3U78A

E67-2 selectively inhibits kiaa1718, a human histone h3 lysine 9 jumonji demethylase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Lysine-specific demethylase 7
publication title An Analog of BIX-01294 Selectively Inhibits a Family of Histone H3 Lysine 9 Jumonji Demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 366
sequence length 366
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3u78A02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3u78A01
4EZ4A 4QXHA 3K3OA 4DO0A 5FP7A 3PU3A 5FP3A 5FXZA 4QXBA 2PXJA 5F5IA 4CUGA 5FZDA 5FWEA 4LITA 5FZEA 3LD8A 5IW0A 3PUAA 3N9PA 5IVBA 5FZBA 3U78A 4CCJA 2YU2A 3LDBA 4C8DA 3PUSA 5FPAA 2YBPA 3AVRA 5FZKA 2OS2A 3U4SA 2OT7A 5FXXA 5A7NA 4XDOA 4CCNA 4CCLA 5FY0A 2YBSA 4EZHA 5FBJA 5F3EA 4Y3OA 5FZ7A 4IGOA 5F2WA 5FPBA 1VRBA 5FYYA 5K4LA 5A7QA 3KV6A 5A1FA 5FYMA 5FPUA 4QXCA 4NUBA 3DXUA 2GP5A 3AL6A 3PDQA 5FY7A 5FZMA 5FZ4A 4TN7A 5A7PA 5IVFA 5KR7A 5A3NA 5FYHA 2Q8DA 4D6RA 4DIQA 5FZOA 5FZ9A 2OX0A 4UF0A 5FY4A 3N9OA 4QX7A 4HONA 5FP9A 5FJKA 5FZ1A 4V2WA 5F5AA 5FV3A 4CCOA 5A80A 3N9MA 2Q8CA 3ZPOA 4Y4RA 5IVYA 4CCMA 2XUEA 4AI9A 5F3CA 5IVJA 5IVVA 5A7WA 4HOOA 5FZGA 4EYUA 5E6HA 5LW9A 5FYBA 4V2VA 3K3NA 3KV9A 5A3PA 2GP3A 5F39A 4IGPA 4Y33A 5FUNA 4GJZA 5F5CA 3N9LA 5FP8A 5IVEA 3N9QA 3ZLIA 5FYCA 5FY8A 5FXWA 4E4HA 3AL5A 5FWJA 4QWNA 5A3TA 3UYJA 3KV5A 3DXTA 5FY1A 4QU1A 5F3IA 5FYVA 5FZFA 5FUPA 4LIUA 4D6SA 4CSWA 3K2OA 3OPTA 4GD4A 2YU1A 5LWBA 4LIVA 5FZ3A 3OPWA 5ANQA 5A3WA 4D6QA 4URAA 3RVHA 2W2IA 4XDPA 5FZAA 5F37A 3N9NA 2OQ7A 5FZ0A 4ASKA 5FY5A 2XMLA 2WWJA 5F32A 4GAZA 2YBKA 4BXFA 2XDVA 5FZCA 5CEHA 4BU2A 5IWFA 5FZ6A 5FZIA 2P5BA 5FZHA 2XXZA 5F2SA 3NJYA 5FZ8A 5A7SA 5FYTA 5A1LA 5FZOB 4UF0B 3PUQA 2WWUA 5FY9A 5FYSA 5A7OA 5FP4A 4AAPA 5FZLA 5ISLA 2OQ6A 4QX8A 5F3GA 5FYUA 5FJHA 5FYZA 4CCKA 5IVCA 5LY1A 3PU8A 2VD7A 2YPDA 3KVAA 4LXLA 5FXVA 5FYIA 5FPVA 4IGQA 3PURA 4GJYA 5FPLA 5A7WB 2Q8EA 3KVBA 3AVSA 3KV4A 5LY2A 3PTRB 4BISA
chains in the Genus database with same CATH superfamily
1Z7S2 2WZR1 3O0XA 5FXZA 2ZKLA 4PT6A 3N7KA 3ZR5A 2FDJA 2CBJA 2YDSA 3MA9A 2YC2A 4IV1A 1GANA 2VCAA 4HKWA 4ZXEA 4RFRB 4GKKT 3ZSEA 4F6RC 1JOBA 2FCTA 2YEVC 1Y64B 2BGPA 5JZGC 4FPGA 5IWAT 5KC5A 3VDDC 3IM0A 4A45A 1UIJA 4RR3C 2D6NA 3AE6A 2VCCA 2Y6HA 4JQRA 3IB3A 1DDLA 1Z0HA 3VBOC 3AFGA 3CJIB 1Y9GA 2DFBA 2J62A 3K3NA 3MZKB 2RE9A 4M0NA 1KJLA 2W2UA 4GJZA 1SLAA 3CX8B 3JCFA 4ASLA 1KXGA 1F4HA 1JI6A 3VBRA 5FOJB 2ZEXA 4XF3A 4XJAA 5M0TA 2RS13 1NLRA 2RV9A 2QE3A 4D6QA 5IUQA 5JSPA 2C6SA 2P17A 4CI2B 1O6UA 4MHUA 3M3ZB 1FV2A 5I0TA 1AYN1 2J1SA 4RHV2 3GN5B 2QQOA 2MHFA 1I9RA 1RUD2 1IBLT 3B57A 4GWNA 1RUC3 5AFEA 2DTWA 5C3JA 3UT0A 3DYOA 1YXWA 2R7EB 5KX5E 3O0WA 5FUIA 2YBSA 4JGYB 4D0QA 4XCAA 2O8OA 4FFFA 3CX6B 1LOEA 4NUBA 4X1KE 1RJ8A 1WR6A 4UF0A 5JXJA 5EZYE 4UEMA 4CEWC 3VKOA 4IDPA 4MLKA 2WYFA 4ZI2C 5C3SA 3ZYBA 4CEYA 1W3VA 3LBXA 1NCQC 4IV1B 3H42B 4Z90A 4COFA 4XILA 5JH7E 2FQPA 4CUCA 2UXXB 4N53C 3RI8A 1M4WA 2LRKA 2NTXA 5A6YA 3TNQA 2C24A 3PIJA 5DZEA 4BQ4A 4MHCA 1POV0 5AQSB 5C2TA 1W8FA 3PUIA 2ADEA 2UXDT 4R9AA 1N1VA 2ACZA 2DCJA 3WHUA 4M3CF 4AL9A 1N3OA 1W9WA 1H1IA 2ZLYA 4HFHA 1AX0A 1UOBA 2VM9A 5HEUA 4YSYA 4ARXA 4GULA 1RITA 4LMKA 4QX5A 5AQIB 4JGZC 4MXVA 5JMCA 3SFEA 3ZMOA 3IDEA 1DQ0A 1NE4A 1HRI2 4RQPC 4IEUA 3ZKUA 4B1LA 5FP9A 2PTMA 3LDRA 2YOEA 4LQRA 3VD3A 4MALA 1PVXA 2PELA 1RUG3 4L92A 3KT4A 3AKRA 4I0WB 3V56A 1JZ5A 2ZEYA 2VL0A 4CZSA 4WM8C 4B6XA 3CF6E 3F95A 5FFOC 5LB6A 4CDUA 2RS11 4HWDA 3B93A 4DUWA 3V5UA 1VAKA 2E2AA 2OA5A 4NRQA 2UY8A 3RRDA 4UF0B 3BU0A 1HB4A 2CGPA 4EEDA 2J1UA 1IZNB 5CADA 5CG8A 4XZPA 1XNBA 1O91A 2EA7A 2H89A 1DLLA 3KVBA 2W61A 3IT8A 3UUXB 4HZFA 4LMFA 1CAVA 1SBEA 1RUC1 4QPWA 1HV1A 5LCYA 1NT0A 1YC61 4FOYA 1T8BA 3A23A 3ZO0B 2VB6A 2OV9A 3D0SA 3RKGA 3ST7A 3ANWA 2J1TA 4XJ8A 4Q2FA 2VZPA 5A1FA 3C4ZA 5CA0E 3LK3B 3HVDA 4UI9L 5ABFB 3POGA 2LSGA 4UFHA 2MPKA 4LF6T 5HXSA 1ULOA 4BIOA 5L4HA 2XQAA 2BBHA 4XJWA 4TYSA 4UWDA 3QB5A 2VTFA 1RHI1 5C8CC 1Y01A 4CDWB 4QU1A 3I2DA 3LPFA 2Q1MA 2VZUA 4YGEA 1N1YA 3OPTA 5IFPA 2R042 3ZJ2A 1PM7A 3MPBA 5JDLA 5F5QA 1B09A 1D1CA 5A1LA 1HIXA 1T2XA 4NHLA 3PVEA 3ZYPA 3EYPA 3USSA 2BYVE 5KBFA 4CN1A 2JDHA 1U5YA 4NXMT 3ZFGC 4KP3C 1S0CA 4CU8A 3HJRA 3OUHA 1OH3A 4N9HA 2JX9A 1LODA 1W6QB 3ZN5A 2VNVA 4ES9A 4PQQA 3IPVA 5HEOA 4H55A 2VURA 1X7NA 2QVSB 4JI5T 5B4XA 5BYNA 4JV4A 3TLTA 2ZJCA 2AZ5A 5HWYA 2XOMA 3KQRA 2XVGA 1QXJA 3PTYA 1CAUA 5AQUB 4AF9A 5L36A 5JAXA 2VKHA 5DAQA 3C64A 4Q4Y3 3N9LA 4KWKA 5IVEA 1GZTA 5JTGA 2PA7A 3HKEE 4FPYA 2XWBB 1ZX5A 5FQ0A 1JYXA 4Z2WA 3ANWB 4OK0A 5FY5A 4IXLA 2VXJA 4X20E 3N3HA 3FHIB 5B2GB 5E0OA 4J1WA 4QWNB 4UT5A 1IQDC 3CK6A 4E2GA 1HS7A 3RRCA 2EIDA 1QJU1 4YSFA 1AXZA 4JRAA 4M3CA 1OT5A 2ARXA 1KNPA 2XL7A 1BLZA 4PCRA 4QXBA 2FMYA 2JDZA 4QPIA 4Q29A 2CPTA 3RQUA 4BH9A 1WWYA 2V6XA 3ILFA 3I2JA 3U4SA 3WQ7A 2OPWA 4GYRA 1Z0PA 3UUNA 5JMOA 5C9AC 2NP0A 2QFEA 3CLPA 4LK6A 3DUIA 4OI1A 2WZEA 3RI9A 2Y26A 2DVBA 1XPWA 2EALA 4DR3T 3CIRA 2BP6A 4LK7A 5K0UB 4HVQA 1RUI2 4F7ZA 1DGRA 1FATA 1CWPA 2JMHA 3TEYA 1W8ZA 2D9DA 4PJYA 4A6OA 4RHV3 4Q4W1 1YQ3A 2IXHA 3W20A 4B4QA 3PJQA 5BNPA 4YZ1A 1RUD3 1V6NA 1YFYA 5L3EB 4KMCA 1GP6A 4ZOLE 5FMDA 5J0ZA 5FBZA 1VBB3 4YJ2E 3VRAA 2UXNB 2VMCA 1VRH2 4KHZF 3IPVB 5KWRA 2MTQA 5IWFA 4ES8A 5H9QA 2GC0A 1HX1B 5EWSA 5JZGA 3ABZA 3VDDA 4MGYE 3U14A 1I6XA 2ZGOA 3B3QE 4QMAA 4RR3A 4ZI2D 3V0AA 3ZOIA 1CAUB 1EP0A 2WO3A 2FBEA 3T2OA 1CPNA 5AQKB 4B1MA 4IE0A 2L3LA 3VBOA 1OQDA 2A6VA 1UMZA 3LD8A 4IEPA 3VRBA 4F3JA 2VC9A 2XAJB 2OS2A 4IQPA 5FQ0B 3AAIA 2BG9A 4NR1A 3NWKA 4O65A 1NYWA 1IJ6A 5TSWA 4GOUA 4XCBA 2D3PA 4O4LE 1QQP1 2EF6A 4P0BA 4M3CB 4C1XA 3DGTA 2VZSA 1US3A 1ENSA 4W6YA 2OZ6A 1QWRA 4AFAA 2JB8A 1ZM1A 4DNYA 5A6ZA 1AJOA 2CBIA 3HNMA 1Z7S1 3KBTA 3NRYA 1S4CA 2XQ9A 5E8AA 1JNRA 3FJSA 4HL0A 2ZMNA 2ZHLA 1GSLA 2LOPA 5GJ6A 1WCRA 1AUYA 1MMDA 3E5QA 3VR9A 1HRI3 4IL4A 3HQRA 3ETUA 2F4LA 4ILBA 4CEWA 4QXHA 4AFBA 1RUF2 5F6LB 3GZUC 3JU9A 3RG0A 1XNAA 5BNPB 3KGLA 2FJAA 3MIHA 3CO2A 5EK3A 3W21A 3DKWA 1NCQA 1IG3A 2AXDS 5CISA 2W5FA 5A7QA 3JC6C 4GYSA 1TME2 3WDXA 3VD4A 5JZGB 3O14A 4O7XA 1G7YA 4I0AA 3VDDB 5JCTA 1QH7A 4X8NA 4RR3B 3GHMA 3V0AB 3SKVA 3W59A 4QM9A 1H0BA 4ARYA 4YW3A 5HXMA 5KXEA 5FCCA 1T7SA 5LBQB 3MFCA 1GOGA 2IHR1 3VBOB 5DMYA 2RP4A 1AR72 1NEKA 4RHV1 4HN1A 2WBLA 1JODA 1RUD1 3HMYA 5JVVA 4HGAA 3VHLA 2WP9A 5HPOA 4JGZA 3NAPC 4HWFA 1YQCA 2W68A 4RQPA 3M65A 4CXYA 4N7IA 1LOGA 5C3PA 1PK6A 4LKDA 4KU8A 3KCCA 1ULEA 3AP9A 4P9WA 4PK4A 1RUE1 2A3YA 4UW3A 2RJKA 1NX9A 2PLV3 2FD8A 4X6QB 2GMEA 2IVJA 2JXAA 2D5HA 4NHKA 3ZSMA 3UJQA 5FO8B 3JZVA 1ZEEA 2E31A 4TNWA 5LATA 1AYM3 1AXYA 1NA1C 1RC6A 1LGNA 5T55A 2XJUA 4HONA 2R043 1WUVA 2PAMA 4OYKA 3LA7A 4AI9A 3Q9DA 4MFRA 4JBWF 1UOGA 2PHLA 4CEWB 4QXHB 1DBNA 2JB4A 4A56A 3TKLB 3WDVA 1ZBE1 2X0YA 4YW5A 3PUYF 3AMPA 3HR9A 4D6SA 4W6XA 5FZ3A 1NCQB 3OY8B 3HD8B 3JAFA 3RC3A 4BZ4A 3KINB 1NOVA 4COWA 2WAUA 4N53B 2VOTA 3O1JA 5A7OA 4XETA 1EYBA 3OD4A 1LECA 5A32B 2RJLA 3GBWA 4DR1T 2NP9A 4XBQA 2WA4A 5LGUB 5LA0A 4LBLA 1H4GA 5C8YE 1RVF2 2QA7A 4ZI7E 1HRI1 2C9KA 3ZN0B 5LA9A 2EXHA 4EIWA 2QVAA 5D1IA 5JUVA 5T3NA 2LS6A 5C8CA 4ZHQE 2Z42A 4YHHT 4JGZB 4EN7B 3RSJA 1POQA 5GZCA 1ZP0A 1RUJ2 2HWB2 5F7UA 3VDCA 2JDAA 5C5TA 1C3HA 3WF4A 4JI1T 3O1IA 3RIAA 4RQPB 1NG0A 2DUPA 2EXKA 1UK5A 4TXWA 4QM8A 5JPNB 2W39A 4QHBA 4CP1A 5DAXA 2E9XD 3W9AA 1SCSA 1MQTA 3I1AA 5JOXA 4YSXA 1UZ0A 4O4JE 4WM8B 1XZYA 2BZDA 3NV4A 1Y3TA 1ZOYA 4MHRA 2P6HA 4QDQA 1LESA 2ZS6B 4D69A 2WAAA 3PURA 4DEVA 2XJTA 5EQUA 3POSA 3FXDB 1UL9A 3BU7A 2N2NA 1AR62 3MUZ1 2B9VA 4OI2A 3FBZA 1RUI3 1T72A 1DF0A 2VECA 5LBCA 3AECA 2R0HA 3WV6A 3M3EA 2EHOA 4YVWA 1VPHA 2PHRA 1XB9A 2ARBA 5BNNA 1XNQT 1CZSA 2FJDA 2D3RA 3PVNA 4TV9E 4IHJE 4YLHA 2Y60A 1PNFA 1VIWB 2JG8C 5LOVE 4FFHA 2J42A 1G86A 5JQGE 3D8CA 1VRH3 3B5LB 1DU2A 1W9FA 1BR4A 1XXNA 1XSRA 3O1MA 3UTKA 2XAGB 4TN7B 4KWUA 4AI6A 2V73A 4FOWA 4XE9A 3U07A 3ETPA 4O2AE 4TSVA 3LOIA 5C8CB 2H7OA 3HKBE 2ZHNA 4PBOA 4HETA 3D82A 1S2BA 2D6PA 1WD4A 1UZYA 4DY3A 2CAVA 5C9AA 1STMA 2WQZC 3PU8A 1VB2A 4WBOA 1GKBA 2WNVC 3FBYA 2BBVA 1EPWA 3H0OA 1LGBA 1J1JA 3PJAA 1IBMT 1W06A 4E2SA 2W0GA 3RZGA 4CDXC 1RUOA 1A6CA 4XQ4A 1TZOA 2W0XA 1IKPA 3ZXJA 3HIFA 3T2QA 4WBNE 4Y3OA 1SUMB 1WLTA 5K4LA 5JR9A 3MYXA 2VVDA 2FDGA 4TWTA 4OHWA 4QGNA 1Q8OA 1X9TA 3GXUA 2CHNA 3RMYA 2WAOA 3I2FA 2VJXA 2ZXQA 5FK8A 1SMVA 3WR0A 4UW4A 2H7VC 2X67A 2JDNA 3ELNA 5F8PA 1CESA 1QLBA 1UW8A 2CAUA 4DR6T 1EY2A 1FMD2 1OFNA 3FLRA 4MLOA 2D44A 1PNGA 3WP6A 2D40A 3IMMA 1W04A 5DUVA 5BNNB 1VBC2 1FJGT 2I74A 3WT3A 1C1FA 4GALA 2ZMKA 4YHJA 3JAEA 1JYCA 2UXCT 3EO6A 2FJBA 3P4QA 1OUSA 1XYPA 3KF3A 5FPUA 2WR9A 1UYXA 2BBJA 3CVRA 4BQWA 4PJMA 2LSYA 4IT4A 1RUI1 3ZKYA 1W6MA 4MUVA 3ZMVB 2ZX3A 5FBJA 3J7Yq 4EYYR 3U1XA 3UK9A 1W6OA 1HNZT 5EHDA 2Q8DA 5C9AB 4QT6A 2K24A 1Q56A 4ANJA 5E6HA 3R05A 2V8SV 3H3ZA 1VRH1 3SH3A 5GLWA 4YSZA 3IF8B 2X09A 2ZX2A 4R4ZA 3RYFE 4OUSA 3HL6A 4WVWA 2XASB 4HFEA 3L9JT 4JVAA 4TWHA 3ZXAC 1ND3C 4YT0A 2ORZA 2VZVA 4L99A 2UWCA 3S4UA 4FBFA 1S94A 1H6XA 4DMVA 4RS5C 2XBO2 2LM2A 2BOJA 3FUOA 5DAPA 2VKJA 1XE7A 2W1SA 3WDUA 1G9DA 3S7IA 4YM2A 2ZGUA 4BQ3A 2NTYA 3AVSA 1QJY2 3T1HT 3WQ0A 3NNMA 4DV0T 1YQ6A 3S6PA 3I54A 5IJRA 2D3SA 5EYYA 1CAWA 1D0XA 1DZQA 2WT2A 1W2UA 1HRV2 3EABA 1IS3A 4DIQA 3PUXF 1K5JA 4OUEA 5EJ3A 5HV4A 2XQYA 3H3MA 4S2HA 5C8WA 2RVAA 3K4AA 3KV9A 3T0BA 4K21A 3S57A 3BQLA 4CUBA 1NY72 3JXSA 4AZZA 3LJCA 2CWSA 2YYOA 5L2LA 2B5HA 4UFMA 1BZWA 3R6NA 1RVF3 1YQ8A 2XGXA 1W6MB 3J7LA 4CA9A 1CQ9A 4PW8A 1N3QA 4UXNB 2WS92 4WM7C 1RUF1 1N36T 1O59A 2XJQA 4NHMA 3KT7A 5JDGA 4EV6A 1HQWA 1C57A 1NA1A 3ZYRA 1AR92 2ADDA 5CA6A 2XKPA 4MGSA 2X5IC 3LCPA 4NHYA 5E88A 1RUJ3 1TME1 3NZPA 5HCMA 3O9XA 3WNXA 2P3IA 2ZZQA 4FPKA 2C5JA 2KXLA 3BN6A 1MMAA 4JEHB 4AHYA 1SEFA 1Q8PA 5KHKA 3LFIA 1W0AA 4HKAA 1AR71 4G63A 5CG9A 3C4WA 4CN6A 2JRKA 2H6CA 5LW9A 1TEIA 3JCIA 1V6OA 2WN2A 4WVVA 3ON7A 4DR7T 3WEZA 4ISRA 3BOWA 1ZZ7A 5FYVA 1WRDA 2XTLA 5F3IA 5APAA 4B4PA 2V7MA 1FAYA 5IT6A 3UU4A 1NUKA 2KD7A 4I4TE 1AR63 3ZXFA 5HCJA 2HEYF 4I02A 4FOQA 2VUCA 4GWJA 1XRUA 2J1EA 4LHNA 2VGDA 3AXDA 3MV11 4UW5A 5EV7A 5JDMA 3AFKA 3K3QC 4YG3A 4WVZA 5K7PA 5DQWA 4HWIB 4AVBA 3MFAA 4G4FA 2WO1A 2IVIB 5JSRA 3NJXA 4G9SB 1UX6A 2WSVA 3POEA 3EB7A 1UZVA 4EB6E 2QTWB 2GH8A 1UOFA 1QJEA 3VBSC 1WZXA 3WNMA 4BB3A 2GC3A 5C3OA 3BQIA 3CJXA 5C4WA 4JZRA 3LK2B 2LHNA 2NPIA 1NA1B 2W95A 4LFBT 2B8MA 1ZNPA 2A7AA 3WP3A 2YFUA 4FFGA 5LEKA 2GP3A 4QPGA 4CDQA 2K48A 1MMGA 4NWVA 2FUPA 2A3XA 2DVAA 5FLIA 5EPAA 3RQ0A 1U5PA 2RA1A 3ZYHA 3M7AA 4JEUB 1RVF1 3AM2A 4M4RA 2XQ7A 2VVEA 4K8RB 1JYNA 1XNTA 5LA6E 3ZN6A 1HDKA 1C8NA 2W9XA 2DU1A 4DMIA 3NNLA 4AQTA 4FO9A 1YYNA 5IHRA 2JG8A 1W0PA 4XF4A 1NXMA 1Y9QA 3AYDA 1RUJ1 2HWB1 4PAGA 3LEIA 3ENRA 4U36A 3ECQA 1KDKA 4DS0A 2A73B 4LF9T 1GP4A 4IV3A 4KUMB 5DZFA 2W00A 4AKGA 3DCQA 1ZRIA 5IVFA 1W9TA 2W94A 3ZFEA 1A8MA 4NIQA 1GQHA 1FV3A 1NENA 3AYEA 2NM1A 5F5AA 1VBC3 3UJOA 4Y4RA 4K1YA 2SPCA 1H9WA 3FHQA 4Y33A 1N1TA 3ZDVA 2P6CA 2WNVA 3T1YT 2CGNA 3ETQA 4Y24A 3LSDA 4LOSA 1F15A 3N5LA 3C7FA 2VMHA 3BVCA 4CDXA 3UQ4A 2W66A 3ZDSA 4O9GA 5DAVA 1LCLA 4KNCA 2CYFA 3DJBA 1W8HA 1AR61 2VW2A 4D7TA 1QOTA 1UMHA 3RH3A 4B3RT 3HN1A 1HX6A 3LSEA 3WG4A 1S0JA 5F3GA 2WNOA 1PGW2 4ZHNA 2QRXA 3D3AA 5EXOA 1XE0A 4Y5TA 2LTNA 4OHYA 3LFMA 3GGLA 1DZTA 4H63V 5C7GA 1WLWA 4E7ZA 5A33A 3J7NA 3KT1A 3A5XA 1JZ6A 2I07B 3WQBA 1UZZA 3DF0A 4IEZA 4BK5A 3CKHA 3OGSA 3ZN6B 2R6GF 5FL0A 2P3KA 5KXDA 1UAIA 2QKDA 2PHWA 1XYNA 3ZPOA 3T0AA 3WDTA 1C8M2 2JG8B 3ONJA 3B13A 5AQMB 3SEEA 5FY8A 3UYJA 4HVRA 2VOXA 1SE7A 1WFDA 5L3DB 4RL7A 3SC7X 1QIQA 2VW0A 1UCUA 1SBDA 5FZ0A 2E7QA 4BXFA 1G9FA 1D4M3 5FZ6A 1JYWA 4N43C 2ZA9A 2BTVC 5CAZA 5F2SA 4P09A 3ZFEB 3IIAA 5LHIB 3AYAA 1DZRA 2E9QA 3BIWE 4KGQA 3FXEB 4QKBA 4Y1VA 5L73A 1MZFA 1HRV3 4LPLA 2ZGNA 2M6BA 1XU2A 2CU5A 4LBQD 2WNVB 4XIOA 2YXSA 3O1HA 5FK7A 4Q8KA 5SV8A 4AHXA 2J1AA 5D8AC 5FZBA 4CDXB 1LRHA 4MO3M 4C91A 2WWVA 4ZY9A 4QX0A 1J3PA 4YYOA 3SKJE 3KV6A 2CSGA 4XACA 5FZEA 3KSCA 5A7PA 2JQHA 2R1DA 1FMD1 3ZCJA 3M3QA 2DU0A 2OKXA 4N9IA 3ZN1B 1UIKA 2WS93 3CBNA 2B45X 1NWMX 4XJUA 3LDKA 2FCUA 4PDWC 2W62A 1YFXA 1AR93 3NJZA 3KV5A 1ND2C 1JW6A 1XWMA 1IS5A 2ZCWA 2N7GA 1QDOA 4GXLA 3BTZA 1XMOT 3NWIA 1KFUL 4NUVA 1YIFA 4A3ZA 4U31A 3TNPB 4A3XA 2A72A 1J3QA 1SLLA 2IXIA 2OQ6A 3RQWA 4LO4B 2XB6C 2A75A 2OZJA 1ASJ3 1KQRA 1OPOA 3NL1A 5HXCA 2BNOA 5AFBA 1VOMA 4A2UA 4CQIA 3NZQA 1LULA 2XWJB 4NIHA 1UY0A 3AEBA 4XHBA 3LQCA 3NV2A 1NCRC 4TWDA 5HAXA 5IVBA 5DUWA 2P3JA 2JPFA 4ZZ8A 1GYKA 1WCQA 1R64A 2F4VT 1NE6A 4ZZBA 3KWVA 1JNZA 1K42A 2Z2SB 4AQGA 4R9BA 5LBMA 4GQ7A 2OX0A 4JCKA 4KWLA 4Q0SA 4WM7A 2V7LA 4AQFA 2WL1A 4U2AA 5T5OA 4LF7T 2XBO1 2NYYA 5J2UE 3AE1A 5AQTB 1T6GC 3PVOA 3ZCIA 3O1VA 4LFCT 4UXAA 2L8KA 1YJKA 4QX7B 3CPZA 1GZ9A 3QACA 1QJY1 3V5SA 3VB9A 1Y4WA 5T52A 3HQUA 2IUBA 1OA3A 3LZZA 3BTXA 1ENQA 1R092 1NZIA 1W2TA 1PX3A 4GA9A 1H8TC 3GM8A 4RS5B 3TLVA 1LR5A 1HXS2 3LDQB 4Z91A 2E33A 4P02B 2LLYA 3PV0F 3A7QA 4MOAA 4XC9A 2LJLA 4WZCA 1LENA 1SDWA 2XVKA 2D43A 1ZZ8A 1HRV1 2PXJA 1CD3G 2K9AA 5FZDA 3C7GA 5BNQA 4COYA 3AE8A 1MZEA 5A7NA 3THDA 5GZGA 4NMIA 2UUBT 3AJZA 5LBFA 1NY71 1RIRA 5FZMA 5A3NA 3OD0A 2WSSV 4AFDA 1QDCA 1W8UA 2J22A 5JDNA 1PVC2 4AI2A 3VBHC 4FTBA 4BJNA 3N9MA 1J5ET 2G4IA 4S2GA 3K46A 4W6WA 3TB0A 2FCVA 2WS91 2X9YA 4IGPA 2G1MA 4PLOA 4WVMA 4UFLA 1AR91 4ISSA 2Q9QA 2C26A 2KSRA 3T8OA 4YTNA 3VBSA 2ES0A 1XBFA 1LHWA 2IZWA 2YMZA 4LBKA 3TRSB 5HWXA 2WDVA 2RM22 4WM7B 2D0UA 5FMNA 1WMEA 4QKNA 1IHMA 4EAHA 4LORA 2IXCA 4QKDA 1MIWA 2J1VA 1OKOA 2X5IB 2UYAA 4YZ3A 5KXBA 1R1A2 2MEV2 2N1GA 4NUUA 5J3UA 3MLJA 2GDFA 1QSDA 5CYYA 4IV1C 3RHWA 3VLBB 2LSIA 1S1AA 3H1YA 2Y6FA 2Q0AA 4DUZT 1AX2A 1VP6A 5EZWA 2QZ3A 5I8YA 3ONXA 4BQ2A 2CXFA 1QGLA 4FVVA 2XJPA 2AC1A 4J2CA 4NRPA 5DQ0A 3BUCA 5A3OA 4O9EA 4QXKA 3QLQA 3POFA 5KC6A 3ZMNA 3N9QA 2KXPB 1PMHX 1FYUA 4N8MA 3OG2A 3USUA 2ZOEB 2VY0A 5FZFA 3DECA 1UU4A 3PJYA 3QUJA 3AEAA 4AI1A 1W39A 3ACIA 2DLRA 3VBRC 4Q26A 3S7EA 2UWAA 3J8F2 3I2KA 3ZM8A 4B4RA 2X0LB 3AE3A 1VCSA 5BMVE 3LEGA 2V4AA 3KV4A 3ZR6A 2RS32 4LR4A 5JI9A 2HH7A 3HNYM 3FMGA 4EWDA 2I6HA 3MF6A 5HEGA 1C8M3 3N2GE 3B69A 2Q9QB 1YW0A 4FI5A 5AC92 1WR0A 1UX7A 4UFKA 2UY9A 2KWIB 4PHZA 3VBSB 4MXWA 2LE8A 5M4YA 3B94A 3N7JA 4L2NA 1O7FA 2UU8A 4COZA 3EBRA 4V2WA 3DKQA 4GKJT 1OSGA 4JDOA 1LGCA 3N2OA 2Y48B 5HBAA 5JOWA 2CTVA 4DV7T 3N35A 3FZ3A 1RYYA 2Z79A 1O5UA 2Y64A 3T30A 3MUY1 3GZTB 4CEYC 3AZWA 4KI5M 2WS3A 2P3YA 4OX9T 3MIGA 1MNEA 4ILUA 3RNSA 3MKDA 4E7SA 3WLUA 4OZOA 5IHYA 2C5KT 2ZGRA 3P3NA 1O8PA 5AQJB 2VQFT 1RJ7A 3CQGB 3E08A 4CRQA 3H50A 3H8UA 4YJ3E 2XAHB 1SFNA 4CP2A 4H9SE 1ZVFA 2BVLA 4HEAA 4JHTA 1GQPA 4YM0A 4AGGA 3WAJA 5EJ1B 1HV0A 4HE8A 4ZZCA 1C5HA 2WLPA 4SBVA 2RMU1 1GOHA 4UW6A 1TMF2 3C8XA 3CQXC 2W67A 2KZ7B 4AI3A 4QXCA 1Q8VA 4H9RC 2LHRA 1QOSA 1IS4A 4Y5Z0 2FDHA 3D0TA 4YTMA 2FMDA 1PIV2 4P00B 3RLFF 2BS2A 1LHNA 5KHIA 3VZLA 1AHSA 3OBAA 2HKXA 3IZOA 2WT1A 3D5OA 4CSWA 5JXIA 2JKBA 4ADZA 1VBD2 3WAKA 5D8AA 3C7EA 2AEZA 4HWCA 1MS3A 2CXDA 5FMCA 4UAPA 1GZCA 4CXWA 4JKKA 3UV9A 1WLDA 4CDUC 1JTZX 2Q8OA 4HKOA 5C71A 1VMJA 3LWCA 5ISLA 2NLRA 4R8HA 2XY8B 3KS7A 2QBXA 3U3IA 2J1RA 1TQ5A 4G3YC 5CFDC 2X10A 4GMP3 2DUOA 3P7IA 5J09A 4YGCA 3WSOA 3POJA 1FIOA 1C8M1 1ND2A 3UNPA 2F17A 1GQGA 1POV1 3I2GA 1C4RA 3F2EA 2JG9A 3L2HA 2ZBJA 3RS6A 5GLTA 1KGYA 2IFRA 3EAMA 3UU8A 1R093 3FBMA 3WZ1A 4UBGA 1CHUA 1BHGA 1HXS3 1RUG2 2PHUA 4C0BA 3AL5A 3AX4A 3T1MA 1CVNA 2VZRA 1LNSA 3J7MA 4NJ4A 3FFZA 3N9NA 3HI2A 4TV8E 1WMDA 2WWJA 4Q4X3 4GAZA 2L9QA 2JDPA 1IPSA 2YG0A 1PHMA 1CR7A 1WGPA 1XSQA 4Q1PA 3GDBA 4PF1A 2HWE2 4HK9A 4N43B 3ZVXA 3J26N 2Q1FA 3EJKA 4JTOA 3WDYA 1DQ5A 3GA8A 2K5BB 1US2A 4X8PA 2C4XA 1UGOA 4LBMA 1U0AA 1XU1A 4O4IE 1PZ9A 3KCXA 2LT3A 4P9JA 5IYZE 5FZ7A 5D8AB 1ZRRA 3L39A 3G7DA 4KX6A 3KD4A 5L9BA 2B76A 1V00A 2LM9A 3H3UA 4BM8A 3WCSA 2MNGA 2WM9A 3N7MA 1H8TA 5FTTC 2G0UA 4HFIA 2BG9E 5F5CA 4NE9A 4YZ5A 3MO4A 3C7OA 1GR3A 5L3CB 1OVPA 4PDWB 1I6ZA 4YLZA 2QQUA 3MI8A 1WBLA 4DUVA 3KHCA 4HSJA 2D93A 2A5ZA 1ND2B 2ZHMA 1OF4A 4O2BE 1R1A3 2MEV3 1CN1A 1V6MA 3AZVA 1OH4A 3PUQA 2PHFA 1W0OA 4HFVA 1JZ4A 5ABHA 1UCXA 3A4UA 2A70A 1J84A 2YGMA 2DDUA 3VBUA 1LB2A 2ET1A 2CL2A 3RI5A 4R52A 3UL2A 3SEPA 4GMP1 3IA3A 3PUSA 5EIYB 1JZ2A 1ONAA 3LKJA 4Y22A 4A42A 2E5LT 2BKOA 3OYWB 4DB5A 2VASA 1NCRB 3WXPA 2DWGA 4QPIC 3K77A 1YEWA 1UNBA 3WNLA 5KR7A 3EI0A 4IGUA 3RYCE 2ATFA 2XJRA 5KHGA 5CFCC 4I50E 5FVKA 1OXZA 2YPJA 1HB3A 3RJ2X 5IVYA 2AE9A 5JWPA 1R091 4AKIA 4XBLA 3OOXA 3IMNA 4QX3A 1W6PA 3DYMA 2V7JA 3WF1A 4UFJA 5A3TA 3UGGA 1HXS1 5DDJ2 4UV9B 2DCFA 3SCFA 1LOFA 2RS33 5FZAA 4QD2A 2B4KA 5T5JA 1OQ1A 4BLIA 1MS4A 5C33A 2WINB 5AC93 3LK42 3EQEA 3I59B 5A6XA 3TEZA 1H8TB 1G9CA 1HB2A 3T2PA 2NZ9A 1XQNA 2Y6XA 3R6SA 2NR4A 4AW7A 1H30A 5A6QA 3WNPA 3O1SA 3I7DA 1PVC1 4QB2A 1LEMA 2WMNA 3OYZA 2JECA 4BYYA 4PBPA 2BS4A 3CQOA 3I4IA 5LZ6A 2H88A 2VK9A 3RFRA 4HMZA 2A9UA 5H9PA 4GB33 5ABJA 2BG9C 2PHTA 4LE3A 1KEXA 2Y0OA 4RGKA 4YFWA 2XQXA 4PQ9A 3P8CD 3CL1A 3KLSA 4B7EA 1ZREA 4XAXB 3FE5A 1VMFA 5LB7B 3Q8FA 3VBHB 2R16A 2MBGA 3Q2MA 5KHHA 5HV0A 5FYCA 1VR3A 2GN7A 3AA1B 3CEWA 2RM21 1OMIA 2IMLA 4LKSA 4FPOB 3ZKRA 1HLCA 1O4ZA 3TLWA 1VBB2 1KNZA 4DXRA 2D2SA 1UOJA 3BPSA 4ZI3C 4ONUA 3OTOT 2D98A 1HTJF 3JUUA 1R1A1 2MEV1 3BCWA 2DTYA 1TMF3 4XUQA 4ITCA 3BI3A 1V70A 4NAOA 1RL3A 1IG0A 2IFWA 2FZ1A 3NNFA 5FOBB 5LHGB 4DRVA 2WY2A 1LAJA 4X5TA 3VD7A 1ZYBA 4LO5B 1PIV3 3PMEA 3GWHA 1HQLA 4A4AA 3FBLA 1IKQA 1LJ7A 4B29A 3ME2A 4CCNA 3PUGA 4BA6A 4KWJA 3HOBA 1AXKA 2LRPA 1FI2A 2PJQA 5BV6A 4LLFA 1R082 4DR2T 3SH4A 1VBD3 4CI1B 4AGRA 4W4ZA 2H3RA 5LG4A 3J8F1 1DGRN 3RGLA 3U10A 4LJHA 1PX4A 2VUAA 4XMAA 2ZGLA 3J9SA 2RS31 1GNHA 4I30A 4YW2A 3VBRB 5ABJB 4K6BA 2X53S 1DLCA 3OUIA 4AAPA 3AZXA 5FYUA 1A34A 5FRAA 1GMMA 2D6MA 5AC91 4H9OC 4R4XA 1MEC2 1DQ6A 2DUQA 2AENA 5F5IA 3E1F1 4U72A 3R4SA 5DPNA 4D7SA 4XEZA 3BYWA 3WW4A 1PK6C 2ZAAA 4PIZA 4QH5A 4P5YA 4LMJA 3UUBA 4FXGB 3UGFA 1G8XA 5L4EA 3WINE 3ZMUB 3N36A 3EDUA 3SWHA 3R0RA 3JQWA 3N7LA 1WYBA 1LHUA 5FZOA 1S0BA 4QX2A 4PFOA 5E1RA 2JMKA 4M01A 4E2QA 3WP5A 1X33A 2WZHA 3NRUA 5IK4A 3THPA 1UQXA 2HWE3 2MYSA 5KHJA 2JICA 1EV12 3KF5A 4CVUA 4EOZB 1S0DA 4DXZA 2JE8A 4Z07A 5CFDA 1E5RA 5JSOA 4YNIA 3F57A 3RZZA 4CEYB 1QY4A 1D0ZA 3NVOA 5EFUA 3LBXB 3C7HA 5FZ8A 3FZKB 2AACA 1OC1A 5D21A 3CIHA 4FPLA 4D7YA 2E6VA 1NKGA 1TMF1 3I3DA 3CWZB 2G19A 3P4WA 1W05A 3UFGA 2A6YA 1CAXA 3LEMA 2ZEWA 4FP3A 3HWJA 1K3IA 2PAEA 2XG3A 1SCRA 2VWAA 2PLV2 5ETWA 2OUJA 3NO8A 4BJMA 4EZHA 2AR6A 4B3MT 3AZZA 2WIIB 2RS52 5JDFA 1I1EA 1AYM2 4IE4A 2Y6KA 5FZ9A 4AGVA 3AA7B 1WCKA 3K8PC 3BTAA 4ERRA 4GH4A 4GMP0 3URFA 1VBD1 2VL8A 4PI2A 5LMUT 3JD72 4XFFA 4XF0A 2A3DA 2P1BA 3S30A 2EIBA 2WU5A 2WYSA 4W50A 4ZEYA 4BDVB 3O4XE 5FXWA 4DXTA 1V9U2 5FWJA 4AI0A 5ANNA 3H8OA 2ZM6T 2CXLA 4DMWA 1IZ3A 4FTSA 2A2FX 1YIPA 1L7LA 4DY5A 1WW4A 4ILAA 1OQEA 2Q4SA 4QAWA 2BDRA 4I3PA 5ABGA 5C3RA 4EV0A 1MQTC 5FZOB 3INAA 2ODUA 1JYIA 1SHWB 1BCXA 3PHMA 3VKHA 3ZPYA 4CDUB 1DIWA 3D4KA 1LTEA 4JI0T 3PU3A 2QQMA 1V6KA 3T1LA 5CBLA 2PMWB 4AR2A 1QUUA 2CA5A 4LHKA 1MNDA 3OEBA 4C8DA 3GALA 4RSUA 3O12A 5CFDB 5A3UA 1X82A 3EUHA 4M0HA 1RUNA 4KQ7A 4AKRB 1UU6A 1T98A 1CAVB 4P1NA 4LMLA 2CCQA 5FY7A 1RUG1 2DFCA 3H8RA 5DDJ3 2EHOC 4YVWC 1MZ6A 1MR5A 4AAXA 5I0RA 3MK7C 5BNNC 3MW3A 4I0UA 3O1TA 3DP7A 4OZXA 2I45A 5L7OC 3WNOA 2VMIA 3IWZA 2VNGA 5GLZA 1OI6A 2EIGA 3POWA 4IEXA 4FP2A 2GU9A 2HWE1 4OCTA 2BRTA 4P9IA 4QKFA 3UULA 2TUNA 2DV9A 1X50A 1EAH2 1UWWA 2XMLA 3AMQA 1TVGA 1KNRA 2AH2A 2W46A 2P4EA 3ZT5A 2DBIA 4CPBA 2JD4A 3MW4A 1GWMA 2VD7A 3H1MA 1BVVA 5FPLA 2I2SA 5CFCA 3ETVA 4IEYA 4EN9B 5JDHA 4BMEA 4GKXA 1QH6A 4IETA 4CU9A 3I9YA 4FPHA 2HEVF 4LF8T 4JAAA 2HBTA 4CCEA 5FO9B 2X9HA 1QJX2 3M3IA 2ILMA 3SHRA 4DR4T 4XVHA 1D0HA 2XSBA 4C0HA 4CU7A 2BNMA 4MGTA 4MVTA 3MACA 2WZPP 2W47A 4JQTA 2V6YA 4N78D 1GNZA 1HR0T 5CJ5A 1FOD2 1HW5A 4HBNA 5JR9C 5A80A 4CCMA 4MGIE 3UFEA 4LHLA 1E2AA 5F39A 4AXPA 1ZZBA 5FP8A 1OA2A 1GP5A 2ZACA 4IE7A 5IAXA 4JI6T 5EK4A 4IERA 1AF9A 1KS5A 4IEQA 2V72A 1VBE2 5F37A 4YW4A 2UXBT 4AVVA 3SLIA 5K8SA 3NKTA 1IBKT 2OLTA 3SQOA 1OFSA 2HWD3 3OEAA 3IIIA 3TAYA 2NMNA 3AB0A 1UPIA 1R083 2MPFA 2YFZA 4EN8B 1AL0G 3AE4A 4Q0VA 3WG3A 5FPZA 1BK0A 3T08A 4P14A 4AFCA 3S5QA 2BFUL 2GZWA 3WP4A 5LHHB 5IAVA 3HN3A 1MMNA 4QXBB 3BK9A 5G04L 4Q4Y1 4QHZA 4QPIB 1HJFA 2DI4A 1W8TA 2WKKA 3RYKA 3R84B 1J3RA 1JZ8A 2VQUA 2D5UA 1PM4A 5CFCB 1LKNA 4XABA 3R4UA 4EN6B 1HCIA 4XJ9A 2BPA2 2WT0A 3POBA 1D1BA 1MEC3 2HYXA 1ST8A 2NW8A 3X1DA 1O3TA 2VVNA 4AIUA 2CDOA 1AR83 2V6YB 3ZSTA 5FY9A 5LCWL 1KRIA 3GCXA 3KHBA 2GMPA 4RA0A 3RMXA 1CONA 2VH9A 3ABVA 2W52A 3TN92 3BODA 5HYAA 2EVXA 2OUHA 3GCWA 4DO0A 3KBUA 3FB2A 5A3LA 3D6EA 5ABEA 1CX4A 1M62A 5F3JA 4HN9A 1GOFA 2VNOA 1H1MA 1GU3A 1GWKA 2WFPA 4FSJA 3BQKA 1EV13 4F8AA 1NZCA 5F1RA 4FPCA 4BOWA 2WU2A 3OBVE 3C3VA 1SHZC 4AHWA 4BCUA 5LK7B 2BG9B 3MIDA 4G2AA 1VBB1 2ZPXA 4DZGA 5KMGP 3CU7A 2UUCT 2YK0A 4FPJA 4H9PC 4YTPA 1W9YA 2ACXA 1S55A 3ES1A 1ZHCA 1E7PA 3BB6A 1MACA 2HBUA 3VDBA 5LBEA 3P6BA 2DNXA 4KU7A 4OQ9A 2JJ9A 1E57A 2IAKA 2F4PA 3FL7A 3UKTA 2RS53 1IPKA 3NQHA 1DYOA 3W15B 2NN8A 4YXDA 3E0ZA 3LIHA 1Q5OA 1EUUA 1XNDA 2E7AA 3JD73 1HN1A 3KB5A 5LG3A 2E32A 4MGQA 2WZR3 4CI3B 3FZFB 4YZ4A 4OLLA 4XUOA 2KWHA 1V9U3 5CB7A 1LVKA 3AKTA 1B35A 2BWCA 4OFZA 4XMIA 4F8HA 4XTMA 2XLGA 1QJU2 5JLVA 2V4VA 1BK1A 3VBFC 1AL22 2BU9A 1NQDA 4E8CA 3CKDA 3J7HA 5FUNA 5A1AA 2QNKA 3ZLIA 1W09A 3SISA 3ACFA 2FDKA 3FWEA 5CKNA 3OPWA 3NBXX 1MEC1 3UETA 4BQXA 1QOOA 2WFF2 3FHNA 5F32A 1OKQA 3AXJA 2EHOD 4ZU5A 1KS4A 3JB4C 5A7SA 4EN0A 1QU0A 3IAQA 1W3XA 4XUPA 4EXTA 3AA6B 2IW5B 1IOAA 4ATFA 4CCCA 3NNGA 1YCIA 1F2NA 1KFXL 3AMHA 5ACA2 4AVSA 4Q4W2 3SS1A 3GHNA 1K12A 3J4UH 3BGAA 3PUVF 3GNEA 4XIKA 1RXGA 1PK6B 1Q8SA 4XF9A 1YKEB 4IDZA 4EWAA 1W9SA 3MW2A 2B46X 5AQFB 3VZNA 3AK0A 1UKGA 2P2KA 2FDIA 1EAH3 3VZJA 3AEFA 4ASMB 4OHFA 1Y9MA 4J1XA 5A7WA 5C4WC 3IBMA 5I93A 3VHOA 4NRMA 3TLUA 2CY6A 5EYXA 2D7FA 2D6LX 4IDQA 3TEXA 3ITQA 1YQ2A 4LBOA 1OURA 2QQVA 3PDYA 3C50A 3GN5A 4QPGC 4CDQC 2BBAA 3A8YC 4I3GA 1MPXA 4ASKA 3WF0A 2ZTNA 5EP9A 4COUA 1CPMA 1QJX3 1A8DA 2ZHKA 3QNUA 3TYJA 4X1IE 4CCKA 2PLV1 1H2NA 2J47A 1UYZA 4KG8A 5JXGA 2Z6EA 4K0KT 4JGYA 2V09A 3ZFFC 4AISA 2XJ7A 5LXTE 3QCWA 4W65A 5BNOC 3AC0A 1X8EA 2RS51 1AYM1 5L7OA 4JHZA 4O4HE 1FOD3 4I01A 2WQ4A 2XL9A 2DVDA 1KITA 4H3WA 3THCA 2R041 2CWYA 3FLTA 3JD71 4KMQA 3VD5A 3AXJB 4IL7A 4FPFA 1CUNA 2X66A 2IXLA 3H7YA 5JOYA 2VVFA 3HAGA 4IV3C 1M06G 1V9U1 3MXZA 3LE0A 1VBE3 3EDVA 4MADA 3ZSJA 3ZFEC 1N32T 4JI8T 3SCGA 3RJRA 1NAEA 1MS8A 3KM5A 2LSKA 3LF7A 3WG2A 5AQGB 4A7KA 3W5MA 2W91A 4KBZA 2CHHA 3H8XA 4TNVA 5LWBA 4TZ4C 2VQ0A 2EXIA 2LROA 2LUWA 3MBWA 1V6LA 1UY3A 3VKLA 4B8EA 3UU3A 3NKZA 1DFQA 3DPRA 3FN9A 2NW9A 4LKFA 1MQTB 1J5WA 5A7WB 4NWWA 2WB5A 4A7ZA 3AA0B 5FP7A 2GK9A 2XHEB 3B5MA 3TOJA 3MHZA 3KDSE 4MH0E 2WNEA 2RPAA 4I43B 3EVYA 1W6NA 3N4MA 1DYPA 5FMOL 1HKDA 2CMRA 5FPAA 3DTOA 3KMHA 2VKOA 1OUXA 1IAPA 4LKEA 1XC6A 4A5XA 1JOJA 5FYMA 1HG5A 1AZDA 2ZGMA 3I0OA 1L0VA 5LASA 2EHOB 4Z8XA 4YVWB 1EAH1 1A3KA 3JC6D 4WYVA 2ZABA 3K1SA 2XQ3A 3CHXA 2I0MA 3G6JB 1N33T 4QX1A 2VZTA 5L7OB 4DXSA 2HN1A 2K9ZA 1RUE2 3NJVA 2ZKNA 3OPCA 2JENA 2Y6LA 3LPGA 3W5NA 3TN93 3CMLA 1LHOA 4COVA 5LJNA 2WDQA 2WNUA 2X8KA 3BALA 2B7YA 2X9XA 5AQLB 1RHI3 2LW8A 2KMFA 4IE5A 2ARAA 1B7TA 2SBAA 3RDIA 1QJX1 4H2AA 5KDMC 2Y6GA 4HXCA 2VZOA 4IEWA 2XVLA 2QDNA 3O1OA 5ABFA 1ZBE2 1WW5A 4Y26A 5JVDE 5CA1E 1FOD1 4U2ZA 5H6RB 4LO7A 4BQ1A 4XDOA 2XAQB 2WDRA 5T5LA 3T2TA 5AFUL 1QJFA 4URTA 5F2WA 3FZLB 1SFYA 4CTEA 4U2YA 4YVSC 4C90A 5I0UA 3ORJA 3VUOA 4CDWA 3DPRB 1VALA 1VBE1 1H2KA 1VJ2A 3P4PA 4DUYT 4LUKA 4P9YA 5JR9B 5AQNB 2UYBA 1OF3A 4K3UA 1W6NB 2QQPA 1FEWA 1LKXA 2C9AA 3ZN4A 2JIWA 2W4XA 1RTVA 4FQZA 2LSJA 1UY2A 2UUAT 2TEPA 1JZ3A 4Q0QA 2LKHA 3ZMZB 1D4M2 4YW6A 2WWUA 3K51A 5FZLA 2PYTA 2P37A 4DV4T 3RZLA 1CJPA 2AYHA 5C70A 4XBFB 1W6QA 3P4RA 4EZ4A 3FZHB 1UURA 1FT9A 4QDSA 1O4TA 1V6IA 4EROA 4ISQA 3N9PA 1QJU3 4KL1A 4BWOA 3HQXA 1AL23 5FY0A 2D6OX 2ZEZA 2WNUB 4O8SA 1R1ZA 3OJAA 4GIQA 1L3JA 4D6RA 3H3AA 4OHVA 3Q5DA 1WCSA 1ZZCA 3HT2A 2WFF3 4JDNA 4E4ZA 4CN4A 3DYPA 1GBGA 4XHXA 2W63A 1GFF2 2VQTA 4AQFC 4Q4V2 4XTPA 3ZYKA 1W6OB 2PN5A 2YY1A 2OPKA 4QWNA 4XUNA 4BK4A 3E6BA 1J58A 2A6XA 5FKYA 4INDA 5CIRA 3TN91 4M00A 5LA2A 3DV8A 5FREA 5ACA3 4Q4W3 3LEKA 3KFWX 2VUDA 4B3TT 5JOZA 4A44A 1GV9A 4S2DA 2ZGKA 5FLHA 3B9CA 2WCAA 5FYZA 4UVBB 4ZXKA 1LU1A 2YINA 2WQ8A 5FXVA 3M3CA 2BEOA 2YDEA 4MSVA 1ASJ2 2GALA 3WF2A 5CVRA 2XKOA 1CX1A 3C51A 2V1DB 2YZ4A 3AE5A 1KDMA 5JPMB 3E97A 3VBFA 1UKRA 3Q9OA 1XE8A 5K0UA 3WG1A 4P9LA 4HFBA 3I8TA 5BUVA 2OVUA 1VAMA 4OMDA 1R8IA 4X64T 3ZX7A 3KCYA 4HFDA 3MIBA 4OUMA 3NNJA 1ULFA 3TBDA 2JJ6A 3GMIA 4MBQA 1CAWB 2XPKA 2XPJA 2PHDA 1TE1B 2WC2A 2BV4A 4XQDA 3PL0A 1QQP3 3ALQA 2GN3A 5IYYA 2ZX1A 2DBNA 1W28A 3AAEB 2VBPA 5J7MA 2BVMA 4MGZE 3WW3A 3IN9A 2G9ZA 4KGGA 5HI0A 3ZSLA 1HX8A 1DU3D 1MS0A 2XHNA 2HH9A 2Q9QC 2W1QA 3VHRA 2OA2A 2FJEA 3X29B 3ZYMA 3VDAA 4QQLA 3ONLC 3CZUA 3AP5A 2X68A 2D0TA 1Z7S3 4KI0F 4OYUA 4YM3A 4QU2A 3H37A 4EQVA 4PLMA 5J2TE 2BJSA 4BQYA 4TTGA 4IDNA 2G9GA 2HWC2 3OGGA 2ZX4A 4H7LA 2YUEA 2YBPA 3A21A 1DGWA 3AEDA 4J25A 2V5CA 1AL21 3LAGA 4CU6A 3RX6A 2QCSB 2DCTA 4YFSA 1VCTA 2IUWA 4YPJA 4XFBA 4O61A 1VE0A 3ZIXA 4LTAA 3VN4A 4LUMA 3N9OA 5CB4E 3VR8A 2JDUA 1OWAA 2PFVA 1GQEA 2Y38A 2E9XC 3CZJA 2XAFB 3VL9A 2WFF1 1H2LA 4I09A 4DNDA 3GBGA 3JBG2 1ZRCA 3GJAA 2DHRA 3EHZA 2CWOA 3T09A 3O5SA 2JQ9A 1QKQA 2BVBA 4DV2T 3VBFB 3ZFFA 5AQPB 3UGHA 3ASIA 5BNOA 4YFZA 5LMNT 2Y0IA 2YB7A 1FMWA 4BJ0A 2R062 3RVHA 5GZFA 1ENXA 4QH4A 1JZ7A 5I8TA 2P5BA 1KJRA 5HXVA 5ACA1 4ZPIA 4Y5SA 3APBA 3NKGA 3RZMA 2XONA 3ZMTB 1OEDE 2DCYA 2R0FA 5IVCA 3WF3A 1E5SA 4RGAA 2A71A 4QB1A 3U0ZA 2CE7A 3OGJA 2RDNA 4Y1XA 1IGOA 4DVDA 4UVAB 1WD3A 5IUXA 4LF4T 1JS9A 5GZEA 3IDBB 3UT5E 4CP0A 2ZGSA 3MIEA 1L7QA 3QK6A 4LO6B 4PNIA 1RUE3 1QJZA 4AVAA 2CEAA 3NRXA 4QH1A 4WZFA 2JEMA 4FAHA 4NIGA 2AEYA 2KT9A 2X05A 3OBZA 3SNMA 4S2FA 3RYHE 4H9QC 5C4WB 5AQQB 5DQVA 3O1RA 5HEHA 2GH2A 3JQXA 4AEKA 4QDRA 5CKQA 3BKZA 1BYHA 5ANQA 2ZAHA 1F4AA 3MLLA 4CDQB 4QPGB 1J1LA 1ZBE3 1DQ2A 3EXUA 4XOGA 2PFWA 5FYSA 4LBJA 1HNXT 1Y7BA 5CZKA 1PGSA 1LU2A 3KVAA 1O3XA 3VGIA 4ET7A 3ACGA 2E8IA 3ZMSB 2VULA 3NV3A 1Z8UA 1NXD1 3ZFFB 1YKHB 2R6QA 4PI0A 3G06A 2VE1A 5BNOB 2QZ2A 4LOTA 1WYCA 1OVSA 5HCBA 1WBFA 5KXJA 2H0BA 3WUDA 3RGBA 4CP9A 4JKLA 3CDZB 3H7JA 3PDQA 3ZXKA 3UKVA 3MICA 2H0VA 3ZYIB 4AFMA 4AQSA 4IV3B 2DYCA 1MVEA 2DCKA 2BERA 4U7YA 3OY8A 5IVJA 1SZBA 5FYBA 4H63H 1CIYA 1QEXA 4BA9A 3I0QA 1DHKB 4N53A 3L09A 2QGSA 4JRLA 5A32A 4LIVA 1OEDC 2IIUA 4U74A 4YW1A 2OXBA 1WMFA 5CNAA 1GICA 4NPMA 5FVLA 3DL3A 3QB5K 4YVSA 2WLQA 4ISTA 2DURA 3OF1A 5FJHA 4DV6T 3RYPA 4OYJA 5I8SA 4DV5T 5DUXA 2D6KA 5LY2A 1S2EA 4NN0A 3I9WA 4OI0A 3SFDA 1PO12 3OCPA 3VKMA 1XDOA 1WW6A 2YGLA 4DBQA 1VBC1 4Q4V3 4D8MA 4NHXA 5LP6E 3ZYLA 3QC9A 2VOVA 1MZ5A 2ERFA 4ORFA 4L9BA 5A33B 2C0SA 4NPLA 4LT5A 2BS3A 5I0DA 3IEEA 2FZ2A 3BTYA 2JG9C 2VTXA 1F31A 3PUHA 4WM8A 2VMGA 5LRRA 1QNYA 2V26A 4Y1YA 2BNNA 1F9KA 1YXRA 1GNYA 3M1HA 1RINA 3I3BA 2W1UA 1SFPA 3WD5A 3PJAJ 2J7MA 4B3ST 1AJ3A 3LSVA 4CP9B 4XDQA 1IPJA 4EE2A 2JQKA 2JDMA 4IE6A 4AEDC 4E9KA 2YPDA 4RN5A 4AKLA 2PG8A 1U5ZA 5JDQA 2XR4A 1KFYA 4ATEA 1U4QA 4XZCA 1S35A 5J37A 5CKMA 2DVGA 2ORXA 2BKNA 4ILCA 4HWHA 4X1YE 2YU2A 1DGLA 5HXHA 1OBNA 4HK8A 3ZXDA 3E6DA 5JIAA 2Q9QD 3WNNA 4PJLA 3O0VA 1COV2 4TN7A 4KHPT 2HWF2 4XFAA 4DINB 1EZ3A 2R32A 3SCHA 2K46A 4Q0PA 3E6CC 4YVSB 3T4VA 3AXEA 4OHZA 4UELA 2XJSA 1WW7A 4AEMA 2UWBA 3HPNA 4LULA 1LOCA 1D4M1 3AE7A 4YG0A 5BXXA 4UVCB 3RPQA 5T5PA 2J1DG 5A70A 2LRLA 4URAA 2KINB 4PF5A 4A41A 2VZQA 2ETEA 1S0EA 1Y43B 2HWC3 3VV1A 4Q4X2 3I3EA 1TNRA 4OQ8A 5FYTA 1QXPA 4E27A 2XQ5A 4X65T 3ZFGA 1YI7A 1I5ZA 1O3SA 4LF5T 1S2KA 4KH9A 1EPZA 1OPMA 3M70A 5FP3A 3MGUA 4WBBA 2HLEA 2WO7A 4PIXA 5FWEA 1G9BA 2Y33A 2FDFA 5DABA 2B1EA 3VBUC 4XZUG 3JBG3 5ADXL 5J1XA 4CCLA 3WY6A 3POIA 4R9CA 1X9PA 4Q4V1 3JB8A 1O3RA 2VZ3A 3DN7A 5FKBA 4UR9A 2R063 2FHRA 1GLHA 2GNMA 5JIUA 4CCDA 5F3CA 2WDBA 4NROA 1WA6X 1JMUB 2DL1A 2O8QA 2SLIA 3ILRA 5CU1A 5FY1A 4K7JA 2GNDA 1U5XA 1YWKA 2YC0A 1V9DA 1UMIA 1HB1A 1Z78A 1ASJ1 3MEPA 2VR4A 2WRAA 3K4DA 2XDVA 2VW1A 4PK6A 1LOFC 4FCAA 1YQ4A 3MLKA 3L2YA 2MAWA 1ALYA 4I55E 1IS6A 3AP6A 3MIFA 1JYVA 1YJLA 2WZIA 3AMMA 1D1AA 2HN2A 3T0DA 3LOBA 1RUH2 3B00A 4Q1RA 2E9XA 1XOYA 3VKNA 1WCDJ 3RYRA 1ULPA 3OUJA 4XPVA 2EIEA 4FT8A 3P1IA 1FXZA 4M4PA 3RZHA 2KLQA 1ZRDA 3A22A 2GP5A 3W58A 5J36A 3ROUA 3NSTA 3FX3A 1LHVA 1H6YA 2WSUA 5E16A 2Q8CA 1N34T 4YRDA 3ZFGB 4M1PA 5ABJC 3SMHA 1YHFA 3FLPA 1LOAA 1NAFA 3LGRA 1HF8A 3IDAA 3E5XA 4AHZA 1J83A 4GD4A 3JADA 5A3WA 2A3WA 2OW4A 2DCZA 2CGOA 1W9RA 1UPSA 3FHAA 3GF6A 1F5JA 3ILNA 4WVMB 2HWC1 5C3QA 4Z92B 2VPVA 3PVBB 2JE7A 4QX8A 2HYKA 4IUGA 3MZHA 4A97A 4FOVA 3OTFA 3NV1A 2YHJA 1RUF3 2CWMA 5IK8A 5DG1A 4IIJE 3UU5A 4Y20A 2ZGPA 4CCJA 2I59A 1UN1A 4JTNA 2E63A 3NMBA 3Q5EA 2EICA 1TME3 3JBG1 5F3EA 2R30A 5GKAC 2M67A 5FYYA 1ZZ6A 2NQYA 5H9RA 4LBNA 1OD3A 1UYPA 1UYYA 4GK0E 4GB32 4HANA 4QPYA 1G73A 1QHDA 4DUXA 2R061 2XJVA 1WLXA 1N3PA 1T6BX 1UO9A 4PJNA 1D0YA 5TAOA 1E5IA 3VKGA 5JR2A 2VZ1A 4U7IA 3H1WA 1AR73 3ZXEA 2E9XB 1VBA2 2RHPA 3QOFA 2WMOA 4DV3T 1BBT2 3O7OA 1BVP1 1PO13 3AE9A 1FNZA 1XNRT 1D2QA 3USUB 4JI4T 4E4DX 1JU3A 5FP4A 4XUTA 3RIFA 2Z5WA 4DEQA 2Y8KA 1Q3EA 4LXLA 5BPXA 3HEIA 3TEWA 4SLIA 1AJKA 3K3OA 3AYCA 2GNTA 4QQ2A 2PBIA 4PIYA 2VUJA 4CUGA 1CIWA 4FAGA 2AREA 4LEJA 4W8JA 4A7YA 1QF3A 3ZT6A 4Y1ZA 2ZM2A 3T4HB 1OLQA 1F8VA 4QGMA 2X29A 5EJZB 4IGOA 1OEDA 5LYJE 3B9IA 1XDPA 5FY4A 2GC1A 1LRZA 2QUOA 1PGW1 4QX8B 1RB8G 3THTA 1HG2A 2XUEA 5FZGA 4LHSA 4Z1VA 3WHTA 4MXWB 1V0AA 1KK7A 1PZ7A 2H6BA 1ZA4A 5IFTA 3LA2A 4Y20B 1X9BA 4LA3A 4AI8A 3NAPA 4Z82A 2BFUS 2LM3A 4ZKTB 1OLRA 4KBBA 1BMV2 3WUCA 2Q1ZB 4K9SA 3BPZA 1JU4A 3NJYA 2QQLA 1ODMA 1XJAA 3ACHA 4WW0A 1VAVA 4YGDA 4K8FA 2O1QA 2Q8EA 4L9IA 1COV3 2BW8A 2HWF3 4Q5OA 1YNAA 5FLJA 4OMCA 2XSAA 2RDQA 4LFAT 4P9GA 3ZYGA 4LE4A 1JUHA 4JV5T 1W8NA 3RIUC 3SH5A 4FI9A 2NMOA 1ENRA 4FFIA 1H2MA 1AX1A 2HWB3 4K40A 3AL6A 5L3BB 4NIDA 4PJJA 2BQPA 4HFCA 5J96B 5LEJA 4AEJA 4IL9A 4AXOA 4ZS2A 2B39A 1PGL2 3MDPA 4PLNA 5FDBA 1DG6A 4AEDA 1ULGA 2VXRA 4QXCB 4GH4C 3I2OA 1SG3A 4DOUA 1QMJA 4UOJA 3ZSKA 2IXJA 3VL8A 5F5WA 1BXHA 2R072 3K48A 4D3WA 2YBKA 3AB3B 4BLJA 1OEDB 4ZZ5A 3EMRA 3UUMA 2ARCA 1LVFA 1SLTA 3E5UA 4ZONA 5L47A 4HVOA 1PO11 1F35A 1C1LA 1ZRFA 4TZDA 2C5IT 1PMJX 4L0PA 1MIYA 3ATGA 1SPPA 4NOTA 1REEA 2B9UA 1K5MC 3NAPB 5C5UA 1QXRA 1X8MA 1SLBA 4ZS3A 4YG6A 2YDQA 1IQAA 1PO22 4TLGA 3I97A 2W3JA 5AQVB 3DXUA 4NVPA 2PQQA 5JRCA 5FYHA 3R4DB 4HT1T 3RZJA 5C6CA 5FJKA 2K3WA 4AQ6A 2K2SA 4KBMB 1A78A 1ODNA 2WJSA 1ZV4X 3I3QA 1XYOA 1ZA7A 4V1Av 4GIWA 4B3NA 2HJIA 2JG9B 2F6BA 2E51A 1ZBA2 2JDKA 2E53A 3K75B 4JI7T 2XQ4A 3MPPG 2D97A 4GWIA 4QQPA 1RUH3 3VD9A 5F6KA 1YD8G 4YM1A 2Y8DA 1BEV2 5HXEA 3ZYJB 4JI2T 3LA3A 3BIEA 1IJ5A 2QQKA 2VMEA 3ZIWA 4FTEA 5DJQC 5FNVE 2J4GA 4ZU7A 4AEDB 3KZ4C 1COV1 2HWF1 3WW2A 1W2OA 4MV2A 2V5DA 2UURA 3U78A 3ZC1A 3GJBA 2A6WA 3AVRA 3P3PA 3PMSA 2Q5TA 1H1AA 4YY3T 2V5YA 4XW3A 2C5DA 4Q25A 5L19A 3U11A 4PK5A 2W08A 4RFT0 4OHXA 2CM0A 4YWAA 3OPZA 2E7TA 2A6ZA 2ODVA 3AEEA 2EAKA 3PUWF 2CV6A 5FV3A 2VTXJ 4BQ5A 4K1ZA 2VO5A 1M7KA 5JREA 1SPPB 2XM1A 5DUUA 4Q4X1 3GYDA 3Q5WA 3QH7A 3AP4A 1FMD3 1ULDA 1HNWT 2Y34A 4META 3UQ7A 2RMU2 2XQ6A 1CZVA 1LOBA 1OXCA 5G05L 5HCFA 1N47A 3RWNA 5JRCB 1FMVA 4IDOA 2ZX0A 4XXAA 4XQWA 5DZGA 2MOZA 5FAXA 4UYBA 5JI7A 3RF1A 2A1XA 2XM2A 2GNBA 5J48A 2BZBA 1FPN2 5F9TA 1EUTA 3P5BA 2RDSA 5HCAA 2CLYC 3Q5XA 3HKCE 4Z8BA 2CDPA 3P50A 1OLME 4R9DA 2JWPA 2R1BA 1VBA3 1VLNA 3VBUB 3TLSA 5JDBA 3RYIE 1VB4A 2UU9T 4TX5A 4CUAA 4F83A 4WZXA 2WA3A 3A0KA 5AQRB 1OOPC 5DN2A 3ZT7A 1BBT3 4Y22B 3AZYA 1UY1A 4K20A 1BJQA 1CGPA 5H6QB 2OIIA 4FJOA 3VZOA 2WBKA 3ZEFB 4DR5T 5T50A 4TLFA 4KG0A 5FIXA 5IK5A 5EK2A 3S5AA 3F2ZA 2XBO3 3FFQA 3I49A 4H9NC 2L9LA 1RMU2 1RUH1 1U12A 1W6PB 4IESA 3RPUA 5DAWA 3ESLA 1H9PA 5FR3A 2HWD2 2CHOA 2N9DA 2WN3A 2ZGQA 4AOCA 1QJY3 5DG2A 2TBVA 1I3HA 4GJYA 2ZM0A 5CGMA 4Y4YA 3PTRB 3PNAA 2EXJA 5LGTB 2IXKA 4JLEA 2VQET 4LLOA 2XHKA 2JKXA 2P34A 4IREA 1YO8A 5J98B 2IC9A 2OT7A 1W2AX 4A6SA 2ZGTA 3CMGA 2VOKA 4OVEA 1O5LA 1UU5A 4AK3A 2GAUA 2ZMAA 4XFGA 2P9BA 1HJGA 5AVPA 4QX7A 3H9AA 1UD1A 3HT1A 2NWBA 2WQYA 1DP0A 2LOSA 3WOGA 4DBRA 1ND3A 4EGWA 4Q0UA 2CNAA 1XMQT 4BPZA 5JXHA 2ZMLA 4RS5A 5AQHB 5FMOS 2YU1A 1H4HA 5BY5A 4BIFA 2W2IA 3RWKX 4I2OA 2YC4A 1I94T 5BR8T 5L9RA 4HFSA 5KXCA 1K45A 1P8JA 1W0NA 1DCSA 3V64A 1WCUA 1YI9A 5A3MA 4N7UA 3MJXA 1AR82 3L8RA 1WA4A 3ZYFA 4RYDA 3CQCB 3OB8A 4JYAT 5T54A 2VVSA 3B7MA 1JBCA 1HN0A 1OA4A 1G8WA 3B01A 1H7CA 4XJZA 4GB31 2EAAA 3KGZA 3VU7H 1YQ5A 1FNYA 1HFAA 1GWLA 1PZ8A 1SA0E 1WKYA 4CYDA 3MV01 1MIVA 5FPBA 3M8LA 4BHPA 1FX5A 2ET7A 1VBA1 3Q8BA 5FZ4A 1J59A 2GMMA 4AKHA 3HBKA 2W87A 4X66T 3AKPA 5LBBA 2XZEA 2W92A 2R073 3WDWA 3V0BA 2RDRA 2VAUA 5IVVA 3VZKA 1BBT1 4LBQA 2VKDA 1B35C 1S0FA 4NO4A 2QQWA 4V2VA 3LB9A 2VBBA 2Y6JA 3RZKA 1UUSA 1DYKA 5LA1A 2AGSA 4YW7A 3IAPA 1OHFA 1BR0A 1MS1A 4X6RB 4EJRA 3CX7B 2ES3A 2IC1A 1WLCA 1W90A 4XXPA 3OBTA 1DGWX 2G9FA 4RGGA 5FPXA 1F5FA 1E5HA 4BXSV 4U33A 2JQQA 4P9XA 2BDEA 3RIUA 3RRWA 2X5IA 2RR12 3CNAA 2HPLA 1NLSA 1PIV1 1REFA 1PO23 3TWIA 3L3PA 2CRBA 4FPEA 5FPVA 2VBDA 4LNVA 4HSLA 2QQJA 3AEGA 5B4NA 3M3OA 1ND3B 2YN6A 4E8DA 3N2KE 4QQHA 4LA2A 2Q30A 4JKMA 1NQJA 3LDBA 3ZXLA 3U75A 5FZKA 5FXXA 1UX4A 2JIJA 4AE2A 1ZBA3 1BR2A 2WZR2 1O3QA 4N90A 3IBPA 1W03A 4BE3A 1L7RA 3Q8CA 1MS9A 3CJIC 1W0BA 2XUMA 3E22E 2R49A 4MG2A 2YROA 3AKSA 4NIAA 4CPBD 2QQNA 2BUKA 2B42B 1BEV3 1BMV1 2E26A 4DPNA 3NW4A 2XQ8A 3P4SA 2XH6A 4WNKA 3AP7A 2VMFA 4E4SA 5HXRA 2LEHA 5AVAA 3HBZA 2IDOB 3OYXA 2VCBA 4XDPA 3AKQA 3SXWA 1K5MA 5CEHA 2BKPA 4I0BA 4QGLA 3C4XA 4MGKE 2X51A 3AE2A 3MF9A 1H8VA 3VHPA 2ZM8A 2YKSA 3V0BB 4LBQB 1VMHA 3AMNA 4C1WA 2TNFA 3BOPA 1S0IA 1YRZA 2C1FA 5LK5A 2VNRA 3FUQA 3RKOA 4JGYC 1AYN2 1QNWA 3ACLA 3Q8AA 4XFCA 5FO7B 2IC6A 1PGL1 4H7MA 2W1WA 4JUYA 4P0AA 4A98A 3DEMA 3HNBM 5AQOB 3S0MA 1CAXB 2RG4A 2RMU3 3OJBA 2E5VA 4AQYT 5GM0A 2OYZA 4EYUA 2R071 2VCMA 4P08A 2M6IA 5A3PA 1OD5A 3WW1A 3I3MA 1JYTA 4XFHA 3ZXGA 2IWGB 2DVFA 2VG9A 5HEJA 3DXTA 3VHNA 4GH4B 3U4XA 1G9AA 4XYXA 1FPN3 2KNDA 1W8WA 1YUDA 2JDYA 3H3LA 1CJDA 1UY4A 2PHXA 3J9X1 2PQSA 2X9WA 3O1PA 1JN2P 4NAMA 1V6JA 1S0GA 1UX5A 2O14A 4IGQA 3QH6A 1PO21 5GLVA 1SBFA 2WABA 4GKYA 5L9VA 4ZI3D 2VMDA 4L5GA 3DPRC 4ZXLA 4JDMA 3IDCB 4DV1T 1AVBA 3OGVA 5IW0A 3F31A 1E1HB 1HQNA 2D5FA 2V7KA 4HTEA 1K5MB 2BVVA 3EHKA 1ZBA1 4CXXA 5J1GA 3SOLA 4MZUA 2HPJA 1DQ4A 1RMU3 1MVQA 2KM2A 1POV3 2WO2A 1BEV1 3HR0A 2HHHT 3K2OA 5H9SA 1KD7A 2ENRA 1MS5A 2OQ7A 4P5HA 3FZMB 3QOPA 4HLTA 2VU9A 2WNUC 3A7MA 1RXFA 4CE8A 3M4FA 4QQOA 4BMBA 3OGRA 4DFSA 2X0HA 3IHRA 5FYIA 2QQIA 4GK5E 5I0SA 2RS12 4IEVA 1OOPA 5FZIA 3OKQA 4BISA 2LALA 5GONE 1YFUA 3M2MA 4BAYB 4LITA 5DDJ1 4L0RA 2QYWA 3OVUA 3PUAA 4YZ2A 3NVCA 1UF2C 1URXA 4DIDB 1W2NA 1CZTA 4AG4A 1SLCA 2DWRA 4EEBA 2WZ8A 1LEDA 1SDDB 2NW7A 1RUC2 3I2IA 4B7KA 1W8OA 4CCOA 4MYEA 3KQ4B 1SACA 4HOOA 1US7B 4AYUA 3T3YA 3IKWA 4UFIA 2YV8A 4CDWC 1PMIA 4GWMA 2Z4FA 3K4ZA 4DRRA 4PFPA 1JH5A 3AAAB 3HA4A 1NLQA 3HKDE 3ES4A 2YDRA 5JR7B 4N43A 1GZWA 3ZSSA 1JHJA 5LRSA 2BOIA 1I5PA 1BQPA 1FPN1 4OFGA 3WVJA 5GALA 1RHI2 4HPKA 5L3FB 3O1UA 5K9YA 4AQ2A 4ZU4A 5LY1A 3WQ1A 2WUHA 4JI3T 3ZJ1A 1GUIA 4NIIA 2JIGA 5ERLA 4UBHA 2LKGA 1J1TA 4L8QA 2DF7A 4H14A 2CLYB 5IK7A 1VRBA 4XAEA 1ZZ9A 3C98B 2RJ2A 4NPRA 5GZDA 2KR2A 1UZWA 3WCRA 1C5IA 3FC0A 5FZ1A 3OSDA 4PDWA 2NOXA 3AJYA 1OOPB 1KF6A 4QHOA 5L3GB 1RMU1 1UXXX 1XNKA 3PLQA 2RR13 1Q43A 2PAKA 4M3CE 1OLMA 5LGNB 4X62T 4QB6A 1X36A 2HWD1 2K0GA 4YGBA 4V1PA 4NPPA 3OBRA 2GSYA 2O0OA 1BR1A 3LG7A 4LO8A 3ZC0A 2HEWF 5FKCA 4DQAA 1SLIA 4UV8B 1BKZA 4HN0A 4XFIA 5FZHA 1O8SA 2XXZA 2BGOA 1R081 2PTFA 1JHNA 1XNCA 3VKFC 3PUZF 4RD7A 3QBQA 3OYWA 4TWFA 1NCRA 5E89A 1U5IA 3UESA 1KEYA 1C28A 1SQ4A 2KA3A 4UIGA 1G6NA 1YLLA 5CFBA 4D94A 2VOWA 3B02A 1JXNA 2WWSA 1GZWB 4GZ9A 5I91A 3POYA 5K0UC 3A0NA 1PVC3 2BGCA 5D2AA 4U3CA 1D2SA 3Q8EA 3GZAA 4HPKB 1TNFA 4FQ4A 4L97A 2DWKA 1D4VB 4AVTA 1ZKEA 1RGSA 3D0JA 1D0GA 1Q8QA 3PIGA 1AR81 4IW3A 3UKNA 5FUPA 2QJVA 1DQ1A 3I59A 4XBNA 4YARA 4Y1UA 3GZEA 4BU2A 2FBWA 5DXDA 1AYN3 2RM23 3SITA 5LJMA 2ID4A 3RC8A 2QDRA 5SV5A 2XLAA 4XF1A 3I2HA 3WI3A 1O4YA 2JE9A 3CJIA 3PE0A 1JOPA 1W99A 2Z69A 2XLFA 1N1SA 4WV8A 4Q27A 1EV11 4XURA 2VL4A 4MX3A 3LIGA 3WNKA 5FL1A 4AWDA 3U37A 1D7PM 4JX0A 4J6GA 3VBHA 1WMXA 4Q8LA 1UXZA 4XAAA 4IEOA 3QD6A 4CZZB 1ULCA 2AUYA 4K0UA 1YFWA 1REDA 5HCHA 5IATA 4HKLA 5LNKA 4E4HA 1B35B 5GLUA 3UU6A 2RR11 3WX5A 2JD9A 1QQP2 2GC2A 4LIUA 1TG7A 3GBFA 2V7IA 3VZMA 4FXKB 3V65A 2ZZJA 4JC1A 3J8F3 4HG6B 1JUIA 4OI4A 5FZCA 4AVCA 4NXNT 4Z2AA 4TUYE 4EWEA 4OULA 2BWAA 1APNA 4Q4Y2 2C0ZA 1X79A 1ACCA 2XQRA 5FMBA 3C2UA 3SRZA 2VQAA 4L11A 5BNPC
chains in the Genus database with same CATH topology
4EZ4A 3ETVA 5FXZA 2PXJA 2E9XA 5JDHA 3CVRA 5GONE 3MA9A 4PAGA 2K9AA 5IVVA 5FZDA 3GWHA 3P7IA 4PK4A 3SS1A 1YKHB 4BAYB 4LITA 1H7CA 3I9YA 4L0RA 4PJMA 2LSYA 3PUAA 3FBLA 3N9PA 4KP3C 2X9HA 3VU7H 1WYCA 5A7NA 1FIOA 1HFAA 4ZS3A 4CCNA 5FY0A 4F6RC 2YEVC 1Y64B 4KUMB 3ZMVB 1SA0E 5FBJA 3PUGA 2KLQA 1ZEEA 4EYYR 3J7Yq 4O8SA 1MIVA 2W00A 5FPBA 1YKEB 3OJAA 2PJQA 4IDZA 2NW7A 4AKGA 5FZMA 3F2EA 2GP5A 3DXUA 3PDQA 5FZ4A 3MACA 5IVFA 5JRCA 5FYHA 2Q8DA 4AKHA 4D6RA 5A3NA 2WSSV 3H3AA 4N78D 5JDNA 4HONA 2K24A 5HWYA 5FJKA 5F5AA 4OYKA 4BJNA 5A80A 3N9MA 5JR9C 2Q8CA 4CCOA 4CI1B 4Y4RA 4CCMA 4ANJA 4AI9A 4KBMB 4OHFA 5IVJA 3Q9DA 4M1PA 4MFRA 1US7B 1ZV4X 2SPCA 2VKDA 3UFEA 4HOOA 2W63A 5E6HA 4V1Av 5FYBA 2H3RA 4H63H 4V2VA 3K3NA 3MZKB 4QXHB 2X9YA 5LG4A 5F39A 2VKHA 4AXPA 4IGPA 4BA9A 3C64A 4Y33A 4AQFC 3I0QA 4A56A 4GJZA 3N9LA 3IF8B 5FP8A 5IVEA 3RYFE 4GIWA 3CX8B 3HL6A 1NAFA 3TKLB 3ZYKA 4IE7A 4PFPA 1BR0A 5EK4A 3AL5A 3CX7B 2XASB 4QWNA 1HF8A 3AAAB 3HA4A 3L09A 2QGSA 3N5LA 3PDYA 3C50A 3GN5A 3HKDE 4ISSA 4D6SA 3HKEE 2Q9QA 4GD4A 4LIVA 5FZ3A 5A3WA 3T8OA 4D6QA 5F37A 3ANWB 3N9NA 3HI2A 4OK0A 3S4UA 4ASKA 4TV8E 4U74A 2JQQA 3DJBA 2WWJA 4GAZA 1YD8G 5FY5A 2L9QA 1S94A 4DMVA 3RC3A 3KINB 2ES0A 4X20E 2Y8DA 3KFWX 4CI2B 5HXEA 2WAUA 2BDEA 5E0OA 2VKJA 3RH3A 4QWNB 3RRWA 5HWXA 3O1JA 5A7OA 2HPLA 3GN5B 4AAPA 1HS7A 5L3FB 2D0UA 1IJ5A 3RRCA 5FMNA 5F3GA 4ISTA 4X1IE 4QKNA 4QX8A 4UVBB 5FJHA 5FYUA 5FYZA 4CCKA 5LY1A 3L3PA 4OYJA 2NP9A 2YINA 4EAHA 5FXVA 5DJQC 5FPVA 4H9OC 5LGUB 5FNVE 2NTYA 3B57A 2Z6EA 3AVSA 5LY2A 3ZJ1A 5C8YE 2QA7A 4ZI7E 3ZN0B 5LXTE 1MIWA 3C51A 3GA8A 4QXBA 2K5BB 2V1DB 4IIJE 5F5IA 3LFMA 3I9WA 4U72A 4O4HE 4EIWA 4H63V 3N2KE 4E7ZA 2N1GA 3U78A 4CCJA 4NUUA 3ZC1A 2I59A 3LDBA 4O4IE 3AVRA 2LT3A 5FZKA 3U4SA 1G8XA 5FXXA 5KX5E 2CWYA 1QSDA 1UX4A 4DBQA 2CLYB 4GYRA 1Z0PA 3ZMUB 3A5XA 5IYZE 3UUNA 4ZHQE 1D0XA 2YBSA 5F3EA 5FZ7A 5LHHB 3ZYLA 5LP6E 3EDUA 3QC9A 3SWHA 1VRBA 2M67A 5FYYA 1BR2A 2LSIA 1MMNA 3CX6B 4QXBB 3C98B 1WYBA 1CUNA 2X66A 4NUBA 4X1KE 3BK9A 3IBPA 4PK5A 2CM0A 3MXZA 4DIQA 5FZOA 1WR6A 4UF0A 4GK0E 2LM9A 5EZYE 2DI4A 2ODVA 4UEMA 4PFOA 2C0SA 3O1IA 2JMKA 5FZ1A 3EDVA 3ONXA 3E22E 1G73A 2CXFA 2XQYA 3ZPOA 5FV3A 3IEEA 2WM9A 3R84B 3GMIA 1WLXA 4J2CA 4MBQA 4MLKA 4PJNA 4ZI2C 5A7WA 2NOXA 2D5UA 2JMHA 1D0YA 5TAOA 4QHOA 5JREA 3KV9A 5L3GB 3VKGA 2G0UA 5LWBA 3BQLA 5F5CA 1HCIA 3B13A 2E9XB 3N9QA 2LSKA 3Q5WA 3LBXA 2KXPB 5FY8A 2MYSA 2V26A 5LGNB 3LJCA 4WNKA 3UYJA 5L2LA 2E9XD 5FZFA 3QUJA 5L3CB 1D1BA 5L3DB 3AAEB 4EOZB 1BR1A 3LG7A 5HXRA 5L3EB 2BVMA 4KMCA 2LEHA 3R6NA 5JH7E 4TZ4C 3ZC0A 4ZOLE 2WMOA 3OYXA 2UXXB 3I1AA 2DLRA 4XDPA 4PW8A 1UCUA 3F57A 5FZ0A 4YJ2E 4O4JE 4UV8B 2NW8A 4BXFA 1HX8A 4UXNB 1AJ3A 2UXNB 5CEHA 2NTXA 2MTQA 5IWFA 1D0ZA 5FZ6A 5FZHA 5JDGA 2Q9QC 4O2BE 3C4XA 3LBXB 2XXZA 4MHCA 5F2SA 4P09A 5FZ8A 5JRCB 1FMVA 2X51A 3ZYMA 3PUQA 5FY9A 2X0LB 5LHIB 5FP4A 4HFVA 2MOZA 4IE6A 4ZI2D 2X68A 2ZM8A 2D0TA 3FXEB 5BMVE 2YPDA 2NW9A 4LXLA 4AKLA 2PG8A 3PURA 5A7WB 5JDQA 3CWZB 3KV4A 3AA0B 3H37A 5HYAA 3FXDB 3NZPA 1U4QA 2HH7A 3K3OA 1S35A 4XZCA 4DO0A 2BZBA 2N2NA 5FP7A 2PBIA 2ZLYA 3KBUA 2GK9A 4IE0A 2XHEB 5FPAA 3FB2A 2L3LA 5J2TE 3O1HA 4CUGA 3O9XA 4UIGA 3RKOA 3FBZA 2CLYC 3KDSE 3Q5XA 3LD8A 2C5JA 4I43B 3EVYA 3HKCE 4X1YE 5FZBA 2YU2A 2ZM2A 3N2GE 5F3JA 5HXHA 2CMRA 3PUSA 2XAJB 2Q9QB 2YBPA 3DTOA 4HN9A 1YW0A 4C91A 1MMAA 4JEHB 2OS2A 2EHOA 3AAIA 2VWAA 2IC6A 5ETWA 2VASA 4FI5A 4BJMA 4EZHA 2DWGA 4JUYA 2Q9QD 2VKOA 4P0AA 4IGOA 3RX6A 3BQKA 1IAPA 2KWIB 3RYIE 3KV6A 2LE8A 1IJ6A 4PJLA 4YFSA 4GOUA 5FYMA 4TX5A 5M4YA 5FPUA 1HG5A 5FZEA 4TV9E 5KR7A 4TN7A 5LYJE 4HKAA 5A7PA 4IHJE 5JDFA 4IGUA 4G63A 1EZ3A 4YLHA 4IE4A 5FZ9A 3C4WA 5FY4A 1LRZA 3N9OA 5CB4E 3RYCE 4O4LE 3AA7B 5LOVE 3OBVE 5FP9A 3ZCJA 3K8PC 1OWAA 2JRKA 2PFVA 4P0BA 4I50E 3I0OA 1SHZC 1OXZA 4QX8B 4ERRA 4V2WA 2EHOB 2DWKA 4Z8XA 5JQGE 3ZN1B 1HG2A 2E9XC 2XUEA 2VL8A 5IVYA 4UELA 2XAFB 3JC6D 4EYUA 5FZGA 1BR4A 5H6QB 4MALA 5LW9A 3N2OA 2Y48B 4G2AA 4DNDA 1NWMX 3UTKA 5A3PA 1ZKEA 4FJOA 2XAGB 1KK7A 2A3DA 2DHRA 2CWOA 5KMGP 4AKIA 4TN7B 2W62A 2YK0A 3O4XE 5FXWA 4H9PC 2V7JA 3ZEFB 5FWJA 4AI6A 5A3TA 3KV5A 3DXTA 1WRDA 2CXLA 2XTLA 2ACXA 4DMWA 5F3IA 4B6XA 5FUPA 5FYVA 4UVCB 4UV9B 2A2FX 5EK2A 2DCFA 2J1DG 2V7MA 4O2AE 3CMLA 1ZHCA 1FMWA 4URAA 4I4TE 5LJNA 3RVHA 2KINB 1MNEA 5FZAA 2KNDA 3KBTA 2H7OA 3NRYA 3HKBE 2X9XA 4H9NC 4BU2A 4ILUA 2P5BA 4NUVA 2KMFA 3MKDA 3V5UA 4E7SA 2OA5A 3J9X1 5IHYA 5LHGB 3NJYA 2C5KT 4IE5A 5LJMA 5FYTA 3RPUA 5FZOB 4UF0B 2LOPA 1B7TA 2X9WA 3RC8A 2A72A 2DNXA 3ESLA 2ODUA 2JJ9A 3ZMTB 1IZNB 3CQGB 4WW0A 2OQ6A 2N9DA