4XVHA 1UNBA 5H6QB 2C5DA 1N3OA 2HWB3 3HQRA 2XJ7A 4AQSA 1ODMA 1PM7A 2W94A 4DIQA 4PK4A 1XE7A 3W21A 2UUAT 1QH6A 5LB7B 5FYCA 3AYEA 3ZYBA 3QOFA 1CJDA 1GP6A 3SISA 1FPN2 2YDQA 2KWIB 5LGTB 4LNVA 4AFDA 4WM8A 5IK8A 3BN6A 1W6QB 5A1AA 2D97A 3PMEA 4YGBA 3A8YC 5HXHA 1POQA 2FCUA 4HVOA 1QJY1 1ND3C 4QH1A 4AQFA 4Q4X3 3PNAA 5IAXA 1ZVFA 3ZSLA 2WP9A 1PGL1 4AKIA 1WA6X 1KS5A 3I59A 4GB31 4Y5SA 5FYBA 3OY8B 4LO8A 4ORFA 2RR11 1OWAA 2BW8A 4XFIA 2QVSB 5JDGA 5F5AA 4NE9A 1BMV2 5L47A 4NO4A 1H1MA 1XNBA 3ETVA 2BOIA 2KD7A 4Y4RA 3ZYKA 1F9KA 4UFMA 2AH2A 4TLGA 3ALQA 4JDMA 2MPFA 2X68A 3PJYA 4CDWA 4CZSA 1EUTA 5A80A 3VD4A 2W2IA 3C7FA 3N4MA 4LK7A 1UYYA 1IS5A 3CEWA 3U11A 4E8CA 2EICA 1SBEA 3HKEE 5JZGC 4HWCA 4ZEYA 1WCSA 3H9AA 3CMLA 2WNUA 4CSWA 5F3GA 1C1FA 3ACHA 4CPBD 5FY7A 1DQ0A 5IUXA 2HYKA 4TV9E 2WU2A 3PL0A 1O3QA 1EAH2 4TX5A 4EXTA 1AR91 1R1A1 4KQ7A 2VMEA 3VZKA 2ZGOA 5E88A 1SFYA 2VMIA 4ZZBA 3Q5EA 4RQPC 1KDMA 2A7AA 5LGUB 3B93A 4YG3A 4M0NA 1MEC3 4V1PA 4QPIC 2WCAA 3J8F1 4YT0A 3HIFA 4YVWA 1V6NA 4LBNA 1PIV3 4GK5E 2QZ3A 1NE4A 2VM9A 2UXXB 2NM1A 4QU1A 3RI9A 3SH5A 5K4LA 5A33B 1JXNA 4INDA 2PFWA 2Y38A 3I3MA 5EZWA 5F5CA 1M62A 2BJSA 3WF4A 3U37A 2A5ZA 4V2VA 1Y9GA 2JICA 1HN0A 2ZOEB 1SLLA 3ZJ1A 4F8AA 2WN3A 4O8SA 2Q9QB 2YROA 4AKLA 4N43A 2QQMA 3ZSEA 1YFWA 4LIUA 4LORA 2WSVA 2UXCT 3LDQB 1E5SA 3AC0A 2WDQA 2QJVA 3VKOA 1LU1A 5T50A 2WNEA 2D6NA 3VN4A 5D8AC 3VKFC 3L2HA 2XG3A 4GH4C 4YHJA 1PGW1 2DVAA 3LK2B 3Q8BA 4DMWA 5FZLA 1GZWA 3KF3A 1UX5A 3NWIA 5FY5A 3ZYRA 3TEWA 3BIWE 1C5IA 4X62T 4AQ2A 3ZXKA 3B00A 1KS4A 1Z7S1 1W9TA 1W6NB 2CLYB 1IJ5A 5L9BA 3NAPA 4KUMB 1DLCA 1NCRC 5HV0A 1VBE3 4K3UA 4KU8A 1ENQA 2H88A 3OD0A 4AAXA 5HPOA 4AE2A 3UYJA 1ND2A 2C26A 3VKMA 5FO7B 5DQWA 4BCUA 5B2GB 5LA6E 3C4XA 3R4DB 5IK4A 2D6OX 4QX5A 2DVGA 5FWJA 2BZBA 2RDQA 3UKTA 4K40A 4ZY9A 4RL7A 5L3EB 2XWJB 2OKXA 4CDUC 3ZC0A 4AEDA 2D5UA 4KG8A 1J1JA 5LP6E 2X53S 1K12A 1R091 2LEHA 3C64A 3Q5DA 4B4PA 1UX4A 5ERLA 4IL4A 1LEDA 2BEOA 3HI2A 3V5UA 3VBRB 4AXOA 1F4HA 2VXRA 2WKKA 2IC9A 2YU2A 2BU9A 4E8DA 2EXKA 5CFDB 3SLIA 3OGGA 4UR9A 1OA4A 4SBVA 3SEEA 1ZRFA 1YIFA 4H14A 1H8TB 2LRLA 4EN6B 3L2YA 4JYAT 2HWF3 2BP6A 4AHWA 3CNAA 2JG9B 4EYUA 2W61A 3N2OA 1LULA 5LEKA 5GZCA 1NZIA 4ISRA 1ZA7A 2R041 1T98A 5HWYA 2ZGQA 4JKKA 4BMEA 1IQAA 1GOGA 4LPLA 4BIFA 2CA5A 4W6XA 1BVP1 2PLV3 4O9EA 3RLFF 1JYWA 1BZWA 2DWRA 3VHRA 2P3KA 1KEYA 2FBWA 3ZYPA 4XBNA 4R4ZA 3AEAA 5HCAA 5F2WA 4MGTA 4UXAA 3O1IA 4H9RC 4CP9B 1N32T 1HRI1 3CLPA 3PUYF 1QLBA 5JWPA 5A7OA 4JBWF 5F3JA 3WVJA 1PNFA 2PHUA 3QB5K 2PYTA 1O3SA 1HR0T 2W62A 3RF1A 3FBYA 5FZ3A 4RGGA 2GN3A 5LA2A 1NOVA 2ZHKA 1GNZA 5IVVA 3KV5A 2LJLA 4MXWB 3LBXB 3AYDA 5FYZA 3D0TA 4E7ZA 2XONA 1QQP1 1HJGA 1RUE2 3C8XA 3N9OA 3KVBA 1RGSA 1G73A 4JI2T 2JMHA 4LO4B 4B3NA 2VBPA 2G0UA 2BBAA 5FTTC 1PK6A 4DEQA 2C0SA 1YFYA 5IWAT 1ZBE3 4ZU7A 2NOXA 2W92A 3IAQA 2ARBA 2JDYA 5EK3A 3N7MA 1RL3A 2X8KA 1SHWB 5CA6A 4EAHA 4B29A 3P4QA 4IUGA 2CTVA 2AUYA 2ZACA 3AVRA 1GP4A 4PDWA 1J3RA 5EYXA 4YLHA 3ECQA 1EYBA 2K3WA 2XB6C 5FP3A 4JGYB 2V26A 1DGWA 5IVBA 1SPPA 4UV9B 3LDRA 1K45A 3Q9DA 3FHIB 3K2OA 3I0QA 3NNGA 5KWRA 1NEKA 1SZBA 4WZXA 2VMFA 1UX6A 4W6WA 2DLRA 4IGQA 4RGAA 3S57A 1OFNA 3IN9A 5JR9C 4COUA 2J1SA 4EJRA 1DBNA 2PQSA 3AZZA 3RZZA 3NV3A 3MPPG 4IXLA 1GQGA 4QDQA 4DPNA 1UKRA 3I59B 4FOWA 1HRV2 3AB0A 4P9WA 1QJY3 3EHZA 1UF2C 2P3YA 2Q5TA 1JN2P 3TRSB 2WUHA 2V5YA 2VBDA 4H55A 1U5XA 2WJSA 3ABVA 2J62A 3WD5A 2YFUA 1QXJA 4XXAA 4GB33 5AQPB 2RR13 2VTXA 4DUWA 2VQFT 1D0YA 2VZVA 4Q0UA 3VBUB 3LE0A 5L3FB 2X9HA 3AP9A 2NWBA 5ETWA 3LWCA 2PHRA 4C90A 3HA4A 2IVIB 3DN7A 2GC2A 3AEFA 1DFQA 2WNUB 1W8HA 1NA1A 1MIVA 3EB7A 2EAKA 2DL1A 3ETUA 2OW4A 1W8OA 4COVA 2H7VC 4NHXA 4LBOA 2EXHA 5FYUA 2WWUA 2D0TA 2SBAA 2LW8A 2AGSA 2VMGA 2ZBJA 5J7MA 4JHZA 5J37A 4BQ4A 2ODVA 4HFSA 1C1LA 4K20A 1WW4A 4DZGA 5LY1A 4FO9A 1MS1A 4R9BA 2XQAA 3EABA 4QMAA 4N90A 2WRAA 2D93A 1R1A3 3IBMA 3RZGA 5FDBA 2UYAA 3VBHC 3V64A 3VHOA 1VALA 4U74A 4A44A 4DXSA 2DWGA 4YVWB 1GICA 4GWMA 5ACA1 3OTOT 1KK7A 5LMNT 4Y1UA 3FBLA 3RZJA 3T2OA 2PHDA 3JD72 4RHV1 3J8F3 3RGBA 3RC3A 2ZGSA 3HKCE 1JUHA 3ZYMA 4CRQA 1QIQA 2V4AA 5AFBA 1PZ8A 3UETA 4LBQA 3AJZA 1JMUB 5AVAA 3ACFA 5LZ6A 1NLSA 2JQHA 3VKGA 2CWOA 5CNAA 1OC1A 4GQ7A 1XE0A 3RQ0A 2W08A 2QQJA 4N9HA 1JHNA 4UF0B 4DV1T 3WAJA 3FFQA 3NNMA 2CAVA 1UUSA 3ZXGA 2QNKA 3AKPA 3OYWA 4B7EA 1Q3EA 3RPQA 4IEQA 1K3IA 3JZVA 3KFWX 4LF6T 2VNVA 3NRXA 1SCRA 3BTYA 4K1YA 1UU4A 3KLSA 3ME2A 2V73A 1OUXA 2XXZA 1O6UA 2Z6EA 2LS6A 3RYKA 2FCTA 3FC0A 3FLPA 2BDRA 5F6LB 4A3ZA 4O4LE 4AVAA 3BALA 2ZZQA 1GZWB 2NTXA 4TN7A 2HN2A 4FSJA 2XQ5A 4CDXA 5AQIB 4WM8C 4NUVA 1GWLA 1N1SA 2WYSA 4NRPA 3T0BA 1LJ7A 1JOBA 4AHXA 1D2QA 2Q8OA 2KM2A 5KXDA 1MMGA 2P6CA 3NAPB 3TYJA 3ONXA 4IIJE 3LF7A 4GYRA 3OPZA 1LGBA 3CL1A 4Q4Y1 5BUVA 3P3PA 2XL9A 1WBLA 1F5JA 1ND2B 1VOMA 2W46A 3O1RA 1Z7S3 1Z0HA 1D0ZA 1D1CA 3M3EA 1JTZX 2VQAA 4UVAB 3S6PA 1H2MA 1PO21 4RGKA 3OBVE 4GKJT 5I8YA 3D6EA 4AEDB 2WBLA 2CHNA 3AFGA 3FZLB 1W06A 4LKFA 2B42B 5ABJC 3MO4A 3LA2A 2BS3A 3LSVA 1RUF1 4RN5A 3ZJ2A 3O5SA 4B3TT 3WNPA 4CDWC 4MGIE 2YBPA 4ITCA 2OPWA 2LTNA 3DV8A 3LGRA 5CFBA 5LHHB 1R093 3QC9A 5JIAA 4WBNE 4IV3A 1D4M3 1RYYA 4AGRA 4XAEA 3AMMA 5BNOA 1PX4A 4ZXKA 5T5JA 3JB4C 3MFAA 3NNFA 4JLEA 5FZBA 3BB6A 5FP4A 1S94A 1IS3A 3W20A 1CAVB 3DCQA 5HCHA 1JH5A 4PAGA 3UU5A 5BY5A 2AEYA 3ZIXA 3LFIA 5J1GA 2I07B 1S0CA 4C1XA 5FZAA 3K3NA 2ZM0A 1Q56A 3ZN0B 1OUSA 2CYFA 3ZYGA 4ET7A 5BNNC 1RMU2 4Y26A 2NTYA 5AQNB 4QX2A 2DDUA 1FPN1 1BVVA 2YINA 3AZVA 2AYHA 3T2TA 2RM22 2DVDA 3RYFE 1O8SA 3DXUA 2CL2A 2VCMA 3RIAA 3M70A 3KGLA 1GNHA 5ABFB 2H6BA 4ASLA 4KP3C 1AF9A 3JBG1 2WQ8A 1HRI3 1S0EA 2EIBA 3QK6A 5A1LA 3P3NA 3B5MA 2XUMA 3PJQA 1LOFC 4JTOA 4EN9B 2YKSA 4Y3OA 5K0UC 4I02A 3CX8B 1LHWA 4P9XA 5F5QA 5CKNA 1X79A 4ANJA 5T5LA 5H9SA 1W99A 3AA1B 2H0BA 1QQP3 4N43C 5FZ0A 4Q26A 4PQQA 1H9WA 3VLBB 5LBBA 2VXJA 4U7IA 2WZR2 1ASJ1 1BMV1 2OXBA 3VHLA 4AZZA 3RZLA 3GJAA 4AEKA 4AF9A 4DNDA 2JIGA 1RUNA 1PMJX 4JI6T 2VD7A 1KNPA 4PDWB 3GHMA 5JVVA 2BFUL 2BKOA 1W39A 2XJQA 4JX0A 3RDIA 5GLUA 5JDMA 2VKDA 1ZZ7A 2LSJA 5FJKA 3VZNA 1C5HA 2GP5A 4CCCA 3VZLA 4IETA 4C1WA 2E9XB 4F8HA 3C50A 3JXSA 3FWEA 4FI5A 5FRAA 4N8MA 4RR3C 4SLIA 2QBXA 2PQQA 5FZKA 2X0HA 4WVZA 2BVBA 3HMYA 2UYBA 4FXKB 2WDVA 2B9VA 5JPMB 3DL3A 4IHJE 4KWLA 4LBMA 3EQEA 2Y6XA 4L8QA 1EV12 1RB8G 3U4SA 5CAZA 2WNVA 4FPGA 2ZGRA 4FFFA 4YW4A 3S5QA 2XUEA 2IZWA 4D6RA 4HFIA 4LE4A 3RFRA 1W9YA 3PUWF 5BYNA 3OYXA 4K8FA 5C2TA 3NW4A 1FIOA 3TLSA 1POV1 4CEWA 1IAPA 4JHTA 2PN5A 4YGEA 1XNCA 2QQUA 3RVHA 1NA1B 1ZZ8A 3JAEA 1DU3D 1K5MA 4UFIA 4R9DA 1K42A 1RVF2 4IDQA 4PFPA 3NJYA 1QJEA 1JOPA 1OOPA 2IMLA 4AK3A 5FY8A 3L3PA 1OFSA 3HBKA 2W39A 2A3YA 4QKNA 2CSGA 3IKWA 5FXWA 1W2TA 2VVFA 4FFHA 1YCIA 3UT5E 4UW4A 4W50A 1VBA2 4ZZ8A 1JYXA 2C24A 1WLWA 1LKNA 2MHFA 3CWZB 3ZOIA 4P02B 1DDLA 1PM4A 4P5YA 3N7KA 3IZOA 5DXDA 4CCOA 1NXD1 5EJZB 1O7FA 4Q8KA 1ZNPA 1AVBA 2FJBA 3FBMA 2UXNB 3T4HB 3D82A 1IG3A 4B3MT 5ACA3 1GU3A 3ZFEA 1O4ZA 4Q1PA 3IPVA 3SWHA 4YTNA 2J1UA 5FYYA 2J22A 3OGSA 4IV1A 4RHV3 5C9AA 3O4XE 4EQVA 3VDAA 1WYCA 4YY3T 1N36T 2DUQA 4GK0E 3WNMA 1YXRA 2QTWB 4AVVA 3A5XA 3QH6A 2VVNA 3GYDA 1YQ2A 4CCMA 2D3PA 5L3BB 1REEA 3LFMA 2VOWA 1H6XA 5SV8A 2C5IT 2X67A 2VECA 2B5HA 2JRKA 1B35A 5LCYA 5LJMA 4PK5A 4RFRB 3ZDSA 3H3ZA 3MIDA 3A7QA 3WDTA 3AE6A 3RKOA 4UIGA 4UBHA 4BJMA 2OVUA 4L5GA 4TN7B 5LHGB 4YJ3E 4LA3A 4AXPA 2CAUA 4GD4A 2DCJA 4CDXB 1HLCA 3K48A 2KA3A 2JX9A 4LFAT 2WO3A 1AX2A 1YQ3A 3VBSC 1VBC3 2NYYA 4CCNA 1QNYA 1CQ9A 5CBLA 3LG7A 4LHLA 4BQXA 5KMGP 4V1Av 4GALA 3BU0A 2W9XA 3H1MA 5E8AA 3G6JB 5FPUA 3BUCA 5DG1A 5FP7A 4LHKA 3GNEA 2FJAA 3IAPA 4Q4Y3 3LEMA 2VY0A 2YMZA 1HN1A 2VPVA 3T4VA 2RMU2 2VMHA 1UYZA 3J7MA 2XH6A 1NENA 2OQ6A 4MVTA 2ZMNA 5LHIB 3VBFA 3ZSJA 1M7KA 2MAWA 1CESA 2ZGPA 3NJZA 2V7MA 2Y60A 1PO23 2D5HA 4I0BA 4CQIA 3SKVA 4OHFA 5BNPB 3L09A 2UURA 4AI3A 2RDSA 3HAGA 1BXHA 1RUE1 1OT5A 3OGRA 5FMOS 4JDOA 4NIDA 1B09A 4QKDA 1BBT2 1R8IA 4N7UA 4QGNA 3PVEA 4GULA 4QX8A 3V65A 5J2TE 3AL6A 1LECA 3MF9A 3TN92 2JB8A 1RUF3 3LPFA 5BNOB 3WW4A 4QXHA 4TXWA 2E53A 5J36A 3WG3A 5J48A 3E5QA 4N53A 1AR72 1O59A 1L7RA 2KXLA 4YTMA 2JG8A 4LOTA 5IJRA 1OH3A 5J1XA 1W8WA 3PUSA 3OJAA 1HDKA 2E8IA 3BPZA 1HTJF 4EWDA 1REFA 3KS7A 5FLHA 2IXKA 3UKNA 3O1TA 1V6MA 3SFDA 2VOVA 1GWMA 2VZPA 3AE7A 5JDFA 1FX5A 2HBUA 2Z5WA 1XSRA 3EYPA 4JQTA 1YD8G 2WA3A 3USUA 2NW7A 2OT7A 4IEUA 5FYHA 5A6QA 4JTNA 3E22E 1O5UA 3KCXA 4OYUA 2KR2A 1FPN3 3WT3A 4C0HA 1MMNA 2K24A 1IKPA 2D43A 1W6MA 2RDRA 3RYCE 2OA5A 3IDEA 3C7HA 3ZYJB 2X5IA 4AHYA 5F1RA 2VTFA 3JBG3 1UZVA 2UWCA 1NXMA 1FEWA 4H9OC 4ISQA 5F9TA 4NHKA 4NR1A 2RS51 2EHOA 1W2AX 3CQXC 4L0PA 4I4TE 3RZMA 4XDPA 1SFNA 4OZOA
chains in the Genus database with same CATH topology
1D1BA 1LKXA 3KFWX 3KV6A 5FXVA 4DIQA 4PK4A 4DO0A 1IAPA 2EHOB 3DTOA 3MJXA 2LHRA 1US7B 3NRXA 5FYMA 4QX8B 3C51A 4EYUA 2W61A 5FXZA 1ZEEA 5J2UE 5FYCA 3N2OA 2YEVC 2DWKA 3RVHA 3M65A 2XXZA 4X1IE 4P09A 1HFAA 2Z6EA 4PJLA 4X20E 1T98A 5HWYA 4FJOA 3ZMTB 3CVRA 3IF8B 4PJJA 2YPDA 4BXFA 5FP8A 2KWIB 5LGTB 3ZYLA 2LSIA 4O4LE 5F32A 2YU1A 2KXPB 5HWXA 3GN5A 5EK4A 2CA5A 4ERRA 5DJQC 2QA7A 2NTXA 4TN7A 5FYIA 4PFPA 4AI6A 3NJYA 3PU8A 5JRCB 2IAKA 2CWYA 2CM0A 3ESLA 3WI3A 3GWHA 1FMWA 1HS7A 5JQGE 3UULA 4P0AA 5IVFA 3VKHA 4JEUB 4CXWA 2LE8A 1H7CA 4NUVA 5FZ4A 5FY8A 3L3PA 5JDHA 4O4HE 5KX5E 5FZEA 2E9XC 5HXHA 4MFRA 5LWBA 5JVDE 4KBMB 2LSGA 1Z0PA 3AB3B 2MBGA 3ZMZB 5KDMC 3Q5XA 5F37A 4QKNA 4CUGA 2CXLA 5F2WA 4AQFA 5FZMA 5A7PA 3CKDA 4MBQA 3HR0A 1MMGA 3EVYA 4I43B 5FXWA 4L0RA 3ONXA 3O1IA 4H9RC 4IIJE 4GYRA 3UUMA 4G63A 3UT5E 3FXDB 5A7OA 1E1HB 2V7LA 3UUXB 2Q8CA 4ZI3C 2LT3A 3RRWA 5ADXL 5F3JA 4AKIA 2X9YA 4K0UA 4XZCA 4CCKA 2MYSA 1VOMA 5FY0A 2W62A 5LBMA 3OPTA 2M67A 2L3LA 5FYBA 3TKLB 4GJZA 5FZ3A 1UCUA 5L3DB 3NRYA 5LNKA 4TZ4C 5FZDA 1BR1A 3AL5A 2D2SA 3LBXA 1SHZC 5A7WA 3CWZB 3KINB 3J9X1 4BU2A 1OWAA 1D0ZA 3H37A 5IVVA 2LOPA 2K5BB 3K3QC 1IZNB 2YBKA 1D1CA 3LD8A 1HX8A 3KV5A 3I1AA 3ZMUB 4CCOA 4HFVA 3FBZA 2LJLA 4UVAB 4IGOA 4KMCA 4MHCA 5FZ6A 5F39A 2MOZA 4ZS3A 3LBXB 5FZIA 3AAIA 5FYZA 3D0TA 4E7ZA 3OBVE 3PE0A 4Y33A 2XQYA 5LBQB 5JDGA 5F5AA 3AVSA 2CE7A 2UXNB 2IW5B 1D0XA 5L3GB 5FYVA 2WBLA 3N9OA 3KVBA 4O2AE 4GJYA 2Q9QA 1G73A 3ETVA 2VL8A 3EUHA 3DXTA 2JMHA 2XAGB 3IBPA 5TAOA 3ZPOA 4ZI2D 4H9SE 4ZHQE 4Y4RA 2G0UA 2ZM2A 1QUUA 3K3OA 3ZYKA 5F2SA 4QWNA 3BQLA 2V7IA 4MLKA 2LHNA 5DABA 3R84B 3SWHA 4QX7A 5E6HA 4IGUA 5FYYA 1ZHCA 2C0SA 4HEAA 2X68A 3WAKA 1U5PA 3ZLIA 2DNXA 4ADZA 5HXSA 1HG5A 4AKHA 2VKOA 3N9MA 5A80A 2XAFB 2A2FX 3MKDA 4MALA 3ZCJA 4EB6E 1MNEA 3ZJ2A 5FY9A 3GMIA 4ZOLE 3HL6A 5HYAA 2W2IA 2L9QA 4EZ4A 3O4XE 1SA0E 2XTLA 2NOXA 2ZM8A 1WYCA 3AAAB 3BQKA 3PTRB 2BDEA 2KNDA 2YBPA 3HKEE 3C4ZA 4OYJA 5FXXA 2LM9A 4GOUA 4OYKA 5EK3A 5FZ9A 4GK0E 5LHHB 5A3NA 1LVKA 1O3XA 3QC9A 3A5XA 3MACA 3CMLA 2Y8DA 4GYSA 4EAHA 1MNDA 3NZPA 4CSWA 2ZLYA 3R6NA 4WBNE 5F3GA 4CCMA 2Y48B 3Q2MA 5LY2A 3K8PC 4UXNB 2JPFA 3U3IA 5L3BB 3I0OA 4AI9A 3RH3A 3UFEA 4PW8A 1Y64B 2XAJB 3AVRA 3LFMA 2GP3A 3EDVA 4ZI7E 5FNVE 3F31A 5FZ1A 5FY7A 3KBUA 1U4QA 2LOSA 3S4UA 4JLEA 4UV8B 1QSDA 5L2LA 5FZBA 2C5IT 4I50E 2X67A 4TV9E 4EYYR 5FP4A 4V2WA 2JRKA 1NWMX 4YLHA 3OPWA 3U78A 2VASA 1S94A 5L3CB 5FZ8A 4AAPA 5LCYA 5LJMA 3PUGA 5FPVA 3KVAA 2YBSA 4TX5A 4PK5A 4EXTA 2L8KA 5FZ7A 5FWEA 2KWHA 5FUNA 1VRBA 5FV3A 5FP3A 4O4IE 5JDNA 4PAGA 5IHYA 5JDQA 2N9DA 2Q9QD 2Q8DA 2V26A 1S35A 2RP4A 3RKOA 5IVBA 4UEMA 4UIGA 4UV9B 5HXRA 5FZCA 3LK42 5F8PA 3GN5B 4BJMA 4YFSA 5J1GA 4HE8A 3F57A 4L5GA 5FUPA 3Q9DA 1KNZA 3K2OA 4TN7B 3I0QA 5LHGB 4YJ3E 5FZAA 3ZC1A 3K3NA 4I55E 4AXPA 3HKDE 4CXXA 2CXDA 2XHEB 4ZI2C 4GD4A 2ZM0A 5A7SA 2D0UA 5LOVE 2X66A 3N2GE 4D6SA 1LVFA 2X0LB 5E0OA 3W15B 3ZN0B 4E4HA 3PDYA 3ANWA 5LGUB 5HXEA 3PDQA 3AAEB 2XASB 1YW0A 3C4WA 4AKRB 5JR9A 4AQFC 5F3EA 2DLRA 2NTYA 4M1PA 4DVDA 4IGQA 5ANQA 4HGAA 2WSSV 2JQQA 2VKJA 3UUNA 2CMRA 4XAXB 5IYZE 2YINA 5A7QA 2W00A 5JR9C 5A3PA 3C98B 4UELA 4JUYA 5HXCA 3PURA 5CB4E 4GK5E 3RYFE 5JR9B 5FP9A 4CCNA 3V5SA 1MMDA 3ZCIA 2B1EA 2J1DG 3DXUA 4IE5A 1ZKEA 3SS1A 2ODUA 3LG7A 3N9QA 3N9NA 2PXJA 4QXCA 5FJHA 2NW8A 2UXXB 4QU1A 5H6RB 3VU7H 1MMAA 4IDZA 5KMGP 4TUYE 3JC6D 4V1Av 5K4LA 2BVLA 2C5KT 3AA0B 5HAXA 2HH7A 2SPCA 2C5JA 2DCFA 4WBOA 3CQGB 4EOZB 3N2KE 3O9XA 5FPLA 5IW0A 4DMVA 5ISLA 4HTEA 5F5CA 5A7WB 2GK9A 4QXCB 4DBQA 2QGSA 4H9PC 4CI2B 4KP3C 5FPUA 3RYIE 2LSKA 3RPUA 4PFOA 4V2VA 5FP7A 2KT9A 4UVBB 2VWAA 5EZYE 3F2EA 4EZHA 4WW0A 5LG4A 3QK6A 5A1LA 4X1YE 4BISA 1D1AA 3CQCB 2KLQA 3ZJ1A 1EZ3A 3ZMVB 5JREA 3EDUA 2XDVA 1IJ6A 4Y3OA 3O1JA 2DHRA 4HONA 2Q9QC 3CX8B 5DQVA 2X9XA 4ZS2A 3GA8A 2OQ6A 1V9DA 2WMNA 4OFZA 4UVCB 5LHIB 3I9WA 1X79A 4O8SA 2NP9A 2Q9QB 1AJ3A 4HKAA 2PJQA 5IVEA 5FZOA 2BVMA 4JEHB 4AQGA 5LYJE 4AKLA 3J7Yq 4ANJA 3SRZA 4C91A 3KBTA 1D0YA 1G8XA 3MA9A 4QWNB 5C8YE 4LIUA 4QX7B 2VK9A 2KMFA 2N1GA 2V7MA 3AA1B 2OS2A 2A3DA 5L3FB 2X9HA 5A7NA 4PJMA 2K48A 4CQIA 5FZOB 3MXZA 3N9LA 2RA1A 4OHFA 5FZ0A 4D6QA 3L09A 5FBJA 3T8OA 2NWBA 5ETWA 1WR6A 4C8DA 3N5LA 4C90A 2N2NA 3HA4A 4CZZB 4IGPA 3N9PA 3VHLA 5FPAA 3P8CD 3KV9A 5FZGA 3CX7B 5KR7A 2IC6A 4A56A 2ACXA 4QX8A 2CXFA 1BR4A 5J2TE 1YKEB 1WRDA 3AL6A 5LJNA 2MTQA 3LK3B 4BA9A 1HCIA 2HPLA 2P5BA 3JC6C 1MIVA 2I59A 3CX6B 1YKHB 3E0ZA 5IVCA 4DNDA 2DI4A 5IWFA 3ETUA 4O4JE 4QXHA 3PUQA 2JMKA 2VD7A 2H7VC 5FZFA 4YHJA 2ES0A 4CCJA 3LJCA 5FYUA 3NBXX 3LK2B