4DR2T

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dr2T00
2UUBT 3T1YT 4NXNT 4B3MT 4X65T 1HNWT 4DV0T 4DV2T 1N34T 4JI5T 1HNXT 4LF7T 4DUZT 4DR1T 4JI2T 4LF8T 2UUAT 4AQYT 4DR5T 4B3ST 1N32T 4JV5T 2ZM6T 4YHHT 1I94T 5IWAT 2UXBT 4JI8T 1FJGT 4GKKT 2UXDT 2HHHT 1J5ET 4K0KT 4YY3T 1IBKT 4KHPT 1HR0T 5LMNT 4DR2T 4LF5T 1XNQT 1XMOT 4LFAT 4GKJT 4JI1T 4DV5T 4JI6T 1N33T 4DV1T 4NXMT 4JYAT 2UXCT 4DR6T 4LF6T 4X64T 2VQFT 4B3TT 1HNZT 2E5LT 4B3RT 1XNRT 4LFBT 3OTOT 4JI0T 2VQET 4DR3T 4DR4T 4DV6T 2UUCT 4X66T 1IBMT 4DV3T 4DV4T 1XMQT 4JI4T 4LF4T 4JI7T 1IBLT 2UU9T 4DR7T 4JI3T 4X62T 5LMUT 3T1HT 1N36T 5BR8T 4OX9T 4LFCT 4LF9T 4DUYT 4DV7T 2F4VT
chains in the Genus database with same CATH superfamily
1SE7A 3DTOA 3TLWA 4QH5A 3I0QA 2G0UA 2IDOB 2ZM0A 5H6RB 5L3DB 1D0XA 4J2CA 4U31A 4O2BE 2KT9A 3BK9A 3MZKB 4UEMA 2X51A 2L9QA 2Y8DA 3ANWB 4CI1B 2NW7A 4YY3T 3ZN1B 4WYVA 3AE1A 2CHOA 5E0OA 1MMNA 5HEUA 3Q9DA 3UUNA 2Q9QD 2CCQA 3P8CD 3C4WA 3N9PA 4GIWA 4JYAT 2C5IT 2LSYA 2YU1A 3P4RA 2KMFA 2PTFA 1ZP0A 5JDGA 4U33A 3AEFA 5JR9A 2LEHA 3VR9A 4IDZA 3OKQA 1HFAA 2V7KA 4QXCB 1EZ3A 1IBMT 5LXTE 2J4GA 5LGUB 4IE4A 3LSVA 4ZI2C 3GA8A 4CXWA 4HGAA 3RIUC 2XJ7A 1MMAA 4ASKA 2UUBT 3EUHA 5L3CB 3FXEB 1N34T 3ZSTA 2EHOD 4DUZT 2C0SA 3PUQA 1UX4A 4TNVA 2ACXA 5F5WA 1MNEA 3I9YA 4UXNB 3NVOA 2HPLA 4PW8A 4GYSA 4AKIA 4YXDA 3HI2A 2CXDA 1UUSA 1I94T 2L8KA 3ZEFB 4K0UA 1WYBA 5JDLA 4KMCA 1HR0T 5HYAA 4H9PC 3Q5DA 3QC9A 2XPKA 3E08A 1LVKA 2Q9QA 2YKSA 4QXHB 1Y64B 2WM9A 5LYJE 3FBLA 2HPJA 2V6XA 5JDFA 4L5GA 1M7KA 4AKHA 2CLYC 2B1EA 3AE8A 2WSSV 3IHRA 1US7B 2Q9QB 4X1YE 3N9QA 4DVDA 3EABA 2BVLA 2MYSA 1Z8UA 1HF8A 5HEOA 3ZMTB 3ZMVB 3PV0F 3C50A 4F6RC 2XAJB 3P7IA 3IEEA 3SFDA 2H88A 1KNZA 3CQCB 1I6ZA 2I59A 1W0BA 3N9LA 3ZT7A 2LSGA 4YTPA 2WZHA 5CGMA 3CMLA 5L3FB 4O2AE 4EZHA 4YSZA 4CN1A 2FUPA 5IWAT 1FJGT 2W0GA 1IBKT 4BJMA 2WS3A 2GK9A 5AQJB 2XQYA 3H37A 4WBOA 2LLYA 2OA5A 3P4QA 3ZYMA 4PK6A 2WCAA 3O1JA 4PFPA 4Z8XA 2CWYA 3RYFE 3I0OA 4ISSA 2PFVA 1YW0A 5AQIB 3KV9A 5L3GB 1T72A 3K3NA 5CA1E 2YDQA 1HCIA 3NZQA 1E1HB 4I43B 4IDQA 3QOFA 3ZCIA 2BG9E 4JI7T 4ZI3D 2BVMA 4TWHA 2D0TA 3FZMB 4YFSA 3MK7C 1UCUA 4UF0A 4UELA 4HFDA 5FL1A 4Z90A 3V5UA 2E8IA 1HNWT 2VVSA 3AXJA 1CUNA 5FVLA 4LMKA 5FKYA 3VR8A 5LGNB 3AEEA 1WFDA 2YOEA 2M6IA 1OEDE 3PUVF 2XQ9A 2V5DA 3RC3A 2NOXA 2VKHA 4UF0B 3WI3A 3RPUA 3N9NA 2CBJA 2D0UA 4DR2T 3AXJB 2IC6A 4B6XA 3KBTA 4O8SA 3KVAA 4LMLA 2J62A 2WWVA 2D5UA 1N33T 4NPPA 2MPKA 3GN5A 4HEAA 2KNDA 3Q2MA 1MMDA 2XQ4A 4AKRB 3U3IA 1OXZA 3S4UA 2VKJA 3MACA 2VQET 2BZBA 4X5TA 3JC6D 4OFZA 5AFUL 3CIRA 2WDRA 2XTLA 2WDQA 1XWMA 1OWAA 3RH3A 3FXDB 2VK9A 3UT5E 3BQLA 3GN5B 3N9OA 1S35A 3LJCA 1VOMA 2VVNA 4U72A 5AQMB 1BR1A 2BDEA 1MNDA 4YJ2E 4DUYT 4IE5A 4XBFB 2LSKA 4ZOLE 2ODUA 3B57A 5HXSA 4H9RC 2ZM8A 3B5MA 3UUMA 2NW8A 2UUAT 4YLHA 3OYZA 3AB3B 1XDOA 4ADZA 2D2SA 5FVKA 4YHHT 2HHHT 4K0KT 5AQVB 5L4HA 2XZEA 3AAEB 3RYHE 4QX8B 2K48A 1YD8G 3CKDA 3R6NA 4DV5T 4A98A 1O3XA 2KLQA 3RC8A 4DV1T 5ABHA 4IGUA 3HL6A 5TAOA 4DO0A 2YU2A 2XAQB 5C8YE 4B3RT 4DNDA 4EEDA 2WMNA 2X9YA 3FBZA 3ESLA 3KINB 4IDOA 1T7SA 4NUVA 3NRYA 3CX6B 3J7Yq 5L47A 3FHNA 4Q25A 3ZCJA 5FXWA 4IL9A 4A56A 1QSDA 5ADXL 3SOLA 3T1HT 2YK0A 5BR8T 4COFA 2LM9A 2NWBA 4OHFA 3OVUA 2HN2A 1ZEEA 1Z0PA 2F4VT 4PFOA 1FEWA 1U5PA 1IAPA 2BBHA 1KNPA 4HWHA 4EIWA 1BR2A 4P1NA 1NWMX 1KNRA 4IDNA 3CX8B 2DLRA 1ZV4X 3EVYA 2V26A 2W62A 2VKDA 5HXCA 4ZS2A 5AQPB 5AQLB 3ZMZB 2MTQA 5JTGA 2XUEA 2ODVA 4P0AA 4JI8T 4WNKA 1G73A 5LMNT 2JIWA 5FXZA 2PG8A 3AE7A 2WU2A 1WYCA 3JAEA 2ACZA 3A7MA 4KBMB 5EK3A 3QUJA 2WWUA 5CFBA 3RX6A 1VCTA 5DQWA 5FY0A 2XQ5A 4H9SE 4CI3B 1YKHB 5AQQB 5JREA 3PUSA 3EAMA 5FL0A 2LHRA 2X9WA 4TV8E 4UIGA 4YTNA 2JJ9A 3NRXA 3MKDA 5HXHA 3LK42 2YN6A 3RGLA 4JI0T 4N78D 2JQ9A 4DR4T 3K3QC 4QH4A 3RIAA 1KK7A 3LFMA 2W66A 5AQNB 2MBGA 2E9XD 1CHUA 1IBLT 3VKGA 2FJDA 3ZJ2A 4JI3T 1MIYA 2JMHA 4ZI2D 2OV9A 1NENA 4UV8B 5KMGP 4EYUA 2VKOA 1E2AA 4DV2T 4ZZBA 4WZXA 4H63V 1J1JA 1QLBA 4ZEYA 2N2NA 2QVAA 4AQFA 2VURA 4OK0A 3N9MA 3DP7A 5FY7A 3KDSE 5JR9B 2HH7A 2XQ3A 5LHGB 3KBUA 5JQGE 2CHNA 2X67A 4NIQA 3LBXA 4I4TE 1XZYA 1XNQT 2XAHB 2CM0A 3SFEA 4JBWF 3UUBA 1BR0A 5CB4E 2W00A 4CXYA 2BBJA 2UXCT 4HWIB 4DR6T 3UFEA 5LOVE 3RI5A 5H6QB 1U4QA 4O4JE 5KXJA 5AQSB 3LBXB 3OTOT 4DMWA 3CQGB 5J1GA 3MXZA 1UURA 2EHOC 2V7JA 3PE0A 3FZKB 3AA1B 1HX1B 2ZM2A 2Y6XA 3GMIA 4YSYA 3PU8A 2X0YA 2E9XA 3IA3A 1ZHCA 5EK4A 4LFCT 4DV7T 4X1KE 2WU5A 2BKPA 5LBQB 3JAFA 1WCRA 3ONXA 4QHOA 4IDPA 1SHZC 4CN6A 3UU3A 5JDNA 3UQ7A 2E9XB 5AQHB 2W2UA 3P4SA 4GK5E 5HCMA 4L9IA 4P0BA 4BJNA 1X9BA 1HG2A 2V7IA 3N2GE 1IZNB 2M6BA 3X1DA 3F57A 2BS4A 4DIDB 2PBIA 3AE2A 2CPTA 3ZMSB 3VRAA 1SUMB 3PDYA 4PJJA 2LJLA 4JEUB 2W63A 4DBQA 3MJXA 4EAHA 3M3ZB 4V1Av 5L4EA 3A8YC 1FMWA 3AE4A 4CQIA 4UV9B 3C51A 3UU8A 2XSBA 1G8XA 2UUCT 4CI2B 5AQOB 4DV4T 4KX6A 1WR6A 3O1IA 3PURA 4X62T 3AE5A 1HX8A 3KV5A 2W61A 3UUXB 4TNWA 3RIFA 2HN1A 4CZZB 3VKHA 2CXFA 2XM1A 2CLYB 4C90A 3JADA 4PJMA 4X65T 1AJ3A 3SS1A 2DWKA 3Q5XA 2C5KT 5JDHA 4BAYB 2VB6A 2YINA 2N9DA 3IF8B 4HKAA 4YT0A 3Q5WA 4HFBA 2LM2A 4CXXA 4JEHB 2WP9A 2LRLA 5CJ5A 1T98A 5IHYA 4H9OC 2UXDT 2XQ7A 3ZT5A 3CX7B 4ERRA 1NAFA 3C64A 4KUMB 2LRKA 1W0AA 4LF5T 3ZPOA 3D0TA 5FMNA 3ZLIA 4GK0E 2QA7A 3FZLB 2CRBA 3QNUA 1JNZA 3HKBE 4U7YA 1UK5A 3UTKA 4OYKA 4IHJE 4HFIA 2BS3A 2UXNB 4B3TT 4TN7B 3AE6A 3E22E 2DL1A 1E7PA 2DI4A 2P9BA 3ONJA 1YQ3A 5AQRB 4TWDA 5KX5E 2QYWA 1R8IA 1IJ5A 1D1AA 2J47A 4ZZCA 3VU7H 3ZC0A 3AEAA 4JI4T 4LF4T 1VRBA 3L3PA 2L3LA 2XAGB 3CPZA 3AA7B 2WBLA 2M67A 2CE7A 2IW5B 5J0ZA 1YXRA 4IE6A 1N36T 2NTYA 4L0RA 2W67A 4HTEA 5FXXA 3QK6A 4G2AA 3HA4A 4AIUA 1FMVA 4EZ4A 3NKZA 4JI2T 3PJAJ 3I9WA 3PU3A 2VL0A 5ABEA 5LGTB 4QXBB 4AQYT 1XDPA 5AQKB 2ZMAA 4AKLA 3PJAA 1MIWA 3C4XA 2VL8A 4IL4A 3PUWF 2FBWA 2FJBA 2CBIA 2H89A 3HKEE 4IT4A 2LKHA 4AQGA 3JC6C 1YKEB 3TKLB 1H7CA 3L8RA 2W4XA 1YQ4A 4I0UA 2CWOA 3JCFA 3ZN0B 5HXEA 5HCJA 2JQQA 3A5XA 2E5LT 4LFBT 2WAUA 4FI5A 3EHZA 2X0HA 5FXVA 2YEVC 4IE0A 2I0MA 4ZHQE 3ETUA 3CQXC 4ILAA 2KWIB 4QX7B 4X66T 5M4YA 2WY2A 4DMVA 3BQIA 3AVSA 2XHEB 4PK5A 2ZLYA 3PUGA 5HAXA 4ISTA 5C3JA 3LK2B 4B3MT 2RP4A 4DV0T 1KF6A 4U7IA 5F8PA 2X9XA 3U78A 3O9XA 4PAGA 3PUXF 4IE7A 3PUZF 2D9DA 4MFRA 3PUAA 2XY8B 2BG9A 3K3OA 5FY1A 1M62A 4TWFA 5KDMC 2V7MA 3H3AA 4KP3C 3IBPA 4HFEA 2PJQA 3OBVE 4YHJA 4MALA 1WR0A 5JR9C 2VASA 4ILUA 3SWHA 2NR4A 3ZKRA 3KFWX 2BG9B 3QB5K 3L39A 3UU5A 3F31A 2RPAA 3T8OA 3M65A 2VWAA 4U2ZA 4CN4A 4A5XA 5IUXA 5LJMA 3N2KE 5HEJA 1OEDA 4DV6T 4U74A 4AQFC 1X79A 2JQKA 2J1DG 3MA9A 2B76A 5BMVE 3AAAB 2LKGA 4O4LE 5HEHA 3VRBA 5LMUT 1T8BA 1LVFA 2WDVA 4H9QC 3I1AA 4AISA 1W09A 3PUYF 3QB5A 4EYYR 2LHNA 2XASB 2CXLA 1OEDB 3E0ZA 3BQKA 2IC9A 5HWXA 4C91A 2CA5A 4IIJE 2XAFB 2AE9A 3V5SA 5CA0E 3AA0B 4YTMA 4PK4A 3UULA 2Q9QC 2DHRA 2I6HA 4HFHA 5LG3A 4XZCA 5JRCA 4E7SA 3RKGA 5LB7B 2E9XC 2R6GF 3UU6A 5LA6E 1HNZT 2E2AA 2V6YA 3ZYLA 4ILBA 4O4HE 2FJEA 4JLEA 3H3MA 4AXPA 5J2UE 5AQTB 1KFYA 4P09A 5FYMA 5JRCB 1WLXA 3RKOA 1QUUA 4TX5A 2X0LB 4DR7T 4GOUA 2NW9A 3OPCA 1D0YA 2V6YB 3HR0A 4MLKA 3AECA 4U3CA 3SRZA 4KI0F 1J5WA 3K8PC 3NBXX 4MBQA 4GYRA 4DR1T 2V8SV 3L09A 5A1LA 4EB6E 3AE3A 3OJAA 3NWIA 2LSIA 4I50E 5C2TA 4KHZF 4DR5T 5DJQC 5L3EB 3NZPA 3TLVA 4JV5T 3TLUA 2X66A 5IYZE 3RIUA 5F3JA 4QH1A 1W9RA 1Y01A 4HWFA 2JMKA 3LK3B 2FJAA 1L0VA 2YDSA 3AE9A 2IMLA 2KSRA 3RLFF 4NXMT 1D1BA 3J9X1 4LF6T 4X64T 2VQFT 1JNRA 1ZKEA 3EDVA 3Q5EA 1MIVA 2E5VA 2LOPA 1UX5A 3CK6A 5J2TE 2NP9A 2UU9T 2EHOA 3FZFB 4EXTA 2KZ7B 5LNKA 2ES0A 4OX9T 4LF9T 1LKXA 3O4XE 2XQAA 4PJLA 1ZOYA 1HTJF 5JDQA 4JUYA 4JI5T 3ABVA 4DBRA 4EEBA 3RF1A 3AA6B 3P4PA 4I55E 4ZI7E 4M1PA 5LBMA 1IJ6A 5EK2A 2EHOB 5DABA 4AI6A 3RQUA 4ILCA 4B3ST 2BKOA 2XQ8A 3ZYKA 3WAJA 1J5ET 3AVRA 1HG5A 5ABGA 3FB2A 4F8HA 4ANJA 1XMOT 2K5BB 2H3RA 4LFAT 3HKCE 2N1GA 4GKJT 3RRWA 2LT3A 2JQHA 4TZ4C 4JI1T 4YJ3E 2IAKA 5GONE 5JH7E 2QGSA 4HWCA 4PNIA 4XAXB 1XNRT 2DWGA 2IHR1 4LMJA 4Z91A 2XSAA 3W15B 3KV6A 2DCFA 4EGWA 4HN9A 5LCYA 2WZIA 2MAWA 2C5JA 2V7LA 4H63H 2OLTA 3EDUA 2LE8A 3VHLA 2A2FX 2CEAA 4QWNB 4ZI3C 2X68A 3LG7A 5FP3A 3TLSA 5AQGB 5AQFB 5LHHB 4PJNA 2H7OA 5LP6E 3AEDA 4HFVA 2WQYA 4UVBB 1NEKA 2LOSA 2V5CA 1HNXT 4BA9A 1B7TA 4UVCB 4LF8T 3ZJ1A 4TV9E 5HWYA 2YDRA 1HS7A 3ZT6A 1WRDA 3KVBA 1D1CA 2A9UA 4ZS3A 3EI0A 3UU4A 3RYIE 2NTXA 3O1HA 2ZM6T 2A72A 3B13A 3WAKA 4EOZB 4GKKT 4UVAB 2KXPB 2JRKA 2K9AA 2Y48B 1MMGA 4YSXA 3GWHA 5EZYE 4JI6T 3RRCA 1FIOA 2RA1A 3LDQB 4H9NC 2A3DA 2BS2A 3TLTA 4IREA 4O4IE 3RHWA 3C98B 3OYXA 5AQUB 4A97A 3ZC1A 4DR3T 2JPFA 4EV6A 2K3WA 3P50A 4G63A 3ZMUB 1XMQT 3AEBA 2KWHA 5LJNA 4TUYE 2LSJA 2DNXA 1DU2A 2BG9C 3T1YT 4NXNT 1D0ZA 2IUBA 1BR4A 3AEGA 2KINB 5HEGA 2X9HA 4LF7T 2WB5A 3HKDE 3ZSSA 5ETWA 3ETVA 2BKNA 3DJBA 3G06A 3K1SA 3CVRA 4X20E 4NUUA 2CMRA 3FZHB 1N32T 3RYCE 2UXBT 2Z6EA 4UR9A 3AAIA 1GQEA 1SA0E 3RQWA 1KEYA 4KHPT 4WW0A 5LG4A 3N5LA 2MOZA 5ABFA 4MHCA 1OEDC 5JVDE 5HXRA 2K24A 1V9DA 3CWZB 2UXXB 1S94A 4HWDA 4AKGA 2XM2A 3P4WA 4E7ZA 2QRXA 5FNVE 4QKNA 4WBNE 4ZXLA 4OYJA 5L2LA 3C4ZA 4FJOA 2SPCA 2V1DB 5JDMA 5ABFB 2IIUA 3UFGA 1LRZA 3N2OA 4HFCA 4DV3T 1UGOA 3ONLC 4HE8A 3F2EA 5DQVA 2H7VC 2XQ6A 3PTRB 4U2YA 3UQ4A 1VCSA 5L3BB 5LHIB 2AXDS 3KV4A 2WMOA 3R84B 3ANWA 4X1IE
chains in the Genus database with same CATH topology
2UUBT 3T1YT 4NXNT 4B3MT 4X65T 1HNWT 4DV0T 4DV2T 1N34T 4JI5T 1HNXT 4LF7T 4DUZT 4DR1T 4JI2T 4LF8T 2UUAT 4AQYT 4DR5T 4B3ST 1N32T 4JV5T 2ZM6T 4YHHT 1I94T 5IWAT 2UXBT 4JI8T 1FJGT 4GKKT 2UXDT 2HHHT 1J5ET 4K0KT 4YY3T 1IBKT 4KHPT 1HR0T 5LMNT 4DR2T 4LF5T 1XNQT 1XMOT 4LFAT 4GKJT 4JI1T 4DV5T 4JI6T 1N33T 4DV1T 4NXMT 4JYAT 2UXCT 4DR6T 4LF6T 4X64T 2VQFT 4B3TT 1HNZT 2E5LT 4B3RT 1XNRT 4LFBT 3OTOT 4JI0T 2VQET 4DR3T 4DR4T 4DV6T 2UUCT 4X66T 1IBMT 4DV3T 4DV4T 1XMQT 4JI4T 4LF4T 4JI7T 1IBLT 2UU9T 4DR7T 4JI3T 4X62T 5LMUT 3T1HT 1N36T 5BR8T 4OX9T 4LFCT 4LF9T 4DUYT 4DV7T 2F4VT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB T;  3T1Y T;  4NXN T;  4B3M T;  4X65 T;  1HNW T;  4DV0 T;  4DV2 T;  1N34 T;  4JI5 T;  1HNX T;  4LF7 T;  4DUZ T;  4DR1 T;  4JI2 T;  4LF8 T;  2UUA T;  4AQY T;  4DR5 T;  4B3S T;  1N32 T;  4JV5 T;  2ZM6 T;  4YHH T;  1I94 T;  5IWA T;  2UXB T;  4JI8 T;  1FJG T;  4GKK T;  2UXD T;  2HHH T;  1J5E T;  4K0K T;  4YY3 T;  1IBK T;  4KHP T;  1HR0 T;  5LMN T;  4DR2 T;  4LF5 T;  1XNQ T;  1XMO T;  4LFA T;  4GKJ T;  4JI1 T;  4DV5 T;  4JI6 T;  1N33 T;  4DV1 T;  4NXM T;  4JYA T;  2UXC T;  4DR6 T;  4LF6 T;  4X64 T;  2VQF T;  4B3T T;  1HNZ T;  2E5L T;  4B3R T;  1XNR T;  4LFB T;  3OTO T;  4JI0 T;  2VQE T;  4DR3 T;  4DR4 T;  4DV6 T;  2UUC T;  4X66 T;  1IBM T;  4DV3 T;  4DV4 T;  1XMQ T;  4JI4 T;  4LF4 T;  4JI7 T;  1IBL T;  2UU9 T;  4DR7 T;  4JI3 T;  4X62 T;  5LMU T;  3T1H T;  1N36 T;  5BR8 T;  4OX9 T;  4LFC T;  4LF9 T;  4DUY T;  4DV7 T;  2F4V T; 
#chains in the Genus database with same CATH topology
 1SE7 A;  3DTO A;  3TLW A;  4QH5 A;  3I0Q A;  2G0U A;  2IDO B;  2ZM0 A;  5H6R B;  5L3D B;  1D0X A;  4J2C A;  4U31 A;  4O2B E;  2KT9 A;  3BK9 A;  3MZK B;  4UEM A;  2X51 A;  2L9Q A;  2Y8D A;  3ANW B;  4CI1 B;  2NW7 A;  4YY3 T;  3ZN1 B;  4WYV A;  3AE1 A;  2CHO A;  5E0O A;  1MMN A;  5HEU A;  3Q9D A;  3UUN A;  2Q9Q D;  2CCQ A;  3P8C D;  3C4W A;  3N9P A;  4GIW A;  4JYA T;  2C5I T;  2LSY A;  2YU1 A;  3P4R A;  2KMF A;  2PTF A;  1ZP0 A;  5JDG A;  4U33 A;  3AEF A;  5JR9 A;  2LEH A;  3VR9 A;  4IDZ A;  3OKQ A;  1HFA A;  2V7K A;  4QXC B;  1EZ3 A;  1IBM T;  5LXT E;  2J4G A;  5LGU B;  4IE4 A;  3LSV A;  4ZI2 C;  3GA8 A;  4CXW A;  4HGA A;  3RIU C;  2XJ7 A;  1MMA A;  4ASK A;  2UUB T;  3EUH A;  5L3C B;  3FXE B;  1N34 T;  3ZST A;  2EHO D;  4DUZ T;  2C0S A;  3PUQ A;  1UX4 A;  4TNV A;  2ACX A;  5F5W A;  1MNE A;  3I9Y A;  4UXN B;  3NVO A;  2HPL A;  4PW8 A;  4GYS A;  4AKI A;  4YXD A;  3HI2 A;  2CXD A;  1UUS A;  1I94 T;  2L8K A;  3ZEF B;  4K0U A;  1WYB A;  5JDL A;  4KMC A;  1HR0 T;  5HYA A;  4H9P C;  3Q5D A;  3QC9 A;  2XPK A;  3E08 A;  1LVK A;  2Q9Q A;  2YKS A;  4QXH B;  1Y64 B;  2WM9 A;  5LYJ E;  3FBL A;  2HPJ A;  2V6X A;  5JDF A;  4L5G A;  1M7K A;  4AKH A;  2CLY C;  2B1E A;  3AE8 A;  2WSS V;  3IHR A;  1US7 B;  2Q9Q B;  4X1Y E;  3N9Q A;  4DVD A;  3EAB A;  2BVL A;  2MYS A;  1Z8U A;  1HF8 A;  5HEO A;  3ZMT B;  3ZMV B;  3PV0 F;  3C50 A;  4F6R C;  2XAJ B;  3P7I A;  3IEE A;  3SFD A;  2H88 A;  1KNZ A;  3CQC B;  1I6Z A;  2I59 A;  1W0B A;  3N9L A;  3ZT7 A;  2LSG A;  4YTP A;  2WZH A;  5CGM A;  3CML A;  5L3F B;  4O2A E;  4EZH A;  4YSZ A;  4CN1 A;  2FUP A;  5IWA T;  1FJG T;  2W0G A;  1IBK T;  4BJM A;  2WS3 A;  2GK9 A;  5AQJ B;  2XQY A;  3H37 A;  4WBO A;  2LLY A;  2OA5 A;  3P4Q A;  3ZYM A;  4PK6 A;  2WCA A;  3O1J A;  4PFP A;  4Z8X A;  2CWY A;  3RYF E;  3I0O A;  4ISS A;  2PFV A;  1YW0 A;  5AQI B;  3KV9 A;  5L3G B;  1T72 A;  3K3N A;  5CA1 E;  2YDQ A;  1HCI A;  3NZQ A;  1E1H B;  4I43 B;  4IDQ A;  3QOF A;  3ZCI A;  2BG9 E;  4JI7 T;  4ZI3 D;  2BVM A;  4TWH A;  2D0T A;  3FZM B;  4YFS A;  3MK7 C;  1UCU A;  4UF0 A;  4UEL A;  4HFD A;  5FL1 A;  4Z90 A;  3V5U A;  2E8I A;  1HNW T;  2VVS A;  3AXJ A;  1CUN A;  5FVL A;  4LMK A;  5FKY A;  3VR8 A;  5LGN B;  3AEE A;  1WFD A;  2YOE A;  2M6I A;  1OED E;  3PUV F;  2XQ9 A;  2V5D A;  3RC3 A;  2NOX A;  2VKH A;  4UF0 B;  3WI3 A;  3RPU A;  3N9N A;  2CBJ A;  2D0U A;  4DR2 T;  3AXJ B;  2IC6 A;  4B6X A;  3KBT A;  4O8S A;  3KVA A;  4LML A;  2J62 A;  2WWV A;  2D5U A;  1N33 T;  4NPP A;  2MPK A;  3GN5 A;  4HEA A;  2KND A;  3Q2M A;  1MMD A;  2XQ4 A;  4AKR B;  3U3I A;  1OXZ A;  3S4U A;  2VKJ A;  3MAC A;  2VQE T;  2BZB A;  4X5T A;  3JC6 D;  4OFZ A;  5AFU L;  3CIR A;  2WDR A;  2XTL A;  2WDQ A;  1XWM A;  1OWA A;  3RH3 A;  3FXD B;  2VK9 A;  3UT5 E;  3BQL A;  3GN5 B;  3N9O A;  1S35 A;  3LJC A;  1VOM A;  2VVN A;  4U72 A;  5AQM B;  1BR1 A;  2BDE A;  1MND A;  4YJ2 E;  4DUY T;  4IE5 A;  4XBF B;  2LSK A;  4ZOL E;  2ODU A;  3B57 A;  5HXS A;  4H9R C;  2ZM8 A;  3B5M A;  3UUM A;  2NW8 A;  2UUA T;  4YLH A;  3OYZ A;  3AB3 B;  1XDO A;  4ADZ A;  2D2S A;  5FVK A;  4YHH T;  2HHH T;  4K0K T;  5AQV B;  5L4H A;  2XZE A;  3AAE B;  3RYH E;  4QX8 B;  2K48 A;  1YD8 G;  3CKD A;  3R6N A;  4DV5 T;  4A98 A;  1O3X A;  2KLQ A;  3RC8 A;  4DV1 T;  5ABH A;  4IGU A;  3HL6 A;  5TAO A;  4DO0 A;  2YU2 A;  2XAQ B;  5C8Y E;  4B3R T;  4DND A;  4EED A;  2WMN A;  2X9Y A;  3FBZ A;  3ESL A;  3KIN B;  4IDO A;  1T7S A;  4NUV A;  3NRY A;  3CX6 B;  3J7Y q;  5L47 A;  3FHN A;  4Q25 A;  3ZCJ A;  5FXW A;  4IL9 A;  4A56 A;  1QSD A;  5ADX L;  3SOL A;  3T1H T;  2YK0 A;  5BR8 T;  4COF A;  2LM9 A;  2NWB A;  4OHF A;  3OVU A;  2HN2 A;  1ZEE A;  1Z0P A;  2F4V T;  4PFO A;  1FEW A;  1U5P A;  1IAP A;  2BBH A;  1KNP A;  4HWH A;  4EIW A;  1BR2 A;  4P1N A;  1NWM X;  1KNR A;  4IDN A;  3CX8 B;  2DLR A;  1ZV4 X;  3EVY A;  2V26 A;  2W62 A;  2VKD A;  5HXC A;  4ZS2 A;  5AQP B;  5AQL B;  3ZMZ B;  2MTQ A;  5JTG A;  2XUE A;  2ODV A;  4P0A A;  4JI8 T;  4WNK A;  1G73 A;  5LMN T;  2JIW A;  5FXZ A;  2PG8 A;  3AE7 A;  2WU2 A;  1WYC A;  3JAE A;  2ACZ A;  3A7M A;  4KBM B;  5EK3 A;  3QUJ A;  2WWU A;  5CFB A;  3RX6 A;  1VCT A;  5DQW A;  5FY0 A;  2XQ5 A;  4H9S E;  4CI3 B;  1YKH B;  5AQQ B;  5JRE A;  3PUS A;  3EAM A;  5FL0 A;  2LHR A;  2X9W A;  4TV8 E;  4UIG A;  4YTN A;  2JJ9 A;  3NRX A;  3MKD A;  5HXH A;  3LK4 2;  2YN6 A;  3RGL A;  4JI0 T;  4N78 D;  2JQ9 A;  4DR4 T;  3K3Q C;  4QH4 A;  3RIA A;  1KK7 A;  3LFM A;  2W66 A;  5AQN B;  2MBG A;  2E9X D;  1CHU A;  1IBL T;  3VKG A;  2FJD A;  3ZJ2 A;  4JI3 T;  1MIY A;  2JMH A;  4ZI2 D;  2OV9 A;  1NEN A;  4UV8 B;  5KMG P;  4EYU A;  2VKO A;  1E2A A;  4DV2 T;  4ZZB A;  4WZX A;  4H63 V;  1J1J A;  1QLB A;  4ZEY A;  2N2N A;  2QVA A;  4AQF A;  2VUR A;  4OK0 A;  3N9M A;  3DP7 A;  5FY7 A;  3KDS E;  5JR9 B;  2HH7 A;  2XQ3 A;  5LHG B;  3KBU A;  5JQG E;  2CHN A;  2X67 A;  4NIQ A;  3LBX A;  4I4T E;  1XZY A;  1XNQ T;  2XAH B;  2CM0 A;  3SFE A;  4JBW F;  3UUB A;  1BR0 A;  5CB4 E;  2W00 A;  4CXY A;  2BBJ A;  2UXC T;  4HWI B;  4DR6 T;  3UFE A;  5LOV E;  3RI5 A;  5H6Q B;  1U4Q A;  4O4J E;  5KXJ A;  5AQS B;  3LBX B;  3OTO T;  4DMW A;  3CQG B;  5J1G A;  3MXZ A;  1UUR A;  2EHO C;  2V7J A;  3PE0 A;  3FZK B;  3AA1 B;  1HX1 B;  2ZM2 A;  2Y6X A;  3GMI A;  4YSY A;  3PU8 A;  2X0Y A;  2E9X A;  3IA3 A;  1ZHC A;  5EK4 A;  4LFC T;  4DV7 T;  4X1K E;  2WU5 A;  2BKP A;  5LBQ B;  3JAF A;  1WCR A;  3ONX A;  4QHO A;  4IDP A;  1SHZ C;  4CN6 A;  3UU3 A;  5JDN A;  3UQ7 A;  2E9X B;  5AQH B;  2W2U A;  3P4S A;  4GK5 E;  5HCM A;  4L9I A;  4P0B A;  4BJN A;  1X9B A;  1HG2 A;  2V7I A;  3N2G E;  1IZN B;  2M6B A;  3X1D A;  3F57 A;  2BS4 A;  4DID B;  2PBI A;  3AE2 A;  2CPT A;  3ZMS B;  3VRA A;  1SUM B;  3PDY A;  4PJJ A;  2LJL A;  4JEU B;  2W63 A;  4DBQ A;  3MJX A;  4EAH A;  3M3Z B;  4V1A v;  5L4E A;  3A8Y C;  1FMW A;  3AE4 A;  4CQI A;  4UV9 B;  3C51 A;  3UU8 A;  2XSB A;  1G8X A;  2UUC T;  4CI2 B;  5AQO B;  4DV4 T;  4KX6 A;  1WR6 A;  3O1I A;  3PUR A;  4X62 T;  3AE5 A;  1HX8 A;  3KV5 A;  2W61 A;  3UUX B;  4TNW A;  3RIF A;  2HN1 A;  4CZZ B;  3VKH A;  2CXF A;  2XM1 A;  2CLY B;  4C90 A;  3JAD A;  4PJM A;  4X65 T;  1AJ3 A;  3SS1 A;  2DWK A;  3Q5X A;  2C5K T;  5JDH A;  4BAY B;  2VB6 A;  2YIN A;  2N9D A;  3IF8 B;  4HKA A;  4YT0 A;  3Q5W A;  4HFB A;  2LM2 A;  4CXX A;  4JEH B;  2WP9 A;  2LRL A;  5CJ5 A;  1T98 A;  5IHY A;  4H9O C;  2UXD T;  2XQ7 A;  3ZT5 A;  3CX7 B;  4ERR A;  1NAF A;  3C64 A;  4KUM B;  2LRK A;  1W0A A;  4LF5 T;  3ZPO A;  3D0T A;  5FMN A;  3ZLI A;  4GK0 E;  2QA7 A;  3FZL B;  2CRB A;  3QNU A;  1JNZ A;  3HKB E;  4U7Y A;  1UK5 A;  3UTK A;  4OYK A;  4IHJ E;  4HFI A;  2BS3 A;  2UXN B;  4B3T T;  4TN7 B;  3AE6 A;  3E22 E;  2DL1 A;  1E7P A;  2DI4 A;  2P9B A;  3ONJ A;  1YQ3 A;  5AQR B;  4TWD A;  5KX5 E;  2QYW A;  1R8I A;  1IJ5 A;  1D1A A;  2J47 A;  4ZZC A;  3VU7 H;  3ZC0 A;  3AEA A;  4JI4 T;  4LF4 T;  1VRB A;  3L3P A;  2L3L A;  2XAG B;  3CPZ A;  3AA7 B;  2WBL A;  2M67 A;  2CE7 A;  2IW5 B;  5J0Z A;  1YXR A;  4IE6 A;  1N36 T;  2NTY A;  4L0R A;  2W67 A;  4HTE A;  5FXX A;  3QK6 A;  4G2A A;  3HA4 A;  4AIU A;  1FMV A;  4EZ4 A;  3NKZ A;  4JI2 T;  3PJA J;  3I9W A;  3PU3 A;  2VL0 A;  5ABE A;  5LGT B;  4QXB B;  4AQY T;  1XDP A;  5AQK B;  2ZMA A;  4AKL A;  3PJA A;  1MIW A;  3C4X A;  2VL8 A;  4IL4 A;  3PUW F;  2FBW A;  2FJB A;  2CBI A;  2H89 A;  3HKE E;  4IT4 A;  2LKH A;  4AQG A;  3JC6 C;  1YKE B;  3TKL B;  1H7C A;  3L8R A;  2W4X A;  1YQ4 A;  4I0U A;  2CWO A;  3JCF A;  3ZN0 B;  5HXE A;  5HCJ A;  2JQQ A;  3A5X A;  2E5L T;  4LFB T;  2WAU A;  4FI5 A;  3EHZ A;  2X0H A;  5FXV A;  2YEV C;  4IE0 A;  2I0M A;  4ZHQ E;  3ETU A;  3CQX C;  4ILA A;  2KWI B;  4QX7 B;  4X66 T;  5M4Y A;  2WY2 A;  4DMV A;  3BQI A;  3AVS A;  2XHE B;  4PK5 A;  2ZLY A;  3PUG A;  5HAX A;  4IST A;  5C3J A;  3LK2 B;  4B3M T;  2RP4 A;  4DV0 T;  1KF6 A;  4U7I A;  5F8P A;  2X9X A;  3U78 A;  3O9X A;  4PAG A;  3PUX F;  4IE7 A;  3PUZ F;  2D9D A;  4MFR A;  3PUA A;  2XY8 B;  2BG9 A;  3K3O A;  5FY1 A;  1M62 A;  4TWF A;  5KDM C;  2V7M A;  3H3A A;  4KP3 C;  3IBP A;  4HFE A;  2PJQ A;  3OBV E;  4YHJ A;  4MAL A;  1WR0 A;  5JR9 C;  2VAS A;  4ILU A;  3SWH A;  2NR4 A;  3ZKR A;  3KFW X;  2BG9 B;  3QB5 K;  3L39 A;  3UU5 A;  3F31 A;  2RPA A;  3T8O A;  3M65 A;  2VWA A;  4U2Z A;  4CN4 A;  4A5X A;  5IUX A;  5LJM A;  3N2K E;  5HEJ A;  1OED A;  4DV6 T;  4U74 A;  4AQF C;  1X79 A;  2JQK A;  2J1D G;  3MA9 A;  2B76 A;  5BMV E;  3AAA B;  2LKG A;  4O4L E;  5HEH A;  3VRB A;  5LMU T;  1T8B A;  1LVF A;  2WDV A;  4H9Q C;  3I1A A;  4AIS A;  1W09 A;  3PUY F;  3QB5 A;  4EYY R;  2LHN A;  2XAS B;  2CXL A;  1OED B;  3E0Z A;  3BQK A;  2IC9 A;  5HWX A;  4C91 A;  2CA5 A;  4IIJ E;  2XAF B;  2AE9 A;  3V5S A;  5CA0 E;  3AA0 B;  4YTM A;  4PK4 A;  3UUL A;  2Q9Q C;  2DHR A;  2I6H A;  4HFH A;  5LG3 A;  4XZC A;  5JRC A;  4E7S A;  3RKG A;  5LB7 B;  2E9X C;  2R6G F;  3UU6 A;  5LA6 E;  1HNZ T;  2E2A A;  2V6Y A;  3ZYL A;  4ILB A;  4O4H E;  2FJE A;  4JLE A;  3H3M A;  4AXP A;  5J2U E;  5AQT B;  1KFY A;  4P09 A;  5FYM A;  5JRC B;  1WLX A;  3RKO A;  1QUU A;  4TX5 A;  2X0L B;  4DR7 T;  4GOU A;  2NW9 A;  3OPC A;  1D0Y A;  2V6Y B;  3HR0 A;  4MLK A;  3AEC A;  4U3C A;  3SRZ A;  4KI0 F;  1J5W A;  3K8P C;  3NBX X;  4MBQ A;  4GYR A;  4DR1 T;  2V8S V;  3L09 A;  5A1L A;  4EB6 E;  3AE3 A;  3OJA A;  3NWI A;  2LSI A;  4I50 E;  5C2T A;  4KHZ F;  4DR5 T;  5DJQ C;  5L3E B;  3NZP A;  3TLV A;  4JV5 T;  3TLU A;  2X66 A;  5IYZ E;  3RIU A;  5F3J A;  4QH1 A;  1W9R A;  1Y01 A;  4HWF A;  2JMK A;  3LK3 B;  2FJA A;  1L0V A;  2YDS A;  3AE9 A;  2IML A;  2KSR A;  3RLF F;  4NXM T;  1D1B A;  3J9X 1;  4LF6 T;  4X64 T;  2VQF T;  1JNR A;  1ZKE A;  3EDV A;  3Q5E A;  1MIV A;  2E5V A;  2LOP A;  1UX5 A;  3CK6 A;  5J2T E;  2NP9 A;  2UU9 T;  2EHO A;  3FZF B;  4EXT A;  2KZ7 B;  5LNK A;  2ES0 A;  4OX9 T;  4LF9 T;  1LKX A;  3O4X E;  2XQA A;  4PJL A;  1ZOY A;  1HTJ F;  5JDQ A;  4JUY A;  4JI5 T;  3ABV A;  4DBR A;  4EEB A;  3RF1 A;  3AA6 B;  3P4P A;  4I55 E;  4ZI7 E;  4M1P A;  5LBM A;  1IJ6 A;  5EK2 A;  2EHO B;  5DAB A;  4AI6 A;  3RQU A;  4ILC A;  4B3S T;  2BKO A;  2XQ8 A;  3ZYK A;  3WAJ A;  1J5E T;  3AVR A;  1HG5 A;  5ABG A;  3FB2 A;  4F8H A;  4ANJ A;  1XMO T;  2K5B B;  2H3R A;  4LFA T;  3HKC E;  2N1G A;  4GKJ T;  3RRW A;  2LT3 A;  2JQH A;  4TZ4 C;  4JI1 T;  4YJ3 E;  2IAK A;  5GON E;  5JH7 E;  2QGS A;  4HWC A;  4PNI A;  4XAX B;  1XNR T;  2DWG A;  2IHR 1;  4LMJ A;  4Z91 A;  2XSA A;  3W15 B;  3KV6 A;  2DCF A;  4EGW A;  4HN9 A;  5LCY A;  2WZI A;  2MAW A;  2C5J A;  2V7L A;  4H63 H;  2OLT A;  3EDU A;  2LE8 A;  3VHL A;  2A2F X;  2CEA A;  4QWN B;  4ZI3 C;  2X68 A;  3LG7 A;  5FP3 A;  3TLS A;  5AQG B;  5AQF B;  5LHH B;  4PJN A;  2H7O A;  5LP6 E;  3AED A;  4HFV A;  2WQY A;  4UVB B;  1NEK A;  2LOS A;  2V5C A;  1HNX T;  4BA9 A;  1B7T A;  4UVC B;  4LF8 T;  3ZJ1 A;  4TV9 E;  5HWY A;  2YDR A;  1HS7 A;  3ZT6 A;  1WRD A;  3KVB A;  1D1C A;  2A9U A;  4ZS3 A;  3EI0 A;  3UU4 A;  3RYI E;  2NTX A;  3O1H A;  2ZM6 T;  2A72 A;  3B13 A;  3WAK A;  4EOZ B;  4GKK T;  4UVA B;  2KXP B;  2JRK A;  2K9A A;  2Y48 B;  1MMG A;  4YSX A;  3GWH A;  5EZY E;  4JI6 T;  3RRC A;  1FIO A;  2RA1 A;  3LDQ B;  4H9N C;  2A3D A;  2BS2 A;  3TLT A;  4IRE A;  4O4I E;  3RHW A;  3C98 B;  3OYX A;  5AQU B;  4A97 A;  3ZC1 A;  4DR3 T;  2JPF A;  4EV6 A;  2K3W A;  3P50 A;  4G63 A;  3ZMU B;  1XMQ T;  3AEB A;  2KWH A;  5LJN A;  4TUY E;  2LSJ A;  2DNX A;  1DU2 A;  2BG9 C;  3T1Y T;  4NXN T;  1D0Z A;  2IUB A;  1BR4 A;  3AEG A;  2KIN B;  5HEG A;  2X9H A;  4LF7 T;  2WB5 A;  3HKD E;  3ZSS A;  5ETW A;  3ETV A;  2BKN A;  3DJB A;  3G06 A;  3K1S A;  3CVR A;  4X20 E;  4NUU A;  2CMR A;  3FZH B;  1N32 T;  3RYC E;  2UXB T;  2Z6E A;  4UR9 A;  3AAI A;  1GQE A;  1SA0 E;  3RQW A;  1KEY A;  4KHP T;  4WW0 A;  5LG4 A;  3N5L A;  2MOZ A;  5ABF A;  4MHC A;  1OED C;  5JVD E;  5HXR A;  2K24 A;  1V9D A;  3CWZ B;  2UXX B;  1S94 A;  4HWD A;  4AKG A;  2XM2 A;  3P4W A;  4E7Z A;  2QRX A;  5FNV E;  4QKN A;  4WBN E;  4ZXL A;  4OYJ A;  5L2L A;  3C4Z A;  4FJO A;  2SPC A;  2V1D B;  5JDM A;  5ABF B;  2IIU A;  3UFG A;  1LRZ A;  3N2O A;  4HFC A;  4DV3 T;  1UGO A;  3ONL C;  4HE8 A;  3F2E A;  5DQV A;  2H7V C;  2XQ6 A;  3PTR B;  4U2Y A;  3UQ4 A;  1VCS A;  5L3B B;  5LHI B;  2AXD S;  3KV4 A;  2WMO A;  3R84 B;  3ANW A;  4X1I E; 
#chains in the Genus database with same CATH homology
 2UUB T;  3T1Y T;  4NXN T;  4B3M T;  4X65 T;  1HNW T;  4DV0 T;  4DV2 T;  1N34 T;  4JI5 T;  1HNX T;  4LF7 T;  4DUZ T;  4DR1 T;  4JI2 T;  4LF8 T;  2UUA T;  4AQY T;  4DR5 T;  4B3S T;  1N32 T;  4JV5 T;  2ZM6 T;  4YHH T;  1I94 T;  5IWA T;  2UXB T;  4JI8 T;  1FJG T;  4GKK T;  2UXD T;  2HHH T;  1J5E T;  4K0K T;  4YY3 T;  1IBK T;  4KHP T;  1HR0 T;  5LMN T;  4DR2 T;  4LF5 T;  1XNQ T;  1XMO T;  4LFA T;  4GKJ T;  4JI1 T;  4DV5 T;  4JI6 T;  1N33 T;  4DV1 T;  4NXM T;  4JYA T;  2UXC T;  4DR6 T;  4LF6 T;  4X64 T;  2VQF T;  4B3T T;  1HNZ T;  2E5L T;  4B3R T;  1XNR T;  4LFB T;  3OTO T;  4JI0 T;  2VQE T;  4DR3 T;  4DR4 T;  4DV6 T;  2UUC T;  4X66 T;  1IBM T;  4DV3 T;  4DV4 T;  1XMQ T;  4JI4 T;  4LF4 T;  4JI7 T;  1IBL T;  2UU9 T;  4DR7 T;  4JI3 T;  4X62 T;  5LMU T;  3T1H T;  1N36 T;  5BR8 T;  4OX9 T;  4LFC T;  4LF9 T;  4DUY T;  4DV7 T;  2F4V T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...