4JI1T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji1T00
4B3ST 4LF5T 5LMNT 1N32T 2UUBT 4B3MT 2HHHT 1J5ET 4DR2T 3T1HT 5BR8T 4DV6T 4AQYT 4NXMT 1N36T 1IBKT 4JI8T 4DR1T 3T1YT 4X65T 2E5LT 4X64T 2UU9T 4NXNT 3OTOT 2UXCT 4DV4T 2UXBT 4GKKT 2UXDT 1XNRT 4JI6T 4DR7T 4YHHT 1IBLT 1HNWT 4DV5T 2ZM6T 2VQFT 4JI2T 5IWAT 4DV3T 2VQET 1XMQT 4LF6T 4JI4T 4B3RT 4KHPT 1XMOT 4DV2T 4JV5T 4DR3T 4DV0T 1FJGT 4DUYT 4GKJT 2UUCT 4JI3T 4X62T 2F4VT 5LMUT 4OX9T 4LFAT 4DR5T 4DV1T 1I94T 4JI7T 1IBMT 1N34T 1XNQT 4B3TT 4LFBT 4LF9T 4K0KT 2UUAT 1HR0T 4JI1T 4JI0T 4LF7T 4X66T 4DV7T 1N33T 4JI5T 1HNZT 4DUZT 4YY3T 1HNXT 4DR6T 4LFCT 4DR4T 4LF8T 4LF4T 4JYAT
chains in the Genus database with same CATH superfamily
1MMAA 1N32T 3E08A 2X9WA 2WDVA 5LJMA 5KX5E 3EAMA 5L47A 2BDEA 2JMKA 3AA7B 1H7CA 2MPKA 2WQYA 3AAAB 1FMVA 1W9RA 4KX6A 4ZS3A 5IUXA 4TV8E 2KZ7B 5L3GB 2YU2A 5AQPB 4L0RA 5JREA 2IC9A 2FJDA 4TX5A 1KK7A 2IAKA 3AE3A 2I0MA 5J1GA 3H3MA 3Q5WA 5LXTE 3FZMB 2BG9E 1OEDE 3JCFA 4NXMT 1BR0A 2EHOD 4X5TA 4IL9A 2IW5B 3K3NA 4JI8T 1M7KA 4O8SA 4P0BA 3WI3A 2UXNB 3AE7A 2A72A 4G2AA 4EOZB 4DR1T 2M6BA 2V26A 2G0UA 3N9OA 4H9QC 3EI0A 4X65T 4PW8A 3AXJA 3IHRA 1WR0A 5ABFB 2LSJA 4MBQA 3RH3A 2E5LT 4X64T 3LBXA 4TWHA 2CLYC 3KVAA 3TLWA 3RYIE 3RKOA 5C8YE 1W0AA 4AKGA 4ZS2A 2QA7A 4ANJA 5CA0E 2E9XA 2WB5A 3O9XA 1XNRT 2UXDT 2X0LB 3KBUA 1E2AA 1Z8UA 2V6YA 3P4RA 5EZYE 4EEDA 2A2FX 4ILAA 3PUWF 4IDPA 2Q9QD 5C3JA 3RC8A 2X67A 2J4GA 1QUUA 2DLRA 2BG9C 1HX1B 3A5XA 3E0ZA 3L09A 3VHLA 1CUNA 3K3QC 3Q5EA 3RRCA 4EB6E 2D2SA 2H88A 1CHUA 2WU2A 3OKQA 4YTPA 5L3EB 4IT4A 3VKHA 1QSDA 3AAIA 4IDQA 3UFGA 3PUXF 4JLEA 2W61A 3ZYMA 4AQFA 3UU5A 4LF6T 2VVSA 2JQKA 2HN2A 2DWKA 3SFDA 5J2UE 3PJAJ 2LE8A 4BJNA 1HNXT 3RKGA 4EIWA 5JRCB 3CX7B 3ONLC 5JRCA 1U5PA 2VKHA 3ZJ1A 1BR1A 5DQVA 2D9DA 2X68A 2KINB 5EK4A 3TKLB 2CCQA 2YU1A 4DV2T 2BBHA 4JV5T 3FZKB 3ZMVB 5ABGA 3TLTA 3FXDB 2CHNA 5LGNB 3NKZA 2OA5A 2H3RA 3AE6A 3P50A 4I50E 4K0UA 4DUYT 4H63H 2JQHA 2VASA 3QOFA 3QUJA 3NBXX 3PURA 4Z90A 3D0TA 5FKYA 2UUCT 4JBWF 4H63V 4P1NA 2J47A 2F4VT 4HN9A 3KV4A 1V9DA 2KNDA 1ZHCA 4YSXA 5LG3A 4UELA 2K9AA 3F2EA 2JRKA 4BAYB 4UXNB 4YTNA 1SE7A 2IDOB 3RI5A 5H6RB 3CX8B 5HEOA 3EVYA 3DJBA 4JEUB 3ZEFB 4LFAT 3ZKRA 3AEAA 2NW7A 5KXJA 4DNDA 3MKDA 2WSSV 2VKOA 3BK9A 2WM9A 5LP6E 2WBLA 2LKHA 4B3TT 2C5IT 2PTFA 3N9MA 3N9NA 4HWIB 4IDOA 4LF9T 2VWAA 3PUYF 2K5BB 2CXLA 4LMJA 4WZXA 2JQ9A 2W0GA 2UUAT 4JI1T 4JI0T 5LB7B 4LF7T 3C98B 4X66T 3KINB 5ADXL 4CXWA 2YDSA 1D0XA 3EABA 2A3DA 4TUYE 4AQGA 4HFHA 4QXBB 2V7JA 1FEWA 4UF0A 3TLSA 1UK5A 3M3ZB 2UXXB 5HEUA 2FJBA 4XZCA 3HL6A 2V7LA 3HR0A 4NPPA 2NP9A 2HN1A 3N2GE 4HFEA 2LSIA 5JVDE 4LFCT 1IJ6A 2HPJA 3C51A 3Q5DA 2FJAA 4ZZBA 4MLKA 4HKAA 5IYZE 3ANWB 5LBMA 4U72A 3R84B 2N1GA 4U33A 1UUSA 3B13A 4LF5T 4P0AA 2OLTA 5ABFA 2UUBT 2DI4A 4B3MT 4GYSA 1FMWA 4QX8B 4AKIA 2XAGB 2XQ5A 1ZOYA 3CWZB 2CHOA 2KXPB 3ETUA 4TN7B 1ZKEA 2BZBA 4PK6A 4QHOA 4X20E 2LOPA 3HKEE 3JAFA 1S94A 3TLVA 1J5ET 2V5DA 2XQYA 3L39A 3L8RA 4ILUA 1YXRA 4IE6A 4H9SE 2XQ7A 3SS1A 4ZI2D 2ZMAA 5FP3A 5HCMA 2E9XC 5JTGA 2DNXA 3UQ7A 5AQOB 2E9XB 4QH5A 4U3CA 2XQAA 4X1IE 2R6GF 3LG7A 2HHHT 3UUMA 2Q9QA 1OEDB 2LOSA 3I1AA 3W15B 4ZI7E 2CWYA 3DTOA 2N2NA 1W0BA 3GA8A 3RGLA 1HG2A 4O4JE 3ZMSB 4A97A 4YT0A 3H3AA 2W66A 3AA1B 4NXNT 4O4IE 4UVCB 5LJNA 2Y8DA 4HTEA 1OWAA 1BR4A 4EZ4A 4HFCA 4JUYA 3I0QA 4U31A 4AXPA 1KNPA 2VK9A 2RPAA 2YOEA 4I4TE 5FY0A 4AKLA 1WYBA 4DBQA 4EV6A 2BS3A 2CBIA 3AVRA 2KMFA 1KF6A 3NWIA 4QH1A 5AQLB 5FY1A 2BS4A 1MMNA 3AE5A 3F57A 3CX6B 1MIWA 3PUZF 3UU4A 4EYYR 3T8OA 4OK0A 2IUBA 2CBJA 3RYCE 3WAJA 2YDQA 3RIFA 3Q2MA 4F8HA 1IJ5A 2V6XA 3J7Yq 3AEGA 5DABA 3A8YC 3OPCA 2M6IA 4IE4A 2CMRA 2ACXA 2L3LA 3U3IA 3LK42 4ADZA 5AFUL 4YFSA 5AQHB 2XAFB 2CLYB 5GONE 2KLQA 2X0YA 4JI2T 3EDVA 2RP4A 1XDPA 4WBOA 4WNKA 2XUEA 2JPFA 5LA6E 4OYKA 5F8PA 3UT5E 3UUXB 3EDUA 2WMNA 4H9NC 3CKDA 3SFEA 4COFA 5EK2A 5HXSA 5L4EA 2B1EA 3CPZA 2JQQA 3LDQB 3IEEA 3ZMZB 2V7IA 2XTLA 4HWDA 4JI4T 4HWCA 3S4UA 2PFVA 2H7VC 3ESLA 3JAEA 2BG9B 1XMOT 2WZHA 5HWXA 5CB4E 4O2AE 1KEYA 1NENA 3UUBA 2VQET 2ZLYA 5HXEA 3IBPA 5FXZA 3AE1A 5ABHA 1L0VA 1VCSA 3QK6A 2LSKA 1HF8A 1WYCA 1UCUA 1U4QA 2GK9A 4H9OC 4FI5A 1SUMB 1UX4A 3M65A 3MJXA 2I6HA 2XQ4A 4YJ3E 3UU3A 2WU5A 3UFEA 3VKGA 2LLYA 2VKDA 1KNRA 3KV9A 3Q9DA 4H9RC 1OEDA 4PNIA 3ZN0B 5CA1E 3OVUA 5LHIB 5BMVE 4OX9T 3PU3A 5AQFB 3FZFB 3RIUC 5FMNA 4QWNB 4CI1B 4ZI3C 3FZLB 2XAJB 3IA3A 3N2OA 5L3DB 2KSRA 2NOXA 3PUVF 2WDRA 1VRBA 2K24A 5JR9B 3C4ZA 1VCTA 1LVFA 3AEFA 3ZPOA 3OYZA 4ZZCA 5J0ZA 1I6ZA 4JI7T 4IREA 1IBMT 5M4YA 1J1JA 2XSAA 1MNEA 2V6YB 3N9QA 3P7IA 3PJAA 4ISSA 3UULA 4BA9A 4ILBA 2XAHB 1T98A 2BVLA 2IMLA 4OFZA 5F3JA 5AQKB 2V8SV 5FNVE 5LHHB 1T7SA 2WAUA 2NW9A 4EEBA 3OYXA 5ABEA 1W09A 5H6QB 5LG4A 5AQNB 5ETWA 5FXWA 3FZHB 2XJ7A 3ABVA 3FBZA 3B57A 3PE0A 4PJJA 2C5JA 4QXCB 5FL0A 2M67A 4JI5T 2XY8B 1VOMA 1DU2A 2YINA 4IDNA 3ONJA 3HA4A 3QB5A 3AE8A 1Y64B 2W4XA 2ES0A 2WMOA 2X66A 2EHOA 5EK3A 3FB2A 3EUHA 5LBQB 3VR8A 3ZT6A 1NWMX 2QGSA 2XQ6A 3H37A 4PJMA 5HXRA 4LF8T 4AISA 3PUSA 4NIQA 4JYAT 2LRKA 2MBGA 4L5GA 3ZLIA 4B3ST 5LMNT 2MAWA 1NEKA 1MNDA 3F31A 2K48A 3AEEA 3P4PA 4GIWA 2VB6A 2YK0A 2HPLA 4TNVA 2L9QA 1MIVA 2Z6EA 3Q5XA 1LVKA 4TV9E 2XHEB 4DVDA 4IIJE 2LM9A 4QH4A 2CPTA 4I55E 4Z8XA 2LHRA 5BR8T 2XAQB 2L8KA 3AXJB 2X51A 3SOLA 4AI6A 2D0TA 5IHYA 1UURA 3TLUA 4CI2B 3N9PA 1X9BA 4HEAA 4PJNA 5L3BB 5AQMB 4UEMA 4WW0A 1N36T 1IBKT 3K3OA 2IHR1 2WCAA 5AQRB 2SPCA 5AQIB 3O1JA 4ILCA 1US7B 4HFDA 4O4LE 3T1YT 4DR4T 4KI0F 3V5UA 5AQSB 5A1LA 5L2LA 2DCFA 2N9DA 4F6RC 4YJ2E 3B5MA 3PTRB 4WYVA 2UU9T 1MMGA 4IE7A 4TWDA 1HS7A 2UXCT 5FXVA 5FYMA 4GKKT 2DHRA 2BG9A 3CIRA 4MALA 2B76A 3K1SA 5JDGA 1YKHB 2A9UA 4O2BE 1D0YA 1YQ3A 4ASKA 2W67A 3IF8B 3LJCA 4BJMA 3RLFF 4ZI2C 4YHHT 5HCJA 4ERRA 3I0OA 3PV0F 3JC6C 1R8IA 1OXZA 2MYSA 3NRXA 1IBLT 1HNWT 5HEGA 5HEHA 2C5KT 4HWHA 3LK3B 2CWOA 4UF0B 4A56A 2Y48B 4ZEYA 1Y01A 2VL8A 2WZIA 1D1AA 4X1KE 4LMLA 4DMVA 5FL1A 4AIUA 5HYAA 3RF1A 5IWAT 3E22E 1EZ3A 2FJEA 4OYJA 4UVAB 4QKNA 4KHZF 3ZT7A 3X1DA 2JMHA 1B7TA 3MA9A 3MZKB 3P4WA 2W00A 2MTQA 2VURA 1SHZC 1WCRA 1G8XA 2DWGA 3OBVE 3NVOA 4TZ4C 1WFDA 3QNUA 2ZM8A 1YKEB 3AEBA 3KBTA 4EAHA 1IAPA 3PUQA 2E5VA 2FUPA 3N2KE 5HXCA 1E7PA 2WY2A 4DR3T 2QVAA 3N9LA 5J2TE 5AQTB 4DV0T 4KMCA 3SWHA 4GK0E 1FJGT 3ZMTB 4YHJA 4EZHA 3BQLA 2J1DG 1D1BA 4UV9B 1LKXA 2XASB 3VRBA 5LGUB 1YW0A 3RQWA 1ZP0A 2BBJA 5LNKA 4CI3B 4X62T 5FY7A 1FIOA 5DQWA 5KMGP 1KFYA 2VKJA 3RRWA 2CA5A 2LM2A 4UIGA 4YTMA 3C4XA 3N5LA 3AE2A 3EHZA 3UU6A 4HFIA 4EYUA 3KVBA 3L3PA 3ETVA 4UVBB 4DV1T 1IZNB 3ZCIA 4HFVA 2AXDS 5LCYA 3ONXA 4JEHB 2CXDA 3KV5A 4YSZA 1N34T 5AQVB 2X9HA 5JDNA 1M62A 2FBWA 4U2YA 3RYHE 3GWHA 2BKNA 3O1HA 4GK5E 3KFWX 4Z91A 3RHWA 3UU8A 5L3CB 2KT9A 2PG8A 1UX5A 3U78A 2CE7A 4ISTA 1ZEEA 2Y6XA 3GMIA 4K0KT 5FXXA 1X79A 1S35A 3MK7C 3PUGA 1XDOA 4QXHB 4CXXA 4WBNE 1HR0T 3MXZA 2VVNA 4A98A 4PFPA 2V7MA 4NUVA 4E7SA 1UGOA 4DV7T 2LHNA 3GN5A 4YSYA 5E0OA 2ACZA 2IIUA 3JC6D 4EXTA 3RIAA 4PK5A 4EGWA 3A7MA 4DUZT 4MHCA 4YY3T 4XBFB 2C0SA 4DR6T 3VU7H 5HXHA 1QLBA 3ZC1A 4V1Av 3ZYLA 3C50A 3FBLA 2I59A 3CVRA 4DO0A 1OEDC 1G73A 2LJLA 2XQ8A 4LF4T 4PK4A 5AQUB 3RX6A 3GN5B 3BQIA 2W63A 2WS3A 3NZPA 3P4SA 4HE8A 5F5WA 5TAOA 3RIUA 4CN1A 3P8CD 3ZC0A 2VL0A 4ZHQE 5CGMA 2PJQA 2BVMA 2WWUA 2MOZA 3HKCE 3NRYA 2Q9QC 3LFMA 3C64A 3CQGB 5DJQC 5AQJB 5JR9A 3ZMUB 3PU8A 2ZM0A 5FVLA 3AA0B 3UQ4A 3KDSE 4CN4A 4C90A 1AJ3A 3O4XE 1LRZA 4ZXLA 2V5CA 3CK6A 2DL1A 4NUUA 3AECA 4YLHA 4DV6T 2ODVA 3SRZA 4AQYT 1WRDA 2WDQA 1J5WA 4PFOA 3AB3B 3AA6B 3FXEB 3ZT5A 5CJ5A 2E8IA 1KNZA 4DV3T 2LEHA 1SA0E 4AQFC 2XZEA 2XQ9A 3I9YA 2CXFA 2K3WA 4J2CA 4LMKA 4U74A 4DMWA 4CZZB 3MACA 2J62A 3AEDA 2X9XA 3HI2A 3O1IA 1ZV4X 4TNWA 3RC3A 2NTXA 4GYRA 3OTOT 1WR6A 2H7OA 4DV4T 4U2ZA 2UXBT 3K8PC 4QX7B 5JDLA 4UV8B 2D5UA 5L3FB 4JI6T 4DR7T 4UR9A 2XQ3A 1D1CA 4KBMB 3ANWA 4I0UA 2YEVC 5LYJE 4AKRB 1T72A 2ZM2A 3OJAA 4HFBA 3ZSSA 3ZYKA 5KDMC 5LHGB 3CQXC 1NAFA 2BKPA 4KUMB 3PUAA 2XM2A 4TWFA 5AQGB 4O4HE 4KP3C 3ZCJA 4DV5T 4MFRA 1Z0PA 2ZM6T 2VQFT 5AQQB 3P4QA 1HCIA 3CQCB 2HH7A 1O3XA 2AE9A 1YD8G 4IL4A 4PAGA 2WWVA 3RQUA 2Q9QB 4C91A 2X9YA 2NR4A 1XMQT 4OHFA 5JDHA 3LK2B 4XAXB 1JNZA 5HAXA 2W2UA 1BR2A 2CEAA 1D0ZA 3PDYA 2XSBA 3AE9A 3ZSTA 4B3RT 1HTJF 1T8BA 5HWYA 1MIYA 2YKSA 3BQKA 4KHPT 4N78D 1WLXA 4ZI3D 1XWMA 4Q25A 1E1HB 5JDFA 3AE4A 5C2TA 4M1PA 2CRBA 2PBIA 3JADA 2QRXA 3HKBE 5FVKA 3WAKA 3RPUA 4GKJT 4U7YA 4G63A 4ZOLE 3ZJ2A 2KWIB 4CQIA 2NTYA 4DBRA 3HKDE 2EHOB 4U7IA 2BS2A 5JDQA 2LSYA 4CN6A 2E9XD 2ODUA 3CMLA 3UUNA 3RYFE 3QC9A 4PJLA 3R6NA 3UTKA 5LMUT 3DP7A 3VR9A 4E7ZA 2LT3A 4IE0A 2CM0A 3LSVA 3AVSA 4B6XA 5LOVE 2LSGA 4HWFA 2W62A 1YQ4A 4DR5T 3T1HT 3ZN1B 4YXDA 4JI3T 1I94T 2H89A 1JNRA 4A5XA 1XNQT 4LFBT 2YN6A 4FJOA 2D0UA 4IHJE 5LGTB 4AKHA 4I43B 2JJ9A 2QYWA 5CFBA 4P09A 3G06A 3QB5K 3NZQA 1HG5A 5JDMA 1HFAA 2WP9A 4DR2T 4HGAA 5JH7E 3V5SA 1HX8A 1XZYA 3LBXB 2E2AA 2XM1A 2RA1A 2EHOC 2OV9A 3I9WA 2KWHA 2JIWA 3J9X1 4IE5A 4H9PC 3AAEB 2BKOA 1GQEA 2XPKA 4IGUA 4X1YE 2X0HA 1N33T 1HNZT 2IC6A 4DIDB 5JR9C 5HEJA 2P9BA 2V7KA 3VRAA 4CXYA 3KV6A 2V1DB 3FHNA 4IDZA 3C4WA 5JQGE 2LKGA 2YDRA 2NW8A 4GOUA 4L9IA 1MMDA 5L4HA 2LRLA 2NWBA
chains in the Genus database with same CATH topology
4B3ST 4LF5T 5LMNT 1N32T 2UUBT 4B3MT 2HHHT 1J5ET 4DR2T 3T1HT 5BR8T 4DV6T 4AQYT 4NXMT 1N36T 1IBKT 4JI8T 4DR1T 3T1YT 4X65T 2E5LT 4X64T 2UU9T 4NXNT 3OTOT 2UXCT 4DV4T 2UXBT 4GKKT 2UXDT 1XNRT 4JI6T 4DR7T 4YHHT 1IBLT 1HNWT 4DV5T 2ZM6T 2VQFT 4JI2T 5IWAT 4DV3T 2VQET 1XMQT 4LF6T 4JI4T 4B3RT 4KHPT 1XMOT 4DV2T 4JV5T 4DR3T 4DV0T 1FJGT 4DUYT 4GKJT 2UUCT 4JI3T 4X62T 2F4VT 5LMUT 4OX9T 4LFAT 4DR5T 4DV1T 1I94T 4JI7T 1IBMT 1N34T 1XNQT 4B3TT 4LFBT 4LF9T 4K0KT 2UUAT 1HR0T 4JI1T 4JI0T 4LF7T 4X66T 4DV7T 1N33T 4JI5T 1HNZT 4DUZT 4YY3T 1HNXT 4DR6T 4LFCT 4DR4T 4LF8T 4LF4T 4JYAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S T;  4LF5 T;  5LMN T;  1N32 T;  2UUB T;  4B3M T;  2HHH T;  1J5E T;  4DR2 T;  3T1H T;  5BR8 T;  4DV6 T;  4AQY T;  4NXM T;  1N36 T;  1IBK T;  4JI8 T;  4DR1 T;  3T1Y T;  4X65 T;  2E5L T;  4X64 T;  2UU9 T;  4NXN T;  3OTO T;  2UXC T;  4DV4 T;  2UXB T;  4GKK T;  2UXD T;  1XNR T;  4JI6 T;  4DR7 T;  4YHH T;  1IBL T;  1HNW T;  4DV5 T;  2ZM6 T;  2VQF T;  4JI2 T;  5IWA T;  4DV3 T;  2VQE T;  1XMQ T;  4LF6 T;  4JI4 T;  4B3R T;  4KHP T;  1XMO T;  4DV2 T;  4JV5 T;  4DR3 T;  4DV0 T;  1FJG T;  4DUY T;  4GKJ T;  2UUC T;  4JI3 T;  4X62 T;  2F4V T;  5LMU T;  4OX9 T;  4LFA T;  4DR5 T;  4DV1 T;  1I94 T;  4JI7 T;  1IBM T;  1N34 T;  1XNQ T;  4B3T T;  4LFB T;  4LF9 T;  4K0K T;  2UUA T;  1HR0 T;  4JI1 T;  4JI0 T;  4LF7 T;  4X66 T;  4DV7 T;  1N33 T;  4JI5 T;  1HNZ T;  4DUZ T;  4YY3 T;  1HNX T;  4DR6 T;  4LFC T;  4DR4 T;  4LF8 T;  4LF4 T;  4JYA T; 
#chains in the Genus database with same CATH topology
 1MMA A;  1N32 T;  3E08 A;  2X9W A;  2WDV A;  5LJM A;  5KX5 E;  3EAM A;  5L47 A;  2BDE A;  2JMK A;  3AA7 B;  1H7C A;  2MPK A;  2WQY A;  3AAA B;  1FMV A;  1W9R A;  4KX6 A;  4ZS3 A;  5IUX A;  4TV8 E;  2KZ7 B;  5L3G B;  2YU2 A;  5AQP B;  4L0R A;  5JRE A;  2IC9 A;  2FJD A;  4TX5 A;  1KK7 A;  2IAK A;  3AE3 A;  2I0M A;  5J1G A;  3H3M A;  3Q5W A;  5LXT E;  3FZM B;  2BG9 E;  1OED E;  3JCF A;  4NXM T;  1BR0 A;  2EHO D;  4X5T A;  4IL9 A;  2IW5 B;  3K3N A;  4JI8 T;  1M7K A;  4O8S A;  4P0B A;  3WI3 A;  2UXN B;  3AE7 A;  2A72 A;  4G2A A;  4EOZ B;  4DR1 T;  2M6B A;  2V26 A;  2G0U A;  3N9O A;  4H9Q C;  3EI0 A;  4X65 T;  4PW8 A;  3AXJ A;  3IHR A;  1WR0 A;  5ABF B;  2LSJ A;  4MBQ A;  3RH3 A;  2E5L T;  4X64 T;  3LBX A;  4TWH A;  2CLY C;  3KVA A;  3TLW A;  3RYI E;  3RKO A;  5C8Y E;  1W0A A;  4AKG A;  4ZS2 A;  2QA7 A;  4ANJ A;  5CA0 E;  2E9X A;  2WB5 A;  3O9X A;  1XNR T;  2UXD T;  2X0L B;  3KBU A;  1E2A A;  1Z8U A;  2V6Y A;  3P4R A;  5EZY E;  4EED A;  2A2F X;  4ILA A;  3PUW F;  4IDP A;  2Q9Q D;  5C3J A;  3RC8 A;  2X67 A;  2J4G A;  1QUU A;  2DLR A;  2BG9 C;  1HX1 B;  3A5X A;  3E0Z A;  3L09 A;  3VHL A;  1CUN A;  3K3Q C;  3Q5E A;  3RRC A;  4EB6 E;  2D2S A;  2H88 A;  1CHU A;  2WU2 A;  3OKQ A;  4YTP A;  5L3E B;  4IT4 A;  3VKH A;  1QSD A;  3AAI A;  4IDQ A;  3UFG A;  3PUX F;  4JLE A;  2W61 A;  3ZYM A;  4AQF A;  3UU5 A;  4LF6 T;  2VVS A;  2JQK A;  2HN2 A;  2DWK A;  3SFD A;  5J2U E;  3PJA J;  2LE8 A;  4BJN A;  1HNX T;  3RKG A;  4EIW A;  5JRC B;  3CX7 B;  3ONL C;  5JRC A;  1U5P A;  2VKH A;  3ZJ1 A;  1BR1 A;  5DQV A;  2D9D A;  2X68 A;  2KIN B;  5EK4 A;  3TKL B;  2CCQ A;  2YU1 A;  4DV2 T;  2BBH A;  4JV5 T;  3FZK B;  3ZMV B;  5ABG A;  3TLT A;  3FXD B;  2CHN A;  5LGN B;  3NKZ A;  2OA5 A;  2H3R A;  3AE6 A;  3P50 A;  4I50 E;  4K0U A;  4DUY T;  4H63 H;  2JQH A;  2VAS A;  3QOF A;  3QUJ A;  3NBX X;  3PUR A;  4Z90 A;  3D0T A;  5FKY A;  2UUC T;  4JBW F;  4H63 V;  4P1N A;  2J47 A;  2F4V T;  4HN9 A;  3KV4 A;  1V9D A;  2KND A;  1ZHC A;  4YSX A;  5LG3 A;  4UEL A;  2K9A A;  3F2E A;  2JRK A;  4BAY B;  4UXN B;  4YTN A;  1SE7 A;  2IDO B;  3RI5 A;  5H6R B;  3CX8 B;  5HEO A;  3EVY A;  3DJB A;  4JEU B;  3ZEF B;  4LFA T;  3ZKR A;  3AEA A;  2NW7 A;  5KXJ A;  4DND A;  3MKD A;  2WSS V;  2VKO A;  3BK9 A;  2WM9 A;  5LP6 E;  2WBL A;  2LKH A;  4B3T T;  2C5I T;  2PTF A;  3N9M A;  3N9N A;  4HWI B;  4IDO A;  4LF9 T;  2VWA A;  3PUY F;  2K5B B;  2CXL A;  4LMJ A;  4WZX A;  2JQ9 A;  2W0G A;  2UUA T;  4JI1 T;  4JI0 T;  5LB7 B;  4LF7 T;  3C98 B;  4X66 T;  3KIN B;  5ADX L;  4CXW A;  2YDS A;  1D0X A;  3EAB A;  2A3D A;  4TUY E;  4AQG A;  4HFH A;  4QXB B;  2V7J A;  1FEW A;  4UF0 A;  3TLS A;  1UK5 A;  3M3Z B;  2UXX B;  5HEU A;  2FJB A;  4XZC A;  3HL6 A;  2V7L A;  3HR0 A;  4NPP A;  2NP9 A;  2HN1 A;  3N2G E;  4HFE A;  2LSI A;  5JVD E;  4LFC T;  1IJ6 A;  2HPJ A;  3C51 A;  3Q5D A;  2FJA A;  4ZZB A;  4MLK A;  4HKA A;  5IYZ E;  3ANW B;  5LBM A;  4U72 A;  3R84 B;  2N1G A;  4U33 A;  1UUS A;  3B13 A;  4LF5 T;  4P0A A;  2OLT A;  5ABF A;  2UUB T;  2DI4 A;  4B3M T;  4GYS A;  1FMW A;  4QX8 B;  4AKI A;  2XAG B;  2XQ5 A;  1ZOY A;  3CWZ B;  2CHO A;  2KXP B;  3ETU A;  4TN7 B;  1ZKE A;  2BZB A;  4PK6 A;  4QHO A;  4X20 E;  2LOP A;  3HKE E;  3JAF A;  1S94 A;  3TLV A;  1J5E T;  2V5D A;  2XQY A;  3L39 A;  3L8R A;  4ILU A;  1YXR A;  4IE6 A;  4H9S E;  2XQ7 A;  3SS1 A;  4ZI2 D;  2ZMA A;  5FP3 A;  5HCM A;  2E9X C;  5JTG A;  2DNX A;  3UQ7 A;  5AQO B;  2E9X B;  4QH5 A;  4U3C A;  2XQA A;  4X1I E;  2R6G F;  3LG7 A;  2HHH T;  3UUM A;  2Q9Q A;  1OED B;  2LOS A;  3I1A A;  3W15 B;  4ZI7 E;  2CWY A;  3DTO A;  2N2N A;  1W0B A;  3GA8 A;  3RGL A;  1HG2 A;  4O4J E;  3ZMS B;  4A97 A;  4YT0 A;  3H3A A;  2W66 A;  3AA1 B;  4NXN T;  4O4I E;  4UVC B;  5LJN A;  2Y8D A;  4HTE A;  1OWA A;  1BR4 A;  4EZ4 A;  4HFC A;  4JUY A;  3I0Q A;  4U31 A;  4AXP A;  1KNP A;  2VK9 A;  2RPA A;  2YOE A;  4I4T E;  5FY0 A;  4AKL A;  1WYB A;  4DBQ A;  4EV6 A;  2BS3 A;  2CBI A;  3AVR A;  2KMF A;  1KF6 A;  3NWI A;  4QH1 A;  5AQL B;  5FY1 A;  2BS4 A;  1MMN A;  3AE5 A;  3F57 A;  3CX6 B;  1MIW A;  3PUZ F;  3UU4 A;  4EYY R;  3T8O A;  4OK0 A;  2IUB A;  2CBJ A;  3RYC E;  3WAJ A;  2YDQ A;  3RIF A;  3Q2M A;  4F8H A;  1IJ5 A;  2V6X A;  3J7Y q;  3AEG A;  5DAB A;  3A8Y C;  3OPC A;  2M6I A;  4IE4 A;  2CMR A;  2ACX A;  2L3L A;  3U3I A;  3LK4 2;  4ADZ A;  5AFU L;  4YFS A;  5AQH B;  2XAF B;  2CLY B;  5GON E;  2KLQ A;  2X0Y A;  4JI2 T;  3EDV A;  2RP4 A;  1XDP A;  4WBO A;  4WNK A;  2XUE A;  2JPF A;  5LA6 E;  4OYK A;  5F8P A;  3UT5 E;  3UUX B;  3EDU A;  2WMN A;  4H9N C;  3CKD A;  3SFE A;  4COF A;  5EK2 A;  5HXS A;  5L4E A;  2B1E A;  3CPZ A;  2JQQ A;  3LDQ B;  3IEE A;  3ZMZ B;  2V7I A;  2XTL A;  4HWD A;  4JI4 T;  4HWC A;  3S4U A;  2PFV A;  2H7V C;  3ESL A;  3JAE A;  2BG9 B;  1XMO T;  2WZH A;  5HWX A;  5CB4 E;  4O2A E;  1KEY A;  1NEN A;  3UUB A;  2VQE T;  2ZLY A;  5HXE A;  3IBP A;  5FXZ A;  3AE1 A;  5ABH A;  1L0V A;  1VCS A;  3QK6 A;  2LSK A;  1HF8 A;  1WYC A;  1UCU A;  1U4Q A;  2GK9 A;  4H9O C;  4FI5 A;  1SUM B;  1UX4 A;  3M65 A;  3MJX A;  2I6H A;  2XQ4 A;  4YJ3 E;  3UU3 A;  2WU5 A;  3UFE A;  3VKG A;  2LLY A;  2VKD A;  1KNR A;  3KV9 A;  3Q9D A;  4H9R C;  1OED A;  4PNI A;  3ZN0 B;  5CA1 E;  3OVU A;  5LHI B;  5BMV E;  4OX9 T;  3PU3 A;  5AQF B;  3FZF B;  3RIU C;  5FMN A;  4QWN B;  4CI1 B;  4ZI3 C;  3FZL B;  2XAJ B;  3IA3 A;  3N2O A;  5L3D B;  2KSR A;  2NOX A;  3PUV F;  2WDR A;  1VRB A;  2K24 A;  5JR9 B;  3C4Z A;  1VCT A;  1LVF A;  3AEF A;  3ZPO A;  3OYZ A;  4ZZC A;  5J0Z A;  1I6Z A;  4JI7 T;  4IRE A;  1IBM T;  5M4Y A;  1J1J A;  2XSA A;  1MNE A;  2V6Y B;  3N9Q A;  3P7I A;  3PJA A;  4ISS A;  3UUL A;  4BA9 A;  4ILB A;  2XAH B;  1T98 A;  2BVL A;  2IML A;  4OFZ A;  5F3J A;  5AQK B;  2V8S V;  5FNV E;  5LHH B;  1T7S A;  2WAU A;  2NW9 A;  4EEB A;  3OYX A;  5ABE A;  1W09 A;  5H6Q B;  5LG4 A;  5AQN B;  5ETW A;  5FXW A;  3FZH B;  2XJ7 A;  3ABV A;  3FBZ A;  3B57 A;  3PE0 A;  4PJJ A;  2C5J A;  4QXC B;  5FL0 A;  2M67 A;  4JI5 T;  2XY8 B;  1VOM A;  1DU2 A;  2YIN A;  4IDN A;  3ONJ A;  3HA4 A;  3QB5 A;  3AE8 A;  1Y64 B;  2W4X A;  2ES0 A;  2WMO A;  2X66 A;  2EHO A;  5EK3 A;  3FB2 A;  3EUH A;  5LBQ B;  3VR8 A;  3ZT6 A;  1NWM X;  2QGS A;  2XQ6 A;  3H37 A;  4PJM A;  5HXR A;  4LF8 T;  4AIS A;  3PUS A;  4NIQ A;  4JYA T;  2LRK A;  2MBG A;  4L5G A;  3ZLI A;  4B3S T;  5LMN T;  2MAW A;  1NEK A;  1MND A;  3F31 A;  2K48 A;  3AEE A;  3P4P A;  4GIW A;  2VB6 A;  2YK0 A;  2HPL A;  4TNV A;  2L9Q A;  1MIV A;  2Z6E A;  3Q5X A;  1LVK A;  4TV9 E;  2XHE B;  4DVD A;  4IIJ E;  2LM9 A;  4QH4 A;  2CPT A;  4I55 E;  4Z8X A;  2LHR A;  5BR8 T;  2XAQ B;  2L8K A;  3AXJ B;  2X51 A;  3SOL A;  4AI6 A;  2D0T A;  5IHY A;  1UUR A;  3TLU A;  4CI2 B;  3N9P A;  1X9B A;  4HEA A;  4PJN A;  5L3B B;  5AQM B;  4UEM A;  4WW0 A;  1N36 T;  1IBK T;  3K3O A;  2IHR 1;  2WCA A;  5AQR B;  2SPC A;  5AQI B;  3O1J A;  4ILC A;  1US7 B;  4HFD A;  4O4L E;  3T1Y T;  4DR4 T;  4KI0 F;  3V5U A;  5AQS B;  5A1L A;  5L2L A;  2DCF A;  2N9D A;  4F6R C;  4YJ2 E;  3B5M A;  3PTR B;  4WYV A;  2UU9 T;  1MMG A;  4IE7 A;  4TWD A;  1HS7 A;  2UXC T;  5FXV A;  5FYM A;  4GKK T;  2DHR A;  2BG9 A;  3CIR A;  4MAL A;  2B76 A;  3K1S A;  5JDG A;  1YKH B;  2A9U A;  4O2B E;  1D0Y A;  1YQ3 A;  4ASK A;  2W67 A;  3IF8 B;  3LJC A;  4BJM A;  3RLF F;  4ZI2 C;  4YHH T;  5HCJ A;  4ERR A;  3I0O A;  3PV0 F;  3JC6 C;  1R8I A;  1OXZ A;  2MYS A;  3NRX A;  1IBL T;  1HNW T;  5HEG A;  5HEH A;  2C5K T;  4HWH A;  3LK3 B;  2CWO A;  4UF0 B;  4A56 A;  2Y48 B;  4ZEY A;  1Y01 A;  2VL8 A;  2WZI A;  1D1A A;  4X1K E;  4LML A;  4DMV A;  5FL1 A;  4AIU A;  5HYA A;  3RF1 A;  5IWA T;  3E22 E;  1EZ3 A;  2FJE A;  4OYJ A;  4UVA B;  4QKN A;  4KHZ F;  3ZT7 A;  3X1D A;  2JMH A;  1B7T A;  3MA9 A;  3MZK B;  3P4W A;  2W00 A;  2MTQ A;  2VUR A;  1SHZ C;  1WCR A;  1G8X A;  2DWG A;  3OBV E;  3NVO A;  4TZ4 C;  1WFD A;  3QNU A;  2ZM8 A;  1YKE B;  3AEB A;  3KBT A;  4EAH A;  1IAP A;  3PUQ A;  2E5V A;  2FUP A;  3N2K E;  5HXC A;  1E7P A;  2WY2 A;  4DR3 T;  2QVA A;  3N9L A;  5J2T E;  5AQT B;  4DV0 T;  4KMC A;  3SWH A;  4GK0 E;  1FJG T;  3ZMT B;  4YHJ A;  4EZH A;  3BQL A;  2J1D G;  1D1B A;  4UV9 B;  1LKX A;  2XAS B;  3VRB A;  5LGU B;  1YW0 A;  3RQW A;  1ZP0 A;  2BBJ A;  5LNK A;  4CI3 B;  4X62 T;  5FY7 A;  1FIO A;  5DQW A;  5KMG P;  1KFY A;  2VKJ A;  3RRW A;  2CA5 A;  2LM2 A;  4UIG A;  4YTM A;  3C4X A;  3N5L A;  3AE2 A;  3EHZ A;  3UU6 A;  4HFI A;  4EYU A;  3KVB A;  3L3P A;  3ETV A;  4UVB B;  4DV1 T;  1IZN B;  3ZCI A;  4HFV A;  2AXD S;  5LCY A;  3ONX A;  4JEH B;  2CXD A;  3KV5 A;  4YSZ A;  1N34 T;  5AQV B;  2X9H A;  5JDN A;  1M62 A;  2FBW A;  4U2Y A;  3RYH E;  3GWH A;  2BKN A;  3O1H A;  4GK5 E;  3KFW X;  4Z91 A;  3RHW A;  3UU8 A;  5L3C B;  2KT9 A;  2PG8 A;  1UX5 A;  3U78 A;  2CE7 A;  4IST A;  1ZEE A;  2Y6X A;  3GMI A;  4K0K T;  5FXX A;  1X79 A;  1S35 A;  3MK7 C;  3PUG A;  1XDO A;  4QXH B;  4CXX A;  4WBN E;  1HR0 T;  3MXZ A;  2VVN A;  4A98 A;  4PFP A;  2V7M A;  4NUV A;  4E7S A;  1UGO A;  4DV7 T;  2LHN A;  3GN5 A;  4YSY A;  5E0O A;  2ACZ A;  2IIU A;  3JC6 D;  4EXT A;  3RIA A;  4PK5 A;  4EGW A;  3A7M A;  4DUZ T;  4MHC A;  4YY3 T;  4XBF B;  2C0S A;  4DR6 T;  3VU7 H;  5HXH A;  1QLB A;  3ZC1 A;  4V1A v;  3ZYL A;  3C50 A;  3FBL A;  2I59 A;  3CVR A;  4DO0 A;  1OED C;  1G73 A;  2LJL A;  2XQ8 A;  4LF4 T;  4PK4 A;  5AQU B;  3RX6 A;  3GN5 B;  3BQI A;  2W63 A;  2WS3 A;  3NZP A;  3P4S A;  4HE8 A;  5F5W A;  5TAO A;  3RIU A;  4CN1 A;  3P8C D;  3ZC0 A;  2VL0 A;  4ZHQ E;  5CGM A;  2PJQ A;  2BVM A;  2WWU A;  2MOZ A;  3HKC E;  3NRY A;  2Q9Q C;  3LFM A;  3C64 A;  3CQG B;  5DJQ C;  5AQJ B;  5JR9 A;  3ZMU B;  3PU8 A;  2ZM0 A;  5FVL A;  3AA0 B;  3UQ4 A;  3KDS E;  4CN4 A;  4C90 A;  1AJ3 A;  3O4X E;  1LRZ A;  4ZXL A;  2V5C A;  3CK6 A;  2DL1 A;  4NUU A;  3AEC A;  4YLH A;  4DV6 T;  2ODV A;  3SRZ A;  4AQY T;  1WRD A;  2WDQ A;  1J5W A;  4PFO A;  3AB3 B;  3AA6 B;  3FXE B;  3ZT5 A;  5CJ5 A;  2E8I A;  1KNZ A;  4DV3 T;  2LEH A;  1SA0 E;  4AQF C;  2XZE A;  2XQ9 A;  3I9Y A;  2CXF A;  2K3W A;  4J2C A;  4LMK A;  4U74 A;  4DMW A;  4CZZ B;  3MAC A;  2J62 A;  3AED A;  2X9X A;  3HI2 A;  3O1I A;  1ZV4 X;  4TNW A;  3RC3 A;  2NTX A;  4GYR A;  3OTO T;  1WR6 A;  2H7O A;  4DV4 T;  4U2Z A;  2UXB T;  3K8P C;  4QX7 B;  5JDL A;  4UV8 B;  2D5U A;  5L3F B;  4JI6 T;  4DR7 T;  4UR9 A;  2XQ3 A;  1D1C A;  4KBM B;  3ANW A;  4I0U A;  2YEV C;  5LYJ E;  4AKR B;  1T72 A;  2ZM2 A;  3OJA A;  4HFB A;  3ZSS A;  3ZYK A;  5KDM C;  5LHG B;  3CQX C;  1NAF A;  2BKP A;  4KUM B;  3PUA A;  2XM2 A;  4TWF A;  5AQG B;  4O4H E;  4KP3 C;  3ZCJ A;  4DV5 T;  4MFR A;  1Z0P A;  2ZM6 T;  2VQF T;  5AQQ B;  3P4Q A;  1HCI A;  3CQC B;  2HH7 A;  1O3X A;  2AE9 A;  1YD8 G;  4IL4 A;  4PAG A;  2WWV A;  3RQU A;  2Q9Q B;  4C91 A;  2X9Y A;  2NR4 A;  1XMQ T;  4OHF A;  5JDH A;  3LK2 B;  4XAX B;  1JNZ A;  5HAX A;  2W2U A;  1BR2 A;  2CEA A;  1D0Z A;  3PDY A;  2XSB A;  3AE9 A;  3ZST A;  4B3R T;  1HTJ F;  1T8B A;  5HWY A;  1MIY A;  2YKS A;  3BQK A;  4KHP T;  4N78 D;  1WLX A;  4ZI3 D;  1XWM A;  4Q25 A;  1E1H B;  5JDF A;  3AE4 A;  5C2T A;  4M1P A;  2CRB A;  2PBI A;  3JAD A;  2QRX A;  3HKB E;  5FVK A;  3WAK A;  3RPU A;  4GKJ T;  4U7Y A;  4G63 A;  4ZOL E;  3ZJ2 A;  2KWI B;  4CQI A;  2NTY A;  4DBR A;  3HKD E;  2EHO B;  4U7I A;  2BS2 A;  5JDQ A;  2LSY A;  4CN6 A;  2E9X D;  2ODU A;  3CML A;  3UUN A;  3RYF E;  3QC9 A;  4PJL A;  3R6N A;  3UTK A;  5LMU T;  3DP7 A;  3VR9 A;  4E7Z A;  2LT3 A;  4IE0 A;  2CM0 A;  3LSV A;  3AVS A;  4B6X A;  5LOV E;  2LSG A;  4HWF A;  2W62 A;  1YQ4 A;  4DR5 T;  3T1H T;  3ZN1 B;  4YXD A;  4JI3 T;  1I94 T;  2H89 A;  1JNR A;  4A5X A;  1XNQ T;  4LFB T;  2YN6 A;  4FJO A;  2D0U A;  4IHJ E;  5LGT B;  4AKH A;  4I43 B;  2JJ9 A;  2QYW A;  5CFB A;  4P09 A;  3G06 A;  3QB5 K;  3NZQ A;  1HG5 A;  5JDM A;  1HFA A;  2WP9 A;  4DR2 T;  4HGA A;  5JH7 E;  3V5S A;  1HX8 A;  1XZY A;  3LBX B;  2E2A A;  2XM1 A;  2RA1 A;  2EHO C;  2OV9 A;  3I9W A;  2KWH A;  2JIW A;  3J9X 1;  4IE5 A;  4H9P C;  3AAE B;  2BKO A;  1GQE A;  2XPK A;  4IGU A;  4X1Y E;  2X0H A;  1N33 T;  1HNZ T;  2IC6 A;  4DID B;  5JR9 C;  5HEJ A;  2P9B A;  2V7K A;  3VRA A;  4CXY A;  3KV6 A;  2V1D B;  3FHN A;  4IDZ A;  3C4W A;  5JQG E;  2LKG A;  2YDR A;  2NW8 A;  4GOU A;  4L9I A;  1MMD A;  5L4H A;  2LRL A;  2NWB A; 
#chains in the Genus database with same CATH homology
 4B3S T;  4LF5 T;  5LMN T;  1N32 T;  2UUB T;  4B3M T;  2HHH T;  1J5E T;  4DR2 T;  3T1H T;  5BR8 T;  4DV6 T;  4AQY T;  4NXM T;  1N36 T;  1IBK T;  4JI8 T;  4DR1 T;  3T1Y T;  4X65 T;  2E5L T;  4X64 T;  2UU9 T;  4NXN T;  3OTO T;  2UXC T;  4DV4 T;  2UXB T;  4GKK T;  2UXD T;  1XNR T;  4JI6 T;  4DR7 T;  4YHH T;  1IBL T;  1HNW T;  4DV5 T;  2ZM6 T;  2VQF T;  4JI2 T;  5IWA T;  4DV3 T;  2VQE T;  1XMQ T;  4LF6 T;  4JI4 T;  4B3R T;  4KHP T;  1XMO T;  4DV2 T;  4JV5 T;  4DR3 T;  4DV0 T;  1FJG T;  4DUY T;  4GKJ T;  2UUC T;  4JI3 T;  4X62 T;  2F4V T;  5LMU T;  4OX9 T;  4LFA T;  4DR5 T;  4DV1 T;  1I94 T;  4JI7 T;  1IBM T;  1N34 T;  1XNQ T;  4B3T T;  4LFB T;  4LF9 T;  4K0K T;  2UUA T;  1HR0 T;  4JI1 T;  4JI0 T;  4LF7 T;  4X66 T;  4DV7 T;  1N33 T;  4JI5 T;  1HNZ T;  4DUZ T;  4YY3 T;  1HNX T;  4DR6 T;  4LFC T;  4DR4 T;  4LF8 T;  4LF4 T;  4JYA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...