4JI0T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 39
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji0T00
4LF6T 3OTOT 1HNWT 4JYAT 2HHHT 1HR0T 4DR3T 4YY3T 4JI1T 4DR7T 4DV7T 4JI2T 4JI7T 2VQFT 2UUBT 2UXCT 1N32T 1J5ET 4JI6T 5BR8T 3T1YT 4LFBT 4LF5T 2F4VT 4LFCT 4AQYT 4X62T 1I94T 2E5LT 4OX9T 4GKJT 4DR1T 1XMOT 5LMNT 4X66T 4K0KT 4JI0T 4JI5T 1IBMT 4JI4T 4DR2T 4B3MT 2UXDT 4GKKT 4NXNT 2UUCT 2ZM6T 4DR4T 4JV5T 4LF8T 4DUZT 4DV0T 4DV5T 4LFAT 4JI8T 1N33T 1HNXT 4JI3T 4LF9T 4DR6T 2VQET 4X64T 4B3RT 2UXBT 5LMUT 4NXMT 1XMQT 1N36T 4B3ST 4DR5T 4X65T 4YHHT 1IBLT 5IWAT 4B3TT 4LF4T 2UU9T 4DV4T 1IBKT 2UUAT 1XNQT 3T1HT 4DUYT 4DV6T 1FJGT 1XNRT 1HNZT 4DV1T 4KHPT 4DV3T 1N34T 4DV2T 4LF7T
chains in the Genus database with same CATH superfamily
4YT0A 5F3JA 5FY0A 3UUXB 4EZ4A 4LF6T 1HNWT 1NEKA 5AQPB 5LYJE 4AKHA 2CLYB 2HHHT 1XZYA 4IIJE 3CWZB 2XAFB 2LOSA 2YU2A 1UCUA 2PBIA 1XDPA 3NZQA 2FJAA 3FBZA 5AQVB 2E9XA 2W00A 1H7CA 2BKOA 3ZKRA 4DV7T 4PAGA 3X1DA 2MYSA 5ABFA 2LSGA 4B3TT 3AA1B 2XSBA 3I0OA 3AE5A 3M3ZB 2K24A 4QWNB 2IW5B 3ZYLA 3KBTA 3MKDA 2N2NA 1DU2A 3N9LA 4ZS3A 3TLTA 4B6XA 5HAXA 4IDQA 5HEJA 4HWCA 1XDOA 2V7KA 1BR1A 2WSSV 5JDQA 3T1YT 1S94A 1JNZA 5LBQB 2WAUA 4TNWA 3R84B 4AKLA 5L3BB 2F4VT 4IE6A 3UFEA 5KX5E 2IIUA 3ONXA 4XBFB 2B1EA 5DQVA 2Q9QD 3UQ4A 4C91A 3PJAA 2JMKA 3C51A 3HKBE 3ZC1A 1Y01A 3OYZA 3HKEE 2N9DA 2X9YA 4IDZA 4Z90A 4IT4A 1YD8G 1OEDB 4U2YA 5AQQB 3ZSSA 2D5UA 4X1YE 2V5CA 3KFWX 4X66T 2X66A 1MNDA 2QYWA 1VCSA 2QGSA 2XQ8A 2YOEA 3GN5A 4H9QC 3V5SA 2MTQA 5LG4A 4LMJA 2LLYA 3IBPA 4OFZA 4UXNB 4YXDA 5HEUA 3OYXA 3HKDE 4ZHQE 4PW8A 5CA1E 3LBXB 4UEMA 4GYRA 3HR0A 4JI4T 4IE5A 3FXEB 2UXDT 1QLBA 2W2UA 5FNVE 5ABGA 3RYIE 4AXPA 2ZM6T 1WR0A 4KHZF 2ODUA 3OKQA 2CMRA 2XAGB 2M6BA 3C4XA 4L9IA 4DBRA 4JV5T 2X67A 1W0BA 2V7MA 1V9DA 2WMOA 2YDQA 3L09A 3AAAB 4G2AA 5IHYA 4EOZB 5JVDE 4EZHA 5DJQC 1VOMA 5ABEA 4DV0T 1XWMA 3GN5B 1KF6A 3FB2A 5A1LA 2XQ3A 5M4YA 3O9XA 2ZM2A 3ZJ1A 1N33T 3KV9A 4ANJA 3VHLA 5L4EA 1U4QA 5LA6E 2BZBA 1D1CA 4UV9B 2RA1A 4GYSA 4DR6T 4QXBB 5ABHA 5LGNB 1YQ4A 3UQ7A 4AQGA 2FUPA 2CE7A 2KINB 1UX4A 3RIUC 4TX5A 4C90A 2YK0A 4WBOA 2UXBT 3CQCB 2SPCA 4KP3C 2WCAA 4OHFA 5F5WA 2C5KT 3SFDA 2BVLA 2A2FX 2CWOA 5CB4E 3ZLIA 2PFVA 2V7JA 3LG7A 3WAKA 4AKRB 5FY1A 3C50A 1HG5A 3PUZF 5FXWA 3ZMUB 4HFDA 4OK0A 4U2ZA 4E7SA 3K8PC 5KMGP 3AA6B 4PNIA 2BKPA 4O2AE 4TV8E 3QK6A 1HS7A 2H88A 1W0AA 3I9YA 2WB5A 5AQHB 3TLSA 4A5XA 4IE4A 2BBHA 2UXNB 4O8SA 1MMNA 4TWHA 4LF4T 3BK9A 2L9QA 1IZNB 1BR4A 1ZOYA 2K5BB 2DL1A 3LBXA 4QH1A 3RLFF 3RQWA 5AFUL 5L3CB 1XNQT 5C3JA 2LOPA 3RIAA 3K3OA 4QXCB 4F6RC 1E1HB 4DUYT 5JRCA 2I0MA 3LK2B 2DCFA 4UELA 3MZKB 2RPAA 2WY2A 3KDSE 3RPUA 1HNZT 4MFRA 4A56A 3FBLA 3AECA 4HFHA 3ZEFB 4KHPT 2A3DA 3EHZA 5AQSB 4ZEYA 5LJMA 3QC9A 3B57A 3JCFA 4H9NC 3MA9A 3EVYA 4H63V 4X20E 5JDFA 2WU2A 1R8IA 2DLRA 3DP7A 5AQUB 3L39A 2X0HA 1FIOA 2YU1A 2R6GF 2YDSA 1OXZA 3C98B 2CCQA 4I55E 5HXCA 4JYAT 3PURA 1E2AA 2P9BA 2XZEA 3K3NA 4MBQA 4MLKA 1WR6A 4LF9T 4M1PA 4AIUA 2DNXA 5JDNA 2XQYA 4IE0A 5GONE 5HXSA 2NWBA 3RKGA 2I59A 1FEWA 4YLHA 4UV8B 4NUVA 2ZM0A 2VWAA 2W63A 3VRBA 4HWFA 3SFEA 4O4JE 4YTPA 4JI7T 1HTJF 3LSVA 4TWFA 2E9XB 1OWAA 2H3RA 2K3WA 5L3EB 2JQ9A 3VR9A 4U33A 2XQ5A 1N32T 4K0UA 3RC3A 4JI6T 4TWDA 4ZOLE 4X5TA 4EV6A 3RYFE 3I0QA 3PU8A 3RIUA 2C5JA 4PFPA 4LFBT 3RH3A 2G0UA 2LKHA 2K9AA 4LF5T 3AE2A 3RRCA 2LRKA 5HXRA 5DQWA 1W9RA 1NWMX 4IHJE 4JBWF 2JQQA 4P09A 4LFCT 3CX7B 3AEEA 5JTGA 3KVBA 2EHOB 4YTMA 1OEDA 4TV9E 3BQIA 3U3IA 2OA5A 3NRXA 3UUBA 4BAYB 4O4HE 4DV3T 4GKJT 4TUYE 5LB7B 4DR1T 1D0YA 1D0ZA 2LJLA 1SE7A 2E5VA 3ZMVB 4YSZA 3H3MA 4CXYA 1XMOT 3FHNA 3JAEA 2BS4A 1WLXA 2KLQA 2XJ7A 4K0KT 5H6RB 4YJ2E 3N9QA 1UURA 1LVFA 3FZMB 3TLUA 3J7Yq 2FBWA 1MNEA 5LHGB 3AEDA 2JRKA 3D0TA 1J5WA 2CWYA 4ERRA 2J1DG 1SHZC 1OEDC 3VR8A 3JAFA 5ADXL 4PFOA 4ZI2D 2UUCT 3CIRA 3F2EA 4DVDA 5HXHA 4GK0E 4KBMB 2EHOA 1W09A 4WW0A 1UGOA 2FJBA 1SUMB 3PE0A 4IDNA 5LGTB 3NVOA 3N9MA 2WP9A 3B5MA 4CN1A 2CXDA 2CRBA 4DV5T 4U31A 2UUAT 3P4RA 2QRXA 2VVSA 3FZHB 5C2TA 4HWIB 3AVRA 4XZCA 4ZI3C 1FMVA 2KMFA 4I0UA 5FY7A 1HNXT 3CX6B 4IDPA 5LHHB 2NTYA 3AB3B 3DTOA 3AXJA 2KZ7B 5JDHA 5L3DB 1NENA 3QUJA 4L5GA 4GIWA 1M7KA 3TLWA 2VQET 3TLVA 2LEHA 4B3MT 4JEHB 2YEVC 4CZZB 4EIWA 2VKHA 4ZZBA 1O3XA 3AA7B 4FJOA 4IL4A 3CQXC 3K1SA 2PJQA 3KVAA 2VKDA 1FMWA 2XAQB 3L8RA 4I4TE 4UF0B 3ZCIA 4CI3B 2OLTA 4DR7T 2PG8A 5LMUT 5JR9B 4NXMT 2MPKA 1MMAA 2J62A 2V1DB 4UVAB 3SOLA 4Z91A 4AISA 3AVSA 3KBUA 3O1JA 4HFEA 4CXXA 4DMWA 4B3ST 4J2CA 2YKSA 3NKZA 4DR5T 5E0OA 3CQGB 3IEEA 4YHHT 3PTRB 3QB5K 1IBLT 5HCJA 5FVLA 4DIDB 2WS3A 2AE9A 2E9XD 5HEGA 3T8OA 5L2LA 2LRLA 3HI2A 1EZ3A 3S4UA 4ZI3D 2VKOA 5FXZA 4IGUA 5JH7E 2XQ6A 3C4WA 2V6YB 4ILCA 5JQGE 2K48A 2X68A 1FJGT 2MOZA 2CBJA 5HWXA 3PJAJ 1QSDA 3ZYMA 3GA8A 4EAHA 3VRAA 2QVAA 2VKJA 4FI5A 5FYMA 5AQRB 4O4LE 2NP9A 5FXVA 4TZ4C 4G63A 3UU5A 3KV4A 3IA3A 3LJCA 4P1NA 2EHOD 1VRBA 2X0LB 4YJ3E 4BJMA 2JQHA 2CEAA 4HE8A 3ETUA 5L3GB 4PJJA 3PV0F 4OYJA 5EK3A 4YFSA 5J1GA 4PJLA 2IHR1 2LSIA 1HFAA 2Q9QB 1MIWA 2NR4A 3Q2MA 4NUUA 1HR0T 4H9OC 3AAEB 4ILUA 1ZP0A 5HYAA 4YY3T 1HF8A 4DR3T 2D9DA 2ZM8A 4JUYA 3UU3A 4H9SE 2XHEB 4WZXA 2XUEA 4JI2T 2UXXB 2X51A 4E7ZA 5CFBA 2WU5A 5J2UE 3CKDA 2JIWA 2XTLA 4NPPA 1VCTA 3P4WA 3ONJA 3QB5A 4NXNT 5AQGB 3EI0A 1LVKA 2L3LA 3JADA 5EZYE 1E7PA 4MHCA 2UUBT 2HPLA 1CUNA 4YSYA 1T98A 3HA4A 4A98A 4HFCA 5BR8T 2YDRA 2VB6A 5KDMC 4MALA 3RIFA 3E22E 3NRYA 3SS1A 5LJNA 3UFGA 1G73A 2IAKA 1ZKEA 2BKNA 3KINB 2X0YA 3RKOA 2NW8A 1MIYA 5BMVE 4PK4A 1OEDE 1US7B 4AQYT 4HFIA 2X9HA 2DWKA 1YXRA 4O2BE 1MMGA 2W61A 1Z0PA 2C0SA 2XQ7A 3MJXA 3G06A 3OJAA 3IF8B 3N5LA 4N78D 3E08A 2E5LT 4OX9T 3RC8A 3AE9A 3KV6A 1U5PA 5TAOA 2ES0A 3C4ZA 1B7TA 1CHUA 5LMNT 3ZYKA 2W62A 3EUHA 5FP3A 3UULA 4UVCB 2LM2A 1KNRA 2EHOC 3RRWA 2L8KA 2BG9E 4TNVA 4EYYR 2MAWA 1IBMT 1I6ZA 3ZT6A 4DR2T 5J2TE 1IAPA 3PU3A 2HN2A 3NBXX 1S35A 3N9NA 3PUXF 5IYZE 4LMLA 3ZMSB 5JRCB 4YSXA 3PUSA 4BJNA 5LHIB 4DUZT 2LSYA 3EDVA 3KV5A 4JEUB 3AXJB 1YW0A 3AA0B 2V26A 4NIQA 4EYUA 2BDEA 3UU6A 1N36T 2BBJA 3TKLB 4P0AA 4LFAT 2Z6EA 2E9XC 4HWDA 2CM0A 1WFDA 1G8XA 2W4XA 4X1IE 3UUMA 2LHNA 3IHRA 1ZV4X 4GOUA 1X9BA 4QH5A 5AQFB 2IC9A 3AE4A 4JI3T 2LSJA 4U74A 4ZI7E 4HN9A 5L3FB 3AEFA 1IJ5A 3ANWA 4QKNA 1KFYA 2CLYC 2KWIB 2V6YA 2WMNA 2WZHA 3AE7A 3O1IA 3PUVF 4I43B 3CPZA 3VU7H 3ZPOA 3ZT5A 5LNKA 2JQKA 3ZN0B 3SWHA 4P0BA 3OBVE 4QX7B 5FMNA 5HWYA 2CXLA 4X64T 5J0ZA 5JDMA 2FJDA 3ABVA 3Q5WA 4ILBA 2ACXA 2HPJA 2WDQA 1IJ6A 4HEAA 3UUNA 2JPFA 3JC6C 3LK3B 4AKIA 3AE8A 3PUYF 4AKGA 3NZPA 4PK5A 3ZT7A 3CVRA 4PJNA 5JDGA 2JJ9A 4HKAA 3Q9DA 4ZI2C 3ZN1B 3PUQA 4QXHB 1UK5A 3ESLA 4AQFC 1T72A 4HFBA 4X65T 1D0XA 4KUMB 5LCYA 1WYCA 3P4SA 5FXXA 5IWAT 2HH7A 3ZJ2A 2X9XA 3GWHA 3J9X1 5JR9C 1T7SA 2KT9A 2WM9A 3GMIA 4Q25A 5AQIB 5AQOB 5FL1A 5IUXA 1Y64B 2BS2A 4DV4T 5ABFB 1IBKT 3N2GE 3R6NA 3H37A 3P7IA 2IDOB 3A7MA 4Z8XA 4TN7B 4ZXLA 3U78A 5L47A 3PUGA 4AI6A 3F57A 3I1AA 3P4PA 5DABA 4L0RA 4CI2B 3JC6D 5HEOA 5CA0E 1GQEA 3OVUA 1XNRT 4JLEA 1YKEB 3N2OA 2I6HA 3VKHA 3A8YC 4I50E 4DV1T 2FJEA 1T8BA 3FXDB 3BQLA 1LKXA 2D0TA 4ILAA 1KEYA 4KX6A 3ZSTA 1D1AA 4LF7T 4KMCA 3N9PA 2BS3A 4ASKA 3CK6A 1WYBA 2BG9A 3EABA 4HFVA 5HCMA 2XQ4A 2QA7A 3OTOT 3LDQB 1BR2A 2XY8B 4XAXB 4ISSA 5AQNB 3QNUA 3RQUA 2KSRA 3RYCE 4CN6A 2M6IA 2XQAA 3EAMA 1YQ3A 5EK2A 2N1GA 2VASA 4JI1T 4PK6A 1YKHB 5LXTE 3QOFA 2XSAA 2VL8A 3ZC0A 4EXTA 4V1Av 5FL0A 3ZMTB 4UVBB 1KNPA 2VQFT 2XQ9A 3Q5EA 1AJ3A 3O4XE 4KI0F 5AQLB 4EEDA 2Q9QA 4ADZA 2UXCT 1QUUA 2V8SV 5HXEA 3ZCJA 1J5ET 2MBGA 2CBIA 2B76A 3MK7C 5HEHA 3P4QA 5FKYA 1HX1B 2V7IA 3CX8B 2VL0A 3H3AA 4OYKA 2BG9C 4WNKA 1Z8UA 3L3PA 2LKGA 3WI3A 4ZZCA 2H89A 5LG3A 2NW7A 3C64A 3HKCE 4X62T 2XAHB 2WDRA 4HTEA 1NAFA 1UX5A 1L0VA 3V5UA 1LRZA 1I94T 2PTFA 3B13A 2XM2A 2IUBA 2H7VC 2Y6XA 3RYHE 1KK7A 3P8CD 2ACZA 4JI0T 2BG9B 5FVKA 4JI5T 3W15B 1KNZA 3FZLB 3AE1A 2KNDA 3ZMZB 2YN6A 5H6QB 2WQYA 1N34T 3AEBA 2GK9A 2C5IT 3AEAA 3M65A 2WZIA 1HG2A 3O1HA 3OPCA 3RI5A 3SRZA 4U7YA 2IC6A 3UU4A 5CJ5A 4DR4T 4GKKT 4CXWA 5ETWA 4DBQA 2Q9QC 4BA9A 2V5DA 2KWHA 4U72A 5F8PA 1HCIA 4LF8T 4AQFA 5CGMA 2E2AA 2IMLA 2V6XA 2CHNA 2LE8A 4PJMA 4QHOA 5EK4A 4QH4A 4IE7A 2YINA 4UIGA 3AE3A 4UF0A 2DI4A 4JI8T 2V7LA 3A5XA 3ETVA 2A72A 1X79A 2VK9A 3I9WA 1ZEEA 4H9PC 2XASB 1UUSA 1M62A 2WWUA 4COFA 4H9RC 3E0ZA 2NW9A 2M67A 2NOXA 2J47A 2W0GA 3N9OA 3RF1A 4DO0A 2CXFA 2XAJB 4EGWA 3RHWA 5JREA 2DHRA 3CMLA 1BR0A 2J4GA 2CPTA 4IDOA 4B3RT 1J1JA 3ONLC 2CHOA 4HGAA 1SA0E 4YHJA 2ZLYA 2A9UA 1D1BA 1MIVA 2D0UA 2XPKA 2XM1A 3F31A 2LHRA 3EDUA 1MMDA 2NTXA 3FZKB 3MACA 4ISTA 5LBMA 4ZS2A 2OV9A 5L4HA 2Y48B 3WAJA 1XMQT 5AQTB 3K3QC 4HWHA 2CA5A 1JNRA 4X1KE 2X9WA 3HL6A 5AQKB 3RGLA 4O4IE 1WCRA 4LMKA 4YTNA 5LGUB 4IL9A 3ANWB 4WYVA 2D2SA 2ODVA 2Y8DA 3MXZA 2H7OA 3LFMA 4DNDA 2W67A 2LSKA 3PUAA 5AQJB 2HN1A 2DWGA 3N2KE 1ZHCA 2VURA 2W66A 2WDVA 2RP4A 3FZFB 3Q5DA 3PDYA 4IREA 4U7IA 2UU9T 5AQMB 4EB6E 5JDLA 5KXJA 3LK42 5C8YE 4EEBA 2VVNA 2LM9A 5LOVE 2WBLA 2E8IA 4F8HA 4H63H 2KXPB 3T1HT 2JMHA 3AAIA 3P50A 4QX8B 4WBNE 4UR9A 5LP6E 5JR9A 2AXDS 3PUWF 4DV6T 3RX6A 1WRDA 4U3CA 4CN4A 3Q5XA 3NWIA 4DMVA 3UT5E 3AE6A 4A97A 4CI1B 3DJBA 3UU8A 3VKGA 2ZMAA 3UTKA 1HX8A 3BQKA 2WWVA 4DV2T 3AEGA 2BVMA 4CQIA 2LT3A 4GK5E
chains in the Genus database with same CATH topology
4LF6T 3OTOT 1HNWT 4JYAT 2HHHT 1HR0T 4DR3T 4YY3T 4JI1T 4DR7T 4DV7T 4JI2T 4JI7T 2VQFT 2UUBT 2UXCT 1N32T 1J5ET 4JI6T 5BR8T 3T1YT 4LFBT 4LF5T 2F4VT 4LFCT 4AQYT 4X62T 1I94T 2E5LT 4OX9T 4GKJT 4DR1T 1XMOT 5LMNT 4X66T 4K0KT 4JI0T 4JI5T 1IBMT 4JI4T 4DR2T 4B3MT 2UXDT 4GKKT 4NXNT 2UUCT 2ZM6T 4DR4T 4JV5T 4LF8T 4DUZT 4DV0T 4DV5T 4LFAT 4JI8T 1N33T 1HNXT 4JI3T 4LF9T 4DR6T 2VQET 4X64T 4B3RT 2UXBT 5LMUT 4NXMT 1XMQT 1N36T 4B3ST 4DR5T 4X65T 4YHHT 1IBLT 5IWAT 4B3TT 4LF4T 2UU9T 4DV4T 1IBKT 2UUAT 1XNQT 3T1HT 4DUYT 4DV6T 1FJGT 1XNRT 1HNZT 4DV1T 4KHPT 4DV3T 1N34T 4DV2T 4LF7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 T;  3OTO T;  1HNW T;  4JYA T;  2HHH T;  1HR0 T;  4DR3 T;  4YY3 T;  4JI1 T;  4DR7 T;  4DV7 T;  4JI2 T;  4JI7 T;  2VQF T;  2UUB T;  2UXC T;  1N32 T;  1J5E T;  4JI6 T;  5BR8 T;  3T1Y T;  4LFB T;  4LF5 T;  2F4V T;  4LFC T;  4AQY T;  4X62 T;  1I94 T;  2E5L T;  4OX9 T;  4GKJ T;  4DR1 T;  1XMO T;  5LMN T;  4X66 T;  4K0K T;  4JI0 T;  4JI5 T;  1IBM T;  4JI4 T;  4DR2 T;  4B3M T;  2UXD T;  4GKK T;  4NXN T;  2UUC T;  2ZM6 T;  4DR4 T;  4JV5 T;  4LF8 T;  4DUZ T;  4DV0 T;  4DV5 T;  4LFA T;  4JI8 T;  1N33 T;  1HNX T;  4JI3 T;  4LF9 T;  4DR6 T;  2VQE T;  4X64 T;  4B3R T;  2UXB T;  5LMU T;  4NXM T;  1XMQ T;  1N36 T;  4B3S T;  4DR5 T;  4X65 T;  4YHH T;  1IBL T;  5IWA T;  4B3T T;  4LF4 T;  2UU9 T;  4DV4 T;  1IBK T;  2UUA T;  1XNQ T;  3T1H T;  4DUY T;  4DV6 T;  1FJG T;  1XNR T;  1HNZ T;  4DV1 T;  4KHP T;  4DV3 T;  1N34 T;  4DV2 T;  4LF7 T; 
#chains in the Genus database with same CATH topology
 4YT0 A;  5F3J A;  5FY0 A;  3UUX B;  4EZ4 A;  4LF6 T;  1HNW T;  1NEK A;  5AQP B;  5LYJ E;  4AKH A;  2CLY B;  2HHH T;  1XZY A;  4IIJ E;  3CWZ B;  2XAF B;  2LOS A;  2YU2 A;  1UCU A;  2PBI A;  1XDP A;  3NZQ A;  2FJA A;  3FBZ A;  5AQV B;  2E9X A;  2W00 A;  1H7C A;  2BKO A;  3ZKR A;  4DV7 T;  4PAG A;  3X1D A;  2MYS A;  5ABF A;  2LSG A;  4B3T T;  3AA1 B;  2XSB A;  3I0O A;  3AE5 A;  3M3Z B;  2K24 A;  4QWN B;  2IW5 B;  3ZYL A;  3KBT A;  3MKD A;  2N2N A;  1DU2 A;  3N9L A;  4ZS3 A;  3TLT A;  4B6X A;  5HAX A;  4IDQ A;  5HEJ A;  4HWC A;  1XDO A;  2V7K A;  1BR1 A;  2WSS V;  5JDQ A;  3T1Y T;  1S94 A;  1JNZ A;  5LBQ B;  2WAU A;  4TNW A;  3R84 B;  4AKL A;  5L3B B;  2F4V T;  4IE6 A;  3UFE A;  5KX5 E;  2IIU A;  3ONX A;  4XBF B;  2B1E A;  5DQV A;  2Q9Q D;  3UQ4 A;  4C91 A;  3PJA A;  2JMK A;  3C51 A;  3HKB E;  3ZC1 A;  1Y01 A;  3OYZ A;  3HKE E;  2N9D A;  2X9Y A;  4IDZ A;  4Z90 A;  4IT4 A;  1YD8 G;  1OED B;  4U2Y A;  5AQQ B;  3ZSS A;  2D5U A;  4X1Y E;  2V5C A;  3KFW X;  4X66 T;  2X66 A;  1MND A;  2QYW A;  1VCS A;  2QGS A;  2XQ8 A;  2YOE A;  3GN5 A;  4H9Q C;  3V5S A;  2MTQ A;  5LG4 A;  4LMJ A;  2LLY A;  3IBP A;  4OFZ A;  4UXN B;  4YXD A;  5HEU A;  3OYX A;  3HKD E;  4ZHQ E;  4PW8 A;  5CA1 E;  3LBX B;  4UEM A;  4GYR A;  3HR0 A;  4JI4 T;  4IE5 A;  3FXE B;  2UXD T;  1QLB A;  2W2U A;  5FNV E;  5ABG A;  3RYI E;  4AXP A;  2ZM6 T;  1WR0 A;  4KHZ F;  2ODU A;  3OKQ A;  2CMR A;  2XAG B;  2M6B A;  3C4X A;  4L9I A;  4DBR A;  4JV5 T;  2X67 A;  1W0B A;  2V7M A;  1V9D A;  2WMO A;  2YDQ A;  3L09 A;  3AAA B;  4G2A A;  5IHY A;  4EOZ B;  5JVD E;  4EZH A;  5DJQ C;  1VOM A;  5ABE A;  4DV0 T;  1XWM A;  3GN5 B;  1KF6 A;  3FB2 A;  5A1L A;  2XQ3 A;  5M4Y A;  3O9X A;  2ZM2 A;  3ZJ1 A;  1N33 T;  3KV9 A;  4ANJ A;  3VHL A;  5L4E A;  1U4Q A;  5LA6 E;  2BZB A;  1D1C A;  4UV9 B;  2RA1 A;  4GYS A;  4DR6 T;  4QXB B;  5ABH A;  5LGN B;  1YQ4 A;  3UQ7 A;  4AQG A;  2FUP A;  2CE7 A;  2KIN B;  1UX4 A;  3RIU C;  4TX5 A;  4C90 A;  2YK0 A;  4WBO A;  2UXB T;  3CQC B;  2SPC A;  4KP3 C;  2WCA A;  4OHF A;  5F5W A;  2C5K T;  3SFD A;  2BVL A;  2A2F X;  2CWO A;  5CB4 E;  3ZLI A;  2PFV A;  2V7J A;  3LG7 A;  3WAK A;  4AKR B;  5FY1 A;  3C50 A;  1HG5 A;  3PUZ F;  5FXW A;  3ZMU B;  4HFD A;  4OK0 A;  4U2Z A;  4E7S A;  3K8P C;  5KMG P;  3AA6 B;  4PNI A;  2BKP A;  4O2A E;  4TV8 E;  3QK6 A;  1HS7 A;  2H88 A;  1W0A A;  3I9Y A;  2WB5 A;  5AQH B;  3TLS A;  4A5X A;  4IE4 A;  2BBH A;  2UXN B;  4O8S A;  1MMN A;  4TWH A;  4LF4 T;  3BK9 A;  2L9Q A;  1IZN B;  1BR4 A;  1ZOY A;  2K5B B;  2DL1 A;  3LBX A;  4QH1 A;  3RLF F;  3RQW A;  5AFU L;  5L3C B;  1XNQ T;  5C3J A;  2LOP A;  3RIA A;  3K3O A;  4QXC B;  4F6R C;  1E1H B;  4DUY T;  5JRC A;  2I0M A;  3LK2 B;  2DCF A;  4UEL A;  3MZK B;  2RPA A;  2WY2 A;  3KDS E;  3RPU A;  1HNZ T;  4MFR A;  4A56 A;  3FBL A;  3AEC A;  4HFH A;  3ZEF B;  4KHP T;  2A3D A;  3EHZ A;  5AQS B;  4ZEY A;  5LJM A;  3QC9 A;  3B57 A;  3JCF A;  4H9N C;  3MA9 A;  3EVY A;  4H63 V;  4X20 E;  5JDF A;  2WU2 A;  1R8I A;  2DLR A;  3DP7 A;  5AQU B;  3L39 A;  2X0H A;  1FIO A;  2YU1 A;  2R6G F;  2YDS A;  1OXZ A;  3C98 B;  2CCQ A;  4I55 E;  5HXC A;  4JYA T;  3PUR A;  1E2A A;  2P9B A;  2XZE A;  3K3N A;  4MBQ A;  4MLK A;  1WR6 A;  4LF9 T;  4M1P A;  4AIU A;  2DNX A;  5JDN A;  2XQY A;  4IE0 A;  5GON E;  5HXS A;  2NWB A;  3RKG A;  2I59 A;  1FEW A;  4YLH A;  4UV8 B;  4NUV A;  2ZM0 A;  2VWA A;  2W63 A;  3VRB A;  4HWF A;  3SFE A;  4O4J E;  4YTP A;  4JI7 T;  1HTJ F;  3LSV A;  4TWF A;  2E9X B;  1OWA A;  2H3R A;  2K3W A;  5L3E B;  2JQ9 A;  3VR9 A;  4U33 A;  2XQ5 A;  1N32 T;  4K0U A;  3RC3 A;  4JI6 T;  4TWD A;  4ZOL E;  4X5T A;  4EV6 A;  3RYF E;  3I0Q A;  3PU8 A;  3RIU A;  2C5J A;  4PFP A;  4LFB T;  3RH3 A;  2G0U A;  2LKH A;  2K9A A;  4LF5 T;  3AE2 A;  3RRC A;  2LRK A;  5HXR A;  5DQW A;  1W9R A;  1NWM X;  4IHJ E;  4JBW F;  2JQQ A;  4P09 A;  4LFC T;  3CX7 B;  3AEE A;  5JTG A;  3KVB A;  2EHO B;  4YTM A;  1OED A;  4TV9 E;  3BQI A;  3U3I A;  2OA5 A;  3NRX A;  3UUB A;  4BAY B;  4O4H E;  4DV3 T;  4GKJ T;  4TUY E;  5LB7 B;  4DR1 T;  1D0Y A;  1D0Z A;  2LJL A;  1SE7 A;  2E5V A;  3ZMV B;  4YSZ A;  3H3M A;  4CXY A;  1XMO T;  3FHN A;  3JAE A;  2BS4 A;  1WLX A;  2KLQ A;  2XJ7 A;  4K0K T;  5H6R B;  4YJ2 E;  3N9Q A;  1UUR A;  1LVF A;  3FZM B;  3TLU A;  3J7Y q;  2FBW A;  1MNE A;  5LHG B;  3AED A;  2JRK A;  3D0T A;  1J5W A;  2CWY A;  4ERR A;  2J1D G;  1SHZ C;  1OED C;  3VR8 A;  3JAF A;  5ADX L;  4PFO A;  4ZI2 D;  2UUC T;  3CIR A;  3F2E A;  4DVD A;  5HXH A;  4GK0 E;  4KBM B;  2EHO A;  1W09 A;  4WW0 A;  1UGO A;  2FJB A;  1SUM B;  3PE0 A;  4IDN A;  5LGT B;  3NVO A;  3N9M A;  2WP9 A;  3B5M A;  4CN1 A;  2CXD A;  2CRB A;  4DV5 T;  4U31 A;  2UUA T;  3P4R A;  2QRX A;  2VVS A;  3FZH B;  5C2T A;  4HWI B;  3AVR A;  4XZC A;  4ZI3 C;  1FMV A;  2KMF A;  4I0U A;  5FY7 A;  1HNX T;  3CX6 B;  4IDP A;  5LHH B;  2NTY A;  3AB3 B;  3DTO A;  3AXJ A;  2KZ7 B;  5JDH A;  5L3D B;  1NEN A;  3QUJ A;  4L5G A;  4GIW A;  1M7K A;  3TLW A;  2VQE T;  3TLV A;  2LEH A;  4B3M T;  4JEH B;  2YEV C;  4CZZ B;  4EIW A;  2VKH A;  4ZZB A;  1O3X A;  3AA7 B;  4FJO A;  4IL4 A;  3CQX C;  3K1S A;  2PJQ A;  3KVA A;  2VKD A;  1FMW A;  2XAQ B;  3L8R A;  4I4T E;  4UF0 B;  3ZCI A;  4CI3 B;  2OLT A;  4DR7 T;  2PG8 A;  5LMU T;  5JR9 B;  4NXM T;  2MPK A;  1MMA A;  2J62 A;  2V1D B;  4UVA B;  3SOL A;  4Z91 A;  4AIS A;  3AVS A;  3KBU A;  3O1J A;  4HFE A;  4CXX A;  4DMW A;  4B3S T;  4J2C A;  2YKS A;  3NKZ A;  4DR5 T;  5E0O A;  3CQG B;  3IEE A;  4YHH T;  3PTR B;  3QB5 K;  1IBL T;  5HCJ A;  5FVL A;  4DID B;  2WS3 A;  2AE9 A;  2E9X D;  5HEG A;  3T8O A;  5L2L A;  2LRL A;  3HI2 A;  1EZ3 A;  3S4U A;  4ZI3 D;  2VKO A;  5FXZ A;  4IGU A;  5JH7 E;  2XQ6 A;  3C4W A;  2V6Y B;  4ILC A;  5JQG E;  2K48 A;  2X68 A;  1FJG T;  2MOZ A;  2CBJ A;  5HWX A;  3PJA J;  1QSD A;  3ZYM A;  3GA8 A;  4EAH A;  3VRA A;  2QVA A;  2VKJ A;  4FI5 A;  5FYM A;  5AQR B;  4O4L E;  2NP9 A;  5FXV A;  4TZ4 C;  4G63 A;  3UU5 A;  3KV4 A;  3IA3 A;  3LJC A;  4P1N A;  2EHO D;  1VRB A;  2X0L B;  4YJ3 E;  4BJM A;  2JQH A;  2CEA A;  4HE8 A;  3ETU A;  5L3G B;  4PJJ A;  3PV0 F;  4OYJ A;  5EK3 A;  4YFS A;  5J1G A;  4PJL A;  2IHR 1;  2LSI A;  1HFA A;  2Q9Q B;  1MIW A;  2NR4 A;  3Q2M A;  4NUU A;  1HR0 T;  4H9O C;  3AAE B;  4ILU A;  1ZP0 A;  5HYA A;  4YY3 T;  1HF8 A;  4DR3 T;  2D9D A;  2ZM8 A;  4JUY A;  3UU3 A;  4H9S E;  2XHE B;  4WZX A;  2XUE A;  4JI2 T;  2UXX B;  2X51 A;  4E7Z A;  5CFB A;  2WU5 A;  5J2U E;  3CKD A;  2JIW A;  2XTL A;  4NPP A;  1VCT A;  3P4W A;  3ONJ A;  3QB5 A;  4NXN T;  5AQG B;  3EI0 A;  1LVK A;  2L3L A;  3JAD A;  5EZY E;  1E7P A;  4MHC A;  2UUB T;  2HPL A;  1CUN A;  4YSY A;  1T98 A;  3HA4 A;  4A98 A;  4HFC A;  5BR8 T;  2YDR A;  2VB6 A;  5KDM C;  4MAL A;  3RIF A;  3E22 E;  3NRY A;  3SS1 A;  5LJN A;  3UFG A;  1G73 A;  2IAK A;  1ZKE A;  2BKN A;  3KIN B;  2X0Y A;  3RKO A;  2NW8 A;  1MIY A;  5BMV E;  4PK4 A;  1OED E;  1US7 B;  4AQY T;  4HFI A;  2X9H A;  2DWK A;  1YXR A;  4O2B E;  1MMG A;  2W61 A;  1Z0P A;  2C0S A;  2XQ7 A;  3MJX A;  3G06 A;  3OJA A;  3IF8 B;  3N5L A;  4N78 D;  3E08 A;  2E5L T;  4OX9 T;  3RC8 A;  3AE9 A;  3KV6 A;  1U5P A;  5TAO A;  2ES0 A;  3C4Z A;  1B7T A;  1CHU A;  5LMN T;  3ZYK A;  2W62 A;  3EUH A;  5FP3 A;  3UUL A;  4UVC B;  2LM2 A;  1KNR A;  2EHO C;  3RRW A;  2L8K A;  2BG9 E;  4TNV A;  4EYY R;  2MAW A;  1IBM T;  1I6Z A;  3ZT6 A;  4DR2 T;  5J2T E;  1IAP A;  3PU3 A;  2HN2 A;  3NBX X;  1S35 A;  3N9N A;  3PUX F;  5IYZ E;  4LML A;  3ZMS B;  5JRC B;  4YSX A;  3PUS A;  4BJN A;  5LHI B;  4DUZ T;  2LSY A;  3EDV A;  3KV5 A;  4JEU B;  3AXJ B;  1YW0 A;  3AA0 B;  2V26 A;  4NIQ A;  4EYU A;  2BDE A;  3UU6 A;  1N36 T;  2BBJ A;  3TKL B;  4P0A A;  4LFA T;  2Z6E A;  2E9X C;  4HWD A;  2CM0 A;  1WFD A;  1G8X A;  2W4X A;  4X1I E;  3UUM A;  2LHN A;  3IHR A;  1ZV4 X;  4GOU A;  1X9B A;  4QH5 A;  5AQF B;  2IC9 A;  3AE4 A;  4JI3 T;  2LSJ A;  4U74 A;  4ZI7 E;  4HN9 A;  5L3F B;  3AEF A;  1IJ5 A;  3ANW A;  4QKN A;  1KFY A;  2CLY C;  2KWI B;  2V6Y A;  2WMN A;  2WZH A;  3AE7 A;  3O1I A;  3PUV F;  4I43 B;  3CPZ A;  3VU7 H;  3ZPO A;  3ZT5 A;  5LNK A;  2JQK A;  3ZN0 B;  3SWH A;  4P0B A;  3OBV E;  4QX7 B;  5FMN A;  5HWY A;  2CXL A;  4X64 T;  5J0Z A;  5JDM A;  2FJD A;  3ABV A;  3Q5W A;  4ILB A;  2ACX A;  2HPJ A;  2WDQ A;  1IJ6 A;  4HEA A;  3UUN A;  2JPF A;  3JC6 C;  3LK3 B;  4AKI A;  3AE8 A;  3PUY F;  4AKG A;  3NZP A;  4PK5 A;  3ZT7 A;  3CVR A;  4PJN A;  5JDG A;  2JJ9 A;  4HKA A;  3Q9D A;  4ZI2 C;  3ZN1 B;  3PUQ A;  4QXH B;  1UK5 A;  3ESL A;  4AQF C;  1T72 A;  4HFB A;  4X65 T;  1D0X A;  4KUM B;  5LCY A;  1WYC A;  3P4S A;  5FXX A;  5IWA T;  2HH7 A;  3ZJ2 A;  2X9X A;  3GWH A;  3J9X 1;  5JR9 C;  1T7S A;  2KT9 A;  2WM9 A;  3GMI A;  4Q25 A;  5AQI B;  5AQO B;  5FL1 A;  5IUX A;  1Y64 B;  2BS2 A;  4DV4 T;  5ABF B;  1IBK T;  3N2G E;  3R6N A;  3H37 A;  3P7I A;  2IDO B;  3A7M A;  4Z8X A;  4TN7 B;  4ZXL A;  3U78 A;  5L47 A;  3PUG A;  4AI6 A;  3F57 A;  3I1A A;  3P4P A;  5DAB A;  4L0R A;  4CI2 B;  3JC6 D;  5HEO A;  5CA0 E;  1GQE A;  3OVU A;  1XNR T;  4JLE A;  1YKE B;  3N2O A;  2I6H A;  3VKH A;  3A8Y C;  4I50 E;  4DV1 T;  2FJE A;  1T8B A;  3FXD B;  3BQL A;  1LKX A;  2D0T A;  4ILA A;  1KEY A;  4KX6 A;  3ZST A;  1D1A A;  4LF7 T;  4KMC A;  3N9P A;  2BS3 A;  4ASK A;  3CK6 A;  1WYB A;  2BG9 A;  3EAB A;  4HFV A;  5HCM A;  2XQ4 A;  2QA7 A;  3OTO T;  3LDQ B;  1BR2 A;  2XY8 B;  4XAX B;  4ISS A;  5AQN B;  3QNU A;  3RQU A;  2KSR A;  3RYC E;  4CN6 A;  2M6I A;  2XQA A;  3EAM A;  1YQ3 A;  5EK2 A;  2N1G A;  2VAS A;  4JI1 T;  4PK6 A;  1YKH B;  5LXT E;  3QOF A;  2XSA A;  2VL8 A;  3ZC0 A;  4EXT A;  4V1A v;  5FL0 A;  3ZMT B;  4UVB B;  1KNP A;  2VQF T;  2XQ9 A;  3Q5E A;  1AJ3 A;  3O4X E;  4KI0 F;  5AQL B;  4EED A;  2Q9Q A;  4ADZ A;  2UXC T;  1QUU A;  2V8S V;  5HXE A;  3ZCJ A;  1J5E T;  2MBG A;  2CBI A;  2B76 A;  3MK7 C;  5HEH A;  3P4Q A;  5FKY A;  1HX1 B;  2V7I A;  3CX8 B;  2VL0 A;  3H3A A;  4OYK A;  2BG9 C;  4WNK A;  1Z8U A;  3L3P A;  2LKG A;  3WI3 A;  4ZZC A;  2H89 A;  5LG3 A;  2NW7 A;  3C64 A;  3HKC E;  4X62 T;  2XAH B;  2WDR A;  4HTE A;  1NAF A;  1UX5 A;  1L0V A;  3V5U A;  1LRZ A;  1I94 T;  2PTF A;  3B13 A;  2XM2 A;  2IUB A;  2H7V C;  2Y6X A;  3RYH E;  1KK7 A;  3P8C D;  2ACZ A;  4JI0 T;  2BG9 B;  5FVK A;  4JI5 T;  3W15 B;  1KNZ A;  3FZL B;  3AE1 A;  2KND A;  3ZMZ B;  2YN6 A;  5H6Q B;  2WQY A;  1N34 T;  3AEB A;  2GK9 A;  2C5I T;  3AEA A;  3M65 A;  2WZI A;  1HG2 A;  3O1H A;  3OPC A;  3RI5 A;  3SRZ A;  4U7Y A;  2IC6 A;  3UU4 A;  5CJ5 A;  4DR4 T;  4GKK T;  4CXW A;  5ETW A;  4DBQ A;  2Q9Q C;  4BA9 A;  2V5D A;  2KWH A;  4U72 A;  5F8P A;  1HCI A;  4LF8 T;  4AQF A;  5CGM A;  2E2A A;  2IML A;  2V6X A;  2CHN A;  2LE8 A;  4PJM A;  4QHO A;  5EK4 A;  4QH4 A;  4IE7 A;  2YIN A;  4UIG A;  3AE3 A;  4UF0 A;  2DI4 A;  4JI8 T;  2V7L A;  3A5X A;  3ETV A;  2A72 A;  1X79 A;  2VK9 A;  3I9W A;  1ZEE A;  4H9P C;  2XAS B;  1UUS A;  1M62 A;  2WWU A;  4COF A;  4H9R C;  3E0Z A;  2NW9 A;  2M67 A;  2NOX A;  2J47 A;  2W0G A;  3N9O A;  3RF1 A;  4DO0 A;  2CXF A;  2XAJ B;  4EGW A;  3RHW A;  5JRE A;  2DHR A;  3CML A;  1BR0 A;  2J4G A;  2CPT A;  4IDO A;  4B3R T;  1J1J A;  3ONL C;  2CHO A;  4HGA A;  1SA0 E;  4YHJ A;  2ZLY A;  2A9U A;  1D1B A;  1MIV A;  2D0U A;  2XPK A;  2XM1 A;  3F31 A;  2LHR A;  3EDU A;  1MMD A;  2NTX A;  3FZK B;  3MAC A;  4IST A;  5LBM A;  4ZS2 A;  2OV9 A;  5L4H A;  2Y48 B;  3WAJ A;  1XMQ T;  5AQT B;  3K3Q C;  4HWH A;  2CA5 A;  1JNR A;  4X1K E;  2X9W A;  3HL6 A;  5AQK B;  3RGL A;  4O4I E;  1WCR A;  4LMK A;  4YTN A;  5LGU B;  4IL9 A;  3ANW B;  4WYV A;  2D2S A;  2ODV A;  2Y8D A;  3MXZ A;  2H7O A;  3LFM A;  4DND A;  2W67 A;  2LSK A;  3PUA A;  5AQJ B;  2HN1 A;  2DWG A;  3N2K E;  1ZHC A;  2VUR A;  2W66 A;  2WDV A;  2RP4 A;  3FZF B;  3Q5D A;  3PDY A;  4IRE A;  4U7I A;  2UU9 T;  5AQM B;  4EB6 E;  5JDL A;  5KXJ A;  3LK4 2;  5C8Y E;  4EEB A;  2VVN A;  2LM9 A;  5LOV E;  2WBL A;  2E8I A;  4F8H A;  4H63 H;  2KXP B;  3T1H T;  2JMH A;  3AAI A;  3P50 A;  4QX8 B;  4WBN E;  4UR9 A;  5LP6 E;  5JR9 A;  2AXD S;  3PUW F;  4DV6 T;  3RX6 A;  1WRD A;  4U3C A;  4CN4 A;  3Q5X A;  3NWI A;  4DMV A;  3UT5 E;  3AE6 A;  4A97 A;  4CI1 B;  3DJB A;  3UU8 A;  3VKG A;  2ZMA A;  3UTK A;  1HX8 A;  3BQK A;  2WWV A;  4DV2 T;  3AEG A;  2BVM A;  4CQI A;  2LT3 A;  4GK5 E; 
#chains in the Genus database with same CATH homology
 4LF6 T;  3OTO T;  1HNW T;  4JYA T;  2HHH T;  1HR0 T;  4DR3 T;  4YY3 T;  4JI1 T;  4DR7 T;  4DV7 T;  4JI2 T;  4JI7 T;  2VQF T;  2UUB T;  2UXC T;  1N32 T;  1J5E T;  4JI6 T;  5BR8 T;  3T1Y T;  4LFB T;  4LF5 T;  2F4V T;  4LFC T;  4AQY T;  4X62 T;  1I94 T;  2E5L T;  4OX9 T;  4GKJ T;  4DR1 T;  1XMO T;  5LMN T;  4X66 T;  4K0K T;  4JI0 T;  4JI5 T;  1IBM T;  4JI4 T;  4DR2 T;  4B3M T;  2UXD T;  4GKK T;  4NXN T;  2UUC T;  2ZM6 T;  4DR4 T;  4JV5 T;  4LF8 T;  4DUZ T;  4DV0 T;  4DV5 T;  4LFA T;  4JI8 T;  1N33 T;  1HNX T;  4JI3 T;  4LF9 T;  4DR6 T;  2VQE T;  4X64 T;  4B3R T;  2UXB T;  5LMU T;  4NXM T;  1XMQ T;  1N36 T;  4B3S T;  4DR5 T;  4X65 T;  4YHH T;  1IBL T;  5IWA T;  4B3T T;  4LF4 T;  2UU9 T;  4DV4 T;  1IBK T;  2UUA T;  1XNQ T;  3T1H T;  4DUY T;  4DV6 T;  1FJG T;  1XNR T;  1HNZ T;  4DV1 T;  4KHP T;  4DV3 T;  1N34 T;  4DV2 T;  4LF7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...