4JI1T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji1T00
2VQFT 1J5ET 1N34T 4DUYT 2HHHT 4B3ST 4NXMT 4X64T 4B3TT 4JI8T 2UXDT 4OX9T 2UUCT 5LMNT 4LF6T 4GKKT 4X62T 1N36T 4DR7T 5BR8T 4JI2T 1XNQT 2F4VT 4X66T 4DR3T 4JI1T 4DV5T 3T1HT 4JI0T 4JI5T 4YY3T 5LMUT 4DV4T 1HNZT 1I94T 1HNXT 4LFBT 4DV6T 2UUBT 1IBLT 4DV3T 4LF5T 1N32T 4LFCT 4B3RT 1FJGT 3T1YT 4LF8T 4LF7T 5IWAT 2UXCT 1IBMT 1IBKT 2UU9T 4YHHT 4DV1T 4LF4T 4DR5T 4JI4T 1N33T 4GKJT 4DR1T 4DR2T 4NXNT 4JI7T 2E5LT 1HR0T 2UXBT 4AQYT 4JI6T 4JYAT 4LF9T 4K0KT 1XMOT 4DR6T 4KHPT 4JI3T 2VQET 4DV0T 2ZM6T 4DV2T 3OTOT 2UUAT 4LFAT 4DUZT 1XNRT 4X65T 4JV5T 4B3MT 4DV7T 1XMQT 1HNWT 4DR4T
chains in the Genus database with same CATH superfamily
1UGOA 2BG9C 3OPCA 3A7MA 4EV6A 1US7B 1XDOA 4ZEYA 1UURA 1HX8A 3GN5B 2K24A 2BKOA 4DR7T 5LJNA 1W09A 2V7KA 1W0BA 3FZHB 3P7IA 2WDRA 2Q9QB 2NW7A 4I4TE 3EHZA 4O4IE 4WNKA 3LK2B 3UU5A 3TLVA 3PDYA 2L9QA 4MBQA 3LK42 3ZSSA 3C4XA 4U2YA 3CVRA 4GKJT 3ZYKA 2FJDA 3GN5A 5JQGE 3RKGA 4PJJA 3ONJA 3AEBA 4EOZB 4DR6T 3UT5E 3PV0F 2Q9QA 3OTOT 4HFCA 5HXSA 1ZV4X 2XPKA 3O9XA 3RC8A 5FXXA 1ZKEA 4GK0E 3P4QA 2N9DA 1NEKA 4H9NC 2BVLA 2XSAA 2JQQA 3H3AA 2YDQA 3RF1A 3UUNA 4QWNB 2KXPB 3AEAA 5ABEA 2VKJA 2E9XD 3CKDA 3LFMA 4UELA 5BR8T 2W66A 3P8CD 4HKAA 1BR1A 4JI0T 5ADXL 3QOFA 2WU5A 2VURA 2GK9A 2K48A 4U72A 1GQEA 4LF5T 4NUUA 2K5BB 2XTLA 4B3RT 1FJGT 3VKHA 4LF7T 4BJNA 3PUXF 2YDRA 4PK6A 3ESLA 2V7LA 4QX8B 3NKZA 3KVAA 5AQSB 4WZXA 4KMCA 2UXBT 4U7IA 3N9LA 3RRWA 2JIWA 2OV9A 5EK4A 2LSYA 1MMDA 5HWYA 3QUJA 1QUUA 2XQ7A 3NRYA 3N2KE 4JUYA 5DQVA 4LFAT 2IAKA 4KBMB 5FXWA 1YXRA 3RRCA 2CRBA 2WMNA 3N2OA 3JADA 1X9BA 1HCIA 4HFBA 1BR2A 2X0HA 4DR4T 2DCFA 1UCUA 4ZXLA 5H6RB 3M3ZB 5DABA 2CM0A 4JI8T 3R84B 2X68A 2KWHA 2CEAA 1XZYA 3QK6A 2CWOA 2V1DB 2BBJA 4CXWA 1U4QA 3RQUA 1NAFA 3MACA 5F3JA 4OYJA 3BQLA 3VR8A 5LNKA 5LOVE 5HXEA 1HTJF 3I0QA 2VL8A 4EAHA 2HPJA 2LSGA 4CXYA 3JCFA 1QSDA 2KWIB 3HL6A 2UU9T 4QKNA 4YHHT 2VWAA 4LF4T 5HYAA 2LOSA 4O4HE 4QXCB 4E7ZA 3ZMZB 3RC3A 4K0UA 4EEDA 3D0TA 2X66A 3I9WA 1XDPA 4OFZA 2OLTA 5JDMA 2Q9QC 2JRKA 2BG9E 1UX4A 5LHHB 4UF0B 3FB2A 2A72A 3SFDA 2XJ7A 5JREA 4P0BA 3N9NA 2W00A 2LKHA 3SS1A 1KK7A 2PBIA 4L5GA 1WRDA 4AKGA 4AISA 3EAMA 2XSBA 3PU8A 4ISSA 3ETVA 5LHIB 2UXDT 3R6NA 3LG7A 4WBNE 2YEVC 4OX9T 1YQ4A 5AFUL 1MIYA 3GMIA 2LKGA 3FZKB 3N2GE 4LMKA 5JH7E 4HWIB 1JNZA 4UF0A 3B57A 4TNVA 2V7MA 1SA0E 4TUYE 3L09A 2IC6A 3O1IA 2J4GA 4NPPA 4KP3C 3X1DA 2Z6EA 3PE0A 2Y8DA 2LRKA 2WWUA 2LHNA 4U33A 2JMKA 3AA0B 5LCYA 1Y01A 1N33T 1LVKA 2IDOB 5AQLB 4H9RC 5AQTB 1UUSA 3ZPOA 2Y6XA 5HEHA 4CI1B 2I6HA 5AQPB 2WDQA 1G8XA 1LVFA 5LHGB 3PURA 3SFEA 4XZCA 2FUPA 2LSIA 2KINB 3WAJA 3OVUA 2FJAA 2V7IA 4DV7T 2WQYA 3O1JA 4EGWA 2VASA 4MLKA 5AQJB 2XY8B 1OWAA 1N34T 5L47A 5HEOA 2HHHT 5ABFB 2MPKA 4ZS2A 4B3TT 5L3BB 3AAEB 4CI3B 4ZS3A 4JEHB 1XNQT 3C98B 2M6BA 3AVSA 5J1GA 2MTQA 1NWMX 2YN6A 4YHJA 4HFDA 2H7VC 3KINB 3PUSA 2IHR1 1HNXT 2QRXA 1L0VA 3UUXB 4BJMA 2DNXA 1KNPA 4OHFA 4HGAA 4AKHA 2DHRA 2E8IA 2Y48B 3KBUA 2JQHA 3O1HA 2BDEA 3FZLB 2X0LB 3LSVA 3UFEA 2X51A 2I0MA 3E0ZA 2MAWA 5HXHA 4JI7T 5L4HA 5JR9B 3ONLC 3I1AA 5LA6E 4QXBB 3CX8B 1XMOT 4JI3T 2CXDA 4AXPA 4DV2T 2W61A 3AEEA 4ZZCA 3AA6B 3Q5DA 2D2SA 3JAFA 3C4WA 3EUHA 4X65T 5AQGB 2J62A 2CHOA 3C51A 1W0AA 4MFRA 2LJLA 3AE9A 4X64T 3F57A 4WBOA 5LMNT 4QX7B 4GKKT 2PG8A 2YU1A 4AKRB 4U74A 4X66T 4IL4A 2XQAA 3TLUA 3UU8A 3HR0A 4O4LE 1E2AA 4YTNA 1Z0PA 3DP7A 1WR0A 1Y64B 5LBMA 4IE0A 2WS3A 3PUYF 4ERRA 3BK9A 4DV3T 2XAHB 3MJXA 3OYXA 1T8BA 4ISTA 3K3QC 4PJMA 3AE2A 2X67A 4ILBA 2XUEA 4YSXA 5GONE 2A9UA 4DNDA 4DR2T 2CHNA 3ZMUB 1CUNA 2E5LT 5AQQB 4EB6E 2YKSA 3VRAA 3LK3B 4K0KT 4KHPT 5LGUB 3PUZF 5LGNB 4G63A 2PJQA 2H7OA 4Z91A 3E08A 3DJBA 5FKYA 3N9QA 1XNRT 3UQ7A 3M65A 1OEDB 1VOMA 1BR0A 3HKCE 4TV9E 3L3PA 4EYYR 4V1Av 5HEGA 3UULA 2EHOB 4HWHA 2DLRA 4A98A 5L3EB 5L3FB 4UEMA 5CGMA 4AIUA 1WYBA 4U3CA 1MNEA 2VKDA 2LLYA 3MZKB 4JI2T 2W67A 4DR3T 3UU4A 4U31A 1HF8A 3KVBA 4YY3T 4F6RC 4GIWA 3I9YA 5HCJA 3Q5XA 2X9YA 2BS4A 3T1YT 2K3WA 3NBXX 3QB5K 1OEDA 3AE3A 4J2CA 1SHZC 3FHNA 5LYJE 4M1PA 2CBJA 2X9XA 3IEEA 1IJ6A 2A3DA 2EHOA 4UV8B 3CX6B 2NOXA 5FVKA 3PUWF 5HXRA 4IE4A 1VRBA 3C50A 4TZ4C 4NUVA 1IAPA 5M4YA 4PJLA 2VKHA 5AQIB 3PU3A 3AAAB 5LP6E 2D0UA 3JC6D 2MYSA 4ILAA 5F8PA 4DUZT 3RIUA 3VU7H 3AA7B 5ABGA 4O4JE 2NW8A 1J1JA 4EYUA 2WWVA 4C91A 2BZBA 1BR4A 2LE8A 5AQKB 1U5PA 4IIJE 3PUQA 4L0RA 3KV6A 2UUCT 2K9AA 1E7PA 2WP9A 5JDQA 4N78D 2FJBA 5JR9C 3G06A 4DV5T 4QH4A 1MIVA 4UXNB 5LMUT 3OBVE 1MIWA 2XASB 4CI2B 1HG5A 4QH5A 5KXJA 4P09A 5JDHA 3CQGB 1D1CA 4NIQA 4E7SA 3MA9A 3ZJ2A 4YTMA 1CHUA 3CPZA 4OYKA 2UXCT 4ZI7E 4IDZA 5ETWA 2OA5A 2B1EA 1MNDA 3PTRB 2J1DG 3KDSE 3PUVF 4DR1T 2NWBA 1FIOA 4EIWA 3FZMB 2WZHA 2G0UA 5C3JA 4JYAT 2KMFA 5IHYA 2UUAT 3OYZA 4YXDA 2QA7A 2WAUA 4TX5A 3KV5A 2FJEA 2BBHA 5C8YE 4CZZB 3EVYA 2XAFB 2V7JA 2JMHA 1YKHB 2C5KT 2NR4A 1UK5A 2UXXB 3ZMTB 2WY2A 4ZI3D 4B3ST 3LDQB 3IA3A 1NENA 3EDUA 3RHWA 2V8SV 3T1HT 3OKQA 3P4SA 4YSZA 3GWHA 2QGSA 4IE5A 3ZLIA 4CXXA 4HFEA 3A8YC 5FY1A 4DMWA 1N32T 2J47A 4B6XA 4YJ2E 5BMVE 2IMLA 3Q5WA 1IBMT 2WSSV 1IBKT 4HN9A 2XHEB 3FXEB 2W2UA 5L3GB 3AE7A 1LRZA 5AQUB 2XAGB 4YT0A 5LG4A 3TLSA 5KDMC 3UU6A 3RGLA 5J0ZA 4ZHQE 4LF9T 2BG9A 4GYSA 3ZCIA 3H37A 4U7YA 1D1AA 2YU2A 3AAIA 2XM1A 1W9RA 5HXCA 2VL0A 3ZT5A 2DL1A 2H3RA 4QHOA 3LJCA 1AJ3A 1VCSA 3RIUC 1ZP0A 1OXZA 1WLXA 4PJNA 4X1IE 2WU2A 2BS3A 4L9IA 4EZ4A 4PAGA 5CB4E 2XQYA 3RYHE 2V6YB 5C2TA 3KBTA 1WFDA 3PJAJ 3CX7B 2WMOA 3KV9A 3NWIA 4PW8A 2XQ6A 5IYZE 2YK0A 4ILCA 2W4XA 4HEAA 4JI1T 3FBZA 2W0GA 4DMVA 4MALA 2LEHA 3HKBE 1T7SA 5AQVB 4ASKA 1I94T 3IBPA 2XQ5A 4IREA 4KHZF 5KX5E 4HFHA 2LOPA 2ZLYA 2ZM0A 2YOEA 4LFCT 1S94A 2PTFA 4FJOA 4C90A 4PFOA 2V6YA 3MXZA 4DIDB 4IT4A 4I50E 3ZJ1A 4LMLA 4TWHA 1Z8UA 1VCTA 4HWDA 3MKDA 4O2BE 4X20E 4X1KE 3HKEE 3AE5A 3U3IA 3RYCE 4TWFA 2L8KA 1HFAA 4EZHA 2E2AA 4Z90A 1G73A 2NP9A 5LBQB 4AI6A 2XAQB 3Q9DA 2ZM6T 3NZPA 2ZMAA 4H63V 1MMNA 3CQCB 5FY7A 4KX6A 5FL1A 1YKEB 2BKPA 1KNRA 2KSRA 4HWFA 5HCMA 1HG2A 1XMQT 2VK9A 4AQFA 3FBLA 3HKDE 3PJAA 1DU2A 3RIAA 4IHJE 2VQFT 2YDSA 1J5ET 5J2TE 2M67A 4AQGA 4IDNA 1SUMB 4NXMT 5A1LA 1HX1B 3NRXA 3ETUA 3DTOA 1J5WA 3J9X1 5HAXA 5F5WA 4A5XA 3CIRA 3O4XE 1HNZT 3ZCJA 3JC6C 3RKOA 4JBWF 2WM9A 2EHOD 5EZYE 3B5MA 4OK0A 2C5JA 3KFWX 4LF8T 5IWAT 4PFPA 5HWXA 3ZT6A 5JDFA 3RYFE 3HA4A 4IDPA 2AXDS 4O8SA 3CK6A 4P0AA 2VKOA 5JDGA 1EZ3A 3VR9A 4GK5E 2VQET 3VHLA 3RYIE 3U78A 2RP4A 3UUMA 2KNDA 3VRBA 4HE8A 4AKLA 3ZKRA 4UVCB 4DUYT 3MK7C 3N5LA 3ANWB 3NZQA 3UUBA 4DBQA 2D9DA 5AQOB 5DJQC 1OEDE 4JI5T 3K1SA 2C0SA 4LFBT 3K3NA 1XWMA 4LMJA 3ZSTA 2V5CA 5TAOA 4WYVA 3F2EA 4XBFB 2X9WA 3WAKA 4UV9B 3TLWA 2KZ7B 2BS2A 4H9QC 2W63A 2NW9A 4ZI2D 4ZI3C 2B76A 2V26A 3CQXC 4JI4T 2ES0A 4KI0F 4YFSA 3ANWA 3AE6A 4O2AE 2DWKA 2PFVA 4U2ZA 2IC9A 5L3CB 4AKIA 2VB6A 3ZT7A 4FI5A 3AEGA 3ZC0A 1YD8G 4A56A 3P4WA 4UR9A 5JDNA 4DV0T 4H9SE 5HEUA 3QB5A 4COFA 5L3DB 2VVSA 2IIUA 4YTPA 4YSYA 1I6ZA 3RQWA 4JV5T 5FMNA 5LJMA 2BVMA 1D1BA 3ONXA 4JLEA 2XQ3A 4AQFC 3ZYMA 3ZMSB 4HTEA 1ZEEA 4I43B 4X5TA 4IE6A 4LF6T 2KLQA 5JVDE 4X62T 1KF6A 4TN7B 1T98A 3N9MA 2WBLA 3RLFF 3OJAA 3RI5A 4Z8XA 2H88A 1IZNB 2CXLA 2L3LA 2VVNA 1JNRA 3AB3B 3J7Yq 1S35A 4EEBA 2YINA 2WCAA 1YW0A 2RA1A 5J2UE 5EK2A 1E1HB 2CCQA 3QNUA 5AQFB 4IGUA 5HEJA 2UXNB 2MOZA 4DV1T 2DWGA 3S4UA 4KUMB 4PNIA 2LRLA 1HS7A 1FMVA 3T8OA 2D5UA 3AECA 3AEFA 3EABA 3LBXB 3TKLB 1MMGA 1B7TA 4P1NA 2E5VA 2SPCA 5FVLA 3L39A 3AE4A 2E9XB 3BQIA 3B13A 3AE8A 1R8IA 1T72A 2ACXA 5E0OA 1QLBA 3UTKA 5FXZA 2ZM8A 3ZN1B 3V5SA 3KV4A 3QC9A 4XAXB 1D0XA 3NVOA 4UIGA 3JAEA 2XQ9A 2WZIA 4PK4A 1WYCA 1V9DA 3CMLA 1FEWA 3P50A 1N36T 3C64A 3PUGA 3AXJB 2IW5B 3AVRA 3LBXA 1WCRA 2CXFA 2N1GA 5LB7B 4DV4T 5CFBA 2H89A 3A5XA 2CLYB 2E9XA 1O3XA 2LSKA 1YQ3A 3GA8A 4MHCA 3ABVA 2V5DA 3UQ4A 3BQKA 3C4ZA 2BG9B 2CBIA 3AE1A 4ZOLE 5DQWA 5FL0A 2I59A 5CJ5A 4YJ3E 3EDVA 3K3OA 5LG3A 5FXVA 2ODUA 3RPUA 1MMAA 1HR0T 3ZEFB 1LKXA 4IE7A 2ZM2A 3FXDB 1OEDC 3AXJA 4CN6A 3RH3A 2XAJB 4QXHB 2HN1A 3EI0A 5AQRB 2EHOC 4BA9A 2JQKA 3RX6A 4GOUA 4CN1A 4B3MT 4YLHA 2R6GF 2LSJA 5JDLA 2D0TA 3W15B 4TWDA 2WB5A 1KNZA 2C5IT 3ZYLA 1SE7A 3H3MA 2HN2A 2CMRA 5FY0A 1FMWA 4TNWA 5FYMA 4ADZA 3IF8B 2P9BA 2X9HA 4TV8E 2F4VT 4F8HA 4EXTA 5KMGP 4GYRA 4UVAB 3V5UA 4PK5A 4DBRA 3RIFA 2JJ9A 2N2NA 3SWHA 3E22E 3N9PA 2X0YA 2W62A 5EK3A 4QH1A 4CN4A 2WDVA 4H63H 1ZHCA 2NTXA 2V6XA 4JEUB 3SOLA 2DI4A 1IJ5A 4DR5T 2ODVA 4ANJA 4NXNT 5AQHB 4I0UA 4UVBB 5AQNB 3Q2MA 4AQYT 2IUBA 4ZZBA 2QYWA 4JI6T 2LHRA 5L4EA 2LM9A 3ZC1A 5JRCB 5LGTB 2JPFA 3VKGA 2BKNA 5H6QB 1ZOYA 5AQMB 3AEDA 2HH7A 4IDQA 5CA0E 5CA1E 3ZMVB 4H9OC 3UU3A 5ABHA 2XQ8A 4ZI2C 4DO0A 4HFIA 1HNWT 3P4PA 2NTYA 3K8PC 5L2LA 1UX5A 3N9OA 3IHRA 3ZN0B 2ACZA 1D0YA 4CQIA 2A2FX 3Q5EA 3FZFB 1X79A 4BAYB 3PUAA 4HFVA 5JRCA 4G2AA 4DV6T 2UUBT 2KT9A 2E9XC 3F31A 5ABFA 2CA5A 2Q9QD 1IBLT 3HI2A 2LT3A 5IUXA 3SRZA 1KEYA 2LM2A 4IDOA 3L8RA 5LXTE 3I0OA 2XM2A 5JTGA 2FBWA 2MBGA 4X1YE 4I55E 2QVAA 3CWZB 2XQ4A 2HPLA 4Q25A 2XZEA 2CWYA 1H7CA 5FP3A 1D0ZA 3AA1B 5FNVE 1M62A 2M6IA 4H9PC 3WI3A 2CE7A 4IL9A 1M7KA 2JQ9A 2CPTA 2CLYC 3TLTA 3UFGA 4HWCA 2AE9A 4WW0A 1KFYA 1WR6A 5JR9A 3P4RA 2RPAA 4A97A 4ILUA 4DVDA
chains in the Genus database with same CATH topology
2VQFT 1J5ET 1N34T 4DUYT 2HHHT 4B3ST 4NXMT 4X64T 4B3TT 4JI8T 2UXDT 4OX9T 2UUCT 5LMNT 4LF6T 4GKKT 4X62T 1N36T 4DR7T 5BR8T 4JI2T 1XNQT 2F4VT 4X66T 4DR3T 4JI1T 4DV5T 3T1HT 4JI0T 4JI5T 4YY3T 5LMUT 4DV4T 1HNZT 1I94T 1HNXT 4LFBT 4DV6T 2UUBT 1IBLT 4DV3T 4LF5T 1N32T 4LFCT 4B3RT 1FJGT 3T1YT 4LF8T 4LF7T 5IWAT 2UXCT 1IBMT 1IBKT 2UU9T 4YHHT 4DV1T 4LF4T 4DR5T 4JI4T 1N33T 4GKJT 4DR1T 4DR2T 4NXNT 4JI7T 2E5LT 1HR0T 2UXBT 4AQYT 4JI6T 4JYAT 4LF9T 4K0KT 1XMOT 4DR6T 4KHPT 4JI3T 2VQET 4DV0T 2ZM6T 4DV2T 3OTOT 2UUAT 4LFAT 4DUZT 1XNRT 4X65T 4JV5T 4B3MT 4DV7T 1XMQT 1HNWT 4DR4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF T;  1J5E T;  1N34 T;  4DUY T;  2HHH T;  4B3S T;  4NXM T;  4X64 T;  4B3T T;  4JI8 T;  2UXD T;  4OX9 T;  2UUC T;  5LMN T;  4LF6 T;  4GKK T;  4X62 T;  1N36 T;  4DR7 T;  5BR8 T;  4JI2 T;  1XNQ T;  2F4V T;  4X66 T;  4DR3 T;  4JI1 T;  4DV5 T;  3T1H T;  4JI0 T;  4JI5 T;  4YY3 T;  5LMU T;  4DV4 T;  1HNZ T;  1I94 T;  1HNX T;  4LFB T;  4DV6 T;  2UUB T;  1IBL T;  4DV3 T;  4LF5 T;  1N32 T;  4LFC T;  4B3R T;  1FJG T;  3T1Y T;  4LF8 T;  4LF7 T;  5IWA T;  2UXC T;  1IBM T;  1IBK T;  2UU9 T;  4YHH T;  4DV1 T;  4LF4 T;  4DR5 T;  4JI4 T;  1N33 T;  4GKJ T;  4DR1 T;  4DR2 T;  4NXN T;  4JI7 T;  2E5L T;  1HR0 T;  2UXB T;  4AQY T;  4JI6 T;  4JYA T;  4LF9 T;  4K0K T;  1XMO T;  4DR6 T;  4KHP T;  4JI3 T;  2VQE T;  4DV0 T;  2ZM6 T;  4DV2 T;  3OTO T;  2UUA T;  4LFA T;  4DUZ T;  1XNR T;  4X65 T;  4JV5 T;  4B3M T;  4DV7 T;  1XMQ T;  1HNW T;  4DR4 T; 
#chains in the Genus database with same CATH topology
 1UGO A;  2BG9 C;  3OPC A;  3A7M A;  4EV6 A;  1US7 B;  1XDO A;  4ZEY A;  1UUR A;  1HX8 A;  3GN5 B;  2K24 A;  2BKO A;  4DR7 T;  5LJN A;  1W09 A;  2V7K A;  1W0B A;  3FZH B;  3P7I A;  2WDR A;  2Q9Q B;  2NW7 A;  4I4T E;  3EHZ A;  4O4I E;  4WNK A;  3LK2 B;  3UU5 A;  3TLV A;  3PDY A;  2L9Q A;  4MBQ A;  3LK4 2;  3ZSS A;  3C4X A;  4U2Y A;  3CVR A;  4GKJ T;  3ZYK A;  2FJD A;  3GN5 A;  5JQG E;  3RKG A;  4PJJ A;  3ONJ A;  3AEB A;  4EOZ B;  4DR6 T;  3UT5 E;  3PV0 F;  2Q9Q A;  3OTO T;  4HFC A;  5HXS A;  1ZV4 X;  2XPK A;  3O9X A;  3RC8 A;  5FXX A;  1ZKE A;  4GK0 E;  3P4Q A;  2N9D A;  1NEK A;  4H9N C;  2BVL A;  2XSA A;  2JQQ A;  3H3A A;  2YDQ A;  3RF1 A;  3UUN A;  4QWN B;  2KXP B;  3AEA A;  5ABE A;  2VKJ A;  2E9X D;  3CKD A;  3LFM A;  4UEL A;  5BR8 T;  2W66 A;  3P8C D;  4HKA A;  1BR1 A;  4JI0 T;  5ADX L;  3QOF A;  2WU5 A;  2VUR A;  2GK9 A;  2K48 A;  4U72 A;  1GQE A;  4LF5 T;  4NUU A;  2K5B B;  2XTL A;  4B3R T;  1FJG T;  3VKH A;  4LF7 T;  4BJN A;  3PUX F;  2YDR A;  4PK6 A;  3ESL A;  2V7L A;  4QX8 B;  3NKZ A;  3KVA A;  5AQS B;  4WZX A;  4KMC A;  2UXB T;  4U7I A;  3N9L A;  3RRW A;  2JIW A;  2OV9 A;  5EK4 A;  2LSY A;  1MMD A;  5HWY A;  3QUJ A;  1QUU A;  2XQ7 A;  3NRY A;  3N2K E;  4JUY A;  5DQV A;  4LFA T;  2IAK A;  4KBM B;  5FXW A;  1YXR A;  3RRC A;  2CRB A;  2WMN A;  3N2O A;  3JAD A;  1X9B A;  1HCI A;  4HFB A;  1BR2 A;  2X0H A;  4DR4 T;  2DCF A;  1UCU A;  4ZXL A;  5H6R B;  3M3Z B;  5DAB A;  2CM0 A;  4JI8 T;  3R84 B;  2X68 A;  2KWH A;  2CEA A;  1XZY A;  3QK6 A;  2CWO A;  2V1D B;  2BBJ A;  4CXW A;  1U4Q A;  3RQU A;  1NAF A;  3MAC A;  5F3J A;  4OYJ A;  3BQL A;  3VR8 A;  5LNK A;  5LOV E;  5HXE A;  1HTJ F;  3I0Q A;  2VL8 A;  4EAH A;  2HPJ A;  2LSG A;  4CXY A;  3JCF A;  1QSD A;  2KWI B;  3HL6 A;  2UU9 T;  4QKN A;  4YHH T;  2VWA A;  4LF4 T;  5HYA A;  2LOS A;  4O4H E;  4QXC B;  4E7Z A;  3ZMZ B;  3RC3 A;  4K0U A;  4EED A;  3D0T A;  2X66 A;  3I9W A;  1XDP A;  4OFZ A;  2OLT A;  5JDM A;  2Q9Q C;  2JRK A;  2BG9 E;  1UX4 A;  5LHH B;  4UF0 B;  3FB2 A;  2A72 A;  3SFD A;  2XJ7 A;  5JRE A;  4P0B A;  3N9N A;  2W00 A;  2LKH A;  3SS1 A;  1KK7 A;  2PBI A;  4L5G A;  1WRD A;  4AKG A;  4AIS A;  3EAM A;  2XSB A;  3PU8 A;  4ISS A;  3ETV A;  5LHI B;  2UXD T;  3R6N A;  3LG7 A;  4WBN E;  2YEV C;  4OX9 T;  1YQ4 A;  5AFU L;  1MIY A;  3GMI A;  2LKG A;  3FZK B;  3N2G E;  4LMK A;  5JH7 E;  4HWI B;  1JNZ A;  4UF0 A;  3B57 A;  4TNV A;  2V7M A;  1SA0 E;  4TUY E;  3L09 A;  2IC6 A;  3O1I A;  2J4G A;  4NPP A;  4KP3 C;  3X1D A;  2Z6E A;  3PE0 A;  2Y8D A;  2LRK A;  2WWU A;  2LHN A;  4U33 A;  2JMK A;  3AA0 B;  5LCY A;  1Y01 A;  1N33 T;  1LVK A;  2IDO B;  5AQL B;  4H9R C;  5AQT B;  1UUS A;  3ZPO A;  2Y6X A;  5HEH A;  4CI1 B;  2I6H A;  5AQP B;  2WDQ A;  1G8X A;  1LVF A;  5LHG B;  3PUR A;  3SFE A;  4XZC A;  2FUP A;  2LSI A;  2KIN B;  3WAJ A;  3OVU A;  2FJA A;  2V7I A;  4DV7 T;  2WQY A;  3O1J A;  4EGW A;  2VAS A;  4MLK A;  5AQJ B;  2XY8 B;  1OWA A;  1N34 T;  5L47 A;  5HEO A;  2HHH T;  5ABF B;  2MPK A;  4ZS2 A;  4B3T T;  5L3B B;  3AAE B;  4CI3 B;  4ZS3 A;  4JEH B;  1XNQ T;  3C98 B;  2M6B A;  3AVS A;  5J1G A;  2MTQ A;  1NWM X;  2YN6 A;  4YHJ A;  4HFD A;  2H7V C;  3KIN B;  3PUS A;  2IHR 1;  1HNX T;  2QRX A;  1L0V A;  3UUX B;  4BJM A;  2DNX A;  1KNP A;  4OHF A;  4HGA A;  4AKH A;  2DHR A;  2E8I A;  2Y48 B;  3KBU A;  2JQH A;  3O1H A;  2BDE A;  3FZL B;  2X0L B;  3LSV A;  3UFE A;  2X51 A;  2I0M A;  3E0Z A;  2MAW A;  5HXH A;  4JI7 T;  5L4H A;  5JR9 B;  3ONL C;  3I1A A;  5LA6 E;  4QXB B;  3CX8 B;  1XMO T;  4JI3 T;  2CXD A;  4AXP A;  4DV2 T;  2W61 A;  3AEE A;  4ZZC A;  3AA6 B;  3Q5D A;  2D2S A;  3JAF A;  3C4W A;  3EUH A;  4X65 T;  5AQG B;  2J62 A;  2CHO A;  3C51 A;  1W0A A;  4MFR A;  2LJL A;  3AE9 A;  4X64 T;  3F57 A;  4WBO A;  5LMN T;  4QX7 B;  4GKK T;  2PG8 A;  2YU1 A;  4AKR B;  4U74 A;  4X66 T;  4IL4 A;  2XQA A;  3TLU A;  3UU8 A;  3HR0 A;  4O4L E;  1E2A A;  4YTN A;  1Z0P A;  3DP7 A;  1WR0 A;  1Y64 B;  5LBM A;  4IE0 A;  2WS3 A;  3PUY F;  4ERR A;  3BK9 A;  4DV3 T;  2XAH B;  3MJX A;  3OYX A;  1T8B A;  4IST A;  3K3Q C;  4PJM A;  3AE2 A;  2X67 A;  4ILB A;  2XUE A;  4YSX A;  5GON E;  2A9U A;  4DND A;  4DR2 T;  2CHN A;  3ZMU B;  1CUN A;  2E5L T;  5AQQ B;  4EB6 E;  2YKS A;  3VRA A;  3LK3 B;  4K0K T;  4KHP T;  5LGU B;  3PUZ F;  5LGN B;  4G63 A;  2PJQ A;  2H7O A;  4Z91 A;  3E08 A;  3DJB A;  5FKY A;  3N9Q A;  1XNR T;  3UQ7 A;  3M65 A;  1OED B;  1VOM A;  1BR0 A;  3HKC E;  4TV9 E;  3L3P A;  4EYY R;  4V1A v;  5HEG A;  3UUL A;  2EHO B;  4HWH A;  2DLR A;  4A98 A;  5L3E B;  5L3F B;  4UEM A;  5CGM A;  4AIU A;  1WYB A;  4U3C A;  1MNE A;  2VKD A;  2LLY A;  3MZK B;  4JI2 T;  2W67 A;  4DR3 T;  3UU4 A;  4U31 A;  1HF8 A;  3KVB A;  4YY3 T;  4F6R C;  4GIW A;  3I9Y A;  5HCJ A;  3Q5X A;  2X9Y A;  2BS4 A;  3T1Y T;  2K3W A;  3NBX X;  3QB5 K;  1OED A;  3AE3 A;  4J2C A;  1SHZ C;  3FHN A;  5LYJ E;  4M1P A;  2CBJ A;  2X9X A;  3IEE A;  1IJ6 A;  2A3D A;  2EHO A;  4UV8 B;  3CX6 B;  2NOX A;  5FVK A;  3PUW F;  5HXR A;  4IE4 A;  1VRB A;  3C50 A;  4TZ4 C;  4NUV A;  1IAP A;  5M4Y A;  4PJL A;  2VKH A;  5AQI B;  3PU3 A;  3AAA B;  5LP6 E;  2D0U A;  3JC6 D;  2MYS A;  4ILA A;  5F8P A;  4DUZ T;  3RIU A;  3VU7 H;  3AA7 B;  5ABG A;  4O4J E;  2NW8 A;  1J1J A;  4EYU A;  2WWV A;  4C91 A;  2BZB A;  1BR4 A;  2LE8 A;  5AQK B;  1U5P A;  4IIJ E;  3PUQ A;  4L0R A;  3KV6 A;  2UUC T;  2K9A A;  1E7P A;  2WP9 A;  5JDQ A;  4N78 D;  2FJB A;  5JR9 C;  3G06 A;  4DV5 T;  4QH4 A;  1MIV A;  4UXN B;  5LMU T;  3OBV E;  1MIW A;  2XAS B;  4CI2 B;  1HG5 A;  4QH5 A;  5KXJ A;  4P09 A;  5JDH A;  3CQG B;  1D1C A;  4NIQ A;  4E7S A;  3MA9 A;  3ZJ2 A;  4YTM A;  1CHU A;  3CPZ A;  4OYK A;  2UXC T;  4ZI7 E;  4IDZ A;  5ETW A;  2OA5 A;  2B1E A;  1MND A;  3PTR B;  2J1D G;  3KDS E;  3PUV F;  4DR1 T;  2NWB A;  1FIO A;  4EIW A;  3FZM B;  2WZH A;  2G0U A;  5C3J A;  4JYA T;  2KMF A;  5IHY A;  2UUA T;  3OYZ A;  4YXD A;  2QA7 A;  2WAU A;  4TX5 A;  3KV5 A;  2FJE A;  2BBH A;  5C8Y E;  4CZZ B;  3EVY A;  2XAF B;  2V7J A;  2JMH A;  1YKH B;  2C5K T;  2NR4 A;  1UK5 A;  2UXX B;  3ZMT B;  2WY2 A;  4ZI3 D;  4B3S T;  3LDQ B;  3IA3 A;  1NEN A;  3EDU A;  3RHW A;  2V8S V;  3T1H T;  3OKQ A;  3P4S A;  4YSZ A;  3GWH A;  2QGS A;  4IE5 A;  3ZLI A;  4CXX A;  4HFE A;  3A8Y C;  5FY1 A;  4DMW A;  1N32 T;  2J47 A;  4B6X A;  4YJ2 E;  5BMV E;  2IML A;  3Q5W A;  1IBM T;  2WSS V;  1IBK T;  4HN9 A;  2XHE B;  3FXE B;  2W2U A;  5L3G B;  3AE7 A;  1LRZ A;  5AQU B;  2XAG B;  4YT0 A;  5LG4 A;  3TLS A;  5KDM C;  3UU6 A;  3RGL A;  5J0Z A;  4ZHQ E;  4LF9 T;  2BG9 A;  4GYS A;  3ZCI A;  3H37 A;  4U7Y A;  1D1A A;  2YU2 A;  3AAI A;  2XM1 A;  1W9R A;  5HXC A;  2VL0 A;  3ZT5 A;  2DL1 A;  2H3R A;  4QHO A;  3LJC A;  1AJ3 A;  1VCS A;  3RIU C;  1ZP0 A;  1OXZ A;  1WLX A;  4PJN A;  4X1I E;  2WU2 A;  2BS3 A;  4L9I A;  4EZ4 A;  4PAG A;  5CB4 E;  2XQY A;  3RYH E;  2V6Y B;  5C2T A;  3KBT A;  1WFD A;  3PJA J;  3CX7 B;  2WMO A;  3KV9 A;  3NWI A;  4PW8 A;  2XQ6 A;  5IYZ E;  2YK0 A;  4ILC A;  2W4X A;  4HEA A;  4JI1 T;  3FBZ A;  2W0G A;  4DMV A;  4MAL A;  2LEH A;  3HKB E;  1T7S A;  5AQV B;  4ASK A;  1I94 T;  3IBP A;  2XQ5 A;  4IRE A;  4KHZ F;  5KX5 E;  4HFH A;  2LOP A;  2ZLY A;  2ZM0 A;  2YOE A;  4LFC T;  1S94 A;  2PTF A;  4FJO A;  4C90 A;  4PFO A;  2V6Y A;  3MXZ A;  4DID B;  4IT4 A;  4I50 E;  3ZJ1 A;  4LML A;  4TWH A;  1Z8U A;  1VCT A;  4HWD A;  3MKD A;  4O2B E;  4X20 E;  4X1K E;  3HKE E;  3AE5 A;  3U3I A;  3RYC E;  4TWF A;  2L8K A;  1HFA A;  4EZH A;  2E2A A;  4Z90 A;  1G73 A;  2NP9 A;  5LBQ B;  4AI6 A;  2XAQ B;  3Q9D A;  2ZM6 T;  3NZP A;  2ZMA A;  4H63 V;  1MMN A;  3CQC B;  5FY7 A;  4KX6 A;  5FL1 A;  1YKE B;  2BKP A;  1KNR A;  2KSR A;  4HWF A;  5HCM A;  1HG2 A;  1XMQ T;  2VK9 A;  4AQF A;  3FBL A;  3HKD E;  3PJA A;  1DU2 A;  3RIA A;  4IHJ E;  2VQF T;  2YDS A;  1J5E T;  5J2T E;  2M67 A;  4AQG A;  4IDN A;  1SUM B;  4NXM T;  5A1L A;  1HX1 B;  3NRX A;  3ETU A;  3DTO A;  1J5W A;  3J9X 1;  5HAX A;  5F5W A;  4A5X A;  3CIR A;  3O4X E;  1HNZ T;  3ZCJ A;  3JC6 C;  3RKO A;  4JBW F;  2WM9 A;  2EHO D;  5EZY E;  3B5M A;  4OK0 A;  2C5J A;  3KFW X;  4LF8 T;  5IWA T;  4PFP A;  5HWX A;  3ZT6 A;  5JDF A;  3RYF E;  3HA4 A;  4IDP A;  2AXD S;  4O8S A;  3CK6 A;  4P0A A;  2VKO A;  5JDG A;  1EZ3 A;  3VR9 A;  4GK5 E;  2VQE T;  3VHL A;  3RYI E;  3U78 A;  2RP4 A;  3UUM A;  2KND A;  3VRB A;  4HE8 A;  4AKL A;  3ZKR A;  4UVC B;  4DUY T;  3MK7 C;  3N5L A;  3ANW B;  3NZQ A;  3UUB A;  4DBQ A;  2D9D A;  5AQO B;  5DJQ C;  1OED E;  4JI5 T;  3K1S A;  2C0S A;  4LFB T;  3K3N A;  1XWM A;  4LMJ A;  3ZST A;  2V5C A;  5TAO A;  4WYV A;  3F2E A;  4XBF B;  2X9W A;  3WAK A;  4UV9 B;  3TLW A;  2KZ7 B;  2BS2 A;  4H9Q C;  2W63 A;  2NW9 A;  4ZI2 D;  4ZI3 C;  2B76 A;  2V26 A;  3CQX C;  4JI4 T;  2ES0 A;  4KI0 F;  4YFS A;  3ANW A;  3AE6 A;  4O2A E;  2DWK A;  2PFV A;  4U2Z A;  2IC9 A;  5L3C B;  4AKI A;  2VB6 A;  3ZT7 A;  4FI5 A;  3AEG A;  3ZC0 A;  1YD8 G;  4A56 A;  3P4W A;  4UR9 A;  5JDN A;  4DV0 T;  4H9S E;  5HEU A;  3QB5 A;  4COF A;  5L3D B;  2VVS A;  2IIU A;  4YTP A;  4YSY A;  1I6Z A;  3RQW A;  4JV5 T;  5FMN A;  5LJM A;  2BVM A;  1D1B A;  3ONX A;  4JLE A;  2XQ3 A;  4AQF C;  3ZYM A;  3ZMS B;  4HTE A;  1ZEE A;  4I43 B;  4X5T A;  4IE6 A;  4LF6 T;  2KLQ A;  5JVD E;  4X62 T;  1KF6 A;  4TN7 B;  1T98 A;  3N9M A;  2WBL A;  3RLF F;  3OJA A;  3RI5 A;  4Z8X A;  2H88 A;  1IZN B;  2CXL A;  2L3L A;  2VVN A;  1JNR A;  3AB3 B;  3J7Y q;  1S35 A;  4EEB A;  2YIN A;  2WCA A;  1YW0 A;  2RA1 A;  5J2U E;  5EK2 A;  1E1H B;  2CCQ A;  3QNU A;  5AQF B;  4IGU A;  5HEJ A;  2UXN B;  2MOZ A;  4DV1 T;  2DWG A;  3S4U A;  4KUM B;  4PNI A;  2LRL A;  1HS7 A;  1FMV A;  3T8O A;  2D5U A;  3AEC A;  3AEF A;  3EAB A;  3LBX B;  3TKL B;  1MMG A;  1B7T A;  4P1N A;  2E5V A;  2SPC A;  5FVL A;  3L39 A;  3AE4 A;  2E9X B;  3BQI A;  3B13 A;  3AE8 A;  1R8I A;  1T72 A;  2ACX A;  5E0O A;  1QLB A;  3UTK A;  5FXZ A;  2ZM8 A;  3ZN1 B;  3V5S A;  3KV4 A;  3QC9 A;  4XAX B;  1D0X A;  3NVO A;  4UIG A;  3JAE A;  2XQ9 A;  2WZI A;  4PK4 A;  1WYC A;  1V9D A;  3CML A;  1FEW A;  3P50 A;  1N36 T;  3C64 A;  3PUG A;  3AXJ B;  2IW5 B;  3AVR A;  3LBX A;  1WCR A;  2CXF A;  2N1G A;  5LB7 B;  4DV4 T;  5CFB A;  2H89 A;  3A5X A;  2CLY B;  2E9X A;  1O3X A;  2LSK A;  1YQ3 A;  3GA8 A;  4MHC A;  3ABV A;  2V5D A;  3UQ4 A;  3BQK A;  3C4Z A;  2BG9 B;  2CBI A;  3AE1 A;  4ZOL E;  5DQW A;  5FL0 A;  2I59 A;  5CJ5 A;  4YJ3 E;  3EDV A;  3K3O A;  5LG3 A;  5FXV A;  2ODU A;  3RPU A;  1MMA A;  1HR0 T;  3ZEF B;  1LKX A;  4IE7 A;  2ZM2 A;  3FXD B;  1OED C;  3AXJ A;  4CN6 A;  3RH3 A;  2XAJ B;  4QXH B;  2HN1 A;  3EI0 A;  5AQR B;  2EHO C;  4BA9 A;  2JQK A;  3RX6 A;  4GOU A;  4CN1 A;  4B3M T;  4YLH A;  2R6G F;  2LSJ A;  5JDL A;  2D0T A;  3W15 B;  4TWD A;  2WB5 A;  1KNZ A;  2C5I T;  3ZYL A;  1SE7 A;  3H3M A;  2HN2 A;  2CMR A;  5FY0 A;  1FMW A;  4TNW A;  5FYM A;  4ADZ A;  3IF8 B;  2P9B A;  2X9H A;  4TV8 E;  2F4V T;  4F8H A;  4EXT A;  5KMG P;  4GYR A;  4UVA B;  3V5U A;  4PK5 A;  4DBR A;  3RIF A;  2JJ9 A;  2N2N A;  3SWH A;  3E22 E;  3N9P A;  2X0Y A;  2W62 A;  5EK3 A;  4QH1 A;  4CN4 A;  2WDV A;  4H63 H;  1ZHC A;  2NTX A;  2V6X A;  4JEU B;  3SOL A;  2DI4 A;  1IJ5 A;  4DR5 T;  2ODV A;  4ANJ A;  4NXN T;  5AQH B;  4I0U A;  4UVB B;  5AQN B;  3Q2M A;  4AQY T;  2IUB A;  4ZZB A;  2QYW A;  4JI6 T;  2LHR A;  5L4E A;  2LM9 A;  3ZC1 A;  5JRC B;  5LGT B;  2JPF A;  3VKG A;  2BKN A;  5H6Q B;  1ZOY A;  5AQM B;  3AED A;  2HH7 A;  4IDQ A;  5CA0 E;  5CA1 E;  3ZMV B;  4H9O C;  3UU3 A;  5ABH A;  2XQ8 A;  4ZI2 C;  4DO0 A;  4HFI A;  1HNW T;  3P4P A;  2NTY A;  3K8P C;  5L2L A;  1UX5 A;  3N9O A;  3IHR A;  3ZN0 B;  2ACZ A;  1D0Y A;  4CQI A;  2A2F X;  3Q5E A;  3FZF B;  1X79 A;  4BAY B;  3PUA A;  4HFV A;  5JRC A;  4G2A A;  4DV6 T;  2UUB T;  2KT9 A;  2E9X C;  3F31 A;  5ABF A;  2CA5 A;  2Q9Q D;  1IBL T;  3HI2 A;  2LT3 A;  5IUX A;  3SRZ A;  1KEY A;  2LM2 A;  4IDO A;  3L8R A;  5LXT E;  3I0O A;  2XM2 A;  5JTG A;  2FBW A;  2MBG A;  4X1Y E;  4I55 E;  2QVA A;  3CWZ B;  2XQ4 A;  2HPL A;  4Q25 A;  2XZE A;  2CWY A;  1H7C A;  5FP3 A;  1D0Z A;  3AA1 B;  5FNV E;  1M62 A;  2M6I A;  4H9P C;  3WI3 A;  2CE7 A;  4IL9 A;  1M7K A;  2JQ9 A;  2CPT A;  2CLY C;  3TLT A;  3UFG A;  4HWC A;  2AE9 A;  4WW0 A;  1KFY A;  1WR6 A;  5JR9 A;  3P4R A;  2RPA A;  4A97 A;  4ILU A;  4DVD A; 
#chains in the Genus database with same CATH homology
 2VQF T;  1J5E T;  1N34 T;  4DUY T;  2HHH T;  4B3S T;  4NXM T;  4X64 T;  4B3T T;  4JI8 T;  2UXD T;  4OX9 T;  2UUC T;  5LMN T;  4LF6 T;  4GKK T;  4X62 T;  1N36 T;  4DR7 T;  5BR8 T;  4JI2 T;  1XNQ T;  2F4V T;  4X66 T;  4DR3 T;  4JI1 T;  4DV5 T;  3T1H T;  4JI0 T;  4JI5 T;  4YY3 T;  5LMU T;  4DV4 T;  1HNZ T;  1I94 T;  1HNX T;  4LFB T;  4DV6 T;  2UUB T;  1IBL T;  4DV3 T;  4LF5 T;  1N32 T;  4LFC T;  4B3R T;  1FJG T;  3T1Y T;  4LF8 T;  4LF7 T;  5IWA T;  2UXC T;  1IBM T;  1IBK T;  2UU9 T;  4YHH T;  4DV1 T;  4LF4 T;  4DR5 T;  4JI4 T;  1N33 T;  4GKJ T;  4DR1 T;  4DR2 T;  4NXN T;  4JI7 T;  2E5L T;  1HR0 T;  2UXB T;  4AQY T;  4JI6 T;  4JYA T;  4LF9 T;  4K0K T;  1XMO T;  4DR6 T;  4KHP T;  4JI3 T;  2VQE T;  4DV0 T;  2ZM6 T;  4DV2 T;  3OTO T;  2UUA T;  4LFA T;  4DUZ T;  1XNR T;  4X65 T;  4JV5 T;  4B3M T;  4DV7 T;  1XMQ T;  1HNW T;  4DR4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...