4JI0T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 39
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji0T00
4DV6T 4JI8T 2UUBT 2E5LT 4X64T 1XNRT 4JI6T 4YY3T 4JI2T 5IWAT 1N33T 4JV5T 1IBMT 4DR5T 4DV7T 1HNWT 2F4VT 4NXMT 4DV3T 4LF4T 2UXCT 4LF9T 1N32T 4AQYT 1N36T 2UXDT 1N34T 2ZM6T 4JI0T 1IBLT 1FJGT 4DR4T 3OTOT 4X62T 1HR0T 1XMOT 4JI3T 2VQET 1I94T 4DV5T 4GKKT 2UXBT 4JI7T 5BR8T 2HHHT 4X66T 4LF8T 2UUAT 4DR7T 4YHHT 4JI4T 4DUZT 4B3MT 4DR2T 4DR1T 4GKJT 4DUYT 4B3ST 4LF6T 4DV4T 1XMQT 4LF7T 3T1HT 4LFBT 4K0KT 1J5ET 5LMUT 1HNXT 4B3RT 4JI1T 4LFAT 1XNQT 3T1YT 4B3TT 4X65T 5LMNT 2UU9T 4JI5T 4JYAT 4DV1T 1IBKT 4DR3T 4LF5T 4KHPT 2VQFT 4DV0T 2UUCT 4DR6T 4NXNT 4OX9T 1HNZT 4LFCT 4DV2T
chains in the Genus database with same CATH superfamily
1Z0PA 1YQ3A 2XQ6A 1T72A 4AKRB 3IA3A 1CHUA 1IJ6A 2FJBA 3PUAA 4M1PA 3ONLC 5AQQB 5EK2A 3OVUA 1Y64B 2OLTA 5HWXA 2D5UA 2V1DB 2V6YB 3BQKA 4IDQA 5AQIB 3HKCE 3UTKA 4X64T 5FVKA 3AECA 2NW8A 3MK7C 4NIQA 2B76A 1T8BA 3KDSE 3RIUA 4CZZB 2XM1A 1KNRA 3DJBA 5F8PA 5HWYA 3SS1A 3AA1B 4G2AA 5CB4E 5JDQA 4HWIB 5KX5E 1YQ4A 1U5PA 4CXYA 3ZSSA 2YDSA 3OJAA 5LCYA 2CLYB 3AAEB 3W15B 4A5XA 4AIUA 5H6QB 2XAQB 3PUVF 5FY7A 5IWAT 1N33T 1HS7A 2ACXA 3AE4A 4ASKA 3VKGA 1D1AA 3PJAA 4DR5T 1G73A 2UXNB 3I0OA 5LHHB 2W67A 5ABFA 2AE9A 4JBWF 4DUZT 2F4VT 3UU3A 1W9RA 4UF0A 4XZCA 3PUYF 3C4WA 3GMIA 2A9UA 4HWHA 2ACZA 2Y6XA 1NWMX 1WLXA 2UXCT 1N36T 3VHLA 3BQIA 3P4RA 1O3XA 2UXDT 4UVCB 3ZCJA 2XTLA 2WAUA 5AFUL 4CI1B 1N34T 3L09A 2XSAA 5IHYA 5LP6E 4H9RC 2WMNA 3K8PC 1DU2A 2WCAA 1HX8A 3ONXA 2XAJB 3UUXB 2ZMAA 4U2YA 5FYMA 3E08A 2Q9QC 3ESLA 3EABA 4KUMB 2CMRA 4AKHA 2XQ8A 5AQOB 2XQ3A 5H6RB 2YU2A 3E22E 4QXHB 4JI3T 5JH7E 1LVFA 2HN1A 2ZM2A 5L4HA 3RKOA 1KK7A 2HH7A 2VURA 3E0ZA 4H9SE 4HFDA 4L0RA 4EIWA 2BDEA 4UELA 4ZI7E 2IAKA 2E9XD 3CMLA 1OWAA 2XSBA 2L9QA 4O4IE 4JYAT 5BR8T 4X66T 2E9XC 1UK5A 4OYKA 2H88A 2KINB 2H3RA 3UUBA 4X1YE 2MPKA 2YKSA 2Q9QA 2LJLA 4QHOA 3FZLB 2W00A 3CWZB 2XAHB 2Z6EA 2KWHA 4HFCA 4HFIA 2V6XA 2WB5A 5HEGA 3K3QC 2BG9C 2IUBA 3IEEA 4F6RC 1E2AA 3FB2A 1WYBA 4H63V 3PV0F 2LSJA 3RIAA 2XQAA 3KINB 1UGOA 2XQYA 4IE4A 5AQVB 3AE6A 4MHCA 5C3JA 3Q5XA 4DR1T 2LRLA 2RP4A 5F3JA 2ZM8A 2MTQA 2LHNA 3CQCB 2BS3A 3ZT7A 4TWFA 3P4WA 4IE7A 2P9BA 2V7KA 2X9XA 5HYAA 5JDHA 4LF7T 1HG5A 4UVBB 1KNPA 4YSXA 3A5XA 3I9YA 3FZMB 5JR9B 2Q9QB 2K24A 2NTXA 2X9YA 4PJLA 2WWUA 3PUWF 1MIYA 1BR1A 4TV8E 5J1GA 3RQWA 1AJ3A 3JAFA 5C2TA 2WSSV 3D0TA 5AQGB 3MA9A 5J0ZA 4TN7B 5HXHA 2OA5A 2W0GA 3TLWA 4YT0A 5HXSA 4HWCA 4JI1T 5DJQC 5KMGP 2A3DA 4EYUA 4F8HA 4PJJA 3VR8A 3ABVA 1BR0A 4JLEA 5LBMA 3H3MA 2CA5A 2HPLA 3N9NA 3K3OA 4ZZCA 1MIVA 1VCTA 1JNRA 2CE7A 2E2AA 2XHEB 4UEMA 2KWIB 2RA1A 1T7SA 3P8CD 4JI5T 2V5DA 3UU5A 4EAHA 3QNUA 2CM0A 4DR3T 4LF5T 3QB5K 2LSYA 2LOPA 2LLYA 4H9OC 3ZYKA 2VQFT 1WYCA 3PE0A 2KMFA 2JRKA 2R6GF 3RQUA 4LMLA 4IGUA 3ZT6A 2W61A 3EDUA 4ILAA 3NVOA 2DI4A 4TWHA 4UF0B 1HNZT 2MAWA 4LFCT 1BR2A 3ZKRA 2WDRA 2VKDA 3ZT5A 1Y01A 4QX7B 2C5IT 2SPCA 1S94A 3RIFA 3H3AA 4U7IA 2X0LB 2M67A 4O4LE 2K5BB 5LOVE 4CQIA 3AA7B 2E5LT 3SFDA 5L3CB 5FL0A 2WDVA 4PK5A 3CQXC 1XNRT 4P0BA 4UV9B 2D0UA 2X0YA 4EOZB 2VVSA 2RPAA 4Z90A 4IL9A 4HFBA 1D0ZA 4L9IA 4AXPA 2CBIA 1XDOA 2NP9A 5KDMC 1OXZA 4QXBB 2XQ4A 4WW0A 2V5CA 2YN6A 3TLTA 4YTPA 3RX6A 1SE7A 4HEAA 1LRZA 2QA7A 2HPJA 3LSVA 2BBHA 3AA0B 3A8YC 3MZKB 4P09A 5AQKB 2IDOB 2K9AA 3V5UA 5FP3A 4DV7T 1IBMT 5AQUB 1I6ZA 4MLKA 2A72A 5CJ5A 5L3GB 2WU5A 4KBMB 2V8SV 3PUZF 2IW5B 4DV3T 4NXMT 1NEKA 2Y48B 4Z8XA 4LF9T 4U74A 1N32T 4IDZA 5JRCB 4QH4A 2VL8A 1IAPA 2YEVC 3AA6B 3P4QA 1UUSA 4OK0A 3QB5A 4L5GA 3UU8A 4I0UA 4EXTA 4JI0T 3LK3B 3GN5A 1FJGT 3AE5A 3Q5WA 4KX6A 3VKHA 4ZEYA 2XQ5A 2K48A 3IBPA 4TNWA 5A1LA 2FBWA 4X62T 4FI5A 2UXXB 4CN6A 2VKHA 4HGAA 5AQFB 2N1GA 3DP7A 3KVAA 2D0TA 2C0SA 2V26A 1KFYA 1CUNA 2X66A 3AE3A 5AQMB 2DWGA 2FUPA 2NW7A 3NZQA 4NUUA 3IHRA 3PDYA 4O4HE 3B5MA 4IE5A 4PK6A 5IYZE 5LBQB 3UULA 3ZMUB 3RGLA 5HXRA 1H7CA 3ZYLA 2HHHT 2BG9B 2NTYA 4LF8T 1YXRA 3RI5A 4ZI2D 2DCFA 5FVLA 3RC3A 2IC9A 2YDQA 3HA4A 3TLSA 3U3IA 4EV6A 1UX4A 5FXZA 2CXDA 3C4ZA 3ZMVB 4DO0A 1M62A 2LM9A 3P4SA 5JQGE 3I1AA 5JTGA 4FJOA 1M7KA 3EVYA 2Q9QD 5F5WA 5LG3A 2JMHA 1WFDA 2ES0A 3AEDA 4AQGA 4DIDB 2NWBA 2IC6A 3PJAJ 4LMKA 3NRXA 4B3ST 3HKBE 4PFPA 5LJNA 4KI0F 3M3ZB 1S35A 5JR9C 4N78D 4YSZA 1J1JA 3X1DA 4JEHB 2VL0A 3OYZA 3QC9A 4TV9E 5FXVA 4WBNE 3IF8B 2H7VC 3KV9A 3HL6A 5JDLA 5JREA 3UUMA 4V1Av 4ZOLE 4AQFC 5IUXA 5LHIB 3QK6A 2KLQA 5CA0E 5KXJA 2J62A 3KV4A 5L3EB 5HEHA 5HEUA 2XAFB 3PUQA 4B3RT 2XM2A 3NRYA 2CHNA 2CBJA 3L39A 2NW9A 4O4JE 2CXFA 2W4XA 5L3BB 3NKZA 4TZ4C 3VRAA 5AQRB 4IDOA 3ZN0B 4U3CA 2WS3A 3PU8A 4P1NA 1XNQT 3T1YT 4A97A 1ZKEA 2XY8B 4ILUA 5HXEA 4HWFA 4ISSA 2XQ9A 4CXWA 4YJ2E 5FMNA 2QGSA 4EB6E 4XAXB 1ZHCA 2C5KT 3RPUA 3N9LA 2M6IA 4DV1T 4TNVA 5EZYE 2X51A 5FXXA 3N9PA 3UFEA 2B1EA 2YDRA 3VU7H 4EEDA 4DV0T 4KHPT 2XZEA 2UUCT 3BK9A 4AI6A 3AE2A 4AKGA 4HFVA 4OX9T 3ETUA 2X9WA 4XBFB 5HAXA 2LE8A 4HN9A 4JEUB 2IMLA 3AE7A 3QUJA 2WBLA 4IDNA 4ZHQE 2W63A 4DBRA 4I4TE 1Z8UA 4DV6T 2VKOA 4ZZBA 1X79A 4PJNA 4PFOA 4ZXLA 4KHZF 5M4YA 4UR9A 3KVBA 1J5WA 3MACA 4Q25A 5JVDE 3ZLIA 3ZEFB 3CQGB 2IHR1 4UV8B 4YLHA 2N9DA 3F31A 4HTEA 2L8KA 4X1IE 2QRXA 5HEOA 3TLUA 3LK2B 1FMWA 4ILCA 4U31A 4DVDA 5JDGA 1E1HB 2LRKA 3PTRB 3GN5B 3JADA 1MNEA 1OEDE 4IE0A 3WI3A 1W09A 2VVNA 3AEGA 2H7OA 2ZM0A 4CI2B 5ABFB 2CHOA 2XPKA 3HR0A 4JI6T 5JRCA 2YK0A 4YY3T 3LK42 4BA9A 2ODUA 2DL1A 2WY2A 3O1IA 5AQHB 1XDPA 4UXNB 4E7ZA 4PW8A 2DWKA 4QH5A 5AQTB 1KEYA 4ANJA 4EGWA 3O1HA 4WZXA 4EEBA 1US7B 3AE8A 3B57A 2WWVA 4H9QC 4AQYT 1D1CA 2VASA 2VKJA 4I55E 5FY0A 2CXLA 5ABGA 3RIUC 5LG4A 3UQ7A 1KNZA 2NOXA 3U78A 3HI2A 2JQHA 3NWIA 2ZM6T 3RF1A 1IBLT 1KF6A 2J1DG 3C98B 4WBOA 1HX1B 3QOFA 3L8RA 5AQLB 2KNDA 1WR0A 1SUMB 3AB3B 3RH3A 1HR0T 1NAFA 1WCRA 1HFAA 1XMOT 1FMVA 3GA8A 2VQET 3ZMZB 3KV5A 2JPFA 4NUVA 5LGTB 2UXBT 4U33A 5ADXL 1IJ5A 1ZOYA 3PUSA 4ADZA 4JI7T 3T8OA 5L4EA 1HG2A 1D1BA 1WRDA 2ZLYA 5L3DB 2BS2A 4IREA 3DTOA 3O9XA 2UUAT 4JI4T 3CIRA 5ABEA 1ZEEA 2LT3A 4ZS3A 4HFHA 1FEWA 4C91A 5FL1A 4CN1A 4YXDA 2ODVA 4B3MT 5EK3A 2E9XB 1NENA 5L2LA 4IE6A 4U72A 4YFSA 2LKGA 3UT5E 1SHZC 2KSRA 2NR4A 3RYCE 4C90A 1YW0A 2PFVA 3KFWX 3J9X1 3N2GE 4QWNB 5CA1E 4GKJT 2G0UA 3H37A 4H63H 4LF6T 2BKNA 4DV4T 2JQKA 1XMQT 3C50A 4A98A 2LHRA 4CI3B 2WP9A 3AEEA 2XJ7A 3OKQA 2M6BA 2MYSA 4CXXA 4EYYR 1XZYA 3T1HT 3G06A 3MKDA 2CLYC 4OHFA 1R8IA 3BQLA 1OEDB 3KBTA 2E8IA 4YJ3E 5AQPB 3WAKA 3CX8B 5JDMA 1LKXA 3TKLB 3RYHE 4LFBT 4MBQA 3VR9A 2BBJA 5EK4A 1J5ET 2I6HA 2Y8DA 4K0KT 4BJMA 3LJCA 4ZS2A 5LMUT 1FIOA 1HNXT 4IHJE 3R84B 3ZMTB 4QKNA 4WYVA 1HTJF 1MMNA 3LBXA 1JNZA 3MJXA 3LBXB 4HE8A 1W0AA 4LFAT 3NBXX 4IT4A 1X9BA 2CPTA 4QXCB 4X20E 4YTMA 4I43B 2N2NA 4X5TA 3SFEA 4AISA 2QVAA 4IIJE 4X65T 2J47A 1VCSA 3EDVA 2EHOA 2WQYA 3C51A 3I0QA 2JQQA 3PU3A 4HWDA 1UX5A 2BVMA 3CX7B 3ZMSB 2X67A 2UU9T 3N5LA 1EZ3A 1OEDA 2PJQA 2WM9A 3FXDB 4HKAA 4PNIA 2LSGA 3RRWA 2WMOA 1IBKT 4HFEA 3LDQB 3O4XE 4UIGA 2FJDA 2EHOC 3B13A 4GYRA 4DR6T 3RLFF 3AVRA 1MMAA 2LEHA 2WDQA 2YOEA 4IDPA 5LYJE 5CGMA 4JI8T 5LGUB 4DV2T 1G8XA 3VRBA 1XWMA 3OBVE 2YU1A 4A56A 3SRZA 4COFA 5GONE 2KXPB 3ETVA 2LM2A 2UUBT 4GK0E 2DHRA 5DABA 3AEAA 4Z91A 2E5VA 2DNXA 3FBLA 3P50A 3FXEB 3MXZA 1VOMA 3RRCA 3LFMA 3AAAB 3KV6A 4BJNA 2EHOB 1YKHB 3EHZA 4WNKA 3JAEA 2LSKA 3S4UA 1D0YA 5LNKA 4DNDA 2V7JA 3FZFB 4QX8B 1MMGA 2D9DA 2LSIA 4MALA 2BZBA 2WU2A 4YSYA 4JI2T 3SWHA 2VK9A 4AKIA 2L3LA 3PUGA 2I59A 3P7IA 4ZI3D 2LOSA 3FHNA 2K3WA 4OFZA 3UUNA 4JV5T 2CWYA 1HNWT 2MBGA 3WAJA 2AXDS 4PJMA 2CCQA 5L3FB 4LF4T 4GIWA 2CEAA 4DMVA 2BS4A 2JJ9A 5AQSB 5HCMA 5LJMA 4UVAB 3RYIE 4QH1A 4TX5A 5DQVA 1GQEA 5HCJA 4ILBA 2BG9E 3CKDA 1BR4A 3UQ4A 1ZP0A 3UU4A 4EZ4A 5CFBA 3AE1A 1QSDA 4P0AA 4DR4T 5ABHA 2V6YA 2FJAA 1D0XA 1MMDA 5J2UE 3J7Yq 3OTOT 2HN2A 4EZHA 3N9OA 3OPCA 4U2ZA 1HF8A 3AE9A 4X1KE 5AQJB 5AQNB 3M65A 2W2UA 3EI0A 4IL4A 5LGNB 2VB6A 4O2BE 3GWHA 3Q5EA 4G63A 5TAOA 3FZKB 3R6NA 1I94T 3RC8A 2VWAA 2W62A 2D2SA 4DV5T 5L47A 1U4QA 1YKEB 1UCUA 3O1JA 5FY1A 2X9HA 5LXTE 4GKKT 3ONJA 2QYWA 3CK6A 5JR9A 1LVKA 3KBUA 2J4GA 3ANWB 3HKEE 1QUUA 3FZHB 2C5JA 4KMCA 2PTFA 3N2KE 4PAGA 5FNVE 3ZN1B 2W66A 3AXJA 3NZPA 2WZIA 4DR7T 2BKOA 3AXJB 4B6XA 3N2OA 4YHHT 4NPPA 3ZYMA 5LA6E 3ANWA 5LB7B 3AEFA 4O8SA 5JDFA 4DR2T 3EUHA 5FXWA 3AEBA 1L0VA 3OYXA 2LKHA 1YD8G 2DLRA 4TWDA 4YHJA 2V7IA 2V7LA 4O2AE 3ZSTA 3HKDE 3ZPOA 2PG8A 1E7PA 4K0UA 4DUYT 4OYJA 4CN4A 2XUEA 4I50E 5ETWA 1HCIA 1VRBA 3CPZA 3JC6C 1W0BA 1MNDA 3V5SA 3CVRA 3Q2MA 4H9PC 3LG7A 3K1SA 4PK4A 3JCFA 3SOLA 3ZC1A 1MIWA 2BVLA 3P4PA 2I0MA 3ZC0A 3AVSA 2A2FX 2BG9A 4TUYE 3PURA 3UFGA 5J2TE 3TLVA 3UU6A 2GK9A 2KZ7B 3AAIA 4H9NC 4BAYB 5LHGB 4KP3C 4YTNA 3ZJ1A 4LMJA 2XAGB 1SA0E 3CX6B 2XQ7A 2XASB 3F2EA 3F57A 4U7YA 2JMKA 4AKLA 2E9XA 5BMVE 4ERRA 3RYFE 4E7SA 1OEDC 3EAMA 3JC6D 4GYSA 3RKGA 5HEJA 2X0HA 4ZI2C 5C8YE 1QLBA 3C64A 4DBQA 2CWOA 2X68A 4GOUA 4B3TT 5JDNA 5E0OA 3FBZA 2OV9A 1T98A 4J2CA 3Q9DA 5FKYA 1B7TA 1V9DA 2H89A 3N9MA 5DQWA 2IIUA 3C4XA 5LMNT 4ISTA 3ZJ2A 2V7MA 2CRBA 3ZCIA 2FJEA 2JQ9A 2JIWA 3K3NA 3PUXF 4DMWA 3Q5DA 2PBIA 1IZNB 3A7MA 4JUYA 2BKPA 3I9WA 4NXNT 1ZV4X 2WZHA 4GK5E 3N9QA 3RHWA 5HXCA 2MOZA 1UURA 4MFRA 4ZI3C 1WR6A 2YINA 2EHOD 2KT9A 3L3PA 4AQFA
chains in the Genus database with same CATH topology
4DV6T 4JI8T 2UUBT 2E5LT 4X64T 1XNRT 4JI6T 4YY3T 4JI2T 5IWAT 1N33T 4JV5T 1IBMT 4DR5T 4DV7T 1HNWT 2F4VT 4NXMT 4DV3T 4LF4T 2UXCT 4LF9T 1N32T 4AQYT 1N36T 2UXDT 1N34T 2ZM6T 4JI0T 1IBLT 1FJGT 4DR4T 3OTOT 4X62T 1HR0T 1XMOT 4JI3T 2VQET 1I94T 4DV5T 4GKKT 2UXBT 4JI7T 5BR8T 2HHHT 4X66T 4LF8T 2UUAT 4DR7T 4YHHT 4JI4T 4DUZT 4B3MT 4DR2T 4DR1T 4GKJT 4DUYT 4B3ST 4LF6T 4DV4T 1XMQT 4LF7T 3T1HT 4LFBT 4K0KT 1J5ET 5LMUT 1HNXT 4B3RT 4JI1T 4LFAT 1XNQT 3T1YT 4B3TT 4X65T 5LMNT 2UU9T 4JI5T 4JYAT 4DV1T 1IBKT 4DR3T 4LF5T 4KHPT 2VQFT 4DV0T 2UUCT 4DR6T 4NXNT 4OX9T 1HNZT 4LFCT 4DV2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 T;  4JI8 T;  2UUB T;  2E5L T;  4X64 T;  1XNR T;  4JI6 T;  4YY3 T;  4JI2 T;  5IWA T;  1N33 T;  4JV5 T;  1IBM T;  4DR5 T;  4DV7 T;  1HNW T;  2F4V T;  4NXM T;  4DV3 T;  4LF4 T;  2UXC T;  4LF9 T;  1N32 T;  4AQY T;  1N36 T;  2UXD T;  1N34 T;  2ZM6 T;  4JI0 T;  1IBL T;  1FJG T;  4DR4 T;  3OTO T;  4X62 T;  1HR0 T;  1XMO T;  4JI3 T;  2VQE T;  1I94 T;  4DV5 T;  4GKK T;  2UXB T;  4JI7 T;  5BR8 T;  2HHH T;  4X66 T;  4LF8 T;  2UUA T;  4DR7 T;  4YHH T;  4JI4 T;  4DUZ T;  4B3M T;  4DR2 T;  4DR1 T;  4GKJ T;  4DUY T;  4B3S T;  4LF6 T;  4DV4 T;  1XMQ T;  4LF7 T;  3T1H T;  4LFB T;  4K0K T;  1J5E T;  5LMU T;  1HNX T;  4B3R T;  4JI1 T;  4LFA T;  1XNQ T;  3T1Y T;  4B3T T;  4X65 T;  5LMN T;  2UU9 T;  4JI5 T;  4JYA T;  4DV1 T;  1IBK T;  4DR3 T;  4LF5 T;  4KHP T;  2VQF T;  4DV0 T;  2UUC T;  4DR6 T;  4NXN T;  4OX9 T;  1HNZ T;  4LFC T;  4DV2 T; 
#chains in the Genus database with same CATH topology
 1Z0P A;  1YQ3 A;  2XQ6 A;  1T72 A;  4AKR B;  3IA3 A;  1CHU A;  1IJ6 A;  2FJB A;  3PUA A;  4M1P A;  3ONL C;  5AQQ B;  5EK2 A;  3OVU A;  1Y64 B;  2OLT A;  5HWX A;  2D5U A;  2V1D B;  2V6Y B;  3BQK A;  4IDQ A;  5AQI B;  3HKC E;  3UTK A;  4X64 T;  5FVK A;  3AEC A;  2NW8 A;  3MK7 C;  4NIQ A;  2B76 A;  1T8B A;  3KDS E;  3RIU A;  4CZZ B;  2XM1 A;  1KNR A;  3DJB A;  5F8P A;  5HWY A;  3SS1 A;  3AA1 B;  4G2A A;  5CB4 E;  5JDQ A;  4HWI B;  5KX5 E;  1YQ4 A;  1U5P A;  4CXY A;  3ZSS A;  2YDS A;  3OJA A;  5LCY A;  2CLY B;  3AAE B;  3W15 B;  4A5X A;  4AIU A;  5H6Q B;  2XAQ B;  3PUV F;  5FY7 A;  5IWA T;  1N33 T;  1HS7 A;  2ACX A;  3AE4 A;  4ASK A;  3VKG A;  1D1A A;  3PJA A;  4DR5 T;  1G73 A;  2UXN B;  3I0O A;  5LHH B;  2W67 A;  5ABF A;  2AE9 A;  4JBW F;  4DUZ T;  2F4V T;  3UU3 A;  1W9R A;  4UF0 A;  4XZC A;  3PUY F;  3C4W A;  3GMI A;  2A9U A;  4HWH A;  2ACZ A;  2Y6X A;  1NWM X;  1WLX A;  2UXC T;  1N36 T;  3VHL A;  3BQI A;  3P4R A;  1O3X A;  2UXD T;  4UVC B;  3ZCJ A;  2XTL A;  2WAU A;  5AFU L;  4CI1 B;  1N34 T;  3L09 A;  2XSA A;  5IHY A;  5LP6 E;  4H9R C;  2WMN A;  3K8P C;  1DU2 A;  2WCA A;  1HX8 A;  3ONX A;  2XAJ B;  3UUX B;  2ZMA A;  4U2Y A;  5FYM A;  3E08 A;  2Q9Q C;  3ESL A;  3EAB A;  4KUM B;  2CMR A;  4AKH A;  2XQ8 A;  5AQO B;  2XQ3 A;  5H6R B;  2YU2 A;  3E22 E;  4QXH B;  4JI3 T;  5JH7 E;  1LVF A;  2HN1 A;  2ZM2 A;  5L4H A;  3RKO A;  1KK7 A;  2HH7 A;  2VUR A;  3E0Z A;  4H9S E;  4HFD A;  4L0R A;  4EIW A;  2BDE A;  4UEL A;  4ZI7 E;  2IAK A;  2E9X D;  3CML A;  1OWA A;  2XSB A;  2L9Q A;  4O4I E;  4JYA T;  5BR8 T;  4X66 T;  2E9X C;  1UK5 A;  4OYK A;  2H88 A;  2KIN B;  2H3R A;  3UUB A;  4X1Y E;  2MPK A;  2YKS A;  2Q9Q A;  2LJL A;  4QHO A;  3FZL B;  2W00 A;  3CWZ B;  2XAH B;  2Z6E A;  2KWH A;  4HFC A;  4HFI A;  2V6X A;  2WB5 A;  5HEG A;  3K3Q C;  2BG9 C;  2IUB A;  3IEE A;  4F6R C;  1E2A A;  3FB2 A;  1WYB A;  4H63 V;  3PV0 F;  2LSJ A;  3RIA A;  2XQA A;  3KIN B;  1UGO A;  2XQY A;  4IE4 A;  5AQV B;  3AE6 A;  4MHC A;  5C3J A;  3Q5X A;  4DR1 T;  2LRL A;  2RP4 A;  5F3J A;  2ZM8 A;  2MTQ A;  2LHN A;  3CQC B;  2BS3 A;  3ZT7 A;  4TWF A;  3P4W A;  4IE7 A;  2P9B A;  2V7K A;  2X9X A;  5HYA A;  5JDH A;  4LF7 T;  1HG5 A;  4UVB B;  1KNP A;  4YSX A;  3A5X A;  3I9Y A;  3FZM B;  5JR9 B;  2Q9Q B;  2K24 A;  2NTX A;  2X9Y A;  4PJL A;  2WWU A;  3PUW F;  1MIY A;  1BR1 A;  4TV8 E;  5J1G A;  3RQW A;  1AJ3 A;  3JAF A;  5C2T A;  2WSS V;  3D0T A;  5AQG B;  3MA9 A;  5J0Z A;  4TN7 B;  5HXH A;  2OA5 A;  2W0G A;  3TLW A;  4YT0 A;  5HXS A;  4HWC A;  4JI1 T;  5DJQ C;  5KMG P;  2A3D A;  4EYU A;  4F8H A;  4PJJ A;  3VR8 A;  3ABV A;  1BR0 A;  4JLE A;  5LBM A;  3H3M A;  2CA5 A;  2HPL A;  3N9N A;  3K3O A;  4ZZC A;  1MIV A;  1VCT A;  1JNR A;  2CE7 A;  2E2A A;  2XHE B;  4UEM A;  2KWI B;  2RA1 A;  1T7S A;  3P8C D;  4JI5 T;  2V5D A;  3UU5 A;  4EAH A;  3QNU A;  2CM0 A;  4DR3 T;  4LF5 T;  3QB5 K;  2LSY A;  2LOP A;  2LLY A;  4H9O C;  3ZYK A;  2VQF T;  1WYC A;  3PE0 A;  2KMF A;  2JRK A;  2R6G F;  3RQU A;  4LML A;  4IGU A;  3ZT6 A;  2W61 A;  3EDU A;  4ILA A;  3NVO A;  2DI4 A;  4TWH A;  4UF0 B;  1HNZ T;  2MAW A;  4LFC T;  1BR2 A;  3ZKR A;  2WDR A;  2VKD A;  3ZT5 A;  1Y01 A;  4QX7 B;  2C5I T;  2SPC A;  1S94 A;  3RIF A;  3H3A A;  4U7I A;  2X0L B;  2M67 A;  4O4L E;  2K5B B;  5LOV E;  4CQI A;  3AA7 B;  2E5L T;  3SFD A;  5L3C B;  5FL0 A;  2WDV A;  4PK5 A;  3CQX C;  1XNR T;  4P0B A;  4UV9 B;  2D0U A;  2X0Y A;  4EOZ B;  2VVS A;  2RPA A;  4Z90 A;  4IL9 A;  4HFB A;  1D0Z A;  4L9I A;  4AXP A;  2CBI A;  1XDO A;  2NP9 A;  5KDM C;  1OXZ A;  4QXB B;  2XQ4 A;  4WW0 A;  2V5C A;  2YN6 A;  3TLT A;  4YTP A;  3RX6 A;  1SE7 A;  4HEA A;  1LRZ A;  2QA7 A;  2HPJ A;  3LSV A;  2BBH A;  3AA0 B;  3A8Y C;  3MZK B;  4P09 A;  5AQK B;  2IDO B;  2K9A A;  3V5U A;  5FP3 A;  4DV7 T;  1IBM T;  5AQU B;  1I6Z A;  4MLK A;  2A72 A;  5CJ5 A;  5L3G B;  2WU5 A;  4KBM B;  2V8S V;  3PUZ F;  2IW5 B;  4DV3 T;  4NXM T;  1NEK A;  2Y48 B;  4Z8X A;  4LF9 T;  4U74 A;  1N32 T;  4IDZ A;  5JRC B;  4QH4 A;  2VL8 A;  1IAP A;  2YEV C;  3AA6 B;  3P4Q A;  1UUS A;  4OK0 A;  3QB5 A;  4L5G A;  3UU8 A;  4I0U A;  4EXT A;  4JI0 T;  3LK3 B;  3GN5 A;  1FJG T;  3AE5 A;  3Q5W A;  4KX6 A;  3VKH A;  4ZEY A;  2XQ5 A;  2K48 A;  3IBP A;  4TNW A;  5A1L A;  2FBW A;  4X62 T;  4FI5 A;  2UXX B;  4CN6 A;  2VKH A;  4HGA A;  5AQF B;  2N1G A;  3DP7 A;  3KVA A;  2D0T A;  2C0S A;  2V26 A;  1KFY A;  1CUN A;  2X66 A;  3AE3 A;  5AQM B;  2DWG A;  2FUP A;  2NW7 A;  3NZQ A;  4NUU A;  3IHR A;  3PDY A;  4O4H E;  3B5M A;  4IE5 A;  4PK6 A;  5IYZ E;  5LBQ B;  3UUL A;  3ZMU B;  3RGL A;  5HXR A;  1H7C A;  3ZYL A;  2HHH T;  2BG9 B;  2NTY A;  4LF8 T;  1YXR A;  3RI5 A;  4ZI2 D;  2DCF A;  5FVL A;  3RC3 A;  2IC9 A;  2YDQ A;  3HA4 A;  3TLS A;  3U3I A;  4EV6 A;  1UX4 A;  5FXZ A;  2CXD A;  3C4Z A;  3ZMV B;  4DO0 A;  1M62 A;  2LM9 A;  3P4S A;  5JQG E;  3I1A A;  5JTG A;  4FJO A;  1M7K A;  3EVY A;  2Q9Q D;  5F5W A;  5LG3 A;  2JMH A;  1WFD A;  2ES0 A;  3AED A;  4AQG A;  4DID B;  2NWB A;  2IC6 A;  3PJA J;  4LMK A;  3NRX A;  4B3S T;  3HKB E;  4PFP A;  5LJN A;  4KI0 F;  3M3Z B;  1S35 A;  5JR9 C;  4N78 D;  4YSZ A;  1J1J A;  3X1D A;  4JEH B;  2VL0 A;  3OYZ A;  3QC9 A;  4TV9 E;  5FXV A;  4WBN E;  3IF8 B;  2H7V C;  3KV9 A;  3HL6 A;  5JDL A;  5JRE A;  3UUM A;  4V1A v;  4ZOL E;  4AQF C;  5IUX A;  5LHI B;  3QK6 A;  2KLQ A;  5CA0 E;  5KXJ A;  2J62 A;  3KV4 A;  5L3E B;  5HEH A;  5HEU A;  2XAF B;  3PUQ A;  4B3R T;  2XM2 A;  3NRY A;  2CHN A;  2CBJ A;  3L39 A;  2NW9 A;  4O4J E;  2CXF A;  2W4X A;  5L3B B;  3NKZ A;  4TZ4 C;  3VRA A;  5AQR B;  4IDO A;  3ZN0 B;  4U3C A;  2WS3 A;  3PU8 A;  4P1N A;  1XNQ T;  3T1Y T;  4A97 A;  1ZKE A;  2XY8 B;  4ILU A;  5HXE A;  4HWF A;  4ISS A;  2XQ9 A;  4CXW A;  4YJ2 E;  5FMN A;  2QGS A;  4EB6 E;  4XAX B;  1ZHC A;  2C5K T;  3RPU A;  3N9L A;  2M6I A;  4DV1 T;  4TNV A;  5EZY E;  2X51 A;  5FXX A;  3N9P A;  3UFE A;  2B1E A;  2YDR A;  3VU7 H;  4EED A;  4DV0 T;  4KHP T;  2XZE A;  2UUC T;  3BK9 A;  4AI6 A;  3AE2 A;  4AKG A;  4HFV A;  4OX9 T;  3ETU A;  2X9W A;  4XBF B;  5HAX A;  2LE8 A;  4HN9 A;  4JEU B;  2IML A;  3AE7 A;  3QUJ A;  2WBL A;  4IDN A;  4ZHQ E;  2W63 A;  4DBR A;  4I4T E;  1Z8U A;  4DV6 T;  2VKO A;  4ZZB A;  1X79 A;  4PJN A;  4PFO A;  4ZXL A;  4KHZ F;  5M4Y A;  4UR9 A;  3KVB A;  1J5W A;  3MAC A;  4Q25 A;  5JVD E;  3ZLI A;  3ZEF B;  3CQG B;  2IHR 1;  4UV8 B;  4YLH A;  2N9D A;  3F31 A;  4HTE A;  2L8K A;  4X1I E;  2QRX A;  5HEO A;  3TLU A;  3LK2 B;  1FMW A;  4ILC A;  4U31 A;  4DVD A;  5JDG A;  1E1H B;  2LRK A;  3PTR B;  3GN5 B;  3JAD A;  1MNE A;  1OED E;  4IE0 A;  3WI3 A;  1W09 A;  2VVN A;  3AEG A;  2H7O A;  2ZM0 A;  4CI2 B;  5ABF B;  2CHO A;  2XPK A;  3HR0 A;  4JI6 T;  5JRC A;  2YK0 A;  4YY3 T;  3LK4 2;  4BA9 A;  2ODU A;  2DL1 A;  2WY2 A;  3O1I A;  5AQH B;  1XDP A;  4UXN B;  4E7Z A;  4PW8 A;  2DWK A;  4QH5 A;  5AQT B;  1KEY A;  4ANJ A;  4EGW A;  3O1H A;  4WZX A;  4EEB A;  1US7 B;  3AE8 A;  3B57 A;  2WWV A;  4H9Q C;  4AQY T;  1D1C A;  2VAS A;  2VKJ A;  4I55 E;  5FY0 A;  2CXL A;  5ABG A;  3RIU C;  5LG4 A;  3UQ7 A;  1KNZ A;  2NOX A;  3U78 A;  3HI2 A;  2JQH A;  3NWI A;  2ZM6 T;  3RF1 A;  1IBL T;  1KF6 A;  2J1D G;  3C98 B;  4WBO A;  1HX1 B;  3QOF A;  3L8R A;  5AQL B;  2KND A;  1WR0 A;  1SUM B;  3AB3 B;  3RH3 A;  1HR0 T;  1NAF A;  1WCR A;  1HFA A;  1XMO T;  1FMV A;  3GA8 A;  2VQE T;  3ZMZ B;  3KV5 A;  2JPF A;  4NUV A;  5LGT B;  2UXB T;  4U33 A;  5ADX L;  1IJ5 A;  1ZOY A;  3PUS A;  4ADZ A;  4JI7 T;  3T8O A;  5L4E A;  1HG2 A;  1D1B A;  1WRD A;  2ZLY A;  5L3D B;  2BS2 A;  4IRE A;  3DTO A;  3O9X A;  2UUA T;  4JI4 T;  3CIR A;  5ABE A;  1ZEE A;  2LT3 A;  4ZS3 A;  4HFH A;  1FEW A;  4C91 A;  5FL1 A;  4CN1 A;  4YXD A;  2ODV A;  4B3M T;  5EK3 A;  2E9X B;  1NEN A;  5L2L A;  4IE6 A;  4U72 A;  4YFS A;  2LKG A;  3UT5 E;  1SHZ C;  2KSR A;  2NR4 A;  3RYC E;  4C90 A;  1YW0 A;  2PFV A;  3KFW X;  3J9X 1;  3N2G E;  4QWN B;  5CA1 E;  4GKJ T;  2G0U A;  3H37 A;  4H63 H;  4LF6 T;  2BKN A;  4DV4 T;  2JQK A;  1XMQ T;  3C50 A;  4A98 A;  2LHR A;  4CI3 B;  2WP9 A;  3AEE A;  2XJ7 A;  3OKQ A;  2M6B A;  2MYS A;  4CXX A;  4EYY R;  1XZY A;  3T1H T;  3G06 A;  3MKD A;  2CLY C;  4OHF A;  1R8I A;  3BQL A;  1OED B;  3KBT A;  2E8I A;  4YJ3 E;  5AQP B;  3WAK A;  3CX8 B;  5JDM A;  1LKX A;  3TKL B;  3RYH E;  4LFB T;  4MBQ A;  3VR9 A;  2BBJ A;  5EK4 A;  1J5E T;  2I6H A;  2Y8D A;  4K0K T;  4BJM A;  3LJC A;  4ZS2 A;  5LMU T;  1FIO A;  1HNX T;  4IHJ E;  3R84 B;  3ZMT B;  4QKN A;  4WYV A;  1HTJ F;  1MMN A;  3LBX A;  1JNZ A;  3MJX A;  3LBX B;  4HE8 A;  1W0A A;  4LFA T;  3NBX X;  4IT4 A;  1X9B A;  2CPT A;  4QXC B;  4X20 E;  4YTM A;  4I43 B;  2N2N A;  4X5T A;  3SFE A;  4AIS A;  2QVA A;  4IIJ E;  4X65 T;  2J47 A;  1VCS A;  3EDV A;  2EHO A;  2WQY A;  3C51 A;  3I0Q A;  2JQQ A;  3PU3 A;  4HWD A;  1UX5 A;  2BVM A;  3CX7 B;  3ZMS B;  2X67 A;  2UU9 T;  3N5L A;  1EZ3 A;  1OED A;  2PJQ A;  2WM9 A;  3FXD B;  4HKA A;  4PNI A;  2LSG A;  3RRW A;  2WMO A;  1IBK T;  4HFE A;  3LDQ B;  3O4X E;  4UIG A;  2FJD A;  2EHO C;  3B13 A;  4GYR A;  4DR6 T;  3RLF F;  3AVR A;  1MMA A;  2LEH A;  2WDQ A;  2YOE A;  4IDP A;  5LYJ E;  5CGM A;  4JI8 T;  5LGU B;  4DV2 T;  1G8X A;  3VRB A;  1XWM A;  3OBV E;  2YU1 A;  4A56 A;  3SRZ A;  4COF A;  5GON E;  2KXP B;  3ETV A;  2LM2 A;  2UUB T;  4GK0 E;  2DHR A;  5DAB A;  3AEA A;  4Z91 A;  2E5V A;  2DNX A;  3FBL A;  3P50 A;  3FXE B;  3MXZ A;  1VOM A;  3RRC A;  3LFM A;  3AAA B;  3KV6 A;  4BJN A;  2EHO B;  1YKH B;  3EHZ A;  4WNK A;  3JAE A;  2LSK A;  3S4U A;  1D0Y A;  5LNK A;  4DND A;  2V7J A;  3FZF B;  4QX8 B;  1MMG A;  2D9D A;  2LSI A;  4MAL A;  2BZB A;  2WU2 A;  4YSY A;  4JI2 T;  3SWH A;  2VK9 A;  4AKI A;  2L3L A;  3PUG A;  2I59 A;  3P7I A;  4ZI3 D;  2LOS A;  3FHN A;  2K3W A;  4OFZ A;  3UUN A;  4JV5 T;  2CWY A;  1HNW T;  2MBG A;  3WAJ A;  2AXD S;  4PJM A;  2CCQ A;  5L3F B;  4LF4 T;  4GIW A;  2CEA A;  4DMV A;  2BS4 A;  2JJ9 A;  5AQS B;  5HCM A;  5LJM A;  4UVA B;  3RYI E;  4QH1 A;  4TX5 A;  5DQV A;  1GQE A;  5HCJ A;  4ILB A;  2BG9 E;  3CKD A;  1BR4 A;  3UQ4 A;  1ZP0 A;  3UU4 A;  4EZ4 A;  5CFB A;  3AE1 A;  1QSD A;  4P0A A;  4DR4 T;  5ABH A;  2V6Y A;  2FJA A;  1D0X A;  1MMD A;  5J2U E;  3J7Y q;  3OTO T;  2HN2 A;  4EZH A;  3N9O A;  3OPC A;  4U2Z A;  1HF8 A;  3AE9 A;  4X1K E;  5AQJ B;  5AQN B;  3M65 A;  2W2U A;  3EI0 A;  4IL4 A;  5LGN B;  2VB6 A;  4O2B E;  3GWH A;  3Q5E A;  4G63 A;  5TAO A;  3FZK B;  3R6N A;  1I94 T;  3RC8 A;  2VWA A;  2W62 A;  2D2S A;  4DV5 T;  5L47 A;  1U4Q A;  1YKE B;  1UCU A;  3O1J A;  5FY1 A;  2X9H A;  5LXT E;  4GKK T;  3ONJ A;  2QYW A;  3CK6 A;  5JR9 A;  1LVK A;  3KBU A;  2J4G A;  3ANW B;  3HKE E;  1QUU A;  3FZH B;  2C5J A;  4KMC A;  2PTF A;  3N2K E;  4PAG A;  5FNV E;  3ZN1 B;  2W66 A;  3AXJ A;  3NZP A;  2WZI A;  4DR7 T;  2BKO A;  3AXJ B;  4B6X A;  3N2O A;  4YHH T;  4NPP A;  3ZYM A;  5LA6 E;  3ANW A;  5LB7 B;  3AEF A;  4O8S A;  5JDF A;  4DR2 T;  3EUH A;  5FXW A;  3AEB A;  1L0V A;  3OYX A;  2LKH A;  1YD8 G;  2DLR A;  4TWD A;  4YHJ A;  2V7I A;  2V7L A;  4O2A E;  3ZST A;  3HKD E;  3ZPO A;  2PG8 A;  1E7P A;  4K0U A;  4DUY T;  4OYJ A;  4CN4 A;  2XUE A;  4I50 E;  5ETW A;  1HCI A;  1VRB A;  3CPZ A;  3JC6 C;  1W0B A;  1MND A;  3V5S A;  3CVR A;  3Q2M A;  4H9P C;  3LG7 A;  3K1S A;  4PK4 A;  3JCF A;  3SOL A;  3ZC1 A;  1MIW A;  2BVL A;  3P4P A;  2I0M A;  3ZC0 A;  3AVS A;  2A2F X;  2BG9 A;  4TUY E;  3PUR A;  3UFG A;  5J2T E;  3TLV A;  3UU6 A;  2GK9 A;  2KZ7 B;  3AAI A;  4H9N C;  4BAY B;  5LHG B;  4KP3 C;  4YTN A;  3ZJ1 A;  4LMJ A;  2XAG B;  1SA0 E;  3CX6 B;  2XQ7 A;  2XAS B;  3F2E A;  3F57 A;  4U7Y A;  2JMK A;  4AKL A;  2E9X A;  5BMV E;  4ERR A;  3RYF E;  4E7S A;  1OED C;  3EAM A;  3JC6 D;  4GYS A;  3RKG A;  5HEJ A;  2X0H A;  4ZI2 C;  5C8Y E;  1QLB A;  3C64 A;  4DBQ A;  2CWO A;  2X68 A;  4GOU A;  4B3T T;  5JDN A;  5E0O A;  3FBZ A;  2OV9 A;  1T98 A;  4J2C A;  3Q9D A;  5FKY A;  1B7T A;  1V9D A;  2H89 A;  3N9M A;  5DQW A;  2IIU A;  3C4X A;  5LMN T;  4IST A;  3ZJ2 A;  2V7M A;  2CRB A;  3ZCI A;  2FJE A;  2JQ9 A;  2JIW A;  3K3N A;  3PUX F;  4DMW A;  3Q5D A;  2PBI A;  1IZN B;  3A7M A;  4JUY A;  2BKP A;  3I9W A;  4NXN T;  1ZV4 X;  2WZH A;  4GK5 E;  3N9Q A;  3RHW A;  5HXC A;  2MOZ A;  1UUR A;  4MFR A;  4ZI3 C;  1WR6 A;  2YIN A;  2EHO D;  2KT9 A;  3L3P A;  4AQF A; 
#chains in the Genus database with same CATH homology
 4DV6 T;  4JI8 T;  2UUB T;  2E5L T;  4X64 T;  1XNR T;  4JI6 T;  4YY3 T;  4JI2 T;  5IWA T;  1N33 T;  4JV5 T;  1IBM T;  4DR5 T;  4DV7 T;  1HNW T;  2F4V T;  4NXM T;  4DV3 T;  4LF4 T;  2UXC T;  4LF9 T;  1N32 T;  4AQY T;  1N36 T;  2UXD T;  1N34 T;  2ZM6 T;  4JI0 T;  1IBL T;  1FJG T;  4DR4 T;  3OTO T;  4X62 T;  1HR0 T;  1XMO T;  4JI3 T;  2VQE T;  1I94 T;  4DV5 T;  4GKK T;  2UXB T;  4JI7 T;  5BR8 T;  2HHH T;  4X66 T;  4LF8 T;  2UUA T;  4DR7 T;  4YHH T;  4JI4 T;  4DUZ T;  4B3M T;  4DR2 T;  4DR1 T;  4GKJ T;  4DUY T;  4B3S T;  4LF6 T;  4DV4 T;  1XMQ T;  4LF7 T;  3T1H T;  4LFB T;  4K0K T;  1J5E T;  5LMU T;  1HNX T;  4B3R T;  4JI1 T;  4LFA T;  1XNQ T;  3T1Y T;  4B3T T;  4X65 T;  5LMN T;  2UU9 T;  4JI5 T;  4JYA T;  4DV1 T;  1IBK T;  4DR3 T;  4LF5 T;  4KHP T;  2VQF T;  4DV0 T;  2UUC T;  4DR6 T;  4NXN T;  4OX9 T;  1HNZ T;  4LFC T;  4DV2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...