2FUPA

Crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
128
Chain Sequence
MPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELPVLQQLLGAKQPLMQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIANQASTGSLLNILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA3352
publication title Crystal structure of hypothetical protein (NP_252042.1) from Pseudomonas aeruginosa at 1.48 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 54
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05130 FlgN FlgN protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.300 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 FlgN-like 2fupA00
3OPCA 2FUPA
chains in the Genus database with same CATH superfamily
4LMLA 2JQHA 2YN6A 2DWKA 2H3RA 3AVSA 1ZHCA 3RQUA 4X62T 1N34T 3AE5A 3M65A 3LJCA 4TZ4C 3ZSSA 5AQHB 2JMKA 2BG9B 4UVAB 4MHCA 3FZKB 1YKHB 4JBWF 2UXCT 3SFDA 3PUZF 2HHHT 4I50E 4JEUB 2UUCT 1ZKEA 5JDMA 2WDRA 4JI7T 4YTNA 4Z90A 4EYYR 4KX6A 4JUYA 3ONJA 3I9YA 2WWUA 2VVSA 4H9SE 2HPLA 5L3EB 5J0ZA 4AIUA 1B7TA 2JQKA 3PUQA 2M67A 3L3PA 3RKOA 5KMGP 2K5BB 2ES0A 2Q9QD 4U74A 2XZEA 3EVYA 3L09A 3LDQB 5L3DB 4ERRA 1FMWA 5IYZE 2XTLA 2H7VC 5AQIB 3L39A 4TWDA 2LM9A 2X0YA 4HFCA 4IDZA 4QH4A 4QXBB 2ZM2A 2JQ9A 4B3TT 1YKEB 1D0ZA 3F31A 4KBMB 3P4RA 5FY0A 4CI1B 1JNRA 3IEEA 5LGUB 2D5UA 3B57A 1NEKA 4B3MT 3BQIA 3ZN0B 3VRBA 5L3BB 2E9XC 3V5UA 2X0HA 3I1AA 5AQRB 5LMNT 4PK6A 4NXNT 3AE3A 5FYMA 5JDQA 5LGTB 4DR6T 3HA4A 2X9WA 2A3DA 5HEJA 3PU8A 4PJNA 5HEUA 2NW9A 4PFPA 2XSBA 3FZHB 3HKCE 5JRCB 3P4QA 2WM9A 5HXEA 4UIGA 4IDOA 3RIAA 4PJMA 3IA3A 5J2UE 4KMCA 3JAEA 1IJ5A 2FBWA 2JJ9A 4UVBB 1XDPA 4EGWA 4B6XA 5ABEA 2BKNA 3ABVA 2IDOB 2WZHA 4V1Av 2MYSA 2KT9A 1X9BA 3C50A 3UTKA 4LF7T 5LHHB 4AQGA 5FVKA 3UQ7A 4A98A 2X68A 3I9WA 2VWAA 4UF0B 3X1DA 2CM0A 2WDQA 1E1HB 1G73A 4YT0A 3N9NA 5LGNB 4ZZBA 2C5IT 4U72A 3W15B 1IZNB 2HN2A 5JRCA 1NAFA 4L5GA 2WMNA 3TLVA 4CXWA 3UFGA 2FJAA 4KHPT 3VKHA 4COFA 4LF4T 3RC8A 3EDVA 3CQCB 2EHOB 3ETVA 4UEMA 4NPPA 4ZI7E 2IC6A 2LKGA 4B3RT 5LHGB 2FJDA 5FMNA 4H63H 3GWHA 3PUVF 1WCRA 5HCJA 4AQFA 3WAJA 4HWCA 5KDMC 5JDNA 3A5XA 4ISSA 5AQMB 4ZHQE 5IUXA 2WWVA 4U33A 4N78D 5IHYA 4MLKA 4CXYA 3HKDE 4X1KE 4UF0A 4PAGA 4HFVA 4HWFA 2A9UA 3E08A 3MZKB 2Z6EA 1MNDA 3P7IA 2UU9T 3PUYF 3NVOA 4IHJE 1KEYA 2JPFA 5CA0E 3PDYA 4ILCA 4DV3T 1T98A 2W67A 2J4GA 2W0GA 5BMVE 2CWYA 2W4XA 5AQNB 4OYKA 3KBUA 4X65T 4EEBA 2NW7A 5IWAT 1MIYA 2XJ7A 2KWHA 4EOZB 1D0YA 4PJJA 2ZM6T 5L47A 3AE4A 2VKDA 1HNZT 1KNRA 4L9IA 4LF9T 4GK5E 4DMVA 5HEGA 2CWOA 4CN1A 4QH5A 5EK2A 1IBMT 1HX1B 4IDQA 5JTGA 2CXFA 2ZMAA 3VU7H 1KNZA 1IAPA 2XQ6A 3EDUA 3RYFE 4UR9A 4BAYB 1IBKT 4QX8B 1J5ET 2JMHA 5HCMA 3C4ZA 4YFSA 5AQLB 5J2TE 2XM2A 4P1NA 3KVAA 4O8SA 4IDPA 1MMDA 3SS1A 3QB5A 3RX6A 4HEAA 3AA7B 5FNVE 2E9XB 4HFIA 3KFWX 4TWFA 2EHOD 2KMFA 4YHJA 2V7LA 3N2GE 2LSKA 2N1GA 5C8YE 2KLQA 2NOXA 2B76A 2CBJA 2IMLA 2X67A 2XQAA 4GOUA 1ZP0A 2XAJB 2LT3A 4GYRA 3KV6A 1O3XA 1E7PA 2IHR1 5JH7E 2H89A 3AE8A 3P8CD 3CK6A 2K48A 5AQPB 5LP6E 3CVRA 4CN6A 4TUYE 4EEDA 1LVKA 3T1YT 3N9QA 2D0UA 2V6YB 3AE7A 1VCSA 2VKHA 3NRYA 1U5PA 1FIOA 2E9XA 3FZLB 2LSYA 2XQ4A 4MBQA 2OA5A 1HNWT 2V7JA 4JI4T 3UU6A 4YJ2E 2XQ9A 3ZYKA 3JAFA 1S94A 3MA9A 2ODUA 2KWIB 2X9XA 1KF6A 3O4XE 1UCUA 4I4TE 2XHEB 4ILUA 4DNDA 1SHZC 3PURA 3Q5DA 1H7CA 4ZI3C 3ESLA 2VKOA 2VL0A 2D0TA 4ZS2A 2L3LA 5L4HA 2JQQA 4O2BE 2CRBA 2Y8DA 5LNKA 4TX5A 3RIFA 4JI6T 4EZ4A 1XWMA 1MIVA 3QUJA 3AEAA 3IHRA 3ZKRA 3DJBA 2WCAA 2OLTA 4GKJT 2ACXA 1Z0PA 5HWYA 1OEDC 2FJBA 3OYZA 4Z91A 2DLRA 1US7B 2J1DG 3CX6B 4LF6T 3VHLA 2E9XD 3PUXF 4XZCA 3AEDA 3ANWB 4JI8T 5EZYE 3VR8A 4TWHA 4IDNA 3AECA 3VR9A 3QK6A 2CBIA 3H37A 4H9QC 4GIWA 2MTQA 4YJ3E 1IJ6A 1KFYA 1D1CA 3ZYLA 1WYCA 1W09A 4X5TA 2BBJA 1Z8UA 4DV1T 1E2AA 1UX5A 4JEHB 4DR3T 2ZM8A 2CHOA 2YOEA 2RP4A 3BQKA 1HS7A 2NW8A 3RPUA 3P4WA 3PUWF 4ASKA 2PJQA 3LK42 3RLFF 3Q2MA 2NP9A 2KNDA 4TN7B 4DV2T 3ANWA 2NR4A 3NWIA 4HWIB 1WYBA 3TLSA 3ETUA 3ZT7A 3AXJB 2UXDT 2M6IA 5CA1E 1HTJF 1AJ3A 3MJXA 2L8KA 4OYJA 2MAWA 1MIWA 5CGMA 1XMQT 4CN4A 2QA7A 3LG7A 4H9RC 4A56A 2QVAA 1J1JA 4KP3C 4HFHA 3I0OA 5FXVA 5LBQB 2BS2A 4YHHT 1UGOA 4UXNB 3UU4A 3AEEA 2W00A 3WAKA 2AE9A 1OWAA 2W62A 3ZT6A 3OVUA 3OKQA 2W63A 3RF1A 2VURA 4QKNA 3JADA 3CMLA 4HGAA 1SE7A 4GYSA 2HPJA 5LXTE 5KXJA 4YXDA 2CEAA 4HTEA 1BR2A 4P0BA 1IBLT 5H6QB 3NRXA 4DO0A 3ZYMA 1MNEA 3K1SA 2CPTA 2XM1A 5LHIB 4CZZB 3AXJA 1N36T 5LBMA 2XQ3A 2RA1A 2YKSA 4IE0A 3NZPA 5CFBA 4HKAA 4J2CA 2YEVC 4WBNE 2V26A 4CQIA 2KZ7B 4I55E 5FXWA 4AQYT 3L8RA 3ZMZB 3NBXX 2LE8A 3CQGB 3T1HT 4DR2T 3ONLC 4YSZA 2C5KT 4EZHA 3R6NA 2D9DA 4HFBA 5DJQC 3RYCE 4ZEYA 1MMAA 4P0AA 3ZJ2A 2PG8A 2CLYC 2H7OA 4X1YE 3N9MA 4H9PC 5J1GA 2K3WA 5ETWA 3UUNA 4IGUA 5JVDE 2E8IA 1NENA 4UV8B 2IW5B 3C4XA 5JR9C 2WMOA 3K8PC 3RKGA 5HXRA 5M4YA 2IUBA 2BVLA 2IAKA 1SUMB 3G06A 1EZ3A 3AA1B 1BR1A 2JIWA 3SRZA 3RRWA 2PBIA 2UXBT 1MMNA 1GQEA 4F8HA 5L3FB 1HCIA 4F6RC 3TLWA 3PU3A 4PK5A 1HG5A 2BG9C 3IF8B 4PNIA 4H63V 4LF8T 5F5WA 2DCFA 4TNWA 1UX4A 4XBFB 5AQUB 3CX7B 3FBLA 2K9AA 3ZMVB 3ZJ1A 3PJAA 1T72A 3ZSTA 3C51A 2LOPA 2PTFA 5AQSB 1T7SA 2ACZA 3C98B 1UK5A 1XMOT 1X79A 2KXPB 1YXRA 2VVNA 4ILBA 2ZLYA 3VKGA 1M62A 2C0SA 4HWDA 5CB4E 3SFEA 5CJ5A 1OEDA 1QLBA 4DUYT 2FJEA 3Q9DA 3HR0A 3HKEE 3HL6A 4PW8A 3FB2A 3K3QC 2HH7A 3UUXB 1HG2A 2LRLA 3AAAB 3KV9A 3UU3A 2HN1A 3RGLA 4AKHA 3GN5A 2CCQA 2L9QA 3PTRB 4JI3T 4QH1A 4AKGA 5AQFB 4KHZF 1YQ3A 5LG3A 2BS3A 3RIUC 2LEHA 5FXXA 1OXZA 4QWNB 5FXZA 4ZI3D 4YTMA 4XAXB 3SOLA 4AKRB 4ZI2D 4H9OC 5ABGA 2YINA 3KVBA 1D0XA 1XZYA 1JNZA 2A72A 2V5CA 5AQTB 3RRCA 1CHUA 4C91A 4DBQA 2P9BA 3O1JA 4DV4T 2CXDA 1LRZA 4JI5T 4UVCB 3ZMUB 3FZMB 5LG4A 1NWMX 3CPZA 3ZC0A 3Q5XA 3B13A 4U2ZA 4EYUA 1W9RA 2DL1A 3AEGA 3JCFA 2WP9A 3AEFA 4IL4A 4EV6A 5F3JA 5HXHA 4IE7A 3N9LA 2VB6A 4LMJA 1YW0A 4X66T 2DI4A 5AQGB 1WR0A 3JC6C 4ZZCA 2MBGA 2H88A 1LVFA 3PE0A 3KV5A 4ANJA 1WR6A 1VOMA 3Q5WA 3PUAA 3CKDA 2W66A 4A5XA 4OX9T 5HYAA 4E7SA 2Y48B 3F2EA 3N9PA 2LKHA 3E0ZA 2WY2A 2XAFB 3M3ZB 3I0QA 2EHOC 2YDRA 3ZN1B 4ILAA 4NUVA 2J62A 3RH3A 5C3JA 3MXZA 4DBRA 5AFUL 1XNRT 4YY3T 3OPCA 3RC3A 1U4QA 5F8PA 4BA9A 4OFZA 4X64T 5HEOA 3CIRA 1L0VA 5JR9B 4DV5T 4EXTA 2YK0A 3AVRA 2MPKA 5LJMA 2X66A 5JDLA 4QXHB 2W2UA 4QXCB 1BR4A 5HXSA 4OK0A 4DR1T 2K24A 5FP3A 4UV9B 4MFRA 3KDSE 2XPKA 2VL8A 2KINB 2XQ8A 2LHNA 4NXMT 4IT4A 2RPAA 3P4PA 4C90A 2QRXA 4YSYA 5LOVE 1UUSA 2R6GF 3ZC1A 1HF8A 3AEBA 4TV9E 5L3GB 5AQJB 4E7ZA 4K0KT 5A1LA 4HFDA 3U78A 3BK9A 5JR9A 2I59A 5E0OA 2XY8B 5AQOB 5ABHA 3ZMTB 4LFBT 2WZIA 3CX8B 2QGSA 2XAHB 3QNUA 4U31A 3KBTA 3PJAJ 3MACA 5FKYA 2QYWA 4JLEA 3P50A 4ZOLE 3RHWA 1HFAA 3MKDA 2VK9A 3QC9A 2E5LT 3FXEB 3CQXC 3UQ4A 5LMUT 4DR5T 4LMKA 5HWXA 4B3ST 1QSDA 2BG9A 2XSAA 2ODVA 4O4HE 3AAIA 2IC9A 4OHFA 3AA0B 3FBZA 3A7MA 5LA6E 4FI5A 2BKOA 2BVMA 5AQQB 4IREA 5LYJE 2BKPA 1KNPA 5HAXA 2WU5A 2E2AA 4O4LE 4WW0A 1V9DA 5LB7B 2WSSV 3S4UA 2B1EA 3AAEB 1XNQT 5DQVA 2YDQA 3UFEA 1T8BA 2I0MA 4PFOA 3PUSA 4PJLA 5JREA 2WAUA 2NWBA 4TNVA 2XAGB 3C4WA 4YTPA 2YU1A 3TKLB 3EHZA 4IE4A 3H3AA 2C5JA 2LLYA 1OEDE 3QB5K 4DV7T 5DABA 2F4VT 3B5MA 5JDGA 3UUMA 2XUEA 2X9HA 5KX5E 3NZQA 5FVLA 3LFMA 4JYAT 4O4IE 1W0BA 2Q9QC 4QX7B 1FMVA 2LRKA 4DIDB 2V5DA 1ZV4X 3N5LA 4LF5T 2LSGA 4PK4A 2UXNB 3SWHA 5LJNA 1J5WA 5GONE 1I6ZA 4DMWA 3FZFB 3TLUA 4IE6A 4ISTA 2V7MA 4WBOA 1ZEEA 5L2LA 3HKBE 4UELA 2JRKA 3RQWA 5JQGE 3RIUA 4IIJE 2FUPA 2E5VA 4DV6T 1W0AA 4M1PA 4HN9A 4IL9A 2IIUA 4K0UA 2VASA 2XASB 4KI0F 4DR7T 3GA8A 2V1DB 3A8YC 4BJMA 4DV0T 3N2KE 3OTOT 1SA0E 4HE8A 3HI2A 3LSVA 3UU5A 2V7IA 4NUUA 4O2AE 4JI1T 4JV5T 2DNXA 2WDVA 2X0LB 3AB3B 4NIQA 3BQLA 5AQVB 4CI3B 3K3OA 2V7KA 2CMRA 1S35A 3J7Yq 5FY7A 3AE2A 3ZMSB 5JDFA 1Y01A 4A97A 2Y6XA 3ZEFB 2WBLA 4WYVA 2LOSA 1OEDB 2N9DA 2AXDS 3DTOA 1QUUA 3V5SA 5TAOA 2M6BA 4FJOA 4ADZA 3U3IA 2V8SV 4WZXA 1I94T 4YSXA 2WB5A 4HFEA 3QOFA 4AI6A 4KUMB 3AE9A 3EABA 3GN5B 2MOZA 3UULA 3ONXA 2VQFT 1YQ4A 4U7IA 3RYHE 1CUNA 2EHOA 4I0UA 2ZM0A 2LJLA 2BBHA 4I43B 3WI3A 5JDHA 3ZCJA 3EI0A 3D0TA 3FHNA 2WQYA 4G63A 2BZBA 5LCYA 1HNXT 3OJAA 5C2TA 3UU8A 2YDSA 1FEWA 2KSRA 2DHRA 4X1IE 3F57A 5FY1A 1HX8A 5AQKB 3LK3B 5ADXL 4LFAT 4QHOA 1D1AA 5EK3A 2CXLA 4AXPA 2BDEA 2XQ7A 2G0UA 3KV4A 4H9NC 3TLTA 3LK2B 1WLXA 1R8IA 4P09A 4GK0E 3JC6D 4DR4T 4O4JE 1ZOYA 1N32T 2WU2A 3ZPOA 3N2OA 4MALA 3E22E 3AE1A 2UUAT 3PUGA 4U7YA 3CWZB 1KK7A 5HEHA 3MK7C 1VRBA 3LBXB 3O1IA 4DUZT 2YU2A 5HXCA 5L3CB 5L4EA 3DP7A 4TV8E 4U3CA 3FXDB 1YD8G 2DWGA 2UXXB 2CE7A 3UT5E 3KINB 4LFCT 1DU2A 2XAQB 3T8OA 3EUHA 5BR8T 3OBVE 4ZS3A 5FL0A 1VCTA 3IBPA 3UUBA 1HR0T 4WNKA 2I6HA 3PV0F 3ZT5A 3K3NA 4L0RA 2N2NA 4JI0T 3C64A 4ZXLA 2BG9E 3GMIA 1M7KA 2VQET 4AISA 1FJGT 3EAMA 3J9X1 1G8XA 4CI2B 2J47A 2X51A 2LSJA 2Q9QB 3R84B 4EAHA 4AQFC 1BR0A 3OYXA 3H3MA 3LBXA 4G2AA 2XQ5A 4EIWA 2D2SA 5ABFB 4EB6E 4X20E 2UUBT 4YLHA 1WRDA 1XDOA 2BS4A 1D1BA 4GKKT 4IE5A 4DVDA 2CA5A 3P4SA 4Z8XA 5DQWA 1UURA 2SPCA 4U2YA 4AKLA 2X9YA 4BJNA 2CHNA 4CXXA 2WS3A 1MMGA 3RYIE 2A2FX 5EK4A 2CLYB 2PFVA 3AA6B 2XQYA 3AE6A 2OV9A 3ZCIA 2V6XA 4JI2T 2VKJA 5FL1A 4Q25A 3ZLIA 2Q9QA 3RI5A 1Y64B 4AKIA 2NTYA 4ZI2C 3Q5EA 3NKZA 2NTXA 5H6RB 3VRAA 2V6YA 2LM2A 4HWHA 2LHRA 2GK9A 2LSIA 1WFDA 2W61A 3N9OA 3O1HA 3O9XA 1LKXA 5ABFA 1N33T
chains in the Genus database with same CATH topology
3OPCA 2FUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPC A;  2FUP A; 
#chains in the Genus database with same CATH topology
 4LML A;  2JQH A;  2YN6 A;  2DWK A;  2H3R A;  3AVS A;  1ZHC A;  3RQU A;  4X62 T;  1N34 T;  3AE5 A;  3M65 A;  3LJC A;  4TZ4 C;  3ZSS A;  5AQH B;  2JMK A;  2BG9 B;  4UVA B;  4MHC A;  3FZK B;  1YKH B;  4JBW F;  2UXC T;  3SFD A;  3PUZ F;  2HHH T;  4I50 E;  4JEU B;  2UUC T;  1ZKE A;  5JDM A;  2WDR A;  4JI7 T;  4YTN A;  4Z90 A;  4EYY R;  4KX6 A;  4JUY A;  3ONJ A;  3I9Y A;  2WWU A;  2VVS A;  4H9S E;  2HPL A;  5L3E B;  5J0Z A;  4AIU A;  1B7T A;  2JQK A;  3PUQ A;  2M67 A;  3L3P A;  3RKO A;  5KMG P;  2K5B B;  2ES0 A;  2Q9Q D;  4U74 A;  2XZE A;  3EVY A;  3L09 A;  3LDQ B;  5L3D B;  4ERR A;  1FMW A;  5IYZ E;  2XTL A;  2H7V C;  5AQI B;  3L39 A;  4TWD A;  2LM9 A;  2X0Y A;  4HFC A;  4IDZ A;  4QH4 A;  4QXB B;  2ZM2 A;  2JQ9 A;  4B3T T;  1YKE B;  1D0Z A;  3F31 A;  4KBM B;  3P4R A;  5FY0 A;  4CI1 B;  1JNR A;  3IEE A;  5LGU B;  2D5U A;  3B57 A;  1NEK A;  4B3M T;  3BQI A;  3ZN0 B;  3VRB A;  5L3B B;  2E9X C;  3V5U A;  2X0H A;  3I1A A;  5AQR B;  5LMN T;  4PK6 A;  4NXN T;  3AE3 A;  5FYM A;  5JDQ A;  5LGT B;  4DR6 T;  3HA4 A;  2X9W A;  2A3D A;  5HEJ A;  3PU8 A;  4PJN A;  5HEU A;  2NW9 A;  4PFP A;  2XSB A;  3FZH B;  3HKC E;  5JRC B;  3P4Q A;  2WM9 A;  5HXE A;  4UIG A;  4IDO A;  3RIA A;  4PJM A;  3IA3 A;  5J2U E;  4KMC A;  3JAE A;  1IJ5 A;  2FBW A;  2JJ9 A;  4UVB B;  1XDP A;  4EGW A;  4B6X A;  5ABE A;  2BKN A;  3ABV A;  2IDO B;  2WZH A;  4V1A v;  2MYS A;  2KT9 A;  1X9B A;  3C50 A;  3UTK A;  4LF7 T;  5LHH B;  4AQG A;  5FVK A;  3UQ7 A;  4A98 A;  2X68 A;  3I9W A;  2VWA A;  4UF0 B;  3X1D A;  2CM0 A;  2WDQ A;  1E1H B;  1G73 A;  4YT0 A;  3N9N A;  5LGN B;  4ZZB A;  2C5I T;  4U72 A;  3W15 B;  1IZN B;  2HN2 A;  5JRC A;  1NAF A;  4L5G A;  2WMN A;  3TLV A;  4CXW A;  3UFG A;  2FJA A;  4KHP T;  3VKH A;  4COF A;  4LF4 T;  3RC8 A;  3EDV A;  3CQC B;  2EHO B;  3ETV A;  4UEM A;  4NPP A;  4ZI7 E;  2IC6 A;  2LKG A;  4B3R T;  5LHG B;  2FJD A;  5FMN A;  4H63 H;  3GWH A;  3PUV F;  1WCR A;  5HCJ A;  4AQF A;  3WAJ A;  4HWC A;  5KDM C;  5JDN A;  3A5X A;  4ISS A;  5AQM B;  4ZHQ E;  5IUX A;  2WWV A;  4U33 A;  4N78 D;  5IHY A;  4MLK A;  4CXY A;  3HKD E;  4X1K E;  4UF0 A;  4PAG A;  4HFV A;  4HWF A;  2A9U A;  3E08 A;  3MZK B;  2Z6E A;  1MND A;  3P7I A;  2UU9 T;  3PUY F;  3NVO A;  4IHJ E;  1KEY A;  2JPF A;  5CA0 E;  3PDY A;  4ILC A;  4DV3 T;  1T98 A;  2W67 A;  2J4G A;  2W0G A;  5BMV E;  2CWY A;  2W4X A;  5AQN B;  4OYK A;  3KBU A;  4X65 T;  4EEB A;  2NW7 A;  5IWA T;  1MIY A;  2XJ7 A;  2KWH A;  4EOZ B;  1D0Y A;  4PJJ A;  2ZM6 T;  5L47 A;  3AE4 A;  2VKD A;  1HNZ T;  1KNR A;  4L9I A;  4LF9 T;  4GK5 E;  4DMV A;  5HEG A;  2CWO A;  4CN1 A;  4QH5 A;  5EK2 A;  1IBM T;  1HX1 B;  4IDQ A;  5JTG A;  2CXF A;  2ZMA A;  3VU7 H;  1KNZ A;  1IAP A;  2XQ6 A;  3EDU A;  3RYF E;  4UR9 A;  4BAY B;  1IBK T;  4QX8 B;  1J5E T;  2JMH A;  5HCM A;  3C4Z A;  4YFS A;  5AQL B;  5J2T E;  2XM2 A;  4P1N A;  3KVA A;  4O8S A;  4IDP A;  1MMD A;  3SS1 A;  3QB5 A;  3RX6 A;  4HEA A;  3AA7 B;  5FNV E;  2E9X B;  4HFI A;  3KFW X;  4TWF A;  2EHO D;  2KMF A;  4YHJ A;  2V7L A;  3N2G E;  2LSK A;  2N1G A;  5C8Y E;  2KLQ A;  2NOX A;  2B76 A;  2CBJ A;  2IML A;  2X67 A;  2XQA A;  4GOU A;  1ZP0 A;  2XAJ B;  2LT3 A;  4GYR A;  3KV6 A;  1O3X A;  1E7P A;  2IHR 1;  5JH7 E;  2H89 A;  3AE8 A;  3P8C D;  3CK6 A;  2K48 A;  5AQP B;  5LP6 E;  3CVR A;  4CN6 A;  4TUY E;  4EED A;  1LVK A;  3T1Y T;  3N9Q A;  2D0U A;  2V6Y B;  3AE7 A;  1VCS A;  2VKH A;  3NRY A;  1U5P A;  1FIO A;  2E9X A;  3FZL B;  2LSY A;  2XQ4 A;  4MBQ A;  2OA5 A;  1HNW T;  2V7J A;  4JI4 T;  3UU6 A;  4YJ2 E;  2XQ9 A;  3ZYK A;  3JAF A;  1S94 A;  3MA9 A;  2ODU A;  2KWI B;  2X9X A;  1KF6 A;  3O4X E;  1UCU A;  4I4T E;  2XHE B;  4ILU A;  4DND A;  1SHZ C;  3PUR A;  3Q5D A;  1H7C A;  4ZI3 C;  3ESL A;  2VKO A;  2VL0 A;  2D0T A;  4ZS2 A;  2L3L A;  5L4H A;  2JQQ A;  4O2B E;  2CRB A;  2Y8D A;  5LNK A;  4TX5 A;  3RIF A;  4JI6 T;  4EZ4 A;  1XWM A;  1MIV A;  3QUJ A;  3AEA A;  3IHR A;  3ZKR A;  3DJB A;  2WCA A;  2OLT A;  4GKJ T;  2ACX A;  1Z0P A;  5HWY A;  1OED C;  2FJB A;  3OYZ A;  4Z91 A;  2DLR A;  1US7 B;  2J1D G;  3CX6 B;  4LF6 T;  3VHL A;  2E9X D;  3PUX F;  4XZC A;  3AED A;  3ANW B;  4JI8 T;  5EZY E;  3VR8 A;  4TWH A;  4IDN A;  3AEC A;  3VR9 A;  3QK6 A;  2CBI A;  3H37 A;  4H9Q C;  4GIW A;  2MTQ A;  4YJ3 E;  1IJ6 A;  1KFY A;  1D1C A;  3ZYL A;  1WYC A;  1W09 A;  4X5T A;  2BBJ A;  1Z8U A;  4DV1 T;  1E2A A;  1UX5 A;  4JEH B;  4DR3 T;  2ZM8 A;  2CHO A;  2YOE A;  2RP4 A;  3BQK A;  1HS7 A;  2NW8 A;  3RPU A;  3P4W A;  3PUW F;  4ASK A;  2PJQ A;  3LK4 2;  3RLF F;  3Q2M A;  2NP9 A;  2KND A;  4TN7 B;  4DV2 T;  3ANW A;  2NR4 A;  3NWI A;  4HWI B;  1WYB A;  3TLS A;  3ETU A;  3ZT7 A;  3AXJ B;  2UXD T;  2M6I A;  5CA1 E;  1HTJ F;  1AJ3 A;  3MJX A;  2L8K A;  4OYJ A;  2MAW A;  1MIW A;  5CGM A;  1XMQ T;  4CN4 A;  2QA7 A;  3LG7 A;  4H9R C;  4A56 A;  2QVA A;  1J1J A;  4KP3 C;  4HFH A;  3I0O A;  5FXV A;  5LBQ B;  2BS2 A;  4YHH T;  1UGO A;  4UXN B;  3UU4 A;  3AEE A;  2W00 A;  3WAK A;  2AE9 A;  1OWA A;  2W62 A;  3ZT6 A;  3OVU A;  3OKQ A;  2W63 A;  3RF1 A;  2VUR A;  4QKN A;  3JAD A;  3CML A;  4HGA A;  1SE7 A;  4GYS A;  2HPJ A;  5LXT E;  5KXJ A;  4YXD A;  2CEA A;  4HTE A;  1BR2 A;  4P0B A;  1IBL T;  5H6Q B;  3NRX A;  4DO0 A;  3ZYM A;  1MNE A;  3K1S A;  2CPT A;  2XM1 A;  5LHI B;  4CZZ B;  3AXJ A;  1N36 T;  5LBM A;  2XQ3 A;  2RA1 A;  2YKS A;  4IE0 A;  3NZP A;  5CFB A;  4HKA A;  4J2C A;  2YEV C;  4WBN E;  2V26 A;  4CQI A;  2KZ7 B;  4I55 E;  5FXW A;  4AQY T;  3L8R A;  3ZMZ B;  3NBX X;  2LE8 A;  3CQG B;  3T1H T;  4DR2 T;  3ONL C;  4YSZ A;  2C5K T;  4EZH A;  3R6N A;  2D9D A;  4HFB A;  5DJQ C;  3RYC E;  4ZEY A;  1MMA A;  4P0A A;  3ZJ2 A;  2PG8 A;  2CLY C;  2H7O A;  4X1Y E;  3N9M A;  4H9P C;  5J1G A;  2K3W A;  5ETW A;  3UUN A;  4IGU A;  5JVD E;  2E8I A;  1NEN A;  4UV8 B;  2IW5 B;  3C4X A;  5JR9 C;  2WMO A;  3K8P C;  3RKG A;  5HXR A;  5M4Y A;  2IUB A;  2BVL A;  2IAK A;  1SUM B;  3G06 A;  1EZ3 A;  3AA1 B;  1BR1 A;  2JIW A;  3SRZ A;  3RRW A;  2PBI A;  2UXB T;  1MMN A;  1GQE A;  4F8H A;  5L3F B;  1HCI A;  4F6R C;  3TLW A;  3PU3 A;  4PK5 A;  1HG5 A;  2BG9 C;  3IF8 B;  4PNI A;  4H63 V;  4LF8 T;  5F5W A;  2DCF A;  4TNW A;  1UX4 A;  4XBF B;  5AQU B;  3CX7 B;  3FBL A;  2K9A A;  3ZMV B;  3ZJ1 A;  3PJA A;  1T72 A;  3ZST A;  3C51 A;  2LOP A;  2PTF A;  5AQS B;  1T7S A;  2ACZ A;  3C98 B;  1UK5 A;  1XMO T;  1X79 A;  2KXP B;  1YXR A;  2VVN A;  4ILB A;  2ZLY A;  3VKG A;  1M62 A;  2C0S A;  4HWD A;  5CB4 E;  3SFE A;  5CJ5 A;  1OED A;  1QLB A;  4DUY T;  2FJE A;  3Q9D A;  3HR0 A;  3HKE E;  3HL6 A;  4PW8 A;  3FB2 A;  3K3Q C;  2HH7 A;  3UUX B;  1HG2 A;  2LRL A;  3AAA B;  3KV9 A;  3UU3 A;  2HN1 A;  3RGL A;  4AKH A;  3GN5 A;  2CCQ A;  2L9Q A;  3PTR B;  4JI3 T;  4QH1 A;  4AKG A;  5AQF B;  4KHZ F;  1YQ3 A;  5LG3 A;  2BS3 A;  3RIU C;  2LEH A;  5FXX A;  1OXZ A;  4QWN B;  5FXZ A;  4ZI3 D;  4YTM A;  4XAX B;  3SOL A;  4AKR B;  4ZI2 D;  4H9O C;  5ABG A;  2YIN A;  3KVB A;  1D0X A;  1XZY A;  1JNZ A;  2A72 A;  2V5C A;  5AQT B;  3RRC A;  1CHU A;  4C91 A;  4DBQ A;  2P9B A;  3O1J A;  4DV4 T;  2CXD A;  1LRZ A;  4JI5 T;  4UVC B;  3ZMU B;  3FZM B;  5LG4 A;  1NWM X;  3CPZ A;  3ZC0 A;  3Q5X A;  3B13 A;  4U2Z A;  4EYU A;  1W9R A;  2DL1 A;  3AEG A;  3JCF A;  2WP9 A;  3AEF A;  4IL4 A;  4EV6 A;  5F3J A;  5HXH A;  4IE7 A;  3N9L A;  2VB6 A;  4LMJ A;  1YW0 A;  4X66 T;  2DI4 A;  5AQG B;  1WR0 A;  3JC6 C;  4ZZC A;  2MBG A;  2H88 A;  1LVF A;  3PE0 A;  3KV5 A;  4ANJ A;  1WR6 A;  1VOM A;  3Q5W A;  3PUA A;  3CKD A;  2W66 A;  4A5X A;  4OX9 T;  5HYA A;  4E7S A;  2Y48 B;  3F2E A;  3N9P A;  2LKH A;  3E0Z A;  2WY2 A;  2XAF B;  3M3Z B;  3I0Q A;  2EHO C;  2YDR A;  3ZN1 B;  4ILA A;  4NUV A;  2J62 A;  3RH3 A;  5C3J A;  3MXZ A;  4DBR A;  5AFU L;  1XNR T;  4YY3 T;  3OPC A;  3RC3 A;  1U4Q A;  5F8P A;  4BA9 A;  4OFZ A;  4X64 T;  5HEO A;  3CIR A;  1L0V A;  5JR9 B;  4DV5 T;  4EXT A;  2YK0 A;  3AVR A;  2MPK A;  5LJM A;  2X66 A;  5JDL A;  4QXH B;  2W2U A;  4QXC B;  1BR4 A;  5HXS A;  4OK0 A;  4DR1 T;  2K24 A;  5FP3 A;  4UV9 B;  4MFR A;  3KDS E;  2XPK A;  2VL8 A;  2KIN B;  2XQ8 A;  2LHN A;  4NXM T;  4IT4 A;  2RPA A;  3P4P A;  4C90 A;  2QRX A;  4YSY A;  5LOV E;  1UUS A;  2R6G F;  3ZC1 A;  1HF8 A;  3AEB A;  4TV9 E;  5L3G B;  5AQJ B;  4E7Z A;  4K0K T;  5A1L A;  4HFD A;  3U78 A;  3BK9 A;  5JR9 A;  2I59 A;  5E0O A;  2XY8 B;  5AQO B;  5ABH A;  3ZMT B;  4LFB T;  2WZI A;  3CX8 B;  2QGS A;  2XAH B;  3QNU A;  4U31 A;  3KBT A;  3PJA J;  3MAC A;  5FKY A;  2QYW A;  4JLE A;  3P50 A;  4ZOL E;  3RHW A;  1HFA A;  3MKD A;  2VK9 A;  3QC9 A;  2E5L T;  3FXE B;  3CQX C;  3UQ4 A;  5LMU T;  4DR5 T;  4LMK A;  5HWX A;  4B3S T;  1QSD A;  2BG9 A;  2XSA A;  2ODV A;  4O4H E;  3AAI A;  2IC9 A;  4OHF A;  3AA0 B;  3FBZ A;  3A7M A;  5LA6 E;  4FI5 A;  2BKO A;  2BVM A;  5AQQ B;  4IRE A;  5LYJ E;  2BKP A;  1KNP A;  5HAX A;  2WU5 A;  2E2A A;  4O4L E;  4WW0 A;  1V9D A;  5LB7 B;  2WSS V;  3S4U A;  2B1E A;  3AAE B;  1XNQ T;  5DQV A;  2YDQ A;  3UFE A;  1T8B A;  2I0M A;  4PFO A;  3PUS A;  4PJL A;  5JRE A;  2WAU A;  2NWB A;  4TNV A;  2XAG B;  3C4W A;  4YTP A;  2YU1 A;  3TKL B;  3EHZ A;  4IE4 A;  3H3A A;  2C5J A;  2LLY A;  1OED E;  3QB5 K;  4DV7 T;  5DAB A;  2F4V T;  3B5M A;  5JDG A;  3UUM A;  2XUE A;  2X9H A;  5KX5 E;  3NZQ A;  5FVL A;  3LFM A;  4JYA T;  4O4I E;  1W0B A;  2Q9Q C;  4QX7 B;  1FMV A;  2LRK A;  4DID B;  2V5D A;  1ZV4 X;  3N5L A;  4LF5 T;  2LSG A;  4PK4 A;  2UXN B;  3SWH A;  5LJN A;  1J5W A;  5GON E;  1I6Z A;  4DMW A;  3FZF B;  3TLU A;  4IE6 A;  4IST A;  2V7M A;  4WBO A;  1ZEE A;  5L2L A;  3HKB E;  4UEL A;  2JRK A;  3RQW A;  5JQG E;  3RIU A;  4IIJ E;  2FUP A;  2E5V A;  4DV6 T;  1W0A A;  4M1P A;  4HN9 A;  4IL9 A;  2IIU A;  4K0U A;  2VAS A;  2XAS B;  4KI0 F;  4DR7 T;  3GA8 A;  2V1D B;  3A8Y C;  4BJM A;  4DV0 T;  3N2K E;  3OTO T;  1SA0 E;  4HE8 A;  3HI2 A;  3LSV A;  3UU5 A;  2V7I A;  4NUU A;  4O2A E;  4JI1 T;  4JV5 T;  2DNX A;  2WDV A;  2X0L B;  3AB3 B;  4NIQ A;  3BQL A;  5AQV B;  4CI3 B;  3K3O A;  2V7K A;  2CMR A;  1S35 A;  3J7Y q;  5FY7 A;  3AE2 A;  3ZMS B;  5JDF A;  1Y01 A;  4A97 A;  2Y6X A;  3ZEF B;  2WBL A;  4WYV A;  2LOS A;  1OED B;  2N9D A;  2AXD S;  3DTO A;  1QUU A;  3V5S A;  5TAO A;  2M6B A;  4FJO A;  4ADZ A;  3U3I A;  2V8S V;  4WZX A;  1I94 T;  4YSX A;  2WB5 A;  4HFE A;  3QOF A;  4AI6 A;  4KUM B;  3AE9 A;  3EAB A;  3GN5 B;  2MOZ A;  3UUL A;  3ONX A;  2VQF T;  1YQ4 A;  4U7I A;  3RYH E;  1CUN A;  2EHO A;  4I0U A;  2ZM0 A;  2LJL A;  2BBH A;  4I43 B;  3WI3 A;  5JDH A;  3ZCJ A;  3EI0 A;  3D0T A;  3FHN A;  2WQY A;  4G63 A;  2BZB A;  5LCY A;  1HNX T;  3OJA A;  5C2T A;  3UU8 A;  2YDS A;  1FEW A;  2KSR A;  2DHR A;  4X1I E;  3F57 A;  5FY1 A;  1HX8 A;  5AQK B;  3LK3 B;  5ADX L;  4LFA T;  4QHO A;  1D1A A;  5EK3 A;  2CXL A;  4AXP A;  2BDE A;  2XQ7 A;  2G0U A;  3KV4 A;  4H9N C;  3TLT A;  3LK2 B;  1WLX A;  1R8I A;  4P09 A;  4GK0 E;  3JC6 D;  4DR4 T;  4O4J E;  1ZOY A;  1N32 T;  2WU2 A;  3ZPO A;  3N2O A;  4MAL A;  3E22 E;  3AE1 A;  2UUA T;  3PUG A;  4U7Y A;  3CWZ B;  1KK7 A;  5HEH A;  3MK7 C;  1VRB A;  3LBX B;  3O1I A;  4DUZ T;  2YU2 A;  5HXC A;  5L3C B;  5L4E A;  3DP7 A;  4TV8 E;  4U3C A;  3FXD B;  1YD8 G;  2DWG A;  2UXX B;  2CE7 A;  3UT5 E;  3KIN B;  4LFC T;  1DU2 A;  2XAQ B;  3T8O A;  3EUH A;  5BR8 T;  3OBV E;  4ZS3 A;  5FL0 A;  1VCT A;  3IBP A;  3UUB A;  1HR0 T;  4WNK A;  2I6H A;  3PV0 F;  3ZT5 A;  3K3N A;  4L0R A;  2N2N A;  4JI0 T;  3C64 A;  4ZXL A;  2BG9 E;  3GMI A;  1M7K A;  2VQE T;  4AIS A;  1FJG T;  3EAM A;  3J9X 1;  1G8X A;  4CI2 B;  2J47 A;  2X51 A;  2LSJ A;  2Q9Q B;  3R84 B;  4EAH A;  4AQF C;  1BR0 A;  3OYX A;  3H3M A;  3LBX A;  4G2A A;  2XQ5 A;  4EIW A;  2D2S A;  5ABF B;  4EB6 E;  4X20 E;  2UUB T;  4YLH A;  1WRD A;  1XDO A;  2BS4 A;  1D1B A;  4GKK T;  4IE5 A;  4DVD A;  2CA5 A;  3P4S A;  4Z8X A;  5DQW A;  1UUR A;  2SPC A;  4U2Y A;  4AKL A;  2X9Y A;  4BJN A;  2CHN A;  4CXX A;  2WS3 A;  1MMG A;  3RYI E;  2A2F X;  5EK4 A;  2CLY B;  2PFV A;  3AA6 B;  2XQY A;  3AE6 A;  2OV9 A;  3ZCI A;  2V6X A;  4JI2 T;  2VKJ A;  5FL1 A;  4Q25 A;  3ZLI A;  2Q9Q A;  3RI5 A;  1Y64 B;  4AKI A;  2NTY A;  4ZI2 C;  3Q5E A;  3NKZ A;  2NTX A;  5H6R B;  3VRA A;  2V6Y A;  2LM2 A;  4HWH A;  2LHR A;  2GK9 A;  2LSI A;  1WFD A;  2W61 A;  3N9O A;  3O1H A;  3O9X A;  1LKX A;  5ABF A;  1N33 T; 
#chains in the Genus database with same CATH homology
 3OPC A;  2FUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...