2FUPA

Crystal structure of a putative flagella synthesis protein flgn (pa3352) from pseudomonas aeruginosa at 1.48 a resolution
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
128
Chain Sequence
MPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELPVLQQLLGAKQPLMQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIANQASTGSLLNILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA3352
publication title Crystal structure of hypothetical protein (NP_252042.1) from Pseudomonas aeruginosa at 1.48 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 54
structure length 128
sequence length 130
ec nomenclature
pdb deposition date 2006-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05130 FlgN FlgN protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.300 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 FlgN-like 2fupA00
2FUPA 3OPCA
chains in the Genus database with same CATH superfamily
2HH7A 5E0OA 1IBKT 3UTKA 2X0LB 4A5XA 2Y48B 3RIFA 2XAJB 2M6IA 2VK9A 4MHCA 4H9OC 2WBLA 4ZXLA 5BMVE 4EV6A 4HFVA 2UUBT 4I55E 5IYZE 3UUXB 2H89A 4B3ST 1MIVA 3C98B 3N9MA 4TWHA 4DUYT 1MIYA 1WYBA 3AXJB 1YKEB 4O4HE 3WI3A 1UCUA 2D9DA 4IREA 2VQFT 2BBHA 3C4ZA 2LKHA 3AE9A 2XY8B 4GIWA 1BR0A 1W9RA 4B6XA 3AVRA 5JDHA 1N32T 4AKGA 2IDOB 3PUXF 1KF6A 3NKZA 5AQSB 1NWMX 3CWZB 2A2FX 5CB4E 2VKJA 2VWAA 2WM9A 4MBQA 4EEBA 3JAFA 4WNKA 1HNZT 3AVSA 5L3GB 3EVYA 4ADZA 1FMVA 3EHZA 2XSBA 5FKYA 2H3RA 3FXEB 3P4QA 1T72A 5FP3A 5LG4A 3UU8A 4TN7B 3Q5DA 4OX9T 4JUYA 3LBXB 1ZOYA 1OXZA 3PTRB 2IW5B 1MNEA 4EB6E 4PJNA 4LMLA 2EHOD 2KXPB 1MIWA 5EK2A 2IC6A 3TKLB 2NTXA 3KVAA 4ILAA 3K3NA 2LE8A 2H7OA 2XAHB 2V7LA 1T7SA 3FZFB 3PU3A 2YN6A 2VQET 2X0YA 2F4VT 2KZ7B 3J7Yq 3RIUC 5FVKA 2YDRA 5KDMC 3H3MA 2EHOB 4ILUA 2JQKA 5FY1A 2HPLA 4HGAA 4AKHA 2XUEA 4UF0B 5JVDE 2HN2A 2AE9A 2W67A 3FXDB 4JI7T 3AA7B 4H9RC 3TLTA 5A1LA 1NENA 4UVAB 3RH3A 4PJMA 5LXTE 3UULA 2XZEA 4HFIA 4IL4A 4NUUA 4JLEA 2YEVC 3N2KE 2YDSA 3VR9A 5FYMA 2WQYA 4ZZCA 3L39A 4Z8XA 2JQHA 2L8KA 4AQFC 5HXHA 4NIQA 2JMKA 5HYAA 2X68A 4QH4A 4X65T 3ZYKA 3AE7A 1H7CA 1MMGA 2K9AA 2X51A 5AFUL 5JDNA 1XDPA 4CXXA 3ZCJA 1M7KA 3P8CD 4O4LE 4ANJA 3KBTA 2ACZA 2ACXA 3H37A 2CA5A 3KFWX 3KVBA 2CWOA 2WZHA 2C0SA 3CQXC 2A9UA 1UUSA 5JR9A 3WAKA 3BQIA 3LSVA 2D0TA 4AKRB 1FIOA 2MAWA 3D0TA 3AE2A 2KNDA 4QKNA 3VR8A 4YSXA 4PFPA 1YD8G 2DCFA 3V5UA 5AQPB 5AQNB 3BK9A 3GWHA 3UU5A 3B5MA 4P1NA 2J47A 4WYVA 1UURA 4CZZB 3JCFA 4TV8E 2J1DG 4UELA 5J2TE 4ILBA 5L2LA 2E2AA 2V1DB 4A56A 2VKHA 4LF7T 4GK0E 4YY3T 3KV6A 5L3CB 1IAPA 1MMAA 1YQ3A 2LHNA 4U7IA 4A97A 3I0QA 4L0RA 5L47A 2XQYA 2YKSA 4AXPA 2WWVA 2K5BB 5H6QB 3AE8A 5AQIB 3AE3A 2YK0A 4V1Av 1WYCA 4EXTA 5L3BB 1VOMA 2N2NA 4X1IE 1N33T 4ZS2A 4CXWA 4KP3C 2VL8A 4P0AA 2ZLYA 5ABFA 3O9XA 1SE7A 1LVKA 2CHOA 3AECA 4P0BA 4JI0T 2MBGA 4HE8A 3AE1A 4K0KT 1XWMA 1HFAA 2DHRA 5KMGP 2OLTA 3L8RA 1MMDA 3AXJA 3NZQA 2IAKA 2YOEA 3ZN1B 5HAXA 4E7SA 3OJAA 3L09A 4O8SA 4N78D 3RX6A 2CWYA 1EZ3A 5AQUB 3KV4A 2FJDA 2KINB 1W0AA 2VKOA 3QB5A 3RQUA 2RA1A 2LSGA 4QXBB 3ZYLA 3ZPOA 3FZKB 4PK5A 4CN6A 3I0OA 3UU6A 3FHNA 4QX8B 4YHHT 3GMIA 4C90A 3ZMZB 3CQGB 4LMJA 4BJMA 3O1HA 3RHWA 2BKOA 3LK2B 4QHOA 3RIUA 3TLUA 4X1KE 4EYYR 4HFDA 5KX5E 3ETUA 4JEUB 3LBXA 1G8XA 2V5CA 1SUMB 3K8PC 3PUWF 4KHZF 2WSSV 3PURA 3UQ4A 3ZMVB 2HPJA 3MKDA 3RYIE 5AQTB 5HCJA 3UUNA 2UXNB 2D2SA 5F3JA 2XQAA 2V5DA 3LK3B 5AQLB 2V7KA 3FZLB 2BVMA 2NP9A 2V7IA 3RPUA 4O2BE 3O4XE 4H9SE 2CE7A 4HWCA 3AEAA 4AQFA 3UU3A 5LG3A 2MPKA 5CA1E 3VRAA 4Q25A 3AB3B 3AEDA 4YJ2E 4AQYT 3EDUA 3AEBA 4OYKA 1HG2A 4ZI2D 2LM2A 2V7MA 4UIGA 1E2AA 3UUBA 5FL1A 3C4XA 4KI0F 3KDSE 2ZM6T 1V9DA 4HWHA 3TLWA 5J0ZA 3PUGA 5TAOA 4GOUA 4EGWA 4H63V 4BA9A 3ABVA 3QUJA 4YT0A 4ZHQE 3AE6A 2CBIA 3Q5EA 3RC8A 4CI3B 5KXJA 4UEMA 5JDGA 4J2CA 4LF5T 4YSYA 1Z0PA 1HCIA 2WU2A 4O4IE 3QOFA 1D1CA 2CCQA 3ZCIA 2FJAA 2KMFA 3NWIA 2JMHA 4JI8T 4L9IA 4JI4T 5LOVE 2CMRA 2LSIA 3ZT6A 5AQOB 2DI4A 1D1AA 5HCMA 1XNQT 2DWGA 4ZI3D 4UR9A 2I0MA 3EI0A 4IT4A 3X1DA 4CXYA 3N2GE 3MZKB 5DQWA 3EUHA 3Q2MA 4DR4T 3QNUA 3C64A 3ZC0A 2XQ8A 2YU1A 5ABEA 5L3FB 3OBVE 3FZHB 2NW9A 5LB7B 3ZSTA 3UFGA 5AQHB 2FBWA 2LM9A 2A72A 4KMCA 4U2ZA 5C8YE 4WBOA 4PK4A 4EYUA 3ANWB 2WWUA 3HKCE 2PFVA 4DBRA 2WS3A 4HEAA 3IHRA 3JADA 4ASKA 4IDNA 3ONJA 4FJOA 3CX7B 2BDEA 4PAGA 1T8BA 4QX7B 4H9QC 3ETVA 5LHIB 4KX6A 4B3RT 4JYAT 4CN4A 2K24A 2M6BA 5HXSA 5JRCA 5AQGB 4U7YA 2BKNA 2ZM8A 2XQ4A 4YFSA 2B76A 5JH7E 5L3EB 5LMNT 3N9PA 4U33A 3TLVA 4ZS3A 1R8IA 2NW7A 2VURA 5FY0A 2YDQA 3H3AA 1OWAA 4OHFA 3PUYF 4E7ZA 3OVUA 1QUUA 2BG9B 1D0XA 3CKDA 2LOPA 3ZMTB 2KT9A 2QVAA 4MFRA 4TNVA 4U2YA 4ISTA 3RYFE 2E9XD 2XQ5A 2CEAA 4JI2T 2I59A 2LHRA 3CIRA 1LRZA 2ES0A 3PU8A 2XM1A 3HL6A 4DNDA 3ZN0B 5CA0E 3PV0F 5FVLA 4F8HA 2Q9QD 5IHYA 2LLYA 5AQMB 2DLRA 4IDZA 3PE0A 3A8YC 4KBMB 3SFDA 3RLFF 4PJLA 2DNXA 2R6GF 4YTNA 2LRKA 2EHOC 2E9XB 2XQ6A 2W2UA 3UT5E 1OEDB 1D1BA 5EZYE 2LSKA 4DBQA 2NTYA 3IF8B 2BKPA 5AQFB 4X66T 3SRZA 2WB5A 4IDPA 1US7B 1ZHCA 4IHJE 3KBUA 3P4WA 4QXHB 3ZT7A 2Q9QB 4EAHA 3ZLIA 1FMWA 4HWFA 4YJ3E 3AAIA 2XQ3A 2CRBA 3P7IA 2A3DA 2UXXB 2CPTA 4PFOA 5JTGA 3AEFA 2WZIA 1FJGT 4P09A 5L4HA 4B3MT 4DV1T 1MNDA 1IJ6A 1GQEA 3B13A 4IE4A 4X1YE 5M4YA 4YXDA 4DV3T 2W0GA 1G73A 2WDVA 2Y8DA 3ZYMA 4YHJA 5CFBA 4FI5A 3GA8A 3B57A 4DV0T 4XZCA 1IZNB 2V6YB 4DMWA 5LMUT 4ZI7E 3HI2A 2VB6A 4TV9E 2RP4A 4IL9A 2V26A 3VKHA 4HN9A 1W0BA 1LKXA 4DV4T 4U31A 5FXVA 4DR5T 3LDQB 1HG5A 5L4EA 3OPCA 3UQ7A 2X66A 4IDOA 4ISSA 4GKKT 3DP7A 4TUYE 3RKOA 4DV2T 3MA9A 4EZ4A 3KINB 5FNVE 3K3OA 4O4JE 1BR1A 2KSRA 4DUZT 1B7TA 3SWHA 1HTJF 2UU9T 1N34T 3PJAJ 5LJNA 1I6ZA 1IJ5A 5HEUA 4BAYB 3G06A 4X64T 2V6XA 3J9X1 5ABGA 5JDQA 2XTLA 1S35A 3NZPA 2UXDT 3PUZF 2W61A 2JJ9A 3SOLA 2CBJA 3AE4A 3OTOT 4U74A 3O1IA 5LBQB 2C5IT 2VASA 2NR4A 3AE5A 1AJ3A 2XHEB 3IBPA 3F31A 2ODUA 4JEHB 1X79A 5LGNB 1XDOA 3FZMB 2JRKA 1IBLT 3ZMSB 3Q9DA 4LF9T 2I6HA 3FBLA 3HR0A 2WMNA 3I9WA 4PW8A 2M67A 4IGUA 5C2TA 4PJJA 3O1JA 2LT3A 2VVSA 4LF6T 1BR4A 4GK5E 1YXRA 2BZBA 1HNXT 3CMLA 3Q5WA 5LYJE 5JREA 2JQQA 3IEEA 3NRYA 4O2AE 5JR9B 5BR8T 3N5LA 2SPCA 2PTFA 3RYCE 4EZHA 5ABHA 4XBFB 2P9BA 4G2AA 4HFBA 4UVBB 2PG8A 1M62A 2HHHT 1JNRA 2L9QA 1XMOT 3FB2A 4PK6A 3R6NA 3ONLC 4LFAT 2H7VC 4IDQA 5LA6E 2IIUA 2BG9A 4I4TE 3E22E 3HA4A 4DR7T 2EHOA 3MK7C 1WR6A 5DQVA 4UF0A 4DR3T 1CUNA 4OFZA 2X9HA 1L0VA 3ZMUB 5FXXA 4NXMT 4QXCB 1KNPA 5JDFA 2KWIB 2IUBA 4I43B 5J1GA 2NW8A 2V7JA 3LK42 3I1AA 2KWHA 5HXRA 3RGLA 3TLSA 2JPFA 3HKDE 4ERRA 5LHHB 5HEOA 4AKIA 2UUAT 2C5KT 3SS1A 2LSJA 5HEGA 2WAUA 4B3TT 5FXZA 2XAQB 4TWDA 2XQ7A 4QH5A 4X62T 2YU2A 4DR2T 5IWAT 5JQGE 2BBJA 2JIWA 1W09A 2CM0A 3AA1B 3RI5A 5LHGB 2RPAA 1JNZA 4DR6T 2WMOA 2QYWA 3KV5A 4F6RC 4JI1T 4ZEYA 2Z6EA 4DR1T 3CK6A 2H88A 4HWIB 1D0YA 5ABFB 3MACA 5FXWA 3RC3A 2MTQA 3P4SA 3LFMA 2E8IA 4ZI2C 4LFCT 3A7MA 3GN5B 4HWDA 1ZEEA 4HKAA 4NUVA 3WAJA 4TNWA 3MJXA 3ZC1A 4HFEA 4H9NC 3AAEB 4CN1A 5EK4A 4ZZBA 5HXCA 1T98A 4TWFA 2K48A 1U4QA 4WW0A 3DTOA 4H9PC 2V6YA 5GONE 5J2UE 4LFBT 2JQ9A 2WP9A 4QWNB 2G0UA 2YINA 3JAEA 2UUCT 5HXEA 5AQVB 2X67A 1WRDA 3CPZA 1ZKEA 3S4UA 4LMKA 2WDQA 4QH1A 3P50A 3W15B 2D5UA 4ZI3C 1VCSA 1E7PA 2W66A 3M3ZB 1U5PA 3ESLA 4DV6T 4IE7A 2CHNA 2W00A 3OKQA 1HNWT 2X9WA 3BQLA 5ADXL 4PNIA 3AA6B 1NAFA 1BR2A 1S94A 4JBWF 3AEEA 2W63A 4Z91A 3M65A 4ILCA 3ZEFB 2ODVA 1WLXA 2BVLA 4L5GA 1CHUA 2UXBT 4A98A 2DL1A 3E0ZA 3JC6D 3NVOA 2XAGB 3CX6B 4WBNE 3AA0B 2BS4A 1KK7A 3RRCA 3NRXA 5F8PA 1ZV4X 2WU5A 1X9BA 3QC9A 2X9YA 1UX4A 4BJNA 5FY7A 1VCTA 2ZMAA 2BG9C 3SFEA 2PJQA 2BS3A 2N1GA 3K3QC 5IUXA 4IIJE 3N9OA 3P4RA 2LRLA 1DU2A 3BQKA 4COFA 4HFHA 3T8OA 2UXCT 5HWXA 3V5SA 4NPPA 4TX5A 2IHR1 5C3JA 1J5ET 5L3DB 1YW0A 2QGSA 3AEGA 2CXDA 3QB5K 5LNKA 4AI6A 1KFYA 5F5WA 2XM2A 3HKEE 1J5WA 2LSYA 4C91A 1J1JA 3DJBA 5LBMA 3AAAB 3P4PA 2E9XC 3RF1A 1OEDC 4H63H 4TZ4C 2E5VA 3N9QA 1NEKA 5EK3A 3JC6C 3RRWA 2AXDS 4I0UA 1SHZC 4AKLA 5LCYA 4WZXA 2DWKA 3EDVA 3UUMA 3VRBA 2E5LT 1HX1B 4GYSA 2VL0A 3QK6A 3HKBE 2Q9QC 1ZP0A 3F57A 3EABA 3T1YT 1WR0A 2NWBA 4XAXB 2X0HA 3ZSSA 1N36T 2PBIA 1E1HB 2XASB 1XZYA 4DVDA 3L3PA 4IE6A 5AQRB 4UV9B 1UGOA 4JV5T 5LGUB 3CVRA 3N9NA 2LJLA 2CXLA 3KV9A 1Y01A 3C4WA 1VRBA 2W62A 4I50E 3PUAA 4YSZA 5JRCB 2WCAA 3RIAA 5ETWA 2J62A 5AQKB 1XNRT 3ZT5A 2OA5A 2LEHA 4HTEA 2NOXA 3ZKRA 4HFCA 2XSAA 5H6RB 4IE0A 2D0UA 4AISA 2WDRA 4IE5A 5JDLA 1IBMT 4AQGA 4GYRA 2ZM2A 3K1SA 3NBXX 5LGTB 5AQJB 1Y64B 4YTMA 3UFEA 4MLKA 1SA0E 5LP6E 5DJQC 4EEDA 2L3LA 3PJAA 2BS2A 2C5JA 3OYZA 3I9YA 4OYJA 2QA7A 3CX8B 4U3CA 4GKJT 5FMNA 3UU4A 4KUMB 3U3IA 3PDYA 1WCRA 3C51A 5CJ5A 2XAFB 3VKGA 3GN5A 3RYHE 2V8SV 3MXZA 4Z90A 4NXNT 2GK9A 3PUVF 1MMNA 3A5XA 1Z8UA 1KEYA 2W4XA 4JI6T 4AIUA 3E08A 1UX5A 4X20E 1KNZA 4ZOLE 1I94T 3T1HT 3ANWA 5HWYA 3PUSA 3FBZA 4X5TA 3VU7H 1D0ZA 4EOZB 2MYSA 4UV8B 1HF8A 3U78A 4DO0A 2LKGA 2ZM0A 5JDMA 5HEJA 3IA3A 3VHLA 4DIDB 3C50A 1WFDA 4YLHA 1O3XA 1HX8A 2B1EA 2BG9E 2VVNA 5DABA 3ZJ1A 3LJCA 4K0UA 3R84B 4M1PA 2J4GA 2FJEA 4DV5T 5AQQB 3N9LA 1QLBA 3ONXA 4U72A 3ZJ2A 3EAMA 2XPKA 2KLQA 4MALA 3PUQA 4UXNB 3OYXA 2Y6XA 4YTPA 5LJMA 4JI5T 3F2EA 2FJBA 2IMLA 5FL0A 4KHPT 4CQIA 2MOZA 1YQ4A 3RKGA 4OK0A 2IC9A 2N9DA 1LVFA 2XQ9A 2QRXA 2CLYB 4CI1B 1KNRA 5JR9C 1OEDE 3N2OA 5HEHA 2CXFA 2K3WA 1XMQT 2WY2A 3CQCB 2HN1A 4JI3T 3Q5XA 2X9XA 1FEWA 4DMVA 5CGMA 2OV9A 2LOSA 4UVCB 2VKDA 4DV7T 3RQWA 1YKHB 2E9XA 1OEDA 2FUPA 4LF8T 4G63A 4LF4T 1HS7A 1HR0T 4EIWA 3LG7A 1UK5A 2CLYC 4CI2B 2XJ7A 1QSDA 2Q9QA
chains in the Genus database with same CATH topology
2FUPA 3OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUP A;  3OPC A; 
#chains in the Genus database with same CATH topology
 2HH7 A;  5E0O A;  1IBK T;  3UTK A;  2X0L B;  4A5X A;  2Y48 B;  3RIF A;  2XAJ B;  2M6I A;  2VK9 A;  4MHC A;  4H9O C;  2WBL A;  4ZXL A;  5BMV E;  4EV6 A;  4HFV A;  2UUB T;  4I55 E;  5IYZ E;  3UUX B;  2H89 A;  4B3S T;  1MIV A;  3C98 B;  3N9M A;  4TWH A;  4DUY T;  1MIY A;  1WYB A;  3AXJ B;  1YKE B;  4O4H E;  3WI3 A;  1UCU A;  2D9D A;  4IRE A;  2VQF T;  2BBH A;  3C4Z A;  2LKH A;  3AE9 A;  2XY8 B;  4GIW A;  1BR0 A;  1W9R A;  4B6X A;  3AVR A;  5JDH A;  1N32 T;  4AKG A;  2IDO B;  3PUX F;  1KF6 A;  3NKZ A;  5AQS B;  1NWM X;  3CWZ B;  2A2F X;  5CB4 E;  2VKJ A;  2VWA A;  2WM9 A;  4MBQ A;  4EEB A;  3JAF A;  4WNK A;  1HNZ T;  3AVS A;  5L3G B;  3EVY A;  4ADZ A;  1FMV A;  3EHZ A;  2XSB A;  5FKY A;  2H3R A;  3FXE B;  3P4Q A;  1T72 A;  5FP3 A;  5LG4 A;  3UU8 A;  4TN7 B;  3Q5D A;  4OX9 T;  4JUY A;  3LBX B;  1ZOY A;  1OXZ A;  3PTR B;  2IW5 B;  1MNE A;  4EB6 E;  4PJN A;  4LML A;  2EHO D;  2KXP B;  1MIW A;  5EK2 A;  2IC6 A;  3TKL B;  2NTX A;  3KVA A;  4ILA A;  3K3N A;  2LE8 A;  2H7O A;  2XAH B;  2V7L A;  1T7S A;  3FZF B;  3PU3 A;  2YN6 A;  2VQE T;  2X0Y A;  2F4V T;  2KZ7 B;  3J7Y q;  3RIU C;  5FVK A;  2YDR A;  5KDM C;  3H3M A;  2EHO B;  4ILU A;  2JQK A;  5FY1 A;  2HPL A;  4HGA A;  4AKH A;  2XUE A;  4UF0 B;  5JVD E;  2HN2 A;  2AE9 A;  2W67 A;  3FXD B;  4JI7 T;  3AA7 B;  4H9R C;  3TLT A;  5A1L A;  1NEN A;  4UVA B;  3RH3 A;  4PJM A;  5LXT E;  3UUL A;  2XZE A;  4HFI A;  4IL4 A;  4NUU A;  4JLE A;  2YEV C;  3N2K E;  2YDS A;  3VR9 A;  5FYM A;  2WQY A;  4ZZC A;  3L39 A;  4Z8X A;  2JQH A;  2L8K A;  4AQF C;  5HXH A;  4NIQ A;  2JMK A;  5HYA A;  2X68 A;  4QH4 A;  4X65 T;  3ZYK A;  3AE7 A;  1H7C A;  1MMG A;  2K9A A;  2X51 A;  5AFU L;  5JDN A;  1XDP A;  4CXX A;  3ZCJ A;  1M7K A;  3P8C D;  4O4L E;  4ANJ A;  3KBT A;  2ACZ A;  2ACX A;  3H37 A;  2CA5 A;  3KFW X;  3KVB A;  2CWO A;  2WZH A;  2C0S A;  3CQX C;  2A9U A;  1UUS A;  5JR9 A;  3WAK A;  3BQI A;  3LSV A;  2D0T A;  4AKR B;  1FIO A;  2MAW A;  3D0T A;  3AE2 A;  2KND A;  4QKN A;  3VR8 A;  4YSX A;  4PFP A;  1YD8 G;  2DCF A;  3V5U A;  5AQP B;  5AQN B;  3BK9 A;  3GWH A;  3UU5 A;  3B5M A;  4P1N A;  2J47 A;  4WYV A;  1UUR A;  4CZZ B;  3JCF A;  4TV8 E;  2J1D G;  4UEL A;  5J2T E;  4ILB A;  5L2L A;  2E2A A;  2V1D B;  4A56 A;  2VKH A;  4LF7 T;  4GK0 E;  4YY3 T;  3KV6 A;  5L3C B;  1IAP A;  1MMA A;  1YQ3 A;  2LHN A;  4U7I A;  4A97 A;  3I0Q A;  4L0R A;  5L47 A;  2XQY A;  2YKS A;  4AXP A;  2WWV A;  2K5B B;  5H6Q B;  3AE8 A;  5AQI B;  3AE3 A;  2YK0 A;  4V1A v;  1WYC A;  4EXT A;  5L3B B;  1VOM A;  2N2N A;  4X1I E;  1N33 T;  4ZS2 A;  4CXW A;  4KP3 C;  2VL8 A;  4P0A A;  2ZLY A;  5ABF A;  3O9X A;  1SE7 A;  1LVK A;  2CHO A;  3AEC A;  4P0B A;  4JI0 T;  2MBG A;  4HE8 A;  3AE1 A;  4K0K T;  1XWM A;  1HFA A;  2DHR A;  5KMG P;  2OLT A;  3L8R A;  1MMD A;  3AXJ A;  3NZQ A;  2IAK A;  2YOE A;  3ZN1 B;  5HAX A;  4E7S A;  3OJA A;  3L09 A;  4O8S A;  4N78 D;  3RX6 A;  2CWY A;  1EZ3 A;  5AQU B;  3KV4 A;  2FJD A;  2KIN B;  1W0A A;  2VKO A;  3QB5 A;  3RQU A;  2RA1 A;  2LSG A;  4QXB B;  3ZYL A;  3ZPO A;  3FZK B;  4PK5 A;  4CN6 A;  3I0O A;  3UU6 A;  3FHN A;  4QX8 B;  4YHH T;  3GMI A;  4C90 A;  3ZMZ B;  3CQG B;  4LMJ A;  4BJM A;  3O1H A;  3RHW A;  2BKO A;  3LK2 B;  4QHO A;  3RIU A;  3TLU A;  4X1K E;  4EYY R;  4HFD A;  5KX5 E;  3ETU A;  4JEU B;  3LBX A;  1G8X A;  2V5C A;  1SUM B;  3K8P C;  3PUW F;  4KHZ F;  2WSS V;  3PUR A;  3UQ4 A;  3ZMV B;  2HPJ A;  3MKD A;  3RYI E;  5AQT B;  5HCJ A;  3UUN A;  2UXN B;  2D2S A;  5F3J A;  2XQA A;  2V5D A;  3LK3 B;  5AQL B;  2V7K A;  3FZL B;  2BVM A;  2NP9 A;  2V7I A;  3RPU A;  4O2B E;  3O4X E;  4H9S E;  2CE7 A;  4HWC A;  3AEA A;  4AQF A;  3UU3 A;  5LG3 A;  2MPK A;  5CA1 E;  3VRA A;  4Q25 A;  3AB3 B;  3AED A;  4YJ2 E;  4AQY T;  3EDU A;  3AEB A;  4OYK A;  1HG2 A;  4ZI2 D;  2LM2 A;  2V7M A;  4UIG A;  1E2A A;  3UUB A;  5FL1 A;  3C4X A;  4KI0 F;  3KDS E;  2ZM6 T;  1V9D A;  4HWH A;  3TLW A;  5J0Z A;  3PUG A;  5TAO A;  4GOU A;  4EGW A;  4H63 V;  4BA9 A;  3ABV A;  3QUJ A;  4YT0 A;  4ZHQ E;  3AE6 A;  2CBI A;  3Q5E A;  3RC8 A;  4CI3 B;  5KXJ A;  4UEM A;  5JDG A;  4J2C A;  4LF5 T;  4YSY A;  1Z0P A;  1HCI A;  2WU2 A;  4O4I E;  3QOF A;  1D1C A;  2CCQ A;  3ZCI A;  2FJA A;  2KMF A;  3NWI A;  2JMH A;  4JI8 T;  4L9I A;  4JI4 T;  5LOV E;  2CMR A;  2LSI A;  3ZT6 A;  5AQO B;  2DI4 A;  1D1A A;  5HCM A;  1XNQ T;  2DWG A;  4ZI3 D;  4UR9 A;  2I0M A;  3EI0 A;  4IT4 A;  3X1D A;  4CXY A;  3N2G E;  3MZK B;  5DQW A;  3EUH A;  3Q2M A;  4DR4 T;  3QNU A;  3C64 A;  3ZC0 A;  2XQ8 A;  2YU1 A;  5ABE A;  5L3F B;  3OBV E;  3FZH B;  2NW9 A;  5LB7 B;  3ZST A;  3UFG A;  5AQH B;  2FBW A;  2LM9 A;  2A72 A;  4KMC A;  4U2Z A;  5C8Y E;  4WBO A;  4PK4 A;  4EYU A;  3ANW B;  2WWU A;  3HKC E;  2PFV A;  4DBR A;  2WS3 A;  4HEA A;  3IHR A;  3JAD A;  4ASK A;  4IDN A;  3ONJ A;  4FJO A;  3CX7 B;  2BDE A;  4PAG A;  1T8B A;  4QX7 B;  4H9Q C;  3ETV A;  5LHI B;  4KX6 A;  4B3R T;  4JYA T;  4CN4 A;  2K24 A;  2M6B A;  5HXS A;  5JRC A;  5AQG B;  4U7Y A;  2BKN A;  2ZM8 A;  2XQ4 A;  4YFS A;  2B76 A;  5JH7 E;  5L3E B;  5LMN T;  3N9P A;  4U33 A;  3TLV A;  4ZS3 A;  1R8I A;  2NW7 A;  2VUR A;  5FY0 A;  2YDQ A;  3H3A A;  1OWA A;  4OHF A;  3PUY F;  4E7Z A;  3OVU A;  1QUU A;  2BG9 B;  1D0X A;  3CKD A;  2LOP A;  3ZMT B;  2KT9 A;  2QVA A;  4MFR A;  4TNV A;  4U2Y A;  4IST A;  3RYF E;  2E9X D;  2XQ5 A;  2CEA A;  4JI2 T;  2I59 A;  2LHR A;  3CIR A;  1LRZ A;  2ES0 A;  3PU8 A;  2XM1 A;  3HL6 A;  4DND A;  3ZN0 B;  5CA0 E;  3PV0 F;  5FVL A;  4F8H A;  2Q9Q D;  5IHY A;  2LLY A;  5AQM B;  2DLR A;  4IDZ A;  3PE0 A;  3A8Y C;  4KBM B;  3SFD A;  3RLF F;  4PJL A;  2DNX A;  2R6G F;  4YTN A;  2LRK A;  2EHO C;  2E9X B;  2XQ6 A;  2W2U A;  3UT5 E;  1OED B;  1D1B A;  5EZY E;  2LSK A;  4DBQ A;  2NTY A;  3IF8 B;  2BKP A;  5AQF B;  4X66 T;  3SRZ A;  2WB5 A;  4IDP A;  1US7 B;  1ZHC A;  4IHJ E;  3KBU A;  3P4W A;  4QXH B;  3ZT7 A;  2Q9Q B;  4EAH A;  3ZLI A;  1FMW A;  4HWF A;  4YJ3 E;  3AAI A;  2XQ3 A;  2CRB A;  3P7I A;  2A3D A;  2UXX B;  2CPT A;  4PFO A;  5JTG A;  3AEF A;  2WZI A;  1FJG T;  4P09 A;  5L4H A;  4B3M T;  4DV1 T;  1MND A;  1IJ6 A;  1GQE A;  3B13 A;  4IE4 A;  4X1Y E;  5M4Y A;  4YXD A;  4DV3 T;  2W0G A;  1G73 A;  2WDV A;  2Y8D A;  3ZYM A;  4YHJ A;  5CFB A;  4FI5 A;  3GA8 A;  3B57 A;  4DV0 T;  4XZC A;  1IZN B;  2V6Y B;  4DMW A;  5LMU T;  4ZI7 E;  3HI2 A;  2VB6 A;  4TV9 E;  2RP4 A;  4IL9 A;  2V26 A;  3VKH A;  4HN9 A;  1W0B A;  1LKX A;  4DV4 T;  4U31 A;  5FXV A;  4DR5 T;  3LDQ B;  1HG5 A;  5L4E A;  3OPC A;  3UQ7 A;  2X66 A;  4IDO A;  4ISS A;  4GKK T;  3DP7 A;  4TUY E;  3RKO A;  4DV2 T;  3MA9 A;  4EZ4 A;  3KIN B;  5FNV E;  3K3O A;  4O4J E;  1BR1 A;  2KSR A;  4DUZ T;  1B7T A;  3SWH A;  1HTJ F;  2UU9 T;  1N34 T;  3PJA J;  5LJN A;  1I6Z A;  1IJ5 A;  5HEU A;  4BAY B;  3G06 A;  4X64 T;  2V6X A;  3J9X 1;  5ABG A;  5JDQ A;  2XTL A;  1S35 A;  3NZP A;  2UXD T;  3PUZ F;  2W61 A;  2JJ9 A;  3SOL A;  2CBJ A;  3AE4 A;  3OTO T;  4U74 A;  3O1I A;  5LBQ B;  2C5I T;  2VAS A;  2NR4 A;  3AE5 A;  1AJ3 A;  2XHE B;  3IBP A;  3F31 A;  2ODU A;  4JEH B;  1X79 A;  5LGN B;  1XDO A;  3FZM B;  2JRK A;  1IBL T;  3ZMS B;  3Q9D A;  4LF9 T;  2I6H A;  3FBL A;  3HR0 A;  2WMN A;  3I9W A;  4PW8 A;  2M67 A;  4IGU A;  5C2T A;  4PJJ A;  3O1J A;  2LT3 A;  2VVS A;  4LF6 T;  1BR4 A;  4GK5 E;  1YXR A;  2BZB A;  1HNX T;  3CML A;  3Q5W A;  5LYJ E;  5JRE A;  2JQQ A;  3IEE A;  3NRY A;  4O2A E;  5JR9 B;  5BR8 T;  3N5L A;  2SPC A;  2PTF A;  3RYC E;  4EZH A;  5ABH A;  4XBF B;  2P9B A;  4G2A A;  4HFB A;  4UVB B;  2PG8 A;  1M62 A;  2HHH T;  1JNR A;  2L9Q A;  1XMO T;  3FB2 A;  4PK6 A;  3R6N A;  3ONL C;  4LFA T;  2H7V C;  4IDQ A;  5LA6 E;  2IIU A;  2BG9 A;  4I4T E;  3E22 E;  3HA4 A;  4DR7 T;  2EHO A;  3MK7 C;  1WR6 A;  5DQV A;  4UF0 A;  4DR3 T;  1CUN A;  4OFZ A;  2X9H A;  1L0V A;  3ZMU B;  5FXX A;  4NXM T;  4QXC B;  1KNP A;  5JDF A;  2KWI B;  2IUB A;  4I43 B;  5J1G A;  2NW8 A;  2V7J A;  3LK4 2;  3I1A A;  2KWH A;  5HXR A;  3RGL A;  3TLS A;  2JPF A;  3HKD E;  4ERR A;  5LHH B;  5HEO A;  4AKI A;  2UUA T;  2C5K T;  3SS1 A;  2LSJ A;  5HEG A;  2WAU A;  4B3T T;  5FXZ A;  2XAQ B;  4TWD A;  2XQ7 A;  4QH5 A;  4X62 T;  2YU2 A;  4DR2 T;  5IWA T;  5JQG E;  2BBJ A;  2JIW A;  1W09 A;  2CM0 A;  3AA1 B;  3RI5 A;  5LHG B;  2RPA A;  1JNZ A;  4DR6 T;  2WMO A;  2QYW A;  3KV5 A;  4F6R C;  4JI1 T;  4ZEY A;  2Z6E A;  4DR1 T;  3CK6 A;  2H88 A;  4HWI B;  1D0Y A;  5ABF B;  3MAC A;  5FXW A;  3RC3 A;  2MTQ A;  3P4S A;  3LFM A;  2E8I A;  4ZI2 C;  4LFC T;  3A7M A;  3GN5 B;  4HWD A;  1ZEE A;  4HKA A;  4NUV A;  3WAJ A;  4TNW A;  3MJX A;  3ZC1 A;  4HFE A;  4H9N C;  3AAE B;  4CN1 A;  5EK4 A;  4ZZB A;  5HXC A;  1T98 A;  4TWF A;  2K48 A;  1U4Q A;  4WW0 A;  3DTO A;  4H9P C;  2V6Y A;  5GON E;  5J2U E;  4LFB T;  2JQ9 A;  2WP9 A;  4QWN B;  2G0U A;  2YIN A;  3JAE A;  2UUC T;  5HXE A;  5AQV B;  2X67 A;  1WRD A;  3CPZ A;  1ZKE A;  3S4U A;  4LMK A;  2WDQ A;  4QH1 A;  3P50 A;  3W15 B;  2D5U A;  4ZI3 C;  1VCS A;  1E7P A;  2W66 A;  3M3Z B;  1U5P A;  3ESL A;  4DV6 T;  4IE7 A;  2CHN A;  2W00 A;  3OKQ A;  1HNW T;  2X9W A;  3BQL A;  5ADX L;  4PNI A;  3AA6 B;  1NAF A;  1BR2 A;  1S94 A;  4JBW F;  3AEE A;  2W63 A;  4Z91 A;  3M65 A;  4ILC A;  3ZEF B;  2ODV A;  1WLX A;  2BVL A;  4L5G A;  1CHU A;  2UXB T;  4A98 A;  2DL1 A;  3E0Z A;  3JC6 D;  3NVO A;  2XAG B;  3CX6 B;  4WBN E;  3AA0 B;  2BS4 A;  1KK7 A;  3RRC A;  3NRX A;  5F8P A;  1ZV4 X;  2WU5 A;  1X9B A;  3QC9 A;  2X9Y A;  1UX4 A;  4BJN A;  5FY7 A;  1VCT A;  2ZMA A;  2BG9 C;  3SFE A;  2PJQ A;  2BS3 A;  2N1G A;  3K3Q C;  5IUX A;  4IIJ E;  3N9O A;  3P4R A;  2LRL A;  1DU2 A;  3BQK A;  4COF A;  4HFH A;  3T8O A;  2UXC T;  5HWX A;  3V5S A;  4NPP A;  4TX5 A;  2IHR 1;  5C3J A;  1J5E T;  5L3D B;  1YW0 A;  2QGS A;  3AEG A;  2CXD A;  3QB5 K;  5LNK A;  4AI6 A;  1KFY A;  5F5W A;  2XM2 A;  3HKE E;  1J5W A;  2LSY A;  4C91 A;  1J1J A;  3DJB A;  5LBM A;  3AAA B;  3P4P A;  2E9X C;  3RF1 A;  1OED C;  4H63 H;  4TZ4 C;  2E5V A;  3N9Q A;  1NEK A;  5EK3 A;  3JC6 C;  3RRW A;  2AXD S;  4I0U A;  1SHZ C;  4AKL A;  5LCY A;  4WZX A;  2DWK A;  3EDV A;  3UUM A;  3VRB A;  2E5L T;  1HX1 B;  4GYS A;  2VL0 A;  3QK6 A;  3HKB E;  2Q9Q C;  1ZP0 A;  3F57 A;  3EAB A;  3T1Y T;  1WR0 A;  2NWB A;  4XAX B;  2X0H A;  3ZSS A;  1N36 T;  2PBI A;  1E1H B;  2XAS B;  1XZY A;  4DVD A;  3L3P A;  4IE6 A;  5AQR B;  4UV9 B;  1UGO A;  4JV5 T;  5LGU B;  3CVR A;  3N9N A;  2LJL A;  2CXL A;  3KV9 A;  1Y01 A;  3C4W A;  1VRB A;  2W62 A;  4I50 E;  3PUA A;  4YSZ A;  5JRC B;  2WCA A;  3RIA A;  5ETW A;  2J62 A;  5AQK B;  1XNR T;  3ZT5 A;  2OA5 A;  2LEH A;  4HTE A;  2NOX A;  3ZKR A;  4HFC A;  2XSA A;  5H6R B;  4IE0 A;  2D0U A;  4AIS A;  2WDR A;  4IE5 A;  5JDL A;  1IBM T;  4AQG A;  4GYR A;  2ZM2 A;  3K1S A;  3NBX X;  5LGT B;  5AQJ B;  1Y64 B;  4YTM A;  3UFE A;  4MLK A;  1SA0 E;  5LP6 E;  5DJQ C;  4EED A;  2L3L A;  3PJA A;  2BS2 A;  2C5J A;  3OYZ A;  3I9Y A;  4OYJ A;  2QA7 A;  3CX8 B;  4U3C A;  4GKJ T;  5FMN A;  3UU4 A;  4KUM B;  3U3I A;  3PDY A;  1WCR A;  3C51 A;  5CJ5 A;  2XAF B;  3VKG A;  3GN5 A;  3RYH E;  2V8S V;  3MXZ A;  4Z90 A;  4NXN T;  2GK9 A;  3PUV F;  1MMN A;  3A5X A;  1Z8U A;  1KEY A;  2W4X A;  4JI6 T;  4AIU A;  3E08 A;  1UX5 A;  4X20 E;  1KNZ A;  4ZOL E;  1I94 T;  3T1H T;  3ANW A;  5HWY A;  3PUS A;  3FBZ A;  4X5T A;  3VU7 H;  1D0Z A;  4EOZ B;  2MYS A;  4UV8 B;  1HF8 A;  3U78 A;  4DO0 A;  2LKG A;  2ZM0 A;  5JDM A;  5HEJ A;  3IA3 A;  3VHL A;  4DID B;  3C50 A;  1WFD A;  4YLH A;  1O3X A;  1HX8 A;  2B1E A;  2BG9 E;  2VVN A;  5DAB A;  3ZJ1 A;  3LJC A;  4K0U A;  3R84 B;  4M1P A;  2J4G A;  2FJE A;  4DV5 T;  5AQQ B;  3N9L A;  1QLB A;  3ONX A;  4U72 A;  3ZJ2 A;  3EAM A;  2XPK A;  2KLQ A;  4MAL A;  3PUQ A;  4UXN B;  3OYX A;  2Y6X A;  4YTP A;  5LJM A;  4JI5 T;  3F2E A;  2FJB A;  2IML A;  5FL0 A;  4KHP T;  4CQI A;  2MOZ A;  1YQ4 A;  3RKG A;  4OK0 A;  2IC9 A;  2N9D A;  1LVF A;  2XQ9 A;  2QRX A;  2CLY B;  4CI1 B;  1KNR A;  5JR9 C;  1OED E;  3N2O A;  5HEH A;  2CXF A;  2K3W A;  1XMQ T;  2WY2 A;  3CQC B;  2HN1 A;  4JI3 T;  3Q5X A;  2X9X A;  1FEW A;  4DMV A;  5CGM A;  2OV9 A;  2LOS A;  4UVC B;  2VKD A;  4DV7 T;  3RQW A;  1YKH B;  2E9X A;  1OED A;  2FUP A;  4LF8 T;  4G63 A;  4LF4 T;  1HS7 A;  1HR0 T;  4EIW A;  3LG7 A;  1UK5 A;  2CLY C;  4CI2 B;  2XJ7 A;  1QSD A;  2Q9Q A; 
#chains in the Genus database with same CATH homology
 2FUP A;  3OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...