4JI0T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji0T00
4DR7T 2UUCT 4LF6T 5LMUT 4X65T 4DUYT 2ZM6T 1IBMT 1N32T 4DV0T 4LF4T 4OX9T 1XMOT 4JI0T 1HNZT 4DR3T 4DV7T 2UU9T 4LFBT 4JI7T 4JI2T 4JI6T 4LF9T 4DR1T 4NXNT 4DV1T 4GKJT 4DR5T 5LMNT 4B3TT 4LFAT 1FJGT 3T1YT 4JV5T 4DR2T 4DV6T 2UXDT 1XNRT 4X62T 1N36T 2E5LT 2UUAT 4LFCT 1J5ET 4LF5T 2VQFT 1HNXT 4JI8T 5IWAT 3OTOT 4LF7T 4JI4T 4K0KT 4B3RT 4DV5T 4DV2T 2UUBT 4DV3T 1I94T 1HNWT 2HHHT 4YY3T 4YHHT 4JI1T 4NXMT 4GKKT 4LF8T 5BR8T 2F4VT 4X64T 1IBLT 1N34T 4KHPT 4AQYT 4B3MT 4DR4T 4X66T 4DUZT 4B3ST 1XMQT 4JI3T 4DR6T 1HR0T 4DV4T 4JYAT 1XNQT 2UXBT 1IBKT 4JI5T 3T1HT 1N33T 2VQET 2UXCT
chains in the Genus database with same CATH superfamily
1MIYA 3P50A 2M6IA 3CQCB 2XHEB 1MIWA 3WAJA 5L4EA 3CK6A 2CCQA 2NR4A 5LHHB 5LYJE 2CWYA 2ODVA 5L3BB 1J1JA 1HNZT 5LGUB 5JTGA 3CPZA 2IHR1 3NRXA 4JI7T 5KDMC 4HFDA 5DQWA 3HR0A 2DI4A 5LMNT 2KINB 2YEVC 1NENA 2V7KA 3CVRA 3MZKB 2ES0A 5HXCA 2MOZA 4ASKA 2A9UA 3ZT5A 1UUSA 4X20E 3RYCE 3FZMB 1T7SA 3P4SA 2BKOA 3GMIA 4FI5A 2K9AA 2WZIA 3M3ZB 5HEJA 2BBJA 4UVCB 1FEWA 2GK9A 2F4VT 3QC9A 5AQKB 5C3JA 1LKXA 2XM2A 2LRKA 4JI3T 1HX1B 1WLXA 3J7Yq 1HR0T 4IDNA 4CQIA 4JI5T 4MHCA 4X1YE 3DTOA 4EEBA 5GONE 2XTLA 5C2TA 1HCIA 2E9XD 4ZZBA 3FB2A 3OVUA 4PNIA 3KBUA 2ACXA 5H6RB 3QB5A 3H37A 2DL1A 3HKEE 5H6QB 3AE2A 5FNVE 3PUZF 2C5IT 3AEGA 2X0YA 3PJAA 3K3NA 2WU5A 2IMLA 1NEKA 4XBFB 1IAPA 3MACA 2CRBA 1ZP0A 3RIUC 4YJ2E 1Z8UA 1HTJF 1E1HB 4YT0A 2Q9QA 5F8PA 4TWDA 4JI8T 3EABA 2LLYA 4JI4T 4DV5T 1YQ4A 2DLRA 4TX5A 2LHRA 4X1IE 1S94A 4PK6A 5ABGA 2NP9A 3AVSA 3ONJA 3W15B 4ERRA 3OKQA 4HWFA 4EYYR 3WI3A 4IE5A 4X64T 1UGOA 5FVKA 2YK0A 5AFUL 4A98A 3RIAA 1D0ZA 3E0ZA 3AE3A 2PTFA 1UX5A 4TWFA 2PG8A 2C5KT 2ACZA 2K24A 5FXWA 2J47A 2H88A 3TLSA 2XQ8A 4DUYT 3PURA 5KXJA 2Q9QB 2RPAA 4OYJA 5CGMA 2FJEA 5HEGA 3T8OA 3NBXX 2XQ3A 3N2GE 2MAWA 4BJMA 2A2FX 2VL8A 2X67A 3RKGA 3AEBA 3CX8B 2UU9T 4YTNA 3RRWA 3AEAA 1FMVA 2JIWA 2JMKA 1WR6A 3SFEA 3K8PC 5JR9A 1T98A 2HN1A 3N9QA 2VURA 3VHLA 2M67A 5JQGE 2BG9C 3KV5A 3M65A 1SHZC 2BS4A 2BVLA 4O4HE 4WZXA 3L39A 3X1DA 2D9DA 3EVYA 5HAXA 4JI1T 3BQKA 4X5TA 4HE8A 3UUBA 2Y6XA 1WYCA 1W09A 4DMVA 2Q9QD 3CMLA 4AKRB 1HFAA 1QSDA 2IC9A 4IHJE 5LNKA 2K5BB 5F3JA 3C51A 1IBKT 2CPTA 2KWIB 2XSBA 3R84B 4O2BE 3AE7A 4DR7T 3ABVA 2WM9A 4O4IE 3UU8A 4BAYB 2C0SA 1VCTA 2V6YB 1OEDB 2W63A 3QK6A 4NIQA 1Y64B 2WMNA 4ZOLE 5AQOB 5FY7A 3QB5K 3AA6B 3MA9A 1OWAA 4DR5T 4LFAT 3C98B 5HXRA 4NUVA 5ABHA 1XDPA 3LBXA 4DR2T 5ADXL 4WNKA 2ZMAA 4HN9A 3RPUA 3ZKRA 3C50A 2W4XA 4P09A 1MMGA 3ZN1B 2WDVA 1J5ET 3AEEA 3F31A 1D1AA 4EV6A 4YJ3E 4LF7T 3VR9A 5JDHA 3A8YC 2XAHB 3AECA 5L3GB 2CHOA 3SRZA 2XJ7A 2H89A 4A5XA 1HG2A 2VVNA 3PU3A 5JDFA 2E5VA 4WBNE 2V1DB 3WAKA 4ZI3D 5CFBA 2E9XC 3P4PA 3ONLC 2MBGA 5FYMA 5DABA 1D1BA 4ZXLA 4QX8B 4HKAA 3KFWX 1D0XA 4QXHB 3AAAB 2H7VC 3KVAA 3UUNA 2FJAA 2PBIA 4TV8E 2XAGB 3P4QA 3AAEB 4ZI2D 2QGSA 5LOVE 2LE8A 1QLBA 4QH4A 2WCAA 2VWAA 2XAQB 4UELA 1NAFA 4UF0B 3OYZA 2JPFA 2CHNA 1GQEA 4IE6A 4GKJT 3B57A 4QWNB 3RYHE 1SE7A 2EHOA 4HFIA 4ILCA 4CZZB 3UULA 3ZSTA 4ILBA 3SFDA 2LT3A 4PFPA 3QNUA 5IYZE 1LVKA 2CXLA 1US7B 2D5UA 4TNWA 4K0KT 4B3RT 2WY2A 4HFEA 4MBQA 1IJ6A 1V9DA 3RC3A 4GK0E 1QUUA 3IA3A 2I59A 3CX6B 1MNDA 4EXTA 5AQSB 4ZI7E 5HWXA 3PUQA 2LM9A 1VOMA 3PUGA 2LJLA 4P0AA 1EZ3A 4YSXA 5J0ZA 3C4ZA 3ZMTB 1CUNA 4ADZA 2CXDA 1MMDA 4K0UA 1HX8A 3Q5XA 5ABFB 5FVLA 3JC6D 1IZNB 2WSSV 5AQQB 1XZYA 2QRXA 5L3FB 4PW8A 1XMOT 2UXXB 2BS2A 3ZSSA 5L2LA 3AAIA 2J1DG 2NWBA 3RH3A 4BA9A 5LG4A 3UFGA 1O3XA 4YLHA 3UUMA 2LSYA 3K1SA 1XDOA 2HH7A 3TLTA 1J5WA 3HKDE 3O1HA 3LK2B 1U5PA 5FXVA 3BQIA 1B7TA 3HL6A 5AQHB 2UUAT 2XAFB 4E7ZA 2YU1A 2Q9QC 4HFHA 2ZLYA 3KVBA 2E9XB 4F8HA 2V7MA 1WYBA 1R8IA 3FBLA 3OYXA 1W0BA 3FZHB 3Q5EA 3DP7A 1SUMB 3SWHA 2OA5A 4XAXB 2N9DA 3I1AA 4JLEA 2DWKA 2H3RA 2BG9E 5FKYA 2JQQA 5CJ5A 1BR2A 3J9X1 4OHFA 4DBRA 4UVAB 3ZCJA 2K3WA 1FIOA 1N32T 4UV9B 1U4QA 3AA7B 3LSVA 5CB4E 4YXDA 2CWOA 3ANWA 4DR3T 4JBWF 1KNPA 3JADA 3C64A 3RRCA 4DR1T 4U7YA 3AB3B 1FJGT 5TAOA 3RHWA 2W0GA 1ZHCA 2E5LT 2X0LB 2VQFT 4UVBB 2E2AA 2ODUA 4ZI3C 2Z6EA 1OEDC 5JDQA 2L9QA 3ETVA 3H3MA 2YDSA 2CLYB 3N9NA 2L8KA 4YY3T 5L3DB 3PUXF 3JAFA 3VKHA 3ANWB 4ISTA 5DQVA 3AXJA 4U31A 3ZMUB 3AEDA 4ILUA 2LEHA 3LDQB 3ONXA 4ZI2C 4QKNA 1XWMA 3N2OA 4DV4T 3ZYKA 3AVRA 2ZM2A 3N9LA 4H9OC 2VKDA 1N33T 2VQET 2H7OA 2DCFA 4IGUA 4UEMA 4IL4A 1IBMT 1Y01A 4EZ4A 4LF4T 4OX9T 1LVFA 1YKHB 3O4XE 5HCJA 4KBMB 3H3AA 3GWHA 2XM1A 4G2AA 2KNDA 4I0UA 4LFBT 2IDOB 3TLWA 3ZJ1A 3UUXB 2LOPA 4U2ZA 1WCRA 2C5JA 2PJQA 4QH1A 2KMFA 5AQGB 5J2UE 3ZMVB 4WYVA 2W2UA 4LMLA 5LG3A 4AQFC 3VKGA 3NKZA 1UX4A 3PUSA 2QA7A 5IWAT 5AQNB 5AQLB 4DV3T 3NRYA 4KI0F 5J1GA 2X9YA 2Y48B 1HNWT 2W61A 4CI1B 1BR1A 2W66A 5AQFB 2WDRA 4IDPA 1UCUA 3ZT7A 4DVDA 1M7KA 4AIUA 5JDMA 2BVMA 4B3MT 2NTYA 3Q2MA 5LGNB 3JC6C 2NW8A 3RQWA 4GYRA 2WBLA 3N9OA 2XQYA 3ZCIA 2YINA 4LMJA 2WDQA 4DBQA 5LMUT 4AKGA 1AJ3A 3K3OA 3UTKA 2LOSA 3VRBA 4TZ4C 2I6HA 4AXPA 3I9WA 3ZT6A 2A72A 5IUXA 5HXEA 1BR0A 3UQ7A 3RIUA 4ILAA 3P8CD 4DV7T 2D2SA 4OYKA 3RI5A 2X9HA 2X0HA 5JR9B 3Q9DA 5KMGP 2FBWA 4IL9A 3LK3B 4NXNT 4L5GA 4L9IA 1KFYA 4IDOA 4NUUA 5HCMA 2LSIA 3RQUA 1YQ3A 1N36T 4H9RC 4LFCT 3Q5DA 5AQJB 3IBPA 5FXXA 3MJXA 5JDGA 4UXNB 4AISA 4TUYE 4H9QC 2BKNA 3C4WA 4O8SA 3IHRA 2X9WA 4JEUB 5JREA 2KXPB 3GN5A 3E08A 4O4JE 1Z0PA 3EI0A 3ZC0A 2IUBA 3UU6A 4B3ST 4AKHA 4JYAT 2IIUA 2UXCT 2K48A 1KEYA 3PUVF 3PDYA 2V5CA 1D1CA 5LXTE 4JEHB 5CA1E 1E7PA 4MFRA 2VK9A 3NWIA 4C90A 3QUJA 5HEUA 4HTEA 5JRCA 2JRKA 3LBXB 4H9NC 4KMCA 4JI2T 2FJDA 3FXEB 4PK4A 2BG9A 2BZBA 1HF8A 1S35A 3PV0F 5J2TE 2LSKA 1KK7A 3T1YT 3ZLIA 2OLTA 4DV6T 2UXDT 2DWGA 5LGTB 3KV6A 4LF5T 2YKSA 4IT4A 1M62A 4GOUA 3VU7H 4HFVA 2VKHA 1YD8G 4IE4A 2XQ6A 3D0TA 3N9PA 1G73A 4LMKA 2AE9A 3O9XA 1VRBA 3EHZA 4L0RA 3B13A 1XMQT 3ZMZB 2N1GA 2UXBT 5JVDE 2A3DA 3UFEA 3V5SA 1OEDE 4EEDA 5JDNA 2WB5A 2I0MA 2KT9A 5HEOA 2SPCA 1YW0A 2VKJA 4DV0T 4V1Av 1DU2A 2CLYC 3IF8B 4HEAA 5LJMA 2WMOA 5FP3A 2EHOB 3FZLB 2B1EA 3N2KE 1I6ZA 4QHOA 2QVAA 4IREA 4DV1T 5FL1A 2CMRA 3N9MA 2LHNA 4O4LE 2N2NA 4DMWA 4U2YA 2V7IA 4QXCB 2W62A 3ZC1A 3RLFF 1UURA 1ZV4X 2OV9A 5EK3A 4COFA 3HA4A 3RYFE 5M4YA 4JUYA 5FL0A 3OTOT 3I0QA 4DV2T 2CEAA 3E22E 4ZEYA 2JQ9A 4EYUA 4I50E 5AQPB 2RP4A 4TWHA 1MIVA 4N78D 1UK5A 3DJBA 3RX6A 4YTPA 2X68A 1SA0E 1WRDA 3AE1A 2KSRA 5HXSA 3AA0B 2XQ7A 2JQKA 2V26A 2YN6A 2LRLA 3PUWF 2EHOD 1XNQT 2V8SV 4LF6T 3CWZB 2XZEA 2V5DA 4CN4A 5ABEA 2ZM8A 2BDEA 4QH5A 4YSYA 1X79A 2WZHA 2XQ5A 4KX6A 2V7JA 3F57A 5LCYA 3O1IA 4PK5A 2CM0A 3JAEA 4PAGA 4JI6T 3NVOA 4GIWA 3HKCE 4KP3C 4AKIA 5FY1A 2HPJA 2J4GA 1W9RA 3UQ4A 3UU4A 5LHIB 2RA1A 2CA5A 3OPCA 1L0VA 4P0BA 3PUYF 2WQYA 4CN6A 2FUPA 5A1LA 1T8BA 1G8XA 2ZM0A 4I43B 4OK0A 5LBQB 3EDVA 4CXWA 3VRAA 5JR9C 4NXMT 4YSZA 4UR9A 2LSGA 5L47A 1N34T 1W0AA 3KBTA 4Z91A 1D0YA 4DR4T 4AI6A 3PUAA 3KINB 5HYAA 3UU5A 4CXYA 4IDZA 4A56A 3NZPA 4DNDA 2V7LA 2XPKA 3U3IA 4E7SA 4EOZB 3AA1B 4O2AE 3IEEA 2VKOA 4EIWA 4QXBB 2J62A 1ZEEA 2MTQA 3PJAJ 3PU8A 3OJAA 3AE6A 5LA6E 2PFVA 3HI2A 4Z8XA 3CQXC 4DIDB 4PJJA 3A5XA 3RYIE 3LFMA 2CE7A 3BK9A 4DO0A 2KLQA 1KF6A 1WR0A 2X51A 1ZKEA 2XQ4A 4C91A 3AXJB 3SS1A 5ETWA 3R6NA 3TLVA 2XQ9A 3F2EA 2LM2A 2UUBT 2XAJB 4IIJE 1CHUA 3AE4A 3ZYLA 4GK5E 4EAHA 4GKKT 5LHGB 3EDUA 2X66A 4IE7A 3L8RA 4WW0A 4AQYT 3ZEFB 3MK7C 4I4TE 4NPPA 2W67A 3LK42 3RKOA 4Q25A 4KHZF 5JH7E 2MPKA 2CBJA 5C8YE 3T1HT 1MNEA 4HWHA 2UUCT 2YOEA 2E8IA 2IW5B 1T72A 4H9SE 5DJQC 1LRZA 5EK2A 1E2AA 3L3PA 1HS7A 4CI2B 2JMHA 3PE0A 2XSAA 4UIGA 4FJOA 1OXZA 2VL0A 4ZS3A 3TLUA 3FZKB 2M6BA 3FZFB 2NTXA 2LSJA 4OFZA 2V6YA 1OEDA 4PFOA 3S4UA 1IJ5A 4B3TT 3L09A 3MKDA 3CKDA 4JV5T 3I0OA 5L4HA 5FMNA 2QYWA 5HEHA 2FJBA 3Q5WA 2NW7A 3CIRA 2HPLA 2WU2A 3N5LA 1HNXT 4HFBA 4Z90A 3PTRB 2P9BA 2UXNB 3EAMA 4AKLA 2HHHT 4YTMA 2EHOC 3LJCA 5AQIB 3AE8A 4PJLA 3RC8A 4ISSA 2Y8DA 4LF8T 3SOLA 3I9YA 1NWMX 1ZOYA 5EK4A 4H9PC 3UT5E 2BBHA 2D0TA 4DUZT 4IE0A 4DR6T 5L3EB 4H63H 1YKEB 4MLKA 4YHJA 1MMNA 5HXHA 4I55E 5LB7B 4U74A 4X1KE 4U7IA 3FBZA 3K3QC 4X65T 3ZJ2A 2ZM6T 2VASA 3RIFA 1X9BA 2XUEA 4U72A 1KNRA 4JI0T 2R6GF 3HKBE 5AQTB 5CA0E 4MALA 4AQFA 5KX5E 2CBIA 4M1PA 3NZQA 4LF9T 5EZYE 5AQUB 3A7MA 3P4RA 3V5UA 2BKPA 4CI3B 4HWCA 2LKGA 2XASB 3VR8A 5IHYA 4CXXA 4TNVA 3ZYMA 3MXZA 4UF0A 1BR4A 5E0OA 4BJNA 4PJMA 4A97A 3ZPOA 3UU3A 2WP9A 4PJNA 1JNZA 3AE9A 2LKHA 3P7IA 4ZS2A 1HG5A 2KWHA 3GN5B 2CXFA 4EB6E 2V6XA 5F5WA 3TKLB 4YHHT 2HN2A 4U3CA 2X9XA 5LBMA 2KZ7B 2D0UA 5L3CB 2XY8B 1KNZA 2WAUA 1IBLT 3U78A 2BS3A 4X66T 2VVSA 5LJNA 1WFDA 3AE5A 3JCFA 3B5MA 3FXDB 4HWIB 1JNRA 4XZCA 4TV9E 3ZN0B 4AQGA 4HFCA 2B76A 1H7CA 2WWUA 5JRCB 2WWVA 4UV8B 3EUHA 3P4WA 2IAKA 2BG9B 3ESLA 4EGWA 4KUMB 4G63A 4EZHA 3FHNA 3O1JA 3KV4A 2YU2A 5ABFA 1YXRA 3RF1A 2G0UA 4B6XA 4IDQA 3RGLA 4ZZCA 4ANJA 4TN7B 2JQHA 2XQAA 5AQRB 4WBOA 1XNRT 2JJ9A 4X62T 3AEFA 5FY0A 1FMWA 2YDQA 4HWDA 3KV9A 4YFSA 5AQMB 4QX7B 5BMVE 3CX7B 2AXDS 2W00A 3BQLA 3G06A 4ZHQE 4HGAA 3KDSE 1I94T 3ETUA 2IC6A 5FXZA 4P1NA 3LG7A 2VB6A 3QOFA 5BR8T 1VCSA 3C4XA 4U33A 2E9XA 2NW9A 4J2CA 3GA8A 4KHPT 2DNXA 4H63V 3ZMSB 2L3LA 4GYSA 4CN1A 2WS3A 2YDRA 1MMAA 5AQVB 3CQGB 5JDLA 4F6RC 5HWYA 3OBVE 5LP6E 2NOXA 2DHRA 2MYSA
chains in the Genus database with same CATH topology
4DR7T 2UUCT 4LF6T 5LMUT 4X65T 4DUYT 2ZM6T 1IBMT 1N32T 4DV0T 4LF4T 4OX9T 1XMOT 4JI0T 1HNZT 4DR3T 4DV7T 2UU9T 4LFBT 4JI7T 4JI2T 4JI6T 4LF9T 4DR1T 4NXNT 4DV1T 4GKJT 4DR5T 5LMNT 4B3TT 4LFAT 1FJGT 3T1YT 4JV5T 4DR2T 4DV6T 2UXDT 1XNRT 4X62T 1N36T 2E5LT 2UUAT 4LFCT 1J5ET 4LF5T 2VQFT 1HNXT 4JI8T 5IWAT 3OTOT 4LF7T 4JI4T 4K0KT 4B3RT 4DV5T 4DV2T 2UUBT 4DV3T 1I94T 1HNWT 2HHHT 4YY3T 4YHHT 4JI1T 4NXMT 4GKKT 4LF8T 5BR8T 2F4VT 4X64T 1IBLT 1N34T 4KHPT 4AQYT 4B3MT 4DR4T 4X66T 4DUZT 4B3ST 1XMQT 4JI3T 4DR6T 1HR0T 4DV4T 4JYAT 1XNQT 2UXBT 1IBKT 4JI5T 3T1HT 1N33T 2VQET 2UXCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 T;  2UUC T;  4LF6 T;  5LMU T;  4X65 T;  4DUY T;  2ZM6 T;  1IBM T;  1N32 T;  4DV0 T;  4LF4 T;  4OX9 T;  1XMO T;  4JI0 T;  1HNZ T;  4DR3 T;  4DV7 T;  2UU9 T;  4LFB T;  4JI7 T;  4JI2 T;  4JI6 T;  4LF9 T;  4DR1 T;  4NXN T;  4DV1 T;  4GKJ T;  4DR5 T;  5LMN T;  4B3T T;  4LFA T;  1FJG T;  3T1Y T;  4JV5 T;  4DR2 T;  4DV6 T;  2UXD T;  1XNR T;  4X62 T;  1N36 T;  2E5L T;  2UUA T;  4LFC T;  1J5E T;  4LF5 T;  2VQF T;  1HNX T;  4JI8 T;  5IWA T;  3OTO T;  4LF7 T;  4JI4 T;  4K0K T;  4B3R T;  4DV5 T;  4DV2 T;  2UUB T;  4DV3 T;  1I94 T;  1HNW T;  2HHH T;  4YY3 T;  4YHH T;  4JI1 T;  4NXM T;  4GKK T;  4LF8 T;  5BR8 T;  2F4V T;  4X64 T;  1IBL T;  1N34 T;  4KHP T;  4AQY T;  4B3M T;  4DR4 T;  4X66 T;  4DUZ T;  4B3S T;  1XMQ T;  4JI3 T;  4DR6 T;  1HR0 T;  4DV4 T;  4JYA T;  1XNQ T;  2UXB T;  1IBK T;  4JI5 T;  3T1H T;  1N33 T;  2VQE T;  2UXC T; 
#chains in the Genus database with same CATH topology
 1MIY A;  3P50 A;  2M6I A;  3CQC B;  2XHE B;  1MIW A;  3WAJ A;  5L4E A;  3CK6 A;  2CCQ A;  2NR4 A;  5LHH B;  5LYJ E;  2CWY A;  2ODV A;  5L3B B;  1J1J A;  1HNZ T;  5LGU B;  5JTG A;  3CPZ A;  2IHR 1;  3NRX A;  4JI7 T;  5KDM C;  4HFD A;  5DQW A;  3HR0 A;  2DI4 A;  5LMN T;  2KIN B;  2YEV C;  1NEN A;  2V7K A;  3CVR A;  3MZK B;  2ES0 A;  5HXC A;  2MOZ A;  4ASK A;  2A9U A;  3ZT5 A;  1UUS A;  4X20 E;  3RYC E;  3FZM B;  1T7S A;  3P4S A;  2BKO A;  3GMI A;  4FI5 A;  2K9A A;  2WZI A;  3M3Z B;  5HEJ A;  2BBJ A;  4UVC B;  1FEW A;  2GK9 A;  2F4V T;  3QC9 A;  5AQK B;  5C3J A;  1LKX A;  2XM2 A;  2LRK A;  4JI3 T;  1HX1 B;  1WLX A;  3J7Y q;  1HR0 T;  4IDN A;  4CQI A;  4JI5 T;  4MHC A;  4X1Y E;  3DTO A;  4EEB A;  5GON E;  2XTL A;  5C2T A;  1HCI A;  2E9X D;  4ZZB A;  3FB2 A;  3OVU A;  4PNI A;  3KBU A;  2ACX A;  5H6R B;  3QB5 A;  3H37 A;  2DL1 A;  3HKE E;  5H6Q B;  3AE2 A;  5FNV E;  3PUZ F;  2C5I T;  3AEG A;  2X0Y A;  3PJA A;  3K3N A;  2WU5 A;  2IML A;  1NEK A;  4XBF B;  1IAP A;  3MAC A;  2CRB A;  1ZP0 A;  3RIU C;  4YJ2 E;  1Z8U A;  1HTJ F;  1E1H B;  4YT0 A;  2Q9Q A;  5F8P A;  4TWD A;  4JI8 T;  3EAB A;  2LLY A;  4JI4 T;  4DV5 T;  1YQ4 A;  2DLR A;  4TX5 A;  2LHR A;  4X1I E;  1S94 A;  4PK6 A;  5ABG A;  2NP9 A;  3AVS A;  3ONJ A;  3W15 B;  4ERR A;  3OKQ A;  4HWF A;  4EYY R;  3WI3 A;  4IE5 A;  4X64 T;  1UGO A;  5FVK A;  2YK0 A;  5AFU L;  4A98 A;  3RIA A;  1D0Z A;  3E0Z A;  3AE3 A;  2PTF A;  1UX5 A;  4TWF A;  2PG8 A;  2C5K T;  2ACZ A;  2K24 A;  5FXW A;  2J47 A;  2H88 A;  3TLS A;  2XQ8 A;  4DUY T;  3PUR A;  5KXJ A;  2Q9Q B;  2RPA A;  4OYJ A;  5CGM A;  2FJE A;  5HEG A;  3T8O A;  3NBX X;  2XQ3 A;  3N2G E;  2MAW A;  4BJM A;  2A2F X;  2VL8 A;  2X67 A;  3RKG A;  3AEB A;  3CX8 B;  2UU9 T;  4YTN A;  3RRW A;  3AEA A;  1FMV A;  2JIW A;  2JMK A;  1WR6 A;  3SFE A;  3K8P C;  5JR9 A;  1T98 A;  2HN1 A;  3N9Q A;  2VUR A;  3VHL A;  2M67 A;  5JQG E;  2BG9 C;  3KV5 A;  3M65 A;  1SHZ C;  2BS4 A;  2BVL A;  4O4H E;  4WZX A;  3L39 A;  3X1D A;  2D9D A;  3EVY A;  5HAX A;  4JI1 T;  3BQK A;  4X5T A;  4HE8 A;  3UUB A;  2Y6X A;  1WYC A;  1W09 A;  4DMV A;  2Q9Q D;  3CML A;  4AKR B;  1HFA A;  1QSD A;  2IC9 A;  4IHJ E;  5LNK A;  2K5B B;  5F3J A;  3C51 A;  1IBK T;  2CPT A;  2KWI B;  2XSB A;  3R84 B;  4O2B E;  3AE7 A;  4DR7 T;  3ABV A;  2WM9 A;  4O4I E;  3UU8 A;  4BAY B;  2C0S A;  1VCT A;  2V6Y B;  1OED B;  2W63 A;  3QK6 A;  4NIQ A;  1Y64 B;  2WMN A;  4ZOL E;  5AQO B;  5FY7 A;  3QB5 K;  3AA6 B;  3MA9 A;  1OWA A;  4DR5 T;  4LFA T;  3C98 B;  5HXR A;  4NUV A;  5ABH A;  1XDP A;  3LBX A;  4DR2 T;  5ADX L;  4WNK A;  2ZMA A;  4HN9 A;  3RPU A;  3ZKR A;  3C50 A;  2W4X A;  4P09 A;  1MMG A;  3ZN1 B;  2WDV A;  1J5E T;  3AEE A;  3F31 A;  1D1A A;  4EV6 A;  4YJ3 E;  4LF7 T;  3VR9 A;  5JDH A;  3A8Y C;  2XAH B;  3AEC A;  5L3G B;  2CHO A;  3SRZ A;  2XJ7 A;  2H89 A;  4A5X A;  1HG2 A;  2VVN A;  3PU3 A;  5JDF A;  2E5V A;  4WBN E;  2V1D B;  3WAK A;  4ZI3 D;  5CFB A;  2E9X C;  3P4P A;  3ONL C;  2MBG A;  5FYM A;  5DAB A;  1D1B A;  4ZXL A;  4QX8 B;  4HKA A;  3KFW X;  1D0X A;  4QXH B;  3AAA B;  2H7V C;  3KVA A;  3UUN A;  2FJA A;  2PBI A;  4TV8 E;  2XAG B;  3P4Q A;  3AAE B;  4ZI2 D;  2QGS A;  5LOV E;  2LE8 A;  1QLB A;  4QH4 A;  2WCA A;  2VWA A;  2XAQ B;  4UEL A;  1NAF A;  4UF0 B;  3OYZ A;  2JPF A;  2CHN A;  1GQE A;  4IE6 A;  4GKJ T;  3B57 A;  4QWN B;  3RYH E;  1SE7 A;  2EHO A;  4HFI A;  4ILC A;  4CZZ B;  3UUL A;  3ZST A;  4ILB A;  3SFD A;  2LT3 A;  4PFP A;  3QNU A;  5IYZ E;  1LVK A;  2CXL A;  1US7 B;  2D5U A;  4TNW A;  4K0K T;  4B3R T;  2WY2 A;  4HFE A;  4MBQ A;  1IJ6 A;  1V9D A;  3RC3 A;  4GK0 E;  1QUU A;  3IA3 A;  2I59 A;  3CX6 B;  1MND A;  4EXT A;  5AQS B;  4ZI7 E;  5HWX A;  3PUQ A;  2LM9 A;  1VOM A;  3PUG A;  2LJL A;  4P0A A;  1EZ3 A;  4YSX A;  5J0Z A;  3C4Z A;  3ZMT B;  1CUN A;  4ADZ A;  2CXD A;  1MMD A;  4K0U A;  1HX8 A;  3Q5X A;  5ABF B;  5FVL A;  3JC6 D;  1IZN B;  2WSS V;  5AQQ B;  1XZY A;  2QRX A;  5L3F B;  4PW8 A;  1XMO T;  2UXX B;  2BS2 A;  3ZSS A;  5L2L A;  3AAI A;  2J1D G;  2NWB A;  3RH3 A;  4BA9 A;  5LG4 A;  3UFG A;  1O3X A;  4YLH A;  3UUM A;  2LSY A;  3K1S A;  1XDO A;  2HH7 A;  3TLT A;  1J5W A;  3HKD E;  3O1H A;  3LK2 B;  1U5P A;  5FXV A;  3BQI A;  1B7T A;  3HL6 A;  5AQH B;  2UUA T;  2XAF B;  4E7Z A;  2YU1 A;  2Q9Q C;  4HFH A;  2ZLY A;  3KVB A;  2E9X B;  4F8H A;  2V7M A;  1WYB A;  1R8I A;  3FBL A;  3OYX A;  1W0B A;  3FZH B;  3Q5E A;  3DP7 A;  1SUM B;  3SWH A;  2OA5 A;  4XAX B;  2N9D A;  3I1A A;  4JLE A;  2DWK A;  2H3R A;  2BG9 E;  5FKY A;  2JQQ A;  5CJ5 A;  1BR2 A;  3J9X 1;  4OHF A;  4DBR A;  4UVA B;  3ZCJ A;  2K3W A;  1FIO A;  1N32 T;  4UV9 B;  1U4Q A;  3AA7 B;  3LSV A;  5CB4 E;  4YXD A;  2CWO A;  3ANW A;  4DR3 T;  4JBW F;  1KNP A;  3JAD A;  3C64 A;  3RRC A;  4DR1 T;  4U7Y A;  3AB3 B;  1FJG T;  5TAO A;  3RHW A;  2W0G A;  1ZHC A;  2E5L T;  2X0L B;  2VQF T;  4UVB B;  2E2A A;  2ODU A;  4ZI3 C;  2Z6E A;  1OED C;  5JDQ A;  2L9Q A;  3ETV A;  3H3M A;  2YDS A;  2CLY B;  3N9N A;  2L8K A;  4YY3 T;  5L3D B;  3PUX F;  3JAF A;  3VKH A;  3ANW B;  4IST A;  5DQV A;  3AXJ A;  4U31 A;  3ZMU B;  3AED A;  4ILU A;  2LEH A;  3LDQ B;  3ONX A;  4ZI2 C;  4QKN A;  1XWM A;  3N2O A;  4DV4 T;  3ZYK A;  3AVR A;  2ZM2 A;  3N9L A;  4H9O C;  2VKD A;  1N33 T;  2VQE T;  2H7O A;  2DCF A;  4IGU A;  4UEM A;  4IL4 A;  1IBM T;  1Y01 A;  4EZ4 A;  4LF4 T;  4OX9 T;  1LVF A;  1YKH B;  3O4X E;  5HCJ A;  4KBM B;  3H3A A;  3GWH A;  2XM1 A;  4G2A A;  2KND A;  4I0U A;  4LFB T;  2IDO B;  3TLW A;  3ZJ1 A;  3UUX B;  2LOP A;  4U2Z A;  1WCR A;  2C5J A;  2PJQ A;  4QH1 A;  2KMF A;  5AQG B;  5J2U E;  3ZMV B;  4WYV A;  2W2U A;  4LML A;  5LG3 A;  4AQF C;  3VKG A;  3NKZ A;  1UX4 A;  3PUS A;  2QA7 A;  5IWA T;  5AQN B;  5AQL B;  4DV3 T;  3NRY A;  4KI0 F;  5J1G A;  2X9Y A;  2Y48 B;  1HNW T;  2W61 A;  4CI1 B;  1BR1 A;  2W66 A;  5AQF B;  2WDR A;  4IDP A;  1UCU A;  3ZT7 A;  4DVD A;  1M7K A;  4AIU A;  5JDM A;  2BVM A;  4B3M T;  2NTY A;  3Q2M A;  5LGN B;  3JC6 C;  2NW8 A;  3RQW A;  4GYR A;  2WBL A;  3N9O A;  2XQY A;  3ZCI A;  2YIN A;  4LMJ A;  2WDQ A;  4DBQ A;  5LMU T;  4AKG A;  1AJ3 A;  3K3O A;  3UTK A;  2LOS A;  3VRB A;  4TZ4 C;  2I6H A;  4AXP A;  3I9W A;  3ZT6 A;  2A72 A;  5IUX A;  5HXE A;  1BR0 A;  3UQ7 A;  3RIU A;  4ILA A;  3P8C D;  4DV7 T;  2D2S A;  4OYK A;  3RI5 A;  2X9H A;  2X0H A;  5JR9 B;  3Q9D A;  5KMG P;  2FBW A;  4IL9 A;  3LK3 B;  4NXN T;  4L5G A;  4L9I A;  1KFY A;  4IDO A;  4NUU A;  5HCM A;  2LSI A;  3RQU A;  1YQ3 A;  1N36 T;  4H9R C;  4LFC T;  3Q5D A;  5AQJ B;  3IBP A;  5FXX A;  3MJX A;  5JDG A;  4UXN B;  4AIS A;  4TUY E;  4H9Q C;  2BKN A;  3C4W A;  4O8S A;  3IHR A;  2X9W A;  4JEU B;  5JRE A;  2KXP B;  3GN5 A;  3E08 A;  4O4J E;  1Z0P A;  3EI0 A;  3ZC0 A;  2IUB A;  3UU6 A;  4B3S T;  4AKH A;  4JYA T;  2IIU A;  2UXC T;  2K48 A;  1KEY A;  3PUV F;  3PDY A;  2V5C A;  1D1C A;  5LXT E;  4JEH B;  5CA1 E;  1E7P A;  4MFR A;  2VK9 A;  3NWI A;  4C90 A;  3QUJ A;  5HEU A;  4HTE A;  5JRC A;  2JRK A;  3LBX B;  4H9N C;  4KMC A;  4JI2 T;  2FJD A;  3FXE B;  4PK4 A;  2BG9 A;  2BZB A;  1HF8 A;  1S35 A;  3PV0 F;  5J2T E;  2LSK A;  1KK7 A;  3T1Y T;  3ZLI A;  2OLT A;  4DV6 T;  2UXD T;  2DWG A;  5LGT B;  3KV6 A;  4LF5 T;  2YKS A;  4IT4 A;  1M62 A;  4GOU A;  3VU7 H;  4HFV A;  2VKH A;  1YD8 G;  4IE4 A;  2XQ6 A;  3D0T A;  3N9P A;  1G73 A;  4LMK A;  2AE9 A;  3O9X A;  1VRB A;  3EHZ A;  4L0R A;  3B13 A;  1XMQ T;  3ZMZ B;  2N1G A;  2UXB T;  5JVD E;  2A3D A;  3UFE A;  3V5S A;  1OED E;  4EED A;  5JDN A;  2WB5 A;  2I0M A;  2KT9 A;  5HEO A;  2SPC A;  1YW0 A;  2VKJ A;  4DV0 T;  4V1A v;  1DU2 A;  2CLY C;  3IF8 B;  4HEA A;  5LJM A;  2WMO A;  5FP3 A;  2EHO B;  3FZL B;  2B1E A;  3N2K E;  1I6Z A;  4QHO A;  2QVA A;  4IRE A;  4DV1 T;  5FL1 A;  2CMR A;  3N9M A;  2LHN A;  4O4L E;  2N2N A;  4DMW A;  4U2Y A;  2V7I A;  4QXC B;  2W62 A;  3ZC1 A;  3RLF F;  1UUR A;  1ZV4 X;  2OV9 A;  5EK3 A;  4COF A;  3HA4 A;  3RYF E;  5M4Y A;  4JUY A;  5FL0 A;  3OTO T;  3I0Q A;  4DV2 T;  2CEA A;  3E22 E;  4ZEY A;  2JQ9 A;  4EYU A;  4I50 E;  5AQP B;  2RP4 A;  4TWH A;  1MIV A;  4N78 D;  1UK5 A;  3DJB A;  3RX6 A;  4YTP A;  2X68 A;  1SA0 E;  1WRD A;  3AE1 A;  2KSR A;  5HXS A;  3AA0 B;  2XQ7 A;  2JQK A;  2V26 A;  2YN6 A;  2LRL A;  3PUW F;  2EHO D;  1XNQ T;  2V8S V;  4LF6 T;  3CWZ B;  2XZE A;  2V5D A;  4CN4 A;  5ABE A;  2ZM8 A;  2BDE A;  4QH5 A;  4YSY A;  1X79 A;  2WZH A;  2XQ5 A;  4KX6 A;  2V7J A;  3F57 A;  5LCY A;  3O1I A;  4PK5 A;  2CM0 A;  3JAE A;  4PAG A;  4JI6 T;  3NVO A;  4GIW A;  3HKC E;  4KP3 C;  4AKI A;  5FY1 A;  2HPJ A;  2J4G A;  1W9R A;  3UQ4 A;  3UU4 A;  5LHI B;  2RA1 A;  2CA5 A;  3OPC A;  1L0V A;  4P0B A;  3PUY F;  2WQY A;  4CN6 A;  2FUP A;  5A1L A;  1T8B A;  1G8X A;  2ZM0 A;  4I43 B;  4OK0 A;  5LBQ B;  3EDV A;  4CXW A;  3VRA A;  5JR9 C;  4NXM T;  4YSZ A;  4UR9 A;  2LSG A;  5L47 A;  1N34 T;  1W0A A;  3KBT A;  4Z91 A;  1D0Y A;  4DR4 T;  4AI6 A;  3PUA A;  3KIN B;  5HYA A;  3UU5 A;  4CXY A;  4IDZ A;  4A56 A;  3NZP A;  4DND A;  2V7L A;  2XPK A;  3U3I A;  4E7S A;  4EOZ B;  3AA1 B;  4O2A E;  3IEE A;  2VKO A;  4EIW A;  4QXB B;  2J62 A;  1ZEE A;  2MTQ A;  3PJA J;  3PU8 A;  3OJA A;  3AE6 A;  5LA6 E;  2PFV A;  3HI2 A;  4Z8X A;  3CQX C;  4DID B;  4PJJ A;  3A5X A;  3RYI E;  3LFM A;  2CE7 A;  3BK9 A;  4DO0 A;  2KLQ A;  1KF6 A;  1WR0 A;  2X51 A;  1ZKE A;  2XQ4 A;  4C91 A;  3AXJ B;  3SS1 A;  5ETW A;  3R6N A;  3TLV A;  2XQ9 A;  3F2E A;  2LM2 A;  2UUB T;  2XAJ B;  4IIJ E;  1CHU A;  3AE4 A;  3ZYL A;  4GK5 E;  4EAH A;  4GKK T;  5LHG B;  3EDU A;  2X66 A;  4IE7 A;  3L8R A;  4WW0 A;  4AQY T;  3ZEF B;  3MK7 C;  4I4T E;  4NPP A;  2W67 A;  3LK4 2;  3RKO A;  4Q25 A;  4KHZ F;  5JH7 E;  2MPK A;  2CBJ A;  5C8Y E;  3T1H T;  1MNE A;  4HWH A;  2UUC T;  2YOE A;  2E8I A;  2IW5 B;  1T72 A;  4H9S E;  5DJQ C;  1LRZ A;  5EK2 A;  1E2A A;  3L3P A;  1HS7 A;  4CI2 B;  2JMH A;  3PE0 A;  2XSA A;  4UIG A;  4FJO A;  1OXZ A;  2VL0 A;  4ZS3 A;  3TLU A;  3FZK B;  2M6B A;  3FZF B;  2NTX A;  2LSJ A;  4OFZ A;  2V6Y A;  1OED A;  4PFO A;  3S4U A;  1IJ5 A;  4B3T T;  3L09 A;  3MKD A;  3CKD A;  4JV5 T;  3I0O A;  5L4H A;  5FMN A;  2QYW A;  5HEH A;  2FJB A;  3Q5W A;  2NW7 A;  3CIR A;  2HPL A;  2WU2 A;  3N5L A;  1HNX T;  4HFB A;  4Z90 A;  3PTR B;  2P9B A;  2UXN B;  3EAM A;  4AKL A;  2HHH T;  4YTM A;  2EHO C;  3LJC A;  5AQI B;  3AE8 A;  4PJL A;  3RC8 A;  4ISS A;  2Y8D A;  4LF8 T;  3SOL A;  3I9Y A;  1NWM X;  1ZOY A;  5EK4 A;  4H9P C;  3UT5 E;  2BBH A;  2D0T A;  4DUZ T;  4IE0 A;  4DR6 T;  5L3E B;  4H63 H;  1YKE B;  4MLK A;  4YHJ A;  1MMN A;  5HXH A;  4I55 E;  5LB7 B;  4U74 A;  4X1K E;  4U7I A;  3FBZ A;  3K3Q C;  4X65 T;  3ZJ2 A;  2ZM6 T;  2VAS A;  3RIF A;  1X9B A;  2XUE A;  4U72 A;  1KNR A;  4JI0 T;  2R6G F;  3HKB E;  5AQT B;  5CA0 E;  4MAL A;  4AQF A;  5KX5 E;  2CBI A;  4M1P A;  3NZQ A;  4LF9 T;  5EZY E;  5AQU B;  3A7M A;  3P4R A;  3V5U A;  2BKP A;  4CI3 B;  4HWC A;  2LKG A;  2XAS B;  3VR8 A;  5IHY A;  4CXX A;  4TNV A;  3ZYM A;  3MXZ A;  4UF0 A;  1BR4 A;  5E0O A;  4BJN A;  4PJM A;  4A97 A;  3ZPO A;  3UU3 A;  2WP9 A;  4PJN A;  1JNZ A;  3AE9 A;  2LKH A;  3P7I A;  4ZS2 A;  1HG5 A;  2KWH A;  3GN5 B;  2CXF A;  4EB6 E;  2V6X A;  5F5W A;  3TKL B;  4YHH T;  2HN2 A;  4U3C A;  2X9X A;  5LBM A;  2KZ7 B;  2D0U A;  5L3C B;  2XY8 B;  1KNZ A;  2WAU A;  1IBL T;  3U78 A;  2BS3 A;  4X66 T;  2VVS A;  5LJN A;  1WFD A;  3AE5 A;  3JCF A;  3B5M A;  3FXD B;  4HWI B;  1JNR A;  4XZC A;  4TV9 E;  3ZN0 B;  4AQG A;  4HFC A;  2B76 A;  1H7C A;  2WWU A;  5JRC B;  2WWV A;  4UV8 B;  3EUH A;  3P4W A;  2IAK A;  2BG9 B;  3ESL A;  4EGW A;  4KUM B;  4G63 A;  4EZH A;  3FHN A;  3O1J A;  3KV4 A;  2YU2 A;  5ABF A;  1YXR A;  3RF1 A;  2G0U A;  4B6X A;  4IDQ A;  3RGL A;  4ZZC A;  4ANJ A;  4TN7 B;  2JQH A;  2XQA A;  5AQR B;  4WBO A;  1XNR T;  2JJ9 A;  4X62 T;  3AEF A;  5FY0 A;  1FMW A;  2YDQ A;  4HWD A;  3KV9 A;  4YFS A;  5AQM B;  4QX7 B;  5BMV E;  3CX7 B;  2AXD S;  2W00 A;  3BQL A;  3G06 A;  4ZHQ E;  4HGA A;  3KDS E;  1I94 T;  3ETU A;  2IC6 A;  5FXZ A;  4P1N A;  3LG7 A;  2VB6 A;  3QOF A;  5BR8 T;  1VCS A;  3C4X A;  4U33 A;  2E9X A;  2NW9 A;  4J2C A;  3GA8 A;  4KHP T;  2DNX A;  4H63 V;  3ZMS B;  2L3L A;  4GYS A;  4CN1 A;  2WS3 A;  2YDR A;  1MMA A;  5AQV B;  3CQG B;  5JDL A;  4F6R C;  5HWY A;  3OBV E;  5LP6 E;  2NOX A;  2DHR A;  2MYS A; 
#chains in the Genus database with same CATH homology
 4DR7 T;  2UUC T;  4LF6 T;  5LMU T;  4X65 T;  4DUY T;  2ZM6 T;  1IBM T;  1N32 T;  4DV0 T;  4LF4 T;  4OX9 T;  1XMO T;  4JI0 T;  1HNZ T;  4DR3 T;  4DV7 T;  2UU9 T;  4LFB T;  4JI7 T;  4JI2 T;  4JI6 T;  4LF9 T;  4DR1 T;  4NXN T;  4DV1 T;  4GKJ T;  4DR5 T;  5LMN T;  4B3T T;  4LFA T;  1FJG T;  3T1Y T;  4JV5 T;  4DR2 T;  4DV6 T;  2UXD T;  1XNR T;  4X62 T;  1N36 T;  2E5L T;  2UUA T;  4LFC T;  1J5E T;  4LF5 T;  2VQF T;  1HNX T;  4JI8 T;  5IWA T;  3OTO T;  4LF7 T;  4JI4 T;  4K0K T;  4B3R T;  4DV5 T;  4DV2 T;  2UUB T;  4DV3 T;  1I94 T;  1HNW T;  2HHH T;  4YY3 T;  4YHH T;  4JI1 T;  4NXM T;  4GKK T;  4LF8 T;  5BR8 T;  2F4V T;  4X64 T;  1IBL T;  1N34 T;  4KHP T;  4AQY T;  4B3M T;  4DR4 T;  4X66 T;  4DUZ T;  4B3S T;  1XMQ T;  4JI3 T;  4DR6 T;  1HR0 T;  4DV4 T;  4JYA T;  1XNQ T;  2UXB T;  1IBK T;  4JI5 T;  3T1H T;  1N33 T;  2VQE T;  2UXC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...