4JI1T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji1T00
4JYAT 2UU9T 4DR7T 4DV1T 4DV5T 3OTOT 4JI5T 5LMNT 1XMQT 4JV5T 4X66T 2VQET 4YY3T 2UXBT 4X65T 2UXCT 3T1HT 4DUZT 4DR2T 4DR5T 4JI2T 4DV0T 2HHHT 4NXNT 4LFAT 4GKKT 2E5LT 4LF9T 2UUCT 1N36T 1XNRT 1HNZT 4DV6T 1HNWT 5IWAT 1IBLT 1J5ET 4JI7T 4DV3T 4JI4T 2ZM6T 4X64T 1FJGT 4NXMT 4DR6T 1XMOT 1XNQT 1I94T 4LF8T 2UUAT 5LMUT 4OX9T 4K0KT 5BR8T 3T1YT 2UUBT 4KHPT 2F4VT 4JI1T 4DV7T 4LFCT 4B3TT 1IBKT 4B3MT 4JI3T 4DR1T 1N33T 4YHHT 1HR0T 4LF4T 4JI0T 1N34T 4DR4T 4DUYT 4JI6T 4LFBT 4LF5T 2VQFT 1HNXT 4GKJT 4X62T 4AQYT 1N32T 1IBMT 4B3ST 4JI8T 4B3RT 2UXDT 4LF6T 4LF7T 4DR3T 4DV2T 4DV4T
chains in the Genus database with same CATH superfamily
3UQ7A 4E7SA 2XQ6A 2KT9A 2NTYA 4NIQA 4QXHB 2UU9T 4DR7T 3RQWA 2ZLYA 3QC9A 4DV1T 4DV5T 2AE9A 2V5CA 1T98A 1VCSA 2DHRA 2VKJA 3QNUA 4O4IE 5AQPB 3RX6A 3P50A 2BG9A 4UEMA 4JV5T 4AQGA 4EOZB 1HG2A 2I0MA 3ONXA 5FL1A 1NEKA 3CX6B 1EZ3A 4DV4T 3PUVF 2J1DG 3N2KE 4IL4A 2VQET 4WYVA 2LRLA 2XQ5A 5AQKB 4X65T 2M67A 2AXDS 4JLEA 2W63A 1G8XA 3EDUA 2B1EA 4HWCA 3CQXC 3JAFA 4K0UA 2WBLA 5FVKA 4DR1T 2KSRA 4ILCA 3LK2B 3AE7A 3CK6A 3E22E 3L8RA 1OEDA 3LJCA 3HR0A 3PV0F 5EZYE 4HWIB 5LB7B 3RYCE 5HWYA 2R6GF 2LM9A 3GN5B 3ONJA 4F8HA 1QLBA 1YQ4A 2FUPA 4FI5A 1IAPA 4QXBB 3TLSA 1WR0A 5A1LA 5AQFB 4KBMB 2E5LT 1I6ZA 3K8PC 2L9QA 2VURA 1N36T 2KWHA 4IGUA 5LHIB 4TNVA 5IHYA 2CMRA 1YKHB 4YTPA 3UU3A 2K24A 3UU8A 3VU7H 5ABFB 2YK0A 2CLYB 2LOSA 3Q9DA 4PK4A 4Z91A 5AQQB 1IJ5A 4PJMA 5AQTB 3AE6A 1U4QA 2BDEA 1UK5A 3CVRA 3IA3A 3ZSSA 3BQKA 5KDMC 3L09A 4PJLA 5CA0E 3AAIA 2XSAA 3NZQA 1HX8A 3CKDA 5KXJA 1SUMB 5HEOA 2XAQB 1GQEA 2CBJA 2G0UA 2SPCA 2YOEA 3LFMA 3UTKA 2GK9A 2IC9A 1J1JA 3N2GE 3N2OA 5FL0A 3ZMTB 4CZZB 2V7JA 3NRXA 4ISSA 4IHJE 2LSGA 3RIFA 2WCAA 3BQLA 4X1KE 2V26A 2X67A 2JQKA 1I94T 3P4SA 3DP7A 1Z0PA 4A98A 5LCYA 2CXFA 2CHOA 2KNDA 3ZT6A 4ZHQE 2EHOD 4K0KT 4H9RC 5BR8T 5L3DB 1V9DA 4COFA 2Y48B 3M65A 3O1IA 3T1YT 2UUBT 1S94A 4YJ3E 3AAAB 4O2AE 2UXNB 3RYHE 5H6QB 1XDOA 2D2SA 3R6NA 4JI1T 4LFCT 2VB6A 3SS1A 5JTGA 3UUMA 3AE5A 2LHRA 2BVMA 3GN5A 2ZM0A 3FZKB 3PURA 1T72A 4I4TE 4MHCA 3UULA 5ADXL 4JI3T 2X9YA 3K3QC 3IBPA 4U74A 4WNKA 3ZYMA 4CXXA 5IUXA 4YHHT 2LHNA 1NAFA 2Q9QA 4DNDA 3AEAA 2C5IT 2WAUA 4NPPA 4XZCA 3ZYKA 2D9DA 2DL1A 3IF8B 4IDPA 4QHOA 1X79A 4CQIA 2EHOC 2ACZA 3SWHA 1CHUA 3AVRA 4HWFA 3CX8B 3HL6A 5CJ5A 4JI6T 3UT5E 3L3PA 4DIDB 1KNRA 5LGNB 2WM9A 2XQYA 3ZN0B 1WRDA 1S35A 2D0UA 3PUQA 4JUYA 2K48A 2W62A 2JJ9A 2XJ7A 3UUBA 4ANJA 2A3DA 4LF5T 4XBFB 5AFUL 2H3RA 2VQFT 2V7MA 3I9WA 4UV9B 4YJ2E 4WBNE 3AE8A 5FXVA 5JR9C 5ETWA 3H3AA 4X1IE 1MIVA 3ANWB 2PJQA 5JRCA 4WZXA 2IC6A 5LHHB 3CPZA 1VRBA 2BKNA 1N32T 4HFVA 4UR9A 1US7B 2VASA 2N2NA 3JAEA 3PUWF 4L9IA 3VR8A 4UELA 4B3RT 5LJMA 2QGSA 3BQIA 3F57A 2XAFB 2CWYA 4XAXB 1HX1B 2E8IA 1VOMA 2FBWA 4OHFA 3VKGA 2A72A 4EGWA 2DWGA 5LBMA 3UU5A 1HF8A 2E2AA 3C4ZA 3ZMSB 2ES0A 4TV9E 3NZPA 1HS7A 4AQFA 2IUBA 3MXZA 5L3BB 2V7IA 4P09A 2J47A 4BJNA 5LHGB 1E1HB 3TLUA 3LSVA 3UFGA 4JI5T 4AKRB 4H9OC 5LXTE 4PK6A 2LSIA 3TLVA 4YSZA 3P4WA 4U2YA 4X66T 3V5UA 2X9WA 4PFPA 4A56A 4YY3T 2UXBT 3RKGA 2XM1A 1D1AA 4I0UA 3WAKA 5HXCA 2LJLA 2QRXA 3Q5DA 2IDOB 3EABA 3CMLA 4HWDA 3T1HT 4NUUA 4O8SA 1MMGA 2LKGA 2RA1A 2LLYA 2YDRA 3RLFF 2ODVA 2V6YB 5JR9A 2XM2A 4ZI7E 2BBJA 3I0OA 1VCTA 3ZLIA 5LGUB 3UUXB 2YEVC 2A2FX 5C3JA 4DV0T 3RC8A 4BJMA 1KNZA 5L2LA 2HHHT 4NXNT 3ESLA 3ABVA 4HWHA 4LF9T 1R8IA 5J1GA 3RF1A 4AI6A 5DQWA 2X0YA 3NBXX 4U7IA 5AQHB 4GK0E 4AKGA 3KBUA 2LSKA 5JREA 2XHEB 5CFBA 5C8YE 4DV6T 3VHLA 5M4YA 5IWAT 5AQSB 3U78A 5HXSA 3HA4A 3OVUA 2IAKA 3N9MA 4C90A 2ACXA 4O4HE 2ZM6T 2W2UA 4I43B 1WLXA 5FXWA 2XAJB 1UURA 5LA6E 2NW7A 4UF0B 4ZS3A 5JDFA 4ZS2A 4HE8A 4TNWA 4DMWA 2MAWA 5L47A 5J0ZA 1E2AA 2H89A 3AE4A 3EI0A 3OPCA 1MIWA 4L0RA 4NXMT 1FJGT 2YU1A 5AQVB 4ILAA 4ERRA 2KXPB 2VKHA 3SFDA 4EZHA 2JMHA 3QUJA 3RC3A 3I1AA 3LBXB 2UUAT 4TUYE 3N9QA 5LMUT 2V6XA 2FJBA 4CXYA 4IREA 4DBRA 2MOZA 2XAGB 5FKYA 4EYYR 2A9UA 2JQQA 4IDZA 3O9XA 4YSYA 4AKHA 1ZP0A 4Z8XA 2ODUA 2J62A 3KFWX 5JDQA 2WP9A 4DV7T 4UVCB 3EAMA 1IBKT 1YQ3A 1M62A 3C50A 3AXJA 3Q2MA 1FMVA 5JQGE 4GIWA 2BKPA 2D0TA 3PUXF 4UF0A 3GWHA 4H63H 5FY7A 1ZHCA 3VRAA 4ZI2D 2DNXA 3ZCIA 1HR0T 4HFHA 3ZT5A 5J2UE 1FIOA 2CCQA 3AA6B 3FB2A 4ILBA 3ZC1A 3AA7B 3ZEFB 3RKOA 5BMVE 4LF4T 4KHZF 4A5XA 4IDNA 3L39A 2WMNA 3JCFA 4DMVA 4ADZA 4Z90A 5JDMA 2JQHA 3MA9A 3Q5EA 2YDQA 4YTMA 3TKLB 2CE7A 3AXJB 2XUEA 4ZXLA 3AE9A 5F5WA 3GMIA 2W00A 2XTLA 2BBHA 3J7Yq 1QSDA 1OEDB 2WB5A 3RYIE 5EK2A 3V5SA 4U31A 3B5MA 2PBIA 3JADA 3ZMVB 5C2TA 4MFRA 5JVDE 2YU2A 3A7MA 3QOFA 4GYRA 1HNXT 3ZT7A 4GKJT 2L8KA 3PU8A 1L0VA 3NWIA 3OKQA 4YFSA 4DBQA 4AQYT 3MK7C 4KI0F 1LKXA 1UCUA 4ZI3C 3AEGA 3WI3A 4HEAA 2WZHA 4EYUA 3AEBA 1OXZA 2EHOB 2WY2A 3RGLA 3UQ4A 4KMCA 5LBQB 5LG4A 1D0XA 1WYBA 3AE2A 4LF6T 3KDSE 3RHWA 5LNKA 4UIGA 2BG9C 2K5BB 3H3MA 4HFEA 4DV2T 4DR3T 1ZOYA 3P4RA 2XAHB 1JNRA 2HH7A 3AEFA 5FVLA 4JYAT 2X9HA 1YW0A 1O3XA 3X1DA 5ABFA 3HKEE 1SHZC 3FZLB 3OTOT 4G2AA 2IMLA 2Q9QD 2BG9E 4UVAB 3RH3A 1WCRA 4HFCA 4IE4A 2IW5B 4CN1A 2NW9A 4ZI3D 3BK9A 4MBQA 2LSYA 4CI1B 5HWXA 2PFVA 4H63V 3CIRA 2ZM8A 1WFDA 3MJXA 2CRBA 3AE3A 4C91A 2W61A 3B13A 5LGTB 2E9XC 2WSSV 2Z6EA 3ETVA 3PJAA 5LOVE 2WDQA 5CB4E 4QH4A 3UFEA 5JDHA 5F8PA 3PUSA 2XQ3A 3RIAA 3ZMUB 4AXPA 3RIUC 4BAYB 5LYJE 4EEBA 4DR2T 3ZSTA 1XZYA 2I6HA 2X9XA 4JI2T 2JMKA 2LRKA 3KV4A 4JBWF 4BA9A 4CXWA 2DWKA 2NWBA 4TN7B 1W09A 3NVOA 3O1HA 3MKDA 2CM0A 5HXRA 3VR9A 4AQFC 1SA0E 1DU2A 1BR4A 3K1SA 4X20E 3PUGA 5L3EB 1D1CA 2UUCT 4M1PA 4IT4A 1LRZA 1T8BA 5J2TE 3AA1B 2WU5A 2RPAA 3U3IA 2ZMAA 3PJAJ 4P1NA 2C0SA 4NUVA 4TZ4C 3K3OA 5AQGB 3CX7B 2FJAA 2JPFA 4OYJA 3UUNA 3AA0B 4ZI2C 5H6RB 3A8YC 2H7VC 4JI7T 5EK4A 2M6IA 1J5ET 4DV3T 4MLKA 5JH7E 4JI4T 1JNZA 2Q9QB 2BS3A 4IIJE 4EAHA 3W15B 1MIYA 2NW8A 2BZBA 3E08A 5E0OA 5FXZA 3ZMZB 4X64T 4B3ST 3PDYA 1FEWA 2E9XB 2BKOA 3I0QA 3KINB 4WBOA 5DABA 4EEDA 1QUUA 4DR6T 2HPLA 1XMOT 1KK7A 2WZIA 4YSXA 3ANWA 2W0GA 3D0TA 1B7TA 1CUNA 3O4XE 5FYMA 4IDQA 1XDPA 2LKHA 2NTXA 2E9XD 2OA5A 3OJAA 3Q5XA 4LF8T 2LSJA 3C98B 4CI2B 1D0YA 1UGOA 5IYZE 1SE7A 3QB5A 1HG5A 2VKDA 4EIWA 1WR6A 3FZHB 4KHPT 3ETUA 2X0HA 2WS3A 1NWMX 2BVLA 3I9YA 4PNIA 3SFEA 3HKDE 3KBTA 2LM2A 2CEAA 4EZ4A 4B3TT 4B3MT 3FHNA 2EHOA 1MNDA 2V5DA 1LVFA 3PTRB 5TAOA 2VL0A 2CBIA 2L3LA 2WU2A 2Y8DA 5AQJB 4CI3B 2KWIB 2NR4A 2IHR1 2XQAA 3ONLC 4TWHA 4HN9A 3S4UA 2V6YA 3UU4A 4U33A 3M3ZB 5JR9B 2NOXA 3P4QA 4ISTA 2VVSA 5LG3A 2Q9QC 4U72A 2QVAA 4U7YA 3AEDA 2I59A 5ABGA 3ZCJA 1W0BA 2KMFA 3P7IA 1WYCA 3H37A 3IHRA 3AVSA 3AE1A 3N9PA 5EK3A 1XMQT 2OLTA 4L5GA 2ZM2A 1YKEB 4YHJA 1D1BA 2HN2A 2PG8A 5AQOB 4DR4T 4DUYT 5FXXA 1X9BA 4ZZCA 2HN1A 3A5XA 5FNVE 2X51A 1IJ6A 2J4GA 4DO0A 2XPKA 3ZN1B 4LFBT 5AQIB 5HXHA 3JC6C 3RI5A 3VKHA 5HEUA 2YKSA 4ZOLE 1KFYA 1M7KA 5AQLB 3QB5K 1MNEA 2NP9A 4QKNA 2CXLA 5LJNA 4GOUA 3ZC0A 2X66A 5HEJA 2BS4A 5LP6E 1MMDA 4H9PC 4N78D 5AQMB 3CQCB 4CN6A 5JDLA 5DJQC 3NKZA 2K9AA 3KV5A 5L3CB 3LK3B 4IE0A 2XZEA 2MYSA 5HCMA 5HAXA 2H88A 5KMGP 4AKLA 4JI8T 4TWDA 2WMOA 1BR1A 1D0ZA 1W9RA 2XSBA 3FXEB 1KNPA 4QH1A 3ZJ2A 3ZKRA 2UXDT 1OEDE 4FJOA 5KX5E 3OYZA 4V1Av 2XQ7A 1HCIA 2X0LB 4TWFA 2B76A 4ZEYA 2CHNA 4I55E 4TX5A 2V1DB 2DLRA 3MZKB 5FY1A 4YT0A 4O4JE 3LBXA 1ZEEA 3IEEA 2W4XA 4HTEA 4YXDA 1G73A 2N1GA 3GA8A 3N9NA 3T8OA 4G63A 1OEDC 4HFDA 4PK5A 5ABHA 4E7ZA 3PE0A 3AECA 4PJJA 4H9NC 4B6XA 5L4EA 3HKCE 4UV8B 4MALA 3LDQB 5L4HA 3TLWA 3O1JA 2LT3A 4I50E 1BR2A 1UX4A 3JC6D 2WDVA 3KV6A 4AISA 2CWOA 2OV9A 3R84B 5F3JA 2UXCT 4Q25A 2KLQA 4ZZBA 1ZV4X 5L3FB 3ZJ1A 4AKIA 2Y6XA 2VK9A 3HKBE 4U2ZA 4IDOA 2FJDA 2RP4A 3F2EA 3FXDB 3FZFB 3G06A 4DUZT 4DR5T 1HTJF 1J5WA 2C5JA 2VKOA 5JDNA 3FBLA 4LFAT 3B57A 2BG9B 2XQ9A 3QK6A 4GKKT 4IE5A 4TV8E 5JDGA 2YDSA 5HXEA 2XASB 4EB6E 3FBZA 2YN6A 3VRBA 1T7SA 4QX8B 4HGAA 5LMNT 1UUSA 2V8SV 3KVBA 3N5LA 4KP3C 1BR0A 2KZ7B 3DTOA 3K3NA 1Y64B 3PUYF 4KUMB 3P8CD 1KEYA 3EVYA 4CN4A 1HNZT 4ASKA 1OWAA 2P9BA 3WAJA 1IBLT 4QH5A 1W0AA 2XQ4A 4YLHA 4EXTA 3SRZA 2X68A 4UVBB 3MACA 4H9SE 2LEHA 1NENA 2K3WA 1MMNA 4PJNA 1ZKEA 1FMWA 4PW8A 2LOPA 3AAEB 4UXNB 3RRWA 3TLTA 3AEEA 3LK42 4HKAA 2CPTA 1XNRT 2W66A 4X5TA 1XNQT 3KV9A 2CA5A 4HFBA 2XY8B 3C4WA 1MMAA 4LMJA 4DVDA 4OX9T 2HPJA 4QXCB 1AJ3A 2QYWA 1E7PA 4OK0A 2CXDA 3RRCA 3AB3B 4QWNB 4PFOA 2F4VT 2PTFA 2V7LA 3UU6A 2FJEA 3OYXA 2BS2A 4QX7B 3C51A 2UXXB 2IIUA 2C5KT 2W67A 4AIUA 4P0BA 1Y01A 1LVKA 2WWUA 1N33T 4OYKA 1U5PA 4JEUB 2VVNA 1HFAA 1KF6A 4HFIA 3EHZA 5HCJA 3F31A 3EDVA 4X1YE 3PUAA 5AQNB 5GONE 2XQ8A 4H9QC 4WW0A 4F6RC 3DJBA 3P4PA 3OBVE 2JRKA 4JI0T 2VL8A 5DQVA 1XWMA 1N34T 4IL9A 3FZMB 3E0ZA 2KINB 2YINA 4LMLA 3N9LA 4PAGA 4IE7A 5HYAA 4IE6A 2WQYA 2M6BA 2CLYC 2E5VA 5ABEA 3C4XA 2V7KA 1IZNB 3KVAA 4OFZA 1HNWT 2DI4A 2VWAA 5FMNA 2D5UA 4O4LE 2MTQA 1Z8UA 3CQGB 5CA1E 4LMKA 2JIWA 2H7OA 4A97A 3LG7A 3N9OA 4O2BE 4EV6A 3RPUA 3Q5WA 4KX6A 3ZPOA 3RIUA 4GK5E 4X62T 3ZYLA 2MPKA 2WDRA 4J2CA 3EUHA 3PUZF 4ILUA 5HEHA 5L3GB 1YD8G 2E9XA 3PU3A 2DCFA 4P0AA 3HI2A 2MBGA 2JQ9A 3C64A 1IBMT 5FY0A 2LE8A 2WWVA 3RYFE 4YTNA 3CWZB 5AQUB 5CGMA 3RQUA 5JRCB 1UX5A 4JEHB 4U3CA 3SOLA 2N9DA 4GYSA 3J9X1 5FP3A 1H7CA 4LF7T 3NRYA 1YXRA 5AQRB 5HEGA 2QA7A
chains in the Genus database with same CATH topology
4JYAT 2UU9T 4DR7T 4DV1T 4DV5T 3OTOT 4JI5T 5LMNT 1XMQT 4JV5T 4X66T 2VQET 4YY3T 2UXBT 4X65T 2UXCT 3T1HT 4DUZT 4DR2T 4DR5T 4JI2T 4DV0T 2HHHT 4NXNT 4LFAT 4GKKT 2E5LT 4LF9T 2UUCT 1N36T 1XNRT 1HNZT 4DV6T 1HNWT 5IWAT 1IBLT 1J5ET 4JI7T 4DV3T 4JI4T 2ZM6T 4X64T 1FJGT 4NXMT 4DR6T 1XMOT 1XNQT 1I94T 4LF8T 2UUAT 5LMUT 4OX9T 4K0KT 5BR8T 3T1YT 2UUBT 4KHPT 2F4VT 4JI1T 4DV7T 4LFCT 4B3TT 1IBKT 4B3MT 4JI3T 4DR1T 1N33T 4YHHT 1HR0T 4LF4T 4JI0T 1N34T 4DR4T 4DUYT 4JI6T 4LFBT 4LF5T 2VQFT 1HNXT 4GKJT 4X62T 4AQYT 1N32T 1IBMT 4B3ST 4JI8T 4B3RT 2UXDT 4LF6T 4LF7T 4DR3T 4DV2T 4DV4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA T;  2UU9 T;  4DR7 T;  4DV1 T;  4DV5 T;  3OTO T;  4JI5 T;  5LMN T;  1XMQ T;  4JV5 T;  4X66 T;  2VQE T;  4YY3 T;  2UXB T;  4X65 T;  2UXC T;  3T1H T;  4DUZ T;  4DR2 T;  4DR5 T;  4JI2 T;  4DV0 T;  2HHH T;  4NXN T;  4LFA T;  4GKK T;  2E5L T;  4LF9 T;  2UUC T;  1N36 T;  1XNR T;  1HNZ T;  4DV6 T;  1HNW T;  5IWA T;  1IBL T;  1J5E T;  4JI7 T;  4DV3 T;  4JI4 T;  2ZM6 T;  4X64 T;  1FJG T;  4NXM T;  4DR6 T;  1XMO T;  1XNQ T;  1I94 T;  4LF8 T;  2UUA T;  5LMU T;  4OX9 T;  4K0K T;  5BR8 T;  3T1Y T;  2UUB T;  4KHP T;  2F4V T;  4JI1 T;  4DV7 T;  4LFC T;  4B3T T;  1IBK T;  4B3M T;  4JI3 T;  4DR1 T;  1N33 T;  4YHH T;  1HR0 T;  4LF4 T;  4JI0 T;  1N34 T;  4DR4 T;  4DUY T;  4JI6 T;  4LFB T;  4LF5 T;  2VQF T;  1HNX T;  4GKJ T;  4X62 T;  4AQY T;  1N32 T;  1IBM T;  4B3S T;  4JI8 T;  4B3R T;  2UXD T;  4LF6 T;  4LF7 T;  4DR3 T;  4DV2 T;  4DV4 T; 
#chains in the Genus database with same CATH topology
 3UQ7 A;  4E7S A;  2XQ6 A;  2KT9 A;  2NTY A;  4NIQ A;  4QXH B;  2UU9 T;  4DR7 T;  3RQW A;  2ZLY A;  3QC9 A;  4DV1 T;  4DV5 T;  2AE9 A;  2V5C A;  1T98 A;  1VCS A;  2DHR A;  2VKJ A;  3QNU A;  4O4I E;  5AQP B;  3RX6 A;  3P50 A;  2BG9 A;  4UEM A;  4JV5 T;  4AQG A;  4EOZ B;  1HG2 A;  2I0M A;  3ONX A;  5FL1 A;  1NEK A;  3CX6 B;  1EZ3 A;  4DV4 T;  3PUV F;  2J1D G;  3N2K E;  4IL4 A;  2VQE T;  4WYV A;  2LRL A;  2XQ5 A;  5AQK B;  4X65 T;  2M67 A;  2AXD S;  4JLE A;  2W63 A;  1G8X A;  3EDU A;  2B1E A;  4HWC A;  3CQX C;  3JAF A;  4K0U A;  2WBL A;  5FVK A;  4DR1 T;  2KSR A;  4ILC A;  3LK2 B;  3AE7 A;  3CK6 A;  3E22 E;  3L8R A;  1OED A;  3LJC A;  3HR0 A;  3PV0 F;  5EZY E;  4HWI B;  5LB7 B;  3RYC E;  5HWY A;  2R6G F;  2LM9 A;  3GN5 B;  3ONJ A;  4F8H A;  1QLB A;  1YQ4 A;  2FUP A;  4FI5 A;  1IAP A;  4QXB B;  3TLS A;  1WR0 A;  5A1L A;  5AQF B;  4KBM B;  2E5L T;  1I6Z A;  3K8P C;  2L9Q A;  2VUR A;  1N36 T;  2KWH A;  4IGU A;  5LHI B;  4TNV A;  5IHY A;  2CMR A;  1YKH B;  4YTP A;  3UU3 A;  2K24 A;  3UU8 A;  3VU7 H;  5ABF B;  2YK0 A;  2CLY B;  2LOS A;  3Q9D A;  4PK4 A;  4Z91 A;  5AQQ B;  1IJ5 A;  4PJM A;  5AQT B;  3AE6 A;  1U4Q A;  2BDE A;  1UK5 A;  3CVR A;  3IA3 A;  3ZSS A;  3BQK A;  5KDM C;  3L09 A;  4PJL A;  5CA0 E;  3AAI A;  2XSA A;  3NZQ A;  1HX8 A;  3CKD A;  5KXJ A;  1SUM B;  5HEO A;  2XAQ B;  1GQE A;  2CBJ A;  2G0U A;  2SPC A;  2YOE A;  3LFM A;  3UTK A;  2GK9 A;  2IC9 A;  1J1J A;  3N2G E;  3N2O A;  5FL0 A;  3ZMT B;  4CZZ B;  2V7J A;  3NRX A;  4ISS A;  4IHJ E;  2LSG A;  3RIF A;  2WCA A;  3BQL A;  4X1K E;  2V26 A;  2X67 A;  2JQK A;  1I94 T;  3P4S A;  3DP7 A;  1Z0P A;  4A98 A;  5LCY A;  2CXF A;  2CHO A;  2KND A;  3ZT6 A;  4ZHQ E;  2EHO D;  4K0K T;  4H9R C;  5BR8 T;  5L3D B;  1V9D A;  4COF A;  2Y48 B;  3M65 A;  3O1I A;  3T1Y T;  2UUB T;  1S94 A;  4YJ3 E;  3AAA B;  4O2A E;  2UXN B;  3RYH E;  5H6Q B;  1XDO A;  2D2S A;  3R6N A;  4JI1 T;  4LFC T;  2VB6 A;  3SS1 A;  5JTG A;  3UUM A;  3AE5 A;  2LHR A;  2BVM A;  3GN5 A;  2ZM0 A;  3FZK B;  3PUR A;  1T72 A;  4I4T E;  4MHC A;  3UUL A;  5ADX L;  4JI3 T;  2X9Y A;  3K3Q C;  3IBP A;  4U74 A;  4WNK A;  3ZYM A;  4CXX A;  5IUX A;  4YHH T;  2LHN A;  1NAF A;  2Q9Q A;  4DND A;  3AEA A;  2C5I T;  2WAU A;  4NPP A;  4XZC A;  3ZYK A;  2D9D A;  2DL1 A;  3IF8 B;  4IDP A;  4QHO A;  1X79 A;  4CQI A;  2EHO C;  2ACZ A;  3SWH A;  1CHU A;  3AVR A;  4HWF A;  3CX8 B;  3HL6 A;  5CJ5 A;  4JI6 T;  3UT5 E;  3L3P A;  4DID B;  1KNR A;  5LGN B;  2WM9 A;  2XQY A;  3ZN0 B;  1WRD A;  1S35 A;  2D0U A;  3PUQ A;  4JUY A;  2K48 A;  2W62 A;  2JJ9 A;  2XJ7 A;  3UUB A;  4ANJ A;  2A3D A;  4LF5 T;  4XBF B;  5AFU L;  2H3R A;  2VQF T;  2V7M A;  3I9W A;  4UV9 B;  4YJ2 E;  4WBN E;  3AE8 A;  5FXV A;  5JR9 C;  5ETW A;  3H3A A;  4X1I E;  1MIV A;  3ANW B;  2PJQ A;  5JRC A;  4WZX A;  2IC6 A;  5LHH B;  3CPZ A;  1VRB A;  2BKN A;  1N32 T;  4HFV A;  4UR9 A;  1US7 B;  2VAS A;  2N2N A;  3JAE A;  3PUW F;  4L9I A;  3VR8 A;  4UEL A;  4B3R T;  5LJM A;  2QGS A;  3BQI A;  3F57 A;  2XAF B;  2CWY A;  4XAX B;  1HX1 B;  2E8I A;  1VOM A;  2FBW A;  4OHF A;  3VKG A;  2A72 A;  4EGW A;  2DWG A;  5LBM A;  3UU5 A;  1HF8 A;  2E2A A;  3C4Z A;  3ZMS B;  2ES0 A;  4TV9 E;  3NZP A;  1HS7 A;  4AQF A;  2IUB A;  3MXZ A;  5L3B B;  2V7I A;  4P09 A;  2J47 A;  4BJN A;  5LHG B;  1E1H B;  3TLU A;  3LSV A;  3UFG A;  4JI5 T;  4AKR B;  4H9O C;  5LXT E;  4PK6 A;  2LSI A;  3TLV A;  4YSZ A;  3P4W A;  4U2Y A;  4X66 T;  3V5U A;  2X9W A;  4PFP A;  4A56 A;  4YY3 T;  2UXB T;  3RKG A;  2XM1 A;  1D1A A;  4I0U A;  3WAK A;  5HXC A;  2LJL A;  2QRX A;  3Q5D A;  2IDO B;  3EAB A;  3CML A;  4HWD A;  3T1H T;  4NUU A;  4O8S A;  1MMG A;  2LKG A;  2RA1 A;  2LLY A;  2YDR A;  3RLF F;  2ODV A;  2V6Y B;  5JR9 A;  2XM2 A;  4ZI7 E;  2BBJ A;  3I0O A;  1VCT A;  3ZLI A;  5LGU B;  3UUX B;  2YEV C;  2A2F X;  5C3J A;  4DV0 T;  3RC8 A;  4BJM A;  1KNZ A;  5L2L A;  2HHH T;  4NXN T;  3ESL A;  3ABV A;  4HWH A;  4LF9 T;  1R8I A;  5J1G A;  3RF1 A;  4AI6 A;  5DQW A;  2X0Y A;  3NBX X;  4U7I A;  5AQH B;  4GK0 E;  4AKG A;  3KBU A;  2LSK A;  5JRE A;  2XHE B;  5CFB A;  5C8Y E;  4DV6 T;  3VHL A;  5M4Y A;  5IWA T;  5AQS B;  3U78 A;  5HXS A;  3HA4 A;  3OVU A;  2IAK A;  3N9M A;  4C90 A;  2ACX A;  4O4H E;  2ZM6 T;  2W2U A;  4I43 B;  1WLX A;  5FXW A;  2XAJ B;  1UUR A;  5LA6 E;  2NW7 A;  4UF0 B;  4ZS3 A;  5JDF A;  4ZS2 A;  4HE8 A;  4TNW A;  4DMW A;  2MAW A;  5L47 A;  5J0Z A;  1E2A A;  2H89 A;  3AE4 A;  3EI0 A;  3OPC A;  1MIW A;  4L0R A;  4NXM T;  1FJG T;  2YU1 A;  5AQV B;  4ILA A;  4ERR A;  2KXP B;  2VKH A;  3SFD A;  4EZH A;  2JMH A;  3QUJ A;  3RC3 A;  3I1A A;  3LBX B;  2UUA T;  4TUY E;  3N9Q A;  5LMU T;  2V6X A;  2FJB A;  4CXY A;  4IRE A;  4DBR A;  2MOZ A;  2XAG B;  5FKY A;  4EYY R;  2A9U A;  2JQQ A;  4IDZ A;  3O9X A;  4YSY A;  4AKH A;  1ZP0 A;  4Z8X A;  2ODU A;  2J62 A;  3KFW X;  5JDQ A;  2WP9 A;  4DV7 T;  4UVC B;  3EAM A;  1IBK T;  1YQ3 A;  1M62 A;  3C50 A;  3AXJ A;  3Q2M A;  1FMV A;  5JQG E;  4GIW A;  2BKP A;  2D0T A;  3PUX F;  4UF0 A;  3GWH A;  4H63 H;  5FY7 A;  1ZHC A;  3VRA A;  4ZI2 D;  2DNX A;  3ZCI A;  1HR0 T;  4HFH A;  3ZT5 A;  5J2U E;  1FIO A;  2CCQ A;  3AA6 B;  3FB2 A;  4ILB A;  3ZC1 A;  3AA7 B;  3ZEF B;  3RKO A;  5BMV E;  4LF4 T;  4KHZ F;  4A5X A;  4IDN A;  3L39 A;  2WMN A;  3JCF A;  4DMV A;  4ADZ A;  4Z90 A;  5JDM A;  2JQH A;  3MA9 A;  3Q5E A;  2YDQ A;  4YTM A;  3TKL B;  2CE7 A;  3AXJ B;  2XUE A;  4ZXL A;  3AE9 A;  5F5W A;  3GMI A;  2W00 A;  2XTL A;  2BBH A;  3J7Y q;  1QSD A;  1OED B;  2WB5 A;  3RYI E;  5EK2 A;  3V5S A;  4U31 A;  3B5M A;  2PBI A;  3JAD A;  3ZMV B;  5C2T A;  4MFR A;  5JVD E;  2YU2 A;  3A7M A;  3QOF A;  4GYR A;  1HNX T;  3ZT7 A;  4GKJ T;  2L8K A;  3PU8 A;  1L0V A;  3NWI A;  3OKQ A;  4YFS A;  4DBQ A;  4AQY T;  3MK7 C;  4KI0 F;  1LKX A;  1UCU A;  4ZI3 C;  3AEG A;  3WI3 A;  4HEA A;  2WZH A;  4EYU A;  3AEB A;  1OXZ A;  2EHO B;  2WY2 A;  3RGL A;  3UQ4 A;  4KMC A;  5LBQ B;  5LG4 A;  1D0X A;  1WYB A;  3AE2 A;  4LF6 T;  3KDS E;  3RHW A;  5LNK A;  4UIG A;  2BG9 C;  2K5B B;  3H3M A;  4HFE A;  4DV2 T;  4DR3 T;  1ZOY A;  3P4R A;  2XAH B;  1JNR A;  2HH7 A;  3AEF A;  5FVL A;  4JYA T;  2X9H A;  1YW0 A;  1O3X A;  3X1D A;  5ABF A;  3HKE E;  1SHZ C;  3FZL B;  3OTO T;  4G2A A;  2IML A;  2Q9Q D;  2BG9 E;  4UVA B;  3RH3 A;  1WCR A;  4HFC A;  4IE4 A;  2IW5 B;  4CN1 A;  2NW9 A;  4ZI3 D;  3BK9 A;  4MBQ A;  2LSY A;  4CI1 B;  5HWX A;  2PFV A;  4H63 V;  3CIR A;  2ZM8 A;  1WFD A;  3MJX A;  2CRB A;  3AE3 A;  4C91 A;  2W61 A;  3B13 A;  5LGT B;  2E9X C;  2WSS V;  2Z6E A;  3ETV A;  3PJA A;  5LOV E;  2WDQ A;  5CB4 E;  4QH4 A;  3UFE A;  5JDH A;  5F8P A;  3PUS A;  2XQ3 A;  3RIA A;  3ZMU B;  4AXP A;  3RIU C;  4BAY B;  5LYJ E;  4EEB A;  4DR2 T;  3ZST A;  1XZY A;  2I6H A;  2X9X A;  4JI2 T;  2JMK A;  2LRK A;  3KV4 A;  4JBW F;  4BA9 A;  4CXW A;  2DWK A;  2NWB A;  4TN7 B;  1W09 A;  3NVO A;  3O1H A;  3MKD A;  2CM0 A;  5HXR A;  3VR9 A;  4AQF C;  1SA0 E;  1DU2 A;  1BR4 A;  3K1S A;  4X20 E;  3PUG A;  5L3E B;  1D1C A;  2UUC T;  4M1P A;  4IT4 A;  1LRZ A;  1T8B A;  5J2T E;  3AA1 B;  2WU5 A;  2RPA A;  3U3I A;  2ZMA A;  3PJA J;  4P1N A;  2C0S A;  4NUV A;  4TZ4 C;  3K3O A;  5AQG B;  3CX7 B;  2FJA A;  2JPF A;  4OYJ A;  3UUN A;  3AA0 B;  4ZI2 C;  5H6R B;  3A8Y C;  2H7V C;  4JI7 T;  5EK4 A;  2M6I A;  1J5E T;  4DV3 T;  4MLK A;  5JH7 E;  4JI4 T;  1JNZ A;  2Q9Q B;  2BS3 A;  4IIJ E;  4EAH A;  3W15 B;  1MIY A;  2NW8 A;  2BZB A;  3E08 A;  5E0O A;  5FXZ A;  3ZMZ B;  4X64 T;  4B3S T;  3PDY A;  1FEW A;  2E9X B;  2BKO A;  3I0Q A;  3KIN B;  4WBO A;  5DAB A;  4EED A;  1QUU A;  4DR6 T;  2HPL A;  1XMO T;  1KK7 A;  2WZI A;  4YSX A;  3ANW A;  2W0G A;  3D0T A;  1B7T A;  1CUN A;  3O4X E;  5FYM A;  4IDQ A;  1XDP A;  2LKH A;  2NTX A;  2E9X D;  2OA5 A;  3OJA A;  3Q5X A;  4LF8 T;  2LSJ A;  3C98 B;  4CI2 B;  1D0Y A;  1UGO A;  5IYZ E;  1SE7 A;  3QB5 A;  1HG5 A;  2VKD A;  4EIW A;  1WR6 A;  3FZH B;  4KHP T;  3ETU A;  2X0H A;  2WS3 A;  1NWM X;  2BVL A;  3I9Y A;  4PNI A;  3SFE A;  3HKD E;  3KBT A;  2LM2 A;  2CEA A;  4EZ4 A;  4B3T T;  4B3M T;  3FHN A;  2EHO A;  1MND A;  2V5D A;  1LVF A;  3PTR B;  5TAO A;  2VL0 A;  2CBI A;  2L3L A;  2WU2 A;  2Y8D A;  5AQJ B;  4CI3 B;  2KWI B;  2NR4 A;  2IHR 1;  2XQA A;  3ONL C;  4TWH A;  4HN9 A;  3S4U A;  2V6Y A;  3UU4 A;  4U33 A;  3M3Z B;  5JR9 B;  2NOX A;  3P4Q A;  4IST A;  2VVS A;  5LG3 A;  2Q9Q C;  4U72 A;  2QVA A;  4U7Y A;  3AED A;  2I59 A;  5ABG A;  3ZCJ A;  1W0B A;  2KMF A;  3P7I A;  1WYC A;  3H37 A;  3IHR A;  3AVS A;  3AE1 A;  3N9P A;  5EK3 A;  1XMQ T;  2OLT A;  4L5G A;  2ZM2 A;  1YKE B;  4YHJ A;  1D1B A;  2HN2 A;  2PG8 A;  5AQO B;  4DR4 T;  4DUY T;  5FXX A;  1X9B A;  4ZZC A;  2HN1 A;  3A5X A;  5FNV E;  2X51 A;  1IJ6 A;  2J4G A;  4DO0 A;  2XPK A;  3ZN1 B;  4LFB T;  5AQI B;  5HXH A;  3JC6 C;  3RI5 A;  3VKH A;  5HEU A;  2YKS A;  4ZOL E;  1KFY A;  1M7K A;  5AQL B;  3QB5 K;  1MNE A;  2NP9 A;  4QKN A;  2CXL A;  5LJN A;  4GOU A;  3ZC0 A;  2X66 A;  5HEJ A;  2BS4 A;  5LP6 E;  1MMD A;  4H9P C;  4N78 D;  5AQM B;  3CQC B;  4CN6 A;  5JDL A;  5DJQ C;  3NKZ A;  2K9A A;  3KV5 A;  5L3C B;  3LK3 B;  4IE0 A;  2XZE A;  2MYS A;  5HCM A;  5HAX A;  2H88 A;  5KMG P;  4AKL A;  4JI8 T;  4TWD A;  2WMO A;  1BR1 A;  1D0Z A;  1W9R A;  2XSB A;  3FXE B;  1KNP A;  4QH1 A;  3ZJ2 A;  3ZKR A;  2UXD T;  1OED E;  4FJO A;  5KX5 E;  3OYZ A;  4V1A v;  2XQ7 A;  1HCI A;  2X0L B;  4TWF A;  2B76 A;  4ZEY A;  2CHN A;  4I55 E;  4TX5 A;  2V1D B;  2DLR A;  3MZK B;  5FY1 A;  4YT0 A;  4O4J E;  3LBX A;  1ZEE A;  3IEE A;  2W4X A;  4HTE A;  4YXD A;  1G73 A;  2N1G A;  3GA8 A;  3N9N A;  3T8O A;  4G63 A;  1OED C;  4HFD A;  4PK5 A;  5ABH A;  4E7Z A;  3PE0 A;  3AEC A;  4PJJ A;  4H9N C;  4B6X A;  5L4E A;  3HKC E;  4UV8 B;  4MAL A;  3LDQ B;  5L4H A;  3TLW A;  3O1J A;  2LT3 A;  4I50 E;  1BR2 A;  1UX4 A;  3JC6 D;  2WDV A;  3KV6 A;  4AIS A;  2CWO A;  2OV9 A;  3R84 B;  5F3J A;  2UXC T;  4Q25 A;  2KLQ A;  4ZZB A;  1ZV4 X;  5L3F B;  3ZJ1 A;  4AKI A;  2Y6X A;  2VK9 A;  3HKB E;  4U2Z A;  4IDO A;  2FJD A;  2RP4 A;  3F2E A;  3FXD B;  3FZF B;  3G06 A;  4DUZ T;  4DR5 T;  1HTJ F;  1J5W A;  2C5J A;  2VKO A;  5JDN A;  3FBL A;  4LFA T;  3B57 A;  2BG9 B;  2XQ9 A;  3QK6 A;  4GKK T;  4IE5 A;  4TV8 E;  5JDG A;  2YDS A;  5HXE A;  2XAS B;  4EB6 E;  3FBZ A;  2YN6 A;  3VRB A;  1T7S A;  4QX8 B;  4HGA A;  5LMN T;  1UUS A;  2V8S V;  3KVB A;  3N5L A;  4KP3 C;  1BR0 A;  2KZ7 B;  3DTO A;  3K3N A;  1Y64 B;  3PUY F;  4KUM B;  3P8C D;  1KEY A;  3EVY A;  4CN4 A;  1HNZ T;  4ASK A;  1OWA A;  2P9B A;  3WAJ A;  1IBL T;  4QH5 A;  1W0A A;  2XQ4 A;  4YLH A;  4EXT A;  3SRZ A;  2X68 A;  4UVB B;  3MAC A;  4H9S E;  2LEH A;  1NEN A;  2K3W A;  1MMN A;  4PJN A;  1ZKE A;  1FMW A;  4PW8 A;  2LOP A;  3AAE B;  4UXN B;  3RRW A;  3TLT A;  3AEE A;  3LK4 2;  4HKA A;  2CPT A;  1XNR T;  2W66 A;  4X5T A;  1XNQ T;  3KV9 A;  2CA5 A;  4HFB A;  2XY8 B;  3C4W A;  1MMA A;  4LMJ A;  4DVD A;  4OX9 T;  2HPJ A;  4QXC B;  1AJ3 A;  2QYW A;  1E7P A;  4OK0 A;  2CXD A;  3RRC A;  3AB3 B;  4QWN B;  4PFO A;  2F4V T;  2PTF A;  2V7L A;  3UU6 A;  2FJE A;  3OYX A;  2BS2 A;  4QX7 B;  3C51 A;  2UXX B;  2IIU A;  2C5K T;  2W67 A;  4AIU A;  4P0B A;  1Y01 A;  1LVK A;  2WWU A;  1N33 T;  4OYK A;  1U5P A;  4JEU B;  2VVN A;  1HFA A;  1KF6 A;  4HFI A;  3EHZ A;  5HCJ A;  3F31 A;  3EDV A;  4X1Y E;  3PUA A;  5AQN B;  5GON E;  2XQ8 A;  4H9Q C;  4WW0 A;  4F6R C;  3DJB A;  3P4P A;  3OBV E;  2JRK A;  4JI0 T;  2VL8 A;  5DQV A;  1XWM A;  1N34 T;  4IL9 A;  3FZM B;  3E0Z A;  2KIN B;  2YIN A;  4LML A;  3N9L A;  4PAG A;  4IE7 A;  5HYA A;  4IE6 A;  2WQY A;  2M6B A;  2CLY C;  2E5V A;  5ABE A;  3C4X A;  2V7K A;  1IZN B;  3KVA A;  4OFZ A;  1HNW T;  2DI4 A;  2VWA A;  5FMN A;  2D5U A;  4O4L E;  2MTQ A;  1Z8U A;  3CQG B;  5CA1 E;  4LMK A;  2JIW A;  2H7O A;  4A97 A;  3LG7 A;  3N9O A;  4O2B E;  4EV6 A;  3RPU A;  3Q5W A;  4KX6 A;  3ZPO A;  3RIU A;  4GK5 E;  4X62 T;  3ZYL A;  2MPK A;  2WDR A;  4J2C A;  3EUH A;  3PUZ F;  4ILU A;  5HEH A;  5L3G B;  1YD8 G;  2E9X A;  3PU3 A;  2DCF A;  4P0A A;  3HI2 A;  2MBG A;  2JQ9 A;  3C64 A;  1IBM T;  5FY0 A;  2LE8 A;  2WWV A;  3RYF E;  4YTN A;  3CWZ B;  5AQU B;  5CGM A;  3RQU A;  5JRC B;  1UX5 A;  4JEH B;  4U3C A;  3SOL A;  2N9D A;  4GYS A;  3J9X 1;  5FP3 A;  1H7C A;  4LF7 T;  3NRY A;  1YXR A;  5AQR B;  5HEG A;  2QA7 A; 
#chains in the Genus database with same CATH homology
 4JYA T;  2UU9 T;  4DR7 T;  4DV1 T;  4DV5 T;  3OTO T;  4JI5 T;  5LMN T;  1XMQ T;  4JV5 T;  4X66 T;  2VQE T;  4YY3 T;  2UXB T;  4X65 T;  2UXC T;  3T1H T;  4DUZ T;  4DR2 T;  4DR5 T;  4JI2 T;  4DV0 T;  2HHH T;  4NXN T;  4LFA T;  4GKK T;  2E5L T;  4LF9 T;  2UUC T;  1N36 T;  1XNR T;  1HNZ T;  4DV6 T;  1HNW T;  5IWA T;  1IBL T;  1J5E T;  4JI7 T;  4DV3 T;  4JI4 T;  2ZM6 T;  4X64 T;  1FJG T;  4NXM T;  4DR6 T;  1XMO T;  1XNQ T;  1I94 T;  4LF8 T;  2UUA T;  5LMU T;  4OX9 T;  4K0K T;  5BR8 T;  3T1Y T;  2UUB T;  4KHP T;  2F4V T;  4JI1 T;  4DV7 T;  4LFC T;  4B3T T;  1IBK T;  4B3M T;  4JI3 T;  4DR1 T;  1N33 T;  4YHH T;  1HR0 T;  4LF4 T;  4JI0 T;  1N34 T;  4DR4 T;  4DUY T;  4JI6 T;  4LFB T;  4LF5 T;  2VQF T;  1HNX T;  4GKJ T;  4X62 T;  4AQY T;  1N32 T;  1IBM T;  4B3S T;  4JI8 T;  4B3R T;  2UXD T;  4LF6 T;  4LF7 T;  4DR3 T;  4DV2 T;  4DV4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...