2VWAA

Crystal structure of a sporozoite protein essential for liver stage development of malaria parasite
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
b'NKINLNKPIIENKNNVDVSIKRYNNFVDIARLSIQKHFEHLSNDQKDSHVNNMEYMQKFVQGLQENRNISLSKYQENKAVMDLKYHLQKVYANYLSQEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN PF13_0012
molecule tags Unknown function
source organism Plasmodium falciparum
publication title Crystal Structure of Soluble Domain of Malaria Sporozoite Protein Uis3 in Complex with Lipid.
pubmed doi rcsb
total genus 39
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11567 PfUIS3 Plasmodium falciparum UIS3 membrane protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1330 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vwaA00
2VWAA
chains in the Genus database with same CATH superfamily
3LBXA 4OYJA 3EAMA 4WYVA 4AKGA 3CQCB 4IIJE 3QB5K 4ZS3A 3SOLA 1SUMB 3P4PA 3KV5A 2YINA 4Q25A 1FIOA 2ZM8A 4NUVA 1T98A 4EZ4A 4DV3T 4DR1T 4GOUA 4PJJA 2N9DA 3N2GE 5LMNT 3IF8B 3AE4A 3KVBA 1T8BA 3NZPA 3PDYA 4IL9A 3UFEA 4NPPA 3ZT7A 3F2EA 3OJAA 4YTPA 2VQFT 2VVSA 5LG4A 4UV9B 3RQWA 3RIUA 3MACA 2PTFA 3AA0B 5FKYA 3WI3A 2VASA 4WW0A 2Y48B 2K3WA 3RYCE 3SFDA 2LHRA 4EOZB 4YTNA 1XWMA 3AAIA 3P50A 5JDLA 3RIAA 3KV4A 5BR8T 1HX1B 2JIWA 2W62A 4U7IA 4TX5A 4YLHA 2NTXA 2QGSA 2X9HA 3RYFE 2XQ5A 3B13A 1UK5A 4TUYE 2WMOA 3KBUA 4X62T 2CHNA 2CLYC 2BDEA 4MALA 3AVSA 3R6NA 4PFOA 4YSZA 4JI7T 4JEUB 3UU5A 5J2TE 1MMDA 1T72A 4KI0F 2KWHA 2IAKA 2W63A 5L4HA 4ZZBA 2W61A 5LHGB 2QYWA 3T1HT 2LHNA 4IL4A 3LK2B 1OXZA 4GK5E 4L0RA 4U7YA 2DNXA 5IYZE 4AIUA 4AI6A 2LRLA 3TLWA 4YHJA 3AB3B 3DJBA 4HWFA 2W2UA 4DV4T 2V7LA 4A98A 5LGNB 4GKKT 4CN1A 2K48A 2WM9A 4ZI7E 4QHOA 2LEHA 2RA1A 3MZKB 3L8RA 3ZKRA 4LFAT 4UVCB 5HXHA 2V7IA 4ZI3D 2CBIA 2FJBA 3CMLA 1WR6A 3ZYKA 5LGUB 1OWAA 4J2CA 3ZCIA 5FXZA 1W9RA 3NKZA 4HFEA 3PUWF 4ZZCA 3ZMVB 2BVMA 3ZSSA 3RC3A 4EEBA 4YTMA 2DI4A 2E9XB 3NRYA 1MIYA 3PUVF 2WZIA 3EDUA 2YOEA 4LMJA 3LDQB 3L39A 5FXXA 5L3BB 4NIQA 3UUBA 4B3RT 3O1HA 3LG7A 3VR9A 2VKOA 2CXDA 2XAHB 3O1IA 2CA5A 5JQGE 5IHYA 2XAJB 4KHZF 4EZHA 1J5ET 1OEDA 3OPCA 3NRXA 4H9NC 4YT0A 3O9XA 3RKOA 4OX9T 3H3AA 3JCFA 4LF8T 2KT9A 2Q9QC 1SA0E 2JMHA 2LKHA 3DP7A 3GN5B 4TV9E 3RPUA 2LOSA 2Q9QD 3RKGA 2DHRA 2L9QA 4O2AE 1MMAA 4DBQA 1W0AA 1UX5A 1KK7A 2FBWA 3C4WA 5GONE 2ES0A 4JI2T 2I59A 3AE5A 4HFDA 3UU6A 2D9DA 4JEHB 3ZCJA 4ADZA 4HFIA 5L2LA 4Z91A 4HWHA 2BVLA 1WR0A 1YQ3A 2XASB 3OYZA 4CZZB 2VL0A 1US7B 1E7PA 3AEGA 4ZI3C 3I9WA 5KDMC 4PK5A 1M7KA 2PG8A 5EK2A 3JAEA 3JAFA 5HEOA 2QRXA 2G0UA 2LT3A 3J9X1 3BQKA 4TWFA 1MIWA 2X9XA 3CX7B 4X1YE 5HWYA 3FZHB 4WBOA 3ZLIA 3W15B 2CWOA 1I94T 5AQHB 1E1HB 1ZKEA 3FZMB 2MAWA 4IE7A 4AISA 2BG9A 1VOMA 2C0SA 2WAUA 4DV1T 4IGUA 2N2NA 2VB6A 2ZM0A 2V26A 2XTLA 3JADA 1NEKA 4FI5A 3AE8A 3KV6A 4TNWA 3PJAA 1M62A 4IE6A 4UXNB 3RH3A 2UUBT 2V7MA 4LF9T 1ZP0A 3VKGA 4H9PC 5CGMA 3UUMA 5LHIB 4K0UA 4NXNT 2W0GA 4QH5A 2LJLA 3ANWA 2J62A 3AAAB 3AXJA 3Q5WA 2D2SA 2KWIB 5L3DB 2IUBA 4JI3T 3G06A 2A9UA 1D0ZA 1EZ3A 5FMNA 4JI8T 4DV5T 2E9XC 2C5IT 4JUYA 4O2BE 5AQJB 4HFBA 2IC6A 3HA4A 3QUJA 3HR0A 2W00A 4XZCA 5FYMA 2W67A 1AJ3A 4DV0T 3U3IA 1G73A 1Y01A 2V7JA 4IE0A 2M67A 3AEBA 2A3DA 3KV9A 3UT5E 2P9BA 2ZMAA 3KFWX 3LSVA 4ISTA 4IHJE 4PFPA 3E22E 3JC6C 4XBFB 4ILAA 1D1CA 3AA7B 5L3CB 5JR9B 4NUUA 2CEAA 1HX8A 2VK9A 3I0OA 5JR9A 3P4QA 4B3MT 4DV2T 4B3ST 1UX4A 4UVAB 4YY3T 3K3OA 3VR8A 3ZT6A 2EHOB 3UQ7A 5LGTB 2UUCT 3L3PA 2H88A 5ABFB 1MNEA 2LSKA 4H63H 4LMLA 3X1DA 3ZT5A 4ZXLA 2Z6EA 3RRCA 4P0AA 2YDQA 4I55E 4P0BA 2D5UA 3CWZB 5AQTB 1IJ5A 4KP3C 2J4GA 3P4SA 5HAXA 1NWMX 3PUGA 2BKPA 5J2UE 3ZN1B 4JI1T 3RI5A 5TAOA 4O4LE 1YD8G 4CN4A 3OTOT 4QH4A 2D0TA 1GQEA 2XQ3A 2JPFA 3OKQA 4O4HE 1NAFA 3UUNA 2NW7A 3A5XA 1HNZT 3WAKA 2XSBA 4AXPA 4QXHB 4ANJA 2JRKA 4LMKA 2KNDA 3A8YC 2ODUA 3VHLA 2JQHA 5LJNA 4JI0T 5KX5E 2XQ8A 2X0YA 4GIWA 2WWUA 4DR4T 3N2KE 5BMVE 2DL1A 2JJ9A 2WU2A 2MTQA 2MYSA 3AE7A 3M65A 3PUXF 4WNKA 2DWKA 3P8CD 4KUMB 3K1SA 2R6GF 3LK42 2IC9A 4EV6A 2XY8B 2UU9T 3AXJB 2E5LT 2WB5A 4A5XA 3CKDA 1ZV4X 2CPTA 3HKBE 4A97A 5JDNA 5J0ZA 4YSYA 3C51A 1HS7A 2H7OA 4ZS2A 4CXWA 2KLQA 3RGLA 2QA7A 4AKHA 3ANWB 2PJQA 2C5KT 1FMVA 3N9OA 2LLYA 2KINB 5AQQB 4HTEA 1N36T 1WFDA 1WYCA 2LE8A 4U2YA 2HH7A 3FZKB 4U3CA 4U33A 2XJ7A 3N9NA 4U72A 4X5TA 4PK6A 3WAJA 1W09A 2XHEB 1S94A 1BR0A 5HEGA 3CK6A 2BBHA 2XUEA 1N33T 2J47A 5JREA 3IBPA 2I0MA 4I0UA 4HWDA 1I6ZA 3EI0A 4COFA 1JNRA 2KMFA 2KXPB 2XM1A 3K3NA 3NZQA 2CLYB 5HEHA 2I6HA 3ZMUB 4E7ZA 3PUSA 4UR9A 2E9XA 4UV8B 3A7MA 5FVKA 4IDQA 3RC8A 3OBVE 4IE4A 3HKCE 4QX7B 2AXDS 3KVAA 4QXBB 3FBZA 2WS3A 1BR1A 3P4WA 4IDOA 1G8XA 4HFVA 2LSJA 4KHPT 3SS1A 1XDPA 4ISSA 4HFCA 3ZYLA 4CI3B 5CB4E 5FXWA 1QUUA 2BZBA 2HPLA 5AQRB 3QNUA 3RLFF 1H7CA 3F31A 4MLKA 5JDMA 2N1GA 4GK0E 1YKHB 2BS2A 2NW9A 3QOFA 5JVDE 3FXDB 4HWIB 3AA6B 5LG3A 1D0XA 1O3XA 3UTKA 3N9LA 3ZN0B 1HNXT 1IBMT 4IREA 3AEAA 4IDZA 3ABVA 3I0QA 5ETWA 4PAGA 4DVDA 5IUXA 4WZXA 3RF1A 2B1EA 2V5CA 4X66T 2K24A 3PV0F 4H9QC 2X9YA 4P09A 1FJGT 5L3FB 4CQIA 1SE7A 2V5DA 5AQIB 2K9AA 4ZOLE 1X9BA 4EXTA 3TLSA 5LP6E 2J1DG 3T8OA 2NR4A 2NW8A 2YK0A 4PJLA 3I1AA 2BBJA 2HN1A 3MKDA 1R8IA 4Z90A 5L4EA 5LMUT 5JH7E 2VVNA 4UF0A 2LSIA 2WDQA 4DIDB 2CRBA 5LJMA 3C4XA 4P1NA 3RIUC 2V6YB 2V6XA 4A56A 3M3ZB 3UQ4A 2YDSA 1KNRA 4FJOA 3HKEE 4ILUA 4PW8A 4ZI2C 2XAGB 4X65T 2EHOD 2V1DB 4XAXB 3FBLA 3GWHA 4DUZT 2B76A 4PJNA 2V8SV 3UU8A 1IJ6A 3ESLA 1CHUA 2FJAA 2WBLA 2BG9E 3NWIA 5DQVA 5FY0A 5ABHA 1KEYA 4BAYB 5AFUL 5HXSA 4GYRA 3ETVA 3RHWA 2H7VC 3ZMSB 5HXEA 4JLEA 1Z0PA 3FXEB 4TNVA 1FMWA 5DJQC 3H37A 3ZPOA 5JDQA 2JMKA 1XMQT 2BKNA 2CM0A 3E08A 2VKJA 2OLTA 2PFVA 3HI2A 3PUQA 5HXCA 3R84B 5LBMA 2WQYA 2XSAA 4EAHA 3C64A 3AE6A 5AQOB 3RQUA 2VKDA 2Y8DA 1B7TA 2H89A 3PTRB 4OHFA 2M6BA 5FY7A 3UU3A 4EEDA 4E7SA 4CXYA 2XQ6A 2UXDT 5KXJA 3AEFA 4G2AA 5HEJA 2X0HA 1XMOT 2W4XA 3FHNA 3IA3A 3L09A 5CA0E 1LVFA 3MJXA 4DR6T 2NOXA 3CPZA 4F6RC 1WRDA 2SPCA 2FUPA 1MMGA 2C5JA 2VWAA 3Q2MA 3CIRA 4H63V 3P7IA 3CQGB 1VRBA 4HWCA 4PJMA 3H3MA 4KBMB 4UEMA 1IBKT 2NP9A 3OVUA 5LBQB 5LXTE 4LF6T 4ZI2D 1KFYA 3VRAA 3C4ZA 5HXRA 1HF8A 3KINB 1X79A 3PUAA 4QWNB 4AQFA 3ZEFB 5IWAT 3AA1B 1YKEB 5F8PA 3RRWA 5JDHA 4IDPA 3RX6A 4CI1B 2MBGA 4TV8E 4JYAT 2X66A 3CX8B 2IMLA 4ILCA 1XNQT 5HEUA 4KX6A 1HTJF 4I50E 2X67A 2XQ9A 5DQWA 5AQGB 5FL0A 4EGWA 2D0UA 2JQQA 3HKDE 4C90A 4G63A 1UURA 3OYXA 4ILBA 2ACXA 3TKLB 3CQXC 1V9DA 4I4TE 4DMVA 3ONJA 2PBIA 1N34T 1OEDB 3K8PC 4DNDA 2WY2A 3LK3B 1N32T 4UF0B 3SFEA 5FXVA 3AVRA 5L47A 4H9OC 4BA9A 5M4YA 2BS4A 2EHOA 2YU2A 4DBRA 4QX8B 4ZEYA 5LHHB 5H6RB 4DUYT 4NXMT 3EVYA 1HNWT 1DU2A 3VKHA 4M1PA 3JC6D 4EYYR 2DCFA 2RP4A 3DTOA 4PK4A 2VURA 2KZ7B 3AE2A 3C50A 3FZFB 5HCJA 2WDRA 2YN6A 5AQFB 4DR3T 3IHRA 3U78A 3NVOA 3AAEB 3BQLA 2NWBA 4PNIA 3PE0A 2V7KA 4L9IA 3B57A 4UVBB 5FY1A 5LCYA 1FEWA 1VCSA 3AE3A 3KDSE 4HFHA 2UXNB 3O4XE 4O4JE 5CJ5A 5AQKB 3RYIE 4ERRA 5JTGA 4C91A 5KMGP 4JI6T 2UUAT 1XDOA 4BJNA 1J5WA 1WLXA 4OK0A 4UIGA 3GN5A 4QH1A 1OEDE 2LSGA 2LM2A 3D0TA 5FL1A 3ZC0A 5JDFA 2V6YA 5A1LA 2IDOB 2GK9A 5AQSB 5ABEA 4H9RC 5JRCB 3VU7H 1YXRA 4ZHQE 5ABFA 5JDGA 4LFBT 1Z8UA 3UULA 2JQKA 4CN6A 2ODVA 3P4RA 2NTYA 2VQET 4TWHA 4JBWF 1HG5A 1JNZA 4YFSA 3ZJ2A 4GKJT 4KMCA 5LNKA 2HHHT 4OYKA 2WMNA 4IE5A 2ZLYA 3ONXA 4LF5T 2H3RA 3FB2A 3I9YA 3TLVA 3UU4A 3TLTA 2ZM2A 1ZHCA 3E0ZA 4AQGA 5F3JA 2XAQB 4MHCA 1WYBA 4ASKA 4K0KT 5AQVB 2YKSA 3PURA 5AQPB 4EYUA 2L8KA 2CCQA 2WWVA 2YU1A 2IHR1 4GYSA 1BR2A 1IZNB 2E5VA 3N5LA 2HN2A 4I43B 5EZYE 3UUXB 4B3TT 1KNZA 2BG9C 3F57A 4N78D 5HCMA 5CFBA 3LJCA 4MFRA 4X64T 1D0YA 1CUNA 3Q5EA 1OEDC 4AKLA 3NBXX 1HCIA 4CXXA 2Q9QB 1XNRT 3VRBA 5EK4A 3ZMZB 3BQIA 4LF7T 2BKOA 4F8HA 2CMRA 3PUYF 2IIUA 2VL8A 4HGAA 3V5UA 3AE9A 3K3QC 3MK7C 4X1IE 4HN9A 2ZM6T 3J7Yq 2WP9A 1KNPA 2HPJA 2WCAA 4IDNA 4Z8XA 3ZYMA 3KBTA 2RPAA 3SWHA 2WDVA 4HKAA 3S4UA 2K5BB 3QC9A 2UXCT 3BK9A 2A2FX 5CA1E 4YXDA 1HR0T 2DLRA 4HE8A 2IW5B 5AQUB 3CVRA 4QXCB 4LF4T 5E0OA 4U74A 5FP3A 4X20E 5HYAA 4JV5T 4JI5T 4V1Av 1WCRA 2FJEA 4AKRB 3AEEA 3N9QA 3MXZA 5LB7B 4WBNE 5JRCA 2UXXB 3GMIA 3PU3A 3HL6A 2A72A 2LKGA 4O8SA 5FNVE 3T1YT 4LFCT 4AKIA 2ACZA 2CWYA 2YDRA 5F5WA 1D1BA 1T7SA 1E2AA 3FZLB 1MNDA 3Q5XA 1VCTA 2E9XD 2JQ9A 3QK6A 2QVAA 3ZMTB 4DR5T 2LRKA 3N9PA 4X1KE 2KSRA 2WSSV 3ETUA 1YW0A 5DABA 1UCUA 4O4IE 3B5MA 3AECA 3C98B 3ZC1A 4U2ZA 2X9WA 3ZSTA 4AQYT 1LRZA 1QLBA 2XQYA 4EB6E 4IT4A 5L3EB 5L3GB 2XAFB 3IEEA 4DO0A 1ZEEA 4DR7T 4DV7T 3Q9DA 1KF6A 3AEDA 4QKNA 5LA6E 1MMNA 1S35A 3N9MA 4L5GA 1W0BA 2MOZA 2XZEA 3EHZA 1SHZC 1NENA 2X68A 3EUHA 2AE9A 4H9SE 5H6QB 3TLUA 4DMWA 5ADXL 3AE1A 5LYJE 3PJAJ 2W66A 4YJ2E 1L0VA 1IAPA 1MIVA 1Y64B 1LKXA 2CHOA 5ABGA 1XZYA 3UFGA 3V5SA 1LVKA 2UXBT 2E8IA 5EK3A 2EHOC 2XQAA 3RIFA 5C8YE 1IBLT 4DR2T 2WU5A 2YEVC 1HG2A 3EABA 2XPKA 1U5PA 1ZOYA 4JI4T 2F4VT 3GA8A 2Y6XA 1D1AA 4YJ3E 2M6IA 2BS3A 1U4QA 5C2TA 2MPKA 4B6XA 3PU8A 2BG9B 3EDVA 2LOPA 2LM9A 4TZ4C 5AQNB 3SRZA 3N2OA 2L3LA 2XM2A 3LBXB 4TN7B 4OFZA 4UELA 4YHHT 5HWXA 1YQ4A 2CXFA 5JR9C 4EIWA 3RYHE 2DWGA 2XQ7A 2FJDA 2LSYA 5FVLA 1HFAA 1QSDA 3MA9A 2CBJA 4CI2B 2OV9A 5LOVE 4YSXA 2XQ4A 2E2AA 3O1JA 1J1JA 1UUSA 2OA5A 4MBQA 2CXLA 5C3JA 2X0LB 3ZJ1A 4BJMA 5AQLB 2Q9QA 2WZHA 4DV6T 1BR4A 5AQMB 3ONLC 1UGOA 3LFMA 4HEAA 4AQFC 3QB5A 2X51A 4TWDA 2CE7A 4U31A 3PUZF 3Q5DA 3CX6B 2VKHA 5J1GA
chains in the Genus database with same CATH topology
3LBXA 4OYJA 4AKGA 3CQCB 4IIJE 4ZS3A 3SOLA 3KV5A 2YINA 1FIOA 2ZM8A 4NUVA 1T98A 4EZ4A 4GOUA 4PJJA 2N9DA 3N2GE 3IF8B 3KVBA 3NZPA 3PDYA 5LNKA 3UFEA 3F2EA 3OJAA 5LG4A 4UV9B 3MACA 3AA0B 3WI3A 2VASA 4WW0A 2Y48B 3RYCE 2LHRA 4EOZB 3AAIA 5JDLA 3KV4A 2W62A 4TX5A 4YLHA 2NTXA 2QGSA 2X9HA 3RYFE 3B13A 4TUYE 2WMOA 3KBUA 4MALA 2CLYC 2BDEA 3AVSA 3R6NA 4PFOA 4JEUB 5J2TE 1MMDA 2KWHA 2IAKA 2W63A 5LHGB 2W61A 2LHNA 5IYZE 3LK2B 1OXZA 4GK5E 4L0RA 4AI6A 2DNXA 4YHJA 3AB3B 3DJBA 2V7LA 5LGNB 2K48A 2WM9A 4QHOA 2LEHA 2RA1A 3MZKB 4UVCB 5HXHA 2V7IA 4ZI3D 3CMLA 5LGUB 1WR6A 3ZYKA 1OWAA 4J2CA 3ZCIA 5FXZA 3ZMVB 2BVMA 3RC3A 2DI4A 2E9XB 3NRYA 1MIYA 3EDUA 5FXXA 5L3BB 3O1HA 3LG7A 2VKOA 2CXDA 2XAHB 3O1IA 2CA5A 5JQGE 5IHYA 2XAJB 4EZHA 3NRXA 4H9NC 3O9XA 3RKOA 3H3AA 2KT9A 2Q9QC 1SA0E 2JMHA 3DP7A 3GN5B 4TV9E 3RPUA 2LOSA 2Q9QD 2DHRA 2L9QA 4O2AE 1MMAA 4DBQA 5GONE 1UX5A 1KK7A 3C4WA 2ES0A 3ZCJA 2I59A 4JEHB 4ADZA 4CZZB 2BVLA 2XASB 3OYZA 1US7B 4ZI3C 3I9WA 5KDMC 4PK5A 2PG8A 5EK2A 2G0UA 2LT3A 3J9X1 3BQKA 1MIWA 2X9XA 3CX7B 4X1YE 5HWYA 4WBOA 3ZLIA 3W15B 2CWOA 1E1HB 1ZKEA 4IE7A 1VOMA 2C0SA 2WAUA 4IGUA 2N2NA 2VB6A 2ZM0A 2V26A 2XTLA 4FI5A 3KV6A 4UXNB 3RH3A 4IE6A 2V7MA 3VKGA 4H9PC 5LHIB 3UUMA 4K0UA 2W0GA 2LJLA 3ANWA 3AAAB 3Q5WA 2D2SA 2KWIB 5L3DB 1D0ZA 5FMNA 1EZ3A 2E9XC 2C5IT 4JUYA 4O2BE 2IC6A 3HA4A 3QUJA 3HR0A 2W00A 4XZCA 5FYMA 1AJ3A 3U3IA 1G73A 2V7JA 4IE0A 2M67A 2A3DA 3KV9A 3UT5E 2P9BA 2ZMAA 3KFWX 4ISTA 4IHJE 4PFPA 3E22E 3JC6C 4XBFB 5L3CB 1D1CA 3AA7B 5JR9B 4NUUA 2CEAA 1HX8A 2VK9A 3I0OA 5JR9A 1UX4A 4UVAB 3K3OA 2EHOB 5LGTB 3L3PA 1MNEA 2LSKA 4H63H 2Z6EA 3RRCA 4P0AA 4I55E 4P0BA 2D5UA 3CWZB 1IJ5A 4KP3C 5HAXA 1NWMX 3PUGA 5J2UE 3ZN1B 5TAOA 4O4LE 1YD8G 2D0TA 2JPFA 3OKQA 4O4HE 1NAFA 3UUNA 2NW7A 3A5XA 3WAKA 4AXPA 4QXHB 4ANJA 2JRKA 2KNDA 3VHLA 2ODUA 5LJNA 5KX5E 4GIWA 2WWUA 3N2KE 5BMVE 2JJ9A 3M65A 2MTQA 2MYSA 4WNKA 2DWKA 3P8CD 4KUMB 3LK42 2IC9A 5JDNA 3CKDA 1ZV4X 3HKBE 3C51A 1HS7A 2H7OA 4ZS2A 4CXWA 2KLQA 2QA7A 4AKHA 3ANWB 2PJQA 2C5KT 1FMVA 3N9OA 2KINB 4HTEA 1WYCA 2LE8A 2HH7A 3WAJA 3N9NA 4U72A 4PK6A 2XHEB 1S94A 1BR0A 2XUEA 5JREA 3IBPA 2KXPB 2KMFA 3K3NA 3NZQA 2CLYB 3ZMUB 4ZI7E 4E7ZA 3PUSA 2E9XA 4UV8B 3RC8A 3OBVE 4IE4A 3HKCE 4QX7B 4QXBB 3KVAA 3FBZA 1BR1A 1G8XA 4HFVA 2LSJA 3SS1A 3ZYLA 4ISSA 4CI3B 5CB4E 5FXWA 1QUUA 2BZBA 2HPLA 1H7CA 3F31A 4MLKA 5JDMA 2N1GA 4GK0E 1YKHB 2NW9A 5JVDE 3FXDB 3AA6B 1D0XA 1O3XA 3UTKA 3N9LA 3ZN0B 4IDZA 3I0QA 5ETWA 4PAGA 4DVDA 2B1EA 2K24A 4H9QC 2X9YA 4P09A 5L3FB 4CQIA 2K9AA 4ZOLE 4EXTA 5LP6E 2J1DG 3T8OA 2NW8A 2YK0A 4PJLA 3I1AA 3MKDA 5JH7E 4UF0A 2LSIA 5LJMA 3C4XA 4A56A 4FJOA 3HKEE 4ILUA 4PW8A 4ZI2C 2XAGB 2EHOD 2V1DB 4XAXB 3FBLA 3GWHA 4PJNA 1IJ6A 3ESLA 5FY0A 2WBLA 5DQVA 5JDQA 5AFUL 4BAYB 5HXSA 4GYRA 3ETVA 2H7VC 3ZMSB 5HXEA 4JLEA 1Z0PA 3FXEB 1FMWA 5DJQC 3H37A 3ZPOA 2JMKA 2CM0A 3E08A 2VKJA 2PFVA 3HI2A 3PUQA 5HXCA 3R84B 5LBMA 4EAHA 3C64A 2VKDA 2Y8DA 1B7TA 3PTRB 4OHFA 5FY7A 4E7SA 4CXYA 4G2AA 3L09A 3FHNA 5CA0E 1LVFA 3MJXA 2NOXA 3CPZA 4F6RC 1WRDA 2SPCA 1MMGA 2C5JA 2VWAA 3Q2MA 4H63V 3P7IA 3CQGB 1VRBA 4PJMA 4UEMA 4KBMB 2NP9A 5LXTE 5LBQB 4ZI2D 3C4ZA 5HXRA 1HF8A 3KINB 1X79A 3PUAA 4QWNB 4AQFA 3ZEFB 3AA1B 1YKEB 5F8PA 3RRWA 5JDHA 3RX6A 4CI1B 2MBGA 4TV8E 2X66A 3CX8B 1HTJF 4I50E 2X67A 5DQWA 2D0UA 2JQQA 3HKDE 4C90A 4G63A 3OYXA 2ACXA 3TKLB 3CQXC 1V9DA 4I4TE 4DMVA 2PBIA 3K8PC 4DNDA 3LK3B 4UF0B 5FXVA 3AVRA 4H9OC 4BA9A 5M4YA 5L2LA 2EHOA 2YU2A 4DBRA 4QX8B 5LHHB 5H6RB 3EVYA 3VKHA 4M1PA 3JC6D 4EYYR 2DCFA 2RP4A 3DTOA 4PK4A 2KZ7B 3C50A 3IHRA 3U78A 3AAEB 3BQLA 2NWBA 4PNIA 3PE0A 2V7KA 4L9IA 3B57A 4UVBB 5FY1A 5LCYA 1FEWA 3KDSE 4O4JE 2UXNB 3O4XE 3RYIE 5KMGP 4ERRA 4C91A 4BJNA 1WLXA 4OK0A 4UIGA 3GN5A 2LSGA 3D0TA 3ZC0A 5JDFA 5A1LA 2GK9A 5JRCB 4H9RC 3VU7H 4ZHQE 5JDGA 3UULA 2ODVA 2NTYA 1HG5A 4YFSA 3ZJ2A 4KMCA 4OYKA 2WMNA 4IE5A 2ZLYA 3ONXA 2H3RA 3FB2A 3I9YA 2ZM2A 1ZHCA 3E0ZA 4AQGA 5F3JA 2XAQB 4MHCA 1WYBA 4ASKA 3PURA 4EYUA 2L8KA 2CCQA 2YU1A 4GYSA 1BR2A 1IZNB 3N5LA 4I43B 5EZYE 3UUXB 1KNZA 3F57A 4N78D 3LJCA 4MFRA 1D0YA 1CUNA 4AKLA 3NBXX 1HCIA 4CXXA 2Q9QB 5EK4A 3ZMZB 3BQIA 2CMRA 2VL8A 4HGAA 3V5UA 3K3QC 3MK7C 4X1IE 4HN9A 3J7Yq 2HPJA 4Z8XA 3ZYMA 3KBTA 3SWHA 4HKAA 3S4UA 2K5BB 3QC9A 3BK9A 2A2FX 5CA1E 2DLRA 4HE8A 2IW5B 3CVRA 4QXCB 5E0OA 4U74A 5FP3A 4X20E 5HYAA 4V1Av 4AKRB 3N9QA 4WBNE 3MXZA 5JRCA 2UXXB 3GMIA 3PU3A 3HL6A 2A72A 4O8SA 5FNVE 4AKIA 2CWYA 1D1BA 1MNDA 3Q5XA 3QK6A 2E9XD 3ZMTB 3N9PA 4X1KE 3ETUA 2WSSV 1YW0A 5DABA 1UCUA 4O4IE 3C98B 3ZC1A 2X9WA 1LRZA 2XQYA 4EB6E 5L3EB 5L3GB 2XAFB 3IEEA 4DO0A 1ZEEA 3Q9DA 4QKNA 5LA6E 1MMNA 1S35A 3N9MA 4L5GA 3EUHA 2MOZA 1SHZC 2X68A 4H9SE 5H6QB 4DMWA 5ADXL 5LYJE 4YJ2E 1IAPA 1MIVA 1Y64B 1LKXA 3V5SA 1LVKA 2E8IA 5EK3A 2EHOC 5C8YE 2YEVC 1HG2A 1U5PA 3GA8A 2Y6XA 1D1AA 4YJ3E 1U4QA 4B6XA 3PU8A 3EDVA 2LOPA 2LM9A 4TZ4C 3SRZA 3N2OA 2L3LA 4TN7B 3LBXB 4OFZA 4UELA 5HWXA 5JR9C 2CXFA 4EIWA 3RYHE 2DWGA 2LSYA 1HFAA 1QSDA 3MA9A 4CI2B 5LOVE 3O1JA 2OA5A 4MBQA 2CXLA 2X0LB 3ZJ1A 4BJMA 2Q9QA 1BR4A 3LFMA 4HEAA 4AQFC 2X51A 2CE7A 3CX6B 2VKHA 5J1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWA A; 
#chains in the Genus database with same CATH topology
 3LBX A;  4OYJ A;  3EAM A;  4WYV A;  4AKG A;  3CQC B;  4IIJ E;  3QB5 K;  4ZS3 A;  3SOL A;  1SUM B;  3P4P A;  3KV5 A;  2YIN A;  4Q25 A;  1FIO A;  2ZM8 A;  4NUV A;  1T98 A;  4EZ4 A;  4DV3 T;  4DR1 T;  4GOU A;  4PJJ A;  2N9D A;  3N2G E;  5LMN T;  3IF8 B;  3AE4 A;  3KVB A;  1T8B A;  3NZP A;  3PDY A;  4IL9 A;  3UFE A;  4NPP A;  3ZT7 A;  3F2E A;  3OJA A;  4YTP A;  2VQF T;  2VVS A;  5LG4 A;  4UV9 B;  3RQW A;  3RIU A;  3MAC A;  2PTF A;  3AA0 B;  5FKY A;  3WI3 A;  2VAS A;  4WW0 A;  2Y48 B;  2K3W A;  3RYC E;  3SFD A;  2LHR A;  4EOZ B;  4YTN A;  1XWM A;  3AAI A;  3P50 A;  5JDL A;  3RIA A;  3KV4 A;  5BR8 T;  1HX1 B;  2JIW A;  2W62 A;  4U7I A;  4TX5 A;  4YLH A;  2NTX A;  2QGS A;  2X9H A;  3RYF E;  2XQ5 A;  3B13 A;  1UK5 A;  4TUY E;  2WMO A;  3KBU A;  4X62 T;  2CHN A;  2CLY C;  2BDE A;  4MAL A;  3AVS A;  3R6N A;  4PFO A;  4YSZ A;  4JI7 T;  4JEU B;  3UU5 A;  5J2T E;  1MMD A;  1T72 A;  4KI0 F;  2KWH A;  2IAK A;  2W63 A;  5L4H A;  4ZZB A;  2W61 A;  5LHG B;  2QYW A;  3T1H T;  2LHN A;  4IL4 A;  3LK2 B;  1OXZ A;  4GK5 E;  4L0R A;  4U7Y A;  2DNX A;  5IYZ E;  4AIU A;  4AI6 A;  2LRL A;  3TLW A;  4YHJ A;  3AB3 B;  3DJB A;  4HWF A;  2W2U A;  4DV4 T;  2V7L A;  4A98 A;  5LGN B;  4GKK T;  4CN1 A;  2K48 A;  2WM9 A;  4ZI7 E;  4QHO A;  2LEH A;  2RA1 A;  3MZK B;  3L8R A;  3ZKR A;  4LFA T;  4UVC B;  5HXH A;  2V7I A;  4ZI3 D;  2CBI A;  2FJB A;  3CML A;  1WR6 A;  3ZYK A;  5LGU B;  1OWA A;  4J2C A;  3ZCI A;  5FXZ A;  1W9R A;  3NKZ A;  4HFE A;  3PUW F;  4ZZC A;  3ZMV B;  2BVM A;  3ZSS A;  3RC3 A;  4EEB A;  4YTM A;  2DI4 A;  2E9X B;  3NRY A;  1MIY A;  3PUV F;  2WZI A;  3EDU A;  2YOE A;  4LMJ A;  3LDQ B;  3L39 A;  5FXX A;  5L3B B;  4NIQ A;  3UUB A;  4B3R T;  3O1H A;  3LG7 A;  3VR9 A;  2VKO A;  2CXD A;  2XAH B;  3O1I A;  2CA5 A;  5JQG E;  5IHY A;  2XAJ B;  4KHZ F;  4EZH A;  1J5E T;  1OED A;  3OPC A;  3NRX A;  4H9N C;  4YT0 A;  3O9X A;  3RKO A;  4OX9 T;  3H3A A;  3JCF A;  4LF8 T;  2KT9 A;  2Q9Q C;  1SA0 E;  2JMH A;  2LKH A;  3DP7 A;  3GN5 B;  4TV9 E;  3RPU A;  2LOS A;  2Q9Q D;  3RKG A;  2DHR A;  2L9Q A;  4O2A E;  1MMA A;  4DBQ A;  1W0A A;  1UX5 A;  1KK7 A;  2FBW A;  3C4W A;  5GON E;  2ES0 A;  4JI2 T;  2I59 A;  3AE5 A;  4HFD A;  3UU6 A;  2D9D A;  4JEH B;  3ZCJ A;  4ADZ A;  4HFI A;  5L2L A;  4Z91 A;  4HWH A;  2BVL A;  1WR0 A;  1YQ3 A;  2XAS B;  3OYZ A;  4CZZ B;  2VL0 A;  1US7 B;  1E7P A;  3AEG A;  4ZI3 C;  3I9W A;  5KDM C;  4PK5 A;  1M7K A;  2PG8 A;  5EK2 A;  3JAE A;  3JAF A;  5HEO A;  2QRX A;  2G0U A;  2LT3 A;  3J9X 1;  3BQK A;  4TWF A;  1MIW A;  2X9X A;  3CX7 B;  4X1Y E;  5HWY A;  3FZH B;  4WBO A;  3ZLI A;  3W15 B;  2CWO A;  1I94 T;  5AQH B;  1E1H B;  1ZKE A;  3FZM B;  2MAW A;  4IE7 A;  4AIS A;  2BG9 A;  1VOM A;  2C0S A;  2WAU A;  4DV1 T;  4IGU A;  2N2N A;  2VB6 A;  2ZM0 A;  2V26 A;  2XTL A;  3JAD A;  1NEK A;  4FI5 A;  3AE8 A;  3KV6 A;  4TNW A;  3PJA A;  1M62 A;  4IE6 A;  4UXN B;  3RH3 A;  2UUB T;  2V7M A;  4LF9 T;  1ZP0 A;  3VKG A;  4H9P C;  5CGM A;  3UUM A;  5LHI B;  4K0U A;  4NXN T;  2W0G A;  4QH5 A;  2LJL A;  3ANW A;  2J62 A;  3AAA B;  3AXJ A;  3Q5W A;  2D2S A;  2KWI B;  5L3D B;  2IUB A;  4JI3 T;  3G06 A;  2A9U A;  1D0Z A;  1EZ3 A;  5FMN A;  4JI8 T;  4DV5 T;  2E9X C;  2C5I T;  4JUY A;  4O2B E;  5AQJ B;  4HFB A;  2IC6 A;  3HA4 A;  3QUJ A;  3HR0 A;  2W00 A;  4XZC A;  5FYM A;  2W67 A;  1AJ3 A;  4DV0 T;  3U3I A;  1G73 A;  1Y01 A;  2V7J A;  4IE0 A;  2M67 A;  3AEB A;  2A3D A;  3KV9 A;  3UT5 E;  2P9B A;  2ZMA A;  3KFW X;  3LSV A;  4IST A;  4IHJ E;  4PFP A;  3E22 E;  3JC6 C;  4XBF B;  4ILA A;  1D1C A;  3AA7 B;  5L3C B;  5JR9 B;  4NUU A;  2CEA A;  1HX8 A;  2VK9 A;  3I0O A;  5JR9 A;  3P4Q A;  4B3M T;  4DV2 T;  4B3S T;  1UX4 A;  4UVA B;  4YY3 T;  3K3O A;  3VR8 A;  3ZT6 A;  2EHO B;  3UQ7 A;  5LGT B;  2UUC T;  3L3P A;  2H88 A;  5ABF B;  1MNE A;  2LSK A;  4H63 H;  4LML A;  3X1D A;  3ZT5 A;  4ZXL A;  2Z6E A;  3RRC A;  4P0A A;  2YDQ A;  4I55 E;  4P0B A;  2D5U A;  3CWZ B;  5AQT B;  1IJ5 A;  4KP3 C;  2J4G A;  3P4S A;  5HAX A;  1NWM X;  3PUG A;  2BKP A;  5J2U E;  3ZN1 B;  4JI1 T;  3RI5 A;  5TAO A;  4O4L E;  1YD8 G;  4CN4 A;  3OTO T;  4QH4 A;  2D0T A;  1GQE A;  2XQ3 A;  2JPF A;  3OKQ A;  4O4H E;  1NAF A;  3UUN A;  2NW7 A;  3A5X A;  1HNZ T;  3WAK A;  2XSB A;  4AXP A;  4QXH B;  4ANJ A;  2JRK A;  4LMK A;  2KND A;  3A8Y C;  2ODU A;  3VHL A;  2JQH A;  5LJN A;  4JI0 T;  5KX5 E;  2XQ8 A;  2X0Y A;  4GIW A;  2WWU A;  4DR4 T;  3N2K E;  5BMV E;  2DL1 A;  2JJ9 A;  2WU2 A;  2MTQ A;  2MYS A;  3AE7 A;  3M65 A;  3PUX F;  4WNK A;  2DWK A;  3P8C D;  4KUM B;  3K1S A;  2R6G F;  3LK4 2;  2IC9 A;  4EV6 A;  2XY8 B;  2UU9 T;  3AXJ B;  2E5L T;  2WB5 A;  4A5X A;  3CKD A;  1ZV4 X;  2CPT A;  3HKB E;  4A97 A;  5JDN A;  5J0Z A;  4YSY A;  3C51 A;  1HS7 A;  2H7O A;  4ZS2 A;  4CXW A;  2KLQ A;  3RGL A;  2QA7 A;  4AKH A;  3ANW B;  2PJQ A;  2C5K T;  1FMV A;  3N9O A;  2LLY A;  2KIN B;  5AQQ B;  4HTE A;  1N36 T;  1WFD A;  1WYC A;  2LE8 A;  4U2Y A;  2HH7 A;  3FZK B;  4U3C A;  4U33 A;  2XJ7 A;  3N9N A;  4U72 A;  4X5T A;  4PK6 A;  3WAJ A;  1W09 A;  2XHE B;  1S94 A;  1BR0 A;  5HEG A;  3CK6 A;  2BBH A;  2XUE A;  1N33 T;  2J47 A;  5JRE A;  3IBP A;  2I0M A;  4I0U A;  4HWD A;  1I6Z A;  3EI0 A;  4COF A;  1JNR A;  2KMF A;  2KXP B;  2XM1 A;  3K3N A;  3NZQ A;  2CLY B;  5HEH A;  2I6H A;  3ZMU B;  4E7Z A;  3PUS A;  4UR9 A;  2E9X A;  4UV8 B;  3A7M A;  5FVK A;  4IDQ A;  3RC8 A;  3OBV E;  4IE4 A;  3HKC E;  4QX7 B;  2AXD S;  3KVA A;  4QXB B;  3FBZ A;  2WS3 A;  1BR1 A;  3P4W A;  4IDO A;  1G8X A;  4HFV A;  2LSJ A;  4KHP T;  3SS1 A;  1XDP A;  4ISS A;  4HFC A;  3ZYL A;  4CI3 B;  5CB4 E;  5FXW A;  1QUU A;  2BZB A;  2HPL A;  5AQR B;  3QNU A;  3RLF F;  1H7C A;  3F31 A;  4MLK A;  5JDM A;  2N1G A;  4GK0 E;  1YKH B;  2BS2 A;  2NW9 A;  3QOF A;  5JVD E;  3FXD B;  4HWI B;  3AA6 B;  5LG3 A;  1D0X A;  1O3X A;  3UTK A;  3N9L A;  3ZN0 B;  1HNX T;  1IBM T;  4IRE A;  3AEA A;  4IDZ A;  3ABV A;  3I0Q A;  5ETW A;  4PAG A;  4DVD A;  5IUX A;  4WZX A;  3RF1 A;  2B1E A;  2V5C A;  4X66 T;  2K24 A;  3PV0 F;  4H9Q C;  2X9Y A;  4P09 A;  1FJG T;  5L3F B;  4CQI A;  1SE7 A;  2V5D A;  5AQI B;  2K9A A;  4ZOL E;  1X9B A;  4EXT A;  3TLS A;  5LP6 E;  2J1D G;  3T8O A;  2NR4 A;  2NW8 A;  2YK0 A;  4PJL A;  3I1A A;  2BBJ A;  2HN1 A;  3MKD A;  1R8I A;  4Z90 A;  5L4E A;  5LMU T;  5JH7 E;  2VVN A;  4UF0 A;  2LSI A;  2WDQ A;  4DID B;  2CRB A;  5LJM A;  3C4X A;  4P1N A;  3RIU C;  2V6Y B;  2V6X A;  4A56 A;  3M3Z B;  3UQ4 A;  2YDS A;  1KNR A;  4FJO A;  3HKE E;  4ILU A;  4PW8 A;  4ZI2 C;  2XAG B;  4X65 T;  2EHO D;  2V1D B;  4XAX B;  3FBL A;  3GWH A;  4DUZ T;  2B76 A;  4PJN A;  2V8S V;  3UU8 A;  1IJ6 A;  3ESL A;  1CHU A;  2FJA A;  2WBL A;  2BG9 E;  3NWI A;  5DQV A;  5FY0 A;  5ABH A;  1KEY A;  4BAY B;  5AFU L;  5HXS A;  4GYR A;  3ETV A;  3RHW A;  2H7V C;  3ZMS B;  5HXE A;  4JLE A;  1Z0P A;  3FXE B;  4TNV A;  1FMW A;  5DJQ C;  3H37 A;  3ZPO A;  5JDQ A;  2JMK A;  1XMQ T;  2BKN A;  2CM0 A;  3E08 A;  2VKJ A;  2OLT A;  2PFV A;  3HI2 A;  3PUQ A;  5HXC A;  3R84 B;  5LBM A;  2WQY A;  2XSA A;  4EAH A;  3C64 A;  3AE6 A;  5AQO B;  3RQU A;  2VKD A;  2Y8D A;  1B7T A;  2H89 A;  3PTR B;  4OHF A;  2M6B A;  5FY7 A;  3UU3 A;  4EED A;  4E7S A;  4CXY A;  2XQ6 A;  2UXD T;  5KXJ A;  3AEF A;  4G2A A;  5HEJ A;  2X0H A;  1XMO T;  2W4X A;  3FHN A;  3IA3 A;  3L09 A;  5CA0 E;  1LVF A;  3MJX A;  4DR6 T;  2NOX A;  3CPZ A;  4F6R C;  1WRD A;  2SPC A;  2FUP A;  1MMG A;  2C5J A;  2VWA A;  3Q2M A;  3CIR A;  4H63 V;  3P7I A;  3CQG B;  1VRB A;  4HWC A;  4PJM A;  3H3M A;  4KBM B;  4UEM A;  1IBK T;  2NP9 A;  3OVU A;  5LBQ B;  5LXT E;  4LF6 T;  4ZI2 D;  1KFY A;  3VRA A;  3C4Z A;  5HXR A;  1HF8 A;  3KIN B;  1X79 A;  3PUA A;  4QWN B;  4AQF A;  3ZEF B;  5IWA T;  3AA1 B;  1YKE B;  5F8P A;  3RRW A;  5JDH A;  4IDP A;  3RX6 A;  4CI1 B;  2MBG A;  4TV8 E;  4JYA T;  2X66 A;  3CX8 B;  2IML A;  4ILC A;  1XNQ T;  5HEU A;  4KX6 A;  1HTJ F;  4I50 E;  2X67 A;  2XQ9 A;  5DQW A;  5AQG B;  5FL0 A;  4EGW A;  2D0U A;  2JQQ A;  3HKD E;  4C90 A;  4G63 A;  1UUR A;  3OYX A;  4ILB A;  2ACX A;  3TKL B;  3CQX C;  1V9D A;  4I4T E;  4DMV A;  3ONJ A;  2PBI A;  1N34 T;  1OED B;  3K8P C;  4DND A;  2WY2 A;  3LK3 B;  1N32 T;  4UF0 B;  3SFE A;  5FXV A;  3AVR A;  5L47 A;  4H9O C;  4BA9 A;  5M4Y A;  2BS4 A;  2EHO A;  2YU2 A;  4DBR A;  4QX8 B;  4ZEY A;  5LHH B;  5H6R B;  4DUY T;  4NXM T;  3EVY A;  1HNW T;  1DU2 A;  3VKH A;  4M1P A;  3JC6 D;  4EYY R;  2DCF A;  2RP4 A;  3DTO A;  4PK4 A;  2VUR A;  2KZ7 B;  3AE2 A;  3C50 A;  3FZF B;  5HCJ A;  2WDR A;  2YN6 A;  5AQF B;  4DR3 T;  3IHR A;  3U78 A;  3NVO A;  3AAE B;  3BQL A;  2NWB A;  4PNI A;  3PE0 A;  2V7K A;  4L9I A;  3B57 A;  4UVB B;  5FY1 A;  5LCY A;  1FEW A;  1VCS A;  3AE3 A;  3KDS E;  4HFH A;  2UXN B;  3O4X E;  4O4J E;  5CJ5 A;  5AQK B;  3RYI E;  4ERR A;  5JTG A;  4C91 A;  5KMG P;  4JI6 T;  2UUA T;  1XDO A;  4BJN A;  1J5W A;  1WLX A;  4OK0 A;  4UIG A;  3GN5 A;  4QH1 A;  1OED E;  2LSG A;  2LM2 A;  3D0T A;  5FL1 A;  3ZC0 A;  5JDF A;  2V6Y A;  5A1L A;  2IDO B;  2GK9 A;  5AQS B;  5ABE A;  4H9R C;  5JRC B;  3VU7 H;  1YXR A;  4ZHQ E;  5ABF A;  5JDG A;  4LFB T;  1Z8U A;  3UUL A;  2JQK A;  4CN6 A;  2ODV A;  3P4R A;  2NTY A;  2VQE T;  4TWH A;  4JBW F;  1HG5 A;  1JNZ A;  4YFS A;  3ZJ2 A;  4GKJ T;  4KMC A;  5LNK A;  2HHH T;  4OYK A;  2WMN A;  4IE5 A;  2ZLY A;  3ONX A;  4LF5 T;  2H3R A;  3FB2 A;  3I9Y A;  3TLV A;  3UU4 A;  3TLT A;  2ZM2 A;  1ZHC A;  3E0Z A;  4AQG A;  5F3J A;  2XAQ B;  4MHC A;  1WYB A;  4ASK A;  4K0K T;  5AQV B;  2YKS A;  3PUR A;  5AQP B;  4EYU A;  2L8K A;  2CCQ A;  2WWV A;  2YU1 A;  2IHR 1;  4GYS A;  1BR2 A;  1IZN B;  2E5V A;  3N5L A;  2HN2 A;  4I43 B;  5EZY E;  3UUX B;  4B3T T;  1KNZ A;  2BG9 C;  3F57 A;  4N78 D;  5HCM A;  5CFB A;  3LJC A;  4MFR A;  4X64 T;  1D0Y A;  1CUN A;  3Q5E A;  1OED C;  4AKL A;  3NBX X;  1HCI A;  4CXX A;  2Q9Q B;  1XNR T;  3VRB A;  5EK4 A;  3ZMZ B;  3BQI A;  4LF7 T;  2BKO A;  4F8H A;  2CMR A;  3PUY F;  2IIU A;  2VL8 A;  4HGA A;  3V5U A;  3AE9 A;  3K3Q C;  3MK7 C;  4X1I E;  4HN9 A;  2ZM6 T;  3J7Y q;  2WP9 A;  1KNP A;  2HPJ A;  2WCA A;  4IDN A;  4Z8X A;  3ZYM A;  3KBT A;  2RPA A;  3SWH A;  2WDV A;  4HKA A;  3S4U A;  2K5B B;  3QC9 A;  2UXC T;  3BK9 A;  2A2F X;  5CA1 E;  4YXD A;  1HR0 T;  2DLR A;  4HE8 A;  2IW5 B;  5AQU B;  3CVR A;  4QXC B;  4LF4 T;  5E0O A;  4U74 A;  5FP3 A;  4X20 E;  5HYA A;  4JV5 T;  4JI5 T;  4V1A v;  1WCR A;  2FJE A;  4AKR B;  3AEE A;  3N9Q A;  3MXZ A;  5LB7 B;  4WBN E;  5JRC A;  2UXX B;  3GMI A;  3PU3 A;  3HL6 A;  2A72 A;  2LKG A;  4O8S A;  5FNV E;  3T1Y T;  4LFC T;  4AKI A;  2ACZ A;  2CWY A;  2YDR A;  5F5W A;  1D1B A;  1T7S A;  1E2A A;  3FZL B;  1MND A;  3Q5X A;  1VCT A;  2E9X D;  2JQ9 A;  3QK6 A;  2QVA A;  3ZMT B;  4DR5 T;  2LRK A;  3N9P A;  4X1K E;  2KSR A;  2WSS V;  3ETU A;  1YW0 A;  5DAB A;  1UCU A;  4O4I E;  3B5M A;  3AEC A;  3C98 B;  3ZC1 A;  4U2Z A;  2X9W A;  3ZST A;  4AQY T;  1LRZ A;  1QLB A;  2XQY A;  4EB6 E;  4IT4 A;  5L3E B;  5L3G B;  2XAF B;  3IEE A;  4DO0 A;  1ZEE A;  4DR7 T;  4DV7 T;  3Q9D A;  1KF6 A;  3AED A;  4QKN A;  5LA6 E;  1MMN A;  1S35 A;  3N9M A;  4L5G A;  1W0B A;  2MOZ A;  2XZE A;  3EHZ A;  1SHZ C;  1NEN A;  2X68 A;  3EUH A;  2AE9 A;  4H9S E;  5H6Q B;  3TLU A;  4DMW A;  5ADX L;  3AE1 A;  5LYJ E;  3PJA J;  2W66 A;  4YJ2 E;  1L0V A;  1IAP A;  1MIV A;  1Y64 B;  1LKX A;  2CHO A;  5ABG A;  1XZY A;  3UFG A;  3V5S A;  1LVK A;  2UXB T;  2E8I A;  5EK3 A;  2EHO C;  2XQA A;  3RIF A;  5C8Y E;  1IBL T;  4DR2 T;  2WU5 A;  2YEV C;  1HG2 A;  3EAB A;  2XPK A;  1U5P A;  1ZOY A;  4JI4 T;  2F4V T;  3GA8 A;  2Y6X A;  1D1A A;  4YJ3 E;  2M6I A;  2BS3 A;  1U4Q A;  5C2T A;  2MPK A;  4B6X A;  3PU8 A;  2BG9 B;  3EDV A;  2LOP A;  2LM9 A;  4TZ4 C;  5AQN B;  3SRZ A;  3N2O A;  2L3L A;  2XM2 A;  3LBX B;  4TN7 B;  4OFZ A;  4UEL A;  4YHH T;  5HWX A;  1YQ4 A;  2CXF A;  5JR9 C;  4EIW A;  3RYH E;  2DWG A;  2XQ7 A;  2FJD A;  2LSY A;  5FVL A;  1HFA A;  1QSD A;  3MA9 A;  2CBJ A;  4CI2 B;  2OV9 A;  5LOV E;  4YSX A;  2XQ4 A;  2E2A A;  3O1J A;  1J1J A;  1UUS A;  2OA5 A;  4MBQ A;  2CXL A;  5C3J A;  2X0L B;  3ZJ1 A;  4BJM A;  5AQL B;  2Q9Q A;  2WZH A;  4DV6 T;  1BR4 A;  5AQM B;  3ONL C;  1UGO A;  3LFM A;  4HEA A;  4AQF C;  3QB5 A;  2X51 A;  4TWD A;  2CE7 A;  4U31 A;  3PUZ F;  3Q5D A;  3CX6 B;  2VKH A;  5J1G A; 
#chains in the Genus database with same CATH homology
 3LBX A;  4OYJ A;  4AKG A;  3CQC B;  4IIJ E;  4ZS3 A;  3SOL A;  3KV5 A;  2YIN A;  1FIO A;  2ZM8 A;  4NUV A;  1T98 A;  4EZ4 A;  4GOU A;  4PJJ A;  2N9D A;  3N2G E;  3IF8 B;  3KVB A;  3NZP A;  3PDY A;  5LNK A;  3UFE A;  3F2E A;  3OJA A;  5LG4 A;  4UV9 B;  3MAC A;  3AA0 B;  3WI3 A;  2VAS A;  4WW0 A;  2Y48 B;  3RYC E;  2LHR A;  4EOZ B;  3AAI A;  5JDL A;  3KV4 A;  2W62 A;  4TX5 A;  4YLH A;  2NTX A;  2QGS A;  2X9H A;  3RYF E;  3B13 A;  4TUY E;  2WMO A;  3KBU A;  4MAL A;  2CLY C;  2BDE A;  3AVS A;  3R6N A;  4PFO A;  4JEU B;  5J2T E;  1MMD A;  2KWH A;  2IAK A;  2W63 A;  5LHG B;  2W61 A;  2LHN A;  5IYZ E;  3LK2 B;  1OXZ A;  4GK5 E;  4L0R A;  4AI6 A;  2DNX A;  4YHJ A;  3AB3 B;  3DJB A;  2V7L A;  5LGN B;  2K48 A;  2WM9 A;  4QHO A;  2LEH A;  2RA1 A;  3MZK B;  4UVC B;  5HXH A;  2V7I A;  4ZI3 D;  3CML A;  5LGU B;  1WR6 A;  3ZYK A;  1OWA A;  4J2C A;  3ZCI A;  5FXZ A;  3ZMV B;  2BVM A;  3RC3 A;  2DI4 A;  2E9X B;  3NRY A;  1MIY A;  3EDU A;  5FXX A;  5L3B B;  3O1H A;  3LG7 A;  2VKO A;  2CXD A;  2XAH B;  3O1I A;  2CA5 A;  5JQG E;  5IHY A;  2XAJ B;  4EZH A;  3NRX A;  4H9N C;  3O9X A;  3RKO A;  3H3A A;  2KT9 A;  2Q9Q C;  1SA0 E;  2JMH A;  3DP7 A;  3GN5 B;  4TV9 E;  3RPU A;  2LOS A;  2Q9Q D;  2DHR A;  2L9Q A;  4O2A E;  1MMA A;  4DBQ A;  5GON E;  1UX5 A;  1KK7 A;  3C4W A;  2ES0 A;  3ZCJ A;  2I59 A;  4JEH B;  4ADZ A;  4CZZ B;  2BVL A;  2XAS B;  3OYZ A;  1US7 B;  4ZI3 C;  3I9W A;  5KDM C;  4PK5 A;  2PG8 A;  5EK2 A;  2G0U A;  2LT3 A;  3J9X 1;  3BQK A;  1MIW A;  2X9X A;  3CX7 B;  4X1Y E;  5HWY A;  4WBO A;  3ZLI A;  3W15 B;  2CWO A;  1E1H B;  1ZKE A;  4IE7 A;  1VOM A;  2C0S A;  2WAU A;  4IGU A;  2N2N A;  2VB6 A;  2ZM0 A;  2V26 A;  2XTL A;  4FI5 A;  3KV6 A;  4UXN B;  3RH3 A;  4IE6 A;  2V7M A;  3VKG A;  4H9P C;  5LHI B;  3UUM A;  4K0U A;  2W0G A;  2LJL A;  3ANW A;  3AAA B;  3Q5W A;  2D2S A;  2KWI B;  5L3D B;  1D0Z A;  5FMN A;  1EZ3 A;  2E9X C;  2C5I T;  4JUY A;  4O2B E;  2IC6 A;  3HA4 A;  3QUJ A;  3HR0 A;  2W00 A;  4XZC A;  5FYM A;  1AJ3 A;  3U3I A;  1G73 A;  2V7J A;  4IE0 A;  2M67 A;  2A3D A;  3KV9 A;  3UT5 E;  2P9B A;  2ZMA A;  3KFW X;  4IST A;  4IHJ E;  4PFP A;  3E22 E;  3JC6 C;  4XBF B;  5L3C B;  1D1C A;  3AA7 B;  5JR9 B;  4NUU A;  2CEA A;  1HX8 A;  2VK9 A;  3I0O A;  5JR9 A;  1UX4 A;  4UVA B;  3K3O A;  2EHO B;  5LGT B;  3L3P A;  1MNE A;  2LSK A;  4H63 H;  2Z6E A;  3RRC A;  4P0A A;  4I55 E;  4P0B A;  2D5U A;  3CWZ B;  1IJ5 A;  4KP3 C;  5HAX A;  1NWM X;  3PUG A;  5J2U E;  3ZN1 B;  5TAO A;  4O4L E;  1YD8 G;  2D0T A;  2JPF A;  3OKQ A;  4O4H E;  1NAF A;  3UUN A;  2NW7 A;  3A5X A;  3WAK A;  4AXP A;  4QXH B;  4ANJ A;  2JRK A;  2KND A;  3VHL A;  2ODU A;  5LJN A;  5KX5 E;  4GIW A;  2WWU A;  3N2K E;  5BMV E;  2JJ9 A;  3M65 A;  2MTQ A;  2MYS A;  4WNK A;  2DWK A;  3P8C D;  4KUM B;  3LK4 2;  2IC9 A;  5JDN A;  3CKD A;  1ZV4 X;  3HKB E;  3C51 A;  1HS7 A;  2H7O A;  4ZS2 A;  4CXW A;  2KLQ A;  2QA7 A;  4AKH A;  3ANW B;  2PJQ A;  2C5K T;  1FMV A;  3N9O A;  2KIN B;  4HTE A;  1WYC A;  2LE8 A;  2HH7 A;  3WAJ A;  3N9N A;  4U72 A;  4PK6 A;  2XHE B;  1S94 A;  1BR0 A;  2XUE A;  5JRE A;  3IBP A;  2KXP B;  2KMF A;  3K3N A;  3NZQ A;  2CLY B;  3ZMU B;  4ZI7 E;  4E7Z A;  3PUS A;  2E9X A;  4UV8 B;  3RC8 A;  3OBV E;  4IE4 A;  3HKC E;  4QX7 B;  4QXB B;  3KVA A;  3FBZ A;  1BR1 A;  1G8X A;  4HFV A;  2LSJ A;  3SS1 A;  3ZYL A;  4ISS A;  4CI3 B;  5CB4 E;  5FXW A;  1QUU A;  2BZB A;  2HPL A;  1H7C A;  3F31 A;  4MLK A;  5JDM A;  2N1G A;  4GK0 E;  1YKH B;  2NW9 A;  5JVD E;  3FXD B;  3AA6 B;  1D0X A;  1O3X A;  3UTK A;  3N9L A;  3ZN0 B;  4IDZ A;  3I0Q A;  5ETW A;  4PAG A;  4DVD A;  2B1E A;  2K24 A;  4H9Q C;  2X9Y A;  4P09 A;  5L3F B;  4CQI A;  2K9A A;  4ZOL E;  4EXT A;  5LP6 E;  2J1D G;  3T8O A;  2NW8 A;  2YK0 A;  4PJL A;  3I1A A;  3MKD A;  5JH7 E;  4UF0 A;  2LSI A;  5LJM A;  3C4X A;  4A56 A;  4FJO A;  3HKE E;  4ILU A;  4PW8 A;  4ZI2 C;  2XAG B;  2EHO D;  2V1D B;  4XAX B;  3FBL A;  3GWH A;  4PJN A;  1IJ6 A;  3ESL A;  5FY0 A;  2WBL A;  5DQV A;  5JDQ A;  5AFU L;  4BAY B;  5HXS A;  4GYR A;  3ETV A;  2H7V C;  3ZMS B;  5HXE A;  4JLE A;  1Z0P A;  3FXE B;  1FMW A;  5DJQ C;  3H37 A;  3ZPO A;  2JMK A;  2CM0 A;  3E08 A;  2VKJ A;  2PFV A;  3HI2 A;  3PUQ A;  5HXC A;  3R84 B;  5LBM A;  4EAH A;  3C64 A;  2VKD A;  2Y8D A;  1B7T A;  3PTR B;  4OHF A;  5FY7 A;  4E7S A;  4CXY A;  4G2A A;  3L09 A;  3FHN A;  5CA0 E;  1LVF A;  3MJX A;  2NOX A;  3CPZ A;  4F6R C;  1WRD A;  2SPC A;  1MMG A;  2C5J A;  2VWA A;  3Q2M A;  4H63 V;  3P7I A;  3CQG B;  1VRB A;  4PJM A;  4UEM A;  4KBM B;  2NP9 A;  5LXT E;  5LBQ B;  4ZI2 D;  3C4Z A;  5HXR A;  1HF8 A;  3KIN B;  1X79 A;  3PUA A;  4QWN B;  4AQF A;  3ZEF B;  3AA1 B;  1YKE B;  5F8P A;  3RRW A;  5JDH A;  3RX6 A;  4CI1 B;  2MBG A;  4TV8 E;  2X66 A;  3CX8 B;  1HTJ F;  4I50 E;  2X67 A;  5DQW A;  2D0U A;  2JQQ A;  3HKD E;  4C90 A;  4G63 A;  3OYX A;  2ACX A;  3TKL B;  3CQX C;  1V9D A;  4I4T E;  4DMV A;  2PBI A;  3K8P C;  4DND A;  3LK3 B;  4UF0 B;  5FXV A;  3AVR A;  4H9O C;  4BA9 A;  5M4Y A;  5L2L A;  2EHO A;  2YU2 A;  4DBR A;  4QX8 B;  5LHH B;  5H6R B;  3EVY A;  3VKH A;  4M1P A;  3JC6 D;  4EYY R;  2DCF A;  2RP4 A;  3DTO A;  4PK4 A;  2KZ7 B;  3C50 A;  3IHR A;  3U78 A;  3AAE B;  3BQL A;  2NWB A;  4PNI A;  3PE0 A;  2V7K A;  4L9I A;  3B57 A;  4UVB B;  5FY1 A;  5LCY A;  1FEW A;  3KDS E;  4O4J E;  2UXN B;  3O4X E;  3RYI E;  5KMG P;  4ERR A;  4C91 A;  4BJN A;  1WLX A;  4OK0 A;  4UIG A;  3GN5 A;  2LSG A;  3D0T A;  3ZC0 A;  5JDF A;  5A1L A;  2GK9 A;  5JRC B;  4H9R C;  3VU7 H;  4ZHQ E;  5JDG A;  3UUL A;  2ODV A;  2NTY A;  1HG5 A;  4YFS A;  3ZJ2 A;  4KMC A;  4OYK A;  2WMN A;  4IE5 A;  2ZLY A;  3ONX A;  2H3R A;  3FB2 A;  3I9Y A;  2ZM2 A;  1ZHC A;  3E0Z A;  4AQG A;  5F3J A;  2XAQ B;  4MHC A;  1WYB A;  4ASK A;  3PUR A;  4EYU A;  2L8K A;  2CCQ A;  2YU1 A;  4GYS A;  1BR2 A;  1IZN B;  3N5L A;  4I43 B;  5EZY E;  3UUX B;  1KNZ A;  3F57 A;  4N78 D;  3LJC A;  4MFR A;  1D0Y A;  1CUN A;  4AKL A;  3NBX X;  1HCI A;  4CXX A;  2Q9Q B;  5EK4 A;  3ZMZ B;  3BQI A;  2CMR A;  2VL8 A;  4HGA A;  3V5U A;  3K3Q C;  3MK7 C;  4X1I E;  4HN9 A;  3J7Y q;  2HPJ A;  4Z8X A;  3ZYM A;  3KBT A;  3SWH A;  4HKA A;  3S4U A;  2K5B B;  3QC9 A;  3BK9 A;  2A2F X;  5CA1 E;  2DLR A;  4HE8 A;  2IW5 B;  3CVR A;  4QXC B;  5E0O A;  4U74 A;  5FP3 A;  4X20 E;  5HYA A;  4V1A v;  4AKR B;  3N9Q A;  4WBN E;  3MXZ A;  5JRC A;  2UXX B;  3GMI A;  3PU3 A;  3HL6 A;  2A72 A;  4O8S A;  5FNV E;  4AKI A;  2CWY A;  1D1B A;  1MND A;  3Q5X A;  3QK6 A;  2E9X D;  3ZMT B;  3N9P A;  4X1K E;  3ETU A;  2WSS V;  1YW0 A;  5DAB A;  1UCU A;  4O4I E;  3C98 B;  3ZC1 A;  2X9W A;  1LRZ A;  2XQY A;  4EB6 E;  5L3E B;  5L3G B;  2XAF B;  3IEE A;  4DO0 A;  1ZEE A;  3Q9D A;  4QKN A;  5LA6 E;  1MMN A;  1S35 A;  3N9M A;  4L5G A;  3EUH A;  2MOZ A;  1SHZ C;  2X68 A;  4H9S E;  5H6Q B;  4DMW A;  5ADX L;  5LYJ E;  4YJ2 E;  1IAP A;  1MIV A;  1Y64 B;  1LKX A;  3V5S A;  1LVK A;  2E8I A;  5EK3 A;  2EHO C;  5C8Y E;  2YEV C;  1HG2 A;  1U5P A;  3GA8 A;  2Y6X A;  1D1A A;  4YJ3 E;  1U4Q A;  4B6X A;  3PU8 A;  3EDV A;  2LOP A;  2LM9 A;  4TZ4 C;  3SRZ A;  3N2O A;  2L3L A;  4TN7 B;  3LBX B;  4OFZ A;  4UEL A;  5HWX A;  5JR9 C;  2CXF A;  4EIW A;  3RYH E;  2DWG A;  2LSY A;  1HFA A;  1QSD A;  3MA9 A;  4CI2 B;  5LOV E;  3O1J A;  2OA5 A;  4MBQ A;  2CXL A;  2X0L B;  3ZJ1 A;  4BJM A;  2Q9Q A;  1BR4 A;  3LFM A;  4HEA A;  4AQF C;  2X51 A;  2CE7 A;  3CX6 B;  2VKH A;  5J1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...