4JI0T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji0T00
2F4VT 5IWAT 1XMQT 4JI5T 4DV7T 4X64T 1IBLT 1XMOT 4DR2T 4DR7T 4DV3T 4LF6T 1XNRT 4YY3T 4B3RT 3T1HT 4DV5T 4JI2T 4X62T 4YHHT 4LFAT 1IBKT 1I94T 1N33T 2VQET 2UXBT 4LF4T 4X65T 1N34T 4DR1T 4LFBT 1HNWT 2UUAT 4JI7T 4DR5T 4K0KT 4LF5T 4JI0T 1N32T 4DUZT 4LF7T 5LMNT 1IBMT 4B3MT 4LFCT 4LF8T 4JI3T 4JV5T 5LMUT 2VQFT 4DUYT 5BR8T 4DV6T 4KHPT 4B3TT 4X66T 4JI4T 4AQYT 1J5ET 4DR4T 4OX9T 4JI6T 2UXDT 2UUCT 2UUBT 3T1YT 2HHHT 1N36T 2UU9T 4JI1T 4NXMT 4NXNT 4GKKT 2ZM6T 3OTOT 1HR0T 4JYAT 1HNZT 1HNXT 4DV0T 4DR6T 1FJGT 2E5LT 4LF9T 4DV4T 4B3ST 4DV2T 1XNQT 4DV1T 4DR3T 4JI8T 4GKJT 2UXCT
chains in the Genus database with same CATH superfamily
2UXNB 2CCQA 4KBMB 4DV7T 4KX6A 2JRKA 3UFEA 1T98A 1V9DA 4LF6T 1Y01A 2MTQA 1X9BA 2VVNA 4OFZA 2X67A 4U74A 1YW0A 3ETUA 2B1EA 2AE9A 4I50E 5LHIB 3UTKA 3F2EA 1YKHB 2L9QA 3RC8A 3P4WA 2QYWA 3V5SA 2JQ9A 4F6RC 4DR1T 2X66A 3ESLA 1ZHCA 3NWIA 2DLRA 2XQ5A 4UEMA 1SE7A 2XQ8A 1OEDC 4BA9A 3IHRA 5LNKA 3ZEFB 4JLEA 2RA1A 3K8PC 3FZMB 4KI0F 3PUQA 3EDUA 5LMUT 3ZJ1A 3RRCA 4YSZA 3N9QA 1WR6A 1MMGA 3ZN0B 4JEUB 5JDFA 1M7KA 2DL1A 3UUMA 2H89A 2ZM0A 1KEYA 5ABEA 3AEEA 3FBZA 1HNZT 4P1NA 4KMCA 4Z8XA 3WAJA 1BR4A 4XBFB 2N1GA 2UXCT 3RC3A 4PW8A 4AKIA 4PJMA 3UU5A 2J62A 4AIUA 4Z91A 2AXDS 1YQ3A 3FXDB 3RGLA 2BG9E 3VRBA 5HWYA 4LMLA 3FZHB 2V7JA 3AEBA 2XAQB 3PJAJ 5FYMA 2X0YA 4ILCA 4HFVA 4X65T 3P4QA 1S94A 1YKEB 2N2NA 4IDOA 4DIDB 1X79A 3PJAA 4LF5T 4CN1A 3TKLB 2C5KT 4OHFA 2WCAA 2V6YA 3ZKRA 2PJQA 4LFCT 3KV6A 4WYVA 5ABFB 2XQ9A 1W09A 5FL1A 4TWDA 5AQOB 4X1IE 4CN4A 4EIWA 5AQSB 1E7PA 2LT3A 2HPJA 3CVRA 4AXPA 3AAIA 4IE0A 3RQWA 4H9NC 4DBQA 1HFAA 4A56A 3N9PA 4X5TA 1D0YA 4PK5A 3CWZB 5AQGB 3AVRA 4B3ST 5HXEA 3PUAA 2Q9QA 3ZCIA 4U7IA 3OBVE 4UIGA 2ES0A 2RPAA 2LRLA 5BMVE 4X64T 5FXZA 4I43B 2A3DA 2JMKA 2LKHA 4UXNB 3FBLA 2FJBA 2IIUA 1LKXA 5KDMC 4IIJE 3GN5A 4EGWA 3W15B 2HH7A 5IYZE 4LF4T 4CXYA 4E7SA 1B7TA 3N2OA 1WYBA 4BJMA 4AKLA 4EV6A 1YQ4A 4AKRB 4I4TE 5HWXA 1HS7A 2WQYA 1FIOA 1MIYA 4JI3T 3QNUA 5JDNA 5CFBA 4ISTA 3ZMVB 3ETVA 4HFIA 4ZS2A 4AQYT 1FMWA 5JRCA 3UUXB 4PAGA 3ZC1A 5AQLB 3UUNA 3F57A 4UR9A 3NZQA 2LE8A 3AE4A 2NOXA 3NVOA 3VR9A 4EB6E 2BS4A 4DV4T 2EHOB 4ERRA 3ONXA 2WY2A 3PUZF 3CQCB 3P7IA 2KT9A 3KVBA 2XUEA 4P0BA 4QH4A 2KZ7B 4UVAB 4DV3T 2I0MA 1VCTA 4EZHA 3H3AA 2XPKA 3BQKA 3RPUA 4L5GA 3T1HT 2VWAA 2W0GA 2LSGA 3AB3B 2BG9A 4ISSA 2Q9QB 2XQ7A 2VQET 3OKQA 2V8SV 2XM1A 1UCUA 2DWGA 1T72A 4Z90A 1NEKA 2WDRA 4EZ4A 5AQUB 4PFPA 3GN5B 2YEVC 1HX1B 3AECA 2X9HA 3LJCA 4YJ2E 1IBMT 3OPCA 5KX5E 2OV9A 4IGUA 2XHEB 2EHOC 4DUYT 1CHUA 4B3TT 1SHZC 4C90A 1G73A 4OX9T 2QGSA 2UUBT 1YD8G 5KXJA 1OEDA 4TN7B 4NXNT 4ZI3D 4PJNA 2LOSA 3P50A 3IF8B 2KSRA 3CQXC 2IDOB 4DR3T 1FMVA 4WBNE 3UFGA 3Q5EA 1S35A 1IBLT 2C5JA 4U2YA 3AVSA 4TZ4C 2X9YA 1XDOA 4HTEA 1IBKT 5A1LA 5LJNA 5JR9B 2WZHA 2J4GA 1MMAA 3PTRB 4OYKA 5LCYA 4AKHA 1D1CA 1D0ZA 4AQGA 2WMOA 1MNEA 1HNWT 4DO0A 4HN9A 3VU7H 3QB5A 4K0KT 3WI3A 4CXWA 3TLUA 2L8KA 3ZMTB 4WW0A 2XQAA 2M67A 1W0AA 3CMLA 2KMFA 3PUGA 2JMHA 2JQKA 2C0SA 4TWHA 5FXVA 4HWFA 4DV6T 3R6NA 1O3XA 1IJ5A 2D0TA 4JI4T 3MA9A 2YK0A 3VR8A 3EI0A 4KP3C 1KNZA 3A7MA 4JUYA 2E9XD 4NXMT 1VRBA 5F8PA 3DTOA 4AQFC 3RYCE 3LFMA 1MMDA 5ADXL 1LVKA 3CQGB 2IUBA 4CI2B 2CM0A 3U78A 1HF8A 4AI6A 2VKOA 3I0OA 5HXHA 3BQLA 5IWAT 4TV9E 4JI5T 3RIFA 3FXEB 2MPKA 3RF1A 1I6ZA 2XASB 1OEDB 2KWIB 3PUXF 4ILAA 4PFOA 4YY3T 4B3RT 4IE5A 4EAHA 5LBQB 4U2ZA 5FNVE 4JI2T 3Q5DA 4IL4A 3KV9A 4B6XA 3D0TA 2VKJA 5FY0A 3X1DA 4G63A 2H3RA 4ZXLA 3KFWX 3RIAA 2XM2A 2NP9A 5FL0A 5AQJB 1YXRA 3E0ZA 1KK7A 3B5MA 4QHOA 2W63A 2CXLA 2CHOA 2IC6A 3LDQB 2IW5B 4LMJA 5ABFA 3PUWF 2KLQA 4JV5T 3K3NA 3MJXA 2X51A 2J47A 3P8CD 1J1JA 4CI3B 5AQIB 2FBWA 2HHHT 4O2BE 5LHHB 2LJLA 5M4YA 2K48A 4IDNA 2X68A 3AE8A 3ZMZB 3I1AA 4PK4A 2YN6A 3ZT5A 5AQTB 5H6RB 2JIWA 3ZSSA 2CPTA 1XMOT 4DR2T 2M6IA 2LKGA 3UU6A 2NTXA 4EEBA 5AQFB 4ADZA 3AE9A 4WBOA 1GQEA 2Z6EA 4U31A 1N33T 2UXBT 2V7LA 2LSYA 4IT4A 1IJ6A 3DJBA 3IA3A 4HWHA 4P09A 4HWCA 4HGAA 1N34T 4H9RC 3RLFF 5CA0E 3Q5WA 4LFBT 5JH7E 4DR5T 3P4SA 2K9AA 3Q9DA 3V5UA 5L3BB 1UGOA 2BBJA 4LF7T 3RQUA 3Q2MA 3FZLB 3G06A 2V5CA 3AEFA 1XWMA 1KF6A 3ANWB 3AEAA 4DVDA 3HL6A 3CX7B 2VQFT 2Y48B 5HEOA 1W9RA 5AQKB 3J7Yq 1T8BA 2YDRA 4KHZF 3JADA 4QH5A 1Y64B 1M62A 4IE7A 4ILBA 4H9SE 4WNKA 4HE8A 5CJ5A 2BKPA 2CRBA 4O8SA 5FP3A 3N9NA 2PTFA 3AE2A 2A9UA 4QX8B 5EK3A 3AA1B 3BK9A 3E08A 3KV4A 2ZM6T 3NRYA 2BVLA 3JC6D 3ZCJA 2Q9QD 3EUHA 4L0RA 2EHOA 1KNPA 2WU2A 2V7KA 4EYYR 5HXSA 2M6BA 4WZXA 1OEDE 4DR7T 2K24A 3TLVA 4ZI2C 2YDQA 2VB6A 3FHNA 1XNRT 5DJQC 3ONLC 3JCFA 2LEHA 3SRZA 3ZT6A 4LFAT 4QXCB 2BS3A 2D0UA 3HR0A 4QXHB 2IC9A 1ZKEA 3N9LA 3M3ZB 3AE1A 2D2SA 5JDGA 2VL0A 3L39A 4K0UA 2ZMAA 2CBJA 4IL9A 3IBPA 3CX8B 2XAHB 2DWKA 2PG8A 5DQVA 4GOUA 4H63H 5FKYA 5FY1A 3HKDE 5JDLA 4GK0E 4NUVA 4X66T 2VKDA 3WAKA 3J9X1 1WYCA 2IAKA 2LM2A 2QRXA 1WCRA 2K5BB 3SS1A 2ZLYA 3EHZA 5LHGB 2XQ3A 5CGMA 4DBRA 5LGUB 3F31A 3M65A 2D9DA 4DV2T 3AEGA 3O1IA 1KNRA 3C4XA 4H9PC 3TLWA 2XQ6A 2VASA 2YU2A 4YTPA 2I6HA 3I9YA 4U3CA 4UV9B 5LBMA 4M1PA 4AQFA 4JEHB 4YFSA 4X62T 4N78D 1QUUA 5LYJE 2GK9A 5JR9A 3OYZA 3ZN1B 2DI4A 2E8IA 2WDVA 3JAEA 1UK5A 1H7CA 4O4JE 2UUAT 4FI5A 2W00A 2HN1A 4YT0A 4JI7T 3RIUC 2OA5A 4EEDA 5J2TE 3CK6A 3EAMA 1E1HB 4OYJA 4F8HA 2YU1A 2IMLA 3HKBE 5FMNA 2LHRA 5HXRA 4DMWA 5AQQB 3QC9A 2JPFA 2WWVA 3LSVA 1L0VA 3UT5E 2UXDT 2BDEA 2X9XA 1UX4A 2LHNA 4IDZA 2NTYA 5LGNB 2NR4A 5L3FB 3EABA 4ZHQE 2H88A 1CUNA 3OYXA 4ZZCA 4DR6T 2E5LT 1W0BA 2W61A 2B76A 4O4HE 2CXFA 4OK0A 4JI8T 4GKJT 5AQNB 2F4VT 4U72A 4HFBA 1HG2A 2ZM2A 3UU4A 2D5UA 1NWMX 3L8RA 5LOVE 3CX6B 2A72A 3KBTA 2XJ7A 4DV5T 4ZS3A 4UVCB 3SFEA 4LMKA 5JQGE 4U7YA 2XQYA 4H9OC 4XZCA 2XSBA 4YTNA 3LBXB 4X1KE 2ACZA 3NKZA 1FEWA 1NENA 5AFUL 1XZYA 1ZP0A 4HWIB 3AE5A 4CZZB 5FVLA 5TAOA 3OJAA 4QH1A 4QXBB 3ZPOA 2PBIA 3AE6A 1UX5A 3HKEE 4CN6A 4KHPT 4EOZB 4TNWA 4KUMB 3RHWA 2UUCT 3O1JA 3T1YT 4UV8B 2KINB 2LM9A 3MXZA 1U4QA 1MIVA 4JYAT 2MAWA 2HN2A 5L47A 3K3OA 5L4EA 4J2CA 3ABVA 3CIRA 4HFDA 5L3EB 4YTMA 2WU5A 2XY8B 2J1DG 3B57A 2W62A 3RKOA 3P4RA 5J2UE 1HTJF 3MZKB 2KWHA 3DP7A 2MBGA 3MK7C 2ZM8A 5L2LA 5J0ZA 2G0UA 3I9WA 3TLTA 2CHNA 2N9DA 3AE3A 5AQRB 2CXDA 5C3JA 1OXZA 4A98A 4NIQA 3ZLIA 5JDMA 3ZSTA 4JI0T 3RYIE 1VOMA 4IDPA 2YOEA 4QWNB 4DUZT 2WAUA 2WM9A 1SUMB 3UU3A 5LP6E 2LSJA 2NWBA 1BR0A 2KNDA 4NUUA 3O4XE 5L3CB 4U33A 3ANWA 2MYSA 5L4HA 5CA1E 2JQHA 4H9QC 5H6QB 4IHJE 5FXXA 4HFEA 3B13A 4O4IE 3RRWA 3K1SA 5AQVB 2LRKA 1G8XA 2C5IT 1T7SA 2V6XA 4P0AA 4JI1T 5LGTB 5LG3A 4NPPA 4GKKT 3AXJB 1HR0T 3AE7A 2YKSA 1HNXT 1IAPA 4TUYE 4O2AE 1IZNB 1HG5A 2QA7A 2WDQA 2DCFA 3AA6B 3FZFB 1R8IA 4ZOLE 3O1HA 1XMQT 4AISA 3UU8A 2MOZA 2XQ4A 2PFVA 4ZZBA 3UQ7A 4IE4A 2WP9A 4PK6A 2CEAA 1ZOYA 5E0OA 4HKAA 1U5PA 4I0UA 5J1GA 3KDSE 2ODUA 3H37A 2CLYB 4YHJA 5LA6E 4Q25A 4H63V 5EZYE 5IHYA 1HX8A 2CMRA 3KBUA 3A5XA 5FY7A 1J5WA 2LOPA 5AQPB 4IE6A 5L3GB 3N2GE 3Q5XA 4CXXA 4CQIA 4YLHA 4GYSA 4ZI3C 4ZI7E 4IREA 2H7OA 4UF0B 2WBLA 2NW8A 1AJ3A 3VRAA 3RH3A 5CB4E 2ACXA 3PU8A 4X20E 2WS3A 4JI6T 2DNXA 2Y6XA 3N5LA 3RIUA 3N9OA 2W4XA 1SA0E 3ONJA 2E9XB 3SWHA 4TNVA 2YDSA 3H3MA 3P4PA 2I59A 2EHOD 1XNQT 4MLKA 2L3LA 4I55E 2CLYC 4YXDA 5DQWA 2XTLA 2ODVA 2V5DA 2CWYA 3ZMSB 3GMIA 5HEUA 3C51A 2HPLA 3C64A 5ABGA 3LK3B 3AAAB 5JDHA 4COFA 4C91A 3U3IA 4MFRA 1D1BA 1HCIA 3PU3A 1QSDA 3GA8A 1N32T 2WZIA 3K3QC 2W66A 4HFHA 5LMNT 4PJLA 4XAXB 2E9XC 3UQ4A 4LF8T 4GK5E 2E2AA 4YJ3E 5HEJA 2W67A 1WFDA 2CBIA 1BR2A 2V7IA 5ETWA 1MNDA 4DR4T 2X9WA 3NBXX 3RX6A 4X1YE 2VK9A 3UUBA 2W2UA 2JJ9A 1N36T 5DABA 2UU9T 1WLXA 5KMGP 2V7MA 4AKGA 4FJOA 1KFYA 2X0LB 1OWAA 3KV5A 5HEHA 4BAYB 3L3PA 3HI2A 2VKHA 3AA7B 2BKNA 3N2KE 2VVSA 5HAXA 2BKOA 4E7ZA 3E22E 2BZBA 5FXWA 2WMNA 1D0XA 4PNIA 4YSYA 2CE7A 4EYUA 2XAFB 3IEEA 3EDVA 5LG4A 3LBXA 4HEAA 1Z8UA 1WR0A 2FJDA 4A97A 4O4LE 3PV0F 4JBWF 2VURA 4G2AA 5C2TA 3RYHE 3QOFA 2DHRA 3CPZA 2V6YB 5EK4A 2UXXB 3PUYF 3HA4A 2BS2A 5LB7B 5AQHB 3TLSA 1Z0PA 4V1Av 3ZYLA 3AA0B 5BR8T 5HEGA 2OLTA 3C98B 3MKDA 4DNDA 1QLBA 3KVAA 2KXPB 2LLYA 2FUPA 1US7B 5GONE 1JNZA 3FZKB 1XDPA 3QUJA 4ZEYA 3LK42 3AEDA 2NW9A 3A8YC 3I0QA 2XZEA 4UVBB 5JVDE 4YSXA 2V1DB 2LSIA 3PUVF 3VKHA 3PDYA 2A2FX 4PJJA 1UURA 3S4UA 3UULA 4GYRA 3EVYA 3RI5A 5ABHA 3R84B 5HCMA 4L9IA 3ZYKA 1EZ3A 5LJMA 3FB2A 3NRXA 3N9MA 5HXCA 2X0HA 3KINB 1I94T 2FJAA 3MACA 5JDQA 2K3WA 2FJEA 1VCSA 1E2AA 3QK6A 3CKDA 3RKGA 4DMVA 1LVFA 4QX7B 2R6GF 2Y8DA 2V26A 2XAJB 3VKGA 4GIWA 3PUSA 4BJNA 2WB5A 5JTGA 5HCJA 4MHCA 3RYFE 4IDQA 3PURA 1LRZA 3L09A 3JC6C 4HWDA 5F5WA 1NAFA 2Q9QC 4QKNA 1J5ET 5AQMB 5JRCB 4TWFA 5F3JA 2NW7A 4UELA 3AAEB 3C4ZA 1JNRA 5L3DB 2BBHA 4TX5A 4ANJA 3OTOT 1MIWA 3QB5K 3O9XA 3AXJA 5FVKA 3ZT7A 4DV0T 4LF9T 4HFCA 4ILUA 3JAFA 2H7VC 2XSAA 5C8YE 3C4WA 1BR1A 2SPCA 2XAGB 3T8OA 3VHLA 2QVAA 2P9BA 4YHHT 2BG9B 3LK2B 2WSSV 3ZYMA 5EK2A 3BQIA 3HKCE 2IHR1 3SOLA 3C50A 1ZEEA 2CWOA 2WWUA 4ZI2D 3NZPA 1UUSA 1DU2A 2YINA 4CI1B 2RP4A 3PE0A 3LG7A 3SFDA 4B3MT 2CA5A 4ASKA 2VL8A 1MMNA 4UF0A 2E5VA 3OVUA 5HYAA 5JR9C 3ZJ2A 4A5XA 5IUXA 5JREA 5LXTE 4MALA 2JQQA 4TV8E 4EXTA 3ZMUB 3GWHA 2E9XA 1WRDA 2BG9C 3ZC0A 1FJGT 2LSKA 4MBQA 1ZV4X 4DV1T 2BVMA 1D1AA
chains in the Genus database with same CATH topology
2F4VT 5IWAT 1XMQT 4JI5T 4DV7T 4X64T 1IBLT 1XMOT 4DR2T 4DR7T 4DV3T 4LF6T 1XNRT 4YY3T 4B3RT 3T1HT 4DV5T 4JI2T 4X62T 4YHHT 4LFAT 1IBKT 1I94T 1N33T 2VQET 2UXBT 4LF4T 4X65T 1N34T 4DR1T 4LFBT 1HNWT 2UUAT 4JI7T 4DR5T 4K0KT 4LF5T 4JI0T 1N32T 4DUZT 4LF7T 5LMNT 1IBMT 4B3MT 4LFCT 4LF8T 4JI3T 4JV5T 5LMUT 2VQFT 4DUYT 5BR8T 4DV6T 4KHPT 4B3TT 4X66T 4JI4T 4AQYT 1J5ET 4DR4T 4OX9T 4JI6T 2UXDT 2UUCT 2UUBT 3T1YT 2HHHT 1N36T 2UU9T 4JI1T 4NXMT 4NXNT 4GKKT 2ZM6T 3OTOT 1HR0T 4JYAT 1HNZT 1HNXT 4DV0T 4DR6T 1FJGT 2E5LT 4LF9T 4DV4T 4B3ST 4DV2T 1XNQT 4DV1T 4DR3T 4JI8T 4GKJT 2UXCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V T;  5IWA T;  1XMQ T;  4JI5 T;  4DV7 T;  4X64 T;  1IBL T;  1XMO T;  4DR2 T;  4DR7 T;  4DV3 T;  4LF6 T;  1XNR T;  4YY3 T;  4B3R T;  3T1H T;  4DV5 T;  4JI2 T;  4X62 T;  4YHH T;  4LFA T;  1IBK T;  1I94 T;  1N33 T;  2VQE T;  2UXB T;  4LF4 T;  4X65 T;  1N34 T;  4DR1 T;  4LFB T;  1HNW T;  2UUA T;  4JI7 T;  4DR5 T;  4K0K T;  4LF5 T;  4JI0 T;  1N32 T;  4DUZ T;  4LF7 T;  5LMN T;  1IBM T;  4B3M T;  4LFC T;  4LF8 T;  4JI3 T;  4JV5 T;  5LMU T;  2VQF T;  4DUY T;  5BR8 T;  4DV6 T;  4KHP T;  4B3T T;  4X66 T;  4JI4 T;  4AQY T;  1J5E T;  4DR4 T;  4OX9 T;  4JI6 T;  2UXD T;  2UUC T;  2UUB T;  3T1Y T;  2HHH T;  1N36 T;  2UU9 T;  4JI1 T;  4NXM T;  4NXN T;  4GKK T;  2ZM6 T;  3OTO T;  1HR0 T;  4JYA T;  1HNZ T;  1HNX T;  4DV0 T;  4DR6 T;  1FJG T;  2E5L T;  4LF9 T;  4DV4 T;  4B3S T;  4DV2 T;  1XNQ T;  4DV1 T;  4DR3 T;  4JI8 T;  4GKJ T;  2UXC T; 
#chains in the Genus database with same CATH topology
 2UXN B;  2CCQ A;  4KBM B;  4DV7 T;  4KX6 A;  2JRK A;  3UFE A;  1T98 A;  1V9D A;  4LF6 T;  1Y01 A;  2MTQ A;  1X9B A;  2VVN A;  4OFZ A;  2X67 A;  4U74 A;  1YW0 A;  3ETU A;  2B1E A;  2AE9 A;  4I50 E;  5LHI B;  3UTK A;  3F2E A;  1YKH B;  2L9Q A;  3RC8 A;  3P4W A;  2QYW A;  3V5S A;  2JQ9 A;  4F6R C;  4DR1 T;  2X66 A;  3ESL A;  1ZHC A;  3NWI A;  2DLR A;  2XQ5 A;  4UEM A;  1SE7 A;  2XQ8 A;  1OED C;  4BA9 A;  3IHR A;  5LNK A;  3ZEF B;  4JLE A;  2RA1 A;  3K8P C;  3FZM B;  4KI0 F;  3PUQ A;  3EDU A;  5LMU T;  3ZJ1 A;  3RRC A;  4YSZ A;  3N9Q A;  1WR6 A;  1MMG A;  3ZN0 B;  4JEU B;  5JDF A;  1M7K A;  2DL1 A;  3UUM A;  2H89 A;  2ZM0 A;  1KEY A;  5ABE A;  3AEE A;  3FBZ A;  1HNZ T;  4P1N A;  4KMC A;  4Z8X A;  3WAJ A;  1BR4 A;  4XBF B;  2N1G A;  2UXC T;  3RC3 A;  4PW8 A;  4AKI A;  4PJM A;  3UU5 A;  2J62 A;  4AIU A;  4Z91 A;  2AXD S;  1YQ3 A;  3FXD B;  3RGL A;  2BG9 E;  3VRB A;  5HWY A;  4LML A;  3FZH B;  2V7J A;  3AEB A;  2XAQ B;  3PJA J;  5FYM A;  2X0Y A;  4ILC A;  4HFV A;  4X65 T;  3P4Q A;  1S94 A;  1YKE B;  2N2N A;  4IDO A;  4DID B;  1X79 A;  3PJA A;  4LF5 T;  4CN1 A;  3TKL B;  2C5K T;  4OHF A;  2WCA A;  2V6Y A;  3ZKR A;  2PJQ A;  4LFC T;  3KV6 A;  4WYV A;  5ABF B;  2XQ9 A;  1W09 A;  5FL1 A;  4TWD A;  5AQO B;  4X1I E;  4CN4 A;  4EIW A;  5AQS B;  1E7P A;  2LT3 A;  2HPJ A;  3CVR A;  4AXP A;  3AAI A;  4IE0 A;  3RQW A;  4H9N C;  4DBQ A;  1HFA A;  4A56 A;  3N9P A;  4X5T A;  1D0Y A;  4PK5 A;  3CWZ B;  5AQG B;  3AVR A;  4B3S T;  5HXE A;  3PUA A;  2Q9Q A;  3ZCI A;  4U7I A;  3OBV E;  4UIG A;  2ES0 A;  2RPA A;  2LRL A;  5BMV E;  4X64 T;  5FXZ A;  4I43 B;  2A3D A;  2JMK A;  2LKH A;  4UXN B;  3FBL A;  2FJB A;  2IIU A;  1LKX A;  5KDM C;  4IIJ E;  3GN5 A;  4EGW A;  3W15 B;  2HH7 A;  5IYZ E;  4LF4 T;  4CXY A;  4E7S A;  1B7T A;  3N2O A;  1WYB A;  4BJM A;  4AKL A;  4EV6 A;  1YQ4 A;  4AKR B;  4I4T E;  5HWX A;  1HS7 A;  2WQY A;  1FIO A;  1MIY A;  4JI3 T;  3QNU A;  5JDN A;  5CFB A;  4IST A;  3ZMV B;  3ETV A;  4HFI A;  4ZS2 A;  4AQY T;  1FMW A;  5JRC A;  3UUX B;  4PAG A;  3ZC1 A;  5AQL B;  3UUN A;  3F57 A;  4UR9 A;  3NZQ A;  2LE8 A;  3AE4 A;  2NOX A;  3NVO A;  3VR9 A;  4EB6 E;  2BS4 A;  4DV4 T;  2EHO B;  4ERR A;  3ONX A;  2WY2 A;  3PUZ F;  3CQC B;  3P7I A;  2KT9 A;  3KVB A;  2XUE A;  4P0B A;  4QH4 A;  2KZ7 B;  4UVA B;  4DV3 T;  2I0M A;  1VCT A;  4EZH A;  3H3A A;  2XPK A;  3BQK A;  3RPU A;  4L5G A;  3T1H T;  2VWA A;  2W0G A;  2LSG A;  3AB3 B;  2BG9 A;  4ISS A;  2Q9Q B;  2XQ7 A;  2VQE T;  3OKQ A;  2V8S V;  2XM1 A;  1UCU A;  2DWG A;  1T72 A;  4Z90 A;  1NEK A;  2WDR A;  4EZ4 A;  5AQU B;  4PFP A;  3GN5 B;  2YEV C;  1HX1 B;  3AEC A;  2X9H A;  3LJC A;  4YJ2 E;  1IBM T;  3OPC A;  5KX5 E;  2OV9 A;  4IGU A;  2XHE B;  2EHO C;  4DUY T;  1CHU A;  4B3T T;  1SHZ C;  4C90 A;  1G73 A;  4OX9 T;  2QGS A;  2UUB T;  1YD8 G;  5KXJ A;  1OED A;  4TN7 B;  4NXN T;  4ZI3 D;  4PJN A;  2LOS A;  3P50 A;  3IF8 B;  2KSR A;  3CQX C;  2IDO B;  4DR3 T;  1FMV A;  4WBN E;  3UFG A;  3Q5E A;  1S35 A;  1IBL T;  2C5J A;  4U2Y A;  3AVS A;  4TZ4 C;  2X9Y A;  1XDO A;  4HTE A;  1IBK T;  5A1L A;  5LJN A;  5JR9 B;  2WZH A;  2J4G A;  1MMA A;  3PTR B;  4OYK A;  5LCY A;  4AKH A;  1D1C A;  1D0Z A;  4AQG A;  2WMO A;  1MNE A;  1HNW T;  4DO0 A;  4HN9 A;  3VU7 H;  3QB5 A;  4K0K T;  3WI3 A;  4CXW A;  3TLU A;  2L8K A;  3ZMT B;  4WW0 A;  2XQA A;  2M67 A;  1W0A A;  3CML A;  2KMF A;  3PUG A;  2JMH A;  2JQK A;  2C0S A;  4TWH A;  5FXV A;  4HWF A;  4DV6 T;  3R6N A;  1O3X A;  1IJ5 A;  2D0T A;  4JI4 T;  3MA9 A;  2YK0 A;  3VR8 A;  3EI0 A;  4KP3 C;  1KNZ A;  3A7M A;  4JUY A;  2E9X D;  4NXM T;  1VRB A;  5F8P A;  3DTO A;  4AQF C;  3RYC E;  3LFM A;  1MMD A;  5ADX L;  1LVK A;  3CQG B;  2IUB A;  4CI2 B;  2CM0 A;  3U78 A;  1HF8 A;  4AI6 A;  2VKO A;  3I0O A;  5HXH A;  3BQL A;  5IWA T;  4TV9 E;  4JI5 T;  3RIF A;  3FXE B;  2MPK A;  3RF1 A;  1I6Z A;  2XAS B;  1OED B;  2KWI B;  3PUX F;  4ILA A;  4PFO A;  4YY3 T;  4B3R T;  4IE5 A;  4EAH A;  5LBQ B;  4U2Z A;  5FNV E;  4JI2 T;  3Q5D A;  4IL4 A;  3KV9 A;  4B6X A;  3D0T A;  2VKJ A;  5FY0 A;  3X1D A;  4G63 A;  2H3R A;  4ZXL A;  3KFW X;  3RIA A;  2XM2 A;  2NP9 A;  5FL0 A;  5AQJ B;  1YXR A;  3E0Z A;  1KK7 A;  3B5M A;  4QHO A;  2W63 A;  2CXL A;  2CHO A;  2IC6 A;  3LDQ B;  2IW5 B;  4LMJ A;  5ABF A;  3PUW F;  2KLQ A;  4JV5 T;  3K3N A;  3MJX A;  2X51 A;  2J47 A;  3P8C D;  1J1J A;  4CI3 B;  5AQI B;  2FBW A;  2HHH T;  4O2B E;  5LHH B;  2LJL A;  5M4Y A;  2K48 A;  4IDN A;  2X68 A;  3AE8 A;  3ZMZ B;  3I1A A;  4PK4 A;  2YN6 A;  3ZT5 A;  5AQT B;  5H6R B;  2JIW A;  3ZSS A;  2CPT A;  1XMO T;  4DR2 T;  2M6I A;  2LKG A;  3UU6 A;  2NTX A;  4EEB A;  5AQF B;  4ADZ A;  3AE9 A;  4WBO A;  1GQE A;  2Z6E A;  4U31 A;  1N33 T;  2UXB T;  2V7L A;  2LSY A;  4IT4 A;  1IJ6 A;  3DJB A;  3IA3 A;  4HWH A;  4P09 A;  4HWC A;  4HGA A;  1N34 T;  4H9R C;  3RLF F;  5CA0 E;  3Q5W A;  4LFB T;  5JH7 E;  4DR5 T;  3P4S A;  2K9A A;  3Q9D A;  3V5U A;  5L3B B;  1UGO A;  2BBJ A;  4LF7 T;  3RQU A;  3Q2M A;  3FZL B;  3G06 A;  2V5C A;  3AEF A;  1XWM A;  1KF6 A;  3ANW B;  3AEA A;  4DVD A;  3HL6 A;  3CX7 B;  2VQF T;  2Y48 B;  5HEO A;  1W9R A;  5AQK B;  3J7Y q;  1T8B A;  2YDR A;  4KHZ F;  3JAD A;  4QH5 A;  1Y64 B;  1M62 A;  4IE7 A;  4ILB A;  4H9S E;  4WNK A;  4HE8 A;  5CJ5 A;  2BKP A;  2CRB A;  4O8S A;  5FP3 A;  3N9N A;  2PTF A;  3AE2 A;  2A9U A;  4QX8 B;  5EK3 A;  3AA1 B;  3BK9 A;  3E08 A;  3KV4 A;  2ZM6 T;  3NRY A;  2BVL A;  3JC6 D;  3ZCJ A;  2Q9Q D;  3EUH A;  4L0R A;  2EHO A;  1KNP A;  2WU2 A;  2V7K A;  4EYY R;  5HXS A;  2M6B A;  4WZX A;  1OED E;  4DR7 T;  2K24 A;  3TLV A;  4ZI2 C;  2YDQ A;  2VB6 A;  3FHN A;  1XNR T;  5DJQ C;  3ONL C;  3JCF A;  2LEH A;  3SRZ A;  3ZT6 A;  4LFA T;  4QXC B;  2BS3 A;  2D0U A;  3HR0 A;  4QXH B;  2IC9 A;  1ZKE A;  3N9L A;  3M3Z B;  3AE1 A;  2D2S A;  5JDG A;  2VL0 A;  3L39 A;  4K0U A;  2ZMA A;  2CBJ A;  4IL9 A;  3IBP A;  3CX8 B;  2XAH B;  2DWK A;  2PG8 A;  5DQV A;  4GOU A;  4H63 H;  5FKY A;  5FY1 A;  3HKD E;  5JDL A;  4GK0 E;  4NUV A;  4X66 T;  2VKD A;  3WAK A;  3J9X 1;  1WYC A;  2IAK A;  2LM2 A;  2QRX A;  1WCR A;  2K5B B;  3SS1 A;  2ZLY A;  3EHZ A;  5LHG B;  2XQ3 A;  5CGM A;  4DBR A;  5LGU B;  3F31 A;  3M65 A;  2D9D A;  4DV2 T;  3AEG A;  3O1I A;  1KNR A;  3C4X A;  4H9P C;  3TLW A;  2XQ6 A;  2VAS A;  2YU2 A;  4YTP A;  2I6H A;  3I9Y A;  4U3C A;  4UV9 B;  5LBM A;  4M1P A;  4AQF A;  4JEH B;  4YFS A;  4X62 T;  4N78 D;  1QUU A;  5LYJ E;  2GK9 A;  5JR9 A;  3OYZ A;  3ZN1 B;  2DI4 A;  2E8I A;  2WDV A;  3JAE A;  1UK5 A;  1H7C A;  4O4J E;  2UUA T;  4FI5 A;  2W00 A;  2HN1 A;  4YT0 A;  4JI7 T;  3RIU C;  2OA5 A;  4EED A;  5J2T E;  3CK6 A;  3EAM A;  1E1H B;  4OYJ A;  4F8H A;  2YU1 A;  2IML A;  3HKB E;  5FMN A;  2LHR A;  5HXR A;  4DMW A;  5AQQ B;  3QC9 A;  2JPF A;  2WWV A;  3LSV A;  1L0V A;  3UT5 E;  2UXD T;  2BDE A;  2X9X A;  1UX4 A;  2LHN A;  4IDZ A;  2NTY A;  5LGN B;  2NR4 A;  5L3F B;  3EAB A;  4ZHQ E;  2H88 A;  1CUN A;  3OYX A;  4ZZC A;  4DR6 T;  2E5L T;  1W0B A;  2W61 A;  2B76 A;  4O4H E;  2CXF A;  4OK0 A;  4JI8 T;  4GKJ T;  5AQN B;  2F4V T;  4U72 A;  4HFB A;  1HG2 A;  2ZM2 A;  3UU4 A;  2D5U A;  1NWM X;  3L8R A;  5LOV E;  3CX6 B;  2A72 A;  3KBT A;  2XJ7 A;  4DV5 T;  4ZS3 A;  4UVC B;  3SFE A;  4LMK A;  5JQG E;  4U7Y A;  2XQY A;  4H9O C;  4XZC A;  2XSB A;  4YTN A;  3LBX B;  4X1K E;  2ACZ A;  3NKZ A;  1FEW A;  1NEN A;  5AFU L;  1XZY A;  1ZP0 A;  4HWI B;  3AE5 A;  4CZZ B;  5FVL A;  5TAO A;  3OJA A;  4QH1 A;  4QXB B;  3ZPO A;  2PBI A;  3AE6 A;  1UX5 A;  3HKE E;  4CN6 A;  4KHP T;  4EOZ B;  4TNW A;  4KUM B;  3RHW A;  2UUC T;  3O1J A;  3T1Y T;  4UV8 B;  2KIN B;  2LM9 A;  3MXZ A;  1U4Q A;  1MIV A;  4JYA T;  2MAW A;  2HN2 A;  5L47 A;  3K3O A;  5L4E A;  4J2C A;  3ABV A;  3CIR A;  4HFD A;  5L3E B;  4YTM A;  2WU5 A;  2XY8 B;  2J1D G;  3B57 A;  2W62 A;  3RKO A;  3P4R A;  5J2U E;  1HTJ F;  3MZK B;  2KWH A;  3DP7 A;  2MBG A;  3MK7 C;  2ZM8 A;  5L2L A;  5J0Z A;  2G0U A;  3I9W A;  3TLT A;  2CHN A;  2N9D A;  3AE3 A;  5AQR B;  2CXD A;  5C3J A;  1OXZ A;  4A98 A;  4NIQ A;  3ZLI A;  5JDM A;  3ZST A;  4JI0 T;  3RYI E;  1VOM A;  4IDP A;  2YOE A;  4QWN B;  4DUZ T;  2WAU A;  2WM9 A;  1SUM B;  3UU3 A;  5LP6 E;  2LSJ A;  2NWB A;  1BR0 A;  2KND A;  4NUU A;  3O4X E;  5L3C B;  4U33 A;  3ANW A;  2MYS A;  5L4H A;  5CA1 E;  2JQH A;  4H9Q C;  5H6Q B;  4IHJ E;  5FXX A;  4HFE A;  3B13 A;  4O4I E;  3RRW A;  3K1S A;  5AQV B;  2LRK A;  1G8X A;  2C5I T;  1T7S A;  2V6X A;  4P0A A;  4JI1 T;  5LGT B;  5LG3 A;  4NPP A;  4GKK T;  3AXJ B;  1HR0 T;  3AE7 A;  2YKS A;  1HNX T;  1IAP A;  4TUY E;  4O2A E;  1IZN B;  1HG5 A;  2QA7 A;  2WDQ A;  2DCF A;  3AA6 B;  3FZF B;  1R8I A;  4ZOL E;  3O1H A;  1XMQ T;  4AIS A;  3UU8 A;  2MOZ A;  2XQ4 A;  2PFV A;  4ZZB A;  3UQ7 A;  4IE4 A;  2WP9 A;  4PK6 A;  2CEA A;  1ZOY A;  5E0O A;  4HKA A;  1U5P A;  4I0U A;  5J1G A;  3KDS E;  2ODU A;  3H37 A;  2CLY B;  4YHJ A;  5LA6 E;  4Q25 A;  4H63 V;  5EZY E;  5IHY A;  1HX8 A;  2CMR A;  3KBU A;  3A5X A;  5FY7 A;  1J5W A;  2LOP A;  5AQP B;  4IE6 A;  5L3G B;  3N2G E;  3Q5X A;  4CXX A;  4CQI A;  4YLH A;  4GYS A;  4ZI3 C;  4ZI7 E;  4IRE A;  2H7O A;  4UF0 B;  2WBL A;  2NW8 A;  1AJ3 A;  3VRA A;  3RH3 A;  5CB4 E;  2ACX A;  3PU8 A;  4X20 E;  2WS3 A;  4JI6 T;  2DNX A;  2Y6X A;  3N5L A;  3RIU A;  3N9O A;  2W4X A;  1SA0 E;  3ONJ A;  2E9X B;  3SWH A;  4TNV A;  2YDS A;  3H3M A;  3P4P A;  2I59 A;  2EHO D;  1XNQ T;  4MLK A;  2L3L A;  4I55 E;  2CLY C;  4YXD A;  5DQW A;  2XTL A;  2ODV A;  2V5D A;  2CWY A;  3ZMS B;  3GMI A;  5HEU A;  3C51 A;  2HPL A;  3C64 A;  5ABG A;  3LK3 B;  3AAA B;  5JDH A;  4COF A;  4C91 A;  3U3I A;  4MFR A;  1D1B A;  1HCI A;  3PU3 A;  1QSD A;  3GA8 A;  1N32 T;  2WZI A;  3K3Q C;  2W66 A;  4HFH A;  5LMN T;  4PJL A;  4XAX B;  2E9X C;  3UQ4 A;  4LF8 T;  4GK5 E;  2E2A A;  4YJ3 E;  5HEJ A;  2W67 A;  1WFD A;  2CBI A;  1BR2 A;  2V7I A;  5ETW A;  1MND A;  4DR4 T;  2X9W A;  3NBX X;  3RX6 A;  4X1Y E;  2VK9 A;  3UUB A;  2W2U A;  2JJ9 A;  1N36 T;  5DAB A;  2UU9 T;  1WLX A;  5KMG P;  2V7M A;  4AKG A;  4FJO A;  1KFY A;  2X0L B;  1OWA A;  3KV5 A;  5HEH A;  4BAY B;  3L3P A;  3HI2 A;  2VKH A;  3AA7 B;  2BKN A;  3N2K E;  2VVS A;  5HAX A;  2BKO A;  4E7Z A;  3E22 E;  2BZB A;  5FXW A;  2WMN A;  1D0X A;  4PNI A;  4YSY A;  2CE7 A;  4EYU A;  2XAF B;  3IEE A;  3EDV A;  5LG4 A;  3LBX A;  4HEA A;  1Z8U A;  1WR0 A;  2FJD A;  4A97 A;  4O4L E;  3PV0 F;  4JBW F;  2VUR A;  4G2A A;  5C2T A;  3RYH E;  3QOF A;  2DHR A;  3CPZ A;  2V6Y B;  5EK4 A;  2UXX B;  3PUY F;  3HA4 A;  2BS2 A;  5LB7 B;  5AQH B;  3TLS A;  1Z0P A;  4V1A v;  3ZYL A;  3AA0 B;  5BR8 T;  5HEG A;  2OLT A;  3C98 B;  3MKD A;  4DND A;  1QLB A;  3KVA A;  2KXP B;  2LLY A;  2FUP A;  1US7 B;  5GON E;  1JNZ A;  3FZK B;  1XDP A;  3QUJ A;  4ZEY A;  3LK4 2;  3AED A;  2NW9 A;  3A8Y C;  3I0Q A;  2XZE A;  4UVB B;  5JVD E;  4YSX A;  2V1D B;  2LSI A;  3PUV F;  3VKH A;  3PDY A;  2A2F X;  4PJJ A;  1UUR A;  3S4U A;  3UUL A;  4GYR A;  3EVY A;  3RI5 A;  5ABH A;  3R84 B;  5HCM A;  4L9I A;  3ZYK A;  1EZ3 A;  5LJM A;  3FB2 A;  3NRX A;  3N9M A;  5HXC A;  2X0H A;  3KIN B;  1I94 T;  2FJA A;  3MAC A;  5JDQ A;  2K3W A;  2FJE A;  1VCS A;  1E2A A;  3QK6 A;  3CKD A;  3RKG A;  4DMV A;  1LVF A;  4QX7 B;  2R6G F;  2Y8D A;  2V26 A;  2XAJ B;  3VKG A;  4GIW A;  3PUS A;  4BJN A;  2WB5 A;  5JTG A;  5HCJ A;  4MHC A;  3RYF E;  4IDQ A;  3PUR A;  1LRZ A;  3L09 A;  3JC6 C;  4HWD A;  5F5W A;  1NAF A;  2Q9Q C;  4QKN A;  1J5E T;  5AQM B;  5JRC B;  4TWF A;  5F3J A;  2NW7 A;  4UEL A;  3AAE B;  3C4Z A;  1JNR A;  5L3D B;  2BBH A;  4TX5 A;  4ANJ A;  3OTO T;  1MIW A;  3QB5 K;  3O9X A;  3AXJ A;  5FVK A;  3ZT7 A;  4DV0 T;  4LF9 T;  4HFC A;  4ILU A;  3JAF A;  2H7V C;  2XSA A;  5C8Y E;  3C4W A;  1BR1 A;  2SPC A;  2XAG B;  3T8O A;  3VHL A;  2QVA A;  2P9B A;  4YHH T;  2BG9 B;  3LK2 B;  2WSS V;  3ZYM A;  5EK2 A;  3BQI A;  3HKC E;  2IHR 1;  3SOL A;  3C50 A;  1ZEE A;  2CWO A;  2WWU A;  4ZI2 D;  3NZP A;  1UUS A;  1DU2 A;  2YIN A;  4CI1 B;  2RP4 A;  3PE0 A;  3LG7 A;  3SFD A;  4B3M T;  2CA5 A;  4ASK A;  2VL8 A;  1MMN A;  4UF0 A;  2E5V A;  3OVU A;  5HYA A;  5JR9 C;  3ZJ2 A;  4A5X A;  5IUX A;  5JRE A;  5LXT E;  4MAL A;  2JQQ A;  4TV8 E;  4EXT A;  3ZMU B;  3GWH A;  2E9X A;  1WRD A;  2BG9 C;  3ZC0 A;  1FJG T;  2LSK A;  4MBQ A;  1ZV4 X;  4DV1 T;  2BVM A;  1D1A A; 
#chains in the Genus database with same CATH homology
 2F4V T;  5IWA T;  1XMQ T;  4JI5 T;  4DV7 T;  4X64 T;  1IBL T;  1XMO T;  4DR2 T;  4DR7 T;  4DV3 T;  4LF6 T;  1XNR T;  4YY3 T;  4B3R T;  3T1H T;  4DV5 T;  4JI2 T;  4X62 T;  4YHH T;  4LFA T;  1IBK T;  1I94 T;  1N33 T;  2VQE T;  2UXB T;  4LF4 T;  4X65 T;  1N34 T;  4DR1 T;  4LFB T;  1HNW T;  2UUA T;  4JI7 T;  4DR5 T;  4K0K T;  4LF5 T;  4JI0 T;  1N32 T;  4DUZ T;  4LF7 T;  5LMN T;  1IBM T;  4B3M T;  4LFC T;  4LF8 T;  4JI3 T;  4JV5 T;  5LMU T;  2VQF T;  4DUY T;  5BR8 T;  4DV6 T;  4KHP T;  4B3T T;  4X66 T;  4JI4 T;  4AQY T;  1J5E T;  4DR4 T;  4OX9 T;  4JI6 T;  2UXD T;  2UUC T;  2UUB T;  3T1Y T;  2HHH T;  1N36 T;  2UU9 T;  4JI1 T;  4NXM T;  4NXN T;  4GKK T;  2ZM6 T;  3OTO T;  1HR0 T;  4JYA T;  1HNZ T;  1HNX T;  4DV0 T;  4DR6 T;  1FJG T;  2E5L T;  4LF9 T;  4DV4 T;  4B3S T;  4DV2 T;  1XNQ T;  4DV1 T;  4DR3 T;  4JI8 T;  4GKJ T;  2UXC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...