2CXDA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein, TTHA0068
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxdA00
2CWYA 2CXDA
chains in the Genus database with same CATH superfamily
2RP4A 1LRZA 2VL0A 1BR4A 3O1HA 3AE6A 1NWMX 4AXPA 2CA5A 1HG2A 2X9WA 4EGWA 1OEDB 1HF8A 4B3ST 1WYBA 2WBLA 2ZLYA 3P4RA 4M1PA 4Z8XA 5FY7A 3ETVA 2JQQA 5HCJA 2YDQA 5DQVA 4YXDA 4YJ3E 2Q9QA 3LDQB 4ZI3C 2CM0A 3C51A 3HKEE 2QYWA 4U7YA 4B3TT 5LCYA 3UT5E 2F4VT 3GN5A 2V6YA 1MIWA 4ILUA 2BKNA 1ZOYA 4L5GA 4PK5A 4EB6E 2L8KA 3ESLA 5ABFA 5LXTE 1QLBA 4IDQA 5LJMA 4QX8B 4HWCA 2IC6A 2M6BA 4OK0A 1V9DA 1VOMA 5ABFB 2VKJA 3AECA 2DCFA 5EK2A 3AXJA 2ZM2A 3ZPOA 4AKRB 5JDNA 1VCSA 4ZZCA 1MMGA 2CRBA 2HN1A 1N34T 3ZMZB 5AQPB 4ZXLA 3MXZA 3PUSA 4UF0B 2L3LA 2W2UA 2D2SA 4ZHQE 4TUYE 4CI1B 4IL4A 2XQ9A 2HN2A 4G2AA 5FXVA 2P9BA 3AVSA 3KV9A 1OEDA 2IIUA 3TLTA 2Q9QD 3VRBA 4ZEYA 2BG9E 2X51A 3LG7A 3TLUA 4DUZT 4XBFB 4U74A 5JREA 3N9PA 4PJMA 3VR8A 1ZP0A 2D9DA 2J47A 3LBXB 2VK9A 3AA6B 3EAMA 1DU2A 2EHOA 3NVOA 4NXMT 4JLEA 3WI3A 2H3RA 4L0RA 3W15B 1SUMB 1T72A 2V1DB 4U72A 2CEAA 5JQGE 2CHNA 3FBLA 4QXHB 2BG9A 4DV5T 3O9XA 4O4LE 1OEDE 3CK6A 3N9MA 4LMKA 4E7SA 3ZKRA 2H88A 1OEDC 4TV8E 5LP6E 2HPJA 2BVMA 4DR5T 5LJNA 4IE5A 2LOPA 4KI0F 1HNXT 5AQSB 3C50A 3N2GE 5JRCB 3FB2A 3CPZA 3UU5A 3V5SA 3CVRA 2NW8A 5C2TA 3AEEA 2XAHB 2MYSA 2YEVC 2XAQB 2IW5B 3FZLB 5HXHA 3P7IA 2CLYB 1H7CA 3N2KE 4PAGA 2WU2A 3AEGA 3LFMA 3Q9DA 4U33A 1ZHCA 5IWAT 4MLKA 5JVDE 2KXPB 3ZYKA 3ZT7A 3ZCIA 1MNDA 1T7SA 4IGUA 2UU9T 2UXCT 2D5UA 2YU2A 2IMLA 3CQCB 3PUAA 4IREA 1U5PA 4ZS3A 5AQVB 3PURA 4EAHA 2UXNB 1WYCA 4C91A 4UV8B 3TLSA 4QHOA 4OFZA 4X1YE 5IHYA 1NAFA 3AXJB 4GK0E 3WAKA 2Y48B 3ANWA 3LK2B 4TN7B 5FVKA 3CX6B 2XQ8A 3HR0A 4QWNB 4YJ2E 3AE5A 3PUZF 2XPKA 4CXXA 3RH3A 1FEWA 1S35A 4X5TA 3AE3A 2VQET 4KHZF 3Q5XA 3Q5EA 4H9PC 5ABGA 3F57A 3IEEA 3F2EA 3SOLA 1VCTA 2WDVA 2YOEA 3N9OA 2ACZA 3UUXB 4HN9A 5JR9B 2XSBA 3I0OA 4IDZA 2G0UA 3KBTA 3QUJA 2CE7A 4OYJA 1M62A 3UU4A 5KDMC 4YSYA 3DJBA 3MK7C 4EYUA 3J7Yq 2MBGA 3ZMTB 4JI4T 2KWHA 4IL9A 3BK9A 2N9DA 1W0BA 1BR2A 2LSGA 5HEOA 1SA0E 3JADA 5HEJA 4DR1T 3T1YT 4DR4T 3N9LA 3QB5A 4YHHT 5HCMA 2V7IA 3AA0B 2NTXA 4OHFA 5LMNT 1IBMT 4Q25A 3AEBA 1XNRT 5FP3A 3UU8A 3B57A 2WM9A 3JC6D 4LFCT 2C5JA 2C5IT 1HNZT 2DLRA 2XUEA 5BMVE 5CB4E 5DQWA 3CQXC 3P50A 2A2FX 5LOVE 2ZM8A 3IF8B 4X20E 4QH1A 4DR3T 1XNQT 5HAXA 2NR4A 4DV3T 1N32T 2K9AA 2YK0A 3M3ZB 4DUYT 1HNWT 5H6RB 2PJQA 3E0ZA 3NRXA 3MKDA 1WFDA 2XTLA 1WR6A 4TWDA 4F6RC 2SPCA 4IIJE 2CXLA 1HX8A 1XDPA 3K8PC 1W09A 3OYXA 3PUVF 4X62T 4PJNA 1G8XA 1D0XA 3SS1A 2NW9A 3U78A 1HTJF 4TNVA 1QSDA 1VRBA 3ZJ1A 2VQFT 2UUBT 2KNDA 3F31A 3VU7H 3Q2MA 5L3FB 1MMAA 2VL8A 1T98A 2BS4A 2M67A 2XQ7A 3PTRB 2BBHA 2VB6A 4GYRA 2LKHA 2QA7A 3OYZA 3RIFA 2XQYA 3BQKA 2E9XB 4CN6A 4K0KT 3ZMSB 3EABA 3VRAA 2XQ5A 4DNDA 2UUCT 3V5UA 1D1AA 4P0AA 4O2AE 3T1HT 2BDEA 5AFUL 3KDSE 5L4HA 4OX9T 4NIQA 2E9XA 1Z0PA 2JMKA 3UUNA 4QXCB 5FKYA 4O4JE 2LKGA 3KFWX 4JEHB 1YXRA 4EXTA 3GWHA 1XMQT 2KWIB 2NW7A 2V7KA 3LSVA 4WZXA 2V5DA 3S4UA 3SWHA 5BR8T 2V6XA 3O1IA 4GOUA 2WS3A 3PU3A 4A5XA 4BJMA 2HHHT 4LF6T 4DBRA 4O4HE 4P1NA 2Q9QC 4A97A 2J4GA 1B7TA 2KSRA 4EZHA 4YT0A 4I55E 2CMRA 2FJDA 1SHZC 3FZHB 4ZI7E 3FZFB 2V7MA 2UUAT 2DL1A 1KFYA 5FL0A 3QC9A 3MACA 4KBMB 5E0OA 2Z6EA 3ZYLA 1YQ3A 5ADXL 1AJ3A 2NOXA 4FI5A 4CN1A 4DV6T 4ZOLE 1I94T 4HGAA 5IUXA 3AAAB 4V1Av 2E9XD 3BQIA 1UK5A 1W0AA 5FMNA 2FJBA 1GQEA 2AE9A 2MAWA 3ZMUB 2XAJB 4PJJA 1XWMA 2HH7A 3H3MA 3LJCA 5FXWA 2ODVA 3C64A 2J62A 2X66A 3K1SA 5LA6E 3T8OA 5CA1E 5JR9A 4X64T 5IYZE 3ZN0B 1J5ET 4HWIB 2W62A 4ISTA 5L3DB 3RQUA 5JDGA 1ZV4X 4IE7A 5LHIB 2JJ9A 2NTYA 4C90A 3KBUA 4ILBA 5J0ZA 5ABEA 4EV6A 2WP9A 2X0LB 4UVBB 5LGUB 5J2TE 1UURA 4HFDA 2K3WA 3EI0A 2D0TA 2K5BB 4GIWA 2LEHA 3KINB 4UVCB 3HKDE 2BG9B 4X1KE 3SFEA 1O3XA 3CX7B 5AQNB 1IZNB 5L3GB 2LSIA 3RYCE 1YQ4A 1KNPA 5AQUB 4YFSA 4L9IA 5JH7E 1X9BA 2EHOC 1G73A 2I0MA 3OKQA 4IE4A 2WCAA 3UULA 5HEUA 2X67A 2XY8B 5LMUT 2I59A 2DWGA 2LHNA 3RX6A 3VHLA 1HCIA 4HFCA 2B1EA 2LHRA 4JI6T 2ACXA 1X79A 3K3OA 3UUMA 1EZ3A 5LGTB 2OV9A 1CHUA 4HFHA 4NPPA 1N33T 4MHCA 5DJQC 5CJ5A 2LM9A 3NZPA 4H9OC 3AAEB 4OYKA 5AQTB 1IBKT 3RRCA 3C4ZA 3N5LA 3ONLC 4KUMB 3ZYMA 4NUVA 3L8RA 5FVLA 2UXDT 1KF6A 3KV4A 3P4PA 1OWAA 5ETWA 4HFIA 1UCUA 4QH5A 5M4YA 2C0SA 2WZHA 3H3AA 3P8CD 5HWXA 5LHHB 2XZEA 1Z8UA 3AAIA 1LVFA 3ZT5A 4UV9B 1IBLT 3NZQA 2V7LA 1E1HB 4K0UA 3D0TA 3TKLB 3RQWA 3UQ7A 3I9WA 4HWHA 3P4QA 4X66T 3P4SA 3AE4A 4MALA 3IHRA 3PUYF 3I0QA 5J1GA 2KMFA 4AKGA 2N2NA 3FBZA 3E22E 5AQMB 3GA8A 4HE8A 4PW8A 3E08A 2BS3A 1FMWA 2WMOA 3AE7A 4XZCA 3AE8A 4Z90A 2D0UA 3HKBE 2LJLA 2E8IA 2V26A 3AEAA 3KVAA 4HEAA 2VKOA 3EHZA 4HWDA 4EZ4A 1D0ZA 4IE0A 3NRYA 4KP3C 3RC3A 2LM2A 2R6GF 2YDRA 1MNEA 4TNWA 4ZI2D 1KEYA 3RYHE 4GKKT 1KNZA 1XMOT 3QK6A 4ISSA 2OLTA 1J5WA 3C98B 3R84B 5JR9C 1D0YA 2MTQA 4IDOA 1UX4A 5JDFA 3RGLA 2WAUA 4ZZBA 5CFBA 4DV2T 3EUHA 1L0VA 1HX1B 2XQ4A 2YU1A 1MMDA 2ZM0A 4GYSA 5ABHA 3PU8A 5JDHA 4AKHA 4AQFA 1WR0A 2A9UA 1Y64B 2LLYA 4B3MT 5HEGA 3OBVE 4I50E 2IDOB 2WSSV 3RLFF 2CCQA 2W61A 4P09A 5FYMA 4E7ZA 4H63H 5KXJA 1Y01A 3IBPA 3BQLA 2V8SV 4YTMA 3SFDA 2IHR1 4GK5E 5HXRA 3J9X1 4F8HA 4UXNB 5C3JA 5JRCA 4CXWA 2JQHA 2YKSA 4YLHA 2JQ9A 3TLWA 4ZS2A 4ADZA 4LMLA 3JC6C 4DV1T 1BR0A 2FJAA 3EDUA 3LBXA 3UQ4A 3RIUA 3A5XA 2KLQA 4EEBA 4YHJA 2L9QA 2V6YB 2XAFB 5LNKA 5HXCA 1MMNA 4PK6A 4DR7T 3FZMB 2VURA 4LF8T 3K3QC 2AXDS 5FXXA 4AQFC 2Q9QB 3RKGA 2VVNA 3PUXF 2JPFA 3DP7A 1E2AA 1US7B 5HWYA 3UFGA 4ERRA 2X9HA 4EOZB 4IE6A 5JDLA 1M7KA 3K3NA 4I4TE 4AKLA 5L3BB 3OVUA 4HFBA 4WBNE 3HL6A 3H37A 3ZN1B 5LGNB 2K24A 1ZEEA 3UU3A 3R6NA 5F3JA 2I6HA 3SRZA 4CQIA 2DHRA 2NWBA 4JI3T 2WMNA 4IHJE 4BJNA 4DV7T 2UXBT 3IA3A 2VVSA 4N78D 2A3DA 3ONJA 5LHGB 2E9XC 3KV5A 2X9XA 4UF0A 5AQJB 3ZC0A 4U7IA 4QXBB 5EZYE 1XZYA 1IJ5A 1E7PA 3L3PA 4YTPA 5CA0E 1KK7A 2CXDA 4IDNA 4JUYA 2H7OA 4KX6A 3PDYA 5FXZA 5L4EA 1FMVA 3CIRA 4AI6A 4H9QC 5FY1A 4FJOA 4JI0T 2CBIA 4CI3B 4JV5T 2JQKA 2CWYA 3CMLA 3GN5B 4B3RT 4ILCA 4ZI2C 1JNRA 4LF5T 4J2CA 3RF1A 5AQQB 2A72A 2BG9C 2WB5A 3NBXX 5FL1A 2KT9A 1YKEB 2YN6A 4LMJA 2LSKA 2EHOB 4ANJA 2PFVA 5CGMA 4NXNT 2W66A 3ZMVB 1YD8G 5L47A 1HG5A 1U4QA 4HFEA 4B6XA 3I9YA 1UGOA 2LOSA 3PE0A 1NEKA 3N9QA 3ANWB 5AQIB 4DIDB 2DI4A 3A7MA 4WW0A 2W67A 3M65A 3ZT6A 3QOFA 3RC8A 1UX5A 2EHOD 5LG3A 3RKOA 3NWIA 4IDPA 1T8BA 2QVAA 5GONE 2VWAA 3O1JA 5KX5E 2W63A 2NP9A 4PJLA 4QH4A 4TWHA 5DABA 5AQLB 3MJXA 2MPKA 4AQYT 2BKOA 2XHEB 4JI1T 5J2UE 2IC9A 2HPLA 3RPUA 3UU6A 4DV4T 2LT3A 4WNKA 3AEFA 1D1CA 3ABVA 4PFOA 3O4XE 4A56A 3N9NA 3HI2A 4TV9E 4X1IE 1NENA 2XQ6A 3UTKA 3ZSTA 4UVAB 2XAGB 2BVLA 2MOZA 2QGSA 2W00A 2JRKA 5LB7B 2VASA 2XM2A 4H63V 4XAXB 4MBQA 3UFEA 5A1LA 5L3CB 4JI5T 2ES0A 5LG4A 3P4WA 5EK3A 1MIVA 2XM1A 2E5VA 3CKDA 4UIGA 3EVYA 3B5MA 2B76A 3HA4A 5JDQA 3RI5A 2X0HA 2Y8DA 1SE7A 2RPAA 2YDSA 2GK9A 2X0YA 2WWVA 5AQKB 3RYFE 5C8YE 4WYVA 1XDOA 4CZZB 4LFAT 1D1BA 2CXFA 2WY2A 4H9SE 2LRKA 4UEMA 4LF7T 3VKHA 5JTGA 2CLYC 1ZKEA 4DR6T 5LBQB 5F8PA 4EYYR 4YY3T 4PK4A 3EDVA 4JI7T 3ZC1A 2DNXA 3AE2A 4TX5A 4CN4A 2V5CA 1LVKA 4I43B 1OXZA 4MFRA 3LK3B 2BS2A 1BR1A 2YINA 3PJAA 4H9NC 4JYAT 2W4XA 4IT4A 3CWZB 4JBWF 5AQRB 3B13A 1IAPA 4AQGA 4HWFA 4ZI3D 2BKPA 3ONXA 2BBJA 4DV0T 4LFBT 2PTFA 2WZIA 3ETUA 5H6QB 5L3EB 2ZMAA 3RIAA 4CI2B 3A8YC 3DTOA 2UXXB 3PUQA 4U2ZA 3FHNA 2M6IA 4ASKA 2KINB 4I0UA 5AQGB 4DBQA 2WWUA 2V7JA 4G63A 3AB3B 1MIYA 1YKHB 3C4WA 3G06A 1KNRA 2WDRA 3LK42 3OJAA 3PUGA 4U3CA 3ZSSA 2QRXA 3NKZA 3MA9A 4QKNA 2JMHA 3KVBA 1UUSA 2WU5A 4AIUA 4BAYB 2FBWA 5JDMA 5LYJE 4PNIA 2XSAA 4KMCA 4TZ4C 4YTNA 4DMVA 4LF4T 2E2AA 5AQFB 2H89A 3OTOT 1WLXA 3AE1A 3PJAJ 3FZKB 5LBMA 4O8SA 3AVRA 4YSXA 2IUBA 1JNZA 3CX8B 3TLVA 3VR9A 4EEDA 3MZKB 5EK4A 5AQHB 3OPCA 3ZLIA 4DO0A 1N36T 4COFA 3ZCJA 4JEUB 1FJGT 1WCRA 4TWFA 3UUBA 4DMWA 3GMIA 2KZ7B 3L09A 3FXDB 2PBIA 2X9YA 2XQAA 3JAFA 4HFVA 2J1DG 2K48A 4H9RC 1R8IA 2RA1A 5HXEA 1J1JA 4A98A 3KV6A 1HR0T 3WAJA 5FNVE 3PV0F 4AKIA 4P0BA 4U2YA 2ZM6T 1HFAA 2FJEA 3QNUA 4UR9A 3RHWA 3RIUC 4LF9T 5L2LA 2XJ7A 4Z91A 4CXYA 5F5WA 4HTEA 4JI8T 4YSZA 2N1GA 2LRLA 3AEDA 2E5LT 2LSJA 3Q5DA 5KMGP 2H7VC 5FY0A 2WQYA 2WDQA 3U3IA 3AA1B 5HYAA 3AA7B 3I1AA 3Q5WA 1W9RA 2DWKA 2CBJA 3CQGB 5TAOA 5HEHA 3RRWA 2LSYA 1YW0A 4JI2T 4ILAA 2JIWA 4DVDA 3C4XA 2BZBA 2IAKA 4KHPT 1WRDA 1I6ZA 3ZJ2A 3JCFA 4U31A 4AISA 3QB5K 4HKAA 3JAEA 4EIWA 3ZEFB 3FXEB 2XQ3A 4BA9A 1QUUA 1CUNA 4QX7B 4WBOA 4O4IE 5AQOB 1S94A 3X1DA 4GKJT 4UELA 2Y6XA 1HS7A 3PUWF 1FIOA 2ODUA 2X68A 3VKGA 2VKDA 4O2BE 3L39A 4DR2T 1IJ6A 2PG8A 2FUPA 2XASB 2CWOA 4NUUA 2LE8A 3HKCE 3N2OA 4X65T 5HXSA 2CHOA 4PFPA 2C5KT 3AE9A 2OA5A 2CPTA 2W0GA 1LKXA 2VKHA 3RYIE
chains in the Genus database with same CATH topology
2RP4A 1LRZA 1BR4A 3O1HA 1NWMX 2CA5A 1HG2A 2X9WA 1HF8A 1WYBA 2WBLA 2ZLYA 4M1PA 4Z8XA 5FY7A 3ETVA 2JQQA 5DQVA 4YJ3E 2Q9QA 4ZI3C 2CM0A 3C51A 3HKEE 5LCYA 3UT5E 3GN5A 1MIWA 4ILUA 4L5GA 4PK5A 4EB6E 2L8KA 3ESLA 5LXTE 5LJMA 4QX8B 2IC6A 4OK0A 1V9DA 1VOMA 2VKJA 2DCFA 5EK2A 2ZM2A 3ZPOA 4AKRB 5JDNA 1MMGA 3ZMZB 3MXZA 3PUSA 4UF0B 2L3LA 2D2SA 4ZHQE 4TUYE 4CI1B 5FXVA 4G2AA 4AXPA 2P9BA 3AVSA 3KV9A 2Q9QD 4XBFB 2X51A 3LG7A 4U74A 5JREA 3N9PA 4PJMA 3LBXB 2VK9A 3AA6B 2EHOA 4JLEA 3WI3A 2H3RA 4L0RA 3W15B 2V1DB 4U72A 2CEAA 5JQGE 3FBLA 4QXHB 3O9XA 4O4LE 3N9MA 4E7SA 4TV8E 5LP6E 2HPJA 2BVMA 5LJNA 4IE5A 2LOPA 3C50A 3N2GE 5JRCB 3FB2A 3CPZA 3V5SA 3CVRA 2NW8A 2XAHB 2MYSA 2YEVC 2XAQB 2IW5B 5HXHA 3P7IA 2CLYB 1H7CA 3N2KE 4PAGA 3LFMA 3Q9DA 1ZHCA 4MLKA 5JVDE 2KXPB 3ZYKA 3ZCIA 1MNDA 4IGUA 2D5UA 2YU2A 3CQCB 3PUAA 1U5PA 4ZS3A 4EAHA 3PURA 2UXNB 1WYCA 4C91A 4UV8B 4QHOA 4OFZA 4X1YE 5IHYA 1NAFA 4GK0E 3WAKA 2Y48B 3ANWA 3LK2B 4TN7B 3CX6B 3HR0A 4QWNB 4YJ2E 4CXXA 3RH3A 1FEWA 1S35A 3Q5XA 4H9PC 3F57A 3IEEA 3F2EA 3SOLA 3UUXB 3N9OA 5JR9B 4HN9A 3I0OA 4IDZA 2G0UA 3KBTA 3QUJA 2CE7A 4OYJA 5KDMC 3DJBA 3MK7C 4EYUA 3J7Yq 2MBGA 3ZMTB 2KWHA 3BK9A 2N9DA 1BR2A 2LSGA 1SA0E 3N9LA 2V7IA 3AA0B 2NTXA 4OHFA 5FP3A 3B57A 2WM9A 3JC6D 2C5JA 2C5IT 2DLRA 2XUEA 5BMVE 5CB4E 5DQWA 3CQXC 5LOVE 2A2FX 2ZM8A 3IF8B 4X20E 5HAXA 2K9AA 2YK0A 5H6RB 2PJQA 3E0ZA 3NRXA 3MKDA 2XTLA 1WR6A 4F6RC 2SPCA 4IIJE 2CXLA 1HX8A 3K8PC 3OYXA 4PJNA 1G8XA 1D0XA 3SS1A 2NW9A 3U78A 1HTJF 1QSDA 1VRBA 3ZJ1A 2KNDA 3F31A 3VU7H 3Q2MA 5L3FB 1MMAA 2VL8A 1T98A 2M67A 3PTRB 4GYRA 2VB6A 2QA7A 3OYZA 2XQYA 3BQKA 2E9XB 3ZMSB 4DNDA 3V5UA 1D1AA 4P0AA 4O2AE 2BDEA 5AFUL 3KDSE 2E9XA 1Z0PA 2JMKA 3UUNA 4QXCB 4EXTA 4O4JE 3KFWX 4JEHB 3GWHA 2KWIB 2NW7A 2V7KA 3SWHA 3S4UA 3O1IA 4GOUA 4BJMA 3PU3A 4DBRA 4O4HE 2Q9QC 1B7TA 4EZHA 4I55E 2CMRA 1SHZC 4ZI7E 2V7MA 3QC9A 3MACA 4KBMB 5E0OA 2Z6EA 3ZYLA 5ADXL 1AJ3A 2NOXA 4FI5A 4ZOLE 4HGAA 3AAAB 4V1Av 2E9XD 3BQIA 5FMNA 3ZMUB 2XAJB 4PJJA 2HH7A 3LJCA 5FXWA 2ODVA 3C64A 2X66A 5LA6E 3T8OA 5CA1E 5JR9A 5IYZE 3ZN0B 2W62A 4ISTA 5L3DB 5JDGA 1ZV4X 4IE7A 5LHIB 2JJ9A 2NTYA 4C90A 3KBUA 2X0LB 4UVBB 5LGUB 5J2TE 2D0TA 2K5BB 4GIWA 2LEHA 3KINB 4UVCB 3HKDE 4X1KE 1O3XA 3CX7B 1IZNB 5L3GB 2LSIA 3RYCE 4YFSA 4L9IA 5JH7E 2EHOC 3OKQA 1G73A 4IE4A 3UULA 2X67A 2I59A 2DWGA 2LHNA 3RX6A 3VHLA 1HCIA 2B1EA 2LHRA 2ACXA 1X79A 3K3OA 3UUMA 1EZ3A 5LGTB 4MHCA 5DJQC 2LM9A 3NZPA 4H9OC 3AAEB 4OYKA 3RRCA 3C4ZA 3N5LA 4KUMB 3ZYMA 4NUVA 3KV4A 5ETWA 1OWAA 1UCUA 5M4YA 2C0SA 3H3AA 3P8CD 5LHHB 5HWXA 3AAIA 1LVFA 4UV9B 3NZQA 2V7LA 1E1HB 4K0UA 3D0TA 3TKLB 3I9WA 5J1GA 4AKGA 4MALA 3IHRA 3I0QA 2KMFA 2N2NA 3FBZA 3E22E 3GA8A 4HE8A 4PW8A 3E08A 4XZCA 1FMWA 2WMOA 2D0UA 3HKBE 2LJLA 2E8IA 2V26A 3KVAA 4HEAA 4EZ4A 2VKOA 1D0ZA 4IE0A 3NRYA 4KP3C 3RC3A 4ZI2D 1MNEA 3RYHE 1KNZA 3QK6A 4ISSA 3C98B 3R84B 5JR9C 1D0YA 2MTQA 1UX4A 5JDFA 2WAUA 3EUHA 2YU1A 1MMDA 2ZM0A 4GYSA 5JDHA 3PU8A 4AKHA 4AI6A 4AQFA 1Y64B 3OBVE 4I50E 2WSSV 2CCQA 2W61A 4P09A 5FYMA 4E7ZA 4H63H 3IBPA 3BQLA 4GK5E 5HXRA 3J9X1 4UXNB 5JRCA 4CXWA 4YLHA 4ZS2A 4ADZA 3JC6C 1BR0A 3EDUA 3LBXA 3A5XA 2KLQA 4YHJA 2L9QA 2XAFB 5LNKA 5HXCA 1MMNA 4PK6A 3K3QC 5FXXA 4AQFC 2Q9QB 2JPFA 3DP7A 1US7B 5HWYA 4ERRA 2X9HA 4EOZB 4IE6A 5JDLA 3K3NA 4I4TE 4AKLA 5L3BB 4WBNE 3HL6A 3H37A 3ZN1B 5LGNB 2K24A 1ZEEA 3R6NA 5F3JA 3SRZA 4CQIA 2DHRA 2NWBA 2WMNA 4IHJE 4BJNA 4N78D 2A3DA 5LHGB 2E9XC 3KV5A 2X9XA 4UF0A 3ZC0A 4QXBB 5EZYE 1IJ5A 3L3PA 5CA0E 1KK7A 2CXDA 4JUYA 2H7OA 3PDYA 5FXZA 1FMVA 4H9QC 5FY1A 4FJOA 4CI3B 3CMLA 2CWYA 3GN5B 4ZI2C 4J2CA 2A72A 3NBXX 2KT9A 1YKEB 2LSKA 2EHOB 4ANJA 2PFVA 3ZMVB 1YD8G 1HG5A 1U4QA 4B6XA 3I9YA 2LOSA 3PE0A 3N9QA 3ANWB 2DI4A 4WW0A 3M65A 3RC8A 1UX5A 2EHOD 3RKOA 5GONE 2VWAA 3O1JA 5KX5E 2W63A 2NP9A 4PJLA 5DABA 3MJXA 2XHEB 5J2UE 2IC9A 2HPLA 3RPUA 2LT3A 4WNKA 1D1CA 4PFOA 3O4XE 4A56A 3N9NA 3HI2A 4TV9E 4X1IE 3UTKA 4UVAB 2XAGB 2BVLA 2MOZA 2QGSA 2W00A 2JRKA 3UFEA 2VASA 4H63V 5A1LA 4XAXB 4MBQA 5L3CB 2ES0A 5LG4A 5EK3A 1MIVA 4UIGA 3CKDA 3EVYA 5JDQA 3HA4A 2Y8DA 2GK9A 3RYFE 5C8YE 4CZZB 1D1BA 2CXFA 4H9SE 4UEMA 3VKHA 2CLYC 1ZKEA 5LBQB 5F8PA 4EYYR 4PK4A 3EDVA 3ZC1A 2DNXA 4TX5A 1LVKA 4I43B 1OXZA 4MFRA 3LK3B 4H9NC 1BR1A 2YINA 3CWZB 4ZI3D 3B13A 1IAPA 4AQGA 3ONXA 3ETUA 5L3EB 5H6QB 2ZMAA 4CI2B 3DTOA 2UXXB 3PUQA 3FHNA 4ASKA 2KINB 4DBQA 2WWUA 2V7JA 4G63A 3AB3B 1MIYA 1YKHB 3C4WA 3LK42 3OJAA 3PUGA 4QKNA 3MA9A 2JMHA 3KVBA 4BAYB 5JDMA 5LYJE 4PNIA 4KMCA 4TZ4C 4DMVA 1WLXA 5LBMA 4O8SA 3AVRA 3CX8B 3MZKB 5EK4A 4DO0A 3ZLIA 3ZCJA 4JEUB 4DMWA 3GMIA 2KZ7B 3L09A 3FXDB 2PBIA 2X9YA 4HFVA 2J1DG 2K48A 4H9RC 2RA1A 5HXEA 3KV6A 3WAJA 5FNVE 4AKIA 4P0BA 1HFAA 5L2LA 4CXYA 4HTEA 2N1GA 2LSJA 5KMGP 2H7VC 5FY0A 3U3IA 5HYAA 3AA1B 3AA7B 3I1AA 3Q5WA 2DWKA 3CQGB 5TAOA 3RRWA 2LSYA 1YW0A 4DVDA 3C4XA 2BZBA 2IAKA 1WRDA 3ZJ2A 4EIWA 3ZEFB 4HKAA 3FXEB 4BA9A 1QUUA 1CUNA 4QX7B 4WBOA 4O4IE 1S94A 1HS7A 4UELA 2Y6XA 1FIOA 2ODUA 2X68A 3VKGA 2VKDA 4O2BE 2XASB 2PG8A 1IJ6A 2CWOA 4NUUA 2LE8A 3HKCE 3N2OA 5HXSA 4PFPA 2C5KT 2OA5A 2W0GA 1LKXA 2VKHA 3RYIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWY A;  2CXD A; 
#chains in the Genus database with same CATH topology
 2RP4 A;  1LRZ A;  2VL0 A;  1BR4 A;  3O1H A;  3AE6 A;  1NWM X;  4AXP A;  2CA5 A;  1HG2 A;  2X9W A;  4EGW A;  1OED B;  1HF8 A;  4B3S T;  1WYB A;  2WBL A;  2ZLY A;  3P4R A;  4M1P A;  4Z8X A;  5FY7 A;  3ETV A;  2JQQ A;  5HCJ A;  2YDQ A;  5DQV A;  4YXD A;  4YJ3 E;  2Q9Q A;  3LDQ B;  4ZI3 C;  2CM0 A;  3C51 A;  3HKE E;  2QYW A;  4U7Y A;  4B3T T;  5LCY A;  3UT5 E;  2F4V T;  3GN5 A;  2V6Y A;  1MIW A;  4ILU A;  2BKN A;  1ZOY A;  4L5G A;  4PK5 A;  4EB6 E;  2L8K A;  3ESL A;  5ABF A;  5LXT E;  1QLB A;  4IDQ A;  5LJM A;  4QX8 B;  4HWC A;  2IC6 A;  2M6B A;  4OK0 A;  1V9D A;  1VOM A;  5ABF B;  2VKJ A;  3AEC A;  2DCF A;  5EK2 A;  3AXJ A;  2ZM2 A;  3ZPO A;  4AKR B;  5JDN A;  1VCS A;  4ZZC A;  1MMG A;  2CRB A;  2HN1 A;  1N34 T;  3ZMZ B;  5AQP B;  4ZXL A;  3MXZ A;  3PUS A;  4UF0 B;  2L3L A;  2W2U A;  2D2S A;  4ZHQ E;  4TUY E;  4CI1 B;  4IL4 A;  2XQ9 A;  2HN2 A;  4G2A A;  5FXV A;  2P9B A;  3AVS A;  3KV9 A;  1OED A;  2IIU A;  3TLT A;  2Q9Q D;  3VRB A;  4ZEY A;  2BG9 E;  2X51 A;  3LG7 A;  3TLU A;  4DUZ T;  4XBF B;  4U74 A;  5JRE A;  3N9P A;  4PJM A;  3VR8 A;  1ZP0 A;  2D9D A;  2J47 A;  3LBX B;  2VK9 A;  3AA6 B;  3EAM A;  1DU2 A;  2EHO A;  3NVO A;  4NXM T;  4JLE A;  3WI3 A;  2H3R A;  4L0R A;  3W15 B;  1SUM B;  1T72 A;  2V1D B;  4U72 A;  2CEA A;  5JQG E;  2CHN A;  3FBL A;  4QXH B;  2BG9 A;  4DV5 T;  3O9X A;  4O4L E;  1OED E;  3CK6 A;  3N9M A;  4LMK A;  4E7S A;  3ZKR A;  2H88 A;  1OED C;  4TV8 E;  5LP6 E;  2HPJ A;  2BVM A;  4DR5 T;  5LJN A;  4IE5 A;  2LOP A;  4KI0 F;  1HNX T;  5AQS B;  3C50 A;  3N2G E;  5JRC B;  3FB2 A;  3CPZ A;  3UU5 A;  3V5S A;  3CVR A;  2NW8 A;  5C2T A;  3AEE A;  2XAH B;  2MYS A;  2YEV C;  2XAQ B;  2IW5 B;  3FZL B;  5HXH A;  3P7I A;  2CLY B;  1H7C A;  3N2K E;  4PAG A;  2WU2 A;  3AEG A;  3LFM A;  3Q9D A;  4U33 A;  1ZHC A;  5IWA T;  4MLK A;  5JVD E;  2KXP B;  3ZYK A;  3ZT7 A;  3ZCI A;  1MND A;  1T7S A;  4IGU A;  2UU9 T;  2UXC T;  2D5U A;  2YU2 A;  2IML A;  3CQC B;  3PUA A;  4IRE A;  1U5P A;  4ZS3 A;  5AQV B;  3PUR A;  4EAH A;  2UXN B;  1WYC A;  4C91 A;  4UV8 B;  3TLS A;  4QHO A;  4OFZ A;  4X1Y E;  5IHY A;  1NAF A;  3AXJ B;  4GK0 E;  3WAK A;  2Y48 B;  3ANW A;  3LK2 B;  4TN7 B;  5FVK A;  3CX6 B;  2XQ8 A;  3HR0 A;  4QWN B;  4YJ2 E;  3AE5 A;  3PUZ F;  2XPK A;  4CXX A;  3RH3 A;  1FEW A;  1S35 A;  4X5T A;  3AE3 A;  2VQE T;  4KHZ F;  3Q5X A;  3Q5E A;  4H9P C;  5ABG A;  3F57 A;  3IEE A;  3F2E A;  3SOL A;  1VCT A;  2WDV A;  2YOE A;  3N9O A;  2ACZ A;  3UUX B;  4HN9 A;  5JR9 B;  2XSB A;  3I0O A;  4IDZ A;  2G0U A;  3KBT A;  3QUJ A;  2CE7 A;  4OYJ A;  1M62 A;  3UU4 A;  5KDM C;  4YSY A;  3DJB A;  3MK7 C;  4EYU A;  3J7Y q;  2MBG A;  3ZMT B;  4JI4 T;  2KWH A;  4IL9 A;  3BK9 A;  2N9D A;  1W0B A;  1BR2 A;  2LSG A;  5HEO A;  1SA0 E;  3JAD A;  5HEJ A;  4DR1 T;  3T1Y T;  4DR4 T;  3N9L A;  3QB5 A;  4YHH T;  5HCM A;  2V7I A;  3AA0 B;  2NTX A;  4OHF A;  5LMN T;  1IBM T;  4Q25 A;  3AEB A;  1XNR T;  5FP3 A;  3UU8 A;  3B57 A;  2WM9 A;  3JC6 D;  4LFC T;  2C5J A;  2C5I T;  1HNZ T;  2DLR A;  2XUE A;  5BMV E;  5CB4 E;  5DQW A;  3CQX C;  3P50 A;  2A2F X;  5LOV E;  2ZM8 A;  3IF8 B;  4X20 E;  4QH1 A;  4DR3 T;  1XNQ T;  5HAX A;  2NR4 A;  4DV3 T;  1N32 T;  2K9A A;  2YK0 A;  3M3Z B;  4DUY T;  1HNW T;  5H6R B;  2PJQ A;  3E0Z A;  3NRX A;  3MKD A;  1WFD A;  2XTL A;  1WR6 A;  4TWD A;  4F6R C;  2SPC A;  4IIJ E;  2CXL A;  1HX8 A;  1XDP A;  3K8P C;  1W09 A;  3OYX A;  3PUV F;  4X62 T;  4PJN A;  1G8X A;  1D0X A;  3SS1 A;  2NW9 A;  3U78 A;  1HTJ F;  4TNV A;  1QSD A;  1VRB A;  3ZJ1 A;  2VQF T;  2UUB T;  2KND A;  3F31 A;  3VU7 H;  3Q2M A;  5L3F B;  1MMA A;  2VL8 A;  1T98 A;  2BS4 A;  2M67 A;  2XQ7 A;  3PTR B;  2BBH A;  2VB6 A;  4GYR A;  2LKH A;  2QA7 A;  3OYZ A;  3RIF A;  2XQY A;  3BQK A;  2E9X B;  4CN6 A;  4K0K T;  3ZMS B;  3EAB A;  3VRA A;  2XQ5 A;  4DND A;  2UUC T;  3V5U A;  1D1A A;  4P0A A;  4O2A E;  3T1H T;  2BDE A;  5AFU L;  3KDS E;  5L4H A;  4OX9 T;  4NIQ A;  2E9X A;  1Z0P A;  2JMK A;  3UUN A;  4QXC B;  5FKY A;  4O4J E;  2LKG A;  3KFW X;  4JEH B;  1YXR A;  4EXT A;  3GWH A;  1XMQ T;  2KWI B;  2NW7 A;  2V7K A;  3LSV A;  4WZX A;  2V5D A;  3S4U A;  3SWH A;  5BR8 T;  2V6X A;  3O1I A;  4GOU A;  2WS3 A;  3PU3 A;  4A5X A;  4BJM A;  2HHH T;  4LF6 T;  4DBR A;  4O4H E;  4P1N A;  2Q9Q C;  4A97 A;  2J4G A;  1B7T A;  2KSR A;  4EZH A;  4YT0 A;  4I55 E;  2CMR A;  2FJD A;  1SHZ C;  3FZH B;  4ZI7 E;  3FZF B;  2V7M A;  2UUA T;  2DL1 A;  1KFY A;  5FL0 A;  3QC9 A;  3MAC A;  4KBM B;  5E0O A;  2Z6E A;  3ZYL A;  1YQ3 A;  5ADX L;  1AJ3 A;  2NOX A;  4FI5 A;  4CN1 A;  4DV6 T;  4ZOL E;  1I94 T;  4HGA A;  5IUX A;  3AAA B;  4V1A v;  2E9X D;  3BQI A;  1UK5 A;  1W0A A;  5FMN A;  2FJB A;  1GQE A;  2AE9 A;  2MAW A;  3ZMU B;  2XAJ B;  4PJJ A;  1XWM A;  2HH7 A;  3H3M A;  3LJC A;  5FXW A;  2ODV A;  3C64 A;  2J62 A;  2X66 A;  3K1S A;  5LA6 E;  3T8O A;  5CA1 E;  5JR9 A;  4X64 T;  5IYZ E;  3ZN0 B;  1J5E T;  4HWI B;  2W62 A;  4IST A;  5L3D B;  3RQU A;  5JDG A;  1ZV4 X;  4IE7 A;  5LHI B;  2JJ9 A;  2NTY A;  4C90 A;  3KBU A;  4ILB A;  5J0Z A;  5ABE A;  4EV6 A;  2WP9 A;  2X0L B;  4UVB B;  5LGU B;  5J2T E;  1UUR A;  4HFD A;  2K3W A;  3EI0 A;  2D0T A;  2K5B B;  4GIW A;  2LEH A;  3KIN B;  4UVC B;  3HKD E;  2BG9 B;  4X1K E;  3SFE A;  1O3X A;  3CX7 B;  5AQN B;  1IZN B;  5L3G B;  2LSI A;  3RYC E;  1YQ4 A;  1KNP A;  5AQU B;  4YFS A;  4L9I A;  5JH7 E;  1X9B A;  2EHO C;  1G73 A;  2I0M A;  3OKQ A;  4IE4 A;  2WCA A;  3UUL A;  5HEU A;  2X67 A;  2XY8 B;  5LMU T;  2I59 A;  2DWG A;  2LHN A;  3RX6 A;  3VHL A;  1HCI A;  4HFC A;  2B1E A;  2LHR A;  4JI6 T;  2ACX A;  1X79 A;  3K3O A;  3UUM A;  1EZ3 A;  5LGT B;  2OV9 A;  1CHU A;  4HFH A;  4NPP A;  1N33 T;  4MHC A;  5DJQ C;  5CJ5 A;  2LM9 A;  3NZP A;  4H9O C;  3AAE B;  4OYK A;  5AQT B;  1IBK T;  3RRC A;  3C4Z A;  3N5L A;  3ONL C;  4KUM B;  3ZYM A;  4NUV A;  3L8R A;  5FVL A;  2UXD T;  1KF6 A;  3KV4 A;  3P4P A;  1OWA A;  5ETW A;  4HFI A;  1UCU A;  4QH5 A;  5M4Y A;  2C0S A;  2WZH A;  3H3A A;  3P8C D;  5HWX A;  5LHH B;  2XZE A;  1Z8U A;  3AAI A;  1LVF A;  3ZT5 A;  4UV9 B;  1IBL T;  3NZQ A;  2V7L A;  1E1H B;  4K0U A;  3D0T A;  3TKL B;  3RQW A;  3UQ7 A;  3I9W A;  4HWH A;  3P4Q A;  4X66 T;  3P4S A;  3AE4 A;  4MAL A;  3IHR A;  3PUY F;  3I0Q A;  5J1G A;  2KMF A;  4AKG A;  2N2N A;  3FBZ A;  3E22 E;  5AQM B;  3GA8 A;  4HE8 A;  4PW8 A;  3E08 A;  2BS3 A;  1FMW A;  2WMO A;  3AE7 A;  4XZC A;  3AE8 A;  4Z90 A;  2D0U A;  3HKB E;  2LJL A;  2E8I A;  2V26 A;  3AEA A;  3KVA A;  4HEA A;  2VKO A;  3EHZ A;  4HWD A;  4EZ4 A;  1D0Z A;  4IE0 A;  3NRY A;  4KP3 C;  3RC3 A;  2LM2 A;  2R6G F;  2YDR A;  1MNE A;  4TNW A;  4ZI2 D;  1KEY A;  3RYH E;  4GKK T;  1KNZ A;  1XMO T;  3QK6 A;  4ISS A;  2OLT A;  1J5W A;  3C98 B;  3R84 B;  5JR9 C;  1D0Y A;  2MTQ A;  4IDO A;  1UX4 A;  5JDF A;  3RGL A;  2WAU A;  4ZZB A;  5CFB A;  4DV2 T;  3EUH A;  1L0V A;  1HX1 B;  2XQ4 A;  2YU1 A;  1MMD A;  2ZM0 A;  4GYS A;  5ABH A;  3PU8 A;  5JDH A;  4AKH A;  4AQF A;  1WR0 A;  2A9U A;  1Y64 B;  2LLY A;  4B3M T;  5HEG A;  3OBV E;  4I50 E;  2IDO B;  2WSS V;  3RLF F;  2CCQ A;  2W61 A;  4P09 A;  5FYM A;  4E7Z A;  4H63 H;  5KXJ A;  1Y01 A;  3IBP A;  3BQL A;  2V8S V;  4YTM A;  3SFD A;  2IHR 1;  4GK5 E;  5HXR A;  3J9X 1;  4F8H A;  4UXN B;  5C3J A;  5JRC A;  4CXW A;  2JQH A;  2YKS A;  4YLH A;  2JQ9 A;  3TLW A;  4ZS2 A;  4ADZ A;  4LML A;  3JC6 C;  4DV1 T;  1BR0 A;  2FJA A;  3EDU A;  3LBX A;  3UQ4 A;  3RIU A;  3A5X A;  2KLQ A;  4EEB A;  4YHJ A;  2L9Q A;  2V6Y B;  2XAF B;  5LNK A;  5HXC A;  1MMN A;  4PK6 A;  4DR7 T;  3FZM B;  2VUR A;  4LF8 T;  3K3Q C;  2AXD S;  5FXX A;  4AQF C;  2Q9Q B;  3RKG A;  2VVN A;  3PUX F;  2JPF A;  3DP7 A;  1E2A A;  1US7 B;  5HWY A;  3UFG A;  4ERR A;  2X9H A;  4EOZ B;  4IE6 A;  5JDL A;  1M7K A;  3K3N A;  4I4T E;  4AKL A;  5L3B B;  3OVU A;  4HFB A;  4WBN E;  3HL6 A;  3H37 A;  3ZN1 B;  5LGN B;  2K24 A;  1ZEE A;  3UU3 A;  3R6N A;  5F3J A;  2I6H A;  3SRZ A;  4CQI A;  2DHR A;  2NWB A;  4JI3 T;  2WMN A;  4IHJ E;  4BJN A;  4DV7 T;  2UXB T;  3IA3 A;  2VVS A;  4N78 D;  2A3D A;  3ONJ A;  5LHG B;  2E9X C;  3KV5 A;  2X9X A;  4UF0 A;  5AQJ B;  3ZC0 A;  4U7I A;  4QXB B;  5EZY E;  1XZY A;  1IJ5 A;  1E7P A;  3L3P A;  4YTP A;  5CA0 E;  1KK7 A;  2CXD A;  4IDN A;  4JUY A;  2H7O A;  4KX6 A;  3PDY A;  5FXZ A;  5L4E A;  1FMV A;  3CIR A;  4AI6 A;  4H9Q C;  5FY1 A;  4FJO A;  4JI0 T;  2CBI A;  4CI3 B;  4JV5 T;  2JQK A;  2CWY A;  3CML A;  3GN5 B;  4B3R T;  4ILC A;  4ZI2 C;  1JNR A;  4LF5 T;  4J2C A;  3RF1 A;  5AQQ B;  2A72 A;  2BG9 C;  2WB5 A;  3NBX X;  5FL1 A;  2KT9 A;  1YKE B;  2YN6 A;  4LMJ A;  2LSK A;  2EHO B;  4ANJ A;  2PFV A;  5CGM A;  4NXN T;  2W66 A;  3ZMV B;  1YD8 G;  5L47 A;  1HG5 A;  1U4Q A;  4HFE A;  4B6X A;  3I9Y A;  1UGO A;  2LOS A;  3PE0 A;  1NEK A;  3N9Q A;  3ANW B;  5AQI B;  4DID B;  2DI4 A;  3A7M A;  4WW0 A;  2W67 A;  3M65 A;  3ZT6 A;  3QOF A;  3RC8 A;  1UX5 A;  2EHO D;  5LG3 A;  3RKO A;  3NWI A;  4IDP A;  1T8B A;  2QVA A;  5GON E;  2VWA A;  3O1J A;  5KX5 E;  2W63 A;  2NP9 A;  4PJL A;  4QH4 A;  4TWH A;  5DAB A;  5AQL B;  3MJX A;  2MPK A;  4AQY T;  2BKO A;  2XHE B;  4JI1 T;  5J2U E;  2IC9 A;  2HPL A;  3RPU A;  3UU6 A;  4DV4 T;  2LT3 A;  4WNK A;  3AEF A;  1D1C A;  3ABV A;  4PFO A;  3O4X E;  4A56 A;  3N9N A;  3HI2 A;  4TV9 E;  4X1I E;  1NEN A;  2XQ6 A;  3UTK A;  3ZST A;  4UVA B;  2XAG B;  2BVL A;  2MOZ A;  2QGS A;  2W00 A;  2JRK A;  5LB7 B;  2VAS A;  2XM2 A;  4H63 V;  4XAX B;  4MBQ A;  3UFE A;  5A1L A;  5L3C B;  4JI5 T;  2ES0 A;  5LG4 A;  3P4W A;  5EK3 A;  1MIV A;  2XM1 A;  2E5V A;  3CKD A;  4UIG A;  3EVY A;  3B5M A;  2B76 A;  3HA4 A;  5JDQ A;  3RI5 A;  2X0H A;  2Y8D A;  1SE7 A;  2RPA A;  2YDS A;  2GK9 A;  2X0Y A;  2WWV A;  5AQK B;  3RYF E;  5C8Y E;  4WYV A;  1XDO A;  4CZZ B;  4LFA T;  1D1B A;  2CXF A;  2WY2 A;  4H9S E;  2LRK A;  4UEM A;  4LF7 T;  3VKH A;  5JTG A;  2CLY C;  1ZKE A;  4DR6 T;  5LBQ B;  5F8P A;  4EYY R;  4YY3 T;  4PK4 A;  3EDV A;  4JI7 T;  3ZC1 A;  2DNX A;  3AE2 A;  4TX5 A;  4CN4 A;  2V5C A;  1LVK A;  4I43 B;  1OXZ A;  4MFR A;  3LK3 B;  2BS2 A;  1BR1 A;  2YIN A;  3PJA A;  4H9N C;  4JYA T;  2W4X A;  4IT4 A;  3CWZ B;  4JBW F;  5AQR B;  3B13 A;  1IAP A;  4AQG A;  4HWF A;  4ZI3 D;  2BKP A;  3ONX A;  2BBJ A;  4DV0 T;  4LFB T;  2PTF A;  2WZI A;  3ETU A;  5H6Q B;  5L3E B;  2ZMA A;  3RIA A;  4CI2 B;  3A8Y C;  3DTO A;  2UXX B;  3PUQ A;  4U2Z A;  3FHN A;  2M6I A;  4ASK A;  2KIN B;  4I0U A;  5AQG B;  4DBQ A;  2WWU A;  2V7J A;  4G63 A;  3AB3 B;  1MIY A;  1YKH B;  3C4W A;  3G06 A;  1KNR A;  2WDR A;  3LK4 2;  3OJA A;  3PUG A;  4U3C A;  3ZSS A;  2QRX A;  3NKZ A;  3MA9 A;  4QKN A;  2JMH A;  3KVB A;  1UUS A;  2WU5 A;  4AIU A;  4BAY B;  2FBW A;  5JDM A;  5LYJ E;  4PNI A;  2XSA A;  4KMC A;  4TZ4 C;  4YTN A;  4DMV A;  4LF4 T;  2E2A A;  5AQF B;  2H89 A;  3OTO T;  1WLX A;  3AE1 A;  3PJA J;  3FZK B;  5LBM A;  4O8S A;  3AVR A;  4YSX A;  2IUB A;  1JNZ A;  3CX8 B;  3TLV A;  3VR9 A;  4EED A;  3MZK B;  5EK4 A;  5AQH B;  3OPC A;  3ZLI A;  4DO0 A;  1N36 T;  4COF A;  3ZCJ A;  4JEU B;  1FJG T;  1WCR A;  4TWF A;  3UUB A;  4DMW A;  3GMI A;  2KZ7 B;  3L09 A;  3FXD B;  2PBI A;  2X9Y A;  2XQA A;  3JAF A;  4HFV A;  2J1D G;  2K48 A;  4H9R C;  1R8I A;  2RA1 A;  5HXE A;  1J1J A;  4A98 A;  3KV6 A;  1HR0 T;  3WAJ A;  5FNV E;  3PV0 F;  4AKI A;  4P0B A;  4U2Y A;  2ZM6 T;  1HFA A;  2FJE A;  3QNU A;  4UR9 A;  3RHW A;  3RIU C;  4LF9 T;  5L2L A;  2XJ7 A;  4Z91 A;  4CXY A;  5F5W A;  4HTE A;  4JI8 T;  4YSZ A;  2N1G A;  2LRL A;  3AED A;  2E5L T;  2LSJ A;  3Q5D A;  5KMG P;  2H7V C;  5FY0 A;  2WQY A;  2WDQ A;  3U3I A;  3AA1 B;  5HYA A;  3AA7 B;  3I1A A;  3Q5W A;  1W9R A;  2DWK A;  2CBJ A;  3CQG B;  5TAO A;  5HEH A;  3RRW A;  2LSY A;  1YW0 A;  4JI2 T;  4ILA A;  2JIW A;  4DVD A;  3C4X A;  2BZB A;  2IAK A;  4KHP T;  1WRD A;  1I6Z A;  3ZJ2 A;  3JCF A;  4U31 A;  4AIS A;  3QB5 K;  4HKA A;  3JAE A;  4EIW A;  3ZEF B;  3FXE B;  2XQ3 A;  4BA9 A;  1QUU A;  1CUN A;  4QX7 B;  4WBO A;  4O4I E;  5AQO B;  1S94 A;  3X1D A;  4GKJ T;  4UEL A;  2Y6X A;  1HS7 A;  3PUW F;  1FIO A;  2ODU A;  2X68 A;  3VKG A;  2VKD A;  4O2B E;  3L39 A;  4DR2 T;  1IJ6 A;  2PG8 A;  2FUP A;  2XAS B;  2CWO A;  4NUU A;  2LE8 A;  3HKC E;  3N2O A;  4X65 T;  5HXS A;  2CHO A;  4PFP A;  2C5K T;  3AE9 A;  2OA5 A;  2CPT A;  2W0G A;  1LKX A;  2VKH A;  3RYI E; 
#chains in the Genus database with same CATH homology
 2RP4 A;  1LRZ A;  1BR4 A;  3O1H A;  1NWM X;  2CA5 A;  1HG2 A;  2X9W A;  1HF8 A;  1WYB A;  2WBL A;  2ZLY A;  4M1P A;  4Z8X A;  5FY7 A;  3ETV A;  2JQQ A;  5DQV A;  4YJ3 E;  2Q9Q A;  4ZI3 C;  2CM0 A;  3C51 A;  3HKE E;  5LCY A;  3UT5 E;  3GN5 A;  1MIW A;  4ILU A;  4L5G A;  4PK5 A;  4EB6 E;  2L8K A;  3ESL A;  5LXT E;  5LJM A;  4QX8 B;  2IC6 A;  4OK0 A;  1V9D A;  1VOM A;  2VKJ A;  2DCF A;  5EK2 A;  2ZM2 A;  3ZPO A;  4AKR B;  5JDN A;  1MMG A;  3ZMZ B;  3MXZ A;  3PUS A;  4UF0 B;  2L3L A;  2D2S A;  4ZHQ E;  4TUY E;  4CI1 B;  5FXV A;  4G2A A;  4AXP A;  2P9B A;  3AVS A;  3KV9 A;  2Q9Q D;  4XBF B;  2X51 A;  3LG7 A;  4U74 A;  5JRE A;  3N9P A;  4PJM A;  3LBX B;  2VK9 A;  3AA6 B;  2EHO A;  4JLE A;  3WI3 A;  2H3R A;  4L0R A;  3W15 B;  2V1D B;  4U72 A;  2CEA A;  5JQG E;  3FBL A;  4QXH B;  3O9X A;  4O4L E;  3N9M A;  4E7S A;  4TV8 E;  5LP6 E;  2HPJ A;  2BVM A;  5LJN A;  4IE5 A;  2LOP A;  3C50 A;  3N2G E;  5JRC B;  3FB2 A;  3CPZ A;  3V5S A;  3CVR A;  2NW8 A;  2XAH B;  2MYS A;  2YEV C;  2XAQ B;  2IW5 B;  5HXH A;  3P7I A;  2CLY B;  1H7C A;  3N2K E;  4PAG A;  3LFM A;  3Q9D A;  1ZHC A;  4MLK A;  5JVD E;  2KXP B;  3ZYK A;  3ZCI A;  1MND A;  4IGU A;  2D5U A;  2YU2 A;  3CQC B;  3PUA A;  1U5P A;  4ZS3 A;  4EAH A;  3PUR A;  2UXN B;  1WYC A;  4C91 A;  4UV8 B;  4QHO A;  4OFZ A;  4X1Y E;  5IHY A;  1NAF A;  4GK0 E;  3WAK A;  2Y48 B;  3ANW A;  3LK2 B;  4TN7 B;  3CX6 B;  3HR0 A;  4QWN B;  4YJ2 E;  4CXX A;  3RH3 A;  1FEW A;  1S35 A;  3Q5X A;  4H9P C;  3F57 A;  3IEE A;  3F2E A;  3SOL A;  3UUX B;  3N9O A;  5JR9 B;  4HN9 A;  3I0O A;  4IDZ A;  2G0U A;  3KBT A;  3QUJ A;  2CE7 A;  4OYJ A;  5KDM C;  3DJB A;  3MK7 C;  4EYU A;  3J7Y q;  2MBG A;  3ZMT B;  2KWH A;  3BK9 A;  2N9D A;  1BR2 A;  2LSG A;  1SA0 E;  3N9L A;  2V7I A;  3AA0 B;  2NTX A;  4OHF A;  5FP3 A;  3B57 A;  2WM9 A;  3JC6 D;  2C5J A;  2C5I T;  2DLR A;  2XUE A;  5BMV E;  5CB4 E;  5DQW A;  3CQX C;  5LOV E;  2A2F X;  2ZM8 A;  3IF8 B;  4X20 E;  5HAX A;  2K9A A;  2YK0 A;  5H6R B;  2PJQ A;  3E0Z A;  3NRX A;  3MKD A;  2XTL A;  1WR6 A;  4F6R C;  2SPC A;  4IIJ E;  2CXL A;  1HX8 A;  3K8P C;  3OYX A;  4PJN A;  1G8X A;  1D0X A;  3SS1 A;  2NW9 A;  3U78 A;  1HTJ F;  1QSD A;  1VRB A;  3ZJ1 A;  2KND A;  3F31 A;  3VU7 H;  3Q2M A;  5L3F B;  1MMA A;  2VL8 A;  1T98 A;  2M67 A;  3PTR B;  4GYR A;  2VB6 A;  2QA7 A;  3OYZ A;  2XQY A;  3BQK A;  2E9X B;  3ZMS B;  4DND A;  3V5U A;  1D1A A;  4P0A A;  4O2A E;  2BDE A;  5AFU L;  3KDS E;  2E9X A;  1Z0P A;  2JMK A;  3UUN A;  4QXC B;  4EXT A;  4O4J E;  3KFW X;  4JEH B;  3GWH A;  2KWI B;  2NW7 A;  2V7K A;  3SWH A;  3S4U A;  3O1I A;  4GOU A;  4BJM A;  3PU3 A;  4DBR A;  4O4H E;  2Q9Q C;  1B7T A;  4EZH A;  4I55 E;  2CMR A;  1SHZ C;  4ZI7 E;  2V7M A;  3QC9 A;  3MAC A;  4KBM B;  5E0O A;  2Z6E A;  3ZYL A;  5ADX L;  1AJ3 A;  2NOX A;  4FI5 A;  4ZOL E;  4HGA A;  3AAA B;  4V1A v;  2E9X D;  3BQI A;  5FMN A;  3ZMU B;  2XAJ B;  4PJJ A;  2HH7 A;  3LJC A;  5FXW A;  2ODV A;  3C64 A;  2X66 A;  5LA6 E;  3T8O A;  5CA1 E;  5JR9 A;  5IYZ E;  3ZN0 B;  2W62 A;  4IST A;  5L3D B;  5JDG A;  1ZV4 X;  4IE7 A;  5LHI B;  2JJ9 A;  2NTY A;  4C90 A;  3KBU A;  2X0L B;  4UVB B;  5LGU B;  5J2T E;  2D0T A;  2K5B B;  4GIW A;  2LEH A;  3KIN B;  4UVC B;  3HKD E;  4X1K E;  1O3X A;  3CX7 B;  1IZN B;  5L3G B;  2LSI A;  3RYC E;  4YFS A;  4L9I A;  5JH7 E;  2EHO C;  3OKQ A;  1G73 A;  4IE4 A;  3UUL A;  2X67 A;  2I59 A;  2DWG A;  2LHN A;  3RX6 A;  3VHL A;  1HCI A;  2B1E A;  2LHR A;  2ACX A;  1X79 A;  3K3O A;  3UUM A;  1EZ3 A;  5LGT B;  4MHC A;  5DJQ C;  2LM9 A;  3NZP A;  4H9O C;  3AAE B;  4OYK A;  3RRC A;  3C4Z A;  3N5L A;  4KUM B;  3ZYM A;  4NUV A;  3KV4 A;  5ETW A;  1OWA A;  1UCU A;  5M4Y A;  2C0S A;  3H3A A;  3P8C D;  5LHH B;  5HWX A;  3AAI A;  1LVF A;  4UV9 B;  3NZQ A;  2V7L A;  1E1H B;  4K0U A;  3D0T A;  3TKL B;  3I9W A;  5J1G A;  4AKG A;  4MAL A;  3IHR A;  3I0Q A;  2KMF A;  2N2N A;  3FBZ A;  3E22 E;  3GA8 A;  4HE8 A;  4PW8 A;  3E08 A;  4XZC A;  1FMW A;  2WMO A;  2D0U A;  3HKB E;  2LJL A;  2E8I A;  2V26 A;  3KVA A;  4HEA A;  4EZ4 A;  2VKO A;  1D0Z A;  4IE0 A;  3NRY A;  4KP3 C;  3RC3 A;  4ZI2 D;  1MNE A;  3RYH E;  1KNZ A;  3QK6 A;  4ISS A;  3C98 B;  3R84 B;  5JR9 C;  1D0Y A;  2MTQ A;  1UX4 A;  5JDF A;  2WAU A;  3EUH A;  2YU1 A;  1MMD A;  2ZM0 A;  4GYS A;  5JDH A;  3PU8 A;  4AKH A;  4AI6 A;  4AQF A;  1Y64 B;  3OBV E;  4I50 E;  2WSS V;  2CCQ A;  2W61 A;  4P09 A;  5FYM A;  4E7Z A;  4H63 H;  3IBP A;  3BQL A;  4GK5 E;  5HXR A;  3J9X 1;  4UXN B;  5JRC A;  4CXW A;  4YLH A;  4ZS2 A;  4ADZ A;  3JC6 C;  1BR0 A;  3EDU A;  3LBX A;  3A5X A;  2KLQ A;  4YHJ A;  2L9Q A;  2XAF B;  5LNK A;  5HXC A;  1MMN A;  4PK6 A;  3K3Q C;  5FXX A;  4AQF C;  2Q9Q B;  2JPF A;  3DP7 A;  1US7 B;  5HWY A;  4ERR A;  2X9H A;  4EOZ B;  4IE6 A;  5JDL A;  3K3N A;  4I4T E;  4AKL A;  5L3B B;  4WBN E;  3HL6 A;  3H37 A;  3ZN1 B;  5LGN B;  2K24 A;  1ZEE A;  3R6N A;  5F3J A;  3SRZ A;  4CQI A;  2DHR A;  2NWB A;  2WMN A;  4IHJ E;  4BJN A;  4N78 D;  2A3D A;  5LHG B;  2E9X C;  3KV5 A;  2X9X A;  4UF0 A;  3ZC0 A;  4QXB B;  5EZY E;  1IJ5 A;  3L3P A;  5CA0 E;  1KK7 A;  2CXD A;  4JUY A;  2H7O A;  3PDY A;  5FXZ A;  1FMV A;  4H9Q C;  5FY1 A;  4FJO A;  4CI3 B;  3CML A;  2CWY A;  3GN5 B;  4ZI2 C;  4J2C A;  2A72 A;  3NBX X;  2KT9 A;  1YKE B;  2LSK A;  2EHO B;  4ANJ A;  2PFV A;  3ZMV B;  1YD8 G;  1HG5 A;  1U4Q A;  4B6X A;  3I9Y A;  2LOS A;  3PE0 A;  3N9Q A;  3ANW B;  2DI4 A;  4WW0 A;  3M65 A;  3RC8 A;  1UX5 A;  2EHO D;  3RKO A;  5GON E;  2VWA A;  3O1J A;  5KX5 E;  2W63 A;  2NP9 A;  4PJL A;  5DAB A;  3MJX A;  2XHE B;  5J2U E;  2IC9 A;  2HPL A;  3RPU A;  2LT3 A;  4WNK A;  1D1C A;  4PFO A;  3O4X E;  4A56 A;  3N9N A;  3HI2 A;  4TV9 E;  4X1I E;  3UTK A;  4UVA B;  2XAG B;  2BVL A;  2MOZ A;  2QGS A;  2W00 A;  2JRK A;  3UFE A;  2VAS A;  4H63 V;  5A1L A;  4XAX B;  4MBQ A;  5L3C B;  2ES0 A;  5LG4 A;  5EK3 A;  1MIV A;  4UIG A;  3CKD A;  3EVY A;  5JDQ A;  3HA4 A;  2Y8D A;  2GK9 A;  3RYF E;  5C8Y E;  4CZZ B;  1D1B A;  2CXF A;  4H9S E;  4UEM A;  3VKH A;  2CLY C;  1ZKE A;  5LBQ B;  5F8P A;  4EYY R;  4PK4 A;  3EDV A;  3ZC1 A;  2DNX A;  4TX5 A;  1LVK A;  4I43 B;  1OXZ A;  4MFR A;  3LK3 B;  4H9N C;  1BR1 A;  2YIN A;  3CWZ B;  4ZI3 D;  3B13 A;  1IAP A;  4AQG A;  3ONX A;  3ETU A;  5L3E B;  5H6Q B;  2ZMA A;  4CI2 B;  3DTO A;  2UXX B;  3PUQ A;  3FHN A;  4ASK A;  2KIN B;  4DBQ A;  2WWU A;  2V7J A;  4G63 A;  3AB3 B;  1MIY A;  1YKH B;  3C4W A;  3LK4 2;  3OJA A;  3PUG A;  4QKN A;  3MA9 A;  2JMH A;  3KVB A;  4BAY B;  5JDM A;  5LYJ E;  4PNI A;  4KMC A;  4TZ4 C;  4DMV A;  1WLX A;  5LBM A;  4O8S A;  3AVR A;  3CX8 B;  3MZK B;  5EK4 A;  4DO0 A;  3ZLI A;  3ZCJ A;  4JEU B;  4DMW A;  3GMI A;  2KZ7 B;  3L09 A;  3FXD B;  2PBI A;  2X9Y A;  4HFV A;  2J1D G;  2K48 A;  4H9R C;  2RA1 A;  5HXE A;  3KV6 A;  3WAJ A;  5FNV E;  4AKI A;  4P0B A;  1HFA A;  5L2L A;  4CXY A;  4HTE A;  2N1G A;  2LSJ A;  5KMG P;  2H7V C;  5FY0 A;  3U3I A;  5HYA A;  3AA1 B;  3AA7 B;  3I1A A;  3Q5W A;  2DWK A;  3CQG B;  5TAO A;  3RRW A;  2LSY A;  1YW0 A;  4DVD A;  3C4X A;  2BZB A;  2IAK A;  1WRD A;  3ZJ2 A;  4EIW A;  3ZEF B;  4HKA A;  3FXE B;  4BA9 A;  1QUU A;  1CUN A;  4QX7 B;  4WBO A;  4O4I E;  1S94 A;  1HS7 A;  4UEL A;  2Y6X A;  1FIO A;  2ODU A;  2X68 A;  3VKG A;  2VKD A;  4O2B E;  2XAS B;  2PG8 A;  1IJ6 A;  2CWO A;  4NUU A;  2LE8 A;  3HKC E;  3N2O A;  5HXS A;  4PFP A;  2C5K T;  2OA5 A;  2W0G A;  1LKX A;  2VKH A;  3RYI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...