4N78D

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
529
structure length
202
Chain Sequence
HTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRSDARSVLLEAIRKGIQLRKVEEIENDVATILSRRIAVEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 202
sequence length 529
ec nomenclature
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78D01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4n78D02
3N4XA 3HRNA 3U1CA 4I1LA 1WT6A 1NKNA 4N78D 5BU5A 5KTBA 3P8CD 3VP8A 4N3YB 2POHA 3BATA 4GIFA 3VP9A 3BASA 2JEEA 3C9IA 3OJAB 1IC2A 4ZKUA 3U1AA 5BVZA 5BU8B 1X79B 4ZKPA 3N7NA 2FXMA 3U59A 4O9BA
chains in the Genus database with same CATH superfamily
2WMOA 3TLUA 2N9DA 1Z0PA 2PTFA 4ISSA 3HL6A 5JDLA 1VCTA 4EYYR 3HTKA 2ITAA 2ODVA 2DW3A 1OEDA 2XTLA 3R84B 4YXDA 4F8HA 4IFDK 2KS1A 4DIDB 1J5WA 1M7KA 4K0UA 3G9RA 3M0DC 1T72A 3HUSB 2I6HA 2QIWA 2BKPA 3D0TA 3ZMSB 1AFOA 2W61A 2PAJA 4U74A 2IBZD 4RO0A 4CN6A 2YN6A 1VQ9P 1XTGB 3PTZA 2X0LB 3K3QC 3H1LJ 4JV5T 3Q5DA 2R5BA 3P32A 1S72P 1FIOA 1JM0A 2BASA 1KQFB 3GLMA 1Y47A 5J1GA 2ZMAA 3UT5E 1HX1B 5ABFA 4O4JE 4WNKA 2VL0A 2R32A 1OVUA 2FKWB 2JIWA 3QC9A 1X8YA 4Y99C 2XY8B 3PLNA 5AW0B 2H88A 1M7LA 1T2KD 5L3CB 3HE4A 1FZBA 1L0LE 1SQVE 2FFDB 3QB5A 3BRVB 1LWUA 5EK2A 3P4WA 2I59A 1I94T 3RL0D 1CSBA 2KNDA 5LA6E 1JY2O 4PJ0E 3P4SA 4DV0T 2UXCT 2N9BA 2E5YA 1BE3E 3C4XA 4ZZCA 1KYOH 1KFMA 3AE1A 3A0BE 3JCUE 3TKLB 4OX9T 1G73A 2V26A 3CPZA 3ZJ1A 2C0WA 4A98A 3P50A 2KINB 1SQBE 2ZYGA 2CXLA 2XM1A 3CK6A 4YLHA 5BMVE 1MFZA 2WBLA 4O4LE 1VPCA 4ZI7E 2FY8A 4KT0J 4MALA 2YDRA 1BGYG 2QM8A 2CWYA 2L5GB 2WQYA 1OXZA 3P4QA 1IFJA 4DT0A 1D1CA 3QUJA 1WRGA 2ZVOB 2YO2A 2W27A 4LF5T 2D2CD 4CZZB 2LM2A 2W6AA 3TNUB 3VN0A 4W7ZA 1N86A 2FJBA 1VQLP 2XAFB 2C5JA 4TUYE 1L0LJ 5AQFB 3EAMA 1KN7A 4W7YA 1SQQK 4U72A 4YT0A 4YTNA 1KILC 2NW7A 4DUZT 1MMAA 4H44B 3RGUA 1U7MA 2E9XD 1J1DB 1X9VA 1HG5A 4MFRA 4HWHA 3A7OA 1BR1A 1NKZB 5HYAA 3GWHA 2W4XA 3AEAC 4E7SA 3M9QA 3VMAA 3AE3A 4QMAA 1US7B 3JSVC 4B3MT 4H13D 3UFEA 1PP9D 3H25A 3B57A 3LBXA 4OYJA 4OFZA 2LXCB 3WAKA 1SQBJ 1AV1A 3MUDA 4I1LA 3CLQA 4H9OC 2KSRA 3ONXA 4ZI3C 2IW5B 2BG9B 1DX7A 3G71P 3CKDA 2E9XA 4PK5A 4LLHA 5F5WA 4QKNA 1UIXA 1GW3A 2KK7A 3WU2H 1CI6A 1GK6A 5AQUB 2JQ9A 3KV5A 1M57D 1FZCA 2W67A 2OYHA 1E5WA 4BRYA 3PU8A 3R2PA 2PP6A 3S4UA 1NU1K 3AE7A 2FYUK 3VP8A 3FXEA 5LHGB 5ETWA 3JCFA 3RPUA 2PGDA 3RYHE 4UF0A 4G2AA 4YHHT 4UV8B 2LKGA 2BS2A 3RK2D 3OAKA 2XQ6A 2X0HA 2K3WA 4V1Av 1VDFA 2UU9T 3Q2YA 4Y99B 1SE7A 1WCRA 5AW7B 5LMNT 3DJBA 3D6ZA 1OW6A 3CWBG 4IHJE 2I8DA 1G1JA 4ILBA 4AKRB 2KLVA 4UXNB 1J2JB 2X9WA 3AA0B 4O8SA 2BVLA 3CX5I 4RESB 5J2TE 2KYVA 3FZMB 3MIWA 3B8EB 3O4XE 3ZYMA 2YU2A 3UIAA 1LNQA 1EZVD 5GTHE 4A7PA 1NTME 4Z90A 1N7SB 3RH3A 4JQ0D 1YTZT 3L73E 1K05A 4DR1T 4HFVA 2E74C 4UEMA 4JI2T 4PK6A 1P84H 2WSFJ 3PUVF 4JI4T 5FXVA 5KMGP 3V4QA 2J58A 2H7VC 2W00A 5AVZB 2CEAA 3CC2P 1NTZG 1NWQA 5LGTB 4DUYT 2K5BB 1OWAA 5C39A 1A02J 1YXRA 3MK7C 4C91A 4F6RC 5AVTB 1SQPG 2Q3EA 1L0NG 3N5LA 3Q5XA 2V6YA 3EDVA 1JO5A 2V8SV 2A2FX 2LR2A 2WDQA 3B5NC 4O2BE 2ACZA 3N2KE 3LJCA 3L72G 3C4ZA 1KNRA 1YIJP 5CCGC 3RGLA 1W2BO 2OTKE 4GYSA 2E76C 3TGUJ 3M3ZB 1ZP0A 4QH5A 1KB9E 3AE5C 2XQ3A 3K5BA 1KILB 2KOGA 2NW8A 1JTHB 3BQIA 4DBQA 2G8YA 3GHGC 2N1TC 4H9NC 5KLIB 1HS7A 4GKGA 1Y9BA 2XAGB 1L0LD 3CCVP 1SQVD 1BCCE 1M1KQ 5ADXL 2V5DA 4GOUA 2J59M 5EFWB 1FMWA 3LK3B 3M9BA 3IAOA 2D0UA 4DZOA 2JWAA 4N78D 4PFPA 3L73J 1QUUA 2YXQB 2LM9A 3PE0A 1H0TB 2X51A 1BE3D 2Q3IA 3F31A 1USDA 3BASA 1YBKA 3H1HG 4YSZA 3C9IA 3LK2B 3HE5B 2NWBA 4UB8H 5LP6E 3RHWA 1E7PA 1UURA 2LSGA 2NP9A 4HEAA 3H1KG 3H1IG 2HPLA 3L74G 3V2NA 2V7KA 1FS0E 2AXCA 3HRNA 3CC7P 3B13A 3VRBA 2RP4A 4EEBA 2K9JB 2FJDA 2Y9ZA 5APYA 2A45H 2DWKA 3C8VA 2XASB 3GF3A 1JY3N 4D6TG 4IT4A 2IZ1A 5KLVK 1M8OB 4ILAA 4QXHB 3CMEP 4KUMB 2WDVA 3UUNA 1MMGA 5L4HA 1ZRTD 3QH9A 2QE7H 2HH7A 2XUEA 4ASKA 4DV7T 3ZYLA 1EXJA 3D71A 2WSCH 5JR9A 3ZC0A 4GK5E 5JREA 1HR0T 2BS3A 5FL1A 5H6QB 4YSXA 3F5HA 3X1DA 2N1GA 1HNXT 4KI0F 1BCCJ 3RX6A 4GT1A 4I7ZB 4DR6T 1BSHA 2MAWA 1OEDE 2ZXXA 4IOIH 3BCCG 3KBUA 4AQFC 4PJMA 4WWIA 4LF7T 1Y01A 1BDDA 2JO1A 2OGUA 4GYRA 3CD6P 3H1JD 3EUHA 1SFCD 5KJ7C 3MACA 4AIUA 3ZMZB 2W62A 1QSDA 4LFAT 5HWXA 3SWYA 1RY3A 4W80A 1A02F 1SQXD 2E74B 2QJYC 2IZ0A 4X1KE 3AEGA 2MOZA 2KP8A 3RQWA 5KAFE 3MZWB 2PG8A 3AE8C 2XQ4A 3RK3E 1Q82Q 4YFSA 4A5XA 2M3BA 3ETUA 2IBZE 3CXHI 2KZ7B 2Q9QD 2X0YA 3RLFF 1SFCA 4ERRA 3SFDA 3P4PA 1FBMA 4MN4C 4B86A 1SQQG 3A5XA 4IE7A 4QXBB 4HFHA 4QH1A 4PJLA 2FYNC 4IL6H 2ZT9C 5AQTB 3CI9A 4QXCB 1KD1Q 3DP7A 1MIYA 2YNYA 4ADZA 2H89C 2KLQA 2BEQD 1ZMEC 2P2UA 1Z56A 1FZAA 3KPEA 2EHOC 1TU3F 2AE9A 2WTYA 2H8PD 3NMDA 4OGQD 2E76B 2WSEH 3AE6C 1IFMA 3UULA 2QG4A 1J5ET 2DWGA 2Q9QA 3ZDMA 1D1AA 4WY4C 5APXA 4Z1MH 3PJAJ 4JI3T 4C7NB 2CPSA 2N1TB 1YQ3C 1DD3A 3L3PA 2JMHA 1J1JA 4IFMA 3CX8B 2ZM2A 2E8IA 1FZEA 2YIUC 2FXOA 1VQ6P 1PFIA 1VOMA 4IIJE 1KNZA 2F4VT 4OHFA 2JR8A 3AE9C 3KZIH 1FZGA 1M1JA 3WUTA 4PV1C 4L5GA 3MZKB 1S5LE 4AQGA 2XQ7A 2BZBA 2VURA 2CXDA 3AXJB 4YTMA 1NTMD 5DJTB 1OFCX 3NRXA 3A8YC 4LMJA 1YHQP 5AW8B 4JI8T 3S9OA 1NU1G 3L36A 2ZFCA 2FYUG 2E42A 1YTZI 4WVZA 2R6GF 4N3YB 2POHA 2CMRA 4OK0A 3V5UA 3HR0A 4DR3T 2A06E 3HD7A 3OJAB 4PJJA 4H0LC 3UUBA 5BR8T 3CC4P 2LEHA 3A2AA 3RYIE 3ZSTA 1KTMA 4AQRD 3T97A 5IYZE 1MNDA 2BG9E 5LMUT 3GN5B 2O1JA 4LF8T 2V7LA 3BQKA 3L71D 2WSCJ 4IDZA 2D0TA 3MKDA 2B87A 4UVAB 1NOHA 1Y8AA 3PP5A 2W2UA 3G3ZA 4X5TA 2L8KA 5AVUB 5JDMA 4L76A 5B5EH 2LSIA 3SOLA 2QM7A 2WWVA 4GKKT 1G1IA 4P1NA 2LJLA 3TLWA 2WU5A 2X9YA 1NTZE 3AEDA 4UVBB 2E75C 3V5BA 2GK9A 4BXLA 3F2EA 2M5AA 1SQPE 1GU5A 1L0NE 2B1EA 4CI2B 3MJXA 2KUBA 5CBOA 1ZR4A 1FDIA 3L72E 1JOCA 2NPSD 3PUAA 4CN4A 2BKOA 1QL2A 4G63A 3ANWB 1PIXA 2NW9A 4I50E 2QJYB 3EQ2A 4LF9T 5HEHA 1JNMA 5AW1B 3N4XA 4HKAA 2FYZA 2X68A 2A9UA 3VR8A 1N73A 1DEEG 1SS1A 4JEHB 1RF1C 2YEVC 3OA7A 1IFIA 2R3CA 5GONE 1Z8UA 3CX5D 5FYMA 2ZT9B 2PFVA 2LSJA 1XWMA 1KQSO 4YXWH 3AAAB 5LGNB 1L0VA 1AQTA 3H1KE 2LOSA 1GL2B 2IYPA 5IHYA 4H44C 3C51A 4HTEA 5H2FE 4EIJA 1J1DC 1PP9J 2XZRA 5FXWA 2K3RA 1BGYD 1L4AB 4WY4B 3ETVA 3I1AA 4YY3T 3C64A 1LT9A 1HFAA 1PZQA 2WQYC 4KHPT 4PJ0H 4D6TE 1PPJG 2RMZA 5JVDE 3Q5PA 3PU3A 3CQCB 2XDJA 1DEBA 3PTRB 3A0BH 3JCUH 4AKGA 4COFA 1URQC 2K1AA 3ITKA 3P7IA 2XM2A 3MTUE 4GIWA 3R6NA 2XJ7A 3HUSA 4PV1B 3CIRA 4ZOLE 2KB7P 3ZT6A 4WBNE 4CN1A 1KMIZ 3UU6A 1HBWA 3NZQA 1OVVA 5C2TA 2KI7B 5CCHC 4UELA 5M1BA 4MLKA 1JUNA 5KLVG 1SVFA 3LIEA 1L2PA 2O01J 3BCCE 3E22E 2Y8DA 4BJMA 3FWLA 1VQ5P 3O1JA 5FL0A 3PJAA 4GOEA 3RK3D 2CHOA 4HKZH 4H0LB 3VYIA 3OTOT 3VKGA 4U3CA 1N33T 4XBFB 2ZYAA 4KX6A 1HX8A 2KWIB 5AFUL 1VF5C 4DJGA 3H3AA 3W68A 1K8AQ 2IFNA 2FFDA 1USEA 2FBWA 3L75G 1VL2A 2Q5UA 1S1CX 5FKYA 4U2ZA 3UQ7A 3VR9A 4YTPC 2O3JA 3AECC 3HTKB 4D6TJ 3L4FA 3KQGA 2FXMA 2KS1B 1YYCA 4QX7B 1FMVA 2WM9A 1QX8A 4O9BA 4HJGH 1GTWA 4PD4E 3U3IA 3IF8B 3AEEA 4N78E 2FJEA 1KYOI 1S2EA 2E75B 2OA5A 2YKQA 1FDMA 1LKXA 4NIQA 2ES0A 2XAJB 2JEEA 4FI5A 1HTJF 1NENA 3NWIA 1N7SC 1N8RQ 1KQGB 5HXHA 2BCCG 3VRAA 1HF8A 4QWNB 3VKHA 2GA1A 3UUXB 5ABFB 5AQVB 1LTJA 2Q9IA 3H3MA 3TNUA 2WSFH 2IAKA 3CWBD 5ABHA 1XZYA 5GTIE 1AQ5A 4DBRA 2A06D 1ZRTE 2YMKA 3CCJP 2M3EA 1IK9A 3Q5WA 1RF1B 4JUYA 1JEKA 3E08A 2WDRA 2V7JA 1YITP 3EVYA 1SQVJ 4E7ZA 3I56P 1NU1E 3P8CE 4AKIA 5AW4B 2FYUE 3PUGA 3VP9A 3ZLIA 3CX6B 4WBAA 4HYTB 1B7TA 5KLIC 3B4SA 4YJ3E 2C0SA 5L3BB 5LOVE 1BE3J 2YOEA 3HKCE 2VB6A 5AQQB 2V6XA 1L0LK 2BG9A 1WR0A 3RQUA 4U7JA 2IYOA 1NTZD 5GTHH 1HF9A 3H1JE 1MIWA 3AVRA 1RE4C 2K9YA 4OH8B 2XV5A 1JNRA 3LW5J 2NOXA 4ILUA 1EQ7A 4XFJA 5LBQB 2PFXA 3AE4C 2WU2A 1SQPD 1URQB 1L0ND 1BR0A 3M0DA 5KAIE 1M62A 5IWAT 4EB6E 1MFTA 4GIFA 1SQXE 2XNXA 3L72D 2ZJSE 5HXEA 4XE5B 3A0HE 2C9NY 2WVRA 4CPGA 2JWDA 5C3JA 1HUCA 1SQBK 4QX8B 1ZOYC 1YW0A 4DMWA 1I6ZA 2CLYC 2A45G 1NTKG 2D2CB 3HKDE 2QA7A 2VKOA 1E79H 2VKJA 1NGMB 5TJHA 1NKNA 3CPWO 3RIUC 4H63V 5LB7B 2E2AA 2IUBA 1G2CB 1YQ4C 3VMXA 1VF5B 2LOPA 2LE8A 3RIFA 3O6QA 1IC2A 3EFFK 3N2GE 3H1HD 2KWHA 3CWZB 1KB9H 5FY0A 3A7MA 5L47A 4EGWA 2E9XB 1LVKA 4I7ZC 2NZ2A 3H1KD 3H1ID 4TN7B 4HE8A 1CUNA 1BR2A 3L74D 5AQRB 1VCSA 1WFDA 2JDIH 1CI6B 3NFQA 1V9DA 2ZAEB 5M4YA 3H1JJ 1NO4A 3Q3DA 2M6BA 1ZKEA 2UUBT 4AI6A 4U31A 4JI0T 1VQOP 3FB2A 1SUMB 2C9LY 4UB6E 3RRCA 3UU5A 1FZCB 2V7QH 1EDIA 4D6TD 4BRYB 3T8OA 5L3FB 3D70A 2BDEA 4CXWA 3LSVA 1SQXJ 2Z6EA 4KMCA 4J2CA 3N9LA 2XQ5A 1RE3C 3FXEB 4K0KT 4UV9B 3RI5A 1OW8A 4EEDA 3IEEA 5JR9C 4U3FE 1P84I 2Y0EA 1YI2P 1T6AA 1KILD 4X65T 4RJTA 2IFMA 2YKPA 2BS4A 4NPPA 1JY2N 2LSKA 3WMM0 1VQ8P 3TSIA 4DNDA 1ZR2A 4PW8A 2VK9A 4IE5A 2OV9A 2IPPA 1PPJE 3BCCD 1IFNA 4X20E 1JMMA 3L71E 3MA9A 1CZQA 2QJPB 2RPAA 2XU6A 3C50A 4WYVA 2HLOA 5FVKA 4HWIB 1KILA 5HCMA 3RBXA 3FZLB 1GK4A 4ZI3D 1JTHA 2Y0DA 4HH2A 4IDPA 2WSSV 2MPKA 3L39A 1VQNP 3L70G 4HWCA 3L8RA 2FXPA 2WP9A 3JC6C 5JRCB 1UIIA 3GW6A 3AEAA 3UU3A 1VRBA 3AEGC 3G4SP 1K04A 1GZLA 4I55E 3HE5A 4X62T 4JF7A 3ZJ2A 2AXDS 2WY2A 4PD4D 1NTMJ 2KNCA 3AEFC 4C7RA 3Q5RA 2K37A 4U3FJ 2K88A 2PRRA 1WR6A 2CCQA 1SA0E 2RA1A 3WUUA 2QJKC 2H7HA 2K9JA 2V6YB 3I0OA 1NHLA 2OYOA 5LGUB 4AYCA 2HR3A 1U4QA 5APTA 4DV3T 5KAFH 4DV6T 3FXDA 4K35A 2CRBA 3PV0F 4HWFA 2KSEA 2XAHB 1AA0A 1T3UA 2A45I 2WZIA 2YDSA 3U1CA 2C5IT 3L71J 2JQKA 3H32B 4LMKA 5JH7E 2CLYB 2HODB 4ASWA 3J9X1 1W0AA 3AA7B 4O4IE 4EOZB 3IFMA 3JADA 3CX5E 3V2PA 1KC8Q 3ONLC 4DR2T 1M1JC 3H1LG 5LXTE 5AQSB 1N34T 4I2LC 4HGAA 1XNQT 3QK6A 2B76A 3RRWA 4OWFA 3OYZA 2BCCE 2KLUA 4AKLA 3N9MA 5LHIB 2E74D 3RF1A 4EXTA 2HN1A 2P1JA 4HFDA 2J5UA 1OIPA 2OQQA 2X9XA 3V2QA 4Q25A 1BGYE 1JY3P 1NU1D 3P8CD 3PRJA 1MMDA 1FAVA 1E2AA 4X64T 2FYUD 5JDGA 1K9MQ 2V7QJ 1RF0C 3CCSP 3SS1A 1MV8A 3R4YA 3HD7C 3GF7A 3KDPB 2IHR1 5APQA 4ZI2C 1S5LH 3FZHB 5APUA 4M1PA 2BVMA 3B5ND 3ONJA 3AE2C 2WT7B 3J7Yq 2Y9YA 5CCGD 1KF6A 1GMJA 2E76D 4KP3C 5JR9B 2JJ9A 3KHUA 5EK3A 3CQGB 2N1TD 4TV8E 2DL1A 3PUQA 2DI4A 1LTAC 2LHNA 1YKEB 3N7NA 3F57A 2UXNB 3OKQA 5AQMB 3EWKA 2XQ8A 2NTYA 1N32T 3B5NA 1JNZA 5FY1A 4HB1A 3K1SA 5CCGA 3RC3A 2Z5IA 3JAFA 1S35A 1IZNB 3AE5A 5HEOA 5JDFA 3KDSE 3NKZA 3RKGA 2YKSA 4JI7T 4C7NA 1LTBC 4PJNA 1BGYJ 5AVSB 2OARA 3GHGA 2N1TA 4MBQA 3RKOA 2UXDT 3ZCJA 3VU7H 1VQ7P 3UUMA 1GL2C 2CE7A 2RKLA 2BBJA 2BEZF 2NRGA 4H63H 1W09A 2UXBT 1L4AC 2WPQA 1NTKE 5LCYA 4JEUB 3SFEC 5HEUA 3A3YB 5KXJA 3AXJA 2AXTE 3IHRA 3TF5A 3ABVA 4LFCT 3IR9A 3KXDA 2ZM8A 4LF6T 1S4XA 1SQBG 4U7IA 1IJ5A 1X79B 3KV9A 1PGJA 4Z8XA 2K48A 2P67A 2OYIC 2VVNA 2JJLA 2ACXA 2QJKB 5CB4E 3Q9DA 3L37A 4U3FD 1XMQT 4EYUA 2YINA 2HPCB 2X67A 4JPZB 3GN5A 1GD2E 4BJNA 4IL9A 1RH5B 2RN0A 3CWBE 1HG2A 2Y48B 2DLRA 2FJAA 2JP3A 5FMNA 1AVOA 2O01H 3LDQB 1SP4A 4R4MA 1PPJD 1XMOT 3CCRP 3PJSK 1XDOA 3QB5K 4ZZBA 4IFFA 2HG5D 5KJ7D 1YJWP 4LC1A 2LKHA 4GDOA 4JBZA 1M1JB 3M65A 3AEBC 2I1JA 2LHRA 3CQXC 3EABA 3PUWF 3BRTB 3M9HA 4OGQB 2D5UA 3MGNA 2L3LA 5H2FH 1NTKJ 2CHNA 5HWYA 1NAFA 4YXDC 1OEDC 3CX7B 4P0BA 2P10A 2HHHT 1M56D 1AJ3A 1EZVI 1IFPA 2ZYDA 5AQIB 2XQAA 4JBWF 2NR4A 3N2OA 4CI3B 2XQ9A 2VASA 5KJ7A 4KHXA 1ZN5A 3U59A 5L4EA 2XHEB 1G8XA 3CXHE 3OYXA 2WSSH 3EHZA 5ABEA 5B66E 5APVA 3HD7B 2VQFT 3V4WA 2CWOA 2ZT9D 2WCAA 3T97B 1HJ0A 3RYCE 4U2YA 2W6JH 3QNUA 2IIUA 3FBLA 4A97A 1QL1A 2EHOD 1EDKA 3V6IA 3AE8A 2FBWC 1Q2NA 2M8RA 2B87B 3CWBJ 1PGQA 5FVLA 3T1YT 4GODA 3KV4A 1K73Q 3VMYA 5JDNA 4HFBA 4H9QC 4WY4D 3CCUP 1HCIA 2P58A 2H88C 2H43A 1IBLT 3RL0g 1WMKA 4GKJT 3P4RA 4CXXA 2BKNA 1LWUC 3P8MC 3FGAD 5CJ5A 2H89A 4ZS2A 2KT9A 1Q81Q 2P9BA 4X1IE 2EHOA 5L3EB 4UIGA 5FNVE 2NPSA 2WAUA 2WB5A 4PV1D 3KINB 4EIWA 3PDYA 3AE6A 3H1HE 5LNKA 3N9NA 3AE1C 4WY4A 2VQET 2Q7CA 4ZS3A 4YSYA 2V4HA 1T2KC 2BCCD 2IDBA 1D0ZA 1YQ3A 3VMZA 1X22A 3H1IE 3PUZF 3TGUG 3L74E 1LTJC 1NTZJ 2WZ7A 2D2SA 5AW6B 1H8AA 3RL0C 4PD4H 5KTBA 4LMLA 4JYBA 1FOSE 3AE9A 1SQPJ 1LP1A 4H0LD 5DABA 1L0NJ 2RH0A 3TLTA 1M90Q 1HH0A 5FXXA 4JI6T 2LKMA 3L72J 3ZEFB 3H1LE 1T98A 3WAJA 2WMMA 3L73G 2FUPA 3AB3B 3LW5H 1KILE 2VRSA 3O8ZA 2E5LT 3A5TA 1FEWA 2OYIB 2G3AA 3H37A 4TWDA 4WBOA 4EI2A 3IA3A 3CVRA 4I43B 2KMFA 1WYBA 1T8BA 3RBZA 4U33A 4IL6X 2W66A 4O2AE 5FP3A 5GTIH 1FC2C 3AA6B 1ZV4X 2D2CC 4NPDA 2J62A 2E75D 2IC9A 3H1HJ 1LT9B 3RC8A 3OBVE 3AA1B 1HGZA 5F8PA 1ZHCA 1T7SA 2DNXA 3AE3C 4GK0E 1Q7YQ 2XQYA 2HN2A 2LT3A 3H1KJ 5AQHB 3H1IJ 5HAXA 1YJ9P 5AQKB 4TWHA 5CGMA 3MUDC 2W0GA 3L74J 1W2EA 5LG3A 5TISE 2HPJA 5L2LA 2E9XC 2MBGA 4AKHA 3B71A 5E79E 1OEDB 1BCCG 1ZXGA 1LTSC 2R3SA 5HEGA 2Y0CA 3II6A 4CQIA 4H13C 4C46A 1FZCC 2YK0A 1NEKA 4KHZF 2OYHC 1NTKD 2E43A 1SQQE 3SWHA 1VQPP 5EZYE 4TWFA 5TAOA 5JTGA 1O3XA 3AE7C 5KAIH 1UCUA 3NTNA 4WB4A 2XAQB 2ZM6T 2X9HA 1LJ2A 5AVWB 2MJZA 1FJPA 1EC5A 3A0HH 1HWTC 2YMYA 2A72A 2V7IA 4H44D 3V5SA 2Q6QA 3BCCJ 3TLSA 1QGKB 3ZT7A 3IN6A 1NJIQ 1IJ6A 2CBJA 2YU1A 3O1IA 3W15B 1RF1A 5BU5A 4DOJA 3RK3B 1X9BA 5JDHA 3HE4B 3O1HA 3ZYKA 3S4RA 4EV6A 1LWUB 2C5KT 2KZJA 4KJMA 2B88A 2IMLA 2WS3A 2QJPC 2MTQA 1URQD 2IC6A 1NYHA 1VQ4P 5J2UE 5CA0E 3HKEE 2WZHA 1DH3A 3TLVA 2LLYA 1QEXA 2Y6XA 3HA4A 5AQGB 2M67A 1H89A 3KFWX 2WITA 3NZPA 3RK2C 1WYCA 3AVSA 4DMVA 5CCHD 4JYAT 3U78A 2GUSA 5AVXB 5HCJA 1KORA 1LTJB 1SQQJ 2DCFA 1PV3A 3CCLP 4UB6H 2SPZA 3RL0B 1URQA 5KKZB 2PJQA 1SQVK 1VF5D 2MYSA 1XTCC 2LXBA 3CXHD 4XA4A 5CCHA 5LBMA 1U7JA 3BVHA 2CK3H 2UWJE 4H9PC 1SLQA 3MP7B 3H6PA 4TNVA 1LTIC 3L70D 3W67A 1Q86Q 5LG4A 1NAYA 4LF4T 3SRZA 1Y64B 1QLBA 2OTJP 5APSA 1ZP0C 1OX3A 2IBZG 4ILCA 3MD0A 3UU4A 1G2CA 1LTTC 1ZV8A 1BDCA 4ZXLA 5L3DB 1MZ9A 1FOSF 3LFMA 3C1LA 5AW5B 1RQUA 5CJ4A 2ZM0A 3FBZA 1N2DC 3ZMVB 4YPCA 1KNPA 5CFBA 1KYOE 4YTPA 1HTLC 1JY3O 3AECA 2V7MA 1N7SD 3PUSA 1KB9I 3WUVA 1NU1J 3LBXB 3VTPC 4B6XA 2FYUJ 4YJ2E 1EXIA 1FU1A 4DR7T 3FWNA 5AVYB 1QLED 1HJBA 4L73A 5CBNA 3LK42 4ZMDA 4CXYA 1RQVA 3GA8A 4IDOA 4X1YE 2XKMA 5EK4A 1FDOA 4DO0A 1W9RA 2YDQA 2KIKA 4AQYT 5CA1E 1N7SA 4H13B 2I0MA 4BAYB 3EFGA 3GG2A 2OYHB 4R4LA 1PGOA 1R5SA 4IL4A 2YO3A 3RYFE 5DJUB 3N9OA 5L3GB 3ZPOA 4DV2T 1N36T 5CJ0A 4I0UA 4MHCA 3H1LD 1JMBA 2O01N 1S9KE 1DD4A 1LTGC 3QOFA 1LGHB 4I4TE 3O6QB 4IDQA 2B89A 3TGUE 1OZHA 4XAXB 4NXNT 1UUSA 4UF0B 4DCKA 2J1DG 4X66T 1SQXK 2A06G 3CCQP 3N9QA 3S1KA 2N9YB 2QGSA 1T3JA 1UGOA 4L9IA 2KZIA 3CX5H 5JRCA 2QSIA 3AAEB 2VL8A 1GU4A 4EAHA 3NXSA 3Q1MA 4AUWA 4DV4T 5LJMA 1FE6A 2A3DA 4DR5T 1JY2P 2DHRA 4KBMB 3ZKRA 4IE6A 4UR9A 1NWMX 2QVAA 3ZN1B 3RK2B 5AVQB 5A1LA 5J0ZA 3WU2E 5LHHB 4FJOA 5KLVE 1HNWT 1IAPA 3N9PA 5DQWA 5LYJE 3FZFB 4ZKPA 3NRYA 1RE4A 1PP9G 1IBMT 4P09A 1H0TA 3KV6A 1R5LA 3AE4A 2QEXP 3ZCIA 1MUUA 2J4GA 1OMIA 2ZVNB 1SFCC 3SFDC 2K24A 3K8PC 5L8RJ 1SQQD 3CMLA 4TNWA 1HNZT 1MKMA 5APWA 5AQOB 2LRKA 3OPCA 1WRDA 4DV5T 2W6BA 4JYCA 1EDJA 4ZEYA 3L75E 4PFOA 2CPBA 3H32A 4U7YA 1ZOYA 3FHNA 3JAEA 2HODA 1ZEEA 1NTMK 2IBZI 1EDLA 1LT1A 4Z91A 1MIVA 5AW9B 1HGVA 2QA4P 4GOFA 3RIUA 2Q9QC 1UK5A 4BWNA 1JCCA 3KVAA 4HFEA 1YQ4A 1IK7A 2NTXA 4OYKA 2GUVA 3I5CA 1BR4A 1U5PA 2AEJA 4PNIA 4WZXA 1SHZC 3KYQA 3ABVC 3ZSSA 1LVFA 2MKVA 1KZUB 4JLEA 2KNCB 4BA9A 3IF4A 4B3ST 4B3RT 3PUYF 1U57A 5KLVJ 2W90A 4L0RA 1R8IA 5JDQA 1SQBD 2OLTA 2CXFA 1KQLA 4OGQC 3D6YA 3CL3D 3HKBE 1P84E 2HFED 3UQ4A 1KK7A 3G06A 5E0OA 3NVOA 4XZCA 1ZLLA 1YD8G 3E1RA 1WLXA 1GDTA 3M0AA 3FXDB 4DVDA 5CMZA 3E0ZA 1EZVG 2AXTH 5AQJB 3T1HT 3CMAP 3CCEP 1RE3A 2WT7A 4ZKUA 1JCDA 3U1AA 2CPTA 2L9QA 3BK9A 3L75J 3K3OA 1CW5A 4HWDA 3Q2MA 1DU2A 4OVNF 1HVVA 4EYYQ 1DIPA 4B3TT 2AEFA 1D1BA 3GMIA 1R8EA 2AEMA 3JC6D 1D0XA 1OW7A 2M0BA 3ZMUB 2JRKA 2VKHA 3I0QA 3I55P 4PAGA 2WMNA 3ESLA 2IDOB 1NH4A 5IUXA 3ZT5A 3Q5SA 4A56A 2P7JA 5AW3B 4NUVA 2XNDH 2WPVB 1PGPA 4AXPA 3AEDC 4Y28J 2BCCJ 2UUCT 4UVCB 4AISA 2UXXB 4C90A 2XSAA 5DJQC 2E5TA 4UB8E 4K3AA 1KYOD 4JI5T 5AQNB 4QHOA 4ZHQE 1QVGO 1BSNA 1IJDB 3NBXX 1QVFO 5CHXA 3UTKA 5BVZA 1L0LG 2QYWA 1SQVG 5HEJA 1IBKT 1S3JA 2BBHA 1KFYA 3SWKA 2J47A 1NVOA 5AVRB 4M3LA 3QWOC 3ZC1A 3AEFA 1J1EC 3EDUA 3IBPA 1PL5A 4EOTA 4L75A 4I6MC 4LFBT 5AW2B 3CXHH 1X79A 3EI0A 5B66H 1MMNA 3AAIA 1BE3G 2HYNA 3V2RA 1IFDA 4L74A 4YHJA 4HFCA 2JQQA 2K9AA 4NPEA 1N73C 2V1DB 1SFCB 2LRLA 3B5NB 1KV4A 2JQHA 5FY7A 2D9DA 2SPCA 3UFGA 3WI3A 2HPCA 2NPSC 1KEYA 1VQMP 3Q5EA 1FZFA 1FJGT 2Q1KA 5KX5E 4QH4A 2JPFA 1Q90D 1JB0J 1IO4A 5LJNA 3GHGB 1S9KD 3OJAA 1UX5A 2YXRB 5HXCA 3TGUD 2H7OA 3C4WA 3TYYA 5AVVB 2Q9QB 2B9BA 2JMKA 1W5CE 2QRXA 3HD7D 1LT9C 2H3RA 3VOPA 4HFIA 1N7LA 4ZI2D 4IE4A 1T8ZA 2V5CA 3VHLA 4EZ4A 3L73D 4H9SE 2Z5HA 1FJKA 1W0BA 3MXZA 2N2NA 3HUSC 2OTLP 1X0TA 5F3JA 3UU8A 1LRZA 4AQFA 1RF0A 3P7KA 2JKVA 1E1HB 2CBIA 5KLVD 3M91A 2WPSA 3MHVA 2W8ZA 2X66A 3HI2A 4EZHA 4ISTA 3H1JG 2VWAA 2KXPB 3DTOA 3AE2A 1NTKK 4IL6E 4TX5A 3ANWA 4NPFX 3KVBA 2WWUA 4TLFA 1SQXG 5H6RB 1ZW0A 3LG7A 5K5GB 4O4HE 3L70E 2FFDC 1KB9D 1GL2D 2VKDA 3F89A 4JI1T 2O1KA 4IE0A 3L75D 3I9WA 1VQKP 2W83C 2VVSA 2IX7C 5BU8B 4CI1B 5AQPB 2CM0A 1L4AD 1PP9E 4WW0A 1BCCD 3RK3C 3ZN0B 2XSBA 2YKOA 3C98B 3M06A 3ZMTB 3SWFA 2I1KA 2LSYA 1UX4A 2W63A 1OVRA 3KZIE 3E1IA 5AQLB 5ABGA 3BQLA 3PHLA 2UUAT 3AEEC 4PK4A 3USSA 3PUXF 2L91A 3PURA 1GL2A 4LGDE 2XPKA 2PBIA 4TZ4C 2R44A 3OW2O 1AJYA 5TISH 5DQVA 2CA5A 3O9XA 4P0AA 2M5AB 1KFNA 4NXMT 1S94A 5KDMC 5FXZA 1XDPA 2E5VA 1L4AA 2C0XA 5E79H 3SFEA 5HXSA 4DV1T 4PD4I 3LIDA 3FX0A 2GM4A 1GW4A 4RKUJ 1AVYA 1P84D 2WWWA 2WPRA 2KSJA 3SSUA 4NUUA 1S5LX 2M6IA 1J1EB 4HN9A 5KKZC 4TV9E 2FYNB 1H7CA 2ZXEB 1D7MA 4H9RC 5C8YE 1XNRT 2OYIA 1EZ3A 3L70J 1NTMG 3RIAA 3FZKB 4N6JA 2XZEA 3JC22 1NTZK 1N73B 4EDFA 2WSEJ 2EHOB 4U3FG 5JQGE 2G0UA 3G6EP 2NPSB 3E7KA 2ODUA 4DR4T 3TDKA 1RHZB 4IGUA 1YKHB 3TK1A 2R5DA 1SQPK 1YJNP 1L0NK 1WT6A 3CCMP 3KBTA 3K3NA 1MNEA 4ASVA 1GQEA 5B5EE 3BATA 4ANJA 1H88A 2ZLYA 3OVUA 3GMAA 3L35A 1D0YA 3L09A 2YIUB 4ZNCA 4IDNA 1EZVE 2Z4EA 4IREA 4TT3H 3L71G 3PH0A 3AEBA 3B5MA 3I9YA 1LP1B 1CHUA 2BG9C 5HXRA
chains in the Genus database with same CATH topology
2WMOA 2N9DA 1Z0PA 4ISSA 5JDLA 3HL6A 4EYYR 3HTKA 2ODVA 2XTLA 3R84B 4IFDK 4K0UA 3M0DC 3HUSB 3D0TA 3ZMSB 1AFOA 2W61A 2PAJA 4U74A 1XTGB 2X0LB 3K3QC 2R5BA 3P32A 1FIOA 2BASA 3UT5E 5J1GA 2ZMAA 4O4JE 2R32A 2FKWB 3QC9A 1X8YA 4Y99C 5AW0B 1M7LA 1T2KD 5L3CB 3HE4A 1FZBA 2FFDB 3BRVB 1LWUA 5EK2A 2I59A 3RL0D 1CSBA 2KNDA 5LA6E 1JY2O 2N9BA 3C4XA 1KFMA 3TKLB 1G73A 2V26A 3CPZA 3ZJ1A 2C0WA 2KINB 2CXLA 4YLHA 5BMVE 1MFZA 2WBLA 4O4LE 1VPCA 4ZI7E 4MALA 2QM8A 2CWYA 2L5GB 1OXZA 1IFJA 1D1CA 3QUJA 1WRGA 2YO2A 2W27A 4CZZB 2W6AA 3TNUB 3VN0A 4W7ZA 1N86A 2XAFB 2C5JA 4TUYE 4W7YA 1SQQK 4U72A 1KILC 2NW7A 1MMAA 2E9XD 1J1DB 1X9VA 1HG5A 4MFRA 3A7OA 1BR1A 1NKZB 5HYAA 3GWHA 4E7SA 3M9QA 1US7B 3UFEA 3B57A 3LBXA 4OYJA 4OFZA 3WAKA 3MUDA 4I1LA 3CLQA 4H9OC 3ONXA 4ZI3C 2IW5B 1DX7A 3CKDA 2E9XA 4PK5A 4LLHA 4QKNA 1GW3A 1CI6A 1GK6A 3KV5A 1FZCA 2OYHA 1E5WA 3PU8A 3R2PA 2PP6A 3S4UA 1NU1K 2FYUK 3VP8A 5LHGB 5ETWA 3RPUA 3RYHE 4UF0A 4G2AA 4UV8B 3RK2D 3OAKA 4V1Av 1VDFA 4Y99B 5AW7B 3DJBA 4IHJE 1G1JA 4AKRB 2KLVA 4UXNB 1J2JB 2X9WA 3AA0B 4O8SA 2BVLA 4RESB 5J2TE 2KYVA 3MIWA 3B8EB 3O4XE 3ZYMA 2YU2A 3UIAA 1N7SB 3RH3A 1YTZT 4HFVA 4UEMA 4PK6A 5FXVA 5KMGP 3V4QA 2J58A 2H7VC 2W00A 5AVZB 2CEAA 1NWQA 5LGTB 2K5BB 1OWAA 1A02J 3MK7C 4C91A 4F6RC 5AVTB 3N5LA 3Q5XA 3EDVA 1JO5A 2A2FX 3B5NC 4O2BE 3N2KE 3LJCA 3C4ZA 5CCGC 4GYSA 4WNKA 1KILB 2KOGA 2NW8A 1JTHB 3BQIA 4DBQA 3GHGC 2N1TC 4H9NC 1HS7A 4GKGA 2XAGB 5ADXL 4GOUA 2J59M 1FMWA 3LK3B 3M9BA 2D0UA 4DZOA 4N78D 4PFPA 1QUUA 2LM9A 3PE0A 2X51A 2Q3IA 3F31A 3BASA 3C9IA 3LK2B 3HE5B 2NWBA 5LP6E 2LSGA 2NP9A 4HEAA 2HPLA 3V2NA 2V7KA 3HRNA 3B13A 2RP4A 5APYA 2A45H 2DWKA 2XASB 1JY3N 4QXHB 5KLVK 4KUMB 3UUNA 1MMGA 2HH7A 2XUEA 4ASKA 3ZYLA 2WSCH 5JR9A 3ZC0A 4GK5E 5JREA 5H6QB 2N1GA 3RX6A 4GT1A 3KBUA 4AQFC 4PJMA 4GYRA 3EUHA 1SFCD 5KJ7C 3MACA 3ZMZB 2W62A 1QSDA 5HWXA 3SWYA 1RY3A 4W80A 1A02F 4X1KE 2MOZA 2KP8A 2PG8A 4YFSA 2M3BA 3ETUA 2KZ7B 2Q9QD 1SFCA 4ERRA 1FBMA 4B86A 3A5XA 4IE7A 4QXBB 4PJLA 3CI9A 4QXCB 3DP7A 1MIYA 2YNYA 4ADZA 2KLQA 2P2UA 1Z56A 1FZAA 3KPEA 2EHOC 2WTYA 2H8PD 3NMDA 2WSEH 3UULA 1IFMA 2DWGA 2Q9QA 1D1AA 4WY4C 5APXA 4C7NB 2CPSA 2N1TB 3L3PA 2JMHA 4IFMA 3CX8B 2ZM2A 2E8IA 1FZEA 4IIJE 1PFIA 1VOMA 1KNZA 4OHFA 1FZGA 1M1JA 4L5GA 3MZKB 4AQGA 2BZBA 2CXDA 3NRXA 5AW8B 3L36A 2ZFCA 2E42A 1YTZI 4N3YB 2POHA 2CMRA 4OK0A 3V5UA 3HR0A 3HD7A 3OJAB 4PJJA 2LEHA 3A2AA 3RYIE 4AQRD 3T97A 5IYZE 1MNDA 3GN5B 2O1JA 2V7LA 3BQKA 4IDZA 2D0TA 3MKDA 4UVAB 1NOHA 3PP5A 3G3ZA 2L8KA 5AVUB 5JDMA 2LSIA 3SOLA 2QM7A 1G1IA 2LJLA 2X9YA 4UVBB 3V5BA 2GK9A 3F2EA 1GU5A 2B1EA 4CI2B 3MJXA 1ZR4A 1JOCA 2NPSD 3PUAA 1QL2A 4G63A 3ANWB 2NW9A 4I50E 3EQ2A 1JNMA 5AW1B 3N4XA 4HKAA 2FYZA 2X68A 1N73A 4JEHB 1RF1C 2YEVC 3OA7A 1IFIA 2R3CA 5GONE 5FYMA 2PFVA 2LSJA 3AAAB 5LGNB 2LOSA 1GL2B 5IHYA 3C51A 4HTEA 4EIJA 1J1DC 2XZRA 5FXWA 1L4AB 4WY4B 3ETVA 3I1AA 3C64A 1LT9A 1HFAA 5JVDE 3PU3A 3CQCB 2XDJA 1DEBA 3PTRB 4AKGA 1URQC 3P7IA 4GIWA 3MTUE 3R6NA 3HUSA 4ZOLE 2KB7P 4WBNE 1HBWA 3NZQA 5CCHC 4UELA 4MLKA 1JUNA 1SVFA 3LIEA 3E22E 2Y8DA 4BJMA 3O1JA 3RK3D 3VYIA 3VKGA 4XBFB 1HX8A 2KWIB 5AFUL 3H3AA 2IFNA 2FFDA 2Q5UA 3HTKB 3L4FA 3KQGA 2FXMA 1YYCA 4QX7B 1FMVA 2WM9A 4O9BA 1GTWA 3U3IA 3IF8B 4N78E 2OA5A 2YKQA 1FDMA 1LKXA 2ES0A 2XAJB 2JEEA 4FI5A 1HTJF 1N7SC 5HXHA 1HF8A 4QWNB 3VKHA 3UUXB 1LTJA 2Q9IA 3TNUA 2WSFH 2IAKA 1AQ5A 4DBRA 1IK9A 3Q5WA 1RF1B 4JUYA 3E08A 2V7JA 3EVYA 4E7ZA 3P8CE 4AKIA 5AW4B 3PUGA 3VP9A 3ZLIA 3CX6B 4WBAA 4HYTB 1B7TA 4YJ3E 2C0SA 5L3BB 5LOVE 3HKCE 2VB6A 1L0LK 1MIWA 3AVRA 1RE4C 4OH8B 2XV5A 2NOXA 4ILUA 1EQ7A 5LBQB 1URQB 1BR0A 3M0DA 4EB6E 4GIFA 2XNXA 5HXEA 4XE5B 2C9NY 1HUCA 1SQBK 4QX8B 1YW0A 4DMWA 2CLYC 2A45G 3HKDE 2QA7A 2VKOA 2VKJA 1NKNA 4H63V 1G2CB 3VMXA 2LOPA 2LE8A 1IC2A 3N2GE 2KWHA 3CWZB 5FY0A 2E9XB 1LVKA 4TN7B 4HE8A 1CUNA 1BR2A 1V9DA 1CI6B 3NFQA 5M4YA 1NO4A 1ZKEA 4AI6A 3FB2A 2C9LY 3RRCA 1FZCB 3T8OA 5L3FB 2BDEA 4CXWA 2Z6EA 4KMCA 4J2CA 3N9LA 3FXEB 1RE3C 4UV9B 3IEEA 5JR9C 1KILD 2IFMA 2YKPA 1JY2N 2LSKA 3WMM0 3TSIA 4DNDA 1ZR2A 4PW8A 2VK9A 4IE5A 2IPPA 1IFNA 4X20E 1JMMA 3MA9A 1CZQA 2XU6A 3C50A 2HLOA 1KILA 1GK4A 4ZI3D 1JTHA 4HH2A 2WSSV 3JC6C 5JRCB 1VRBA 1GZLA 4I55E 3HE5A 4JF7A 3ZJ2A 4C7RA 1WR6A 2CCQA 1SA0E 2RA1A 2H7HA 3I0OA 1NHLA 5LGUB 4AYCA 5APTA 2XAHB 1T3UA 2A45I 3U1CA 2C5IT 3H32B 5JH7E 2CLYB 2HODB 3J9X1 3AA7B 4O4IE 4EOZB 3IFMA 3V2PA 1M1JC 5LXTE 4I2LC 4HGAA 3QK6A 3RRWA 3OYZA 4AKLA 3N9MA 5LHIB 4EXTA 2P1JA 2X9XA 3V2QA 1JY3P 3P8CD 1MMDA 1FAVA 5JDGA 1RF0C 3SS1A 1MV8A 3HD7C 3KDPB 5APQA 4ZI2C 5APUA 4M1PA 2BVMA 3B5ND 2WT7B 3J7Yq 5CCGD 4KP3C 5JR9B 2JJ9A 5EK3A 3CQGB 2N1TD 4TV8E 3PUQA 2DI4A 1LTAC 2LHNA 1YKEB 3N7NA 3F57A 2UXNB 3OKQA 2NTYA 3B5NA 5FY1A 5CCGA 3RC3A 2Z5IA 1S35A 1IZNB 5JDFA 3KDSE 4C7NA 1LTBC 4PJNA 5AVSB 2OARA 3GHGA 2N1TA 4MBQA 3RKOA 3ZCJA 3VU7H 3UUMA 1GL2C 2CE7A 4H63H 1L4AC 2WPQA 5LCYA 4JEUB 3A3YB 3IHRA 3IR9A 2ZM8A 1IJ5A 1X79B 3KV9A 4Z8XA 2K48A 2P67A 2OYIC 2JJLA 2ACXA 5CB4E 3Q9DA 3L37A 4EYUA 2YINA 2HPCB 2X67A 3GN5A 1GD2E 4BJNA 1HG2A 2Y48B 2DLRA 5FMNA 2O01H 1SP4A 4IFFA 2HG5D 5KJ7D 4LC1A 1M1JB 3M65A 2I1JA 2LHRA 3CQXC 3BRTB 3M9HA 2D5UA 3MGNA 2L3LA 5HWYA 1NAFA 3CX7B 4P0BA 1AJ3A 3N2OA 4CI3B 2VASA 5KJ7A 4KHXA 1ZN5A 3U59A 2XHEB 1G8XA 3OYXA 5APVA 3HD7B 3V4WA 2CWOA 3RYCE 3FBLA 1QL1A 2EHOD 2M8RA 3KV4A 3VMYA 5JDNA 4H9QC 4WY4D 1HCIA 2H43A 4CXXA 1LWUC 3P8MC 4ZS2A 2KT9A 2P9BA 4X1IE 2EHOA 5L3EB 4UIGA 5FNVE 2NPSA 2WAUA 3KINB 4EIWA 3PDYA 5LNKA 3N9NA 4WY4A 2Q7CA 4ZS3A 1T2KC 1D0ZA 3VMZA 1LTJC 2WZ7A 2D2SA 5AW6B 1H8AA 3RL0C 5KTBA 4JYBA 1FOSE 5DABA 1HH0A 5FXXA 2LKMA 3ZEFB 1T98A 3WAJA 3AB3B 3LW5H 2VRSA 3O8ZA 3A5TA 1FEWA 2OYIB 3H37A 4WBOA 3CVRA 4I43B 2KMFA 1WYBA 5FP3A 4O2AE 3AA6B 1ZV4X 2IC9A 3RC8A 1LT9B 3OBVE 3AA1B 1HGZA 5F8PA 1ZHCA 2DNXA 4GK0E 2XQYA 2LT3A 5HAXA 2W0GA 1W2EA 2HPJA 5L2LA 2E9XC 2MBGA 4AKHA 1LTSC 3II6A 4CQIA 4C46A 1FZCC 2YK0A 2OYHC 2E43A 3SWHA 5EZYE 5TAOA 1O3XA 1UCUA 3NTNA 4WB4A 2XAQB 2X9HA 5AVWB 2MJZA 1FJPA 1HWTC 2YMYA 2A72A 2V7IA 3V5SA 1IJ6A 2YU1A 3O1IA 3W15B 1RF1A 5BU5A 4DOJA 3RK3B 5JDHA 3HE4B 3O1HA 3ZYKA 1LWUB 2C5KT 2MTQA 1URQD 2IC6A 5J2UE 5CA0E 3HKEE 1DH3A 2Y6XA 3HA4A 2M67A 3KFWX 1H89A 2WITA 3NZPA 3RK2C 1WYCA 3AVSA 4DMVA 5CCHD 3U78A 2GUSA 5AVXB 1LTJB 2DCFA 3RL0B 1URQA 2PJQA 1SQVK 2MYSA 1XTCC 4XA4A 5CCHA 5LBMA 3BVHA 4H9PC 1SLQA 3H6PA 1LTIC 5LG4A 3SRZA 1Y64B 5APSA 3MD0A 1G2CA 1LTTC 1ZV8A 5L3DB 1MZ9A 1FOSF 3LFMA 5AW5B 5CJ4A 2ZM0A 3FBZA 1N2DC 3ZMVB 1HTLC 1JY3O 2V7MA 1N7SD 3PUSA 3LBXB 3VTPC 4B6XA 4YJ2E 1FU1A 5AVYB 1HJBA 3LK42 4CXYA 3GA8A 4X1YE 2XKMA 5EK4A 4DO0A 5CA1E 1N7SA 4BAYB 3EFGA 2OYHB 2YO3A 3RYFE 3N9OA 5L3GB 3ZPOA 5CJ0A 4MHCA 1S9KE 1LTGC 4I4TE 1LGHB 4XAXB 4UF0B 2J1DG 1SQXK 3N9QA 2QGSA 1T3JA 4L9IA 5JRCA 3AAEB 2VL8A 1GU4A 4EAHA 3NXSA 4AUWA 5LJMA 2A3DA 1JY2P 2DHRA 4KBMB 4IE6A 1NWMX 3ZN1B 3RK2B 5AVQB 5A1LA 5LHHB 4FJOA 1IAPA 3N9PA 5DQWA 5LYJE 4ZKPA 3NRYA 1RE4A 4P09A 3KV6A 3ZCIA 1MUUA 1SFCC 2K24A 3K8PC 3CMLA 5APWA 1WRDA 2W6BA 4JYCA 4PFOA 2CPBA 3H32A 3FHNA 2HODA 1ZEEA 1NTMK 1MIVA 5AW9B 1HGVA 2Q9QC 1JCCA 3KVAA 2NTXA 4OYKA 2GUVA 3I5CA 1BR4A 1U5PA 4PNIA 1SHZC 3KYQA 1LVFA 1KZUB 4JLEA 4BA9A 4L0RA 5JDQA 2CXFA 1KQLA 3CL3D 3HKBE 2HFED 1KK7A 5E0OA 4XZCA 1ZLLA 1YD8G 1WLXA 1GDTA 3M0AA 3FXDB 4DVDA 5CMZA 3E0ZA 1RE3A 2WT7A 4ZKUA 1JCDA 3U1AA 2L9QA 3BK9A 3K3OA 1CW5A 3Q2MA 1HVVA 1D1BA 3GMIA 3JC6D 1D0XA 3ZMUB 2JRKA 2VKHA 3I0QA 4PAGA 2WMNA 3ESLA 1NH4A 4A56A 2P7JA 5AW3B 4NUVA 4AXPA 4UVCB 2UXXB 4C90A 5DJQC 4QHOA 4ZHQE 1IJDB 3NBXX 5CHXA 3UTKA 5BVZA 5AVRB 4M3LA 3ZC1A 1J1EC 3EDUA 3IBPA 4EOTA 4I6MC 5AW2B 1X79A 3AAIA 1MMNA 2HYNA 3V2RA 1IFDA 4YHJA 2JQQA 2K9AA 1N73C 2V1DB 1SFCB 3B5NB 5FY7A 2SPCA 3WI3A 2HPCA 2NPSC 1FZFA 5KX5E 2JPFA 1IO4A 5LJNA 3GHGB 1S9KD 3OJAA 1UX5A 5HXCA 2H7OA 3C4WA 3TYYA 5AVVB 2Q9QB 2JMKA 3HD7D 1LT9C 2H3RA 3VOPA 1N7LA 4ZI2D 4IE4A 1T8ZA 3VHLA 4EZ4A 4H9SE 2Z5HA 1FJKA 3MXZA 2N2NA 3HUSC 5F3JA 1LRZA 4AQFA 1RF0A 3P7KA 1E1HB 3M91A 2WPSA 2X66A 3HI2A 4EZHA 4ISTA 2VWAA 2KXPB 3DTOA 1NTKK 4TX5A 3ANWA 3KVBA 2WWUA 5H6RB 3LG7A 4O4HE 2FFDC 1GL2D 2VKDA 2O1KA 4IE0A 3I9WA 2IX7C 5BU8B 4CI1B 2CM0A 1L4AD 4WW0A 3RK3C 3ZN0B 2YKOA 3C98B 3M06A 3ZMTB 3SWFA 2I1KA 2LSYA 1UX4A 2W63A 3E1IA 3BQLA 4PK4A 3PURA 1GL2A 4LGDE 4TZ4C 2PBIA 5DQVA 2CA5A 3O9XA 4P0AA 1KFNA 1S94A 5KDMC 5FXZA 1L4AA 2C0XA 5HXSA 3LIDA 2GM4A 1GW4A 2WWWA 2WPRA 2KSJA 4NUUA 1J1EB 4HN9A 4TV9E 1H7CA 2ZXEB 4H9RC 5C8YE 2OYIA 1EZ3A 4N6JA 1NTZK 1N73B 2EHOB 5JQGE 2G0UA 2NPSB 2ODUA 4IGUA 1YKHB 3TK1A 2R5DA 1SQPK 1L0NK 1WT6A 3KBTA 3K3NA 1MNEA 3BATA 4ANJA 1H88A 2ZLYA 3L35A 1D0YA 3L09A 2Z4EA 3I9YA 1U4QA 5HXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4X A;  3HRN A;  3U1C A;  4I1L A;  1WT6 A;  1NKN A;  4N78 D;  5BU5 A;  5KTB A;  3P8C D;  3VP8 A;  4N3Y B;  2POH A;  3BAT A;  4GIF A;  3VP9 A;  3BAS A;  2JEE A;  3C9I A;  3OJA B;  1IC2 A;  4ZKU A;  3U1A A;  5BVZ A;  5BU8 B;  1X79 B;  4ZKP A;  3N7N A;  2FXM A;  3U59 A;  4O9B A; 
#chains in the Genus database with same CATH topology
 2WMO A;  3TLU A;  2N9D A;  1Z0P A;  2PTF A;  4ISS A;  3HL6 A;  5JDL A;  1VCT A;  4EYY R;  3HTK A;  2ITA A;  2ODV A;  2DW3 A;  1OED A;  2XTL A;  3R84 B;  4YXD A;  4F8H A;  4IFD K;  2KS1 A;  4DID B;  1J5W A;  1M7K A;  4K0U A;  3G9R A;  3M0D C;  1T72 A;  3HUS B;  2I6H A;  2QIW A;  2BKP A;  3D0T A;  3ZMS B;  1AFO A;  2W61 A;  2PAJ A;  4U74 A;  2IBZ D;  4RO0 A;  4CN6 A;  2YN6 A;  1VQ9 P;  1XTG B;  3PTZ A;  2X0L B;  3K3Q C;  3H1L J;  4JV5 T;  3Q5D A;  2R5B A;  3P32 A;  1S72 P;  1FIO A;  1JM0 A;  2BAS A;  1KQF B;  3GLM A;  1Y47 A;  5J1G A;  2ZMA A;  3UT5 E;  1HX1 B;  5ABF A;  4O4J E;  4WNK A;  2VL0 A;  2R32 A;  1OVU A;  2FKW B;  2JIW A;  3QC9 A;  1X8Y A;  4Y99 C;  2XY8 B;  3PLN A;  5AW0 B;  2H88 A;  1M7L A;  1T2K D;  5L3C B;  3HE4 A;  1FZB A;  1L0L E;  1SQV E;  2FFD B;  3QB5 A;  3BRV B;  1LWU A;  5EK2 A;  3P4W A;  2I59 A;  1I94 T;  3RL0 D;  1CSB A;  2KND A;  5LA6 E;  1JY2 O;  4PJ0 E;  3P4S A;  4DV0 T;  2UXC T;  2N9B A;  2E5Y A;  1BE3 E;  3C4X A;  4ZZC A;  1KYO H;  1KFM A;  3AE1 A;  3A0B E;  3JCU E;  3TKL B;  4OX9 T;  1G73 A;  2V26 A;  3CPZ A;  3ZJ1 A;  2C0W A;  4A98 A;  3P50 A;  2KIN B;  1SQB E;  2ZYG A;  2CXL A;  2XM1 A;  3CK6 A;  4YLH A;  5BMV E;  1MFZ A;  2WBL A;  4O4L E;  1VPC A;  4ZI7 E;  2FY8 A;  4KT0 J;  4MAL A;  2YDR A;  1BGY G;  2QM8 A;  2CWY A;  2L5G B;  2WQY A;  1OXZ A;  3P4Q A;  1IFJ A;  4DT0 A;  1D1C A;  3QUJ A;  1WRG A;  2ZVO B;  2YO2 A;  2W27 A;  4LF5 T;  2D2C D;  4CZZ B;  2LM2 A;  2W6A A;  3TNU B;  3VN0 A;  4W7Z A;  1N86 A;  2FJB A;  1VQL P;  2XAF B;  2C5J A;  4TUY E;  1L0L J;  5AQF B;  3EAM A;  1KN7 A;  4W7Y A;  1SQQ K;  4U72 A;  4YT0 A;  4YTN A;  1KIL C;  2NW7 A;  4DUZ T;  1MMA A;  4H44 B;  3RGU A;  1U7M A;  2E9X D;  1J1D B;  1X9V A;  1HG5 A;  4MFR A;  4HWH A;  3A7O A;  1BR1 A;  1NKZ B;  5HYA A;  3GWH A;  2W4X A;  3AEA C;  4E7S A;  3M9Q A;  3VMA A;  3AE3 A;  4QMA A;  1US7 B;  3JSV C;  4B3M T;  4H13 D;  3UFE A;  1PP9 D;  3H25 A;  3B57 A;  3LBX A;  4OYJ A;  4OFZ A;  2LXC B;  3WAK A;  1SQB J;  1AV1 A;  3MUD A;  4I1L A;  3CLQ A;  4H9O C;  2KSR A;  3ONX A;  4ZI3 C;  2IW5 B;  2BG9 B;  1DX7 A;  3G71 P;  3CKD A;  2E9X A;  4PK5 A;  4LLH A;  5F5W A;  4QKN A;  1UIX A;  1GW3 A;  2KK7 A;  3WU2 H;  1CI6 A;  1GK6 A;  5AQU B;  2JQ9 A;  3KV5 A;  1M57 D;  1FZC A;  2W67 A;  2OYH A;  1E5W A;  4BRY A;  3PU8 A;  3R2P A;  2PP6 A;  3S4U A;  1NU1 K;  3AE7 A;  2FYU K;  3VP8 A;  3FXE A;  5LHG B;  5ETW A;  3JCF A;  3RPU A;  2PGD A;  3RYH E;  4UF0 A;  4G2A A;  4YHH T;  4UV8 B;  2LKG A;  2BS2 A;  3RK2 D;  3OAK A;  2XQ6 A;  2X0H A;  2K3W A;  4V1A v;  1VDF A;  2UU9 T;  3Q2Y A;  4Y99 B;  1SE7 A;  1WCR A;  5AW7 B;  5LMN T;  3DJB A;  3D6Z A;  1OW6 A;  3CWB G;  4IHJ E;  2I8D A;  1G1J A;  4ILB A;  4AKR B;  2KLV A;  4UXN B;  1J2J B;  2X9W A;  3AA0 B;  4O8S A;  2BVL A;  3CX5 I;  4RES B;  5J2T E;  2KYV A;  3FZM B;  3MIW A;  3B8E B;  3O4X E;  3ZYM A;  2YU2 A;  3UIA A;  1LNQ A;  1EZV D;  5GTH E;  4A7P A;  1NTM E;  4Z90 A;  1N7S B;  3RH3 A;  4JQ0 D;  1YTZ T;  3L73 E;  1K05 A;  4DR1 T;  4HFV A;  2E74 C;  4UEM A;  4JI2 T;  4PK6 A;  1P84 H;  2WSF J;  3PUV F;  4JI4 T;  5FXV A;  5KMG P;  3V4Q A;  2J58 A;  2H7V C;  2W00 A;  5AVZ B;  2CEA A;  3CC2 P;  1NTZ G;  1NWQ A;  5LGT B;  4DUY T;  2K5B B;  1OWA A;  5C39 A;  1A02 J;  1YXR A;  3MK7 C;  4C91 A;  4F6R C;  5AVT B;  1SQP G;  2Q3E A;  1L0N G;  3N5L A;  3Q5X A;  2V6Y A;  3EDV A;  1JO5 A;  2V8S V;  2A2F X;  2LR2 A;  2WDQ A;  3B5N C;  4O2B E;  2ACZ A;  3N2K E;  3LJC A;  3L72 G;  3C4Z A;  1KNR A;  1YIJ P;  5CCG C;  3RGL A;  1W2B O;  2OTK E;  4GYS A;  2E76 C;  3TGU J;  3M3Z B;  1ZP0 A;  4QH5 A;  1KB9 E;  3AE5 C;  2XQ3 A;  3K5B A;  1KIL B;  2KOG A;  2NW8 A;  1JTH B;  3BQI A;  4DBQ A;  2G8Y A;  3GHG C;  2N1T C;  4H9N C;  5KLI B;  1HS7 A;  4GKG A;  1Y9B A;  2XAG B;  1L0L D;  3CCV P;  1SQV D;  1BCC E;  1M1K Q;  5ADX L;  2V5D A;  4GOU A;  2J59 M;  5EFW B;  1FMW A;  3LK3 B;  3M9B A;  3IAO A;  2D0U A;  4DZO A;  2JWA A;  4N78 D;  4PFP A;  3L73 J;  1QUU A;  2YXQ B;  2LM9 A;  3PE0 A;  1H0T B;  2X51 A;  1BE3 D;  2Q3I A;  3F31 A;  1USD A;  3BAS A;  1YBK A;  3H1H G;  4YSZ A;  3C9I A;  3LK2 B;  3HE5 B;  2NWB A;  4UB8 H;  5LP6 E;  3RHW A;  1E7P A;  1UUR A;  2LSG A;  2NP9 A;  4HEA A;  3H1K G;  3H1I G;  2HPL A;  3L74 G;  3V2N A;  2V7K A;  1FS0 E;  2AXC A;  3HRN A;  3CC7 P;  3B13 A;  3VRB A;  2RP4 A;  4EEB A;  2K9J B;  2FJD A;  2Y9Z A;  5APY A;  2A45 H;  2DWK A;  3C8V A;  2XAS B;  3GF3 A;  1JY3 N;  4D6T G;  4IT4 A;  2IZ1 A;  5KLV K;  1M8O B;  4ILA A;  4QXH B;  3CME P;  4KUM B;  2WDV A;  3UUN A;  1MMG A;  5L4H A;  1ZRT D;  3QH9 A;  2QE7 H;  2HH7 A;  2XUE A;  4ASK A;  4DV7 T;  3ZYL A;  1EXJ A;  3D71 A;  2WSC H;  5JR9 A;  3ZC0 A;  4GK5 E;  5JRE A;  1HR0 T;  2BS3 A;  5FL1 A;  5H6Q B;  4YSX A;  3F5H A;  3X1D A;  2N1G A;  1HNX T;  4KI0 F;  1BCC J;  3RX6 A;  4GT1 A;  4I7Z B;  4DR6 T;  1BSH A;  2MAW A;  1OED E;  2ZXX A;  4IOI H;  3BCC G;  3KBU A;  4AQF C;  4PJM A;  4WWI A;  4LF7 T;  1Y01 A;  1BDD A;  2JO1 A;  2OGU A;  4GYR A;  3CD6 P;  3H1J D;  3EUH A;  1SFC D;  5KJ7 C;  3MAC A;  4AIU A;  3ZMZ B;  2W62 A;  1QSD A;  4LFA T;  5HWX A;  3SWY A;  1RY3 A;  4W80 A;  1A02 F;  1SQX D;  2E74 B;  2QJY C;  2IZ0 A;  4X1K E;  3AEG A;  2MOZ A;  2KP8 A;  3RQW A;  5KAF E;  3MZW B;  2PG8 A;  3AE8 C;  2XQ4 A;  3RK3 E;  1Q82 Q;  4YFS A;  4A5X A;  2M3B A;  3ETU A;  2IBZ E;  3CXH I;  2KZ7 B;  2Q9Q D;  2X0Y A;  3RLF F;  1SFC A;  4ERR A;  3SFD A;  3P4P A;  1FBM A;  4MN4 C;  4B86 A;  1SQQ G;  3A5X A;  4IE7 A;  4QXB B;  4HFH A;  4QH1 A;  4PJL A;  2FYN C;  4IL6 H;  2ZT9 C;  5AQT B;  3CI9 A;  4QXC B;  1KD1 Q;  3DP7 A;  1MIY A;  2YNY A;  4ADZ A;  2H89 C;  2KLQ A;  2BEQ D;  1ZME C;  2P2U A;  1Z56 A;  1FZA A;  3KPE A;  2EHO C;  1TU3 F;  2AE9 A;  2WTY A;  2H8P D;  3NMD A;  4OGQ D;  2E76 B;  2WSE H;  3AE6 C;  1IFM A;  3UUL A;  2QG4 A;  1J5E T;  2DWG A;  2Q9Q A;  3ZDM A;  1D1A A;  4WY4 C;  5APX A;  4Z1M H;  3PJA J;  4JI3 T;  4C7N B;  2CPS A;  2N1T B;  1YQ3 C;  1DD3 A;  3L3P A;  2JMH A;  1J1J A;  4IFM A;  3CX8 B;  2ZM2 A;  2E8I A;  1FZE A;  2YIU C;  2FXO A;  1VQ6 P;  1PFI A;  1VOM A;  4IIJ E;  1KNZ A;  2F4V T;  4OHF A;  2JR8 A;  3AE9 C;  3KZI H;  1FZG A;  1M1J A;  3WUT A;  4PV1 C;  4L5G A;  3MZK B;  1S5L E;  4AQG A;  2XQ7 A;  2BZB A;  2VUR A;  2CXD A;  3AXJ B;  4YTM A;  1NTM D;  5DJT B;  1OFC X;  3NRX A;  3A8Y C;  4LMJ A;  1YHQ P;  5AW8 B;  4JI8 T;  3S9O A;  1NU1 G;  3L36 A;  2ZFC A;  2FYU G;  2E42 A;  1YTZ I;  4WVZ A;  2R6G F;  4N3Y B;  2POH A;  2CMR A;  4OK0 A;  3V5U A;  3HR0 A;  4DR3 T;  2A06 E;  3HD7 A;  3OJA B;  4PJJ A;  4H0L C;  3UUB A;  5BR8 T;  3CC4 P;  2LEH A;  3A2A A;  3RYI E;  3ZST A;  1KTM A;  4AQR D;  3T97 A;  5IYZ E;  1MND A;  2BG9 E;  5LMU T;  3GN5 B;  2O1J A;  4LF8 T;  2V7L A;  3BQK A;  3L71 D;  2WSC J;  4IDZ A;  2D0T A;  3MKD A;  2B87 A;  4UVA B;  1NOH A;  1Y8A A;  3PP5 A;  2W2U A;  3G3Z A;  4X5T A;  2L8K A;  5AVU B;  5JDM A;  4L76 A;  5B5E H;  2LSI A;  3SOL A;  2QM7 A;  2WWV A;  4GKK T;  1G1I A;  4P1N A;  2LJL A;  3TLW A;  2WU5 A;  2X9Y A;  1NTZ E;  3AED A;  4UVB B;  2E75 C;  3V5B A;  2GK9 A;  4BXL A;  3F2E A;  2M5A A;  1SQP E;  1GU5 A;  1L0N E;  2B1E A;  4CI2 B;  3MJX A;  2KUB A;  5CBO A;  1ZR4 A;  1FDI A;  3L72 E;  1JOC A;  2NPS D;  3PUA A;  4CN4 A;  2BKO A;  1QL2 A;  4G63 A;  3ANW B;  1PIX A;  2NW9 A;  4I50 E;  2QJY B;  3EQ2 A;  4LF9 T;  5HEH A;  1JNM A;  5AW1 B;  3N4X A;  4HKA A;  2FYZ A;  2X68 A;  2A9U A;  3VR8 A;  1N73 A;  1DEE G;  1SS1 A;  4JEH B;  1RF1 C;  2YEV C;  3OA7 A;  1IFI A;  2R3C A;  5GON E;  1Z8U A;  3CX5 D;  5FYM A;  2ZT9 B;  2PFV A;  2LSJ A;  1XWM A;  1KQS O;  4YXW H;  3AAA B;  5LGN B;  1L0V A;  1AQT A;  3H1K E;  2LOS A;  1GL2 B;  2IYP A;  5IHY A;  4H44 C;  3C51 A;  4HTE A;  5H2F E;  4EIJ A;  1J1D C;  1PP9 J;  2XZR A;  5FXW A;  2K3R A;  1BGY D;  1L4A B;  4WY4 B;  3ETV A;  3I1A A;  4YY3 T;  3C64 A;  1LT9 A;  1HFA A;  1PZQ A;  2WQY C;  4KHP T;  4PJ0 H;  4D6T E;  1PPJ G;  2RMZ A;  5JVD E;  3Q5P A;  3PU3 A;  3CQC B;  2XDJ A;  1DEB A;  3PTR B;  3A0B H;  3JCU H;  4AKG A;  4COF A;  1URQ C;  2K1A A;  3ITK A;  3P7I A;  2XM2 A;  3MTU E;  4GIW A;  3R6N A;  2XJ7 A;  3HUS A;  4PV1 B;  3CIR A;  4ZOL E;  2KB7 P;  3ZT6 A;  4WBN E;  4CN1 A;  1KMI Z;  3UU6 A;  1HBW A;  3NZQ A;  1OVV A;  5C2T A;  2KI7 B;  5CCH C;  4UEL A;  5M1B A;  4MLK A;  1JUN A;  5KLV G;  1SVF A;  3LIE A;  1L2P A;  2O01 J;  3BCC E;  3E22 E;  2Y8D A;  4BJM A;  3FWL A;  1VQ5 P;  3O1J A;  5FL0 A;  3PJA A;  4GOE A;  3RK3 D;  2CHO A;  4HKZ H;  4H0L B;  3VYI A;  3OTO T;  3VKG A;  4U3C A;  1N33 T;  4XBF B;  2ZYA A;  4KX6 A;  1HX8 A;  2KWI B;  5AFU L;  1VF5 C;  4DJG A;  3H3A A;  3W68 A;  1K8A Q;  2IFN A;  2FFD A;  1USE A;  2FBW A;  3L75 G;  1VL2 A;  2Q5U A;  1S1C X;  5FKY A;  4U2Z A;  3UQ7 A;  3VR9 A;  4YTP C;  2O3J A;  3AEC C;  3HTK B;  4D6T J;  3L4F A;  3KQG A;  2FXM A;  2KS1 B;  1YYC A;  4QX7 B;  1FMV A;  2WM9 A;  1QX8 A;  4O9B A;  4HJG H;  1GTW A;  4PD4 E;  3U3I A;  3IF8 B;  3AEE A;  4N78 E;  2FJE A;  1KYO I;  1S2E A;  2E75 B;  2OA5 A;  2YKQ A;  1FDM A;  1LKX A;  4NIQ A;  2ES0 A;  2XAJ B;  2JEE A;  4FI5 A;  1HTJ F;  1NEN A;  3NWI A;  1N7S C;  1N8R Q;  1KQG B;  5HXH A;  2BCC G;  3VRA A;  1HF8 A;  4QWN B;  3VKH A;  2GA1 A;  3UUX B;  5ABF B;  5AQV B;  1LTJ A;  2Q9I A;  3H3M A;  3TNU A;  2WSF H;  2IAK A;  3CWB D;  5ABH A;  1XZY A;  5GTI E;  1AQ5 A;  4DBR A;  2A06 D;  1ZRT E;  2YMK A;  3CCJ P;  2M3E A;  1IK9 A;  3Q5W A;  1RF1 B;  4JUY A;  1JEK A;  3E08 A;  2WDR A;  2V7J A;  1YIT P;  3EVY A;  1SQV J;  4E7Z A;  3I56 P;  1NU1 E;  3P8C E;  4AKI A;  5AW4 B;  2FYU E;  3PUG A;  3VP9 A;  3ZLI A;  3CX6 B;  4WBA A;  4HYT B;  1B7T A;  5KLI C;  3B4S A;  4YJ3 E;  2C0S A;  5L3B B;  5LOV E;  1BE3 J;  2YOE A;  3HKC E;  2VB6 A;  5AQQ B;  2V6X A;  1L0L K;  2BG9 A;  1WR0 A;  3RQU A;  4U7J A;  2IYO A;  1NTZ D;  5GTH H;  1HF9 A;  3H1J E;  1MIW A;  3AVR A;  1RE4 C;  2K9Y A;  4OH8 B;  2XV5 A;  1JNR A;  3LW5 J;  2NOX A;  4ILU A;  1EQ7 A;  4XFJ A;  5LBQ B;  2PFX A;  3AE4 C;  2WU2 A;  1SQP D;  1URQ B;  1L0N D;  1BR0 A;  3M0D A;  5KAI E;  1M62 A;  5IWA T;  4EB6 E;  1MFT A;  4GIF A;  1SQX E;  2XNX A;  3L72 D;  2ZJS E;  5HXE A;  4XE5 B;  3A0H E;  2C9N Y;  2WVR A;  4CPG A;  2JWD A;  5C3J A;  1HUC A;  1SQB K;  4QX8 B;  1ZOY C;  1YW0 A;  4DMW A;  1I6Z A;  2CLY C;  2A45 G;  1NTK G;  2D2C B;  3HKD E;  2QA7 A;  2VKO A;  1E79 H;  2VKJ A;  1NGM B;  5TJH A;  1NKN A;  3CPW O;  3RIU C;  4H63 V;  5LB7 B;  2E2A A;  2IUB A;  1G2C B;  1YQ4 C;  3VMX A;  1VF5 B;  2LOP A;  2LE8 A;  3RIF A;  3O6Q A;  1IC2 A;  3EFF K;  3N2G E;  3H1H D;  2KWH A;  3CWZ B;  1KB9 H;  5FY0 A;  3A7M A;  5L47 A;  4EGW A;  2E9X B;  1LVK A;  4I7Z C;  2NZ2 A;  3H1K D;  3H1I D;  4TN7 B;  4HE8 A;  1CUN A;  1BR2 A;  3L74 D;  5AQR B;  1VCS A;  1WFD A;  2JDI H;  1CI6 B;  3NFQ A;  1V9D A;  2ZAE B;  5M4Y A;  3H1J J;  1NO4 A;  3Q3D A;  2M6B A;  1ZKE A;  2UUB T;  4AI6 A;  4U31 A;  4JI0 T;  1VQO P;  3FB2 A;  1SUM B;  2C9L Y;  4UB6 E;  3RRC A;  3UU5 A;  1FZC B;  2V7Q H;  1EDI A;  4D6T D;  4BRY B;  3T8O A;  5L3F B;  3D70 A;  2BDE A;  4CXW A;  3LSV A;  1SQX J;  2Z6E A;  4KMC A;  4J2C A;  3N9L A;  2XQ5 A;  1RE3 C;  3FXE B;  4K0K T;  4UV9 B;  3RI5 A;  1OW8 A;  4EED A;  3IEE A;  5JR9 C;  4U3F E;  1P84 I;  2Y0E A;  1YI2 P;  1T6A A;  1KIL D;  4X65 T;  4RJT A;  2IFM A;  2YKP A;  2BS4 A;  4NPP A;  1JY2 N;  2LSK A;  3WMM 0;  1VQ8 P;  3TSI A;  4DND A;  1ZR2 A;  4PW8 A;  2VK9 A;  4IE5 A;  2OV9 A;  2IPP A;  1PPJ E;  3BCC D;  1IFN A;  4X20 E;  1JMM A;  3L71 E;  3MA9 A;  1CZQ A;  2QJP B;  2RPA A;  2XU6 A;  3C50 A;  4WYV A;  2HLO A;  5FVK A;  4HWI B;  1KIL A;  5HCM A;  3RBX A;  3FZL B;  1GK4 A;  4ZI3 D;  1JTH A;  2Y0D A;  4HH2 A;  4IDP A;  2WSS V;  2MPK A;  3L39 A;  1VQN P;  3L70 G;  4HWC A;  3L8R A;  2FXP A;  2WP9 A;  3JC6 C;  5JRC B;  1UII A;  3GW6 A;  3AEA A;  3UU3 A;  1VRB A;  3AEG C;  3G4S P;  1K04 A;  1GZL A;  4I55 E;  3HE5 A;  4X62 T;  4JF7 A;  3ZJ2 A;  2AXD S;  2WY2 A;  4PD4 D;  1NTM J;  2KNC A;  3AEF C;  4C7R A;  3Q5R A;  2K37 A;  4U3F J;  2K88 A;  2PRR A;  1WR6 A;  2CCQ A;  1SA0 E;  2RA1 A;  3WUU A;  2QJK C;  2H7H A;  2K9J A;  2V6Y B;  3I0O A;  1NHL A;  2OYO A;  5LGU B;  4AYC A;  2HR3 A;  1U4Q A;  5APT A;  4DV3 T;  5KAF H;  4DV6 T;  3FXD A;  4K35 A;  2CRB A;  3PV0 F;  4HWF A;  2KSE A;  2XAH B;  1AA0 A;  1T3U A;  2A45 I;  2WZI A;  2YDS A;  3U1C A;  2C5I T;  3L71 J;  2JQK A;  3H32 B;  4LMK A;  5JH7 E;  2CLY B;  2HOD B;  4ASW A;  3J9X 1;  1W0A A;  3AA7 B;  4O4I E;  4EOZ B;  3IFM A;  3JAD A;  3CX5 E;  3V2P A;  1KC8 Q;  3ONL C;  4DR2 T;  1M1J C;  3H1L G;  5LXT E;  5AQS B;  1N34 T;  4I2L C;  4HGA A;  1XNQ T;  3QK6 A;  2B76 A;  3RRW A;  4OWF A;  3OYZ A;  2BCC E;  2KLU A;  4AKL A;  3N9M A;  5LHI B;  2E74 D;  3RF1 A;  4EXT A;  2HN1 A;  2P1J A;  4HFD A;  2J5U A;  1OIP A;  2OQQ A;  2X9X A;  3V2Q A;  4Q25 A;  1BGY E;  1JY3 P;  1NU1 D;  3P8C D;  3PRJ A;  1MMD A;  1FAV A;  1E2A A;  4X64 T;  2FYU D;  5JDG A;  1K9M Q;  2V7Q J;  1RF0 C;  3CCS P;  3SS1 A;  1MV8 A;  3R4Y A;  3HD7 C;  3GF7 A;  3KDP B;  2IHR 1;  5APQ A;  4ZI2 C;  1S5L H;  3FZH B;  5APU A;  4M1P A;  2BVM A;  3B5N D;  3ONJ A;  3AE2 C;  2WT7 B;  3J7Y q;  2Y9Y A;  5CCG D;  1KF6 A;  1GMJ A;  2E76 D;  4KP3 C;  5JR9 B;  2JJ9 A;  3KHU A;  5EK3 A;  3CQG B;  2N1T D;  4TV8 E;  2DL1 A;  3PUQ A;  2DI4 A;  1LTA C;  2LHN A;  1YKE B;  3N7N A;  3F57 A;  2UXN B;  3OKQ A;  5AQM B;  3EWK A;  2XQ8 A;  2NTY A;  1N32 T;  3B5N A;  1JNZ A;  5FY1 A;  4HB1 A;  3K1S A;  5CCG A;  3RC3 A;  2Z5I A;  3JAF A;  1S35 A;  1IZN B;  3AE5 A;  5HEO A;  5JDF A;  3KDS E;  3NKZ A;  3RKG A;  2YKS A;  4JI7 T;  4C7N A;  1LTB C;  4PJN A;  1BGY J;  5AVS B;  2OAR A;  3GHG A;  2N1T A;  4MBQ A;  3RKO A;  2UXD T;  3ZCJ A;  3VU7 H;  1VQ7 P;  3UUM A;  1GL2 C;  2CE7 A;  2RKL A;  2BBJ A;  2BEZ F;  2NRG A;  4H63 H;  1W09 A;  2UXB T;  1L4A C;  2WPQ A;  1NTK E;  5LCY A;  4JEU B;  3SFE C;  5HEU A;  3A3Y B;  5KXJ A;  3AXJ A;  2AXT E;  3IHR A;  3TF5 A;  3ABV A;  4LFC T;  3IR9 A;  3KXD A;  2ZM8 A;  4LF6 T;  1S4X A;  1SQB G;  4U7I A;  1IJ5 A;  1X79 B;  3KV9 A;  1PGJ A;  4Z8X A;  2K48 A;  2P67 A;  2OYI C;  2VVN A;  2JJL A;  2ACX A;  2QJK B;  5CB4 E;  3Q9D A;  3L37 A;  4U3F D;  1XMQ T;  4EYU A;  2YIN A;  2HPC B;  2X67 A;  4JPZ B;  3GN5 A;  1GD2 E;  4BJN A;  4IL9 A;  1RH5 B;  2RN0 A;  3CWB E;  1HG2 A;  2Y48 B;  2DLR A;  2FJA A;  2JP3 A;  5FMN A;  1AVO A;  2O01 H;  3LDQ B;  1SP4 A;  4R4M A;  1PPJ D;  1XMO T;  3CCR P;  3PJS K;  1XDO A;  3QB5 K;  4ZZB A;  4IFF A;  2HG5 D;  5KJ7 D;  1YJW P;  4LC1 A;  2LKH A;  4GDO A;  4JBZ A;  1M1J B;  3M65 A;  3AEB C;  2I1J A;  2LHR A;  3CQX C;  3EAB A;  3PUW F;  3BRT B;  3M9H A;  4OGQ B;  2D5U A;  3MGN A;  2L3L A;  5H2F H;  1NTK J;  2CHN A;  5HWY A;  1NAF A;  4YXD C;  1OED C;  3CX7 B;  4P0B A;  2P10 A;  2HHH T;  1M56 D;  1AJ3 A;  1EZV I;  1IFP A;  2ZYD A;  5AQI B;  2XQA A;  4JBW F;  2NR4 A;  3N2O A;  4CI3 B;  2XQ9 A;  2VAS A;  5KJ7 A;  4KHX A;  1ZN5 A;  3U59 A;  5L4E A;  2XHE B;  1G8X A;  3CXH E;  3OYX A;  2WSS H;  3EHZ A;  5ABE A;  5B66 E;  5APV A;  3HD7 B;  2VQF T;  3V4W A;  2CWO A;  2ZT9 D;  2WCA A;  3T97 B;  1HJ0 A;  3RYC E;  4U2Y A;  2W6J H;  3QNU A;  2IIU A;  3FBL A;  4A97 A;  1QL1 A;  2EHO D;  1EDK A;  3V6I A;  3AE8 A;  2FBW C;  1Q2N A;  2M8R A;  2B87 B;  3CWB J;  1PGQ A;  5FVL A;  3T1Y T;  4GOD A;  3KV4 A;  1K73 Q;  3VMY A;  5JDN A;  4HFB A;  4H9Q C;  4WY4 D;  3CCU P;  1HCI A;  2P58 A;  2H88 C;  2H43 A;  1IBL T;  3RL0 g;  1WMK A;  4GKJ T;  3P4R A;  4CXX A;  2BKN A;  1LWU C;  3P8M C;  3FGA D;  5CJ5 A;  2H89 A;  4ZS2 A;  2KT9 A;  1Q81 Q;  2P9B A;  4X1I E;  2EHO A;  5L3E B;  4UIG A;  5FNV E;  2NPS A;  2WAU A;  2WB5 A;  4PV1 D;  3KIN B;  4EIW A;  3PDY A;  3AE6 A;  3H1H E;  5LNK A;  3N9N A;  3AE1 C;  4WY4 A;  2VQE T;  2Q7C A;  4ZS3 A;  4YSY A;  2V4H A;  1T2K C;  2BCC D;  2IDB A;  1D0Z A;  1YQ3 A;  3VMZ A;  1X22 A;  3H1I E;  3PUZ F;  3TGU G;  3L74 E;  1LTJ C;  1NTZ J;  2WZ7 A;  2D2S A;  5AW6 B;  1H8A A;  3RL0 C;  4PD4 H;  5KTB A;  4LML A;  4JYB A;  1FOS E;  3AE9 A;  1SQP J;  1LP1 A;  4H0L D;  5DAB A;  1L0N J;  2RH0 A;  3TLT A;  1M90 Q;  1HH0 A;  5FXX A;  4JI6 T;  2LKM A;  3L72 J;  3ZEF B;  3H1L E;  1T98 A;  3WAJ A;  2WMM A;  3L73 G;  2FUP A;  3AB3 B;  3LW5 H;  1KIL E;  2VRS A;  3O8Z A;  2E5L T;  3A5T A;  1FEW A;  2OYI B;  2G3A A;  3H37 A;  4TWD A;  4WBO A;  4EI2 A;  3IA3 A;  3CVR A;  4I43 B;  2KMF A;  1WYB A;  1T8B A;  3RBZ A;  4U33 A;  4IL6 X;  2W66 A;  4O2A E;  5FP3 A;  5GTI H;  1FC2 C;  3AA6 B;  1ZV4 X;  2D2C C;  4NPD A;  2J62 A;  2E75 D;  2IC9 A;  3H1H J;  1LT9 B;  3RC8 A;  3OBV E;  3AA1 B;  1HGZ A;  5F8P A;  1ZHC A;  1T7S A;  2DNX A;  3AE3 C;  4GK0 E;  1Q7Y Q;  2XQY A;  2HN2 A;  2LT3 A;  3H1K J;  5AQH B;  3H1I J;  5HAX A;  1YJ9 P;  5AQK B;  4TWH A;  5CGM A;  3MUD C;  2W0G A;  3L74 J;  1W2E A;  5LG3 A;  5TIS E;  2HPJ A;  5L2L A;  2E9X C;  2MBG A;  4AKH A;  3B71 A;  5E79 E;  1OED B;  1BCC G;  1ZXG A;  1LTS C;  2R3S A;  5HEG A;  2Y0C A;  3II6 A;  4CQI A;  4H13 C;  4C46 A;  1FZC C;  2YK0 A;  1NEK A;  4KHZ F;  2OYH C;  1NTK D;  2E43 A;  1SQQ E;  3SWH A;  1VQP P;  5EZY E;  4TWF A;  5TAO A;  5JTG A;  1O3X A;  3AE7 C;  5KAI H;  1UCU A;  3NTN A;  4WB4 A;  2XAQ B;  2ZM6 T;  2X9H A;  1LJ2 A;  5AVW B;  2MJZ A;  1FJP A;  1EC5 A;  3A0H H;  1HWT C;  2YMY A;  2A72 A;  2V7I A;  4H44 D;  3V5S A;  2Q6Q A;  3BCC J;  3TLS A;  1QGK B;  3ZT7 A;  3IN6 A;  1NJI Q;  1IJ6 A;  2CBJ A;  2YU1 A;  3O1I A;  3W15 B;  1RF1 A;  5BU5 A;  4DOJ A;  3RK3 B;  1X9B A;  5JDH A;  3HE4 B;  3O1H A;  3ZYK A;  3S4R A;  4EV6 A;  1LWU B;  2C5K T;  2KZJ A;  4KJM A;  2B88 A;  2IML A;  2WS3 A;  2QJP C;  2MTQ A;  1URQ D;  2IC6 A;  1NYH A;  1VQ4 P;  5J2U E;  5CA0 E;  3HKE E;  2WZH A;  1DH3 A;  3TLV A;  2LLY A;  1QEX A;  2Y6X A;  3HA4 A;  5AQG B;  2M67 A;  1H89 A;  3KFW X;  2WIT A;  3NZP A;  3RK2 C;  1WYC A;  3AVS A;  4DMV A;  5CCH D;  4JYA T;  3U78 A;  2GUS A;  5AVX B;  5HCJ A;  1KOR A;  1LTJ B;  1SQQ J;  2DCF A;  1PV3 A;  3CCL P;  4UB6 H;  2SPZ A;  3RL0 B;  1URQ A;  5KKZ B;  2PJQ A;  1SQV K;  1VF5 D;  2MYS A;  1XTC C;  2LXB A;  3CXH D;  4XA4 A;  5CCH A;  5LBM A;  1U7J A;  3BVH A;  2CK3 H;  2UWJ E;  4H9P C;  1SLQ A;  3MP7 B;  3H6P A;  4TNV A;  1LTI C;  3L70 D;  3W67 A;  1Q86 Q;  5LG4 A;  1NAY A;  4LF4 T;  3SRZ A;  1Y64 B;  1QLB A;  2OTJ P;  5APS A;  1ZP0 C;  1OX3 A;  2IBZ G;  4ILC A;  3MD0 A;  3UU4 A;  1G2C A;  1LTT C;  1ZV8 A;  1BDC A;  4ZXL A;  5L3D B;  1MZ9 A;  1FOS F;  3LFM A;  3C1L A;  5AW5 B;  1RQU A;  5CJ4 A;  2ZM0 A;  3FBZ A;  1N2D C;  3ZMV B;  4YPC A;  1KNP A;  5CFB A;  1KYO E;  4YTP A;  1HTL C;  1JY3 O;  3AEC A;  2V7M A;  1N7S D;  3PUS A;  1KB9 I;  3WUV A;  1NU1 J;  3LBX B;  3VTP C;  4B6X A;  2FYU J;  4YJ2 E;  1EXI A;  1FU1 A;  4DR7 T;  3FWN A;  5AVY B;  1QLE D;  1HJB A;  4L73 A;  5CBN A;  3LK4 2;  4ZMD A;  4CXY A;  1RQV A;  3GA8 A;  4IDO A;  4X1Y E;  2XKM A;  5EK4 A;  1FDO A;  4DO0 A;  1W9R A;  2YDQ A;  2KIK A;  4AQY T;  5CA1 E;  1N7S A;  4H13 B;  2I0M A;  4BAY B;  3EFG A;  3GG2 A;  2OYH B;  4R4L A;  1PGO A;  1R5S A;  4IL4 A;  2YO3 A;  3RYF E;  5DJU B;  3N9O A;  5L3G B;  3ZPO A;  4DV2 T;  1N36 T;  5CJ0 A;  4I0U A;  4MHC A;  3H1L D;  1JMB A;  2O01 N;  1S9K E;  1DD4 A;  1LTG C;  3QOF A;  1LGH B;  4I4T E;  3O6Q B;  4IDQ A;  2B89 A;  3TGU E;  1OZH A;  4XAX B;  4NXN T;  1UUS A;  4UF0 B;  4DCK A;  2J1D G;  4X66 T;  1SQX K;  2A06 G;  3CCQ P;  3N9Q A;  3S1K A;  2N9Y B;  2QGS A;  1T3J A;  1UGO A;  4L9I A;  2KZI A;  3CX5 H;  5JRC A;  2QSI A;  3AAE B;  2VL8 A;  1GU4 A;  4EAH A;  3NXS A;  3Q1M A;  4AUW A;  4DV4 T;  5LJM A;  1FE6 A;  2A3D A;  4DR5 T;  1JY2 P;  2DHR A;  4KBM B;  3ZKR A;  4IE6 A;  4UR9 A;  1NWM X;  2QVA A;  3ZN1 B;  3RK2 B;  5AVQ B;  5A1L A;  5J0Z A;  3WU2 E;  5LHH B;  4FJO A;  5KLV E;  1HNW T;  1IAP A;  3N9P A;  5DQW A;  5LYJ E;  3FZF B;  4ZKP A;  3NRY A;  1RE4 A;  1PP9 G;  1IBM T;  4P09 A;  1H0T A;  3KV6 A;  1R5L A;  3AE4 A;  2QEX P;  3ZCI A;  1MUU A;  2J4G A;  1OMI A;  2ZVN B;  1SFC C;  3SFD C;  2K24 A;  3K8P C;  5L8R J;  1SQQ D;  3CML A;  4TNW A;  1HNZ T;  1MKM A;  5APW A;  5AQO B;  2LRK A;  3OPC A;  1WRD A;  4DV5 T;  2W6B A;  4JYC A;  1EDJ A;  4ZEY A;  3L75 E;  4PFO A;  2CPB A;  3H32 A;  4U7Y A;  1ZOY A;  3FHN A;  3JAE A;  2HOD A;  1ZEE A;  1NTM K;  2IBZ I;  1EDL A;  1LT1 A;  4Z91 A;  1MIV A;  5AW9 B;  1HGV A;  2QA4 P;  4GOF A;  3RIU A;  2Q9Q C;  1UK5 A;  4BWN A;  1JCC A;  3KVA A;  4HFE A;  1YQ4 A;  1IK7 A;  2NTX A;  4OYK A;  2GUV A;  3I5C A;  1BR4 A;  1U5P A;  2AEJ A;  4PNI A;  4WZX A;  1SHZ C;  3KYQ A;  3ABV C;  3ZSS A;  1LVF A;  2MKV A;  1KZU B;  4JLE A;  2KNC B;  4BA9 A;  3IF4 A;  4B3S T;  4B3R T;  3PUY F;  1U57 A;  5KLV J;  2W90 A;  4L0R A;  1R8I A;  5JDQ A;  1SQB D;  2OLT A;  2CXF A;  1KQL A;  4OGQ C;  3D6Y A;  3CL3 D;  3HKB E;  1P84 E;  2HFE D;  3UQ4 A;  1KK7 A;  3G06 A;  5E0O A;  3NVO A;  4XZC A;  1ZLL A;  1YD8 G;  3E1R A;  1WLX A;  1GDT A;  3M0A A;  3FXD B;  4DVD A;  5CMZ A;  3E0Z A;  1EZV G;  2AXT H;  5AQJ B;  3T1H T;  3CMA P;  3CCE P;  1RE3 A;  2WT7 A;  4ZKU A;  1JCD A;  3U1A A;  2CPT A;  2L9Q A;  3BK9 A;  3L75 J;  3K3O A;  1CW5 A;  4HWD A;  3Q2M A;  1DU2 A;  4OVN F;  1HVV A;  4EYY Q;  1DIP A;  4B3T T;  2AEF A;  1D1B A;  3GMI A;  1R8E A;  2AEM A;  3JC6 D;  1D0X A;  1OW7 A;  2M0B A;  3ZMU B;  2JRK A;  2VKH A;  3I0Q A;  3I55 P;  4PAG A;  2WMN A;  3ESL A;  2IDO B;  1NH4 A;  5IUX A;  3ZT5 A;  3Q5S A;  4A56 A;  2P7J A;  5AW3 B;  4NUV A;  2XND H;  2WPV B;  1PGP A;  4AXP A;  3AED C;  4Y28 J;  2BCC J;  2UUC T;  4UVC B;  4AIS A;  2UXX B;  4C90 A;  2XSA A;  5DJQ C;  2E5T A;  4UB8 E;  4K3A A;  1KYO D;  4JI5 T;  5AQN B;  4QHO A;  4ZHQ E;  1QVG O;  1BSN A;  1IJD B;  3NBX X;  1QVF O;  5CHX A;  3UTK A;  5BVZ A;  1L0L G;  2QYW A;  1SQV G;  5HEJ A;  1IBK T;  1S3J A;  2BBH A;  1KFY A;  3SWK A;  2J47 A;  1NVO A;  5AVR B;  4M3L A;  3QWO C;  3ZC1 A;  3AEF A;  1J1E C;  3EDU A;  3IBP A;  1PL5 A;  4EOT A;  4L75 A;  4I6M C;  4LFB T;  5AW2 B;  3CXH H;  1X79 A;  3EI0 A;  5B66 H;  1MMN A;  3AAI A;  1BE3 G;  2HYN A;  3V2R A;  1IFD A;  4L74 A;  4YHJ A;  4HFC A;  2JQQ A;  2K9A A;  4NPE A;  1N73 C;  2V1D B;  1SFC B;  2LRL A;  3B5N B;  1KV4 A;  2JQH A;  5FY7 A;  2D9D A;  2SPC A;  3UFG A;  3WI3 A;  2HPC A;  2NPS C;  1KEY A;  1VQM P;  3Q5E A;  1FZF A;  1FJG T;  2Q1K A;  5KX5 E;  4QH4 A;  2JPF A;  1Q90 D;  1JB0 J;  1IO4 A;  5LJN A;  3GHG B;  1S9K D;  3OJA A;  1UX5 A;  2YXR B;  5HXC A;  3TGU D;  2H7O A;  3C4W A;  3TYY A;  5AVV B;  2Q9Q B;  2B9B A;  2JMK A;  1W5C E;  2QRX A;  3HD7 D;  1LT9 C;  2H3R A;  3VOP A;  4HFI A;  1N7L A;  4ZI2 D;  4IE4 A;  1T8Z A;  2V5C A;  3VHL A;  4EZ4 A;  3L73 D;  4H9S E;  2Z5H A;  1FJK A;  1W0B A;  3MXZ A;  2N2N A;  3HUS C;  2OTL P;  1X0T A;  5F3J A;  3UU8 A;  1LRZ A;  4AQF A;  1RF0 A;  3P7K A;  2JKV A;  1E1H B;  2CBI A;  5KLV D;  3M91 A;  2WPS A;  3MHV A;  2W8Z A;  2X66 A;  3HI2 A;  4EZH A;  4IST A;  3H1J G;  2VWA A;  2KXP B;  3DTO A;  3AE2 A;  1NTK K;  4IL6 E;  4TX5 A;  3ANW A;  4NPF X;  3KVB A;  2WWU A;  4TLF A;  1SQX G;  5H6R B;  1ZW0 A;  3LG7 A;  5K5G B;  4O4H E;  3L70 E;  2FFD C;  1KB9 D;  1GL2 D;  2VKD A;  3F89 A;  4JI1 T;  2O1K A;  4IE0 A;  3L75 D;  3I9W A;  1VQK P;  2W83 C;  2VVS A;  2IX7 C;  5BU8 B;  4CI1 B;  5AQP B;  2CM0 A;  1L4A D;  1PP9 E;  4WW0 A;  1BCC D;  3RK3 C;  3ZN0 B;  2XSB A;  2YKO A;  3C98 B;  3M06 A;  3ZMT B;  3SWF A;  2I1K A;  2LSY A;  1UX4 A;  2W63 A;  1OVR A;  3KZI E;  3E1I A;  5AQL B;  5ABG A;  3BQL A;  3PHL A;  2UUA T;  3AEE C;  4PK4 A;  3USS A;  3PUX F;  2L91 A;  3PUR A;  1GL2 A;  4LGD E;  2XPK A;  2PBI A;  4TZ4 C;  2R44 A;  3OW2 O;  1AJY A;  5TIS H;  5DQV A;  2CA5 A;  3O9X A;  4P0A A;  2M5A B;  1KFN A;  4NXM T;  1S94 A;  5KDM C;  5FXZ A;  1XDP A;  2E5V A;  1L4A A;  2C0X A;  5E79 H;  3SFE A;  5HXS A;  4DV1 T;  4PD4 I;  3LID A;  3FX0 A;  2GM4 A;  1GW4 A;  4RKU J;  1AVY A;  1P84 D;  2WWW A;  2WPR A;  2KSJ A;  3SSU A;  4NUU A;  1S5L X;  2M6I A;  1J1E B;  4HN9 A;  5KKZ C;  4TV9 E;  2FYN B;  1H7C A;  2ZXE B;  1D7M A;  4H9R C;  5C8Y E;  1XNR T;  2OYI A;  1EZ3 A;  3L70 J;  1NTM G;  3RIA A;  3FZK B;  4N6J A;  2XZE A;  3JC2 2;  1NTZ K;  1N73 B;  4EDF A;  2WSE J;  2EHO B;  4U3F G;  5JQG E;  2G0U A;  3G6E P;  2NPS B;  3E7K A;  2ODU A;  4DR4 T;  3TDK A;  1RHZ B;  4IGU A;  1YKH B;  3TK1 A;  2R5D A;  1SQP K;  1YJN P;  1L0N K;  1WT6 A;  3CCM P;  3KBT A;  3K3N A;  1MNE A;  4ASV A;  1GQE A;  5B5E E;  3BAT A;  4ANJ A;  1H88 A;  2ZLY A;  3OVU A;  3GMA A;  3L35 A;  1D0Y A;  3L09 A;  2YIU B;  4ZNC A;  4IDN A;  1EZV E;  2Z4E A;  4IRE A;  4TT3 H;  3L71 G;  3PH0 A;  3AEB A;  3B5M A;  3I9Y A;  1LP1 B;  1CHU A;  2BG9 C;  5HXR A; 
#chains in the Genus database with same CATH homology
 2WMO A;  2N9D A;  1Z0P A;  4ISS A;  5JDL A;  3HL6 A;  4EYY R;  3HTK A;  2ODV A;  2XTL A;  3R84 B;  4IFD K;  4K0U A;  3M0D C;  3HUS B;  3D0T A;  3ZMS B;  1AFO A;  2W61 A;  2PAJ A;  4U74 A;  1XTG B;  2X0L B;  3K3Q C;  2R5B A;  3P32 A;  1FIO A;  2BAS A;  3UT5 E;  5J1G A;  2ZMA A;  4O4J E;  2R32 A;  2FKW B;  3QC9 A;  1X8Y A;  4Y99 C;  5AW0 B;  1M7L A;  1T2K D;  5L3C B;  3HE4 A;  1FZB A;  2FFD B;  3BRV B;  1LWU A;  5EK2 A;  2I59 A;  3RL0 D;  1CSB A;  2KND A;  5LA6 E;  1JY2 O;  2N9B A;  3C4X A;  1KFM A;  3TKL B;  1G73 A;  2V26 A;  3CPZ A;  3ZJ1 A;  2C0W A;  2KIN B;  2CXL A;  4YLH A;  5BMV E;  1MFZ A;  2WBL A;  4O4L E;  1VPC A;  4ZI7 E;  4MAL A;  2QM8 A;  2CWY A;  2L5G B;  1OXZ A;  1IFJ A;  1D1C A;  3QUJ A;  1WRG A;  2YO2 A;  2W27 A;  4CZZ B;  2W6A A;  3TNU B;  3VN0 A;  4W7Z A;  1N86 A;  2XAF B;  2C5J A;  4TUY E;  4W7Y A;  1SQQ K;  4U72 A;  1KIL C;  2NW7 A;  1MMA A;  2E9X D;  1J1D B;  1X9V A;  1HG5 A;  4MFR A;  3A7O A;  1BR1 A;  1NKZ B;  5HYA A;  3GWH A;  4E7S A;  3M9Q A;  1US7 B;  3UFE A;  3B57 A;  3LBX A;  4OYJ A;  4OFZ A;  3WAK A;  3MUD A;  4I1L A;  3CLQ A;  4H9O C;  3ONX A;  4ZI3 C;  2IW5 B;  1DX7 A;  3CKD A;  2E9X A;  4PK5 A;  4LLH A;  4QKN A;  1GW3 A;  1CI6 A;  1GK6 A;  3KV5 A;  1FZC A;  2OYH A;  1E5W A;  3PU8 A;  3R2P A;  2PP6 A;  3S4U A;  1NU1 K;  2FYU K;  3VP8 A;  5LHG B;  5ETW A;  3RPU A;  3RYH E;  4UF0 A;  4G2A A;  4UV8 B;  3RK2 D;  3OAK A;  4V1A v;  1VDF A;  4Y99 B;  5AW7 B;  3DJB A;  4IHJ E;  1G1J A;  4AKR B;  2KLV A;  4UXN B;  1J2J B;  2X9W A;  3AA0 B;  4O8S A;  2BVL A;  4RES B;  5J2T E;  2KYV A;  3MIW A;  3B8E B;  3O4X E;  3ZYM A;  2YU2 A;  3UIA A;  1N7S B;  3RH3 A;  1YTZ T;  4HFV A;  4UEM A;  4PK6 A;  5FXV A;  5KMG P;  3V4Q A;  2J58 A;  2H7V C;  2W00 A;  5AVZ B;  2CEA A;  1NWQ A;  5LGT B;  2K5B B;  1OWA A;  1A02 J;  3MK7 C;  4C91 A;  4F6R C;  5AVT B;  3N5L A;  3Q5X A;  3EDV A;  1JO5 A;  2A2F X;  3B5N C;  4O2B E;  3N2K E;  3LJC A;  3C4Z A;  5CCG C;  4GYS A;  4WNK A;  1KIL B;  2KOG A;  2NW8 A;  1JTH B;  3BQI A;  4DBQ A;  3GHG C;  2N1T C;  4H9N C;  1HS7 A;  4GKG A;  2XAG B;  5ADX L;  4GOU A;  2J59 M;  1FMW A;  3LK3 B;  3M9B A;  2D0U A;  4DZO A;  4N78 D;  4PFP A;  1QUU A;  2LM9 A;  3PE0 A;  2X51 A;  2Q3I A;  3F31 A;  3BAS A;  3C9I A;  3LK2 B;  3HE5 B;  2NWB A;  5LP6 E;  2LSG A;  2NP9 A;  4HEA A;  2HPL A;  3V2N A;  2V7K A;  3HRN A;  3B13 A;  2RP4 A;  5APY A;  2A45 H;  2DWK A;  2XAS B;  1JY3 N;  4QXH B;  5KLV K;  4KUM B;  3UUN A;  1MMG A;  2HH7 A;  2XUE A;  4ASK A;  3ZYL A;  2WSC H;  5JR9 A;  3ZC0 A;  4GK5 E;  5JRE A;  5H6Q B;  2N1G A;  3RX6 A;  4GT1 A;  3KBU A;  4AQF C;  4PJM A;  4GYR A;  3EUH A;  1SFC D;  5KJ7 C;  3MAC A;  3ZMZ B;  2W62 A;  1QSD A;  5HWX A;  3SWY A;  1RY3 A;  4W80 A;  1A02 F;  4X1K E;  2MOZ A;  2KP8 A;  2PG8 A;  4YFS A;  2M3B A;  3ETU A;  2KZ7 B;  2Q9Q D;  1SFC A;  4ERR A;  1FBM A;  4B86 A;  3A5X A;  4IE7 A;  4QXB B;  4PJL A;  3CI9 A;  4QXC B;  3DP7 A;  1MIY A;  2YNY A;  4ADZ A;  2KLQ A;  2P2U A;  1Z56 A;  1FZA A;  3KPE A;  2EHO C;  2WTY A;  2H8P D;  3NMD A;  2WSE H;  3UUL A;  1IFM A;  2DWG A;  2Q9Q A;  1D1A A;  4WY4 C;  5APX A;  4C7N B;  2CPS A;  2N1T B;  3L3P A;  2JMH A;  4IFM A;  3CX8 B;  2ZM2 A;  2E8I A;  1FZE A;  4IIJ E;  1PFI A;  1VOM A;  1KNZ A;  4OHF A;  1FZG A;  1M1J A;  4L5G A;  3MZK B;  4AQG A;  2BZB A;  2CXD A;  3NRX A;  5AW8 B;  3L36 A;  2ZFC A;  2E42 A;  1YTZ I;  4N3Y B;  2POH A;  2CMR A;  4OK0 A;  3V5U A;  3HR0 A;  3HD7 A;  3OJA B;  4PJJ A;  2LEH A;  3A2A A;  3RYI E;  4AQR D;  3T97 A;  5IYZ E;  1MND A;  3GN5 B;  2O1J A;  2V7L A;  3BQK A;  4IDZ A;  2D0T A;  3MKD A;  4UVA B;  1NOH A;  3PP5 A;  3G3Z A;  2L8K A;  5AVU B;  5JDM A;  2LSI A;  3SOL A;  2QM7 A;  1G1I A;  2LJL A;  2X9Y A;  4UVB B;  3V5B A;  2GK9 A;  3F2E A;  1GU5 A;  2B1E A;  4CI2 B;  3MJX A;  1ZR4 A;  1JOC A;  2NPS D;  3PUA A;  1QL2 A;  4G63 A;  3ANW B;  2NW9 A;  4I50 E;  3EQ2 A;  1JNM A;  5AW1 B;  3N4X A;  4HKA A;  2FYZ A;  2X68 A;  1N73 A;  4JEH B;  1RF1 C;  2YEV C;  3OA7 A;  1IFI A;  2R3C A;  5GON E;  5FYM A;  2PFV A;  2LSJ A;  3AAA B;  5LGN B;  2LOS A;  1GL2 B;  5IHY A;  3C51 A;  4HTE A;  4EIJ A;  1J1D C;  2XZR A;  5FXW A;  1L4A B;  4WY4 B;  3ETV A;  3I1A A;  3C64 A;  1LT9 A;  1HFA A;  5JVD E;  3PU3 A;  3CQC B;  2XDJ A;  1DEB A;  3PTR B;  4AKG A;  1URQ C;  3P7I A;  4GIW A;  3MTU E;  3R6N A;  3HUS A;  4ZOL E;  2KB7 P;  4WBN E;  1HBW A;  3NZQ A;  5CCH C;  4UEL A;  4MLK A;  1JUN A;  1SVF A;  3LIE A;  3E22 E;  2Y8D A;  4BJM A;  3O1J A;  3RK3 D;  3VYI A;  3VKG A;  4XBF B;  1HX8 A;  2KWI B;  5AFU L;  3H3A A;  2IFN A;  2FFD A;  2Q5U A;  3HTK B;  3L4F A;  3KQG A;  2FXM A;  1YYC A;  4QX7 B;  1FMV A;  2WM9 A;  4O9B A;  1GTW A;  3U3I A;  3IF8 B;  4N78 E;  2OA5 A;  2YKQ A;  1FDM A;  1LKX A;  2ES0 A;  2XAJ B;  2JEE A;  4FI5 A;  1HTJ F;  1N7S C;  5HXH A;  1HF8 A;  4QWN B;  3VKH A;  3UUX B;  1LTJ A;  2Q9I A;  3TNU A;  2WSF H;  2IAK A;  1AQ5 A;  4DBR A;  1IK9 A;  3Q5W A;  1RF1 B;  4JUY A;  3E08 A;  2V7J A;  3EVY A;  4E7Z A;  3P8C E;  4AKI A;  5AW4 B;  3PUG A;  3VP9 A;  3ZLI A;  3CX6 B;  4WBA A;  4HYT B;  1B7T A;  4YJ3 E;  2C0S A;  5L3B B;  5LOV E;  3HKC E;  2VB6 A;  1L0L K;  1MIW A;  3AVR A;  1RE4 C;  4OH8 B;  2XV5 A;  2NOX A;  4ILU A;  1EQ7 A;  5LBQ B;  1URQ B;  1BR0 A;  3M0D A;  4EB6 E;  4GIF A;  2XNX A;  5HXE A;  4XE5 B;  2C9N Y;  1HUC A;  1SQB K;  4QX8 B;  1YW0 A;  4DMW A;  2CLY C;  2A45 G;  3HKD E;  2QA7 A;  2VKO A;  2VKJ A;  1NKN A;  4H63 V;  1G2C B;  3VMX A;  2LOP A;  2LE8 A;  1IC2 A;  3N2G E;  2KWH A;  3CWZ B;  5FY0 A;  2E9X B;  1LVK A;  4TN7 B;  4HE8 A;  1CUN A;  1BR2 A;  1V9D A;  1CI6 B;  3NFQ A;  5M4Y A;  1NO4 A;  1ZKE A;  4AI6 A;  3FB2 A;  2C9L Y;  3RRC A;  1FZC B;  3T8O A;  5L3F B;  2BDE A;  4CXW A;  2Z6E A;  4KMC A;  4J2C A;  3N9L A;  3FXE B;  1RE3 C;  4UV9 B;  3IEE A;  5JR9 C;  1KIL D;  2IFM A;  2YKP A;  1JY2 N;  2LSK A;  3WMM 0;  3TSI A;  4DND A;  1ZR2 A;  4PW8 A;  2VK9 A;  4IE5 A;  2IPP A;  1IFN A;  4X20 E;  1JMM A;  3MA9 A;  1CZQ A;  2XU6 A;  3C50 A;  2HLO A;  1KIL A;  1GK4 A;  4ZI3 D;  1JTH A;  4HH2 A;  2WSS V;  3JC6 C;  5JRC B;  1VRB A;  1GZL A;  4I55 E;  3HE5 A;  4JF7 A;  3ZJ2 A;  4C7R A;  1WR6 A;  2CCQ A;  1SA0 E;  2RA1 A;  2H7H A;  3I0O A;  1NHL A;  5LGU B;  4AYC A;  5APT A;  2XAH B;  1T3U A;  2A45 I;  3U1C A;  2C5I T;  3H32 B;  5JH7 E;  2CLY B;  2HOD B;  3J9X 1;  3AA7 B;  4O4I E;  4EOZ B;  3IFM A;  3V2P A;  1M1J C;  5LXT E;  4I2L C;  4HGA A;  3QK6 A;  3RRW A;  3OYZ A;  4AKL A;  3N9M A;  5LHI B;  4EXT A;  2P1J A;  2X9X A;  3V2Q A;  1JY3 P;  3P8C D;  1MMD A;  1FAV A;  5JDG A;  1RF0 C;  3SS1 A;  1MV8 A;  3HD7 C;  3KDP B;  5APQ A;  4ZI2 C;  5APU A;  4M1P A;  2BVM A;  3B5N D;  2WT7 B;  3J7Y q;  5CCG D;  4KP3 C;  5JR9 B;  2JJ9 A;  5EK3 A;  3CQG B;  2N1T D;  4TV8 E;  3PUQ A;  2DI4 A;  1LTA C;  2LHN A;  1YKE B;  3N7N A;  3F57 A;  2UXN B;  3OKQ A;  2NTY A;  3B5N A;  5FY1 A;  5CCG A;  3RC3 A;  2Z5I A;  1S35 A;  1IZN B;  5JDF A;  3KDS E;  4C7N A;  1LTB C;  4PJN A;  5AVS B;  2OAR A;  3GHG A;  2N1T A;  4MBQ A;  3RKO A;  3ZCJ A;  3VU7 H;  3UUM A;  1GL2 C;  2CE7 A;  4H63 H;  1L4A C;  2WPQ A;  5LCY A;  4JEU B;  3A3Y B;  3IHR A;  3IR9 A;  2ZM8 A;  1IJ5 A;  1X79 B;  3KV9 A;  4Z8X A;  2K48 A;  2P67 A;  2OYI C;  2JJL A;  2ACX A;  5CB4 E;  3Q9D A;  3L37 A;  4EYU A;  2YIN A;  2HPC B;  2X67 A;  3GN5 A;  1GD2 E;  4BJN A;  1HG2 A;  2Y48 B;  2DLR A;  5FMN A;  2O01 H;  1SP4 A;  4IFF A;  2HG5 D;  5KJ7 D;  4LC1 A;  1M1J B;  3M65 A;  2I1J A;  2LHR A;  3CQX C;  3BRT B;  3M9H A;  2D5U A;  3MGN A;  2L3L A;  5HWY A;  1NAF A;  3CX7 B;  4P0B A;  1AJ3 A;  3N2O A;  4CI3 B;  2VAS A;  5KJ7 A;  4KHX A;  1ZN5 A;  3U59 A;  2XHE B;  1G8X A;  3OYX A;  5APV A;  3HD7 B;  3V4W A;  2CWO A;  3RYC E;  3FBL A;  1QL1 A;  2EHO D;  2M8R A;  3KV4 A;  3VMY A;  5JDN A;  4H9Q C;  4WY4 D;  1HCI A;  2H43 A;  4CXX A;  1LWU C;  3P8M C;  4ZS2 A;  2KT9 A;  2P9B A;  4X1I E;  2EHO A;  5L3E B;  4UIG A;  5FNV E;  2NPS A;  2WAU A;  3KIN B;  4EIW A;  3PDY A;  5LNK A;  3N9N A;  4WY4 A;  2Q7C A;  4ZS3 A;  1T2K C;  1D0Z A;  3VMZ A;  1LTJ C;  2WZ7 A;  2D2S A;  5AW6 B;  1H8A A;  3RL0 C;  5KTB A;  4JYB A;  1FOS E;  5DAB A;  1HH0 A;  5FXX A;  2LKM A;  3ZEF B;  1T98 A;  3WAJ A;  3AB3 B;  3LW5 H;  2VRS A;  3O8Z A;  3A5T A;  1FEW A;  2OYI B;  3H37 A;  4WBO A;  3CVR A;  4I43 B;  2KMF A;  1WYB A;  5FP3 A;  4O2A E;  3AA6 B;  1ZV4 X;  2IC9 A;  3RC8 A;  1LT9 B;  3OBV E;  3AA1 B;  1HGZ A;  5F8P A;  1ZHC A;  2DNX A;  4GK0 E;  2XQY A;  2LT3 A;  5HAX A;  2W0G A;  1W2E A;  2HPJ A;  5L2L A;  2E9X C;  2MBG A;  4AKH A;  1LTS C;  3II6 A;  4CQI A;  4C46 A;  1FZC C;  2YK0 A;  2OYH C;  2E43 A;  3SWH A;  5EZY E;  5TAO A;  1O3X A;  1UCU A;  3NTN A;  4WB4 A;  2XAQ B;  2X9H A;  5AVW B;  2MJZ A;  1FJP A;  1HWT C;  2YMY A;  2A72 A;  2V7I A;  3V5S A;  1IJ6 A;  2YU1 A;  3O1I A;  3W15 B;  1RF1 A;  5BU5 A;  4DOJ A;  3RK3 B;  5JDH A;  3HE4 B;  3O1H A;  3ZYK A;  1LWU B;  2C5K T;  2MTQ A;  1URQ D;  2IC6 A;  5J2U E;  5CA0 E;  3HKE E;  1DH3 A;  2Y6X A;  3HA4 A;  2M67 A;  3KFW X;  1H89 A;  2WIT A;  3NZP A;  3RK2 C;  1WYC A;  3AVS A;  4DMV A;  5CCH D;  3U78 A;  2GUS A;  5AVX B;  1LTJ B;  2DCF A;  3RL0 B;  1URQ A;  2PJQ A;  1SQV K;  2MYS A;  1XTC C;  4XA4 A;  5CCH A;  5LBM A;  3BVH A;  4H9P C;  1SLQ A;  3H6P A;  1LTI C;  5LG4 A;  3SRZ A;  1Y64 B;  5APS A;  3MD0 A;  1G2C A;  1LTT C;  1ZV8 A;  5L3D B;  1MZ9 A;  1FOS F;  3LFM A;  5AW5 B;  5CJ4 A;  2ZM0 A;  3FBZ A;  1N2D C;  3ZMV B;  1HTL C;  1JY3 O;  2V7M A;  1N7S D;  3PUS A;  3LBX B;  3VTP C;  4B6X A;  4YJ2 E;  1FU1 A;  5AVY B;  1HJB A;  3LK4 2;  4CXY A;  3GA8 A;  4X1Y E;  2XKM A;  5EK4 A;  4DO0 A;  5CA1 E;  1N7S A;  4BAY B;  3EFG A;  2OYH B;  2YO3 A;  3RYF E;  3N9O A;  5L3G B;  3ZPO A;  5CJ0 A;  4MHC A;  1S9K E;  1LTG C;  4I4T E;  1LGH B;  4XAX B;  4UF0 B;  2J1D G;  1SQX K;  3N9Q A;  2QGS A;  1T3J A;  4L9I A;  5JRC A;  3AAE B;  2VL8 A;  1GU4 A;  4EAH A;  3NXS A;  4AUW A;  5LJM A;  2A3D A;  1JY2 P;  2DHR A;  4KBM B;  4IE6 A;  1NWM X;  3ZN1 B;  3RK2 B;  5AVQ B;  5A1L A;  5LHH B;  4FJO A;  1IAP A;  3N9P A;  5DQW A;  5LYJ E;  4ZKP A;  3NRY A;  1RE4 A;  4P09 A;  3KV6 A;  3ZCI A;  1MUU A;  1SFC C;  2K24 A;  3K8P C;  3CML A;  5APW A;  1WRD A;  2W6B A;  4JYC A;  4PFO A;  2CPB A;  3H32 A;  3FHN A;  2HOD A;  1ZEE A;  1NTM K;  1MIV A;  5AW9 B;  1HGV A;  2Q9Q C;  1JCC A;  3KVA A;  2NTX A;  4OYK A;  2GUV A;  3I5C A;  1BR4 A;  1U5P A;  4PNI A;  1SHZ C;  3KYQ A;  1LVF A;  1KZU B;  4JLE A;  4BA9 A;  4L0R A;  5JDQ A;  2CXF A;  1KQL A;  3CL3 D;  3HKB E;  2HFE D;  1KK7 A;  5E0O A;  4XZC A;  1ZLL A;  1YD8 G;  1WLX A;  1GDT A;  3M0A A;  3FXD B;  4DVD A;  5CMZ A;  3E0Z A;  1RE3 A;  2WT7 A;  4ZKU A;  1JCD A;  3U1A A;  2L9Q A;  3BK9 A;  3K3O A;  1CW5 A;  3Q2M A;  1HVV A;  1D1B A;  3GMI A;  3JC6 D;  1D0X A;  3ZMU B;  2JRK A;  2VKH A;  3I0Q A;  4PAG A;  2WMN A;  3ESL A;  1NH4 A;  4A56 A;  2P7J A;  5AW3 B;  4NUV A;  4AXP A;  4UVC B;  2UXX B;  4C90 A;  5DJQ C;  4QHO A;  4ZHQ E;  1IJD B;  3NBX X;  5CHX A;  3UTK A;  5BVZ A;  5AVR B;  4M3L A;  3ZC1 A;  1J1E C;  3EDU A;  3IBP A;  4EOT A;  4I6M C;  5AW2 B;  1X79 A;  3AAI A;  1MMN A;  2HYN A;  3V2R A;  1IFD A;  4YHJ A;  2JQQ A;  2K9A A;  1N73 C;  2V1D B;  1SFC B;  3B5N B;  5FY7 A;  2SPC A;  3WI3 A;  2HPC A;  2NPS C;  1FZF A;  5KX5 E;  2JPF A;  1IO4 A;  5LJN A;  3GHG B;  1S9K D;  3OJA A;  1UX5 A;  5HXC A;  2H7O A;  3C4W A;  3TYY A;  5AVV B;  2Q9Q B;  2JMK A;  3HD7 D;  1LT9 C;  2H3R A;  3VOP A;  1N7L A;  4ZI2 D;  4IE4 A;  1T8Z A;  3VHL A;  4EZ4 A;  4H9S E;  2Z5H A;  1FJK A;  3MXZ A;  2N2N A;  3HUS C;  5F3J A;  1LRZ A;  4AQF A;  1RF0 A;  3P7K A;  1E1H B;  3M91 A;  2WPS A;  2X66 A;  3HI2 A;  4EZH A;  4IST A;  2VWA A;  2KXP B;  3DTO A;  1NTK K;  4TX5 A;  3ANW A;  3KVB A;  2WWU A;  5H6R B;  3LG7 A;  4O4H E;  2FFD C;  1GL2 D;  2VKD A;  2O1K A;  4IE0 A;  3I9W A;  2IX7 C;  5BU8 B;  4CI1 B;  2CM0 A;  1L4A D;  4WW0 A;  3RK3 C;  3ZN0 B;  2YKO A;  3C98 B;  3M06 A;  3ZMT B;  3SWF A;  2I1K A;  2LSY A;  1UX4 A;  2W63 A;  3E1I A;  3BQL A;  4PK4 A;  3PUR A;  1GL2 A;  4LGD E;  4TZ4 C;  2PBI A;  5DQV A;  2CA5 A;  3O9X A;  4P0A A;  1KFN A;  1S94 A;  5KDM C;  5FXZ A;  1L4A A;  2C0X A;  5HXS A;  3LID A;  2GM4 A;  1GW4 A;  2WWW A;  2WPR A;  2KSJ A;  4NUU A;  1J1E B;  4HN9 A;  4TV9 E;  1H7C A;  2ZXE B;  4H9R C;  5C8Y E;  2OYI A;  1EZ3 A;  4N6J A;  1NTZ K;  1N73 B;  2EHO B;  5JQG E;  2G0U A;  2NPS B;  2ODU A;  4IGU A;  1YKH B;  3TK1 A;  2R5D A;  1SQP K;  1L0N K;  1WT6 A;  3KBT A;  3K3N A;  1MNE A;  3BAT A;  4ANJ A;  1H88 A;  2ZLY A;  3L35 A;  1D0Y A;  3L09 A;  2Z4E A;  3I9Y A;  1U4Q A;  5HXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...