4DR2T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr2T00
2UU9T 4YHHT 3OTOT 4B3ST 4DV2T 4GKJT 4JI1T 4DV3T 4DV0T 4NXNT 4X65T 1IBKT 4B3RT 4JI2T 4LF9T 2HHHT 4GKKT 3T1HT 5LMUT 4X64T 5LMNT 4DV6T 4LF5T 3T1YT 4DR4T 4DV4T 4DR5T 4LFAT 2F4VT 4B3TT 4K0KT 5BR8T 4DV5T 4LF8T 4DV7T 4X66T 2ZM6T 4LFCT 4DR2T 2UXBT 4JI6T 4JYAT 4LF4T 4DR6T 2UUCT 4JI4T 1IBMT 2UUBT 4KHPT 4YY3T 2UXCT 2E5LT 4DR3T 4AQYT 4LFBT 4DUYT 5IWAT 4LF7T 1N33T 1N36T 4JI0T 2VQET 4DV1T 1N32T 4DUZT 1J5ET 4B3MT 4JI7T 1XNQT 4JI5T 1HNZT 2UUAT 2UXDT 4X62T 4DR7T 4JI3T 2VQFT 1I94T 1HNWT 4OX9T 4NXMT 1XMQT 1HNXT 1XNRT 4LF6T 1XMOT 4JI8T 1N34T 1IBLT 4DR1T 4JV5T 1FJGT 1HR0T
chains in the Genus database with same CATH superfamily
3AEAA 3RC8A 5FP3A 5LJNA 5LNKA 3SWHA 4O4JE 2JJ9A 4O4LE 5FY0A 1WRDA 4UIGA 4AXPA 1FMWA 2VK9A 3VKGA 2XAGB 2PFVA 4O4IE 4QH4A 4DV3T 5ABFA 4H9SE 4DV0T 1ZEEA 4CN1A 4IE7A 2XQ8A 1IZNB 4EEBA 3FXDB 4GYRA 2WWUA 4A56A 4EYYR 2FUPA 1H7CA 3CQCB 4ZS2A 2QVAA 3R84B 4JI6T 5GONE 4QX7B 2BG9E 1JNRA 2V6YB 2YN6A 4EXTA 3P4RA 4HWHA 5AQGB 3AXJA 4HFBA 4WBOA 5FKYA 5HXEA 3AE7A 4CI3B 3NWIA 5LMUT 2WY2A 4DV6T 1KNRA 1SA0E 2YU2A 5AQIB 4CXWA 1D0XA 5DQVA 3AE9A 4K0UA 2W66A 4QXCB 4TNVA 5AQHB 5DQWA 3VR8A 3ZCIA 3ZN0B 5JTGA 3UUNA 1SUMB 4X20E 2BBHA 3IBPA 3VRBA 4CN6A 2B76A 2E8IA 3RYFE 4HWFA 2LJLA 3RKGA 3N2GE 4ERRA 3MACA 1G73A 3ONXA 4HWIB 3F57A 5JDFA 3ZT6A 3ZJ1A 4DV5T 2VKDA 2XAJB 3PJAJ 5C8YE 3JAFA 5L2LA 5JRCA 1IJ5A 3VKHA 2N2NA 2L9QA 1B7TA 2CCQA 2XHEB 3RYCE 4CXXA 5H6QB 1BR4A 2CWYA 2OA5A 4JYAT 3PTRB 5CA0E 4LF4T 4A98A 5LHHB 4DR6T 1D1AA 1BR1A 3EI0A 5JDMA 4AQGA 4CZZB 2N9DA 5LA6E 3KVBA 2ES0A 2V1DB 3GMIA 3O1JA 3NRXA 1HTJF 2JQ9A 2X9XA 4HE8A 4YY3T 2LSGA 2J4GA 2KINB 3QNUA 4OFZA 4QH5A 2V7KA 4ZXLA 2HPLA 3PUGA 3K1SA 2MBGA 3CKDA 3RRCA 2M6IA 2H3RA 3C50A 3ZMVB 2CBIA 3WAKA 3AEBA 3MK7C 2YINA 1FMVA 2I6HA 2ZM0A 2CE7A 4IE4A 3ZYMA 4ZI2D 5IWAT 1E1HB 1N33T 1WYBA 2Y48B 1N36T 2NOXA 2VWAA 4U2ZA 5FXWA 4MHCA 3B13A 2BS2A 4ZI2C 2LOSA 2BKNA 2V26A 3ETUA 4DMWA 3EDVA 4DV1T 4H9QC 3MXZA 1WYCA 4GK5E 4ADZA 4O8SA 5J2TE 2WB5A 4LMLA 2BKOA 2Q9QB 1T8BA 3VRAA 2HH7A 3ETVA 3VU7H 1ZHCA 2WS3A 4HEAA 3B57A 3UUXB 4JUYA 2VL8A 3BQIA 3P4WA 3ZEFB 2LEHA 2JQHA 5KX5E 3UU3A 4YJ2E 1UX5A 4MFRA 3UFGA 3UULA 4WBNE 3C4ZA 2UUAT 2UXNB 2ACXA 3L09A 5LCYA 4CXYA 3EVYA 4XAXB 4KHZF 4F8HA 3QOFA 4EGWA 1HG2A 1HG5A 1QUUA 1UX4A 2CLYB 3O1IA 1KEYA 1WR0A 2X0HA 3CQGB 4NPPA 3ZMUB 2KT9A 2D5UA 4TZ4C 3O9XA 1T7SA 1UGOA 4HFVA 4TWFA 3N9QA 4U33A 5FYMA 1US7B 3K8PC 3CMLA 3QB5K 4EV6A 2XQ3A 5FL1A 4ZZBA 2L8KA 4B6XA 4IE6A 3PUQA 5LGUB 4GK0E 3L3PA 4C90A 2JMKA 3HA4A 3H37A 2B1EA 4O4HE 4H9NC 4LF6T 3AE3A 2CHOA 5J2UE 3QK6A 3HKCE 1XDOA 1XMOT 1Y01A 1HF8A 5L47A 3BK9A 3PURA 4JI8T 4ZI3C 2P9BA 3N9PA 4AI6A 2KLQA 2CXLA 2BDEA 2PJQA 4ANJA 2DWGA 3N2KE 3AA7B 3UTKA 3C64A 4KUMB 3DTOA 3WI3A 2WCAA 3JC6C 2MOZA 2ACZA 3ZKRA 4BA9A 4IDPA 4DBQA 2WM9A 2LHNA 3HKDE 3OBVE 2NTXA 3N9MA 4ZS3A 5ABGA 4YHHT 4B3ST 5HXSA 2YDSA 4GKJT 3CIRA 4HFEA 3NKZA 4UF0A 3FB2A 3H3AA 1EZ3A 2BG9B 4KMCA 2Y6XA 5EZYE 4Z8XA 3KFWX 3KV4A 4HKAA 1NAFA 2NW7A 1L0VA 5JQGE 3J7Yq 3LBXB 2YDRA 2K5BB 2W63A 1M7KA 4UR9A 5LB7B 4CN4A 4QXHB 3AB3B 5C2TA 3NZPA 4UVCB 5DABA 3RI5A 4X65T 2LSJA 5J1GA 1XWMA 2M6BA 2VASA 2WDVA 3FZLB 4DMVA 3UT5E 3AE1A 5CJ5A 4B3RT 4ZI7E 5IHYA 5AQSB 4XBFB 5HXRA 4I4TE 4YSYA 2HHHT 2V6XA 4CI1B 1E7PA 5LMNT 3PUAA 2A3DA 4DV4T 2NR4A 3UUBA 2C5KT 4LFAT 2LM2A 5J0ZA 5FNVE 5ABEA 4YSXA 3CX6B 4U7YA 4HFCA 4IT4A 2XQ9A 3CWZB 1NENA 4Z90A 2C5IT 2MTQA 3ZSSA 5JVDE 1XZYA 2IW5B 5BR8T 3RRWA 4JEHB 5HEOA 2V7LA 4QX8B 3UU4A 1BR2A 3AEDA 2A72A 3VR9A 3AE4A 2ZM6T 1LKXA 3NZQA 5BMVE 5E0OA 4AQFA 3AEEA 4HWDA 2WU2A 3HKBE 2M67A 2XZEA 2WMNA 1QLBA 2YKSA 1IJ6A 1UCUA 2IIUA 2X0LB 2ZM2A 2CLYC 3JCFA 3AAAB 4IL4A 4IDZA 1D0YA 3FBZA 2VKJA 2XSBA 3KV5A 4QKNA 4U3CA 2ODUA 4EAHA 4IREA 4ASKA 3P4QA 4JI4T 5JDLA 4TWDA 3TLSA 5FXZA 3ONLC 4U7IA 4COFA 2WP9A 2J62A 2W00A 4U2YA 3RQWA 4ZZCA 1IAPA 5LHIB 2PTFA 1WLXA 2YK0A 2UXCT 2YDQA 3EUHA 3LK2B 4YTPA 5H6RB 3UU5A 4P0AA 1ZKEA 2DLRA 3K3NA 1MMDA 2WSSV 4H9RC 4QH1A 3N9OA 5HCMA 2NW8A 2LKGA 3GWHA 2KWIB 3CQXC 4IL9A 4AIUA 4JLEA 1E2AA 2CMRA 3I1AA 4LF7T 2X51A 2J47A 2AXDS 2I59A 4X1KE 3I9WA 4JI0T 3SFDA 4IDQA 2H88A 4C91A 3ANWA 3MZKB 5HWXA 3KV6A 3PUSA 5AQOB 3PUVF 5KMGP 2BKPA 3Q5EA 1T98A 3AVSA 3ZT7A 4F6RC 1HX8A 4DUZT 2W61A 4V1Av 3ZC1A 3K3QC 2CRBA 2XASB 3PUYF 4JI7T 3A7MA 1LVFA 1BR0A 3ZN1B 2FBWA 5ETWA 3P4SA 4CI2B 1CHUA 2RPAA 5HXCA 2UXDT 1KF6A 1WCRA 4AKRB 1S35A 1VOMA 1J1JA 4X1YE 5AQVB 3RC3A 1MMGA 4HFHA 3RF1A 4ILCA 3QC9A 2CM0A 4H9PC 4EIWA 3KDSE 4AKHA 3GA8A 2A9UA 4DNDA 3N5LA 4AQFC 5JRCB 2BVLA 3ANWB 2RP4A 3LBXA 1WFDA 3P8CD 1X9BA 3V5UA 4PJJA 5L3EB 3IF8B 1HNXT 5AQQB 1XDPA 2IHR1 2N1GA 3C4XA 3EAMA 1AJ3A 2EHOB 2LSKA 4WZXA 1YD8G 3LDQB 3RYHE 1R8IA 3E22E 2WDRA 3KV9A 4TUYE 1MNDA 3HR0A 1W0BA 4UEMA 3OKQA 1M62A 3UQ4A 2YOEA 1UUSA 1W0AA 2X68A 3EDUA 3OJAA 1UK5A 3A5XA 3B5MA 2JPFA 4MBQA 5JDQA 4YFSA 4QXBB 1OEDE 2VVNA 1J5WA 1HS7A 3PUZF 3SFEA 4FJOA 1YQ3A 4P0BA 3AE2A 4DVDA 5JDGA 1HR0T 4UVBB 3Q9DA 4EZ4A 1VCSA 2Y8DA 1U4QA 3ZYKA 3OTOT 2UU9T 3FBLA 2BZBA 4WNKA 3Q2MA 4I55E 2PG8A 2W2UA 2WAUA 4KI0F 3MKDA 5ABFB 3RIUA 5LYJE 3RLFF 1MMNA 2KXPB 1YXRA 2DWKA 4O2AE 4JI1T 3P4PA 3AA0B 2FJAA 2NWBA 4IGUA 4L5GA 4X5TA 2BVMA 2XTLA 5EK2A 4NXNT 1W09A 3PE0A 4A5XA 1JNZA 5LOVE 2XQ5A 2D0UA 3CK6A 4XZCA 2XQ6A 2FJDA 3AAIA 2VKHA 3KBTA 2XSAA 3C4WA 3F2EA 3I0QA 1O3XA 4TN7B 4FI5A 4UV9B 2XAHB 4I43B 3RGLA 3U78A 3T8OA 2XUEA 2X66A 3UUMA 3Q5WA 4X64T 4DR4T 5HYAA 3MJXA 2SPCA 2I0MA 2IUBA 3OVUA 4DR5T 3T1YT 3ZC0A 4LF9T 2BBJA 3N9NA 4B3TT 2Q9QD 2LSYA 4JEUB 3RYIE 3MA9A 2VB6A 4LF8T 2HN1A 3RHWA 4DV7T 4ILAA 3LFMA 3ZSTA 5JR9B 1YKHB 2H89A 2VVSA 5FXVA 4LFCT 4PW8A 3I0OA 4Z91A 4DR2T 4ZI3D 4ZOLE 2DL1A 2WU5A 2XQAA 2Q9QA 3AE8A 1G8XA 2IC9A 2ZLYA 1V9DA 4H63V 3ZCJA 3JC6D 4CQIA 2XQ7A 2MAWA 3OYZA 4NUVA 5LGTB 2K9AA 4HN9A 2VKOA 2C5JA 2HPJA 3O4XE 3PV0F 4TWHA 4UXNB 2V5DA 4HFIA 3Q5XA 4HWCA 3ZMZB 4BJNA 4GIWA 2XQ4A 3ZPOA 4U72A 2W67A 3O1HA 1MIWA 3ZYLA 2VL0A 5LG4A 1IBMT 2UUBT 3M65A 4KHPT 1OEDC 3FZFB 5EK4A 5AQKB 4H9OC 5FY1A 3HL6A 2VURA 1X79A 1HFAA 3H3MA 3PUXF 2W0GA 2CBJA 2E5LT 1VCTA 4I50E 5HEUA 4DR3T 3SS1A 5M4YA 2H7OA 5ADXL 1U5PA 3UFEA 2LSIA 4QWNB 4WW0A 5C3JA 5ABHA 2OLTA 2E9XC 4OYKA 5HCJA 3RH3A 4YT0A 4NIQA 2ZMAA 5HXHA 4PK5A 2CA5A 2E9XD 3V5SA 3X1DA 5JR9C 4NUUA 4P09A 3W15B 1N32T 2IAKA 3AA1B 2EHOA 3EABA 5HEHA 4OHFA 4EZHA 4HTEA 2QA7A 5HEJA 2IMLA 3OYXA 2FJBA 2AE9A 3CPZA 3JAEA 3K3OA 1VRBA 4EB6E 1I6ZA 1KNZA 2LLYA 5JDHA 4JI2T 2X9WA 4BJMA 4JI5T 3AECA 3BQLA 3RIAA 4X62T 1ZOYA 2LM9A 3A8YC 3M3ZB 2VQFT 4JI3T 2BS4A 5TAOA 3RIFA 5CA1E 5LGNB 5LJMA 4UF0B 1I94T 2Q9QC 4PAGA 3IEEA 4I0UA 1NWMX 2LHRA 3G06A 4MALA 1MIYA 3TLVA 2KZ7B 4OX9T 3LG7A 4NXMT 2XPKA 3P50A 2K24A 3PU3A 5FL0A 2XM1A 3OPCA 4P1NA 3AXJB 4HGAA 4BAYB 3UU6A 2K3WA 3LSVA 2DI4A 2WDQA 5JH7E 1XNRT 5HEGA 2Z6EA 5KXJA 5AQRB 4ISTA 4MLKA 4ZEYA 2MYSA 4LMKA 2KWHA 2XQYA 3SRZA 2JRKA 1D0ZA 1N34T 1FIOA 2DHRA 3N2OA 3FZKB 5EK3A 1ZV4X 3AEFA 1NEKA 4J2CA 3ESLA 2D2SA 1OXZA 3CX8B 2QRXA 5KDMC 2CWOA 5L3GB 1HX1B 2QGSA 2E9XA 4M1PA 4DV2T 2CXFA 1ZP0A 1KK7A 3DJBA 5IUXA 2KNDA 1MIVA 2GK9A 2KMFA 2R6GF 3UQ7A 2W4XA 2YU1A 3LK42 4ILUA 4QHOA 4YJ3E 5IYZE 2IC6A 2EHOC 2EHOD 3AVRA 4KBMB 4PJNA 4YXDA 1KNPA 4YTMA 5JR9A 4A97A 4UVAB 5FY7A 3UU8A 5L4EA 1LVKA 2NTYA 4ILBA 2LKHA 2IDOB 1HCIA 2JIWA 5AQNB 2BG9C 3J9X1 3TLWA 1S94A 2X9YA 4E7ZA 1IBKT 3L8RA 5JREA 2WZHA 1GQEA 3CVRA 3F31A 3I9YA 3FZHB 3HI2A 4IDOA 5FMNA 3T1HT 2LOPA 2V7IA 5L3BB 2YEVC 4LF5T 2LRLA 3Q5DA 4WYVA 2DCFA 2CPTA 4UV8B 3AE6A 3ZMTB 1OEDA 5FXXA 2F4VT 4YHJA 5AFUL 2D9DA 5CGMA 3NRYA 2CHNA 4IHJE 4KP3C 2V5CA 4PK6A 5LXTE 4K0KT 5LBMA 2JMHA 4N78D 3S4UA 2KSRA 3L39A 3VHLA 1Z0PA 2JQQA 4GYSA 3AE5A 3JADA 5AQPB 4X66T 1D1CA 3BQKA 4UELA 4X1IE 3D0TA 3E08A 2RA1A 2NP9A 3GN5B 4YLHA 3RPUA 1YQ4A 5L3FB 4AKIA 1CUNA 5AQJB 1QSDA 3EHZA 3KBUA 3QUJA 5LG3A 3C98B 2UXBT 2LRKA 3CX7B 3ABVA 2XY8B 4PFOA 2V8SV 4YTNA 4ISSA 2XAQB 2JQKA 3RIUC 2UUCT 2J1DG 2XJ7A 3RKOA 4DO0A 5AQTB 4PK4A 1OEDB 3ZT5A 3LJCA 3IA3A 1YKEB 2G0UA 4DBRA 3RQUA 4AKGA 3PU8A 2HN2A 1SHZC 3AEGA 3FHNA 3R6NA 5CFBA 5LP6E 4GKKT 2WWVA 2WQYA 3PUWF 4TNWA 4JBWF 3FZMB 3N9LA 4AQYT 4LFBT 4DUYT 1UURA 1Z8UA 2BS3A 4AISA 4PJMA 2D0TA 5JDNA 2WZIA 3AAEB 5L3DB 3IHRA 5FVLA 1FEWA 2A2FX 1LRZA 5AQMB 3RX6A 2VQET 3SOLA 3KVAA 4H63H 2L3LA 4LMJA 4E7SA 1YW0A 5DJQC 1MMAA 5F5WA 4L9IA 1J5ET 1DU2A 1T72A 2OV9A 2ZM8A 4B3MT 2PBIA 4KX6A 4O2BE 2W62A 3HKEE 4PNIA 3U3IA 3ONJA 3ZJ2A 1XNQT 2WMOA 2V7JA 4IIJE 2XM2A 2X9HA 4G2AA 3GN5A 2NW9A 1HNZT 2K48A 3TLTA 3ZLIA 4DR7T 2MPKA 4GOUA 2E5VA 5AQUB 3PDYA 4OYJA 5FVKA 5F3JA 2C0SA 4YSZA 3NBXX 2V6YA 2ODVA 1Y64B 3FXEB 4EEDA 4G63A 4U31A 3ZMSB 1HNWT 1OWAA 2V7MA 4IE0A 5L4HA 4EOZB 2LE8A 2QYWA 2X0YA 4PJLA 1D1BA 4IDNA 2DNXA 4AKLA 1XMQT 1W9RA 1KFYA 2H7VC 2E9XB 5AQFB 5HAXA 3WAJA 3NVOA 3AA6B 4HFDA 1MNEA 2E2AA 3TLUA 3DP7A 2CEAA 2WBLA 3PJAA 3E0ZA 4PFPA 4ZHQE 5AQLB 3C51A 1SE7A 3QB5A 4TV9E 3KINB 3LK3B 4Q25A 5A1LA 4U74A 2FJEA 2CXDA 4EYUA 5L3CB 4TV8E 4OK0A 2XAFB 1IBLT 2UXXB 3P7IA 2X67A 3TKLB 5LHGB 5CB4E 5HWYA 4DR1T 5F8PA 1WR6A 5LBQB 4TX5A 4JV5T 1FJGT 4L0RA 4IE5A 2BG9A 2LT3A 4DIDB
chains in the Genus database with same CATH topology
2UU9T 4YHHT 3OTOT 4B3ST 4DV2T 4GKJT 4JI1T 4DV3T 4DV0T 4NXNT 4X65T 1IBKT 4B3RT 4JI2T 4LF9T 2HHHT 4GKKT 3T1HT 5LMUT 4X64T 5LMNT 4DV6T 4LF5T 3T1YT 4DR4T 4DV4T 4DR5T 4LFAT 2F4VT 4B3TT 4K0KT 5BR8T 4DV5T 4LF8T 4DV7T 4X66T 2ZM6T 4LFCT 4DR2T 2UXBT 4JI6T 4JYAT 4LF4T 4DR6T 2UUCT 4JI4T 1IBMT 2UUBT 4KHPT 4YY3T 2UXCT 2E5LT 4DR3T 4AQYT 4LFBT 4DUYT 5IWAT 4LF7T 1N33T 1N36T 4JI0T 2VQET 4DV1T 1N32T 4DUZT 1J5ET 4B3MT 4JI7T 1XNQT 4JI5T 1HNZT 2UUAT 2UXDT 4X62T 4DR7T 4JI3T 2VQFT 1I94T 1HNWT 4OX9T 4NXMT 1XMQT 1HNXT 1XNRT 4LF6T 1XMOT 4JI8T 1N34T 1IBLT 4DR1T 4JV5T 1FJGT 1HR0T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  4YHH T;  3OTO T;  4B3S T;  4DV2 T;  4GKJ T;  4JI1 T;  4DV3 T;  4DV0 T;  4NXN T;  4X65 T;  1IBK T;  4B3R T;  4JI2 T;  4LF9 T;  2HHH T;  4GKK T;  3T1H T;  5LMU T;  4X64 T;  5LMN T;  4DV6 T;  4LF5 T;  3T1Y T;  4DR4 T;  4DV4 T;  4DR5 T;  4LFA T;  2F4V T;  4B3T T;  4K0K T;  5BR8 T;  4DV5 T;  4LF8 T;  4DV7 T;  4X66 T;  2ZM6 T;  4LFC T;  4DR2 T;  2UXB T;  4JI6 T;  4JYA T;  4LF4 T;  4DR6 T;  2UUC T;  4JI4 T;  1IBM T;  2UUB T;  4KHP T;  4YY3 T;  2UXC T;  2E5L T;  4DR3 T;  4AQY T;  4LFB T;  4DUY T;  5IWA T;  4LF7 T;  1N33 T;  1N36 T;  4JI0 T;  2VQE T;  4DV1 T;  1N32 T;  4DUZ T;  1J5E T;  4B3M T;  4JI7 T;  1XNQ T;  4JI5 T;  1HNZ T;  2UUA T;  2UXD T;  4X62 T;  4DR7 T;  4JI3 T;  2VQF T;  1I94 T;  1HNW T;  4OX9 T;  4NXM T;  1XMQ T;  1HNX T;  1XNR T;  4LF6 T;  1XMO T;  4JI8 T;  1N34 T;  1IBL T;  4DR1 T;  4JV5 T;  1FJG T;  1HR0 T; 
#chains in the Genus database with same CATH topology
 3AEA A;  3RC8 A;  5FP3 A;  5LJN A;  5LNK A;  3SWH A;  4O4J E;  2JJ9 A;  4O4L E;  5FY0 A;  1WRD A;  4UIG A;  4AXP A;  1FMW A;  2VK9 A;  3VKG A;  2XAG B;  2PFV A;  4O4I E;  4QH4 A;  4DV3 T;  5ABF A;  4H9S E;  4DV0 T;  1ZEE A;  4CN1 A;  4IE7 A;  2XQ8 A;  1IZN B;  4EEB A;  3FXD B;  4GYR A;  2WWU A;  4A56 A;  4EYY R;  2FUP A;  1H7C A;  3CQC B;  4ZS2 A;  2QVA A;  3R84 B;  4JI6 T;  5GON E;  4QX7 B;  2BG9 E;  1JNR A;  2V6Y B;  2YN6 A;  4EXT A;  3P4R A;  4HWH A;  5AQG B;  3AXJ A;  4HFB A;  4WBO A;  5FKY A;  5HXE A;  3AE7 A;  4CI3 B;  3NWI A;  5LMU T;  2WY2 A;  4DV6 T;  1KNR A;  1SA0 E;  2YU2 A;  5AQI B;  4CXW A;  1D0X A;  5DQV A;  3AE9 A;  4K0U A;  2W66 A;  4QXC B;  4TNV A;  5AQH B;  5DQW A;  3VR8 A;  3ZCI A;  3ZN0 B;  5JTG A;  3UUN A;  1SUM B;  4X20 E;  2BBH A;  3IBP A;  3VRB A;  4CN6 A;  2B76 A;  2E8I A;  3RYF E;  4HWF A;  2LJL A;  3RKG A;  3N2G E;  4ERR A;  3MAC A;  1G73 A;  3ONX A;  4HWI B;  3F57 A;  5JDF A;  3ZT6 A;  3ZJ1 A;  4DV5 T;  2VKD A;  2XAJ B;  3PJA J;  5C8Y E;  3JAF A;  5L2L A;  5JRC A;  1IJ5 A;  3VKH A;  2N2N A;  2L9Q A;  1B7T A;  2CCQ A;  2XHE B;  3RYC E;  4CXX A;  5H6Q B;  1BR4 A;  2CWY A;  2OA5 A;  4JYA T;  3PTR B;  5CA0 E;  4LF4 T;  4A98 A;  5LHH B;  4DR6 T;  1D1A A;  1BR1 A;  3EI0 A;  5JDM A;  4AQG A;  4CZZ B;  2N9D A;  5LA6 E;  3KVB A;  2ES0 A;  2V1D B;  3GMI A;  3O1J A;  3NRX A;  1HTJ F;  2JQ9 A;  2X9X A;  4HE8 A;  4YY3 T;  2LSG A;  2J4G A;  2KIN B;  3QNU A;  4OFZ A;  4QH5 A;  2V7K A;  4ZXL A;  2HPL A;  3PUG A;  3K1S A;  2MBG A;  3CKD A;  3RRC A;  2M6I A;  2H3R A;  3C50 A;  3ZMV B;  2CBI A;  3WAK A;  3AEB A;  3MK7 C;  2YIN A;  1FMV A;  2I6H A;  2ZM0 A;  2CE7 A;  4IE4 A;  3ZYM A;  4ZI2 D;  5IWA T;  1E1H B;  1N33 T;  1WYB A;  2Y48 B;  1N36 T;  2NOX A;  2VWA A;  4U2Z A;  5FXW A;  4MHC A;  3B13 A;  2BS2 A;  4ZI2 C;  2LOS A;  2BKN A;  2V26 A;  3ETU A;  4DMW A;  3EDV A;  4DV1 T;  4H9Q C;  3MXZ A;  1WYC A;  4GK5 E;  4ADZ A;  4O8S A;  5J2T E;  2WB5 A;  4LML A;  2BKO A;  2Q9Q B;  1T8B A;  3VRA A;  2HH7 A;  3ETV A;  3VU7 H;  1ZHC A;  2WS3 A;  4HEA A;  3B57 A;  3UUX B;  4JUY A;  2VL8 A;  3BQI A;  3P4W A;  3ZEF B;  2LEH A;  2JQH A;  5KX5 E;  3UU3 A;  4YJ2 E;  1UX5 A;  4MFR A;  3UFG A;  3UUL A;  4WBN E;  3C4Z A;  2UUA T;  2UXN B;  2ACX A;  3L09 A;  5LCY A;  4CXY A;  3EVY A;  4XAX B;  4KHZ F;  4F8H A;  3QOF A;  4EGW A;  1HG2 A;  1HG5 A;  1QUU A;  1UX4 A;  2CLY B;  3O1I A;  1KEY A;  1WR0 A;  2X0H A;  3CQG B;  4NPP A;  3ZMU B;  2KT9 A;  2D5U A;  4TZ4 C;  3O9X A;  1T7S A;  1UGO A;  4HFV A;  4TWF A;  3N9Q A;  4U33 A;  5FYM A;  1US7 B;  3K8P C;  3CML A;  3QB5 K;  4EV6 A;  2XQ3 A;  5FL1 A;  4ZZB A;  2L8K A;  4B6X A;  4IE6 A;  3PUQ A;  5LGU B;  4GK0 E;  3L3P A;  4C90 A;  2JMK A;  3HA4 A;  3H37 A;  2B1E A;  4O4H E;  4H9N C;  4LF6 T;  3AE3 A;  2CHO A;  5J2U E;  3QK6 A;  3HKC E;  1XDO A;  1XMO T;  1Y01 A;  1HF8 A;  5L47 A;  3BK9 A;  3PUR A;  4JI8 T;  4ZI3 C;  2P9B A;  3N9P A;  4AI6 A;  2KLQ A;  2CXL A;  2BDE A;  2PJQ A;  4ANJ A;  2DWG A;  3N2K E;  3AA7 B;  3UTK A;  3C64 A;  4KUM B;  3DTO A;  3WI3 A;  2WCA A;  3JC6 C;  2MOZ A;  2ACZ A;  3ZKR A;  4BA9 A;  4IDP A;  4DBQ A;  2WM9 A;  2LHN A;  3HKD E;  3OBV E;  2NTX A;  3N9M A;  4ZS3 A;  5ABG A;  4YHH T;  4B3S T;  5HXS A;  2YDS A;  4GKJ T;  3CIR A;  4HFE A;  3NKZ A;  4UF0 A;  3FB2 A;  3H3A A;  1EZ3 A;  2BG9 B;  4KMC A;  2Y6X A;  5EZY E;  4Z8X A;  3KFW X;  3KV4 A;  4HKA A;  1NAF A;  2NW7 A;  1L0V A;  5JQG E;  3J7Y q;  3LBX B;  2YDR A;  2K5B B;  2W63 A;  1M7K A;  4UR9 A;  5LB7 B;  4CN4 A;  4QXH B;  3AB3 B;  5C2T A;  3NZP A;  4UVC B;  5DAB A;  3RI5 A;  4X65 T;  2LSJ A;  5J1G A;  1XWM A;  2M6B A;  2VAS A;  2WDV A;  3FZL B;  4DMV A;  3UT5 E;  3AE1 A;  5CJ5 A;  4B3R T;  4ZI7 E;  5IHY A;  5AQS B;  4XBF B;  5HXR A;  4I4T E;  4YSY A;  2HHH T;  2V6X A;  4CI1 B;  1E7P A;  5LMN T;  3PUA A;  2A3D A;  4DV4 T;  2NR4 A;  3UUB A;  2C5K T;  4LFA T;  2LM2 A;  5J0Z A;  5FNV E;  5ABE A;  4YSX A;  3CX6 B;  4U7Y A;  4HFC A;  4IT4 A;  2XQ9 A;  3CWZ B;  1NEN A;  4Z90 A;  2C5I T;  2MTQ A;  3ZSS A;  5JVD E;  1XZY A;  2IW5 B;  5BR8 T;  3RRW A;  4JEH B;  5HEO A;  2V7L A;  4QX8 B;  3UU4 A;  1BR2 A;  3AED A;  2A72 A;  3VR9 A;  3AE4 A;  2ZM6 T;  1LKX A;  3NZQ A;  5BMV E;  5E0O A;  4AQF A;  3AEE A;  4HWD A;  2WU2 A;  3HKB E;  2M67 A;  2XZE A;  2WMN A;  1QLB A;  2YKS A;  1IJ6 A;  1UCU A;  2IIU A;  2X0L B;  2ZM2 A;  2CLY C;  3JCF A;  3AAA B;  4IL4 A;  4IDZ A;  1D0Y A;  3FBZ A;  2VKJ A;  2XSB A;  3KV5 A;  4QKN A;  4U3C A;  2ODU A;  4EAH A;  4IRE A;  4ASK A;  3P4Q A;  4JI4 T;  5JDL A;  4TWD A;  3TLS A;  5FXZ A;  3ONL C;  4U7I A;  4COF A;  2WP9 A;  2J62 A;  2W00 A;  4U2Y A;  3RQW A;  4ZZC A;  1IAP A;  5LHI B;  2PTF A;  1WLX A;  2YK0 A;  2UXC T;  2YDQ A;  3EUH A;  3LK2 B;  4YTP A;  5H6R B;  3UU5 A;  4P0A A;  1ZKE A;  2DLR A;  3K3N A;  1MMD A;  2WSS V;  4H9R C;  4QH1 A;  3N9O A;  5HCM A;  2NW8 A;  2LKG A;  3GWH A;  2KWI B;  3CQX C;  4IL9 A;  4AIU A;  4JLE A;  1E2A A;  2CMR A;  3I1A A;  4LF7 T;  2X51 A;  2J47 A;  2AXD S;  2I59 A;  4X1K E;  3I9W A;  4JI0 T;  3SFD A;  4IDQ A;  2H88 A;  4C91 A;  3ANW A;  3MZK B;  5HWX A;  3KV6 A;  3PUS A;  5AQO B;  3PUV F;  5KMG P;  2BKP A;  3Q5E A;  1T98 A;  3AVS A;  3ZT7 A;  4F6R C;  1HX8 A;  4DUZ T;  2W61 A;  4V1A v;  3ZC1 A;  3K3Q C;  2CRB A;  2XAS B;  3PUY F;  4JI7 T;  3A7M A;  1LVF A;  1BR0 A;  3ZN1 B;  2FBW A;  5ETW A;  3P4S A;  4CI2 B;  1CHU A;  2RPA A;  5HXC A;  2UXD T;  1KF6 A;  1WCR A;  4AKR B;  1S35 A;  1VOM A;  1J1J A;  4X1Y E;  5AQV B;  3RC3 A;  1MMG A;  4HFH A;  3RF1 A;  4ILC A;  3QC9 A;  2CM0 A;  4H9P C;  4EIW A;  3KDS E;  4AKH A;  3GA8 A;  2A9U A;  4DND A;  3N5L A;  4AQF C;  5JRC B;  2BVL A;  3ANW B;  2RP4 A;  3LBX A;  1WFD A;  3P8C D;  1X9B A;  3V5U A;  4PJJ A;  5L3E B;  3IF8 B;  1HNX T;  5AQQ B;  1XDP A;  2IHR 1;  2N1G A;  3C4X A;  3EAM A;  1AJ3 A;  2EHO B;  2LSK A;  4WZX A;  1YD8 G;  3LDQ B;  3RYH E;  1R8I A;  3E22 E;  2WDR A;  3KV9 A;  4TUY E;  1MND A;  3HR0 A;  1W0B A;  4UEM A;  3OKQ A;  1M62 A;  3UQ4 A;  2YOE A;  1UUS A;  1W0A A;  2X68 A;  3EDU A;  3OJA A;  1UK5 A;  3A5X A;  3B5M A;  2JPF A;  4MBQ A;  5JDQ A;  4YFS A;  4QXB B;  1OED E;  2VVN A;  1J5W A;  1HS7 A;  3PUZ F;  3SFE A;  4FJO A;  1YQ3 A;  4P0B A;  3AE2 A;  4DVD A;  5JDG A;  1HR0 T;  4UVB B;  3Q9D A;  4EZ4 A;  1VCS A;  2Y8D A;  1U4Q A;  3ZYK A;  3OTO T;  2UU9 T;  3FBL A;  2BZB A;  4WNK A;  3Q2M A;  4I55 E;  2PG8 A;  2W2U A;  2WAU A;  4KI0 F;  3MKD A;  5ABF B;  3RIU A;  5LYJ E;  3RLF F;  1MMN A;  2KXP B;  1YXR A;  2DWK A;  4O2A E;  4JI1 T;  3P4P A;  3AA0 B;  2FJA A;  2NWB A;  4IGU A;  4L5G A;  4X5T A;  2BVM A;  2XTL A;  5EK2 A;  4NXN T;  1W09 A;  3PE0 A;  4A5X A;  1JNZ A;  5LOV E;  2XQ5 A;  2D0U A;  3CK6 A;  4XZC A;  2XQ6 A;  2FJD A;  3AAI A;  2VKH A;  3KBT A;  2XSA A;  3C4W A;  3F2E A;  3I0Q A;  1O3X A;  4TN7 B;  4FI5 A;  4UV9 B;  2XAH B;  4I43 B;  3RGL A;  3U78 A;  3T8O A;  2XUE A;  2X66 A;  3UUM A;  3Q5W A;  4X64 T;  4DR4 T;  5HYA A;  3MJX A;  2SPC A;  2I0M A;  2IUB A;  3OVU A;  4DR5 T;  3T1Y T;  3ZC0 A;  4LF9 T;  2BBJ A;  3N9N A;  4B3T T;  2Q9Q D;  2LSY A;  4JEU B;  3RYI E;  3MA9 A;  2VB6 A;  4LF8 T;  2HN1 A;  3RHW A;  4DV7 T;  4ILA A;  3LFM A;  3ZST A;  5JR9 B;  1YKH B;  2H89 A;  2VVS A;  5FXV A;  4LFC T;  4PW8 A;  3I0O A;  4Z91 A;  4DR2 T;  4ZI3 D;  4ZOL E;  2DL1 A;  2WU5 A;  2XQA A;  2Q9Q A;  3AE8 A;  1G8X A;  2IC9 A;  2ZLY A;  1V9D A;  4H63 V;  3ZCJ A;  3JC6 D;  4CQI A;  2XQ7 A;  2MAW A;  3OYZ A;  4NUV A;  5LGT B;  2K9A A;  4HN9 A;  2VKO A;  2C5J A;  2HPJ A;  3O4X E;  3PV0 F;  4TWH A;  4UXN B;  2V5D A;  4HFI A;  3Q5X A;  4HWC A;  3ZMZ B;  4BJN A;  4GIW A;  2XQ4 A;  3ZPO A;  4U72 A;  2W67 A;  3O1H A;  1MIW A;  3ZYL A;  2VL0 A;  5LG4 A;  1IBM T;  2UUB T;  3M65 A;  4KHP T;  1OED C;  3FZF B;  5EK4 A;  5AQK B;  4H9O C;  5FY1 A;  3HL6 A;  2VUR A;  1X79 A;  1HFA A;  3H3M A;  3PUX F;  2W0G A;  2CBJ A;  2E5L T;  1VCT A;  4I50 E;  5HEU A;  4DR3 T;  3SS1 A;  5M4Y A;  2H7O A;  5ADX L;  1U5P A;  3UFE A;  2LSI A;  4QWN B;  4WW0 A;  5C3J A;  5ABH A;  2OLT A;  2E9X C;  4OYK A;  5HCJ A;  3RH3 A;  4YT0 A;  4NIQ A;  2ZMA A;  5HXH A;  4PK5 A;  2CA5 A;  2E9X D;  3V5S A;  3X1D A;  5JR9 C;  4NUU A;  4P09 A;  3W15 B;  1N32 T;  2IAK A;  3AA1 B;  2EHO A;  3EAB A;  5HEH A;  4OHF A;  4EZH A;  4HTE A;  2QA7 A;  5HEJ A;  2IML A;  3OYX A;  2FJB A;  2AE9 A;  3CPZ A;  3JAE A;  3K3O A;  1VRB A;  4EB6 E;  1I6Z A;  1KNZ A;  2LLY A;  5JDH A;  4JI2 T;  2X9W A;  4BJM A;  4JI5 T;  3AEC A;  3BQL A;  3RIA A;  4X62 T;  1ZOY A;  2LM9 A;  3A8Y C;  3M3Z B;  2VQF T;  4JI3 T;  2BS4 A;  5TAO A;  3RIF A;  5CA1 E;  5LGN B;  5LJM A;  4UF0 B;  1I94 T;  2Q9Q C;  4PAG A;  3IEE A;  4I0U A;  1NWM X;  2LHR A;  3G06 A;  4MAL A;  1MIY A;  3TLV A;  2KZ7 B;  4OX9 T;  3LG7 A;  4NXM T;  2XPK A;  3P50 A;  2K24 A;  3PU3 A;  5FL0 A;  2XM1 A;  3OPC A;  4P1N A;  3AXJ B;  4HGA A;  4BAY B;  3UU6 A;  2K3W A;  3LSV A;  2DI4 A;  2WDQ A;  5JH7 E;  1XNR T;  5HEG A;  2Z6E A;  5KXJ A;  5AQR B;  4IST A;  4MLK A;  4ZEY A;  2MYS A;  4LMK A;  2KWH A;  2XQY A;  3SRZ A;  2JRK A;  1D0Z A;  1N34 T;  1FIO A;  2DHR A;  3N2O A;  3FZK B;  5EK3 A;  1ZV4 X;  3AEF A;  1NEK A;  4J2C A;  3ESL A;  2D2S A;  1OXZ A;  3CX8 B;  2QRX A;  5KDM C;  2CWO A;  5L3G B;  1HX1 B;  2QGS A;  2E9X A;  4M1P A;  4DV2 T;  2CXF A;  1ZP0 A;  1KK7 A;  3DJB A;  5IUX A;  2KND A;  1MIV A;  2GK9 A;  2KMF A;  2R6G F;  3UQ7 A;  2W4X A;  2YU1 A;  3LK4 2;  4ILU A;  4QHO A;  4YJ3 E;  5IYZ E;  2IC6 A;  2EHO C;  2EHO D;  3AVR A;  4KBM B;  4PJN A;  4YXD A;  1KNP A;  4YTM A;  5JR9 A;  4A97 A;  4UVA B;  5FY7 A;  3UU8 A;  5L4E A;  1LVK A;  2NTY A;  4ILB A;  2LKH A;  2IDO B;  1HCI A;  2JIW A;  5AQN B;  2BG9 C;  3J9X 1;  3TLW A;  1S94 A;  2X9Y A;  4E7Z A;  1IBK T;  3L8R A;  5JRE A;  2WZH A;  1GQE A;  3CVR A;  3F31 A;  3I9Y A;  3FZH B;  3HI2 A;  4IDO A;  5FMN A;  3T1H T;  2LOP A;  2V7I A;  5L3B B;  2YEV C;  4LF5 T;  2LRL A;  3Q5D A;  4WYV A;  2DCF A;  2CPT A;  4UV8 B;  3AE6 A;  3ZMT B;  1OED A;  5FXX A;  2F4V T;  4YHJ A;  5AFU L;  2D9D A;  5CGM A;  3NRY A;  2CHN A;  4IHJ E;  4KP3 C;  2V5C A;  4PK6 A;  5LXT E;  4K0K T;  5LBM A;  2JMH A;  4N78 D;  3S4U A;  2KSR A;  3L39 A;  3VHL A;  1Z0P A;  2JQQ A;  4GYS A;  3AE5 A;  3JAD A;  5AQP B;  4X66 T;  1D1C A;  3BQK A;  4UEL A;  4X1I E;  3D0T A;  3E08 A;  2RA1 A;  2NP9 A;  3GN5 B;  4YLH A;  3RPU A;  1YQ4 A;  5L3F B;  4AKI A;  1CUN A;  5AQJ B;  1QSD A;  3EHZ A;  3KBU A;  3QUJ A;  5LG3 A;  3C98 B;  2UXB T;  2LRK A;  3CX7 B;  3ABV A;  2XY8 B;  4PFO A;  2V8S V;  4YTN A;  4ISS A;  2XAQ B;  2JQK A;  3RIU C;  2UUC T;  2J1D G;  2XJ7 A;  3RKO A;  4DO0 A;  5AQT B;  4PK4 A;  1OED B;  3ZT5 A;  3LJC A;  3IA3 A;  1YKE B;  2G0U A;  4DBR A;  3RQU A;  4AKG A;  3PU8 A;  2HN2 A;  1SHZ C;  3AEG A;  3FHN A;  3R6N A;  5CFB A;  5LP6 E;  4GKK T;  2WWV A;  2WQY A;  3PUW F;  4TNW A;  4JBW F;  3FZM B;  3N9L A;  4AQY T;  4LFB T;  4DUY T;  1UUR A;  1Z8U A;  2BS3 A;  4AIS A;  4PJM A;  2D0T A;  5JDN A;  2WZI A;  3AAE B;  5L3D B;  3IHR A;  5FVL A;  1FEW A;  2A2F X;  1LRZ A;  5AQM B;  3RX6 A;  2VQE T;  3SOL A;  3KVA A;  4H63 H;  2L3L A;  4LMJ A;  4E7S A;  1YW0 A;  5DJQ C;  1MMA A;  5F5W A;  4L9I A;  1J5E T;  1DU2 A;  1T72 A;  2OV9 A;  2ZM8 A;  4B3M T;  2PBI A;  4KX6 A;  4O2B E;  2W62 A;  3HKE E;  4PNI A;  3U3I A;  3ONJ A;  3ZJ2 A;  1XNQ T;  2WMO A;  2V7J A;  4IIJ E;  2XM2 A;  2X9H A;  4G2A A;  3GN5 A;  2NW9 A;  1HNZ T;  2K48 A;  3TLT A;  3ZLI A;  4DR7 T;  2MPK A;  4GOU A;  2E5V A;  5AQU B;  3PDY A;  4OYJ A;  5FVK A;  5F3J A;  2C0S A;  4YSZ A;  3NBX X;  2V6Y A;  2ODV A;  1Y64 B;  3FXE B;  4EED A;  4G63 A;  4U31 A;  3ZMS B;  1HNW T;  1OWA A;  2V7M A;  4IE0 A;  5L4H A;  4EOZ B;  2LE8 A;  2QYW A;  2X0Y A;  4PJL A;  1D1B A;  4IDN A;  2DNX A;  4AKL A;  1XMQ T;  1W9R A;  1KFY A;  2H7V C;  2E9X B;  5AQF B;  5HAX A;  3WAJ A;  3NVO A;  3AA6 B;  4HFD A;  1MNE A;  2E2A A;  3TLU A;  3DP7 A;  2CEA A;  2WBL A;  3PJA A;  3E0Z A;  4PFP A;  4ZHQ E;  5AQL B;  3C51 A;  1SE7 A;  3QB5 A;  4TV9 E;  3KIN B;  3LK3 B;  4Q25 A;  5A1L A;  4U74 A;  2FJE A;  2CXD A;  4EYU A;  5L3C B;  4TV8 E;  4OK0 A;  2XAF B;  1IBL T;  2UXX B;  3P7I A;  2X67 A;  3TKL B;  5LHG B;  5CB4 E;  5HWY A;  4DR1 T;  5F8P A;  1WR6 A;  5LBQ B;  4TX5 A;  4JV5 T;  1FJG T;  4L0R A;  4IE5 A;  2BG9 A;  2LT3 A;  4DID B; 
#chains in the Genus database with same CATH homology
 2UU9 T;  4YHH T;  3OTO T;  4B3S T;  4DV2 T;  4GKJ T;  4JI1 T;  4DV3 T;  4DV0 T;  4NXN T;  4X65 T;  1IBK T;  4B3R T;  4JI2 T;  4LF9 T;  2HHH T;  4GKK T;  3T1H T;  5LMU T;  4X64 T;  5LMN T;  4DV6 T;  4LF5 T;  3T1Y T;  4DR4 T;  4DV4 T;  4DR5 T;  4LFA T;  2F4V T;  4B3T T;  4K0K T;  5BR8 T;  4DV5 T;  4LF8 T;  4DV7 T;  4X66 T;  2ZM6 T;  4LFC T;  4DR2 T;  2UXB T;  4JI6 T;  4JYA T;  4LF4 T;  4DR6 T;  2UUC T;  4JI4 T;  1IBM T;  2UUB T;  4KHP T;  4YY3 T;  2UXC T;  2E5L T;  4DR3 T;  4AQY T;  4LFB T;  4DUY T;  5IWA T;  4LF7 T;  1N33 T;  1N36 T;  4JI0 T;  2VQE T;  4DV1 T;  1N32 T;  4DUZ T;  1J5E T;  4B3M T;  4JI7 T;  1XNQ T;  4JI5 T;  1HNZ T;  2UUA T;  2UXD T;  4X62 T;  4DR7 T;  4JI3 T;  2VQF T;  1I94 T;  1HNW T;  4OX9 T;  4NXM T;  1XMQ T;  1HNX T;  1XNR T;  4LF6 T;  1XMO T;  4JI8 T;  1N34 T;  1IBL T;  4DR1 T;  4JV5 T;  1FJG T;  1HR0 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...