4N78D

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
529
structure length
202
Chain Sequence
HTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRSDARSVLLEAIRKGIQLRKVEEIENDVATILSRRIAVEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
total genus 57
structure length 202
sequence length 529
ec nomenclature
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78D01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4n78D02
3N4XA 4ZKUA 5BU8B 3N7NA 3BATA 4N78D 3VP9A 4N3YB 5BVZA 3HRNA 3U1CA 3VP8A 5BU5A 1X79B 4O9BA 1WT6A 4GIFA 4I1LA 3C9IA 2JEEA 3BASA 1IC2A 3U59A 4ZKPA 1NKNA 2FXMA 2POHA 3U1AA 5KTBA 3OJAB 3P8CD
chains in the Genus database with same CATH superfamily
4LF6T 2E8IA 4ILCA 5JRCB 2D9DA 1LWUB 2WPRA 3H1HJ 5KAFH 3AEFA 2QM7A 1M1JA 3NWIA 1IAPA 3VP8A 1LGHB 2C5IT 1ZP0C 2NOXA 2YO3A 2UUAT 3GF7A 4DV4T 3KV9A 2LKHA 4YTNA 3E08A 3PJAA 5KLIB 2D2CD 2JMKA 4CPGA 5FNVE 4XA4A 2VL8A 2RN0A 3ZPOA 4OK0A 3D70A 1Q7YQ 3K3NA 3K3OA 1KILE 3V2PA 2FYUE 1H88A 1M56D 3FZKB 3CPZA 3BRVB 3A0HE 1YI2P 5HEUA 3PUQA 3JAEA 2Y0CA 2V7IA 2R3SA 5AVUB 4QX8B 1HG2A 2YO2A 1IFNA 3IR9A 4Q25A 3D71A 2PRRA 1MMAA 3B57A 1N7SB 3DTOA 4ILBA 4CI3B 5E0OA 2Q9QD 5C8YE 3A2AA 3GA8A 2V5CA 2C0SA 3V2QA 4DV7T 3U78A 1BDDA 5APWA 2W27A 4IGUA 5CB4E 3FXDB 2YDRA 2XM2A 4C90A 3S4UA 2R5BA 1SQQJ 3AE3A 1FAVA 3ZN0B 1SQXG 4ASVA 1NYHA 2YINA 1VCSA 2LT3A 3LK42 5HEOA 3S9OA 1YKEB 2KSJA 4GIWA 1M1KQ 2QVAA 4COFA 3KVBA 3NZPA 1KFYA 1SQPJ 1WRDA 4KBMB 5IWAT 1KMIZ 1NTMK 3I5CA 5AQMB 4EAHA 3RIFA 1N7SD 3Q5XA 1SQQK 5JTGA 1LT1A 1FE6A 2XAGB 3S4RA 5AW2B 2X66A 3H1LD 4LF8T 3G4SP 3V4WA 5H2FH 1LVKA 1GK6A 2B87B 1CI6B 4UF0B 4CXYA 5AQOB 4IT4A 2PP6A 2PFXA 4Z1MH 2B88A 4JYAT 4AQFA 1N73B 2K48A 3C98B 4WY4B 2AXTH 1SQXK 4ZI2C 1DU2A 4H0LD 3AA6B 3JCUH 2LHNA 4JEHB 3AE5C 4P0BA 2I1KA 3TGUJ 2ZT9C 3KDPB 2CA5A 1BGYJ 1LRZA 2KSEA 3KXDA 1FJKA 2P1JA 2ZM8A 3V5SA 3K5BA 3IA3A 2Q5UA 3I9YA 3UULA 5KLIC 1NWQA 1WR0A 5AQRB 1IFIA 2ZVOB 3CCVP 1US7B 4H9OC 4UF0A 3UU6A 2BZBA 2JO1A 3MACA 5AQFB 3CKDA 1GL2B 2HPLA 4M1PA 5AW9B 2BVMA 2LLYA 2Y0EA 3UUMA 3U3IA 3P50A 1NTKK 1PP9D 5KXJA 4UB8H 5AQHB 1NTME 2Y0DA 3NZQA 5IUXA 5CCGC 1WRGA 3CWBE 3WUUA 5KLVG 1A02F 2NW9A 2ZXXA 3PURA 2EHOA 4P1NA 3EWKA 3M9BA 5APTA 1H89A 5HXRA 5KAIH 2NRGA 2HPJA 3HA4A 4JEUB 4LFAT 1R5LA 1SHZC 5HEJA 1N34T 4HN9A 2E75D 4PD4H 2DWKA 2XNXA 1OWAA 2WQYA 3ZMSB 1AJ3A 4PV1B 1MV8A 1D1AA 4WYVA 1EZVG 2QGSA 1Q81Q 3RK2B 5BR8T 2FJDA 2WS3A 3UUXB 1S2EA 2WT7B 3RI5A 2KXPB 4GIFA 4QH5A 3DP7A 2EHOB 2BCCJ 3L72D 2ES0A 2XNDH 2VL0A 4JI6T 3N2OA 3L37A 2CLYB 4RKUJ 3EQ2A 2ZM2A 3MKDA 1VQPP 4X1YE 4L76A 3H1LE 4G63A 4DV2T 4WY4A 3JCUE 1JNZA 3L71D 4Z90A 3T1YT 3ZC0A 4JI8T 2X51A 2WQYC 2V7LA 5CJ0A 1LP1A 1L4AA 3CXHD 1FZCB 2XQ9A 3TYYA 3U59A 4OFZA 3AE1C 3CK6A 4WBNE 2W62A 3RF1A 2CM0A 2BKPA 3ZSSA 1KQGB 1KILB 4R4LA 2V6YB 4RJTA 2X9XA 1H8AA 4DIDB 1T98A 4H63V 2HN1A 3QUJA 4H13C 2K9JA 2YKQA 4YSZA 3AE8C 3QC9A 5JDFA 1FOSE 4YLHA 5APXA 3FBLA 4E7ZA 1VDFA 2SPCA 3RBZA 4K35A 3CWZB 4AKGA 2LM2A 3AE1A 4L74A 2FXMA 4PK5A 1BCCJ 3L71E 5C39A 3IF8B 3H1KJ 1JY2P 2YDQA 3H3MA 3C4ZA 1HBWA 3UQ7A 2BKOA 3H1KE 2LXBA 4C91A 3MA9A 4B3MT 5LJMA 4QXCB 4WNKA 5BU5A 3R2PA 4U7IA 1HVVA 3CX8B 1G1IA 5LP6E 4YPCA 2D5UA 4NXNT 3W67A 5AVWB 4DUZT 5L8RJ 2QA4P 2W66A 1X9VA 1MIVA 3UFEA 4E7SA 1W0BA 2N1TD 2P67A 4IOIH 2CRBA 3PUWF 2WU2A 5AQNB 2NPSD 2I6HA 1UGOA 3F31A 3KBTA 3ONLC 1IBKT 2ACZA 4P09A 1SFCC 1JY2N 2W6BA 1FZAA 4X20E 5KAFE 4MHCA 3NXSA 3RK3D 2B76A 5HXSA 2WSCH 1NTZD 2IBZG 2WPVB 5HEHA 3O1JA 5DJUB 2ODUA 3GMIA 3V2RA 2DWGA 2CLYC 3JADA 5JR9C 2M6BA 1SQQG 1W9RA 3M06A 1NTZJ 1URQD 5L3CB 3HI2A 5KJ7A 3MGNA 3RL0D 1M62A 2KOGA 4XBFB 1KFMA 4OGQC 2VURA 3QOFA 3B8EB 2W83C 4HWHA 1M57D 5AFUL 2HH7A 1CSBA 4QH1A 2BG9A 1KZUB 4O8SA 3AE7C 1EXJA 2NPSB 2IBZI 1S4XA 4C46A 3L3PA 1SE7A 1FIOA 1QUUA 3H1JE 5AQPB 3N4XA 5AVSB 1VQKP 2M3BA 2FYUD 1YKHB 1D0ZA 4TWFA 1MFTA 4DO0A 2YKOA 1RF1A 4HFHA 3CCSP 3L70E 2D0UA 2PG8A 4TUYE 2BG9B 3SOLA 4O9BA 3P8CE 3HUSB 4HGAA 1M7KA 3H3AA 3PJAJ 4JV5T 3KZIE 3K3QC 1BR2A 2QA7A 1VQMP 4C7NB 1DIPA 1HGVA 4JI1T 3LK2B 1OMIA 4R4MA 4HKZH 5LOVE 1KQLA 1N32T 4N78D 1LTJC 1L0LJ 3AXJA 2R44A 4HWCA 1AA0A 3KZIH 3CIRA 3FZFB 4ZZBA 3F57A 1FMWA 4IE4A 4JI5T 4KT0J 1JO5A 1XWMA 4JQ0D 4JYBA 3K1SA 3MUDC 3TF5A 1PZQA 5AVVB 2VK9A 1NOHA 3PU3A 2FXOA 4L73A 3ZMUB 1EC5A 1JMBA 1VCTA 4MN4C 4UV8B 1VQLP 3SWKA 3PU8A 2WWWA 4EXTA 2YMKA 2IFMA 3M0DC 1CZQA 3LDQB 1ZHCA 1QVGO 1PFIA 3OTOT 2YIUB 1Y47A 2KT9A 2LEHA 2OV9A 3C64A 2V5DA 4YJ3E 2FBWC 2JWDA 2KINB 2O01H 4BRYB 5GONE 1J5WA 4ZNCA 2VVSA 3RL0C 4AUWA 1SQVD 3FHNA 5AQIB 4I6MC 3P8MC 4UVBB 3K8PC 3T1HT 1HF9A 3LG7A 5LCYA 1SQVJ 3CQGB 3CVRA 2KB7P 3AE5A 1SQBJ 2DLRA 5AQVB 3AEBC 1LT9A 4QXHB 1Y01A 2H88C 2CHNA 3FXEA 4I50E 4UELA 3L73D 2FFDC 2FYUG 4OVNF 4C7NA 2FY8A 3NRYA 3L70D 3KPEA 1EDLA 3SFDC 1HWTC 2P7JA 4GKGA 3IHRA 2PTFA 3TSIA 1UUSA 1FZFA 3UIAA 1VRBA 4DV3T 2KLUA 1RF0C 3CCUP 1NU1K 2XY8B 5TISE 1MKMA 2HYNA 2K3RA 3A3YB 5AQUB 5KMGP 2X0HA 2MOZA 4I1LA 2I1JA 3VTPC 4KP3C 2IMLA 4K0UA 3UU5A 5LGTB 3F89A 3L75D 2ACXA 2LSGA 3TKLB 2QYWA 1Q2NA 2W61A 4U72A 1IK9A 4PJ0H 3MHVA 3KFWX 1SQBK 4ADZA 2WSEH 1NTZE 2CXLA 1GK4A 1OEDA 1G1JA 2JKVA 1N73A 2J47A 4I2LC 4IDZA 3AAEB 2CCQA 4PNIA 1RF1C 2XTLA 4JI7T 4H44B 5AVZB 1W0AA 2KLVA 4AQFC 1KF6A 1VQ7P 4PJ0E 3LBXA 2WM9A 4PW8A 4U7YA 2HR3A 2WPQA 5M4YA 4EOZB 5HEGA 3F5HA 3VR9A 4QMAA 4DR7T 4OYKA 1K04A 2YNYA 3ZN1B 4GODA 4L5GA 2WTYA 3HE4A 1NTKE 3EHZA 1Y64B 1URQB 1ZRTD 1NH4A 3Q5RA 3UUNA 5HCJA 1OW7A 2XU6A 2JR8A 1WYBA 3M0AA 1QGKB 2GM4A 1LNQA 2B87A 1XZYA 4PD4D 4WBOA 3CQCB 3TLVA 1ZP0A 4DCKA 2CE7A 5CGMA 4W7ZA 5BU8B 2CWYA 1BCCE 3L71J 2VKJA 5CBOA 4GT1A 4AXPA 1JUNA 4PD4E 2X68A 2X0LB 1LKXA 3TK1A 1DD4A 2FYNB 2E74D 4AKRB 3AECC 1JY3N 1L0NG 1Q90D 1IFJA 2V4HA 3H1IG 2K5BB 2OLTA 3C50A 4HFDA 4EGWA 3DJBA 3MZWB 4DV6T 2E75C 1NTMG 3ZYMA 4I43B 2DHRA 3B5MA 1VQ8P 3I0OA 2Z4EA 4U3FE 3CWBG 2AXDS 3ETUA 1AQTA 5EFWB 3RK3E 4J2CA 1JEKA 5FVKA 3VP9A 1USDA 5AW6B 3B5NC 5J0ZA 3VKHA 3Q2YA 2CPSA 5CHXA 1GDTA 2FYZA 2WITA 1WLXA 1BCCD 3UT5E 3LFMA 3RIUA 3V6IA 3AA0B 4OYJA 1EZVE 4ZKPA 5JVDE 1FJGT 5F5WA 2X9HA 1SQXJ 1MZ9A 1JCCA 2DW3A 2UU9T 5ABHA 5FL1A 2JQHA 5FXZA 3HD7B 2XQ3A 3ZT6A 4EZ4A 1YQ4A 1FS0E 2BCCE 3QH9A 3CQXC 3MZKB 4ASWA 3C4WA 3ZC1A 2W6AA 3FZLB 2WAUA 1SQBG 2XQ7A 3SFEC 2Q7CA 1FDIA 4K0KT 4L75A 2AXTE 1ZOYA 2VKOA 1ZRTE 1VF5C 4XFJA 1NU1D 1UIIA 3AEGA 2KIKA 1SP4A 4HTEA 3LIDA 3WAKA 2WU5A 3OJAA 2HN2A 2QJPC 3HKBE 1M1JB 5AVYB 2DCFA 2I59A 4LF7T 2LR2A 2UXXB 3OAKA 2N9BA 4OH8B 1N7SC 2P2UA 3AEAC 4V1Av 1FZBA 2W4XA 3N9LA 3ZJ2A 1LTIC 2N2NA 5LJNA 1PGQA 1SUMB 3HR0A 1HJBA 3VU7H 2E9XC 1GQEA 4CXWA 3HL6A 4IE6A 2L3LA 3GHGB 3N9OA 4JBWF 4LF4T 3IFMA 2QJYB 2XASB 2X0YA 5FMNA 1UX5A 3IEEA 1VQNP 4G2AA 3LIEA 3O1HA 2A2FX 2WBLA 3UU8A 2YK0A 2WSFJ 2IFNA 5J1GA 3MXZA 2YDSA 4B3RT 1NU1G 2CK3H 2LSJA 1N7SA 1QLBA 1OEDE 5KLVD 3RK3B 4IIJE 4IREA 2LOSA 2WZHA 3GHGA 2D2CB 4CXXA 2QJPB 3KV5A 4PD4I 3ESLA 5AQGB 4GK5E 2E5TA 4IE7A 1IO4A 1PL5A 2WSSH 4ZS3A 2W8ZA 5KJ7C 1NO4A 1YW0A 3O1IA 1HX8A 1JB0J 4H63H 3BCCJ 2OYIA 2JQQA 2NPSA 3G3ZA 1CUNA 3ETVA 1IC2A 4X62T 3WMM0 4H9RC 1PP9E 4XE5B 2XV5A 1JY3P 3B71A 1S1CX 1YQ3A 1KQFB 1B7TA 5FY7A 5B5EH 4EIWA 2D2CC 2NR4A 2XAFB 4IFDK 4YSXA 5LHGB 2R6GF 3GHGC 1SFCD 4HE8A 3IF4A 2Q1KA 2V7QH 4IL6X 4O4HE 1SQQE 4UIGA 5KJ7D 2V1DB 1BSNA 1QL2A 5JDLA 3L74J 2KYVA 3OYXA 4ANJA 3I0QA 2K3WA 2O1JA 5GTIE 1D7MA 4HWFA 5APSA 5LGNB 2Q3EA 3C1LA 3L8RA 1IJ5A 4DBQA 5J2UE 4H9QC 5KLVE 4DUYT 3G9RA 3FBZA 3W68A 3PUXF 4YY3T 4FI5A 2BBHA 2PFVA 1OVVA 1HTLC 3AE7A 1NKZB 4TZ4C 3VR8A 4JI3T 3II6A 2XAJB 3SWYA 4CZZB 5AVTB 1U5PA 5JDQA 2BS4A 5JDNA 3CC2P 3RLFF 1BSHA 1KYOH 2FYUJ 5C2TA 2WCAA 4YSYA 2E9XD 3JC6C 5FY0A 1L0NK 3HUSC 1HNZT 2KMFA 3L72G 5H6RB 2A45G 2V26A 2VB6A 4YXWH 5FP3A 1D1BA 1OVRA 4GDOA 3GWHA 5BVZA 2A9UA 2XUEA 3H1IJ 2KSRA 2WY2A 3BQLA 2RPAA 3L73J 3MP7B 3P4QA 2WZIA 3PUYF 3WUVA 3KDSE 1IBMT 2RP4A 3H1LG 3C9IA 1KFNA 2RMZA 2ZVNB 2KNDA 4LLHA 3BQKA 3H1HE 4D6TG 3CI9A 5AVXB 1L0LD 3ZT5A 3Q9DA 2FKWB 3D6YA 5KLVK 1OEDC 4GYRA 1LWUC 1KNPA 2N9DA 1KB9E 1GD2E 4DMVA 3I1AA 2R32A 4N6JA 1N86A 2HG5D 3GMAA 2OTLP 4JBZA 1R8IA 2H7HA 3CCMP 2N1TA 3HKEE 2NZ2A 5ADXL 4BRYA 1BR1A 4Y99C 5GTHH 2UXNB 3EUHA 4U2YA 4KHPT 2C9NY 2P9BA 4H44C 5ABGA 3A0HH 2H88A 5JQGE 1T2KD 1IFMA 1KB9D 3E1RA 5APQA 1EDJA 1BR4A 1E2AA 2LXCB 3OA7A 1HG5A 3NFQA 1G8XA 3Q5PA 3H1KD 4HYTB 5E79H 1FDOA 2J4GA 1S3JA 3RPUA 2P58A 3I56P 4IL9A 1FDMA 5HXHA 1X22A 4I4TE 4N78E 2XZEA 5DQWA 3FXEB 4CN4A 1E1HB 3RIAA 3N9MA 1RQVA 2FJBA 4IDOA 3PUSA 1SFCB 3UUBA 1CI6A 1JNRA 2YXQB 3EABA 3AE2A 5CMZA 3T97A 2BG9C 3GN5B 3Q2MA 2F4VT 2IUBA 2W67A 5AQQB 4YFSA 2OYOA 2C0WA 5JRCA 3RKOA 1NJIQ 1OEDB 1E5WA 3LJCA 4BA9A 5IHYA 4L0RA 4H0LB 1L0ND 3C8VA 2KS1A 5HCMA 1T2KC 1HTJF 3PUGA 3A5TA 4H44D 3TLSA 3I9WA 3RYHE 5FKYA 2MKVA 3A0BE 1LJ2A 4OX9T 2GK9A 2BASA 4ZOLE 2VWAA 2ZT9D 5LG3A 3H25A 2IBZE 1MMNA 1KEYA 5FVLA 4TV8E 1MNDA 4H0LC 4ZI2D 5KKZB 5B66H 3CLQA 4HWDA 1NTZG 2IBZD 4AIUA 3G71P 3RIUC 2WWUA 5AW7B 1KK7A 3EDUA 1LTSC 4GOUA 2HHHT 2PGDA 1JTHB 1P84D 5HWYA 3Q5SA 3ZDMA 3ZJ1A 1L0LK 2BS3A 3N7NA 1N73C 5EK4A 5LBQB 2CEAA 1Y8AA 2O01J 3CD6P 3HE4B 4AKIA 2BEQD 3H1JG 4RESB 1J1EC 5KDMC 5CCGA 4O4IE 4WB4A 5HXCA 2CPTA 3RYFE 4JI0T 4F8HA 3E0ZA 4HKAA 2ZT9B 1T72A 3RQUA 3AE2C 2WT7A 4KHZF 4DZOA 2X9YA 3JC6D 1W5CE 3PE0A 2LRKA 1XMQT 3C51A 1BE3E 2I0MA 3AE9C 3TLTA 3M65A 4FJOA 2QG4A 2W0GA 1KB9I 1K05A 3L75E 1MMDA 3CX6B 5JH7E 3P4PA 3Q5EA 2W00A 1MFZA 1QL1A 3V4QA 4KI0F 1L0LG 2WMMA 1KC8Q 4GK0E 1BCCG 2FXPA 3SS1A 4X65T 1L4AB 2KZ7B 2YEVC 1NKNA 3Q5DA 3CX5H 3SRZA 3HE5A 2UXDT 4I0UA 4IDQA 1NAYA 2XQAA 3R84B 1PPJE 2J58A 1XNRT 2M5AA 4LMLA 3VMYA 1J5ET 4EB6E 1NGMB 3P7KA 3V5BA 2BVLA 3GF3A 3ZMVB 1Z8UA 1ZLLA 2M0BA 1NTKD 2CXDA 3VOPA 2WSEJ 3B5NB 5F3JA 3VHLA 1SQQD 2WDVA 5L3DB 2FJEA 3AE6C 4AI6A 1WYCA 1PPJD 1GL2A 3BVHA 2VRSA 4NUVA 4EYYR 4DR2T 5CBNA 1WMKA 1HX1B 3AE4C 2KNCB 2CBIA 2L5GB 3TLUA 3FB2A 2E75B 3QK6A 4HEAA 3RGUA 2UXBT 3J9X1 3L4FA 1PGPA 3PUVF 4JUYA 3GG2A 5HAXA 4DR5T 2B89A 4EI2A 2ODVA 4M3LA 5CJ4A 1HFAA 2XSAA 3O4XE 2NTXA 3N2GE 5DQVA 5FL0A 3EFGA 1A02J 2OYHB 3AEAA 2QE7H 4WY4D 1I6ZA 1EDKA 2NTYA 2XAQB 2G3AA 1CW5A 4ZS2A 1S35A 3SSUA 1AV1A 2LM9A 3AE4A 4NPPA 4YTMA 2H89A 1FC2C 2EHOC 5FYMA 4HJGH 1QVFO 5HWXA 2IC9A 1VL2A 3TGUD 2YU1A 1YTZI 3C4XA 2K9AA 2SPZA 1P84H 1L0VA 5L4EA 2IC6A 3OJAB 3AEDA 3JSVC 4U2ZA 3VRBA 2R3CA 4B3ST 4BWNA 2YXRB 4I55E 1S5LH 4UB6E 3BCCG 1UCUA 4TWDA 2WMOA 2FJAA 3OYZA 3AEFC 3PH0A 3CCEP 5CA1E 5AQKB 3RRWA 2GUSA 3TDKA 2GUVA 3FWNA 3WUTA 3LSVA 4QKNA 2H89C 1WT6A 1HUCA 3H32B 3UQ4A 2Y48B 1VF5D 2XM1A 2BG9E 1SQPD 3O6QA 2YOEA 4LF5T 2OYIC 1RY3A 5FXXA 2WDQA 3RKGA 1LTAC 1N7LA 4RO0A 2NW8A 1NU1E 3WI3A 1OXZA 1BGYG 4U74A 2HODB 4O4JE 1EXIA 1GZLA 4DJGA 1XDPA 1MMGA 1AVYA 3BK9A 1OX3A 1UK5A 4HH2A 4HFBA 4A56A 4OGQD 2IIUA 2IYPA 1FZGA 4LF9T 2Z5IA 2JQ9A 1URQC 5KTBA 1JNMA 2E5YA 4HFVA 2IZ0A 1QLED 3ANWB 2A06E 1G2CB 3WAJA 1JY3O 1NVOA 3ZYLA 2YIUC 3B5ND 1VQOP 5LYJE 1HR0T 2NP9A 2VQET 2CPBA 1NEKA 2QSIA 1XMOT 4O4LE 1GW3A 3KVAA 1SVFA 2L8KA 2NPSC 4ZEYA 2K88A 1GU5A 2H7OA 3CMAP 4HWIB 2M6IA 1RHZB 1SQPG 1L2PA 2P10A 3MJXA 2XQ4A 2BEZF 2Z6EA 1AQ5A 2ZLYA 4IFMA 1L0NE 2OYHC 3H1IE 2NWBA 2CXFA 4ZI7E 5KX5E 4EDFA 2E74C 1EZVI 3L74D 3L73G 1SQVK 4H9PC 4EEBA 3NVOA 2B9BA 1ZOYC 4X1IE 4U3FG 1JCDA 2AEMA 1LVFA 4PJNA 1XDOA 3AA1B 3AEGC 5F8PA 3EFFK 2QM8A 2KP8A 1VQ5P 2NW7A 2LHRA 2Z5HA 1E79H 3CX7B 4LMKA 3RQWA 2ZM6T 1I94T 3L35A 4PV1D 1HNXT 3O6QB 4B6XA 1YXRA 1KILC 3P4RA 3RBXA 3BQIA 4EZHA 1OZHA 4W7YA 2WMNA 4EIJA 3FWLA 5E79E 3HKCE 3ZCIA 3OVUA 2E76D 3M0DA 1FU1A 5KLVJ 4JF7A 4IHJE 2DNXA 3UU4A 2VASA 3HTKB 3KHUA 2OARA 2H3RA 4PFPA 1YJ9P 2O3JA 1LT9B 4TN7B 3L72E 1G73A 5GTHE 2W90A 2A45H 2WZ7A 1K9MQ 1O3XA 4U7JA 2BCCG 2YKPA 3LW5H 1KD1Q 3VMAA 4GKKT 2ZXEB 1MNEA 2DI4A 3PV0F 2PJQA 1SQBE 3ANWA 1NTZK 3L74G 3M3ZB 3CCQP 1L0NJ 2LOPA 1Z0PA 3P7IA 3TGUG 2KLQA 3AVSA 3KINB 1SQVE 3H1HG 3AEBA 3PUZF 3VYIA 1KTMA 4GOFA 4TLFA 3SFEA 2K37A 3PLNA 5DJTB 2KWHA 1AVOA 2MTQA 4PJJA 1J1DB 1KV4A 1X8YA 1H0TB 2IX7C 4LC1A 3CC7P 3P8CD 3KV4A 4HFIA 1N36T 4B3TT 4UXNB 5CCHA 4YTPA 1K73Q 2ZYGA 3N5LA 4AISA 1SA0E 4D6TJ 3H6PA 3FZHB 4CQIA 1T7SA 1LTBC 1SFCA 5JR9A 3ONJA 5AW1B 3PP5A 2FBWA 4UV9B 1ZN5A 4OHFA 4BAYB 4WZXA 2V7JA 4OWFA 4N3YB 3PRJA 3P32A 3ABVA 1SQPK 2V7KA 5CCGD 3ZCJA 2AEJA 2IPPA 3W15B 2M8RA 2KWIB 3Q3DA 2CBJA 2XSBA 1XTCC 3BASA 2DL1A 3N2KE 3P4WA 1KN7A 2G8YA 3GW6A 3MUDA 1PV3A 3WU2H 5APVA 1DH3A 1JTHA 1KQSO 4LFCT 3T97B 3GN5A 4UEMA 4BJNA 2J59M 2UUCT 2ZYAA 3X1DA 2V8SV 3L70J 1Y9BA 1R8EA 3RRCA 1PP9G 1OIPA 4U33A 3F2EA 3PTZA 2IW5B 1EDIA 1VQ4P 2IHR1 4YJ2E 1OW6A 2XPKA 1LP1B 4ERRA 4WWIA 2N1GA 3ZEFB 1DEEG 1KB9H 1KNZA 1JM0A 1TU3F 1KILA 2V6YA 2H43A 2Q9QB 2XQ5A 5AW5B 2Y6XA 1KYOD 5APYA 4IE5A 2V7MA 4DBRA 3HD7C 1SQXE 3RC3A 4D6TD 3V5UA 2WDRA 2MJZA 2XHEB 1FJPA 2LKGA 5ETWA 3TNUA 2JJLA 2A72A 2XQ6A 4LFBT 4QHOA 4DT0A 3ZKRA 1VQ6P 2QJKB 1RH5B 2W2UA 3N9NA 5JR9B 1J1DC 1KORA 1OW8A 1PGOA 3ABVC 4LGDE 4WBAA 2HFED 1YIJP 1MIYA 5JDHA 1ZV4X 2JQKA 4ZKUA 3CWBD 2Y8DA 4JYCA 2XJ7A 5TJHA 1RE4A 5L3BB 2E74B 1LTJB 2GA1A 2WSSV 3HD7A 3VKGA 3NRXA 2C0XA 2YMYA 4K3AA 5L47A 2BS2A 3MD0A 3M91A 3ZT7A 1M7LA 4AQYT 5J2TE 3RGLA 4EYUA 4DNDA 5KKZC 1S5LE 1VOMA 3QNUA 1YITP 3PJSK 4EOTA 5AQSB 4MFRA 3MTUE 1S9KE 3HE5B 1PGJA 5LBMA 1IK7A 1USEA 1JY2O 4ZXLA 1RE4C 1R5SA 3E22E 2YKSA 4YHJA 2AEFA 4YTPC 4D6TE 4A5XA 1ZXGA 5HXEA 1T8ZA 4JI4T 1GW4A 5L4HA 5JREA 2JP3A 2FFDB 1QSDA 2VKDA 2E76C 4PK4A 3KQGA 1M8OB 5APUA 3AB3B 1HCIA 2Q9IA 5TISH 2OA5A 3CX5D 3RL0B 1V9DA 2KZIA 3PUAA 1BR0A 3RK3C 3L75J 3SFDA 4UB8E 1J2JB 2WP9A 4QWNB 5LG4A 1YJWP 3PTRB 5L3EB 4HB1A 3B13A 1BE3J 3CC4P 3FZMB 3LK3B 1RF0A 3T8OA 3ZSTA 3A5XA 1IJ6A 5DJQC 1AJYA 3P4SA 4U31A 3CPWO 4DV1T 2N1TC 3B5NA 2QRXA 4EV6A 3OPCA 3RYCE 4DR6T 4QXBB 4NIQA 2A06D 5AW0B 4OGQB 1IZNB 4KUMB 3SWHA 5AVQB 1RF1B 3EVYA 3CMEP 5HYAA 4JI2T 1PIXA 3H1LJ 2YU2A 2K9JB 2BCCD 3L72J 2L9QA 2J1DG 1FBMA 2N1TB 3H32A 4AQGA 4DMWA 3D0TA 2E5VA 3Q1MA 2QJKC 3JC22 5M1BA 3OBVE 1J1JA 2OYHA 4GYSA 1W09A 2YN6A 4UVAB 3D6ZA 2B1EA 3CL3D 1T8BA 3G06A 4F6RC 1X0TA 2LKMA 2UWJE 3H37A 1BGYD 4H13D 4MBQA 2IDOB 3L09A 2JPFA 2HODA 1X79B 2RKLA 3AEDC 2MYSA 3RL0g 2IAKA 1EQ7A 1N8RQ 3U1AA 2XAHB 1KNRA 4O2BE 3ZYKA 4DOJA 4O2AE 4UR9A 2N9YB 2MPKA 5FXWA 4JPZB 3KV6A 3O8ZA 1E7PA 1WCRA 3QWOC 2XZRA 3ZLIA 2CWOA 2V7QJ 3FXDA 1X79A 1X9BA 2K9YA 3GLMA 1MUUA 2Q3IA 2KK7A 3H1JD 3H1KG 1SQXD 3HKDE 5B66E 5LHIB 1HH0A 4KX6A 2RA1A 1ZR2A 1BGYE 4X64T 3R6NA 4IFFA 3M9HA 3RC8A 3A7MA 1YJNP 1S9KD 3ZMTB 2E42A 2KZJA 5FY1A 2ZJSE 1S94A 3AE3C 3HRNA 2EHOD 1M1JC 1ZMEC 5GTIH 3HD7D 4Z8XA 2LSYA 3RHWA 4H9NC 2D2SA 3A8YC 1BE3G 3AEEC 4AYCA 3AE6A 2AE9A 2JEEA 2PBIA 2A06G 1NU1J 3L75G 3M9QA 2WPSA 4WY4C 4AQRD 4PFOA 3AE8A 1FEWA 1GTWA 4WW0A 2XQYA 3A0BH 3WU2E 2BDEA 3RX6A 4IL6H 3EI0A 1L0LE 1OFCX 2UXCT 3V2NA 1G2CA 4W80A 3J7Yq 4X1KE 1U7MA 5AQLB 5FXVA 5CCHC 1L4AC 5AW8B 3CX5I 1DEBA 4TT3H 1SQPE 4DR4T 3VMXA 2JRKA 4TV9E 1IFPA 2IZ1A 3G6EP 4YXDC 5L3GB 3IN6A 4IL4A 1U57A 1ZW0A 3AEEA 3L39A 5BMVE 3AAAB 5ABFA 1PPJG 4IE0A 3RYIE 4GOEA 4X66T 2E2AA 5AW4B 5CJ5A 1NAFA 3RK2C 3L73E 5LA6E 4JLEA 2O1KA 4ZHQE 2X9WA 4ASKA 1RQUA 2H7VC 4EEDA 1SS1A 2CMRA 3ONXA 5K5GB 5CA0E 1QX8A 4NPDA 3NTNA 3AXJB 3CX5E 1Q82Q 2FUPA 2LJLA 2V6XA 4TWHA 3HTKA 4ISTA 1SLQA 3H1JJ 4PJLA 4YXDA 5AVRB 1IBLT 1N33T 1YYCA 4BXLA 1RE3C 5ABFB 1T6AA 3ZMZB 5JDGA 2WB5A 3E7KA 3L70G 2ZFCA 1YQ4C 2KUBA 3L36A 3NBXX 2VVNA 4H13B 2WWVA 5EZYE 4XAXB 1H0TA 5IYZE 2LRLA 3VRAA 4HFEA 3FGAD 1K8AQ 5C3JA 1M90Q 2M5AB 4PJMA 3CXHI 3N9PA 4PK6A 3JCFA 1URQA 1BDCA 4BJMA 1N2DC 1P84I 4EYYQ 4WVZA 3MIWA 3MK7C 2ITAA 4ILAA 2Y9YA 2M3EA 5H6QB 1XNQT 3AECA 1S72P 1JMMA 1RE3A 1XTGB 3L74E 4ZI3C 2LE8A 4Y99B 1ZV8A 3BCCD 3CXHH 1ZKEA 1ZEEA 3PHLA 2POHA 4UVCB 1DD3A 1HGZA 2WSCJ 2C5JA 1WFDA 4CN1A 2A45I 4ZI3D 3OW2O 4C7RA 4ISSA 4HFCA 1YD8G 3CXHE 2ZM0A 1FZCC 1P84E 1IFDA 3ITKA 3CMLA 2Y9ZA 2BKNA 1PP9J 2Q9QC 4DR3T 1LTGC 3I55P 3USSA 5LMNT 3BCCE 3Q5WA 4X5TA 2X67A 1Z56A 1VQ9P 4AKLA 1VF5B 4P0AA 3E1IA 1S5LX 3CCJP 4KHXA 1HJ0A 5AQTB 1KYOE 2Q6QA 2G0UA 2JMHA 1OVUA 2ZMAA 3OKQA 2FYNC 1YQ3C 4IDNA 3L71G 2I8DA 3R4YA 2OTJP 2HPCB 1W2BO 3O9XA 1D0XA 2OYIB 4I7ZB 2C9LY 4TX5A 1KILD 2R5DA 1FZCA 1UIXA 4PV1C 5DABA 4ZMDA 3VMZA 1FOSF 1FZEA 3EDVA 1DX7A 2IYOA 2E9XB 4YT0A 3CCLP 1EZ3A 3AVRA 3RK2D 4QH4A 1H7CA 3RH3A 4TNVA 4NUUA 2L91A 4DVDA 3QB5A 2OTKE 3LW5J 3FX0A 4TNWA 3VN0A 1UX4A 4PAGA 1HNWT 4AKHA 3NKZA 1HF8A 4CI2B 1FMVA 4ILUA 4LMJA 3H1ID 1T3JA 1NENA 3TNUB 1L4AD 5CCHD 2IDBA 1D1CA 3KBUA 3LBXB 3NMDA 1MIWA 5L2LA 1YBKA 1YTZT 5B5EE 5CFBA 4U3CA 2J62A 5LB7B 1QEXA 2JDIH 4QX7B 2E9XA 2OQQA 2Q9QA 1IJDB 2JIWA 5L3FB 1NHLA 1U4QA 2WSFH 3U1CA 5AQJB 2OGUA 4Z91A 2BBJA 4A97A 3N9QA 2E5LT 2ZYDA 4KJMA 2VQFT 3B4SA 1CHUA 2KS1B 2CHOA 5LNKA 4I7ZC 4NPEA 2HLOA 3JAFA 4IDPA 1JOCA 4IL6E 5H2FE 3AA7B 3UU3A 4MALA 4NXMT 5JDMA 1LT9C 4GKJT 1BE3D 2K24A 2E43A 4MLKA 2H8PD 2LSIA 1LWUA 1AFOA 5LHHB 1D0YA 5TAOA 1T3UA 5EK3A 2UUBT 4CI1B 2HPCA 2KNCA 1GMJA 1W2EA 2KI7B 5A1LA 3HUSA 5LMUT 3PDYA 1GL2D 1EZVD 1NTMD 1NTKG 4A98A 3A7OA 3CWBJ 2C5KT 5LGUB 4CN6A 1NTMJ 4U3FD 1GL2C 2W63A 2MAWA 2XDJA 1SQBD 2AXCA 4DV0T 1NWMX 3BATA 4KMCA 4L9IA 1LTJA 4U3FJ 2QJYC 1HS7A 4UB6H 3SWFA 4H9SE 5AW3B 1VPCA 4DR1T 1WR6A 4ZZCA 4B86A 2ZAEB 2MBGA 2FFDA 1GU4A 2JWAA 2XKMA 3TGUE 2RH0A 3S1KA 5LXTE 1SQVG 4DV5T 2W6JH 1UURA 1U7JA 3KYQA 3QB5K 1Q86Q 2E76B 4NPFX 1KYOI 2M67A 4XZCA 2FYUK 1ZR4A 3UFGA 2WVRA 2LSKA 3UTKA 5EK2A 3IAOA 2JJ9A 4A7PA 4Y28J 1J1EB 2D0TA 2J5UA 2O01N 3BRTB 1YHQP 2QIWA 3CCRP 2VKHA 3IBPA 5ABEA 1LTTC 2K1AA 4YHHT 3AAIA 3EAMA 3TLWA 3H1HD 2PAJA 2A3DA 2XQ8A 1NTKJ 5KAIE 2QEXP 3AE9A
chains in the Genus database with same CATH topology
3MTUE 4GKGA 1S9KE 2E8IA 3IHRA 3SOLA 1L0LK 3HE5B 3N7NA 5LBMA 3TSIA 5JRCB 1LWUB 1N73C 5EK4A 2WPRA 1FZFA 5LBQB 2CEAA 1JY2O 3UIAA 1VRBA 1RE4C 1M1JA 2QM7A 1IAPA 3HE4B 3VP8A 3E22E 4RESB 1LGHB 2C5IT 1J1EC 1RF0C 5CCGA 4O4IE 4WB4A 4YHJA 1NU1K 5HXCA 3RYFE 5KDMC 2NOXA 5HXEA 1T8ZA 3E0ZA 2HYNA 1GW4A 2YO3A 3A3YB 4HKAA 5JREA 5KMGP 2MOZA 2WT7A 2FFDB 4I1LA 2I1JA 3VTPC 1QSDA 2VKDA 4DZOA 2X9YA 3KV9A 3KQGA 4K0UA 4KP3C 4PK4A 5LGTB 3E08A 5APUA 3JC6D 2ACXA 3AB3B 2JMKA 1HCIA 2LSGA 2Q9IA 2OA5A 3PE0A 5FNVE 3RL0B 4XA4A 3TKLB 1V9DA 2VL8A 2W61A 3C51A 3PUAA 4U72A 1IK9A 3KFWX 3ZPOA 3RK3C 4OK0A 5LG4A 1SQBK 1J2JB 3K3NA 4QWNB 2WSEH 3M65A 3K3OA 2CXLA 4FJOA 4ADZA 1GK4A 3V2PA 2W0GA 3PTRB 1G1JA 5L3EB 1N73A 3CX6B 1MMDA 1H88A 3B13A 5JH7E 4I2LC 4IDZA 3AAEB 2CCQA 4PNIA 1RF1C 3CPZA 3BRVB 3LK3B 2W00A 2XTLA 1RF0A 3T8OA 1MFZA 1IJ6A 3A5XA 3PUQA 5AVZB 1QL1A 3V4QA 5DJQC 2KLVA 4AQFC 4GK0E 2V7IA 3SS1A 2N1TC 3B5NA 5AVUB 1L4AB 1HG2A 3LBXA 2YO2A 2KZ7B 2WM9A 4PW8A 4QX8B 2YEVC 2WPQA 3RYCE 1IFNA 4EOZB 3IR9A 5M4YA 1NKNA 1MMAA 3B57A 4QXBB 1N7SB 3DTOA 3SRZA 3HE5A 4CI3B 5AW0B 4OYKA 1IZNB 5E0OA 2YNYA 2Q9QD 2J58A 3A2AA 4KUMB 3GA8A 5AVQB 4L5GA 1RF1B 3R84B 2WTYA 2C0SA 3HE4A 3EVYA 3VMYA 5HYAA 3V2QA 1Y64B 1URQB 3U78A 1NH4A 2YU2A 3UUNA 4EB6E 2XU6A 5APWA 3P7KA 3V5BA 2BVLA 2W27A 1WYBA 2L9QA 4IGUA 3ZMVB 2J1DG 5CB4E 3FXDB 5JDFA 1ZLLA 3M0AA 1FBMA 2N1TB 3H32A 2GM4A 3S4UA 2R5BA 4AQGA 4C90A 4DMWA 3D0TA 1FAVA 2CXDA 3VOPA 3B5NB 3ZN0B 4WBOA 5F3JA 2YINA 3VHLA 3CQCB 2LT3A 3LK42 3OBVE 1YKEB 5L3DB 2OYHA 2KSJA 4GIWA 4GYSA 4AI6A 2CE7A 1WYCA 4W7ZA 5BU8B 1GL2A 3BVHA 2VRSA 2B1EA 2CWYA 3KVBA 3CL3D 3NZPA 4UVAB 4NUVA 4EYYR 4F6RC 1WRDA 2VKJA 2LKMA 4GT1A 4KBMB 1JUNA 2X68A 3H37A 3HI2A 4AXPA 1NTMK 3I5CA 2X0LB 4EAHA 1LKXA 3TK1A 1N7SD 4MBQA 3ZN1B 3L09A 2L5GB 4AKRB 3FB2A 3Q5XA 1SQQK 3QK6A 4EXTA 2JPFA 2HODA 1X79B 1JY3N 4HEAA 2XAGB 1IFJA 2K5BB 3J9X1 3L4FA 5AW2B 2MYSA 3C50A 2X66A 4JUYA 2IAKA 3DJBA 3V4WA 5HAXA 1LVKA 1GK6A 2ODVA 3ZYMA 1CI6B 4I43B 4M3LA 1EQ7A 5CJ4A 1HFAA 2DHRA 2NTXA 3O4XE 3U1AA 3N2GE 2XAHB 3I0OA 5DQVA 4CXYA 3EFGA 2Z4EA 1A02J 2OYHB 3ETUA 4O2BE 3ZYKA 2PP6A 4DOJA 4O2AE 4WY4D 2NTYA 1N73B 2XAQB 2K48A 4J2CA 4AQFA 3C98B 5FXWA 3VP9A 4WY4B 1CW5A 5AW6B 1SQXK 3KV6A 4ZI2C 3B5NC 4ZS2A 3O8ZA 1S35A 4EZHA 3AA6B 2LM9A 3VKHA 2LHNA 4JEHB 2XZRA 2CPSA 3ZLIA 4P0BA 5CHXA 4AKIA 2I1KA 2CWOA 1GDTA 2FYZA 3KDPB 1X79A 2CA5A 2EHOC 1LRZA 2P1JA 1FJKA 2WITA 5FYMA 1MUUA 1WLXA 2ZM8A 2Q3IA 3V5SA 5HWXA 2Q5UA 2IC9A 3HKDE 3I9YA 3LFMA 2YU1A 3AA0B 1NWQA 1YTZI 3C4XA 4OYJA 3UULA 5LHIB 1HH0A 4ZKPA 1IFIA 1US7B 4H9OC 2RA1A 1ZR2A 4UF0A 2K9AA 5JVDE 2BZBA 3MACA 2X9HA 3R6NA 4IFFA 3CKDA 1MZ9A 1JCCA 3OJAB 1GL2B 2HPLA 2IC6A 3M9HA 4M1PA 5AW9B 2BVMA 3RC8A 2R3CA 4I55E 1S9KD 1UCUA 3UUMA 3ZMTB 2E42A 3U3IA 2WMOA 1NTKK 3OYZA 1S94A 3HRNA 3HD7B 5FY1A 2EHOD 5FXZA 4EZ4A 1M1JC 3CQXC 3NZQA 5CA1E 3RRWA 3HD7D 5CCGC 3MZKB 2LSYA 2GUSA 4Z8XA 4H9NC 3C4WA 1WRGA 2D2SA 2GUVA 2W6AA 3ZC1A 4AYCA 4QKNA 1A02F 2NW9A 1WT6A 1HUCA 3H32B 2WAUA 3PURA 2EHOA 2JEEA 5L3BB 2PBIA 3M9BA 2Q7CA 5APTA 2Y48B 1H89A 5A1LA 3M9QA 5HXRA 2WPSA 4WY4C 4AQRD 2HPJA 3HA4A 4PFOA 1FEWA 1GTWA 2VKOA 4WW0A 4JEUB 2XQYA 2BDEA 2OYIC 3RX6A 1SP4A 4HTEA 3LIDA 1SHZC 3WAKA 4HN9A 1RY3A 3OJAA 5FXXA 2DWKA 3V2NA 1G2CA 4W80A 3HKBE 2XNXA 1OWAA 4X1KE 5FXVA 3J7Yq 1LTAC 1N7LA 2NW8A 1M1JB 3ZMSB 5CCHC 1AJ3A 1L4AC 1MV8A 5AVYB 5AW8B 1D1AA 1DEBA 2DCFA 2I59A 2QGSA 3VMXA 2JRKA 3WI3A 2UXXB 1OXZA 4TV9E 4U74A 2HODB 3RK2B 3OAKA 2N9BA 4O4JE 4DBRA 3UUXB 1GZLA 4OH8B 1N7SC 5L3GB 1MMGA 3BK9A 2WT7B 2P2UA 5BMVE 4A56A 4GIFA 4HH2A 2KXPB 3DP7A 1FZBA 3N9LA 4V1Av 2EHOB 3AAAB 3ZJ2A 4IE0A 3RYIE 1LTIC 5AW4B 2ES0A 2N2NA 1FZGA 1NAFA 5LJNA 3RK2C 3HR0A 2Z5IA 4JLEA 5LA6E 3N2OA 2O1KA 3L37A 1HJBA 2CLYB 1URQC 3Q2MA 5KTBA 4ZHQE 2X9WA 1JNMA 3EQ2A 3VU7H 4ASKA 2E9XC 2H7VC 2ZM2A 4HFVA 3MKDA 4X1YE 4CXWA 3HL6A 4IE6A 2CMRA 3GHGB 2L3LA 3N9OA 3ONXA 3IFMA 3ANWB 4G63A 5CA0E 4WY4A 5L3CB 1G2CB 3WAJA 4UF0B 1JY3O 2XASB 3NTNA 5FMNA 2LJLA 3ZYLA 3B5ND 5LYJE 3HTKA 1UX5A 1SLQA 2NP9A 3IEEA 4ISTA 3ZC0A 2CPBA 4G2AA 4PJLA 3LIEA 4O4LE 1GW3A 3KVAA 2X51A 3O1HA 1SVFA 2A2FX 5AVRB 2L8KA 2NPSC 5CJ0A 1YYCA 2V7LA 1RE3C 2WBLA 2YK0A 1L4AA 2IFNA 1GU5A 5J1GA 4XBFB 3MXZA 1FZCB 2H7OA 3TYYA 3ZMZB 3U59A 4OFZA 5JDGA 4WBNE 2ZFCA 2LSJA 3MJXA 2W62A 1N7SA 3L36A 3NBXX 2Z6EA 1AQ5A 2CM0A 4IFMA 2OYHC 2ZLYA 4XAXB 3RK3B 4IIJE 5EZYE 5IYZE 1KILB 2NWBA 2X9XA 2CXFA 2LOSA 4ZI7E 5KX5E 3GHGA 1H8AA 4CXXA 1T98A 3KV5A 4H63V 3ESLA 3N9PA 4PJMA 4GK5E 4PK6A 1BR0A 1URQA 3QUJA 4IE7A 1SQVK 1N2DC 4BJMA 4H9PC 2YKQA 1IO4A 3MIWA 3MK7C 4ZS3A 4X1IE 5KJ7C 3SWHA 3QC9A 5H6QB 1NO4A 1JCDA 1HWTC 1LVFA 1FOSE 1YW0A 3O1IA 1HX8A 3AA1B 4H63H 2OYIA 4PJNA 1JMMA 2QM8A 4YLHA 5F8PA 2KP8A 5APXA 2JQQA 3FBLA 4E7ZA 2NPSA 3G3ZA 1CUNA 1RE3A 1XTGB 1IC2A 1VDFA 3WMM0 2SPCA 3ETVA 2LE8A 2NW7A 4H9RC 4ZI3C 4Y99B 4XE5B 1ZV8A 2Z5HA 2LHRA 2XV5A 3CWZB 1JY3P 1ZKEA 1ZEEA 3CX7B 3L35A 5C8YE 2FXMA 2POHA 4PK5A 4UVCB 4B6XA 1KILC 3IF8B 1HGZA 1JY2P 1B7TA 3BQIA 2C5JA 4W7YA 5FY7A 4EIWA 2XAFB 2WMNA 3C4ZA 4EIJA 4IFDK 5LHGB 2A45I 3HKCE 4ZI3D 1HBWA 3GHGC 4C7RA 1SFCD 4HE8A 4ISSA 3M0DA 1FU1A 1YD8G 3MA9A 3ZCIA 4C91A 5LJMA 2ZM0A 4JF7A 1FZCC 4IHJE 5BU5A 2DNXA 3R2PA 2VASA 4O4HE 3HTKB 4QXCB 4WNKA 1IFDA 1HVVA 3CX8B 1G1IA 4UIGA 5KJ7D 2OARA 3CMLA 2D5UA 2V1DB 5LP6E 2Q9QC 2H3RA 1QL2A 4PFPA 5JDLA 2KYVA 3OYXA 1LT9B 4TN7B 1LTGC 3I0QA 1G73A 4ANJA 5AVWB 3Q5WA 2WZ7A 2A45H 1X9VA 2O1JA 1O3XA 1MIVA 2X67A 1Z56A 5APSA 5LGNB 2YKPA 3LW5H 4AKLA 1IJ5A 3UFEA 4DBQA 4E7SA 3E1IA 5J2UE 4P0AA 4H9QC 2N1TD 2ZXEB 2P67A 1MNEA 4KHXA 2DI4A 2PJQA 3ANWA 3FBZA 2G0UA 1NTZK 3UT5E 2JMHA 4FI5A 2NPSD 2LOPA 1Z0PA 3P7IA 2KLQA 2PFVA 2ZMAA 3AVSA 3OKQA 3KINB 3F31A 3KBTA 1HTLC 4P09A 1SFCC 2HPCB 3O9XA 1NKZB 3VYIA 2OYIB 1D0XA 4TZ4C 1JY2N 2W6BA 3II6A 5JR9C 1FZAA 2XAJB 3SWYA 4X20E 2C9LY 4TX5A 4MHCA 5AVTB 3NXSA 3RK3D 1U5PA 4CZZB 5HXSA 2WSCH 1KILD 2R5DA 1FZCA 5JDQA 5JDNA 3O1JA 3GMIA 2ODUA 5DABA 3V2RA 2KWHA 2DWGA 2CLYC 2E9XD 2MTQA 3JC6C 4PJJA 1J1DB 3VMZA 1FOSF 1FZEA 3M06A 5FY0A 1L0NK 1X8YA 3EDVA 1URQD 1DX7A 2IX7C 4LC1A 3HUSC 5KJ7A 3P8CD 1EZ3A 3MGNA 3RL0D 2E9XB 3RK2D 3AVRA 1H7CA 2KMFA 5H6RB 2A45G 2KOGA 4NUUA 1KFMA 2V26A 3RH3A 2VB6A 3KV4A 4DVDA 5FP3A 1D1BA 3GWHA 3B8EB 5BVZA 2XUEA 4UXNB 5CCHA 3VN0A 1UX4A 4PAGA 3BQLA 5AFUL 2HH7A 4AKHA 1CSBA 1HF8A 1KZUB 4CI2B 4O8SA 3N5LA 1FMVA 4ILUA 1SA0E 1T3JA 3KDSE 2RP4A 3TNUB 1L4AD 2NPSB 5CCHD 3C9IA 3H6PA 1D1CA 3L3PA 1KFNA 4C46A 4CQIA 3KBUA 3W15B 3LBXB 1FIOA 3NMDA 1QUUA 2KNDA 1LTBC 4LLHA 1MIWA 3BQKA 1SFCA 5L2LA 1YTZT 5JR9A 3CI9A 5AVXB 5AW1B 3PP5A 4QX7B 3Q9DA 4UV9B 3N4XA 2E9XA 1ZN5A 5AVSB 2FKWB 2M3BA 5KLVK 1YKHB 1IJDB 2Q9QA 4GYRA 1D0ZA 4OHFA 4BAYB 1LWUC 1NHLA 1U4QA 2WSFH 2N9DA 2V7JA 5L3FB 4DO0A 4N3YB 1GD2E 2YKOA 4DMVA 3U1CA 1RF1A 3P32A 1SQPK 2D0UA 2PG8A 3I1AA 2V7KA 2R32A 4TUYE 3N9QA 5CCGD 4N6JA 3ZCJA 1N86A 2HG5D 2IPPA 3P8CE 4O9BA 2M8RA 3HUSB 2KWIB 3H3AA 4HGAA 2H7HA 5LNKA 2N1TA 3HKEE 1XTCC 3BASA 3N2KE 5ADXL 2HLOA 3K3QC 1BR1A 4Y99C 3MUDA 1BR2A 2QA7A 5APVA 4C7NB 2UXNB 1JOCA 1HGVA 3AA7B 2C9NY 2P9BA 3EUHA 3LK2B 1DH3A 4MALA 1JTHA 5JDMA 1LT9C 3GN5A 4UEMA 2K24A 1T2KD 4BJNA 1IFMA 5JQGE 2J59M 2E43A 4MLKA 5LOVE 5APQA 1BR4A 1KQLA 2H8PD 2LSIA 1LWUA 1LTJC 3OA7A 4N78D 3NFQA 1AFOA 1HG5A 1G8XA 3RRCA 1D0YA 5TAOA 5LHHB 1T3UA 5EK3A 4HYTB 3F2EA 3RPUA 4CI1B 2IW5B 2HPCA 4YJ2E 5HXHA 1FDMA 3F57A 1W2EA 4I4TE 3HUSA 1FMWA 4N78E 3PDYA 5DQWA 3FXEB 4ERRA 1GL2D 2N1GA 4IE4A 1E1HB 1JO5A 3N9MA 3ZEFB 1KNZA 4JYBA 3A7OA 3PUSA 1SFCB 2C5KT 5LGUB 1CI6A 5AVVB 2VK9A 1NOHA 5CMZA 3T97A 2Y6XA 1KILA 1GL2C 2H43A 2Q9QB 2W63A 5AW5B 2XDJA 3GN5B 3PU3A 3ZMUB 5APYA 4UV8B 4YFSA 2C0WA 1NWMX 3BATA 3RKOA 4KMCA 5JRCA 3PU8A 2WWWA 2V7MA 4IE5A 1LTJA 4L9IA 1E5WA 2IFMA 3M0DC 3HD7C 1CZQA 4H9SE 3SWFA 1HS7A 5AW3B 1VPCA 1ZHCA 1PFIA 3LJCA 1WR6A 3RC3A 4BA9A 5IHYA 3V5UA 2KT9A 2LEHA 4L0RA 4B86A 2MJZA 2XHEB 3C64A 1FJPA 2MBGA 5ETWA 4YJ3E 3TNUA 2JJLA 2A72A 2KINB 4QHOA 2O01H 2FFDA 1T2KC 5GONE 1GU4A 1HTJF 2XKMA 3PUGA 3A5TA 3RL0C 3I9WA 5LXTE 4AUWA 3N9NA 3FHNA 3RYHE 5JR9B 1J1DC 4I6MC 4LGDE 4WBAA 3P8MC 4UVBB 3K8PC 3KYQA 2HFED 1MIYA 5JDHA 1ZV4X 4ZKUA 3LG7A 2GK9A 2BASA 2Y8DA 4JYCA 5LCYA 4ZOLE 2M67A 2VWAA 3CQGB 4XZCA 2FYUK 1ZR4A 1RE4A 3CVRA 3UTKA 1MMNA 1LTJB 2LSKA 2WSSV 5EK2A 3HD7A 2JJ9A 4TV8E 3VKGA 1MNDA 2KB7P 2DLRA 3NRXA 4ZI2D 4AKGA 3CLQA 1J1EB 2C0XA 2D0TA 2YMYA 3BRTB 1LT9A 2VKHA 3IBPA 4QXHB 3MD0A 1LTTC 4I50E 3M91A 4UELA 1M7LA 2FFDC 5J2TE 2WWUA 5AW7B 1KK7A 4EYUA 3EDUA 1LTSC 4C7NA 4GOUA 4DNDA 3NRYA 1VOMA 3AAIA 1JTHB 3KPEA 5HWYA 2A3DA 2PAJA 4EOTA 4MFRA 3ZJ1A 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4X A;  4ZKU A;  5BU8 B;  3N7N A;  3BAT A;  4N78 D;  3VP9 A;  4N3Y B;  5BVZ A;  3HRN A;  3U1C A;  3VP8 A;  5BU5 A;  1X79 B;  4O9B A;  1WT6 A;  4GIF A;  4I1L A;  3C9I A;  2JEE A;  3BAS A;  1IC2 A;  3U59 A;  4ZKP A;  1NKN A;  2FXM A;  2POH A;  3U1A A;  5KTB A;  3OJA B;  3P8C D; 
#chains in the Genus database with same CATH topology
 4LF6 T;  2E8I A;  4ILC A;  5JRC B;  2D9D A;  1LWU B;  2WPR A;  3H1H J;  5KAF H;  3AEF A;  2QM7 A;  1M1J A;  3NWI A;  1IAP A;  3VP8 A;  1LGH B;  2C5I T;  1ZP0 C;  2NOX A;  2YO3 A;  2UUA T;  3GF7 A;  4DV4 T;  3KV9 A;  2LKH A;  4YTN A;  3E08 A;  3PJA A;  5KLI B;  2D2C D;  2JMK A;  4CPG A;  5FNV E;  4XA4 A;  2VL8 A;  2RN0 A;  3ZPO A;  4OK0 A;  3D70 A;  1Q7Y Q;  3K3N A;  3K3O A;  1KIL E;  3V2P A;  2FYU E;  1H88 A;  1M56 D;  3FZK B;  3CPZ A;  3BRV B;  3A0H E;  1YI2 P;  5HEU A;  3PUQ A;  3JAE A;  2Y0C A;  2V7I A;  2R3S A;  5AVU B;  4QX8 B;  1HG2 A;  2YO2 A;  1IFN A;  3IR9 A;  4Q25 A;  3D71 A;  2PRR A;  1MMA A;  3B57 A;  1N7S B;  3DTO A;  4ILB A;  4CI3 B;  5E0O A;  2Q9Q D;  5C8Y E;  3A2A A;  3GA8 A;  2V5C A;  2C0S A;  3V2Q A;  4DV7 T;  3U78 A;  1BDD A;  5APW A;  2W27 A;  4IGU A;  5CB4 E;  3FXD B;  2YDR A;  2XM2 A;  4C90 A;  3S4U A;  2R5B A;  1SQQ J;  3AE3 A;  1FAV A;  3ZN0 B;  1SQX G;  4ASV A;  1NYH A;  2YIN A;  1VCS A;  2LT3 A;  3LK4 2;  5HEO A;  3S9O A;  1YKE B;  2KSJ A;  4GIW A;  1M1K Q;  2QVA A;  4COF A;  3KVB A;  3NZP A;  1KFY A;  1SQP J;  1WRD A;  4KBM B;  5IWA T;  1KMI Z;  1NTM K;  3I5C A;  5AQM B;  4EAH A;  3RIF A;  1N7S D;  3Q5X A;  1SQQ K;  5JTG A;  1LT1 A;  1FE6 A;  2XAG B;  3S4R A;  5AW2 B;  2X66 A;  3H1L D;  4LF8 T;  3G4S P;  3V4W A;  5H2F H;  1LVK A;  1GK6 A;  2B87 B;  1CI6 B;  4UF0 B;  4CXY A;  5AQO B;  4IT4 A;  2PP6 A;  2PFX A;  4Z1M H;  2B88 A;  4JYA T;  4AQF A;  1N73 B;  2K48 A;  3C98 B;  4WY4 B;  2AXT H;  1SQX K;  4ZI2 C;  1DU2 A;  4H0L D;  3AA6 B;  3JCU H;  2LHN A;  4JEH B;  3AE5 C;  4P0B A;  2I1K A;  3TGU J;  2ZT9 C;  3KDP B;  2CA5 A;  1BGY J;  1LRZ A;  2KSE A;  3KXD A;  1FJK A;  2P1J A;  2ZM8 A;  3V5S A;  3K5B A;  3IA3 A;  2Q5U A;  3I9Y A;  3UUL A;  5KLI C;  1NWQ A;  1WR0 A;  5AQR B;  1IFI A;  2ZVO B;  3CCV P;  1US7 B;  4H9O C;  4UF0 A;  3UU6 A;  2BZB A;  2JO1 A;  3MAC A;  5AQF B;  3CKD A;  1GL2 B;  2HPL A;  4M1P A;  5AW9 B;  2BVM A;  2LLY A;  2Y0E A;  3UUM A;  3U3I A;  3P50 A;  1NTK K;  1PP9 D;  5KXJ A;  4UB8 H;  5AQH B;  1NTM E;  2Y0D A;  3NZQ A;  5IUX A;  5CCG C;  1WRG A;  3CWB E;  3WUU A;  5KLV G;  1A02 F;  2NW9 A;  2ZXX A;  3PUR A;  2EHO A;  4P1N A;  3EWK A;  3M9B A;  5APT A;  1H89 A;  5HXR A;  5KAI H;  2NRG A;  2HPJ A;  3HA4 A;  4JEU B;  4LFA T;  1R5L A;  1SHZ C;  5HEJ A;  1N34 T;  4HN9 A;  2E75 D;  4PD4 H;  2DWK A;  2XNX A;  1OWA A;  2WQY A;  3ZMS B;  1AJ3 A;  4PV1 B;  1MV8 A;  1D1A A;  4WYV A;  1EZV G;  2QGS A;  1Q81 Q;  3RK2 B;  5BR8 T;  2FJD A;  2WS3 A;  3UUX B;  1S2E A;  2WT7 B;  3RI5 A;  2KXP B;  4GIF A;  4QH5 A;  3DP7 A;  2EHO B;  2BCC J;  3L72 D;  2ES0 A;  2XND H;  2VL0 A;  4JI6 T;  3N2O A;  3L37 A;  2CLY B;  4RKU J;  3EQ2 A;  2ZM2 A;  3MKD A;  1VQP P;  4X1Y E;  4L76 A;  3H1L E;  4G63 A;  4DV2 T;  4WY4 A;  3JCU E;  1JNZ A;  3L71 D;  4Z90 A;  3T1Y T;  3ZC0 A;  4JI8 T;  2X51 A;  2WQY C;  2V7L A;  5CJ0 A;  1LP1 A;  1L4A A;  3CXH D;  1FZC B;  2XQ9 A;  3TYY A;  3U59 A;  4OFZ A;  3AE1 C;  3CK6 A;  4WBN E;  2W62 A;  3RF1 A;  2CM0 A;  2BKP A;  3ZSS A;  1KQG B;  1KIL B;  4R4L A;  2V6Y B;  4RJT A;  2X9X A;  1H8A A;  4DID B;  1T98 A;  4H63 V;  2HN1 A;  3QUJ A;  4H13 C;  2K9J A;  2YKQ A;  4YSZ A;  3AE8 C;  3QC9 A;  5JDF A;  1FOS E;  4YLH A;  5APX A;  3FBL A;  4E7Z A;  1VDF A;  2SPC A;  3RBZ A;  4K35 A;  3CWZ B;  4AKG A;  2LM2 A;  3AE1 A;  4L74 A;  2FXM A;  4PK5 A;  1BCC J;  3L71 E;  5C39 A;  3IF8 B;  3H1K J;  1JY2 P;  2YDQ A;  3H3M A;  3C4Z A;  1HBW A;  3UQ7 A;  2BKO A;  3H1K E;  2LXB A;  4C91 A;  3MA9 A;  4B3M T;  5LJM A;  4QXC B;  4WNK A;  5BU5 A;  3R2P A;  4U7I A;  1HVV A;  3CX8 B;  1G1I A;  5LP6 E;  4YPC A;  2D5U A;  4NXN T;  3W67 A;  5AVW B;  4DUZ T;  5L8R J;  2QA4 P;  2W66 A;  1X9V A;  1MIV A;  3UFE A;  4E7S A;  1W0B A;  2N1T D;  2P67 A;  4IOI H;  2CRB A;  3PUW F;  2WU2 A;  5AQN B;  2NPS D;  2I6H A;  1UGO A;  3F31 A;  3KBT A;  3ONL C;  1IBK T;  2ACZ A;  4P09 A;  1SFC C;  1JY2 N;  2W6B A;  1FZA A;  4X20 E;  5KAF E;  4MHC A;  3NXS A;  3RK3 D;  2B76 A;  5HXS A;  2WSC H;  1NTZ D;  2IBZ G;  2WPV B;  5HEH A;  3O1J A;  5DJU B;  2ODU A;  3GMI A;  3V2R A;  2DWG A;  2CLY C;  3JAD A;  5JR9 C;  2M6B A;  1SQQ G;  1W9R A;  3M06 A;  1NTZ J;  1URQ D;  5L3C B;  3HI2 A;  5KJ7 A;  3MGN A;  3RL0 D;  1M62 A;  2KOG A;  4XBF B;  1KFM A;  4OGQ C;  2VUR A;  3QOF A;  3B8E B;  2W83 C;  4HWH A;  1M57 D;  5AFU L;  2HH7 A;  1CSB A;  4QH1 A;  2BG9 A;  1KZU B;  4O8S A;  3AE7 C;  1EXJ A;  2NPS B;  2IBZ I;  1S4X A;  4C46 A;  3L3P A;  1SE7 A;  1FIO A;  1QUU A;  3H1J E;  5AQP B;  3N4X A;  5AVS B;  1VQK P;  2M3B A;  2FYU D;  1YKH B;  1D0Z A;  4TWF A;  1MFT A;  4DO0 A;  2YKO A;  1RF1 A;  4HFH A;  3CCS P;  3L70 E;  2D0U A;  2PG8 A;  4TUY E;  2BG9 B;  3SOL A;  4O9B A;  3P8C E;  3HUS B;  4HGA A;  1M7K A;  3H3A A;  3PJA J;  4JV5 T;  3KZI E;  3K3Q C;  1BR2 A;  2QA7 A;  1VQM P;  4C7N B;  1DIP A;  1HGV A;  4JI1 T;  3LK2 B;  1OMI A;  4R4M A;  4HKZ H;  5LOV E;  1KQL A;  1N32 T;  4N78 D;  1LTJ C;  1L0L J;  3AXJ A;  2R44 A;  4HWC A;  1AA0 A;  3KZI H;  3CIR A;  3FZF B;  4ZZB A;  3F57 A;  1FMW A;  4IE4 A;  4JI5 T;  4KT0 J;  1JO5 A;  1XWM A;  4JQ0 D;  4JYB A;  3K1S A;  3MUD C;  3TF5 A;  1PZQ A;  5AVV B;  2VK9 A;  1NOH A;  3PU3 A;  2FXO A;  4L73 A;  3ZMU B;  1EC5 A;  1JMB A;  1VCT A;  4MN4 C;  4UV8 B;  1VQL P;  3SWK A;  3PU8 A;  2WWW A;  4EXT A;  2YMK A;  2IFM A;  3M0D C;  1CZQ A;  3LDQ B;  1ZHC A;  1QVG O;  1PFI A;  3OTO T;  2YIU B;  1Y47 A;  2KT9 A;  2LEH A;  2OV9 A;  3C64 A;  2V5D A;  4YJ3 E;  2FBW C;  2JWD A;  2KIN B;  2O01 H;  4BRY B;  5GON E;  1J5W A;  4ZNC A;  2VVS A;  3RL0 C;  4AUW A;  1SQV D;  3FHN A;  5AQI B;  4I6M C;  3P8M C;  4UVB B;  3K8P C;  3T1H T;  1HF9 A;  3LG7 A;  5LCY A;  1SQV J;  3CQG B;  3CVR A;  2KB7 P;  3AE5 A;  1SQB J;  2DLR A;  5AQV B;  3AEB C;  1LT9 A;  4QXH B;  1Y01 A;  2H88 C;  2CHN A;  3FXE A;  4I50 E;  4UEL A;  3L73 D;  2FFD C;  2FYU G;  4OVN F;  4C7N A;  2FY8 A;  3NRY A;  3L70 D;  3KPE A;  1EDL A;  3SFD C;  1HWT C;  2P7J A;  4GKG A;  3IHR A;  2PTF A;  3TSI A;  1UUS A;  1FZF A;  3UIA A;  1VRB A;  4DV3 T;  2KLU A;  1RF0 C;  3CCU P;  1NU1 K;  2XY8 B;  5TIS E;  1MKM A;  2HYN A;  2K3R A;  3A3Y B;  5AQU B;  5KMG P;  2X0H A;  2MOZ A;  4I1L A;  2I1J A;  3VTP C;  4KP3 C;  2IML A;  4K0U A;  3UU5 A;  5LGT B;  3F89 A;  3L75 D;  2ACX A;  2LSG A;  3TKL B;  2QYW A;  1Q2N A;  2W61 A;  4U72 A;  1IK9 A;  4PJ0 H;  3MHV A;  3KFW X;  1SQB K;  4ADZ A;  2WSE H;  1NTZ E;  2CXL A;  1GK4 A;  1OED A;  1G1J A;  2JKV A;  1N73 A;  2J47 A;  4I2L C;  4IDZ A;  3AAE B;  2CCQ A;  4PNI A;  1RF1 C;  2XTL A;  4JI7 T;  4H44 B;  5AVZ B;  1W0A A;  2KLV A;  4AQF C;  1KF6 A;  1VQ7 P;  4PJ0 E;  3LBX A;  2WM9 A;  4PW8 A;  4U7Y A;  2HR3 A;  2WPQ A;  5M4Y A;  4EOZ B;  5HEG A;  3F5H A;  3VR9 A;  4QMA A;  4DR7 T;  4OYK A;  1K04 A;  2YNY A;  3ZN1 B;  4GOD A;  4L5G A;  2WTY A;  3HE4 A;  1NTK E;  3EHZ A;  1Y64 B;  1URQ B;  1ZRT D;  1NH4 A;  3Q5R A;  3UUN A;  5HCJ A;  1OW7 A;  2XU6 A;  2JR8 A;  1WYB A;  3M0A A;  1QGK B;  2GM4 A;  1LNQ A;  2B87 A;  1XZY A;  4PD4 D;  4WBO A;  3CQC B;  3TLV A;  1ZP0 A;  4DCK A;  2CE7 A;  5CGM A;  4W7Z A;  5BU8 B;  2CWY A;  1BCC E;  3L71 J;  2VKJ A;  5CBO A;  4GT1 A;  4AXP A;  1JUN A;  4PD4 E;  2X68 A;  2X0L B;  1LKX A;  3TK1 A;  1DD4 A;  2FYN B;  2E74 D;  4AKR B;  3AEC C;  1JY3 N;  1L0N G;  1Q90 D;  1IFJ A;  2V4H A;  3H1I G;  2K5B B;  2OLT A;  3C50 A;  4HFD A;  4EGW A;  3DJB A;  3MZW B;  4DV6 T;  2E75 C;  1NTM G;  3ZYM A;  4I43 B;  2DHR A;  3B5M A;  1VQ8 P;  3I0O A;  2Z4E A;  4U3F E;  3CWB G;  2AXD S;  3ETU A;  1AQT A;  5EFW B;  3RK3 E;  4J2C A;  1JEK A;  5FVK A;  3VP9 A;  1USD A;  5AW6 B;  3B5N C;  5J0Z A;  3VKH A;  3Q2Y A;  2CPS A;  5CHX A;  1GDT A;  2FYZ A;  2WIT A;  1WLX A;  1BCC D;  3UT5 E;  3LFM A;  3RIU A;  3V6I A;  3AA0 B;  4OYJ A;  1EZV E;  4ZKP A;  5JVD E;  1FJG T;  5F5W A;  2X9H A;  1SQX J;  1MZ9 A;  1JCC A;  2DW3 A;  2UU9 T;  5ABH A;  5FL1 A;  2JQH A;  5FXZ A;  3HD7 B;  2XQ3 A;  3ZT6 A;  4EZ4 A;  1YQ4 A;  1FS0 E;  2BCC E;  3QH9 A;  3CQX C;  3MZK B;  4ASW A;  3C4W A;  3ZC1 A;  2W6A A;  3FZL B;  2WAU A;  1SQB G;  2XQ7 A;  3SFE C;  2Q7C A;  1FDI A;  4K0K T;  4L75 A;  2AXT E;  1ZOY A;  2VKO A;  1ZRT E;  1VF5 C;  4XFJ A;  1NU1 D;  1UII A;  3AEG A;  2KIK A;  1SP4 A;  4HTE A;  3LID A;  3WAK A;  2WU5 A;  3OJA A;  2HN2 A;  2QJP C;  3HKB E;  1M1J B;  5AVY B;  2DCF A;  2I59 A;  4LF7 T;  2LR2 A;  2UXX B;  3OAK A;  2N9B A;  4OH8 B;  1N7S C;  2P2U A;  3AEA C;  4V1A v;  1FZB A;  2W4X A;  3N9L A;  3ZJ2 A;  1LTI C;  2N2N A;  5LJN A;  1PGQ A;  1SUM B;  3HR0 A;  1HJB A;  3VU7 H;  2E9X C;  1GQE A;  4CXW A;  3HL6 A;  4IE6 A;  2L3L A;  3GHG B;  3N9O A;  4JBW F;  4LF4 T;  3IFM A;  2QJY B;  2XAS B;  2X0Y A;  5FMN A;  1UX5 A;  3IEE A;  1VQN P;  4G2A A;  3LIE A;  3O1H A;  2A2F X;  2WBL A;  3UU8 A;  2YK0 A;  2WSF J;  2IFN A;  5J1G A;  3MXZ A;  2YDS A;  4B3R T;  1NU1 G;  2CK3 H;  2LSJ A;  1N7S A;  1QLB A;  1OED E;  5KLV D;  3RK3 B;  4IIJ E;  4IRE A;  2LOS A;  2WZH A;  3GHG A;  2D2C B;  4CXX A;  2QJP B;  3KV5 A;  4PD4 I;  3ESL A;  5AQG B;  4GK5 E;  2E5T A;  4IE7 A;  1IO4 A;  1PL5 A;  2WSS H;  4ZS3 A;  2W8Z A;  5KJ7 C;  1NO4 A;  1YW0 A;  3O1I A;  1HX8 A;  1JB0 J;  4H63 H;  3BCC J;  2OYI A;  2JQQ A;  2NPS A;  3G3Z A;  1CUN A;  3ETV A;  1IC2 A;  4X62 T;  3WMM 0;  4H9R C;  1PP9 E;  4XE5 B;  2XV5 A;  1JY3 P;  3B71 A;  1S1C X;  1YQ3 A;  1KQF B;  1B7T A;  5FY7 A;  5B5E H;  4EIW A;  2D2C C;  2NR4 A;  2XAF B;  4IFD K;  4YSX A;  5LHG B;  2R6G F;  3GHG C;  1SFC D;  4HE8 A;  3IF4 A;  2Q1K A;  2V7Q H;  4IL6 X;  4O4H E;  1SQQ E;  4UIG A;  5KJ7 D;  2V1D B;  1BSN A;  1QL2 A;  5JDL A;  3L74 J;  2KYV A;  3OYX A;  4ANJ A;  3I0Q A;  2K3W A;  2O1J A;  5GTI E;  1D7M A;  4HWF A;  5APS A;  5LGN B;  2Q3E A;  3C1L A;  3L8R A;  1IJ5 A;  4DBQ A;  5J2U E;  4H9Q C;  5KLV E;  4DUY T;  3G9R A;  3FBZ A;  3W68 A;  3PUX F;  4YY3 T;  4FI5 A;  2BBH A;  2PFV A;  1OVV A;  1HTL C;  3AE7 A;  1NKZ B;  4TZ4 C;  3VR8 A;  4JI3 T;  3II6 A;  2XAJ B;  3SWY A;  4CZZ B;  5AVT B;  1U5P A;  5JDQ A;  2BS4 A;  5JDN A;  3CC2 P;  3RLF F;  1BSH A;  1KYO H;  2FYU J;  5C2T A;  2WCA A;  4YSY A;  2E9X D;  3JC6 C;  5FY0 A;  1L0N K;  3HUS C;  1HNZ T;  2KMF A;  3L72 G;  5H6R B;  2A45 G;  2V26 A;  2VB6 A;  4YXW H;  5FP3 A;  1D1B A;  1OVR A;  4GDO A;  3GWH A;  5BVZ A;  2A9U A;  2XUE A;  3H1I J;  2KSR A;  2WY2 A;  3BQL A;  2RPA A;  3L73 J;  3MP7 B;  3P4Q A;  2WZI A;  3PUY F;  3WUV A;  3KDS E;  1IBM T;  2RP4 A;  3H1L G;  3C9I A;  1KFN A;  2RMZ A;  2ZVN B;  2KND A;  4LLH A;  3BQK A;  3H1H E;  4D6T G;  3CI9 A;  5AVX B;  1L0L D;  3ZT5 A;  3Q9D A;  2FKW B;  3D6Y A;  5KLV K;  1OED C;  4GYR A;  1LWU C;  1KNP A;  2N9D A;  1KB9 E;  1GD2 E;  4DMV A;  3I1A A;  2R32 A;  4N6J A;  1N86 A;  2HG5 D;  3GMA A;  2OTL P;  4JBZ A;  1R8I A;  2H7H A;  3CCM P;  2N1T A;  3HKE E;  2NZ2 A;  5ADX L;  4BRY A;  1BR1 A;  4Y99 C;  5GTH H;  2UXN B;  3EUH A;  4U2Y A;  4KHP T;  2C9N Y;  2P9B A;  4H44 C;  5ABG A;  3A0H H;  2H88 A;  5JQG E;  1T2K D;  1IFM A;  1KB9 D;  3E1R A;  5APQ A;  1EDJ A;  1BR4 A;  1E2A A;  2LXC B;  3OA7 A;  1HG5 A;  3NFQ A;  1G8X A;  3Q5P A;  3H1K D;  4HYT B;  5E79 H;  1FDO A;  2J4G A;  1S3J A;  3RPU A;  2P58 A;  3I56 P;  4IL9 A;  1FDM A;  5HXH A;  1X22 A;  4I4T E;  4N78 E;  2XZE A;  5DQW A;  3FXE B;  4CN4 A;  1E1H B;  3RIA A;  3N9M A;  1RQV A;  2FJB A;  4IDO A;  3PUS A;  1SFC B;  3UUB A;  1CI6 A;  1JNR A;  2YXQ B;  3EAB A;  3AE2 A;  5CMZ A;  3T97 A;  2BG9 C;  3GN5 B;  3Q2M A;  2F4V T;  2IUB A;  2W67 A;  5AQQ B;  4YFS A;  2OYO A;  2C0W A;  5JRC A;  3RKO A;  1NJI Q;  1OED B;  1E5W A;  3LJC A;  4BA9 A;  5IHY A;  4L0R A;  4H0L B;  1L0N D;  3C8V A;  2KS1 A;  5HCM A;  1T2K C;  1HTJ F;  3PUG A;  3A5T A;  4H44 D;  3TLS A;  3I9W A;  3RYH E;  5FKY A;  2MKV A;  3A0B E;  1LJ2 A;  4OX9 T;  2GK9 A;  2BAS A;  4ZOL E;  2VWA A;  2ZT9 D;  5LG3 A;  3H25 A;  2IBZ E;  1MMN A;  1KEY A;  5FVL A;  4TV8 E;  1MND A;  4H0L C;  4ZI2 D;  5KKZ B;  5B66 H;  3CLQ A;  4HWD A;  1NTZ G;  2IBZ D;  4AIU A;  3G71 P;  3RIU C;  2WWU A;  5AW7 B;  1KK7 A;  3EDU A;  1LTS C;  4GOU A;  2HHH T;  2PGD A;  1JTH B;  1P84 D;  5HWY A;  3Q5S A;  3ZDM A;  3ZJ1 A;  1L0L K;  2BS3 A;  3N7N A;  1N73 C;  5EK4 A;  5LBQ B;  2CEA A;  1Y8A A;  2O01 J;  3CD6 P;  3HE4 B;  4AKI A;  2BEQ D;  3H1J G;  4RES B;  1J1E C;  5KDM C;  5CCG A;  4O4I E;  4WB4 A;  5HXC A;  2CPT A;  3RYF E;  4JI0 T;  4F8H A;  3E0Z A;  4HKA A;  2ZT9 B;  1T72 A;  3RQU A;  3AE2 C;  2WT7 A;  4KHZ F;  4DZO A;  2X9Y A;  3JC6 D;  1W5C E;  3PE0 A;  2LRK A;  1XMQ T;  3C51 A;  1BE3 E;  2I0M A;  3AE9 C;  3TLT A;  3M65 A;  4FJO A;  2QG4 A;  2W0G A;  1KB9 I;  1K05 A;  3L75 E;  1MMD A;  3CX6 B;  5JH7 E;  3P4P A;  3Q5E A;  2W00 A;  1MFZ A;  1QL1 A;  3V4Q A;  4KI0 F;  1L0L G;  2WMM A;  1KC8 Q;  4GK0 E;  1BCC G;  2FXP A;  3SS1 A;  4X65 T;  1L4A B;  2KZ7 B;  2YEV C;  1NKN A;  3Q5D A;  3CX5 H;  3SRZ A;  3HE5 A;  2UXD T;  4I0U A;  4IDQ A;  1NAY A;  2XQA A;  3R84 B;  1PPJ E;  2J58 A;  1XNR T;  2M5A A;  4LML A;  3VMY A;  1J5E T;  4EB6 E;  1NGM B;  3P7K A;  3V5B A;  2BVL A;  3GF3 A;  3ZMV B;  1Z8U A;  1ZLL A;  2M0B A;  1NTK D;  2CXD A;  3VOP A;  2WSE J;  3B5N B;  5F3J A;  3VHL A;  1SQQ D;  2WDV A;  5L3D B;  2FJE A;  3AE6 C;  4AI6 A;  1WYC A;  1PPJ D;  1GL2 A;  3BVH A;  2VRS A;  4NUV A;  4EYY R;  4DR2 T;  5CBN A;  1WMK A;  1HX1 B;  3AE4 C;  2KNC B;  2CBI A;  2L5G B;  3TLU A;  3FB2 A;  2E75 B;  3QK6 A;  4HEA A;  3RGU A;  2UXB T;  3J9X 1;  3L4F A;  1PGP A;  3PUV F;  4JUY A;  3GG2 A;  5HAX A;  4DR5 T;  2B89 A;  4EI2 A;  2ODV A;  4M3L A;  5CJ4 A;  1HFA A;  2XSA A;  3O4X E;  2NTX A;  3N2G E;  5DQV A;  5FL0 A;  3EFG A;  1A02 J;  2OYH B;  3AEA A;  2QE7 H;  4WY4 D;  1I6Z A;  1EDK A;  2NTY A;  2XAQ B;  2G3A A;  1CW5 A;  4ZS2 A;  1S35 A;  3SSU A;  1AV1 A;  2LM9 A;  3AE4 A;  4NPP A;  4YTM A;  2H89 A;  1FC2 C;  2EHO C;  5FYM A;  4HJG H;  1QVF O;  5HWX A;  2IC9 A;  1VL2 A;  3TGU D;  2YU1 A;  1YTZ I;  3C4X A;  2K9A A;  2SPZ A;  1P84 H;  1L0V A;  5L4E A;  2IC6 A;  3OJA B;  3AED A;  3JSV C;  4U2Z A;  3VRB A;  2R3C A;  4B3S T;  4BWN A;  2YXR B;  4I55 E;  1S5L H;  4UB6 E;  3BCC G;  1UCU A;  4TWD A;  2WMO A;  2FJA A;  3OYZ A;  3AEF C;  3PH0 A;  3CCE P;  5CA1 E;  5AQK B;  3RRW A;  2GUS A;  3TDK A;  2GUV A;  3FWN A;  3WUT A;  3LSV A;  4QKN A;  2H89 C;  1WT6 A;  1HUC A;  3H32 B;  3UQ4 A;  2Y48 B;  1VF5 D;  2XM1 A;  2BG9 E;  1SQP D;  3O6Q A;  2YOE A;  4LF5 T;  2OYI C;  1RY3 A;  5FXX A;  2WDQ A;  3RKG A;  1LTA C;  1N7L A;  4RO0 A;  2NW8 A;  1NU1 E;  3WI3 A;  1OXZ A;  1BGY G;  4U74 A;  2HOD B;  4O4J E;  1EXI A;  1GZL A;  4DJG A;  1XDP A;  1MMG A;  1AVY A;  3BK9 A;  1OX3 A;  1UK5 A;  4HH2 A;  4HFB A;  4A56 A;  4OGQ D;  2IIU A;  2IYP A;  1FZG A;  4LF9 T;  2Z5I A;  2JQ9 A;  1URQ C;  5KTB A;  1JNM A;  2E5Y A;  4HFV A;  2IZ0 A;  1QLE D;  3ANW B;  2A06 E;  1G2C B;  3WAJ A;  1JY3 O;  1NVO A;  3ZYL A;  2YIU C;  3B5N D;  1VQO P;  5LYJ E;  1HR0 T;  2NP9 A;  2VQE T;  2CPB A;  1NEK A;  2QSI A;  1XMO T;  4O4L E;  1GW3 A;  3KVA A;  1SVF A;  2L8K A;  2NPS C;  4ZEY A;  2K88 A;  1GU5 A;  2H7O A;  3CMA P;  4HWI B;  2M6I A;  1RHZ B;  1SQP G;  1L2P A;  2P10 A;  3MJX A;  2XQ4 A;  2BEZ F;  2Z6E A;  1AQ5 A;  2ZLY A;  4IFM A;  1L0N E;  2OYH C;  3H1I E;  2NWB A;  2CXF A;  4ZI7 E;  5KX5 E;  4EDF A;  2E74 C;  1EZV I;  3L74 D;  3L73 G;  1SQV K;  4H9P C;  4EEB A;  3NVO A;  2B9B A;  1ZOY C;  4X1I E;  4U3F G;  1JCD A;  2AEM A;  1LVF A;  4PJN A;  1XDO A;  3AA1 B;  3AEG C;  5F8P A;  3EFF K;  2QM8 A;  2KP8 A;  1VQ5 P;  2NW7 A;  2LHR A;  2Z5H A;  1E79 H;  3CX7 B;  4LMK A;  3RQW A;  2ZM6 T;  1I94 T;  3L35 A;  4PV1 D;  1HNX T;  3O6Q B;  4B6X A;  1YXR A;  1KIL C;  3P4R A;  3RBX A;  3BQI A;  4EZH A;  1OZH A;  4W7Y A;  2WMN A;  4EIJ A;  3FWL A;  5E79 E;  3HKC E;  3ZCI A;  3OVU A;  2E76 D;  3M0D A;  1FU1 A;  5KLV J;  4JF7 A;  4IHJ E;  2DNX A;  3UU4 A;  2VAS A;  3HTK B;  3KHU A;  2OAR A;  2H3R A;  4PFP A;  1YJ9 P;  2O3J A;  1LT9 B;  4TN7 B;  3L72 E;  1G73 A;  5GTH E;  2W90 A;  2A45 H;  2WZ7 A;  1K9M Q;  1O3X A;  4U7J A;  2BCC G;  2YKP A;  3LW5 H;  1KD1 Q;  3VMA A;  4GKK T;  2ZXE B;  1MNE A;  2DI4 A;  3PV0 F;  2PJQ A;  1SQB E;  3ANW A;  1NTZ K;  3L74 G;  3M3Z B;  3CCQ P;  1L0N J;  2LOP A;  1Z0P A;  3P7I A;  3TGU G;  2KLQ A;  3AVS A;  3KIN B;  1SQV E;  3H1H G;  3AEB A;  3PUZ F;  3VYI A;  1KTM A;  4GOF A;  4TLF A;  3SFE A;  2K37 A;  3PLN A;  5DJT B;  2KWH A;  1AVO A;  2MTQ A;  4PJJ A;  1J1D B;  1KV4 A;  1X8Y A;  1H0T B;  2IX7 C;  4LC1 A;  3CC7 P;  3P8C D;  3KV4 A;  4HFI A;  1N36 T;  4B3T T;  4UXN B;  5CCH A;  4YTP A;  1K73 Q;  2ZYG A;  3N5L A;  4AIS A;  1SA0 E;  4D6T J;  3H6P A;  3FZH B;  4CQI A;  1T7S A;  1LTB C;  1SFC A;  5JR9 A;  3ONJ A;  5AW1 B;  3PP5 A;  2FBW A;  4UV9 B;  1ZN5 A;  4OHF A;  4BAY B;  4WZX A;  2V7J A;  4OWF A;  4N3Y B;  3PRJ A;  3P32 A;  3ABV A;  1SQP K;  2V7K A;  5CCG D;  3ZCJ A;  2AEJ A;  2IPP A;  3W15 B;  2M8R A;  2KWI B;  3Q3D A;  2CBJ A;  2XSB A;  1XTC C;  3BAS A;  2DL1 A;  3N2K E;  3P4W A;  1KN7 A;  2G8Y A;  3GW6 A;  3MUD A;  1PV3 A;  3WU2 H;  5APV A;  1DH3 A;  1JTH A;  1KQS O;  4LFC T;  3T97 B;  3GN5 A;  4UEM A;  4BJN A;  2J59 M;  2UUC T;  2ZYA A;  3X1D A;  2V8S V;  3L70 J;  1Y9B A;  1R8E A;  3RRC A;  1PP9 G;  1OIP A;  4U33 A;  3F2E A;  3PTZ A;  2IW5 B;  1EDI A;  1VQ4 P;  2IHR 1;  4YJ2 E;  1OW6 A;  2XPK A;  1LP1 B;  4ERR A;  4WWI A;  2N1G A;  3ZEF B;  1DEE G;  1KB9 H;  1KNZ A;  1JM0 A;  1TU3 F;  1KIL A;  2V6Y A;  2H43 A;  2Q9Q B;  2XQ5 A;  5AW5 B;  2Y6X A;  1KYO D;  5APY A;  4IE5 A;  2V7M A;  4DBR A;  3HD7 C;  1SQX E;  3RC3 A;  4D6T D;  3V5U A;  2WDR A;  2MJZ A;  2XHE B;  1FJP A;  2LKG A;  5ETW A;  3TNU A;  2JJL A;  2A72 A;  2XQ6 A;  4LFB T;  4QHO A;  4DT0 A;  3ZKR A;  1VQ6 P;  2QJK B;  1RH5 B;  2W2U A;  3N9N A;  5JR9 B;  1J1D C;  1KOR A;  1OW8 A;  1PGO A;  3ABV C;  4LGD E;  4WBA A;  2HFE D;  1YIJ P;  1MIY A;  5JDH A;  1ZV4 X;  2JQK A;  4ZKU A;  3CWB D;  2Y8D A;  4JYC A;  2XJ7 A;  5TJH A;  1RE4 A;  5L3B B;  2E74 B;  1LTJ B;  2GA1 A;  2WSS V;  3HD7 A;  3VKG A;  3NRX A;  2C0X A;  2YMY A;  4K3A A;  5L47 A;  2BS2 A;  3MD0 A;  3M91 A;  3ZT7 A;  1M7L A;  4AQY T;  5J2T E;  3RGL A;  4EYU A;  4DND A;  5KKZ C;  1S5L E;  1VOM A;  3QNU A;  1YIT P;  3PJS K;  4EOT A;  5AQS B;  4MFR A;  3MTU E;  1S9K E;  3HE5 B;  1PGJ A;  5LBM A;  1IK7 A;  1USE A;  1JY2 O;  4ZXL A;  1RE4 C;  1R5S A;  3E22 E;  2YKS A;  4YHJ A;  2AEF A;  4YTP C;  4D6T E;  4A5X A;  1ZXG A;  5HXE A;  1T8Z A;  4JI4 T;  1GW4 A;  5L4H A;  5JRE A;  2JP3 A;  2FFD B;  1QSD A;  2VKD A;  2E76 C;  4PK4 A;  3KQG A;  1M8O B;  5APU A;  3AB3 B;  1HCI A;  2Q9I A;  5TIS H;  2OA5 A;  3CX5 D;  3RL0 B;  1V9D A;  2KZI A;  3PUA A;  1BR0 A;  3RK3 C;  3L75 J;  3SFD A;  4UB8 E;  1J2J B;  2WP9 A;  4QWN B;  5LG4 A;  1YJW P;  3PTR B;  5L3E B;  4HB1 A;  3B13 A;  1BE3 J;  3CC4 P;  3FZM B;  3LK3 B;  1RF0 A;  3T8O A;  3ZST A;  3A5X A;  1IJ6 A;  5DJQ C;  1AJY A;  3P4S A;  4U31 A;  3CPW O;  4DV1 T;  2N1T C;  3B5N A;  2QRX A;  4EV6 A;  3OPC A;  3RYC E;  4DR6 T;  4QXB B;  4NIQ A;  2A06 D;  5AW0 B;  4OGQ B;  1IZN B;  4KUM B;  3SWH A;  5AVQ B;  1RF1 B;  3EVY A;  3CME P;  5HYA A;  4JI2 T;  1PIX A;  3H1L J;  2YU2 A;  2K9J B;  2BCC D;  3L72 J;  2L9Q A;  2J1D G;  1FBM A;  2N1T B;  3H32 A;  4AQG A;  4DMW A;  3D0T A;  2E5V A;  3Q1M A;  2QJK C;  3JC2 2;  5M1B A;  3OBV E;  1J1J A;  2OYH A;  4GYS A;  1W09 A;  2YN6 A;  4UVA B;  3D6Z A;  2B1E A;  3CL3 D;  1T8B A;  3G06 A;  4F6R C;  1X0T A;  2LKM A;  2UWJ E;  3H37 A;  1BGY D;  4H13 D;  4MBQ A;  2IDO B;  3L09 A;  2JPF A;  2HOD A;  1X79 B;  2RKL A;  3AED C;  2MYS A;  3RL0 g;  2IAK A;  1EQ7 A;  1N8R Q;  3U1A A;  2XAH B;  1KNR A;  4O2B E;  3ZYK A;  4DOJ A;  4O2A E;  4UR9 A;  2N9Y B;  2MPK A;  5FXW A;  4JPZ B;  3KV6 A;  3O8Z A;  1E7P A;  1WCR A;  3QWO C;  2XZR A;  3ZLI A;  2CWO A;  2V7Q J;  3FXD A;  1X79 A;  1X9B A;  2K9Y A;  3GLM A;  1MUU A;  2Q3I A;  2KK7 A;  3H1J D;  3H1K G;  1SQX D;  3HKD E;  5B66 E;  5LHI B;  1HH0 A;  4KX6 A;  2RA1 A;  1ZR2 A;  1BGY E;  4X64 T;  3R6N A;  4IFF A;  3M9H A;  3RC8 A;  3A7M A;  1YJN P;  1S9K D;  3ZMT B;  2E42 A;  2KZJ A;  5FY1 A;  2ZJS E;  1S94 A;  3AE3 C;  3HRN A;  2EHO D;  1M1J C;  1ZME C;  5GTI H;  3HD7 D;  4Z8X A;  2LSY A;  3RHW A;  4H9N C;  2D2S A;  3A8Y C;  1BE3 G;  3AEE C;  4AYC A;  3AE6 A;  2AE9 A;  2JEE A;  2PBI A;  2A06 G;  1NU1 J;  3L75 G;  3M9Q A;  2WPS A;  4WY4 C;  4AQR D;  4PFO A;  3AE8 A;  1FEW A;  1GTW A;  4WW0 A;  2XQY A;  3A0B H;  3WU2 E;  2BDE A;  3RX6 A;  4IL6 H;  3EI0 A;  1L0L E;  1OFC X;  2UXC T;  3V2N A;  1G2C A;  4W80 A;  3J7Y q;  4X1K E;  1U7M A;  5AQL B;  5FXV A;  5CCH C;  1L4A C;  5AW8 B;  3CX5 I;  1DEB A;  4TT3 H;  1SQP E;  4DR4 T;  3VMX A;  2JRK A;  4TV9 E;  1IFP A;  2IZ1 A;  3G6E P;  4YXD C;  5L3G B;  3IN6 A;  4IL4 A;  1U57 A;  1ZW0 A;  3AEE A;  3L39 A;  5BMV E;  3AAA B;  5ABF A;  1PPJ G;  4IE0 A;  3RYI E;  4GOE A;  4X66 T;  2E2A A;  5AW4 B;  5CJ5 A;  1NAF A;  3RK2 C;  3L73 E;  5LA6 E;  4JLE A;  2O1K A;  4ZHQ E;  2X9W A;  4ASK A;  1RQU A;  2H7V C;  4EED A;  1SS1 A;  2CMR A;  3ONX A;  5K5G B;  5CA0 E;  1QX8 A;  4NPD A;  3NTN A;  3AXJ B;  3CX5 E;  1Q82 Q;  2FUP A;  2LJL A;  2V6X A;  4TWH A;  3HTK A;  4IST A;  1SLQ A;  3H1J J;  4PJL A;  4YXD A;  5AVR B;  1IBL T;  1N33 T;  1YYC A;  4BXL A;  1RE3 C;  5ABF B;  1T6A A;  3ZMZ B;  5JDG A;  2WB5 A;  3E7K A;  3L70 G;  2ZFC A;  1YQ4 C;  2KUB A;  3L36 A;  3NBX X;  2VVN A;  4H13 B;  2WWV A;  5EZY E;  4XAX B;  1H0T A;  5IYZ E;  2LRL A;  3VRA A;  4HFE A;  3FGA D;  1K8A Q;  5C3J A;  1M90 Q;  2M5A B;  4PJM A;  3CXH I;  3N9P A;  4PK6 A;  3JCF A;  1URQ A;  1BDC A;  4BJM A;  1N2D C;  1P84 I;  4EYY Q;  4WVZ A;  3MIW A;  3MK7 C;  2ITA A;  4ILA A;  2Y9Y A;  2M3E A;  5H6Q B;  1XNQ T;  3AEC A;  1S72 P;  1JMM A;  1RE3 A;  1XTG B;  3L74 E;  4ZI3 C;  2LE8 A;  4Y99 B;  1ZV8 A;  3BCC D;  3CXH H;  1ZKE A;  1ZEE A;  3PHL A;  2POH A;  4UVC B;  1DD3 A;  1HGZ A;  2WSC J;  2C5J A;  1WFD A;  4CN1 A;  2A45 I;  4ZI3 D;  3OW2 O;  4C7R A;  4ISS A;  4HFC A;  1YD8 G;  3CXH E;  2ZM0 A;  1FZC C;  1P84 E;  1IFD A;  3ITK A;  3CML A;  2Y9Z A;  2BKN A;  1PP9 J;  2Q9Q C;  4DR3 T;  1LTG C;  3I55 P;  3USS A;  5LMN T;  3BCC E;  3Q5W A;  4X5T A;  2X67 A;  1Z56 A;  1VQ9 P;  4AKL A;  1VF5 B;  4P0A A;  3E1I A;  1S5L X;  3CCJ P;  4KHX A;  1HJ0 A;  5AQT B;  1KYO E;  2Q6Q A;  2G0U A;  2JMH A;  1OVU A;  2ZMA A;  3OKQ A;  2FYN C;  1YQ3 C;  4IDN A;  3L71 G;  2I8D A;  3R4Y A;  2OTJ P;  2HPC B;  1W2B O;  3O9X A;  1D0X A;  2OYI B;  4I7Z B;  2C9L Y;  4TX5 A;  1KIL D;  2R5D A;  1FZC A;  1UIX A;  4PV1 C;  5DAB A;  4ZMD A;  3VMZ A;  1FOS F;  1FZE A;  3EDV A;  1DX7 A;  2IYO A;  2E9X B;  4YT0 A;  3CCL P;  1EZ3 A;  3AVR A;  3RK2 D;  4QH4 A;  1H7C A;  3RH3 A;  4TNV A;  4NUU A;  2L91 A;  4DVD A;  3QB5 A;  2OTK E;  3LW5 J;  3FX0 A;  4TNW A;  3VN0 A;  1UX4 A;  4PAG A;  1HNW T;  4AKH A;  3NKZ A;  1HF8 A;  4CI2 B;  1FMV A;  4ILU A;  4LMJ A;  3H1I D;  1T3J A;  1NEN A;  3TNU B;  1L4A D;  5CCH D;  2IDB A;  1D1C A;  3KBU A;  3LBX B;  3NMD A;  1MIW A;  5L2L A;  1YBK A;  1YTZ T;  5B5E E;  5CFB A;  4U3C A;  2J62 A;  5LB7 B;  1QEX A;  2JDI H;  4QX7 B;  2E9X A;  2OQQ A;  2Q9Q A;  1IJD B;  2JIW A;  5L3F B;  1NHL A;  1U4Q A;  2WSF H;  3U1C A;  5AQJ B;  2OGU A;  4Z91 A;  2BBJ A;  4A97 A;  3N9Q A;  2E5L T;  2ZYD A;  4KJM A;  2VQF T;  3B4S A;  1CHU A;  2KS1 B;  2CHO A;  5LNK A;  4I7Z C;  4NPE A;  2HLO A;  3JAF A;  4IDP A;  1JOC A;  4IL6 E;  5H2F E;  3AA7 B;  3UU3 A;  4MAL A;  4NXM T;  5JDM A;  1LT9 C;  4GKJ T;  1BE3 D;  2K24 A;  2E43 A;  4MLK A;  2H8P D;  2LSI A;  1LWU A;  1AFO A;  5LHH B;  1D0Y A;  5TAO A;  1T3U A;  5EK3 A;  2UUB T;  4CI1 B;  2HPC A;  2KNC A;  1GMJ A;  1W2E A;  2KI7 B;  5A1L A;  3HUS A;  5LMU T;  3PDY A;  1GL2 D;  1EZV D;  1NTM D;  1NTK G;  4A98 A;  3A7O A;  3CWB J;  2C5K T;  5LGU B;  4CN6 A;  1NTM J;  4U3F D;  1GL2 C;  2W63 A;  2MAW A;  2XDJ A;  1SQB D;  2AXC A;  4DV0 T;  1NWM X;  3BAT A;  4KMC A;  4L9I A;  1LTJ A;  4U3F J;  2QJY C;  1HS7 A;  4UB6 H;  3SWF A;  4H9S E;  5AW3 B;  1VPC A;  4DR1 T;  1WR6 A;  4ZZC A;  4B86 A;  2ZAE B;  2MBG A;  2FFD A;  1GU4 A;  2JWA A;  2XKM A;  3TGU E;  2RH0 A;  3S1K A;  5LXT E;  1SQV G;  4DV5 T;  2W6J H;  1UUR A;  1U7J A;  3KYQ A;  3QB5 K;  1Q86 Q;  2E76 B;  4NPF X;  1KYO I;  2M67 A;  4XZC A;  2FYU K;  1ZR4 A;  3UFG A;  2WVR A;  2LSK A;  3UTK A;  5EK2 A;  3IAO A;  2JJ9 A;  4A7P A;  4Y28 J;  1J1E B;  2D0T A;  2J5U A;  2O01 N;  3BRT B;  1YHQ P;  2QIW A;  3CCR P;  2VKH A;  3IBP A;  5ABE A;  1LTT C;  2K1A A;  4YHH T;  3AAI A;  3EAM A;  3TLW A;  3H1H D;  2PAJ A;  2A3D A;  2XQ8 A;  1NTK J;  5KAI E;  2QEX P;  3AE9 A; 
#chains in the Genus database with same CATH homology
 3MTU E;  4GKG A;  1S9K E;  2E8I A;  3IHR A;  3SOL A;  1L0L K;  3HE5 B;  3N7N A;  5LBM A;  3TSI A;  5JRC B;  1LWU B;  1N73 C;  5EK4 A;  2WPR A;  1FZF A;  5LBQ B;  2CEA A;  1JY2 O;  3UIA A;  1VRB A;  1RE4 C;  1M1J A;  2QM7 A;  1IAP A;  3HE4 B;  3VP8 A;  3E22 E;  4RES B;  1LGH B;  2C5I T;  1J1E C;  1RF0 C;  5CCG A;  4O4I E;  4WB4 A;  4YHJ A;  1NU1 K;  5HXC A;  3RYF E;  5KDM C;  2NOX A;  5HXE A;  1T8Z A;  3E0Z A;  2HYN A;  1GW4 A;  2YO3 A;  3A3Y B;  4HKA A;  5JRE A;  5KMG P;  2MOZ A;  2WT7 A;  2FFD B;  4I1L A;  2I1J A;  3VTP C;  1QSD A;  2VKD A;  4DZO A;  2X9Y A;  3KV9 A;  3KQG A;  4K0U A;  4KP3 C;  4PK4 A;  5LGT B;  3E08 A;  5APU A;  3JC6 D;  2ACX A;  3AB3 B;  2JMK A;  1HCI A;  2LSG A;  2Q9I A;  2OA5 A;  3PE0 A;  5FNV E;  3RL0 B;  4XA4 A;  3TKL B;  1V9D A;  2VL8 A;  2W61 A;  3C51 A;  3PUA A;  4U72 A;  1IK9 A;  3KFW X;  3ZPO A;  3RK3 C;  4OK0 A;  5LG4 A;  1SQB K;  1J2J B;  3K3N A;  4QWN B;  2WSE H;  3M65 A;  3K3O A;  2CXL A;  4FJO A;  4ADZ A;  1GK4 A;  3V2P A;  2W0G A;  3PTR B;  1G1J A;  5L3E B;  1N73 A;  3CX6 B;  1MMD A;  1H88 A;  3B13 A;  5JH7 E;  4I2L C;  4IDZ A;  3AAE B;  2CCQ A;  4PNI A;  1RF1 C;  3CPZ A;  3BRV B;  3LK3 B;  2W00 A;  2XTL A;  1RF0 A;  3T8O A;  1MFZ A;  1IJ6 A;  3A5X A;  3PUQ A;  5AVZ B;  1QL1 A;  3V4Q A;  5DJQ C;  2KLV A;  4AQF C;  4GK0 E;  2V7I A;  3SS1 A;  2N1T C;  3B5N A;  5AVU B;  1L4A B;  1HG2 A;  3LBX A;  2YO2 A;  2KZ7 B;  2WM9 A;  4PW8 A;  4QX8 B;  2YEV C;  2WPQ A;  3RYC E;  1IFN A;  4EOZ B;  3IR9 A;  5M4Y A;  1NKN A;  1MMA A;  3B57 A;  4QXB B;  1N7S B;  3DTO A;  3SRZ A;  3HE5 A;  4CI3 B;  5AW0 B;  4OYK A;  1IZN B;  5E0O A;  2YNY A;  2Q9Q D;  2J58 A;  3A2A A;  4KUM B;  3GA8 A;  5AVQ B;  4L5G A;  1RF1 B;  3R84 B;  2WTY A;  2C0S A;  3HE4 A;  3EVY A;  3VMY A;  5HYA A;  3V2Q A;  1Y64 B;  1URQ B;  3U78 A;  1NH4 A;  2YU2 A;  3UUN A;  4EB6 E;  2XU6 A;  5APW A;  3P7K A;  3V5B A;  2BVL A;  2W27 A;  1WYB A;  2L9Q A;  4IGU A;  3ZMV B;  2J1D G;  5CB4 E;  3FXD B;  5JDF A;  1ZLL A;  3M0A A;  1FBM A;  2N1T B;  3H32 A;  2GM4 A;  3S4U A;  2R5B A;  4AQG A;  4C90 A;  4DMW A;  3D0T A;  1FAV A;  2CXD A;  3VOP A;  3B5N B;  3ZN0 B;  4WBO A;  5F3J A;  2YIN A;  3VHL A;  3CQC B;  2LT3 A;  3LK4 2;  3OBV E;  1YKE B;  5L3D B;  2OYH A;  2KSJ A;  4GIW A;  4GYS A;  4AI6 A;  2CE7 A;  1WYC A;  4W7Z A;  5BU8 B;  1GL2 A;  3BVH A;  2VRS A;  2B1E A;  2CWY A;  3KVB A;  3CL3 D;  3NZP A;  4UVA B;  4NUV A;  4EYY R;  4F6R C;  1WRD A;  2VKJ A;  2LKM A;  4GT1 A;  4KBM B;  1JUN A;  2X68 A;  3H37 A;  3HI2 A;  4AXP A;  1NTM K;  3I5C A;  2X0L B;  4EAH A;  1LKX A;  3TK1 A;  1N7S D;  4MBQ A;  3ZN1 B;  3L09 A;  2L5G B;  4AKR B;  3FB2 A;  3Q5X A;  1SQQ K;  3QK6 A;  4EXT A;  2JPF A;  2HOD A;  1X79 B;  1JY3 N;  4HEA A;  2XAG B;  1IFJ A;  2K5B B;  3J9X 1;  3L4F A;  5AW2 B;  2MYS A;  3C50 A;  2X66 A;  4JUY A;  2IAK A;  3DJB A;  3V4W A;  5HAX A;  1LVK A;  1GK6 A;  2ODV A;  3ZYM A;  1CI6 B;  4I43 B;  4M3L A;  1EQ7 A;  5CJ4 A;  1HFA A;  2DHR A;  2NTX A;  3O4X E;  3U1A A;  3N2G E;  2XAH B;  3I0O A;  5DQV A;  4CXY A;  3EFG A;  2Z4E A;  1A02 J;  2OYH B;  3ETU A;  4O2B E;  3ZYK A;  2PP6 A;  4DOJ A;  4O2A E;  4WY4 D;  2NTY A;  1N73 B;  2XAQ B;  2K48 A;  4J2C A;  4AQF A;  3C98 B;  5FXW A;  3VP9 A;  4WY4 B;  1CW5 A;  5AW6 B;  1SQX K;  3KV6 A;  4ZI2 C;  3B5N C;  4ZS2 A;  3O8Z A;  1S35 A;  4EZH A;  3AA6 B;  2LM9 A;  3VKH A;  2LHN A;  4JEH B;  2XZR A;  2CPS A;  3ZLI A;  4P0B A;  5CHX A;  4AKI A;  2I1K A;  2CWO A;  1GDT A;  2FYZ A;  3KDP B;  1X79 A;  2CA5 A;  2EHO C;  1LRZ A;  2P1J A;  1FJK A;  2WIT A;  5FYM A;  1MUU A;  1WLX A;  2ZM8 A;  2Q3I A;  3V5S A;  5HWX A;  2Q5U A;  2IC9 A;  3HKD E;  3I9Y A;  3LFM A;  2YU1 A;  3AA0 B;  1NWQ A;  1YTZ I;  3C4X A;  4OYJ A;  3UUL A;  5LHI B;  1HH0 A;  4ZKP A;  1IFI A;  1US7 B;  4H9O C;  2RA1 A;  1ZR2 A;  4UF0 A;  2K9A A;  5JVD E;  2BZB A;  3MAC A;  2X9H A;  3R6N A;  4IFF A;  3CKD A;  1MZ9 A;  1JCC A;  3OJA B;  1GL2 B;  2HPL A;  2IC6 A;  3M9H A;  4M1P A;  5AW9 B;  2BVM A;  3RC8 A;  2R3C A;  4I55 E;  1S9K D;  1UCU A;  3UUM A;  3ZMT B;  2E42 A;  3U3I A;  2WMO A;  1NTK K;  3OYZ A;  1S94 A;  3HRN A;  3HD7 B;  5FY1 A;  2EHO D;  5FXZ A;  4EZ4 A;  1M1J C;  3CQX C;  3NZQ A;  5CA1 E;  3RRW A;  3HD7 D;  5CCG C;  3MZK B;  2LSY A;  2GUS A;  4Z8X A;  4H9N C;  3C4W A;  1WRG A;  2D2S A;  2GUV A;  2W6A A;  3ZC1 A;  4AYC A;  4QKN A;  1A02 F;  2NW9 A;  1WT6 A;  1HUC A;  3H32 B;  2WAU A;  3PUR A;  2EHO A;  2JEE A;  5L3B B;  2PBI A;  3M9B A;  2Q7C A;  5APT A;  2Y48 B;  1H89 A;  5A1L A;  3M9Q A;  5HXR A;  2WPS A;  4WY4 C;  4AQR D;  2HPJ A;  3HA4 A;  4PFO A;  1FEW A;  1GTW A;  2VKO A;  4WW0 A;  4JEU B;  2XQY A;  2BDE A;  2OYI C;  3RX6 A;  1SP4 A;  4HTE A;  3LID A;  1SHZ C;  3WAK A;  4HN9 A;  1RY3 A;  3OJA A;  5FXX A;  2DWK A;  3V2N A;  1G2C A;  4W80 A;  3HKB E;  2XNX A;  1OWA A;  4X1K E;  5FXV A;  3J7Y q;  1LTA C;  1N7L A;  2NW8 A;  1M1J B;  3ZMS B;  5CCH C;  1AJ3 A;  1L4A C;  1MV8 A;  5AVY B;  5AW8 B;  1D1A A;  1DEB A;  2DCF A;  2I59 A;  2QGS A;  3VMX A;  2JRK A;  3WI3 A;  2UXX B;  1OXZ A;  4TV9 E;  4U74 A;  2HOD B;  3RK2 B;  3OAK A;  2N9B A;  4O4J E;  4DBR A;  3UUX B;  1GZL A;  4OH8 B;  1N7S C;  5L3G B;  1MMG A;  3BK9 A;  2WT7 B;  2P2U A;  5BMV E;  4A56 A;  4GIF A;  4HH2 A;  2KXP B;  3DP7 A;  1FZB A;  3N9L A;  4V1A v;  2EHO B;  3AAA B;  3ZJ2 A;  4IE0 A;  3RYI E;  1LTI C;  5AW4 B;  2ES0 A;  2N2N A;  1FZG A;  1NAF A;  5LJN A;  3RK2 C;  3HR0 A;  2Z5I A;  4JLE A;  5LA6 E;  3N2O A;  2O1K A;  3L37 A;  1HJB A;  2CLY B;  1URQ C;  3Q2M A;  5KTB A;  4ZHQ E;  2X9W A;  1JNM A;  3EQ2 A;  3VU7 H;  4ASK A;  2E9X C;  2H7V C;  2ZM2 A;  4HFV A;  3MKD A;  4X1Y E;  4CXW A;  3HL6 A;  4IE6 A;  2CMR A;  3GHG B;  2L3L A;  3N9O A;  3ONX A;  3IFM A;  3ANW B;  4G63 A;  5CA0 E;  4WY4 A;  5L3C B;  1G2C B;  3WAJ A;  4UF0 B;  1JY3 O;  2XAS B;  3NTN A;  5FMN A;  2LJL A;  3ZYL A;  3B5N D;  5LYJ E;  3HTK A;  1UX5 A;  1SLQ A;  2NP9 A;  3IEE A;  4IST A;  3ZC0 A;  2CPB A;  4G2A A;  4PJL A;  3LIE A;  4O4L E;  1GW3 A;  3KVA A;  2X51 A;  3O1H A;  1SVF A;  2A2F X;  5AVR B;  2L8K A;  2NPS C;  5CJ0 A;  1YYC A;  2V7L A;  1RE3 C;  2WBL A;  2YK0 A;  1L4A A;  2IFN A;  1GU5 A;  5J1G A;  4XBF B;  3MXZ A;  1FZC B;  2H7O A;  3TYY A;  3ZMZ B;  3U59 A;  4OFZ A;  5JDG A;  4WBN E;  2ZFC A;  2LSJ A;  3MJX A;  2W62 A;  1N7S A;  3L36 A;  3NBX X;  2Z6E A;  1AQ5 A;  2CM0 A;  4IFM A;  2OYH C;  2ZLY A;  4XAX B;  3RK3 B;  4IIJ E;  5EZY E;  5IYZ E;  1KIL B;  2NWB A;  2X9X A;  2CXF A;  2LOS A;  4ZI7 E;  5KX5 E;  3GHG A;  1H8A A;  4CXX A;  1T98 A;  3KV5 A;  4H63 V;  3ESL A;  3N9P A;  4PJM A;  4GK5 E;  4PK6 A;  1BR0 A;  1URQ A;  3QUJ A;  4IE7 A;  1SQV K;  1N2D C;  4BJM A;  4H9P C;  2YKQ A;  1IO4 A;  3MIW A;  3MK7 C;  4ZS3 A;  4X1I E;  5KJ7 C;  3SWH A;  3QC9 A;  5H6Q B;  1NO4 A;  1JCD A;  1HWT C;  1LVF A;  1FOS E;  1YW0 A;  3O1I A;  1HX8 A;  3AA1 B;  4H63 H;  2OYI A;  4PJN A;  1JMM A;  2QM8 A;  4YLH A;  5F8P A;  2KP8 A;  5APX A;  2JQQ A;  3FBL A;  4E7Z A;  2NPS A;  3G3Z A;  1CUN A;  1RE3 A;  1XTG B;  1IC2 A;  1VDF A;  3WMM 0;  2SPC A;  3ETV A;  2LE8 A;  2NW7 A;  4H9R C;  4ZI3 C;  4Y99 B;  4XE5 B;  1ZV8 A;  2Z5H A;  2LHR A;  2XV5 A;  3CWZ B;  1JY3 P;  1ZKE A;  1ZEE A;  3CX7 B;  3L35 A;  5C8Y E;  2FXM A;  2POH A;  4PK5 A;  4UVC B;  4B6X A;  1KIL C;  3IF8 B;  1HGZ A;  1JY2 P;  1B7T A;  3BQI A;  2C5J A;  4W7Y A;  5FY7 A;  4EIW A;  2XAF B;  2WMN A;  3C4Z A;  4EIJ A;  4IFD K;  5LHG B;  2A45 I;  3HKC E;  4ZI3 D;  1HBW A;  3GHG C;  4C7R A;  1SFC D;  4HE8 A;  4ISS A;  3M0D A;  1FU1 A;  1YD8 G;  3MA9 A;  3ZCI A;  4C91 A;  5LJM A;  2ZM0 A;  4JF7 A;  1FZC C;  4IHJ E;  5BU5 A;  2DNX A;  3R2P A;  2VAS A;  4O4H E;  3HTK B;  4QXC B;  4WNK A;  1IFD A;  1HVV A;  3CX8 B;  1G1I A;  4UIG A;  5KJ7 D;  2OAR A;  3CML A;  2D5U A;  2V1D B;  5LP6 E;  2Q9Q C;  2H3R A;  1QL2 A;  4PFP A;  5JDL A;  2KYV A;  3OYX A;  1LT9 B;  4TN7 B;  1LTG C;  3I0Q A;  1G73 A;  4ANJ A;  5AVW B;  3Q5W A;  2WZ7 A;  2A45 H;  1X9V A;  2O1J A;  1O3X A;  1MIV A;  2X67 A;  1Z56 A;  5APS A;  5LGN B;  2YKP A;  3LW5 H;  4AKL A;  1IJ5 A;  3UFE A;  4DBQ A;  4E7S A;  3E1I A;  5J2U E;  4P0A A;  4H9Q C;  2N1T D;  2ZXE B;  2P67 A;  1MNE A;  4KHX A;  2DI4 A;  2PJQ A;  3ANW A;  3FBZ A;  2G0U A;  1NTZ K;  3UT5 E;  2JMH A;  4FI5 A;  2NPS D;  2LOP A;  1Z0P A;  3P7I A;  2KLQ A;  2PFV A;  2ZMA A;  3AVS A;  3OKQ A;  3KIN B;  3F31 A;  3KBT A;  1HTL C;  4P09 A;  1SFC C;  2HPC B;  3O9X A;  1NKZ B;  3VYI A;  2OYI B;  1D0X A;  4TZ4 C;  1JY2 N;  2W6B A;  3II6 A;  5JR9 C;  1FZA A;  2XAJ B;  3SWY A;  4X20 E;  2C9L Y;  4TX5 A;  4MHC A;  5AVT B;  3NXS A;  3RK3 D;  1U5P A;  4CZZ B;  5HXS A;  2WSC H;  1KIL D;  2R5D A;  1FZC A;  5JDQ A;  5JDN A;  3O1J A;  3GMI A;  2ODU A;  5DAB A;  3V2R A;  2KWH A;  2DWG A;  2CLY C;  2E9X D;  2MTQ A;  3JC6 C;  4PJJ A;  1J1D B;  3VMZ A;  1FOS F;  1FZE A;  3M06 A;  5FY0 A;  1L0N K;  1X8Y A;  3EDV A;  1URQ D;  1DX7 A;  2IX7 C;  4LC1 A;  3HUS C;  5KJ7 A;  3P8C D;  1EZ3 A;  3MGN A;  3RL0 D;  2E9X B;  3RK2 D;  3AVR A;  1H7C A;  2KMF A;  5H6R B;  2A45 G;  2KOG A;  4NUU A;  1KFM A;  2V26 A;  3RH3 A;  2VB6 A;  3KV4 A;  4DVD A;  5FP3 A;  1D1B A;  3GWH A;  3B8E B;  5BVZ A;  2XUE A;  4UXN B;  5CCH A;  3VN0 A;  1UX4 A;  4PAG A;  3BQL A;  5AFU L;  2HH7 A;  4AKH A;  1CSB A;  1HF8 A;  1KZU B;  4CI2 B;  4O8S A;  3N5L A;  1FMV A;  4ILU A;  1SA0 E;  1T3J A;  3KDS E;  2RP4 A;  3TNU B;  1L4A D;  2NPS B;  5CCH D;  3C9I A;  3H6P A;  1D1C A;  3L3P A;  1KFN A;  4C46 A;  4CQI A;  3KBU A;  3W15 B;  3LBX B;  1FIO A;  3NMD A;  1QUU A;  2KND A;  1LTB C;  4LLH A;  1MIW A;  3BQK A;  1SFC A;  5L2L A;  1YTZ T;  5JR9 A;  3CI9 A;  5AVX B;  5AW1 B;  3PP5 A;  4QX7 B;  3Q9D A;  4UV9 B;  3N4X A;  2E9X A;  1ZN5 A;  5AVS B;  2FKW B;  2M3B A;  5KLV K;  1YKH B;  1IJD B;  2Q9Q A;  4GYR A;  1D0Z A;  4OHF A;  4BAY B;  1LWU C;  1NHL A;  1U4Q A;  2WSF H;  2N9D A;  2V7J A;  5L3F B;  4DO0 A;  4N3Y B;  1GD2 E;  2YKO A;  4DMV A;  3U1C A;  1RF1 A;  3P32 A;  1SQP K;  2D0U A;  2PG8 A;  3I1A A;  2V7K A;  2R32 A;  4TUY E;  3N9Q A;  5CCG D;  4N6J A;  3ZCJ A;  1N86 A;  2HG5 D;  2IPP A;  3P8C E;  4O9B A;  2M8R A;  3HUS B;  2KWI B;  3H3A A;  4HGA A;  2H7H A;  5LNK A;  2N1T A;  3HKE E;  1XTC C;  3BAS A;  3N2K E;  5ADX L;  2HLO A;  3K3Q C;  1BR1 A;  4Y99 C;  3MUD A;  1BR2 A;  2QA7 A;  5APV A;  4C7N B;  2UXN B;  1JOC A;  1HGV A;  3AA7 B;  2C9N Y;  2P9B A;  3EUH A;  3LK2 B;  1DH3 A;  4MAL A;  1JTH A;  5JDM A;  1LT9 C;  3GN5 A;  4UEM A;  2K24 A;  1T2K D;  4BJN A;  1IFM A;  5JQG E;  2J59 M;  2E43 A;  4MLK A;  5LOV E;  5APQ A;  1BR4 A;  1KQL A;  2H8P D;  2LSI A;  1LWU A;  1LTJ C;  3OA7 A;  4N78 D;  3NFQ A;  1AFO A;  1HG5 A;  1G8X A;  3RRC A;  1D0Y A;  5TAO A;  5LHH B;  1T3U A;  5EK3 A;  4HYT B;  3F2E A;  3RPU A;  4CI1 B;  2IW5 B;  2HPC A;  4YJ2 E;  5HXH A;  1FDM A;  3F57 A;  1W2E A;  4I4T E;  3HUS A;  1FMW A;  4N78 E;  3PDY A;  5DQW A;  3FXE B;  4ERR A;  1GL2 D;  2N1G A;  4IE4 A;  1E1H B;  1JO5 A;  3N9M A;  3ZEF B;  1KNZ A;  4JYB A;  3A7O A;  3PUS A;  1SFC B;  2C5K T;  5LGU B;  1CI6 A;  5AVV B;  2VK9 A;  1NOH A;  5CMZ A;  3T97 A;  2Y6X A;  1KIL A;  1GL2 C;  2H43 A;  2Q9Q B;  2W63 A;  5AW5 B;  2XDJ A;  3GN5 B;  3PU3 A;  3ZMU B;  5APY A;  4UV8 B;  4YFS A;  2C0W A;  1NWM X;  3BAT A;  3RKO A;  4KMC A;  5JRC A;  3PU8 A;  2WWW A;  2V7M A;  4IE5 A;  1LTJ A;  4L9I A;  1E5W A;  2IFM A;  3M0D C;  3HD7 C;  1CZQ A;  4H9S E;  3SWF A;  1HS7 A;  5AW3 B;  1VPC A;  1ZHC A;  1PFI A;  3LJC A;  1WR6 A;  3RC3 A;  4BA9 A;  5IHY A;  3V5U A;  2KT9 A;  2LEH A;  4L0R A;  4B86 A;  2MJZ A;  2XHE B;  3C64 A;  1FJP A;  2MBG A;  5ETW A;  4YJ3 E;  3TNU A;  2JJL A;  2A72 A;  2KIN B;  4QHO A;  2O01 H;  2FFD A;  1T2K C;  5GON E;  1GU4 A;  1HTJ F;  2XKM A;  3PUG A;  3A5T A;  3RL0 C;  3I9W A;  5LXT E;  4AUW A;  3N9N A;  3FHN A;  3RYH E;  5JR9 B;  1J1D C;  4I6M C;  4LGD E;  4WBA A;  3P8M C;  4UVB B;  3K8P C;  3KYQ A;  2HFE D;  1MIY A;  5JDH A;  1ZV4 X;  4ZKU A;  3LG7 A;  2GK9 A;  2BAS A;  2Y8D A;  4JYC A;  5LCY A;  4ZOL E;  2M67 A;  2VWA A;  3CQG B;  4XZC A;  2FYU K;  1ZR4 A;  1RE4 A;  3CVR A;  3UTK A;  1MMN A;  1LTJ B;  2LSK A;  2WSS V;  5EK2 A;  3HD7 A;  2JJ9 A;  4TV8 E;  3VKG A;  1MND A;  2KB7 P;  2DLR A;  3NRX A;  4ZI2 D;  4AKG A;  3CLQ A;  1J1E B;  2C0X A;  2D0T A;  2YMY A;  3BRT B;  1LT9 A;  2VKH A;  3IBP A;  4QXH B;  3MD0 A;  1LTT C;  4I50 E;  3M91 A;  4UEL A;  1M7L A;  2FFD C;  5J2T E;  2WWU A;  5AW7 B;  1KK7 A;  4EYU A;  3EDU A;  1LTS C;  4C7N A;  4GOU A;  4DND A;  3NRY A;  1VOM A;  3AAI A;  1JTH B;  3KPE A;  5HWY A;  2A3D A;  2PAJ A;  4EOT A;  4MFR A;  3ZJ1 A;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...