4DR2T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr2T00
4JI8T 4LF4T 2UUBT 1N32T 2VQET 4LFBT 4X64T 1HNXT 4LF5T 4LF7T 4YY3T 4AQYT 1N34T 4DR4T 4JI0T 2UXDT 4DR6T 4DV3T 1XNQT 4DV1T 4KHPT 1HNWT 2E5LT 2UXCT 1XMOT 5IWAT 4JYAT 4DR1T 4JI2T 4K0KT 4X62T 4DV7T 1XMQT 4JI1T 4GKJT 4NXMT 4YHHT 1N33T 5LMNT 4DV6T 3T1YT 4NXNT 1HNZT 4DR5T 3OTOT 4LF9T 4DR2T 4LFCT 2F4VT 2UXBT 4JV5T 4LFAT 1I94T 4LF6T 3T1HT 1HR0T 1FJGT 4DR7T 4DV5T 4JI4T 1XNRT 4JI3T 4LF8T 4DV4T 4X66T 4JI5T 1IBLT 1IBMT 2HHHT 1J5ET 4X65T 4JI7T 4DV0T 1N36T 4DUZT 2ZM6T 2UU9T 2VQFT 4B3TT 2UUCT 5LMUT 4GKKT 4OX9T 4B3MT 4B3ST 4DUYT 4B3RT 1IBKT 4JI6T 2UUAT 4DV2T 5BR8T 4DR3T
chains in the Genus database with same CATH superfamily
4FJOA 3B5MA 3QOFA 4YTPA 1X79A 4YT0A 2LSIA 3H3AA 1W0AA 4LF5T 1YQ4A 2LOSA 3N9QA 2QRXA 3PUYF 2H89A 2XAQB 3TKLB 4JEHB 4PK4A 4EZ4A 4DNDA 2OA5A 1HFAA 3AE5A 5L4HA 1YKHB 5IWAT 4NPPA 4H9RC 2CBIA 3JCFA 5CB4E 3RRCA 2V8SV 3I0QA 3B57A 2BG9C 1US7B 1SA0E 3K3QC 2V7KA 3AAAB 5FY0A 3SOLA 4CI3B 4O2AE 3KVBA 2DNXA 2XQ9A 2V6YA 1S94A 2ODUA 2N9DA 1MMAA 2WBLA 2WM9A 4DV5T 3PDYA 4YSZA 3VKHA 4ZXLA 5AQIB 2JPFA 5LCYA 5AQOB 5HYAA 4ISSA 3R6NA 2CA5A 2HPLA 3PUWF 5AQNB 2ODVA 3C50A 3PUZF 4G2AA 4AQFC 2V6YB 4DUYT 5LHHB 3RH3A 3FHNA 2LSKA 3KFWX 2BBJA 4LFBT 2NTYA 4IL9A 2JMKA 5HEJA 4CXXA 4N78D 4I55E 4O4IE 5HCMA 4CI2B 1KNZA 5CA0E 2PTFA 5L3BB 4UR9A 4M1PA 3OKQA 3KDSE 2C5JA 5JDNA 5H6RB 3KBUA 4AKRB 5LMNT 3CQGB 2YINA 1DU2A 4PJMA 2EHOA 1BR1A 1MIVA 2DWKA 2K24A 1LVFA 1OEDA 2BKNA 2UXXB 1D0ZA 3P4WA 3ZMZB 5AQQB 2H7OA 2WMOA 4EZHA 2HH7A 1M62A 5FL1A 2XQ4A 2MBGA 2I0MA 2LM2A 4P0BA 4IE7A 3IA3A 5AQMB 2VVSA 2ZM0A 5KXJA 2KSRA 2M6BA 3SRZA 4PNIA 5AQVB 5FVLA 4HFVA 3AAIA 3K3NA 1ZP0A 3TLSA 2EHOB 1WR0A 1OEDB 4B3ST 4GK0E 4ZEYA 3QK6A 3IBPA 3KINB 2BKPA 4DV2T 4O4LE 2ZLYA 3VR8A 2LEHA 4C91A 2IMLA 1Z8UA 2HPJA 2CBJA 2X0HA 2X0LB 3FBZA 4WZXA 4LF7T 1IJ6A 4KX6A 4Z91A 4L5GA 1QSDA 2XTLA 2WDRA 5C2TA 4YFSA 5L3GB 2H88A 4IE0A 4Z8XA 4KHPT 2D0TA 3UU3A 1KNPA 3IHRA 2XJ7A 4JI2T 2XQAA 4L9IA 3RPUA 4MHCA 5FNVE 4CQIA 2LLYA 2CLYB 5HWYA 2HN2A 5F8PA 2OV9A 3TLWA 2W63A 4H9PC 4QXBB 2BS4A 2M6IA 1I94T 4QXHB 3ZJ1A 1WR6A 4HFBA 4PK5A 1JNZA 5AQKB 3RRWA 2LRLA 3PUXF 4ZI3D 3IF8B 4HTEA 2CPTA 4V1Av 5H6QB 5HEGA 3VRAA 3RGLA 2JRKA 3VR9A 2KWIB 4PJLA 3UQ4A 4PFPA 2CWOA 3PUAA 5J1GA 4EEBA 1MMDA 2XM2A 2NW8A 3I9YA 5LA6E 5LG4A 1UURA 1G8XA 5HXSA 4ZHQE 1FEWA 1KF6A 3N2KE 5L3FB 2PFVA 2VKHA 3Q2MA 3J7Yq 1Y64B 5EK2A 3HL6A 1E2AA 3O1IA 5CJ5A 4UVCB 4DV7T 4KHZF 5LNKA 5EZYE 2QGSA 1J1JA 1LKXA 3ONXA 4EIWA 4LFCT 1XZYA 5BMVE 3QNUA 4E7SA 1HTJF 3RI5A 4ANJA 3H3MA 3NWIA 2WWUA 2WSSV 3KBTA 4I0UA 3I1AA 3RYIE 1N36T 4H63V 4AKHA 3T8OA 3FBLA 3LK3B 2UU9T 4B3TT 4HWCA 5HEOA 2XQ7A 1W0BA 3QB5A 4AISA 4QH4A 1IBKT 4AI6A 3E08A 4QKNA 3AVSA 1NAFA 4ILAA 2DCFA 2W2UA 3ETVA 3FXDB 1H7CA 3ZN0B 4Q25A 1N32T 1NWMX 2YU2A 4ZZBA 2DWGA 2W4XA 5FXVA 4ISTA 5AQRB 1N34T 1HX8A 4HWHA 4BA9A 2I59A 2WCAA 3U78A 5IHYA 2YK0A 4HEAA 4G63A 5M4YA 4DR6T 2XQ6A 3CX6B 3AB3B 3RQUA 1WYBA 5LOVE 2VKDA 2UXCT 1VOMA 3RIUA 2PG8A 2LOPA 2VVNA 4QX8B 4QXCB 2VKOA 3ZYLA 1ZHCA 2J47A 3AA7B 3ETUA 5AQFB 4LMLA 3RYFE 5LXTE 4JV5T 3G06A 2IW5B 4NUVA 3T1HT 3PUGA 3OYXA 2YDRA 2FJBA 4JUYA 4GYSA 3JC6C 2DL1A 3WI3A 3K3OA 3O1JA 1IZNB 3AE7A 1IJ5A 5LGNB 2KLQA 3E22E 3P4QA 1Z0PA 3LG7A 4F8HA 2IC9A 1LVKA 2Q9QD 3ZJ2A 4UXNB 4U74A 3PUQA 2ACXA 2W67A 1D0XA 2E8IA 3ZMSB 2LJLA 4MALA 4C90A 2K9AA 3RKGA 2LM9A 2YU1A 5ABFA 2BG9A 4DR3T 2QVAA 1XDPA 4XBFB 2FJDA 2OLTA 4TNWA 5FXXA 3P8CD 2R6GF 4TV9E 3Q9DA 4EB6E 4IIJE 4TNVA 3CPZA 2H3RA 1MIYA 1G73A 4GK5E 2VK9A 2XASB 2X9YA 4HWFA 4A98A 1UUSA 2A72A 2WWVA 4KI0F 1HNWT 3EHZA 5JRCA 5ABFB 2BG9B 3Q5WA 3P4SA 3AE1A 3CMLA 2VWAA 4DMVA 4ZI3C 2V7JA 4IDNA 4EEDA 3PUVF 4J2CA 1HX1B 3M3ZB 3VU7H 5AQTB 5JH7E 3N9LA 3N9NA 4OHFA 2NW7A 5HXEA 4H9NC 5JRCB 4X66T 2E9XA 4UVAB 3CQXC 2XAFB 4JI7T 3MACA 2XHEB 3AA6B 4DV0T 2ZM6T 3VHLA 5HXCA 2XM1A 3ZSTA 4WBOA 4U2ZA 2VKJA 2XAJB 5AFUL 1ZEEA 1YKEB 4IGUA 2BVMA 1D1BA 3A5XA 3AECA 3HI2A 2X68A 4X1YE 1WRDA 4JLEA 2E9XB 3ZLIA 1HNXT 1JNRA 1NENA 5DABA 5AQHB 4DR4T 1BR4A 2YN6A 3QUJA 4DVDA 3QB5K 5L4EA 1E7PA 3PU3A 3LK42 4TZ4C 3SWHA 4O4HE 4IREA 2XSAA 1VRBA 2XY8B 5KDMC 3AE9A 2VURA 1KEYA 2CXFA 4JYAT 1XMQT 4GKJT 3N2OA 3O1HA 4UVBB 1FMVA 1WFDA 1OEDE 3ZT6A 2CRBA 2W62A 5ETWA 2GK9A 3IEEA 3ZMUB 4JI4T 3OYZA 5DQWA 3ZT7A 1YQ3A 3BQLA 3RIFA 4WNKA 2KZ7B 4HFEA 2YDSA 5KX5E 3CX8B 5GONE 4EYYR 5LHGB 5JR9A 2PJQA 1YW0A 2LHRA 3RIAA 5AQPB 1OXZA 5IYZE 1AJ3A 5AQUB 2YDQA 4A5XA 2LSYA 3I0OA 2C0SA 1UK5A 2IHR1 2ES0A 2XQ3A 3EABA 4LF4T 2N1GA 4U7IA 3AEAA 3SFEA 3ONLC 1ZOYA 3JC6D 3KV6A 2CHNA 3UTKA 2D5UA 3HKCE 5JR9B 3NRYA 1MMNA 5LJNA 4YHJA 4CN4A 3NVOA 3NKZA 2W0GA 4DV1T 1BR0A 2JQQA 4YSYA 3AAEB 3F31A 2WU2A 3ZYKA 2CE7A 4JI1T 3B13A 4DV6T 1D0YA 4NXNT 3TLVA 3C64A 4A97A 1T98A 4H9SE 4P09A 4UV8B 2BVLA 3P50A 4PAGA 4CXYA 2Q9QC 4H9OC 3R84B 1VCSA 5FY7A 3OPCA 3JADA 2P9BA 4IHJE 3UT5E 3UU6A 2C5IT 4JI3T 4P1NA 2WY2A 4FI5A 1M7KA 1OEDC 4P0AA 5L3DB 4YJ3E 4O2BE 4X65T 4GIWA 5FKYA 4ERRA 2MYSA 3PU8A 5AQGB 1LRZA 1Y01A 1ZKEA 3EDVA 4YJ2E 3AE3A 5AQJB 1WCRA 4QWNB 4B3MT 5E0OA 3F57A 3M65A 3NRXA 3UQ7A 3AEFA 5EK4A 4UV9B 2CCQA 4EYUA 4ZZCA 2UUBT 5JVDE 5L3CB 4U3CA 2VL8A 3CWZB 2JQ9A 3LK2B 4XAXB 3C4WA 2WS3A 1HG2A 4HFDA 4H63H 2CLYC 4QH5A 4DIDB 1X9BA 4AKGA 1E1HB 2K5BB 2LSGA 5FVKA 4YLHA 3HA4A 3UULA 1VCTA 2CXLA 4NXMT 4OFZA 2BDEA 1HG5A 1U5PA 4LF9T 1SE7A 4X1IE 2F4VT 4LF6T 4HFCA 4COFA 3NBXX 3P4RA 3Q5DA 3X1DA 4ILCA 2BS3A 5JDHA 5HEUA 4MBQA 3L3PA 2WB5A 3AVRA 3O9XA 5JQGE 5A1LA 3PUSA 4QHOA 1MMGA 3BQIA 4AKLA 4B6XA 3OVUA 2XZEA 2W00A 1KFYA 2BBHA 4KBMB 2DHRA 2CXDA 2KXPB 3Q5XA 1D1CA 5JDGA 3C98B 3VRBA 3AEEA 4MFRA 4YY3T 4WBNE 4PK6A 1CHUA 1S35A 4IDPA 3MKDA 3ZMTB 4IT4A 3BQKA 2MOZA 3OJAA 3UU4A 4HFHA 2N2NA 1O3XA 2LKGA 1XWMA 4OK0A 3FZMB 4ZI2C 2XUEA 3FZLB 3EDUA 3MJXA 5CA1E 4ADZA 4DR2T 2FJAA 2J1DG 3QC9A 2IC6A 4TN7B 2W61A 3C4ZA 4ZS3A 3ESLA 2X9XA 5JREA 4ZI7E 3GWHA 3RC3A 3AA0B 2X9HA 1KNRA 3D0TA 3FZKB 3PURA 5LGTB 1U4QA 2CEAA 2UUCT 3VKGA 5DJQC 5LGUB 2Y8DA 5HXHA 2BG9E 4CN1A 4GYRA 5FP3A 4U33A 3PV0F 2VB6A 2ACZA 3HKBE 2X66A 2JQKA 1UGOA 2EHOD 3ANWA 5F3JA 5LJMA 3KV4A 3KV5A 3U3IA 5ABEA 1MIWA 2XAGB 5CFBA 1UX5A 4X1KE 3CK6A 5CGMA 4BJMA 3LBXA 2J62A 3GA8A 3HKDE 2RPAA 4UIGA 3I9WA 4U31A 4TWFA 4LMKA 4ZOLE 4YHHT 3UFEA 3GMIA 2PBIA 3ANWB 3DTOA 3RIUC 4LFAT 2HN1A 3MZKB 3F2EA 2B1EA 1MNEA 2CHOA 2NP9A 1FJGT 4DR7T 2KINB 3EAMA 1MNDA 2L3LA 4LF8T 2BS2A 3LBXB 1IBLT 4PW8A 2XAHB 4YXDA 2V26A 4AQFA 4I43B 2CWYA 5L2LA 4BAYB 1I6ZA 5LMUT 3L09A 2YOEA 2X51A 4GOUA 4B3RT 4AKIA 2RA1A 3CKDA 3CX7B 2IIUA 2L8KA 4OYJA 4IDZA 2FUPA 3N9OA 2NW9A 4JBWF 5AQSB 3LJCA 4EAHA 4Z90A 5J2TE 3KV9A 5JDQA 5HCJA 4ILBA 2C5KT 3FZFB 2E5LT 1SHZC 2IUBA 4I4TE 3NZPA 4UEMA 4X62T 5HAXA 5ABHA 2L9QA 2X9WA 2NOXA 5JTGA 4DR5T 2IAKA 3V5SA 3JAFA 2IDOB 2AE9A 4MLKA 4I50E 4O4JE 3ZKRA 5JDFA 3AA1B 3ZC1A 2D9DA 1D1AA 2JIWA 2HHHT 3RYCE 1OWAA 5JDMA 3ONJA 5LG3A 3AE4A 5FXZA 5TAOA 4DUZT 3CVRA 1BR2A 3EI0A 2NTXA 4F6RC 4GKKT 3K8PC 1V9DA 2ZM2A 1HCIA 2V7LA 2E9XC 5FL0A 2AXDS 4ZI2D 4AQGA 3ZCJA 3TLUA 2XPKA 3RQWA 4JI6T 5FXWA 2W66A 2MAWA 3ZEFB 4DO0A 1YXRA 4A56A 2XQ5A 4O8SA 3BK9A 4AQYT 2Q9QA 1KK7A 5JDLA 4YSXA 4IE4A 2D0UA 2V7MA 1XDOA 2FBWA 3OBVE 2X67A 3MXZA 2K48A 1QUUA 1HF8A 3LSVA 2LRKA 4K0KT 2ZM8A 1L0VA 3C51A 1EZ3A 3KVAA 3A8YC 3AEDA 3RKOA 5HWXA 5LBMA 3P7IA 2Q9QB 4KP3C 3ZT5A 4NIQA 4CN6A 3FXEB 3UU8A 1ZV4X 2NWBA 2CM0A 4HFIA 2E2AA 5DQVA 3ZSSA 3AXJA 3Q5EA 5C3JA 4DMWA 1IBMT 4LMJA 1J5ET 5LBQB 2YEVC 1W9RA 1J5WA 2WDQA 4TUYE 2VQFT 1T8BA 4KMCA 2A3DA 2LE8A 3K1SA 3EUHA 3WAKA 2I6HA 3L8RA 2FJEA 1R8IA 2EHOC 3MK7C 5FY1A 1UX4A 2Y6XA 4NUUA 3SS1A 3UU5A 5JR9C 5BR8T 5ABGA 2A9UA 3AXJB 4WW0A 3W15B 4H9QC 3PJAA 2VQET 2DI4A 4U2YA 2V6XA 4PFOA 3HKEE 3ZC0A 1NEKA 4HWIB 4L0RA 4EGWA 4ASKA 2SPCA 1B7TA 3FZHB 3SFDA 2E5VA 5LHIB 2G0UA 1W09A 5FYMA 4DV3T 4WYVA 4X5TA 1XMOT 4E7ZA 4HN9A 3UFGA 2XQYA 3ZPOA 5FMNA 3ZYMA 4CI1B 3T1YT 1FMWA 5AQLB 2ZMAA 1IAPA 2B76A 1GQEA 2QYWA 3OTOT 3N5LA 5LYJE 2M67A 2UXBT 1SUMB 1HR0T 5EK3A 4IDOA 4EOZB 4CZZB 1UCUA 3RX6A 4IL4A 2BKOA 4U72A 4ZS2A 1T7SA 4JEUB 2KMFA 2NR4A 4JI5T 4TWDA 2KWHA 3EVYA 5HEHA 4AIUA 4K0UA 3E0ZA 2Z6EA 4OX9T 2LT3A 3HR0A 4KUMB 4IE5A 2WAUA 3DJBA 4PJJA 4JI8T 2UXNB 5LP6E 3LDQB 3RYHE 1CUNA 2WDVA 2KT9A 3P4PA 2UXDT 5LB7B 4DBQA 3C4XA 2XSBA 4EXTA 3WAJA 2WZIA 3TLTA 1YD8G 3PJAJ 4QX7B 2K3WA 2E9XD 3ABVA 3A7MA 4YTMA 3RLFF 1HNZT 2DLRA 3AE6A 3NZQA 4TX5A 3UUXB 2D2SA 1FIOA 1QLBA 1WLXA 4IDQA 2LHNA 3CQCB 3RC8A 4ILUA 1XNRT 2V5DA 3AEGA 3RF1A 2V1DB 5IUXA 2VASA 3ZMVB 3LFMA 3DP7A 3UUMA 4BJNA 4X20E 4DBRA 2RP4A 2A2FX 4IE6A 2WU5A 4EV6A 5C8YE 5KMGP 2WP9A 3ZN1B 2UUAT 2H7VC 3H37A 3ZCIA 4XZCA 4HKAA 4X64T 2J4GA 2Y48B 3N9MA 5L3EB 4JI0T 2MPKA 3L39A 3UUNA 3AEBA 4UF0A 3J9X1 2QA7A 3N2GE 1XNQT 2LSJA 3MA9A 4CXWA 3GN5A 4YTNA 2JMHA 3CIRA 4HGAA 4DR1T 3RHWA 1N33T 3S4UA 5HXRA 2MTQA 3N9PA 2VL0A 2LKHA 2JJ9A 4TWHA 5J2UE 4TV8E 1HS7A 4UF0B 3AE2A 3O4XE 2XQ8A 4OYKA 2WZHA 2KNDA 4DV4T 3GN5B 2V7IA 2WMNA 4PJNA 2YKSA 2X0YA 3PE0A 3V5UA 2V5CA 3AE8A 5L47A 4U7YA 2WQYA 1WYCA 4HWDA 4AXPA 3UUBA 2JQHA 4HE8A 5F5WA 2CMRA 1T72A 3PTRB 4UELA 2BZBA 5ADXL 5J0ZA 3FB2A 4QH1A 3JAEA
chains in the Genus database with same CATH topology
4JI8T 4LF4T 2UUBT 1N32T 2VQET 4LFBT 4X64T 1HNXT 4LF5T 4LF7T 4YY3T 4AQYT 1N34T 4DR4T 4JI0T 2UXDT 4DR6T 4DV3T 1XNQT 4DV1T 4KHPT 1HNWT 2E5LT 2UXCT 1XMOT 5IWAT 4JYAT 4DR1T 4JI2T 4K0KT 4X62T 4DV7T 1XMQT 4JI1T 4GKJT 4NXMT 4YHHT 1N33T 5LMNT 4DV6T 3T1YT 4NXNT 1HNZT 4DR5T 3OTOT 4LF9T 4DR2T 4LFCT 2F4VT 2UXBT 4JV5T 4LFAT 1I94T 4LF6T 3T1HT 1HR0T 1FJGT 4DR7T 4DV5T 4JI4T 1XNRT 4JI3T 4LF8T 4DV4T 4X66T 4JI5T 1IBLT 1IBMT 2HHHT 1J5ET 4X65T 4JI7T 4DV0T 1N36T 4DUZT 2ZM6T 2UU9T 2VQFT 4B3TT 2UUCT 5LMUT 4GKKT 4OX9T 4B3MT 4B3ST 4DUYT 4B3RT 1IBKT 4JI6T 2UUAT 4DV2T 5BR8T 4DR3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 T;  4LF4 T;  2UUB T;  1N32 T;  2VQE T;  4LFB T;  4X64 T;  1HNX T;  4LF5 T;  4LF7 T;  4YY3 T;  4AQY T;  1N34 T;  4DR4 T;  4JI0 T;  2UXD T;  4DR6 T;  4DV3 T;  1XNQ T;  4DV1 T;  4KHP T;  1HNW T;  2E5L T;  2UXC T;  1XMO T;  5IWA T;  4JYA T;  4DR1 T;  4JI2 T;  4K0K T;  4X62 T;  4DV7 T;  1XMQ T;  4JI1 T;  4GKJ T;  4NXM T;  4YHH T;  1N33 T;  5LMN T;  4DV6 T;  3T1Y T;  4NXN T;  1HNZ T;  4DR5 T;  3OTO T;  4LF9 T;  4DR2 T;  4LFC T;  2F4V T;  2UXB T;  4JV5 T;  4LFA T;  1I94 T;  4LF6 T;  3T1H T;  1HR0 T;  1FJG T;  4DR7 T;  4DV5 T;  4JI4 T;  1XNR T;  4JI3 T;  4LF8 T;  4DV4 T;  4X66 T;  4JI5 T;  1IBL T;  1IBM T;  2HHH T;  1J5E T;  4X65 T;  4JI7 T;  4DV0 T;  1N36 T;  4DUZ T;  2ZM6 T;  2UU9 T;  2VQF T;  4B3T T;  2UUC T;  5LMU T;  4GKK T;  4OX9 T;  4B3M T;  4B3S T;  4DUY T;  4B3R T;  1IBK T;  4JI6 T;  2UUA T;  4DV2 T;  5BR8 T;  4DR3 T; 
#chains in the Genus database with same CATH topology
 4FJO A;  3B5M A;  3QOF A;  4YTP A;  1X79 A;  4YT0 A;  2LSI A;  3H3A A;  1W0A A;  4LF5 T;  1YQ4 A;  2LOS A;  3N9Q A;  2QRX A;  3PUY F;  2H89 A;  2XAQ B;  3TKL B;  4JEH B;  4PK4 A;  4EZ4 A;  4DND A;  2OA5 A;  1HFA A;  3AE5 A;  5L4H A;  1YKH B;  5IWA T;  4NPP A;  4H9R C;  2CBI A;  3JCF A;  5CB4 E;  3RRC A;  2V8S V;  3I0Q A;  3B57 A;  2BG9 C;  1US7 B;  1SA0 E;  3K3Q C;  2V7K A;  3AAA B;  5FY0 A;  3SOL A;  4CI3 B;  4O2A E;  3KVB A;  2DNX A;  2XQ9 A;  2V6Y A;  1S94 A;  2ODU A;  2N9D A;  1MMA A;  2WBL A;  2WM9 A;  4DV5 T;  3PDY A;  4YSZ A;  3VKH A;  4ZXL A;  5AQI B;  2JPF A;  5LCY A;  5AQO B;  5HYA A;  4ISS A;  3R6N A;  2CA5 A;  2HPL A;  3PUW F;  5AQN B;  2ODV A;  3C50 A;  3PUZ F;  4G2A A;  4AQF C;  2V6Y B;  4DUY T;  5LHH B;  3RH3 A;  3FHN A;  2LSK A;  3KFW X;  2BBJ A;  4LFB T;  2NTY A;  4IL9 A;  2JMK A;  5HEJ A;  4CXX A;  4N78 D;  4I55 E;  4O4I E;  5HCM A;  4CI2 B;  1KNZ A;  5CA0 E;  2PTF A;  5L3B B;  4UR9 A;  4M1P A;  3OKQ A;  3KDS E;  2C5J A;  5JDN A;  5H6R B;  3KBU A;  4AKR B;  5LMN T;  3CQG B;  2YIN A;  1DU2 A;  4PJM A;  2EHO A;  1BR1 A;  1MIV A;  2DWK A;  2K24 A;  1LVF A;  1OED A;  2BKN A;  2UXX B;  1D0Z A;  3P4W A;  3ZMZ B;  5AQQ B;  2H7O A;  2WMO A;  4EZH A;  2HH7 A;  1M62 A;  5FL1 A;  2XQ4 A;  2MBG A;  2I0M A;  2LM2 A;  4P0B A;  4IE7 A;  3IA3 A;  5AQM B;  2VVS A;  2ZM0 A;  5KXJ A;  2KSR A;  2M6B A;  3SRZ A;  4PNI A;  5AQV B;  5FVL A;  4HFV A;  3AAI A;  3K3N A;  1ZP0 A;  3TLS A;  2EHO B;  1WR0 A;  1OED B;  4B3S T;  4GK0 E;  4ZEY A;  3QK6 A;  3IBP A;  3KIN B;  2BKP A;  4DV2 T;  4O4L E;  2ZLY A;  3VR8 A;  2LEH A;  4C91 A;  2IML A;  1Z8U A;  2HPJ A;  2CBJ A;  2X0H A;  2X0L B;  3FBZ A;  4WZX A;  4LF7 T;  1IJ6 A;  4KX6 A;  4Z91 A;  4L5G A;  1QSD A;  2XTL A;  2WDR A;  5C2T A;  4YFS A;  5L3G B;  2H88 A;  4IE0 A;  4Z8X A;  4KHP T;  2D0T A;  3UU3 A;  1KNP A;  3IHR A;  2XJ7 A;  4JI2 T;  2XQA A;  4L9I A;  3RPU A;  4MHC A;  5FNV E;  4CQI A;  2LLY A;  2CLY B;  5HWY A;  2HN2 A;  5F8P A;  2OV9 A;  3TLW A;  2W63 A;  4H9P C;  4QXB B;  2BS4 A;  2M6I A;  1I94 T;  4QXH B;  3ZJ1 A;  1WR6 A;  4HFB A;  4PK5 A;  1JNZ A;  5AQK B;  3RRW A;  2LRL A;  3PUX F;  4ZI3 D;  3IF8 B;  4HTE A;  2CPT A;  4V1A v;  5H6Q B;  5HEG A;  3VRA A;  3RGL A;  2JRK A;  3VR9 A;  2KWI B;  4PJL A;  3UQ4 A;  4PFP A;  2CWO A;  3PUA A;  5J1G A;  4EEB A;  1MMD A;  2XM2 A;  2NW8 A;  3I9Y A;  5LA6 E;  5LG4 A;  1UUR A;  1G8X A;  5HXS A;  4ZHQ E;  1FEW A;  1KF6 A;  3N2K E;  5L3F B;  2PFV A;  2VKH A;  3Q2M A;  3J7Y q;  1Y64 B;  5EK2 A;  3HL6 A;  1E2A A;  3O1I A;  5CJ5 A;  4UVC B;  4DV7 T;  4KHZ F;  5LNK A;  5EZY E;  2QGS A;  1J1J A;  1LKX A;  3ONX A;  4EIW A;  4LFC T;  1XZY A;  5BMV E;  3QNU A;  4E7S A;  1HTJ F;  3RI5 A;  4ANJ A;  3H3M A;  3NWI A;  2WWU A;  2WSS V;  3KBT A;  4I0U A;  3I1A A;  3RYI E;  1N36 T;  4H63 V;  4AKH A;  3T8O A;  3FBL A;  3LK3 B;  2UU9 T;  4B3T T;  4HWC A;  5HEO A;  2XQ7 A;  1W0B A;  3QB5 A;  4AIS A;  4QH4 A;  1IBK T;  4AI6 A;  3E08 A;  4QKN A;  3AVS A;  1NAF A;  4ILA A;  2DCF A;  2W2U A;  3ETV A;  3FXD B;  1H7C A;  3ZN0 B;  4Q25 A;  1N32 T;  1NWM X;  2YU2 A;  4ZZB A;  2DWG A;  2W4X A;  5FXV A;  4IST A;  5AQR B;  1N34 T;  1HX8 A;  4HWH A;  4BA9 A;  2I59 A;  2WCA A;  3U78 A;  5IHY A;  2YK0 A;  4HEA A;  4G63 A;  5M4Y A;  4DR6 T;  2XQ6 A;  3CX6 B;  3AB3 B;  3RQU A;  1WYB A;  5LOV E;  2VKD A;  2UXC T;  1VOM A;  3RIU A;  2PG8 A;  2LOP A;  2VVN A;  4QX8 B;  4QXC B;  2VKO A;  3ZYL A;  1ZHC A;  2J47 A;  3AA7 B;  3ETU A;  5AQF B;  4LML A;  3RYF E;  5LXT E;  4JV5 T;  3G06 A;  2IW5 B;  4NUV A;  3T1H T;  3PUG A;  3OYX A;  2YDR A;  2FJB A;  4JUY A;  4GYS A;  3JC6 C;  2DL1 A;  3WI3 A;  3K3O A;  3O1J A;  1IZN B;  3AE7 A;  1IJ5 A;  5LGN B;  2KLQ A;  3E22 E;  3P4Q A;  1Z0P A;  3LG7 A;  4F8H A;  2IC9 A;  1LVK A;  2Q9Q D;  3ZJ2 A;  4UXN B;  4U74 A;  3PUQ A;  2ACX A;  2W67 A;  1D0X A;  2E8I A;  3ZMS B;  2LJL A;  4MAL A;  4C90 A;  2K9A A;  3RKG A;  2LM9 A;  2YU1 A;  5ABF A;  2BG9 A;  4DR3 T;  2QVA A;  1XDP A;  4XBF B;  2FJD A;  2OLT A;  4TNW A;  5FXX A;  3P8C D;  2R6G F;  4TV9 E;  3Q9D A;  4EB6 E;  4IIJ E;  4TNV A;  3CPZ A;  2H3R A;  1MIY A;  1G73 A;  4GK5 E;  2VK9 A;  2XAS B;  2X9Y A;  4HWF A;  4A98 A;  1UUS A;  2A72 A;  2WWV A;  4KI0 F;  1HNW T;  3EHZ A;  5JRC A;  5ABF B;  2BG9 B;  3Q5W A;  3P4S A;  3AE1 A;  3CML A;  2VWA A;  4DMV A;  4ZI3 C;  2V7J A;  4IDN A;  4EED A;  3PUV F;  4J2C A;  1HX1 B;  3M3Z B;  3VU7 H;  5AQT B;  5JH7 E;  3N9L A;  3N9N A;  4OHF A;  2NW7 A;  5HXE A;  4H9N C;  5JRC B;  4X66 T;  2E9X A;  4UVA B;  3CQX C;  2XAF B;  4JI7 T;  3MAC A;  2XHE B;  3AA6 B;  4DV0 T;  2ZM6 T;  3VHL A;  5HXC A;  2XM1 A;  3ZST A;  4WBO A;  4U2Z A;  2VKJ A;  2XAJ B;  5AFU L;  1ZEE A;  1YKE B;  4IGU A;  2BVM A;  1D1B A;  3A5X A;  3AEC A;  3HI2 A;  2X68 A;  4X1Y E;  1WRD A;  4JLE A;  2E9X B;  3ZLI A;  1HNX T;  1JNR A;  1NEN A;  5DAB A;  5AQH B;  4DR4 T;  1BR4 A;  2YN6 A;  3QUJ A;  4DVD A;  3QB5 K;  5L4E A;  1E7P A;  3PU3 A;  3LK4 2;  4TZ4 C;  3SWH A;  4O4H E;  4IRE A;  2XSA A;  1VRB A;  2XY8 B;  5KDM C;  3AE9 A;  2VUR A;  1KEY A;  2CXF A;  4JYA T;  1XMQ T;  4GKJ T;  3N2O A;  3O1H A;  4UVB B;  1FMV A;  1WFD A;  1OED E;  3ZT6 A;  2CRB A;  2W62 A;  5ETW A;  2GK9 A;  3IEE A;  3ZMU B;  4JI4 T;  3OYZ A;  5DQW A;  3ZT7 A;  1YQ3 A;  3BQL A;  3RIF A;  4WNK A;  2KZ7 B;  4HFE A;  2YDS A;  5KX5 E;  3CX8 B;  5GON E;  4EYY R;  5LHG B;  5JR9 A;  2PJQ A;  1YW0 A;  2LHR A;  3RIA A;  5AQP B;  1OXZ A;  5IYZ E;  1AJ3 A;  5AQU B;  2YDQ A;  4A5X A;  2LSY A;  3I0O A;  2C0S A;  1UK5 A;  2IHR 1;  2ES0 A;  2XQ3 A;  3EAB A;  4LF4 T;  2N1G A;  4U7I A;  3AEA A;  3SFE A;  3ONL C;  1ZOY A;  3JC6 D;  3KV6 A;  2CHN A;  3UTK A;  2D5U A;  3HKC E;  5JR9 B;  3NRY A;  1MMN A;  5LJN A;  4YHJ A;  4CN4 A;  3NVO A;  3NKZ A;  2W0G A;  4DV1 T;  1BR0 A;  2JQQ A;  4YSY A;  3AAE B;  3F31 A;  2WU2 A;  3ZYK A;  2CE7 A;  4JI1 T;  3B13 A;  4DV6 T;  1D0Y A;  4NXN T;  3TLV A;  3C64 A;  4A97 A;  1T98 A;  4H9S E;  4P09 A;  4UV8 B;  2BVL A;  3P50 A;  4PAG A;  4CXY A;  2Q9Q C;  4H9O C;  3R84 B;  1VCS A;  5FY7 A;  3OPC A;  3JAD A;  2P9B A;  4IHJ E;  3UT5 E;  3UU6 A;  2C5I T;  4JI3 T;  4P1N A;  2WY2 A;  4FI5 A;  1M7K A;  1OED C;  4P0A A;  5L3D B;  4YJ3 E;  4O2B E;  4X65 T;  4GIW A;  5FKY A;  4ERR A;  2MYS A;  3PU8 A;  5AQG B;  1LRZ A;  1Y01 A;  1ZKE A;  3EDV A;  4YJ2 E;  3AE3 A;  5AQJ B;  1WCR A;  4QWN B;  4B3M T;  5E0O A;  3F57 A;  3M65 A;  3NRX A;  3UQ7 A;  3AEF A;  5EK4 A;  4UV9 B;  2CCQ A;  4EYU A;  4ZZC A;  2UUB T;  5JVD E;  5L3C B;  4U3C A;  2VL8 A;  3CWZ B;  2JQ9 A;  3LK2 B;  4XAX B;  3C4W A;  2WS3 A;  1HG2 A;  4HFD A;  4H63 H;  2CLY C;  4QH5 A;  4DID B;  1X9B A;  4AKG A;  1E1H B;  2K5B B;  2LSG A;  5FVK A;  4YLH A;  3HA4 A;  3UUL A;  1VCT A;  2CXL A;  4NXM T;  4OFZ A;  2BDE A;  1HG5 A;  1U5P A;  4LF9 T;  1SE7 A;  4X1I E;  2F4V T;  4LF6 T;  4HFC A;  4COF A;  3NBX X;  3P4R A;  3Q5D A;  3X1D A;  4ILC A;  2BS3 A;  5JDH A;  5HEU A;  4MBQ A;  3L3P A;  2WB5 A;  3AVR A;  3O9X A;  5JQG E;  5A1L A;  3PUS A;  4QHO A;  1MMG A;  3BQI A;  4AKL A;  4B6X A;  3OVU A;  2XZE A;  2W00 A;  1KFY A;  2BBH A;  4KBM B;  2DHR A;  2CXD A;  2KXP B;  3Q5X A;  1D1C A;  5JDG A;  3C98 B;  3VRB A;  3AEE A;  4MFR A;  4YY3 T;  4WBN E;  4PK6 A;  1CHU A;  1S35 A;  4IDP A;  3MKD A;  3ZMT B;  4IT4 A;  3BQK A;  2MOZ A;  3OJA A;  3UU4 A;  4HFH A;  2N2N A;  1O3X A;  2LKG A;  1XWM A;  4OK0 A;  3FZM B;  4ZI2 C;  2XUE A;  3FZL B;  3EDU A;  3MJX A;  5CA1 E;  4ADZ A;  4DR2 T;  2FJA A;  2J1D G;  3QC9 A;  2IC6 A;  4TN7 B;  2W61 A;  3C4Z A;  4ZS3 A;  3ESL A;  2X9X A;  5JRE A;  4ZI7 E;  3GWH A;  3RC3 A;  3AA0 B;  2X9H A;  1KNR A;  3D0T A;  3FZK B;  3PUR A;  5LGT B;  1U4Q A;  2CEA A;  2UUC T;  3VKG A;  5DJQ C;  5LGU B;  2Y8D A;  5HXH A;  2BG9 E;  4CN1 A;  4GYR A;  5FP3 A;  4U33 A;  3PV0 F;  2VB6 A;  2ACZ A;  3HKB E;  2X66 A;  2JQK A;  1UGO A;  2EHO D;  3ANW A;  5F3J A;  5LJM A;  3KV4 A;  3KV5 A;  3U3I A;  5ABE A;  1MIW A;  2XAG B;  5CFB A;  1UX5 A;  4X1K E;  3CK6 A;  5CGM A;  4BJM A;  3LBX A;  2J62 A;  3GA8 A;  3HKD E;  2RPA A;  4UIG A;  3I9W A;  4U31 A;  4TWF A;  4LMK A;  4ZOL E;  4YHH T;  3UFE A;  3GMI A;  2PBI A;  3ANW B;  3DTO A;  3RIU C;  4LFA T;  2HN1 A;  3MZK B;  3F2E A;  2B1E A;  1MNE A;  2CHO A;  2NP9 A;  1FJG T;  4DR7 T;  2KIN B;  3EAM A;  1MND A;  2L3L A;  4LF8 T;  2BS2 A;  3LBX B;  1IBL T;  4PW8 A;  2XAH B;  4YXD A;  2V26 A;  4AQF A;  4I43 B;  2CWY A;  5L2L A;  4BAY B;  1I6Z A;  5LMU T;  3L09 A;  2YOE A;  2X51 A;  4GOU A;  4B3R T;  4AKI A;  2RA1 A;  3CKD A;  3CX7 B;  2IIU A;  2L8K A;  4OYJ A;  4IDZ A;  2FUP A;  3N9O A;  2NW9 A;  4JBW F;  5AQS B;  3LJC A;  4EAH A;  4Z90 A;  5J2T E;  3KV9 A;  5JDQ A;  5HCJ A;  4ILB A;  2C5K T;  3FZF B;  2E5L T;  1SHZ C;  2IUB A;  4I4T E;  3NZP A;  4UEM A;  4X62 T;  5HAX A;  5ABH A;  2L9Q A;  2X9W A;  2NOX A;  5JTG A;  4DR5 T;  2IAK A;  3V5S A;  3JAF A;  2IDO B;  2AE9 A;  4MLK A;  4I50 E;  4O4J E;  3ZKR A;  5JDF A;  3AA1 B;  3ZC1 A;  2D9D A;  1D1A A;  2JIW A;  2HHH T;  3RYC E;  1OWA A;  5JDM A;  3ONJ A;  5LG3 A;  3AE4 A;  5FXZ A;  5TAO A;  4DUZ T;  3CVR A;  1BR2 A;  3EI0 A;  2NTX A;  4F6R C;  4GKK T;  3K8P C;  1V9D A;  2ZM2 A;  1HCI A;  2V7L A;  2E9X C;  5FL0 A;  2AXD S;  4ZI2 D;  4AQG A;  3ZCJ A;  3TLU A;  2XPK A;  3RQW A;  4JI6 T;  5FXW A;  2W66 A;  2MAW A;  3ZEF B;  4DO0 A;  1YXR A;  4A56 A;  2XQ5 A;  4O8S A;  3BK9 A;  4AQY T;  2Q9Q A;  1KK7 A;  5JDL A;  4YSX A;  4IE4 A;  2D0U A;  2V7M A;  1XDO A;  2FBW A;  3OBV E;  2X67 A;  3MXZ A;  2K48 A;  1QUU A;  1HF8 A;  3LSV A;  2LRK A;  4K0K T;  2ZM8 A;  1L0V A;  3C51 A;  1EZ3 A;  3KVA A;  3A8Y C;  3AED A;  3RKO A;  5HWX A;  5LBM A;  3P7I A;  2Q9Q B;  4KP3 C;  3ZT5 A;  4NIQ A;  4CN6 A;  3FXE B;  3UU8 A;  1ZV4 X;  2NWB A;  2CM0 A;  4HFI A;  2E2A A;  5DQV A;  3ZSS A;  3AXJ A;  3Q5E A;  5C3J A;  4DMW A;  1IBM T;  4LMJ A;  1J5E T;  5LBQ B;  2YEV C;  1W9R A;  1J5W A;  2WDQ A;  4TUY E;  2VQF T;  1T8B A;  4KMC A;  2A3D A;  2LE8 A;  3K1S A;  3EUH A;  3WAK A;  2I6H A;  3L8R A;  2FJE A;  1R8I A;  2EHO C;  3MK7 C;  5FY1 A;  1UX4 A;  2Y6X A;  4NUU A;  3SS1 A;  3UU5 A;  5JR9 C;  5BR8 T;  5ABG A;  2A9U A;  3AXJ B;  4WW0 A;  3W15 B;  4H9Q C;  3PJA A;  2VQE T;  2DI4 A;  4U2Y A;  2V6X A;  4PFO A;  3HKE E;  3ZC0 A;  1NEK A;  4HWI B;  4L0R A;  4EGW A;  4ASK A;  2SPC A;  1B7T A;  3FZH B;  3SFD A;  2E5V A;  5LHI B;  2G0U A;  1W09 A;  5FYM A;  4DV3 T;  4WYV A;  4X5T A;  1XMO T;  4E7Z A;  4HN9 A;  3UFG A;  2XQY A;  3ZPO A;  5FMN A;  3ZYM A;  4CI1 B;  3T1Y T;  1FMW A;  5AQL B;  2ZMA A;  1IAP A;  2B76 A;  1GQE A;  2QYW A;  3OTO T;  3N5L A;  5LYJ E;  2M67 A;  2UXB T;  1SUM B;  1HR0 T;  5EK3 A;  4IDO A;  4EOZ B;  4CZZ B;  1UCU A;  3RX6 A;  4IL4 A;  2BKO A;  4U72 A;  4ZS2 A;  1T7S A;  4JEU B;  2KMF A;  2NR4 A;  4JI5 T;  4TWD A;  2KWH A;  3EVY A;  5HEH A;  4AIU A;  4K0U A;  3E0Z A;  2Z6E A;  4OX9 T;  2LT3 A;  3HR0 A;  4KUM B;  4IE5 A;  2WAU A;  3DJB A;  4PJJ A;  4JI8 T;  2UXN B;  5LP6 E;  3LDQ B;  3RYH E;  1CUN A;  2WDV A;  2KT9 A;  3P4P A;  2UXD T;  5LB7 B;  4DBQ A;  3C4X A;  2XSB A;  4EXT A;  3WAJ A;  2WZI A;  3TLT A;  1YD8 G;  3PJA J;  4QX7 B;  2K3W A;  2E9X D;  3ABV A;  3A7M A;  4YTM A;  3RLF F;  1HNZ T;  2DLR A;  3AE6 A;  3NZQ A;  4TX5 A;  3UUX B;  2D2S A;  1FIO A;  1QLB A;  1WLX A;  4IDQ A;  2LHN A;  3CQC B;  3RC8 A;  4ILU A;  1XNR T;  2V5D A;  3AEG A;  3RF1 A;  2V1D B;  5IUX A;  2VAS A;  3ZMV B;  3LFM A;  3DP7 A;  3UUM A;  4BJN A;  4X20 E;  4DBR A;  2RP4 A;  2A2F X;  4IE6 A;  2WU5 A;  4EV6 A;  5C8Y E;  5KMG P;  2WP9 A;  3ZN1 B;  2UUA T;  2H7V C;  3H37 A;  3ZCI A;  4XZC A;  4HKA A;  4X64 T;  2J4G A;  2Y48 B;  3N9M A;  5L3E B;  4JI0 T;  2MPK A;  3L39 A;  3UUN A;  3AEB A;  4UF0 A;  3J9X 1;  2QA7 A;  3N2G E;  1XNQ T;  2LSJ A;  3MA9 A;  4CXW A;  3GN5 A;  4YTN A;  2JMH A;  3CIR A;  4HGA A;  4DR1 T;  3RHW A;  1N33 T;  3S4U A;  5HXR A;  2MTQ A;  3N9P A;  2VL0 A;  2LKH A;  2JJ9 A;  4TWH A;  5J2U E;  4TV8 E;  1HS7 A;  4UF0 B;  3AE2 A;  3O4X E;  2XQ8 A;  4OYK A;  2WZH A;  2KND A;  4DV4 T;  3GN5 B;  2V7I A;  2WMN A;  4PJN A;  2YKS A;  2X0Y A;  3PE0 A;  3V5U A;  2V5C A;  3AE8 A;  5L47 A;  4U7Y A;  2WQY A;  1WYC A;  4HWD A;  4AXP A;  3UUB A;  2JQH A;  4HE8 A;  5F5W A;  2CMR A;  1T72 A;  3PTR B;  4UEL A;  2BZB A;  5ADX L;  5J0Z A;  3FB2 A;  4QH1 A;  3JAE A; 
#chains in the Genus database with same CATH homology
 4JI8 T;  4LF4 T;  2UUB T;  1N32 T;  2VQE T;  4LFB T;  4X64 T;  1HNX T;  4LF5 T;  4LF7 T;  4YY3 T;  4AQY T;  1N34 T;  4DR4 T;  4JI0 T;  2UXD T;  4DR6 T;  4DV3 T;  1XNQ T;  4DV1 T;  4KHP T;  1HNW T;  2E5L T;  2UXC T;  1XMO T;  5IWA T;  4JYA T;  4DR1 T;  4JI2 T;  4K0K T;  4X62 T;  4DV7 T;  1XMQ T;  4JI1 T;  4GKJ T;  4NXM T;  4YHH T;  1N33 T;  5LMN T;  4DV6 T;  3T1Y T;  4NXN T;  1HNZ T;  4DR5 T;  3OTO T;  4LF9 T;  4DR2 T;  4LFC T;  2F4V T;  2UXB T;  4JV5 T;  4LFA T;  1I94 T;  4LF6 T;  3T1H T;  1HR0 T;  1FJG T;  4DR7 T;  4DV5 T;  4JI4 T;  1XNR T;  4JI3 T;  4LF8 T;  4DV4 T;  4X66 T;  4JI5 T;  1IBL T;  1IBM T;  2HHH T;  1J5E T;  4X65 T;  4JI7 T;  4DV0 T;  1N36 T;  4DUZ T;  2ZM6 T;  2UU9 T;  2VQF T;  4B3T T;  2UUC T;  5LMU T;  4GKK T;  4OX9 T;  4B3M T;  4B3S T;  4DUY T;  4B3R T;  1IBK T;  4JI6 T;  2UUA T;  4DV2 T;  5BR8 T;  4DR3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...