2FUPA

Crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
128
Chain Sequence
b'MPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELPVLQQLLGAKQPLMQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIANQASTGSLLNILR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA3352
publication title Crystal structure of hypothetical protein (NP_252042.1) from Pseudomonas aeruginosa at 1.48 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 54
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05130 FlgN FlgN protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.300 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 FlgN-like 2fupA00
3OPCA 2FUPA
chains in the Genus database with same CATH superfamily
4TWDA 3CX7B 2NOXA 2WY2A 3N9NA 2YN6A 4GK5E 3LK42 5H6QB 2EHOA 4UF0B 5JRCA 3OYXA 1X9BA 5FXZA 3KV9A 5HXEA 3FBZA 2XAQB 2IMLA 2WMNA 5LHIB 4DUZT 2KXPB 2CM0A 2XQ6A 4TNVA 2BKPA 2JMKA 4HWFA 5ADXL 5JDHA 3K1SA 2DCFA 3LBXB 2X0LB 4FJOA 3ZYLA 2KSRA 5F3JA 3D0TA 4MLKA 2XAGB 3M65A 2D0TA 1DU2A 5HCJA 5KMGP 1YKEB 5L3CB 2K5BB 3EHZA 4I55E 2L8KA 3FXDB 4ZHQE 3OVUA 3PV0F 2AE9A 3ESLA 3N2GE 1N32T 2XQ7A 3M3ZB 4QKNA 3CQGB 3ZJ2A 1T72A 3AXJA 3BQLA 3LG7A 3ZC0A 2YU2A 2J1DG 4YTNA 1UX5A 4TNWA 2XAFB 2V6XA 1N34T 3AE9A 4LF7T 1LVFA 2CXLA 4JUYA 3P50A 3MK7C 4YHJA 5LYJE 3NKZA 3CK6A 5JDQA 1WRDA 4JI1T 4AKIA 2BDEA 2V6YA 4IDNA 4WYVA 5IYZE 2JMHA 2E2AA 2JJ9A 4YHHT 5AQPB 4GK0E 5AQOB 1KNPA 2V7LA 1FJGT 3ETUA 2FUPA 4ISTA 2VL0A 4JI2T 4PW8A 3X1DA 1IBMT 1MNEA 3UFGA 3KFWX 2IC9A 3FZMB 4OFZA 5IUXA 1OWAA 3ZLIA 1UK5A 2KT9A 2PJQA 4LF8T 3RC3A 2Y8DA 3PURA 2BG9E 3WAJA 2X67A 4WNKA 1D0XA 2IDOB 5LG3A 2OA5A 2QRXA 3PUVF 3UUBA 4CI3B 2VVNA 1Z0PA 2UUAT 4JLEA 5LGTB 3Q5DA 4KMCA 3LDQB 2VQFT 4V1Av 1H7CA 2KZ7B 2NR4A 3J7Yq 3PUYF 3MACA 3KVBA 2WQYA 1D0YA 3PU3A 3KBUA 4X1KE 1EZ3A 4HEAA 4DIDB 2CWYA 3GA8A 4EOZB 2H89A 3RRCA 3B57A 2WB5A 2V7KA 2ZM6T 4C91A 1D0ZA 1UCUA 3FZLB 3H37A 4PJJA 4QH1A 4TX5A 2BBJA 1ZKEA 3UU3A 2Y6XA 2WDQA 3AECA 4CN6A 5ETWA 3AA1B 1MNDA 3KDSE 4MBQA 1WLXA 2NTYA 2WCAA 5JREA 2VASA 3V5UA 3I0QA 5CA0E 4JYAT 2NTXA 2X0YA 5LGUB 4XAXB 5LMNT 3JAEA 5J2UE 3AEDA 4P1NA 4NUUA 3AEBA 5L4HA 5AQUB 1Y64B 3SWHA 1BR1A 1HF8A 2LHNA 1LKXA 3PE0A 2E5LT 2AXDS 5AQIB 3ZMVB 4ADZA 2HPLA 3UU8A 4EYYR 4A97A 4X64T 3CX8B 2LOPA 1YD8G 3F31A 3LSVA 2CRBA 5JR9B 4TV8E 3PUQA 2VURA 2UXCT 2WSSV 1R8IA 3PUGA 4DO0A 4QX7B 5JH7E 3K3QC 2IAKA 2I59A 1IAPA 4H9RC 2YDSA 2IC6A 2VVSA 3N9PA 2V7MA 5KXJA 4EIWA 2KLQA 3IA3A 3AE4A 3UTKA 3AE6A 4U74A 5JDLA 3CQXC 3N9LA 3AAIA 3JADA 5LXTE 4DV6T 2XHEB 5CGMA 1HG2A 3VR8A 4IT4A 3HI2A 4DV0T 2VQET 2W2UA 5AQQB 5LB7B 4DMVA 2LLYA 1MMGA 4OHFA 3MKDA 3E22E 4AKRB 2M6IA 2LKHA 2LKGA 3R6NA 4B3TT 2UU9T 2DWKA 2PFVA 1GQEA 1XDOA 1FMWA 1W9RA 3ZMTB 4UELA 5L3EB 3NBXX 2E8IA 4HFEA 2BS2A 2V5CA 3DTOA 4EAHA 4I50E 4HWCA 3VKHA 1BR0A 2Y48B 3QUJA 4UXNB 4HFHA 4LF4T 2JQ9A 5AQMB 4BJMA 5HEJA 1N33T 3O1HA 4KUMB 3BQKA 4LF9T 2XQ5A 4PAGA 2WDVA 4DR4T 2UXXB 2UUCT 1HNWT 1VRBA 3K8PC 4DBRA 4GOUA 4P0BA 4Z8XA 3Q9DA 1KFYA 1QSDA 1IBLT 5F8PA 1MIVA 3EAMA 4OX9T 1VOMA 5FY7A 2WZHA 4O2AE 4HE8A 4UV8B 4HFDA 2V5DA 5ABFB 3G06A 1JNRA 3RRWA 1KNRA 4UIGA 2BKOA 5FMNA 4IDOA 4DUYT 4NUVA 4DMWA 5FY0A 1V9DA 4DBQA 2OLTA 2W0GA 5HEOA 2J62A 5AQJB 3ZSSA 3BK9A 4EV6A 3UULA 5L4EA 4CQIA 5L3DB 3AB3B 4O4IE 3VHLA 3CWZB 1US7B 2XQ9A 2LOSA 4ILBA 5F5WA 2D5UA 3RYHE 2UXBT 4QH4A 1WYCA 2RA1A 1G8XA 5AQNB 4DV4T 4AKHA 4AKGA 5GONE 3CIRA 2JQHA 2LE8A 4Z90A 3UUXB 5CJ5A 3Q5EA 3ZCJA 5C8YE 1SE7A 2A2FX 5HXRA 4MALA 2K3WA 2C5KT 3CVRA 3RPUA 5JDNA 4L0RA 4AQFC 1UGOA 3HR0A 5LHHB 3F57A 2I6HA 2V1DB 4CZZB 1M62A 4YSXA 5HAXA 1ZV4X 4PK6A 2CA5A 5HXSA 2LEHA 3AEEA 3GN5A 2PBIA 4LFBT 2L9QA 3ABVA 4TZ4C 2HHHT 4AIUA 3TKLB 3AE7A 2Q9QD 1X79A 2Q9QB 3HA4A 5C3JA 3QC9A 3H3MA 2LRKA 4O4LE 4I0UA 3C4WA 2YINA 4U33A 3B5MA 2MOZA 3T8OA 4UVAB 3KBTA 4I4TE 3CPZA 1ZHCA 4X62T 2CBIA 3SFEA 4HFCA 1O3XA 3UQ7A 4PK5A 5LNKA 4OK0A 3C51A 2NW8A 5HEGA 5DQWA 5LJNA 1ZEEA 2BS3A 4DR7T 2VWAA 5KDMC 2X9XA 3AEFA 4ZZBA 2K48A 3Q2MA 4GYSA 2RPAA 3L8RA 1IJ6A 2X9YA 4BJNA 3F2EA 4HTEA 2ES0A 3A5XA 2L3LA 3ZYMA 4DR3T 4U2ZA 2NP9A 2LSIA 2SPCA 2D0UA 4U31A 3C50A 4UV9B 2BS4A 1MIYA 3AE3A 2Q9QC 2CXFA 3JAFA 1IZNB 3J9X1 5LJMA 1M7KA 3NVOA 3P4PA 4NXMT 3OTOT 1I6ZA 3VR9A 1D1BA 1MMDA 3FXEB 2XSAA 5JDMA 5ABEA 4AI6A 3AE8A 4AQGA 2A9UA 3MJXA 2CHOA 2DI4A 3UFEA 3VU7H 2IHR1 5JRCB 1WCRA 2XQ3A 2FJDA 3K3OA 5IHYA 2DL1A 2HN2A 2WWUA 2VL8A 4JI4T 2GK9A 2JIWA 4QWNB 2LHRA 2CHNA 3VRBA 5L47A 3LFMA 4B3ST 3IEEA 4CXWA 5LP6E 1U4QA 3HKCE 3OKQA 2DWGA 3L09A 4IDZA 2E9XA 2FJAA 3EDUA 3O4XE 2BG9A 4EZ4A 1YW0A 2QYWA 4FI5A 4ZS3A 3T1HT 3AXJB 3HKEE 3CKDA 3DP7A 1SHZC 1Y01A 3OBVE 3I9WA 4YTPA 2W67A 3AE1A 3VKGA 5JDGA 4QXHB 2XQ8A 3AA0B 3SS1A 2R6GF 4U3CA 1WR0A 2B76A 3RX6A 4U72A 3FHNA 4KHPT 3C98B 2C5IT 3RQUA 1D1CA 2LSKA 4AKLA 2V6YB 3O1IA 2BZBA 4B6XA 4H63V 4QXBB 5FXXA 2ACZA 2LT3A 4U7IA 2BVLA 3SRZA 4O2BE 3ZN0B 5AFUL 3U78A 3OYZA 3CMLA 4CI1B 4IE0A 3UQ4A 1YXRA 2LSGA 2HH7A 1YKHB 4IE6A 2XQ4A 4DR6T 5LOVE 1IJ5A 3EDVA 3ZN1B 1OEDB 4YFSA 3RH3A 3AEGA 4G63A 4ERRA 2CLYB 2E5VA 4JI0T 4XBFB 2XAHB 3PUWF 2WZIA 4YSYA 2XPKA 1XNQT 2W66A 1T7SA 1XZYA 3MZKB 1XDPA 5FXVA 1HR0T 4X20E 3L39A 4Q25A 4E7ZA 4BAYB 3JC6D 3Q5WA 2NW9A 4AQFA 3I9YA 4IGUA 4YTMA 4H9NC 5BR8T 4IL4A 4F8HA 5AQLB 3EI0A 4IE4A 2A3DA 3GWHA 3WAKA 2JQKA 2YU1A 2X68A 5L2LA 2HN1A 3I1AA 4AISA 3A7MA 2D9DA 3U3IA 3CX6B 3FB2A 4ANJA 1UUSA 3SOLA 3ZMSB 5JR9C 2Z6EA 4IE7A 3OJAA 3NZQA 2VB6A 2VK9A 3TLVA 4PNIA 4KP3C 5ABGA 4GKJT 1OEDC 2DHRA 2D2SA 2XQYA 1OXZA 5HWXA 2X0HA 5FKYA 4DV7T 2CLYC 5FYMA 4L5GA 3E0ZA 4B3RT 3UUNA 2CWOA 1HS7A 1CUNA 1NEKA 2QGSA 4BA9A 5LCYA 2KINB 3ONJA 3RYIE 4ZZCA 3ANWA 5HEHA 2XTLA 3JC6C 1WFDA 4DR1T 3RKGA 3LK2B 5AQGB 1VCTA 2VKJA 1S35A 4DV2T 2K24A 3RLFF 4UF0A 4TV9E 2ACXA 3O9XA 4ZI3D 4EB6E 1LVKA 4DR2T 4QX8B 2Q9QA 2XZEA 3QK6A 5JQGE 2J4GA 1NWMX 3JCFA 3ZT7A 2V7IA 4HFBA 4GYRA 1D1AA 3LBXA 1NENA 4ZI2D 1WR6A 4PJNA 5FVLA 3RYCE 2LM9A 2IW5B 3RGLA 3AAEB 3P4WA 3E08A 5TAOA 2FBWA 4DV3T 4QH5A 3ZCIA 4H9OC 4NIQA 2XUEA 5AQRB 4DVDA 4ILUA 2UXNB 2M67A 4HFIA 4Z91A 2V8SV 1HCIA 2XAJB 5LG4A 1JNZA 4PFPA 3QB5A 4M1PA 4MHCA 3RHWA 4HKAA 3OPCA 4KBMB 5LHGB 5L3GB 3AVRA 3RIFA 3C4ZA 3FZFB 3KVAA 3LK3B 4ZI3C 5FNVE 4TWFA 2ZM8A 5A1LA 2CXDA 4U7YA 5BMVE 4DV5T 3P8CD 4YLHA 2YEVC 2X51A 1FIOA 4P0AA 2G0UA 5AQTB 3KV6A 3UU4A 5HCMA 4E7SA 5HEUA 3NWIA 2X9HA 3C4XA 3CQCB 3AA6B 5E0OA 3ZJ1A 5J2TE 2WMOA 2MAWA 5LBQB 4B3MT 4PFOA 2N2NA 1XMQT 2JQQA 4WW0A 2BKNA 5FXWA 2XM2A 5IWAT 1LRZA 2H7VC 4DR5T 2FJEA 2CCQA 2WM9A 3RIUC 2W62A 2W4XA 2N9DA 3FZKB 3NRYA 1KF6A 4ZOLE 3PUSA 3ETVA 3ZSTA 4EZHA 1S94A 2C5JA 3VRAA 2XY8B 5AQFB 3ZPOA 5DQVA 5FL1A 5HYAA 4QHOA 4ISSA 3W15B 3QOFA 4A98A 2DLRA 2CPTA 4X65T 3RKOA 5FL0A 2MYSA 4HFVA 2KMFA 4XZCA 3R84B 3IHRA 5ABHA 2J47A 3AVSA 1FMVA 3PJAJ 2MBGA 2LJLA 3ZKRA 2LSYA 3EUHA 2YDRA 1J1JA 4PJLA 3EVYA 3HKBE 3RYFE 4J2CA 2VKDA 3UU5A 5JTGA 2H7OA 1OEDE 4YJ2E 3I0OA 3P4QA 2EHOD 2EHOB 2PTFA 5EK4A 4YJ3E 4IHJE 2ZMAA 4A56A 2WS3A 3GN5B 1WYBA 4LMKA 1J5ET 1KNZA 2F4VT 4ZEYA 5HWYA 2K9AA 1G73A 3P4RA 3RC8A 2W61A 3KINB 5JR9A 2V7JA 2ZM0A 3N5LA 3GMIA 2LRLA 4X1IE 4O8SA 5DABA 4ILAA 1OEDA 4JEUB 5AQKB 1HTJF 4X66T 1UURA 4A5XA 4UVCB 1XMOT 4H9QC 3MA9A 1ZP0A 4COFA 1E2AA 5CA1E 4K0KT 1YQ3A 5LMUT 1XWMA 4PJMA 1BR2A 3P4SA 1QUUA 3EABA 4IIJE 5FVKA 5LBMA 1CHUA 3HL6A 3NZPA 2EHOC 4JV5T 1HNZT 2ZLYA 2QVAA 3HKDE 1T8BA 1UX4A 2BVMA 2WAUA 4GIWA 3Q5XA 2UXDT 1HNXT 4LFCT 2H3RA 2KWHA 1FEWA 2YK0A 3LJCA 2CEAA 3RQWA 2I0MA 3PUXF 5C2TA 3IBPA 3S4UA 1XNRT 1KEYA 1W09A 5AQSB 4EGWA 4JI6T 4IDPA 2ODVA 1E7PA 4IREA 1IBKT 1KK7A 2LSJA 1SUMB 3K3NA 4CN4A 2KNDA 3N9OA 2ZM2A 3PJAA 3N9MA 4L9IA 2KWIB 5JVDE 2WU5A 3H3AA 2QA7A 2FJBA 3ZC1A 2XASB 2W63A 1B7TA 4EYUA 4EEDA 4EXTA 2RP4A 2HPJA 4JI5T 5H6RB 3RIAA 5HXCA 4HWDA 2BBHA 4GKKT 4AQYT 3NRXA 4UR9A 3V5SA 4DV1T 4TN7B 4AXPA 5JDFA 3P7IA 3BQIA 2ODUA 3AAAB 2CBJA 3AE2A 2LM2A 1T98A 1L0VA 1BR4A 1QLBA 4PK4A 3ZEFB 2CMRA 5AQVB 4EEBA 5ABFA 4X1YE 3WI3A 3KV4A 4G2AA 2E9XD 2E9XB 4NXNT 2MTQA 4YSZA 2BG9B 4HWHA 3PU8A 3ZT5A 3UUMA 1SA0E 3KV5A 3UU6A 5HXHA 4ZI7E 2YKSA 4N78D 4ILCA 3UT5E 4YXDA 4WZXA 3TLWA 5LA6E 4WBNE 4H63H 1HX1B 4HGAA 4JEHB 4UEMA 3SFDA 4LF5T 3AA7B 3ONXA 2VKOA 3L3PA 5AQHB 3B13A 3ONLC 2W00A 4UVBB 4CN1A 2PG8A 2VKHA 1W0BA 3RI5A 2B1EA 1NAFA 5EZYE 4ASKA 2CE7A 4CXXA 2XM1A 3AE5A 4JBWF 2V26A 2C0SA 4KHZF 2IUBA 2YDQA 5M4YA 3RIUA 4DNDA 3QNUA 2E9XC 4H9SE 2DNXA 4X5TA 2XSBA 5KX5E 2BG9C 1ZOYA 1U5PA 1AJ3A 4IDQA 4C90A 2WBLA 2WWVA 3ZMUB 5FY1A 4LF6T 2A72A 1VCSA 4ZXLA 4OYKA 2YOEA 4CI2B 3RF1A 5FP3A 5EK3A 2MPKA 3A8YC 2OV9A 4CXYA 3ZYKA 5J1GA 3TLSA 3FBLA 2NWBA 4YY3T 1MIWA 3TLUA 3AEAA 2X9WA 3N9QA 2H88A 4JI8T 3QB5K 1Z8UA 2X66A 2JPFA 3IF8B 3PDYA 3ZMZB 3N2OA 3FZHB 2IIUA 2P9BA 3PUZF 1HG5A 5L3FB 1N36T 3T1YT 3ZT6A 1HX8A 4H9PC 2XJ7A 4HN9A 4U2YA 3N2KE 5DJQC 4TWHA 2N1GA 4I43B 4JI3T 4KI0F 5LGNB 5EK2A 2JRKA 2WP9A 1HFAA 4O4JE 4WBOA 3MXZA 5CB4E 4JI7T 1E1HB 4LMJA 3TLTA 4K0UA 4P09A 3O1JA 2M6BA 4OYJA 1YQ4A 3DJBA 4YT0A 3C64A 2UUBT 4F6RC 4IE5A 1MMNA 1W0AA 2WU2A 4ZS2A 4LFAT 2WDRA 4NPPA 3PUAA 1MMAA 3ANWB 5J0ZA 4LMLA 4IL9A 5CFBA 2NW7A 4HWIB 1J5WA 3PTRB 4O4HE 4ZI2C 4MFRA 5L3BB 2XQAA 1I94T 4TUYE 4QXCB 4KX6A
chains in the Genus database with same CATH topology
3OPCA 2FUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPC A;  2FUP A; 
#chains in the Genus database with same CATH topology
 4TWD A;  3CX7 B;  2NOX A;  2WY2 A;  3N9N A;  2YN6 A;  4GK5 E;  3LK4 2;  5H6Q B;  2EHO A;  4UF0 B;  5JRC A;  3OYX A;  1X9B A;  5FXZ A;  3KV9 A;  5HXE A;  3FBZ A;  2XAQ B;  2IML A;  2WMN A;  5LHI B;  4DUZ T;  2KXP B;  2CM0 A;  2XQ6 A;  4TNV A;  2BKP A;  2JMK A;  4HWF A;  5ADX L;  5JDH A;  3K1S A;  2DCF A;  3LBX B;  2X0L B;  4FJO A;  3ZYL A;  2KSR A;  5F3J A;  3D0T A;  4MLK A;  2XAG B;  3M65 A;  2D0T A;  1DU2 A;  5HCJ A;  5KMG P;  1YKE B;  5L3C B;  2K5B B;  3EHZ A;  4I55 E;  2L8K A;  3FXD B;  4ZHQ E;  3OVU A;  3PV0 F;  2AE9 A;  3ESL A;  3N2G E;  1N32 T;  2XQ7 A;  3M3Z B;  4QKN A;  3CQG B;  3ZJ2 A;  1T72 A;  3AXJ A;  3BQL A;  3LG7 A;  3ZC0 A;  2YU2 A;  2J1D G;  4YTN A;  1UX5 A;  4TNW A;  2XAF B;  2V6X A;  1N34 T;  3AE9 A;  4LF7 T;  1LVF A;  2CXL A;  4JUY A;  3P50 A;  3MK7 C;  4YHJ A;  5LYJ E;  3NKZ A;  3CK6 A;  5JDQ A;  1WRD A;  4JI1 T;  4AKI A;  2BDE A;  2V6Y A;  4IDN A;  4WYV A;  5IYZ E;  2JMH A;  2E2A A;  2JJ9 A;  4YHH T;  5AQP B;  4GK0 E;  5AQO B;  1KNP A;  2V7L A;  1FJG T;  3ETU A;  2FUP A;  4IST A;  2VL0 A;  4JI2 T;  4PW8 A;  3X1D A;  1IBM T;  1MNE A;  3UFG A;  3KFW X;  2IC9 A;  3FZM B;  4OFZ A;  5IUX A;  1OWA A;  3ZLI A;  1UK5 A;  2KT9 A;  2PJQ A;  4LF8 T;  3RC3 A;  2Y8D A;  3PUR A;  2BG9 E;  3WAJ A;  2X67 A;  4WNK A;  1D0X A;  2IDO B;  5LG3 A;  2OA5 A;  2QRX A;  3PUV F;  3UUB A;  4CI3 B;  2VVN A;  1Z0P A;  2UUA T;  4JLE A;  5LGT B;  3Q5D A;  4KMC A;  3LDQ B;  2VQF T;  4V1A v;  1H7C A;  2KZ7 B;  2NR4 A;  3J7Y q;  3PUY F;  3MAC A;  3KVB A;  2WQY A;  1D0Y A;  3PU3 A;  3KBU A;  4X1K E;  1EZ3 A;  4HEA A;  4DID B;  2CWY A;  3GA8 A;  4EOZ B;  2H89 A;  3RRC A;  3B57 A;  2WB5 A;  2V7K A;  2ZM6 T;  4C91 A;  1D0Z A;  1UCU A;  3FZL B;  3H37 A;  4PJJ A;  4QH1 A;  4TX5 A;  2BBJ A;  1ZKE A;  3UU3 A;  2Y6X A;  2WDQ A;  3AEC A;  4CN6 A;  5ETW A;  3AA1 B;  1MND A;  3KDS E;  4MBQ A;  1WLX A;  2NTY A;  2WCA A;  5JRE A;  2VAS A;  3V5U A;  3I0Q A;  5CA0 E;  4JYA T;  2NTX A;  2X0Y A;  5LGU B;  4XAX B;  5LMN T;  3JAE A;  5J2U E;  3AED A;  4P1N A;  4NUU A;  3AEB A;  5L4H A;  5AQU B;  1Y64 B;  3SWH A;  1BR1 A;  1HF8 A;  2LHN A;  1LKX A;  3PE0 A;  2E5L T;  2AXD S;  5AQI B;  3ZMV B;  4ADZ A;  2HPL A;  3UU8 A;  4EYY R;  4A97 A;  4X64 T;  3CX8 B;  2LOP A;  1YD8 G;  3F31 A;  3LSV A;  2CRB A;  5JR9 B;  4TV8 E;  3PUQ A;  2VUR A;  2UXC T;  2WSS V;  1R8I A;  3PUG A;  4DO0 A;  4QX7 B;  5JH7 E;  3K3Q C;  2IAK A;  2I59 A;  1IAP A;  4H9R C;  2YDS A;  2IC6 A;  2VVS A;  3N9P A;  2V7M A;  5KXJ A;  4EIW A;  2KLQ A;  3IA3 A;  3AE4 A;  3UTK A;  3AE6 A;  4U74 A;  5JDL A;  3CQX C;  3N9L A;  3AAI A;  3JAD A;  5LXT E;  4DV6 T;  2XHE B;  5CGM A;  1HG2 A;  3VR8 A;  4IT4 A;  3HI2 A;  4DV0 T;  2VQE T;  2W2U A;  5AQQ B;  5LB7 B;  4DMV A;  2LLY A;  1MMG A;  4OHF A;  3MKD A;  3E22 E;  4AKR B;  2M6I A;  2LKH A;  2LKG A;  3R6N A;  4B3T T;  2UU9 T;  2DWK A;  2PFV A;  1GQE A;  1XDO A;  1FMW A;  1W9R A;  3ZMT B;  4UEL A;  5L3E B;  3NBX X;  2E8I A;  4HFE A;  2BS2 A;  2V5C A;  3DTO A;  4EAH A;  4I50 E;  4HWC A;  3VKH A;  1BR0 A;  2Y48 B;  3QUJ A;  4UXN B;  4HFH A;  4LF4 T;  2JQ9 A;  5AQM B;  4BJM A;  5HEJ A;  1N33 T;  3O1H A;  4KUM B;  3BQK A;  4LF9 T;  2XQ5 A;  4PAG A;  2WDV A;  4DR4 T;  2UXX B;  2UUC T;  1HNW T;  1VRB A;  3K8P C;  4DBR A;  4GOU A;  4P0B A;  4Z8X A;  3Q9D A;  1KFY A;  1QSD A;  1IBL T;  5F8P A;  1MIV A;  3EAM A;  4OX9 T;  1VOM A;  5FY7 A;  2WZH A;  4O2A E;  4HE8 A;  4UV8 B;  4HFD A;  2V5D A;  5ABF B;  3G06 A;  1JNR A;  3RRW A;  1KNR A;  4UIG A;  2BKO A;  5FMN A;  4IDO A;  4DUY T;  4NUV A;  4DMW A;  5FY0 A;  1V9D A;  4DBQ A;  2OLT A;  2W0G A;  5HEO A;  2J62 A;  5AQJ B;  3ZSS A;  3BK9 A;  4EV6 A;  3UUL A;  5L4E A;  4CQI A;  5L3D B;  3AB3 B;  4O4I E;  3VHL A;  3CWZ B;  1US7 B;  2XQ9 A;  2LOS A;  4ILB A;  5F5W A;  2D5U A;  3RYH E;  2UXB T;  4QH4 A;  1WYC A;  2RA1 A;  1G8X A;  5AQN B;  4DV4 T;  4AKH A;  4AKG A;  5GON E;  3CIR A;  2JQH A;  2LE8 A;  4Z90 A;  3UUX B;  5CJ5 A;  3Q5E A;  3ZCJ A;  5C8Y E;  1SE7 A;  2A2F X;  5HXR A;  4MAL A;  2K3W A;  2C5K T;  3CVR A;  3RPU A;  5JDN A;  4L0R A;  4AQF C;  1UGO A;  3HR0 A;  5LHH B;  3F57 A;  2I6H A;  2V1D B;  4CZZ B;  1M62 A;  4YSX A;  5HAX A;  1ZV4 X;  4PK6 A;  2CA5 A;  5HXS A;  2LEH A;  3AEE A;  3GN5 A;  2PBI A;  4LFB T;  2L9Q A;  3ABV A;  4TZ4 C;  2HHH T;  4AIU A;  3TKL B;  3AE7 A;  2Q9Q D;  1X79 A;  2Q9Q B;  3HA4 A;  5C3J A;  3QC9 A;  3H3M A;  2LRK A;  4O4L E;  4I0U A;  3C4W A;  2YIN A;  4U33 A;  3B5M A;  2MOZ A;  3T8O A;  4UVA B;  3KBT A;  4I4T E;  3CPZ A;  1ZHC A;  4X62 T;  2CBI A;  3SFE A;  4HFC A;  1O3X A;  3UQ7 A;  4PK5 A;  5LNK A;  4OK0 A;  3C51 A;  2NW8 A;  5HEG A;  5DQW A;  5LJN A;  1ZEE A;  2BS3 A;  4DR7 T;  2VWA A;  5KDM C;  2X9X A;  3AEF A;  4ZZB A;  2K48 A;  3Q2M A;  4GYS A;  2RPA A;  3L8R A;  1IJ6 A;  2X9Y A;  4BJN A;  3F2E A;  4HTE A;  2ES0 A;  3A5X A;  2L3L A;  3ZYM A;  4DR3 T;  4U2Z A;  2NP9 A;  2LSI A;  2SPC A;  2D0U A;  4U31 A;  3C50 A;  4UV9 B;  2BS4 A;  1MIY A;  3AE3 A;  2Q9Q C;  2CXF A;  3JAF A;  1IZN B;  3J9X 1;  5LJM A;  1M7K A;  3NVO A;  3P4P A;  4NXM T;  3OTO T;  1I6Z A;  3VR9 A;  1D1B A;  1MMD A;  3FXE B;  2XSA A;  5JDM A;  5ABE A;  4AI6 A;  3AE8 A;  4AQG A;  2A9U A;  3MJX A;  2CHO A;  2DI4 A;  3UFE A;  3VU7 H;  2IHR 1;  5JRC B;  1WCR A;  2XQ3 A;  2FJD A;  3K3O A;  5IHY A;  2DL1 A;  2HN2 A;  2WWU A;  2VL8 A;  4JI4 T;  2GK9 A;  2JIW A;  4QWN B;  2LHR A;  2CHN A;  3VRB A;  5L47 A;  3LFM A;  4B3S T;  3IEE A;  4CXW A;  5LP6 E;  1U4Q A;  3HKC E;  3OKQ A;  2DWG A;  3L09 A;  4IDZ A;  2E9X A;  2FJA A;  3EDU A;  3O4X E;  2BG9 A;  4EZ4 A;  1YW0 A;  2QYW A;  4FI5 A;  4ZS3 A;  3T1H T;  3AXJ B;  3HKE E;  3CKD A;  3DP7 A;  1SHZ C;  1Y01 A;  3OBV E;  3I9W A;  4YTP A;  2W67 A;  3AE1 A;  3VKG A;  5JDG A;  4QXH B;  2XQ8 A;  3AA0 B;  3SS1 A;  2R6G F;  4U3C A;  1WR0 A;  2B76 A;  3RX6 A;  4U72 A;  3FHN A;  4KHP T;  3C98 B;  2C5I T;  3RQU A;  1D1C A;  2LSK A;  4AKL A;  2V6Y B;  3O1I A;  2BZB A;  4B6X A;  4H63 V;  4QXB B;  5FXX A;  2ACZ A;  2LT3 A;  4U7I A;  2BVL A;  3SRZ A;  4O2B E;  3ZN0 B;  5AFU L;  3U78 A;  3OYZ A;  3CML A;  4CI1 B;  4IE0 A;  3UQ4 A;  1YXR A;  2LSG A;  2HH7 A;  1YKH B;  4IE6 A;  2XQ4 A;  4DR6 T;  5LOV E;  1IJ5 A;  3EDV A;  3ZN1 B;  1OED B;  4YFS A;  3RH3 A;  3AEG A;  4G63 A;  4ERR A;  2CLY B;  2E5V A;  4JI0 T;  4XBF B;  2XAH B;  3PUW F;  2WZI A;  4YSY A;  2XPK A;  1XNQ T;  2W66 A;  1T7S A;  1XZY A;  3MZK B;  1XDP A;  5FXV A;  1HR0 T;  4X20 E;  3L39 A;  4Q25 A;  4E7Z A;  4BAY B;  3JC6 D;  3Q5W A;  2NW9 A;  4AQF A;  3I9Y A;  4IGU A;  4YTM A;  4H9N C;  5BR8 T;  4IL4 A;  4F8H A;  5AQL B;  3EI0 A;  4IE4 A;  2A3D A;  3GWH A;  3WAK A;  2JQK A;  2YU1 A;  2X68 A;  5L2L A;  2HN1 A;  3I1A A;  4AIS A;  3A7M A;  2D9D A;  3U3I A;  3CX6 B;  3FB2 A;  4ANJ A;  1UUS A;  3SOL A;  3ZMS B;  5JR9 C;  2Z6E A;  4IE7 A;  3OJA A;  3NZQ A;  2VB6 A;  2VK9 A;  3TLV A;  4PNI A;  4KP3 C;  5ABG A;  4GKJ T;  1OED C;  2DHR A;  2D2S A;  2XQY A;  1OXZ A;  5HWX A;  2X0H A;  5FKY A;  4DV7 T;  2CLY C;  5FYM A;  4L5G A;  3E0Z A;  4B3R T;  3UUN A;  2CWO A;  1HS7 A;  1CUN A;  1NEK A;  2QGS A;  4BA9 A;  5LCY A;  2KIN B;  3ONJ A;  3RYI E;  4ZZC A;  3ANW A;  5HEH A;  2XTL A;  3JC6 C;  1WFD A;  4DR1 T;  3RKG A;  3LK2 B;  5AQG B;  1VCT A;  2VKJ A;  1S35 A;  4DV2 T;  2K24 A;  3RLF F;  4UF0 A;  4TV9 E;  2ACX A;  3O9X A;  4ZI3 D;  4EB6 E;  1LVK A;  4DR2 T;  4QX8 B;  2Q9Q A;  2XZE A;  3QK6 A;  5JQG E;  2J4G A;  1NWM X;  3JCF A;  3ZT7 A;  2V7I A;  4HFB A;  4GYR A;  1D1A A;  3LBX A;  1NEN A;  4ZI2 D;  1WR6 A;  4PJN A;  5FVL A;  3RYC E;  2LM9 A;  2IW5 B;  3RGL A;  3AAE B;  3P4W A;  3E08 A;  5TAO A;  2FBW A;  4DV3 T;  4QH5 A;  3ZCI A;  4H9O C;  4NIQ A;  2XUE A;  5AQR B;  4DVD A;  4ILU A;  2UXN B;  2M67 A;  4HFI A;  4Z91 A;  2V8S V;  1HCI A;  2XAJ B;  5LG4 A;  1JNZ A;  4PFP A;  3QB5 A;  4M1P A;  4MHC A;  3RHW A;  4HKA A;  3OPC A;  4KBM B;  5LHG B;  5L3G B;  3AVR A;  3RIF A;  3C4Z A;  3FZF B;  3KVA A;  3LK3 B;  4ZI3 C;  5FNV E;  4TWF A;  2ZM8 A;  5A1L A;  2CXD A;  4U7Y A;  5BMV E;  4DV5 T;  3P8C D;  4YLH A;  2YEV C;  2X51 A;  1FIO A;  4P0A A;  2G0U A;  5AQT B;  3KV6 A;  3UU4 A;  5HCM A;  4E7S A;  5HEU A;  3NWI A;  2X9H A;  3C4X A;  3CQC B;  3AA6 B;  5E0O A;  3ZJ1 A;  5J2T E;  2WMO A;  2MAW A;  5LBQ B;  4B3M T;  4PFO A;  2N2N A;  1XMQ T;  2JQQ A;  4WW0 A;  2BKN A;  5FXW A;  2XM2 A;  5IWA T;  1LRZ A;  2H7V C;  4DR5 T;  2FJE A;  2CCQ A;  2WM9 A;  3RIU C;  2W62 A;  2W4X A;  2N9D A;  3FZK B;  3NRY A;  1KF6 A;  4ZOL E;  3PUS A;  3ETV A;  3ZST A;  4EZH A;  1S94 A;  2C5J A;  3VRA A;  2XY8 B;  5AQF B;  3ZPO A;  5DQV A;  5FL1 A;  5HYA A;  4QHO A;  4ISS A;  3W15 B;  3QOF A;  4A98 A;  2DLR A;  2CPT A;  4X65 T;  3RKO A;  5FL0 A;  2MYS A;  4HFV A;  2KMF A;  4XZC A;  3R84 B;  3IHR A;  5ABH A;  2J47 A;  3AVS A;  1FMV A;  3PJA J;  2MBG A;  2LJL A;  3ZKR A;  2LSY A;  3EUH A;  2YDR A;  1J1J A;  4PJL A;  3EVY A;  3HKB E;  3RYF E;  4J2C A;  2VKD A;  3UU5 A;  5JTG A;  2H7O A;  1OED E;  4YJ2 E;  3I0O A;  3P4Q A;  2EHO D;  2EHO B;  2PTF A;  5EK4 A;  4YJ3 E;  4IHJ E;  2ZMA A;  4A56 A;  2WS3 A;  3GN5 B;  1WYB A;  4LMK A;  1J5E T;  1KNZ A;  2F4V T;  4ZEY A;  5HWY A;  2K9A A;  1G73 A;  3P4R A;  3RC8 A;  2W61 A;  3KIN B;  5JR9 A;  2V7J A;  2ZM0 A;  3N5L A;  3GMI A;  2LRL A;  4X1I E;  4O8S A;  5DAB A;  4ILA A;  1OED A;  4JEU B;  5AQK B;  1HTJ F;  4X66 T;  1UUR A;  4A5X A;  4UVC B;  1XMO T;  4H9Q C;  3MA9 A;  1ZP0 A;  4COF A;  1E2A A;  5CA1 E;  4K0K T;  1YQ3 A;  5LMU T;  1XWM A;  4PJM A;  1BR2 A;  3P4S A;  1QUU A;  3EAB A;  4IIJ E;  5FVK A;  5LBM A;  1CHU A;  3HL6 A;  3NZP A;  2EHO C;  4JV5 T;  1HNZ T;  2ZLY A;  2QVA A;  3HKD E;  1T8B A;  1UX4 A;  2BVM A;  2WAU A;  4GIW A;  3Q5X A;  2UXD T;  1HNX T;  4LFC T;  2H3R A;  2KWH A;  1FEW A;  2YK0 A;  3LJC A;  2CEA A;  3RQW A;  2I0M A;  3PUX F;  5C2T A;  3IBP A;  3S4U A;  1XNR T;  1KEY A;  1W09 A;  5AQS B;  4EGW A;  4JI6 T;  4IDP A;  2ODV A;  1E7P A;  4IRE A;  1IBK T;  1KK7 A;  2LSJ A;  1SUM B;  3K3N A;  4CN4 A;  2KND A;  3N9O A;  2ZM2 A;  3PJA A;  3N9M A;  4L9I A;  2KWI B;  5JVD E;  2WU5 A;  3H3A A;  2QA7 A;  2FJB A;  3ZC1 A;  2XAS B;  2W63 A;  1B7T A;  4EYU A;  4EED A;  4EXT A;  2RP4 A;  2HPJ A;  4JI5 T;  5H6R B;  3RIA A;  5HXC A;  4HWD A;  2BBH A;  4GKK T;  4AQY T;  3NRX A;  4UR9 A;  3V5S A;  4DV1 T;  4TN7 B;  4AXP A;  5JDF A;  3P7I A;  3BQI A;  2ODU A;  3AAA B;  2CBJ A;  3AE2 A;  2LM2 A;  1T98 A;  1L0V A;  1BR4 A;  1QLB A;  4PK4 A;  3ZEF B;  2CMR A;  5AQV B;  4EEB A;  5ABF A;  4X1Y E;  3WI3 A;  3KV4 A;  4G2A A;  2E9X D;  2E9X B;  4NXN T;  2MTQ A;  4YSZ A;  2BG9 B;  4HWH A;  3PU8 A;  3ZT5 A;  3UUM A;  1SA0 E;  3KV5 A;  3UU6 A;  5HXH A;  4ZI7 E;  2YKS A;  4N78 D;  4ILC A;  3UT5 E;  4YXD A;  4WZX A;  3TLW A;  5LA6 E;  4WBN E;  4H63 H;  1HX1 B;  4HGA A;  4JEH B;  4UEM A;  3SFD A;  4LF5 T;  3AA7 B;  3ONX A;  2VKO A;  3L3P A;  5AQH B;  3B13 A;  3ONL C;  2W00 A;  4UVB B;  4CN1 A;  2PG8 A;  2VKH A;  1W0B A;  3RI5 A;  2B1E A;  1NAF A;  5EZY E;  4ASK A;  2CE7 A;  4CXX A;  2XM1 A;  3AE5 A;  4JBW F;  2V26 A;  2C0S A;  4KHZ F;  2IUB A;  2YDQ A;  5M4Y A;  3RIU A;  4DND A;  3QNU A;  2E9X C;  4H9S E;  2DNX A;  4X5T A;  2XSB A;  5KX5 E;  2BG9 C;  1ZOY A;  1U5P A;  1AJ3 A;  4IDQ A;  4C90 A;  2WBL A;  2WWV A;  3ZMU B;  5FY1 A;  4LF6 T;  2A72 A;  1VCS A;  4ZXL A;  4OYK A;  2YOE A;  4CI2 B;  3RF1 A;  5FP3 A;  5EK3 A;  2MPK A;  3A8Y C;  2OV9 A;  4CXY A;  3ZYK A;  5J1G A;  3TLS A;  3FBL A;  2NWB A;  4YY3 T;  1MIW A;  3TLU A;  3AEA A;  2X9W A;  3N9Q A;  2H88 A;  4JI8 T;  3QB5 K;  1Z8U A;  2X66 A;  2JPF A;  3IF8 B;  3PDY A;  3ZMZ B;  3N2O A;  3FZH B;  2IIU A;  2P9B A;  3PUZ F;  1HG5 A;  5L3F B;  1N36 T;  3T1Y T;  3ZT6 A;  1HX8 A;  4H9P C;  2XJ7 A;  4HN9 A;  4U2Y A;  3N2K E;  5DJQ C;  4TWH A;  2N1G A;  4I43 B;  4JI3 T;  4KI0 F;  5LGN B;  5EK2 A;  2JRK A;  2WP9 A;  1HFA A;  4O4J E;  4WBO A;  3MXZ A;  5CB4 E;  4JI7 T;  1E1H B;  4LMJ A;  3TLT A;  4K0U A;  4P09 A;  3O1J A;  2M6B A;  4OYJ A;  1YQ4 A;  3DJB A;  4YT0 A;  3C64 A;  2UUB T;  4F6R C;  4IE5 A;  1MMN A;  1W0A A;  2WU2 A;  4ZS2 A;  4LFA T;  2WDR A;  4NPP A;  3PUA A;  1MMA A;  3ANW B;  5J0Z A;  4LML A;  4IL9 A;  5CFB A;  2NW7 A;  4HWI B;  1J5W A;  3PTR B;  4O4H E;  4ZI2 C;  4MFR A;  5L3B B;  2XQA A;  1I94 T;  4TUY E;  4QXC B;  4KX6 A; 
#chains in the Genus database with same CATH homology
 3OPC A;  2FUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...