2VWAA

Crystal structure of a sporozoite protein essential for liver stage development of malaria parasite
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
NKINLNKPIIENKNNVDVSIKRYNNFVDIARLSIQKHFEHLSNDQKDSHVNNMEYMQKFVQGLQENRNISLSKYQENKAVMDLKYHLQKVYANYLSQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN PF13_0012
publication title Crystal Structure of Soluble Domain of Malaria Sporozoite Protein Uis3 in Complex with Lipid.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Unknown function
total genus 39
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11567 PfUIS3 Plasmodium falciparum UIS3 membrane protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1330 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vwaA00
2VWAA
chains in the Genus database with same CATH superfamily
4DO0A 4H9OC 3ABVA 1YD8G 4ILCA 4DV7T 5HXSA 2C5JA 1LRZA 4I4TE 5ABHA 2Y6XA 2ZM2A 1IBKT 1HX1B 1MMDA 1R8IA 2JRKA 5JR9B 3FBLA 2HPJA 1T7SA 4DV5T 4FI5A 3VKHA 3AEFA 2LSIA 2WM9A 4TUYE 4PFOA 1YQ4A 2V6XA 3ZKRA 1ZKEA 3FZFB 3GA8A 5AQHB 4LF6T 3F31A 5JDFA 3SS1A 1SE7A 3OYXA 2D9DA 4DR1T 2XQ7A 5LMUT 2KSRA 4OK0A 1HTJF 4CXXA 4UVCB 3K1SA 4O2AE 4PNIA 3VHLA 4K0KT 2ZM8A 2DWKA 3E08A 3PURA 5LG3A 4QWNB 3OTOT 4NPPA 1NWMX 4MBQA 2LSKA 5JQGE 5AQNB 3MA9A 3TLSA 4DV0T 5AQLB 5LMNT 4GK0E 2CMRA 1ZOYA 2CHNA 3CQXC 3AE4A 2E5LT 3F57A 5HYAA 3ZYKA 3HI2A 2XQ4A 3RKGA 2NW8A 3NBXX 2ZM0A 3FBZA 3Q5DA 4LF4T 1HNWT 2A72A 4UF0A 3FB2A 3HKEE 2AXDS 4JI2T 4KMCA 4IHJE 2YINA 1HX8A 2LSYA 3AE1A 2VQFT 3CX8B 2BG9C 1XDPA 4ANJA 4UVAB 2DLRA 1D0YA 4HGAA 3C98B 4DVDA 4PFPA 2XQ3A 4TWDA 3AECA 3J9X1 4O2BE 2ZLYA 3LDQB 2J4GA 2L3LA 3UT5E 4ZZCA 3RYFE 4GOUA 2VKHA 2VWAA 3PU3A 1AJ3A 4NXMT 3DTOA 2K24A 3N9MA 2DL1A 2VB6A 2YU2A 5JDQA 3HKCE 2ACXA 1G8XA 4QH1A 4UF0B 2XSBA 3ZYMA 5F3JA 4Z8XA 4ADZA 2I6HA 2PBIA 3KFWX 2VL8A 5AQTB 5EZYE 3F2EA 3JADA 3I9WA 1FJGT 4B3RT 1QUUA 3MZKB 2WMNA 5L3BB 2QVAA 4JI4T 3WAKA 4IL9A 3ZSSA 3RX6A 5FY7A 2HHHT 4HFDA 4WYVA 1MIVA 2X0HA 5HEGA 2ODVA 4EV6A 2KT9A 2XQAA 4OX9T 5AQKB 3TLUA 3ZEFB 3PUAA 3P4PA 1Z8UA 3EHZA 4CN4A 2VK9A 5H6QB 4IDPA 3MK7C 2LJLA 2Z6EA 3CWZB 1S94A 4I50E 2IIUA 4UV8B 2UU9T 4DR5T 4YJ3E 4QXBB 1FIOA 2EHOD 3NZQA 4X1YE 2H7OA 5FXXA 2RP4A 2BG9E 4KI0F 5HWXA 3N9NA 2E9XA 2IUBA 5EK4A 3CX6B 2WWVA 2UUBT 4YHHT 2JQ9A 3ESLA 5HEJA 3AAAB 4X66T 4L9IA 1ZP0A 5FXZA 4JI7T 3ZCIA 4ZI3C 4NUVA 5LJNA 1OEDA 4UR9A 1V9DA 5HCMA 3OVUA 5LGTB 3ZCJA 4LMJA 2C0SA 4H9PC 2V7JA 4G2AA 2NTYA 1VRBA 3SOLA 5LBMA 4X1IE 1T72A 2BS3A 3CMLA 1HF8A 2YDQA 4IE6A 2OLTA 5LHIB 2HN1A 3AVRA 4X62T 1N34T 2R6GF 3LFMA 3RIFA 2E9XB 2V7MA 3TLTA 1YXRA 5H6RB 5JVDE 2UXDT 3RIUA 5JTGA 2V7LA 3QB5A 4JI0T 3AE5A 1OXZA 5F5WA 4H63H 3KINB 4DR2T 2AE9A 2JQHA 3RF1A 5FL1A 2K48A 2CWYA 4MLKA 3MXZA 3R6NA 2QGSA 2WWUA 3MACA 3N9OA 2PFVA 4EXTA 2XTLA 3ZSTA 1D1BA 1BR4A 3UUXB 3SRZA 2QRXA 2BKNA 5FP3A 2YK0A 5AQIB 2Y8DA 2NOXA 3C4WA 4GYSA 2BBHA 4EAHA 4UVBB 3AEDA 1HS7A 2XM1A 4TWFA 3PDYA 2JMHA 2YDRA 5JDHA 4ILUA 4JYAT 5AQQB 2XAQB 4LFCT 1T98A 5LGUB 3KV6A 3UU5A 2N1GA 3EVYA 1HG2A 3ONLC 4ZI3D 3K8PC 5AQSB 2W62A 3RQWA 1KK7A 5LA6E 4JBWF 1NAFA 3KVAA 2X67A 4HFVA 3JAFA 3T1YT 1D1CA 4EEDA 1Y64B 2M6BA 5HXRA 3AA0B 3U78A 3P50A 1IBMT 1WRDA 4ERRA 1NENA 4AKRB 3FZHB 3PUVF 4ZXLA 2VKDA 3NVOA 3PUZF 3ZC0A 4CI2B 1XMOT 3FHNA 4U33A 4HN9A 1WCRA 3UUBA 3L3PA 5JR9C 4LF5T 1WR6A 2V7KA 3OKQA 3PUGA 2HH7A 5L47A 3N2KE 5ADXL 1SA0E 3M3ZB 2XQ6A 4YTMA 3H3MA 1FMVA 2IAKA 2RPAA 2DWGA 4K0UA 3K3NA 4TV9E 3PJAJ 5CA1E 4ZOLE 4KHZF 3GMIA 4HWIB 5AQRB 2Q9QB 2C5IT 2XZEA 4DUZT 5L3GB 4X64T 2XJ7A 1N32T 4KBMB 5L3EB 3UQ4A 4KX6A 5TAOA 4YLHA 4OFZA 5JRCA 5E0OA 4O4IE 2YOEA 4HEAA 1Y01A 2N9DA 2NR4A 3LK3B 2CBIA 3AEEA 2JQQA 2RA1A 4AKIA 3AAIA 1UGOA 2X9HA 2VKOA 4MHCA 3BQLA 4FJOA 3TLVA 1LVKA 2LOPA 3JAEA 3N2OA 5BR8T 4DNDA 4B3TT 4PK6A 4WBNE 2WY2A 5LG4A 2N2NA 4JI3T 5AFUL 3UU4A 4U3CA 4I55E 4I0UA 2SPCA 5IHYA 5DQWA 3PUQA 2LSJA 5JRCB 1LVFA 4EB6E 3K3QC 2CLYB 2WBLA 4QX8B 5HEOA 1MNEA 4OHFA 2KMFA 4JUYA 4ZS2A 4A5XA 3VRBA 4EYUA 4M1PA 4X20E 2VKJA 4TWHA 2W00A 4DBRA 4CQIA 3GWHA 1UCUA 4WNKA 2MOZA 5J2UE 3N9LA 3N5LA 5AQJB 5AQFB 5DQVA 3ZMVB 1M62A 3CKDA 1WYBA 3LK42 3I9YA 2JMKA 3ZLIA 4A98A 1W9RA 5HXCA 1UUSA 5LBQB 3ZC1A 1W0AA 1MNDA 4HFBA 3H3AA 4JI1T 4ZS3A 3AXJA 5AQOB 3K3OA 1JNRA 1I6ZA 2CRBA 3B13A 1G73A 3ETVA 4IREA 4ZZBA 4ILAA 5LP6E 4QH4A 3CQCB 2X0YA 2KNDA 4AKHA 3KVBA 3KDSE 1E2AA 2E2AA 2BG9A 1M7KA 4AXPA 2V5CA 2EHOA 4DIDB 5CJ5A 5CB4E 3OBVE 4YSYA 2CBJA 1WR0A 3HKDE 3CIRA 2MPKA 2LRKA 4QX7B 1SHZC 4LFBT 1IAPA 4TZ4C 4U2YA 5CA0E 2X9XA 4Z91A 3PUSA 3OJAA 1J5ET 5IWAT 3ZJ1A 3EABA 4IE7A 3PJAA 3NKZA 3CK6A 2H3RA 3VKGA 5LXTE 5ABGA 3EUHA 4HTEA 4DR7T 3FZKB 4X5TA 4XAXB 3PU8A 4ZI2C 4CN6A 3O4XE 3VR8A 3ZT7A 2BG9B 1D0ZA 3ONXA 2V26A 3ZT5A 4YFSA 3EI0A 1UX5A 3AA1B 3B5MA 3AE7A 2EHOB 3IBPA 5LJMA 1OWAA 2V6YA 2WDRA 2XQ8A 4HWDA 4AIUA 2VQET 4P0BA 1D0XA 2X0LB 3CQGB 3ZT6A 2LKHA 2LHRA 2XAHB 4TX5A 3P7IA 4YHJA 1FMWA 3FZMB 2ES0A 2KLQA 2G0UA 4JI6T 4H9NC 2H88A 3OPCA 4IE5A 3RH3A 3I1AA 4AQFA 2BBJA 2IDOB 5FXWA 4IDNA 2CM0A 2ACZA 4HWHA 2CPTA 3HL6A 2MAWA 4WBOA 3RPUA 4QHOA 1US7B 4EIWA 3I0QA 1XDOA 2V5DA 5L4EA 1J1JA 4H9RC 1S35A 1BR2A 4YSXA 1DU2A 2K3WA 5FNVE 1O3XA 5FMNA 5HXHA 5LHGB 4PW8A 2M6IA 1KNZA 5JREA 2BS4A 3BQKA 4MFRA 4P0AA 4PK4A 4F8HA 3UULA 4LF8T 5GONE 2LOSA 4H9SE 1VCSA 4ILBA 2E8IA 2W66A 2H89A 4DV1T 3EAMA 4YSZA 1H7CA 1W0BA 3BK9A 3C64A 4DUYT 3P4QA 2UXNB 3RYHE 1WLXA 3RRCA 3JC6C 4F6RC 4ZI2D 2YEVC 3LSVA 4COFA 2WU5A 3UU3A 2XSAA 1BR0A 4IIJE 4QXCB 4U7YA 3ZN0B 2KWHA 2WZIA 4NXNT 1CUNA 4HFEA 1J5WA 4CXWA 5FKYA 3RI5A 4IE0A 5AQPB 1XNQT 2A9UA 1OEDB 4P1NA 2D0UA 5AQGB 5FVLA 4JEHB 3PV0F 4U7IA 2NW9A 5JDNA 3SFDA 2W2UA 4U74A 4A97A 4X65T 2V1DB 3ZMUB 4GIWA 4IGUA 4DMVA 1W09A 4O4JE 4LMLA 2LSGA 2XUEA 3RC8A 4B6XA 1EZ3A 3RHWA 3ZN1B 3ZMZB 3AB3B 4BJMA 1XNRT 2B1EA 2LM9A 4WZXA 4GKJT 1LKXA 2DHRA 4NUUA 3J7Yq 3KV9A 2XQ9A 3IF8B 2KINB 5A1LA 1N33T 4ZI7E 3UUMA 2Q9QC 5HCJA 3AE3A 3ZJ2A 3AEGA 1QLBA 3TKLB 2IHR1 2M67A 5HEHA 3WAJA 4L5GA 2X68A 3DP7A 4C91A 5CFBA 3L39A 2X9WA 1WYCA 3JC6D 3P8CD 4IDOA 3M65A 1E1HB 5KX5E 2BKPA 4LF9T 4DR6T 1VCTA 4ZEYA 4AI6A 5CGMA 5FXVA 4B3MT 3AE8A 2XASB 4O8SA 4TNWA 2CE7A 2X51A 4E7ZA 5IYZE 3O9XA 1KNPA 2KXPB 4EYYR 2CEAA 3FZLB 4WW0A 3UU6A 3C4XA 4YT0A 2W0GA 4HWCA 3UU8A 3RYCE 2L9QA 3D0TA 3NWIA 2YDSA 4JLEA 1UX4A 2MYSA 3HR0A 4DV6T 1D1AA 3AA7B 3PUYF 1X79A 3QK6A 3AEBA 4HKAA 2WQYA 3QB5K 2VASA 5J0ZA 2D2SA 2CLYC 3CX7B 1FEWA 1X9BA 3IHRA 3O1IA 4O4HE 4PJNA 4BAYB 2CA5A 4V1Av 1ZEEA 2IMLA 3FXEB 3AAEB 5EK2A 5JH7E 5ETWA 3UFEA 2DNXA 2WB5A 2D0TA 3Q5XA 5LCYA 1YKEB 3ANWA 2X9YA 4H9QC 5L4HA 4ZHQE 2Q9QD 3Q5WA 3TLWA 1QSDA 4DR4T 3MKDA 4DMWA 2WAUA 2WS3A 3KBUA 1HG5A 4PAGA 4LFAT 3W15B 1ZHCA 1UURA 3KBTA 3PTRB 3V5UA 3X1DA 3AE9A 4A56A 4CZZB 3C50A 5KDMC 5FY1A 3O1JA 4N78D 4NIQA 3GN5A 1CHUA 2H7VC 5AQMB 1ZV4X 3PE0A 3V5SA 5L2LA 4U72A 3ZMTB 2UXXB 3S4UA 5F8PA 1XWMA 2P9BA 4HWFA 4UXNB 1KF6A 5LHHB 4JV5T 4HFHA 4KP3C 3QOFA 4IDZA 3RC3A 3ANWB 2L8KA 3N9PA 2XAJB 2UXCT 2IC9A 2JQKA 2ODUA 2J47A 2J62A 3H37A 4L0RA 2MTQA 1MMGA 1T8BA 4P09A 3VR9A 2DI4A 5JDLA 4EZ4A 5IUXA 2J1DG 1U4QA 3L8RA 2KZ7B 2K5BB 2WMOA 3LG7A 3QNUA 2CXFA 3GN5B 2UXBT 2GK9A 2XQ5A 3AE2A 2QA7A 4PJMA 1Z0PA 3SFEA 3AEAA 4UEMA 4AKLA 4IE4A 2PJQA 2JPFA 3LBXA 2VVNA 1E7PA 2CHOA 2EHOC 3AA6B 3OYZA 1IZNB 3EDUA 4J2CA 1L0VA 1UK5A 3KV5A 3E22E 5FY0A 2KWIB 2XM2A 2CXLA 2LE8A 2ZMAA 3A5XA 4TV8E 1XZYA 4CXYA 4IDQA 1HCIA 4YXDA 2JJ9A 5HXEA 2B76A 3R84B 3QC9A 2OA5A 4AISA 3SWHA 4U2ZA 4MALA 3AXJB 2C5KT 3AE6A 2XHEB 3T8OA 4XZCA 4KHPT 1YW0A 3P4RA 2FJBA 4O4LE 4JI8T 2A2FX 5C8YE 3IEEA 5DABA 4GK5E 4AKGA 3LK2B 5HEUA 4C90A 2LM2A 2PTFA 4HE8A 3RGLA 1VOMA 1MMNA 3HA4A 3UFGA 2D5UA 3ZMSB 3LBXB 2XY8B 2LHNA 2HN2A 4QKNA 2XQYA 4PJLA 3NRYA 5HWYA 1B7TA 2NWBA 5L3FB 3UQ7A 5JDGA 1BR1A 2W67A 4KUMB 4EEBA 1HFAA 2Y48B 3L09A 2YKSA 4BJNA 2CCQA 3C4ZA 2IW5B 2FJDA 3P4WA 2UUCT 5HAXA 3Q2MA 2BZBA 2NW7A 2WSSV 2YU1A 1IBLT 4UV9B 4AQFC 4UELA 4YJ2E 2E9XC 2FJEA 4PK5A 1HR0T 3UTKA 2K9AA 5C3JA 4IT4A 2LLYA 4G63A 2WZHA 4CI1B 2BS2A 3RYIE 5ABEA 2XAFB 2PG8A 2V6YB 3IA3A 3ZYLA 3KV4A 1OEDC 3RQUA 4ISTA 2WU2A 2W63A 3RKOA 1SUMB 4EOZB 4QH5A 5FYMA 2HPLA 2OV9A 3G06A 5L3CB 3BQIA 4PJJA 4DV2T 2I59A 2CWOA 4ISSA 1HNZT 1HNXT 2BVLA 1N36T 2ZM6T 3RLFF 2VVSA 3VU7H 3E0ZA 4X1KE 4CN1A 3MJXA 2QYWA 2XAGB 3I0OA 5LOVE 4QXHB 2LKGA 3C51A 3B57A 4Q25A 4U31A 5FVKA 5C2TA 2VL0A 3P4SA 4OYJA 3RIUC 1MIWA 4JEUB 4LMKA 4XBFB 5LB7B 4OYKA 3Q5EA 4Z90A 2VURA 4YTPA 2MBGA 2LRLA 5KXJA 2CXDA 2I0MA 3AVSA 5L3DB 2FJAA 4B3ST 2BVMA 1MMAA 3O1HA 2V8SV 3RRWA 2E9XD 4HFCA 3A8YC 3A7MA 4TNVA 5JDMA 5EK3A 3JCFA 2X66A 2YN6A 4UIGA 2XPKA 4YTNA 2W4XA 4DV4T 4E7SA 5J2TE 3U3IA 4AQYT 3EDVA 3NZPA 4GYRA 1XMQT 3DJBA 5BMVE 4I43B 1KEYA 5J1GA 2NP9A 5ABFA 2WCAA 3PUXF 5KMGP 2F4VT 2W61A 1OEDE 3UUNA 4CI3B 2WP9A 3NRXA 1KFYA 4H63V 2JIWA 4EGWA 2Q9QA 1JNZA 3RIAA 3ZPOA 1U5PA 5M4YA 5AQVB 3FXDB 5LYJE 3ETUA 2UUAT 1GQEA 3CPZA 2NTXA 3WI3A 3QUJA 1I94T 1YQ3A 3N2GE 2LEHA 5AQUB 4TN7B 3CVRA 4HFIA 4LF7T 2FBWA 1WFDA 2IC6A 4GKKT 2V7IA 1IJ6A 4BA9A 1IJ5A 2WDQA 5JR9A 3Q9DA 4DR3T 2A3DA 4DBQA 2BKOA 3ONJA 3N9QA 2LT3A 1MIYA 2WDVA 5FL0A 4DV3T 2DCFA 5ABFB 3PUWF 3T1HT 5DJQC 3VRAA 2E5VA 4IL4A 4ASKA 5LGNB 2BDEA 3HKBE 4AQGA 5LNKA 4EZHA 1NEKA 1YKHB 4YY3T 1KNRA 3LJCA 4JI5T 2FUPA
chains in the Genus database with same CATH topology
4EXTA 4IE5A 2GK9A 2XTLA 4DO0A 3RH3A 2QA7A 4PJMA 3I1AA 1D1BA 1BR4A 4AQFA 4H9OC 3SRZA 3UUXB 5FXWA 1Z0PA 2CM0A 5FP3A 1YD8G 2YK0A 3HL6A 2Y8DA 4WBOA 2NOXA 3C4WA 3RPUA 4GYSA 5HXSA 2C5JA 1LRZA 4QHOA 4I4TE 4UEMA 1US7B 2Y6XA 4EAHA 2ZM2A 3I0QA 4EIWA 4UVBB 4AKLA 1MMDA 4IE4A 2PJQA 2JPFA 1HS7A 3LBXA 4H9RC 2JRKA 3PDYA 2EHOC 2JMHA 1S35A 5JR9B 5JDHA 1BR2A 3AA6B 4ILUA 3OYZA 2XAQB 1IZNB 3FBLA 3EDUA 4J2CA 3KV5A 2HPJA 3E22E 5FY0A 1T98A 2KWIB 4FI5A 5LGUB 3VKHA 3KV6A 2LSIA 1O3XA 2WM9A 4TUYE 2CXLA 5FMNA 5FNVE 2LE8A 2ZMAA 5HXHA 5LHGB 2N1GA 3EVYA 4PFOA 3A5XA 1HG2A 3GN5B 4ZI3D 3K8PC 4PW8A 1ZKEA 3GA8A 1KNZA 5JREA 2W62A 4TV8E 3BQKA 1KK7A 4CXYA 4MFRA 3F31A 1HCIA 5JDFA 4PK4A 2JJ9A 5LA6E 4P0AA 3UULA 3SS1A 3OYXA 5HXEA 5GONE 3R84B 2LOSA 1NAFA 3KVAA 2X67A 4H9SE 4HFVA 3QC9A 4OK0A 2OA5A 1D1CA 1HTJF 1Y64B 2E8IA 3SWHA 5HXRA 3AA0B 4MALA 4CXXA 3U78A 1WRDA 4ERRA 4UVCB 4O2AE 2C5KT 4PNIA 1H7CA 3BK9A 4AKRB 3VHLA 3C64A 2XHEB 3T8OA 4XZCA 2UXNB 3RYHE 1WLXA 1YW0A 3RRCA 2ZM8A 2VKDA 3JC6C 4O4LE 3ZC0A 4CI2B 2DWKA 3E08A 3PURA 2A2FX 3FHNA 5C8YE 4HN9A 3IEEA 4F6RC 5DABA 4GK5E 4QWNB 4AKGA 4ZI2D 3LK2B 3L3PA 5JR9C 2YEVC 4C90A 1NWMX 4MBQA 2LSKA 1WR6A 4HE8A 5JQGE 2V7KA 3OKQA 3PUGA 1VOMA 2HH7A 3MA9A 1MMNA 3N2KE 5ADXL 3HA4A 4GK0E 1SA0E 2CMRA 2D5UA 3ZMSB 3LBXB 1BR0A 2LHNA 4IIJE 3CQXC 4QKNA 4QXCB 2XQYA 4PJLA 3NRYA 3F57A 3ZN0B 2KWHA 5HWYA 1B7TA 2NWBA 5HYAA 1FMVA 2IAKA 5L3FB 3ZYKA 1CUNA 5JDGA 1BR1A 3HI2A 4CXWA 2DWGA 4KUMB 1HFAA 2Y48B 4K0UA 3K3NA 3L09A 4TV9E 4BJNA 4IE0A 5CA1E 2NW8A 3NBXX 2ZM0A 4ZOLE 3GMIA 3FBZA 2Q9QB 2D0UA 2C5IT 2CCQA 3C4ZA 4JEHB 2IW5B 2NW9A 5L3GB 5JDNA 2A72A 4UF0A 3FB2A 5HAXA 3HKEE 3Q2MA 4KBMB 2BZBA 2NW7A 4U74A 5L3EB 2WSSV 4KMCA 2YU1A 4UV9B 4IHJE 5TAOA 4AQFC 2YINA 4YLHA 4OFZA 5JRCA 5E0OA 1HX8A 4O4IE 2LSYA 4HEAA 4UELA 2V1DB 3ZMUB 4YJ2E 2N9DA 4GIWA 2E9XC 4IGUA 4DMVA 4PK5A 3CX8B 3LK3B 4O4JE 3UTKA 2JQQA 2K9AA 4ANJA 2RA1A 4UVAB 4AKIA 2DLRA 4G63A 2LSGA 1D0YA 4HGAA 2XUEA 3AAIA 3RC8A 4B6XA 4CI1B 3C98B 4DVDA 3RYIE 1EZ3A 4PFPA 3ZN1B 3ZMZB 3AB3B 4BJMA 2X9HA 2B1EA 2LM9A 2XAFB 3J9X1 2PG8A 2VKOA 4O2BE 1LKXA 2ZLYA 4MHCA 2DHRA 4NUUA 3J7Yq 3BQLA 3KV9A 3ZYLA 4FJOA 3IF8B 2L3LA 2KINB 3UT5E 5A1LA 3RYFE 3KV4A 4ZI7E 3UUMA 2Q9QC 1LVKA 2LOPA 4ISTA 3N2OA 2W63A 4GOUA 3ZJ2A 3RKOA 2VKHA 4EOZB 3TKLB 2VWAA 5FYMA 2HPLA 2M67A 3PU3A 1AJ3A 3DTOA 4DNDA 2K24A 3N9MA 4PK6A 5L3CB 2VB6A 4WBNE 3WAJA 3BQIA 4PJJA 2YU2A 4L5GA 5JDQA 2X68A 3DP7A 2I59A 2CWOA 4ISSA 3HKCE 5LG4A 2ACXA 4C91A 2N2NA 1G8XA 2BVLA 5AFUL 4UF0B 3ZYMA 5F3JA 2X9WA 1WYCA 3JC6D 3P8CD 3M65A 4Z8XA 4ADZA 4I55E 2PBIA 3KFWX 1E1HB 2VL8A 2SPCA 3VU7H 5IHYA 5EZYE 3F2EA 5DQWA 3PUQA 3E0ZA 5KX5E 2LSJA 5JRCB 1LVFA 4EB6E 3K3QC 3I9WA 4X1KE 3MJXA 2CLYB 2XAGB 3I0OA 4AI6A 5LOVE 4QXHB 5FXVA 1QUUA 3MZKB 3C51A 2WMNA 3B57A 2WBLA 5L3BB 4QX8B 2XASB 4O8SA 1MNEA 4OHFA 3WAKA 2CE7A 2X51A 2KMFA 4JUYA 4ZS2A 3RX6A 5FY7A 4OYJA 4EYUA 1MIWA 4E7ZA 5IYZE 3O9XA 4M1PA 4X20E 4JEUB 2KXPB 2VKJA 4EYYR 2CEAA 1MIVA 2W00A 4DBRA 4WW0A 4CQIA 3C4XA 3GWHA 2W0GA 1UCUA 4WNKA 2MOZA 5J2UE 4XBFB 2ODVA 3N9LA 4OYKA 2KT9A 3RYCE 3N5LA 2L9QA 5DQVA 3ZMVB 2MBGA 3CKDA 3D0TA 4JLEA 1WYBA 3LK42 2CXDA 1UX4A 3ZEFB 3I9YA 2MYSA 2JMKA 3ZLIA 3HR0A 3PUAA 5HXCA 1D1AA 3AA7B 1X79A 3AVSA 5L3DB 2BVMA 2VK9A 5LBQB 3ZC1A 5H6QB 1MMAA 3QK6A 1MNDA 4HKAA 3H3AA 3MK7C 3O1HA 2VASA 2LJLA 3RRWA 2E9XD 2D2SA 2CLYC 3CX7B 1FEWA 3IHRA 4ZS3A 2Z6EA 3CWZB 1S94A 3O1IA 4O4HE 4PJNA 4I50E 4BAYB 4UV8B 2CA5A 4V1Av 5JDMA 3K3OA 1ZEEA 4QXBB 4YJ3E 5EK3A 1FIOA 2EHOD 2X66A 3FXEB 3NZQA 4UIGA 4X1YE 2H7OA 3AAEB 5FXXA 3B13A 2RP4A 5EK2A 1G73A 4E7SA 5J2TE 5JH7E 3U3IA 5ETWA 3ETVA 5LP6E 5HWXA 3UFEA 2DNXA 3N9NA 3CQCB 2E9XA 2D0TA 2KNDA 3CX6B 5EK4A 3Q5XA 5LCYA 4AKHA 3EDVA 1YKEB 3KDSE 3KVBA 3NZPA 3ANWA 2X9YA 4H9QC 4GYRA 3DJBA 4AXPA 2Q9QD 4ZHQE 3Q5WA 5BMVE 4I43B 2EHOA 1QSDA 3ESLA 5J1GA 3AAAB 2NP9A 3OBVE 5CB4E 3MKDA 3HKDE 5KMGP 4L9IA 2W61A 4DMWA 4QX7B 2WAUA 1SHZC 3UUNA 4CI3B 5FXZA 1IAPA 3NRXA 3ZCIA 4ZI3C 3KBUA 4TZ4C 1HG5A 4PAGA 4H63V 3W15B 1ZHCA 3KBTA 3PTRB 4NUVA 3V5UA 5CA0E 5LJNA 4A56A 2X9XA 2Q9QA 1V9DA 4CZZB 3ZPOA 3C50A 1U5PA 5M4YA 3PUSA 3FXDB 5LGTB 3OJAA 5KDMC 3ZCJA 2C0SA 5FY1A 4H9PC 2V7JA 3O1JA 3ZJ1A 4N78D 4IE7A 3ETUA 5LYJE 4G2AA 3GN5A 3CPZA 2H7VC 2NTXA 3WI3A 1VRBA 2NTYA 1ZV4X 3QUJA 3PE0A 2H3RA 3SOLA 5LBMA 3N2GE 2LEHA 3V5SA 4X1IE 5L2LA 4TN7B 3CVRA 4U72A 3VKGA 3ZMTB 3CMLA 2UXXB 3S4UA 1HF8A 2IC6A 4IE6A 5F8PA 5LXTE 2P9BA 5LHIB 4UXNB 3EUHA 3AVRA 5LHHB 4HTEA 2V7IA 1IJ6A 4BA9A 1IJ5A 3LFMA 4KP3C 5JR9A 3Q9DA 4IDZA 4XAXB 3PU8A 4ZI2C 3RC3A 2E9XB 2A3DA 4DBQA 2V7MA 3O4XE 3ANWB 2L8KA 1D0ZA 3N9PA 3ONXA 2V26A 3N9QA 2LT3A 2XAJB 1MIYA 5H6RB 2IC9A 4YFSA 1UX5A 3AA1B 2EHOB 3IBPA 5LJMA 5JVDE 1OWAA 2ODUA 2V7LA 2DCFA 3H37A 4L0RA 1OXZA 2MTQA 4H63H 1MMGA 4P09A 5DJQC 3KINB 2DI4A 4P0BA 1D0XA 5JDLA 2X0LB 4EZ4A 3CQGB 2J1DG 1U4QA 2LHRA 2XAHB 2K48A 4TX5A 2CWYA 3P7IA 4ASKA 4MLKA 4YHJA 2KZ7B 2BDEA 3HKBE 1FMWA 3MXZA 4AQGA 5LGNB 5LNKA 2K5BB 2ES0A 2WMOA 3LG7A 2KLQA 2QGSA 2G0UA 3R6NA 4EZHA 1YKHB 2WWUA 3MACA 4H9NC 3N9OA 3LJCA 2CXFA 2PFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWA A; 
#chains in the Genus database with same CATH topology
 4DO0 A;  4H9O C;  3ABV A;  1YD8 G;  4ILC A;  4DV7 T;  5HXS A;  2C5J A;  1LRZ A;  4I4T E;  5ABH A;  2Y6X A;  2ZM2 A;  1IBK T;  1HX1 B;  1MMD A;  1R8I A;  2JRK A;  5JR9 B;  3FBL A;  2HPJ A;  1T7S A;  4DV5 T;  4FI5 A;  3VKH A;  3AEF A;  2LSI A;  2WM9 A;  4TUY E;  4PFO A;  1YQ4 A;  2V6X A;  3ZKR A;  1ZKE A;  3FZF B;  3GA8 A;  5AQH B;  4LF6 T;  3F31 A;  5JDF A;  3SS1 A;  1SE7 A;  3OYX A;  2D9D A;  4DR1 T;  2XQ7 A;  5LMU T;  2KSR A;  4OK0 A;  1HTJ F;  4CXX A;  4UVC B;  3K1S A;  4O2A E;  4PNI A;  3VHL A;  4K0K T;  2ZM8 A;  2DWK A;  3E08 A;  3PUR A;  5LG3 A;  4QWN B;  3OTO T;  4NPP A;  1NWM X;  4MBQ A;  2LSK A;  5JQG E;  5AQN B;  3MA9 A;  3TLS A;  4DV0 T;  5AQL B;  5LMN T;  4GK0 E;  2CMR A;  1ZOY A;  2CHN A;  3CQX C;  3AE4 A;  2E5L T;  3F57 A;  5HYA A;  3ZYK A;  3HI2 A;  2XQ4 A;  3RKG A;  2NW8 A;  3NBX X;  2ZM0 A;  3FBZ A;  3Q5D A;  4LF4 T;  1HNW T;  2A72 A;  4UF0 A;  3FB2 A;  3HKE E;  2AXD S;  4JI2 T;  4KMC A;  4IHJ E;  2YIN A;  1HX8 A;  2LSY A;  3AE1 A;  2VQF T;  3CX8 B;  2BG9 C;  1XDP A;  4ANJ A;  4UVA B;  2DLR A;  1D0Y A;  4HGA A;  3C98 B;  4DVD A;  4PFP A;  2XQ3 A;  4TWD A;  3AEC A;  3J9X 1;  4O2B E;  2ZLY A;  3LDQ B;  2J4G A;  2L3L A;  3UT5 E;  4ZZC A;  3RYF E;  4GOU A;  2VKH A;  2VWA A;  3PU3 A;  1AJ3 A;  4NXM T;  3DTO A;  2K24 A;  3N9M A;  2DL1 A;  2VB6 A;  2YU2 A;  5JDQ A;  3HKC E;  2ACX A;  1G8X A;  4QH1 A;  4UF0 B;  2XSB A;  3ZYM A;  5F3J A;  4Z8X A;  4ADZ A;  2I6H A;  2PBI A;  3KFW X;  2VL8 A;  5AQT B;  5EZY E;  3F2E A;  3JAD A;  3I9W A;  1FJG T;  4B3R T;  1QUU A;  3MZK B;  2WMN A;  5L3B B;  2QVA A;  4JI4 T;  3WAK A;  4IL9 A;  3ZSS A;  3RX6 A;  5FY7 A;  2HHH T;  4HFD A;  4WYV A;  1MIV A;  2X0H A;  5HEG A;  2ODV A;  4EV6 A;  2KT9 A;  2XQA A;  4OX9 T;  5AQK B;  3TLU A;  3ZEF B;  3PUA A;  3P4P A;  1Z8U A;  3EHZ A;  4CN4 A;  2VK9 A;  5H6Q B;  4IDP A;  3MK7 C;  2LJL A;  2Z6E A;  3CWZ B;  1S94 A;  4I50 E;  2IIU A;  4UV8 B;  2UU9 T;  4DR5 T;  4YJ3 E;  4QXB B;  1FIO A;  2EHO D;  3NZQ A;  4X1Y E;  2H7O A;  5FXX A;  2RP4 A;  2BG9 E;  4KI0 F;  5HWX A;  3N9N A;  2E9X A;  2IUB A;  5EK4 A;  3CX6 B;  2WWV A;  2UUB T;  4YHH T;  2JQ9 A;  3ESL A;  5HEJ A;  3AAA B;  4X66 T;  4L9I A;  1ZP0 A;  5FXZ A;  4JI7 T;  3ZCI A;  4ZI3 C;  4NUV A;  5LJN A;  1OED A;  4UR9 A;  1V9D A;  5HCM A;  3OVU A;  5LGT B;  3ZCJ A;  4LMJ A;  2C0S A;  4H9P C;  2V7J A;  4G2A A;  2NTY A;  1VRB A;  3SOL A;  5LBM A;  4X1I E;  1T72 A;  2BS3 A;  3CML A;  1HF8 A;  2YDQ A;  4IE6 A;  2OLT A;  5LHI B;  2HN1 A;  3AVR A;  4X62 T;  1N34 T;  2R6G F;  3LFM A;  3RIF A;  2E9X B;  2V7M A;  3TLT A;  1YXR A;  5H6R B;  5JVD E;  2UXD T;  3RIU A;  5JTG A;  2V7L A;  3QB5 A;  4JI0 T;  3AE5 A;  1OXZ A;  5F5W A;  4H63 H;  3KIN B;  4DR2 T;  2AE9 A;  2JQH A;  3RF1 A;  5FL1 A;  2K48 A;  2CWY A;  4MLK A;  3MXZ A;  3R6N A;  2QGS A;  2WWU A;  3MAC A;  3N9O A;  2PFV A;  4EXT A;  2XTL A;  3ZST A;  1D1B A;  1BR4 A;  3UUX B;  3SRZ A;  2QRX A;  2BKN A;  5FP3 A;  2YK0 A;  5AQI B;  2Y8D A;  2NOX A;  3C4W A;  4GYS A;  2BBH A;  4EAH A;  4UVB B;  3AED A;  1HS7 A;  2XM1 A;  4TWF A;  3PDY A;  2JMH A;  2YDR A;  5JDH A;  4ILU A;  4JYA T;  5AQQ B;  2XAQ B;  4LFC T;  1T98 A;  5LGU B;  3KV6 A;  3UU5 A;  2N1G A;  3EVY A;  1HG2 A;  3ONL C;  4ZI3 D;  3K8P C;  5AQS B;  2W62 A;  3RQW A;  1KK7 A;  5LA6 E;  4JBW F;  1NAF A;  3KVA A;  2X67 A;  4HFV A;  3JAF A;  3T1Y T;  1D1C A;  4EED A;  1Y64 B;  2M6B A;  5HXR A;  3AA0 B;  3U78 A;  3P50 A;  1IBM T;  1WRD A;  4ERR A;  1NEN A;  4AKR B;  3FZH B;  3PUV F;  4ZXL A;  2VKD A;  3NVO A;  3PUZ F;  3ZC0 A;  4CI2 B;  1XMO T;  3FHN A;  4U33 A;  4HN9 A;  1WCR A;  3UUB A;  3L3P A;  5JR9 C;  4LF5 T;  1WR6 A;  2V7K A;  3OKQ A;  3PUG A;  2HH7 A;  5L47 A;  3N2K E;  5ADX L;  1SA0 E;  3M3Z B;  2XQ6 A;  4YTM A;  3H3M A;  1FMV A;  2IAK A;  2RPA A;  2DWG A;  4K0U A;  3K3N A;  4TV9 E;  3PJA J;  5CA1 E;  4ZOL E;  4KHZ F;  3GMI A;  4HWI B;  5AQR B;  2Q9Q B;  2C5I T;  2XZE A;  4DUZ T;  5L3G B;  4X64 T;  2XJ7 A;  1N32 T;  4KBM B;  5L3E B;  3UQ4 A;  4KX6 A;  5TAO A;  4YLH A;  4OFZ A;  5JRC A;  5E0O A;  4O4I E;  2YOE A;  4HEA A;  1Y01 A;  2N9D A;  2NR4 A;  3LK3 B;  2CBI A;  3AEE A;  2JQQ A;  2RA1 A;  4AKI A;  3AAI A;  1UGO A;  2X9H A;  2VKO A;  4MHC A;  3BQL A;  4FJO A;  3TLV A;  1LVK A;  2LOP A;  3JAE A;  3N2O A;  5BR8 T;  4DND A;  4B3T T;  4PK6 A;  4WBN E;  2WY2 A;  5LG4 A;  2N2N A;  4JI3 T;  5AFU L;  3UU4 A;  4U3C A;  4I55 E;  4I0U A;  2SPC A;  5IHY A;  5DQW A;  3PUQ A;  2LSJ A;  5JRC B;  1LVF A;  4EB6 E;  3K3Q C;  2CLY B;  2WBL A;  4QX8 B;  5HEO A;  1MNE A;  4OHF A;  2KMF A;  4JUY A;  4ZS2 A;  4A5X A;  3VRB A;  4EYU A;  4M1P A;  4X20 E;  2VKJ A;  4TWH A;  2W00 A;  4DBR A;  4CQI A;  3GWH A;  1UCU A;  4WNK A;  2MOZ A;  5J2U E;  3N9L A;  3N5L A;  5AQJ B;  5AQF B;  5DQV A;  3ZMV B;  1M62 A;  3CKD A;  1WYB A;  3LK4 2;  3I9Y A;  2JMK A;  3ZLI A;  4A98 A;  1W9R A;  5HXC A;  1UUS A;  5LBQ B;  3ZC1 A;  1W0A A;  1MND A;  4HFB A;  3H3A A;  4JI1 T;  4ZS3 A;  3AXJ A;  5AQO B;  3K3O A;  1JNR A;  1I6Z A;  2CRB A;  3B13 A;  1G73 A;  3ETV A;  4IRE A;  4ZZB A;  4ILA A;  5LP6 E;  4QH4 A;  3CQC B;  2X0Y A;  2KND A;  4AKH A;  3KVB A;  3KDS E;  1E2A A;  2E2A A;  2BG9 A;  1M7K A;  4AXP A;  2V5C A;  2EHO A;  4DID B;  5CJ5 A;  5CB4 E;  3OBV E;  4YSY A;  2CBJ A;  1WR0 A;  3HKD E;  3CIR A;  2MPK A;  2LRK A;  4QX7 B;  1SHZ C;  4LFB T;  1IAP A;  4TZ4 C;  4U2Y A;  5CA0 E;  2X9X A;  4Z91 A;  3PUS A;  3OJA A;  1J5E T;  5IWA T;  3ZJ1 A;  3EAB A;  4IE7 A;  3PJA A;  3NKZ A;  3CK6 A;  2H3R A;  3VKG A;  5LXT E;  5ABG A;  3EUH A;  4HTE A;  4DR7 T;  3FZK B;  4X5T A;  4XAX B;  3PU8 A;  4ZI2 C;  4CN6 A;  3O4X E;  3VR8 A;  3ZT7 A;  2BG9 B;  1D0Z A;  3ONX A;  2V26 A;  3ZT5 A;  4YFS A;  3EI0 A;  1UX5 A;  3AA1 B;  3B5M A;  3AE7 A;  2EHO B;  3IBP A;  5LJM A;  1OWA A;  2V6Y A;  2WDR A;  2XQ8 A;  4HWD A;  4AIU A;  2VQE T;  4P0B A;  1D0X A;  2X0L B;  3CQG B;  3ZT6 A;  2LKH A;  2LHR A;  2XAH B;  4TX5 A;  3P7I A;  4YHJ A;  1FMW A;  3FZM B;  2ES0 A;  2KLQ A;  2G0U A;  4JI6 T;  4H9N C;  2H88 A;  3OPC A;  4IE5 A;  3RH3 A;  3I1A A;  4AQF A;  2BBJ A;  2IDO B;  5FXW A;  4IDN A;  2CM0 A;  2ACZ A;  4HWH A;  2CPT A;  3HL6 A;  2MAW A;  4WBO A;  3RPU A;  4QHO A;  1US7 B;  4EIW A;  3I0Q A;  1XDO A;  2V5D A;  5L4E A;  1J1J A;  4H9R C;  1S35 A;  1BR2 A;  4YSX A;  1DU2 A;  2K3W A;  5FNV E;  1O3X A;  5FMN A;  5HXH A;  5LHG B;  4PW8 A;  2M6I A;  1KNZ A;  5JRE A;  2BS4 A;  3BQK A;  4MFR A;  4P0A A;  4PK4 A;  4F8H A;  3UUL A;  4LF8 T;  5GON E;  2LOS A;  4H9S E;  1VCS A;  4ILB A;  2E8I A;  2W66 A;  2H89 A;  4DV1 T;  3EAM A;  4YSZ A;  1H7C A;  1W0B A;  3BK9 A;  3C64 A;  4DUY T;  3P4Q A;  2UXN B;  3RYH E;  1WLX A;  3RRC A;  3JC6 C;  4F6R C;  4ZI2 D;  2YEV C;  3LSV A;  4COF A;  2WU5 A;  3UU3 A;  2XSA A;  1BR0 A;  4IIJ E;  4QXC B;  4U7Y A;  3ZN0 B;  2KWH A;  2WZI A;  4NXN T;  1CUN A;  4HFE A;  1J5W A;  4CXW A;  5FKY A;  3RI5 A;  4IE0 A;  5AQP B;  1XNQ T;  2A9U A;  1OED B;  4P1N A;  2D0U A;  5AQG B;  5FVL A;  4JEH B;  3PV0 F;  4U7I A;  2NW9 A;  5JDN A;  3SFD A;  2W2U A;  4U74 A;  4A97 A;  4X65 T;  2V1D B;  3ZMU B;  4GIW A;  4IGU A;  4DMV A;  1W09 A;  4O4J E;  4LML A;  2LSG A;  2XUE A;  3RC8 A;  4B6X A;  1EZ3 A;  3RHW A;  3ZN1 B;  3ZMZ B;  3AB3 B;  4BJM A;  1XNR T;  2B1E A;  2LM9 A;  4WZX A;  4GKJ T;  1LKX A;  2DHR A;  4NUU A;  3J7Y q;  3KV9 A;  2XQ9 A;  3IF8 B;  2KIN B;  5A1L A;  1N33 T;  4ZI7 E;  3UUM A;  2Q9Q C;  5HCJ A;  3AE3 A;  3ZJ2 A;  3AEG A;  1QLB A;  3TKL B;  2IHR 1;  2M67 A;  5HEH A;  3WAJ A;  4L5G A;  2X68 A;  3DP7 A;  4C91 A;  5CFB A;  3L39 A;  2X9W A;  1WYC A;  3JC6 D;  3P8C D;  4IDO A;  3M65 A;  1E1H B;  5KX5 E;  2BKP A;  4LF9 T;  4DR6 T;  1VCT A;  4ZEY A;  4AI6 A;  5CGM A;  5FXV A;  4B3M T;  3AE8 A;  2XAS B;  4O8S A;  4TNW A;  2CE7 A;  2X51 A;  4E7Z A;  5IYZ E;  3O9X A;  1KNP A;  2KXP B;  4EYY R;  2CEA A;  3FZL B;  4WW0 A;  3UU6 A;  3C4X A;  4YT0 A;  2W0G A;  4HWC A;  3UU8 A;  3RYC E;  2L9Q A;  3D0T A;  3NWI A;  2YDS A;  4JLE A;  1UX4 A;  2MYS A;  3HR0 A;  4DV6 T;  1D1A A;  3AA7 B;  3PUY F;  1X79 A;  3QK6 A;  3AEB A;  4HKA A;  2WQY A;  3QB5 K;  2VAS A;  5J0Z A;  2D2S A;  2CLY C;  3CX7 B;  1FEW A;  1X9B A;  3IHR A;  3O1I A;  4O4H E;  4PJN A;  4BAY B;  2CA5 A;  4V1A v;  1ZEE A;  2IML A;  3FXE B;  3AAE B;  5EK2 A;  5JH7 E;  5ETW A;  3UFE A;  2DNX A;  2WB5 A;  2D0T A;  3Q5X A;  5LCY A;  1YKE B;  3ANW A;  2X9Y A;  4H9Q C;  5L4H A;  4ZHQ E;  2Q9Q D;  3Q5W A;  3TLW A;  1QSD A;  4DR4 T;  3MKD A;  4DMW A;  2WAU A;  2WS3 A;  3KBU A;  1HG5 A;  4PAG A;  4LFA T;  3W15 B;  1ZHC A;  1UUR A;  3KBT A;  3PTR B;  3V5U A;  3X1D A;  3AE9 A;  4A56 A;  4CZZ B;  3C50 A;  5KDM C;  5FY1 A;  3O1J A;  4N78 D;  4NIQ A;  3GN5 A;  1CHU A;  2H7V C;  5AQM B;  1ZV4 X;  3PE0 A;  3V5S A;  5L2L A;  4U72 A;  3ZMT B;  2UXX B;  3S4U A;  5F8P A;  1XWM A;  2P9B A;  4HWF A;  4UXN B;  1KF6 A;  5LHH B;  4JV5 T;  4HFH A;  4KP3 C;  3QOF A;  4IDZ A;  3RC3 A;  3ANW B;  2L8K A;  3N9P A;  2XAJ B;  2UXC T;  2IC9 A;  2JQK A;  2ODU A;  2J47 A;  2J62 A;  3H37 A;  4L0R A;  2MTQ A;  1MMG A;  1T8B A;  4P09 A;  3VR9 A;  2DI4 A;  5JDL A;  4EZ4 A;  5IUX A;  2J1D G;  1U4Q A;  3L8R A;  2KZ7 B;  2K5B B;  2WMO A;  3LG7 A;  3QNU A;  2CXF A;  3GN5 B;  2UXB T;  2GK9 A;  2XQ5 A;  3AE2 A;  2QA7 A;  4PJM A;  1Z0P A;  3SFE A;  3AEA A;  4UEM A;  4AKL A;  4IE4 A;  2PJQ A;  2JPF A;  3LBX A;  2VVN A;  1E7P A;  2CHO A;  2EHO C;  3AA6 B;  3OYZ A;  1IZN B;  3EDU A;  4J2C A;  1L0V A;  1UK5 A;  3KV5 A;  3E22 E;  5FY0 A;  2KWI B;  2XM2 A;  2CXL A;  2LE8 A;  2ZMA A;  3A5X A;  4TV8 E;  1XZY A;  4CXY A;  4IDQ A;  1HCI A;  4YXD A;  2JJ9 A;  5HXE A;  2B76 A;  3R84 B;  3QC9 A;  2OA5 A;  4AIS A;  3SWH A;  4U2Z A;  4MAL A;  3AXJ B;  2C5K T;  3AE6 A;  2XHE B;  3T8O A;  4XZC A;  4KHP T;  1YW0 A;  3P4R A;  2FJB A;  4O4L E;  4JI8 T;  2A2F X;  5C8Y E;  3IEE A;  5DAB A;  4GK5 E;  4AKG A;  3LK2 B;  5HEU A;  4C90 A;  2LM2 A;  2PTF A;  4HE8 A;  3RGL A;  1VOM A;  1MMN A;  3HA4 A;  3UFG A;  2D5U A;  3ZMS B;  3LBX B;  2XY8 B;  2LHN A;  2HN2 A;  4QKN A;  2XQY A;  4PJL A;  3NRY A;  5HWY A;  1B7T A;  2NWB A;  5L3F B;  3UQ7 A;  5JDG A;  1BR1 A;  2W67 A;  4KUM B;  4EEB A;  1HFA A;  2Y48 B;  3L09 A;  2YKS A;  4BJN A;  2CCQ A;  3C4Z A;  2IW5 B;  2FJD A;  3P4W A;  2UUC T;  5HAX A;  3Q2M A;  2BZB A;  2NW7 A;  2WSS V;  2YU1 A;  1IBL T;  4UV9 B;  4AQF C;  4UEL A;  4YJ2 E;  2E9X C;  2FJE A;  4PK5 A;  1HR0 T;  3UTK A;  2K9A A;  5C3J A;  4IT4 A;  2LLY A;  4G63 A;  2WZH A;  4CI1 B;  2BS2 A;  3RYI E;  5ABE A;  2XAF B;  2PG8 A;  2V6Y B;  3IA3 A;  3ZYL A;  3KV4 A;  1OED C;  3RQU A;  4IST A;  2WU2 A;  2W63 A;  3RKO A;  1SUM B;  4EOZ B;  4QH5 A;  5FYM A;  2HPL A;  2OV9 A;  3G06 A;  5L3C B;  3BQI A;  4PJJ A;  4DV2 T;  2I59 A;  2CWO A;  4ISS A;  1HNZ T;  1HNX T;  2BVL A;  1N36 T;  2ZM6 T;  3RLF F;  2VVS A;  3VU7 H;  3E0Z A;  4X1K E;  4CN1 A;  3MJX A;  2QYW A;  2XAG B;  3I0O A;  5LOV E;  4QXH B;  2LKG A;  3C51 A;  3B57 A;  4Q25 A;  4U31 A;  5FVK A;  5C2T A;  2VL0 A;  3P4S A;  4OYJ A;  3RIU C;  1MIW A;  4JEU B;  4LMK A;  4XBF B;  5LB7 B;  4OYK A;  3Q5E A;  4Z90 A;  2VUR A;  4YTP A;  2MBG A;  2LRL A;  5KXJ A;  2CXD A;  2I0M A;  3AVS A;  5L3D B;  2FJA A;  4B3S T;  2BVM A;  1MMA A;  3O1H A;  2V8S V;  3RRW A;  2E9X D;  4HFC A;  3A8Y C;  3A7M A;  4TNV A;  5JDM A;  5EK3 A;  3JCF A;  2X66 A;  2YN6 A;  4UIG A;  2XPK A;  4YTN A;  2W4X A;  4DV4 T;  4E7S A;  5J2T E;  3U3I A;  4AQY T;  3EDV A;  3NZP A;  4GYR A;  1XMQ T;  3DJB A;  5BMV E;  4I43 B;  1KEY A;  5J1G A;  2NP9 A;  5ABF A;  2WCA A;  3PUX F;  5KMG P;  2F4V T;  2W61 A;  1OED E;  3UUN A;  4CI3 B;  2WP9 A;  3NRX A;  1KFY A;  4H63 V;  2JIW A;  4EGW A;  2Q9Q A;  1JNZ A;  3RIA A;  3ZPO A;  1U5P A;  5M4Y A;  5AQV B;  3FXD B;  5LYJ E;  3ETU A;  2UUA T;  1GQE A;  3CPZ A;  2NTX A;  3WI3 A;  3QUJ A;  1I94 T;  1YQ3 A;  3N2G E;  2LEH A;  5AQU B;  4TN7 B;  3CVR A;  4HFI A;  4LF7 T;  2FBW A;  1WFD A;  2IC6 A;  4GKK T;  2V7I A;  1IJ6 A;  4BA9 A;  1IJ5 A;  2WDQ A;  5JR9 A;  3Q9D A;  4DR3 T;  2A3D A;  4DBQ A;  2BKO A;  3ONJ A;  3N9Q A;  2LT3 A;  1MIY A;  2WDV A;  5FL0 A;  4DV3 T;  2DCF A;  5ABF B;  3PUW F;  3T1H T;  5DJQ C;  3VRA A;  2E5V A;  4IL4 A;  4ASK A;  5LGN B;  2BDE A;  3HKB E;  4AQG A;  5LNK A;  4EZH A;  1NEK A;  1YKH B;  4YY3 T;  1KNR A;  3LJC A;  4JI5 T;  2FUP A; 
#chains in the Genus database with same CATH homology
 4EXT A;  4IE5 A;  2GK9 A;  2XTL A;  4DO0 A;  3RH3 A;  2QA7 A;  4PJM A;  3I1A A;  1D1B A;  1BR4 A;  4AQF A;  4H9O C;  3SRZ A;  3UUX B;  5FXW A;  1Z0P A;  2CM0 A;  5FP3 A;  1YD8 G;  2YK0 A;  3HL6 A;  2Y8D A;  4WBO A;  2NOX A;  3C4W A;  3RPU A;  4GYS A;  5HXS A;  2C5J A;  1LRZ A;  4QHO A;  4I4T E;  4UEM A;  1US7 B;  2Y6X A;  4EAH A;  2ZM2 A;  3I0Q A;  4EIW A;  4UVB B;  4AKL A;  1MMD A;  4IE4 A;  2PJQ A;  2JPF A;  1HS7 A;  3LBX A;  4H9R C;  2JRK A;  3PDY A;  2EHO C;  2JMH A;  1S35 A;  5JR9 B;  5JDH A;  1BR2 A;  3AA6 B;  4ILU A;  3OYZ A;  2XAQ B;  1IZN B;  3FBL A;  3EDU A;  4J2C A;  3KV5 A;  2HPJ A;  3E22 E;  5FY0 A;  1T98 A;  2KWI B;  4FI5 A;  5LGU B;  3VKH A;  3KV6 A;  2LSI A;  1O3X A;  2WM9 A;  4TUY E;  2CXL A;  5FMN A;  5FNV E;  2LE8 A;  2ZMA A;  5HXH A;  5LHG B;  2N1G A;  3EVY A;  4PFO A;  3A5X A;  1HG2 A;  3GN5 B;  4ZI3 D;  3K8P C;  4PW8 A;  1ZKE A;  3GA8 A;  1KNZ A;  5JRE A;  2W62 A;  4TV8 E;  3BQK A;  1KK7 A;  4CXY A;  4MFR A;  3F31 A;  1HCI A;  5JDF A;  4PK4 A;  2JJ9 A;  5LA6 E;  4P0A A;  3UUL A;  3SS1 A;  3OYX A;  5HXE A;  5GON E;  3R84 B;  2LOS A;  1NAF A;  3KVA A;  2X67 A;  4H9S E;  4HFV A;  3QC9 A;  4OK0 A;  2OA5 A;  1D1C A;  1HTJ F;  1Y64 B;  2E8I A;  3SWH A;  5HXR A;  3AA0 B;  4MAL A;  4CXX A;  3U78 A;  1WRD A;  4ERR A;  4UVC B;  4O2A E;  2C5K T;  4PNI A;  1H7C A;  3BK9 A;  4AKR B;  3VHL A;  3C64 A;  2XHE B;  3T8O A;  4XZC A;  2UXN B;  3RYH E;  1WLX A;  1YW0 A;  3RRC A;  2ZM8 A;  2VKD A;  3JC6 C;  4O4L E;  3ZC0 A;  4CI2 B;  2DWK A;  3E08 A;  3PUR A;  2A2F X;  3FHN A;  5C8Y E;  4HN9 A;  3IEE A;  4F6R C;  5DAB A;  4GK5 E;  4QWN B;  4AKG A;  4ZI2 D;  3LK2 B;  3L3P A;  5JR9 C;  2YEV C;  4C90 A;  1NWM X;  4MBQ A;  2LSK A;  1WR6 A;  4HE8 A;  5JQG E;  2V7K A;  3OKQ A;  3PUG A;  1VOM A;  2HH7 A;  3MA9 A;  1MMN A;  3N2K E;  5ADX L;  3HA4 A;  4GK0 E;  1SA0 E;  2CMR A;  2D5U A;  3ZMS B;  3LBX B;  1BR0 A;  2LHN A;  4IIJ E;  3CQX C;  4QKN A;  4QXC B;  2XQY A;  4PJL A;  3NRY A;  3F57 A;  3ZN0 B;  2KWH A;  5HWY A;  1B7T A;  2NWB A;  5HYA A;  1FMV A;  2IAK A;  5L3F B;  3ZYK A;  1CUN A;  5JDG A;  1BR1 A;  3HI2 A;  4CXW A;  2DWG A;  4KUM B;  1HFA A;  2Y48 B;  4K0U A;  3K3N A;  3L09 A;  4TV9 E;  4BJN A;  4IE0 A;  5CA1 E;  2NW8 A;  3NBX X;  2ZM0 A;  4ZOL E;  3GMI A;  3FBZ A;  2Q9Q B;  2D0U A;  2C5I T;  2CCQ A;  3C4Z A;  4JEH B;  2IW5 B;  2NW9 A;  5L3G B;  5JDN A;  2A72 A;  4UF0 A;  3FB2 A;  5HAX A;  3HKE E;  3Q2M A;  4KBM B;  2BZB A;  2NW7 A;  4U74 A;  5L3E B;  2WSS V;  4KMC A;  2YU1 A;  4UV9 B;  4IHJ E;  5TAO A;  4AQF C;  2YIN A;  4YLH A;  4OFZ A;  5JRC A;  5E0O A;  1HX8 A;  4O4I E;  2LSY A;  4HEA A;  4UEL A;  2V1D B;  3ZMU B;  4YJ2 E;  2N9D A;  4GIW A;  2E9X C;  4IGU A;  4DMV A;  4PK5 A;  3CX8 B;  3LK3 B;  4O4J E;  3UTK A;  2JQQ A;  2K9A A;  4ANJ A;  2RA1 A;  4UVA B;  4AKI A;  2DLR A;  4G63 A;  2LSG A;  1D0Y A;  4HGA A;  2XUE A;  3AAI A;  3RC8 A;  4B6X A;  4CI1 B;  3C98 B;  4DVD A;  3RYI E;  1EZ3 A;  4PFP A;  3ZN1 B;  3ZMZ B;  3AB3 B;  4BJM A;  2X9H A;  2B1E A;  2LM9 A;  2XAF B;  3J9X 1;  2PG8 A;  2VKO A;  4O2B E;  1LKX A;  2ZLY A;  4MHC A;  2DHR A;  4NUU A;  3J7Y q;  3BQL A;  3KV9 A;  3ZYL A;  4FJO A;  3IF8 B;  2L3L A;  2KIN B;  3UT5 E;  5A1L A;  3RYF E;  3KV4 A;  4ZI7 E;  3UUM A;  2Q9Q C;  1LVK A;  2LOP A;  4IST A;  3N2O A;  2W63 A;  4GOU A;  3ZJ2 A;  3RKO A;  2VKH A;  4EOZ B;  3TKL B;  2VWA A;  5FYM A;  2HPL A;  2M67 A;  3PU3 A;  1AJ3 A;  3DTO A;  4DND A;  2K24 A;  3N9M A;  4PK6 A;  5L3C B;  2VB6 A;  4WBN E;  3WAJ A;  3BQI A;  4PJJ A;  2YU2 A;  4L5G A;  5JDQ A;  2X68 A;  3DP7 A;  2I59 A;  2CWO A;  4ISS A;  3HKC E;  5LG4 A;  2ACX A;  4C91 A;  2N2N A;  1G8X A;  2BVL A;  5AFU L;  4UF0 B;  3ZYM A;  5F3J A;  2X9W A;  1WYC A;  3JC6 D;  3P8C D;  3M65 A;  4Z8X A;  4ADZ A;  4I55 E;  2PBI A;  3KFW X;  1E1H B;  2VL8 A;  2SPC A;  3VU7 H;  5IHY A;  5EZY E;  3F2E A;  5DQW A;  3PUQ A;  3E0Z A;  5KX5 E;  2LSJ A;  5JRC B;  1LVF A;  4EB6 E;  3K3Q C;  3I9W A;  4X1K E;  3MJX A;  2CLY B;  2XAG B;  3I0O A;  4AI6 A;  5LOV E;  4QXH B;  5FXV A;  1QUU A;  3MZK B;  3C51 A;  2WMN A;  3B57 A;  2WBL A;  5L3B B;  4QX8 B;  2XAS B;  4O8S A;  1MNE A;  4OHF A;  3WAK A;  2CE7 A;  2X51 A;  2KMF A;  4JUY A;  4ZS2 A;  3RX6 A;  5FY7 A;  4OYJ A;  4EYU A;  1MIW A;  4E7Z A;  5IYZ E;  3O9X A;  4M1P A;  4X20 E;  4JEU B;  2KXP B;  2VKJ A;  4EYY R;  2CEA A;  1MIV A;  2W00 A;  4DBR A;  4WW0 A;  4CQI A;  3C4X A;  3GWH A;  2W0G A;  1UCU A;  4WNK A;  2MOZ A;  5J2U E;  4XBF B;  2ODV A;  3N9L A;  4OYK A;  2KT9 A;  3RYC E;  3N5L A;  2L9Q A;  5DQV A;  3ZMV B;  2MBG A;  3CKD A;  3D0T A;  4JLE A;  1WYB A;  3LK4 2;  2CXD A;  1UX4 A;  3ZEF B;  3I9Y A;  2MYS A;  2JMK A;  3ZLI A;  3HR0 A;  3PUA A;  5HXC A;  1D1A A;  3AA7 B;  1X79 A;  3AVS A;  5L3D B;  2BVM A;  2VK9 A;  5LBQ B;  3ZC1 A;  5H6Q B;  1MMA A;  3QK6 A;  1MND A;  4HKA A;  3H3A A;  3MK7 C;  3O1H A;  2VAS A;  2LJL A;  3RRW A;  2E9X D;  2D2S A;  2CLY C;  3CX7 B;  1FEW A;  3IHR A;  4ZS3 A;  2Z6E A;  3CWZ B;  1S94 A;  3O1I A;  4O4H E;  4PJN A;  4I50 E;  4BAY B;  4UV8 B;  2CA5 A;  4V1A v;  5JDM A;  3K3O A;  1ZEE A;  4QXB B;  4YJ3 E;  5EK3 A;  1FIO A;  2EHO D;  2X66 A;  3FXE B;  3NZQ A;  4UIG A;  4X1Y E;  2H7O A;  3AAE B;  5FXX A;  3B13 A;  2RP4 A;  5EK2 A;  1G73 A;  4E7S A;  5J2T E;  5JH7 E;  3U3I A;  5ETW A;  3ETV A;  5LP6 E;  5HWX A;  3UFE A;  2DNX A;  3N9N A;  3CQC B;  2E9X A;  2D0T A;  2KND A;  3CX6 B;  5EK4 A;  3Q5X A;  5LCY A;  4AKH A;  3EDV A;  1YKE B;  3KDS E;  3KVB A;  3NZP A;  3ANW A;  2X9Y A;  4H9Q C;  4GYR A;  3DJB A;  4AXP A;  2Q9Q D;  4ZHQ E;  3Q5W A;  5BMV E;  4I43 B;  2EHO A;  1QSD A;  3ESL A;  5J1G A;  3AAA B;  2NP9 A;  3OBV E;  5CB4 E;  3MKD A;  3HKD E;  5KMG P;  4L9I A;  2W61 A;  4DMW A;  4QX7 B;  2WAU A;  1SHZ C;  3UUN A;  4CI3 B;  5FXZ A;  1IAP A;  3NRX A;  3ZCI A;  4ZI3 C;  3KBU A;  4TZ4 C;  1HG5 A;  4PAG A;  4H63 V;  3W15 B;  1ZHC A;  3KBT A;  3PTR B;  4NUV A;  3V5U A;  5CA0 E;  5LJN A;  4A56 A;  2X9X A;  2Q9Q A;  1V9D A;  4CZZ B;  3ZPO A;  3C50 A;  1U5P A;  5M4Y A;  3PUS A;  3FXD B;  5LGT B;  3OJA A;  5KDM C;  3ZCJ A;  2C0S A;  5FY1 A;  4H9P C;  2V7J A;  3O1J A;  3ZJ1 A;  4N78 D;  4IE7 A;  3ETU A;  5LYJ E;  4G2A A;  3GN5 A;  3CPZ A;  2H7V C;  2NTX A;  3WI3 A;  1VRB A;  2NTY A;  1ZV4 X;  3QUJ A;  3PE0 A;  2H3R A;  3SOL A;  5LBM A;  3N2G E;  2LEH A;  3V5S A;  4X1I E;  5L2L A;  4TN7 B;  3CVR A;  4U72 A;  3VKG A;  3ZMT B;  3CML A;  2UXX B;  3S4U A;  1HF8 A;  2IC6 A;  4IE6 A;  5F8P A;  5LXT E;  2P9B A;  5LHI B;  4UXN B;  3EUH A;  3AVR A;  5LHH B;  4HTE A;  2V7I A;  1IJ6 A;  4BA9 A;  1IJ5 A;  3LFM A;  4KP3 C;  5JR9 A;  3Q9D A;  4IDZ A;  4XAX B;  3PU8 A;  4ZI2 C;  3RC3 A;  2E9X B;  2A3D A;  4DBQ A;  2V7M A;  3O4X E;  3ANW B;  2L8K A;  1D0Z A;  3N9P A;  3ONX A;  2V26 A;  3N9Q A;  2LT3 A;  2XAJ B;  1MIY A;  5H6R B;  2IC9 A;  4YFS A;  1UX5 A;  3AA1 B;  2EHO B;  3IBP A;  5LJM A;  5JVD E;  1OWA A;  2ODU A;  2V7L A;  2DCF A;  3H37 A;  4L0R A;  1OXZ A;  2MTQ A;  4H63 H;  1MMG A;  4P09 A;  5DJQ C;  3KIN B;  2DI4 A;  4P0B A;  1D0X A;  5JDL A;  2X0L B;  4EZ4 A;  3CQG B;  2J1D G;  1U4Q A;  2LHR A;  2XAH B;  2K48 A;  4TX5 A;  2CWY A;  3P7I A;  4ASK A;  4MLK A;  4YHJ A;  2KZ7 B;  2BDE A;  3HKB E;  1FMW A;  3MXZ A;  4AQG A;  5LGN B;  5LNK A;  2K5B B;  2ES0 A;  2WMO A;  3LG7 A;  2KLQ A;  2QGS A;  2G0U A;  3R6N A;  4EZH A;  1YKH B;  2WWU A;  3MAC A;  4H9N C;  3N9O A;  3LJC A;  2CXF A;  2PFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...