4DR2T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr2T00
2UXCT 1N34T 4DUYT 4DR5T 2HHHT 4LF4T 4LF5T 4B3ST 3T1YT 4NXNT 3T1HT 4DV2T 4LF7T 4LF9T 4JI0T 4X65T 2VQFT 5IWAT 1N33T 1XMOT 4DV3T 4DV0T 4LF8T 1XMQT 1IBKT 4DR7T 1HNWT 4JI3T 4DR4T 4DV4T 4JI4T 4B3RT 4DR3T 4AQYT 1I94T 1N32T 1HNZT 2UU9T 4DV6T 4LF6T 4DUZT 4JYAT 4NXMT 5LMNT 2UXBT 4GKKT 1FJGT 2VQET 4KHPT 4OX9T 4DR1T 4B3MT 4JI8T 4JI2T 4DV5T 2UXDT 1J5ET 2F4VT 4GKJT 4B3TT 4JI6T 4JI5T 4DV1T 3OTOT 1N36T 1IBMT 4JV5T 2UUCT 1HNXT 4X66T 4LFBT 4LFCT 1XNRT 4DR2T 4JI7T 5LMUT 1XNQT 4DR6T 4YHHT 2E5LT 1IBLT 5BR8T 4LFAT 4YY3T 2UUAT 2ZM6T 4JI1T 4DV7T 4X62T 2UUBT 4K0KT 1HR0T 4X64T
chains in the Genus database with same CATH superfamily
2N1GA 5HWXA 4EOZB 3AECA 3O1HA 2DLRA 3UU5A 1G73A 2LSIA 4EV6A 4IGUA 4U31A 2YDQA 4X65T 1WR0A 5LBMA 5FY1A 4H9QC 4AKLA 3ONXA 1KK7A 4LF8T 2WB5A 4PK5A 1QUUA 5JRCA 1QSDA 4DR4T 2W2UA 2FBWA 3GMIA 4NUUA 4B3RT 2C5KT 4COFA 4ERRA 1U4QA 1HCIA 3K8PC 4HFVA 5JDNA 3B13A 3VKHA 4L5GA 3RI5A 4KHPT 4OX9T 1MNDA 4YSYA 5JR9B 3B5MA 3E0ZA 1UX5A 2RP4A 4DVDA 2GK9A 3KV6A 3ZT7A 1FIOA 3GN5A 2XUEA 2JJ9A 4QHOA 3RLFF 3QB5A 4P0AA 2YU1A 4ZXLA 3AXJA 1D0ZA 3TLVA 5ABHA 3EDVA 2WU2A 2KINB 3RGLA 2JIWA 3BK9A 4O8SA 1E7PA 4I55E 1BR2A 2QVAA 2B76A 4HKAA 2JQHA 3AAAB 2N9DA 2BBHA 4K0UA 2WSSV 3I9YA 3PUSA 5ABEA 4DMVA 4B3ST 1SUMB 1OEDB 2DNXA 5HXSA 2OA5A 2JQQA 3RKGA 3WI3A 4LF9T 4E7SA 3NBXX 3QK6A 2W63A 4YTNA 4AQFC 4ZS2A 2JMHA 1HNWT 3Q9DA 5AQQB 3UQ7A 2D0UA 2M6BA 4JI4T 2DWKA 4G2AA 2R6GF 2V6XA 3FBZA 3RPUA 5AQMB 3RYIE 2VVSA 1XDPA 4JEUB 4YXDA 3PJAA 4F8HA 5LMNT 4P0BA 3AE4A 4EAHA 2V5CA 4YSXA 1S94A 2V6YA 4JI2T 3ABVA 2CMRA 2UXDT 2WBLA 1T8BA 3AA6B 5AQOB 2D5UA 3HL6A 4AKRB 4Z91A 4O2BE 3P8CD 4X66T 1XNRT 3QC9A 3SFEA 3ONJA 2K3WA 3MJXA 4DR6T 4X20E 1SE7A 3RRWA 4HWHA 1D1CA 2ZM6T 3I0QA 4U74A 2W0GA 4YJ3E 3N2OA 4EB6E 3KINB 4YLHA 1UUSA 4IDNA 4CI2B 5LNKA 3AB3B 4I0UA 2PFVA 3MACA 3SWHA 1U5PA 5IWAT 4HFBA 3UU3A 3EUHA 2BZBA 3FHNA 2MOZA 2VK9A 1J1JA 5HCMA 4DR3T 2XAQB 1I6ZA 2MTQA 5EK2A 3MKDA 4DV6T 5ABFB 2FUPA 2NWBA 5FL0A 2XQ8A 3P50A 2EHOA 1VRBA 2NW9A 3QNUA 4ISTA 4AKHA 3CK6A 3H3MA 3RIUA 2WCAA 4CXYA 3OJAA 2PG8A 2H7VC 5EK4A 4XZCA 4ASKA 3O9XA 4UELA 3D0TA 4F6RC 3AE1A 5JTGA 4AQFA 3CMLA 3AEDA 1SHZC 2KSRA 3ETVA 4QH4A 2UUCT 3ESLA 3HI2A 4TUYE 4LFCT 5AQHB 4EEBA 3WAKA 5DABA 4ZZCA 5LMUT 4U72A 5FMNA 4GOUA 3LBXA 5CA1E 4X62T 4UV8B 4HFHA 3RRCA 3RYFE 3BQIA 4DR5T 5IYZE 4AXPA 3ZMUB 4KI0F 5JR9C 3T1HT 2AXDS 1GQEA 3AE2A 4H9SE 3O4XE 1WCRA 3N9MA 4KBMB 3N5LA 3A5XA 4AIUA 4GYRA 1Z8UA 2DI4A 1IBKT 3EHZA 1W09A 4BAYB 1O3XA 4OHFA 4IDQA 1S35A 5J0ZA 4ZI2C 2LSKA 5AQGB 1HG5A 3M3ZB 4OYKA 3ZEFB 5LJMA 3ANWA 3ETUA 3AEEA 3WAJA 1W0AA 3N9OA 3VR9A 1FJGT 2CRBA 4DR1T 2WMNA 3VR8A 3AA1B 4B3MT 1X9BA 2V1DB 2NP9A 3IA3A 3CQGB 3L8RA 4IDZA 1OEDC 3RYHE 4JI5T 3NVOA 5L2LA 3IF8B 4JEHB 3ZYLA 2BKNA 3N2GE 2UXNB 1KFYA 2D9DA 2XM1A 4DR2T 4YHHT 4CXWA 4LMKA 3AEAA 3EAMA 2LSYA 3S4UA 2XQ9A 2LHRA 3AE3A 2V8SV 1BR1A 2VKDA 4UVBB 3F2EA 4X64T 2XPKA 1N34T 4LF4T 3MK7C 1WR6A 1WYCA 2XQ7A 3ZJ1A 2E9XB 2K48A 2WU5A 3T8OA 3AEBA 3ZSSA 4NIQA 5HEGA 2B1EA 4JI3T 2PBIA 1Y64B 2CCQA 2H3RA 3C51A 5CFBA 2IUBA 3CX7B 3N2KE 3ZMTB 2BS3A 3KVAA 2V7IA 3PUVF 4OYJA 1YD8G 2C0SA 4JUYA 3OVUA 1ZV4X 3QB5K 5M4YA 4Q25A 5C8YE 4I50E 5F5WA 5JR9A 3FXDB 3Q5XA 4ZI7E 1L0VA 1VCSA 2LRLA 2VB6A 3TLUA 2F4VT 4B3TT 4CQIA 1UK5A 4LMJA 1NWMX 3AEGA 1KEYA 3IHRA 3CX6B 1CUNA 2VKJA 1T98A 4I4TE 4GK0E 2YOEA 5BR8T 2L8KA 3RF1A 1ZKEA 4K0KT 3L09A 1OEDA 2CLYB 4DUYT 4KMCA 3B57A 2BG9B 5CB4E 1N33T 4U3CA 3PV0F 1HFAA 2KZ7B 1NEKA 1XDOA 4O4JE 2OV9A 4HFEA 3KBUA 1YQ4A 3OYXA 2CWOA 2XSAA 1D1BA 2UXXB 3ZCJA 3F31A 2VWAA 2WY2A 4IDOA 3SFDA 3ZJ2A 3L3PA 3LDQB 3P4RA 4V1Av 5FXZA 4TN7B 4MALA 4EIWA 2NTXA 3PUQA 2SPCA 3PUWF 1HX8A 1MMGA 2LSGA 2VKOA 4L9IA 3H3AA 4CN1A 3BQKA 4JI6T 3KVBA 2LM9A 5L4EA 4DV1T 3N9QA 3FB2A 2MBGA 4CZZB 3DTOA 3FZLB 2C5JA 3KFWX 3AAEB 3LFMA 2W00A 3ZMZB 3JAFA 2ODUA 4PW8A 2K5BB 4IL4A 3UU6A 2FJAA 3IBPA 4HTEA 2G0UA 4QKNA 1IJ5A 4WBNE 5C2TA 3GWHA 1ZP0A 3VKGA 2LHNA 3ZN0B 3E22E 4B6XA 2LRKA 5BMVE 5L3EB 2WS3A 2HN1A 3V5SA 4ZI2D 4IE4A 4IE0A 4EYUA 2KMFA 1YKHB 4HGAA 4UVCB 4QXCB 3RHWA 2WZHA 3P7IA 4DBRA 1D1AA 4JLEA 4YT0A 5LA6E 2EHOC 5TAOA 4UIGA 5ABFA 1US7B 1N32T 4GIWA 1IAPA 2LOSA 2OLTA 3ZMVB 3RIUC 2J4GA 2J47A 2DHRA 5HWYA 4TX5A 2X9HA 2AE9A 4JI8T 2LEHA 1MMDA 2V7MA 3W15B 5E0OA 2X68A 3O1IA 2V26A 2E9XC 2WMOA 1MNEA 5JH7E 5DJQC 1SA0E 3OYZA 4ZI3C 4JBWF 5AQVB 2PTFA 4P09A 4X1YE 4FJOA 2YKSA 2X9WA 3VHLA 3H37A 4WYVA 2BKOA 3J9X1 4ZEYA 4U33A 5LXTE 4A97A 2V7JA 4YFSA 4PFPA 2W61A 3KDSE 1Y01A 2BVMA 4P1NA 5KDMC 2LKHA 5JDQA 3KBTA 5AQLB 3CKDA 4DV3T 2I6HA 4YSZA 3PDYA 4DR7T 3EI0A 3UQ4A 2MAWA 4QH5A 2WWUA 2C5IT 1G8XA 4G63A 2ODVA 2XAHB 3AE8A 3ZC1A 5LGUB 2XQAA 4EGWA 5AQPB 2YN6A 1IJ6A 3LK2B 2UXBT 3N9NA 3U78A 5JREA 4H9OC 1MMAA 3JAEA 2BKPA 2CLYC 5CA0E 1JNRA 2XQ3A 1Z0PA 2W66A 2BG9C 1D0XA 4E7ZA 5J2UE 4OFZA 4KP3C 4HE8A 4YJ2E 2YU2A 5JQGE 3NZQA 5L47A 3C98B 3P4WA 4ZS3A 4ZZBA 2W62A 4CI3B 1T7SA 3ONLC 4YY3T 3NWIA 3RQUA 5LP6E 2HN2A 5AFUL 2YINA 3DP7A 4PJMA 4IIJE 3OPCA 5FVLA 4MHCA 5HYAA 4PNIA 3KV5A 3PU8A 1HTJF 3A7MA 4HWDA 2E9XA 3K1SA 3AE5A 3J7Yq 4A56A 2XAGB 4YTPA 2VASA 2WWVA 2W67A 4TV9E 2JPFA 4EZ4A 5JVDE 2WDVA 2E5VA 2CA5A 5LG4A 4UVAB 3PUXF 3UTKA 4IL9A 1UX4A 1YW0A 4CN4A 2MPKA 4U2ZA 3NRXA 2L9QA 1OXZA 4JYAT 3UFEA 5FNVE 2J62A 3TLWA 2V5DA 2MYSA 1OEDE 3K3NA 3I0OA 2H7OA 2BBJA 4LMLA 2LM2A 3Q2MA 2XASB 4N78D 3C64A 4HFCA 4HN9A 2XZEA 3R84B 3ZYMA 1T72A 2XM2A 4YHJA 2CEAA 2YDSA 2XQ4A 1XNQT 2X9XA 2XSBA 1UGOA 4BJNA 2HH7A 4UF0B 2HPLA 2CPTA 3LG7A 5LGNB 2BG9A 4LF7T 2ES0A 3PUYF 1VCTA 2CBJA 2EHOD 4NPPA 2NW7A 4BJMA 3LJCA 4DV0T 4PJNA 1KNRA 3HKBE 3UUXB 4HWIB 2KXPB 2XY8B 3TKLB 4IT4A 3HKEE 1I94T 1WLXA 3SOLA 4DMWA 4UXNB 2X51A 4H63H 2BS2A 4M1PA 3CQCB 2BVLA 3P4SA 4O2AE 4ZI3D 2CM0A 3MA9A 3HKDE 3AVSA 3RH3A 5JDLA 1UURA 5CGMA 3IEEA 2WP9A 2HPJA 2FJEA 3ZPOA 3JADA 2KWHA 2LSJA 2RPAA 3UT5E 3KV9A 2A72A 5FXWA 1MIVA 2Q9QB 4HFIA 2KT9A 1ZOYA 2UUAT 3UUNA 5IHYA 4HFDA 4C90A 5EK3A 4GK5E 5FKYA 4H63V 2JQKA 5L3FB 2WQYA 4IDPA 4TWHA 5L3CB 3T1YT 3CWZB 2Y8DA 3K3OA 5DQWA 3Q5DA 4PJLA 4L0RA 4U2YA 5AQNB 3CX8B 5AQUB 1XMOT 3ZC0A 1YQ3A 2KLQA 4KX6A 2H88A 2ZM2A 5AQTB 2N2NA 4WBOA 3C50A 4H9NC 4XBFB 2XQ5A 1LVFA 3TLTA 4I43B 2LKGA 4GKKT 4AISA 5ETWA 2IDOB 5CJ5A 2QGSA 2XTLA 4ILCA 4QWNB 1W0BA 3PJAJ 3HR0A 3ZT6A 4CN6A 2XJ7A 4JV5T 3UUBA 1HNXT 3K3QC 1LRZA 2M6IA 3A8YC 3N9LA 1J5WA 2X0HA 3FZHB 3ZLIA 1HF8A 4JI1T 4TNVA 5JDHA 3FZKB 3L39A 3HA4A 3PUGA 3JCFA 2WAUA 4PFOA 3ZMSB 2ZM8A 2PJQA 2CBIA 4A5XA 3F57A 1IZNB 2ZMAA 3QUJA 4QX7B 4J2CA 4JI0T 4PAGA 3ZN1B 3MXZA 1HX1B 2L3LA 3CVRA 5EZYE 3CIRA 1EZ3A 5IUXA 5FL1A 1H7CA 4WW0A 5AQIB 2IMLA 5FYMA 4ZHQE 4EZHA 4X5TA 4TV8E 4LF6T 2LJLA 5LGTB 5LB7B 2CHOA 2VL8A 4UR9A 4ANJA 2V7KA 1WYBA 2IC6A 3PUZF 1D0YA 3N9PA 2CXDA 4X1IE 1FMVA 4O4LE 2LOPA 3AE6A 3PURA 3VRAA 3KV4A 2P9BA 2XAJB 1NAFA 3JC6C 1IBLT 2XHEB 3VRBA 1CHUA 4TZ4C 2X0YA 1YKEB 5HEUA 4KUMB 1HR0T 2NTYA 1KNZA 3QOFA 5FY0A 1MIYA 2D0TA 2IIUA 4NXNT 3P4PA 1M7KA 4PJJA 4BA9A 2VQFT 4IE6A 3FBLA 1UCUA 4KHZF 1NENA 3UFGA 5JDMA 2DWGA 4EYYR 5L3DB 1HS7A 4DV4T 5JRCB 2BS4A 4AQYT 2Q9QC 3AE9A 3MZKB 1QLBA 5DQVA 2IW5B 3SRZA 2I59A 3AEFA 2DCFA 4EEDA 2WDRA 3G06A 4MLKA 2ZM0A 4DV5T 1J5ET 2I0MA 5JDFA 3E08A 2BG9E 3FZMB 3UU8A 1XWMA 3I9WA 2IC9A 3X1DA 2IHR1 5LBQB 1N36T 4H9RC 3AA0B 3CQXC 1WFDA 3NKZA 3GN5B 4HWFA 4IE5A 3BQLA 2JRKA 5LYJE 4O4HE 3AXJB 4WNKA 5AQKB 4UF0A 3LSVA 4Z8XA 4DIDB 4X1KE 2QA7A 1JNZA 5LHHB 3I1AA 5FP3A 1YXRA 4DBQA 1M62A 2QRXA 3FXEB 2WZIA 2X9YA 3UUMA 5LHGB 4H9PC 1XMQT 4MBQA 3VU7H 4ISSA 5LG3A 3RKOA 4QXHB 3RYCE 2LLYA 2WDQA 5LOVE 1ZEEA 1BR0A 1KNPA 1HNZT 1XZYA 1OWAA 2UU9T 4UEMA 1LKXA 5HCJA 5AQRB 3C4WA 4DUZT 4PK4A 4U7IA 4TWDA 2NOXA 1DU2A 3AAIA 3EDUA 2FJDA 5HEOA 4TWFA 4YTMA 5HXHA 2RA1A 2V6YB 2JMKA 4XAXB 3NZPA 2BDEA 2CXFA 5LCYA 2K24A 4A98A 5F3JA 5KMGP 5ABGA 4TNWA 5L4HA 3ZCIA 2JQ9A 2LT3A 1B7TA 2YK0A 2Q9QA 3UU4A 3C4XA 3HKCE 3RIAA 4UV9B 1MIWA 3U3IA 5H6RB 3FZFB 4HWCA 5FXVA 4DO0A 4QXBB 3OKQA 4MFRA 3RIFA 3ZT5A 4C91A 1E1HB 3NRYA 4PK6A 2E8IA 5L3GB 2KWIB 4Z90A 5AQFB 2YDRA 1FEWA 2J1DG 2VURA 2XAFB 4CI1B 1W9RA 1MMNA 1FMWA 5J2TE 1R8IA 3UULA 3LK42 1ZHCA 3P4QA 3CPZA 2E2AA 3Q5WA 5HXCA 4IE7A 5F8PA 5ADXL 5LHIB 2X0LB 5KXJA 4GYSA 3PE0A 4NXMT 5FY7A 2A3DA 3LK3B 2VQET 4U7YA 4NUVA 2EHOB 2CWYA 2WM9A 2W4XA 5AQJB 2VL0A 4FI5A 3AVRA 3JC6D 3Q5EA 4HEAA 3RC3A 5GONE 3TLSA 2Y6XA 3OTOT 5HEJA 2M67A 5L3BB 4AQGA 4AI6A 2Y48B 2E9XD 3GA8A 2KNDA 3O1JA 2IAKA 2CE7A 4JI7T 5KX5E 5HEHA 2E5LT 2V7LA 3OBVE 5A1LA 5JDGA 4DV7T 2YEVC 1E2AA 2XQ6A 3EVYA 3LBXB 2UUBT 4ILUA 3RC8A 5H6QB 4ZOLE 3RX6A 2X66A 4QH1A 2UXCT 2HHHT 4LF5T 3RQWA 3R6NA 5LJNA 1KF6A 3C4ZA 5J1GA 4WZXA 4DV2T 1AJ3A 2Q9QD 2VVNA 4AKGA 1VOMA 4IREA 4CXXA 3SS1A 2ACXA 3ZKRA 2LE8A 4ADZA 2A9UA 1LVKA 3PU3A 2NR4A 5AQSB 2ZLYA 4EXTA 2H89A 3DJBA 2D2SA 4QX8B 3V5UA 2CXLA 1WRDA 3AA7B 4ILAA 1V9DA 3ANWB 3AE7A 2X67A 4OK0A 4GKJT 5HXRA 3ZSTA 1IBMT 3M65A 2FJBA 2K9AA 3EABA 3PTRB 5FXXA 2ACZA 4LFBT 1BR4A 2CHNA 2VKHA 4DNDA 5HAXA 4O4IE 2Z6EA 3PUAA 1X79A 2QYWA 4LFAT 2DL1A 4ILBA 1HG2A 4IHJE 4AKIA 5C3JA 2NW8A 3ZYKA 5FVKA 2XQYA 5HXEA 2A2FX
chains in the Genus database with same CATH topology
2UXCT 1N34T 4DUYT 4DR5T 2HHHT 4LF4T 4LF5T 4B3ST 3T1YT 4NXNT 3T1HT 4DV2T 4LF7T 4LF9T 4JI0T 4X65T 2VQFT 5IWAT 1N33T 1XMOT 4DV3T 4DV0T 4LF8T 1XMQT 1IBKT 4DR7T 1HNWT 4JI3T 4DR4T 4DV4T 4JI4T 4B3RT 4DR3T 4AQYT 1I94T 1N32T 1HNZT 2UU9T 4DV6T 4LF6T 4DUZT 4JYAT 4NXMT 5LMNT 2UXBT 4GKKT 1FJGT 2VQET 4KHPT 4OX9T 4DR1T 4B3MT 4JI8T 4JI2T 4DV5T 2UXDT 1J5ET 2F4VT 4GKJT 4B3TT 4JI6T 4JI5T 4DV1T 3OTOT 1N36T 1IBMT 4JV5T 2UUCT 1HNXT 4X66T 4LFBT 4LFCT 1XNRT 4DR2T 4JI7T 5LMUT 1XNQT 4DR6T 4YHHT 2E5LT 1IBLT 5BR8T 4LFAT 4YY3T 2UUAT 2ZM6T 4JI1T 4DV7T 4X62T 2UUBT 4K0KT 1HR0T 4X64T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC T;  1N34 T;  4DUY T;  4DR5 T;  2HHH T;  4LF4 T;  4LF5 T;  4B3S T;  3T1Y T;  4NXN T;  3T1H T;  4DV2 T;  4LF7 T;  4LF9 T;  4JI0 T;  4X65 T;  2VQF T;  5IWA T;  1N33 T;  1XMO T;  4DV3 T;  4DV0 T;  4LF8 T;  1XMQ T;  1IBK T;  4DR7 T;  1HNW T;  4JI3 T;  4DR4 T;  4DV4 T;  4JI4 T;  4B3R T;  4DR3 T;  4AQY T;  1I94 T;  1N32 T;  1HNZ T;  2UU9 T;  4DV6 T;  4LF6 T;  4DUZ T;  4JYA T;  4NXM T;  5LMN T;  2UXB T;  4GKK T;  1FJG T;  2VQE T;  4KHP T;  4OX9 T;  4DR1 T;  4B3M T;  4JI8 T;  4JI2 T;  4DV5 T;  2UXD T;  1J5E T;  2F4V T;  4GKJ T;  4B3T T;  4JI6 T;  4JI5 T;  4DV1 T;  3OTO T;  1N36 T;  1IBM T;  4JV5 T;  2UUC T;  1HNX T;  4X66 T;  4LFB T;  4LFC T;  1XNR T;  4DR2 T;  4JI7 T;  5LMU T;  1XNQ T;  4DR6 T;  4YHH T;  2E5L T;  1IBL T;  5BR8 T;  4LFA T;  4YY3 T;  2UUA T;  2ZM6 T;  4JI1 T;  4DV7 T;  4X62 T;  2UUB T;  4K0K T;  1HR0 T;  4X64 T; 
#chains in the Genus database with same CATH topology
 2N1G A;  5HWX A;  4EOZ B;  3AEC A;  3O1H A;  2DLR A;  3UU5 A;  1G73 A;  2LSI A;  4EV6 A;  4IGU A;  4U31 A;  2YDQ A;  4X65 T;  1WR0 A;  5LBM A;  5FY1 A;  4H9Q C;  4AKL A;  3ONX A;  1KK7 A;  4LF8 T;  2WB5 A;  4PK5 A;  1QUU A;  5JRC A;  1QSD A;  4DR4 T;  2W2U A;  2FBW A;  3GMI A;  4NUU A;  4B3R T;  2C5K T;  4COF A;  4ERR A;  1U4Q A;  1HCI A;  3K8P C;  4HFV A;  5JDN A;  3B13 A;  3VKH A;  4L5G A;  3RI5 A;  4KHP T;  4OX9 T;  1MND A;  4YSY A;  5JR9 B;  3B5M A;  3E0Z A;  1UX5 A;  2RP4 A;  4DVD A;  2GK9 A;  3KV6 A;  3ZT7 A;  1FIO A;  3GN5 A;  2XUE A;  2JJ9 A;  4QHO A;  3RLF F;  3QB5 A;  4P0A A;  2YU1 A;  4ZXL A;  3AXJ A;  1D0Z A;  3TLV A;  5ABH A;  3EDV A;  2WU2 A;  2KIN B;  3RGL A;  2JIW A;  3BK9 A;  4O8S A;  1E7P A;  4I55 E;  1BR2 A;  2QVA A;  2B76 A;  4HKA A;  2JQH A;  3AAA B;  2N9D A;  2BBH A;  4K0U A;  2WSS V;  3I9Y A;  3PUS A;  5ABE A;  4DMV A;  4B3S T;  1SUM B;  1OED B;  2DNX A;  5HXS A;  2OA5 A;  2JQQ A;  3RKG A;  3WI3 A;  4LF9 T;  4E7S A;  3NBX X;  3QK6 A;  2W63 A;  4YTN A;  4AQF C;  4ZS2 A;  2JMH A;  1HNW T;  3Q9D A;  5AQQ B;  3UQ7 A;  2D0U A;  2M6B A;  4JI4 T;  2DWK A;  4G2A A;  2R6G F;  2V6X A;  3FBZ A;  3RPU A;  5AQM B;  3RYI E;  2VVS A;  1XDP A;  4JEU B;  4YXD A;  3PJA A;  4F8H A;  5LMN T;  4P0B A;  3AE4 A;  4EAH A;  2V5C A;  4YSX A;  1S94 A;  2V6Y A;  4JI2 T;  3ABV A;  2CMR A;  2UXD T;  2WBL A;  1T8B A;  3AA6 B;  5AQO B;  2D5U A;  3HL6 A;  4AKR B;  4Z91 A;  4O2B E;  3P8C D;  4X66 T;  1XNR T;  3QC9 A;  3SFE A;  3ONJ A;  2K3W A;  3MJX A;  4DR6 T;  4X20 E;  1SE7 A;  3RRW A;  4HWH A;  1D1C A;  2ZM6 T;  3I0Q A;  4U74 A;  2W0G A;  4YJ3 E;  3N2O A;  4EB6 E;  3KIN B;  4YLH A;  1UUS A;  4IDN A;  4CI2 B;  5LNK A;  3AB3 B;  4I0U A;  2PFV A;  3MAC A;  3SWH A;  1U5P A;  5IWA T;  4HFB A;  3UU3 A;  3EUH A;  2BZB A;  3FHN A;  2MOZ A;  2VK9 A;  1J1J A;  5HCM A;  4DR3 T;  2XAQ B;  1I6Z A;  2MTQ A;  5EK2 A;  3MKD A;  4DV6 T;  5ABF B;  2FUP A;  2NWB A;  5FL0 A;  2XQ8 A;  3P50 A;  2EHO A;  1VRB A;  2NW9 A;  3QNU A;  4IST A;  4AKH A;  3CK6 A;  3H3M A;  3RIU A;  2WCA A;  4CXY A;  3OJA A;  2PG8 A;  2H7V C;  5EK4 A;  4XZC A;  4ASK A;  3O9X A;  4UEL A;  3D0T A;  4F6R C;  3AE1 A;  5JTG A;  4AQF A;  3CML A;  3AED A;  1SHZ C;  2KSR A;  3ETV A;  4QH4 A;  2UUC T;  3ESL A;  3HI2 A;  4TUY E;  4LFC T;  5AQH B;  4EEB A;  3WAK A;  5DAB A;  4ZZC A;  5LMU T;  4U72 A;  5FMN A;  4GOU A;  3LBX A;  5CA1 E;  4X62 T;  4UV8 B;  4HFH A;  3RRC A;  3RYF E;  3BQI A;  4DR5 T;  5IYZ E;  4AXP A;  3ZMU B;  4KI0 F;  5JR9 C;  3T1H T;  2AXD S;  1GQE A;  3AE2 A;  4H9S E;  3O4X E;  1WCR A;  3N9M A;  4KBM B;  3N5L A;  3A5X A;  4AIU A;  4GYR A;  1Z8U A;  2DI4 A;  1IBK T;  3EHZ A;  1W09 A;  4BAY B;  1O3X A;  4OHF A;  4IDQ A;  1S35 A;  5J0Z A;  4ZI2 C;  2LSK A;  5AQG B;  1HG5 A;  3M3Z B;  4OYK A;  3ZEF B;  5LJM A;  3ANW A;  3ETU A;  3AEE A;  3WAJ A;  1W0A A;  3N9O A;  3VR9 A;  1FJG T;  2CRB A;  4DR1 T;  2WMN A;  3VR8 A;  3AA1 B;  4B3M T;  1X9B A;  2V1D B;  2NP9 A;  3IA3 A;  3CQG B;  3L8R A;  4IDZ A;  1OED C;  3RYH E;  4JI5 T;  3NVO A;  5L2L A;  3IF8 B;  4JEH B;  3ZYL A;  2BKN A;  3N2G E;  2UXN B;  1KFY A;  2D9D A;  2XM1 A;  4DR2 T;  4YHH T;  4CXW A;  4LMK A;  3AEA A;  3EAM A;  2LSY A;  3S4U A;  2XQ9 A;  2LHR A;  3AE3 A;  2V8S V;  1BR1 A;  2VKD A;  4UVB B;  3F2E A;  4X64 T;  2XPK A;  1N34 T;  4LF4 T;  3MK7 C;  1WR6 A;  1WYC A;  2XQ7 A;  3ZJ1 A;  2E9X B;  2K48 A;  2WU5 A;  3T8O A;  3AEB A;  3ZSS A;  4NIQ A;  5HEG A;  2B1E A;  4JI3 T;  2PBI A;  1Y64 B;  2CCQ A;  2H3R A;  3C51 A;  5CFB A;  2IUB A;  3CX7 B;  3N2K E;  3ZMT B;  2BS3 A;  3KVA A;  2V7I A;  3PUV F;  4OYJ A;  1YD8 G;  2C0S A;  4JUY A;  3OVU A;  1ZV4 X;  3QB5 K;  5M4Y A;  4Q25 A;  5C8Y E;  4I50 E;  5F5W A;  5JR9 A;  3FXD B;  3Q5X A;  4ZI7 E;  1L0V A;  1VCS A;  2LRL A;  2VB6 A;  3TLU A;  2F4V T;  4B3T T;  4CQI A;  1UK5 A;  4LMJ A;  1NWM X;  3AEG A;  1KEY A;  3IHR A;  3CX6 B;  1CUN A;  2VKJ A;  1T98 A;  4I4T E;  4GK0 E;  2YOE A;  5BR8 T;  2L8K A;  3RF1 A;  1ZKE A;  4K0K T;  3L09 A;  1OED A;  2CLY B;  4DUY T;  4KMC A;  3B57 A;  2BG9 B;  5CB4 E;  1N33 T;  4U3C A;  3PV0 F;  1HFA A;  2KZ7 B;  1NEK A;  1XDO A;  4O4J E;  2OV9 A;  4HFE A;  3KBU A;  1YQ4 A;  3OYX A;  2CWO A;  2XSA A;  1D1B A;  2UXX B;  3ZCJ A;  3F31 A;  2VWA A;  2WY2 A;  4IDO A;  3SFD A;  3ZJ2 A;  3L3P A;  3LDQ B;  3P4R A;  4V1A v;  5FXZ A;  4TN7 B;  4MAL A;  4EIW A;  2NTX A;  3PUQ A;  2SPC A;  3PUW F;  1HX8 A;  1MMG A;  2LSG A;  2VKO A;  4L9I A;  3H3A A;  4CN1 A;  3BQK A;  4JI6 T;  3KVB A;  2LM9 A;  5L4E A;  4DV1 T;  3N9Q A;  3FB2 A;  2MBG A;  4CZZ B;  3DTO A;  3FZL B;  2C5J A;  3KFW X;  3AAE B;  3LFM A;  2W00 A;  3ZMZ B;  3JAF A;  2ODU A;  4PW8 A;  2K5B B;  4IL4 A;  3UU6 A;  2FJA A;  3IBP A;  4HTE A;  2G0U A;  4QKN A;  1IJ5 A;  4WBN E;  5C2T A;  3GWH A;  1ZP0 A;  3VKG A;  2LHN A;  3ZN0 B;  3E22 E;  4B6X A;  2LRK A;  5BMV E;  5L3E B;  2WS3 A;  2HN1 A;  3V5S A;  4ZI2 D;  4IE4 A;  4IE0 A;  4EYU A;  2KMF A;  1YKH B;  4HGA A;  4UVC B;  4QXC B;  3RHW A;  2WZH A;  3P7I A;  4DBR A;  1D1A A;  4JLE A;  4YT0 A;  5LA6 E;  2EHO C;  5TAO A;  4UIG A;  5ABF A;  1US7 B;  1N32 T;  4GIW A;  1IAP A;  2LOS A;  2OLT A;  3ZMV B;  3RIU C;  2J4G A;  2J47 A;  2DHR A;  5HWY A;  4TX5 A;  2X9H A;  2AE9 A;  4JI8 T;  2LEH A;  1MMD A;  2V7M A;  3W15 B;  5E0O A;  2X68 A;  3O1I A;  2V26 A;  2E9X C;  2WMO A;  1MNE A;  5JH7 E;  5DJQ C;  1SA0 E;  3OYZ A;  4ZI3 C;  4JBW F;  5AQV B;  2PTF A;  4P09 A;  4X1Y E;  4FJO A;  2YKS A;  2X9W A;  3VHL A;  3H37 A;  4WYV A;  2BKO A;  3J9X 1;  4ZEY A;  4U33 A;  5LXT E;  4A97 A;  2V7J A;  4YFS A;  4PFP A;  2W61 A;  3KDS E;  1Y01 A;  2BVM A;  4P1N A;  5KDM C;  2LKH A;  5JDQ A;  3KBT A;  5AQL B;  3CKD A;  4DV3 T;  2I6H A;  4YSZ A;  3PDY A;  4DR7 T;  3EI0 A;  3UQ4 A;  2MAW A;  4QH5 A;  2WWU A;  2C5I T;  1G8X A;  4G63 A;  2ODV A;  2XAH B;  3AE8 A;  3ZC1 A;  5LGU B;  2XQA A;  4EGW A;  5AQP B;  2YN6 A;  1IJ6 A;  3LK2 B;  2UXB T;  3N9N A;  3U78 A;  5JRE A;  4H9O C;  1MMA A;  3JAE A;  2BKP A;  2CLY C;  5CA0 E;  1JNR A;  2XQ3 A;  1Z0P A;  2W66 A;  2BG9 C;  1D0X A;  4E7Z A;  5J2U E;  4OFZ A;  4KP3 C;  4HE8 A;  4YJ2 E;  2YU2 A;  5JQG E;  3NZQ A;  5L47 A;  3C98 B;  3P4W A;  4ZS3 A;  4ZZB A;  2W62 A;  4CI3 B;  1T7S A;  3ONL C;  4YY3 T;  3NWI A;  3RQU A;  5LP6 E;  2HN2 A;  5AFU L;  2YIN A;  3DP7 A;  4PJM A;  4IIJ E;  3OPC A;  5FVL A;  4MHC A;  5HYA A;  4PNI A;  3KV5 A;  3PU8 A;  1HTJ F;  3A7M A;  4HWD A;  2E9X A;  3K1S A;  3AE5 A;  3J7Y q;  4A56 A;  2XAG B;  4YTP A;  2VAS A;  2WWV A;  2W67 A;  4TV9 E;  2JPF A;  4EZ4 A;  5JVD E;  2WDV A;  2E5V A;  2CA5 A;  5LG4 A;  4UVA B;  3PUX F;  3UTK A;  4IL9 A;  1UX4 A;  1YW0 A;  4CN4 A;  2MPK A;  4U2Z A;  3NRX A;  2L9Q A;  1OXZ A;  4JYA T;  3UFE A;  5FNV E;  2J62 A;  3TLW A;  2V5D A;  2MYS A;  1OED E;  3K3N A;  3I0O A;  2H7O A;  2BBJ A;  4LML A;  2LM2 A;  3Q2M A;  2XAS B;  4N78 D;  3C64 A;  4HFC A;  4HN9 A;  2XZE A;  3R84 B;  3ZYM A;  1T72 A;  2XM2 A;  4YHJ A;  2CEA A;  2YDS A;  2XQ4 A;  1XNQ T;  2X9X A;  2XSB A;  1UGO A;  4BJN A;  2HH7 A;  4UF0 B;  2HPL A;  2CPT A;  3LG7 A;  5LGN B;  2BG9 A;  4LF7 T;  2ES0 A;  3PUY F;  1VCT A;  2CBJ A;  2EHO D;  4NPP A;  2NW7 A;  4BJM A;  3LJC A;  4DV0 T;  4PJN A;  1KNR A;  3HKB E;  3UUX B;  4HWI B;  2KXP B;  2XY8 B;  3TKL B;  4IT4 A;  3HKE E;  1I94 T;  1WLX A;  3SOL A;  4DMW A;  4UXN B;  2X51 A;  4H63 H;  2BS2 A;  4M1P A;  3CQC B;  2BVL A;  3P4S A;  4O2A E;  4ZI3 D;  2CM0 A;  3MA9 A;  3HKD E;  3AVS A;  3RH3 A;  5JDL A;  1UUR A;  5CGM A;  3IEE A;  2WP9 A;  2HPJ A;  2FJE A;  3ZPO A;  3JAD A;  2KWH A;  2LSJ A;  2RPA A;  3UT5 E;  3KV9 A;  2A72 A;  5FXW A;  1MIV A;  2Q9Q B;  4HFI A;  2KT9 A;  1ZOY A;  2UUA T;  3UUN A;  5IHY A;  4HFD A;  4C90 A;  5EK3 A;  4GK5 E;  5FKY A;  4H63 V;  2JQK A;  5L3F B;  2WQY A;  4IDP A;  4TWH A;  5L3C B;  3T1Y T;  3CWZ B;  2Y8D A;  3K3O A;  5DQW A;  3Q5D A;  4PJL A;  4L0R A;  4U2Y A;  5AQN B;  3CX8 B;  5AQU B;  1XMO T;  3ZC0 A;  1YQ3 A;  2KLQ A;  4KX6 A;  2H88 A;  2ZM2 A;  5AQT B;  2N2N A;  4WBO A;  3C50 A;  4H9N C;  4XBF B;  2XQ5 A;  1LVF A;  3TLT A;  4I43 B;  2LKG A;  4GKK T;  4AIS A;  5ETW A;  2IDO B;  5CJ5 A;  2QGS A;  2XTL A;  4ILC A;  4QWN B;  1W0B A;  3PJA J;  3HR0 A;  3ZT6 A;  4CN6 A;  2XJ7 A;  4JV5 T;  3UUB A;  1HNX T;  3K3Q C;  1LRZ A;  2M6I A;  3A8Y C;  3N9L A;  1J5W A;  2X0H A;  3FZH B;  3ZLI A;  1HF8 A;  4JI1 T;  4TNV A;  5JDH A;  3FZK B;  3L39 A;  3HA4 A;  3PUG A;  3JCF A;  2WAU A;  4PFO A;  3ZMS B;  2ZM8 A;  2PJQ A;  2CBI A;  4A5X A;  3F57 A;  1IZN B;  2ZMA A;  3QUJ A;  4QX7 B;  4J2C A;  4JI0 T;  4PAG A;  3ZN1 B;  3MXZ A;  1HX1 B;  2L3L A;  3CVR A;  5EZY E;  3CIR A;  1EZ3 A;  5IUX A;  5FL1 A;  1H7C A;  4WW0 A;  5AQI B;  2IML A;  5FYM A;  4ZHQ E;  4EZH A;  4X5T A;  4TV8 E;  4LF6 T;  2LJL A;  5LGT B;  5LB7 B;  2CHO A;  2VL8 A;  4UR9 A;  4ANJ A;  2V7K A;  1WYB A;  2IC6 A;  3PUZ F;  1D0Y A;  3N9P A;  2CXD A;  4X1I E;  1FMV A;  4O4L E;  2LOP A;  3AE6 A;  3PUR A;  3VRA A;  3KV4 A;  2P9B A;  2XAJ B;  1NAF A;  3JC6 C;  1IBL T;  2XHE B;  3VRB A;  1CHU A;  4TZ4 C;  2X0Y A;  1YKE B;  5HEU A;  4KUM B;  1HR0 T;  2NTY A;  1KNZ A;  3QOF A;  5FY0 A;  1MIY A;  2D0T A;  2IIU A;  4NXN T;  3P4P A;  1M7K A;  4PJJ A;  4BA9 A;  2VQF T;  4IE6 A;  3FBL A;  1UCU A;  4KHZ F;  1NEN A;  3UFG A;  5JDM A;  2DWG A;  4EYY R;  5L3D B;  1HS7 A;  4DV4 T;  5JRC B;  2BS4 A;  4AQY T;  2Q9Q C;  3AE9 A;  3MZK B;  1QLB A;  5DQV A;  2IW5 B;  3SRZ A;  2I59 A;  3AEF A;  2DCF A;  4EED A;  2WDR A;  3G06 A;  4MLK A;  2ZM0 A;  4DV5 T;  1J5E T;  2I0M A;  5JDF A;  3E08 A;  2BG9 E;  3FZM B;  3UU8 A;  1XWM A;  3I9W A;  2IC9 A;  3X1D A;  2IHR 1;  5LBQ B;  1N36 T;  4H9R C;  3AA0 B;  3CQX C;  1WFD A;  3NKZ A;  3GN5 B;  4HWF A;  4IE5 A;  3BQL A;  2JRK A;  5LYJ E;  4O4H E;  3AXJ B;  4WNK A;  5AQK B;  4UF0 A;  3LSV A;  4Z8X A;  4DID B;  4X1K E;  2QA7 A;  1JNZ A;  5LHH B;  3I1A A;  5FP3 A;  1YXR A;  4DBQ A;  1M62 A;  2QRX A;  3FXE B;  2WZI A;  2X9Y A;  3UUM A;  5LHG B;  4H9P C;  1XMQ T;  4MBQ A;  3VU7 H;  4ISS A;  5LG3 A;  3RKO A;  4QXH B;  3RYC E;  2LLY A;  2WDQ A;  5LOV E;  1ZEE A;  1BR0 A;  1KNP A;  1HNZ T;  1XZY A;  1OWA A;  2UU9 T;  4UEM A;  1LKX A;  5HCJ A;  5AQR B;  3C4W A;  4DUZ T;  4PK4 A;  4U7I A;  4TWD A;  2NOX A;  1DU2 A;  3AAI A;  3EDU A;  2FJD A;  5HEO A;  4TWF A;  4YTM A;  5HXH A;  2RA1 A;  2V6Y B;  2JMK A;  4XAX B;  3NZP A;  2BDE A;  2CXF A;  5LCY A;  2K24 A;  4A98 A;  5F3J A;  5KMG P;  5ABG A;  4TNW A;  5L4H A;  3ZCI A;  2JQ9 A;  2LT3 A;  1B7T A;  2YK0 A;  2Q9Q A;  3UU4 A;  3C4X A;  3HKC E;  3RIA A;  4UV9 B;  1MIW A;  3U3I A;  5H6R B;  3FZF B;  4HWC A;  5FXV A;  4DO0 A;  4QXB B;  3OKQ A;  4MFR A;  3RIF A;  3ZT5 A;  4C91 A;  1E1H B;  3NRY A;  4PK6 A;  2E8I A;  5L3G B;  2KWI B;  4Z90 A;  5AQF B;  2YDR A;  1FEW A;  2J1D G;  2VUR A;  2XAF B;  4CI1 B;  1W9R A;  1MMN A;  1FMW A;  5J2T E;  1R8I A;  3UUL A;  3LK4 2;  1ZHC A;  3P4Q A;  3CPZ A;  2E2A A;  3Q5W A;  5HXC A;  4IE7 A;  5F8P A;  5ADX L;  5LHI B;  2X0L B;  5KXJ A;  4GYS A;  3PE0 A;  4NXM T;  5FY7 A;  2A3D A;  3LK3 B;  2VQE T;  4U7Y A;  4NUV A;  2EHO B;  2CWY A;  2WM9 A;  2W4X A;  5AQJ B;  2VL0 A;  4FI5 A;  3AVR A;  3JC6 D;  3Q5E A;  4HEA A;  3RC3 A;  5GON E;  3TLS A;  2Y6X A;  3OTO T;  5HEJ A;  2M67 A;  5L3B B;  4AQG A;  4AI6 A;  2Y48 B;  2E9X D;  3GA8 A;  2KND A;  3O1J A;  2IAK A;  2CE7 A;  4JI7 T;  5KX5 E;  5HEH A;  2E5L T;  2V7L A;  3OBV E;  5A1L A;  5JDG A;  4DV7 T;  2YEV C;  1E2A A;  2XQ6 A;  3EVY A;  3LBX B;  2UUB T;  4ILU A;  3RC8 A;  5H6Q B;  4ZOL E;  3RX6 A;  2X66 A;  4QH1 A;  2UXC T;  2HHH T;  4LF5 T;  3RQW A;  3R6N A;  5LJN A;  1KF6 A;  3C4Z A;  5J1G A;  4WZX A;  4DV2 T;  1AJ3 A;  2Q9Q D;  2VVN A;  4AKG A;  1VOM A;  4IRE A;  4CXX A;  3SS1 A;  2ACX A;  3ZKR A;  2LE8 A;  4ADZ A;  2A9U A;  1LVK A;  3PU3 A;  2NR4 A;  5AQS B;  2ZLY A;  4EXT A;  2H89 A;  3DJB A;  2D2S A;  4QX8 B;  3V5U A;  2CXL A;  1WRD A;  3AA7 B;  4ILA A;  1V9D A;  3ANW B;  3AE7 A;  2X67 A;  4OK0 A;  4GKJ T;  5HXR A;  3ZST A;  1IBM T;  3M65 A;  2FJB A;  2K9A A;  3EAB A;  3PTR B;  5FXX A;  2ACZ A;  4LFB T;  1BR4 A;  2CHN A;  2VKH A;  4DND A;  5HAX A;  4O4I E;  2Z6E A;  3PUA A;  1X79 A;  2QYW A;  4LFA T;  2DL1 A;  4ILB A;  1HG2 A;  4IHJ E;  4AKI A;  5C3J A;  2NW8 A;  3ZYK A;  5FVK A;  2XQY A;  5HXE A;  2A2F X; 
#chains in the Genus database with same CATH homology
 2UXC T;  1N34 T;  4DUY T;  4DR5 T;  2HHH T;  4LF4 T;  4LF5 T;  4B3S T;  3T1Y T;  4NXN T;  3T1H T;  4DV2 T;  4LF7 T;  4LF9 T;  4JI0 T;  4X65 T;  2VQF T;  5IWA T;  1N33 T;  1XMO T;  4DV3 T;  4DV0 T;  4LF8 T;  1XMQ T;  1IBK T;  4DR7 T;  1HNW T;  4JI3 T;  4DR4 T;  4DV4 T;  4JI4 T;  4B3R T;  4DR3 T;  4AQY T;  1I94 T;  1N32 T;  1HNZ T;  2UU9 T;  4DV6 T;  4LF6 T;  4DUZ T;  4JYA T;  4NXM T;  5LMN T;  2UXB T;  4GKK T;  1FJG T;  2VQE T;  4KHP T;  4OX9 T;  4DR1 T;  4B3M T;  4JI8 T;  4JI2 T;  4DV5 T;  2UXD T;  1J5E T;  2F4V T;  4GKJ T;  4B3T T;  4JI6 T;  4JI5 T;  4DV1 T;  3OTO T;  1N36 T;  1IBM T;  4JV5 T;  2UUC T;  1HNX T;  4X66 T;  4LFB T;  4LFC T;  1XNR T;  4DR2 T;  4JI7 T;  5LMU T;  1XNQ T;  4DR6 T;  4YHH T;  2E5L T;  1IBL T;  5BR8 T;  4LFA T;  4YY3 T;  2UUA T;  2ZM6 T;  4JI1 T;  4DV7 T;  4X62 T;  2UUB T;  4K0K T;  1HR0 T;  4X64 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...