2CXDA

Crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
MVPDWEEVLGLWRAGRYYEVHEVLEPYWLKATGEERRLLQGVILLAAALHQRRLGRPGLRNLRKAEARLEGLPCPLMGLDWRSLLQEARRRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein, TTHA0068
publication title Crystal structure of conserved hypothetical protein, TTHA0068 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 33
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03745 DUF309 Domain of unknown function (DUF309)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.500 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2cxdA00
2CWYA 2CXDA
chains in the Genus database with same CATH superfamily
4FJOA 3D0TA 2XQ9A 4JBWF 4X20E 4MHCA 3N2KE 1MNEA 2EHOB 1N36T 4L9IA 5JDMA 4X66T 3RH3A 2XAHB 1MMGA 1SA0E 2W66A 5F3JA 4YFSA 3J7Yq 3I9YA 3MZKB 2DWGA 4ANJA 4LMKA 4DR7T 3MXZA 3MA9A 4JI1T 1DU2A 4UVAB 4IE5A 4JEHB 3ZN0B 4QX7B 3NZPA 2N9DA 1OEDB 1HG2A 3MKDA 3UFGA 2CHOA 2LSGA 4AXPA 3PV0F 4YHHT 3I0QA 2BVLA 2D5UA 4N78D 2WAUA 2QRXA 5CA0E 1W9RA 4B3TT 3LK42 3NKZA 3I0OA 4JI0T 2IHR1 1B7TA 2XQAA 4OHFA 2M6IA 4MFRA 4B6XA 4PJNA 2CPTA 3HKEE 5FKYA 5AQRB 3ZMTB 1IBKT 2WDRA 2CE7A 3EVYA 4I0UA 1YKEB 3QC9A 3L39A 1WYBA 4TNWA 4G2AA 2E9XA 1N32T 2K3WA 3AEBA 4WBNE 3BQIA 3ZJ1A 2V6YA 3P4PA 5JDNA 2CHNA 2VL0A 3AVRA 4U7IA 5DQWA 4DUZT 2K5BB 2LSJA 3EI0A 4QX8B 3EHZA 4IE6A 4ZHQE 3RI5A 3K3NA 3AA7B 2DHRA 3LBXB 1JNRA 2V6XA 4O4HE 2MPKA 1AJ3A 2BG9E 3L3PA 5AQKB 4NXNT 4LFAT 4FI5A 3RPUA 4JI4T 1W0BA 2E8IA 4JEUB 2NTXA 4ISSA 5LHHB 5FY7A 2X0LB 5JR9C 3NVOA 4C91A 4ERRA 2EHOD 2E9XB 5IHYA 1KF6A 5KMGP 3CIRA 3N9LA 5L4EA 4DUYT 4O4IE 2NW9A 3RF1A 3ZN1B 5JDGA 2VVSA 1KNRA 1UCUA 3OVUA 2V6YB 2ZM0A 3QNUA 4HFCA 3T1HT 5LNKA 4YLHA 2WWVA 4HFBA 2BZBA 3AAAB 5C3JA 3N9NA 3PUVF 3O1JA 4LF9T 2CXFA 4JYAT 4F8HA 5KX5E 2XUEA 5CB4E 3G06A 4DV2T 2X9XA 1XNRT 5L47A 2JQ9A 3EABA 3AE3A 1ZP0A 3CPZA 1D0ZA 2WWUA 2P9BA 2VQFT 1HNWT 2H89A 4ZOLE 4DR3T 4P0BA 4YY3T 5HEGA 1KEYA 3P7IA 1SHZC 3Q5XA 2JJ9A 4K0KT 1HS7A 5JTGA 1ZEEA 1YXRA 4NUUA 3FB2A 2MBGA 2V7LA 5IUXA 3EUHA 3RGLA 4QXHB 5FXXA 5E0OA 4CN4A 4UVBB 3TLUA 1MMDA 2J4GA 2LKHA 3E08A 3Q5DA 1J1JA 1VOMA 1D0XA 4JI5T 4EEBA 2D9DA 4JUYA 5AQQB 1XDOA 2V7KA 2PJQA 3CX8B 3FXDB 2CXDA 2FJBA 4J2CA 4IHJE 2WZHA 3FZLB 4LFCT 2XPKA 5CJ5A 3RX6A 3CQXC 3OTOT 4X1KE 3SRZA 4IDOA 3B57A 3UTKA 3UT5E 2WU2A 1XMQT 4IDQA 3BQLA 2ACZA 1ZV4X 4GK5E 2YU1A 2X9HA 4KX6A 2K24A 4O4JE 2E9XD 4TWFA 5KDMC 4X62T 2LRLA 3PU8A 5ETWA 4COFA 3RLFF 4WNKA 1D1CA 4DV0T 1MIYA 2H3RA 2RPAA 5AQJB 5FY1A 4IDZA 4AKGA 3N9OA 3ZYKA 4LF5T 4I43B 2Y8DA 4X5TA 3BQKA 4U72A 3NRYA 3NWIA 4KBMB 2W62A 3O1HA 2IMLA 5J1GA 4UELA 2CMRA 4YTMA 4O8SA 4Z90A 3IA3A 2I6HA 5IYZE 2LLYA 3JC6D 3HKCE 4DVDA 3ZMZB 5ADXL 4QXBB 4YXDA 3HA4A 4ZI7E 5L2LA 2YN6A 4U2YA 3W15B 2DCFA 3QUJA 4HFEA 1M62A 2MOZA 3PE0A 2VWAA 5AQIB 1OEDE 3OYXA 4ILBA 2BBJA 1L0VA 4XAXB 4QH4A 2QA7A 2HHHT 4EAHA 5JR9A 3MK7C 4YSZA 5FY0A 4TX5A 1NWMX 3O9XA 4LF6T 2XHEB 2BDEA 1WLXA 4TWHA 4DIDB 1J5WA 1W09A 3B13A 5AQSB 2X67A 3SFEA 2CWOA 3V5UA 2ODUA 3AEGA 4ASKA 3ESLA 2K48A 5EK3A 1HTJF 3ZMSB 2X9YA 3RKGA 3T8OA 5EZYE 2UXXB 3EDUA 4BJMA 2YEVC 5JDQA 3KDSE 1FMVA 5JDFA 3AE4A 2FJAA 2E5VA 1KFYA 4GIWA 2XASB 3F57A 2UXCT 5JR9B 4DMVA 4QH1A 4I4TE 2ACXA 5ABFA 4H63H 3VKGA 4HE8A 2IUBA 3HR0A 1HCIA 1BR4A 3TKLB 4QHOA 3N9QA 2UU9T 2N2NA 2D0TA 4NUVA 2VKJA 3B5MA 2KMFA 3ZT7A 2LEHA 1IJ6A 4B3ST 3DTOA 4CXWA 3CX7B 1X9BA 4DV1T 2RA1A 2W4XA 3ONJA 5CA1E 4EEDA 2ODVA 4EXTA 4YTPA 2V7IA 3E0ZA 2E5LT 2CBIA 5ABFB 3KBTA 4QKNA 4ZI2C 4PJJA 2W00A 3RC8A 1WFDA 1I6ZA 1T7SA 2XJ7A 4GK0E 3PUYF 3ANWB 2OA5A 4PK4A 3P8CD 3VHLA 3T1YT 2KXPB 4L0RA 2G0UA 4U33A 3C98B 4JI7T 2V5CA 4LMLA 2WMNA 1MMNA 3KBUA 3AEEA 3KVBA 2JMHA 3M65A 5LG4A 1NEKA 2J62A 2V1DB 3RYCE 4ADZA 4PK6A 3PTRB 4EIWA 1UGOA 5JREA 3P4SA 3WAKA 3QB5K 4MALA 4DV4T 3N9PA 3Q9DA 3AE5A 2WB5A 2VKOA 4IREA 2WU5A 4JI2T 3A7MA 2K9AA 1R8IA 3O4XE 2R6GF 5LXTE 3ABVA 3PJAJ 2H7OA 3RC3A 4LF4T 1HX1B 1IJ5A 4AKIA 1ZHCA 2M67A 3GN5A 4H9QC 2W2UA 5HEUA 2YKSA 2C5KT 3PUZF 2L8KA 2JMKA 1QSDA 3IF8B 1OWAA 3ZKRA 3ZLIA 2X9WA 2CCQA 4PFOA 4YSYA 4U2ZA 3S4UA 2UXDT 2UXNB 3AE6A 3SOLA 3KV9A 5AQOB 3CWZB 4PAGA 4ILCA 3LG7A 2DWKA 3RIUC 4XBFB 4YJ2E 4P1NA 3HI2A 4UR9A 3RHWA 2XAQB 3ZT6A 2L9QA 3ZMVB 2DNXA 4UF0A 3GN5B 2W61A 2XQ6A 2ZMAA 4Z91A 4B3MT 1Z8UA 4P0AA 3N2OA 4DR5T 1D1BA 5L3DB 5DJQC 3FBLA 3AVSA 5HXRA 3AE2A 4YT0A 5LMNT 2XM1A 2OLTA 3FZFB 5HEHA 3CQGB 4GKJT 3TLVA 2CA5A 5HWXA 3TLWA 4KI0F 2LSIA 3ETVA 5FMNA 2HPLA 3UU5A 1T8BA 4Z8XA 5HCJA 4OX9T 2XAGB 2XAFB 4DBRA 2I59A 4AQFC 3ZYLA 1HNXT 3ZC0A 4I50E 4BJNA 2YDRA 5FVKA 4DNDA 3RRCA 1YQ4A 2H88A 5LGTB 2X0HA 5A1LA 4AKHA 3UU8A 2ZM2A 4WBOA 1G73A 1HG5A 5KXJA 5CFBA 4UXNB 5JRCA 3PUGA 3WAJA 4G63A 4X65T 1LRZA 2JQQA 3PUAA 5HXSA 1X79A 3CVRA 3P4WA 5FXVA 5EK4A 1S35A 3GMIA 1KNZA 4OYJA 3C4WA 1IZNB 2LKGA 2VB6A 2IW5B 1HR0T 4TN7B 4A5XA 1UURA 3K3QC 4HKAA 2IIUA 2XQ3A 1UX4A 5JQGE 2XQYA 2LJLA 3ZT5A 4JI3T 2V7MA 4IT4A 5HXHA 1ZKEA 3U3IA 2JQHA 3RQWA 2XQ4A 5JRCB 3VRBA 5L3EB 2CLYC 4O4LE 3AECA 5LJNA 4EZ4A 2LT3A 1HNZT 5HWYA 4PJMA 4UIGA 5LB7B 3OKQA 3A5XA 3FBZA 5L3GB 2BVMA 5AQNB 2Q9QC 4IE0A 3KINB 1WYCA 1UK5A 2VL8A 3PUWF 2BS2A 4ZI3C 4C90A 2L3LA 4HWIB 2V8SV 3RIAA 3RYHE 5AFUL 4ILUA 2WMOA 2D2SA 2BS4A 4F6RC 2UXBT 1XNQT 4H9OC 4JLEA 2MAWA 5HXEA 3PURA 4A98A 2YINA 4CN1A 4CN6A 2W63A 4IGUA 3PJAA 4O2AE 4Q25A 3ETUA 2I0MA 3VR9A 2KWIB 4U7YA 1ZOYA 4QXCB 5LMUT 2IC6A 2FJDA 3F2EA 4NIQA 4AQGA 3UUNA 1XZYA 3AEFA 3IBPA 4NXMT 4H9PC 1NAFA 3AA0B 4CXXA 1CUNA 3Q5EA 3AEAA 1NENA 4H9NC 3RIUA 3SFDA 2YK0A 4DV7T 5JDHA 5M4YA 1VRBA 3ZSTA 2AXDS 2KZ7B 2MYSA 4BA9A 3PUXF 3ONXA 3LK2B 4JV5T 3K1SA 3ZPOA 2LE8A 2NTYA 1M7KA 4M1PA 3UUMA 5AQFB 2CBJA 4DV6T 5CGMA 4OFZA 1MIWA 3KFWX 3P4RA 1WRDA 4LFBT 3QK6A 1LKXA 3CKDA 3UQ7A 5H6QB 2VKDA 2YDQA 4AQFA 3I1AA 2VURA 4PW8A 2LHRA 4YSXA 3AB3B 4BAYB 4DV3T 2WDVA 4ZI2D 2PTFA 3R6NA 3ZCIA 3ZYMA 2ES0A 5JH7E 4A97A 4UVCB 2IDOB 3QB5A 3ZC1A 2J47A 2X68A 5HXCA 4PK5A 1OXZA 1BR2A 2A9UA 4HWDA 2Z6EA 1IAPA 3P50A 5F8PA 5AQUB 5FVLA 2H7VC 5L3FB 3FHNA 5FL0A 3OJAA 4HWCA 2KNDA 3CK6A 4X1IE 5FP3A 2XQ8A 2HH7A 2AE9A 2W0GA 2Y6XA 5FYMA 3LK3B 1YW0A 3RRWA 4A56A 2F4VT 1E7PA 4TWDA 3V5SA 4E7ZA 5DQVA 3QOFA 3JADA 3LJCA 2NP9A 3AEDA 4GYSA 2B76A 4L5GA 1D0YA 4IL9A 2XAJB 4TZ4C 3VKHA 2WSSV 3AE1A 3UUBA 3O1IA 2C0SA 2QVAA 2WZIA 2LM9A 4ZZCA 4H63V 5AQHB 5L3BB 3C4XA 3A8YC 1EZ3A 3H37A 1US7B 1O3XA 4ZS2A 2IC9A 4XZCA 1FEWA 2Q9QA 3ZMUB 1YQ3A 2CWYA 5ABGA 4PFPA 4CI3B 3LDQB 2PG8A 3H3AA 4EZHA 2BG9C 4UV9B 2XQ5A 1JNZA 2HPJA 4MLKA 2KWHA 3KVAA 2DI4A 1KNPA 4LMJA 3DP7A 1Y64B 4GYRA 1WR0A 2CLYB 2V7JA 4U74A 1V9DA 1HFAA 1T98A 3OPCA 2M6BA 2QYWA 3I9WA 3H3MA 5LHIB 2KSRA 4QH5A 2JRKA 3RYFE 3OBVE 3IEEA 2MTQA 2X66A 1U5PA 2Q9QB 3LBXA 1E2AA 3X1DA 1U4QA 1FIOA 5HAXA 5LBMA 3RKOA 5J0ZA 3VRAA 2A2FX 3ZCJA 5AQTB 4IE4A 2KINB 2DLRA 3K8PC 3NBXX 5LA6E 4HFHA 5H6RB 3MACA 2NW8A 5ABEA 4I55E 3N5LA 2RP4A 5JDLA 1UUSA 1S94A 2QGSA 1BR1A 5LHGB 5ABHA 2XZEA 4CI2B 1XWMA 4IDPA 2LHNA 2UUBT 4KHZF 4OK0A 3TLTA 4U3CA 3HKBE 4H9SE 3BK9A 4V1Av 3R84B 4YTNA 4CZZB 3AE7A 4DR2T 1QUUA 1MNDA 2W67A 3L8RA 2BKPA 2J1DG 4TUYE 3VU7H 1BR0A 2VQET 2XSBA 4O2BE 4DO0A 3AE9A 1I94T 2BS3A 2CEAA 2XY8B 4KMCA 2XM2A 5FNVE 4DR1T 5L4HA 2FJEA 2PFVA 1MIVA 3FZKB 3LSVA 1W0AA 4E7SA 3EAMA 1N34T 4IL4A 4DBQA 3PDYA 1D1AA 5LJMA 2KLQA 4AIUA 1KK7A 4TV9E 4UF0B 4WYVA 2VVNA 5EK2A 2UUCT 2YU2A 3LFMA 4HFIA 5LP6E 1Z0PA 5L3CB 2WDQA 1WCRA 3C64A 4JI6T 1XDPA 4DV5T 3C4ZA 2WM9A 3J9X1 3IHRA 3WI3A 1E1HB 4HEAA 2ZM6T 2Q9QD 2ZM8A 2D0UA 4ZI3D 4JI8T 3OYZA 4CQIA 3NZQA 3NRXA 4K0UA 3MJXA 2EHOC 4EYUA 5BR8T 3UUXB 2WY2A 1HX8A 4MBQA 4PNIA 3ZSSA 4EYYR 5LCYA 4GKKT 1IBMT 4KP3C 2LSYA 1LVFA 4AI6A 5FL1A 1OEDC 4B3RT 4TV8E 2BG9A 4HGAA 3SWHA 5J2TE 2NWBA 2JIWA 3ONLC 3N9MA 3CX6B 4QWNB 4ZS3A 4KUMB 1SE7A 3KV4A 4WZXA 1QLBA 4CI1B 2LRKA 2NR4A 3TLSA 3UQ4A 3C50A 4UEMA 2SPCA 3CMLA 2N1GA 3C51A 1XMOT 2BBHA 4ILAA 5FXWA 3UULA 3Q5WA 5HCMA 5JVDE 4EGWA 5HEOA 1T72A 2LSKA 2VASA 4GOUA 3RQUA 3AE8A 1Y01A 3P4QA 4YHJA 5LG3A 5AQVB 4NPPA 3GA8A 3AAEB 3UFEA 4EV6A 2A3DA 2IAKA 1MMAA 2BG9B 3F31A 2B1EA 1UX5A 2UUAT 2C5IT 3CQCB 3ZJ2A 4H9RC 2PBIA 5IWAT 3ZEFB 2V5DA 3L09A 5HYAA 5LOVE 2VKHA 4HFDA 2BKNA 5AQGB 2HN2A 4UV8B 5C2TA 5AQLB 1J5ET 4HWFA 4AQYT 1CHUA 2WS3A 4LF7T 2V26A 3UU3A 3JAEA 4HN9A 4AISA 5TAOA 2E9XC 3KV6A 2JPFA 2X0YA 2C5JA 3RIFA 3M3ZB 3UU6A 5LGNB 2GK9A 1FJGT 5DABA 4X1YE 4HFVA 4X64T 1YKHB 2Y48B 3VR8A 3FXEB 1SUMB 3K3OA 4PJLA 5LYJE 1GQEA 2YDSA 2DL1A 2E2AA 3HKDE 2HN1A 5AQMB 2XQ7A 4AKRB 4AKLA 3AA1B 2FUPA 3Q2MA 3FZMB 2BKOA 4HTEA 2LOPA 4ZEYA 2CXLA 3FZHB 4IE7A 3PUQA 2NW7A 3JAFA 4EOZB 4LF8T 3PU3A 3PUSA 1N33T 4DR6T 3DJBA 1VCSA 2CM0A 4P09A 4IDNA 2OV9A 5AQPB 3JC6C 3N2GE 2LOSA 3E22E 1LVKA 2VK9A 1H7CA 4EB6E 3AAIA 3UU4A 1HF8A 4TNVA 3AXJA 4KHPT 2X51A 1G8XA 1IBLT 2XTLA 2A72A 2NOXA 5F5WA 4DMWA 3SS1A 3U78A 4DR4T 5LBQB 4ZXLA 1YD8G 1FMWA 5FXZA 2ZLYA 2EHOA 3ANWA 2YOEA 2LM2A 3KV5A 4CXYA 2FBWA 5GONE 4HWHA 2JQKA 2WP9A 4ISTA 3RYIE 5C8YE 1WR6A 2XSAA 4OYKA 2WBLA 4U31A 3HL6A 5BMVE 4IIJE 3GWHA 4WW0A 4YJ3E 2KT9A 3AA6B 3EDVA 1VCTA 2CRBA 1OEDA 5J2UE 3AXJB 2WCAA 3JCFA 5HEJA 5LGUB 2WQYA 4ZZBA
chains in the Genus database with same CATH topology
3MK7C 4FJOA 5HXHA 3D0TA 1ZKEA 3U3IA 5FY0A 3HKBE 1NWMX 3BK9A 4H9SE 4TX5A 4V1Av 3R84B 4CZZB 4X20E 4MHCA 3O9XA 2XHEB 3N2KE 1QUUA 5JRCB 2BDEA 1MNDA 1MNEA 2EHOB 5L3EB 1WLXA 2CLYC 4L9IA 4O4LE 4TUYE 2J1DG 3VU7H 5JDMA 5LJNA 3RH3A 4EZ4A 1BR0A 2XAHB 1MMGA 3B13A 1SA0E 4O2BE 4DO0A 5F3JA 4YFSA 2LT3A 3J7Yq 3I9YA 3MZKB 2X67A 2CEAA 5HWYA 2DWGA 2CWOA 4PJMA 4ANJA 4UIGA 3V5UA 2ODUA 4KMCA 3OKQA 4ASKA 3ESLA 3A5XA 3FBZA 3MXZA 3MA9A 5L3GB 2K48A 5FNVE 2BVMA 4UVAB 2Q9QC 4IE5A 4IE0A 4JEHB 3KINB 5EK3A 1WYCA 1HTJF 2PFVA 1MIVA 4QX7B 3ZN0B 2X9YA 3ZMSB 3T8OA 2VL8A 5EZYE 2UXXB 3EDUA 4ZI3C 3NZPA 2N9DA 2YEVC 4BJMA 4C90A 5JDQA 1HG2A 2L3LA 3KDSE 4E7SA 1FMVA 5JDFA 3MKDA 4DBQA 3RYHE 5AFUL 3PDYA 4GIWA 2XASB 3F57A 1D1AA 5LJMA 2KLQA 5JR9B 4ILUA 2LSGA 4DMVA 1KK7A 4AXPA 2WMOA 2D2SA 4TV9E 4I4TE 4UF0B 2ACXA 3I0QA 4F6RC 2BVLA 2D5UA 5EK2A 4H63H 2YU2A 4N78D 2WAUA 3LFMA 4H9OC 4JLEA 5CA0E 5LP6E 1Z0PA 3LK42 5L3CB 5HXEA 3PURA 3VKGA 4HE8A 3HR0A 2YINA 3C64A 1HCIA 3C4ZA 2W63A 4IGUA 2WM9A 1BR4A 3J9X1 4O2AE 3IHRA 3TKLB 4QHOA 3ETUA 2KWIB 3WI3A 3N9QA 1E1HB 4HEAA 2N2NA 4QXCB 2D0TA 3I0OA 2IC6A 2Q9QD 1B7TA 2ZM8A 4NUVA 4OHFA 4MFRA 4B6XA 3F2EA 2D0UA 4PJNA 2VKJA 3HKEE 2KMFA 3ZMTB 4ZI3D 2LEHA 4AQGA 2CE7A 3OYZA 4CQIA 3EVYA 3NZQA 3UUNA 3IBPA 1YKEB 3QC9A 1IJ6A 1WYBA 1NAFA 3AA0B 3DTOA 4G2AA 4H9PC 1CUNA 2E9XA 4CXWA 4CXXA 3CX7B 3NRXA 4H9NC 4K0UA 2RA1A 4WBNE 3BQIA 3ZJ1A 2YK0A 5JDHA 5M4YA 1VRBA 3MJXA 2KZ7B 2EHOC 4EYUA 5CA1E 2ODVA 2MYSA 5JDNA 3UUXB 4EXTA 3AVRA 1HX8A 4MBQA 5DQWA 4BA9A 2V7IA 3E0ZA 3ONXA 3LK2B 2K5BB 4PNIA 2LSJA 3ZPOA 4EYYR 2LE8A 2NTYA 4QX8B 4IE6A 4ZHQE 5LCYA 3KBTA 3K3NA 4M1PA 4QKNA 3AA7B 3UUMA 4KP3C 2DHRA 4ZI2C 3LBXB 4O4HE 2LSYA 4PJJA 2W00A 1LVFA 1AJ3A 4AI6A 3L3PA 3RC8A 4OFZA 4FI5A 3RPUA 1MIWA 4GK0E 3ANWB 2OA5A 2E8IA 3KFWX 4TV8E 4JEUB 4PK4A 3P8CD 3VHLA 1WRDA 4HGAA 3SWHA 2KXPB 2NTXA 4ISSA 5LHHB 5J2TE 2NWBA 5FY7A 4L0RA 2G0UA 2X0LB 3QK6A 3N9MA 3C98B 3CX6B 5JR9C 4QWNB 4ZS3A 4C91A 1LKXA 4KUMB 4ERRA 3CKDA 2EHOD 3KV4A 2E9XB 5IHYA 4CI1B 5KMGP 3N9LA 3C50A 5H6QB 2VKDA 2WMNA 4O4IE 2NW9A 1MMNA 4AQFA 3KBUA 3ZN1B 4UEMA 5JDGA 2SPCA 3I1AA 3CMLA 2N1GA 3C51A 1UCUA 3KVBA 4PW8A 2ZM0A 2JMHA 5FXWA 3Q5WA 2LHRA 3M65A 3AB3B 3UULA 5LG4A 2V1DB 5JVDE 3RYCE 4BAYB 5LNKA 2LSKA 4YLHA 2BZBA 3AAAB 2VASA 4ZI2D 3N9NA 4ADZA 4GOUA 3R6NA 4PK6A 3ZCIA 3O1JA 3PTRB 2CXFA 4EIWA 3ZYMA 2ES0A 5JREA 5JH7E 3WAKA 4MALA 4UVCB 4YHJA 3ZC1A 5KX5E 2XUEA 2X68A 3GA8A 3N9PA 3Q9DA 5CB4E 3AAEB 5HXCA 3UFEA 2VKOA 4PK5A 2X9XA 1OXZA 1BR2A 2A3DA 2IAKA 2K9AA 1MMAA 3O4XE 3F31A 5LXTE 2B1EA 2Z6EA 1UX5A 3CPZA 1D0ZA 1IAPA 2P9BA 2H7OA 2WWUA 3RC3A 2C5IT 5F8PA 3CQCB 1IJ5A 3ZJ2A 4AKIA 4H9RC 1ZHCA 2H7VC 2M67A 4ZOLE 5L3FB 3FHNA 3GN5A 2PBIA 4H9QC 4P0BA 3OJAA 2C5KT 2KNDA 3ZEFB 3L09A 5HYAA 4X1IE 2L8KA 5FP3A 5LOVE 2JMKA 3P7IA 2VKHA 1SHZC 2HH7A 3Q5XA 1QSDA 2JJ9A 3IF8B 1OWAA 1HS7A 2W0GA 2Y6XA 5FYMA 3ZLIA 1ZEEA 4UV8B 2X9WA 2CCQA 4PFOA 3S4UA 4NUUA 3FB2A 3LK3B 2MBGA 2V7LA 3EUHA 1YW0A 3RRWA 2UXNB 4QXHB 4A56A 5FXXA 5E0OA 3SOLA 2V26A 4UVBB 3KV9A 3V5SA 4E7ZA 1MMDA 3CWZB 4HN9A 4PAGA 5DQVA 3E08A 3LJCA 5TAOA 2NP9A 1VOMA 2E9XC 3KV6A 4GYSA 2JPFA 1D0XA 3LG7A 4JUYA 2C5JA 4L5GA 5LGNB 1D0YA 2GK9A 5DABA 2DWKA 4X1YE 2XAJB 4XBFB 2V7KA 2PJQA 4HFVA 4YJ2E 3CX8B 3FXDB 4TZ4C 3HI2A 3VKHA 2WSSV 2CXDA 3O1IA 1YKHB 2XAQB 2Y48B 2C0SA 2L9QA 3FXEB 4J2CA 3ZMVB 4IHJE 3K3OA 4PJLA 5LYJE 2LM9A 3RX6A 3HKDE 4H63V 5L3BB 3CQXC 3C4XA 2DNXA 4AKRB 4AKLA 3AA1B 1EZ3A 4UF0A 3GN5B 4X1KE 3H37A 3Q2MA 3SRZA 1US7B 3B57A 3UTKA 3UT5E 2W61A 2ZMAA 1O3XA 4HTEA 2LOPA 4ZS2A 2CXLA 4IE7A 3PUQA 2IC9A 4XZCA 4P0AA 2NW7A 3N2OA 3BQLA 1ZV4X 1D1BA 5L3DB 1FEWA 2Q9QA 5DJQC 3FBLA 3ZMUB 3AVSA 5HXRA 4EOZB 2CWYA 4GK5E 3PU3A 4PFPA 2YU1A 4CI3B 2X9HA 3PUSA 2PG8A 2K24A 4O4JE 2E9XD 3H3AA 5KDMC 3DJBA 3CQGB 3PU8A 2CA5A 4EZHA 2CM0A 4P09A 4UV9B 5HWXA 5ETWA 2HPJA 2LSIA 3ETVA 4WNKA 1D1CA 4MLKA 5FMNA 2KWHA 3KVAA 2DI4A 2HPLA 4Z8XA 3JC6C 2XAGB 2XAFB 3N2GE 1MIYA 4DBRA 2LOSA 2H3RA 3E22E 5FY1A 1LVKA 4IDZA 2VK9A 3DP7A 1H7CA 2I59A 4AQFC 4EB6E 4AKGA 1Y64B 3AAIA 1HF8A 4GYRA 3N9OA 3ZYKA 3ZYLA 2CLYB 2V7JA 4U74A 4I43B 2Y8DA 1V9DA 1HFAA 1T98A 3BQKA 3ZC0A 4I50E 4U72A 4BJNA 3NRYA 2X51A 4DNDA 1G8XA 4KBMB 2W62A 2XTLA 3O1HA 5J1GA 3RRCA 2A72A 3I9WA 4UELA 2CMRA 5LHIB 5LGTB 2NOXA 4DMWA 5A1LA 2JRKA 4O8SA 3RYFE 3OBVE 3SS1A 3IEEA 4AKHA 2MTQA 2X66A 3U78A 1U5PA 2Q9QB 2ZM2A 5IYZE 5LBQB 3LBXA 4WBOA 1G73A 1HG5A 1YD8G 1FMWA 3JC6D 3HKCE 4UXNB 5FXZA 5JRCA 2ZLYA 3PUGA 1U4QA 4DVDA 1FIOA 2EHOA 3WAJA 3ANWA 5HAXA 5LBMA 3RKOA 3ZMZB 4G63A 1LRZA 2JQQA 3PUAA 2A2FX 3KV5A 4QXBB 5ADXL 3ZCJA 5HXSA 4IE4A 1X79A 2KINB 3CVRA 3HA4A 4ZI7E 2DLRA 4CXYA 5L2LA 3K8PC 5GONE 3NBXX 5LA6E 4ISTA 5H6RB 3W15B 3MACA 5FXVA 3RYIE 1WR6A 2NW8A 2DCFA 5EK4A 5C8YE 1S35A 3QUJA 4I55E 3N5LA 3GMIA 1KNZA 4OYKA 2WBLA 2MOZA 3HL6A 4OYJA 3C4WA 5BMVE 1IZNB 2RP4A 2VWAA 3PE0A 3GWHA 4IIJE 4WW0A 4YJ3E 5JDLA 2KT9A 3AA6B 1S94A 3EDVA 2QGSA 1BR1A 3OYXA 5LHGB 2VB6A 2IW5B 4TN7B 4XAXB 4CI2B 5J2UE 3K3QC 4HKAA 2QA7A 5LGUB 1UX4A 5JQGE 2LHNA 4EAHA 2XQYA 2LJLA 5JR9A 4OK0A 2V7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWY A;  2CXD A; 
#chains in the Genus database with same CATH topology
 4FJO A;  3D0T A;  2XQ9 A;  4JBW F;  4X20 E;  4MHC A;  3N2K E;  1MNE A;  2EHO B;  1N36 T;  4L9I A;  5JDM A;  4X66 T;  3RH3 A;  2XAH B;  1MMG A;  1SA0 E;  2W66 A;  5F3J A;  4YFS A;  3J7Y q;  3I9Y A;  3MZK B;  2DWG A;  4ANJ A;  4LMK A;  4DR7 T;  3MXZ A;  3MA9 A;  4JI1 T;  1DU2 A;  4UVA B;  4IE5 A;  4JEH B;  3ZN0 B;  4QX7 B;  3NZP A;  2N9D A;  1OED B;  1HG2 A;  3MKD A;  3UFG A;  2CHO A;  2LSG A;  4AXP A;  3PV0 F;  4YHH T;  3I0Q A;  2BVL A;  2D5U A;  4N78 D;  2WAU A;  2QRX A;  5CA0 E;  1W9R A;  4B3T T;  3LK4 2;  3NKZ A;  3I0O A;  4JI0 T;  2IHR 1;  1B7T A;  2XQA A;  4OHF A;  2M6I A;  4MFR A;  4B6X A;  4PJN A;  2CPT A;  3HKE E;  5FKY A;  5AQR B;  3ZMT B;  1IBK T;  2WDR A;  2CE7 A;  3EVY A;  4I0U A;  1YKE B;  3QC9 A;  3L39 A;  1WYB A;  4TNW A;  4G2A A;  2E9X A;  1N32 T;  2K3W A;  3AEB A;  4WBN E;  3BQI A;  3ZJ1 A;  2V6Y A;  3P4P A;  5JDN A;  2CHN A;  2VL0 A;  3AVR A;  4U7I A;  5DQW A;  4DUZ T;  2K5B B;  2LSJ A;  3EI0 A;  4QX8 B;  3EHZ A;  4IE6 A;  4ZHQ E;  3RI5 A;  3K3N A;  3AA7 B;  2DHR A;  3LBX B;  1JNR A;  2V6X A;  4O4H E;  2MPK A;  1AJ3 A;  2BG9 E;  3L3P A;  5AQK B;  4NXN T;  4LFA T;  4FI5 A;  3RPU A;  4JI4 T;  1W0B A;  2E8I A;  4JEU B;  2NTX A;  4ISS A;  5LHH B;  5FY7 A;  2X0L B;  5JR9 C;  3NVO A;  4C91 A;  4ERR A;  2EHO D;  2E9X B;  5IHY A;  1KF6 A;  5KMG P;  3CIR A;  3N9L A;  5L4E A;  4DUY T;  4O4I E;  2NW9 A;  3RF1 A;  3ZN1 B;  5JDG A;  2VVS A;  1KNR A;  1UCU A;  3OVU A;  2V6Y B;  2ZM0 A;  3QNU A;  4HFC A;  3T1H T;  5LNK A;  4YLH A;  2WWV A;  4HFB A;  2BZB A;  3AAA B;  5C3J A;  3N9N A;  3PUV F;  3O1J A;  4LF9 T;  2CXF A;  4JYA T;  4F8H A;  5KX5 E;  2XUE A;  5CB4 E;  3G06 A;  4DV2 T;  2X9X A;  1XNR T;  5L47 A;  2JQ9 A;  3EAB A;  3AE3 A;  1ZP0 A;  3CPZ A;  1D0Z A;  2WWU A;  2P9B A;  2VQF T;  1HNW T;  2H89 A;  4ZOL E;  4DR3 T;  4P0B A;  4YY3 T;  5HEG A;  1KEY A;  3P7I A;  1SHZ C;  3Q5X A;  2JJ9 A;  4K0K T;  1HS7 A;  5JTG A;  1ZEE A;  1YXR A;  4NUU A;  3FB2 A;  2MBG A;  2V7L A;  5IUX A;  3EUH A;  3RGL A;  4QXH B;  5FXX A;  5E0O A;  4CN4 A;  4UVB B;  3TLU A;  1MMD A;  2J4G A;  2LKH A;  3E08 A;  3Q5D A;  1J1J A;  1VOM A;  1D0X A;  4JI5 T;  4EEB A;  2D9D A;  4JUY A;  5AQQ B;  1XDO A;  2V7K A;  2PJQ A;  3CX8 B;  3FXD B;  2CXD A;  2FJB A;  4J2C A;  4IHJ E;  2WZH A;  3FZL B;  4LFC T;  2XPK A;  5CJ5 A;  3RX6 A;  3CQX C;  3OTO T;  4X1K E;  3SRZ A;  4IDO A;  3B57 A;  3UTK A;  3UT5 E;  2WU2 A;  1XMQ T;  4IDQ A;  3BQL A;  2ACZ A;  1ZV4 X;  4GK5 E;  2YU1 A;  2X9H A;  4KX6 A;  2K24 A;  4O4J E;  2E9X D;  4TWF A;  5KDM C;  4X62 T;  2LRL A;  3PU8 A;  5ETW A;  4COF A;  3RLF F;  4WNK A;  1D1C A;  4DV0 T;  1MIY A;  2H3R A;  2RPA A;  5AQJ B;  5FY1 A;  4IDZ A;  4AKG A;  3N9O A;  3ZYK A;  4LF5 T;  4I43 B;  2Y8D A;  4X5T A;  3BQK A;  4U72 A;  3NRY A;  3NWI A;  4KBM B;  2W62 A;  3O1H A;  2IML A;  5J1G A;  4UEL A;  2CMR A;  4YTM A;  4O8S A;  4Z90 A;  3IA3 A;  2I6H A;  5IYZ E;  2LLY A;  3JC6 D;  3HKC E;  4DVD A;  3ZMZ B;  5ADX L;  4QXB B;  4YXD A;  3HA4 A;  4ZI7 E;  5L2L A;  2YN6 A;  4U2Y A;  3W15 B;  2DCF A;  3QUJ A;  4HFE A;  1M62 A;  2MOZ A;  3PE0 A;  2VWA A;  5AQI B;  1OED E;  3OYX A;  4ILB A;  2BBJ A;  1L0V A;  4XAX B;  4QH4 A;  2QA7 A;  2HHH T;  4EAH A;  5JR9 A;  3MK7 C;  4YSZ A;  5FY0 A;  4TX5 A;  1NWM X;  3O9X A;  4LF6 T;  2XHE B;  2BDE A;  1WLX A;  4TWH A;  4DID B;  1J5W A;  1W09 A;  3B13 A;  5AQS B;  2X67 A;  3SFE A;  2CWO A;  3V5U A;  2ODU A;  3AEG A;  4ASK A;  3ESL A;  2K48 A;  5EK3 A;  1HTJ F;  3ZMS B;  2X9Y A;  3RKG A;  3T8O A;  5EZY E;  2UXX B;  3EDU A;  4BJM A;  2YEV C;  5JDQ A;  3KDS E;  1FMV A;  5JDF A;  3AE4 A;  2FJA A;  2E5V A;  1KFY A;  4GIW A;  2XAS B;  3F57 A;  2UXC T;  5JR9 B;  4DMV A;  4QH1 A;  4I4T E;  2ACX A;  5ABF A;  4H63 H;  3VKG A;  4HE8 A;  2IUB A;  3HR0 A;  1HCI A;  1BR4 A;  3TKL B;  4QHO A;  3N9Q A;  2UU9 T;  2N2N A;  2D0T A;  4NUV A;  2VKJ A;  3B5M A;  2KMF A;  3ZT7 A;  2LEH A;  1IJ6 A;  4B3S T;  3DTO A;  4CXW A;  3CX7 B;  1X9B A;  4DV1 T;  2RA1 A;  2W4X A;  3ONJ A;  5CA1 E;  4EED A;  2ODV A;  4EXT A;  4YTP A;  2V7I A;  3E0Z A;  2E5L T;  2CBI A;  5ABF B;  3KBT A;  4QKN A;  4ZI2 C;  4PJJ A;  2W00 A;  3RC8 A;  1WFD A;  1I6Z A;  1T7S A;  2XJ7 A;  4GK0 E;  3PUY F;  3ANW B;  2OA5 A;  4PK4 A;  3P8C D;  3VHL A;  3T1Y T;  2KXP B;  4L0R A;  2G0U A;  4U33 A;  3C98 B;  4JI7 T;  2V5C A;  4LML A;  2WMN A;  1MMN A;  3KBU A;  3AEE A;  3KVB A;  2JMH A;  3M65 A;  5LG4 A;  1NEK A;  2J62 A;  2V1D B;  3RYC E;  4ADZ A;  4PK6 A;  3PTR B;  4EIW A;  1UGO A;  5JRE A;  3P4S A;  3WAK A;  3QB5 K;  4MAL A;  4DV4 T;  3N9P A;  3Q9D A;  3AE5 A;  2WB5 A;  2VKO A;  4IRE A;  2WU5 A;  4JI2 T;  3A7M A;  2K9A A;  1R8I A;  3O4X E;  2R6G F;  5LXT E;  3ABV A;  3PJA J;  2H7O A;  3RC3 A;  4LF4 T;  1HX1 B;  1IJ5 A;  4AKI A;  1ZHC A;  2M67 A;  3GN5 A;  4H9Q C;  2W2U A;  5HEU A;  2YKS A;  2C5K T;  3PUZ F;  2L8K A;  2JMK A;  1QSD A;  3IF8 B;  1OWA A;  3ZKR A;  3ZLI A;  2X9W A;  2CCQ A;  4PFO A;  4YSY A;  4U2Z A;  3S4U A;  2UXD T;  2UXN B;  3AE6 A;  3SOL A;  3KV9 A;  5AQO B;  3CWZ B;  4PAG A;  4ILC A;  3LG7 A;  2DWK A;  3RIU C;  4XBF B;  4YJ2 E;  4P1N A;  3HI2 A;  4UR9 A;  3RHW A;  2XAQ B;  3ZT6 A;  2L9Q A;  3ZMV B;  2DNX A;  4UF0 A;  3GN5 B;  2W61 A;  2XQ6 A;  2ZMA A;  4Z91 A;  4B3M T;  1Z8U A;  4P0A A;  3N2O A;  4DR5 T;  1D1B A;  5L3D B;  5DJQ C;  3FBL A;  3AVS A;  5HXR A;  3AE2 A;  4YT0 A;  5LMN T;  2XM1 A;  2OLT A;  3FZF B;  5HEH A;  3CQG B;  4GKJ T;  3TLV A;  2CA5 A;  5HWX A;  3TLW A;  4KI0 F;  2LSI A;  3ETV A;  5FMN A;  2HPL A;  3UU5 A;  1T8B A;  4Z8X A;  5HCJ A;  4OX9 T;  2XAG B;  2XAF B;  4DBR A;  2I59 A;  4AQF C;  3ZYL A;  1HNX T;  3ZC0 A;  4I50 E;  4BJN A;  2YDR A;  5FVK A;  4DND A;  3RRC A;  1YQ4 A;  2H88 A;  5LGT B;  2X0H A;  5A1L A;  4AKH A;  3UU8 A;  2ZM2 A;  4WBO A;  1G73 A;  1HG5 A;  5KXJ A;  5CFB A;  4UXN B;  5JRC A;  3PUG A;  3WAJ A;  4G63 A;  4X65 T;  1LRZ A;  2JQQ A;  3PUA A;  5HXS A;  1X79 A;  3CVR A;  3P4W A;  5FXV A;  5EK4 A;  1S35 A;  3GMI A;  1KNZ A;  4OYJ A;  3C4W A;  1IZN B;  2LKG A;  2VB6 A;  2IW5 B;  1HR0 T;  4TN7 B;  4A5X A;  1UUR A;  3K3Q C;  4HKA A;  2IIU A;  2XQ3 A;  1UX4 A;  5JQG E;  2XQY A;  2LJL A;  3ZT5 A;  4JI3 T;  2V7M A;  4IT4 A;  5HXH A;  1ZKE A;  3U3I A;  2JQH A;  3RQW A;  2XQ4 A;  5JRC B;  3VRB A;  5L3E B;  2CLY C;  4O4L E;  3AEC A;  5LJN A;  4EZ4 A;  2LT3 A;  1HNZ T;  5HWY A;  4PJM A;  4UIG A;  5LB7 B;  3OKQ A;  3A5X A;  3FBZ A;  5L3G B;  2BVM A;  5AQN B;  2Q9Q C;  4IE0 A;  3KIN B;  1WYC A;  1UK5 A;  2VL8 A;  3PUW F;  2BS2 A;  4ZI3 C;  4C90 A;  2L3L A;  4HWI B;  2V8S V;  3RIA A;  3RYH E;  5AFU L;  4ILU A;  2WMO A;  2D2S A;  2BS4 A;  4F6R C;  2UXB T;  1XNQ T;  4H9O C;  4JLE A;  2MAW A;  5HXE A;  3PUR A;  4A98 A;  2YIN A;  4CN1 A;  4CN6 A;  2W63 A;  4IGU A;  3PJA A;  4O2A E;  4Q25 A;  3ETU A;  2I0M A;  3VR9 A;  2KWI B;  4U7Y A;  1ZOY A;  4QXC B;  5LMU T;  2IC6 A;  2FJD A;  3F2E A;  4NIQ A;  4AQG A;  3UUN A;  1XZY A;  3AEF A;  3IBP A;  4NXM T;  4H9P C;  1NAF A;  3AA0 B;  4CXX A;  1CUN A;  3Q5E A;  3AEA A;  1NEN A;  4H9N C;  3RIU A;  3SFD A;  2YK0 A;  4DV7 T;  5JDH A;  5M4Y A;  1VRB A;  3ZST A;  2AXD S;  2KZ7 B;  2MYS A;  4BA9 A;  3PUX F;  3ONX A;  3LK2 B;  4JV5 T;  3K1S A;  3ZPO A;  2LE8 A;  2NTY A;  1M7K A;  4M1P A;  3UUM A;  5AQF B;  2CBJ A;  4DV6 T;  5CGM A;  4OFZ A;  1MIW A;  3KFW X;  3P4R A;  1WRD A;  4LFB T;  3QK6 A;  1LKX A;  3CKD A;  3UQ7 A;  5H6Q B;  2VKD A;  2YDQ A;  4AQF A;  3I1A A;  2VUR A;  4PW8 A;  2LHR A;  4YSX A;  3AB3 B;  4BAY B;  4DV3 T;  2WDV A;  4ZI2 D;  2PTF A;  3R6N A;  3ZCI A;  3ZYM A;  2ES0 A;  5JH7 E;  4A97 A;  4UVC B;  2IDO B;  3QB5 A;  3ZC1 A;  2J47 A;  2X68 A;  5HXC A;  4PK5 A;  1OXZ A;  1BR2 A;  2A9U A;  4HWD A;  2Z6E A;  1IAP A;  3P50 A;  5F8P A;  5AQU B;  5FVL A;  2H7V C;  5L3F B;  3FHN A;  5FL0 A;  3OJA A;  4HWC A;  2KND A;  3CK6 A;  4X1I E;  5FP3 A;  2XQ8 A;  2HH7 A;  2AE9 A;  2W0G A;  2Y6X A;  5FYM A;  3LK3 B;  1YW0 A;  3RRW A;  4A56 A;  2F4V T;  1E7P A;  4TWD A;  3V5S A;  4E7Z A;  5DQV A;  3QOF A;  3JAD A;  3LJC A;  2NP9 A;  3AED A;  4GYS A;  2B76 A;  4L5G A;  1D0Y A;  4IL9 A;  2XAJ B;  4TZ4 C;  3VKH A;  2WSS V;  3AE1 A;  3UUB A;  3O1I A;  2C0S A;  2QVA A;  2WZI A;  2LM9 A;  4ZZC A;  4H63 V;  5AQH B;  5L3B B;  3C4X A;  3A8Y C;  1EZ3 A;  3H37 A;  1US7 B;  1O3X A;  4ZS2 A;  2IC9 A;  4XZC A;  1FEW A;  2Q9Q A;  3ZMU B;  1YQ3 A;  2CWY A;  5ABG A;  4PFP A;  4CI3 B;  3LDQ B;  2PG8 A;  3H3A A;  4EZH A;  2BG9 C;  4UV9 B;  2XQ5 A;  1JNZ A;  2HPJ A;  4MLK A;  2KWH A;  3KVA A;  2DI4 A;  1KNP A;  4LMJ A;  3DP7 A;  1Y64 B;  4GYR A;  1WR0 A;  2CLY B;  2V7J A;  4U74 A;  1V9D A;  1HFA A;  1T98 A;  3OPC A;  2M6B A;  2QYW A;  3I9W A;  3H3M A;  5LHI B;  2KSR A;  4QH5 A;  2JRK A;  3RYF E;  3OBV E;  3IEE A;  2MTQ A;  2X66 A;  1U5P A;  2Q9Q B;  3LBX A;  1E2A A;  3X1D A;  1U4Q A;  1FIO A;  5HAX A;  5LBM A;  3RKO A;  5J0Z A;  3VRA A;  2A2F X;  3ZCJ A;  5AQT B;  4IE4 A;  2KIN B;  2DLR A;  3K8P C;  3NBX X;  5LA6 E;  4HFH A;  5H6R B;  3MAC A;  2NW8 A;  5ABE A;  4I55 E;  3N5L A;  2RP4 A;  5JDL A;  1UUS A;  1S94 A;  2QGS A;  1BR1 A;  5LHG B;  5ABH A;  2XZE A;  4CI2 B;  1XWM A;  4IDP A;  2LHN A;  2UUB T;  4KHZ F;  4OK0 A;  3TLT A;  4U3C A;  3HKB E;  4H9S E;  3BK9 A;  4V1A v;  3R84 B;  4YTN A;  4CZZ B;  3AE7 A;  4DR2 T;  1QUU A;  1MND A;  2W67 A;  3L8R A;  2BKP A;  2J1D G;  4TUY E;  3VU7 H;  1BR0 A;  2VQE T;  2XSB A;  4O2B E;  4DO0 A;  3AE9 A;  1I94 T;  2BS3 A;  2CEA A;  2XY8 B;  4KMC A;  2XM2 A;  5FNV E;  4DR1 T;  5L4H A;  2FJE A;  2PFV A;  1MIV A;  3FZK B;  3LSV A;  1W0A A;  4E7S A;  3EAM A;  1N34 T;  4IL4 A;  4DBQ A;  3PDY A;  1D1A A;  5LJM A;  2KLQ A;  4AIU A;  1KK7 A;  4TV9 E;  4UF0 B;  4WYV A;  2VVN A;  5EK2 A;  2UUC T;  2YU2 A;  3LFM A;  4HFI A;  5LP6 E;  1Z0P A;  5L3C B;  2WDQ A;  1WCR A;  3C64 A;  4JI6 T;  1XDP A;  4DV5 T;  3C4Z A;  2WM9 A;  3J9X 1;  3IHR A;  3WI3 A;  1E1H B;  4HEA A;  2ZM6 T;  2Q9Q D;  2ZM8 A;  2D0U A;  4ZI3 D;  4JI8 T;  3OYZ A;  4CQI A;  3NZQ A;  3NRX A;  4K0U A;  3MJX A;  2EHO C;  4EYU A;  5BR8 T;  3UUX B;  2WY2 A;  1HX8 A;  4MBQ A;  4PNI A;  3ZSS A;  4EYY R;  5LCY A;  4GKK T;  1IBM T;  4KP3 C;  2LSY A;  1LVF A;  4AI6 A;  5FL1 A;  1OED C;  4B3R T;  4TV8 E;  2BG9 A;  4HGA A;  3SWH A;  5J2T E;  2NWB A;  2JIW A;  3ONL C;  3N9M A;  3CX6 B;  4QWN B;  4ZS3 A;  4KUM B;  1SE7 A;  3KV4 A;  4WZX A;  1QLB A;  4CI1 B;  2LRK A;  2NR4 A;  3TLS A;  3UQ4 A;  3C50 A;  4UEM A;  2SPC A;  3CML A;  2N1G A;  3C51 A;  1XMO T;  2BBH A;  4ILA A;  5FXW A;  3UUL A;  3Q5W A;  5HCM A;  5JVD E;  4EGW A;  5HEO A;  1T72 A;  2LSK A;  2VAS A;  4GOU A;  3RQU A;  3AE8 A;  1Y01 A;  3P4Q A;  4YHJ A;  5LG3 A;  5AQV B;  4NPP A;  3GA8 A;  3AAE B;  3UFE A;  4EV6 A;  2A3D A;  2IAK A;  1MMA A;  2BG9 B;  3F31 A;  2B1E A;  1UX5 A;  2UUA T;  2C5I T;  3CQC B;  3ZJ2 A;  4H9R C;  2PBI A;  5IWA T;  3ZEF B;  2V5D A;  3L09 A;  5HYA A;  5LOV E;  2VKH A;  4HFD A;  2BKN A;  5AQG B;  2HN2 A;  4UV8 B;  5C2T A;  5AQL B;  1J5E T;  4HWF A;  4AQY T;  1CHU A;  2WS3 A;  4LF7 T;  2V26 A;  3UU3 A;  3JAE A;  4HN9 A;  4AIS A;  5TAO A;  2E9X C;  3KV6 A;  2JPF A;  2X0Y A;  2C5J A;  3RIF A;  3M3Z B;  3UU6 A;  5LGN B;  2GK9 A;  1FJG T;  5DAB A;  4X1Y E;  4HFV A;  4X64 T;  1YKH B;  2Y48 B;  3VR8 A;  3FXE B;  1SUM B;  3K3O A;  4PJL A;  5LYJ E;  1GQE A;  2YDS A;  2DL1 A;  2E2A A;  3HKD E;  2HN1 A;  5AQM B;  2XQ7 A;  4AKR B;  4AKL A;  3AA1 B;  2FUP A;  3Q2M A;  3FZM B;  2BKO A;  4HTE A;  2LOP A;  4ZEY A;  2CXL A;  3FZH B;  4IE7 A;  3PUQ A;  2NW7 A;  3JAF A;  4EOZ B;  4LF8 T;  3PU3 A;  3PUS A;  1N33 T;  4DR6 T;  3DJB A;  1VCS A;  2CM0 A;  4P09 A;  4IDN A;  2OV9 A;  5AQP B;  3JC6 C;  3N2G E;  2LOS A;  3E22 E;  1LVK A;  2VK9 A;  1H7C A;  4EB6 E;  3AAI A;  3UU4 A;  1HF8 A;  4TNV A;  3AXJ A;  4KHP T;  2X51 A;  1G8X A;  1IBL T;  2XTL A;  2A72 A;  2NOX A;  5F5W A;  4DMW A;  3SS1 A;  3U78 A;  4DR4 T;  5LBQ B;  4ZXL A;  1YD8 G;  1FMW A;  5FXZ A;  2ZLY A;  2EHO A;  3ANW A;  2YOE A;  2LM2 A;  3KV5 A;  4CXY A;  2FBW A;  5GON E;  4HWH A;  2JQK A;  2WP9 A;  4IST A;  3RYI E;  5C8Y E;  1WR6 A;  2XSA A;  4OYK A;  2WBL A;  4U31 A;  3HL6 A;  5BMV E;  4IIJ E;  3GWH A;  4WW0 A;  4YJ3 E;  2KT9 A;  3AA6 B;  3EDV A;  1VCT A;  2CRB A;  1OED A;  5J2U E;  3AXJ B;  2WCA A;  3JCF A;  5HEJ A;  5LGU B;  2WQY A;  4ZZB A; 
#chains in the Genus database with same CATH homology
 3MK7 C;  4FJO A;  5HXH A;  3D0T A;  1ZKE A;  3U3I A;  5FY0 A;  3HKB E;  1NWM X;  3BK9 A;  4H9S E;  4TX5 A;  4V1A v;  3R84 B;  4CZZ B;  4X20 E;  4MHC A;  3O9X A;  2XHE B;  3N2K E;  1QUU A;  5JRC B;  2BDE A;  1MND A;  1MNE A;  2EHO B;  5L3E B;  1WLX A;  2CLY C;  4L9I A;  4O4L E;  4TUY E;  2J1D G;  3VU7 H;  5JDM A;  5LJN A;  3RH3 A;  4EZ4 A;  1BR0 A;  2XAH B;  1MMG A;  3B13 A;  1SA0 E;  4O2B E;  4DO0 A;  5F3J A;  4YFS A;  2LT3 A;  3J7Y q;  3I9Y A;  3MZK B;  2X67 A;  2CEA A;  5HWY A;  2DWG A;  2CWO A;  4PJM A;  4ANJ A;  4UIG A;  3V5U A;  2ODU A;  4KMC A;  3OKQ A;  4ASK A;  3ESL A;  3A5X A;  3FBZ A;  3MXZ A;  3MA9 A;  5L3G B;  2K48 A;  5FNV E;  2BVM A;  4UVA B;  2Q9Q C;  4IE5 A;  4IE0 A;  4JEH B;  3KIN B;  5EK3 A;  1WYC A;  1HTJ F;  2PFV A;  1MIV A;  4QX7 B;  3ZN0 B;  2X9Y A;  3ZMS B;  3T8O A;  2VL8 A;  5EZY E;  2UXX B;  3EDU A;  4ZI3 C;  3NZP A;  2N9D A;  2YEV C;  4BJM A;  4C90 A;  5JDQ A;  1HG2 A;  2L3L A;  3KDS E;  4E7S A;  1FMV A;  5JDF A;  3MKD A;  4DBQ A;  3RYH E;  5AFU L;  3PDY A;  4GIW A;  2XAS B;  3F57 A;  1D1A A;  5LJM A;  2KLQ A;  5JR9 B;  4ILU A;  2LSG A;  4DMV A;  1KK7 A;  4AXP A;  2WMO A;  2D2S A;  4TV9 E;  4I4T E;  4UF0 B;  2ACX A;  3I0Q A;  4F6R C;  2BVL A;  2D5U A;  5EK2 A;  4H63 H;  2YU2 A;  4N78 D;  2WAU A;  3LFM A;  4H9O C;  4JLE A;  5CA0 E;  5LP6 E;  1Z0P A;  3LK4 2;  5L3C B;  5HXE A;  3PUR A;  3VKG A;  4HE8 A;  3HR0 A;  2YIN A;  3C64 A;  1HCI A;  3C4Z A;  2W63 A;  4IGU A;  2WM9 A;  1BR4 A;  3J9X 1;  4O2A E;  3IHR A;  3TKL B;  4QHO A;  3ETU A;  2KWI B;  3WI3 A;  3N9Q A;  1E1H B;  4HEA A;  2N2N A;  4QXC B;  2D0T A;  3I0O A;  2IC6 A;  2Q9Q D;  1B7T A;  2ZM8 A;  4NUV A;  4OHF A;  4MFR A;  4B6X A;  3F2E A;  2D0U A;  4PJN A;  2VKJ A;  3HKE E;  2KMF A;  3ZMT B;  4ZI3 D;  2LEH A;  4AQG A;  2CE7 A;  3OYZ A;  4CQI A;  3EVY A;  3NZQ A;  3UUN A;  3IBP A;  1YKE B;  3QC9 A;  1IJ6 A;  1WYB A;  1NAF A;  3AA0 B;  3DTO A;  4G2A A;  4H9P C;  1CUN A;  2E9X A;  4CXW A;  4CXX A;  3CX7 B;  3NRX A;  4H9N C;  4K0U A;  2RA1 A;  4WBN E;  3BQI A;  3ZJ1 A;  2YK0 A;  5JDH A;  5M4Y A;  1VRB A;  3MJX A;  2KZ7 B;  2EHO C;  4EYU A;  5CA1 E;  2ODV A;  2MYS A;  5JDN A;  3UUX B;  4EXT A;  3AVR A;  1HX8 A;  4MBQ A;  5DQW A;  4BA9 A;  2V7I A;  3E0Z A;  3ONX A;  3LK2 B;  2K5B B;  4PNI A;  2LSJ A;  3ZPO A;  4EYY R;  2LE8 A;  2NTY A;  4QX8 B;  4IE6 A;  4ZHQ E;  5LCY A;  3KBT A;  3K3N A;  4M1P A;  4QKN A;  3AA7 B;  3UUM A;  4KP3 C;  2DHR A;  4ZI2 C;  3LBX B;  4O4H E;  2LSY A;  4PJJ A;  2W00 A;  1LVF A;  1AJ3 A;  4AI6 A;  3L3P A;  3RC8 A;  4OFZ A;  4FI5 A;  3RPU A;  1MIW A;  4GK0 E;  3ANW B;  2OA5 A;  2E8I A;  3KFW X;  4TV8 E;  4JEU B;  4PK4 A;  3P8C D;  3VHL A;  1WRD A;  4HGA A;  3SWH A;  2KXP B;  2NTX A;  4ISS A;  5LHH B;  5J2T E;  2NWB A;  5FY7 A;  4L0R A;  2G0U A;  2X0L B;  3QK6 A;  3N9M A;  3C98 B;  3CX6 B;  5JR9 C;  4QWN B;  4ZS3 A;  4C91 A;  1LKX A;  4KUM B;  4ERR A;  3CKD A;  2EHO D;  3KV4 A;  2E9X B;  5IHY A;  4CI1 B;  5KMG P;  3N9L A;  3C50 A;  5H6Q B;  2VKD A;  2WMN A;  4O4I E;  2NW9 A;  1MMN A;  4AQF A;  3KBU A;  3ZN1 B;  4UEM A;  5JDG A;  2SPC A;  3I1A A;  3CML A;  2N1G A;  3C51 A;  1UCU A;  3KVB A;  4PW8 A;  2ZM0 A;  2JMH A;  5FXW A;  3Q5W A;  2LHR A;  3M65 A;  3AB3 B;  3UUL A;  5LG4 A;  2V1D B;  5JVD E;  3RYC E;  4BAY B;  5LNK A;  2LSK A;  4YLH A;  2BZB A;  3AAA B;  2VAS A;  4ZI2 D;  3N9N A;  4ADZ A;  4GOU A;  3R6N A;  4PK6 A;  3ZCI A;  3O1J A;  3PTR B;  2CXF A;  4EIW A;  3ZYM A;  2ES0 A;  5JRE A;  5JH7 E;  3WAK A;  4MAL A;  4UVC B;  4YHJ A;  3ZC1 A;  5KX5 E;  2XUE A;  2X68 A;  3GA8 A;  3N9P A;  3Q9D A;  5CB4 E;  3AAE B;  5HXC A;  3UFE A;  2VKO A;  4PK5 A;  2X9X A;  1OXZ A;  1BR2 A;  2A3D A;  2IAK A;  2K9A A;  1MMA A;  3O4X E;  3F31 A;  5LXT E;  2B1E A;  2Z6E A;  1UX5 A;  3CPZ A;  1D0Z A;  1IAP A;  2P9B A;  2H7O A;  2WWU A;  3RC3 A;  2C5I T;  5F8P A;  3CQC B;  1IJ5 A;  3ZJ2 A;  4AKI A;  4H9R C;  1ZHC A;  2H7V C;  2M67 A;  4ZOL E;  5L3F B;  3FHN A;  3GN5 A;  2PBI A;  4H9Q C;  4P0B A;  3OJA A;  2C5K T;  2KND A;  3ZEF B;  3L09 A;  5HYA A;  4X1I E;  2L8K A;  5FP3 A;  5LOV E;  2JMK A;  3P7I A;  2VKH A;  1SHZ C;  2HH7 A;  3Q5X A;  1QSD A;  2JJ9 A;  3IF8 B;  1OWA A;  1HS7 A;  2W0G A;  2Y6X A;  5FYM A;  3ZLI A;  1ZEE A;  4UV8 B;  2X9W A;  2CCQ A;  4PFO A;  3S4U A;  4NUU A;  3FB2 A;  3LK3 B;  2MBG A;  2V7L A;  3EUH A;  1YW0 A;  3RRW A;  2UXN B;  4QXH B;  4A56 A;  5FXX A;  5E0O A;  3SOL A;  2V26 A;  4UVB B;  3KV9 A;  3V5S A;  4E7Z A;  1MMD A;  3CWZ B;  4HN9 A;  4PAG A;  5DQV A;  3E08 A;  3LJC A;  5TAO A;  2NP9 A;  1VOM A;  2E9X C;  3KV6 A;  4GYS A;  2JPF A;  1D0X A;  3LG7 A;  4JUY A;  2C5J A;  4L5G A;  5LGN B;  1D0Y A;  2GK9 A;  5DAB A;  2DWK A;  4X1Y E;  2XAJ B;  4XBF B;  2V7K A;  2PJQ A;  4HFV A;  4YJ2 E;  3CX8 B;  3FXD B;  4TZ4 C;  3HI2 A;  3VKH A;  2WSS V;  2CXD A;  3O1I A;  1YKH B;  2XAQ B;  2Y48 B;  2C0S A;  2L9Q A;  3FXE B;  4J2C A;  3ZMV B;  4IHJ E;  3K3O A;  4PJL A;  5LYJ E;  2LM9 A;  3RX6 A;  3HKD E;  4H63 V;  5L3B B;  3CQX C;  3C4X A;  2DNX A;  4AKR B;  4AKL A;  3AA1 B;  1EZ3 A;  4UF0 A;  3GN5 B;  4X1K E;  3H37 A;  3Q2M A;  3SRZ A;  1US7 B;  3B57 A;  3UTK A;  3UT5 E;  2W61 A;  2ZMA A;  1O3X A;  4HTE A;  2LOP A;  4ZS2 A;  2CXL A;  4IE7 A;  3PUQ A;  2IC9 A;  4XZC A;  4P0A A;  2NW7 A;  3N2O A;  3BQL A;  1ZV4 X;  1D1B A;  5L3D B;  1FEW A;  2Q9Q A;  5DJQ C;  3FBL A;  3ZMU B;  3AVS A;  5HXR A;  4EOZ B;  2CWY A;  4GK5 E;  3PU3 A;  4PFP A;  2YU1 A;  4CI3 B;  2X9H A;  3PUS A;  2PG8 A;  2K24 A;  4O4J E;  2E9X D;  3H3A A;  5KDM C;  3DJB A;  3CQG B;  3PU8 A;  2CA5 A;  4EZH A;  2CM0 A;  4P09 A;  4UV9 B;  5HWX A;  5ETW A;  2HPJ A;  2LSI A;  3ETV A;  4WNK A;  1D1C A;  4MLK A;  5FMN A;  2KWH A;  3KVA A;  2DI4 A;  2HPL A;  4Z8X A;  3JC6 C;  2XAG B;  2XAF B;  3N2G E;  1MIY A;  4DBR A;  2LOS A;  2H3R A;  3E22 E;  5FY1 A;  1LVK A;  4IDZ A;  2VK9 A;  3DP7 A;  1H7C A;  2I59 A;  4AQF C;  4EB6 E;  4AKG A;  1Y64 B;  3AAI A;  1HF8 A;  4GYR A;  3N9O A;  3ZYK A;  3ZYL A;  2CLY B;  2V7J A;  4U74 A;  4I43 B;  2Y8D A;  1V9D A;  1HFA A;  1T98 A;  3BQK A;  3ZC0 A;  4I50 E;  4U72 A;  4BJN A;  3NRY A;  2X51 A;  4DND A;  1G8X A;  4KBM B;  2W62 A;  2XTL A;  3O1H A;  5J1G A;  3RRC A;  2A72 A;  3I9W A;  4UEL A;  2CMR A;  5LHI B;  5LGT B;  2NOX A;  4DMW A;  5A1L A;  2JRK A;  4O8S A;  3RYF E;  3OBV E;  3SS1 A;  3IEE A;  4AKH A;  2MTQ A;  2X66 A;  3U78 A;  1U5P A;  2Q9Q B;  2ZM2 A;  5IYZ E;  5LBQ B;  3LBX A;  4WBO A;  1G73 A;  1HG5 A;  1YD8 G;  1FMW A;  3JC6 D;  3HKC E;  4UXN B;  5FXZ A;  5JRC A;  2ZLY A;  3PUG A;  1U4Q A;  4DVD A;  1FIO A;  2EHO A;  3WAJ A;  3ANW A;  5HAX A;  5LBM A;  3RKO A;  3ZMZ B;  4G63 A;  1LRZ A;  2JQQ A;  3PUA A;  2A2F X;  3KV5 A;  4QXB B;  5ADX L;  3ZCJ A;  5HXS A;  4IE4 A;  1X79 A;  2KIN B;  3CVR A;  3HA4 A;  4ZI7 E;  2DLR A;  4CXY A;  5L2L A;  3K8P C;  5GON E;  3NBX X;  5LA6 E;  4IST A;  5H6R B;  3W15 B;  3MAC A;  5FXV A;  3RYI E;  1WR6 A;  2NW8 A;  2DCF A;  5EK4 A;  5C8Y E;  1S35 A;  3QUJ A;  4I55 E;  3N5L A;  3GMI A;  1KNZ A;  4OYK A;  2WBL A;  2MOZ A;  3HL6 A;  4OYJ A;  3C4W A;  5BMV E;  1IZN B;  2RP4 A;  2VWA A;  3PE0 A;  3GWH A;  4IIJ E;  4WW0 A;  4YJ3 E;  5JDL A;  2KT9 A;  3AA6 B;  1S94 A;  3EDV A;  2QGS A;  1BR1 A;  3OYX A;  5LHG B;  2VB6 A;  2IW5 B;  4TN7 B;  4XAX B;  4CI2 B;  5J2U E;  3K3Q C;  4HKA A;  2QA7 A;  5LGU B;  1UX4 A;  5JQG E;  2LHN A;  4EAH A;  2XQY A;  2LJL A;  5JR9 A;  4OK0 A;  2V7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...