4DR2T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr2T00
1HNZT 4DR4T 2HHHT 2UUBT 4DV1T 2UXBT 4DV5T 4DV7T 4YY3T 4X64T 4DV3T 1IBMT 4JI3T 4GKJT 1N36T 4YHHT 4DV6T 4DR6T 4LF5T 4DV0T 5IWAT 4B3RT 4JI0T 4JI1T 1IBKT 4DUYT 4DR7T 4DR5T 4LFCT 4X62T 3OTOT 4LF4T 4JYAT 1XNRT 3T1YT 4KHPT 2UXDT 1N32T 4JI4T 2E5LT 3T1HT 4B3MT 4JI6T 4JV5T 4DV2T 1J5ET 1FJGT 4DR2T 4NXNT 4JI5T 1XMOT 4JI7T 4B3ST 2ZM6T 2UUCT 4JI8T 2UUAT 4LF8T 4AQYT 4JI2T 2F4VT 4X65T 1HR0T 2UXCT 1IBLT 4LF7T 4LFBT 1HNXT 2UU9T 4LFAT 4K0KT 4B3TT 4DV4T 4GKKT 1I94T 1N34T 4X66T 1HNWT 1N33T 4LF9T 2VQFT 4OX9T 1XMQT 5LMNT 4NXMT 5LMUT 4DUZT 4LF6T 4DR3T 5BR8T 1XNQT 4DR1T 2VQET
chains in the Genus database with same CATH superfamily
2HN1A 2K24A 4CI2B 2W2UA 2JRKA 3O1HA 5AQFB 1UUSA 2V6YA 2E5VA 3VRAA 3AE2A 3MKDA 2XHEB 4A97A 5LHHB 2LHRA 1DU2A 1JNRA 2NW8A 3CWZB 3ETUA 3OYXA 1XNRT 3GA8A 1IJ5A 3P4PA 5ABFB 4TWFA 2J4GA 3F31A 3ZYKA 3AA7B 1Z8UA 2YDQA 2BVMA 3AEDA 4ZEYA 2DL1A 1LRZA 4ZI3D 2WBLA 4HN9A 2WP9A 5LNKA 4UVBB 2VL0A 2CM0A 4ISTA 4DBRA 2JQHA 5JDHA 3CQGB 4PW8A 5JDFA 3VU7H 4JI8T 2KWIB 2AXDS 4KHZF 3AEAA 4HTEA 3JCFA 4FI5A 4TN7B 3PUSA 5FY1A 3I9YA 1VRBA 4HWCA 5HEJA 4GKKT 4GYSA 4DO0A 2EHOB 5LMUT 3VR9A 3ZT5A 1J1JA 4MFRA 1O3XA 1WR6A 2HPLA 4V1Av 3DTOA 2CHNA 4KBMB 3BK9A 2MTQA 4ZI2C 3N9MA 2M67A 2B1EA 5L3CB 2BG9B 2X66A 3N2GE 3ZN1B 2BS2A 4HE8A 2X0HA 4DMVA 2NR4A 3NBXX 4ASKA 3OYZA 2Q9QB 3HKEE 4CI3B 2VVSA 1HFAA 1LVKA 4DV2T 2EHOC 5HYAA 3CX7B 4TNWA 1NEKA 4ZXLA 3JC6C 2IHR1 3H37A 5J2TE 4TNVA 2NP9A 3AE7A 2MBGA 3PUVF 2W00A 5AQMB 4LMKA 5AQRB 4A98A 2BG9C 3L09A 3FZLB 2D2SA 3AA1B 2ZLYA 2UXCT 4QXCB 4LF7T 4LFBT 2KINB 5HXCA 1NENA 4YFSA 3G06A 2NTXA 3HL6A 3DP7A 2C5KT 4JEUB 2V7LA 3PUGA 3CMLA 3N9LA 2V7IA 3C4ZA 3KINB 2Q9QC 4OYJA 3LJCA 1KNZA 4IDOA 3KBUA 2E9XA 5EZYE 5HAXA 1HX8A 4KP3C 3ZMVB 1HCIA 4ILBA 4PK5A 3RQWA 4UVAB 3U78A 4AKRB 4ZZCA 4ISSA 2IAKA 2E8IA 4QXBB 1HTJF 5LA6E 4YT0A 4JBWF 5HEGA 5FVLA 4DV0T 5IWAT 3ZCJA 5LB7B 2X0YA 3Q5DA 4IE7A 4X62T 2CXDA 5L4EA 2HN2A 2CHOA 2C0SA 1D0ZA 2WU5A 2J62A 3CQCB 4H9PC 4DMWA 4L5GA 2BDEA 3Q9DA 3E0ZA 3FZFB 3RKGA 4B3ST 2VASA 3CX8B 5HWXA 4EYUA 2GK9A 5LOVE 4QH4A 3K8PC 4MLKA 4LF8T 1X79A 4AIUA 2WY2A 1WYBA 3RX6A 4H9SE 2ZM0A 2LSIA 5FL0A 3ABVA 1KEYA 3FHNA 3HKDE 2H7VC 4TV8E 5CA1E 2HPJA 2KXPB 4U2ZA 1G73A 3F2EA 1V9DA 4X66T 2BKPA 1MIYA 2XZEA 1MIWA 3SFDA 3N2OA 5CB4E 2VWAA 1QUUA 4Z91A 1MNEA 4X64T 2IC6A 4E7SA 3J7Yq 5DABA 2XQAA 3O9XA 2CLYB 1HF8A 2J1DG 5F5WA 3Q5XA 3SOLA 5HCMA 3O4XE 1AJ3A 4YSZA 1ZKEA 2YOEA 3MJXA 5LBQB 1VCTA 3B5MA 2XM2A 2LM9A 4M1PA 4X1YE 5FXXA 1R8IA 4I55E 5ABEA 4IE4A 1SE7A 4CN4A 2ES0A 4JLEA 2M6BA 1FJGT 1YQ3A 2SPCA 2L9QA 3P4RA 5AQGB 1XMOT 1HS7A 5JR9A 3K3QC 2X68A 3ANWA 3EDVA 2LSGA 1ZV4X 3D0TA 5L2LA 1D1AA 2XJ7A 4TZ4C 4U33A 4Z8XA 2CLYC 3UUXB 3ETVA 3OKQA 2DI4A 2WSSV 5J1GA 1MNDA 3UUBA 2X51A 3IHRA 1XWMA 3FB2A 2UU9T 4C90A 5TAOA 4K0UA 3RIUC 4HWHA 3QB5A 2WDVA 2VQFT 1XMQT 4NXMT 3RIFA 5AQKB 3HR0A 3UFEA 4DNDA 2HH7A 1U5PA 2BKNA 4DV7T 2XSAA 2LOPA 4YY3T 4EZ4A 2W61A 2V7MA 3VHLA 3RGLA 3NRXA 4I50E 3ZCIA 5LGTB 3GWHA 5H6QB 4HFVA 3AAEB 4YXDA 4B6XA 2FJDA 3EDUA 5CJ5A 1ZEEA 4IHJE 2H89A 3PDYA 4UXNB 1NWMX 4PK4A 4LF4T 3AEEA 4O8SA 4I4TE 4X1IE 3QB5K 5JDLA 3IBPA 4IT4A 3CQXC 4TV9E 1KFYA 1OEDA 2H7OA 1OWAA 3N2KE 2I6HA 5C8YE 3L3PA 3ONJA 5LCYA 5HXEA 3ZC1A 5J0ZA 4YHJA 5AQIB 2YEVC 4IE0A 1FIOA 1YXRA 3AA0B 4WZXA 3AXJA 3UQ4A 2LLYA 4O4IE 4G2AA 1EZ3A 3R6NA 2CXLA 4XAXB 2FJEA 3C50A 4OX9T 3LG7A 3C4WA 4E7ZA 3AE9A 4GOUA 3LBXA 4UVCB 1US7B 1W09A 1HNZT 2HHHT 5HEOA 4DV1T 4P1NA 5L3DB 2L8KA 1L0VA 3UUMA 1W0AA 3AECA 2X9HA 4QHOA 2RPAA 3RLFF 2CEAA 4Q25A 3N5LA 2WCAA 2Y8DA 1W0BA 3PUQA 4U3CA 4JYAT 2ZM8A 2PG8A 3L39A 4KHPT 2CPTA 3ZEFB 4P0AA 4JV5T 3C51A 2LJLA 2FJBA 5JH7E 1MMGA 2QYWA 4QH5A 4IDPA 1IAPA 5EK3A 3TLVA 2ODVA 5AQNB 3UU4A 5H6RB 2WWUA 3N9NA 1M62A 4U72A 3GN5A 2LKGA 1HR0T 5J2UE 2LOSA 4YJ3E 1IBLT 1WYCA 4MALA 2CWYA 2VKDA 2OA5A 2DNXA 4K0KT 3I1AA 2CCQA 3IA3A 3TKLB 2QA7A 4UF0A 4HFCA 5HXHA 4LF9T 3P4WA 2XAGB 4BJMA 2A2FX 4DR3T 3L8RA 5JDMA 4HFHA 5JRCB 3CPZA 2UUBT 5LYJE 5KDMC 3BQLA 1FEWA 5FYMA 3OJAA 2IDOB 2CE7A 5FY0A 4N78D 1N36T 4O4LE 4YHHT 2KWHA 4HEAA 3CKDA 2NWBA 4B3RT 2IW5B 4H9NC 2CBIA 3AE3A 2K48A 5AQJB 4H9QC 3WI3A 5JDNA 5FMNA 4O2BE 4L9IA 3PUXF 1YKHB 5JTGA 3AB3B 3VR8A 4JI5T 3ZT6A 3PJAJ 3ZJ2A 2K3WA 3X1DA 2BBHA 2D0UA 3LK2B 4DBQA 4ERRA 4F6RC 3ZMSB 3LK3B 3AAIA 4EEBA 2IC9A 1VCSA 4EYYR 4ZI2D 4X65T 4PNIA 2N1GA 2CRBA 2BKOA 3RI5A 4PFOA 1OXZA 3FBZA 4AISA 2D0TA 5ETWA 2QGSA 2IUBA 1N34T 2XQ8A 2W67A 2DWKA 3VKHA 1N33T 1HG5A 2CWOA 2M6IA 2D5UA 1LKXA 5LMNT 3E08A 2LM2A 2YN6A 4HFEA 1I6ZA 3QUJA 3QK6A 5AQTB 2UXBT 2BS4A 2V7KA 2EHOD 4HWDA 3KVAA 4YLHA 5JDGA 3RYIE 3UU6A 3N9QA 4HFDA 3P7IA 1OEDE 2V8SV 3CIRA 2C5JA 2VB6A 3TLUA 1S35A 2QVAA 4DR7T 4LFCT 3OTOT 2ACZA 4OFZA 3AEBA 4JEHB 2LT3A 4WBOA 2V6YB 3T1HT 3B57A 4NXNT 4EGWA 4YTPA 1ZOYA 3RRCA 4UV9B 4HFIA 3RIAA 5L3FB 3MK7C 4ILUA 1ZHCA 3QNUA 4JI2T 5IUXA 3LSVA 5F8PA 2FUPA 3PUAA 2XTLA 2YDSA 5AQSB 3KV5A 3V5SA 1IJ6A 2WZHA 4U2YA 5CGMA 4UELA 3PURA 5CFBA 2BBJA 3C64A 4DUZT 2FJAA 4EXTA 1YKEB 2ODUA 5C2TA 4QKNA 2PJQA 4ANJA 4IDZA 3EHZA 2MYSA 4HWIB 3UU3A 4YSYA 2K9AA 3PUZF 3ZLIA 5KXJA 4L0RA 5LJMA 5FVKA 5AQHB 3PUYF 1HG2A 3PU3A 2NW9A 5AQVB 5KMGP 4DUYT 4H63H 2CA5A 1UX5A 4CN6A 3T1YT 3AE8A 2NOXA 3AAAB 5ADXL 1D1BA 3EAMA 3ZKRA 4JUYA 2WM9A 1XDOA 4XBFB 2V5CA 3GMIA 3VKGA 2X67A 5GONE 4ZZBA 1U4QA 3S4UA 3PV0F 2XUEA 2JQ9A 3RC8A 2DCFA 3ZMZB 3K3NA 2F4VT 4GIWA 2WQYA 3KDSE 3EUHA 3HKBE 1E7PA 3J9X1 4ZS2A 2W62A 2P9BA 2OV9A 4UR9A 2LRKA 4AKIA 2JJ9A 5FY7A 4LF6T 3HI2A 3SS1A 1BR4A 3EI0A 4O4JE 2ACXA 3K1SA 3Q5EA 3H3AA 4TX5A 5JVDE 2KLQA 5AQUB 4EIWA 3ONLC 5LG3A 4DV6T 4G63A 3KBTA 4LF5T 2C5IT 2K5BB 4COFA 2CBJA 2VKOA 2E9XB 1UCUA 4AKGA 4EV6A 2WDQA 2AE9A 3U3IA 5BMVE 3RRWA 4BJNA 3EABA 4HFBA 3VRBA 2V1DB 4IDNA 2JIWA 3SWHA 2H88A 2G0UA 2KZ7B 4PK6A 4AKLA 5AQPB 2EHOA 3CVRA 1WR0A 2RA1A 3AE6A 3JADA 4H63V 1Y64B 1S94A 2XQ4A 1CHUA 5EK2A 4U7YA 2E9XC 4DV4T 2BG9A 4BAYB 1MMNA 2W66A 4UEMA 3MA9A 3ZSSA 4CZZB 4KUMB 3PU8A 3UU5A 4DR4T 3O1IA 5HWYA 3UU8A 4IGUA 3E22E 1Z0PA 4U7IA 3UFGA 5DQVA 5FKYA 1E1HB 2XSBA 5F3JA 3KV9A 4ZOLE 1JNZA 1FMWA 3NZPA 2Y6XA 2CMRA 3B13A 3RYFE 3MXZA 2X0LB 4PAGA 1WRDA 2WDRA 2JMHA 5HCJA 2XQ6A 5FP3A 3CK6A 4PJLA 4AXPA 3C4XA 3AVSA 4EEDA 2WU2A 4Z90A 1BR0A 1FMVA 2XASB 5AFUL 3RPUA 1WLXA 5EK4A 2V6XA 3RF1A 3ZJ1A 2V26A 2JPFA 4NIQA 4AQYT 5JQGE 3M3ZB 1GQEA 4IL4A 2XQ7A 4GK5E 2IIUA 1MMDA 4X5TA 5JR9B 3ANWB 5FL1A 1I94T 4ZI3C 3P4QA 3IF8B 2YU1A 4UV8B 1J5WA 2YU2A 2W0GA 4CXYA 2CXFA 5AQLB 2XQ5A 3RHWA 3JAEA 1QLBA 4GKJT 4EAHA 5KX5E 1KK7A 4GYRA 4IL9A 3MZKB 2LRLA 3I0QA 4P09A 2OLTA 2X9YA 4H9RC 4JI0T 2FBWA 3C98B 5HXSA 2W63A 2XAQB 1IBKT 3ZPOA 4DR5T 1M7KA 5LGNB 4PJNA 5JR9C 2UXDT 4U74A 2VKHA 2BS3A 2UXNB 3NWIA 4KMCA 1W9RA 4DR2T 2XAHB 2W4XA 2UUCT 2X9WA 2UUAT 3AA6B 2XAJB 2XQ9A 1XDPA 4O4HE 3UTKA 4QWNB 3Q2MA 1UK5A 4P0BA 5JDQA 5LHIB 1OEDB 2J47A 3HKCE 4ZHQE 3PTRB 2I0MA 1HNXT 4HGAA 2BZBA 4YTNA 2LEHA 3KVBA 4IIJE 4AQGA 2WMNA 4WBNE 1SHZC 4OHFA 2XQ3A 3DJBA 5FNVE 3FXDB 4WYVA 4PFPA 4WNKA 2WB5A 3P4SA 4MBQA 3TLTA 3A8YC 3ZC0A 3RIUA 5LXTE 1VOMA 3AXJB 2DWGA 4GK0E 4DV3T 2MAWA 2PFVA 4J2CA 4OK0A 3RYHE 3BQKA 5JREA 4CXXA 3ZSTA 4DR6T 2VVNA 3LBXB 3M65A 5DQWA 3RYCE 4IREA 2NTYA 1OEDC 4UIGA 3RH3A 3ONXA 4JI1T 3AE1A 1KNRA 3T8OA 4TWHA 1H7CA 4OYKA 1X9BA 3TLWA 4ILCA 3UUNA 3BQIA 2E5LT 3JC6D 1BR1A 4CXWA 4B3MT 1D0XA 3A5XA 1J5ET 5L3EB 4CQIA 2YINA 3NVOA 4HKAA 2YK0A 3V5UA 4IDQA 2BG9E 5LHGB 3ZYLA 2WAUA 2WWVA 5LG4A 1D1CA 2V7JA 4IE5A 3ZN0B 4DVDA 5CA0E 4NUVA 1UGOA 4PJMA 1WFDA 2Q9QD 3Q5WA 1T98A 4AQFA 4AKHA 1HNWT 2NW7A 2DLRA 5IYZE 3SRZA 3GN5B 4TWDA 3LDQB 2VQET 1T72A 2I59A 5E0OA 4DV5T 3FZHB 2XM1A 3UT5E 1ZP0A 3WAKA 4UF0B 2D9DA 3QOFA 1BR2A 1T8BA 3FZMB 2WZIA 2VKJA 2JMKA 4YTMA 1IZNB 4KX6A 1WCRA 1YQ4A 3LK42 5DJQC 4FJOA 4YJ2E 2JQQA 2XY8B 3O1JA 1MIVA 4NUUA 3OPCA 2ZM2A 2YDRA 5AQQB 4ILAA 1B7TA 2JQKA 4A5XA 2LSKA 3LFMA 3MACA 5LP6E 4I43B 3NRYA 2KSRA 3ZYMA 4LFAT 3I0OA 2L3LA 2Z6EA 1UX4A 4ZI7E 5AQOB 3OVUA 3KV4A 3AE4A 3AEFA 4AI6A 4QXHB 3SFEA 5L3BB 3ZT7A 2QRXA 5BR8T 3A7MA 3EVYA 4HWFA 3UULA 3CX6B 5LBMA 5ABGA 2LSYA 1KF6A 2LKHA 2MOZA 4EOZB 1G8XA 1UURA 5C3JA 2X9XA 5M4YA 2VURA 4KI0F 4QH1A 1YD8G 2XPKA 2A72A 3RKOA 2XQYA 5ABFA 4DIDB 1XZYA 3QC9A 4JI4T 5FXZA 1KNPA 3AE5A 5L3GB 1D0YA 4JI7T 2KT9A 4X1KE 4EB6E 4EZHA 2LSJA 2WS3A 3RC3A 4QX7B 4LMJA 3R84B 4NPPA 4TUYE 3KFWX 3JAFA 3W15B 3P50A 4F8HA 5JRCA 4I0UA 3ESLA 1SUMB 2MPKA 5L4HA 3FXEB 2R6GF 2N9DA 3ZMTB 2LHNA 4WW0A 5A1LA 4IE6A 3AEGA 4B3TT 5ABHA 1NAFA 1QSDA 3TLSA 3N9OA 3WAJA 5LGUB 2VK9A 4DR1T 3UQ7A 5LJNA 2V5DA 4O2AE 1HX1B 2N2NA 3OBVE 2PBIA 2XAFB 1IBMT 4C91A 2A9UA 4JI3T 2KNDA 4H9OC 5HEHA 4LMLA 4YSXA 3IEEA 1LVFA 4ADZA 3NZQA 3FZKB 3N9PA 4U31A 3ZMUB 2DHRA 1CUNA 4ZS3A 1Y01A 2Q9QA 1N32T 4AQFC 2Y48B 3PE0A 2PTFA 2A3DA 4QX8B 5L47A 2E9XD 4JI6T 3AVRA 5FXWA 2WMOA 2ZMAA 3RQUA 4A56A 3P8CD 3K3OA 3I9WA 3F57A 5HEUA 2ZM6T 3PUWF 2KMFA 1SA0E 4BA9A 2BVLA 1YW0A 2E2AA 3HA4A 2UXXB 4MHCA 4PJJA 3KV6A 2YKSA 3NKZA 5IHYA 2H3RA 1MMAA 4CI1B 5FXVA 5HXRA 2IMLA 3PJAA 3FBLA 2LE8A 4CN1A 1E2AA 2RP4A 4XZCA 4X20E 2B76A 2VL8A 3H3MA 1XNQT 1T7SA
chains in the Genus database with same CATH topology
1HNZT 4DR4T 2HHHT 2UUBT 4DV1T 2UXBT 4DV5T 4DV7T 4YY3T 4X64T 4DV3T 1IBMT 4JI3T 4GKJT 1N36T 4YHHT 4DV6T 4DR6T 4LF5T 4DV0T 5IWAT 4B3RT 4JI0T 4JI1T 1IBKT 4DUYT 4DR7T 4DR5T 4LFCT 4X62T 3OTOT 4LF4T 4JYAT 1XNRT 3T1YT 4KHPT 2UXDT 1N32T 4JI4T 2E5LT 3T1HT 4B3MT 4JI6T 4JV5T 4DV2T 1J5ET 1FJGT 4DR2T 4NXNT 4JI5T 1XMOT 4JI7T 4B3ST 2ZM6T 2UUCT 4JI8T 2UUAT 4LF8T 4AQYT 4JI2T 2F4VT 4X65T 1HR0T 2UXCT 1IBLT 4LF7T 4LFBT 1HNXT 2UU9T 4LFAT 4K0KT 4B3TT 4DV4T 4GKKT 1I94T 1N34T 4X66T 1HNWT 1N33T 4LF9T 2VQFT 4OX9T 1XMQT 5LMNT 4NXMT 5LMUT 4DUZT 4LF6T 4DR3T 5BR8T 1XNQT 4DR1T 2VQET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  4DR4 T;  2HHH T;  2UUB T;  4DV1 T;  2UXB T;  4DV5 T;  4DV7 T;  4YY3 T;  4X64 T;  4DV3 T;  1IBM T;  4JI3 T;  4GKJ T;  1N36 T;  4YHH T;  4DV6 T;  4DR6 T;  4LF5 T;  4DV0 T;  5IWA T;  4B3R T;  4JI0 T;  4JI1 T;  1IBK T;  4DUY T;  4DR7 T;  4DR5 T;  4LFC T;  4X62 T;  3OTO T;  4LF4 T;  4JYA T;  1XNR T;  3T1Y T;  4KHP T;  2UXD T;  1N32 T;  4JI4 T;  2E5L T;  3T1H T;  4B3M T;  4JI6 T;  4JV5 T;  4DV2 T;  1J5E T;  1FJG T;  4DR2 T;  4NXN T;  4JI5 T;  1XMO T;  4JI7 T;  4B3S T;  2ZM6 T;  2UUC T;  4JI8 T;  2UUA T;  4LF8 T;  4AQY T;  4JI2 T;  2F4V T;  4X65 T;  1HR0 T;  2UXC T;  1IBL T;  4LF7 T;  4LFB T;  1HNX T;  2UU9 T;  4LFA T;  4K0K T;  4B3T T;  4DV4 T;  4GKK T;  1I94 T;  1N34 T;  4X66 T;  1HNW T;  1N33 T;  4LF9 T;  2VQF T;  4OX9 T;  1XMQ T;  5LMN T;  4NXM T;  5LMU T;  4DUZ T;  4LF6 T;  4DR3 T;  5BR8 T;  1XNQ T;  4DR1 T;  2VQE T; 
#chains in the Genus database with same CATH topology
 2HN1 A;  2K24 A;  4CI2 B;  2W2U A;  2JRK A;  3O1H A;  5AQF B;  1UUS A;  2V6Y A;  2E5V A;  3VRA A;  3AE2 A;  3MKD A;  2XHE B;  4A97 A;  5LHH B;  2LHR A;  1DU2 A;  1JNR A;  2NW8 A;  3CWZ B;  3ETU A;  3OYX A;  1XNR T;  3GA8 A;  1IJ5 A;  3P4P A;  5ABF B;  4TWF A;  2J4G A;  3F31 A;  3ZYK A;  3AA7 B;  1Z8U A;  2YDQ A;  2BVM A;  3AED A;  4ZEY A;  2DL1 A;  1LRZ A;  4ZI3 D;  2WBL A;  4HN9 A;  2WP9 A;  5LNK A;  4UVB B;  2VL0 A;  2CM0 A;  4IST A;  4DBR A;  2JQH A;  5JDH A;  3CQG B;  4PW8 A;  5JDF A;  3VU7 H;  4JI8 T;  2KWI B;  2AXD S;  4KHZ F;  3AEA A;  4HTE A;  3JCF A;  4FI5 A;  4TN7 B;  3PUS A;  5FY1 A;  3I9Y A;  1VRB A;  4HWC A;  5HEJ A;  4GKK T;  4GYS A;  4DO0 A;  2EHO B;  5LMU T;  3VR9 A;  3ZT5 A;  1J1J A;  4MFR A;  1O3X A;  1WR6 A;  2HPL A;  4V1A v;  3DTO A;  2CHN A;  4KBM B;  3BK9 A;  2MTQ A;  4ZI2 C;  3N9M A;  2M67 A;  2B1E A;  5L3C B;  2BG9 B;  2X66 A;  3N2G E;  3ZN1 B;  2BS2 A;  4HE8 A;  2X0H A;  4DMV A;  2NR4 A;  3NBX X;  4ASK A;  3OYZ A;  2Q9Q B;  3HKE E;  4CI3 B;  2VVS A;  1HFA A;  1LVK A;  4DV2 T;  2EHO C;  5HYA A;  3CX7 B;  4TNW A;  1NEK A;  4ZXL A;  3JC6 C;  2IHR 1;  3H37 A;  5J2T E;  4TNV A;  2NP9 A;  3AE7 A;  2MBG A;  3PUV F;  2W00 A;  5AQM B;  4LMK A;  5AQR B;  4A98 A;  2BG9 C;  3L09 A;  3FZL B;  2D2S A;  3AA1 B;  2ZLY A;  2UXC T;  4QXC B;  4LF7 T;  4LFB T;  2KIN B;  5HXC A;  1NEN A;  4YFS A;  3G06 A;  2NTX A;  3HL6 A;  3DP7 A;  2C5K T;  4JEU B;  2V7L A;  3PUG A;  3CML A;  3N9L A;  2V7I A;  3C4Z A;  3KIN B;  2Q9Q C;  4OYJ A;  3LJC A;  1KNZ A;  4IDO A;  3KBU A;  2E9X A;  5EZY E;  5HAX A;  1HX8 A;  4KP3 C;  3ZMV B;  1HCI A;  4ILB A;  4PK5 A;  3RQW A;  4UVA B;  3U78 A;  4AKR B;  4ZZC A;  4ISS A;  2IAK A;  2E8I A;  4QXB B;  1HTJ F;  5LA6 E;  4YT0 A;  4JBW F;  5HEG A;  5FVL A;  4DV0 T;  5IWA T;  3ZCJ A;  5LB7 B;  2X0Y A;  3Q5D A;  4IE7 A;  4X62 T;  2CXD A;  5L4E A;  2HN2 A;  2CHO A;  2C0S A;  1D0Z A;  2WU5 A;  2J62 A;  3CQC B;  4H9P C;  4DMW A;  4L5G A;  2BDE A;  3Q9D A;  3E0Z A;  3FZF B;  3RKG A;  4B3S T;  2VAS A;  3CX8 B;  5HWX A;  4EYU A;  2GK9 A;  5LOV E;  4QH4 A;  3K8P C;  4MLK A;  4LF8 T;  1X79 A;  4AIU A;  2WY2 A;  1WYB A;  3RX6 A;  4H9S E;  2ZM0 A;  2LSI A;  5FL0 A;  3ABV A;  1KEY A;  3FHN A;  3HKD E;  2H7V C;  4TV8 E;  5CA1 E;  2HPJ A;  2KXP B;  4U2Z A;  1G73 A;  3F2E A;  1V9D A;  4X66 T;  2BKP A;  1MIY A;  2XZE A;  1MIW A;  3SFD A;  3N2O A;  5CB4 E;  2VWA A;  1QUU A;  4Z91 A;  1MNE A;  4X64 T;  2IC6 A;  4E7S A;  3J7Y q;  5DAB A;  2XQA A;  3O9X A;  2CLY B;  1HF8 A;  2J1D G;  5F5W A;  3Q5X A;  3SOL A;  5HCM A;  3O4X E;  1AJ3 A;  4YSZ A;  1ZKE A;  2YOE A;  3MJX A;  5LBQ B;  1VCT A;  3B5M A;  2XM2 A;  2LM9 A;  4M1P A;  4X1Y E;  5FXX A;  1R8I A;  4I55 E;  5ABE A;  4IE4 A;  1SE7 A;  4CN4 A;  2ES0 A;  4JLE A;  2M6B A;  1FJG T;  1YQ3 A;  2SPC A;  2L9Q A;  3P4R A;  5AQG B;  1XMO T;  1HS7 A;  5JR9 A;  3K3Q C;  2X68 A;  3ANW A;  3EDV A;  2LSG A;  1ZV4 X;  3D0T A;  5L2L A;  1D1A A;  2XJ7 A;  4TZ4 C;  4U33 A;  4Z8X A;  2CLY C;  3UUX B;  3ETV A;  3OKQ A;  2DI4 A;  2WSS V;  5J1G A;  1MND A;  3UUB A;  2X51 A;  3IHR A;  1XWM A;  3FB2 A;  2UU9 T;  4C90 A;  5TAO A;  4K0U A;  3RIU C;  4HWH A;  3QB5 A;  2WDV A;  2VQF T;  1XMQ T;  4NXM T;  3RIF A;  5AQK B;  3HR0 A;  3UFE A;  4DND A;  2HH7 A;  1U5P A;  2BKN A;  4DV7 T;  2XSA A;  2LOP A;  4YY3 T;  4EZ4 A;  2W61 A;  2V7M A;  3VHL A;  3RGL A;  3NRX A;  4I50 E;  3ZCI A;  5LGT B;  3GWH A;  5H6Q B;  4HFV A;  3AAE B;  4YXD A;  4B6X A;  2FJD A;  3EDU A;  5CJ5 A;  1ZEE A;  4IHJ E;  2H89 A;  3PDY A;  4UXN B;  1NWM X;  4PK4 A;  4LF4 T;  3AEE A;  4O8S A;  4I4T E;  4X1I E;  3QB5 K;  5JDL A;  3IBP A;  4IT4 A;  3CQX C;  4TV9 E;  1KFY A;  1OED A;  2H7O A;  1OWA A;  3N2K E;  2I6H A;  5C8Y E;  3L3P A;  3ONJ A;  5LCY A;  5HXE A;  3ZC1 A;  5J0Z A;  4YHJ A;  5AQI B;  2YEV C;  4IE0 A;  1FIO A;  1YXR A;  3AA0 B;  4WZX A;  3AXJ A;  3UQ4 A;  2LLY A;  4O4I E;  4G2A A;  1EZ3 A;  3R6N A;  2CXL A;  4XAX B;  2FJE A;  3C50 A;  4OX9 T;  3LG7 A;  3C4W A;  4E7Z A;  3AE9 A;  4GOU A;  3LBX A;  4UVC B;  1US7 B;  1W09 A;  1HNZ T;  2HHH T;  5HEO A;  4DV1 T;  4P1N A;  5L3D B;  2L8K A;  1L0V A;  3UUM A;  1W0A A;  3AEC A;  2X9H A;  4QHO A;  2RPA A;  3RLF F;  2CEA A;  4Q25 A;  3N5L A;  2WCA A;  2Y8D A;  1W0B A;  3PUQ A;  4U3C A;  4JYA T;  2ZM8 A;  2PG8 A;  3L39 A;  4KHP T;  2CPT A;  3ZEF B;  4P0A A;  4JV5 T;  3C51 A;  2LJL A;  2FJB A;  5JH7 E;  1MMG A;  2QYW A;  4QH5 A;  4IDP A;  1IAP A;  5EK3 A;  3TLV A;  2ODV A;  5AQN B;  3UU4 A;  5H6R B;  2WWU A;  3N9N A;  1M62 A;  4U72 A;  3GN5 A;  2LKG A;  1HR0 T;  5J2U E;  2LOS A;  4YJ3 E;  1IBL T;  1WYC A;  4MAL A;  2CWY A;  2VKD A;  2OA5 A;  2DNX A;  4K0K T;  3I1A A;  2CCQ A;  3IA3 A;  3TKL B;  2QA7 A;  4UF0 A;  4HFC A;  5HXH A;  4LF9 T;  3P4W A;  2XAG B;  4BJM A;  2A2F X;  4DR3 T;  3L8R A;  5JDM A;  4HFH A;  5JRC B;  3CPZ A;  2UUB T;  5LYJ E;  5KDM C;  3BQL A;  1FEW A;  5FYM A;  3OJA A;  2IDO B;  2CE7 A;  5FY0 A;  4N78 D;  1N36 T;  4O4L E;  4YHH T;  2KWH A;  4HEA A;  3CKD A;  2NWB A;  4B3R T;  2IW5 B;  4H9N C;  2CBI A;  3AE3 A;  2K48 A;  5AQJ B;  4H9Q C;  3WI3 A;  5JDN A;  5FMN A;  4O2B E;  4L9I A;  3PUX F;  1YKH B;  5JTG A;  3AB3 B;  3VR8 A;  4JI5 T;  3ZT6 A;  3PJA J;  3ZJ2 A;  2K3W A;  3X1D A;  2BBH A;  2D0U A;  3LK2 B;  4DBQ A;  4ERR A;  4F6R C;  3ZMS B;  3LK3 B;  3AAI A;  4EEB A;  2IC9 A;  1VCS A;  4EYY R;  4ZI2 D;  4X65 T;  4PNI A;  2N1G A;  2CRB A;  2BKO A;  3RI5 A;  4PFO A;  1OXZ A;  3FBZ A;  4AIS A;  2D0T A;  5ETW A;  2QGS A;  2IUB A;  1N34 T;  2XQ8 A;  2W67 A;  2DWK A;  3VKH A;  1N33 T;  1HG5 A;  2CWO A;  2M6I A;  2D5U A;  1LKX A;  5LMN T;  3E08 A;  2LM2 A;  2YN6 A;  4HFE A;  1I6Z A;  3QUJ A;  3QK6 A;  5AQT B;  2UXB T;  2BS4 A;  2V7K A;  2EHO D;  4HWD A;  3KVA A;  4YLH A;  5JDG A;  3RYI E;  3UU6 A;  3N9Q A;  4HFD A;  3P7I A;  1OED E;  2V8S V;  3CIR A;  2C5J A;  2VB6 A;  3TLU A;  1S35 A;  2QVA A;  4DR7 T;  4LFC T;  3OTO T;  2ACZ A;  4OFZ A;  3AEB A;  4JEH B;  2LT3 A;  4WBO A;  2V6Y B;  3T1H T;  3B57 A;  4NXN T;  4EGW A;  4YTP A;  1ZOY A;  3RRC A;  4UV9 B;  4HFI A;  3RIA A;  5L3F B;  3MK7 C;  4ILU A;  1ZHC A;  3QNU A;  4JI2 T;  5IUX A;  3LSV A;  5F8P A;  2FUP A;  3PUA A;  2XTL A;  2YDS A;  5AQS B;  3KV5 A;  3V5S A;  1IJ6 A;  2WZH A;  4U2Y A;  5CGM A;  4UEL A;  3PUR A;  5CFB A;  2BBJ A;  3C64 A;  4DUZ T;  2FJA A;  4EXT A;  1YKE B;  2ODU A;  5C2T A;  4QKN A;  2PJQ A;  4ANJ A;  4IDZ A;  3EHZ A;  2MYS A;  4HWI B;  3UU3 A;  4YSY A;  2K9A A;  3PUZ F;  3ZLI A;  5KXJ A;  4L0R A;  5LJM A;  5FVK A;  5AQH B;  3PUY F;  1HG2 A;  3PU3 A;  2NW9 A;  5AQV B;  5KMG P;  4DUY T;  4H63 H;  2CA5 A;  1UX5 A;  4CN6 A;  3T1Y T;  3AE8 A;  2NOX A;  3AAA B;  5ADX L;  1D1B A;  3EAM A;  3ZKR A;  4JUY A;  2WM9 A;  1XDO A;  4XBF B;  2V5C A;  3GMI A;  3VKG A;  2X67 A;  5GON E;  4ZZB A;  1U4Q A;  3S4U A;  3PV0 F;  2XUE A;  2JQ9 A;  3RC8 A;  2DCF A;  3ZMZ B;  3K3N A;  2F4V T;  4GIW A;  2WQY A;  3KDS E;  3EUH A;  3HKB E;  1E7P A;  3J9X 1;  4ZS2 A;  2W62 A;  2P9B A;  2OV9 A;  4UR9 A;  2LRK A;  4AKI A;  2JJ9 A;  5FY7 A;  4LF6 T;  3HI2 A;  3SS1 A;  1BR4 A;  3EI0 A;  4O4J E;  2ACX A;  3K1S A;  3Q5E A;  3H3A A;  4TX5 A;  5JVD E;  2KLQ A;  5AQU B;  4EIW A;  3ONL C;  5LG3 A;  4DV6 T;  4G63 A;  3KBT A;  4LF5 T;  2C5I T;  2K5B B;  4COF A;  2CBJ A;  2VKO A;  2E9X B;  1UCU A;  4AKG A;  4EV6 A;  2WDQ A;  2AE9 A;  3U3I A;  5BMV E;  3RRW A;  4BJN A;  3EAB A;  4HFB A;  3VRB A;  2V1D B;  4IDN A;  2JIW A;  3SWH A;  2H88 A;  2G0U A;  2KZ7 B;  4PK6 A;  4AKL A;  5AQP B;  2EHO A;  3CVR A;  1WR0 A;  2RA1 A;  3AE6 A;  3JAD A;  4H63 V;  1Y64 B;  1S94 A;  2XQ4 A;  1CHU A;  5EK2 A;  4U7Y A;  2E9X C;  4DV4 T;  2BG9 A;  4BAY B;  1MMN A;  2W66 A;  4UEM A;  3MA9 A;  3ZSS A;  4CZZ B;  4KUM B;  3PU8 A;  3UU5 A;  4DR4 T;  3O1I A;  5HWY A;  3UU8 A;  4IGU A;  3E22 E;  1Z0P A;  4U7I A;  3UFG A;  5DQV A;  5FKY A;  1E1H B;  2XSB A;  5F3J A;  3KV9 A;  4ZOL E;  1JNZ A;  1FMW A;  3NZP A;  2Y6X A;  2CMR A;  3B13 A;  3RYF E;  3MXZ A;  2X0L B;  4PAG A;  1WRD A;  2WDR A;  2JMH A;  5HCJ A;  2XQ6 A;  5FP3 A;  3CK6 A;  4PJL A;  4AXP A;  3C4X A;  3AVS A;  4EED A;  2WU2 A;  4Z90 A;  1BR0 A;  1FMV A;  2XAS B;  5AFU L;  3RPU A;  1WLX A;  5EK4 A;  2V6X A;  3RF1 A;  3ZJ1 A;  2V26 A;  2JPF A;  4NIQ A;  4AQY T;  5JQG E;  3M3Z B;  1GQE A;  4IL4 A;  2XQ7 A;  4GK5 E;  2IIU A;  1MMD A;  4X5T A;  5JR9 B;  3ANW B;  5FL1 A;  1I94 T;  4ZI3 C;  3P4Q A;  3IF8 B;  2YU1 A;  4UV8 B;  1J5W A;  2YU2 A;  2W0G A;  4CXY A;  2CXF A;  5AQL B;  2XQ5 A;  3RHW A;  3JAE A;  1QLB A;  4GKJ T;  4EAH A;  5KX5 E;  1KK7 A;  4GYR A;  4IL9 A;  3MZK B;  2LRL A;  3I0Q A;  4P09 A;  2OLT A;  2X9Y A;  4H9R C;  4JI0 T;  2FBW A;  3C98 B;  5HXS A;  2W63 A;  2XAQ B;  1IBK T;  3ZPO A;  4DR5 T;  1M7K A;  5LGN B;  4PJN A;  5JR9 C;  2UXD T;  4U74 A;  2VKH A;  2BS3 A;  2UXN B;  3NWI A;  4KMC A;  1W9R A;  4DR2 T;  2XAH B;  2W4X A;  2UUC T;  2X9W A;  2UUA T;  3AA6 B;  2XAJ B;  2XQ9 A;  1XDP A;  4O4H E;  3UTK A;  4QWN B;  3Q2M A;  1UK5 A;  4P0B A;  5JDQ A;  5LHI B;  1OED B;  2J47 A;  3HKC E;  4ZHQ E;  3PTR B;  2I0M A;  1HNX T;  4HGA A;  2BZB A;  4YTN A;  2LEH A;  3KVB A;  4IIJ E;  4AQG A;  2WMN A;  4WBN E;  1SHZ C;  4OHF A;  2XQ3 A;  3DJB A;  5FNV E;  3FXD B;  4WYV A;  4PFP A;  4WNK A;  2WB5 A;  3P4S A;  4MBQ A;  3TLT A;  3A8Y C;  3ZC0 A;  3RIU A;  5LXT E;  1VOM A;  3AXJ B;  2DWG A;  4GK0 E;  4DV3 T;  2MAW A;  2PFV A;  4J2C A;  4OK0 A;  3RYH E;  3BQK A;  5JRE A;  4CXX A;  3ZST A;  4DR6 T;  2VVN A;  3LBX B;  3M65 A;  5DQW A;  3RYC E;  4IRE A;  2NTY A;  1OED C;  4UIG A;  3RH3 A;  3ONX A;  4JI1 T;  3AE1 A;  1KNR A;  3T8O A;  4TWH A;  1H7C A;  4OYK A;  1X9B A;  3TLW A;  4ILC A;  3UUN A;  3BQI A;  2E5L T;  3JC6 D;  1BR1 A;  4CXW A;  4B3M T;  1D0X A;  3A5X A;  1J5E T;  5L3E B;  4CQI A;  2YIN A;  3NVO A;  4HKA A;  2YK0 A;  3V5U A;  4IDQ A;  2BG9 E;  5LHG B;  3ZYL A;  2WAU A;  2WWV A;  5LG4 A;  1D1C A;  2V7J A;  4IE5 A;  3ZN0 B;  4DVD A;  5CA0 E;  4NUV A;  1UGO A;  4PJM A;  1WFD A;  2Q9Q D;  3Q5W A;  1T98 A;  4AQF A;  4AKH A;  1HNW T;  2NW7 A;  2DLR A;  5IYZ E;  3SRZ A;  3GN5 B;  4TWD A;  3LDQ B;  2VQE T;  1T72 A;  2I59 A;  5E0O A;  4DV5 T;  3FZH B;  2XM1 A;  3UT5 E;  1ZP0 A;  3WAK A;  4UF0 B;  2D9D A;  3QOF A;  1BR2 A;  1T8B A;  3FZM B;  2WZI A;  2VKJ A;  2JMK A;  4YTM A;  1IZN B;  4KX6 A;  1WCR A;  1YQ4 A;  3LK4 2;  5DJQ C;  4FJO A;  4YJ2 E;  2JQQ A;  2XY8 B;  3O1J A;  1MIV A;  4NUU A;  3OPC A;  2ZM2 A;  2YDR A;  5AQQ B;  4ILA A;  1B7T A;  2JQK A;  4A5X A;  2LSK A;  3LFM A;  3MAC A;  5LP6 E;  4I43 B;  3NRY A;  2KSR A;  3ZYM A;  4LFA T;  3I0O A;  2L3L A;  2Z6E A;  1UX4 A;  4ZI7 E;  5AQO B;  3OVU A;  3KV4 A;  3AE4 A;  3AEF A;  4AI6 A;  4QXH B;  3SFE A;  5L3B B;  3ZT7 A;  2QRX A;  5BR8 T;  3A7M A;  3EVY A;  4HWF A;  3UUL A;  3CX6 B;  5LBM A;  5ABG A;  2LSY A;  1KF6 A;  2LKH A;  2MOZ A;  4EOZ B;  1G8X A;  1UUR A;  5C3J A;  2X9X A;  5M4Y A;  2VUR A;  4KI0 F;  4QH1 A;  1YD8 G;  2XPK A;  2A72 A;  3RKO A;  2XQY A;  5ABF A;  4DID B;  1XZY A;  3QC9 A;  4JI4 T;  5FXZ A;  1KNP A;  3AE5 A;  5L3G B;  1D0Y A;  4JI7 T;  2KT9 A;  4X1K E;  4EB6 E;  4EZH A;  2LSJ A;  2WS3 A;  3RC3 A;  4QX7 B;  4LMJ A;  3R84 B;  4NPP A;  4TUY E;  3KFW X;  3JAF A;  3W15 B;  3P50 A;  4F8H A;  5JRC A;  4I0U A;  3ESL A;  1SUM B;  2MPK A;  5L4H A;  3FXE B;  2R6G F;  2N9D A;  3ZMT B;  2LHN A;  4WW0 A;  5A1L A;  4IE6 A;  3AEG A;  4B3T T;  5ABH A;  1NAF A;  1QSD A;  3TLS A;  3N9O A;  3WAJ A;  5LGU B;  2VK9 A;  4DR1 T;  3UQ7 A;  5LJN A;  2V5D A;  4O2A E;  1HX1 B;  2N2N A;  3OBV E;  2PBI A;  2XAF B;  1IBM T;  4C91 A;  2A9U A;  4JI3 T;  2KND A;  4H9O C;  5HEH A;  4LML A;  4YSX A;  3IEE A;  1LVF A;  4ADZ A;  3NZQ A;  3FZK B;  3N9P A;  4U31 A;  3ZMU B;  2DHR A;  1CUN A;  4ZS3 A;  1Y01 A;  2Q9Q A;  1N32 T;  4AQF C;  2Y48 B;  3PE0 A;  2PTF A;  2A3D A;  4QX8 B;  5L47 A;  2E9X D;  4JI6 T;  3AVR A;  5FXW A;  2WMO A;  2ZMA A;  3RQU A;  4A56 A;  3P8C D;  3K3O A;  3I9W A;  3F57 A;  5HEU A;  2ZM6 T;  3PUW F;  2KMF A;  1SA0 E;  4BA9 A;  2BVL A;  1YW0 A;  2E2A A;  3HA4 A;  2UXX B;  4MHC A;  4PJJ A;  3KV6 A;  2YKS A;  3NKZ A;  5IHY A;  2H3R A;  1MMA A;  4CI1 B;  5FXV A;  5HXR A;  2IML A;  3PJA A;  3FBL A;  2LE8 A;  4CN1 A;  1E2A A;  2RP4 A;  4XZC A;  4X20 E;  2B76 A;  2VL8 A;  3H3M A;  1XNQ T;  1T7S A; 
#chains in the Genus database with same CATH homology
 1HNZ T;  4DR4 T;  2HHH T;  2UUB T;  4DV1 T;  2UXB T;  4DV5 T;  4DV7 T;  4YY3 T;  4X64 T;  4DV3 T;  1IBM T;  4JI3 T;  4GKJ T;  1N36 T;  4YHH T;  4DV6 T;  4DR6 T;  4LF5 T;  4DV0 T;  5IWA T;  4B3R T;  4JI0 T;  4JI1 T;  1IBK T;  4DUY T;  4DR7 T;  4DR5 T;  4LFC T;  4X62 T;  3OTO T;  4LF4 T;  4JYA T;  1XNR T;  3T1Y T;  4KHP T;  2UXD T;  1N32 T;  4JI4 T;  2E5L T;  3T1H T;  4B3M T;  4JI6 T;  4JV5 T;  4DV2 T;  1J5E T;  1FJG T;  4DR2 T;  4NXN T;  4JI5 T;  1XMO T;  4JI7 T;  4B3S T;  2ZM6 T;  2UUC T;  4JI8 T;  2UUA T;  4LF8 T;  4AQY T;  4JI2 T;  2F4V T;  4X65 T;  1HR0 T;  2UXC T;  1IBL T;  4LF7 T;  4LFB T;  1HNX T;  2UU9 T;  4LFA T;  4K0K T;  4B3T T;  4DV4 T;  4GKK T;  1I94 T;  1N34 T;  4X66 T;  1HNW T;  1N33 T;  4LF9 T;  2VQF T;  4OX9 T;  1XMQ T;  5LMN T;  4NXM T;  5LMU T;  4DUZ T;  4LF6 T;  4DR3 T;  5BR8 T;  1XNQ T;  4DR1 T;  2VQE T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...