2VWAA

Crystal structure of a sporozoite protein essential for liver stage development of malaria parasite
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
NKINLNKPIIENKNNVDVSIKRYNNFVDIARLSIQKHFEHLSNDQKDSHVNNMEYMQKFVQGLQENRNISLSKYQENKAVMDLKYHLQKVYANYLSQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN PF13_0012
publication title Crystal Structure of Soluble Domain of Malaria Sporozoite Protein Uis3 in Complex with Lipid.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 39
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11567 PfUIS3 Plasmodium falciparum UIS3 membrane protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1330 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vwaA00
2VWAA
chains in the Genus database with same CATH superfamily
4HN9A 2UUCT 4TWFA 2MBGA 4TN7B 4YFSA 3UU6A 4GK0E 2UUBT 2LT3A 4IHJE 2N2NA 3OPCA 4IDOA 2KWHA 2H7OA 1HG5A 3BQKA 3K3QC 1OEDB 4AKLA 5JR9B 3F57A 3RYHE 2JMKA 4V1Av 2K9AA 3NZPA 2C5IT 4DR7T 4P0BA 4KHPT 4CI2B 3LFMA 4EB6E 5IWAT 3P4SA 3U3IA 3C51A 4UF0A 1KNRA 4QH4A 3H37A 5FXXA 3DP7A 2NOXA 3B5MA 1UX4A 5LHIB 1HNXT 4AKRB 5AQNB 4IREA 1X9BA 1G73A 2JQQA 4X65T 2WQYA 3LK3B 4JEHB 3SRZA 2BVMA 3C4ZA 2WB5A 3MK7C 4UVAB 2AXDS 2A9UA 2WZIA 4QX7B 3K3OA 4PK6A 3AE1A 3AE2A 3ANWB 5LBQB 3WAJA 3RRWA 4J2CA 3RX6A 2UXBT 2H88A 5AQMB 5FYMA 3B13A 3FZLB 3ONLC 5HXCA 4YTNA 2ZMAA 4ZOLE 1JNZA 5C2TA 1UUSA 4B3RT 2QVAA 3A7MA 3HKBE 2MOZA 3HKDE 2V7LA 2NW7A 5AQVB 2WU5A 1N36T 4LF9T 1YKEB 1N33T 2D0UA 3ZLIA 4EZHA 4DR4T 2MAWA 2BG9E 2CE7A 4TX5A 5TAOA 2CCQA 3CMLA 5FXWA 1CUNA 4TV9E 1ZV4X 3P4RA 3KV4A 2N1GA 3PUQA 2C5KT 2XSAA 4DR5T 2QGSA 2HN2A 2B1EA 2M6IA 2LHRA 4GK5E 1D0XA 2I6HA 5J2UE 5DQWA 2XAGB 3KBUA 4A5XA 4PJMA 4X66T 5F8PA 3NVOA 2WDQA 1T8BA 2Z6EA 4DV5T 3AA0B 5DABA 4QXCB 4IE7A 5HCMA 3ZN1B 3C4XA 4A56A 2OV9A 3ZYKA 5EK2A 4HFCA 3N9LA 3KBTA 2IMLA 3BQIA 3ZT7A 4X1YE 1R8IA 5J1GA 5LG3A 2I59A 2IC9A 1N34T 1IZNB 3VR8A 2H7VC 2HN1A 4LFBT 1MNDA 5HEGA 4QXHB 5BMVE 2XM2A 5JQGE 4DV4T 5JDMA 2PG8A 3MZKB 4YLHA 4NXMT 4HWIB 3ZCJA 3OJAA 4O4IE 4CQIA 3EUHA 3SOLA 3AAAB 3F31A 4ILCA 2KLQA 4YSXA 1T7SA 4P0AA 3Q5XA 3RQWA 5CJ5A 2V7IA 3UQ4A 1VRBA 5AQOB 1ZEEA 3FZKB 4EGWA 3N5LA 4CXYA 4IE6A 5KX5E 5AQUB 5ABGA 3PJAA 3K1SA 4PW8A 4O2AE 3PUVF 3UU8A 3C4WA 2XZEA 1KFYA 2KT9A 2BDEA 4ZZCA 1MMGA 3RC8A 2LSIA 2X66A 2ES0A 1QUUA 3RLFF 3PV0F 4YXDA 2XUEA 2BG9B 4LMKA 2GK9A 2Q9QD 2LSJA 5F3JA 1S35A 1D1CA 3E22E 3K3NA 4MHCA 4GKJT 2IC6A 3FHNA 3VR9A 3GMIA 3QUJA 1NAFA 3UQ7A 2XY8B 2E9XB 4NPPA 2OA5A 5ABFA 4AI6A 5HWXA 3OTOT 2CBJA 1HR0T 1E7PA 4BJMA 2WDRA 3MJXA 2FJBA 4ISTA 2LKGA 4MBQA 2X0YA 4EEDA 4UELA 2YDQA 3X1DA 1XNQT 5IHYA 2ACZA 2L8KA 4PNIA 4H9RC 4CN6A 2EHOD 3JADA 2CXDA 4P1NA 3UUXB 2DI4A 1I6ZA 3K8PC 4COFA 4A97A 1IJ5A 3AA1B 2K48A 4IDQA 1HS7A 2K24A 1KEYA 2CWYA 1Z8UA 4LMJA 4ZI3D 3JC6D 2V26A 4L5GA 1T98A 4ZHQE 4ZZBA 4AQYT 4I55E 4MLKA 5FL1A 5FL0A 4OFZA 2CM0A 2KWIB 5E0OA 2F4VT 3CK6A 5C8YE 2C0SA 5LA6E 3HA4A 2M6BA 1LVKA 4U3CA 3AEDA 2FJDA 4JI8T 2VL8A 3VKGA 4DV0T 4X5TA 5AQKB 5JDFA 4WBOA 4PK5A 3AEBA 2LOPA 4QH5A 4XBFB 3VU7H 3ZCIA 4H9SE 2JRKA 2W00A 4QH1A 3T1YT 2YKSA 3FXDB 3TLVA 1OEDC 4AISA 4ISSA 5JR9C 2W4XA 4E7ZA 5AQRB 4IGUA 5LNKA 2A2FX 4GYRA 3TLUA 4HFIA 3B57A 5AFUL 4DUYT 4HWCA 1VCSA 4KI0F 3C64A 3PDYA 3P8CD 4AIUA 2HHHT 3N2GE 1XDPA 1MMNA 4HFHA 5LG4A 4H9QC 3RYCE 3OBVE 4TNVA 3RYIE 2CLYC 5HWYA 4LFCT 1ZP0A 3EVYA 5LHHB 1T72A 1KK7A 2K5BB 2NTXA 3V5SA 5HXHA 4X1KE 2SPCA 3AAIA 5EK4A 2WWUA 4U2YA 2WDVA 5JDLA 2KZ7B 3IA3A 5L2LA 4ILAA 2IAKA 3ZN0B 2ZM2A 3EI0A 3CX6B 4QX8B 2JQ9A 1W9RA 3NRYA 2M67A 1X79A 4IE4A 1SA0E 4AKIA 4AKGA 3EAMA 1M7KA 3ZPOA 5LJNA 2X67A 2VKJA 4EOZB 4X20E 1QSDA 3GWHA 5HEOA 2LE8A 2UXNB 4ZXLA 3AEAA 3M3ZB 2VB6A 2PJQA 3ZSTA 3MKDA 2J62A 4H9NC 2IUBA 1YW0A 2FJEA 4L0RA 2R6GF 1UK5A 2IHR1 1SUMB 3P4QA 1V9DA 2Y6XA 2V5DA 4YSYA 1MMDA 2VKHA 4Q25A 3CQGB 2BG9A 2XQ4A 3I0QA 3P4WA 4NIQA 4HFDA 3AEGA 3RGLA 1YQ3A 3RIUC 2LKHA 2A3DA 1MMAA 2CXFA 2E9XA 2UXDT 2XM1A 3RIAA 3NZQA 1EZ3A 5AQJB 1HNZT 4JI5T 3KV9A 2V5CA 1D0ZA 1IBLT 2W62A 2WP9A 1L0VA 3PUAA 5ABFB 2LEHA 4DBRA 3A8YC 4O2BE 4GIWA 4EV6A 2ZM6T 4CZZB 5LJMA 3AXJB 2BZBA 3N2OA 3OYZA 5LYJE 2Q9QB 5AQPB 5DJQC 3UT5E 4ZEYA 3H3MA 5L3GB 4DR6T 3DJBA 3DTOA 4KX6A 4ASKA 1N32T 2X9WA 1BR0A 1O3XA 4X1IE 2WSSV 5M4YA 2IDOB 3AECA 5J2TE 1NENA 1VCTA 4AQFC 2JJ9A 4DMWA 2XQAA 5H6RB 5FMNA 3AE8A 3AE5A 5AQQB 2W2UA 5AQTB 3T8OA 2VVSA 3GN5A 3AE3A 5FXVA 4Z91A 5JVDE 4ILBA 2L3LA 2XQYA 4ZI2C 4GKKT 5LHGB 2EHOB 3ZYMA 4BA9A 2PFVA 2V7JA 4ZS3A 4UEMA 2V1DB 3IEEA 4LF6T 1IAPA 2XQ5A 5AQHB 4XZCA 3TLWA 2JMHA 4U2ZA 2CWOA 3MACA 2J4GA 4YTMA 4K0UA 3HKEE 2V6XA 1S94A 3ZKRA 2WAUA 2JQHA 3MA9A 3PU3A 1KNZA 4YHJA 5ABHA 5JH7E 1MIWA 2BS3A 1SHZC 1D1AA 4XAXB 4GYSA 3UUMA 5HXSA 2XQ6A 4JUYA 3D0TA 4I4TE 3RYFE 1FEWA 1US7B 1XNRT 2JIWA 3EDVA 2BKPA 2PBIA 5KXJA 3G06A 2E5VA 2VASA 2UU9T 4YTPA 3PTRB 1W0BA 2W63A 1WR6A 2DNXA 1I94T 5EK3A 3ZMTB 4NUUA 1HFAA 4UV8B 3L8RA 4UIGA 1UX5A 3PUYF 3UU4A 2X9XA 2XQ9A 1SE7A 4G63A 2UUAT 4LF4T 5LB7B 4PK4A 3CQCB 2CMRA 2D0TA 5JREA 1UCUA 1Y01A 1YQ4A 2CXLA 4LFAT 4PAGA 3BK9A 2BBJA 4LF7T 4WW0A 4B6XA 1MIYA 1M62A 3KVAA 4HEAA 1HNWT 1IBKT 2NR4A 3QC9A 2CA5A 1B7TA 1VOMA 4B3TT 1H7CA 2NTYA 5LP6E 2YDSA 4EAHA 4N78D 1XDOA 5FVKA 2CHOA 3ZC0A 2D2SA 4U7IA 3Q9DA 4UR9A 4JYAT 3VRAA 2DCFA 3AXJA 2BS4A 2A72A 2KXPB 2Q9QA 5L3DB 1HCIA 1CHUA 3CX7B 5FXZA 5HXRA 2NP9A 3O1JA 4CN4A 5A1LA 3ESLA 3NWIA 4WBNE 4H63H 3TLTA 5JDGA 3FB2A 1G8XA 3KDSE 3AEEA 2LRLA 4EIWA 5HXEA 3LK2B 2E5LT 4WZXA 3OVUA 3CWZB 3ZMZB 3N2KE 2V7KA 4GOUA 3KINB 2EHOA 2X68A 2KMFA 5HYAA 5HEUA 3CIRA 1WRDA 3GN5B 5FP3A 5L47A 3O9XA 3I9YA 3VKHA 2W0GA 2V6YB 5LCYA 2VK9A 3RF1A 2LSGA 2VKOA 1J1JA 2VVNA 4KHZF 4DVDA 3PJAJ 4U31A 3ZJ2A 1NEKA 5FNVE 5JDQA 4DNDA 2N9DA 4MALA 4FJOA 2LSKA 4PFPA 3WI3A 4HFVA 4DBQA 4X62T 2XPKA 1IBMT 3ZMVB 4B3ST 2C5JA 4TZ4C 5CFBA 4O4JE 3PUZF 2FBWA 2X9HA 1J5WA 2LM2A 3HKCE 1HX1B 4H9PC 3C98B 3AE9A 4PFOA 5L3FB 4QXBB 2XAJB 4U33A 2VQET 1HTJF 3NBXX 3LJCA 2RA1A 3RH3A 4H9OC 2Y8DA 3AAEB 2BS2A 3ETUA 3UTKA 3TLSA 3C50A 2D5UA 3PUSA 3HL6A 3RRCA 4IDPA 3EHZA 2CRBA 5GONE 2KNDA 3FBZA 4LF8T 5IUXA 4EEBA 1YKHB 3AE4A 2HH7A 3VRBA 3F2EA 3O1IA 2WCAA 3FZMB 3QB5A 4YHHT 1HG2A 2CHNA 2XASB 3CKDA 3UFGA 4DUZT 3QK6A 2NW8A 4QHOA 4AQGA 3AE7A 1WFDA 4ZI2D 1OWAA 2FJAA 5FVLA 5AQSB 4BJNA 3SFEA 1D1BA 4JI3T 1DU2A 3LSVA 1XMOT 2QYWA 2IIUA 2D9DA 3NKZA 3FZFB 5JDNA 2ZM0A 4HTEA 4A98A 4K0KT 1YXRA 2XQ8A 4ZI3C 5AQIB 3H3AA 3E08A 1XZYA 5HAXA 2BKOA 3N9OA 4O4HE 3CQXC 1Z0PA 4NUVA 2ACXA 1BR2A 1E2AA 3LDQB 5EZYE 3KV6A 2VL0A 2YEVC 4JI0T 2YK0A 4U72A 3UUBA 1XWMA 4IL9A 5BR8T 2XAHB 4DR1T 4P09A 5LXTE 4DR3T 3O4XE 1ZKEA 4IE5A 4OHFA 2XSBA 3FBLA 2DHRA 3PUWF 4CXWA 1AJ3A 4HGAA 5H6QB 5DQVA 4G2AA 1Y64B 1W09A 1LKXA 1FMWA 4FI5A 2LM9A 3A5XA 3IF8B 5JRCB 3WAKA 5L4EA 3PUXF 4KP3C 2L9QA 3ZMSB 2K3WA 3RPUA 2CLYB 2W61A 2WM9A 4U74A 2VQFT 3RKOA 3KV5A 3PURA 5KMGP 2B76A 3LBXA 2X9YA 4ILUA 3J9X1 4EZ4A 3W15B 3RQUA 3P50A 4DV2T 2MYSA 3QOFA 4ZI7E 4DO0A 4QKNA 5LMUT 2V6YA 3L39A 2W67A 4MFRA 4YY3T 1KF6A 2LJLA 2E8IA 3E0ZA 1OXZA 1ZOYA 4TWHA 4C90A 2VURA 3GA8A 2CEAA 2WU2A 2BKNA 2FUPA 2BG9C 5L3BB 3QNUA 2V8SV 5LOVE 3ZC1A 3QB5K 2XAFB 1NWMX 1BR4A 3EABA 2YU1A 4NXNT 4JI4T 2E2AA 2QRXA 2E9XC 2YN6A 5LGNB 3LG7A 1W0AA 4YSZA 4X64T 4HFEA 2RP4A 2LHNA 4EYYR 4OK0A 3PU8A 4HE8A 3MXZA 3P4PA 1YD8G 5LMNT 4AXPA 4DV6T 4JLEA 1LRZA 2WWVA 3N9MA 5JTGA 4DR2T 3HI2A 4O4LE 3I1AA 2YOEA 3UU3A 3R6NA 4HWFA 3ZT6A 3CPZA 4IIJE 2X0LB 3SWHA 1D0YA 1MIVA 1LVFA 4JI1T 5CB4E 4CN1A 2H89A 4O8SA 4B3MT 2XAQB 2Y48B 2WZHA 4JI2T 4DV3T 5HEJA 4KMCA 3NRXA 5CA1E 2BVLA 3ABVA 3JAEA 2OLTA 4PJJA 3RC3A 5C3JA 5ADXL 3U78A 2WBLA 2LOSA 3UULA 3ONJA 4TNWA 5FY0A 4C91A 3CX8B 2J1DG 2AE9A 4JV5T 2VKDA 4LMLA 3ZEFB 3KVBA 4E7SA 4JI7T 3L09A 4HWHA 3ZJ1A 4WYVA 3HR0A 3PE0A 4DV1T 2JQKA 3RKGA 4YT0A 4JBWF 5LGUB 1QLBA 3L3PA 4TV8E 2XJ7A 3VHLA 2KSRA 5L3EB 4ANJA 4I43B 4JI6T 3SS1A 4DV7T 4OYKA 4Z90A 3BQLA 1OEDA 3JCFA 4IDZA 5JR9A 4KUMB 3UFEA 4IT4A 3N9NA 2WMOA 5ETWA 5AQGB 3RHWA 5LGTB 2XQ7A 4YJ3E 5AQFB 3V5UA 1FIOA 2JPFA 4AKHA 4U7YA 3S4UA 4UF0B 3I0OA 3Q5EA 4Z8XA 5JRCA 3AE6A 4TUYE 4QWNB 4OX9T 3RI5A 1WR0A 3ZSSA 2LRKA 2HPJA 3FZHB 3ZMUB 2NWBA 2VWAA 3ANWA 3RIFA 4I50E 4HFBA 5L3CB 5FKYA 3UUNA 3LBXB 4ERRA 4L9IA 5L4HA 4UVBB 1WYCA 3CVRA 5F5WA 4YJ2E 1MNEA 4ADZA 2YDRA 2RPAA 3ETVA 5FY7A 4CXXA 3J7Yq 5JDHA 4DMVA 2QA7A 4PJLA 3PUGA 4BAYB 4UVCB 3Q5WA 1KNPA 5J0ZA 1ZHCA 4CI1B 2KINB 1WYBA 3P7IA 1UGOA 1JNRA 1WCRA 3AEFA 2X0HA 4IDNA 4F8HA 4IE0A 1GQEA 2WY2A 3O1HA 3AB3B 3ONXA 5ABEA 2DL1A 3AA6B 2ODVA 4EYUA 3KFWX 1OEDE 4WNKA 1WLXA 3JAFA 4HKAA 3ZYLA 2I0MA 1XMQT 5LBMA 4H63V 3T1HT 2V7MA 4DIDB 3SFDA 1IJ6A 4HWDA 4I0UA 1FJGT 3I9WA 3RIUA 4UV9B 2DWGA 4M1PA 4IL4A 4CI3B 2CPTA 2DWKA 2WS3A 5IYZE 2MPKA 5KDMC 3R84B 1E1HB 2Q9QC 1U4QA 2YU2A 3UU5A 2ZLYA 2LLYA 3Q5DA 2W66A 2ODUA 5HCJA 5CGMA 2XHEB 3Q2MA 2P9BA 4PJNA 2XTLA 3EDUA 3OKQA 4EXTA 1J5ET 2WMNA 3AVRA 2BBHA 2UXXB 2PTFA 4F6RC 2G0UA 2ZM8A 4UXNB 3OYXA 5CA0E 3AVSA 5HEHA 2HPLA 1UURA 1HF8A 2MTQA 3TKLB 4AQFA 2YINA 2EHOC 2IW5B 4JEUB 2X51A 3FXEB 4LF5T 2CBIA 2J47A 2H3RA 5FY1A 2LSYA 1U5PA 1BR1A 3IHRA 4OYJA 3ZT5A 2DLRA 3JC6C 1HX8A 4TWDA 2XQ3A 3M65A 3N9QA 5AQLB 4KBMB 1FMVA 3IBPA 2UXCT 3N9PA 4ZS2A 2NW9A 3AA7B 3LK42 2E9XD
chains in the Genus database with same CATH topology
2LOPA 4HN9A 4XBFB 3VU7H 3ZCIA 5L3BB 5LOVE 3ZC1A 4WW0A 2MBGA 4H9SE 4B6XA 2JRKA 4TN7B 2W00A 1MIYA 4YFSA 4GK0E 3KVAA 2XAFB 3FXDB 4HEAA 1NWMX 1BR4A 2LT3A 4IHJE 2YU1A 2N2NA 3QC9A 2CA5A 4ISSA 1B7TA 1VOMA 2KWHA 2H7OA 5JR9C 1H7CA 1HG5A 2NTYA 3BQKA 2E9XC 5LP6E 3K3QC 4E7ZA 5LGNB 3LG7A 4AKLA 5JR9B 4IGUA 4EAHA 4N78D 3F57A 5LNKA 2A2FX 2JMKA 2RP4A 3RYHE 4V1Av 2K9AA 2LHNA 4GYRA 3NZPA 4EYYR 2C5IT 3B57A 4OK0A 3ZC0A 2D2SA 3PU8A 4P0BA 5AFUL 4CI2B 3Q9DA 4HE8A 3LFMA 4EB6E 3MXZA 3U3IA 3C51A 1YD8G 4UF0A 2DCFA 3C64A 3PDYA 4BA9A 3P8CD 2A72A 3H37A 5FXXA 4AXPA 2KXPB 3DP7A 2Q9QA 2NOXA 3N2GE 1UX4A 5LHIB 1MMNA 4JLEA 5LG4A 1LRZA 4H9QC 4AKRB 3N9MA 3OBVE 3RYCE 5L3DB 3RYIE 1G73A 1HCIA 2JQQA 2CLYC 3HI2A 5HWYA 3LK3B 4JEHB 3SRZA 3EVYA 5LHHB 2BVMA 4O4LE 3I1AA 3CX7B 1KK7A 3C4ZA 5FXZA 3R6NA 2K5BB 3MK7C 3CPZA 2NTXA 5HXRA 2NP9A 4UVAB 3V5SA 3O1JA 5HXHA 5A1LA 3ESLA 4X1KE 4WBNE 4H63H 2SPCA 4QX7B 3K3OA 4IIJE 3AAIA 4PK6A 5EK4A 5JDGA 2X0LB 2WWUA 3ANWB 3SWHA 3FB2A 1G8XA 1D0YA 1MIVA 1LVFA 5LBQB 3KDSE 5JDLA 2KZ7B 5CB4E 4O8SA 4EIWA 5L2LA 5HXEA 2XAQB 3LK2B 2Y48B 2IAKA 3ZN0B 3WAJA 3RRWA 4J2CA 2ZM2A 4KMCA 3CWZB 3NRXA 3ZMZB 3N2KE 5CA1E 2V7KA 3CX6B 4GOUA 4QX8B 2BVLA 3RX6A 3KINB 2EHOA 2X68A 3B13A 5FYMA 2KMFA 5HYAA 4PJJA 3RC3A 1WRDA 3U78A 3GN5B 5HXCA 5ADXL 2WBLA 5FP3A 2ZMAA 2LOSA 4ZOLE 3NRYA 3UULA 2M67A 1X79A 5FY0A 4IE4A 1SA0E 3O9XA 4C91A 3I9YA 3VKHA 3CX8B 4AKIA 2W0GA 2J1DG 5LCYA 2VKDA 2VK9A 4AKGA 2LSGA 2VKOA 3ZEFB 3ZPOA 3KVBA 5LJNA 4E7SA 3HKBE 2X67A 2VKJA 4EOZB 4X20E 2MOZA 4DVDA 3L09A 1QSDA 3GWHA 3ZJ2A 2LE8A 2UXNB 3HKDE 5FNVE 5JDQA 2V7LA 3ZJ1A 4DNDA 2NW7A 2N9DA 2VB6A 3HR0A 4MALA 2PJQA 4FJOA 3PE0A 3MKDA 2LSKA 1YKEB 4H9NC 2D0UA 1YW0A 4L0RA 3ZLIA 4EZHA 5LGUB 2CE7A 1V9DA 3L3PA 4HFVA 4PFPA 3WI3A 2Y6XA 4TV8E 4TX5A 5TAOA 3VHLA 4DBQA 1MMDA 2VKHA 2CCQA 3CQGB 5L3EB 3I0QA 3CMLA 5FXWA 3ZMVB 4ANJA 1CUNA 4I43B 4TV9E 2C5JA 4TZ4C 3SS1A 1ZV4X 4O4JE 3KV4A 4OYKA 2X9HA 2N1GA 3PUQA 3BQLA 2C5KT 2A3DA 4IDZA 2QGSA 5JR9A 4KUMB 1MMAA 2CXFA 2E9XA 3HKCE 2B1EA 3UFEA 2LHRA 3N9NA 1D0XA 4GK5E 4H9PC 3NZQA 1EZ3A 2WMOA 3C98B 4PFOA 5ETWA 5L3FB 5J2UE 3KV9A 4QXBB 5DQWA 2XAJB 2XAGB 1HTJF 1D0ZA 3KBUA 3NBXX 2W62A 3LJCA 5LGTB 4YJ3E 4PJMA 2RA1A 3RH3A 3PUAA 4H9OC 2Y8DA 3AAEB 2LEHA 3V5UA 3ETUA 1FIOA 3UTKA 2JPFA 4DBRA 5F8PA 4AKHA 4O2BE 4GIWA 2Z6EA 3S4UA 3C50A 4UF0B 3AA0B 5DABA 4QXCB 2D5UA 3PUSA 3I0OA 4CZZB 5LJMA 2BZBA 3HL6A 3N2OA 4Z8XA 4TUYE 3RRCA 3OYZA 5JRCA 4IE7A 5LYJE 3ZN1B 2Q9QB 3C4XA 5DJQC 4QWNB 3UT5E 4A56A 3ZYKA 5EK2A 5L3GB 3N9LA 3DJBA 3DTOA 3KBTA 5GONE 2KNDA 4ASKA 3BQIA 3FBZA 2X9WA 4X1YE 1BR0A 1O3XA 5J1GA 4X1IE 1YKHB 2HPJA 2I59A 3ZMUB 2HH7A 2NWBA 2VWAA 2IC9A 3ANWA 2WSSV 3F2EA 5M4YA 4I50E 1IZNB 3O1IA 2H7VC 1HG2A 2XASB 3CKDA 5L3CB 1MNDA 5J2TE 3QK6A 3UUNA 4QXHB 5BMVE 2NW8A 4QHOA 4AQGA 5JQGE 3LBXB 4AQFC 2PG8A 3MZKB 5JDMA 2JJ9A 4YLHA 4DMWA 4ERRA 4ZI2D 4L9IA 1OWAA 4UVBB 3ZCJA 3OJAA 4O4IE 1WYCA 3CVRA 5H6RB 3EUHA 4CQIA 5FMNA 3SOLA 4YJ2E 3AAAB 3F31A 4BJNA 1D1BA 1MNEA 4ADZA 3T8OA 3ETVA 5FY7A 3GN5A 2KLQA 5FXVA 4CXXA 3J7Yq 4P0AA 5JVDE 3Q5XA 5JDHA 4DMVA 2L3LA 2QA7A 2XQYA 4ZI2C 2V7IA 4PJLA 1VRBA 3PUGA 2EHOB 3ZYMA 5LHGB 5JDNA 2PFVA 2V7JA 2ZM0A 4UVCB 4ZS3A 1ZEEA 3Q5WA 4BAYB 4HTEA 4UEMA 1ZHCA 2V1DB 4CI1B 3N5LA 4CXYA 3IEEA 4IE6A 2KINB 1WYBA 5KX5E 4ZI3C 3H3AA 4PW8A 1IAPA 3E08A 3P7IA 4O2AE 5HAXA 3N9OA 4O4HE 3C4WA 4XZCA 3CQXC 1Z0PA 4NUVA 4IE0A 2ACXA 3O1HA 3AB3B 1BR2A 3ONXA 2JMHA 2BDEA 2KT9A 2CWOA 1MMGA 3MACA 3AA6B 3RC8A 5EZYE 2ODVA 4EYUA 3KV6A 3KFWX 2LSIA 2X66A 4WNKA 2ES0A 4K0UA 1QUUA 1WLXA 3HKEE 4HKAA 2YEVC 3ZYLA 5LBMA 4H63V 1S94A 2WAUA 2YK0A 2V7MA 2XUEA 4U72A 2GK9A 2Q9QD 2LSJA 5F3JA 3MA9A 1S35A 1D1CA 1IJ6A 3PU3A 1KNZA 3I9WA 4YHJA 3E22E 3K3NA 4MHCA 2IC6A 3FHNA 2XAHB 4UV9B 2DWGA 4M1PA 3GMIA 4P09A 5LXTE 4CI3B 3QUJA 1NAFA 3O4XE 2DWKA 5JH7E 5IYZE 2E9XB 1MIWA 1ZKEA 4IE5A 5KDMC 4OHFA 3R84B 2OA5A 1E1HB 3FBLA 2Q9QC 2DHRA 1U4QA 1SHZC 2YU2A 4AI6A 4CXWA 5HWXA 1AJ3A 1D1AA 4XAXB 2ZLYA 4HGAA 5H6QB 5DQVA 4BJMA 3MJXA 4GYSA 2ODUA 3UUMA 4ISTA 5HXSA 4G2AA 1Y64B 4JUYA 3D0TA 4MBQA 2XHEB 4I4TE 3RYFE 3Q2MA 1LKXA 1FEWA 1FMWA 1US7B 2P9BA 4FI5A 4PJNA 4UELA 2LM9A 2XTLA 3EDUA 3OKQA 4EXTA 3A5XA 3EDVA 3IF8B 5JRCB 3WAKA 5IHYA 2WMNA 3AVRA 2PBIA 2UXXB 4KP3C 2L9QA 4F6RC 2L8KA 3ZMSB 4PNIA 2G0UA 2VASA 2CLYB 2W61A 2ZM8A 4H9RC 4UXNB 2WM9A 4U74A 2EHOD 3RPUA 2CXDA 3OYXA 3RKOA 3UUXB 5CA0E 2DI4A 3PTRB 3K8PC 3AVSA 3KV5A 3PURA 5KMGP 1IJ5A 3AA1B 2K48A 3LBXA 2W63A 2X9YA 4ILUA 1HS7A 1WR6A 3J9X1 2K24A 4EZ4A 2DNXA 3W15B 2HPLA 5EK3A 2CWYA 3ZMTB 1HF8A 2MTQA 3TKLB 4AQFA 4ZI3D 2MYSA 4NUUA 2YINA 2EHOC 2IW5B 3JC6D 4JEUB 2V26A 1HFAA 2X51A 4ZI7E 4UV8B 4L5GA 1T98A 4UIGA 3FXEB 4ZHQE 1UX5A 4I55E 2H3RA 4MLKA 4QKNA 4DO0A 4OFZA 2CM0A 5FY1A 2KWIB 2X9XA 2LSYA 4G63A 5E0OA 5C8YE 4MFRA 1U5PA 2C0SA 1BR1A 3IHRA 5LA6E 4OYJA 2LJLA 2E8IA 4PK4A 2DLRA 3HA4A 3E0ZA 3CQCB 1LVKA 1OXZA 3JC6C 2CMRA 4C90A 2D0TA 1HX8A 2VL8A 3M65A 3N9QA 5JREA 1UCUA 3VKGA 4KBMB 1FMVA 2CXLA 3IBPA 3N9PA 4ZS2A 2NW9A 3GA8A 4PAGA 3AA7B 3BK9A 5JDFA 4WBOA 4PK5A 2CEAA 3LK42 2E9XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWA A; 
#chains in the Genus database with same CATH topology
 4HN9 A;  2UUC T;  4TWF A;  2MBG A;  4TN7 B;  4YFS A;  3UU6 A;  4GK0 E;  2UUB T;  2LT3 A;  4IHJ E;  2N2N A;  3OPC A;  4IDO A;  2KWH A;  2H7O A;  1HG5 A;  3BQK A;  3K3Q C;  1OED B;  4AKL A;  5JR9 B;  3F57 A;  3RYH E;  2JMK A;  4V1A v;  2K9A A;  3NZP A;  2C5I T;  4DR7 T;  4P0B A;  4KHP T;  4CI2 B;  3LFM A;  4EB6 E;  5IWA T;  3P4S A;  3U3I A;  3C51 A;  4UF0 A;  1KNR A;  4QH4 A;  3H37 A;  5FXX A;  3DP7 A;  2NOX A;  3B5M A;  1UX4 A;  5LHI B;  1HNX T;  4AKR B;  5AQN B;  4IRE A;  1X9B A;  1G73 A;  2JQQ A;  4X65 T;  2WQY A;  3LK3 B;  4JEH B;  3SRZ A;  2BVM A;  3C4Z A;  2WB5 A;  3MK7 C;  4UVA B;  2AXD S;  2A9U A;  2WZI A;  4QX7 B;  3K3O A;  4PK6 A;  3AE1 A;  3AE2 A;  3ANW B;  5LBQ B;  3WAJ A;  3RRW A;  4J2C A;  3RX6 A;  2UXB T;  2H88 A;  5AQM B;  5FYM A;  3B13 A;  3FZL B;  3ONL C;  5HXC A;  4YTN A;  2ZMA A;  4ZOL E;  1JNZ A;  5C2T A;  1UUS A;  4B3R T;  2QVA A;  3A7M A;  3HKB E;  2MOZ A;  3HKD E;  2V7L A;  2NW7 A;  5AQV B;  2WU5 A;  1N36 T;  4LF9 T;  1YKE B;  1N33 T;  2D0U A;  3ZLI A;  4EZH A;  4DR4 T;  2MAW A;  2BG9 E;  2CE7 A;  4TX5 A;  5TAO A;  2CCQ A;  3CML A;  5FXW A;  1CUN A;  4TV9 E;  1ZV4 X;  3P4R A;  3KV4 A;  2N1G A;  3PUQ A;  2C5K T;  2XSA A;  4DR5 T;  2QGS A;  2HN2 A;  2B1E A;  2M6I A;  2LHR A;  4GK5 E;  1D0X A;  2I6H A;  5J2U E;  5DQW A;  2XAG B;  3KBU A;  4A5X A;  4PJM A;  4X66 T;  5F8P A;  3NVO A;  2WDQ A;  1T8B A;  2Z6E A;  4DV5 T;  3AA0 B;  5DAB A;  4QXC B;  4IE7 A;  5HCM A;  3ZN1 B;  3C4X A;  4A56 A;  2OV9 A;  3ZYK A;  5EK2 A;  4HFC A;  3N9L A;  3KBT A;  2IML A;  3BQI A;  3ZT7 A;  4X1Y E;  1R8I A;  5J1G A;  5LG3 A;  2I59 A;  2IC9 A;  1N34 T;  1IZN B;  3VR8 A;  2H7V C;  2HN1 A;  4LFB T;  1MND A;  5HEG A;  4QXH B;  5BMV E;  2XM2 A;  5JQG E;  4DV4 T;  5JDM A;  2PG8 A;  3MZK B;  4YLH A;  4NXM T;  4HWI B;  3ZCJ A;  3OJA A;  4O4I E;  4CQI A;  3EUH A;  3SOL A;  3AAA B;  3F31 A;  4ILC A;  2KLQ A;  4YSX A;  1T7S A;  4P0A A;  3Q5X A;  3RQW A;  5CJ5 A;  2V7I A;  3UQ4 A;  1VRB A;  5AQO B;  1ZEE A;  3FZK B;  4EGW A;  3N5L A;  4CXY A;  4IE6 A;  5KX5 E;  5AQU B;  5ABG A;  3PJA A;  3K1S A;  4PW8 A;  4O2A E;  3PUV F;  3UU8 A;  3C4W A;  2XZE A;  1KFY A;  2KT9 A;  2BDE A;  4ZZC A;  1MMG A;  3RC8 A;  2LSI A;  2X66 A;  2ES0 A;  1QUU A;  3RLF F;  3PV0 F;  4YXD A;  2XUE A;  2BG9 B;  4LMK A;  2GK9 A;  2Q9Q D;  2LSJ A;  5F3J A;  1S35 A;  1D1C A;  3E22 E;  3K3N A;  4MHC A;  4GKJ T;  2IC6 A;  3FHN A;  3VR9 A;  3GMI A;  3QUJ A;  1NAF A;  3UQ7 A;  2XY8 B;  2E9X B;  4NPP A;  2OA5 A;  5ABF A;  4AI6 A;  5HWX A;  3OTO T;  2CBJ A;  1HR0 T;  1E7P A;  4BJM A;  2WDR A;  3MJX A;  2FJB A;  4IST A;  2LKG A;  4MBQ A;  2X0Y A;  4EED A;  4UEL A;  2YDQ A;  3X1D A;  1XNQ T;  5IHY A;  2ACZ A;  2L8K A;  4PNI A;  4H9R C;  4CN6 A;  2EHO D;  3JAD A;  2CXD A;  4P1N A;  3UUX B;  2DI4 A;  1I6Z A;  3K8P C;  4COF A;  4A97 A;  1IJ5 A;  3AA1 B;  2K48 A;  4IDQ A;  1HS7 A;  2K24 A;  1KEY A;  2CWY A;  1Z8U A;  4LMJ A;  4ZI3 D;  3JC6 D;  2V26 A;  4L5G A;  1T98 A;  4ZHQ E;  4ZZB A;  4AQY T;  4I55 E;  4MLK A;  5FL1 A;  5FL0 A;  4OFZ A;  2CM0 A;  2KWI B;  5E0O A;  2F4V T;  3CK6 A;  5C8Y E;  2C0S A;  5LA6 E;  3HA4 A;  2M6B A;  1LVK A;  4U3C A;  3AED A;  2FJD A;  4JI8 T;  2VL8 A;  3VKG A;  4DV0 T;  4X5T A;  5AQK B;  5JDF A;  4WBO A;  4PK5 A;  3AEB A;  2LOP A;  4QH5 A;  4XBF B;  3VU7 H;  3ZCI A;  4H9S E;  2JRK A;  2W00 A;  4QH1 A;  3T1Y T;  2YKS A;  3FXD B;  3TLV A;  1OED C;  4AIS A;  4ISS A;  5JR9 C;  2W4X A;  4E7Z A;  5AQR B;  4IGU A;  5LNK A;  2A2F X;  4GYR A;  3TLU A;  4HFI A;  3B57 A;  5AFU L;  4DUY T;  4HWC A;  1VCS A;  4KI0 F;  3C64 A;  3PDY A;  3P8C D;  4AIU A;  2HHH T;  3N2G E;  1XDP A;  1MMN A;  4HFH A;  5LG4 A;  4H9Q C;  3RYC E;  3OBV E;  4TNV A;  3RYI E;  2CLY C;  5HWY A;  4LFC T;  1ZP0 A;  3EVY A;  5LHH B;  1T72 A;  1KK7 A;  2K5B B;  2NTX A;  3V5S A;  5HXH A;  4X1K E;  2SPC A;  3AAI A;  5EK4 A;  2WWU A;  4U2Y A;  2WDV A;  5JDL A;  2KZ7 B;  3IA3 A;  5L2L A;  4ILA A;  2IAK A;  3ZN0 B;  2ZM2 A;  3EI0 A;  3CX6 B;  4QX8 B;  2JQ9 A;  1W9R A;  3NRY A;  2M67 A;  1X79 A;  4IE4 A;  1SA0 E;  4AKI A;  4AKG A;  3EAM A;  1M7K A;  3ZPO A;  5LJN A;  2X67 A;  2VKJ A;  4EOZ B;  4X20 E;  1QSD A;  3GWH A;  5HEO A;  2LE8 A;  2UXN B;  4ZXL A;  3AEA A;  3M3Z B;  2VB6 A;  2PJQ A;  3ZST A;  3MKD A;  2J62 A;  4H9N C;  2IUB A;  1YW0 A;  2FJE A;  4L0R A;  2R6G F;  1UK5 A;  2IHR 1;  1SUM B;  3P4Q A;  1V9D A;  2Y6X A;  2V5D A;  4YSY A;  1MMD A;  2VKH A;  4Q25 A;  3CQG B;  2BG9 A;  2XQ4 A;  3I0Q A;  3P4W A;  4NIQ A;  4HFD A;  3AEG A;  3RGL A;  1YQ3 A;  3RIU C;  2LKH A;  2A3D A;  1MMA A;  2CXF A;  2E9X A;  2UXD T;  2XM1 A;  3RIA A;  3NZQ A;  1EZ3 A;  5AQJ B;  1HNZ T;  4JI5 T;  3KV9 A;  2V5C A;  1D0Z A;  1IBL T;  2W62 A;  2WP9 A;  1L0V A;  3PUA A;  5ABF B;  2LEH A;  4DBR A;  3A8Y C;  4O2B E;  4GIW A;  4EV6 A;  2ZM6 T;  4CZZ B;  5LJM A;  3AXJ B;  2BZB A;  3N2O A;  3OYZ A;  5LYJ E;  2Q9Q B;  5AQP B;  5DJQ C;  3UT5 E;  4ZEY A;  3H3M A;  5L3G B;  4DR6 T;  3DJB A;  3DTO A;  4KX6 A;  4ASK A;  1N32 T;  2X9W A;  1BR0 A;  1O3X A;  4X1I E;  2WSS V;  5M4Y A;  2IDO B;  3AEC A;  5J2T E;  1NEN A;  1VCT A;  4AQF C;  2JJ9 A;  4DMW A;  2XQA A;  5H6R B;  5FMN A;  3AE8 A;  3AE5 A;  5AQQ B;  2W2U A;  5AQT B;  3T8O A;  2VVS A;  3GN5 A;  3AE3 A;  5FXV A;  4Z91 A;  5JVD E;  4ILB A;  2L3L A;  2XQY A;  4ZI2 C;  4GKK T;  5LHG B;  2EHO B;  3ZYM A;  4BA9 A;  2PFV A;  2V7J A;  4ZS3 A;  4UEM A;  2V1D B;  3IEE A;  4LF6 T;  1IAP A;  2XQ5 A;  5AQH B;  4XZC A;  3TLW A;  2JMH A;  4U2Z A;  2CWO A;  3MAC A;  2J4G A;  4YTM A;  4K0U A;  3HKE E;  2V6X A;  1S94 A;  3ZKR A;  2WAU A;  2JQH A;  3MA9 A;  3PU3 A;  1KNZ A;  4YHJ A;  5ABH A;  5JH7 E;  1MIW A;  2BS3 A;  1SHZ C;  1D1A A;  4XAX B;  4GYS A;  3UUM A;  5HXS A;  2XQ6 A;  4JUY A;  3D0T A;  4I4T E;  3RYF E;  1FEW A;  1US7 B;  1XNR T;  2JIW A;  3EDV A;  2BKP A;  2PBI A;  5KXJ A;  3G06 A;  2E5V A;  2VAS A;  2UU9 T;  4YTP A;  3PTR B;  1W0B A;  2W63 A;  1WR6 A;  2DNX A;  1I94 T;  5EK3 A;  3ZMT B;  4NUU A;  1HFA A;  4UV8 B;  3L8R A;  4UIG A;  1UX5 A;  3PUY F;  3UU4 A;  2X9X A;  2XQ9 A;  1SE7 A;  4G63 A;  2UUA T;  4LF4 T;  5LB7 B;  4PK4 A;  3CQC B;  2CMR A;  2D0T A;  5JRE A;  1UCU A;  1Y01 A;  1YQ4 A;  2CXL A;  4LFA T;  4PAG A;  3BK9 A;  2BBJ A;  4LF7 T;  4WW0 A;  4B6X A;  1MIY A;  1M62 A;  3KVA A;  4HEA A;  1HNW T;  1IBK T;  2NR4 A;  3QC9 A;  2CA5 A;  1B7T A;  1VOM A;  4B3T T;  1H7C A;  2NTY A;  5LP6 E;  2YDS A;  4EAH A;  4N78 D;  1XDO A;  5FVK A;  2CHO A;  3ZC0 A;  2D2S A;  4U7I A;  3Q9D A;  4UR9 A;  4JYA T;  3VRA A;  2DCF A;  3AXJ A;  2BS4 A;  2A72 A;  2KXP B;  2Q9Q A;  5L3D B;  1HCI A;  1CHU A;  3CX7 B;  5FXZ A;  5HXR A;  2NP9 A;  3O1J A;  4CN4 A;  5A1L A;  3ESL A;  3NWI A;  4WBN E;  4H63 H;  3TLT A;  5JDG A;  3FB2 A;  1G8X A;  3KDS E;  3AEE A;  2LRL A;  4EIW A;  5HXE A;  3LK2 B;  2E5L T;  4WZX A;  3OVU A;  3CWZ B;  3ZMZ B;  3N2K E;  2V7K A;  4GOU A;  3KIN B;  2EHO A;  2X68 A;  2KMF A;  5HYA A;  5HEU A;  3CIR A;  1WRD A;  3GN5 B;  5FP3 A;  5L47 A;  3O9X A;  3I9Y A;  3VKH A;  2W0G A;  2V6Y B;  5LCY A;  2VK9 A;  3RF1 A;  2LSG A;  2VKO A;  1J1J A;  2VVN A;  4KHZ F;  4DVD A;  3PJA J;  4U31 A;  3ZJ2 A;  1NEK A;  5FNV E;  5JDQ A;  4DND A;  2N9D A;  4MAL A;  4FJO A;  2LSK A;  4PFP A;  3WI3 A;  4HFV A;  4DBQ A;  4X62 T;  2XPK A;  1IBM T;  3ZMV B;  4B3S T;  2C5J A;  4TZ4 C;  5CFB A;  4O4J E;  3PUZ F;  2FBW A;  2X9H A;  1J5W A;  2LM2 A;  3HKC E;  1HX1 B;  4H9P C;  3C98 B;  3AE9 A;  4PFO A;  5L3F B;  4QXB B;  2XAJ B;  4U33 A;  2VQE T;  1HTJ F;  3NBX X;  3LJC A;  2RA1 A;  3RH3 A;  4H9O C;  2Y8D A;  3AAE B;  2BS2 A;  3ETU A;  3UTK A;  3TLS A;  3C50 A;  2D5U A;  3PUS A;  3HL6 A;  3RRC A;  4IDP A;  3EHZ A;  2CRB A;  5GON E;  2KND A;  3FBZ A;  4LF8 T;  5IUX A;  4EEB A;  1YKH B;  3AE4 A;  2HH7 A;  3VRB A;  3F2E A;  3O1I A;  2WCA A;  3FZM B;  3QB5 A;  4YHH T;  1HG2 A;  2CHN A;  2XAS B;  3CKD A;  3UFG A;  4DUZ T;  3QK6 A;  2NW8 A;  4QHO A;  4AQG A;  3AE7 A;  1WFD A;  4ZI2 D;  1OWA A;  2FJA A;  5FVL A;  5AQS B;  4BJN A;  3SFE A;  1D1B A;  4JI3 T;  1DU2 A;  3LSV A;  1XMO T;  2QYW A;  2IIU A;  2D9D A;  3NKZ A;  3FZF B;  5JDN A;  2ZM0 A;  4HTE A;  4A98 A;  4K0K T;  1YXR A;  2XQ8 A;  4ZI3 C;  5AQI B;  3H3A A;  3E08 A;  1XZY A;  5HAX A;  2BKO A;  3N9O A;  4O4H E;  3CQX C;  1Z0P A;  4NUV A;  2ACX A;  1BR2 A;  1E2A A;  3LDQ B;  5EZY E;  3KV6 A;  2VL0 A;  2YEV C;  4JI0 T;  2YK0 A;  4U72 A;  3UUB A;  1XWM A;  4IL9 A;  5BR8 T;  2XAH B;  4DR1 T;  4P09 A;  5LXT E;  4DR3 T;  3O4X E;  1ZKE A;  4IE5 A;  4OHF A;  2XSB A;  3FBL A;  2DHR A;  3PUW F;  4CXW A;  1AJ3 A;  4HGA A;  5H6Q B;  5DQV A;  4G2A A;  1Y64 B;  1W09 A;  1LKX A;  1FMW A;  4FI5 A;  2LM9 A;  3A5X A;  3IF8 B;  5JRC B;  3WAK A;  5L4E A;  3PUX F;  4KP3 C;  2L9Q A;  3ZMS B;  2K3W A;  3RPU A;  2CLY B;  2W61 A;  2WM9 A;  4U74 A;  2VQF T;  3RKO A;  3KV5 A;  3PUR A;  5KMG P;  2B76 A;  3LBX A;  2X9Y A;  4ILU A;  3J9X 1;  4EZ4 A;  3W15 B;  3RQU A;  3P50 A;  4DV2 T;  2MYS A;  3QOF A;  4ZI7 E;  4DO0 A;  4QKN A;  5LMU T;  2V6Y A;  3L39 A;  2W67 A;  4MFR A;  4YY3 T;  1KF6 A;  2LJL A;  2E8I A;  3E0Z A;  1OXZ A;  1ZOY A;  4TWH A;  4C90 A;  2VUR A;  3GA8 A;  2CEA A;  2WU2 A;  2BKN A;  2FUP A;  2BG9 C;  5L3B B;  3QNU A;  2V8S V;  5LOV E;  3ZC1 A;  3QB5 K;  2XAF B;  1NWM X;  1BR4 A;  3EAB A;  2YU1 A;  4NXN T;  4JI4 T;  2E2A A;  2QRX A;  2E9X C;  2YN6 A;  5LGN B;  3LG7 A;  1W0A A;  4YSZ A;  4X64 T;  4HFE A;  2RP4 A;  2LHN A;  4EYY R;  4OK0 A;  3PU8 A;  4HE8 A;  3MXZ A;  3P4P A;  1YD8 G;  5LMN T;  4AXP A;  4DV6 T;  4JLE A;  1LRZ A;  2WWV A;  3N9M A;  5JTG A;  4DR2 T;  3HI2 A;  4O4L E;  3I1A A;  2YOE A;  3UU3 A;  3R6N A;  4HWF A;  3ZT6 A;  3CPZ A;  4IIJ E;  2X0L B;  3SWH A;  1D0Y A;  1MIV A;  1LVF A;  4JI1 T;  5CB4 E;  4CN1 A;  2H89 A;  4O8S A;  4B3M T;  2XAQ B;  2Y48 B;  2WZH A;  4JI2 T;  4DV3 T;  5HEJ A;  4KMC A;  3NRX A;  5CA1 E;  2BVL A;  3ABV A;  3JAE A;  2OLT A;  4PJJ A;  3RC3 A;  5C3J A;  5ADX L;  3U78 A;  2WBL A;  2LOS A;  3UUL A;  3ONJ A;  4TNW A;  5FY0 A;  4C91 A;  3CX8 B;  2J1D G;  2AE9 A;  4JV5 T;  2VKD A;  4LML A;  3ZEF B;  3KVB A;  4E7S A;  4JI7 T;  3L09 A;  4HWH A;  3ZJ1 A;  4WYV A;  3HR0 A;  3PE0 A;  4DV1 T;  2JQK A;  3RKG A;  4YT0 A;  4JBW F;  5LGU B;  1QLB A;  3L3P A;  4TV8 E;  2XJ7 A;  3VHL A;  2KSR A;  5L3E B;  4ANJ A;  4I43 B;  4JI6 T;  3SS1 A;  4DV7 T;  4OYK A;  4Z90 A;  3BQL A;  1OED A;  3JCF A;  4IDZ A;  5JR9 A;  4KUM B;  3UFE A;  4IT4 A;  3N9N A;  2WMO A;  5ETW A;  5AQG B;  3RHW A;  5LGT B;  2XQ7 A;  4YJ3 E;  5AQF B;  3V5U A;  1FIO A;  2JPF A;  4AKH A;  4U7Y A;  3S4U A;  4UF0 B;  3I0O A;  3Q5E A;  4Z8X A;  5JRC A;  3AE6 A;  4TUY E;  4QWN B;  4OX9 T;  3RI5 A;  1WR0 A;  3ZSS A;  2LRK A;  2HPJ A;  3FZH B;  3ZMU B;  2NWB A;  2VWA A;  3ANW A;  3RIF A;  4I50 E;  4HFB A;  5L3C B;  5FKY A;  3UUN A;  3LBX B;  4ERR A;  4L9I A;  5L4H A;  4UVB B;  1WYC A;  3CVR A;  5F5W A;  4YJ2 E;  1MNE A;  4ADZ A;  2YDR A;  2RPA A;  3ETV A;  5FY7 A;  4CXX A;  3J7Y q;  5JDH A;  4DMV A;  2QA7 A;  4PJL A;  3PUG A;  4BAY B;  4UVC B;  3Q5W A;  1KNP A;  5J0Z A;  1ZHC A;  4CI1 B;  2KIN B;  1WYB A;  3P7I A;  1UGO A;  1JNR A;  1WCR A;  3AEF A;  2X0H A;  4IDN A;  4F8H A;  4IE0 A;  1GQE A;  2WY2 A;  3O1H A;  3AB3 B;  3ONX A;  5ABE A;  2DL1 A;  3AA6 B;  2ODV A;  4EYU A;  3KFW X;  1OED E;  4WNK A;  1WLX A;  3JAF A;  4HKA A;  3ZYL A;  2I0M A;  1XMQ T;  5LBM A;  4H63 V;  3T1H T;  2V7M A;  4DID B;  3SFD A;  1IJ6 A;  4HWD A;  4I0U A;  1FJG T;  3I9W A;  3RIU A;  4UV9 B;  2DWG A;  4M1P A;  4IL4 A;  4CI3 B;  2CPT A;  2DWK A;  2WS3 A;  5IYZ E;  2MPK A;  5KDM C;  3R84 B;  1E1H B;  2Q9Q C;  1U4Q A;  2YU2 A;  3UU5 A;  2ZLY A;  2LLY A;  3Q5D A;  2W66 A;  2ODU A;  5HCJ A;  5CGM A;  2XHE B;  3Q2M A;  2P9B A;  4PJN A;  2XTL A;  3EDU A;  3OKQ A;  4EXT A;  1J5E T;  2WMN A;  3AVR A;  2BBH A;  2UXX B;  2PTF A;  4F6R C;  2G0U A;  2ZM8 A;  4UXN B;  3OYX A;  5CA0 E;  3AVS A;  5HEH A;  2HPL A;  1UUR A;  1HF8 A;  2MTQ A;  3TKL B;  4AQF A;  2YIN A;  2EHO C;  2IW5 B;  4JEU B;  2X51 A;  3FXE B;  4LF5 T;  2CBI A;  2J47 A;  2H3R A;  5FY1 A;  2LSY A;  1U5P A;  1BR1 A;  3IHR A;  4OYJ A;  3ZT5 A;  2DLR A;  3JC6 C;  1HX8 A;  4TWD A;  2XQ3 A;  3M65 A;  3N9Q A;  5AQL B;  4KBM B;  1FMV A;  3IBP A;  2UXC T;  3N9P A;  4ZS2 A;  2NW9 A;  3AA7 B;  3LK4 2;  2E9X D; 
#chains in the Genus database with same CATH homology
 2LOP A;  4HN9 A;  4XBF B;  3VU7 H;  3ZCI A;  5L3B B;  5LOV E;  3ZC1 A;  4WW0 A;  2MBG A;  4H9S E;  4B6X A;  2JRK A;  4TN7 B;  2W00 A;  1MIY A;  4YFS A;  4GK0 E;  3KVA A;  2XAF B;  3FXD B;  4HEA A;  1NWM X;  1BR4 A;  2LT3 A;  4IHJ E;  2YU1 A;  2N2N A;  3QC9 A;  2CA5 A;  4ISS A;  1B7T A;  1VOM A;  2KWH A;  2H7O A;  5JR9 C;  1H7C A;  1HG5 A;  2NTY A;  3BQK A;  2E9X C;  5LP6 E;  3K3Q C;  4E7Z A;  5LGN B;  3LG7 A;  4AKL A;  5JR9 B;  4IGU A;  4EAH A;  4N78 D;  3F57 A;  5LNK A;  2A2F X;  2JMK A;  2RP4 A;  3RYH E;  4V1A v;  2K9A A;  2LHN A;  4GYR A;  3NZP A;  4EYY R;  2C5I T;  3B57 A;  4OK0 A;  3ZC0 A;  2D2S A;  3PU8 A;  4P0B A;  5AFU L;  4CI2 B;  3Q9D A;  4HE8 A;  3LFM A;  4EB6 E;  3MXZ A;  3U3I A;  3C51 A;  1YD8 G;  4UF0 A;  2DCF A;  3C64 A;  3PDY A;  4BA9 A;  3P8C D;  2A72 A;  3H37 A;  5FXX A;  4AXP A;  2KXP B;  3DP7 A;  2Q9Q A;  2NOX A;  3N2G E;  1UX4 A;  5LHI B;  1MMN A;  4JLE A;  5LG4 A;  1LRZ A;  4H9Q C;  4AKR B;  3N9M A;  3OBV E;  3RYC E;  5L3D B;  3RYI E;  1G73 A;  1HCI A;  2JQQ A;  2CLY C;  3HI2 A;  5HWY A;  3LK3 B;  4JEH B;  3SRZ A;  3EVY A;  5LHH B;  2BVM A;  4O4L E;  3I1A A;  3CX7 B;  1KK7 A;  3C4Z A;  5FXZ A;  3R6N A;  2K5B B;  3MK7 C;  3CPZ A;  2NTX A;  5HXR A;  2NP9 A;  4UVA B;  3V5S A;  3O1J A;  5HXH A;  5A1L A;  3ESL A;  4X1K E;  4WBN E;  4H63 H;  2SPC A;  4QX7 B;  3K3O A;  4IIJ E;  3AAI A;  4PK6 A;  5EK4 A;  5JDG A;  2X0L B;  2WWU A;  3ANW B;  3SWH A;  3FB2 A;  1G8X A;  1D0Y A;  1MIV A;  1LVF A;  5LBQ B;  3KDS E;  5JDL A;  2KZ7 B;  5CB4 E;  4O8S A;  4EIW A;  5L2L A;  5HXE A;  2XAQ B;  3LK2 B;  2Y48 B;  2IAK A;  3ZN0 B;  3WAJ A;  3RRW A;  4J2C A;  2ZM2 A;  4KMC A;  3CWZ B;  3NRX A;  3ZMZ B;  3N2K E;  5CA1 E;  2V7K A;  3CX6 B;  4GOU A;  4QX8 B;  2BVL A;  3RX6 A;  3KIN B;  2EHO A;  2X68 A;  3B13 A;  5FYM A;  2KMF A;  5HYA A;  4PJJ A;  3RC3 A;  1WRD A;  3U78 A;  3GN5 B;  5HXC A;  5ADX L;  2WBL A;  5FP3 A;  2ZMA A;  2LOS A;  4ZOL E;  3NRY A;  3UUL A;  2M67 A;  1X79 A;  5FY0 A;  4IE4 A;  1SA0 E;  3O9X A;  4C91 A;  3I9Y A;  3VKH A;  3CX8 B;  4AKI A;  2W0G A;  2J1D G;  5LCY A;  2VKD A;  2VK9 A;  4AKG A;  2LSG A;  2VKO A;  3ZEF B;  3ZPO A;  3KVB A;  5LJN A;  4E7S A;  3HKB E;  2X67 A;  2VKJ A;  4EOZ B;  4X20 E;  2MOZ A;  4DVD A;  3L09 A;  1QSD A;  3GWH A;  3ZJ2 A;  2LE8 A;  2UXN B;  3HKD E;  5FNV E;  5JDQ A;  2V7L A;  3ZJ1 A;  4DND A;  2NW7 A;  2N9D A;  2VB6 A;  3HR0 A;  4MAL A;  2PJQ A;  4FJO A;  3PE0 A;  3MKD A;  2LSK A;  1YKE B;  4H9N C;  2D0U A;  1YW0 A;  4L0R A;  3ZLI A;  4EZH A;  5LGU B;  2CE7 A;  1V9D A;  3L3P A;  4HFV A;  4PFP A;  3WI3 A;  2Y6X A;  4TV8 E;  4TX5 A;  5TAO A;  3VHL A;  4DBQ A;  1MMD A;  2VKH A;  2CCQ A;  3CQG B;  5L3E B;  3I0Q A;  3CML A;  5FXW A;  3ZMV B;  4ANJ A;  1CUN A;  4I43 B;  4TV9 E;  2C5J A;  4TZ4 C;  3SS1 A;  1ZV4 X;  4O4J E;  3KV4 A;  4OYK A;  2X9H A;  2N1G A;  3PUQ A;  3BQL A;  2C5K T;  2A3D A;  4IDZ A;  2QGS A;  5JR9 A;  4KUM B;  1MMA A;  2CXF A;  2E9X A;  3HKC E;  2B1E A;  3UFE A;  2LHR A;  3N9N A;  1D0X A;  4GK5 E;  4H9P C;  3NZQ A;  1EZ3 A;  2WMO A;  3C98 B;  4PFO A;  5ETW A;  5L3F B;  5J2U E;  3KV9 A;  4QXB B;  5DQW A;  2XAJ B;  2XAG B;  1HTJ F;  1D0Z A;  3KBU A;  3NBX X;  2W62 A;  3LJC A;  5LGT B;  4YJ3 E;  4PJM A;  2RA1 A;  3RH3 A;  3PUA A;  4H9O C;  2Y8D A;  3AAE B;  2LEH A;  3V5U A;  3ETU A;  1FIO A;  3UTK A;  2JPF A;  4DBR A;  5F8P A;  4AKH A;  4O2B E;  4GIW A;  2Z6E A;  3S4U A;  3C50 A;  4UF0 B;  3AA0 B;  5DAB A;  4QXC B;  2D5U A;  3PUS A;  3I0O A;  4CZZ B;  5LJM A;  2BZB A;  3HL6 A;  3N2O A;  4Z8X A;  4TUY E;  3RRC A;  3OYZ A;  5JRC A;  4IE7 A;  5LYJ E;  3ZN1 B;  2Q9Q B;  3C4X A;  5DJQ C;  4QWN B;  3UT5 E;  4A56 A;  3ZYK A;  5EK2 A;  5L3G B;  3N9L A;  3DJB A;  3DTO A;  3KBT A;  5GON E;  2KND A;  4ASK A;  3BQI A;  3FBZ A;  2X9W A;  4X1Y E;  1BR0 A;  1O3X A;  5J1G A;  4X1I E;  1YKH B;  2HPJ A;  2I59 A;  3ZMU B;  2HH7 A;  2NWB A;  2VWA A;  2IC9 A;  3ANW A;  2WSS V;  3F2E A;  5M4Y A;  4I50 E;  1IZN B;  3O1I A;  2H7V C;  1HG2 A;  2XAS B;  3CKD A;  5L3C B;  1MND A;  5J2T E;  3QK6 A;  3UUN A;  4QXH B;  5BMV E;  2NW8 A;  4QHO A;  4AQG A;  5JQG E;  3LBX B;  4AQF C;  2PG8 A;  3MZK B;  5JDM A;  2JJ9 A;  4YLH A;  4DMW A;  4ERR A;  4ZI2 D;  4L9I A;  1OWA A;  4UVB B;  3ZCJ A;  3OJA A;  4O4I E;  1WYC A;  3CVR A;  5H6R B;  3EUH A;  4CQI A;  5FMN A;  3SOL A;  4YJ2 E;  3AAA B;  3F31 A;  4BJN A;  1D1B A;  1MNE A;  4ADZ A;  3T8O A;  3ETV A;  5FY7 A;  3GN5 A;  2KLQ A;  5FXV A;  4CXX A;  3J7Y q;  4P0A A;  5JVD E;  3Q5X A;  5JDH A;  4DMV A;  2L3L A;  2QA7 A;  2XQY A;  4ZI2 C;  2V7I A;  4PJL A;  1VRB A;  3PUG A;  2EHO B;  3ZYM A;  5LHG B;  5JDN A;  2PFV A;  2V7J A;  2ZM0 A;  4UVC B;  4ZS3 A;  1ZEE A;  3Q5W A;  4BAY B;  4HTE A;  4UEM A;  1ZHC A;  2V1D B;  4CI1 B;  3N5L A;  4CXY A;  3IEE A;  4IE6 A;  2KIN B;  1WYB A;  5KX5 E;  4ZI3 C;  3H3A A;  4PW8 A;  1IAP A;  3E08 A;  3P7I A;  4O2A E;  5HAX A;  3N9O A;  4O4H E;  3C4W A;  4XZC A;  3CQX C;  1Z0P A;  4NUV A;  4IE0 A;  2ACX A;  3O1H A;  3AB3 B;  1BR2 A;  3ONX A;  2JMH A;  2BDE A;  2KT9 A;  2CWO A;  1MMG A;  3MAC A;  3AA6 B;  3RC8 A;  5EZY E;  2ODV A;  4EYU A;  3KV6 A;  3KFW X;  2LSI A;  2X66 A;  4WNK A;  2ES0 A;  4K0U A;  1QUU A;  1WLX A;  3HKE E;  4HKA A;  2YEV C;  3ZYL A;  5LBM A;  4H63 V;  1S94 A;  2WAU A;  2YK0 A;  2V7M A;  2XUE A;  4U72 A;  2GK9 A;  2Q9Q D;  2LSJ A;  5F3J A;  3MA9 A;  1S35 A;  1D1C A;  1IJ6 A;  3PU3 A;  1KNZ A;  3I9W A;  4YHJ A;  3E22 E;  3K3N A;  4MHC A;  2IC6 A;  3FHN A;  2XAH B;  4UV9 B;  2DWG A;  4M1P A;  3GMI A;  4P09 A;  5LXT E;  4CI3 B;  3QUJ A;  1NAF A;  3O4X E;  2DWK A;  5JH7 E;  5IYZ E;  2E9X B;  1MIW A;  1ZKE A;  4IE5 A;  5KDM C;  4OHF A;  3R84 B;  2OA5 A;  1E1H B;  3FBL A;  2Q9Q C;  2DHR A;  1U4Q A;  1SHZ C;  2YU2 A;  4AI6 A;  4CXW A;  5HWX A;  1AJ3 A;  1D1A A;  4XAX B;  2ZLY A;  4HGA A;  5H6Q B;  5DQV A;  4BJM A;  3MJX A;  4GYS A;  2ODU A;  3UUM A;  4IST A;  5HXS A;  4G2A A;  1Y64 B;  4JUY A;  3D0T A;  4MBQ A;  2XHE B;  4I4T E;  3RYF E;  3Q2M A;  1LKX A;  1FEW A;  1FMW A;  1US7 B;  2P9B A;  4FI5 A;  4PJN A;  4UEL A;  2LM9 A;  2XTL A;  3EDU A;  3OKQ A;  4EXT A;  3A5X A;  3EDV A;  3IF8 B;  5JRC B;  3WAK A;  5IHY A;  2WMN A;  3AVR A;  2PBI A;  2UXX B;  4KP3 C;  2L9Q A;  4F6R C;  2L8K A;  3ZMS B;  4PNI A;  2G0U A;  2VAS A;  2CLY B;  2W61 A;  2ZM8 A;  4H9R C;  4UXN B;  2WM9 A;  4U74 A;  2EHO D;  3RPU A;  2CXD A;  3OYX A;  3RKO A;  3UUX B;  5CA0 E;  2DI4 A;  3PTR B;  3K8P C;  3AVS A;  3KV5 A;  3PUR A;  5KMG P;  1IJ5 A;  3AA1 B;  2K48 A;  3LBX A;  2W63 A;  2X9Y A;  4ILU A;  1HS7 A;  1WR6 A;  3J9X 1;  2K24 A;  4EZ4 A;  2DNX A;  3W15 B;  2HPL A;  5EK3 A;  2CWY A;  3ZMT B;  1HF8 A;  2MTQ A;  3TKL B;  4AQF A;  4ZI3 D;  2MYS A;  4NUU A;  2YIN A;  2EHO C;  2IW5 B;  3JC6 D;  4JEU B;  2V26 A;  1HFA A;  2X51 A;  4ZI7 E;  4UV8 B;  4L5G A;  1T98 A;  4UIG A;  3FXE B;  4ZHQ E;  1UX5 A;  4I55 E;  2H3R A;  4MLK A;  4QKN A;  4DO0 A;  4OFZ A;  2CM0 A;  5FY1 A;  2KWI B;  2X9X A;  2LSY A;  4G63 A;  5E0O A;  5C8Y E;  4MFR A;  1U5P A;  2C0S A;  1BR1 A;  3IHR A;  5LA6 E;  4OYJ A;  2LJL A;  2E8I A;  4PK4 A;  2DLR A;  3HA4 A;  3E0Z A;  3CQC B;  1LVK A;  1OXZ A;  3JC6 C;  2CMR A;  4C90 A;  2D0T A;  1HX8 A;  2VL8 A;  3M65 A;  3N9Q A;  5JRE A;  1UCU A;  3VKG A;  4KBM B;  1FMV A;  2CXL A;  3IBP A;  3N9P A;  4ZS2 A;  2NW9 A;  3GA8 A;  4PAG A;  3AA7 B;  3BK9 A;  5JDF A;  4WBO A;  4PK5 A;  2CEA A;  3LK4 2;  2E9X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...