2CXDA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
b'MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein, TTHA0068
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxdA00
2CXDA 2CWYA
chains in the Genus database with same CATH superfamily
3LJCA 3VKHA 4HFBA 2HPJA 4LF7T 1X9BA 5J2UE 5DJQC 2AXDS 3I0OA 5JDLA 2ACZA 3ESLA 3P4PA 5ETWA 4JEHB 1ZKEA 3ZYKA 5M4YA 5JTGA 2UUAT 4EV6A 2X9XA 4EEDA 3C4ZA 1MMAA 2V6YB 5A1LA 2LJLA 2LRKA 1HG2A 5LP6E 4YTNA 1H7CA 2LSIA 4CN1A 3HA4A 5JRCB 4DMVA 3RF1A 4ZEYA 2LSYA 1YD8G 2YN6A 3O1HA 1NENA 2NP9A 5L3FB 2WY2A 4B3ST 4HWCA 5JR9A 2DLRA 4JYAT 3OKQA 4IL9A 3GN5B 4NUUA 2NTYA 3PDYA 2HN1A 4JI5T 4L5GA 5FNVE 3WI3A 1KF6A 3AAIA 3RKGA 4TWHA 2W4XA 3H3AA 4EZ4A 3AXJA 2Q9QD 4IGUA 4COFA 5AQPB 3SS1A 3AA0B 4KP3C 3DP7A 4GKKT 5BR8T 2VVNA 5HXRA 2IHR1 3HKEE 4IREA 4PJNA 3VU7H 3JAFA 4LMJA 1V9DA 3C51A 4X64T 3HKCE 4TZ4C 3RX6A 4X1IE 4H9SE 4JLEA 3FXDB 4U7IA 2KMFA 5LBQB 4P0AA 3HL6A 3AA7B 5LA6E 5AQQB 3J7Yq 5AQUB 2Y8DA 3QUJA 3EHZA 5LG3A 4B6XA 3D0TA 2F4VT 3QB5K 4UV8B 4ILCA 3P7IA 4L9IA 4ILBA 2K3WA 1IBLT 3UFGA 5FXVA 2K24A 4HTEA 2XASB 3NBXX 3AAAB 2I0MA 2LSGA 1HG5A 5AQTB 4X65T 4LFCT 3UU6A 1ZOYA 2WM9A 4ADZA 3FZLB 3ZJ2A 3P50A 1M62A 2MOZA 4TV9E 2BG9A 4HFHA 5AQSB 5IYZE 4YLHA 1SHZC 5LOVE 4I55E 1U4QA 2V5CA 4PFOA 2DWKA 3LFMA 2X0LB 1KNZA 4O2AE 2FJAA 2D2SA 5J1GA 2C0SA 5KX5E 2HN2A 2X9WA 4ILUA 1YQ4A 5FKYA 2I6HA 3VRBA 4LF6T 3AEAA 1FJGT 4AKLA 2LM9A 3AE6A 3PU3A 5DABA 3PTRB 5FXWA 4OYKA 3ANWB 3E0ZA 4JI7T 4PK5A 1LVFA 4IIJE 3FBLA 3BQKA 4DV2T 2L8KA 4QH5A 3LG7A 4KUMB 4LF9T 5AQFB 2UXBT 2VASA 2K9AA 4X62T 2IW5B 5FL0A 5JDGA 4HFEA 2VKOA 3FZMB 5HAXA 4NIQA 2ZM6T 1Y64B 2A72A 1ZV4X 3OVUA 2XJ7A 2LHNA 4U3CA 4K0UA 3ONXA 1EZ3A 3O4XE 2K48A 4A56A 1UX4A 1OEDB 2P9BA 4GK5E 3RPUA 4Z91A 2CE7A 3T1HT 4EZHA 4PFPA 2IAKA 4LFBT 3OBVE 2MAWA 3HKBE 2VVSA 3JCFA 3QC9A 2ES0A 3N2GE 5C3JA 1UX5A 2WMOA 2UUCT 2C5IT 1HTJF 2CLYC 3JADA 1VOMA 2W67A 4LMKA 2BDEA 2A3DA 4YSYA 2X9HA 2XZEA 3LDQB 2PFVA 2XM2A 3VRAA 4U2YA 2V8SV 3CX6B 4CI2B 5JREA 3Q5DA 5CFBA 3ZYMA 2E9XC 4YSXA 1BR2A 5FY7A 2KINB 2R6GF 4Q25A 4C90A 3OYZA 5L3DB 3OJAA 3A5XA 3KDSE 4DR5T 3AVSA 3V5UA 5LMUT 4TN7B 4DR1T 5L3EB 4H63H 5FVKA 5AQJB 4DR2T 1D0XA 5FYMA 5EK4A 4ZHQE 4HWFA 1IBKT 3AE5A 5AQLB 4DVDA 2MTQA 2HHHT 3ZCJA 1UGOA 1KFYA 2BBJA 4XZCA 3KV6A 2V7LA 3LBXB 3FB2A 4N78D 1MMDA 3UUBA 3N9QA 2XHEB 2PJQA 1WCRA 1US7B 1XWMA 3NZQA 5LXTE 2UXDT 2NW7A 2WCAA 1AJ3A 2AE9A 2CBJA 4IDPA 2YOEA 3UQ4A 4ZI3C 1D0ZA 4HWHA 1QLBA 4DMWA 4C91A 2MYSA 5AFUL 1KNPA 5LNKA 4TV8E 3T1YT 4IT4A 3KFWX 3O1JA 1BR4A 3MA9A 5AQVB 4DUYT 5ABFB 4DR4T 2Y6XA 3ETUA 5AQNB 5J2TE 2XAGB 3ZT5A 2YDSA 2XAJB 3PUAA 3MXZA 2E9XB 1G73A 3CVRA 4MBQA 4UF0B 2XQ9A 2XQAA 5F5WA 2DHRA 3LK2B 3RYFE 1D1AA 4QXHB 2YEVC 2W63A 2OV9A 4DV5T 3KV4A 5CB4E 1JNRA 3ZMUB 1FEWA 4YJ3E 5ABHA 2KT9A 2C5KT 3CWZB 4CXWA 5JQGE 4UXNB 3WAJA 4HEAA 2H7VC 3NRXA 3KVAA 5JDFA 1Z0PA 2JMKA 1HNWT 3PUGA 4WW0A 4YHJA 3H3MA 3KVBA 3LK3B 3C4XA 2V7IA 4EEBA 5LJMA 1U5PA 1W9RA 4QX8B 4CN4A 4DR6T 2E9XD 2N9DA 5LB7B 2XM1A 4GYSA 3FZKB 5LHGB 4ZZBA 3NKZA 2CHOA 2NTXA 3N9OA 4DR3T 2W00A 4IE6A 2A2FX 1SUMB 4X1YE 2D0TA 3ZEFB 2WSSV 3RHWA 3L09A 2IC9A 1FMVA 2YKSA 3Q2MA 3M65A 4ZOLE 3MKDA 4YFSA 4AQFC 2CCQA 2XTLA 2LKHA 2L9QA 2VURA 4WZXA 5L2LA 3QB5A 5CA0E 5JR9B 5LJNA 1GQEA 3FBZA 3N9MA 1IJ5A 3IF8B 2VB6A 3RC3A 1FIOA 2IIUA 1MIVA 2BS2A 2RA1A 4ZI3D 2WDQA 3RYCE 2Q9QA 2HPLA 3VR9A 1VCSA 4YJ2E 4OX9T 2JQQA 2C5JA 1MMGA 5FY1A 5JDMA 3AXJB 2V6YA 3N2KE 3RGLA 1FMWA 3O1IA 3ZSSA 2RP4A 4M1PA 3NZPA 1N34T 3TLSA 4QXCB 4EYUA 4YY3T 5JRCA 3PURA 4HFIA 4DV7T 3UU3A 3PUZF 4I0UA 4ISSA 2EHOC 3GN5A 3ZPOA 2XAQB 3R6NA 2PG8A 5HEUA 4PJMA 2CMRA 2DWGA 2UU9T 2XUEA 1WLXA 3TLWA 4YSZA 4IDZA 3RIUC 2BG9E 4H63V 4IHJE 2V1DB 2X67A 1J5ET 3EUHA 4G2AA 4JI8T 4GK0E 3K8PC 3P8CD 4LFAT 1E2AA 1HS7A 3SFDA 3A7MA 1YKHB 2LT3A 2ZLYA 3UFEA 1R8IA 3F57A 5EK3A 2VK9A 3MK7C 2ZM2A 2IC6A 4NXNT 1IJ6A 2V7KA 4BA9A 4LMLA 4NXMT 2X0YA 1W09A 3CX8B 3NVOA 4HKAA 1OEDC 1MMNA 5HXEA 4ZZCA 2WWVA 2A9UA 3TKLB 4AQFA 2J62A 5ABGA 3BQIA 2XY8B 3WAKA 3ZT6A 3EDUA 5F3JA 4O4HE 3LK42 3CIRA 2L3LA 1I6ZA 2X51A 2LSKA 3NRYA 3W15B 2WMNA 4EGWA 4WBNE 1UCUA 1W0AA 3AEEA 4DBQA 3SWHA 1HR0T 1BR0A 2EHOB 3PUXF 3AE9A 5JDHA 1XDPA 2XSAA 5KDMC 3AE2A 3HKDE 3JC6C 3SFEA 3CPZA 2VL8A 3TLVA 3U3IA 4JI1T 3SOLA 3RYIE 4AISA 2W0GA 2FJBA 4LF8T 5L3CB 1N36T 3RYHE 4MALA 4HFDA 5JDNA 4X66T 3RRCA 4AQYT 5FY0A 3FHNA 1J1JA 4KMCA 5L47A 3KBTA 2JJ9A 3V5SA 4OK0A 1HX1B 4FJOA 2BVMA 4EIWA 5HYAA 2LE8A 3ANWA 4E7SA 4DV4T 4OYJA 2EHOD 3N2OA 2CPTA 4EAHA 2IDOB 3TLTA 4TUYE 4AQGA 2D5UA 4DO0A 2WU5A 3KV5A 4MHCA 3UUMA 4U2ZA 5LCYA 4H9QC 4QWNB 2QVAA 3VKGA 4NPPA 2WQYA 4IE0A 1N33T 4CN6A 2H7OA 5GONE 1W0BA 2QA7A 2YDQA 2Y48B 2E8IA 3PJAJ 2WB5A 3RH3A 4I50E 4A5XA 3RI5A 4PK6A 2VKDA 3JAEA 3UQ7A 4P0BA 1MIWA 1HF8A 2W61A 2XQ5A 5DQVA 4XBFB 4ANJA 4GOUA 2NOXA 3C4WA 2JIWA 4LF5T 1G8XA 1UUSA 4UELA 2JRKA 2X68A 2YU2A 3BQLA 2B76A 4OHFA 3QNUA 2BBHA 4EOZB 1NAFA 5KMGP 3CQCB 3UUXB 2V5DA 5FP3A 2KNDA 2QYWA 3UT5E 5TAOA 2VQET 1X79A 1XNQT 1T8BA 4QH1A 4GYRA 5AQGB 5HWXA 3JC6D 3TLUA 2N2NA 2WU2A 1MIYA 3I0QA 5IUXA 3EI0A 4UV9B 4QXBB 4IE7A 5IWAT 1XMQT 3HR0A 2YU1A 4KI0F 3AVRA 3VHLA 1YQ3A 4UR9A 2M67A 3LBXA 4KHZF 3ZMVB 4IE4A 3ZN1B 1XDOA 3P4SA 3AE7A 4EXTA 1M7KA 2LKGA 1IAPA 2OLTA 5LGUB 4KBMB 1YW0A 1E7PA 2XQ7A 2JPFA 2MBGA 3E22E 2W62A 4EYYR 4IL4A 3UU4A 2WS3A 4ZI7E 5LGTB 2FBWA 2NWBA 5E0OA 2XAHB 3ZC0A 4IDQA 1YKEB 4DBRA 5JR9C 3PUQA 4L0RA 3PUSA 5CGMA 3K1SA 3K3NA 3AAEB 5ABFA 5HEJA 4YTPA 3AEGA 1HCIA 4G63A 2LLYA 4JI3T 2YDRA 3EABA 5HEHA 2DCFA 3U78A 4CXYA 3ONLC 2E9XA 3IEEA 3RLFF 3RQUA 4O4IE 5L4HA 5HCJA 3AEBA 2XQ3A 5HXHA 4P09A 2XPKA 3GA8A 2WBLA 1CUNA 3IBPA 2UXCT 2VQFT 1WYCA 2OA5A 2LRLA 3GMIA 2BKPA 2XQ8A 2LOPA 3M3ZB 3QK6A 2KLQA 1DU2A 4TX5A 2KWHA 4MLKA 4ERRA 5L4EA 4DNDA 3O9XA 1Y01A 4U33A 3KV9A 3DTOA 1QSDA 4I43B 1IBMT 1UURA 2JQ9A 2XSBA 2J47A 4PJLA 3Q5WA 5HEGA 4QX7B 1D0YA 4O2BE 5CJ5A 4NUVA 5KXJA 2I59A 2BKOA 4IDOA 1T72A 4HWDA 4UIGA 1JNZA 3AA1B 1N32T 3UUNA 1BR1A 4PK4A 5FMNA 4B3RT 2KWIB 4AKRB 3RC8A 3MACA 4Z90A 2Q9QB 3C50A 1KK7A 2UXXB 3FZHB 3R84B 3ZSTA 3FXEB 5HWYA 2BS3A 1LVKA 5H6QB 2ODUA 3VR8A 4CQIA 4PW8A 2BG9C 2WAUA 3EAMA 5HXSA 2QRXA 4U74A 5LMNT 4LF4T 5AQHB 2SPCA 1XZYA 2KZ7B 2M6IA 1ZP0A 2WZHA 3A8YC 4H9PC 2E2AA 4B3MT 4U72A 4UVBB 1E1HB 3AEDA 5LYJE 3ZMTB 2N1GA 3C98B 4X5TA 4DV3T 4IE5A 3AA6B 2E5VA 5ADXL 4PJJA 4H9RC 4OFZA 5C2TA 3F31A 2XQ4A 2ODVA 1D1CA 2J4GA 2V7JA 2YINA 3C64A 2LM2A 1HX8A 3UU8A 3RRWA 2D0UA 1KEYA 2W2UA 2UUBT 2CBIA 4ZXLA 3ZMZB 2KSRA 4HWIB 2BKNA 4EB6E 4YXDA 5LBMA 4HFCA 2BS4A 3CQGB 4Z8XA 5C8YE 3N9LA 4KX6A 1XNRT 3AE3A 3B5MA 3EVYA 2M6BA 4BJMA 2CHNA 2X0HA 4JI4T 2VL0A 2WDVA 3OPCA 3PV0F 4CZZB 4O4JE 2CRBA 4BAYB 3PUWF 3UTKA 4F6RC 3AB3B 2JQKA 1L0VA 3OYXA 2BG9B 3EDVA 5EZYE 5FVLA 2DI4A 5HEOA 3AEFA 3J9X1 3PJAA 3KINB 5AQMB 4PNIA 4HN9A 4DR7T 3ZN0B 2X66A 4ISTA 3PUYF 4AXPA 4V1Av 2G0UA 4QH4A 3UU5A 5HCMA 5IHYA 5AQKB 2CXLA 1J5WA 1OWAA 4ASKA 3ZKRA 3I9YA 4H9NC 5H6RB 3ZC1A 4YHHT 2Z6EA 3FZFB 3PE0A 4F8HA 4JEUB 5LG4A 5AQOB 1SA0E 2H88A 1S94A 2H89A 4TNVA 1CHUA 3OTOT 3ONJA 1I94T 3QOFA 4ZS3A 3H37A 4YT0A 1HFAA 4WNKA 1WR0A 3KBUA 2XQ6A 3PUVF 1O3XA 4GKJT 2EHOA 4CI3B 1ZEEA 3I1AA 2WP9A 3P4WA 3ETVA 3DJBA 1OEDE 3RIUA 4ZI2C 2CXDA 2VKHA 3ZMSB 2DNXA 4J2CA 4A98A 2X9YA 3K3QC 3CQXC 4AKHA 4CI1B 4B3TT 2PTFA 4TNWA 4U7YA 3CX7B 5L3BB 3ZYLA 4ZS2A 2IUBA 3X1DA 3N9PA 3MZKB 2NR4A 3IA3A 3T8OA 2H3RA 4JI2T 1LKXA 4DV6T 3GWHA 4JV5T 5AQRB 5AQIB 4TWDA 2BVLA 3K3OA 1B7TA 3B13A 2K5BB 1XMOT 2ACXA 2DL1A 1IZNB 3UULA 1OEDA 3RIFA 3AE8A 1T98A 2IMLA 2ZM0A 2MPKA 3BK9A 3MJXA 2LOSA 3CKDA 2W66A 4UVCB 3B57A 2D9DA 2CA5A 2YK0A 2HH7A 3E08A 3RQWA 4ILAA 4CXXA 1NWMX 1NEKA 4X1KE 2LSJA 2ZM8A 3CMLA 2E5LT 4JI6T 5JH7E 3ZCIA 2JMHA 2JQHA 2BZBA 5FXXA 4AKIA 4O4LE 4DUZT 4AIUA 2V6XA 3I9WA 1YXRA 2V26A 1HNXT 2CWOA 1WRDA 3HI2A 4QHOA 4JBWF 2VWAA 1VCTA 2RPAA 4BJNA 2FUPA 3ZT7A 3L39A 2UXNB 1Z8UA 1HNZT 4GIWA 1KNRA 4K0KT 3AECA 3ABVA 4JUYA 5L3GB 4JI0T 4U31A 3LSVA 1QUUA 3N5LA 4X20E 5ABEA 2XAFB 4MFRA 4YTMA 4FI5A 4TWFA 2J1DG 4XAXB 5FL1A 4O8SA 2KXPB 5LHHB 4P1NA 2CM0A 4HGAA 5BMVE 4HE8A 4A97A 3G06A 5FXZA 1SE7A 4ZI2D 4IDNA 3ZJ1A 3NWIA 3Q5XA 5LHIB 5JVDE 2LHRA 4UEMA 4E7ZA 5CA1E 2CLYB 1MNEA 3P4QA 4WYVA 1LRZA 2B1EA 3Q5EA 5EK2A 1OXZA 3IHRA 4DIDB 2XQYA 2VKJA 2Q9QC 3L3PA 3RIAA 4PAGA 1MNDA 4UVAB 5F8PA 3RKOA 3N9NA 1WYBA 2CEAA 2WWUA 3AE1A 3F2EA 2FJEA 2V7MA 4UF0A 4WBOA 3P4RA 4AI6A 2FJDA 3Q9DA 4AKGA 2NW9A 1VRBA 4H9OC 2LEHA 1T7SA 1S35A 1D1BA 5HXCA 2PBIA 5DQWA 1WFDA 3AE4A 3SRZA 4KHPT 3CK6A 3ZLIA 5J0ZA 2WZIA 3S4UA 4I4TE 2ZMAA 3L8RA 2NW8A 4HFVA 1UK5A 3PU8A 1WR6A 2WDRA 5LGNB 4DV0T 4QKNA 2QGSA 2CWYA 2CXFA 1ZHCA 4DV1T 5JDQA 2GK9A
chains in the Genus database with same CATH topology
1US7B 3NZQA 4CZZB 4O4JE 5LXTE 2NW7A 3LJCA 4OYJA 2EHOD 4BAYB 3VKHA 3UTKA 3N2OA 1AJ3A 4F6RC 2HPJA 3AB3B 4EAHA 4ZI3C 1D0ZA 3OYXA 5J2UE 5DJQC 4DMWA 4C91A 3I0OA 2MYSA 5JDLA 3EDVA 4TUYE 5EZYE 5AFUL 4AQGA 3ESLA 2D5UA 2DI4A 5LNKA 4TV8E 5ETWA 4JEHB 1ZKEA 3ZYKA 5M4YA 4DO0A 3KV5A 4MHCA 3KFWX 3O1JA 3J9X1 1BR4A 2X9XA 3UUMA 3KINB 3MA9A 4PNIA 3C4ZA 1MMAA 5LCYA 4HN9A 4H9QC 2Y6XA 5A1LA 4QWNB 3ZN0B 2LJLA 3ETUA 3VKGA 2X66A 1HG2A 4ISTA 5LP6E 5J2TE 1H7CA 2XAGB 2LSIA 4IE0A 2XAJB 3PUAA 3HA4A 5JRCB 4AXPA 4V1Av 2G0UA 3MXZA 4DMVA 2E9XB 1G73A 2H7OA 3CVRA 4MBQA 5GONE 4UF0B 2LSYA 1YD8G 3O1HA 2QA7A 5IHYA 2DHRA 2Y48B 2NP9A 3LK2B 2CXLA 3RYFE 2E8IA 5L3FB 1D1AA 4QXHB 1OWAA 2YEVC 3RH3A 4ASKA 4I50E 2W63A 5JR9A 2DLRA 3I9YA 4H9NC 3OKQA 5H6RB 3KV4A 3ZC1A 5CB4E 2Z6EA 3GN5B 3PE0A 4NUUA 2NTYA 4PK6A 2VKDA 3PDYA 3ZMUB 1FEWA 4JEUB 5LG4A 4YJ3E 2KT9A 2C5KT 4L5GA 3CWZB 1SA0E 4P0BA 1MIWA 5FNVE 3WI3A 4CXWA 1HF8A 1S94A 5JQGE 2W61A 4UXNB 3WAJA 3AAIA 5DQVA 4HEAA 4XBFB 2H7VC 4ZS3A 3NRXA 4GOUA 2NOXA 3KVAA 3H3AA 3C4WA 4ANJA 4EZ4A 2Q9QD 3H37A 4IGUA 5JDFA 1G8XA 1Z0PA 3SS1A 1HFAA 3AA0B 2JMKA 4KP3C 4UELA 3BQLA 2JRKA 2X68A 2YU2A 3DP7A 4OHFA 3PUGA 4WW0A 4YHJA 4WNKA 5HXRA 4EOZB 3KVBA 3LK3B 1NAFA 3KBUA 3C4XA 5KMGP 2V7IA 3HKEE 1O3XA 3CQCB 3UUXB 5LJMA 2EHOA 4CI3B 4PJNA 1U5PA 3VU7H 5FP3A 1ZEEA 2KNDA 1V9DA 4QX8B 3C51A 3I1AA 3UT5E 3HKCE 5TAOA 4TZ4C 3RX6A 3ETVA 4X1IE 2E9XD 3DJBA 2N9DA 4H9SE 1X79A 4GYSA 4JLEA 3FXDB 2KMFA 4GYRA 5LHGB 5HWXA 4ZI2C 2CXDA 2VKHA 3JC6D 5LBQB 3ZMSB 2DNXA 4J2CA 2N2NA 4P0AA 2X9YA 2NTXA 3K3QC 3CQXC 4AKHA 1MIYA 3N9OA 3I0QA 4CI1B 3HL6A 3AA7B 5LA6E 3J7Yq 4UV9B 2W00A 4IE6A 2Y8DA 2A2FX 3QUJA 4QXBB 4X1YE 4B6XA 3D0TA 4IE7A 2D0TA 3HR0A 2YU1A 3ZEFB 2WSSV 3CX7B 3L09A 2IC9A 3AVRA 3VHLA 1FMVA 5L3BB 3ZYLA 4UV8B 4ZS2A 3Q2MA 2M67A 3P7IA 4L9IA 3LBXA 3M65A 3ZMVB 4IE4A 3N9PA 5FXVA 2K24A 4HTEA 3MZKB 4ZOLE 3ZN1B 3T8OA 2XASB 3NBXX 2H3RA 3AAAB 3MKDA 4YFSA 2LSGA 4AQFC 2CCQA 1LKXA 4EXTA 1HG5A 2XTLA 3GWHA 1IAPA 2L9QA 2BVLA 3K3OA 1B7TA 3B13A 2K5BB 5LGUB 5L2LA 4KBMB 2ACXA 1YW0A 2WM9A 4ADZA 1IZNB 5CA0E 5JR9B 3UULA 3ZJ2A 5LJNA 1T98A 2JPFA 3FBZA 3N9MA 2MBGA 2MOZA 2ZM0A 4TV9E 3E22E 1IJ5A 2W62A 3BK9A 3IF8B 3MJXA 2LOSA 2VB6A 5IYZE 4EYYR 4YLHA 3RC3A 1FIOA 1SHZC 1MIVA 3CKDA 4ZI7E 5LGTB 2RA1A 4ZI3D 2NWBA 3RYCE 4UVCB 2XAHB 5E0OA 2Q9QA 2HPLA 3ZC0A 5LOVE 4YJ2E 4I55E 1U4QA 4PFOA 2DWKA 3B57A 2JQQA 3LFMA 2C5JA 1YKEB 2X0LB 4DBRA 2CA5A 5JR9C 3PUQA 1KNZA 2YK0A 4L0RA 4O2AE 2HH7A 1MMGA 3K3NA 3PUSA 5FY1A 5JDMA 3E08A 3AAEB 2D2SA 3N2KE 5J1GA 2C0SA 4CXXA 5KX5E 1NWMX 1FMWA 4X1KE 3O1IA 2RP4A 1HCIA 2X9WA 4M1PA 3NZPA 2LSJA 2ZM8A 4QXCB 4G63A 4ILUA 3CMLA 4EYUA 5JRCA 3U78A 2DCFA 4CXYA 2E9XA 3IEEA 3PURA 4O4IE 5JH7E 4AKLA 3ZCIA 5HXHA 2JMHA 4P09A 2BZBA 2LM9A 5FXXA 4AKIA 4ISSA 4O4LE 5DABA 3PU3A 3GA8A 2WBLA 1CUNA 3PTRB 3I9WA 5FXWA 3IBPA 4OYKA 3ANWB 3E0ZA 2EHOC 1WYCA 2OA5A 3GN5A 4PK5A 2V26A 3GMIA 3ZPOA 2CWOA 2XAQB 3R6NA 1LVFA 4IIJE 2LOPA 2PG8A 1WRDA 3FBLA 3HI2A 3BQKA 4PJMA 2CMRA 2L8KA 2DWGA 2KLQA 3QK6A 2XUEA 1WLXA 4QHOA 3LG7A 4TX5A 2KWHA 2VWAA 4MLKA 4IDZA 4ERRA 4DNDA 4KUMB 4BJNA 3O9XA 2VASA 4H63V 2K9AA 3KV9A 4IHJE 2IW5B 2UXNB 2V1DB 5JDGA 4GIWA 3DTOA 1QSDA 4I43B 2X67A 2VKOA 5HAXA 3EUHA 4JUYA 5L3GB 4G2AA 1Y64B 2A72A 1ZV4X 4PJLA 4GK0E 3K8PC 1QUUA 3N5LA 4X20E 2XAFB 3P8CD 3Q5WA 4MFRA 2LHNA 4FI5A 2J1DG 1HS7A 4QX7B 1D0YA 4O2BE 4XAXB 4K0UA 4NUVA 3ONXA 1EZ3A 2ZLYA 1YKHB 2I59A 2LT3A 3O4XE 4O8SA 2KXPB 2K48A 3UFEA 4A56A 5LHHB 1UX4A 3F57A 5EK3A 2CM0A 4HGAA 2VK9A 4UIGA 5BMVE 2P9BA 4GK5E 4HE8A 3AA1B 3MK7C 2ZM2A 5FXZA 3UUNA 1BR1A 2IC6A 4PK4A 5FMNA 2KWIB 3RPUA 1IJ6A 4AKRB 4ZI2D 2V7KA 3RC8A 2CE7A 3MACA 4BA9A 2Q9QB 4EZHA 3C50A 1KK7A 3ZJ1A 4PFPA 2UXXB 3Q5XA 2IAKA 3R84B 5LHIB 3FXEB 3CX8B 5HWYA 5JVDE 4HKAA 1MMNA 2LHRA 1LVKA 3OBVE 4UEMA 4E7ZA 5CA1E 5H6QB 5HXEA 2CLYB 1MNEA 2ODUA 3TKLB 4AQFA 1LRZA 3HKBE 4CQIA 4PW8A 2B1EA 2WAUA 3BQIA 3QC9A 5HXSA 5EK2A 1OXZA 4U74A 3IHRA 3WAKA 2ES0A 3N2GE 2XQYA 1UX5A 2WMOA 2VKJA 2Q9QC 3EDUA 5F3JA 3L3PA 2SPCA 4O4HE 2KZ7B 3LK42 2L3LA 4PAGA 2C5IT 1MNDA 2X51A 1HTJF 2LSKA 4H9PC 4UVAB 2CLYC 3NRYA 1VOMA 3W15B 2WMNA 4U72A 2BDEA 2A3DA 5F8PA 3RKOA 1UCUA 1E1HB 4UVBB 4WBNE 2X9HA 5LYJE 4DBQA 3N9NA 2PFVA 1WYBA 3ZMTB 2N1GA 3C98B 2CEAA 3SWHA 2WWUA 3CX6B 4IE5A 4CI2B 5JREA 1BR0A 2EHOB 3AA6B 3F2EA 2V7MA 4UF0A 5ADXL 4PJJA 5JDHA 4H9RC 2E9XC 4OFZA 4WBOA 3ZYMA 1BR2A 5FY7A 2KINB 4AI6A 4C90A 5KDMC 3F31A 2ODVA 3OYZA 1D1CA 3Q9DA 2NW9A 5L3DB 4AKGA 3HKDE 1VRBA 3OJAA 3JC6C 2V7JA 2YINA 3A5XA 3CPZA 3KDSE 2VL8A 4H9OC 3AVSA 2LEHA 3C64A 3U3IA 3V5UA 1S35A 3SOLA 1HX8A 1D1BA 5HXCA 4TN7B 3RRWA 2D0UA 2PBIA 5DQWA 5L3EB 3RYIE 4H63H 3ZMZB 2W0GA 3SRZA 5L3CB 3RYHE 1D0XA 4MALA 5JDNA 3ZLIA 5FYMA 3RRCA 5EK4A 4ZHQE 4EB6E 5FY0A 3S4UA 4I4TE 3FHNA 4KMCA 2ZMAA 5LBMA 3CQGB 4DVDA 3KBTA 2MTQA 4Z8XA 2NW8A 4HFVA 2JJ9A 3PU8A 3ZCJA 1WR6A 3V5SA 5LGNB 5C8YE 3N9LA 4OK0A 4XZCA 3KV6A 2V7LA 4QKNA 3EVYA 3LBXB 2QGSA 3FB2A 4BJMA 4N78D 1MMDA 2CWYA 2CXFA 1ZHCA 4FJOA 2BVMA 3N9QA 2XHEB 5JDQA 4EIWA 5HYAA 2LE8A 2PJQA 3ANWA 2GK9A 4E7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXD A;  2CWY A; 
#chains in the Genus database with same CATH topology
 3LJC A;  3VKH A;  4HFB A;  2HPJ A;  4LF7 T;  1X9B A;  5J2U E;  5DJQ C;  2AXD S;  3I0O A;  5JDL A;  2ACZ A;  3ESL A;  3P4P A;  5ETW A;  4JEH B;  1ZKE A;  3ZYK A;  5M4Y A;  5JTG A;  2UUA T;  4EV6 A;  2X9X A;  4EED A;  3C4Z A;  1MMA A;  2V6Y B;  5A1L A;  2LJL A;  2LRK A;  1HG2 A;  5LP6 E;  4YTN A;  1H7C A;  2LSI A;  4CN1 A;  3HA4 A;  5JRC B;  4DMV A;  3RF1 A;  4ZEY A;  2LSY A;  1YD8 G;  2YN6 A;  3O1H A;  1NEN A;  2NP9 A;  5L3F B;  2WY2 A;  4B3S T;  4HWC A;  5JR9 A;  2DLR A;  4JYA T;  3OKQ A;  4IL9 A;  3GN5 B;  4NUU A;  2NTY A;  3PDY A;  2HN1 A;  4JI5 T;  4L5G A;  5FNV E;  3WI3 A;  1KF6 A;  3AAI A;  3RKG A;  4TWH A;  2W4X A;  3H3A A;  4EZ4 A;  3AXJ A;  2Q9Q D;  4IGU A;  4COF A;  5AQP B;  3SS1 A;  3AA0 B;  4KP3 C;  3DP7 A;  4GKK T;  5BR8 T;  2VVN A;  5HXR A;  2IHR 1;  3HKE E;  4IRE A;  4PJN A;  3VU7 H;  3JAF A;  4LMJ A;  1V9D A;  3C51 A;  4X64 T;  3HKC E;  4TZ4 C;  3RX6 A;  4X1I E;  4H9S E;  4JLE A;  3FXD B;  4U7I A;  2KMF A;  5LBQ B;  4P0A A;  3HL6 A;  3AA7 B;  5LA6 E;  5AQQ B;  3J7Y q;  5AQU B;  2Y8D A;  3QUJ A;  3EHZ A;  5LG3 A;  4B6X A;  3D0T A;  2F4V T;  3QB5 K;  4UV8 B;  4ILC A;  3P7I A;  4L9I A;  4ILB A;  2K3W A;  1IBL T;  3UFG A;  5FXV A;  2K24 A;  4HTE A;  2XAS B;  3NBX X;  3AAA B;  2I0M A;  2LSG A;  1HG5 A;  5AQT B;  4X65 T;  4LFC T;  3UU6 A;  1ZOY A;  2WM9 A;  4ADZ A;  3FZL B;  3ZJ2 A;  3P50 A;  1M62 A;  2MOZ A;  4TV9 E;  2BG9 A;  4HFH A;  5AQS B;  5IYZ E;  4YLH A;  1SHZ C;  5LOV E;  4I55 E;  1U4Q A;  2V5C A;  4PFO A;  2DWK A;  3LFM A;  2X0L B;  1KNZ A;  4O2A E;  2FJA A;  2D2S A;  5J1G A;  2C0S A;  5KX5 E;  2HN2 A;  2X9W A;  4ILU A;  1YQ4 A;  5FKY A;  2I6H A;  3VRB A;  4LF6 T;  3AEA A;  1FJG T;  4AKL A;  2LM9 A;  3AE6 A;  3PU3 A;  5DAB A;  3PTR B;  5FXW A;  4OYK A;  3ANW B;  3E0Z A;  4JI7 T;  4PK5 A;  1LVF A;  4IIJ E;  3FBL A;  3BQK A;  4DV2 T;  2L8K A;  4QH5 A;  3LG7 A;  4KUM B;  4LF9 T;  5AQF B;  2UXB T;  2VAS A;  2K9A A;  4X62 T;  2IW5 B;  5FL0 A;  5JDG A;  4HFE A;  2VKO A;  3FZM B;  5HAX A;  4NIQ A;  2ZM6 T;  1Y64 B;  2A72 A;  1ZV4 X;  3OVU A;  2XJ7 A;  2LHN A;  4U3C A;  4K0U A;  3ONX A;  1EZ3 A;  3O4X E;  2K48 A;  4A56 A;  1UX4 A;  1OED B;  2P9B A;  4GK5 E;  3RPU A;  4Z91 A;  2CE7 A;  3T1H T;  4EZH A;  4PFP A;  2IAK A;  4LFB T;  3OBV E;  2MAW A;  3HKB E;  2VVS A;  3JCF A;  3QC9 A;  2ES0 A;  3N2G E;  5C3J A;  1UX5 A;  2WMO A;  2UUC T;  2C5I T;  1HTJ F;  2CLY C;  3JAD A;  1VOM A;  2W67 A;  4LMK A;  2BDE A;  2A3D A;  4YSY A;  2X9H A;  2XZE A;  3LDQ B;  2PFV A;  2XM2 A;  3VRA A;  4U2Y A;  2V8S V;  3CX6 B;  4CI2 B;  5JRE A;  3Q5D A;  5CFB A;  3ZYM A;  2E9X C;  4YSX A;  1BR2 A;  5FY7 A;  2KIN B;  2R6G F;  4Q25 A;  4C90 A;  3OYZ A;  5L3D B;  3OJA A;  3A5X A;  3KDS E;  4DR5 T;  3AVS A;  3V5U A;  5LMU T;  4TN7 B;  4DR1 T;  5L3E B;  4H63 H;  5FVK A;  5AQJ B;  4DR2 T;  1D0X A;  5FYM A;  5EK4 A;  4ZHQ E;  4HWF A;  1IBK T;  3AE5 A;  5AQL B;  4DVD A;  2MTQ A;  2HHH T;  3ZCJ A;  1UGO A;  1KFY A;  2BBJ A;  4XZC A;  3KV6 A;  2V7L A;  3LBX B;  3FB2 A;  4N78 D;  1MMD A;  3UUB A;  3N9Q A;  2XHE B;  2PJQ A;  1WCR A;  1US7 B;  1XWM A;  3NZQ A;  5LXT E;  2UXD T;  2NW7 A;  2WCA A;  1AJ3 A;  2AE9 A;  2CBJ A;  4IDP A;  2YOE A;  3UQ4 A;  4ZI3 C;  1D0Z A;  4HWH A;  1QLB A;  4DMW A;  4C91 A;  2MYS A;  5AFU L;  1KNP A;  5LNK A;  4TV8 E;  3T1Y T;  4IT4 A;  3KFW X;  3O1J A;  1BR4 A;  3MA9 A;  5AQV B;  4DUY T;  5ABF B;  4DR4 T;  2Y6X A;  3ETU A;  5AQN B;  5J2T E;  2XAG B;  3ZT5 A;  2YDS A;  2XAJ B;  3PUA A;  3MXZ A;  2E9X B;  1G73 A;  3CVR A;  4MBQ A;  4UF0 B;  2XQ9 A;  2XQA A;  5F5W A;  2DHR A;  3LK2 B;  3RYF E;  1D1A A;  4QXH B;  2YEV C;  2W63 A;  2OV9 A;  4DV5 T;  3KV4 A;  5CB4 E;  1JNR A;  3ZMU B;  1FEW A;  4YJ3 E;  5ABH A;  2KT9 A;  2C5K T;  3CWZ B;  4CXW A;  5JQG E;  4UXN B;  3WAJ A;  4HEA A;  2H7V C;  3NRX A;  3KVA A;  5JDF A;  1Z0P A;  2JMK A;  1HNW T;  3PUG A;  4WW0 A;  4YHJ A;  3H3M A;  3KVB A;  3LK3 B;  3C4X A;  2V7I A;  4EEB A;  5LJM A;  1U5P A;  1W9R A;  4QX8 B;  4CN4 A;  4DR6 T;  2E9X D;  2N9D A;  5LB7 B;  2XM1 A;  4GYS A;  3FZK B;  5LHG B;  4ZZB A;  3NKZ A;  2CHO A;  2NTX A;  3N9O A;  4DR3 T;  2W00 A;  4IE6 A;  2A2F X;  1SUM B;  4X1Y E;  2D0T A;  3ZEF B;  2WSS V;  3RHW A;  3L09 A;  2IC9 A;  1FMV A;  2YKS A;  3Q2M A;  3M65 A;  4ZOL E;  3MKD A;  4YFS A;  4AQF C;  2CCQ A;  2XTL A;  2LKH A;  2L9Q A;  2VUR A;  4WZX A;  5L2L A;  3QB5 A;  5CA0 E;  5JR9 B;  5LJN A;  1GQE A;  3FBZ A;  3N9M A;  1IJ5 A;  3IF8 B;  2VB6 A;  3RC3 A;  1FIO A;  2IIU A;  1MIV A;  2BS2 A;  2RA1 A;  4ZI3 D;  2WDQ A;  3RYC E;  2Q9Q A;  2HPL A;  3VR9 A;  1VCS A;  4YJ2 E;  4OX9 T;  2JQQ A;  2C5J A;  1MMG A;  5FY1 A;  5JDM A;  3AXJ B;  2V6Y A;  3N2K E;  3RGL A;  1FMW A;  3O1I A;  3ZSS A;  2RP4 A;  4M1P A;  3NZP A;  1N34 T;  3TLS A;  4QXC B;  4EYU A;  4YY3 T;  5JRC A;  3PUR A;  4HFI A;  4DV7 T;  3UU3 A;  3PUZ F;  4I0U A;  4ISS A;  2EHO C;  3GN5 A;  3ZPO A;  2XAQ B;  3R6N A;  2PG8 A;  5HEU A;  4PJM A;  2CMR A;  2DWG A;  2UU9 T;  2XUE A;  1WLX A;  3TLW A;  4YSZ A;  4IDZ A;  3RIU C;  2BG9 E;  4H63 V;  4IHJ E;  2V1D B;  2X67 A;  1J5E T;  3EUH A;  4G2A A;  4JI8 T;  4GK0 E;  3K8P C;  3P8C D;  4LFA T;  1E2A A;  1HS7 A;  3SFD A;  3A7M A;  1YKH B;  2LT3 A;  2ZLY A;  3UFE A;  1R8I A;  3F57 A;  5EK3 A;  2VK9 A;  3MK7 C;  2ZM2 A;  2IC6 A;  4NXN T;  1IJ6 A;  2V7K A;  4BA9 A;  4LML A;  4NXM T;  2X0Y A;  1W09 A;  3CX8 B;  3NVO A;  4HKA A;  1OED C;  1MMN A;  5HXE A;  4ZZC A;  2WWV A;  2A9U A;  3TKL B;  4AQF A;  2J62 A;  5ABG A;  3BQI A;  2XY8 B;  3WAK A;  3ZT6 A;  3EDU A;  5F3J A;  4O4H E;  3LK4 2;  3CIR A;  2L3L A;  1I6Z A;  2X51 A;  2LSK A;  3NRY A;  3W15 B;  2WMN A;  4EGW A;  4WBN E;  1UCU A;  1W0A A;  3AEE A;  4DBQ A;  3SWH A;  1HR0 T;  1BR0 A;  2EHO B;  3PUX F;  3AE9 A;  5JDH A;  1XDP A;  2XSA A;  5KDM C;  3AE2 A;  3HKD E;  3JC6 C;  3SFE A;  3CPZ A;  2VL8 A;  3TLV A;  3U3I A;  4JI1 T;  3SOL A;  3RYI E;  4AIS A;  2W0G A;  2FJB A;  4LF8 T;  5L3C B;  1N36 T;  3RYH E;  4MAL A;  4HFD A;  5JDN A;  4X66 T;  3RRC A;  4AQY T;  5FY0 A;  3FHN A;  1J1J A;  4KMC A;  5L47 A;  3KBT A;  2JJ9 A;  3V5S A;  4OK0 A;  1HX1 B;  4FJO A;  2BVM A;  4EIW A;  5HYA A;  2LE8 A;  3ANW A;  4E7S A;  4DV4 T;  4OYJ A;  2EHO D;  3N2O A;  2CPT A;  4EAH A;  2IDO B;  3TLT A;  4TUY E;  4AQG A;  2D5U A;  4DO0 A;  2WU5 A;  3KV5 A;  4MHC A;  3UUM A;  4U2Z A;  5LCY A;  4H9Q C;  4QWN B;  2QVA A;  3VKG A;  4NPP A;  2WQY A;  4IE0 A;  1N33 T;  4CN6 A;  2H7O A;  5GON E;  1W0B A;  2QA7 A;  2YDQ A;  2Y48 B;  2E8I A;  3PJA J;  2WB5 A;  3RH3 A;  4I50 E;  4A5X A;  3RI5 A;  4PK6 A;  2VKD A;  3JAE A;  3UQ7 A;  4P0B A;  1MIW A;  1HF8 A;  2W61 A;  2XQ5 A;  5DQV A;  4XBF B;  4ANJ A;  4GOU A;  2NOX A;  3C4W A;  2JIW A;  4LF5 T;  1G8X A;  1UUS A;  4UEL A;  2JRK A;  2X68 A;  2YU2 A;  3BQL A;  2B76 A;  4OHF A;  3QNU A;  2BBH A;  4EOZ B;  1NAF A;  5KMG P;  3CQC B;  3UUX B;  2V5D A;  5FP3 A;  2KND A;  2QYW A;  3UT5 E;  5TAO A;  2VQE T;  1X79 A;  1XNQ T;  1T8B A;  4QH1 A;  4GYR A;  5AQG B;  5HWX A;  3JC6 D;  3TLU A;  2N2N A;  2WU2 A;  1MIY A;  3I0Q A;  5IUX A;  3EI0 A;  4UV9 B;  4QXB B;  4IE7 A;  5IWA T;  1XMQ T;  3HR0 A;  2YU1 A;  4KI0 F;  3AVR A;  3VHL A;  1YQ3 A;  4UR9 A;  2M67 A;  3LBX A;  4KHZ F;  3ZMV B;  4IE4 A;  3ZN1 B;  1XDO A;  3P4S A;  3AE7 A;  4EXT A;  1M7K A;  2LKG A;  1IAP A;  2OLT A;  5LGU B;  4KBM B;  1YW0 A;  1E7P A;  2XQ7 A;  2JPF A;  2MBG A;  3E22 E;  2W62 A;  4EYY R;  4IL4 A;  3UU4 A;  2WS3 A;  4ZI7 E;  5LGT B;  2FBW A;  2NWB A;  5E0O A;  2XAH B;  3ZC0 A;  4IDQ A;  1YKE B;  4DBR A;  5JR9 C;  3PUQ A;  4L0R A;  3PUS A;  5CGM A;  3K1S A;  3K3N A;  3AAE B;  5ABF A;  5HEJ A;  4YTP A;  3AEG A;  1HCI A;  4G63 A;  2LLY A;  4JI3 T;  2YDR A;  3EAB A;  5HEH A;  2DCF A;  3U78 A;  4CXY A;  3ONL C;  2E9X A;  3IEE A;  3RLF F;  3RQU A;  4O4I E;  5L4H A;  5HCJ A;  3AEB A;  2XQ3 A;  5HXH A;  4P09 A;  2XPK A;  3GA8 A;  2WBL A;  1CUN A;  3IBP A;  2UXC T;  2VQF T;  1WYC A;  2OA5 A;  2LRL A;  3GMI A;  2BKP A;  2XQ8 A;  2LOP A;  3M3Z B;  3QK6 A;  2KLQ A;  1DU2 A;  4TX5 A;  2KWH A;  4MLK A;  4ERR A;  5L4E A;  4DND A;  3O9X A;  1Y01 A;  4U33 A;  3KV9 A;  3DTO A;  1QSD A;  4I43 B;  1IBM T;  1UUR A;  2JQ9 A;  2XSB A;  2J47 A;  4PJL A;  3Q5W A;  5HEG A;  4QX7 B;  1D0Y A;  4O2B E;  5CJ5 A;  4NUV A;  5KXJ A;  2I59 A;  2BKO A;  4IDO A;  1T72 A;  4HWD A;  4UIG A;  1JNZ A;  3AA1 B;  1N32 T;  3UUN A;  1BR1 A;  4PK4 A;  5FMN A;  4B3R T;  2KWI B;  4AKR B;  3RC8 A;  3MAC A;  4Z90 A;  2Q9Q B;  3C50 A;  1KK7 A;  2UXX B;  3FZH B;  3R84 B;  3ZST A;  3FXE B;  5HWY A;  2BS3 A;  1LVK A;  5H6Q B;  2ODU A;  3VR8 A;  4CQI A;  4PW8 A;  2BG9 C;  2WAU A;  3EAM A;  5HXS A;  2QRX A;  4U74 A;  5LMN T;  4LF4 T;  5AQH B;  2SPC A;  1XZY A;  2KZ7 B;  2M6I A;  1ZP0 A;  2WZH A;  3A8Y C;  4H9P C;  2E2A A;  4B3M T;  4U72 A;  4UVB B;  1E1H B;  3AED A;  5LYJ E;  3ZMT B;  2N1G A;  3C98 B;  4X5T A;  4DV3 T;  4IE5 A;  3AA6 B;  2E5V A;  5ADX L;  4PJJ A;  4H9R C;  4OFZ A;  5C2T A;  3F31 A;  2XQ4 A;  2ODV A;  1D1C A;  2J4G A;  2V7J A;  2YIN A;  3C64 A;  2LM2 A;  1HX8 A;  3UU8 A;  3RRW A;  2D0U A;  1KEY A;  2W2U A;  2UUB T;  2CBI A;  4ZXL A;  3ZMZ B;  2KSR A;  4HWI B;  2BKN A;  4EB6 E;  4YXD A;  5LBM A;  4HFC A;  2BS4 A;  3CQG B;  4Z8X A;  5C8Y E;  3N9L A;  4KX6 A;  1XNR T;  3AE3 A;  3B5M A;  3EVY A;  2M6B A;  4BJM A;  2CHN A;  2X0H A;  4JI4 T;  2VL0 A;  2WDV A;  3OPC A;  3PV0 F;  4CZZ B;  4O4J E;  2CRB A;  4BAY B;  3PUW F;  3UTK A;  4F6R C;  3AB3 B;  2JQK A;  1L0V A;  3OYX A;  2BG9 B;  3EDV A;  5EZY E;  5FVL A;  2DI4 A;  5HEO A;  3AEF A;  3J9X 1;  3PJA A;  3KIN B;  5AQM B;  4PNI A;  4HN9 A;  4DR7 T;  3ZN0 B;  2X66 A;  4IST A;  3PUY F;  4AXP A;  4V1A v;  2G0U A;  4QH4 A;  3UU5 A;  5HCM A;  5IHY A;  5AQK B;  2CXL A;  1J5W A;  1OWA A;  4ASK A;  3ZKR A;  3I9Y A;  4H9N C;  5H6R B;  3ZC1 A;  4YHH T;  2Z6E A;  3FZF B;  3PE0 A;  4F8H A;  4JEU B;  5LG4 A;  5AQO B;  1SA0 E;  2H88 A;  1S94 A;  2H89 A;  4TNV A;  1CHU A;  3OTO T;  3ONJ A;  1I94 T;  3QOF A;  4ZS3 A;  3H37 A;  4YT0 A;  1HFA A;  4WNK A;  1WR0 A;  3KBU A;  2XQ6 A;  3PUV F;  1O3X A;  4GKJ T;  2EHO A;  4CI3 B;  1ZEE A;  3I1A A;  2WP9 A;  3P4W A;  3ETV A;  3DJB A;  1OED E;  3RIU A;  4ZI2 C;  2CXD A;  2VKH A;  3ZMS B;  2DNX A;  4J2C A;  4A98 A;  2X9Y A;  3K3Q C;  3CQX C;  4AKH A;  4CI1 B;  4B3T T;  2PTF A;  4TNW A;  4U7Y A;  3CX7 B;  5L3B B;  3ZYL A;  4ZS2 A;  2IUB A;  3X1D A;  3N9P A;  3MZK B;  2NR4 A;  3IA3 A;  3T8O A;  2H3R A;  4JI2 T;  1LKX A;  4DV6 T;  3GWH A;  4JV5 T;  5AQR B;  5AQI B;  4TWD A;  2BVL A;  3K3O A;  1B7T A;  3B13 A;  2K5B B;  1XMO T;  2ACX A;  2DL1 A;  1IZN B;  3UUL A;  1OED A;  3RIF A;  3AE8 A;  1T98 A;  2IML A;  2ZM0 A;  2MPK A;  3BK9 A;  3MJX A;  2LOS A;  3CKD A;  2W66 A;  4UVC B;  3B57 A;  2D9D A;  2CA5 A;  2YK0 A;  2HH7 A;  3E08 A;  3RQW A;  4ILA A;  4CXX A;  1NWM X;  1NEK A;  4X1K E;  2LSJ A;  2ZM8 A;  3CML A;  2E5L T;  4JI6 T;  5JH7 E;  3ZCI A;  2JMH A;  2JQH A;  2BZB A;  5FXX A;  4AKI A;  4O4L E;  4DUZ T;  4AIU A;  2V6X A;  3I9W A;  1YXR A;  2V26 A;  1HNX T;  2CWO A;  1WRD A;  3HI2 A;  4QHO A;  4JBW F;  2VWA A;  1VCT A;  2RPA A;  4BJN A;  2FUP A;  3ZT7 A;  3L39 A;  2UXN B;  1Z8U A;  1HNZ T;  4GIW A;  1KNR A;  4K0K T;  3AEC A;  3ABV A;  4JUY A;  5L3G B;  4JI0 T;  4U31 A;  3LSV A;  1QUU A;  3N5L A;  4X20 E;  5ABE A;  2XAF B;  4MFR A;  4YTM A;  4FI5 A;  4TWF A;  2J1D G;  4XAX B;  5FL1 A;  4O8S A;  2KXP B;  5LHH B;  4P1N A;  2CM0 A;  4HGA A;  5BMV E;  4HE8 A;  4A97 A;  3G06 A;  5FXZ A;  1SE7 A;  4ZI2 D;  4IDN A;  3ZJ1 A;  3NWI A;  3Q5X A;  5LHI B;  5JVD E;  2LHR A;  4UEM A;  4E7Z A;  5CA1 E;  2CLY B;  1MNE A;  3P4Q A;  4WYV A;  1LRZ A;  2B1E A;  3Q5E A;  5EK2 A;  1OXZ A;  3IHR A;  4DID B;  2XQY A;  2VKJ A;  2Q9Q C;  3L3P A;  3RIA A;  4PAG A;  1MND A;  4UVA B;  5F8P A;  3RKO A;  3N9N A;  1WYB A;  2CEA A;  2WWU A;  3AE1 A;  3F2E A;  2FJE A;  2V7M A;  4UF0 A;  4WBO A;  3P4R A;  4AI6 A;  2FJD A;  3Q9D A;  4AKG A;  2NW9 A;  1VRB A;  4H9O C;  2LEH A;  1T7S A;  1S35 A;  1D1B A;  5HXC A;  2PBI A;  5DQW A;  1WFD A;  3AE4 A;  3SRZ A;  4KHP T;  3CK6 A;  3ZLI A;  5J0Z A;  2WZI A;  3S4U A;  4I4T E;  2ZMA A;  3L8R A;  2NW8 A;  4HFV A;  1UK5 A;  3PU8 A;  1WR6 A;  2WDR A;  5LGN B;  4DV0 T;  4QKN A;  2QGS A;  2CWY A;  2CXF A;  1ZHC A;  4DV1 T;  5JDQ A;  2GK9 A; 
#chains in the Genus database with same CATH homology
 1US7 B;  3NZQ A;  4CZZ B;  4O4J E;  5LXT E;  2NW7 A;  3LJC A;  4OYJ A;  2EHO D;  4BAY B;  3VKH A;  3UTK A;  3N2O A;  1AJ3 A;  4F6R C;  2HPJ A;  3AB3 B;  4EAH A;  4ZI3 C;  1D0Z A;  3OYX A;  5J2U E;  5DJQ C;  4DMW A;  4C91 A;  3I0O A;  2MYS A;  5JDL A;  3EDV A;  4TUY E;  5EZY E;  5AFU L;  4AQG A;  3ESL A;  2D5U A;  2DI4 A;  5LNK A;  4TV8 E;  5ETW A;  4JEH B;  1ZKE A;  3ZYK A;  5M4Y A;  4DO0 A;  3KV5 A;  4MHC A;  3KFW X;  3O1J A;  3J9X 1;  1BR4 A;  2X9X A;  3UUM A;  3KIN B;  3MA9 A;  4PNI A;  3C4Z A;  1MMA A;  5LCY A;  4HN9 A;  4H9Q C;  2Y6X A;  5A1L A;  4QWN B;  3ZN0 B;  2LJL A;  3ETU A;  3VKG A;  2X66 A;  1HG2 A;  4IST A;  5LP6 E;  5J2T E;  1H7C A;  2XAG B;  2LSI A;  4IE0 A;  2XAJ B;  3PUA A;  3HA4 A;  5JRC B;  4AXP A;  4V1A v;  2G0U A;  3MXZ A;  4DMV A;  2E9X B;  1G73 A;  2H7O A;  3CVR A;  4MBQ A;  5GON E;  4UF0 B;  2LSY A;  1YD8 G;  3O1H A;  2QA7 A;  5IHY A;  2DHR A;  2Y48 B;  2NP9 A;  3LK2 B;  2CXL A;  3RYF E;  2E8I A;  5L3F B;  1D1A A;  4QXH B;  1OWA A;  2YEV C;  3RH3 A;  4ASK A;  4I50 E;  2W63 A;  5JR9 A;  2DLR A;  3I9Y A;  4H9N C;  3OKQ A;  5H6R B;  3KV4 A;  3ZC1 A;  5CB4 E;  2Z6E A;  3GN5 B;  3PE0 A;  4NUU A;  2NTY A;  4PK6 A;  2VKD A;  3PDY A;  3ZMU B;  1FEW A;  4JEU B;  5LG4 A;  4YJ3 E;  2KT9 A;  2C5K T;  4L5G A;  3CWZ B;  1SA0 E;  4P0B A;  1MIW A;  5FNV E;  3WI3 A;  4CXW A;  1HF8 A;  1S94 A;  5JQG E;  2W61 A;  4UXN B;  3WAJ A;  3AAI A;  5DQV A;  4HEA A;  4XBF B;  2H7V C;  4ZS3 A;  3NRX A;  4GOU A;  2NOX A;  3KVA A;  3H3A A;  3C4W A;  4ANJ A;  4EZ4 A;  2Q9Q D;  3H37 A;  4IGU A;  5JDF A;  1G8X A;  1Z0P A;  3SS1 A;  1HFA A;  3AA0 B;  2JMK A;  4KP3 C;  4UEL A;  3BQL A;  2JRK A;  2X68 A;  2YU2 A;  3DP7 A;  4OHF A;  3PUG A;  4WW0 A;  4YHJ A;  4WNK A;  5HXR A;  4EOZ B;  3KVB A;  3LK3 B;  1NAF A;  3KBU A;  3C4X A;  5KMG P;  2V7I A;  3HKE E;  1O3X A;  3CQC B;  3UUX B;  5LJM A;  2EHO A;  4CI3 B;  4PJN A;  1U5P A;  3VU7 H;  5FP3 A;  1ZEE A;  2KND A;  1V9D A;  4QX8 B;  3C51 A;  3I1A A;  3UT5 E;  3HKC E;  5TAO A;  4TZ4 C;  3RX6 A;  3ETV A;  4X1I E;  2E9X D;  3DJB A;  2N9D A;  4H9S E;  1X79 A;  4GYS A;  4JLE A;  3FXD B;  2KMF A;  4GYR A;  5LHG B;  5HWX A;  4ZI2 C;  2CXD A;  2VKH A;  3JC6 D;  5LBQ B;  3ZMS B;  2DNX A;  4J2C A;  2N2N A;  4P0A A;  2X9Y A;  2NTX A;  3K3Q C;  3CQX C;  4AKH A;  1MIY A;  3N9O A;  3I0Q A;  4CI1 B;  3HL6 A;  3AA7 B;  5LA6 E;  3J7Y q;  4UV9 B;  2W00 A;  4IE6 A;  2Y8D A;  2A2F X;  3QUJ A;  4QXB B;  4X1Y E;  4B6X A;  3D0T A;  4IE7 A;  2D0T A;  3HR0 A;  2YU1 A;  3ZEF B;  2WSS V;  3CX7 B;  3L09 A;  2IC9 A;  3AVR A;  3VHL A;  1FMV A;  5L3B B;  3ZYL A;  4UV8 B;  4ZS2 A;  3Q2M A;  2M67 A;  3P7I A;  4L9I A;  3LBX A;  3M65 A;  3ZMV B;  4IE4 A;  3N9P A;  5FXV A;  2K24 A;  4HTE A;  3MZK B;  4ZOL E;  3ZN1 B;  3T8O A;  2XAS B;  3NBX X;  2H3R A;  3AAA B;  3MKD A;  4YFS A;  2LSG A;  4AQF C;  2CCQ A;  1LKX A;  4EXT A;  1HG5 A;  2XTL A;  3GWH A;  1IAP A;  2L9Q A;  2BVL A;  3K3O A;  1B7T A;  3B13 A;  2K5B B;  5LGU B;  5L2L A;  4KBM B;  2ACX A;  1YW0 A;  2WM9 A;  4ADZ A;  1IZN B;  5CA0 E;  5JR9 B;  3UUL A;  3ZJ2 A;  5LJN A;  1T98 A;  2JPF A;  3FBZ A;  3N9M A;  2MBG A;  2MOZ A;  2ZM0 A;  4TV9 E;  3E22 E;  1IJ5 A;  2W62 A;  3BK9 A;  3IF8 B;  3MJX A;  2LOS A;  2VB6 A;  5IYZ E;  4EYY R;  4YLH A;  3RC3 A;  1FIO A;  1SHZ C;  1MIV A;  3CKD A;  4ZI7 E;  5LGT B;  2RA1 A;  4ZI3 D;  2NWB A;  3RYC E;  4UVC B;  2XAH B;  5E0O A;  2Q9Q A;  2HPL A;  3ZC0 A;  5LOV E;  4YJ2 E;  4I55 E;  1U4Q A;  4PFO A;  2DWK A;  3B57 A;  2JQQ A;  3LFM A;  2C5J A;  1YKE B;  2X0L B;  4DBR A;  2CA5 A;  5JR9 C;  3PUQ A;  1KNZ A;  2YK0 A;  4L0R A;  4O2A E;  2HH7 A;  1MMG A;  3K3N A;  3PUS A;  5FY1 A;  5JDM A;  3E08 A;  3AAE B;  2D2S A;  3N2K E;  5J1G A;  2C0S A;  4CXX A;  5KX5 E;  1NWM X;  1FMW A;  4X1K E;  3O1I A;  2RP4 A;  1HCI A;  2X9W A;  4M1P A;  3NZP A;  2LSJ A;  2ZM8 A;  4QXC B;  4G63 A;  4ILU A;  3CML A;  4EYU A;  5JRC A;  3U78 A;  2DCF A;  4CXY A;  2E9X A;  3IEE A;  3PUR A;  4O4I E;  5JH7 E;  4AKL A;  3ZCI A;  5HXH A;  2JMH A;  4P09 A;  2BZB A;  2LM9 A;  5FXX A;  4AKI A;  4ISS A;  4O4L E;  5DAB A;  3PU3 A;  3GA8 A;  2WBL A;  1CUN A;  3PTR B;  3I9W A;  5FXW A;  3IBP A;  4OYK A;  3ANW B;  3E0Z A;  2EHO C;  1WYC A;  2OA5 A;  3GN5 A;  4PK5 A;  2V26 A;  3GMI A;  3ZPO A;  2CWO A;  2XAQ B;  3R6N A;  1LVF A;  4IIJ E;  2LOP A;  2PG8 A;  1WRD A;  3FBL A;  3HI2 A;  3BQK A;  4PJM A;  2CMR A;  2L8K A;  2DWG A;  2KLQ A;  3QK6 A;  2XUE A;  1WLX A;  4QHO A;  3LG7 A;  4TX5 A;  2KWH A;  2VWA A;  4MLK A;  4IDZ A;  4ERR A;  4DND A;  4KUM B;  4BJN A;  3O9X A;  2VAS A;  4H63 V;  2K9A A;  3KV9 A;  4IHJ E;  2IW5 B;  2UXN B;  2V1D B;  5JDG A;  4GIW A;  3DTO A;  1QSD A;  4I43 B;  2X67 A;  2VKO A;  5HAX A;  3EUH A;  4JUY A;  5L3G B;  4G2A A;  1Y64 B;  2A72 A;  1ZV4 X;  4PJL A;  4GK0 E;  3K8P C;  1QUU A;  3N5L A;  4X20 E;  2XAF B;  3P8C D;  3Q5W A;  4MFR A;  2LHN A;  4FI5 A;  2J1D G;  1HS7 A;  4QX7 B;  1D0Y A;  4O2B E;  4XAX B;  4K0U A;  4NUV A;  3ONX A;  1EZ3 A;  2ZLY A;  1YKH B;  2I59 A;  2LT3 A;  3O4X E;  4O8S A;  2KXP B;  2K48 A;  3UFE A;  4A56 A;  5LHH B;  1UX4 A;  3F57 A;  5EK3 A;  2CM0 A;  4HGA A;  2VK9 A;  4UIG A;  5BMV E;  2P9B A;  4GK5 E;  4HE8 A;  3AA1 B;  3MK7 C;  2ZM2 A;  5FXZ A;  3UUN A;  1BR1 A;  2IC6 A;  4PK4 A;  5FMN A;  2KWI B;  3RPU A;  1IJ6 A;  4AKR B;  4ZI2 D;  2V7K A;  3RC8 A;  2CE7 A;  3MAC A;  4BA9 A;  2Q9Q B;  4EZH A;  3C50 A;  1KK7 A;  3ZJ1 A;  4PFP A;  2UXX B;  3Q5X A;  2IAK A;  3R84 B;  5LHI B;  3FXE B;  3CX8 B;  5HWY A;  5JVD E;  4HKA A;  1MMN A;  2LHR A;  1LVK A;  3OBV E;  4UEM A;  4E7Z A;  5CA1 E;  5H6Q B;  5HXE A;  2CLY B;  1MNE A;  2ODU A;  3TKL B;  4AQF A;  1LRZ A;  3HKB E;  4CQI A;  4PW8 A;  2B1E A;  2WAU A;  3BQI A;  3QC9 A;  5HXS A;  5EK2 A;  1OXZ A;  4U74 A;  3IHR A;  3WAK A;  2ES0 A;  3N2G E;  2XQY A;  1UX5 A;  2WMO A;  2VKJ A;  2Q9Q C;  3EDU A;  5F3J A;  3L3P A;  2SPC A;  4O4H E;  2KZ7 B;  3LK4 2;  2L3L A;  4PAG A;  2C5I T;  1MND A;  2X51 A;  1HTJ F;  2LSK A;  4H9P C;  4UVA B;  2CLY C;  3NRY A;  1VOM A;  3W15 B;  2WMN A;  4U72 A;  2BDE A;  2A3D A;  5F8P A;  3RKO A;  1UCU A;  1E1H B;  4UVB B;  4WBN E;  2X9H A;  5LYJ E;  4DBQ A;  3N9N A;  2PFV A;  1WYB A;  3ZMT B;  2N1G A;  3C98 B;  2CEA A;  3SWH A;  2WWU A;  3CX6 B;  4IE5 A;  4CI2 B;  5JRE A;  1BR0 A;  2EHO B;  3AA6 B;  3F2E A;  2V7M A;  4UF0 A;  5ADX L;  4PJJ A;  5JDH A;  4H9R C;  2E9X C;  4OFZ A;  4WBO A;  3ZYM A;  1BR2 A;  5FY7 A;  2KIN B;  4AI6 A;  4C90 A;  5KDM C;  3F31 A;  2ODV A;  3OYZ A;  1D1C A;  3Q9D A;  2NW9 A;  5L3D B;  4AKG A;  3HKD E;  1VRB A;  3OJA A;  3JC6 C;  2V7J A;  2YIN A;  3A5X A;  3CPZ A;  3KDS E;  2VL8 A;  4H9O C;  3AVS A;  2LEH A;  3C64 A;  3U3I A;  3V5U A;  1S35 A;  3SOL A;  1HX8 A;  1D1B A;  5HXC A;  4TN7 B;  3RRW A;  2D0U A;  2PBI A;  5DQW A;  5L3E B;  3RYI E;  4H63 H;  3ZMZ B;  2W0G A;  3SRZ A;  5L3C B;  3RYH E;  1D0X A;  4MAL A;  5JDN A;  3ZLI A;  5FYM A;  3RRC A;  5EK4 A;  4ZHQ E;  4EB6 E;  5FY0 A;  3S4U A;  4I4T E;  3FHN A;  4KMC A;  2ZMA A;  5LBM A;  3CQG B;  4DVD A;  3KBT A;  2MTQ A;  4Z8X A;  2NW8 A;  4HFV A;  2JJ9 A;  3PU8 A;  3ZCJ A;  1WR6 A;  3V5S A;  5LGN B;  5C8Y E;  3N9L A;  4OK0 A;  4XZC A;  3KV6 A;  2V7L A;  4QKN A;  3EVY A;  3LBX B;  2QGS A;  3FB2 A;  4BJM A;  4N78 D;  1MMD A;  2CWY A;  2CXF A;  1ZHC A;  4FJO A;  2BVM A;  3N9Q A;  2XHE B;  5JDQ A;  4EIW A;  5HYA A;  2LE8 A;  2PJQ A;  3ANW A;  2GK9 A;  4E7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...