2FUPA

Crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
128
Chain Sequence
MPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELPVLQQLLGAKQPLMQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIANQASTGSLLNILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords hypothetical protein PA3352
publication title Crystal structure of hypothetical protein (NP_252042.1) from Pseudomonas aeruginosa at 1.48 A resolution
rcsb
source organism Pseudomonas aeruginosa
total genus 54
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05130 FlgN FlgN protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.300 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 FlgN-like 2fupA00
3OPCA 2FUPA
chains in the Genus database with same CATH superfamily
1KNPA 3RKGA 3QNUA 1VCTA 4X1YE 2H3RA 3JC6D 4ZHQE 1HTJF 4O2AE 2WBLA 3PUVF 1WFDA 3U3IA 3UUNA 3P4PA 2QVAA 4I43B 3TLVA 1I94T 2JMHA 4TV8E 3SOLA 3QC9A 4HFDA 2E5LT 5FP3A 3RGLA 2L9QA 2VVNA 1WYCA 1H7CA 2PG8A 2OLTA 3S4UA 4QX8B 1X9BA 5CA0E 3HKBE 3JC6C 3WAKA 1W0AA 3UFEA 5AQOB 4A5XA 3PUXF 3BQKA 4G2AA 3HR0A 3AA1B 2IC6A 3QB5K 4IHJE 4ZI7E 2FJAA 2MYSA 3AA6B 2H7OA 3TLSA 4U7IA 4UV9B 4WW0A 2LE8A 4HWCA 3AE3A 4IDZA 4J2CA 2XSAA 2BZBA 4ISTA 3KVAA 2RPAA 2V7MA 5AQFB 5FXWA 2V1DB 1I6ZA 2V6XA 2DHRA 2JRKA 3GA8A 2NW8A 3E22E 5LNKA 5L4EA 1XDOA 5AQSB 2J1DG 4B3TT 3JAEA 4CXYA 3NVOA 1WYBA 2VQFT 1KNZA 2B76A 3IHRA 3AVSA 4HFVA 3LBXA 4U72A 3AXJA 5C3JA 3F2EA 5JR9C 4BJNA 2K24A 3NZPA 3AE7A 3AVRA 4NPPA 4G63A 4UVBB 4MBQA 2JIWA 3U78A 2XZEA 5FKYA 2VK9A 4TWHA 1D0XA 5IWAT 3UU3A 3PV0F 4DO0A 4ILAA 4YHJA 3M65A 4NXMT 5JVDE 4DV3T 4PFPA 2EHOB 3UFGA 2FBWA 2X9HA 1IJ5A 2BVLA 2XM2A 2VURA 4AI6A 1WR6A 3K3QC 4UR9A 4UV8B 3C4WA 1MMDA 2V5DA 2XJ7A 2H88A 3ZT5A 5FXXA 1G8XA 2CXFA 4ZOLE 3AA0B 2BBJA 3ZN1B 5HXSA 3LK2B 1J1JA 4PJJA 4UF0B 3RIUA 5EK4A 2Q9QB 2MAWA 4B3MT 4WZXA 2Z6EA 3O9XA 3M3ZB 2WWUA 3RLFF 3CQCB 5FMNA 4X64T 2ZMAA 1OEDC 2YDQA 3OYXA 2CE7A 4CN1A 4ASKA 3PUYF 4QH1A 5JH7E 5ETWA 2JPFA 2UU9T 2KSRA 4CI3B 4JLEA 3N9LA 5FL1A 2WDVA 3BQLA 5F8PA 2FJEA 2RA1A 5L3EB 2LKGA 4MLKA 2VWAA 5LHGB 3LJCA 4P0BA 3C4ZA 2YKSA 4EZHA 2NR4A 2ODUA 5J2UE 3FZMB 2ACZA 3N2KE 1KNRA 2W0GA 2WMOA 4PK4A 2JQQA 3QB5A 1JNRA 4JEHB 3NKZA 4L9IA 5HXHA 2J62A 2CHOA 2V8SV 3MZKB 4ZS2A 2W67A 3C98B 1GQEA 1YXRA 2R6GF 2WM9A 3JAFA 3V5UA 4HTEA 3ZC1A 4X5TA 3AE1A 3UULA 3OJAA 1MMAA 4WBNE 4CN4A 3KV5A 5HXCA 2IW5B 3ZEFB 4JI4T 2LT3A 3ETUA 3ZT7A 4Q25A 3ANWB 2BS2A 3C4XA 4AQYT 5M4YA 1N36T 4P1NA 3L09A 3DP7A 4LF8T 4DR1T 4V1Av 5HCJA 3NZQA 1T8BA 4I50E 2DWKA 4MHCA 3B5MA 5F3JA 4H63V 3UU4A 4AKRB 1N32T 3K8PC 5C2TA 3O1HA 3EDUA 3UTKA 2C0SA 4TN7B 2BBHA 5FVLA 5AQQB 4BJMA 5J2TE 2XASB 4DVDA 5KMGP 2P9BA 4C90A 2F4VT 3Q5WA 1Z8UA 4EEDA 3ZSTA 5L3BB 5KX5E 5FY0A 1OXZA 5J1GA 2C5KT 4UVAB 2LSIA 4HN9A 4QH4A 2BG9E 5IHYA 3CIRA 3PUWF 3GN5A 5DABA 3P7IA 3Q5DA 5AQTB 5IYZE 3KINB 1J5ET 2PTFA 2XAQB 3QOFA 4CI2B 1WCRA 4HKAA 3N9NA 5AQIB 4DMVA 4DR6T 4H9SE 4CXWA 3OPCA 3EABA 2L8KA 5LG4A 3WAJA 2VKHA 4YT0A 5JR9A 4IE0A 2NWBA 2XAGB 2X67A 1MIWA 3I9WA 5FY7A 4OFZA 4KHPT 2IAKA 2LM9A 4CQIA 5TAOA 2VB6A 1D1CA 3RHWA 2V7JA 2UXCT 1MNEA 1ZHCA 4UVCB 2DNXA 4EIWA 3CX8B 3N9OA 2D5UA 3ZYLA 4AKIA 1AJ3A 5CGMA 4YTMA 3ZCJA 4WNKA 4E7ZA 4O2BE 4DV0T 3L39A 2W00A 3BQIA 4ADZA 4LFBT 3FZHB 2K48A 3TLUA 4CN6A 4GK5E 4P0AA 2NP9A 1CUNA 4X65T 4YSZA 4ZZBA 5AQMB 4DV2T 2VKJA 3JCFA 4AKGA 5DQWA 4ZI2D 4TUYE 2LHNA 4M1PA 4H9NC 3RF1A 3NRYA 2BKPA 2WCAA 3F31A 5JDHA 2CPTA 1OEDA 1HNWT 4DBQA 3SS1A 2I6HA 4OK0A 3NWIA 3CK6A 4XZCA 2KNDA 4EGWA 4DV1T 1UX5A 4I55E 5LMUT 5LA6E 4HGAA 4YJ3E 2N1GA 2XSBA 4LMLA 5HYAA 2PBIA 3EHZA 5L3GB 1NEKA 2EHOD 5AQKB 4PJLA 5L4HA 4ZI2C 3ZC0A 2G0UA 3VKGA 2D0TA 1OWAA 2M6BA 3H3MA 3LG7A 2X9WA 4X66T 3AAAB 3K3NA 2J47A 4DR2T 2XPKA 4TWFA 4K0UA 1U4QA 4OYKA 4LF5T 2WZHA 3HA4A 3C51A 3FB2A 2KWHA 3IA3A 3Q5XA 1SHZC 3N5LA 4PAGA 4ZZCA 1IBLT 2XQ4A 3CQGB 2NW7A 3FHNA 4DBRA 2ES0A 4DV6T 2CWOA 2KWIB 4AQGA 2Q9QD 2EHOC 5AQGB 1XZYA 3PU3A 4IE7A 2BG9C 4DNDA 1XMOT 2QA7A 5GONE 2M67A 2X68A 4B3ST 2CHNA 2DCFA 2MTQA 4ZI3D 3ZJ1A 4LMJA 4AQFC 3P4WA 2DWGA 2Y48B 3CX7B 2XQYA 3AEDA 1LKXA 3EVYA 3CMLA 2W2UA 4A98A 3ZCIA 5HEJA 5AQJB 3P4SA 2E9XD 2K9AA 2A3DA 3AE8A 2JQHA 4U2YA 4UIGA 1M7KA 1DU2A 4EAHA 2HN1A 3VKHA 4YTPA 4O8SA 2HPLA 2D9DA 2CLYB 3RC8A 4YXDA 5DQVA 2WDRA 2Q9QC 4N78D 4IDNA 2LM2A 3T1YT 2LRLA 2VQET 1UCUA 3OTOT 2VKOA 3KFWX 4ZI3C 2C5IT 2V6YB 1HR0T 5LBMA 4HWFA 3RH3A 3NBXX 1IJ6A 4TWDA 2VASA 3GWHA 5HWXA 3RQUA 2WQYA 2WDQA 2E9XC 3K1SA 2E2AA 4ZS3A 3PUQA 3UU5A 3DTOA 5H6RB 4EEBA 4DR7T 5L3CB 5FVKA 2JMKA 3ETVA 3N9MA 5CFBA 3AA7B 2CXDA 3HKDE 1WLXA 5LHIB 4YSYA 3EAMA 2ZM0A 2NOXA 2WP9A 5JRCB 1Z0PA 2NTYA 2WAUA 2I0MA 2XM1A 3P8CD 1HCIA 4I4TE 4L0RA 2BG9B 3H37A 1M62A 1LRZA 1MMGA 4O4LE 4F6RC 4H63H 2PFVA 3RRWA 1ZV4X 3AEBA 1HNZT 2V7IA 1W09A 2M6IA 2XAFB 1FJGT 2ZM6T 5EZYE 4IIJE 4AXPA 2J4GA 5BMVE 2B1EA 3ZMVB 3I9YA 5AFUL 2CXLA 4NXNT 1EZ3A 3ZT6A 4CI1B 1R8IA 4JI7T 5LJMA 2JQKA 4IDPA 2ODVA 4JI5T 1W0BA 3PTRB 4IE4A 3ZMZB 5LMNT 5E0OA 3R6NA 2XHEB 3OVUA 5LHHB 4AKLA 2E5VA 3ZMSB 2LJLA 3WI3A 3ZMUB 2V7LA 2E9XB 4X20E 3R84B 2DL1A 4JI6T 2KLQA 2XUEA 3UUMA 5L3FB 3P50A 3W15B 4HFHA 3O1JA 4GKJT 2H7VC 5J0ZA 1BR1A 3EI0A 3K3OA 2UXBT 4FI5A 4CXXA 2LEHA 4GYRA 4F8HA 3PUZF 2IMLA 4YHHT 2WY2A 4KX6A 3KV4A 3MKDA 4WYVA 4IDOA 4HFIA 3T1HT 4U31A 4ILBA 4L5GA 5L47A 3AE9A 3A8YC 3CKDA 3RPUA 1IBMT 1XDPA 3N2GE 5AQHB 3CWZB 3PDYA 3E08A 3LK42 2VVSA 2WB5A 5BR8T 5LCYA 1VCSA 1W9RA 5AQPB 4GIWA 2LLYA 4P09A 3FXEB 5JTGA 3KDSE 1S94A 5ADXL 3VRAA 4YLHA 2CA5A 1V9DA 3PJAA 2V7KA 4ISSA 3PUSA 3ABVA 4QXHB 1FMWA 5CJ5A 3RIAA 3ZYMA 2CRBA 2EHOA 3D0TA 2YU2A 2IDOB 5ABFB 2UUAT 1UURA 2X9YA 2BKOA 3ZJ2A 2YDSA 2WS3A 4KP3C 5JQGE 2BS4A 2CEAA 4AQFA 4TX5A 1US7B 4ILUA 2LHRA 3PUAA 4MFRA 1LVFA 3QK6A 1YQ3A 2WU5A 4QHOA 4AKHA 2XQ7A 2YOEA 4QWNB 4O4HE 3RYFE 3ESLA 3V5SA 4YSXA 4IL9A 1ZP0A 4UF0A 3FBLA 2Q9QA 2PJQA 3B13A 3SWHA 3ZYKA 4KMCA 4JI0T 1BR2A 2WZIA 2LOPA 1S35A 2CBIA 4IE5A 4EB6E 4DUYT 2YINA 4ILCA 3I0OA 3ZN0B 3FZKB 1FEWA 2VL0A 1YKHB 1KF6A 2NTXA 3L3PA 5JDGA 3IF8B 1MMNA 1JNZA 3PJAJ 1B7TA 4X1IE 1HF8A 1HFAA 2E9XA 3Q9DA 1E1HB 3UU6A 4OHFA 4U3CA 4Z91A 5HEGA 5LJNA 4OYJA 4LFAT 5LGNB 1ZKEA 1KEYA 4EZ4A 1E7PA 3A7MA 4DV4T 4U2ZA 3NRXA 4O4JE 3RKOA 4EXTA 2UUBT 4KHZF 4IREA 3MACA 2VL8A 1O3XA 4ZEYA 2X0YA 2W4XA 1UK5A 4X62T 3RYHE 3AAEB 2ZM2A 2UXXB 3CVRA 4DR4T 2CCQA 3AAIA 3FBZA 3LSVA 3RYIE 3VU7H 4JV5T 5DJQC 4WBOA 5ABHA 1VOMA 2XAHB 3ANWA 1Y64B 4IT4A 3N9QA 3O1IA 3LBXB 1QSDA 3AXJB 3ONXA 4NIQA 4GYSA 2WSSV 3KVBA 1Y01A 4H9OC 4GOUA 1ZEEA 3UU8A 2V26A 4LF6T 1UGOA 2CLYC 2IIUA 4HWIB 4HE8A 4QXCB 3AE6A 1T72A 2KMFA 4KUMB 3G06A 2HHHT 5L2LA 3KBUA 3SRZA 4OX9T 4HWHA 3RI5A 2YN6A 2UXNB 2BKNA 4H9QC 5L3DB 4U33A 3CQXC 2Y8DA 3HL6A 2N2NA 3UUXB 3FZLB 4PFOA 2IC9A 5JDNA 4DV7T 5HEHA 5JDMA 1OEDE 2YEVC 2GK9A 1D0YA 4HFBA 4TV9E 4C91A 3AE5A 2BVMA 2NW9A 5ABGA 4LF7T 4YJ2E 2XQ5A 2L3LA 1BR0A 2XQ6A 1T7SA 1FIOA 3UQ4A 5EK2A 4TNWA 2UXDT 3I0QA 4PW8A 3AB3B 3AEGA 5HXRA 2OV9A 5FY1A 4B6XA 3KV6A 5FXZA 1MIYA 3QUJA 5JDFA 4U74A 1XMQT 4AISA 3MJXA 5FL0A 2K5BB 4ZXLA 3MK7C 3PU8A 3VR9A 3UT5E 3AE4A 3F57A 1T98A 4AIUA 4I0UA 4JI2T 4DR3T 1SA0E 4EOZB 3TKLB 5FYMA 3SFEA 2XQ3A 3Q2MA 2K3WA 3PUGA 4NUUA 3RQWA 1D1AA 2XQAA 4HWDA 3ONJA 1NAFA 3ZMTB 1HX8A 2IHR1 2CMRA 5LYJE 5CB4E 2AE9A 4COFA 3AEEA 4U7YA 3GMIA 1N33T 2KT9A 1VRBA 4DV5T 1U5PA 1YQ4A 4QKNA 3VRBA 4IL4A 4JEUB 5KDMC 3PURA 1CHUA 1HG5A 2HPJA 4FJOA 3C50A 3FZFB 1X79A 2XTLA 5KXJA 4DUZT 5HCMA 3HI2A 4LF4T 2QGSA 1MIVA 1MNDA 5HEUA 1SE7A 5LOVE 1IAPA 1E2AA 3P4RA 3N9PA 5AQNB 5HEOA 1XNQT 3X1DA 2A9UA 3OYZA 3ONLC 3IEEA 4TZ4C 4YY3T 2W61A 4DIDB 2QYWA 4ANJA 3TLTA 2WU2A 3B57A 2BDEA 4KI0F 4LFCT 3AECA 4YTNA 1QLBA 4GK0E 2RP4A 2SPCA 2DI4A 2LSKA 3HKCE 4H9RC 4H9PC 2IUBA 1UUSA 4IGUA 1NENA 4DR5T 3EUHA 3FXDB 1KFYA 1LVKA 3UQ7A 1L0VA 3ZPOA 4HFCA 3GN5B 3IBPA 2JJ9A 3AEFA 2KZ7B 3LFMA 2VKDA 1UX4A 3ZSSA 5FXVA 3I1AA 1SUMB 3J9X1 2HH7A 2YU1A 2W66A 3E0ZA 4JI3T 5LGTB 2WWVA 2FJBA 5JR9B 2X0LB 4IDQA 4UELA 2OA5A 5A1LA 1HNXT 4JUYA 2JQ9A 3RC3A 2BS3A 2Y6XA 1IBKT 5ABEA 2V6YA 5AQUB 4EV6A 5LBQB 1WR0A 2X66A 3BK9A 4LMKA 2FJDA 2LSYA 2LSJA 3ZKRA 1YKEB 4JI8T 1WRDA 3CX6B 2X9XA 3OBVE 3N2OA 3MXZA 2QRXA 2W63A 4UXNB 1XWMA 2LOSA 2UUCT 3RRCA 5JRCA 3PE0A 2LKHA 2W62A 3P4QA 4EYYR 5EK3A 2H89A 2CM0A 2BG9A 4PJMA 2D0UA 3LDQB 5FNVE 4MALA 2WMNA 2E8IA 3CPZA 4TNVA 3O4XE 5AQLB 4A97A 1OEDB 1G73A 2N9DA 4QXBB 2A72A 2X51A 2XAJB 2KINB 2KXPB 1QUUA 3KBTA 1YD8G 3MA9A 5LP6E 1XNRT 5HXEA 4EYUA 1HS7A 5F5WA 3KV9A 2A2FX 2XQ8A 3RIFA 4Z90A 1D1BA 3C64A 5LB7B 4A56A 4PNIA 4Z8XA 1IZNB 2XQ9A 3Q5EA 4B3RT 2X0HA 3J7Yq 4BA9A 3VR8A 4UEMA 1ZOYA 2I59A 4E7SA 3L8RA 5JDLA 2CWYA 5H6QB 2V5CA 4JYAT 2MOZA 4YFSA 2D2SA 2YK0A 5LXTE 3AEAA 1HX1B 4PK5A 5CA1E 4XAXB 4HEAA 4O4IE 4PK6A 5C8YE 4GKKT 2XY8B 2LSGA 1N34T 2AXDS 4KBMB 3RYCE 5HAXA 4DMWA 5LGUB 1FMVA 3A5XA 1KK7A 2FUPA 2YDRA 4X1KE 2ZLYA 2ZM8A 1YW0A 4LF9T 3H3AA 4NUVA 2LRKA 3DJBA 2C5JA 2ACXA 2CBJA 5HWYA 4CZZB 3RIUC 4JBWF 4K0KT 3ZLIA 3AE2A 5AQVB 1BR4A 5IUXA 4QH5A 1J5WA 3UUBA 4BAYB 5AQRB 5JREA 1HG2A 3JADA 2HN2A 3EDVA 4JI1T 4PJNA 1D0ZA 3VHLA 4IE6A 5LG3A 4ERRA 2MBGA 2DLRA 3HKEE 1NWMX 5JDQA 3TLWA 2MPKA 5ABFA 4XBFB 3OKQA 4QX7B 3SFDA 3LK3B 3RX6A 3T8OA 4HFEA
chains in the Genus database with same CATH topology
3OPCA 2FUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPC A;  2FUP A; 
#chains in the Genus database with same CATH topology
 1KNP A;  3RKG A;  3QNU A;  1VCT A;  4X1Y E;  2H3R A;  3JC6 D;  4ZHQ E;  1HTJ F;  4O2A E;  2WBL A;  3PUV F;  1WFD A;  3U3I A;  3UUN A;  3P4P A;  2QVA A;  4I43 B;  3TLV A;  1I94 T;  2JMH A;  4TV8 E;  3SOL A;  3QC9 A;  4HFD A;  2E5L T;  5FP3 A;  3RGL A;  2L9Q A;  2VVN A;  1WYC A;  1H7C A;  2PG8 A;  2OLT A;  3S4U A;  4QX8 B;  1X9B A;  5CA0 E;  3HKB E;  3JC6 C;  3WAK A;  1W0A A;  3UFE A;  5AQO B;  4A5X A;  3PUX F;  3BQK A;  4G2A A;  3HR0 A;  3AA1 B;  2IC6 A;  3QB5 K;  4IHJ E;  4ZI7 E;  2FJA A;  2MYS A;  3AA6 B;  2H7O A;  3TLS A;  4U7I A;  4UV9 B;  4WW0 A;  2LE8 A;  4HWC A;  3AE3 A;  4IDZ A;  4J2C A;  2XSA A;  2BZB A;  4IST A;  3KVA A;  2RPA A;  2V7M A;  5AQF B;  5FXW A;  2V1D B;  1I6Z A;  2V6X A;  2DHR A;  2JRK A;  3GA8 A;  2NW8 A;  3E22 E;  5LNK A;  5L4E A;  1XDO A;  5AQS B;  2J1D G;  4B3T T;  3JAE A;  4CXY A;  3NVO A;  1WYB A;  2VQF T;  1KNZ A;  2B76 A;  3IHR A;  3AVS A;  4HFV A;  3LBX A;  4U72 A;  3AXJ A;  5C3J A;  3F2E A;  5JR9 C;  4BJN A;  2K24 A;  3NZP A;  3AE7 A;  3AVR A;  4NPP A;  4G63 A;  4UVB B;  4MBQ A;  2JIW A;  3U78 A;  2XZE A;  5FKY A;  2VK9 A;  4TWH A;  1D0X A;  5IWA T;  3UU3 A;  3PV0 F;  4DO0 A;  4ILA A;  4YHJ A;  3M65 A;  4NXM T;  5JVD E;  4DV3 T;  4PFP A;  2EHO B;  3UFG A;  2FBW A;  2X9H A;  1IJ5 A;  2BVL A;  2XM2 A;  2VUR A;  4AI6 A;  1WR6 A;  3K3Q C;  4UR9 A;  4UV8 B;  3C4W A;  1MMD A;  2V5D A;  2XJ7 A;  2H88 A;  3ZT5 A;  5FXX A;  1G8X A;  2CXF A;  4ZOL E;  3AA0 B;  2BBJ A;  3ZN1 B;  5HXS A;  3LK2 B;  1J1J A;  4PJJ A;  4UF0 B;  3RIU A;  5EK4 A;  2Q9Q B;  2MAW A;  4B3M T;  4WZX A;  2Z6E A;  3O9X A;  3M3Z B;  2WWU A;  3RLF F;  3CQC B;  5FMN A;  4X64 T;  2ZMA A;  1OED C;  2YDQ A;  3OYX A;  2CE7 A;  4CN1 A;  4ASK A;  3PUY F;  4QH1 A;  5JH7 E;  5ETW A;  2JPF A;  2UU9 T;  2KSR A;  4CI3 B;  4JLE A;  3N9L A;  5FL1 A;  2WDV A;  3BQL A;  5F8P A;  2FJE A;  2RA1 A;  5L3E B;  2LKG A;  4MLK A;  2VWA A;  5LHG B;  3LJC A;  4P0B A;  3C4Z A;  2YKS A;  4EZH A;  2NR4 A;  2ODU A;  5J2U E;  3FZM B;  2ACZ A;  3N2K E;  1KNR A;  2W0G A;  2WMO A;  4PK4 A;  2JQQ A;  3QB5 A;  1JNR A;  4JEH B;  3NKZ A;  4L9I A;  5HXH A;  2J62 A;  2CHO A;  2V8S V;  3MZK B;  4ZS2 A;  2W67 A;  3C98 B;  1GQE A;  1YXR A;  2R6G F;  2WM9 A;  3JAF A;  3V5U A;  4HTE A;  3ZC1 A;  4X5T A;  3AE1 A;  3UUL A;  3OJA A;  1MMA A;  4WBN E;  4CN4 A;  3KV5 A;  5HXC A;  2IW5 B;  3ZEF B;  4JI4 T;  2LT3 A;  3ETU A;  3ZT7 A;  4Q25 A;  3ANW B;  2BS2 A;  3C4X A;  4AQY T;  5M4Y A;  1N36 T;  4P1N A;  3L09 A;  3DP7 A;  4LF8 T;  4DR1 T;  4V1A v;  5HCJ A;  3NZQ A;  1T8B A;  4I50 E;  2DWK A;  4MHC A;  3B5M A;  5F3J A;  4H63 V;  3UU4 A;  4AKR B;  1N32 T;  3K8P C;  5C2T A;  3O1H A;  3EDU A;  3UTK A;  2C0S A;  4TN7 B;  2BBH A;  5FVL A;  5AQQ B;  4BJM A;  5J2T E;  2XAS B;  4DVD A;  5KMG P;  2P9B A;  4C90 A;  2F4V T;  3Q5W A;  1Z8U A;  4EED A;  3ZST A;  5L3B B;  5KX5 E;  5FY0 A;  1OXZ A;  5J1G A;  2C5K T;  4UVA B;  2LSI A;  4HN9 A;  4QH4 A;  2BG9 E;  5IHY A;  3CIR A;  3PUW F;  3GN5 A;  5DAB A;  3P7I A;  3Q5D A;  5AQT B;  5IYZ E;  3KIN B;  1J5E T;  2PTF A;  2XAQ B;  3QOF A;  4CI2 B;  1WCR A;  4HKA A;  3N9N A;  5AQI B;  4DMV A;  4DR6 T;  4H9S E;  4CXW A;  3OPC A;  3EAB A;  2L8K A;  5LG4 A;  3WAJ A;  2VKH A;  4YT0 A;  5JR9 A;  4IE0 A;  2NWB A;  2XAG B;  2X67 A;  1MIW A;  3I9W A;  5FY7 A;  4OFZ A;  4KHP T;  2IAK A;  2LM9 A;  4CQI A;  5TAO A;  2VB6 A;  1D1C A;  3RHW A;  2V7J A;  2UXC T;  1MNE A;  1ZHC A;  4UVC B;  2DNX A;  4EIW A;  3CX8 B;  3N9O A;  2D5U A;  3ZYL A;  4AKI A;  1AJ3 A;  5CGM A;  4YTM A;  3ZCJ A;  4WNK A;  4E7Z A;  4O2B E;  4DV0 T;  3L39 A;  2W00 A;  3BQI A;  4ADZ A;  4LFB T;  3FZH B;  2K48 A;  3TLU A;  4CN6 A;  4GK5 E;  4P0A A;  2NP9 A;  1CUN A;  4X65 T;  4YSZ A;  4ZZB A;  5AQM B;  4DV2 T;  2VKJ A;  3JCF A;  4AKG A;  5DQW A;  4ZI2 D;  4TUY E;  2LHN A;  4M1P A;  4H9N C;  3RF1 A;  3NRY A;  2BKP A;  2WCA A;  3F31 A;  5JDH A;  2CPT A;  1OED A;  1HNW T;  4DBQ A;  3SS1 A;  2I6H A;  4OK0 A;  3NWI A;  3CK6 A;  4XZC A;  2KND A;  4EGW A;  4DV1 T;  1UX5 A;  4I55 E;  5LMU T;  5LA6 E;  4HGA A;  4YJ3 E;  2N1G A;  2XSB A;  4LML A;  5HYA A;  2PBI A;  3EHZ A;  5L3G B;  1NEK A;  2EHO D;  5AQK B;  4PJL A;  5L4H A;  4ZI2 C;  3ZC0 A;  2G0U A;  3VKG A;  2D0T A;  1OWA A;  2M6B A;  3H3M A;  3LG7 A;  2X9W A;  4X66 T;  3AAA B;  3K3N A;  2J47 A;  4DR2 T;  2XPK A;  4TWF A;  4K0U A;  1U4Q A;  4OYK A;  4LF5 T;  2WZH A;  3HA4 A;  3C51 A;  3FB2 A;  2KWH A;  3IA3 A;  3Q5X A;  1SHZ C;  3N5L A;  4PAG A;  4ZZC A;  1IBL T;  2XQ4 A;  3CQG B;  2NW7 A;  3FHN A;  4DBR A;  2ES0 A;  4DV6 T;  2CWO A;  2KWI B;  4AQG A;  2Q9Q D;  2EHO C;  5AQG B;  1XZY A;  3PU3 A;  4IE7 A;  2BG9 C;  4DND A;  1XMO T;  2QA7 A;  5GON E;  2M67 A;  2X68 A;  4B3S T;  2CHN A;  2DCF A;  2MTQ A;  4ZI3 D;  3ZJ1 A;  4LMJ A;  4AQF C;  3P4W A;  2DWG A;  2Y48 B;  3CX7 B;  2XQY A;  3AED A;  1LKX A;  3EVY A;  3CML A;  2W2U A;  4A98 A;  3ZCI A;  5HEJ A;  5AQJ B;  3P4S A;  2E9X D;  2K9A A;  2A3D A;  3AE8 A;  2JQH A;  4U2Y A;  4UIG A;  1M7K A;  1DU2 A;  4EAH A;  2HN1 A;  3VKH A;  4YTP A;  4O8S A;  2HPL A;  2D9D A;  2CLY B;  3RC8 A;  4YXD A;  5DQV A;  2WDR A;  2Q9Q C;  4N78 D;  4IDN A;  2LM2 A;  3T1Y T;  2LRL A;  2VQE T;  1UCU A;  3OTO T;  2VKO A;  3KFW X;  4ZI3 C;  2C5I T;  2V6Y B;  1HR0 T;  5LBM A;  4HWF A;  3RH3 A;  3NBX X;  1IJ6 A;  4TWD A;  2VAS A;  3GWH A;  5HWX A;  3RQU A;  2WQY A;  2WDQ A;  2E9X C;  3K1S A;  2E2A A;  4ZS3 A;  3PUQ A;  3UU5 A;  3DTO A;  5H6R B;  4EEB A;  4DR7 T;  5L3C B;  5FVK A;  2JMK A;  3ETV A;  3N9M A;  5CFB A;  3AA7 B;  2CXD A;  3HKD E;  1WLX A;  5LHI B;  4YSY A;  3EAM A;  2ZM0 A;  2NOX A;  2WP9 A;  5JRC B;  1Z0P A;  2NTY A;  2WAU A;  2I0M A;  2XM1 A;  3P8C D;  1HCI A;  4I4T E;  4L0R A;  2BG9 B;  3H37 A;  1M62 A;  1LRZ A;  1MMG A;  4O4L E;  4F6R C;  4H63 H;  2PFV A;  3RRW A;  1ZV4 X;  3AEB A;  1HNZ T;  2V7I A;  1W09 A;  2M6I A;  2XAF B;  1FJG T;  2ZM6 T;  5EZY E;  4IIJ E;  4AXP A;  2J4G A;  5BMV E;  2B1E A;  3ZMV B;  3I9Y A;  5AFU L;  2CXL A;  4NXN T;  1EZ3 A;  3ZT6 A;  4CI1 B;  1R8I A;  4JI7 T;  5LJM A;  2JQK A;  4IDP A;  2ODV A;  4JI5 T;  1W0B A;  3PTR B;  4IE4 A;  3ZMZ B;  5LMN T;  5E0O A;  3R6N A;  2XHE B;  3OVU A;  5LHH B;  4AKL A;  2E5V A;  3ZMS B;  2LJL A;  3WI3 A;  3ZMU B;  2V7L A;  2E9X B;  4X20 E;  3R84 B;  2DL1 A;  4JI6 T;  2KLQ A;  2XUE A;  3UUM A;  5L3F B;  3P50 A;  3W15 B;  4HFH A;  3O1J A;  4GKJ T;  2H7V C;  5J0Z A;  1BR1 A;  3EI0 A;  3K3O A;  2UXB T;  4FI5 A;  4CXX A;  2LEH A;  4GYR A;  4F8H A;  3PUZ F;  2IML A;  4YHH T;  2WY2 A;  4KX6 A;  3KV4 A;  3MKD A;  4WYV A;  4IDO A;  4HFI A;  3T1H T;  4U31 A;  4ILB A;  4L5G A;  5L47 A;  3AE9 A;  3A8Y C;  3CKD A;  3RPU A;  1IBM T;  1XDP A;  3N2G E;  5AQH B;  3CWZ B;  3PDY A;  3E08 A;  3LK4 2;  2VVS A;  2WB5 A;  5BR8 T;  5LCY A;  1VCS A;  1W9R A;  5AQP B;  4GIW A;  2LLY A;  4P09 A;  3FXE B;  5JTG A;  3KDS E;  1S94 A;  5ADX L;  3VRA A;  4YLH A;  2CA5 A;  1V9D A;  3PJA A;  2V7K A;  4ISS A;  3PUS A;  3ABV A;  4QXH B;  1FMW A;  5CJ5 A;  3RIA A;  3ZYM A;  2CRB A;  2EHO A;  3D0T A;  2YU2 A;  2IDO B;  5ABF B;  2UUA T;  1UUR A;  2X9Y A;  2BKO A;  3ZJ2 A;  2YDS A;  2WS3 A;  4KP3 C;  5JQG E;  2BS4 A;  2CEA A;  4AQF A;  4TX5 A;  1US7 B;  4ILU A;  2LHR A;  3PUA A;  4MFR A;  1LVF A;  3QK6 A;  1YQ3 A;  2WU5 A;  4QHO A;  4AKH A;  2XQ7 A;  2YOE A;  4QWN B;  4O4H E;  3RYF E;  3ESL A;  3V5S A;  4YSX A;  4IL9 A;  1ZP0 A;  4UF0 A;  3FBL A;  2Q9Q A;  2PJQ A;  3B13 A;  3SWH A;  3ZYK A;  4KMC A;  4JI0 T;  1BR2 A;  2WZI A;  2LOP A;  1S35 A;  2CBI A;  4IE5 A;  4EB6 E;  4DUY T;  2YIN A;  4ILC A;  3I0O A;  3ZN0 B;  3FZK B;  1FEW A;  2VL0 A;  1YKH B;  1KF6 A;  2NTX A;  3L3P A;  5JDG A;  3IF8 B;  1MMN A;  1JNZ A;  3PJA J;  1B7T A;  4X1I E;  1HF8 A;  1HFA A;  2E9X A;  3Q9D A;  1E1H B;  3UU6 A;  4OHF A;  4U3C A;  4Z91 A;  5HEG A;  5LJN A;  4OYJ A;  4LFA T;  5LGN B;  1ZKE A;  1KEY A;  4EZ4 A;  1E7P A;  3A7M A;  4DV4 T;  4U2Z A;  3NRX A;  4O4J E;  3RKO A;  4EXT A;  2UUB T;  4KHZ F;  4IRE A;  3MAC A;  2VL8 A;  1O3X A;  4ZEY A;  2X0Y A;  2W4X A;  1UK5 A;  4X62 T;  3RYH E;  3AAE B;  2ZM2 A;  2UXX B;  3CVR A;  4DR4 T;  2CCQ A;  3AAI A;  3FBZ A;  3LSV A;  3RYI E;  3VU7 H;  4JV5 T;  5DJQ C;  4WBO A;  5ABH A;  1VOM A;  2XAH B;  3ANW A;  1Y64 B;  4IT4 A;  3N9Q A;  3O1I A;  3LBX B;  1QSD A;  3AXJ B;  3ONX A;  4NIQ A;  4GYS A;  2WSS V;  3KVB A;  1Y01 A;  4H9O C;  4GOU A;  1ZEE A;  3UU8 A;  2V26 A;  4LF6 T;  1UGO A;  2CLY C;  2IIU A;  4HWI B;  4HE8 A;  4QXC B;  3AE6 A;  1T72 A;  2KMF A;  4KUM B;  3G06 A;  2HHH T;  5L2L A;  3KBU A;  3SRZ A;  4OX9 T;  4HWH A;  3RI5 A;  2YN6 A;  2UXN B;  2BKN A;  4H9Q C;  5L3D B;  4U33 A;  3CQX C;  2Y8D A;  3HL6 A;  2N2N A;  3UUX B;  3FZL B;  4PFO A;  2IC9 A;  5JDN A;  4DV7 T;  5HEH A;  5JDM A;  1OED E;  2YEV C;  2GK9 A;  1D0Y A;  4HFB A;  4TV9 E;  4C91 A;  3AE5 A;  2BVM A;  2NW9 A;  5ABG A;  4LF7 T;  4YJ2 E;  2XQ5 A;  2L3L A;  1BR0 A;  2XQ6 A;  1T7S A;  1FIO A;  3UQ4 A;  5EK2 A;  4TNW A;  2UXD T;  3I0Q A;  4PW8 A;  3AB3 B;  3AEG A;  5HXR A;  2OV9 A;  5FY1 A;  4B6X A;  3KV6 A;  5FXZ A;  1MIY A;  3QUJ A;  5JDF A;  4U74 A;  1XMQ T;  4AIS A;  3MJX A;  5FL0 A;  2K5B B;  4ZXL A;  3MK7 C;  3PU8 A;  3VR9 A;  3UT5 E;  3AE4 A;  3F57 A;  1T98 A;  4AIU A;  4I0U A;  4JI2 T;  4DR3 T;  1SA0 E;  4EOZ B;  3TKL B;  5FYM A;  3SFE A;  2XQ3 A;  3Q2M A;  2K3W A;  3PUG A;  4NUU A;  3RQW A;  1D1A A;  2XQA A;  4HWD A;  3ONJ A;  1NAF A;  3ZMT B;  1HX8 A;  2IHR 1;  2CMR A;  5LYJ E;  5CB4 E;  2AE9 A;  4COF A;  3AEE A;  4U7Y A;  3GMI A;  1N33 T;  2KT9 A;  1VRB A;  4DV5 T;  1U5P A;  1YQ4 A;  4QKN A;  3VRB A;  4IL4 A;  4JEU B;  5KDM C;  3PUR A;  1CHU A;  1HG5 A;  2HPJ A;  4FJO A;  3C50 A;  3FZF B;  1X79 A;  2XTL A;  5KXJ A;  4DUZ T;  5HCM A;  3HI2 A;  4LF4 T;  2QGS A;  1MIV A;  1MND A;  5HEU A;  1SE7 A;  5LOV E;  1IAP A;  1E2A A;  3P4R A;  3N9P A;  5AQN B;  5HEO A;  1XNQ T;  3X1D A;  2A9U A;  3OYZ A;  3ONL C;  3IEE A;  4TZ4 C;  4YY3 T;  2W61 A;  4DID B;  2QYW A;  4ANJ A;  3TLT A;  2WU2 A;  3B57 A;  2BDE A;  4KI0 F;  4LFC T;  3AEC A;  4YTN A;  1QLB A;  4GK0 E;  2RP4 A;  2SPC A;  2DI4 A;  2LSK A;  3HKC E;  4H9R C;  4H9P C;  2IUB A;  1UUS A;  4IGU A;  1NEN A;  4DR5 T;  3EUH A;  3FXD B;  1KFY A;  1LVK A;  3UQ7 A;  1L0V A;  3ZPO A;  4HFC A;  3GN5 B;  3IBP A;  2JJ9 A;  3AEF A;  2KZ7 B;  3LFM A;  2VKD A;  1UX4 A;  3ZSS A;  5FXV A;  3I1A A;  1SUM B;  3J9X 1;  2HH7 A;  2YU1 A;  2W66 A;  3E0Z A;  4JI3 T;  5LGT B;  2WWV A;  2FJB A;  5JR9 B;  2X0L B;  4IDQ A;  4UEL A;  2OA5 A;  5A1L A;  1HNX T;  4JUY A;  2JQ9 A;  3RC3 A;  2BS3 A;  2Y6X A;  1IBK T;  5ABE A;  2V6Y A;  5AQU B;  4EV6 A;  5LBQ B;  1WR0 A;  2X66 A;  3BK9 A;  4LMK A;  2FJD A;  2LSY A;  2LSJ A;  3ZKR A;  1YKE B;  4JI8 T;  1WRD A;  3CX6 B;  2X9X A;  3OBV E;  3N2O A;  3MXZ A;  2QRX A;  2W63 A;  4UXN B;  1XWM A;  2LOS A;  2UUC T;  3RRC A;  5JRC A;  3PE0 A;  2LKH A;  2W62 A;  3P4Q A;  4EYY R;  5EK3 A;  2H89 A;  2CM0 A;  2BG9 A;  4PJM A;  2D0U A;  3LDQ B;  5FNV E;  4MAL A;  2WMN A;  2E8I A;  3CPZ A;  4TNV A;  3O4X E;  5AQL B;  4A97 A;  1OED B;  1G73 A;  2N9D A;  4QXB B;  2A72 A;  2X51 A;  2XAJ B;  2KIN B;  2KXP B;  1QUU A;  3KBT A;  1YD8 G;  3MA9 A;  5LP6 E;  1XNR T;  5HXE A;  4EYU A;  1HS7 A;  5F5W A;  3KV9 A;  2A2F X;  2XQ8 A;  3RIF A;  4Z90 A;  1D1B A;  3C64 A;  5LB7 B;  4A56 A;  4PNI A;  4Z8X A;  1IZN B;  2XQ9 A;  3Q5E A;  4B3R T;  2X0H A;  3J7Y q;  4BA9 A;  3VR8 A;  4UEM A;  1ZOY A;  2I59 A;  4E7S A;  3L8R A;  5JDL A;  2CWY A;  5H6Q B;  2V5C A;  4JYA T;  2MOZ A;  4YFS A;  2D2S A;  2YK0 A;  5LXT E;  3AEA A;  1HX1 B;  4PK5 A;  5CA1 E;  4XAX B;  4HEA A;  4O4I E;  4PK6 A;  5C8Y E;  4GKK T;  2XY8 B;  2LSG A;  1N34 T;  2AXD S;  4KBM B;  3RYC E;  5HAX A;  4DMW A;  5LGU B;  1FMV A;  3A5X A;  1KK7 A;  2FUP A;  2YDR A;  4X1K E;  2ZLY A;  2ZM8 A;  1YW0 A;  4LF9 T;  3H3A A;  4NUV A;  2LRK A;  3DJB A;  2C5J A;  2ACX A;  2CBJ A;  5HWY A;  4CZZ B;  3RIU C;  4JBW F;  4K0K T;  3ZLI A;  3AE2 A;  5AQV B;  1BR4 A;  5IUX A;  4QH5 A;  1J5W A;  3UUB A;  4BAY B;  5AQR B;  5JRE A;  1HG2 A;  3JAD A;  2HN2 A;  3EDV A;  4JI1 T;  4PJN A;  1D0Z A;  3VHL A;  4IE6 A;  5LG3 A;  4ERR A;  2MBG A;  2DLR A;  3HKE E;  1NWM X;  5JDQ A;  3TLW A;  2MPK A;  5ABF A;  4XBF B;  3OKQ A;  4QX7 B;  3SFD A;  3LK3 B;  3RX6 A;  3T8O A;  4HFE A; 
#chains in the Genus database with same CATH homology
 3OPC A;  2FUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...