2CXDA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein, TTHA0068
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxdA00
2CXDA 2CWYA
chains in the Genus database with same CATH superfamily
5AQOB 3AEDA 1W9RA 3NRXA 3KVAA 4AQYT 4HFHA 4U3CA 1HX1B 1SUMB 3R6NA 3PE0A 2V6XA 4DUZT 1OWAA 2XTLA 4ZI7E 1V9DA 2DL1A 4IHJE 3N5LA 4GK5E 2X9XA 1M62A 2LSJA 1MIVA 3JC6D 3QK6A 3RF1A 3ZMSB 1BR0A 2CHNA 2ACZA 2NOXA 4QH1A 4MLKA 4DR6T 2N2NA 2IMLA 3SFDA 2J1DG 2CM0A 5LCYA 2VKJA 1WYCA 4DR4T 4HFCA 1XWMA 4YTMA 1YQ3A 5LNKA 5FVLA 3QOFA 2HPJA 1IBKT 5AQUB 3PDYA 3RIAA 5L4EA 4CI1B 2AE9A 3GA8A 2YDSA 5C2TA 4Z91A 2IC9A 2BZBA 2PFVA 2XQ6A 3U3IA 2V8SV 3X1DA 2Q9QA 3HKCE 3NZPA 3Q5XA 2IUBA 3ANWB 5M4YA 4HKAA 2HN1A 3AE7A 2V5DA 2KWHA 2LHNA 3RRCA 3K3OA 4UXNB 1XDOA 1GQEA 1ZV4X 2XQYA 5FVKA 1KFYA 2A72A 2WSSV 2CE7A 2LJLA 5F8PA 3KDSE 3Q5DA 4ZHQE 4B3MT 2CCQA 3KFWX 4DV5T 4EEDA 1XNQT 4DUYT 1E1HB 4HFBA 5J2TE 3ZSSA 3P4PA 4TV9E 3KVBA 4BA9A 2VKDA 3PUSA 2XAFB 4UV8B 4JYAT 1HG5A 4U31A 5FY0A 1UX4A 4AQGA 1XNRT 4I0UA 3ZJ1A 2NR4A 2PJQA 5CA0E 4UF0B 3WAJA 4L9IA 1T8BA 4UVCB 4GOUA 2I0MA 2ZM2A 2NTXA 3K8PC 5AQGB 4AQFA 1KNPA 2BG9C 2BS4A 2N9DA 1SA0E 4IREA 2I59A 4QWNB 2QA7A 4QX8B 5EK2A 2WAUA 5DJQC 1IZNB 1HX8A 5HXCA 4HFVA 4EXTA 3HR0A 2OV9A 3TKLB 3QUJA 4Z8XA 5J0ZA 3I0OA 4JI5T 3RPUA 4GYRA 3LBXA 2UXDT 4KP3C 1YKEB 3RGLA 1KEYA 3KBUA 3HA4A 2XHEB 3ZC0A 3ONLC 5LOVE 1J5ET 3LFMA 5LMUT 4CN6A 1I94T 5JDHA 5AQFB 1BR1A 2VKHA 1UGOA 1WR6A 4LFBT 2P9BA 4IE5A 4X1IE 4DR7T 2E8IA 4NUUA 4BAYB 4AXPA 4P0AA 3JAFA 1VRBA 2XJ7A 5LB7B 3AA7B 4EYUA 4TWDA 1YQ4A 4HTEA 2BS2A 2M6IA 2WZHA 2RPAA 5FKYA 3P4QA 5FY1A 4AKRB 3RHWA 3P4WA 3LJCA 2BDEA 2VURA 4ILCA 2AXDS 2YEVC 4ZZCA 3UU4A 4YY3T 5IUXA 3FXDB 5JQGE 4H63V 5FL1A 4JBWF 2VASA 2JRKA 3AXJA 4OX9T 4CXXA 5KMGP 2PTFA 1Z0PA 1YKHB 4GIWA 1N32T 5KDMC 2D9DA 2FJEA 5L3FB 2SPCA 3QNUA 2J62A 4UELA 3UU3A 2V26A 2A2FX 1HFAA 4UV9B 2XY8B 5AQNB 4JI7T 2H7OA 2NW8A 4TX5A 2LRKA 2NWBA 2JQHA 5L3EB 3E08A 2KXPB 4DV4T 5LXTE 4IE7A 5LJNA 3TLVA 4JI6T 4ZI3D 3RIFA 3AAAB 3P4SA 3BK9A 4ADZA 2YU1A 5LHIB 3GN5A 5FY7A 4HGAA 5HXSA 2XSBA 4J2CA 4BJMA 3CX7B 2V7IA 5AQTB 2UXBT 2H7VC 2Q9QC 2LSGA 2IW5B 3ZN1B 2W00A 2XAJB 1HS7A 3UQ7A 1QLBA 2A3DA 1HCIA 2CBIA 3CKDA 2VQFT 4JI4T 4HFIA 5EK3A 3ZN0B 4NXMT 5L3GB 5AQHB 2XQ3A 4JI2T 1WLXA 2LT3A 3AB3B 1HNWT 4FI5A 4EIWA 4DR3T 1MIWA 2E5VA 3ZYLA 5BR8T 4TWFA 1OEDC 4YHJA 5JREA 4A5XA 3TLWA 4LF8T 4YSXA 3RKGA 2Z6EA 3EDUA 1LKXA 1MNDA 3N2KE 3EI0A 2Q9QB 4YSYA 2XQ7A 4WYVA 1WRDA 2MYSA 1CHUA 2D2SA 1XMQT 3PU8A 5FXWA 3AEBA 4U7IA 2KMFA 3CIRA 2IIUA 4U2YA 2X0HA 2NP9A 4H9PC 4CQIA 3CQGB 5FL0A 2KT9A 4CN4A 5ADXL 4AISA 3D0TA 4AIUA 2NTYA 3IHRA 3ZCJA 2E9XD 3NKZA 3VKGA 2KLQA 4JV5T 4YTPA 1MNEA 2JMKA 1J5WA 2D0TA 4CZZB 3AECA 2FJDA 3PUAA 3RX6A 1ZP0A 4JUYA 1FIOA 4ZOLE 4JEUB 3K3NA 5HAXA 3T1YT 5C3JA 3MZKB 2XAHB 4JEHB 1H7CA 3LDQB 4ANJA 2UXNB 2WMNA 1G8XA 3PUGA 3KV5A 4TNWA 2LHRA 5EK4A 4O2AE 2FBWA 4TZ4C 2JQ9A 3ZSTA 2JMHA 5FYMA 2EHOC 1D0YA 5AQRB 4YTNA 4A56A 5HXRA 3M3ZB 3NZQA 3L09A 3HKDE 1X79A 2W67A 1MMNA 5HEUA 5FXVA 3ZYKA 3ZMVB 2WQYA 1CUNA 3HKBE 2X67A 5LGUB 1HNXT 2OA5A 2CXDA 1UURA 5ABHA 3LBXB 4Z90A 5H6QB 5HEGA 3OVUA 4HWIB 3N9LA 1Y64B 2K5BB 4I50E 4JLEA 1T72A 2UU9T 3RYIE 4U74A 3F31A 4EYYR 2C5JA 3C64A 2KSRA 4ZZBA 3H3MA 2GK9A 3GWHA 4G2AA 2WM9A 5KX5E 3DP7A 4PJLA 2UXXB 1HG2A 2WB5A 3RC8A 2IC6A 4ILBA 4GKKT 4Q25A 4DO0A 2KWIB 1NENA 3NWIA 4L5GA 5F5WA 5FXZA 3JC6C 1QSDA 3SS1A 2IHR1 5JDGA 3PUYF 4L0RA 3C4WA 4U7YA 4DMWA 1D1BA 4H63H 3AXJB 1N34T 2XAQB 4AKIA 4K0UA 5AQSB 2WMOA 5DABA 3AAIA 3KBTA 3VKHA 2DWKA 4F6RC 1G73A 3U78A 1VCSA 4YLHA 3HKEE 5L3BB 3M65A 3EAMA 3UTKA 5FNVE 4ILUA 1AJ3A 1OEDA 2VKOA 2LOPA 3J7Yq 3VR9A 5HYAA 1VOMA 4LF7T 3PUQA 3T8OA 3F2EA 5JRCA 1NEKA 2BVLA 3ETVA 3GN5B 2L9QA 3P50A 3PURA 3ZT7A 1W0AA 2DI4A 4O4LE 4TNVA 3P4RA 4DIDB 3JAEA 4DR5T 4BJNA 3J9X1 3K3QC 2DLRA 5ABFB 5BMVE 3PJAJ 2W61A 4EZHA 2UUCT 3MA9A 3H3AA 4X20E 4ZI2D 5HXHA 2IAKA 4YSZA 2LSIA 4LF4T 2WDRA 1D0XA 2ACXA 1YW0A 4OYJA 5ABEA 3OTOT 4HE8A 3CPZA 1N33T 3NBXX 3V5SA 3A8YC 2ZM6T 2FJBA 4TUYE 4IDNA 2WZIA 1D1AA 3E0ZA 3ZCIA 3RIUA 3VR8A 3UU5A 3HL6A 4N78D 3O9XA 4PFOA 2OLTA 4HFDA 4WW0A 2ES0A 3F57A 4H9SE 3AE1A 5CB4E 3AVSA 2BG9B 2E9XA 2BBHA 3SWHA 3RRWA 2EHOA 4YJ2E 3UUNA 2BKNA 5HWYA 2RP4A 2E5LT 2DNXA 4OK0A 3O4XE 4KMCA 4U33A 4AKHA 4H9RC 1WCRA 2CEAA 2CBJA 4NIQA 2WU2A 4O2BE 5J1GA 3WAKA 2CWOA 4K0KT 1D1CA 5JDFA 2CXFA 4TWHA 3RYFE 4TV8E 3S4UA 2V7LA 3EUHA 2UUAT 3BQKA 2V1DB 4V1Av 3P7IA 1E7PA 4U72A 5AFUL 4ZS3A 1MMAA 3ESLA 2YN6A 2W4XA 5EZYE 4A97A 2V7KA 4LFAT 1J1JA 2D5UA 4PJNA 5HEHA 3VRBA 4DVDA 2F4VT 1E2AA 1UX5A 3AE4A 1T7SA 5KXJA 3RI5A 2C5IT 2HPLA 2CA5A 4ISTA 2WWUA 1X9BA 2YINA 5JR9C 3N9MA 2ODVA 5LHGB 4KUMB 4PNIA 1L0VA 2WU5A 3C51A 4I55E 3I0QA 3UU6A 3AE8A 3IEEA 5JH7E 1VCTA 2MTQA 3RKOA 2WS3A 2X68A 3ZT5A 2YOEA 3RYHE 3L8RA 1SE7A 2LEHA 3UQ4A 4KHPT 1W09A 3V5UA 4OYKA 2WWVA 2KZ7B 2Y48B 1NWMX 2QGSA 3DTOA 3ZMTB 4B3RT 3E22E 2LSYA 3AA1B 3EHZA 3LSVA 2BS3A 2V6YA 4ZI3C 3ZC1A 3RLFF 3FZMB 4DV3T 2BKPA 4NPPA 5AQMB 3AEEA 5AQPB 3RH3A 1OXZA 2X9HA 2MPKA 4DBRA 2XAGB 3UUBA 3AE2A 1ZEEA 5JDLA 3VU7H 1FMVA 1NAFA 2LOSA 3H37A 2LM2A 2VVNA 5LGNB 2HH7A 1N36T 2X0YA 3C98B 4WZXA 2HN2A 3N2OA 4X1KE 3ZPOA 4PFPA 2CRBA 4EB6E 2W62A 4IDPA 4DNDA 2V7MA 1HTJF 2VB6A 4IE4A 3VHLA 2WCAA 5TAOA 3AEGA 4ISSA 4YXDA 1IAPA 4O4HE 5JDNA 2X51A 5GONE 3RQUA 2CLYC 2X66A 4ILAA 4ZEYA 2CXLA 2BG9E 3AA0B 1JNRA 4XAXB 4H9OC 1UUSA 3NVOA 2XZEA 4M1PA 2WP9A 3MK7C 1OEDB 4PK5A 4EEBA 1HR0T 4DMVA 2LSKA 4QXBB 5JRCB 4KHZF 3LK42 1WYBA 2B76A 3RIUC 2MBGA 3CX6B 4X64T 3I9YA 4PK6A 1ZKEA 3FHNA 4CXYA 3VRAA 4HWDA 3MXZA 2E9XC 4MALA 5LG3A 4JI8T 4F8HA 3SFEA 4KBMB 5LYJE 4CN1A 5ETWA 3ZKRA 3CMLA 4E7ZA 4IDZA 2YU2A 3C4XA 1KK7A 4DV1T 4CI3B 4B3TT 5JTGA 1Z8UA 3QB5A 5HXEA 2XUEA 1LVFA 1IJ5A 4QH4A 4O4JE 4P0BA 3FXEB 3KV9A 4MFRA 1ZOYA 1MIYA 3Q5EA 4MBQA 2ZLYA 3UT5E 3N9QA 3EVYA 4COFA 3RC3A 4U2ZA 3ZLIA 2N1GA 1WR0A 1JNZA 3ZEFB 2HHHT 4JI1T 4HN9A 1EZ3A 2QYWA 2KINB 2XQ8A 2E9XB 4JI3T 1XZYA 3AVRA 1KNRA 3PV0F 4PJMA 2EHOB 4HFEA 5JR9A 3AE6A 4KI0F 1Y01A 3W15B 3Q2MA 4IL4A 5HEOA 2ZMAA 4G63A 3B5MA 2Y6XA 4ASKA 1U4QA 2JJ9A 3KV6A 4LF9T 3AE5A 2JQQA 2XM2A 4IT4A 1LVKA 3WI3A 4EZ4A 3OBVE 2DWGA 2KNDA 2PBIA 3JADA 5LA6E 2CPTA 2X9WA 3CVRA 5IWAT 2WBLA 3K1SA 4PK4A 1QUUA 3QC9A 1M7KA 4HWCA 4B3ST 4AKGA 4EOZB 5AQLB 4HEAA 4EAHA 5AQQB 2J47A 5IHYA 1BR2A 3C50A 1BR4A 4IIJE 3IF8B 3R84B 4O8SA 4IE6A 2VL0A 5AQJB 3MJXA 1T98A 1S35A 3OJAA 2A9UA 4LF6T 2BVMA 1YXRA 2V7JA 2J4GA 3AEFA 2BKOA 2WDVA 1MMGA 1B7TA 2JQKA 2VL8A 4KX6A 3TLUA 1I6ZA 2XSAA 3UU8A 3N2GE 5CFBA 5L3DB 3NRYA 4LMJA 3CQCB 4DV6T 3QB5K 3RYCE 3MKDA 3N9OA 1OEDE 3LK2B 5HCMA 3FBLA 2JIWA 4QHOA 4OFZA 3Q9DA 5DQWA 2XQAA 2M6BA 2LM9A 3ZMZB 1IBLT 5CGMA 3PU3A 2FJAA 2XM1A 3IA3A 4GYSA 3L3PA 4E7SA 1FJGT 3UUMA 4QH5A 2V6YB 3AE3A 3SRZA 1WFDA 3IBPA 3OPCA 5JVDE 2I6HA 2H3RA 3CWZB 4WBOA 3KINB 3GMIA 4YJ3E 5LBQB 4PAGA 5AQKB 2W66A 3FB2A 5LP6E 1U5PA 3BQLA 4DR1T 3ONJA 2K3WA 4ZI2C 3RQWA 2W2UA 4MHCA 1W0BA 2LKGA 3EDVA 2CHOA 4LFCT 4JI0T 3P8CD 5AQVB 2VQET 5LJMA 3TLTA 3ZMUB 2B1EA 3N9PA 4UVBB 3SOLA 3ZYMA 4HWFA 1IJ6A 3CQXC 5ABGA 5FP3A 3UFGA 2XQ9A 1XDPA 2VWAA 3LK3B 3ANWA 1UK5A 3G06A 3AEAA 2DCFA 2XASB 3ZT6A 5AQIB 3OYXA 2PG8A 4OHFA 4H9NC 1KF6A 3O1HA 3UFEA 2NW9A 3Q5WA 2JPFA 2M67A 4NXNT 2LE8A 5H6RB 3FZLB 3MACA 4DBQA 2K9AA 4FJOA 2K48A 4X5TA 4GK0E 5F3JA 5E0OA 2VK9A 4P1NA 2Q9QD 2L3LA 2LLYA 2X0LB 4WNKA 2K24A 3PUVF 1MMDA 1D0ZA 4IE0A 4DV0T 2MAWA 2CMRA 4LMKA 5FXXA 5FMNA 1FEWA 4UR9A 4DV2T 4UIGA 5A1LA 4C91A 2ZM8A 4O4IE 3AA6B 2G0UA 2YDRA 2XQ5A 2L8KA 3PTRB 2BBJA 4YT0A 2W0GA 5JDQA 4TN7B 4ERRA 4UF0A 3UULA 2YKSA 3JCFA 4UEMA 3ETUA 5ABFA 5HEJA 3FBZA 5L47A 3AE9A 1HNZT 4NUVA 4IL9A 5LHHB 3AAEB 2DHRA 1US7B 2H89A 2UXCT 4IDOA 1SHZC 2Y8DA 3A7MA 2RA1A 1ZHCA 4LMLA 2NW7A 2LRLA 1HF8A 3A5XA 3TLSA 3UUXB 2D0UA 5JR9B 4GKJT 3BQIA 5CJ5A 4UVAB 5LG4A 3PUWF 4H9QC 4ZXLA 2E2AA 3OYZA 3T1HT 2MOZA 1UCUA 2XQ4A 4AKLA 2WDQA 3DJBA 3B57A 3ABVA 3FZKB 1R8IA 1YD8G 3I1AA 3L39A 4XZCA 1FMWA 4PW8A 2X9YA 2C5KT 4YFSA 4A98A 3CK6A 3FZHB 3KV4A 4QXCB 5CA1E 2BG9A 5JDMA 4LF5T 3ONXA 4EGWA 4YHHT 3FZFB 4QXHB 3N9NA 4IGUA 4PJJA 3PJAA 4X62T 5HCJA 4EV6A 3ZJ2A 4AI6A 1DU2A 2VVSA 4AQFC 1XMOT 5LMNT 2UUBT 2ZM0A 5DQVA 3B13A 5IYZE 4DR2T 4WBNE 5HWXA 2QVAA 1IBMT 3I9WA 2C0SA 3LG7A 4X1YE 2EHOD 4X65T 4ZS2A 3C4ZA 2YK0A 2WY2A 4X66T 4DV7T 5L3CB 4HWHA 2V5CA 3O1IA 4CI2B 4I43B 5L2LA 5L4HA 2H88A 3HI2A 4C90A 4I4TE 4CXWA 3O1JA 4P09A 4IDQA 4B6XA 5LBMA 2W63A 1KNZA 5J2UE 3EABA 2CWYA 2LKHA 2FUPA 3PUXF 3OKQA 1S94A 2ODUA 2QRXA 5LGTB 2CLYB 3PUZF 3CX8B 2IDOB 2XPKA 4XBFB 5C8YE 2R6GF 4QX7B 1LRZA 1O3XA 4QKNA 2YDQA
chains in the Genus database with same CATH topology
1WLXA 1T98A 3MJXA 2CEAA 1S35A 3KVAA 3NRXA 3OJAA 2LT3A 4O2BE 5J1GA 3WAKA 2CWOA 2BVMA 3AB3B 3R6NA 2V7JA 1D1CA 3PE0A 4FI5A 5JDFA 4EIWA 2CXFA 1OWAA 1MIWA 3RYFE 3ZYLA 4TV8E 3S4UA 4YHJA 5JREA 2V7LA 1MMGA 2XTLA 3EUHA 1B7TA 1V9DA 4IHJE 4ZI7E 2VL8A 3BQKA 3N2GE 3N5LA 2Z6EA 5L3DB 4GK5E 2X9XA 3EDUA 2LSJA 2V1DB 4V1Av 1LKXA 1MIVA 1MNDA 3N2KE 3NRYA 3P7IA 2Q9QB 3JC6D 3QK6A 1WRDA 4U72A 3CQCB 2MYSA 5AFUL 4ZS3A 3RYCE 3MKDA 3N9OA 2D2SA 3LK2B 3PU8A 5FXWA 3ZMSB 3FBLA 1MMAA 3ESLA 2KMFA 4OFZA 4QHOA 5EZYE 2V7KA 3Q9DA 5DQWA 1BR0A 2LM9A 2NOXA 3ZMZB 2D5UA 4PJNA 2NP9A 4MLKA 4H9PC 3PU3A 2N2NA 2J1DG 2CM0A 4CQIA 4DVDA 5LCYA 2VKJA 1WYCA 3CQGB 4GYSA 2KT9A 1UX5A 5ADXL 3D0TA 3L3PA 4E7SA 2NTYA 5LNKA 3IHRA 3ZCJA 2E9XD 2C5IT 3UUMA 2HPJA 3VKGA 2HPLA 2CA5A 3PDYA 4ISTA 2KLQA 2WWUA 2YINA 3SRZA 4CI1B 5JR9C 3IBPA 1MNEA 3N9MA 3GA8A 2JMKA 2ODVA 2D0TA 5LHGB 4KUMB 4PNIA 4CZZB 5JVDE 3C51A 4I55E 3I0QA 2H3RA 3PUAA 3RX6A 2IC9A 2BZBA 2PFVA 3CWZB 4JUYA 3U3IA 4WBOA 1FIOA 2Q9QA 3HKCE 3GMIA 3IEEA 3KINB 3NZPA 4YJ3E 4ZOLE 5LBQB 3Q5XA 5JH7E 3ANWB 4PAGA 5M4YA 4HKAA 2MTQA 4JEUB 3K3NA 5HAXA 3RKOA 3FB2A 5LP6E 3MZKB 2XAHB 1U5PA 2KWHA 2LHNA 3BQLA 3RRCA 3K3OA 2X68A 4JEHB 1H7CA 4ANJA 2UXNB 2WMNA 4ZI2C 1G8XA 4UXNB 3RYHE 4MHCA 3PUGA 2LEHA 3EDVA 1ZV4X 2XQYA 3KV5A 3V5UA 4OYKA 3P8CD 2LHRA 2KZ7B 2A72A 1NWMX 2QGSA 2Y48B 3DTOA 5EK4A 3ZMTB 5LJMA 2WSSV 3ZMUB 2CE7A 2LJLA 4O2AE 5F8PA 3E22E 2LSYA 3AA1B 4TZ4C 3KDSE 2B1EA 3N9PA 4ZI3C 4UVBB 4ZHQE 3ZC1A 3SOLA 2CCQA 2JMHA 3KFWX 5FYMA 3ZYMA 2EHOC 1D0YA 1IJ6A 4A56A 3CQXC 5HXRA 5FP3A 3RH3A 1E1HB 1OXZA 3NZQA 3L09A 2X9HA 5J2TE 2VWAA 2XAGB 4TV9E 4DBRA 3KVBA 4BA9A 3HKDE 1ZEEA 1X79A 2VKDA 3PUSA 5JDLA 2XAFB 1MMNA 3VU7H 5FXVA 3ZYKA 1FMVA 4UV8B 3LK3B 3ZMVB 3ANWA 1NAFA 1CUNA 3HKBE 1HG5A 2LOSA 2DCFA 2X67A 3H37A 5FY0A 1UX4A 5LGUB 4AQGA 2XASB 2OA5A 2CXDA 5LGNB 2HH7A 3OYXA 2PG8A 3LBXB 4OHFA 3C98B 4H9NC 5H6QB 3ZJ1A 3O1HA 2PJQA 3UFEA 2NW9A 3Q5WA 5CA0E 3N2OA 3N9LA 2JPFA 4UF0B 2M67A 4X1KE 4L9IA 3ZPOA 3WAJA 1Y64B 2K5BB 2LE8A 5H6RB 4I50E 3MACA 4DBQA 2K9AA 4FJOA 2K48A 4JLEA 4PFPA 4EB6E 4UVCB 3RYIE 4GK0E 4U74A 5F3JA 4GOUA 3F31A 2VK9A 2W62A 5E0OA 4DNDA 4EYYR 2V7MA 2ZM2A 3C64A 1HTJF 2C5JA 2VB6A 2Q9QD 2NTXA 3K8PC 4IE4A 3VHLA 2GK9A 4AQFA 2L3LA 2X0LB 2N9DA 3GWHA 4G2AA 2WM9A 1SA0E 4WNKA 2K24A 5TAOA 4ISSA 2I59A 1IAPA 5KX5E 3DP7A 2QA7A 4O4HE 4QWNB 4QX8B 1MMDA 4PJLA 5JDNA 2X51A 5GONE 2CLYC 1D0ZA 2X66A 5EK2A 2UXXB 2WAUA 4IE0A 1HG2A 5DJQC 2CMRA 2CXLA 1IZNB 3RC8A 2IC6A 3AA0B 4XAXB 1HX8A 5HXCA 4HFVA 4EXTA 4H9OC 3HR0A 4DO0A 3TKLB 3QUJA 5FXXA 4Z8XA 1FEWA 5FMNA 2KWIB 4M1PA 3MK7C 4UIGA 4L5GA 4PK5A 5A1LA 4C91A 2ZM8A 5FXZA 4O4IE 3AA6B 3I0OA 2G0UA 3JC6C 1QSDA 3SS1A 3RPUA 4GYRA 2L8KA 3PTRB 3LBXA 4DMVA 5JDGA 2LSKA 4QXBB 5JDQA 2W0GA 4KP3C 5JRCB 1YKEB 4TN7B 4L0RA 4ERRA 3LK42 4UF0A 3C4WA 3KBUA 3HA4A 3UULA 2XHEB 1WYBA 3ZC0A 4DMWA 1D1BA 2MBGA 5LOVE 3LFMA 4H63H 4UEMA 2XAQB 3ETUA 5JDHA 4AKIA 3CX6B 4K0UA 1BR1A 3FBZA 3I9YA 2VKHA 2WMOA 4PK6A 1WR6A 1ZKEA 2P9BA 3FHNA 4NUVA 4IE5A 4CXYA 4X1IE 5LHHB 3AAEB 5DABA 2DHRA 2E8IA 4NUUA 1US7B 4BAYB 3AAIA 3KBTA 3MXZA 4AXPA 2E9XC 4P0AA 3VKHA 1SHZC 2Y8DA 4MALA 2DWKA 1VRBA 4F6RC 2RA1A 4KBMB 1G73A 3U78A 5LYJE 3AA7B 1ZHCA 5ETWA 4YLHA 4EYUA 3HKEE 5L3BB 3CMLA 4E7ZA 4IDZA 2NW7A 2YU2A 3C4XA 3M65A 4HTEA 3UTKA 1KK7A 5FNVE 1HF8A 4ILUA 3A5XA 4CI3B 3UUXB 2D0UA 5JR9B 1AJ3A 3BQIA 2VKOA 2LOPA 4UVAB 3J7Yq 5FY1A 4AKRB 5HXEA 5LG4A 4H9QC 2XUEA 5HYAA 1LVFA 1VOMA 1IJ5A 3LJCA 3OYZA 2BDEA 3PUQA 3T8OA 3F2EA 4O4JE 4P0BA 2MOZA 1UCUA 5JRCA 2YEVC 3FXEB 4AKLA 3KV9A 3DJBA 4MFRA 3B57A 3FXDB 2BVLA 5JQGE 4H63V 1MIYA 3ETVA 1YD8G 3I1AA 2VASA 2JRKA 4MBQA 2ZLYA 4XZCA 3UT5E 3GN5B 4CXXA 1FMWA 2L9QA 5KMGP 3PURA 2DI4A 1Z0PA 4O4LE 3N9QA 1YKHB 4PW8A 3EVYA 2X9YA 2C5KT 4YFSA 3RC3A 4BJNA 3J9X1 4GIWA 3ZLIA 3K3QC 3KV4A 4QXCB 2DLRA 2N1GA 5BMVE 5CA1E 5KDMC 5L3FB 2SPCA 5JDMA 3ZEFB 4UELA 4HN9A 1EZ3A 2V26A 2A2FX 3ONXA 2W61A 2KINB 1HFAA 4EZHA 4QXHB 4UV9B 3N9NA 2H7OA 2E9XB 2NW8A 4IGUA 4TX5A 3MA9A 3AVRA 3H3AA 4X20E 2NWBA 4PJJA 4ZI2D 5HXHA 2IAKA 4PJMA 2EHOB 5L3EB 2LSIA 1D0XA 3E08A 2KXPB 5JR9A 3ZJ2A 4AI6A 2ACXA 1YW0A 3W15B 4OYJA 4AQFC 3Q2MA 2ZMAA 2ZM0A 4HE8A 5LXTE 4G63A 3CPZA 4IE7A 5LJNA 5DQVA 3NBXX 2Y6XA 3V5SA 4ASKA 3B13A 5IYZE 1U4QA 2JJ9A 4WBNE 4ZI3D 3KV6A 5HWXA 2JQQA 4TUYE 3I9WA 2C0SA 3LG7A 4X1YE 2EHOD 4ZS2A 3AAAB 3BK9A 1LVKA 4ADZA 3WI3A 4EZ4A 1D1AA 3C4ZA 2YK0A 2YU1A 3OBVE 5LHIB 3GN5A 5L3CB 5FY7A 4HGAA 2DWGA 3E0ZA 3ZCIA 3O1IA 5HXSA 2KNDA 4J2CA 4CI2B 3HL6A 4I43B 2PBIA 4N78D 4BJMA 5L2LA 5LA6E 3CX7B 3O9XA 2V7IA 4PFOA 2H7VC 2X9WA 3CVRA 3HI2A 2Q9QC 4C90A 4I4TE 2LSGA 4CXWA 3O1JA 4P09A 2IW5B 3ZN1B 4WW0A 2W00A 2XAJB 1HS7A 2ES0A 3F57A 4H9SE 4B6XA 2WBLA 4PK4A 2A3DA 1HCIA 1QUUA 3AVSA 5CB4E 3QC9A 5LBMA 3CKDA 2W63A 2E9XA 1KNZA 5J2UE 3SWHA 3RRWA 2CWYA 4AKGA 2EHOA 4EOZB 4YJ2E 3UUNA 3OKQA 1S94A 2ODUA 5EK3A 5HWYA 2RP4A 4HEAA 3ZN0B 4EAHA 5LGTB 2CLYB 3CX8B 5IHYA 2DNXA 1BR2A 4OK0A 3C50A 1BR4A 4IIJE 5L3GB 3IF8B 3R84B 5C8YE 4XBFB 4O8SA 3O4XE 4IE6A 4KMCA 4QX7B 1LRZA 1O3XA 4QKNA 4AKHA 4H9RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXD A;  2CWY A; 
#chains in the Genus database with same CATH topology
 5AQO B;  3AED A;  1W9R A;  3NRX A;  3KVA A;  4AQY T;  4HFH A;  4U3C A;  1HX1 B;  1SUM B;  3R6N A;  3PE0 A;  2V6X A;  4DUZ T;  1OWA A;  2XTL A;  4ZI7 E;  1V9D A;  2DL1 A;  4IHJ E;  3N5L A;  4GK5 E;  2X9X A;  1M62 A;  2LSJ A;  1MIV A;  3JC6 D;  3QK6 A;  3RF1 A;  3ZMS B;  1BR0 A;  2CHN A;  2ACZ A;  2NOX A;  4QH1 A;  4MLK A;  4DR6 T;  2N2N A;  2IML A;  3SFD A;  2J1D G;  2CM0 A;  5LCY A;  2VKJ A;  1WYC A;  4DR4 T;  4HFC A;  1XWM A;  4YTM A;  1YQ3 A;  5LNK A;  5FVL A;  3QOF A;  2HPJ A;  1IBK T;  5AQU B;  3PDY A;  3RIA A;  5L4E A;  4CI1 B;  2AE9 A;  3GA8 A;  2YDS A;  5C2T A;  4Z91 A;  2IC9 A;  2BZB A;  2PFV A;  2XQ6 A;  3U3I A;  2V8S V;  3X1D A;  2Q9Q A;  3HKC E;  3NZP A;  3Q5X A;  2IUB A;  3ANW B;  5M4Y A;  4HKA A;  2HN1 A;  3AE7 A;  2V5D A;  2KWH A;  2LHN A;  3RRC A;  3K3O A;  4UXN B;  1XDO A;  1GQE A;  1ZV4 X;  2XQY A;  5FVK A;  1KFY A;  2A72 A;  2WSS V;  2CE7 A;  2LJL A;  5F8P A;  3KDS E;  3Q5D A;  4ZHQ E;  4B3M T;  2CCQ A;  3KFW X;  4DV5 T;  4EED A;  1XNQ T;  4DUY T;  1E1H B;  4HFB A;  5J2T E;  3ZSS A;  3P4P A;  4TV9 E;  3KVB A;  4BA9 A;  2VKD A;  3PUS A;  2XAF B;  4UV8 B;  4JYA T;  1HG5 A;  4U31 A;  5FY0 A;  1UX4 A;  4AQG A;  1XNR T;  4I0U A;  3ZJ1 A;  2NR4 A;  2PJQ A;  5CA0 E;  4UF0 B;  3WAJ A;  4L9I A;  1T8B A;  4UVC B;  4GOU A;  2I0M A;  2ZM2 A;  2NTX A;  3K8P C;  5AQG B;  4AQF A;  1KNP A;  2BG9 C;  2BS4 A;  2N9D A;  1SA0 E;  4IRE A;  2I59 A;  4QWN B;  2QA7 A;  4QX8 B;  5EK2 A;  2WAU A;  5DJQ C;  1IZN B;  1HX8 A;  5HXC A;  4HFV A;  4EXT A;  3HR0 A;  2OV9 A;  3TKL B;  3QUJ A;  4Z8X A;  5J0Z A;  3I0O A;  4JI5 T;  3RPU A;  4GYR A;  3LBX A;  2UXD T;  4KP3 C;  1YKE B;  3RGL A;  1KEY A;  3KBU A;  3HA4 A;  2XHE B;  3ZC0 A;  3ONL C;  5LOV E;  1J5E T;  3LFM A;  5LMU T;  4CN6 A;  1I94 T;  5JDH A;  5AQF B;  1BR1 A;  2VKH A;  1UGO A;  1WR6 A;  4LFB T;  2P9B A;  4IE5 A;  4X1I E;  4DR7 T;  2E8I A;  4NUU A;  4BAY B;  4AXP A;  4P0A A;  3JAF A;  1VRB A;  2XJ7 A;  5LB7 B;  3AA7 B;  4EYU A;  4TWD A;  1YQ4 A;  4HTE A;  2BS2 A;  2M6I A;  2WZH A;  2RPA A;  5FKY A;  3P4Q A;  5FY1 A;  4AKR B;  3RHW A;  3P4W A;  3LJC A;  2BDE A;  2VUR A;  4ILC A;  2AXD S;  2YEV C;  4ZZC A;  3UU4 A;  4YY3 T;  5IUX A;  3FXD B;  5JQG E;  4H63 V;  5FL1 A;  4JBW F;  2VAS A;  2JRK A;  3AXJ A;  4OX9 T;  4CXX A;  5KMG P;  2PTF A;  1Z0P A;  1YKH B;  4GIW A;  1N32 T;  5KDM C;  2D9D A;  2FJE A;  5L3F B;  2SPC A;  3QNU A;  2J62 A;  4UEL A;  3UU3 A;  2V26 A;  2A2F X;  1HFA A;  4UV9 B;  2XY8 B;  5AQN B;  4JI7 T;  2H7O A;  2NW8 A;  4TX5 A;  2LRK A;  2NWB A;  2JQH A;  5L3E B;  3E08 A;  2KXP B;  4DV4 T;  5LXT E;  4IE7 A;  5LJN A;  3TLV A;  4JI6 T;  4ZI3 D;  3RIF A;  3AAA B;  3P4S A;  3BK9 A;  4ADZ A;  2YU1 A;  5LHI B;  3GN5 A;  5FY7 A;  4HGA A;  5HXS A;  2XSB A;  4J2C A;  4BJM A;  3CX7 B;  2V7I A;  5AQT B;  2UXB T;  2H7V C;  2Q9Q C;  2LSG A;  2IW5 B;  3ZN1 B;  2W00 A;  2XAJ B;  1HS7 A;  3UQ7 A;  1QLB A;  2A3D A;  1HCI A;  2CBI A;  3CKD A;  2VQF T;  4JI4 T;  4HFI A;  5EK3 A;  3ZN0 B;  4NXM T;  5L3G B;  5AQH B;  2XQ3 A;  4JI2 T;  1WLX A;  2LT3 A;  3AB3 B;  1HNW T;  4FI5 A;  4EIW A;  4DR3 T;  1MIW A;  2E5V A;  3ZYL A;  5BR8 T;  4TWF A;  1OED C;  4YHJ A;  5JRE A;  4A5X A;  3TLW A;  4LF8 T;  4YSX A;  3RKG A;  2Z6E A;  3EDU A;  1LKX A;  1MND A;  3N2K E;  3EI0 A;  2Q9Q B;  4YSY A;  2XQ7 A;  4WYV A;  1WRD A;  2MYS A;  1CHU A;  2D2S A;  1XMQ T;  3PU8 A;  5FXW A;  3AEB A;  4U7I A;  2KMF A;  3CIR A;  2IIU A;  4U2Y A;  2X0H A;  2NP9 A;  4H9P C;  4CQI A;  3CQG B;  5FL0 A;  2KT9 A;  4CN4 A;  5ADX L;  4AIS A;  3D0T A;  4AIU A;  2NTY A;  3IHR A;  3ZCJ A;  2E9X D;  3NKZ A;  3VKG A;  2KLQ A;  4JV5 T;  4YTP A;  1MNE A;  2JMK A;  1J5W A;  2D0T A;  4CZZ B;  3AEC A;  2FJD A;  3PUA A;  3RX6 A;  1ZP0 A;  4JUY A;  1FIO A;  4ZOL E;  4JEU B;  3K3N A;  5HAX A;  3T1Y T;  5C3J A;  3MZK B;  2XAH B;  4JEH B;  1H7C A;  3LDQ B;  4ANJ A;  2UXN B;  2WMN A;  1G8X A;  3PUG A;  3KV5 A;  4TNW A;  2LHR A;  5EK4 A;  4O2A E;  2FBW A;  4TZ4 C;  2JQ9 A;  3ZST A;  2JMH A;  5FYM A;  2EHO C;  1D0Y A;  5AQR B;  4YTN A;  4A56 A;  5HXR A;  3M3Z B;  3NZQ A;  3L09 A;  3HKD E;  1X79 A;  2W67 A;  1MMN A;  5HEU A;  5FXV A;  3ZYK A;  3ZMV B;  2WQY A;  1CUN A;  3HKB E;  2X67 A;  5LGU B;  1HNX T;  2OA5 A;  2CXD A;  1UUR A;  5ABH A;  3LBX B;  4Z90 A;  5H6Q B;  5HEG A;  3OVU A;  4HWI B;  3N9L A;  1Y64 B;  2K5B B;  4I50 E;  4JLE A;  1T72 A;  2UU9 T;  3RYI E;  4U74 A;  3F31 A;  4EYY R;  2C5J A;  3C64 A;  2KSR A;  4ZZB A;  3H3M A;  2GK9 A;  3GWH A;  4G2A A;  2WM9 A;  5KX5 E;  3DP7 A;  4PJL A;  2UXX B;  1HG2 A;  2WB5 A;  3RC8 A;  2IC6 A;  4ILB A;  4GKK T;  4Q25 A;  4DO0 A;  2KWI B;  1NEN A;  3NWI A;  4L5G A;  5F5W A;  5FXZ A;  3JC6 C;  1QSD A;  3SS1 A;  2IHR 1;  5JDG A;  3PUY F;  4L0R A;  3C4W A;  4U7Y A;  4DMW A;  1D1B A;  4H63 H;  3AXJ B;  1N34 T;  2XAQ B;  4AKI A;  4K0U A;  5AQS B;  2WMO A;  5DAB A;  3AAI A;  3KBT A;  3VKH A;  2DWK A;  4F6R C;  1G73 A;  3U78 A;  1VCS A;  4YLH A;  3HKE E;  5L3B B;  3M65 A;  3EAM A;  3UTK A;  5FNV E;  4ILU A;  1AJ3 A;  1OED A;  2VKO A;  2LOP A;  3J7Y q;  3VR9 A;  5HYA A;  1VOM A;  4LF7 T;  3PUQ A;  3T8O A;  3F2E A;  5JRC A;  1NEK A;  2BVL A;  3ETV A;  3GN5 B;  2L9Q A;  3P50 A;  3PUR A;  3ZT7 A;  1W0A A;  2DI4 A;  4O4L E;  4TNV A;  3P4R A;  4DID B;  3JAE A;  4DR5 T;  4BJN A;  3J9X 1;  3K3Q C;  2DLR A;  5ABF B;  5BMV E;  3PJA J;  2W61 A;  4EZH A;  2UUC T;  3MA9 A;  3H3A A;  4X20 E;  4ZI2 D;  5HXH A;  2IAK A;  4YSZ A;  2LSI A;  4LF4 T;  2WDR A;  1D0X A;  2ACX A;  1YW0 A;  4OYJ A;  5ABE A;  3OTO T;  4HE8 A;  3CPZ A;  1N33 T;  3NBX X;  3V5S A;  3A8Y C;  2ZM6 T;  2FJB A;  4TUY E;  4IDN A;  2WZI A;  1D1A A;  3E0Z A;  3ZCI A;  3RIU A;  3VR8 A;  3UU5 A;  3HL6 A;  4N78 D;  3O9X A;  4PFO A;  2OLT A;  4HFD A;  4WW0 A;  2ES0 A;  3F57 A;  4H9S E;  3AE1 A;  5CB4 E;  3AVS A;  2BG9 B;  2E9X A;  2BBH A;  3SWH A;  3RRW A;  2EHO A;  4YJ2 E;  3UUN A;  2BKN A;  5HWY A;  2RP4 A;  2E5L T;  2DNX A;  4OK0 A;  3O4X E;  4KMC A;  4U33 A;  4AKH A;  4H9R C;  1WCR A;  2CEA A;  2CBJ A;  4NIQ A;  2WU2 A;  4O2B E;  5J1G A;  3WAK A;  2CWO A;  4K0K T;  1D1C A;  5JDF A;  2CXF A;  4TWH A;  3RYF E;  4TV8 E;  3S4U A;  2V7L A;  3EUH A;  2UUA T;  3BQK A;  2V1D B;  4V1A v;  3P7I A;  1E7P A;  4U72 A;  5AFU L;  4ZS3 A;  1MMA A;  3ESL A;  2YN6 A;  2W4X A;  5EZY E;  4A97 A;  2V7K A;  4LFA T;  1J1J A;  2D5U A;  4PJN A;  5HEH A;  3VRB A;  4DVD A;  2F4V T;  1E2A A;  1UX5 A;  3AE4 A;  1T7S A;  5KXJ A;  3RI5 A;  2C5I T;  2HPL A;  2CA5 A;  4IST A;  2WWU A;  1X9B A;  2YIN A;  5JR9 C;  3N9M A;  2ODV A;  5LHG B;  4KUM B;  4PNI A;  1L0V A;  2WU5 A;  3C51 A;  4I55 E;  3I0Q A;  3UU6 A;  3AE8 A;  3IEE A;  5JH7 E;  1VCT A;  2MTQ A;  3RKO A;  2WS3 A;  2X68 A;  3ZT5 A;  2YOE A;  3RYH E;  3L8R A;  1SE7 A;  2LEH A;  3UQ4 A;  4KHP T;  1W09 A;  3V5U A;  4OYK A;  2WWV A;  2KZ7 B;  2Y48 B;  1NWM X;  2QGS A;  3DTO A;  3ZMT B;  4B3R T;  3E22 E;  2LSY A;  3AA1 B;  3EHZ A;  3LSV A;  2BS3 A;  2V6Y A;  4ZI3 C;  3ZC1 A;  3RLF F;  3FZM B;  4DV3 T;  2BKP A;  4NPP A;  5AQM B;  3AEE A;  5AQP B;  3RH3 A;  1OXZ A;  2X9H A;  2MPK A;  4DBR A;  2XAG B;  3UUB A;  3AE2 A;  1ZEE A;  5JDL A;  3VU7 H;  1FMV A;  1NAF A;  2LOS A;  3H37 A;  2LM2 A;  2VVN A;  5LGN B;  2HH7 A;  1N36 T;  2X0Y A;  3C98 B;  4WZX A;  2HN2 A;  3N2O A;  4X1K E;  3ZPO A;  4PFP A;  2CRB A;  4EB6 E;  2W62 A;  4IDP A;  4DND A;  2V7M A;  1HTJ F;  2VB6 A;  4IE4 A;  3VHL A;  2WCA A;  5TAO A;  3AEG A;  4ISS A;  4YXD A;  1IAP A;  4O4H E;  5JDN A;  2X51 A;  5GON E;  3RQU A;  2CLY C;  2X66 A;  4ILA A;  4ZEY A;  2CXL A;  2BG9 E;  3AA0 B;  1JNR A;  4XAX B;  4H9O C;  1UUS A;  3NVO A;  2XZE A;  4M1P A;  2WP9 A;  3MK7 C;  1OED B;  4PK5 A;  4EEB A;  1HR0 T;  4DMV A;  2LSK A;  4QXB B;  5JRC B;  4KHZ F;  3LK4 2;  1WYB A;  2B76 A;  3RIU C;  2MBG A;  3CX6 B;  4X64 T;  3I9Y A;  4PK6 A;  1ZKE A;  3FHN A;  4CXY A;  3VRA A;  4HWD A;  3MXZ A;  2E9X C;  4MAL A;  5LG3 A;  4JI8 T;  4F8H A;  3SFE A;  4KBM B;  5LYJ E;  4CN1 A;  5ETW A;  3ZKR A;  3CML A;  4E7Z A;  4IDZ A;  2YU2 A;  3C4X A;  1KK7 A;  4DV1 T;  4CI3 B;  4B3T T;  5JTG A;  1Z8U A;  3QB5 A;  5HXE A;  2XUE A;  1LVF A;  1IJ5 A;  4QH4 A;  4O4J E;  4P0B A;  3FXE B;  3KV9 A;  4MFR A;  1ZOY A;  1MIY A;  3Q5E A;  4MBQ A;  2ZLY A;  3UT5 E;  3N9Q A;  3EVY A;  4COF A;  3RC3 A;  4U2Z A;  3ZLI A;  2N1G A;  1WR0 A;  1JNZ A;  3ZEF B;  2HHH T;  4JI1 T;  4HN9 A;  1EZ3 A;  2QYW A;  2KIN B;  2XQ8 A;  2E9X B;  4JI3 T;  1XZY A;  3AVR A;  1KNR A;  3PV0 F;  4PJM A;  2EHO B;  4HFE A;  5JR9 A;  3AE6 A;  4KI0 F;  1Y01 A;  3W15 B;  3Q2M A;  4IL4 A;  5HEO A;  2ZMA A;  4G63 A;  3B5M A;  2Y6X A;  4ASK A;  1U4Q A;  2JJ9 A;  3KV6 A;  4LF9 T;  3AE5 A;  2JQQ A;  2XM2 A;  4IT4 A;  1LVK A;  3WI3 A;  4EZ4 A;  3OBV E;  2DWG A;  2KND A;  2PBI A;  3JAD A;  5LA6 E;  2CPT A;  2X9W A;  3CVR A;  5IWA T;  2WBL A;  3K1S A;  4PK4 A;  1QUU A;  3QC9 A;  1M7K A;  4HWC A;  4B3S T;  4AKG A;  4EOZ B;  5AQL B;  4HEA A;  4EAH A;  5AQQ B;  2J47 A;  5IHY A;  1BR2 A;  3C50 A;  1BR4 A;  4IIJ E;  3IF8 B;  3R84 B;  4O8S A;  4IE6 A;  2VL0 A;  5AQJ B;  3MJX A;  1T98 A;  1S35 A;  3OJA A;  2A9U A;  4LF6 T;  2BVM A;  1YXR A;  2V7J A;  2J4G A;  3AEF A;  2BKO A;  2WDV A;  1MMG A;  1B7T A;  2JQK A;  2VL8 A;  4KX6 A;  3TLU A;  1I6Z A;  2XSA A;  3UU8 A;  3N2G E;  5CFB A;  5L3D B;  3NRY A;  4LMJ A;  3CQC B;  4DV6 T;  3QB5 K;  3RYC E;  3MKD A;  3N9O A;  1OED E;  3LK2 B;  5HCM A;  3FBL A;  2JIW A;  4QHO A;  4OFZ A;  3Q9D A;  5DQW A;  2XQA A;  2M6B A;  2LM9 A;  3ZMZ B;  1IBL T;  5CGM A;  3PU3 A;  2FJA A;  2XM1 A;  3IA3 A;  4GYS A;  3L3P A;  4E7S A;  1FJG T;  3UUM A;  4QH5 A;  2V6Y B;  3AE3 A;  3SRZ A;  1WFD A;  3IBP A;  3OPC A;  5JVD E;  2I6H A;  2H3R A;  3CWZ B;  4WBO A;  3KIN B;  3GMI A;  4YJ3 E;  5LBQ B;  4PAG A;  5AQK B;  2W66 A;  3FB2 A;  5LP6 E;  1U5P A;  3BQL A;  4DR1 T;  3ONJ A;  2K3W A;  4ZI2 C;  3RQW A;  2W2U A;  4MHC A;  1W0B A;  2LKG A;  3EDV A;  2CHO A;  4LFC T;  4JI0 T;  3P8C D;  5AQV B;  2VQE T;  5LJM A;  3TLT A;  3ZMU B;  2B1E A;  3N9P A;  4UVB B;  3SOL A;  3ZYM A;  4HWF A;  1IJ6 A;  3CQX C;  5ABG A;  5FP3 A;  3UFG A;  2XQ9 A;  1XDP A;  2VWA A;  3LK3 B;  3ANW A;  1UK5 A;  3G06 A;  3AEA A;  2DCF A;  2XAS B;  3ZT6 A;  5AQI B;  3OYX A;  2PG8 A;  4OHF A;  4H9N C;  1KF6 A;  3O1H A;  3UFE A;  2NW9 A;  3Q5W A;  2JPF A;  2M67 A;  4NXN T;  2LE8 A;  5H6R B;  3FZL B;  3MAC A;  4DBQ A;  2K9A A;  4FJO A;  2K48 A;  4X5T A;  4GK0 E;  5F3J A;  5E0O A;  2VK9 A;  4P1N A;  2Q9Q D;  2L3L A;  2LLY A;  2X0L B;  4WNK A;  2K24 A;  3PUV F;  1MMD A;  1D0Z A;  4IE0 A;  4DV0 T;  2MAW A;  2CMR A;  4LMK A;  5FXX A;  5FMN A;  1FEW A;  4UR9 A;  4DV2 T;  4UIG A;  5A1L A;  4C91 A;  2ZM8 A;  4O4I E;  3AA6 B;  2G0U A;  2YDR A;  2XQ5 A;  2L8K A;  3PTR B;  2BBJ A;  4YT0 A;  2W0G A;  5JDQ A;  4TN7 B;  4ERR A;  4UF0 A;  3UUL A;  2YKS A;  3JCF A;  4UEM A;  3ETU A;  5ABF A;  5HEJ A;  3FBZ A;  5L47 A;  3AE9 A;  1HNZ T;  4NUV A;  4IL9 A;  5LHH B;  3AAE B;  2DHR A;  1US7 B;  2H89 A;  2UXC T;  4IDO A;  1SHZ C;  2Y8D A;  3A7M A;  2RA1 A;  1ZHC A;  4LML A;  2NW7 A;  2LRL A;  1HF8 A;  3A5X A;  3TLS A;  3UUX B;  2D0U A;  5JR9 B;  4GKJ T;  3BQI A;  5CJ5 A;  4UVA B;  5LG4 A;  3PUW F;  4H9Q C;  4ZXL A;  2E2A A;  3OYZ A;  3T1H T;  2MOZ A;  1UCU A;  2XQ4 A;  4AKL A;  2WDQ A;  3DJB A;  3B57 A;  3ABV A;  3FZK B;  1R8I A;  1YD8 G;  3I1A A;  3L39 A;  4XZC A;  1FMW A;  4PW8 A;  2X9Y A;  2C5K T;  4YFS A;  4A98 A;  3CK6 A;  3FZH B;  3KV4 A;  4QXC B;  5CA1 E;  2BG9 A;  5JDM A;  4LF5 T;  3ONX A;  4EGW A;  4YHH T;  3FZF B;  4QXH B;  3N9N A;  4IGU A;  4PJJ A;  3PJA A;  4X62 T;  5HCJ A;  4EV6 A;  3ZJ2 A;  4AI6 A;  1DU2 A;  2VVS A;  4AQF C;  1XMO T;  5LMN T;  2UUB T;  2ZM0 A;  5DQV A;  3B13 A;  5IYZ E;  4DR2 T;  4WBN E;  5HWX A;  2QVA A;  1IBM T;  3I9W A;  2C0S A;  3LG7 A;  4X1Y E;  2EHO D;  4X65 T;  4ZS2 A;  3C4Z A;  2YK0 A;  2WY2 A;  4X66 T;  4DV7 T;  5L3C B;  4HWH A;  2V5C A;  3O1I A;  4CI2 B;  4I43 B;  5L2L A;  5L4H A;  2H88 A;  3HI2 A;  4C90 A;  4I4T E;  4CXW A;  3O1J A;  4P09 A;  4IDQ A;  4B6X A;  5LBM A;  2W63 A;  1KNZ A;  5J2U E;  3EAB A;  2CWY A;  2LKH A;  2FUP A;  3PUX F;  3OKQ A;  1S94 A;  2ODU A;  2QRX A;  5LGT B;  2CLY B;  3PUZ F;  3CX8 B;  2IDO B;  2XPK A;  4XBF B;  5C8Y E;  2R6G F;  4QX7 B;  1LRZ A;  1O3X A;  4QKN A;  2YDQ A; 
#chains in the Genus database with same CATH homology
 1WLX A;  1T98 A;  3MJX A;  2CEA A;  1S35 A;  3KVA A;  3NRX A;  3OJA A;  2LT3 A;  4O2B E;  5J1G A;  3WAK A;  2CWO A;  2BVM A;  3AB3 B;  3R6N A;  2V7J A;  1D1C A;  3PE0 A;  4FI5 A;  5JDF A;  4EIW A;  2CXF A;  1OWA A;  1MIW A;  3RYF E;  3ZYL A;  4TV8 E;  3S4U A;  4YHJ A;  5JRE A;  2V7L A;  1MMG A;  2XTL A;  3EUH A;  1B7T A;  1V9D A;  4IHJ E;  4ZI7 E;  2VL8 A;  3BQK A;  3N2G E;  3N5L A;  2Z6E A;  5L3D B;  4GK5 E;  2X9X A;  3EDU A;  2LSJ A;  2V1D B;  4V1A v;  1LKX A;  1MIV A;  1MND A;  3N2K E;  3NRY A;  3P7I A;  2Q9Q B;  3JC6 D;  3QK6 A;  1WRD A;  4U72 A;  3CQC B;  2MYS A;  5AFU L;  4ZS3 A;  3RYC E;  3MKD A;  3N9O A;  2D2S A;  3LK2 B;  3PU8 A;  5FXW A;  3ZMS B;  3FBL A;  1MMA A;  3ESL A;  2KMF A;  4OFZ A;  4QHO A;  5EZY E;  2V7K A;  3Q9D A;  5DQW A;  1BR0 A;  2LM9 A;  2NOX A;  3ZMZ B;  2D5U A;  4PJN A;  2NP9 A;  4MLK A;  4H9P C;  3PU3 A;  2N2N A;  2J1D G;  2CM0 A;  4CQI A;  4DVD A;  5LCY A;  2VKJ A;  1WYC A;  3CQG B;  4GYS A;  2KT9 A;  1UX5 A;  5ADX L;  3D0T A;  3L3P A;  4E7S A;  2NTY A;  5LNK A;  3IHR A;  3ZCJ A;  2E9X D;  2C5I T;  3UUM A;  2HPJ A;  3VKG A;  2HPL A;  2CA5 A;  3PDY A;  4IST A;  2KLQ A;  2WWU A;  2YIN A;  3SRZ A;  4CI1 B;  5JR9 C;  3IBP A;  1MNE A;  3N9M A;  3GA8 A;  2JMK A;  2ODV A;  2D0T A;  5LHG B;  4KUM B;  4PNI A;  4CZZ B;  5JVD E;  3C51 A;  4I55 E;  3I0Q A;  2H3R A;  3PUA A;  3RX6 A;  2IC9 A;  2BZB A;  2PFV A;  3CWZ B;  4JUY A;  3U3I A;  4WBO A;  1FIO A;  2Q9Q A;  3HKC E;  3GMI A;  3IEE A;  3KIN B;  3NZP A;  4YJ3 E;  4ZOL E;  5LBQ B;  3Q5X A;  5JH7 E;  3ANW B;  4PAG A;  5M4Y A;  4HKA A;  2MTQ A;  4JEU B;  3K3N A;  5HAX A;  3RKO A;  3FB2 A;  5LP6 E;  3MZK B;  2XAH B;  1U5P A;  2KWH A;  2LHN A;  3BQL A;  3RRC A;  3K3O A;  2X68 A;  4JEH B;  1H7C A;  4ANJ A;  2UXN B;  2WMN A;  4ZI2 C;  1G8X A;  4UXN B;  3RYH E;  4MHC A;  3PUG A;  2LEH A;  3EDV A;  1ZV4 X;  2XQY A;  3KV5 A;  3V5U A;  4OYK A;  3P8C D;  2LHR A;  2KZ7 B;  2A72 A;  1NWM X;  2QGS A;  2Y48 B;  3DTO A;  5EK4 A;  3ZMT B;  5LJM A;  2WSS V;  3ZMU B;  2CE7 A;  2LJL A;  4O2A E;  5F8P A;  3E22 E;  2LSY A;  3AA1 B;  4TZ4 C;  3KDS E;  2B1E A;  3N9P A;  4ZI3 C;  4UVB B;  4ZHQ E;  3ZC1 A;  3SOL A;  2CCQ A;  2JMH A;  3KFW X;  5FYM A;  3ZYM A;  2EHO C;  1D0Y A;  1IJ6 A;  4A56 A;  3CQX C;  5HXR A;  5FP3 A;  3RH3 A;  1E1H B;  1OXZ A;  3NZQ A;  3L09 A;  2X9H A;  5J2T E;  2VWA A;  2XAG B;  4TV9 E;  4DBR A;  3KVB A;  4BA9 A;  3HKD E;  1ZEE A;  1X79 A;  2VKD A;  3PUS A;  5JDL A;  2XAF B;  1MMN A;  3VU7 H;  5FXV A;  3ZYK A;  1FMV A;  4UV8 B;  3LK3 B;  3ZMV B;  3ANW A;  1NAF A;  1CUN A;  3HKB E;  1HG5 A;  2LOS A;  2DCF A;  2X67 A;  3H37 A;  5FY0 A;  1UX4 A;  5LGU B;  4AQG A;  2XAS B;  2OA5 A;  2CXD A;  5LGN B;  2HH7 A;  3OYX A;  2PG8 A;  3LBX B;  4OHF A;  3C98 B;  4H9N C;  5H6Q B;  3ZJ1 A;  3O1H A;  2PJQ A;  3UFE A;  2NW9 A;  3Q5W A;  5CA0 E;  3N2O A;  3N9L A;  2JPF A;  4UF0 B;  2M67 A;  4X1K E;  4L9I A;  3ZPO A;  3WAJ A;  1Y64 B;  2K5B B;  2LE8 A;  5H6R B;  4I50 E;  3MAC A;  4DBQ A;  2K9A A;  4FJO A;  2K48 A;  4JLE A;  4PFP A;  4EB6 E;  4UVC B;  3RYI E;  4GK0 E;  4U74 A;  5F3J A;  4GOU A;  3F31 A;  2VK9 A;  2W62 A;  5E0O A;  4DND A;  4EYY R;  2V7M A;  2ZM2 A;  3C64 A;  1HTJ F;  2C5J A;  2VB6 A;  2Q9Q D;  2NTX A;  3K8P C;  4IE4 A;  3VHL A;  2GK9 A;  4AQF A;  2L3L A;  2X0L B;  2N9D A;  3GWH A;  4G2A A;  2WM9 A;  1SA0 E;  4WNK A;  2K24 A;  5TAO A;  4ISS A;  2I59 A;  1IAP A;  5KX5 E;  3DP7 A;  2QA7 A;  4O4H E;  4QWN B;  4QX8 B;  1MMD A;  4PJL A;  5JDN A;  2X51 A;  5GON E;  2CLY C;  1D0Z A;  2X66 A;  5EK2 A;  2UXX B;  2WAU A;  4IE0 A;  1HG2 A;  5DJQ C;  2CMR A;  2CXL A;  1IZN B;  3RC8 A;  2IC6 A;  3AA0 B;  4XAX B;  1HX8 A;  5HXC A;  4HFV A;  4EXT A;  4H9O C;  3HR0 A;  4DO0 A;  3TKL B;  3QUJ A;  5FXX A;  4Z8X A;  1FEW A;  5FMN A;  2KWI B;  4M1P A;  3MK7 C;  4UIG A;  4L5G A;  4PK5 A;  5A1L A;  4C91 A;  2ZM8 A;  5FXZ A;  4O4I E;  3AA6 B;  3I0O A;  2G0U A;  3JC6 C;  1QSD A;  3SS1 A;  3RPU A;  4GYR A;  2L8K A;  3PTR B;  3LBX A;  4DMV A;  5JDG A;  2LSK A;  4QXB B;  5JDQ A;  2W0G A;  4KP3 C;  5JRC B;  1YKE B;  4TN7 B;  4L0R A;  4ERR A;  3LK4 2;  4UF0 A;  3C4W A;  3KBU A;  3HA4 A;  3UUL A;  2XHE B;  1WYB A;  3ZC0 A;  4DMW A;  1D1B A;  2MBG A;  5LOV E;  3LFM A;  4H63 H;  4UEM A;  2XAQ B;  3ETU A;  5JDH A;  4AKI A;  3CX6 B;  4K0U A;  1BR1 A;  3FBZ A;  3I9Y A;  2VKH A;  2WMO A;  4PK6 A;  1WR6 A;  1ZKE A;  2P9B A;  3FHN A;  4NUV A;  4IE5 A;  4CXY A;  4X1I E;  5LHH B;  3AAE B;  5DAB A;  2DHR A;  2E8I A;  4NUU A;  1US7 B;  4BAY B;  3AAI A;  3KBT A;  3MXZ A;  4AXP A;  2E9X C;  4P0A A;  3VKH A;  1SHZ C;  2Y8D A;  4MAL A;  2DWK A;  1VRB A;  4F6R C;  2RA1 A;  4KBM B;  1G73 A;  3U78 A;  5LYJ E;  3AA7 B;  1ZHC A;  5ETW A;  4YLH A;  4EYU A;  3HKE E;  5L3B B;  3CML A;  4E7Z A;  4IDZ A;  2NW7 A;  2YU2 A;  3C4X A;  3M65 A;  4HTE A;  3UTK A;  1KK7 A;  5FNV E;  1HF8 A;  4ILU A;  3A5X A;  4CI3 B;  3UUX B;  2D0U A;  5JR9 B;  1AJ3 A;  3BQI A;  2VKO A;  2LOP A;  4UVA B;  3J7Y q;  5FY1 A;  4AKR B;  5HXE A;  5LG4 A;  4H9Q C;  2XUE A;  5HYA A;  1LVF A;  1VOM A;  1IJ5 A;  3LJC A;  3OYZ A;  2BDE A;  3PUQ A;  3T8O A;  3F2E A;  4O4J E;  4P0B A;  2MOZ A;  1UCU A;  5JRC A;  2YEV C;  3FXE B;  4AKL A;  3KV9 A;  3DJB A;  4MFR A;  3B57 A;  3FXD B;  2BVL A;  5JQG E;  4H63 V;  1MIY A;  3ETV A;  1YD8 G;  3I1A A;  2VAS A;  2JRK A;  4MBQ A;  2ZLY A;  4XZC A;  3UT5 E;  3GN5 B;  4CXX A;  1FMW A;  2L9Q A;  5KMG P;  3PUR A;  2DI4 A;  1Z0P A;  4O4L E;  3N9Q A;  1YKH B;  4PW8 A;  3EVY A;  2X9Y A;  2C5K T;  4YFS A;  3RC3 A;  4BJN A;  3J9X 1;  4GIW A;  3ZLI A;  3K3Q C;  3KV4 A;  4QXC B;  2DLR A;  2N1G A;  5BMV E;  5CA1 E;  5KDM C;  5L3F B;  2SPC A;  5JDM A;  3ZEF B;  4UEL A;  4HN9 A;  1EZ3 A;  2V26 A;  2A2F X;  3ONX A;  2W61 A;  2KIN B;  1HFA A;  4EZH A;  4QXH B;  4UV9 B;  3N9N A;  2H7O A;  2E9X B;  2NW8 A;  4IGU A;  4TX5 A;  3MA9 A;  3AVR A;  3H3A A;  4X20 E;  2NWB A;  4PJJ A;  4ZI2 D;  5HXH A;  2IAK A;  4PJM A;  2EHO B;  5L3E B;  2LSI A;  1D0X A;  3E08 A;  2KXP B;  5JR9 A;  3ZJ2 A;  4AI6 A;  2ACX A;  1YW0 A;  3W15 B;  4OYJ A;  4AQF C;  3Q2M A;  2ZMA A;  2ZM0 A;  4HE8 A;  5LXT E;  4G63 A;  3CPZ A;  4IE7 A;  5LJN A;  5DQV A;  3NBX X;  2Y6X A;  3V5S A;  4ASK A;  3B13 A;  5IYZ E;  1U4Q A;  2JJ9 A;  4WBN E;  4ZI3 D;  3KV6 A;  5HWX A;  2JQQ A;  4TUY E;  3I9W A;  2C0S A;  3LG7 A;  4X1Y E;  2EHO D;  4ZS2 A;  3AAA B;  3BK9 A;  1LVK A;  4ADZ A;  3WI3 A;  4EZ4 A;  1D1A A;  3C4Z A;  2YK0 A;  2YU1 A;  3OBV E;  5LHI B;  3GN5 A;  5L3C B;  5FY7 A;  4HGA A;  2DWG A;  3E0Z A;  3ZCI A;  3O1I A;  5HXS A;  2KND A;  4J2C A;  4CI2 B;  3HL6 A;  4I43 B;  2PBI A;  4N78 D;  4BJM A;  5L2L A;  5LA6 E;  3CX7 B;  3O9X A;  2V7I A;  4PFO A;  2H7V C;  2X9W A;  3CVR A;  3HI2 A;  2Q9Q C;  4C90 A;  4I4T E;  2LSG A;  4CXW A;  3O1J A;  4P09 A;  2IW5 B;  3ZN1 B;  4WW0 A;  2W00 A;  2XAJ B;  1HS7 A;  2ES0 A;  3F57 A;  4H9S E;  4B6X A;  2WBL A;  4PK4 A;  2A3D A;  1HCI A;  1QUU A;  3AVS A;  5CB4 E;  3QC9 A;  5LBM A;  3CKD A;  2W63 A;  2E9X A;  1KNZ A;  5J2U E;  3SWH A;  3RRW A;  2CWY A;  4AKG A;  2EHO A;  4EOZ B;  4YJ2 E;  3UUN A;  3OKQ A;  1S94 A;  2ODU A;  5EK3 A;  5HWY A;  2RP4 A;  4HEA A;  3ZN0 B;  4EAH A;  5LGT B;  2CLY B;  3CX8 B;  5IHY A;  2DNX A;  1BR2 A;  4OK0 A;  3C50 A;  1BR4 A;  4IIJ E;  5L3G B;  3IF8 B;  3R84 B;  5C8Y E;  4XBF B;  4O8S A;  3O4X E;  4IE6 A;  4KMC A;  4QX7 B;  1LRZ A;  1O3X A;  4QKN A;  4AKH A;  4H9R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...