4JI0T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 39
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji0T00
4DV1T 3OTOT 1N33T 1IBLT 2UUCT 4JI3T 1HNWT 1HNXT 1IBKT 4GKKT 4DR3T 2VQFT 4LF9T 2UXCT 4B3ST 4JI7T 1XMOT 4JI2T 2HHHT 4NXMT 4LFBT 4B3RT 2F4VT 4DV4T 4GKJT 4YHHT 1XNQT 4DV3T 4DV7T 4JI8T 1IBMT 4DV5T 2E5LT 4K0KT 4X62T 4LF5T 1XMQT 3T1YT 1HR0T 4KHPT 2UXBT 2VQET 4AQYT 4LFCT 2UUAT 1N32T 4JI1T 1J5ET 4DUZT 4DV0T 4JI6T 4B3TT 1N34T 4DV2T 4DR1T 4LF7T 4OX9T 4DR4T 2UXDT 2UUBT 4JI4T 4LF6T 4LF8T 1FJGT 5LMNT 4DR5T 4DR7T 4X64T 4LFAT 5IWAT 4JYAT 4JI0T 3T1HT 4X65T 4JI5T 1XNRT 4DV6T 4YY3T 1HNZT 4DUYT 4X66T 5LMUT 2UU9T 1N36T 4DR6T 2ZM6T 4JV5T 4DR2T 4B3MT 4LF4T 5BR8T 4NXNT 1I94T
chains in the Genus database with same CATH superfamily
4TNVA 4MBQA 2MYSA 2BG9E 3LDQB 4PJMA 1G73A 2CXFA 4PFPA 2DWKA 3L8RA 3ZMTB 5AQSB 5IYZE 4CN6A 2X68A 3Q5XA 2X0LB 4B6XA 4HFIA 4YHHT 1XNQT 5HYAA 3ANWA 3BQKA 2WS3A 1D0ZA 4ZI2D 3I1AA 4DV3T 2NTYA 4U7YA 2QYWA 4IREA 5IUXA 3VRAA 2C0SA 4YT0A 5AQHB 3ZN1B 3F2EA 3CK6A 4U72A 3FZFB 4ANJA 5JDFA 2E2AA 2I0MA 3PURA 5LGTB 3PV0F 2HH7A 5EK4A 1UURA 4HFEA 4DV2T 3AEGA 4IE6A 5AQPB 5BMVE 1KF6A 4UVCB 2KNDA 5JRCA 2LE8A 4IIJE 5LBQB 4ZXLA 2BG9C 2LSYA 2OV9A 1I6ZA 2CA5A 4AKGA 1FEWA 1UX5A 2JIWA 1ZOYA 3Q5EA 4HFVA 2A9UA 2SPCA 5LBMA 5HCMA 3L3PA 4FJOA 3SFEA 1QSDA 3N9OA 4TN7B 4A5XA 2DNXA 4I4TE 4TV9E 5FY7A 2XQYA 4PK4A 3K3NA 4CXXA 2D5UA 3ZYKA 3PUQA 5AQIB 1UUSA 5F8PA 2JPFA 4H63H 3TLVA 4P0AA 2NW8A 2N1GA 4LMKA 3RIUA 2JQQA 2D0UA 3N9QA 1UCUA 2K48A 1D1AA 4U7IA 3IBPA 4IDOA 4HTEA 3EI0A 5ABEA 3S4UA 4BAYB 2LM2A 3PU8A 4KHPT 4HWIB 3ZJ2A 1E7PA 2W63A 4JUYA 1UK5A 2PG8A 3PUXF 1BR4A 5DQVA 4BJMA 4ILBA 2XSAA 4DBRA 4PJNA 4Z91A 1M7KA 3FBZA 4U3CA 4NIQA 4O4IE 3QNUA 4OYJA 4X65T 4DV6T 1HX1B 5CB4E 3K1SA 3N9LA 4QXBB 4DR6T 1VOMA 2KXPB 3WI3A 2C5IT 4E7ZA 3Q9DA 3VKGA 5DQWA 3A8YC 1B7TA 3GWHA 2N9DA 4H63V 1SE7A 5BR8T 4DV1T 3OJAA 2WMOA 3AEDA 3PUZF 4H9OC 1VCSA 3OYZA 1CHUA 4IE4A 1W0BA 4TX5A 2VB6A 3ETUA 1NEKA 4TV8E 2ZLYA 2X51A 2X67A 3RH3A 3SWHA 1T98A 4X62T 2VQET 4MFRA 3J9X1 2ZM8A 3SFDA 5LA6E 5JR9B 4O8SA 3A7MA 3C98B 1N34T 4AQFC 3Q5WA 3NZQA 4LF6T 4PK5A 2XM2A 1E1HB 1WYBA 1V9DA 4EOZB 4HWCA 4YFSA 4EGWA 3P8CD 5L2LA 5FVKA 4G2AA 3V5SA 4JI5T 4YJ3E 5H6RB 2C5JA 4YTMA 4YY3T 2PTFA 3NRYA 2UU9T 3L09A 3GN5B 3UU4A 5FXZA 2KLQA 2VVNA 2W61A 2NWBA 2XAFB 3N2GE 5EK2A 4H9RC 1FMWA 4A97A 1HS7A 4G63A 1IBLT 5A1LA 2X9XA 4JI3T 1IBKT 4GKKT 5KDMC 3RF1A 2ES0A 2V7LA 4Q25A 4GYRA 4HWFA 5AQUB 1SA0E 4ZI3C 4UVAB 4LFBT 2XUEA 3PUVF 2F4VT 3AE4A 3EDUA 5DJQC 5KX5E 2DI4A 3BQIA 4ASKA 2H88A 2L3LA 4K0KT 2XZEA 2YU2A 3U78A 2E9XC 4L5GA 2UUAT 1MNEA 5LP6E 5LYJE 3ZMZB 4ZZBA 3MA9A 3F31A 3RYFE 4QH1A 4A56A 1WR0A 3CQCB 3C64A 3LJCA 1OEDB 3FXEB 1YQ3A 2WDRA 4JYAT 1S35A 4XZCA 3HKBE 5J2TE 2D0TA 3MJXA 5J2UE 2B1EA 4EB6E 3N9MA 2W62A 3C4WA 3MKDA 3PTRB 2KINB 4AI6A 5JDLA 2WU2A 5FXWA 1XDPA 3FXDB 3ANWB 1HX8A 5JR9A 2HPJA 4CN4A 5LOVE 3VHLA 2OA5A 2CWOA 5FP3A 3PUWF 4KX6A 5H6QB 3RIFA 2LT3A 5FYMA 2XY8B 4HN9A 4ISSA 3RRWA 3TLWA 2V26A 3P4SA 5ABHA 4EYYR 2FJAA 5HXEA 3N9PA 3RIUC 4DV7T 5HEUA 3HA4A 3AE2A 3AXJB 4DV5T 5LHIB 1XMQT 4IT4A 1HG2A 1MMDA 4TUYE 4QH4A 3ZEFB 3GN5A 2NW9A 2HPLA 1H7CA 3PUAA 4GIWA 4UELA 4PFOA 1J5WA 1LVKA 1QLBA 3ZT5A 4OX9T 4DR1T 5AQTB 5HEOA 1X79A 2JMKA 4OFZA 3AE9A 3JCFA 4FI5A 1BR0A 2N2NA 4WYVA 4IE5A 4EV6A 1Z8UA 4X64T 1MMGA 2JQ9A 1U4QA 3VR8A 3SS1A 1HNZT 2YOEA 2R6GF 2BKOA 4AKRB 4DO0A 2LSIA 4KI0F 2HN2A 2LRLA 3RYCE 3KBTA 1BR2A 3VRBA 3IF8B 4GK0E 1WCRA 1O3XA 3AE5A 5L3FB 5JDQA 2DWGA 3IEEA 4UR9A 4AXPA 1WYCA 3OBVE 2CCQA 3PU3A 4JI7T 4CI2B 4GOUA 5L3EB 4CQIA 2A72A 4ZOLE 5AFUL 3CX6B 2CBIA 2KSRA 3ESLA 4J2CA 3AE8A 3O1HA 5C3JA 2ZMAA 2LSGA 2VK9A 3N2KE 4CZZB 2ODVA 2E5LT 3UUBA 2LKHA 3ZPOA 2UXBT 2YINA 5LNKA 3LK3B 2UXNB 3UFGA 4C91A 5AQOB 1NENA 2M6BA 4JI6T 3T8OA 3MK7C 3P4QA 3JAEA 3HKCE 5HEHA 3ZYLA 2X66A 2KMFA 3PE0A 3FHNA 3K3OA 2XQ6A 2Q9QB 2P9BA 3ONJA 2V8SV 3ZLIA 2XQ3A 3UT5E 3LFMA 3AEFA 5JDHA 2VL0A 4HKAA 3TKLB 4ZI2C 3KV5A 1AJ3A 3AXJA 1T7SA 2YEVC 5FY1A 2V7MA 3Q2MA 3F57A 3K8PC 4CXYA 3AE1A 5DABA 4IE7A 1MIYA 2K9AA 3JADA 1XMOT 2D9DA 5HXRA 4ZHQE 4X20E 4JBWF 4WNKA 4QHOA 1MMAA 4AKIA 1NAFA 2MBGA 3LK42 1KFYA 4X1IE 2IHR1 4P09A 2WU5A 3CPZA 4QWNB 3FZKB 2BBHA 2RPAA 3KBUA 3P50A 3RGLA 1N32T 2L9QA 3O1IA 1M62A 3RYIE 2FJBA 2LHNA 3UU3A 3KV6A 3UUXB 2X9YA 2QVAA 2X0YA 3UU5A 2H7OA 5AQGB 5AQMB 1D0XA 1IAPA 3KV4A 2BZBA 5L47A 4HFDA 5HAXA 5IHYA 5L3BB 2BG9B 3RKOA 3KINB 3R84B 1IZNB 3T1HT 2XSBA 3ZSTA 1Z0PA 4ERRA 1BR1A 1YQ4A 3AAEB 3QC9A 2BDEA 2J62A 5HCJA 1D1CA 3EAMA 2K5BB 4X5TA 3ZC0A 2QRXA 4UV8B 3NVOA 5FXVA 2YKSA 4E7SA 2QGSA 3LG7A 3UU6A 2W0GA 2W2UA 4IDPA 4DR3T 4ILAA 2Y8DA 2XHEB 3ZYMA 2HHHT 5JR9C 2JMHA 4PW8A 2ODUA 4K0UA 3RC3A 4CN1A 2Q9QA 5AQLB 2YDQA 4YJ2E 2XQ5A 2VL8A 3H37A 3RC8A 3RI5A 4CXWA 3FZMB 4DUZT 2WAUA 5JDMA 5JDGA 2E5VA 1KNPA 1HF8A 4F6RC 3TLSA 3VU7H 5L4EA 4UIGA 5JH7E 1YXRA 4L0RA 4LFAT 5LHHB 4JI0T 5L4HA 1OEDE 2AXDS 3AEAA 5ADXL 5HWXA 1YW0A 3OPCA 3RX6A 2EHOB 4PJJA 1XZYA 5LG4A 5C2TA 3AAIA 4DBQA 3W15B 5HXHA 1OXZA 4U31A 3ZT7A 3MXZA 4NXNT 3NBXX 3TLUA 1N33T 4M1PA 3C50A 1HNXT 1CUNA 3L39A 5HWYA 3AE7A 3KFWX 2YK0A 4QXHB 2WCAA 4JI2T 3I0OA 2BG9A 1EZ3A 4U74A 1DU2A 3EABA 2NP9A 2WZIA 4AIUA 2V6YB 3HL6A 5KXJA 1OEDC 2CBJA 4DNDA 2IMLA 2LRKA 5AQNB 4O2BE 4ZEYA 4IDNA 2V7KA 2FBWA 3EDVA 5ABFB 5LJMA 2V5DA 3AA7B 1XDOA 3QK6A 4IL9A 1FJGT 3I9WA 4UXNB 3CMLA 5FY0A 5EZYE 2DHRA 2VKOA 4ZS3A 4TZ4C 5IWAT 4DVDA 2WSSV 3A5XA 1XNRT 2A2FX 3UULA 3TLTA 2WZHA 3KVAA 1IJ5A 1U5PA 2ZM2A 4EXTA 1N36T 4O4LE 4KHZF 3SRZA 2ZM6T 4IDQA 4AKHA 5AQRB 2DCFA 5AQKB 1KK7A 2W67A 3MZKB 4DMWA 3V5UA 2UUCT 2CE7A 4BA9A 2AE9A 2VQFT 4WW0A 1HTJF 4DIDB 4NXMT 5L3DB 4Z8XA 2MAWA 5LXTE 2KZ7B 3AE6A 4X1YE 2BVLA 3D0TA 4X1KE 4XBFB 3T1YT 4UV9B 5LB7B 4TNWA 3CX8B 2J4GA 2ZM0A 3HR0A 2EHOA 3JC6D 1KNZA 2WBLA 2KT9A 2YDSA 3UQ7A 4PNIA 4JEUB 1NWMX 4AISA 3RQWA 2H7VC 2UUBT 4LMLA 3E0ZA 1KNRA 4HFHA 4AKLA 3ZT6A 3ABVA 4UF0B 5C8YE 1L0VA 4EZHA 5FXXA 4QX7B 1MIWA 2XM1A 2Y48B 5FL0A 4JEHB 4QKNA 1HG5A 3AVSA 3LBXB 3Q5DA 1UX4A 4QX8B 3B5MA 1R8IA 1YD8G 2V6YA 3X1DA 4I43B 2VKHA 3BK9A 3C4XA 4YSXA 1HFAA 2JQHA 4B3MT 3ZMVB 3AEBA 3M65A 4C90A 5FL1A 2X9WA 2WP9A 3ZN0B 4AQFA 4P1NA 5ABFA 2Q9QD 3UUMA 3ETVA 2CWYA 1WR6A 2JJ9A 2VWAA 2IC6A 2WWVA 2JQKA 2CPTA 4GKJT 2I6HA 4TWDA 1LRZA 2CM0A 2B76A 1T8BA 3ZSSA 5TAOA 3AAAB 4EZ4A 1MIVA 2H3RA 3FBLA 4JI1T 3I9YA 1ZHCA 3QB5K 2XASB 4N78D 4I50E 5JVDE 3AECA 3GA8A 4IL4A 1W9RA 2Z6EA 3AA1B 1W0AA 3J7Yq 2OLTA 2NR4A 2PBIA 4ADZA 5LGNB 3LSVA 4UEMA 2DLRA 4DR5T 2J47A 3E08A 3UQ4A 2WB5A 4DR7T 3KV9A 2V1DB 2HN1A 4O4HE 3CIRA 4X66T 4WZXA 4YTPA 5ETWA 5FNVE 2L8KA 5JDNA 2E9XA 3P4WA 4Z90A 3E22E 3NRXA 5CGMA 3P4PA 3EHZA 3QOFA 4LF9T 1YKEB 2CLYB 4UF0A 3EVYA 4HGAA 4DV4T 2YU1A 2DL1A 3RRCA 3ZJ1A 1WFDA 3CVRA 2M6IA 3I0QA 2XQ9A 4GK5E 2K24A 1MNDA 3HKDE 4JI8T 3LBXA 1ZKEA 2V7IA 3RKGA 4LF5T 1X9BA 1HR0T 2BS2A 1ZV4X 4LFCT 4DV0T 2QA7A 2CRBA 3PUGA 3DTOA 1UGOA 3K3QC 1WLXA 4JI4T 4OYKA 3ZCJA 3UUNA 3VR9A 4LF8T 3HI2A 4AQGA 2CEAA 2W66A 1E2AA 2FJDA 3AB3B 3R6NA 2C5KT 2PJQA 2XTLA 2XAQB 3DJBA 5F3JA 5ABGA 2H89A 2D2SA 2NTXA 4A98A 5JQGE 3DP7A 4O2AE 5L3GB 2UXXB 1G8XA 1SHZC 3ZC1A 4HEAA 3N9NA 4LF4T 5FVLA 2E8IA 2M67A 5LHGB 2V6XA 4KUMB 2XQ8A 5M4YA 4H9NC 4U2ZA 2FUPA 2IW5B 4EEDA 2MTQA 3LK2B 2CMRA 2VKDA 4H9QC 3CWZB 5LG3A 4YSYA 4LMJA 2FJEA 2XAHB 4U33A 5HEJA 3ZMUB 2LSKA 5HXCA 2ACXA 2EHOD 4YTNA 2LLYA 4YXDA 3N5LA 2G0UA 2XAJB 3RLFF 5L3CB 1IBMT 2WM9A 5F5WA 2XAGB 4YLHA 4L9IA 3ONXA 1D1BA 4NUUA 2MPKA 2CXDA 5HEGA 4MHCA 3PJAA 2BS3A 2VURA 1KEYA 4BJNA 1ZP0A 3PUYF 4P0BA 1Y64B 3BQLA 2EHOC 2X0HA 1LKXA 1YKHB 2LSJA 3VKHA 5J1GA 5LGUB 3UFEA 3AA0B 1S94A 2BBJA 5E0OA 4WBOA 3P7IA 3RHWA 4DUYT 3MACA 3O9XA 2BKPA 2WQYA 5JREA 3NZPA 4JV5T 3PUSA 4DR2T 1T72A 2YDRA 3O1JA 3PJAJ 4QH5A 4YSZA 3ZKRA 2RP4A 1FMVA 4B3ST 3QUJA 1VCTA 4ZZCA 3RPUA 2Y6XA 4DMVA 3IHRA 1Y01A 3KDSE 3H3MA 4QXCB 1JNRA 4HFBA 4COFA 2J1DG 2LOPA 1GQEA 2KWIB 2IUBA 2IC9A 3HKEE 2XPKA 2WDQA 4ZI7E 5CA1E 1W09A 2WDVA 2LEHA 4EIWA 5AQQB 4DR4T 2UXDT 2A3DA 4ZI3D 2RA1A 5CJ5A 1JNZA 4I0UA 1FIOA 1ZEEA 4EAHA 4CI3B 4TWHA 4KMCA 4U2YA 2E9XD 3GMIA 2IIUA 4KBMB 3FZHB 2V7JA 5FKYA 4HWDA 4WBNE 3OVUA 2VVSA 2BS4A 2WWUA 3AA6B 4GYSA 3C51A 4H9SE 4H9PC 3ONLC 3OTOT 3IA3A 4IDZA 4EEBA 2NOXA 2LKGA 2WY2A 3OKQA 5LCYA 4PJLA 2IDOB 4HWHA 4NPPA 4B3RT 3FZLB 3SOLA 2XJ7A 4KP3C 2KWHA 5HXSA 5KMGP 4HFCA 2BKNA 5JTGA 3M3ZB 2MOZA 2XQ7A 1WRDA 5AQFB 4IE0A 2YN6A 4B3TT 1OWAA 2LM9A 4OK0A 3N2OA 2BVMA 3WAJA 3UTKA 1HCIA 4UVBB 4HE8A 3RYHE 2CHNA 4O4JE 2ACZA 4OHFA 1XWMA 2VASA 2E9XB 2LHRA 3NKZA 5LJNA 4ISTA 4V1Av 4TWFA 4EYUA 4MALA 3WAKA 2NW7A 2WMNA 3QB5A 3CQXC 5LMUT 4ILCA 1LVFA 4IGUA 2CXLA 3B57A 4F8HA 1J1JA 4MLKA 1IJ6A 5EK3A 3ZCIA 3JC6C 1US7B 1HNWT 5JRCB 3FB2A 2UXCT 5J0ZA 3UU8A 4ILUA 3CX7B 2W00A 3AEEA 4PK6A 3G06A 2IAKA 3NWIA 3B13A 3OYXA 2V5CA 5FMNA 2XQAA 3KVBA 2LOSA 4AQYT 4JLEA 3CKDA 1J5ET 3O4XE 5GONE 2X9HA 4XAXB 1QUUA 4CI1B 2PFVA 3ZMSB 2W4XA 4ZS2A 4LF7T 3C4ZA 1VRBA 3P4RA 3RIAA 1D0YA 2VKJA 2CHOA 2LJLA 4I55E 2XQ4A 5LMNT 4NUVA 4YHJA 5CFBA 2K3WA 3PDYA 3JAFA 3H3AA 2I59A 2Q9QC 2GK9A 1SUMB 3U3IA 3AE3A 3CQGB 4PAGA 3RQUA 4IHJE 2CLYC 5AQVB 1MMNA 3EUHA 5AQJB 2JRKA 1OEDA 3AVRA 5CA0E 1I94T
chains in the Genus database with same CATH topology
4DV1T 3OTOT 1N33T 1IBLT 2UUCT 4JI3T 1HNWT 1HNXT 1IBKT 4GKKT 4DR3T 2VQFT 4LF9T 2UXCT 4B3ST 4JI7T 1XMOT 4JI2T 2HHHT 4NXMT 4LFBT 4B3RT 2F4VT 4DV4T 4GKJT 4YHHT 1XNQT 4DV3T 4DV7T 4JI8T 1IBMT 4DV5T 2E5LT 4K0KT 4X62T 4LF5T 1XMQT 3T1YT 1HR0T 4KHPT 2UXBT 2VQET 4AQYT 4LFCT 2UUAT 1N32T 4JI1T 1J5ET 4DUZT 4DV0T 4JI6T 4B3TT 1N34T 4DV2T 4DR1T 4LF7T 4OX9T 4DR4T 2UXDT 2UUBT 4JI4T 4LF6T 4LF8T 1FJGT 5LMNT 4DR5T 4DR7T 4X64T 4LFAT 5IWAT 4JYAT 4JI0T 3T1HT 4X65T 4JI5T 1XNRT 4DV6T 4YY3T 1HNZT 4DUYT 4X66T 5LMUT 2UU9T 1N36T 4DR6T 2ZM6T 4JV5T 4DR2T 4B3MT 4LF4T 5BR8T 4NXNT 1I94T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 T;  3OTO T;  1N33 T;  1IBL T;  2UUC T;  4JI3 T;  1HNW T;  1HNX T;  1IBK T;  4GKK T;  4DR3 T;  2VQF T;  4LF9 T;  2UXC T;  4B3S T;  4JI7 T;  1XMO T;  4JI2 T;  2HHH T;  4NXM T;  4LFB T;  4B3R T;  2F4V T;  4DV4 T;  4GKJ T;  4YHH T;  1XNQ T;  4DV3 T;  4DV7 T;  4JI8 T;  1IBM T;  4DV5 T;  2E5L T;  4K0K T;  4X62 T;  4LF5 T;  1XMQ T;  3T1Y T;  1HR0 T;  4KHP T;  2UXB T;  2VQE T;  4AQY T;  4LFC T;  2UUA T;  1N32 T;  4JI1 T;  1J5E T;  4DUZ T;  4DV0 T;  4JI6 T;  4B3T T;  1N34 T;  4DV2 T;  4DR1 T;  4LF7 T;  4OX9 T;  4DR4 T;  2UXD T;  2UUB T;  4JI4 T;  4LF6 T;  4LF8 T;  1FJG T;  5LMN T;  4DR5 T;  4DR7 T;  4X64 T;  4LFA T;  5IWA T;  4JYA T;  4JI0 T;  3T1H T;  4X65 T;  4JI5 T;  1XNR T;  4DV6 T;  4YY3 T;  1HNZ T;  4DUY T;  4X66 T;  5LMU T;  2UU9 T;  1N36 T;  4DR6 T;  2ZM6 T;  4JV5 T;  4DR2 T;  4B3M T;  4LF4 T;  5BR8 T;  4NXN T;  1I94 T; 
#chains in the Genus database with same CATH topology
 4TNV A;  4MBQ A;  2MYS A;  2BG9 E;  3LDQ B;  4PJM A;  1G73 A;  2CXF A;  4PFP A;  2DWK A;  3L8R A;  3ZMT B;  5AQS B;  5IYZ E;  4CN6 A;  2X68 A;  3Q5X A;  2X0L B;  4B6X A;  4HFI A;  4YHH T;  1XNQ T;  5HYA A;  3ANW A;  3BQK A;  2WS3 A;  1D0Z A;  4ZI2 D;  3I1A A;  4DV3 T;  2NTY A;  4U7Y A;  2QYW A;  4IRE A;  5IUX A;  3VRA A;  2C0S A;  4YT0 A;  5AQH B;  3ZN1 B;  3F2E A;  3CK6 A;  4U72 A;  3FZF B;  4ANJ A;  5JDF A;  2E2A A;  2I0M A;  3PUR A;  5LGT B;  3PV0 F;  2HH7 A;  5EK4 A;  1UUR A;  4HFE A;  4DV2 T;  3AEG A;  4IE6 A;  5AQP B;  5BMV E;  1KF6 A;  4UVC B;  2KND A;  5JRC A;  2LE8 A;  4IIJ E;  5LBQ B;  4ZXL A;  2BG9 C;  2LSY A;  2OV9 A;  1I6Z A;  2CA5 A;  4AKG A;  1FEW A;  1UX5 A;  2JIW A;  1ZOY A;  3Q5E A;  4HFV A;  2A9U A;  2SPC A;  5LBM A;  5HCM A;  3L3P A;  4FJO A;  3SFE A;  1QSD A;  3N9O A;  4TN7 B;  4A5X A;  2DNX A;  4I4T E;  4TV9 E;  5FY7 A;  2XQY A;  4PK4 A;  3K3N A;  4CXX A;  2D5U A;  3ZYK A;  3PUQ A;  5AQI B;  1UUS A;  5F8P A;  2JPF A;  4H63 H;  3TLV A;  4P0A A;  2NW8 A;  2N1G A;  4LMK A;  3RIU A;  2JQQ A;  2D0U A;  3N9Q A;  1UCU A;  2K48 A;  1D1A A;  4U7I A;  3IBP A;  4IDO A;  4HTE A;  3EI0 A;  5ABE A;  3S4U A;  4BAY B;  2LM2 A;  3PU8 A;  4KHP T;  4HWI B;  3ZJ2 A;  1E7P A;  2W63 A;  4JUY A;  1UK5 A;  2PG8 A;  3PUX F;  1BR4 A;  5DQV A;  4BJM A;  4ILB A;  2XSA A;  4DBR A;  4PJN A;  4Z91 A;  1M7K A;  3FBZ A;  4U3C A;  4NIQ A;  4O4I E;  3QNU A;  4OYJ A;  4X65 T;  4DV6 T;  1HX1 B;  5CB4 E;  3K1S A;  3N9L A;  4QXB B;  4DR6 T;  1VOM A;  2KXP B;  3WI3 A;  2C5I T;  4E7Z A;  3Q9D A;  3VKG A;  5DQW A;  3A8Y C;  1B7T A;  3GWH A;  2N9D A;  4H63 V;  1SE7 A;  5BR8 T;  4DV1 T;  3OJA A;  2WMO A;  3AED A;  3PUZ F;  4H9O C;  1VCS A;  3OYZ A;  1CHU A;  4IE4 A;  1W0B A;  4TX5 A;  2VB6 A;  3ETU A;  1NEK A;  4TV8 E;  2ZLY A;  2X51 A;  2X67 A;  3RH3 A;  3SWH A;  1T98 A;  4X62 T;  2VQE T;  4MFR A;  3J9X 1;  2ZM8 A;  3SFD A;  5LA6 E;  5JR9 B;  4O8S A;  3A7M A;  3C98 B;  1N34 T;  4AQF C;  3Q5W A;  3NZQ A;  4LF6 T;  4PK5 A;  2XM2 A;  1E1H B;  1WYB A;  1V9D A;  4EOZ B;  4HWC A;  4YFS A;  4EGW A;  3P8C D;  5L2L A;  5FVK A;  4G2A A;  3V5S A;  4JI5 T;  4YJ3 E;  5H6R B;  2C5J A;  4YTM A;  4YY3 T;  2PTF A;  3NRY A;  2UU9 T;  3L09 A;  3GN5 B;  3UU4 A;  5FXZ A;  2KLQ A;  2VVN A;  2W61 A;  2NWB A;  2XAF B;  3N2G E;  5EK2 A;  4H9R C;  1FMW A;  4A97 A;  1HS7 A;  4G63 A;  1IBL T;  5A1L A;  2X9X A;  4JI3 T;  1IBK T;  4GKK T;  5KDM C;  3RF1 A;  2ES0 A;  2V7L A;  4Q25 A;  4GYR A;  4HWF A;  5AQU B;  1SA0 E;  4ZI3 C;  4UVA B;  4LFB T;  2XUE A;  3PUV F;  2F4V T;  3AE4 A;  3EDU A;  5DJQ C;  5KX5 E;  2DI4 A;  3BQI A;  4ASK A;  2H88 A;  2L3L A;  4K0K T;  2XZE A;  2YU2 A;  3U78 A;  2E9X C;  4L5G A;  2UUA T;  1MNE A;  5LP6 E;  5LYJ E;  3ZMZ B;  4ZZB A;  3MA9 A;  3F31 A;  3RYF E;  4QH1 A;  4A56 A;  1WR0 A;  3CQC B;  3C64 A;  3LJC A;  1OED B;  3FXE B;  1YQ3 A;  2WDR A;  4JYA T;  1S35 A;  4XZC A;  3HKB E;  5J2T E;  2D0T A;  3MJX A;  5J2U E;  2B1E A;  4EB6 E;  3N9M A;  2W62 A;  3C4W A;  3MKD A;  3PTR B;  2KIN B;  4AI6 A;  5JDL A;  2WU2 A;  5FXW A;  1XDP A;  3FXD B;  3ANW B;  1HX8 A;  5JR9 A;  2HPJ A;  4CN4 A;  5LOV E;  3VHL A;  2OA5 A;  2CWO A;  5FP3 A;  3PUW F;  4KX6 A;  5H6Q B;  3RIF A;  2LT3 A;  5FYM A;  2XY8 B;  4HN9 A;  4ISS A;  3RRW A;  3TLW A;  2V26 A;  3P4S A;  5ABH A;  4EYY R;  2FJA A;  5HXE A;  3N9P A;  3RIU C;  4DV7 T;  5HEU A;  3HA4 A;  3AE2 A;  3AXJ B;  4DV5 T;  5LHI B;  1XMQ T;  4IT4 A;  1HG2 A;  1MMD A;  4TUY E;  4QH4 A;  3ZEF B;  3GN5 A;  2NW9 A;  2HPL A;  1H7C A;  3PUA A;  4GIW A;  4UEL A;  4PFO A;  1J5W A;  1LVK A;  1QLB A;  3ZT5 A;  4OX9 T;  4DR1 T;  5AQT B;  5HEO A;  1X79 A;  2JMK A;  4OFZ A;  3AE9 A;  3JCF A;  4FI5 A;  1BR0 A;  2N2N A;  4WYV A;  4IE5 A;  4EV6 A;  1Z8U A;  4X64 T;  1MMG A;  2JQ9 A;  1U4Q A;  3VR8 A;  3SS1 A;  1HNZ T;  2YOE A;  2R6G F;  2BKO A;  4AKR B;  4DO0 A;  2LSI A;  4KI0 F;  2HN2 A;  2LRL A;  3RYC E;  3KBT A;  1BR2 A;  3VRB A;  3IF8 B;  4GK0 E;  1WCR A;  1O3X A;  3AE5 A;  5L3F B;  5JDQ A;  2DWG A;  3IEE A;  4UR9 A;  4AXP A;  1WYC A;  3OBV E;  2CCQ A;  3PU3 A;  4JI7 T;  4CI2 B;  4GOU A;  5L3E B;  4CQI A;  2A72 A;  4ZOL E;  5AFU L;  3CX6 B;  2CBI A;  2KSR A;  3ESL A;  4J2C A;  3AE8 A;  3O1H A;  5C3J A;  2ZMA A;  2LSG A;  2VK9 A;  3N2K E;  4CZZ B;  2ODV A;  2E5L T;  3UUB A;  2LKH A;  3ZPO A;  2UXB T;  2YIN A;  5LNK A;  3LK3 B;  2UXN B;  3UFG A;  4C91 A;  5AQO B;  1NEN A;  2M6B A;  4JI6 T;  3T8O A;  3MK7 C;  3P4Q A;  3JAE A;  3HKC E;  5HEH A;  3ZYL A;  2X66 A;  2KMF A;  3PE0 A;  3FHN A;  3K3O A;  2XQ6 A;  2Q9Q B;  2P9B A;  3ONJ A;  2V8S V;  3ZLI A;  2XQ3 A;  3UT5 E;  3LFM A;  3AEF A;  5JDH A;  2VL0 A;  4HKA A;  3TKL B;  4ZI2 C;  3KV5 A;  1AJ3 A;  3AXJ A;  1T7S A;  2YEV C;  5FY1 A;  2V7M A;  3Q2M A;  3F57 A;  3K8P C;  4CXY A;  3AE1 A;  5DAB A;  4IE7 A;  1MIY A;  2K9A A;  3JAD A;  1XMO T;  2D9D A;  5HXR A;  4ZHQ E;  4X20 E;  4JBW F;  4WNK A;  4QHO A;  1MMA A;  4AKI A;  1NAF A;  2MBG A;  3LK4 2;  1KFY A;  4X1I E;  2IHR 1;  4P09 A;  2WU5 A;  3CPZ A;  4QWN B;  3FZK B;  2BBH A;  2RPA A;  3KBU A;  3P50 A;  3RGL A;  1N32 T;  2L9Q A;  3O1I A;  1M62 A;  3RYI E;  2FJB A;  2LHN A;  3UU3 A;  3KV6 A;  3UUX B;  2X9Y A;  2QVA A;  2X0Y A;  3UU5 A;  2H7O A;  5AQG B;  5AQM B;  1D0X A;  1IAP A;  3KV4 A;  2BZB A;  5L47 A;  4HFD A;  5HAX A;  5IHY A;  5L3B B;  2BG9 B;  3RKO A;  3KIN B;  3R84 B;  1IZN B;  3T1H T;  2XSB A;  3ZST A;  1Z0P A;  4ERR A;  1BR1 A;  1YQ4 A;  3AAE B;  3QC9 A;  2BDE A;  2J62 A;  5HCJ A;  1D1C A;  3EAM A;  2K5B B;  4X5T A;  3ZC0 A;  2QRX A;  4UV8 B;  3NVO A;  5FXV A;  2YKS A;  4E7S A;  2QGS A;  3LG7 A;  3UU6 A;  2W0G A;  2W2U A;  4IDP A;  4DR3 T;  4ILA A;  2Y8D A;  2XHE B;  3ZYM A;  2HHH T;  5JR9 C;  2JMH A;  4PW8 A;  2ODU A;  4K0U A;  3RC3 A;  4CN1 A;  2Q9Q A;  5AQL B;  2YDQ A;  4YJ2 E;  2XQ5 A;  2VL8 A;  3H37 A;  3RC8 A;  3RI5 A;  4CXW A;  3FZM B;  4DUZ T;  2WAU A;  5JDM A;  5JDG A;  2E5V A;  1KNP A;  1HF8 A;  4F6R C;  3TLS A;  3VU7 H;  5L4E A;  4UIG A;  5JH7 E;  1YXR A;  4L0R A;  4LFA T;  5LHH B;  4JI0 T;  5L4H A;  1OED E;  2AXD S;  3AEA A;  5ADX L;  5HWX A;  1YW0 A;  3OPC A;  3RX6 A;  2EHO B;  4PJJ A;  1XZY A;  5LG4 A;  5C2T A;  3AAI A;  4DBQ A;  3W15 B;  5HXH A;  1OXZ A;  4U31 A;  3ZT7 A;  3MXZ A;  4NXN T;  3NBX X;  3TLU A;  1N33 T;  4M1P A;  3C50 A;  1HNX T;  1CUN A;  3L39 A;  5HWY A;  3AE7 A;  3KFW X;  2YK0 A;  4QXH B;  2WCA A;  4JI2 T;  3I0O A;  2BG9 A;  1EZ3 A;  4U74 A;  1DU2 A;  3EAB A;  2NP9 A;  2WZI A;  4AIU A;  2V6Y B;  3HL6 A;  5KXJ A;  1OED C;  2CBJ A;  4DND A;  2IML A;  2LRK A;  5AQN B;  4O2B E;  4ZEY A;  4IDN A;  2V7K A;  2FBW A;  3EDV A;  5ABF B;  5LJM A;  2V5D A;  3AA7 B;  1XDO A;  3QK6 A;  4IL9 A;  1FJG T;  3I9W A;  4UXN B;  3CML A;  5FY0 A;  5EZY E;  2DHR A;  2VKO A;  4ZS3 A;  4TZ4 C;  5IWA T;  4DVD A;  2WSS V;  3A5X A;  1XNR T;  2A2F X;  3UUL A;  3TLT A;  2WZH A;  3KVA A;  1IJ5 A;  1U5P A;  2ZM2 A;  4EXT A;  1N36 T;  4O4L E;  4KHZ F;  3SRZ A;  2ZM6 T;  4IDQ A;  4AKH A;  5AQR B;  2DCF A;  5AQK B;  1KK7 A;  2W67 A;  3MZK B;  4DMW A;  3V5U A;  2UUC T;  2CE7 A;  4BA9 A;  2AE9 A;  2VQF T;  4WW0 A;  1HTJ F;  4DID B;  4NXM T;  5L3D B;  4Z8X A;  2MAW A;  5LXT E;  2KZ7 B;  3AE6 A;  4X1Y E;  2BVL A;  3D0T A;  4X1K E;  4XBF B;  3T1Y T;  4UV9 B;  5LB7 B;  4TNW A;  3CX8 B;  2J4G A;  2ZM0 A;  3HR0 A;  2EHO A;  3JC6 D;  1KNZ A;  2WBL A;  2KT9 A;  2YDS A;  3UQ7 A;  4PNI A;  4JEU B;  1NWM X;  4AIS A;  3RQW A;  2H7V C;  2UUB T;  4LML A;  3E0Z A;  1KNR A;  4HFH A;  4AKL A;  3ZT6 A;  3ABV A;  4UF0 B;  5C8Y E;  1L0V A;  4EZH A;  5FXX A;  4QX7 B;  1MIW A;  2XM1 A;  2Y48 B;  5FL0 A;  4JEH B;  4QKN A;  1HG5 A;  3AVS A;  3LBX B;  3Q5D A;  1UX4 A;  4QX8 B;  3B5M A;  1R8I A;  1YD8 G;  2V6Y A;  3X1D A;  4I43 B;  2VKH A;  3BK9 A;  3C4X A;  4YSX A;  1HFA A;  2JQH A;  4B3M T;  3ZMV B;  3AEB A;  3M65 A;  4C90 A;  5FL1 A;  2X9W A;  2WP9 A;  3ZN0 B;  4AQF A;  4P1N A;  5ABF A;  2Q9Q D;  3UUM A;  3ETV A;  2CWY A;  1WR6 A;  2JJ9 A;  2VWA A;  2IC6 A;  2WWV A;  2JQK A;  2CPT A;  4GKJ T;  2I6H A;  4TWD A;  1LRZ A;  2CM0 A;  2B76 A;  1T8B A;  3ZSS A;  5TAO A;  3AAA B;  4EZ4 A;  1MIV A;  2H3R A;  3FBL A;  4JI1 T;  3I9Y A;  1ZHC A;  3QB5 K;  2XAS B;  4N78 D;  4I50 E;  5JVD E;  3AEC A;  3GA8 A;  4IL4 A;  1W9R A;  2Z6E A;  3AA1 B;  1W0A A;  3J7Y q;  2OLT A;  2NR4 A;  2PBI A;  4ADZ A;  5LGN B;  3LSV A;  4UEM A;  2DLR A;  4DR5 T;  2J47 A;  3E08 A;  3UQ4 A;  2WB5 A;  4DR7 T;  3KV9 A;  2V1D B;  2HN1 A;  4O4H E;  3CIR A;  4X66 T;  4WZX A;  4YTP A;  5ETW A;  5FNV E;  2L8K A;  5JDN A;  2E9X A;  3P4W A;  4Z90 A;  3E22 E;  3NRX A;  5CGM A;  3P4P A;  3EHZ A;  3QOF A;  4LF9 T;  1YKE B;  2CLY B;  4UF0 A;  3EVY A;  4HGA A;  4DV4 T;  2YU1 A;  2DL1 A;  3RRC A;  3ZJ1 A;  1WFD A;  3CVR A;  2M6I A;  3I0Q A;  2XQ9 A;  4GK5 E;  2K24 A;  1MND A;  3HKD E;  4JI8 T;  3LBX A;  1ZKE A;  2V7I A;  3RKG A;  4LF5 T;  1X9B A;  1HR0 T;  2BS2 A;  1ZV4 X;  4LFC T;  4DV0 T;  2QA7 A;  2CRB A;  3PUG A;  3DTO A;  1UGO A;  3K3Q C;  1WLX A;  4JI4 T;  4OYK A;  3ZCJ A;  3UUN A;  3VR9 A;  4LF8 T;  3HI2 A;  4AQG A;  2CEA A;  2W66 A;  1E2A A;  2FJD A;  3AB3 B;  3R6N A;  2C5K T;  2PJQ A;  2XTL A;  2XAQ B;  3DJB A;  5F3J A;  5ABG A;  2H89 A;  2D2S A;  2NTX A;  4A98 A;  5JQG E;  3DP7 A;  4O2A E;  5L3G B;  2UXX B;  1G8X A;  1SHZ C;  3ZC1 A;  4HEA A;  3N9N A;  4LF4 T;  5FVL A;  2E8I A;  2M67 A;  5LHG B;  2V6X A;  4KUM B;  2XQ8 A;  5M4Y A;  4H9N C;  4U2Z A;  2FUP A;  2IW5 B;  4EED A;  2MTQ A;  3LK2 B;  2CMR A;  2VKD A;  4H9Q C;  3CWZ B;  5LG3 A;  4YSY A;  4LMJ A;  2FJE A;  2XAH B;  4U33 A;  5HEJ A;  3ZMU B;  2LSK A;  5HXC A;  2ACX A;  2EHO D;  4YTN A;  2LLY A;  4YXD A;  3N5L A;  2G0U A;  2XAJ B;  3RLF F;  5L3C B;  1IBM T;  2WM9 A;  5F5W A;  2XAG B;  4YLH A;  4L9I A;  3ONX A;  1D1B A;  4NUU A;  2MPK A;  2CXD A;  5HEG A;  4MHC A;  3PJA A;  2BS3 A;  2VUR A;  1KEY A;  4BJN A;  1ZP0 A;  3PUY F;  4P0B A;  1Y64 B;  3BQL A;  2EHO C;  2X0H A;  1LKX A;  1YKH B;  2LSJ A;  3VKH A;  5J1G A;  5LGU B;  3UFE A;  3AA0 B;  1S94 A;  2BBJ A;  5E0O A;  4WBO A;  3P7I A;  3RHW A;  4DUY T;  3MAC A;  3O9X A;  2BKP A;  2WQY A;  5JRE A;  3NZP A;  4JV5 T;  3PUS A;  4DR2 T;  1T72 A;  2YDR A;  3O1J A;  3PJA J;  4QH5 A;  4YSZ A;  3ZKR A;  2RP4 A;  1FMV A;  4B3S T;  3QUJ A;  1VCT A;  4ZZC A;  3RPU A;  2Y6X A;  4DMV A;  3IHR A;  1Y01 A;  3KDS E;  3H3M A;  4QXC B;  1JNR A;  4HFB A;  4COF A;  2J1D G;  2LOP A;  1GQE A;  2KWI B;  2IUB A;  2IC9 A;  3HKE E;  2XPK A;  2WDQ A;  4ZI7 E;  5CA1 E;  1W09 A;  2WDV A;  2LEH A;  4EIW A;  5AQQ B;  4DR4 T;  2UXD T;  2A3D A;  4ZI3 D;  2RA1 A;  5CJ5 A;  1JNZ A;  4I0U A;  1FIO A;  1ZEE A;  4EAH A;  4CI3 B;  4TWH A;  4KMC A;  4U2Y A;  2E9X D;  3GMI A;  2IIU A;  4KBM B;  3FZH B;  2V7J A;  5FKY A;  4HWD A;  4WBN E;  3OVU A;  2VVS A;  2BS4 A;  2WWU A;  3AA6 B;  4GYS A;  3C51 A;  4H9S E;  4H9P C;  3ONL C;  3OTO T;  3IA3 A;  4IDZ A;  4EEB A;  2NOX A;  2LKG A;  2WY2 A;  3OKQ A;  5LCY A;  4PJL A;  2IDO B;  4HWH A;  4NPP A;  4B3R T;  3FZL B;  3SOL A;  2XJ7 A;  4KP3 C;  2KWH A;  5HXS A;  5KMG P;  4HFC A;  2BKN A;  5JTG A;  3M3Z B;  2MOZ A;  2XQ7 A;  1WRD A;  5AQF B;  4IE0 A;  2YN6 A;  4B3T T;  1OWA A;  2LM9 A;  4OK0 A;  3N2O A;  2BVM A;  3WAJ A;  3UTK A;  1HCI A;  4UVB B;  4HE8 A;  3RYH E;  2CHN A;  4O4J E;  2ACZ A;  4OHF A;  1XWM A;  2VAS A;  2E9X B;  2LHR A;  3NKZ A;  5LJN A;  4IST A;  4V1A v;  4TWF A;  4EYU A;  4MAL A;  3WAK A;  2NW7 A;  2WMN A;  3QB5 A;  3CQX C;  5LMU T;  4ILC A;  1LVF A;  4IGU A;  2CXL A;  3B57 A;  4F8H A;  1J1J A;  4MLK A;  1IJ6 A;  5EK3 A;  3ZCI A;  3JC6 C;  1US7 B;  1HNW T;  5JRC B;  3FB2 A;  2UXC T;  5J0Z A;  3UU8 A;  4ILU A;  3CX7 B;  2W00 A;  3AEE A;  4PK6 A;  3G06 A;  2IAK A;  3NWI A;  3B13 A;  3OYX A;  2V5C A;  5FMN A;  2XQA A;  3KVB A;  2LOS A;  4AQY T;  4JLE A;  3CKD A;  1J5E T;  3O4X E;  5GON E;  2X9H A;  4XAX B;  1QUU A;  4CI1 B;  2PFV A;  3ZMS B;  2W4X A;  4ZS2 A;  4LF7 T;  3C4Z A;  1VRB A;  3P4R A;  3RIA A;  1D0Y A;  2VKJ A;  2CHO A;  2LJL A;  4I55 E;  2XQ4 A;  5LMN T;  4NUV A;  4YHJ A;  5CFB A;  2K3W A;  3PDY A;  3JAF A;  3H3A A;  2I59 A;  2Q9Q C;  2GK9 A;  1SUM B;  3U3I A;  3AE3 A;  3CQG B;  4PAG A;  3RQU A;  4IHJ E;  2CLY C;  5AQV B;  1MMN A;  3EUH A;  5AQJ B;  2JRK A;  1OED A;  3AVR A;  5CA0 E;  1I94 T; 
#chains in the Genus database with same CATH homology
 4DV1 T;  3OTO T;  1N33 T;  1IBL T;  2UUC T;  4JI3 T;  1HNW T;  1HNX T;  1IBK T;  4GKK T;  4DR3 T;  2VQF T;  4LF9 T;  2UXC T;  4B3S T;  4JI7 T;  1XMO T;  4JI2 T;  2HHH T;  4NXM T;  4LFB T;  4B3R T;  2F4V T;  4DV4 T;  4GKJ T;  4YHH T;  1XNQ T;  4DV3 T;  4DV7 T;  4JI8 T;  1IBM T;  4DV5 T;  2E5L T;  4K0K T;  4X62 T;  4LF5 T;  1XMQ T;  3T1Y T;  1HR0 T;  4KHP T;  2UXB T;  2VQE T;  4AQY T;  4LFC T;  2UUA T;  1N32 T;  4JI1 T;  1J5E T;  4DUZ T;  4DV0 T;  4JI6 T;  4B3T T;  1N34 T;  4DV2 T;  4DR1 T;  4LF7 T;  4OX9 T;  4DR4 T;  2UXD T;  2UUB T;  4JI4 T;  4LF6 T;  4LF8 T;  1FJG T;  5LMN T;  4DR5 T;  4DR7 T;  4X64 T;  4LFA T;  5IWA T;  4JYA T;  4JI0 T;  3T1H T;  4X65 T;  4JI5 T;  1XNR T;  4DV6 T;  4YY3 T;  1HNZ T;  4DUY T;  4X66 T;  5LMU T;  2UU9 T;  1N36 T;  4DR6 T;  2ZM6 T;  4JV5 T;  4DR2 T;  4B3M T;  4LF4 T;  5BR8 T;  4NXN T;  1I94 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...