2CXDA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
b'MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein, TTHA0068
molecule tags Structural genomics, unknown function
source organism Thermus thermophilus
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxdA00
2CXDA 2CWYA
chains in the Genus database with same CATH superfamily
2ZM0A 4ISTA 2RPAA 3JCFA 4C91A 3A5XA 3AE2A 4KP3C 4UIGA 2JMHA 2VB6A 3C50A 5LGUB 2E9XB 2VKHA 5HYAA 3NWIA 3UT5E 2BS4A 4LFCT 3RLFF 2FJAA 4X1YE 2XAHB 4IHJE 2IW5B 4JI3T 4ZXLA 2BG9B 1H7CA 3UU6A 2LSYA 5HAXA 2LEHA 3Q9DA 3ZPOA 1I6ZA 2W67A 4IIJE 4BJNA 4YTMA 3PUAA 2XSBA 3Q5WA 3V5UA 3C4XA 5LYJE 3RRWA 4HWCA 1MNDA 4U2ZA 3KFWX 3J7Yq 3RIUC 1M62A 4F8HA 2VASA 3EDVA 2W00A 3OJAA 4KX6A 4WBOA 3OPCA 4X65T 5AQOB 5LHHB 5LB7B 1XDPA 5LJMA 5JH7E 5EK3A 4HE8A 5FVLA 4NPPA 4EB6E 4O2AE 3ZSSA 1KF6A 3TKLB 2CLYC 2JQHA 4O8SA 3TLSA 3Q5EA 4CI1B 1IBLT 2I6HA 1X79A 3ZKRA 3FZKB 4PJJA 1MIYA 4K0UA 2XQ7A 4IE0A 2NW9A 3W15B 5L3EB 3IHRA 4IDQA 4O4IE 2LHNA 5DABA 1MMDA 1HG2A 2LOPA 1BR2A 2V5CA 2KZ7B 3AEAA 3N9NA 4B6XA 4OX9T 3P4SA 4MLKA 1DU2A 5HWYA 3RPUA 3I0OA 2FUPA 5AQQB 5BMVE 1BR1A 4IL9A 3SOLA 5L3DB 2LSIA 4IDNA 1YQ4A 4X66T 2V7MA 1FIOA 3VR9A 1IJ6A 4YTNA 4DUZT 4JI7T 4P0BA 2DNXA 2Q9QB 3RIUA 4XZCA 5ETWA 5KDMC 3LDQB 1T98A 3EAMA 3VKHA 4AKHA 3FZFB 1S94A 1QSDA 4TNWA 4K0KT 2QGSA 3TLUA 4DMVA 3B57A 3MKDA 3C4WA 5LG3A 1D0XA 5FY0A 2PFVA 3AA0B 2XM2A 5HCMA 3RYHE 3RYFE 2MAWA 3E0ZA 1AJ3A 1L0VA 5AQTB 2VKOA 1N34T 4OK0A 2K48A 3N2KE 4YJ3E 2QA7A 5FYMA 1XDOA 4LMJA 3C51A 2QRXA 4A98A 4HTEA 5ABHA 4Q25A 1VRBA 2WSSV 4NUUA 5L3BB 1FEWA 5H6QB 3HKDE 3AEFA 2Y6XA 2WMOA 4IDOA 2LKHA 2X0HA 4YT0A 5L3GB 4HWIB 3FBZA 3IEEA 2GK9A 2RA1A 3KV9A 4KUMB 1N32T 4AQYT 4JI5T 2YU1A 3CQCB 4QXCB 4DVDA 5JDNA 2UXBT 2Y8DA 3CQXC 3VHLA 5HXSA 2RP4A 2YU2A 3ABVA 3HKBE 4JI1T 3PDYA 1G73A 3KV4A 2LT3A 2A2FX 4PFOA 3QOFA 1KFYA 5AQGB 2NW8A 4EEBA 2JJ9A 4U31A 4LF6T 2YDSA 3C4ZA 3M3ZB 3N2OA 4ZS3A 3MA9A 5ABGA 3RIFA 3AE5A 3SS1A 1WRDA 4MALA 3OBVE 3ZC1A 4DMWA 5CA0E 2VWAA 3FZLB 5LXTE 4H9RC 4N78D 4CN4A 1YKHB 3ONLC 2IMLA 2V7KA 2VK9A 5LCYA 4GKKT 5JQGE 4YLHA 2Z6EA 2H88A 4NXNT 4ZI2D 4OFZA 2CM0A 3F2EA 4QXBB 2BS3A 4TWHA 3K8PC 4LF8T 5H6RB 1FMWA 3RKOA 2ZMAA 4HWHA 3WI3A 3PUSA 2XUEA 4DV3T 2X9XA 4LF4T 4Z8XA 3PUWF 2LRKA 2BG9E 4H9OC 4GKJT 4JI0T 4QXHB 1X9BA 4DV4T 2LJLA 4EZ4A 4LF7T 3ZN0B 1WFDA 2E5LT 4UF0B 4DV2T 4LF5T 3ZYLA 1NEKA 1Z0PA 3PE0A 3FB2A 5KXJA 5LHGB 4JI4T 4B3ST 2NP9A 3UUNA 3PJAJ 3AAEB 4HFDA 2A3DA 4I0UA 3R84B 1HNXT 3JAEA 3PU8A 1JNRA 2CPTA 5EZYE 5CJ5A 4YHHT 1N33T 5GONE 5A1LA 1OEDC 2CE7A 4QKNA 2E2AA 1E1HB 3UUMA 2CXLA 1MIVA 2IDOB 3P4RA 4EXTA 1HX8A 3UULA 3P4QA 2EHOB 2V5DA 4U33A 4JI6T 5ADXL 2KSRA 2XQAA 4I43B 2FJDA 2Q9QD 3P8CD 2W4XA 3UQ4A 4AXPA 2V6XA 4EOZB 3U78A 1D1AA 2ZM6T 2Q9QC 2CHOA 2QVAA 5L2LA 4I50E 4MHCA 2WWVA 5ABFA 4CN6A 5IUXA 4QWNB 1OEDE 1IAPA 2CXDA 3AB3B 1QUUA 3I9YA 4WNKA 2Y48B 5FY1A 4DNDA 2H7VC 5HXEA 2XQ5A 4I55E 5CFBA 2JPFA 1QLBA 3KV5A 5LOVE 1CUNA 1SE7A 2NW7A 1OEDA 3NVOA 3O4XE 4JLEA 4TWFA 3J9X1 3S4UA 5ABFB 2XQ4A 3B5MA 3JC6D 1HFAA 2EHOC 1UX4A 2H3RA 4L5GA 3P4PA 5LMNT 2LSKA 4HWDA 2BKPA 5FL1A 4ZI3D 2C5JA 2WM9A 2WCAA 3RF1A 2MYSA 3PUYF 4HFCA 1XNQT 1HX1B 2IC6A 2WQYA 3RKGA 4ILCA 3AXJA 3GA8A 3QC9A 3AVSA 3E22E 3MJXA 4CI2B 4DIDB 3AE1A 3AE6A 3LJCA 4EAHA 4E7ZA 5FKYA 2WDRA 4ZI2C 1UX5A 2MPKA 4YHJA 2KXPB 5J2TE 2VQET 2WZHA 4DR2T 4F6RC 5JDQA 1KEYA 4WBNE 4LMLA 3UU3A 4ZHQE 3I0QA 5JDMA 2WMNA 1OWAA 4UELA 4LF9T 2E5VA 1YQ3A 1YD8G 3JC6C 3PUGA 4U3CA 4LFAT 4I4TE 4EV6A 1HCIA 1XZYA 1KNRA 2LM9A 4CN1A 4IL4A 3K3OA 5FP3A 3ZT7A 3U3IA 1HNZT 2UU9T 4A5XA 1HTJF 2AE9A 3AEEA 4YSYA 4ILAA 3RYCE 4YTPA 1T72A 4ZZBA 2WBLA 3CX7B 2DWKA 3PUZF 3RQWA 3E08A 1LVKA 4AIUA 4EYYR 4DBQA 4DO0A 4HFVA 2F4VT 4PAGA 2X51A 3RHWA 1US7B 4O4HE 5FNVE 1T7SA 1YKEB 4AISA 5L47A 3UQ7A 2C0SA 2KMFA 3HKEE 3NRYA 4X1IE 3PURA 3ZMZB 3ZYMA 2IUBA 1O3XA 2FBWA 3EDUA 3ETUA 4EZHA 4ZEYA 3QB5A 4UVCB 5JREA 4TWDA 2L3LA 4COFA 1KNPA 2X0YA 2XM1A 2X9YA 4EYUA 4DV1T 3NZQA 5AFUL 4TNVA 5TAOA 3SWHA 4BA9A 3O1IA 5J1GA 1IBKT 2V6YA 3KV6A 2OV9A 4DV6T 2UXCT 5JTGA 2MBGA 2LRLA 2L9QA 2XASB 3L3PA 4PFPA 1IZNB 4QHOA 5LBQB 2CMRA 3RH3A 2UUBT 4DR7T 1WR0A 3IF8B 2A72A 3PUXF 5LJNA 3T1YT 2PBIA 1R8IA 2LSJA 4OYJA 5L3FB 2J4GA 5ABEA 3AXJB 2V8SV 3BK9A 4UVBB 5AQPB 5L4HA 3ZLIA 3X1DA 2XQ6A 1XMQT 3KDSE 2XHEB 1B7TA 3BQLA 3HR0A 3PJAA 3ANWA 4CXYA 2XAJB 3BQIA 4ISSA 2K9AA 5FXWA 4DV0T 3AA7B 2XQ8A 4EGWA 1EZ3A 1W0BA 2CLYB 3B13A 4OYKA 3V5SA 5M4YA 3AE7A 4PJMA 1XMOT 3JADA 3KBUA 2XY8B 5CA1E 2NTXA 2XPKA 2LOSA 4KHZF 4P1NA 3T8OA 3K3QC 5FXVA 5AQRB 3NKZA 1Z8UA 1FMVA 5BR8T 2XSAA 4YSZA 2YN6A 3ONJA 3GN5B 2QYWA 3N9LA 2BG9C 3CK6A 2HPJA 4E7SA 5HXRA 5AQUB 4C90A 2IIUA 2XZEA 3TLVA 2BKOA 2IHR1 4WZXA 1E7PA 4L9IA 2YOEA 3AA6B 2CBJA 5J0ZA 2DWGA 3A7MA 4IGUA 5F3JA 3M65A 5HXHA 2XJ7A 4JUYA 5LP6E 2ODUA 2NTYA 4OHFA 5L4EA 2ACXA 4J2CA 2XAGB 4U72A 3ZT6A 1SUMB 4BJMA 2W0GA 3WAJA 2XQ3A 2PG8A 2E8IA 3N5LA 3LBXA 4KI0F 4H9PC 5F5WA 4H9NC 3UU8A 2W2UA 4JEHB 4A97A 1WR6A 5LGNB 2UUAT 2HPLA 4DBRA 2X9HA 2YKSA 2D5UA 3A8YC 5FVKA 2D0TA 3ZMUB 2WU2A 3P7IA 2WU5A 3AE8A 3EABA 4ZZCA 1LRZA 2DL1A 2D0UA 2KNDA 2ZM8A 3GWHA 2IC9A 4U2YA 2YDQA 2YEVC 3CPZA 4UV9B 4EEDA 1SHZC 3D0TA 2DCFA 4UEMA 3QK6A 2C5IT 2V7JA 2LSGA 2VKJA 1W09A 5LHIB 2BZBA 4L0RA 3DJBA 3ZT5A 5HEUA 4YSXA 4UVAB 3N9OA 3ZN1B 4X5TA 3NRXA 3AVRA 1ZV4X 4NUVA 2CRBA 3RYIE 2R6GF 2X66A 3FXEB 2W62A 3IBPA 1NAFA 3UFGA 3FZMB 3AA1B 4YY3T 4PK5A 4AKRB 4B3RT 3P4WA 1WLXA 1BR0A 3FHNA 3HKCE 5HEGA 3TLWA 1Y64B 3I1AA 4YXDA 3T1HT 1YW0A 2J62A 3MK7C 2HHHT 3FXDB 4V1Av 1UCUA 2B76A 5E0OA 3N9PA 5AQVB 4IDPA 1N36T 3QNUA 3N9QA 4MFRA 1UUSA 3ZEFB 3AECA 4FJOA 4AKGA 3PUQA 1VCTA 4DR6T 5FY7A 3UUXB 3GN5A 3AE9A 5LA6E 1HG5A 2CWYA 3ZJ2A 2JIWA 4TV8E 3OTOT 2UXDT 4DV5T 4AQGA 4U7IA 1HF8A 3ZCIA 2G0UA 2LE8A 2FJBA 3CIRA 2CWOA 2JQQA 1J5ET 3CMLA 4QX7B 3I9WA 4X20E 5HEOA 5HXCA 5DQVA 4X62T 3PU3A 4BAYB 3ZC0A 4IE7A 4JI8T 2W61A 3LK2B 4JV5T 1J1JA 3RI5A 2KLQA 3LG7A 4UXNB 4ZS2A 2KWIB 3K1SA 3KVBA 5CGMA 3F31A 2XTLA 2VVNA 2H7OA 1ZKEA 2LM2A 2YINA 3CQGB 3FZHB 3Q5DA 3ZCJA 3GMIA 4JI2T 4JEUB 4ASKA 2XAFB 3ETVA 4JBWF 1J5WA 4YJ2E 3L8RA 4PJNA 4CI3B 2BG9A 2PTFA 3VRAA 3LFMA 2CXFA 3Q2MA 4H63H 4TUYE 3N2GE 4H63V 4Z91A 1Y01A 2VVSA 2WP9A 4KMCA 3WAKA 5LBMA 3VU7H 4HKAA 2C5KT 5JDLA 2E9XD 5JR9A 4NXMT 4KBMB 2J47A 5IYZE 1WCRA 2WAUA 2V7IA 4KHPT 2E9XA 3QB5K 3MACA 2VL0A 4PK6A 4AQFA 2ACZA 2FJEA 5FL0A 4DR1T 5HWXA 5JR9B 2K5BB 3CVRA 1V9DA 3N9MA 2VURA 4QX8B 2ES0A 2P9BA 5LGTB 3DTOA 3RRCA 5JDGA 4GK0E 5AQSB 1W0AA 3H37A 2N1GA 2ODVA 2NR4A 3ANWB 4IE6A 4WYVA 3AEDA 3ZMVB 5C8YE 4DV7T 1VCSA 1KK7A 2MOZA 3FBLA 5IHYA 4HWFA 4ZI7E 1KNZA 4P09A 1S35A 3DP7A 2OA5A 2V7LA 2YK0A 2DI4A 3ESLA 2N9DA 3QUJA 1GQEA 5AQJB 3RX6A 3UUBA 2MTQA 5KX5E 2BS2A 1ZP0A 2I59A 1MMAA 1T8BA 3AE4A 3ZYKA 1HS7A 4UF0A 3PV0F 4DR3T 5JDHA 4DUYT 1OXZA 2X0LB 3L39A 4QH1A 4LFBT 5JRCA 2CA5A 5FXZA 1MIWA 2LLYA 2X9WA 2X68A 3AEGA 4O2BE 4H9SE 3K3NA 2V6YB 2UXXB 2W63A 3ZJ1A 4TZ4C 2BBHA 2CHNA 2V1DB 3EHZA 2L8KA 3LSVA 4G2AA 4HFHA 2WB5A 2ZM2A 4ILUA 1U5PA 2WZIA 3RQUA 2SPCA 1OEDB 5LMUT 3VKGA 2K3WA 2B1EA 5LG4A 3EI0A 2W66A 3NZPA 4UV8B 2M6IA 3R6NA 3ZSTA 5EK2A 5LNKA 3LK3B 1U4QA 2HN1A 4CXXA 3LBXB 2UXNB 3HL6A 4ZOLE 5F8PA 5FXXA 1BR4A 4CQIA 4YFSA 4GYSA 3RC3A 4M1PA 3OYXA 2HH7A 5AQFB 2Q9QA 5AQKB 1WYBA 4LMKA 3Q5XA 2V26A 3LK42 4G63A 3C98B 4HFEA 5DJQC 3CWZB 2EHOA 3TLTA 3O9XA 2EHOD 1W9RA 2LHRA 1UURA 2JMKA 2VQFT 4XBFB 2DHRA 1NENA 2CCQA 5CB4E 4HEAA 3RIAA 3CX6B 3OVUA 2VL8A 3JAFA 3L09A 4UR9A 1SA0E 3MZKB 4U74A 4FI5A 4O4LE 4PK4A 4QH5A 5JDFA 2XAQB 2WS3A 2AXDS 1NWMX 1YXRA 2JQ9A 5DQWA 4AI6A 3CX8B 4ZI3C 5HEJA 4HFBA 5HEHA 5JVDE 5C3JA 4JYAT 1G8XA 3KBTA 3OKQA 4MBQA 5HCJA 1IBMT 3UU5A 5AQMB 2X67A 4B3TT 1MMNA 2LKGA 2PJQA 4A56A 1XWMA 3F57A 2KINB 4HGAA 2YDRA 4HN9A 1JNZA 3O1JA 5JRCB 4PJLA 2N2NA 3PTRB 4CXWA 4H9QC 1WYCA 4NIQA 5EK4A 5AQLB 1ZOYA 1CHUA 3HI2A 4P0AA 2BDEA 3OYZA 4X64T 4AKIA 4AQFC 4ANJA 3RC8A 2E9XC 3EVYA 1FJGT 3HA4A 4DR5T 4IT4A 3VR8A 4U7YA 4ADZA 2A9UA 2DLRA 3AE3A 4IE5A 4WW0A 5AQIB 2D2SA 2I0MA 2CEAA 3C64A 3PUVF 4ERRA 5JR9C 3VRBA 5KMGP 4EIWA 3UFEA 4QH4A 2XQ9A 1D0ZA 3O1HA 1M7KA 2OLTA 3UTKA 1HR0T 1ZHCA 4PW8A 4TN7B 3SFEA 1D0YA 1UK5A 2BBJA 2K24A 3H3AA 4TV9E 4PNIA 2BVLA 4TX5A 3AEBA 4B3MT 4AKLA 4IREA 2CBIA 2WDVA 4IDZA 4O4JE 1D1BA 3NBXX 3BQKA 1MNEA 2HN2A 4GIWA 2M67A 4ILBA 3EUHA 2H89A 3RGLA 3SRZA 5C2TA 1XNRT 2ZLYA 5L3CB 4GOUA 4CZZB 2D9DA 2M6BA 2WWUA 2JRKA 4Z90A 1MMGA 2IAKA 2NWBA 2WY2A 2VKDA 5AQHB 3ZMSB 1D1CA 2KWHA 4IE4A 1E2AA 1ZEEA 2KT9A 2NOXA 5FMNA 4DR4T 3UU4A 2UUCT 3ZMTB 2WDQA 1I94T 1IJ5A 3MXZA 2JQKA 3G06A 3KVAA 3ONXA 2XQYA 3KINB 4X1KE 4XAXB 3SFDA 1HNWT 3H3MA 3IA3A 3AAIA 4GYRA 2BVMA 5AQNB 1VOMA 2J1DG 4GK5E 3CKDA 2BKNA 4HFIA 5IWAT 3AAAB 5J2UE 1LVFA 1LKXA 1UGOA 3P50A
chains in the Genus database with same CATH topology
2ZM0A 4ISTA 4C91A 4P0AA 3A5XA 4KP3C 4UIGA 5LGUB 2JMHA 2VB6A 3C50A 2E9XB 2VKHA 5HYAA 3UT5E 4X1YE 2XAHB 4IHJE 2IW5B 1H7CA 2LSYA 5HAXA 2LEHA 3Q9DA 3ZPOA 4IIJE 4BJNA 3PUAA 3Q5WA 3V5UA 5LYJE 3C4XA 3RRWA 1MNDA 3KFWX 3J7Yq 2VASA 3EDVA 2W00A 3OJAA 4WBOA 5LHHB 5LJMA 5JH7E 5EK3A 4HE8A 4EB6E 4O2AE 3TKLB 2CLYC 4O8SA 4CI1B 1X79A 4PJJA 1MIYA 4K0UA 3W15B 4IE0A 2NW9A 5L3EB 3IHRA 4O4IE 2LHNA 5DABA 1MMDA 1HG2A 2LOPA 1BR2A 2KZ7B 4B6XA 3N9NA 4MLKA 5HWYA 3RPUA 3I0OA 5BMVE 1BR1A 3SOLA 2LSIA 2V7MA 1FIOA 1IJ6A 4P0BA 2DNXA 2Q9QB 4XZCA 5ETWA 5KDMC 3VKHA 1T98A 4AKHA 1S94A 1QSDA 2QGSA 4DMVA 3B57A 3MKDA 3C4WA 1D0XA 5FY0A 2PFVA 3AA0B 3RYHE 3RYFE 3E0ZA 1AJ3A 2VKOA 4OK0A 2K48A 3N2KE 4YJ3E 2QA7A 5FYMA 3C51A 4HTEA 1VRBA 2WSSV 4NUUA 5L3BB 1FEWA 5H6QB 3HKDE 2Y6XA 2WMOA 5L3GB 3FBZA 3IEEA 2GK9A 2RA1A 3KV9A 4KUMB 2YU1A 3CQCB 4QXCB 4DVDA 5JDNA 2Y8DA 3CQXC 3VHLA 5HXSA 2RP4A 2YU2A 3HKBE 3PDYA 1G73A 3KV4A 2LT3A 2A2FX 4PFOA 2NW8A 2JJ9A 3C4ZA 3N2OA 4ZS3A 3MA9A 3SS1A 1WRDA 4MALA 3OBVE 4DMWA 5CA0E 2VWAA 5LXTE 4H9RC 4N78D 1YKHB 2V7KA 2VK9A 5LCYA 5JQGE 4YLHA 2Z6EA 4ZI2D 4OFZA 2CM0A 3F2EA 4QXBB 3WI3A 3K8PC 5H6RB 1FMWA 3RKOA 2ZMAA 3PUSA 2XUEA 2X9XA 4Z8XA 4H9OC 4QXHB 2LJLA 4EZ4A 3ZN0B 4UF0B 3ZYLA 1Z0PA 5LHGB 3PE0A 3FB2A 2NP9A 3UUNA 3AAEB 2A3DA 3R84B 3PU8A 5EZYE 5GONE 2CE7A 4QKNA 1E1HB 3UUMA 2CXLA 1MIVA 4EXTA 1HX8A 3UULA 2EHOB 4I43B 4AXPA 2Q9QD 3P8CD 4EOZB 3U78A 1D1AA 2Q9QC 5L2LA 4I50E 4MHCA 4QWNB 1IAPA 2CXDA 3AB3B 1QUUA 3I9YA 4WNKA 2Y48B 5FY1A 4DNDA 2H7VC 5HXEA 4I55E 2JPFA 3KV5A 5LOVE 1CUNA 4YJ2E 2NW7A 3O4XE 4JLEA 3S4UA 3J9X1 3JC6D 1HFAA 2EHOC 1UX4A 2H3RA 4L5GA 2LSKA 4ZI3D 2C5JA 2WM9A 2MYSA 2IC6A 3GA8A 3QC9A 3AVSA 3E22E 3MJXA 4CI2B 4E7ZA 4EAHA 3LJCA 4ZI2C 1UX5A 4YHJA 5J2TE 2KXPB 4F6RC 5JDQA 4WBNE 4ZHQE 3I0QA 5JDMA 2WMNA 1OWAA 4UELA 1YD8G 3JC6C 3PUGA 4I4TE 1HCIA 2LM9A 3K3OA 5FP3A 3U3IA 1HTJF 3RYCE 2WBLA 3CX7B 2DWKA 4EYYR 3E08A 1LVKA 4DBQA 4DO0A 4HFVA 4PAGA 2X51A 1US7B 4O4HE 5FNVE 1YKEB 2C0SA 2KMFA 3HKEE 3NRYA 4X1IE 3PURA 3ZMZB 3ZYMA 3EDUA 1O3XA 3ETUA 4EZHA 5JREA 4UVCB 2L3LA 2X9YA 4EYUA 3NZQA 5AFUL 5TAOA 3SWHA 4BA9A 3O1IA 5J1GA 3KV6A 2MBGA 2L9QA 2XASB 3L3PA 4PFPA 1IZNB 4QHOA 5LBQB 2CMRA 3RH3A 3IF8B 2A72A 5LJNA 2PBIA 2LSJA 4OYJA 5L3FB 3BK9A 4UVBB 3ZLIA 3KDSE 2XHEB 1B7TA 3BQLA 3HR0A 3ANWA 4CXYA 2XAJB 3BQIA 4ISSA 2K9AA 5FXWA 3AA7B 5M4YA 1EZ3A 2CLYB 3V5SA 3B13A 4OYKA 4PJMA 3KBUA 5CA1E 2NTXA 2LOSA 3T8OA 3K3QC 5FXVA 1FMVA 3GN5B 3N9LA 2HPJA 4E7SA 5HXRA 4C90A 4L9IA 3AA6B 2DWGA 4IGUA 5F3JA 5LP6E 3M65A 5HXHA 4JUYA 2ODUA 2NTYA 4OHFA 2ACXA 4J2CA 2XAGB 4U72A 4BJMA 3WAJA 2W0GA 2PG8A 2E8IA 3N5LA 3LBXA 4H9PC 4H9NC 4JEHB 5LGNB 1WR6A 2HPLA 4DBRA 2X9HA 2D5UA 2D0TA 3ZMUB 3P7IA 1LRZA 2D0UA 2KNDA 2ZM8A 3GWHA 2IC9A 4UV9B 3CPZA 2YEVC 1SHZC 3D0TA 2DCFA 4UEMA 3QK6A 2C5IT 2V7JA 2LSGA 2VKJA 5LHIB 2BZBA 4L0RA 3DJBA 4UVAB 3N9OA 3ZN1B 3NRXA 3AVRA 1ZV4X 4NUVA 3RYIE 2X66A 3FXEB 2W62A 3IBPA 1NAFA 3AA1B 4PK5A 4AKRB 1BR0A 1WLXA 3FHNA 3HKCE 1Y64B 3I1AA 1YW0A 3MK7C 3FXDB 4V1Av 1UCUA 5E0OA 3N9PA 3ZEFB 3N9QA 4MFRA 4AKGA 4FJOA 3PUQA 5FY7A 3UUXB 3GN5A 5LA6E 1HG5A 2CWYA 3ZJ2A 4TV8E 4AQGA 1HF8A 2G0UA 2LE8A 2CWOA 2JQQA 3CMLA 4QX7B 3I9WA 4X20E 5HXCA 5DQVA 3PU3A 4BAYB 3ZC0A 4IE7A 2W61A 3LK2B 2KLQA 3LG7A 4UXNB 4ZS2A 2KWIB 3KVBA 3F31A 2XTLA 3CQGB 2H7OA 1ZKEA 2YINA 3ZCJA 4ASKA 3GMIA 4JEUB 2XAFB 3ETVA 5ADXL 4PJNA 4CI3B 3LFMA 2CXFA 3Q2MA 4H63H 4TUYE 3N2GE 4H63V 4KMCA 3WAKA 5LBMA 3VU7H 4HKAA 2C5KT 5JDLA 2E9XD 5JR9A 4KBMB 5IYZE 2WAUA 2V7IA 2E9XA 3MACA 4PK6A 4AQFA 5HWXA 5JR9B 2K5BB 3CVRA 1V9DA 3N9MA 4QX8B 2ES0A 2P9BA 5LGTB 3DTOA 3RRCA 5JDGA 4GK0E 3H37A 2N1GA 2ODVA 3ANWB 4IE6A 5C8YE 3ZMVB 1KNZA 5IHYA 1KK7A 2MOZA 3FBLA 4ZI7E 4P09A 3ESLA 3DP7A 1S35A 2OA5A 2V7LA 2DI4A 2YK0A 2N9DA 3QUJA 3RX6A 5KX5E 5L3DB 2MTQA 2I59A 1MMAA 3ZYKA 1HS7A 4UF0A 5JDHA 5JRCA 1OXZA 2X0LB 2CA5A 5FXZA 1MIWA 2X9WA 4O2BE 2X68A 4H9SE 3K3NA 2UXXB 2W63A 3ZJ1A 4TZ4C 2V1DB 4G2AA 4ILUA 5A1LA 2L8KA 2ZM2A 1U5PA 2SPCA 3VKGA 2B1EA 5LG4A 3R6NA 3NZPA 4UV8B 5EK2A 5LNKA 3LK3B 1U4QA 4CXXA 3LBXB 2UXNB 3HL6A 4ZOLE 5F8PA 5FXXA 1BR4A 4CQIA 4YFSA 4GYSA 3RC3A 4M1PA 3OYXA 2HH7A 2Q9QA 1WYBA 3Q5XA 2V26A 3LK42 4G63A 3C98B 5DJQC 3CWZB 2EHOA 3O9XA 2EHOD 2LHRA 2JMKA 4XBFB 2DHRA 2CCQA 5CB4E 4HEAA 3CX6B 2VL8A 3L09A 1SA0E 3MZKB 4U74A 4FI5A 4O4LE 4PK4A 5JDFA 2XAQB 1NWMX 5DQWA 4AI6A 3CX8B 4ZI3C 5JVDE 1G8XA 3KBTA 3OKQA 4MBQA 2X67A 1MMNA 2PJQA 4A56A 3F57A 4HGAA 2KINB 4HN9A 3O1JA 5JRCB 4PJLA 2N2NA 3PTRB 4CXWA 4H9QC 1WYCA 5EK4A 3HI2A 2BDEA 3OYZA 4AKIA 4AQFC 4ANJA 3RC8A 2E9XC 3EVYA 3HA4A 4ADZA 2DLRA 4IE5A 4WW0A 4ERRA 2D2SA 3C64A 2CEAA 5JR9C 5KMGP 4EIWA 3UFEA 1D0ZA 3O1HA 3UTKA 1ZHCA 4PW8A 4TN7B 1D0YA 3H3AA 4TV9E 2K24A 4TX5A 4PNIA 2BVLA 4AKLA 4IDZA 4O4JE 1D1BA 3NBXX 3BQKA 1MNEA 4GIWA 3SRZA 2M67A 3ZC1A 3EUHA 2ZLYA 5L3CB 4GOUA 4CZZB 2WWUA 2JRKA 1MMGA 2IAKA 2NWBA 3ZMSB 2VKDA 1D1CA 2KWHA 4IE4A 2KT9A 1ZEEA 5FMNA 2NOXA 3ZMTB 1IJ5A 3MXZA 3KVAA 3ONXA 2XQYA 3KINB 4X1KE 4XAXB 3AAIA 4GYRA 2BVMA 1VOMA 2J1DG 4GK5E 3CKDA 3AAAB 5J2UE 1LVFA 1LKXA 3ZCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXD A;  2CWY A; 
#chains in the Genus database with same CATH topology
 2ZM0 A;  4IST A;  2RPA A;  3JCF A;  4C91 A;  3A5X A;  3AE2 A;  4KP3 C;  4UIG A;  2JMH A;  2VB6 A;  3C50 A;  5LGU B;  2E9X B;  2VKH A;  5HYA A;  3NWI A;  3UT5 E;  2BS4 A;  4LFC T;  3RLF F;  2FJA A;  4X1Y E;  2XAH B;  4IHJ E;  2IW5 B;  4JI3 T;  4ZXL A;  2BG9 B;  1H7C A;  3UU6 A;  2LSY A;  5HAX A;  2LEH A;  3Q9D A;  3ZPO A;  1I6Z A;  2W67 A;  4IIJ E;  4BJN A;  4YTM A;  3PUA A;  2XSB A;  3Q5W A;  3V5U A;  3C4X A;  5LYJ E;  3RRW A;  4HWC A;  1MND A;  4U2Z A;  3KFW X;  3J7Y q;  3RIU C;  1M62 A;  4F8H A;  2VAS A;  3EDV A;  2W00 A;  3OJA A;  4KX6 A;  4WBO A;  3OPC A;  4X65 T;  5AQO B;  5LHH B;  5LB7 B;  1XDP A;  5LJM A;  5JH7 E;  5EK3 A;  4HE8 A;  5FVL A;  4NPP A;  4EB6 E;  4O2A E;  3ZSS A;  1KF6 A;  3TKL B;  2CLY C;  2JQH A;  4O8S A;  3TLS A;  3Q5E A;  4CI1 B;  1IBL T;  2I6H A;  1X79 A;  3ZKR A;  3FZK B;  4PJJ A;  1MIY A;  4K0U A;  2XQ7 A;  4IE0 A;  2NW9 A;  3W15 B;  5L3E B;  3IHR A;  4IDQ A;  4O4I E;  2LHN A;  5DAB A;  1MMD A;  1HG2 A;  2LOP A;  1BR2 A;  2V5C A;  2KZ7 B;  3AEA A;  3N9N A;  4B6X A;  4OX9 T;  3P4S A;  4MLK A;  1DU2 A;  5HWY A;  3RPU A;  3I0O A;  2FUP A;  5AQQ B;  5BMV E;  1BR1 A;  4IL9 A;  3SOL A;  5L3D B;  2LSI A;  4IDN A;  1YQ4 A;  4X66 T;  2V7M A;  1FIO A;  3VR9 A;  1IJ6 A;  4YTN A;  4DUZ T;  4JI7 T;  4P0B A;  2DNX A;  2Q9Q B;  3RIU A;  4XZC A;  5ETW A;  5KDM C;  3LDQ B;  1T98 A;  3EAM A;  3VKH A;  4AKH A;  3FZF B;  1S94 A;  1QSD A;  4TNW A;  4K0K T;  2QGS A;  3TLU A;  4DMV A;  3B57 A;  3MKD A;  3C4W A;  5LG3 A;  1D0X A;  5FY0 A;  2PFV A;  3AA0 B;  2XM2 A;  5HCM A;  3RYH E;  3RYF E;  2MAW A;  3E0Z A;  1AJ3 A;  1L0V A;  5AQT B;  2VKO A;  1N34 T;  4OK0 A;  2K48 A;  3N2K E;  4YJ3 E;  2QA7 A;  5FYM A;  1XDO A;  4LMJ A;  3C51 A;  2QRX A;  4A98 A;  4HTE A;  5ABH A;  4Q25 A;  1VRB A;  2WSS V;  4NUU A;  5L3B B;  1FEW A;  5H6Q B;  3HKD E;  3AEF A;  2Y6X A;  2WMO A;  4IDO A;  2LKH A;  2X0H A;  4YT0 A;  5L3G B;  4HWI B;  3FBZ A;  3IEE A;  2GK9 A;  2RA1 A;  3KV9 A;  4KUM B;  1N32 T;  4AQY T;  4JI5 T;  2YU1 A;  3CQC B;  4QXC B;  4DVD A;  5JDN A;  2UXB T;  2Y8D A;  3CQX C;  3VHL A;  5HXS A;  2RP4 A;  2YU2 A;  3ABV A;  3HKB E;  4JI1 T;  3PDY A;  1G73 A;  3KV4 A;  2LT3 A;  2A2F X;  4PFO A;  3QOF A;  1KFY A;  5AQG B;  2NW8 A;  4EEB A;  2JJ9 A;  4U31 A;  4LF6 T;  2YDS A;  3C4Z A;  3M3Z B;  3N2O A;  4ZS3 A;  3MA9 A;  5ABG A;  3RIF A;  3AE5 A;  3SS1 A;  1WRD A;  4MAL A;  3OBV E;  3ZC1 A;  4DMW A;  5CA0 E;  2VWA A;  3FZL B;  5LXT E;  4H9R C;  4N78 D;  4CN4 A;  1YKH B;  3ONL C;  2IML A;  2V7K A;  2VK9 A;  5LCY A;  4GKK T;  5JQG E;  4YLH A;  2Z6E A;  2H88 A;  4NXN T;  4ZI2 D;  4OFZ A;  2CM0 A;  3F2E A;  4QXB B;  2BS3 A;  4TWH A;  3K8P C;  4LF8 T;  5H6R B;  1FMW A;  3RKO A;  2ZMA A;  4HWH A;  3WI3 A;  3PUS A;  2XUE A;  4DV3 T;  2X9X A;  4LF4 T;  4Z8X A;  3PUW F;  2LRK A;  2BG9 E;  4H9O C;  4GKJ T;  4JI0 T;  4QXH B;  1X9B A;  4DV4 T;  2LJL A;  4EZ4 A;  4LF7 T;  3ZN0 B;  1WFD A;  2E5L T;  4UF0 B;  4DV2 T;  4LF5 T;  3ZYL A;  1NEK A;  1Z0P A;  3PE0 A;  3FB2 A;  5KXJ A;  5LHG B;  4JI4 T;  4B3S T;  2NP9 A;  3UUN A;  3PJA J;  3AAE B;  4HFD A;  2A3D A;  4I0U A;  3R84 B;  1HNX T;  3JAE A;  3PU8 A;  1JNR A;  2CPT A;  5EZY E;  5CJ5 A;  4YHH T;  1N33 T;  5GON E;  5A1L A;  1OED C;  2CE7 A;  4QKN A;  2E2A A;  1E1H B;  3UUM A;  2CXL A;  1MIV A;  2IDO B;  3P4R A;  4EXT A;  1HX8 A;  3UUL A;  3P4Q A;  2EHO B;  2V5D A;  4U33 A;  4JI6 T;  5ADX L;  2KSR A;  2XQA A;  4I43 B;  2FJD A;  2Q9Q D;  3P8C D;  2W4X A;  3UQ4 A;  4AXP A;  2V6X A;  4EOZ B;  3U78 A;  1D1A A;  2ZM6 T;  2Q9Q C;  2CHO A;  2QVA A;  5L2L A;  4I50 E;  4MHC A;  2WWV A;  5ABF A;  4CN6 A;  5IUX A;  4QWN B;  1OED E;  1IAP A;  2CXD A;  3AB3 B;  1QUU A;  3I9Y A;  4WNK A;  2Y48 B;  5FY1 A;  4DND A;  2H7V C;  5HXE A;  2XQ5 A;  4I55 E;  5CFB A;  2JPF A;  1QLB A;  3KV5 A;  5LOV E;  1CUN A;  1SE7 A;  2NW7 A;  1OED A;  3NVO A;  3O4X E;  4JLE A;  4TWF A;  3J9X 1;  3S4U A;  5ABF B;  2XQ4 A;  3B5M A;  3JC6 D;  1HFA A;  2EHO C;  1UX4 A;  2H3R A;  4L5G A;  3P4P A;  5LMN T;  2LSK A;  4HWD A;  2BKP A;  5FL1 A;  4ZI3 D;  2C5J A;  2WM9 A;  2WCA A;  3RF1 A;  2MYS A;  3PUY F;  4HFC A;  1XNQ T;  1HX1 B;  2IC6 A;  2WQY A;  3RKG A;  4ILC A;  3AXJ A;  3GA8 A;  3QC9 A;  3AVS A;  3E22 E;  3MJX A;  4CI2 B;  4DID B;  3AE1 A;  3AE6 A;  3LJC A;  4EAH A;  4E7Z A;  5FKY A;  2WDR A;  4ZI2 C;  1UX5 A;  2MPK A;  4YHJ A;  2KXP B;  5J2T E;  2VQE T;  2WZH A;  4DR2 T;  4F6R C;  5JDQ A;  1KEY A;  4WBN E;  4LML A;  3UU3 A;  4ZHQ E;  3I0Q A;  5JDM A;  2WMN A;  1OWA A;  4UEL A;  4LF9 T;  2E5V A;  1YQ3 A;  1YD8 G;  3JC6 C;  3PUG A;  4U3C A;  4LFA T;  4I4T E;  4EV6 A;  1HCI A;  1XZY A;  1KNR A;  2LM9 A;  4CN1 A;  4IL4 A;  3K3O A;  5FP3 A;  3ZT7 A;  3U3I A;  1HNZ T;  2UU9 T;  4A5X A;  1HTJ F;  2AE9 A;  3AEE A;  4YSY A;  4ILA A;  3RYC E;  4YTP A;  1T72 A;  4ZZB A;  2WBL A;  3CX7 B;  2DWK A;  3PUZ F;  3RQW A;  3E08 A;  1LVK A;  4AIU A;  4EYY R;  4DBQ A;  4DO0 A;  4HFV A;  2F4V T;  4PAG A;  2X51 A;  3RHW A;  1US7 B;  4O4H E;  5FNV E;  1T7S A;  1YKE B;  4AIS A;  5L47 A;  3UQ7 A;  2C0S A;  2KMF A;  3HKE E;  3NRY A;  4X1I E;  3PUR A;  3ZMZ B;  3ZYM A;  2IUB A;  1O3X A;  2FBW A;  3EDU A;  3ETU A;  4EZH A;  4ZEY A;  3QB5 A;  4UVC B;  5JRE A;  4TWD A;  2L3L A;  4COF A;  1KNP A;  2X0Y A;  2XM1 A;  2X9Y A;  4EYU A;  4DV1 T;  3NZQ A;  5AFU L;  4TNV A;  5TAO A;  3SWH A;  4BA9 A;  3O1I A;  5J1G A;  1IBK T;  2V6Y A;  3KV6 A;  2OV9 A;  4DV6 T;  2UXC T;  5JTG A;  2MBG A;  2LRL A;  2L9Q A;  2XAS B;  3L3P A;  4PFP A;  1IZN B;  4QHO A;  5LBQ B;  2CMR A;  3RH3 A;  2UUB T;  4DR7 T;  1WR0 A;  3IF8 B;  2A72 A;  3PUX F;  5LJN A;  3T1Y T;  2PBI A;  1R8I A;  2LSJ A;  4OYJ A;  5L3F B;  2J4G A;  5ABE A;  3AXJ B;  2V8S V;  3BK9 A;  4UVB B;  5AQP B;  5L4H A;  3ZLI A;  3X1D A;  2XQ6 A;  1XMQ T;  3KDS E;  2XHE B;  1B7T A;  3BQL A;  3HR0 A;  3PJA A;  3ANW A;  4CXY A;  2XAJ B;  3BQI A;  4ISS A;  2K9A A;  5FXW A;  4DV0 T;  3AA7 B;  2XQ8 A;  4EGW A;  1EZ3 A;  1W0B A;  2CLY B;  3B13 A;  4OYK A;  3V5S A;  5M4Y A;  3AE7 A;  4PJM A;  1XMO T;  3JAD A;  3KBU A;  2XY8 B;  5CA1 E;  2NTX A;  2XPK A;  2LOS A;  4KHZ F;  4P1N A;  3T8O A;  3K3Q C;  5FXV A;  5AQR B;  3NKZ A;  1Z8U A;  1FMV A;  5BR8 T;  2XSA A;  4YSZ A;  2YN6 A;  3ONJ A;  3GN5 B;  2QYW A;  3N9L A;  2BG9 C;  3CK6 A;  2HPJ A;  4E7S A;  5HXR A;  5AQU B;  4C90 A;  2IIU A;  2XZE A;  3TLV A;  2BKO A;  2IHR 1;  4WZX A;  1E7P A;  4L9I A;  2YOE A;  3AA6 B;  2CBJ A;  5J0Z A;  2DWG A;  3A7M A;  4IGU A;  5F3J A;  3M65 A;  5HXH A;  2XJ7 A;  4JUY A;  5LP6 E;  2ODU A;  2NTY A;  4OHF A;  5L4E A;  2ACX A;  4J2C A;  2XAG B;  4U72 A;  3ZT6 A;  1SUM B;  4BJM A;  2W0G A;  3WAJ A;  2XQ3 A;  2PG8 A;  2E8I A;  3N5L A;  3LBX A;  4KI0 F;  4H9P C;  5F5W A;  4H9N C;  3UU8 A;  2W2U A;  4JEH B;  4A97 A;  1WR6 A;  5LGN B;  2UUA T;  2HPL A;  4DBR A;  2X9H A;  2YKS A;  2D5U A;  3A8Y C;  5FVK A;  2D0T A;  3ZMU B;  2WU2 A;  3P7I A;  2WU5 A;  3AE8 A;  3EAB A;  4ZZC A;  1LRZ A;  2DL1 A;  2D0U A;  2KND A;  2ZM8 A;  3GWH A;  2IC9 A;  4U2Y A;  2YDQ A;  2YEV C;  3CPZ A;  4UV9 B;  4EED A;  1SHZ C;  3D0T A;  2DCF A;  4UEM A;  3QK6 A;  2C5I T;  2V7J A;  2LSG A;  2VKJ A;  1W09 A;  5LHI B;  2BZB A;  4L0R A;  3DJB A;  3ZT5 A;  5HEU A;  4YSX A;  4UVA B;  3N9O A;  3ZN1 B;  4X5T A;  3NRX A;  3AVR A;  1ZV4 X;  4NUV A;  2CRB A;  3RYI E;  2R6G F;  2X66 A;  3FXE B;  2W62 A;  3IBP A;  1NAF A;  3UFG A;  3FZM B;  3AA1 B;  4YY3 T;  4PK5 A;  4AKR B;  4B3R T;  3P4W A;  1WLX A;  1BR0 A;  3FHN A;  3HKC E;  5HEG A;  3TLW A;  1Y64 B;  3I1A A;  4YXD A;  3T1H T;  1YW0 A;  2J62 A;  3MK7 C;  2HHH T;  3FXD B;  4V1A v;  1UCU A;  2B76 A;  5E0O A;  3N9P A;  5AQV B;  4IDP A;  1N36 T;  3QNU A;  3N9Q A;  4MFR A;  1UUS A;  3ZEF B;  3AEC A;  4FJO A;  4AKG A;  3PUQ A;  1VCT A;  4DR6 T;  5FY7 A;  3UUX B;  3GN5 A;  3AE9 A;  5LA6 E;  1HG5 A;  2CWY A;  3ZJ2 A;  2JIW A;  4TV8 E;  3OTO T;  2UXD T;  4DV5 T;  4AQG A;  4U7I A;  1HF8 A;  3ZCI A;  2G0U A;  2LE8 A;  2FJB A;  3CIR A;  2CWO A;  2JQQ A;  1J5E T;  3CML A;  4QX7 B;  3I9W A;  4X20 E;  5HEO A;  5HXC A;  5DQV A;  4X62 T;  3PU3 A;  4BAY B;  3ZC0 A;  4IE7 A;  4JI8 T;  2W61 A;  3LK2 B;  4JV5 T;  1J1J A;  3RI5 A;  2KLQ A;  3LG7 A;  4UXN B;  4ZS2 A;  2KWI B;  3K1S A;  3KVB A;  5CGM A;  3F31 A;  2XTL A;  2VVN A;  2H7O A;  1ZKE A;  2LM2 A;  2YIN A;  3CQG B;  3FZH B;  3Q5D A;  3ZCJ A;  3GMI A;  4JI2 T;  4JEU B;  4ASK A;  2XAF B;  3ETV A;  4JBW F;  1J5W A;  4YJ2 E;  3L8R A;  4PJN A;  4CI3 B;  2BG9 A;  2PTF A;  3VRA A;  3LFM A;  2CXF A;  3Q2M A;  4H63 H;  4TUY E;  3N2G E;  4H63 V;  4Z91 A;  1Y01 A;  2VVS A;  2WP9 A;  4KMC A;  3WAK A;  5LBM A;  3VU7 H;  4HKA A;  2C5K T;  5JDL A;  2E9X D;  5JR9 A;  4NXM T;  4KBM B;  2J47 A;  5IYZ E;  1WCR A;  2WAU A;  2V7I A;  4KHP T;  2E9X A;  3QB5 K;  3MAC A;  2VL0 A;  4PK6 A;  4AQF A;  2ACZ A;  2FJE A;  5FL0 A;  4DR1 T;  5HWX A;  5JR9 B;  2K5B B;  3CVR A;  1V9D A;  3N9M A;  2VUR A;  4QX8 B;  2ES0 A;  2P9B A;  5LGT B;  3DTO A;  3RRC A;  5JDG A;  4GK0 E;  5AQS B;  1W0A A;  3H37 A;  2N1G A;  2ODV A;  2NR4 A;  3ANW B;  4IE6 A;  4WYV A;  3AED A;  3ZMV B;  5C8Y E;  4DV7 T;  1VCS A;  1KK7 A;  2MOZ A;  3FBL A;  5IHY A;  4HWF A;  4ZI7 E;  1KNZ A;  4P09 A;  1S35 A;  3DP7 A;  2OA5 A;  2V7L A;  2YK0 A;  2DI4 A;  3ESL A;  2N9D A;  3QUJ A;  1GQE A;  5AQJ B;  3RX6 A;  3UUB A;  2MTQ A;  5KX5 E;  2BS2 A;  1ZP0 A;  2I59 A;  1MMA A;  1T8B A;  3AE4 A;  3ZYK A;  1HS7 A;  4UF0 A;  3PV0 F;  4DR3 T;  5JDH A;  4DUY T;  1OXZ A;  2X0L B;  3L39 A;  4QH1 A;  4LFB T;  5JRC A;  2CA5 A;  5FXZ A;  1MIW A;  2LLY A;  2X9W A;  2X68 A;  3AEG A;  4O2B E;  4H9S E;  3K3N A;  2V6Y B;  2UXX B;  2W63 A;  3ZJ1 A;  4TZ4 C;  2BBH A;  2CHN A;  2V1D B;  3EHZ A;  2L8K A;  3LSV A;  4G2A A;  4HFH A;  2WB5 A;  2ZM2 A;  4ILU A;  1U5P A;  2WZI A;  3RQU A;  2SPC A;  1OED B;  5LMU T;  3VKG A;  2K3W A;  2B1E A;  5LG4 A;  3EI0 A;  2W66 A;  3NZP A;  4UV8 B;  2M6I A;  3R6N A;  3ZST A;  5EK2 A;  5LNK A;  3LK3 B;  1U4Q A;  2HN1 A;  4CXX A;  3LBX B;  2UXN B;  3HL6 A;  4ZOL E;  5F8P A;  5FXX A;  1BR4 A;  4CQI A;  4YFS A;  4GYS A;  3RC3 A;  4M1P A;  3OYX A;  2HH7 A;  5AQF B;  2Q9Q A;  5AQK B;  1WYB A;  4LMK A;  3Q5X A;  2V26 A;  3LK4 2;  4G63 A;  3C98 B;  4HFE A;  5DJQ C;  3CWZ B;  2EHO A;  3TLT A;  3O9X A;  2EHO D;  1W9R A;  2LHR A;  1UUR A;  2JMK A;  2VQF T;  4XBF B;  2DHR A;  1NEN A;  2CCQ A;  5CB4 E;  4HEA A;  3RIA A;  3CX6 B;  3OVU A;  2VL8 A;  3JAF A;  3L09 A;  4UR9 A;  1SA0 E;  3MZK B;  4U74 A;  4FI5 A;  4O4L E;  4PK4 A;  4QH5 A;  5JDF A;  2XAQ B;  2WS3 A;  2AXD S;  1NWM X;  1YXR A;  2JQ9 A;  5DQW A;  4AI6 A;  3CX8 B;  4ZI3 C;  5HEJ A;  4HFB A;  5HEH A;  5JVD E;  5C3J A;  4JYA T;  1G8X A;  3KBT A;  3OKQ A;  4MBQ A;  5HCJ A;  1IBM T;  3UU5 A;  5AQM B;  2X67 A;  4B3T T;  1MMN A;  2LKG A;  2PJQ A;  4A56 A;  1XWM A;  3F57 A;  2KIN B;  4HGA A;  2YDR A;  4HN9 A;  1JNZ A;  3O1J A;  5JRC B;  4PJL A;  2N2N A;  3PTR B;  4CXW A;  4H9Q C;  1WYC A;  4NIQ A;  5EK4 A;  5AQL B;  1ZOY A;  1CHU A;  3HI2 A;  4P0A A;  2BDE A;  3OYZ A;  4X64 T;  4AKI A;  4AQF C;  4ANJ A;  3RC8 A;  2E9X C;  3EVY A;  1FJG T;  3HA4 A;  4DR5 T;  4IT4 A;  3VR8 A;  4U7Y A;  4ADZ A;  2A9U A;  2DLR A;  3AE3 A;  4IE5 A;  4WW0 A;  5AQI B;  2D2S A;  2I0M A;  2CEA A;  3C64 A;  3PUV F;  4ERR A;  5JR9 C;  3VRB A;  5KMG P;  4EIW A;  3UFE A;  4QH4 A;  2XQ9 A;  1D0Z A;  3O1H A;  1M7K A;  2OLT A;  3UTK A;  1HR0 T;  1ZHC A;  4PW8 A;  4TN7 B;  3SFE A;  1D0Y A;  1UK5 A;  2BBJ A;  2K24 A;  3H3A A;  4TV9 E;  4PNI A;  2BVL A;  4TX5 A;  3AEB A;  4B3M T;  4AKL A;  4IRE A;  2CBI A;  2WDV A;  4IDZ A;  4O4J E;  1D1B A;  3NBX X;  3BQK A;  1MNE A;  2HN2 A;  4GIW A;  2M67 A;  4ILB A;  3EUH A;  2H89 A;  3RGL A;  3SRZ A;  5C2T A;  1XNR T;  2ZLY A;  5L3C B;  4GOU A;  4CZZ B;  2D9D A;  2M6B A;  2WWU A;  2JRK A;  4Z90 A;  1MMG A;  2IAK A;  2NWB A;  2WY2 A;  2VKD A;  5AQH B;  3ZMS B;  1D1C A;  2KWH A;  4IE4 A;  1E2A A;  1ZEE A;  2KT9 A;  2NOX A;  5FMN A;  4DR4 T;  3UU4 A;  2UUC T;  3ZMT B;  2WDQ A;  1I94 T;  1IJ5 A;  3MXZ A;  2JQK A;  3G06 A;  3KVA A;  3ONX A;  2XQY A;  3KIN B;  4X1K E;  4XAX B;  3SFD A;  1HNW T;  3H3M A;  3IA3 A;  3AAI A;  4GYR A;  2BVM A;  5AQN B;  1VOM A;  2J1D G;  4GK5 E;  3CKD A;  2BKN A;  4HFI A;  5IWA T;  3AAA B;  5J2U E;  1LVF A;  1LKX A;  1UGO A;  3P50 A; 
#chains in the Genus database with same CATH homology
 2ZM0 A;  4IST A;  4C91 A;  4P0A A;  3A5X A;  4KP3 C;  4UIG A;  5LGU B;  2JMH A;  2VB6 A;  3C50 A;  2E9X B;  2VKH A;  5HYA A;  3UT5 E;  4X1Y E;  2XAH B;  4IHJ E;  2IW5 B;  1H7C A;  2LSY A;  5HAX A;  2LEH A;  3Q9D A;  3ZPO A;  4IIJ E;  4BJN A;  3PUA A;  3Q5W A;  3V5U A;  5LYJ E;  3C4X A;  3RRW A;  1MND A;  3KFW X;  3J7Y q;  2VAS A;  3EDV A;  2W00 A;  3OJA A;  4WBO A;  5LHH B;  5LJM A;  5JH7 E;  5EK3 A;  4HE8 A;  4EB6 E;  4O2A E;  3TKL B;  2CLY C;  4O8S A;  4CI1 B;  1X79 A;  4PJJ A;  1MIY A;  4K0U A;  3W15 B;  4IE0 A;  2NW9 A;  5L3E B;  3IHR A;  4O4I E;  2LHN A;  5DAB A;  1MMD A;  1HG2 A;  2LOP A;  1BR2 A;  2KZ7 B;  4B6X A;  3N9N A;  4MLK A;  5HWY A;  3RPU A;  3I0O A;  5BMV E;  1BR1 A;  3SOL A;  2LSI A;  2V7M A;  1FIO A;  1IJ6 A;  4P0B A;  2DNX A;  2Q9Q B;  4XZC A;  5ETW A;  5KDM C;  3VKH A;  1T98 A;  4AKH A;  1S94 A;  1QSD A;  2QGS A;  4DMV A;  3B57 A;  3MKD A;  3C4W A;  1D0X A;  5FY0 A;  2PFV A;  3AA0 B;  3RYH E;  3RYF E;  3E0Z A;  1AJ3 A;  2VKO A;  4OK0 A;  2K48 A;  3N2K E;  4YJ3 E;  2QA7 A;  5FYM A;  3C51 A;  4HTE A;  1VRB A;  2WSS V;  4NUU A;  5L3B B;  1FEW A;  5H6Q B;  3HKD E;  2Y6X A;  2WMO A;  5L3G B;  3FBZ A;  3IEE A;  2GK9 A;  2RA1 A;  3KV9 A;  4KUM B;  2YU1 A;  3CQC B;  4QXC B;  4DVD A;  5JDN A;  2Y8D A;  3CQX C;  3VHL A;  5HXS A;  2RP4 A;  2YU2 A;  3HKB E;  3PDY A;  1G73 A;  3KV4 A;  2LT3 A;  2A2F X;  4PFO A;  2NW8 A;  2JJ9 A;  3C4Z A;  3N2O A;  4ZS3 A;  3MA9 A;  3SS1 A;  1WRD A;  4MAL A;  3OBV E;  4DMW A;  5CA0 E;  2VWA A;  5LXT E;  4H9R C;  4N78 D;  1YKH B;  2V7K A;  2VK9 A;  5LCY A;  5JQG E;  4YLH A;  2Z6E A;  4ZI2 D;  4OFZ A;  2CM0 A;  3F2E A;  4QXB B;  3WI3 A;  3K8P C;  5H6R B;  1FMW A;  3RKO A;  2ZMA A;  3PUS A;  2XUE A;  2X9X A;  4Z8X A;  4H9O C;  4QXH B;  2LJL A;  4EZ4 A;  3ZN0 B;  4UF0 B;  3ZYL A;  1Z0P A;  5LHG B;  3PE0 A;  3FB2 A;  2NP9 A;  3UUN A;  3AAE B;  2A3D A;  3R84 B;  3PU8 A;  5EZY E;  5GON E;  2CE7 A;  4QKN A;  1E1H B;  3UUM A;  2CXL A;  1MIV A;  4EXT A;  1HX8 A;  3UUL A;  2EHO B;  4I43 B;  4AXP A;  2Q9Q D;  3P8C D;  4EOZ B;  3U78 A;  1D1A A;  2Q9Q C;  5L2L A;  4I50 E;  4MHC A;  4QWN B;  1IAP A;  2CXD A;  3AB3 B;  1QUU A;  3I9Y A;  4WNK A;  2Y48 B;  5FY1 A;  4DND A;  2H7V C;  5HXE A;  4I55 E;  2JPF A;  3KV5 A;  5LOV E;  1CUN A;  4YJ2 E;  2NW7 A;  3O4X E;  4JLE A;  3S4U A;  3J9X 1;  3JC6 D;  1HFA A;  2EHO C;  1UX4 A;  2H3R A;  4L5G A;  2LSK A;  4ZI3 D;  2C5J A;  2WM9 A;  2MYS A;  2IC6 A;  3GA8 A;  3QC9 A;  3AVS A;  3E22 E;  3MJX A;  4CI2 B;  4E7Z A;  4EAH A;  3LJC A;  4ZI2 C;  1UX5 A;  4YHJ A;  5J2T E;  2KXP B;  4F6R C;  5JDQ A;  4WBN E;  4ZHQ E;  3I0Q A;  5JDM A;  2WMN A;  1OWA A;  4UEL A;  1YD8 G;  3JC6 C;  3PUG A;  4I4T E;  1HCI A;  2LM9 A;  3K3O A;  5FP3 A;  3U3I A;  1HTJ F;  3RYC E;  2WBL A;  3CX7 B;  2DWK A;  4EYY R;  3E08 A;  1LVK A;  4DBQ A;  4DO0 A;  4HFV A;  4PAG A;  2X51 A;  1US7 B;  4O4H E;  5FNV E;  1YKE B;  2C0S A;  2KMF A;  3HKE E;  3NRY A;  4X1I E;  3PUR A;  3ZMZ B;  3ZYM A;  3EDU A;  1O3X A;  3ETU A;  4EZH A;  5JRE A;  4UVC B;  2L3L A;  2X9Y A;  4EYU A;  3NZQ A;  5AFU L;  5TAO A;  3SWH A;  4BA9 A;  3O1I A;  5J1G A;  3KV6 A;  2MBG A;  2L9Q A;  2XAS B;  3L3P A;  4PFP A;  1IZN B;  4QHO A;  5LBQ B;  2CMR A;  3RH3 A;  3IF8 B;  2A72 A;  5LJN A;  2PBI A;  2LSJ A;  4OYJ A;  5L3F B;  3BK9 A;  4UVB B;  3ZLI A;  3KDS E;  2XHE B;  1B7T A;  3BQL A;  3HR0 A;  3ANW A;  4CXY A;  2XAJ B;  3BQI A;  4ISS A;  2K9A A;  5FXW A;  3AA7 B;  5M4Y A;  1EZ3 A;  2CLY B;  3V5S A;  3B13 A;  4OYK A;  4PJM A;  3KBU A;  5CA1 E;  2NTX A;  2LOS A;  3T8O A;  3K3Q C;  5FXV A;  1FMV A;  3GN5 B;  3N9L A;  2HPJ A;  4E7S A;  5HXR A;  4C90 A;  4L9I A;  3AA6 B;  2DWG A;  4IGU A;  5F3J A;  5LP6 E;  3M65 A;  5HXH A;  4JUY A;  2ODU A;  2NTY A;  4OHF A;  2ACX A;  4J2C A;  2XAG B;  4U72 A;  4BJM A;  3WAJ A;  2W0G A;  2PG8 A;  2E8I A;  3N5L A;  3LBX A;  4H9P C;  4H9N C;  4JEH B;  5LGN B;  1WR6 A;  2HPL A;  4DBR A;  2X9H A;  2D5U A;  2D0T A;  3ZMU B;  3P7I A;  1LRZ A;  2D0U A;  2KND A;  2ZM8 A;  3GWH A;  2IC9 A;  4UV9 B;  3CPZ A;  2YEV C;  1SHZ C;  3D0T A;  2DCF A;  4UEM A;  3QK6 A;  2C5I T;  2V7J A;  2LSG A;  2VKJ A;  5LHI B;  2BZB A;  4L0R A;  3DJB A;  4UVA B;  3N9O A;  3ZN1 B;  3NRX A;  3AVR A;  1ZV4 X;  4NUV A;  3RYI E;  2X66 A;  3FXE B;  2W62 A;  3IBP A;  1NAF A;  3AA1 B;  4PK5 A;  4AKR B;  1BR0 A;  1WLX A;  3FHN A;  3HKC E;  1Y64 B;  3I1A A;  1YW0 A;  3MK7 C;  3FXD B;  4V1A v;  1UCU A;  5E0O A;  3N9P A;  3ZEF B;  3N9Q A;  4MFR A;  4AKG A;  4FJO A;  3PUQ A;  5FY7 A;  3UUX B;  3GN5 A;  5LA6 E;  1HG5 A;  2CWY A;  3ZJ2 A;  4TV8 E;  4AQG A;  1HF8 A;  2G0U A;  2LE8 A;  2CWO A;  2JQQ A;  3CML A;  4QX7 B;  3I9W A;  4X20 E;  5HXC A;  5DQV A;  3PU3 A;  4BAY B;  3ZC0 A;  4IE7 A;  2W61 A;  3LK2 B;  2KLQ A;  3LG7 A;  4UXN B;  4ZS2 A;  2KWI B;  3KVB A;  3F31 A;  2XTL A;  3CQG B;  2H7O A;  1ZKE A;  2YIN A;  3ZCJ A;  4ASK A;  3GMI A;  4JEU B;  2XAF B;  3ETV A;  5ADX L;  4PJN A;  4CI3 B;  3LFM A;  2CXF A;  3Q2M A;  4H63 H;  4TUY E;  3N2G E;  4H63 V;  4KMC A;  3WAK A;  5LBM A;  3VU7 H;  4HKA A;  2C5K T;  5JDL A;  2E9X D;  5JR9 A;  4KBM B;  5IYZ E;  2WAU A;  2V7I A;  2E9X A;  3MAC A;  4PK6 A;  4AQF A;  5HWX A;  5JR9 B;  2K5B B;  3CVR A;  1V9D A;  3N9M A;  4QX8 B;  2ES0 A;  2P9B A;  5LGT B;  3DTO A;  3RRC A;  5JDG A;  4GK0 E;  3H37 A;  2N1G A;  2ODV A;  3ANW B;  4IE6 A;  5C8Y E;  3ZMV B;  1KNZ A;  5IHY A;  1KK7 A;  2MOZ A;  3FBL A;  4ZI7 E;  4P09 A;  3ESL A;  3DP7 A;  1S35 A;  2OA5 A;  2V7L A;  2DI4 A;  2YK0 A;  2N9D A;  3QUJ A;  3RX6 A;  5KX5 E;  5L3D B;  2MTQ A;  2I59 A;  1MMA A;  3ZYK A;  1HS7 A;  4UF0 A;  5JDH A;  5JRC A;  1OXZ A;  2X0L B;  2CA5 A;  5FXZ A;  1MIW A;  2X9W A;  4O2B E;  2X68 A;  4H9S E;  3K3N A;  2UXX B;  2W63 A;  3ZJ1 A;  4TZ4 C;  2V1D B;  4G2A A;  4ILU A;  5A1L A;  2L8K A;  2ZM2 A;  1U5P A;  2SPC A;  3VKG A;  2B1E A;  5LG4 A;  3R6N A;  3NZP A;  4UV8 B;  5EK2 A;  5LNK A;  3LK3 B;  1U4Q A;  4CXX A;  3LBX B;  2UXN B;  3HL6 A;  4ZOL E;  5F8P A;  5FXX A;  1BR4 A;  4CQI A;  4YFS A;  4GYS A;  3RC3 A;  4M1P A;  3OYX A;  2HH7 A;  2Q9Q A;  1WYB A;  3Q5X A;  2V26 A;  3LK4 2;  4G63 A;  3C98 B;  5DJQ C;  3CWZ B;  2EHO A;  3O9X A;  2EHO D;  2LHR A;  2JMK A;  4XBF B;  2DHR A;  2CCQ A;  5CB4 E;  4HEA A;  3CX6 B;  2VL8 A;  3L09 A;  1SA0 E;  3MZK B;  4U74 A;  4FI5 A;  4O4L E;  4PK4 A;  5JDF A;  2XAQ B;  1NWM X;  5DQW A;  4AI6 A;  3CX8 B;  4ZI3 C;  5JVD E;  1G8X A;  3KBT A;  3OKQ A;  4MBQ A;  2X67 A;  1MMN A;  2PJQ A;  4A56 A;  3F57 A;  4HGA A;  2KIN B;  4HN9 A;  3O1J A;  5JRC B;  4PJL A;  2N2N A;  3PTR B;  4CXW A;  4H9Q C;  1WYC A;  5EK4 A;  3HI2 A;  2BDE A;  3OYZ A;  4AKI A;  4AQF C;  4ANJ A;  3RC8 A;  2E9X C;  3EVY A;  3HA4 A;  4ADZ A;  2DLR A;  4IE5 A;  4WW0 A;  4ERR A;  2D2S A;  3C64 A;  2CEA A;  5JR9 C;  5KMG P;  4EIW A;  3UFE A;  1D0Z A;  3O1H A;  3UTK A;  1ZHC A;  4PW8 A;  4TN7 B;  1D0Y A;  3H3A A;  4TV9 E;  2K24 A;  4TX5 A;  4PNI A;  2BVL A;  4AKL A;  4IDZ A;  4O4J E;  1D1B A;  3NBX X;  3BQK A;  1MNE A;  4GIW A;  3SRZ A;  2M67 A;  3ZC1 A;  3EUH A;  2ZLY A;  5L3C B;  4GOU A;  4CZZ B;  2WWU A;  2JRK A;  1MMG A;  2IAK A;  2NWB A;  3ZMS B;  2VKD A;  1D1C A;  2KWH A;  4IE4 A;  2KT9 A;  1ZEE A;  5FMN A;  2NOX A;  3ZMT B;  1IJ5 A;  3MXZ A;  3KVA A;  3ONX A;  2XQY A;  3KIN B;  4X1K E;  4XAX B;  3AAI A;  4GYR A;  2BVM A;  1VOM A;  2J1D G;  4GK5 E;  3CKD A;  3AAA B;  5J2U E;  1LVF A;  1LKX A;  3ZCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...