4N78D

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
529
structure length
202
Chain Sequence
HTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRSDARSVLLEAIRKGIQLRKVEEIENDVATILSRRIAVEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 57
structure length 202
sequence length 529
ec nomenclature
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78D01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4n78D02
3U1AA 3OJAB 3HRNA 1X79B 4I1LA 3P8CD 5KTBA 3C9IA 3U59A 2POHA 3BATA 1NKNA 3N7NA 4N78D 4N3YB 5BVZA 5BU5A 3U1CA 3BASA 3VP8A 2FXMA 1WT6A 3N4XA 3VP9A 4ZKUA 4GIFA 2JEEA 4O9BA 4ZKPA 1IC2A 5BU8B
chains in the Genus database with same CATH superfamily
3CX7B 1SQVE 1E7PA 2FYUJ 3OJAB 3PV0F 1KB9E 3B8EB 2X0LB 4JLEA 2VQFT 2HODA 2AE9A 2KSRA 3PUQA 2QSIA 1AJYA 1UIXA 1LT9A 3RPUA 4U7JA 3BVHA 2C5KT 4P09A 1AV1A 1NAFA 4HTEA 5HXRA 1VQLP 3L37A 3RK3E 4X1KE 5AQRB 3L72G 3CMEP 3LBXA 2EHOB 2LOPA 1QGKB 1XWMA 2XHEB 3CWBD 1S94A 4YSXA 4U2YA 1R8IA 1HS7A 3II6A 1KF6A 5LGUB 3M0DA 3H1LE 1PIXA 4EEBA 4ASVA 1S5LE 3L73E 4JV5T 5ABHA 3AECA 2DW3A 5B66H 3T1HT 3JADA 5CCGC 2QVAA 3HUSC 3BASA 1AFOA 1JNMA 4NPFX 1VQ9P 3I1AA 2HH7A 3N9LA 1LT1A 4WYVA 1N7SD 4WNKA 2WWWA 3RYCE 2I1JA 3KV4A 3F31A 2BCCD 1KILB 3CC7P 3AEAA 3CMLA 5KLIC 3P8CE 2K1AA 1RF1C 3IN6A 2M3EA 2BKNA 3O1IA 4U2ZA 4A5XA 1IFIA 3B71A 3EI0A 3L70G 3L09A 3A0BH 3AA7B 1ZW0A 5E79H 3EDVA 4TWHA 3HD7B 5AQUB 4PK4A 5M4YA 1S2EA 4KT0J 2IC6A 4WY4A 4U3FD 1OW8A 3PHLA 1LTGC 4DV3T 5EK4A 3HTKB 4D6TG 3RIUA 3I9WA 5JR9A 1HH0A 2K3RA 5DJQC 1L4AB 4DUYT 1LTSC 3ZT5A 1P84H 4ILCA 3N7NA 1HBWA 2VL0A 4KHZF 1L0LK 2WAUA 3JAFA 3KYQA 4L74A 1KQFB 3TGUJ 4IE7A 3T97B 1N7LA 5FP3A 1SQVG 4OH8B 1CHUA 1OEDC 4JI5T 5CBNA 5AW0B 2H7VC 3VR9A 2JO1A 2Z5HA 1NH4A 1IFNA 2P7JA 1FS0E 3VRAA 1EDLA 3HKDE 3AEGC 2XPKA 5LBMA 2IIUA 2ZM0A 2YKOA 3EFGA 4PJLA 2QA4P 2BZBA 2A45I 2FJBA 3L35A 4NPPA 4NPDA 2IYPA 1VQOP 2YKSA 3CQCB 3WAKA 2WM9A 2WSEH 5BVZA 1GW3A 2NPSC 2XJ7A 3H3MA 3PUGA 2E74C 1L0LD 1ZOYA 4LMLA 4HFBA 2KS1A 4TLFA 3H1LG 4CN1A 2Y8DA 4F8HA 5HWYA 3OTOT 3L73G 1BE3E 2HPLA 1JB0J 2ZLYA 3IFMA 2LSIA 3SOLA 3H1KD 2BG9A 3JC6C 2G0UA 3Q9DA 3H32B 2X9WA 1YIJP 3H1HJ 2AEJA 4WVZA 1Q82Q 4UVBB 3FBZA 3E7KA 4E7SA 1HJBA 2X0HA 4QKNA 3RK3C 2B88A 3AE5C 4JPZB 1NO4A 2R5DA 4X64T 2KK7A 1SQQE 2ZXXA 2BDEA 5LHHB 2G3AA 3CVRA 2ES0A 2YKPA 2J47A 4ILBA 2BVMA 3UU5A 1R5LA 3IF4A 3R2PA 4I0UA 2KZ7B 4UV9B 4K3AA 3SFEC 2XM1A 4NUVA 3PUZF 1YQ3A 1Q81Q 2KZIA 2C0SA 2OTLP 4KHXA 1H0TB 2NWBA 2FFDA 1T3JA 3CPZA 3N2OA 3CCRP 2Z5IA 4H44D 4PK6A 3SWHA 2XZEA 1S72P 2E76D 2PTFA 3PUAA 1EDJA 3N9OA 1PGOA 5KAIE 3CC2P 4LF8T 4Y99B 3RL0g 4ANJA 2NZ2A 4DMWA 4AKHA 2PAJA 1A02F 5KLVK 3OYXA 2OYHC 1S5LH 2XQ7A 1PPJE 3L3PA 1JM0A 3MHVA 2F4VT 2D2SA 1VF5C 3ZJ2A 1AVOA 2QE7H 3H1JJ 2KLQA 2HFED 1N8RQ 1GW4A 1GK6A 1OFCX 4LF5T 1UCUA 2LHNA 3IA3A 2JR8A 1Z0PA 4WY4D 1LTJB 3JCFA 4P0BA 5AQVB 3ZT6A 2ZYDA 1MFTA 2XQ5A 3RRWA 3A7MA 3V4QA 3Q5DA 2JKVA 1RE3C 3NXSA 3QNUA 2WVRA 5BMVE 1ZEEA 2LKHA 1U7MA 1ZRTE 3BRVB 2RA1A 1NGMB 3D6YA 4M1PA 3G06A 3FB2A 1S4XA 3V5SA 2IZ0A 4KX6A 4UVAB 1FBMA 2YEVC 1DEBA 2I0MA 1GL2B 3VMYA 2M8RA 2RMZA 1J1DC 5KLVD 3P4PA 3CX5E 3E08A 1WMKA 2WMOA 4LGDE 4NPEA 2XV5A 1WYCA 1BE3G 3LIDA 1SQBE 2N1TB 3CCJP 1J1JA 2LXCB 4JI7T 1NTME 2GUSA 4ZMDA 3CC4P 1JY2O 1PP9E 1VL2A 1KZUB 3UFEA 1YTZT 4UB8E 5JRCB 1UK5A 1VOMA 2GUVA 5CHXA 3ETUA 1IFMA 1KILE 2PJQA 4P1NA 1JNZA 4TV8E 2SPZA 1JUNA 2LHRA 4HH2A 2C9NY 3NWIA 4U74A 2UXNB 2L3LA 3FXDA 5ADXL 3FWNA 1YITP 4JYAT 3CX6B 3NZQA 1JY2N 2I1KA 3GWHA 3SFDA 2V4HA 4HFIA 4TN7B 1J5WA 1S35A 1KN7A 3ZCJA 1RQVA 3PJSK 2XASB 3PE0A 3G71P 2H7OA 2FJAA 4RO0A 3EWKA 3GN5A 3UTKA 3RYIE 3AE8A 5HWXA 4H9QC 4QHOA 2LOSA 5CFBA 4TX5A 3N2GE 1FZBA 2IYOA 4PNIA 4ZI3D 1KNPA 3TNUB 4H9NC 2LXBA 4HWDA 2W6BA 1FJGT 1L0VA 3N5LA 1MUUA 1NJIQ 4OYJA 5AQNB 1LTIC 1IFDA 5EZYE 4GKGA 1HJ0A 1HTJF 1KYOE 4ILAA 5APUA 5JVDE 3HI2A 4QXHB 3VR8A 1PPJG 2WS3A 4C91A 1BSNA 2J59M 2HLOA 1HGVA 4DR5T 4IDNA 3UUMA 2XM2A 4UF0B 3AE7C 1FDOA 1HUCA 1U4QA 3EVYA 1M1KQ 1R5SA 4U33A 3P7IA 3ANWB 3T1YT 2BS4A 2RPAA 1K8AQ 2Q9QB 2ZM6T 3P4WA 1XNQT 5APQA 3GHGC 3BQIA 1NTKE 2Y0CA 2IAKA 2CK3H 1MMAA 3AE6C 2XAQB 4O2BE 5AQTB 1KQSO 2XKMA 2QGSA 4WZXA 5AW8B 3BK9A 3I5CA 2ZMAA 4I4TE 3NRXA 1HF8A 1Y01A 1A02J 4IL6X 2P9BA 3EABA 3M0AA 1SQBG 2D2CD 2OQQA 5CCGA 1EXIA 3TLVA 3HUSA 3UU3A 3S9OA 1SQPE 1HG5A 1NTMG 1W0BA 1PP9G 3CWBJ 1KQGB 2K24A 1VRBA 1GMJA 1N73B 2JJ9A 3J9X1 5BR8T 1NU1K 2YNYA 2JWAA 3KBUA 1WRGA 2EHOC 4KHPT 1RF1A 2VKOA 4AYCA 1NTZE 3B57A 5L3FB 1GZLA 1S9KE 2W0GA 3CCQP 1D0YA 2QM8A 3UUNA 3S1KA 1UUSA 1EC5A 3BCCD 5L47A 4TV9E 3BQKA 2BKOA 1RH5B 2ZYGA 3AEDC 1UX4A 3PRJA 2VVNA 1M1JB 2OGUA 2XTLA 2YDQA 2QRXA 4FI5A 3GF7A 4XFJA 2BCCJ 2O01J 1L0NJ 3I56P 4L0RA 4UELA 4DO0A 2WPQA 4CQIA 4JBZA 3HKEE 3V2PA 4DNDA 4IDQA 4B3ST 3JC22 1DU2A 3ONXA 3G4SP 3L74E 1KILC 3RQWA 1PFIA 3C1LA 5B5EE 1NEKA 1NU1D 1EZVD 4H9SE 4AKLA 3CPWO 3NRYA 2ITAA 2WWVA 3PUVF 3CX5H 1X9BA 4U3FJ 4O8SA 4ERRA 1OW7A 1OEDA 4PD4E 1RY3A 2ZVNB 5GTHH 4UV8B 3RC3A 3HD7C 2VWAA 3LW5H 2P10A 2E5VA 3CLQA 2XQ3A 1N36T 5FVLA 3AEGA 3FHNA 1K73Q 4HWCA 4DOJA 2W62A 2Y9ZA 5LHIB 4BJNA 2H89C 1GQEA 2W8ZA 4MHCA 3CCUP 1NTKG 4BWNA 2XZRA 3F2EA 5B66E 3SWYA 2WZHA 1BSHA 1W9RA 3SWFA 3RK2D 3IHRA 2UUAT 2NPSA 2WT7A 2QJYB 3AEEC 5ETWA 5DQVA 2CBJA 1IAPA 4O4HE 2XDJA 4EYYQ 1G2CA 2R32A 1RF0C 4ZKUA 3AVSA 3CL3D 2L8KA 2M6BA 4F6RC 5F8PA 1JMBA 1IO4A 1SQPG 4JI4T 1HWTC 3HRNA 3KV5A 4TWFA 2K5BB 2POHA 3UUXB 3LJCA 1L0LJ 4JI1T 3VKGA 5APYA 2CA5A 2A06D 3AE5A 2HYNA 2IBZI 5E79E 2BBJA 3PUSA 3AAIA 4AQGA 2AEFA 1NTZG 1ZHCA 4UEMA 1WLXA 2LSYA 3H1ID 3H1KJ 1UX5A 2LM2A 1X0TA 2X9HA 3L72E 5APTA 4CN4A 2UXDT 2AXTE 1M8OB 4W7YA 2KI7B 2C5JA 4JI2T 3N9MA 2JP3A 2K9YA 1N86A 3GG2A 5CCGD 4HFCA 4OFZA 5L3BB 1M7LA 1U7JA 3HA4A 4EOZB 1IBKT 1VQKP 3IEEA 1ZV8A 3L74G 1T72A 1BDCA 3I55P 2XQ4A 3RLFF 4DIDB 2XUEA 3CCMP 3AE9A 5JDQA 4L76A 1P84D 2OYHA 1LT9B 2LKMA 1PGPA 3ONLC 1VQMP 3GMIA 1NWQA 4B3TT 5LJMA 1J5ET 2E75B 4EYYR 3RX6A 1T6AA 3OW2O 1FOSF 4Z1MH 4PJNA 1KFYA 3A5XA 5LMNT 1X8YA 5HEOA 4YJ2E 3R84B 1CZQA 2Y9YA 3EQ2A 4XA4A 2UXXB 4TNWA 1SUMB 1RE3A 1QX8A 3P8MC 4QXCB 1PL5A 1E5WA 2O3JA 5KX5E 4H44B 4K0KT 1BCCE 2CMRA 4Y99C 4D6TE 2E76B 2V6YB 4JI6T 5HEGA 1NOHA 1SQVK 2ZFCA 3VMZA 1YQ4A 2W90A 3RBZA 4OGQB 4C7NA 3L70D 2P58A 3N9NA 3RL0D 3NBXX 1KQLA 2O1JA 3VU7H 1G1IA 1R8EA 1GU4A 4XZCA 5LG3A 1AQTA 3R6NA 1LTJC 3K3OA 1FDIA 1DX7A 3P32A 1OW6A 5HCJA 5B5EH 4DMVA 4IL9A 2FJDA 5AQPB 4JI3T 3C9IA 1AQ5A 3U59A 5CBOA 1UIIA 2H88C 4QMAA 5KJ7C 5KLVJ 2E9XB 2VURA 1UURA 4PD4H 5LA6E 2W6AA 3MGNA 5H2FH 4BJMA 2WMMA 3FGAD 3C51A 1Q2NA 4LC1A 3CI9A 2Q7CA 2ZT9B 1GL2C 1MZ9A 3HE5A 3ZYMA 2WMNA 2XY8B 1SQVD 2E74D 3VMAA 3KZIH 3U1AA 1YXRA 5DQWA 4X1YE 4EZHA 2N1TC 1KB9D 3CXHI 1FZCB 4Z91A 4BA9A 1HNWT 1JCDA 5C39A 4PW8A 2WU5A 4YTMA 1Y47A 3JC6D 1YJWP 5C2TA 3W68A 4AXPA 2FJEA 3NKZA 3QUJA 5HXSA 1Y8AA 1LTBC 3P4QA 3RK3D 4JF7A 4LFCT 1H7CA 5LB7B 5JQGE 3A3YB 1BR4A 2IW5B 3RKOA 3E1IA 3K1SA 2CLYB 4GT1A 1L0NE 1ZLLA 3H1LD 2W63A 2V7KA 2KMFA 3RKGA 5FY7A 2JDIH 3AE7A 1NKNA 3L73D 2I59A 3ZT7A 1D7MA 4N78E 2IFNA 5FYMA 5LHGB 3EHZA 2ZYAA 1NAYA 3LIEA 1SQXE 2IZ1A 4JQ0D 3VP9A 4LF4T 3GHGA 3WUVA 4X65T 3AE6A 5AVRB 3CQGB 4CPGA 1BCCG 3C8VA 5IYZE 3P8CD 2WDRA 4TNVA 2AXTH 4QX8B 3AEFC 3KV6A 3OJAA 4UIGA 1H88A 2MAWA 1FEWA 2NTXA 4EYUA 3USSA 3O1JA 4GOFA 1CUNA 2VKDA 3KDPB 2WDQA 1N32T 1VF5D 1MNEA 2FXMA 3WMM0 5L4EA 3L75E 3GF3A 3ZLIA 3FZLB 1FZGA 4TWDA 3O6QB 2JPFA 4HWIB 1LGHB 1QSDA 2XAHB 2Q9QC 3FZFB 4U3CA 4DV5T 2W00A 2DCFA 3M06A 2OARA 3FX0A 2WBLA 3Q5EA 2A45G 5HXEA 5FNVE 3Q1MA 5K5GB 3AEDA 2P1JA 1URQB 2KNDA 3QOFA 2D5UA 2YDRA 5GTIE 1KV4A 1D1BA 5LYJE 2CBIA 3CMAP 2WPRA 1N73C 3N9QA 3L71E 2PFXA 2D2CB 1SQQK 3LSVA 2JRKA 1IZNB 1W0AA 1KILA 1S1CX 1W09A 2YKQA 5AQIB 2VB6A 2FBWC 3BCCJ 1XTGB 5JH7E 3VYIA 4W7ZA 1OVRA 5DJTB 3SRZA 2NTYA 3D0TA 2V8SV 4DR1T 4MLKA 2DNXA 1L0NG 2QG4A 3HD7A 1JMMA 1BR2A 3M9BA 2C9LY 1M1JC 3NFQA 1N34T 1BE3D 1JTHB 4OWFA 1NU1J 3E22E 4N3YB 3NZPA 4IFFA 2KXPB 2DL1A 4G63A 1LVKA 4IT4A 1SQXG 4DZOA 2MOZA 2H89A 3AE4C 2HPCB 2OTKE 4ZEYA 3CCLP 2JEEA 1SQQD 1K05A 3MZWB 1O3XA 2A45H 2IC9A 1H8AA 3AEEA 3T97A 2Q3IA 1X22A 3VRBA 3M9HA 5KTBA 3ZDMA 1RF0A 5L3CB 3LK42 4DV2T 4XBFB 4YSZA 2XAJB 4PFOA 2CCQA 5AQSB 2CEAA 2NRGA 3L75G 2A2FX 1ZR2A 2BVLA 2N9DA 3GW6A 3FXDB 5LG4A 1PGJA 3V5BA 2WWUA 4BRYB 2XQAA 1KC8Q 3AA6B 1YKEB 3PJAJ 1JY3O 2PRRA 2CXFA 1XDOA 2PGDA 3QWOC 3RIAA 3ZN0B 4BXLA 1TU3F 2QJYC 2O01H 4IDOA 2Z4EA 3OBVE 2OYIB 1GTWA 1PPJD 2KSEA 3RHWA 2V7IA 1SQBK 3AA0B 1NYHA 5LNKA 3MP7B 2FYUE 2WSCJ 4WBOA 4DBQA 2KT9A 1NTMK 1JY3N 1VQ4P 4A7PA 4MALA 3H32A 4AKIA 2ACXA 1KFNA 2IDBA 4DT0A 3FXEA 3L71G 3V4WA 3H1IJ 4HKZH 4ILUA 3KVBA 4YJ3E 5GTHE 3QC9A 4O4IE 4UB6H 1ZRTD 2WSSV 1US7B 5BU5A 3ESLA 4Q25A 5AQQB 1HX8A 3K8PC 1BGYJ 2CXDA 2V5CA 1H0TA 3CX5D 4EXTA 4U72A 1SQBD 3PH0A 2L5GB 2RH0A 2R3CA 1FMVA 2BBHA 4QH1A 5FY0A 4DV6T 1NTMD 2Y0EA 2V5DA 1PP9D 2HN1A 2NR4A 4EAHA 3ZCIA 5HEUA 4YXDC 1SP4A 1CI6B 4OK0A 1D1CA 1SFCB 2W2UA 1KILD 3B5NB 4DJGA 1IC2A 1LT9C 3M3ZB 1KFMA 4AQFC 2CM0A 4HB1A 2KLUA 4N6JA 5L3GB 3UIAA 5APWA 2VKJA 2ZM2A 5CA0E 2ZJSE 2E75C 5GTIH 5EFWB 2V7QJ 3Q5PA 2E8IA 2MTQA 5E0OA 4PV1B 4H0LD 2PG8A 3ZMZB 3ZEFB 3HE4B 1WR0A 1RE4C 4H13D 1LTJA 3VN0A 2V7LA 1QEXA 4YHHT 3M0DC 5ABFB 2XNXA 1NTKK 5LGTB 2LM9A 3K3NA 2X0YA 4ZKPA 2QEXP 4H44C 3AECC 4I7ZB 2H88A 1EXJA 3L70J 3RGUA 4PK5A 2E76C 3L4FA 4NXNT 5AW9B 4GK0E 3D70A 2RP4A 2KNCB 4LF7T 5HCMA 3AXJB 1KYOD 1IK7A 1GL2A 3PTZA 1NVOA 4QH5A 4OGQC 3Q5WA 3TGUE 2M5AB 5AQOB 4ZI7E 5C3JA 2JQKA 1T2KD 2N1TA 1FOSE 4IL6E 1Y9BA 2FYUG 5F3JA 2Q3EA 1SQPK 5CJ4A 2WQYC 3AEAC 2OLTA 4GOEA 4IHJE 4AUWA 1ZN5A 3O9XA 2M6IA 1EZ3A 3ITKA 2V7JA 2O01N 3I0OA 3JAEA 2Y48B 3RL0B 5JRCA 3L36A 5L3EB 1FMWA 2ZAEB 2E9XC 1SQVJ 1NTKD 3FWLA 3CIRA 1NTZK 2WITA 3ZMVB 5HXHA 2NW8A 1WYBA 3HKCE 4COFA 1E2AA 2ZT9C 1X79A 2FYNB 4DUZT 2RN0A 4OX9T 2XQ6A 2CWYA 2IBZE 1QLED 3TK1A 1IJ5A 1FZCC 1LP1B 1QUUA 4IE6A 2N2NA 2OV9A 4DV1T 5F5WA 2WSSH 1SQPD 1NHLA 1OMIA 3TNUA 4HYTB 2Z6EA 5J1GA 3H1HE 4BAYB 5JDMA 4LF9T 5AVYB 3H1LJ 3HR0A 4H63V 3GMAA 5H6RB 2Q6QA 3SWKA 3L73J 1LWUB 2CLYC 2E42A 3AEFA 1NTZD 3NVOA 3JSVC 1S9KD 5LP6E 1YJNP 2KIKA 3W15B 3DTOA 2QIWA 2Q9IA 1D1AA 3AAEB 1FDMA 3OVUA 2XQ9A 4WW0A 1N7SB 2QJPB 2YXRB 2IPPA 2CPBA 4AKRB 3ANWA 1ZOYC 1VCSA 3UFGA 2WZ7A 5H2FE 2UUCT 1SLQA 2GA1A 4KUMB 2NW9A 4AQYT 1FAVA 2SPCA 3QK6A 3H6PA 3KZIE 3L74D 1DH3A 1ZMEC 3D71A 1BR0A 3TKLB 5AQKB 2CPTA 5AW6B 2RKLA 1XZYA 1L4AC 3CKDA 5JTGA 3TGUG 1I6ZA 4PD4D 3W67A 1VQPP 2N9YB 2NP9A 3OAKA 3M91A 1MMGA 2QYWA 4DV4T 4EV6A 2O1KA 3ETVA 5HYAA 3H1JE 3DP7A 1VQ6P 5AQJB 2KINB 2LEHA 4C46A 2VQET 1N73A 3MUDC 5H6QB 4CN6A 1U57A 1YQ3C 1ZKEA 4YY3T 2DHRA 2FBWA 5IHYA 1LRZA 3M65A 3C4XA 1S3JA 4YLHA 2DWGA 2E5YA 2MPKA 4L5GA 3WI3A 3BRTB 4MFRA 5J2UE 2K9JB 1IJDB 4HKAA 4UXNB 4GODA 5HXCA 4EGWA 2IBZG 1GL2D 1URQC 2OA5A 1GU5A 1M1JA 2FY8A 2ODVA 4UR9A 2UXBT 2N1TD 2E43A 2YIUB 2YINA 1LKXA 1LTTC 1FIOA 4OHFA 2H3RA 3F5HA 4TUYE 2X67A 3P50A 2YO2A 2HN2A 3SFEA 2B87B 4P0AA 1FJKA 1LTAC 2D2CC 1J1DB 3F89A 4IFDK 4IE0A 3AE4A 3TSIA 3UU8A 4LFAT 3H1HG 1XNRT 1SVFA 3CXHE 3G6EP 1NKZB 4MN4C 1SE7A 5FL0A 2B9BA 4KP3C 1BGYE 3MJXA 1H89A 4V1Av 1LNQA 5TISH 1BE3J 1W5CE 4IL6H 2GM4A 1I94T 2MKVA 4NIQA 1EZVI 3L72D 2HODB 3PLNA 4DBRA 4Z8XA 3MD0A 4YPCA 1MIWA 3CWZB 5LBQB 1SQQJ 2M67A 2MJZA 2N9BA 1G73A 1YKHB 4OYKA 1QVFO 5HEHA 4IREA 4B6XA 1BDDA 1M7KA 3LBXB 4LF6T 4ZZBA 1HGZA 5LCYA 4AIUA 4G2AA 4GIFA 4X5TA 3CCEP 4X66T 2J62A 4IE5A 2LKGA 3PURA 5CCHC 2WTYA 1D0XA 2DLRA 4ZI2C 2K9AA 1FZFA 5CJ5A 3RC8A 1UGOA 5EK2A 3H1JG 4PJJA 1FZEA 3N4XA 3WUUA 2L9QA 2OYOA 3KQGA 3NTNA 1KEYA 2FUPA 4E7ZA 1VDFA 5TAOA 4M3LA 5JREA 5LJNA 2LSGA 3Q5RA 2B1EA 1BCCD 1MV8A 4D6TD 4GIWA 1ZP0C 3P4SA 2OYIC 3C64A 2K37A 2JQ9A 2YOEA 5FMNA 4EDFA 2WPVB 2CHOA 3MA9A 4L75A 4WY4B 1IFJA 4HWHA 2W6JH 1EDIA 3H1IG 2D0TA 1E1HB 4J2CA 2CWOA 4KJMA 5JR9B 2NPSD 3NMDA 5AVSB 2J58A 3FBLA 4XE5B 4YXDA 3CWBE 5KAFE 3VHLA 1KTMA 3RYFE 3TF5A 2LT3A 1BGYG 2ZVOB 2VASA 5FXXA 4IIJE 2WPSA 1SQBJ 3K5BA 3S4RA 5CGMA 2UU9T 4AQFA 4EOTA 1L0NK 3PDYA 5JDFA 3ZSTA 4HFVA 1NTMJ 2Q1KA 2HPJA 3LW5J 1G1JA 3J7Yq 4WBAA 2B89A 1PP9J 2HHHT 1P84I 2UXCT 4HFHA 5JDHA 3A2AA 3PU3A 1RE4A 4EEDA 1SQXK 2BCCE 2XU6A 1OIPA 1JOCA 3ZC1A 3BATA 4H9OC 1K9MQ 4JEUB 2KOGA 2KYVA 3U1CA 2V6YA 2WSCH 5ABGA 1SFCC 3B5NC 2JMKA 5AQHB 5DABA 1S5LX 2KS1B 3AEBC 2FKWB 3IAOA 3EDUA 4A98A 4U3FE 4GOUA 3LG7A 4HEAA 3QB5A 5KKZB 1L0ND 2BG9B 4PV1C 2WQYA 3RRCA 2JWDA 4UB6E 3KDSE 3ZPOA 4N78D 1W2BO 4DV7T 3CXHH 1VQNP 2X9XA 4RJTA 2BEQD 4CXWA 5FXVA 3MKDA 1SQXD 4H0LB 2E9XA 4I7ZC 4ISTA 3ZMSB 4H13B 1J1EB 5AW7B 5AFUL 4NXMT 3TDKA 3TYYA 3AE2C 4HJGH 3MXZA 2X9YA 2PFVA 2ODUA 2EHOA 5AW5B 4LMKA 2FFDB 3JCUE 1FZCA 2OTJP 1VQ8P 2BKPA 3VTPC 5HAXA 2YMYA 3UQ7A 2BEZF 5DJUB 1NTKJ 1E79H 3L75D 5AW1B 3B13A 5AW2B 4U31A 3RL0C 1MFZA 3V5UA 2WSFJ 3AE1C 1KB9I 5AQGB 3ABVC 3AA1B 1JY3P 1ZXGA 3CWBG 3CCVP 4EIJA 5M1BA 1L0LE 2V7QH 5L8RJ 4MBQA 3ZKRA 4ZS2A 3MIWA 3QH9A 3C4WA 1N2DC 5AQLB 2P2UA 2FYNC 3Q5SA 3AE3C 3C50A 3CQXC 1JEKA 1JO5A 4TZ4C 1SQPJ 2PP6A 3H1KE 1XMQT 1K04A 4TT3H 3GA8A 3I9YA 5J0ZA 4O9BA 1EDKA 1M57D 1USDA 1DEEG 2FYZA 2XQYA 1Q86Q 4O2AE 1HR0T 2BCCG 1ZR4A 1NTZJ 3OKQA 3L71D 4I6MC 4DVDA 2BS3A 1QL2A 3HL6A 4QWNB 1SA0E 5JDGA 4ZZCA 3HTKA 1JY2P 1QVGO 4C7RA 5L3DB 1MKMA 1LWUC 4OVNF 4DR3T 2LSJA 5CA1E 4IOIH 1HNXT 3VP8A 3D6ZA 1L4AA 3FXEB 1V9DA 4QX7B 3WUTA 2LR2A 4U3FG 1Z56A 3M9QA 3QB5K 3OYZA 2R6GF 5FXZA 2QM7A 4ZXLA 4ZHQE 2V26A 2E75D 1N7SC 4CXXA 2QJPC 1NENA 1T98A 2W67A 2WCAA 3L74J 3O6QA 3ONJA 1KB9H 4EB6E 5CB4E 2QJKB 1YTZI 4HFDA 1AJ3A 5KAFH 3L8RA 2HR3A 3MUDA 1HVVA 2LE8A 3AB3B 1FJPA 2XAFB 2JIWA 1FU1A 4PJ0E 1RQUA 3RI5A 5AW3B 2H43A 3ZC0A 3AAAB 2K3WA 2JQQA 3LFMA 3MTUE 1OX3A 2XSAA 2KWIB 3KINB 2FYUK 4A97A 1URQA 2UUBT 4YTPC 4OGQD 1AVYA 3BQLA 2YO3A 2CXLA 4AI6A 1YBKA 1MIVA 3GN5B 5JDLA 2HG5D 3AE9C 5AVZB 3OPCA 3CK6A 4X1IE 1PZQA 2VL8A 4HE8A 3ZMTB 1M90Q 2X51A 3S4UA 5KDMC 1EQ7A 3VKHA 3H37A 1IBLT 2D0UA 3RK2B 4KBMB 3L39A 1IBMT 2H8PD 5ABEA 1L0LG 3KVAA 1VQ7P 3MK7C 1N33T 4XAXB 3EFFK 2KP8A 2J1DG 3N9PA 2E9XD 1SHZC 5KLVE 2E2AA 4ZOLE 2VRSA 4O4LE 3U78A 3I0QA 2LLYA 4AKGA 3H1KG 2ZT9D 2CPSA 3KXDA 3EUHA 4EZ4A 1LJ2A 5AVTB 3IBPA 5AVVB 3TLTA 4HN9A 2FYUD 2EHOD 1JTHA 2CRBA 2YIUC 2A3DA 1LVFA 1YQ4C 1VQ5P 5AQMB 5BU8B 2J4GA 4GYSA 2LJLA 2Y0DA 2HPCA 3ZYKA 4CZZB 3CD6P 1XDPA 2PBIA 3MZKB 3PUWF 2W4XA 2X66A 1IJ6A 3UUBA 3L72J 2YXQB 1VCTA 4EI2A 2XNDH 2ZM8A 3G3ZA 3JCUH 3O1HA 3GLMA 4HGAA 2AXDS 4WWIA 5CCHA 2NW7A 3Q2MA 3CX8B 5L2LA 3V2QA 1SQQG 3WU2E 3HUSB 2YU2A 3ZMUB 1KNZA 2LRLA 2LSKA 4U7IA 2N1GA 3G9RA 4K35A 2BG9E 2R44A 2VK9A 5FVKA 3P4RA 2P67A 1X79B 1YD8G 4KMCA 4BRYA 5FY1A 1J2JB 2WZIA 3LK2B 2IFMA 4W80A 5KLIB 3HD7D 1RF1B 2YDSA 2L91A 2A9UA 4DR2T 3A0HE 2B76A 1WT6A 1ZP0A 3UU6A 2OYIA 4B3RT 2W27A 5KJ7A 2I6HA 1L4AD 3F57A 2WSEJ 1YJ9P 2CE7A 4QXBB 5LMUT 4YHJA 3RH3A 4QH4A 3PJAA 4YTNA 5IWAT 4L9IA 2C0WA 4JEHB 5FXWA 1U5PA 5TJHA 4I43B 1BCCJ 5TISE 1GD2E 1KMIZ 1IFPA 4D6TJ 4C90A 3UT5E 2JJLA 2WU2A 4GYRA 1MMNA 4X62T 4CI2B 4JI8T 4K0UA 1KD1Q 5KLVG 1OEDB 1L2PA 1T3UA 2IDOB 4O4JE 2QA7A 3SS1A 3T8OA 5APSA 4LMJA 1YI2P 3OA7A 3TGUD 1HFAA 1WCRA 4WY4C 2MYSA 1MMDA 4I50E 3TLSA 3ZJ1A 4DR7T 1ZV4X 2JMHA 1URQD 4IGUA 3O4XE 3RIUC 1HX1B 4YXWH 5JDNA 5JR9C 2LRKA 4PJ0H 3UQ4A 4DR6T 4LLHA 2IUBA 3RBXA 3KPEA 3CX5I 2NOXA 1CSBA 1QL1A 3E1RA 1CI6A 3H25A 2IMLA 3CCSP 1SFCA 3B5NA 2NPSB 2WT7B 2E74B 3PUXF 3BCCE 3ZYLA 4KI0F 2FXOA 3AEBA 1G2CB 5KAIH 2DI4A 2M0BA 5L4HA 1HTLC 4B86A 1WRDA 2KSJA 4X20E 1MNDA 2KLVA 2IBZD 2C0XA 3B5MA 4DR4T 3HE4A 3PU8A 3P7KA 2ACZA 3X1DA 3KBTA 3PTRB 1Z8UA 3IR9A 1HG2A 1WFDA 3Q5XA 3ZN1B 3K3QC 5ABFA 1OWAA 3RK3B 2XSBA 5AQFB 4JBWF 1NU1E 3SSUA 1EZVE 4UF0A 1DIPA 2VVSA 4Y28J 3H1HD 4AISA 2YN6A 1JNRA 1HF9A 3O8ZA 3FZMB 2UWJE 4ZNCA 4FJOA 2I8DA 3PUYF 2KNCA 2Q9QA 3AXJA 3AE2A 5AVUB 4IFMA 2M5AA 1DD4A 2IX7C 1JCCA 2VKHA 1XTCC 2KZJA 5KKZC 1GDTA 5HEJA 1KORA 1W2EA 2AXCA 3A8YC 2BG9C 1T8ZA 4ZI3C 1SQXJ 5CCHD 3LK3B 4IE4A 4YT0A 1KYOI 4ZI2D 4ADZA 1MIYA 1B7TA 1PGQA 3AE1A 5GONE 3ABVA 3PP5A 4H0LC 4AQRD 5AVQB 2KB7P 4Z90A 3ZSSA 2H7HA 1BR1A 5EK3A 4H13C 4CXYA 3KHUA 1J1EC 1G8XA 2OYHB 4UB8H 1AA0A 1OZHA 5FKYA 2XQ8A 4CI3B 4I55E 4DV0T 1VF5B 3WU2H 3AE3A 4WB4A 1YHQP 4RESB 4ISSA 5KXJA 4I2LC 3KV9A 5LOVE 3L75J 2E5TA 2FFDC 5J2TE 2WY2A 3AVRA 1LP1A 2K48A 5A1LA 2C5IT 1OVUA 5KJ7D 1IK9A 1OXZA 2BASA 1FZAA 4DCKA 5C8YE 2A06E 1GK4A 2V1DB 1HCIA 3H1JD 2FXPA 3VMXA 1T2KC 3IF8B 3A5TA 1M62A 3RIFA 4JI0T 2R5BA 3E0ZA 3UULA 2A72A 4CI1B 3RGLA 1VPCA 3A0HH 3H1IE 4UVCB 3EAMA 1YYCA 2WDVA 5KMGP 4EIWA 1LWUA 1PV3A 3BCCG 1RHZB 2IHR1 4JYBA 4GKJT 1NWMX 4C7NB 5CMZA 2YMKA 4HFEA 2GK9A 3HKBE 4IL4A 5FL1A 4JYCA 5IUXA 3A0BE 1KYOH 2W66A 4JUYA 4R4LA 1Y64B 3WAJA 3L71J 2J5UA 2YU1A 1N7SA 3B4SA 2XAGB 3FZKB 4RKUJ 1CW5A 5AVWB 2G8YA 3DJBA 4ASKA 3V2RA 3Q3DA 1OVVA 3V6IA 1KK7A 1NU1G 1EZVG 2V7MA 2YK0A 1X9VA 1T8BA 1P84E 3C4ZA 4B3MT 3TLWA 3CXHD 4H63H 1WR6A 5LXTE 3FZHB 3RF1A 4GDOA 3C98B 2WB5A 1BGYD 2K88A 3HE5B 1SFCD 5CJ0A 3B5ND 2Y6XA 4ZS3A 4GKKT 2KUBA 2W61A 5APXA 3UU4A 2DWKA 2JQHA 2WSFH 3H3AA 4LFBT 4YTPA 3N2KE 4H9RC 4PAGA 1DD3A 1KNRA 3U3IA 4PV1D 4IDPA 2QJKC 2ZXEB 4PD4I 5LGNB 4IDZA 4I1LA 5APVA 5AVXB 2V6XA 1M56D 3KFWX 3LDQB 3VOPA 1D0ZA 4L73A 2E5LT 3RQUA 4U7YA 3L70E 2X68A 2W83C 3A7OA 2K9JA 5AW4B 1OEDE 3SFDC 4PJMA 2R3SA 4ASWA 3TLUA 4NUUA 4R4MA 2Q9QD 4YFSA 1USEA 1Q7YQ 3R4YA 2M3BA 4HWFA 4GK5E 4H9PC 3AE8C 2WP9A 2MBGA 3V2NA 1T7SA 2CHNA 2D9DA 3RYHE 2A06G 2B87A 4PFPA 2BS2A 3GHGB 1Q90D 4YSYA 3RK2C 1HNZT 4WBNE 1FE6A 3MACA 2AEMA 2Q5UA 1XMOT 1FC2C 3Q2YA 1YW0A 1SS1A 1QLBA 2KWHA 4A56A
chains in the Genus database with same CATH topology
3CX7B 3OJAB 3B8EB 2X0LB 4JLEA 2HODA 3PUQA 1LT9A 3RPUA 3BVHA 2C5KT 4P09A 1NAFA 4HTEA 5HXRA 3L37A 4X1KE 3LBXA 2EHOB 2LOPA 2XHEB 1S94A 1HS7A 3II6A 5LGUB 3M0DA 5CCGC 3HUSC 3BASA 1AFOA 1JNMA 3I1AA 2HH7A 3N9LA 1N7SD 4WNKA 2WWWA 3RYCE 2I1JA 3KV4A 3F31A 1KILB 3CMLA 3P8CE 1RF1C 3O1IA 1IFIA 3L09A 3AA7B 3EDVA 3HD7B 5M4YA 4PK4A 2IC6A 4WY4A 1LTGC 5EK4A 3HTKB 3I9WA 5JR9A 1HH0A 5DJQC 1L4AB 1LTSC 3N7NA 1HBWA 1L0LK 2WAUA 3KYQA 4IE7A 1N7LA 5FP3A 4OH8B 5AW0B 2H7VC 2Z5HA 1NH4A 1IFNA 2P7JA 3HKDE 5LBMA 2ZM0A 2YKOA 3EFGA 4PJLA 2BZBA 2A45I 3L35A 3CQCB 3WAKA 2WM9A 2WSEH 5BVZA 1GW3A 2NPSC 3PUGA 2Y8DA 5HWYA 2HPLA 2ZLYA 3IFMA 2LSIA 3SOLA 3JC6C 2G0UA 3Q9DA 3H32B 2X9WA 4UVBB 3FBZA 4E7SA 1HJBA 4QKNA 3RK3C 1NO4A 2R5DA 2BDEA 5LHHB 3CVRA 2ES0A 2YKPA 2BVMA 3R2PA 2KZ7B 4UV9B 4NUVA 2C0SA 4KHXA 2NWBA 2FFDA 1T3JA 3CPZA 3N2OA 2Z5IA 4PK6A 3SWHA 3PUAA 3N9OA 4Y99B 4ANJA 4AKHA 4DMWA 2PAJA 1A02F 5KLVK 3OYXA 2OYHC 3L3PA 2D2SA 3ZJ2A 2KLQA 2HFED 1GW4A 1GK6A 1UCUA 2LHNA 1Z0PA 4WY4D 1LTJB 4P0BA 3RRWA 3V4QA 1RE3C 3NXSA 5BMVE 1ZEEA 3BRVB 2RA1A 4M1PA 3FB2A 3V5SA 4UVAB 1FBMA 2YEVC 1DEBA 1GL2B 3VMYA 2M8RA 1J1DC 3E08A 2WMOA 4LGDE 2XV5A 1WYCA 3LIDA 2N1TB 2GUSA 1JY2O 3UFEA 1KZUB 1YTZT 5JRCB 1VOMA 2GUVA 5CHXA 3ETUA 1IFMA 2PJQA 4TV8E 1JUNA 2LHRA 4HH2A 2C9NY 4U74A 2UXNB 2L3LA 5ADXL 3CX6B 3NZQA 1JY2N 2I1KA 3GWHA 4TN7B 1S35A 3ZCJA 2XASB 3PE0A 2H7OA 3GN5A 3UTKA 3RYIE 5HWXA 4H9QC 4QHOA 2LOSA 4TX5A 3N2GE 1FZBA 4PNIA 4ZI3D 3TNUB 4H9NC 2W6BA 3N5LA 1MUUA 4OYJA 1LTIC 1IFDA 5EZYE 4GKGA 1HTJF 5APUA 5JVDE 3HI2A 4QXHB 4C91A 2J59M 2HLOA 1HGVA 3UUMA 4UF0B 1U4QA 1HUCA 3EVYA 3P7IA 3ANWB 2Q9QB 5APQA 3GHGC 3BQIA 2IAKA 1MMAA 2XAQB 4O2BE 2XKMA 2QGSA 5AW8B 3BK9A 3I5CA 2ZMAA 4I4TE 3NRXA 1HF8A 1A02J 2P9BA 3M0AA 5CCGA 3HUSA 1HG5A 2K24A 3J9X1 1VRBA 1N73B 2JJ9A 1NU1K 2YNYA 3KBUA 1WRGA 2EHOC 1RF1A 2VKOA 4AYCA 3B57A 5L3FB 1GZLA 1S9KE 2W0GA 1D0YA 2QM8A 3UUNA 4TV9E 3BQKA 1UX4A 1M1JB 2XTLA 4FI5A 4L0RA 4UELA 4DO0A 2WPQA 4CQIA 3HKEE 3V2PA 4DNDA 3ONXA 1KILC 1PFIA 4H9SE 4AKLA 3NRYA 4O8SA 4ERRA 1RY3A 4UV8B 3RC3A 3HD7C 2VWAA 3LW5H 3CLQA 3FHNA 4DOJA 2W62A 5LHIB 4BJNA 4MHCA 2XZRA 3F2EA 3SWYA 3SWFA 3RK2D 3IHRA 2NPSA 2WT7A 5ETWA 5DQVA 1IAPA 4O4HE 2XDJA 1G2CA 2R32A 1RF0C 4ZKUA 3AVSA 3CL3D 2L8KA 4F6RC 5F8PA 1IO4A 1HWTC 3HRNA 3KV5A 2K5BB 2POHA 3UUXB 3LJCA 3VKGA 5APYA 2CA5A 2HYNA 3PUSA 3AAIA 4AQGA 1ZHCA 4UEMA 1WLXA 2LSYA 1UX5A 2X9HA 5APTA 4W7YA 2C5JA 3N9MA 1N86A 5CCGD 4OFZA 5L3BB 1M7LA 3HA4A 4EOZB 3IEEA 1ZV8A 2XUEA 5JDQA 2OYHA 1LT9B 2LKMA 3GMIA 1NWQA 5LJMA 4EYYR 3RX6A 1FOSF 4PJNA 3A5XA 1X8YA 4YJ2E 3R84B 1CZQA 3EQ2A 4XA4A 2UXXB 1RE3A 3P8MC 4QXCB 1E5WA 5KX5E 2CMRA 4Y99C 1NOHA 1SQVK 2ZFCA 3VMZA 4C7NA 3N9NA 3RL0D 3NBXX 1KQLA 2O1JA 3VU7H 1G1IA 1GU4A 4XZCA 3R6NA 1LTJC 3K3OA 1DX7A 3P32A 4DMVA 3C9IA 1AQ5A 3U59A 5KJ7C 2E9XB 5LA6E 2W6AA 3MGNA 4BJMA 3C51A 4LC1A 3CI9A 2Q7CA 1GL2C 1MZ9A 3HE5A 3ZYMA 2WMNA 3U1AA 5DQWA 4X1YE 4EZHA 2N1TC 1FZCB 4BA9A 1JCDA 4PW8A 3JC6D 4AXPA 3QUJA 5HXSA 1LTBC 3RK3D 4JF7A 1H7CA 5JQGE 3A3YB 1BR4A 2IW5B 3RKOA 3E1IA 2CLYB 4GT1A 1ZLLA 2W63A 2V7KA 2KMFA 5FY7A 1NKNA 2I59A 4N78E 2IFNA 5FYMA 5LHGB 3LIEA 3VP9A 3GHGA 5AVRB 3CQGB 5IYZE 3P8CD 4QX8B 3KV6A 3OJAA 4UIGA 1H88A 1FEWA 2NTXA 4EYUA 3O1JA 2VKDA 1CUNA 3KDPB 1MNEA 2FXMA 3WMM0 3ZLIA 1FZGA 2JPFA 1LGHB 1QSDA 2XAHB 2Q9QC 2W00A 2DCFA 3M06A 2OARA 2WBLA 2A45G 5HXEA 5FNVE 2P1JA 1URQB 2KNDA 2D5UA 1D1BA 5LYJE 2WPRA 1N73C 3N9QA 1SQQK 2JRKA 1IZNB 1KILA 2YKQA 2VB6A 1XTGB 5JH7E 3VYIA 4W7ZA 3SRZA 2NTYA 3D0TA 4MLKA 2DNXA 3HD7A 1JMMA 1BR2A 3M9BA 2C9LY 1M1JC 3NFQA 1JTHB 3E22E 4N3YB 3NZPA 4IFFA 2KXPB 4G63A 1LVKA 4DZOA 2MOZA 2HPCB 2JEEA 1O3XA 2A45H 2IC9A 1H8AA 3T97A 2Q3IA 3M9HA 5KTBA 1RF0A 5L3CB 3LK42 4XBFB 2XAJB 4PFOA 2CCQA 2CEAA 2A2FX 1ZR2A 2BVLA 2N9DA 3FXDB 5LG4A 3V5BA 2WWUA 3AA6B 1YKEB 1JY3O 2CXFA 3ZN0B 2O01H 2Z4EA 3OBVE 2OYIB 1GTWA 2V7IA 1SQBK 3AA0B 5LNKA 4WBOA 4DBQA 2KT9A 1NTMK 1JY3N 4MALA 3H32A 4AKIA 2ACXA 1KFNA 3V4WA 4ILUA 3KVBA 4YJ3E 3QC9A 4O4IE 2WSSV 1US7B 5BU5A 3ESLA 1HX8A 3K8PC 2CXDA 4EXTA 4U72A 2L5GB 2R3CA 1FMVA 5FY0A 4EAHA 3ZCIA 1SP4A 1CI6B 4OK0A 1D1CA 1SFCB 1KILD 3B5NB 1IC2A 1LT9C 1KFMA 4AQFC 2CM0A 4N6JA 5L3GB 3UIAA 5APWA 2VKJA 2ZM2A 5CA0E 2E8IA 2MTQA 5E0OA 2PG8A 3ZMZB 3ZEFB 3HE4B 1RE4C 2V7LA 1LTJA 3VN0A 3M0DC 5LGTB 2XNXA 1NTKK 2LM9A 3K3NA 4ZKPA 4PK5A 3L4FA 5AW9B 4GK0E 2RP4A 1GL2A 3Q5WA 4ZI7E 1T2KD 2N1TA 1FOSE 5F3JA 1SQPK 5CJ4A 4IHJE 4AUWA 1ZN5A 3O9XA 1EZ3A 2V7JA 3I0OA 2Y48B 3RL0B 5JRCA 3L36A 5L3EB 1FMWA 2E9XC 1NTZK 2WITA 3ZMVB 5HXHA 2NW8A 1WYBA 3HKCE 1X79A 2CWYA 3TK1A 1IJ5A 1FZCC 1QUUA 4IE6A 2N2NA 1NHLA 3TNUA 4HYTB 2Z6EA 5J1GA 4BAYB 5JDMA 5AVYB 3HR0A 4H63V 5H6RB 1LWUB 2CLYC 2E42A 1S9KD 5LP6E 3W15B 3DTOA 2Q9IA 1D1AA 3AAEB 1FDMA 4WW0A 1N7SB 2IPPA 2CPBA 4AKRB 3ANWA 2WZ7A 1SLQA 4KUMB 2NW9A 1FAVA 2SPCA 3QK6A 3H6PA 1DH3A 1BR0A 3TKLB 5AW6B 1L4AC 3CKDA 2NP9A 3OAKA 3M91A 1MMGA 2O1KA 3ETVA 5HYAA 3DP7A 2KINB 2LEHA 4C46A 1N73A 5H6QB 1ZKEA 2DHRA 5IHYA 1LRZA 3M65A 3C4XA 4YLHA 2DWGA 4L5GA 3WI3A 3BRTB 4MFRA 5J2UE 1IJDB 4HKAA 4UXNB 5HXCA 1GL2D 1URQC 2OA5A 1GU5A 1M1JA 2ODVA 2N1TD 2E43A 2YINA 1LKXA 1LTTC 1FIOA 4OHFA 2H3RA 4TUYE 2X67A 2YO2A 4P0AA 1FJKA 1LTAC 4IFDK 1J1DB 4IE0A 3TSIA 1SVFA 1NKZB 4KP3C 4V1Av 3MJXA 1H89A 2GM4A 2HODB 4DBRA 4Z8XA 3MD0A 1MIWA 3CWZB 5LBQB 2M67A 2MJZA 2N9BA 1G73A 1YKHB 4OYKA 4B6XA 3LBXB 1HGZA 5LCYA 4G2AA 4GIFA 4IE5A 3PURA 5CCHC 2WTYA 1D0XA 2DLRA 4ZI2C 2K9AA 1FZFA 3RC8A 5EK2A 4PJJA 1FZEA 3N4XA 2L9QA 3KQGA 3NTNA 4E7ZA 1VDFA 5TAOA 4M3LA 5JREA 5LJNA 2LSGA 2B1EA 1MV8A 4GIWA 2OYIC 3C64A 5FMNA 3MA9A 4WY4B 1IFJA 2D0TA 4J2CA 1E1HB 2CWOA 5JR9B 2NPSD 3NMDA 5AVSB 2J58A 3FBLA 4XE5B 3VHLA 3RYFE 2LT3A 2VASA 5FXXA 4IIJE 2WPSA 4AQFA 4EOTA 1L0NK 3PDYA 5JDFA 4HFVA 2HPJA 1G1JA 3J7Yq 4WBAA 5JDHA 3A2AA 3PU3A 1RE4A 1SQXK 2XU6A 1JOCA 3ZC1A 3BATA 4H9OC 4JEUB 2KOGA 2KYVA 3U1CA 2WSCH 1SFCC 3B5NC 2JMKA 5DABA 2FKWB 3EDUA 4GOUA 4HEAA 3LG7A 3RRCA 3KDSE 3ZPOA 4N78D 2X9XA 4CXWA 5FXVA 2E9XA 4ISTA 3ZMSB 1J1EB 5AW7B 5AFUL 3TYYA 3MXZA 2X9YA 2PFVA 2ODUA 2EHOA 5AW5B 2FFDB 1FZCA 3VTPC 5HAXA 2YMYA 5AW1B 3B13A 5AW2B 3RL0C 1MFZA 3V5UA 3AA1B 1JY3P 4EIJA 4MBQA 4ZS2A 3MIWA 3C4WA 1N2DC 2P2UA 3C50A 3CQXC 1JO5A 4TZ4C 2PP6A 3GA8A 3I9YA 4O9BA 2XQYA 2FYZA 4O2AE 1ZR4A 3OKQA 4I6MC 4DVDA 1QL2A 3HL6A 4QWNB 1SA0E 5JDGA 3HTKA 1JY2P 4C7RA 5L3DB 1LWUC 2LSJA 5CA1E 3VP8A 1L4AA 3FXEB 1V9DA 4QX7B 1Z56A 3M9QA 3OYZA 5FXZA 2QM7A 4ZHQE 2V26A 1N7SC 4CXXA 1T98A 4EB6E 5CB4E 1YTZI 1AJ3A 3MUDA 1HVVA 2LE8A 3AB3B 1FJPA 2XAFB 1FU1A 5AW3B 2H43A 3ZC0A 3AAAB 2JQQA 3LFMA 3MTUE 2KWIB 3KINB 2FYUK 1URQA 3BQLA 2YO3A 2CXLA 4AI6A 1MIVA 3GN5B 5JDLA 2HG5D 5AVZB 4X1IE 3ZMTB 2VL8A 4HE8A 3S4UA 2X51A 5KDMC 1EQ7A 3VKHA 3H37A 2D0UA 3RK2B 4KBMB 2H8PD 3KVAA 3MK7C 4XAXB 2KP8A 2J1DG 3N9PA 2E9XD 1SHZC 4ZOLE 2VRSA 4O4LE 3U78A 3I0QA 4AKGA 2CPSA 3EUHA 4EZ4A 5AVTB 3IBPA 5AVVB 4HN9A 2EHOD 1JTHA 2A3DA 1LVFA 5BU8B 4GYSA 2LJLA 2HPCA 3ZYKA 4CZZB 2PBIA 3MZKB 2X66A 1IJ6A 2ZM8A 3G3ZA 3O1HA 4HGAA 2NW7A 5CCHA 3Q2MA 3CX8B 5L2LA 3V2QA 3HUSB 2YU2A 3ZMUB 1KNZA 2LSKA 2N1GA 2VK9A 2P67A 1X79B 1YD8G 4KMCA 5FY1A 1J2JB 3LK2B 2IFMA 4W80A 3HD7D 1RF1B 1WT6A 2OYIA 2W27A 5KJ7A 1L4AD 3F57A 2CE7A 4QXBB 4YHJA 3RH3A 4L9IA 2C0WA 4JEHB 5FXWA 1U5PA 4I43B 1GD2E 4C90A 3UT5E 2JJLA 4GYRA 1MMNA 4CI2B 4K0UA 1T3UA 3SS1A 4O4JE 2QA7A 3T8OA 5APSA 3OA7A 1HFAA 4WY4C 2MYSA 1MMDA 4I50E 3ZJ1A 1ZV4X 2JMHA 1URQD 4IGUA 3O4XE 5JDNA 5JR9C 4LLHA 3KPEA 2NOXA 1CSBA 1QL1A 1CI6A 1SFCA 3B5NA 2NPSB 2WT7B 3ZYLA 1G2CB 2DI4A 1HTLC 4B86A 1WRDA 2KSJA 4X20E 1MNDA 2KLVA 2C0XA 3HE4A 3PU8A 3P7KA 3KBTA 3PTRB 3IR9A 1HG2A 3Q5XA 3ZN1B 3K3QC 1OWAA 3RK3B 4UF0A 3O8ZA 4FJOA 2Q9QA 5AVUB 4IFMA 2IX7C 1JCCA 2VKHA 1XTCC 1GDTA 1W2EA 1T8ZA 4ZI3C 5CCHD 3LK3B 4IE4A 4ZI2D 4ADZA 1MIYA 1B7TA 5GONE 3PP5A 4AQRD 5AVQB 2KB7P 2H7HA 1BR1A 5EK3A 4CXYA 1J1EC 1G8XA 2OYHB 4CI3B 4I55E 4WB4A 4RESB 4ISSA 4I2LC 3KV9A 5LOVE 2FFDC 5J2TE 3AVRA 2K48A 5A1LA 2C5IT 5KJ7D 1IK9A 1OXZA 2BASA 1FZAA 5C8YE 1GK4A 2V1DB 1HCIA 3VMXA 1T2KC 3IF8B 3A5TA 2R5BA 3E0ZA 3UULA 2A72A 4CI1B 1VPCA 4UVCB 1YYCA 5KMGP 4EIWA 1LWUA 4JYBA 1NWMX 4C7NB 5CMZA 2GK9A 3HKBE 4JYCA 4JUYA 1Y64B 3WAJA 2YU1A 1N7SA 2XAGB 1CW5A 5AVWB 3DJBA 4ASKA 3V2RA 1KK7A 2V7MA 2YK0A 1X9VA 3C4ZA 4H63H 1WR6A 5LXTE 3C98B 3HE5B 1SFCD 5CJ0A 4ZS3A 3B5ND 2Y6XA 2W61A 5APXA 2DWKA 2WSFH 3H3AA 3N2KE 4H9RC 4PAGA 3U3IA 2ZXEB 5LGNB 4IDZA 4I1LA 5APVA 5AVXB 3KFWX 3VOPA 1D0ZA 2X68A 3A7OA 5AW4B 4PJMA 4NUUA 2Q9QD 4YFSA 2M3BA 4GK5E 4H9PC 2MBGA 3V2NA 3RYHE 4PFPA 3GHGB 3RK2C 4WBNE 3MACA 2Q5UA 1YW0A 3MKDA 2KWHA 4A56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1A A;  3OJA B;  3HRN A;  1X79 B;  4I1L A;  3P8C D;  5KTB A;  3C9I A;  3U59 A;  2POH A;  3BAT A;  1NKN A;  3N7N A;  4N78 D;  4N3Y B;  5BVZ A;  5BU5 A;  3U1C A;  3BAS A;  3VP8 A;  2FXM A;  1WT6 A;  3N4X A;  3VP9 A;  4ZKU A;  4GIF A;  2JEE A;  4O9B A;  4ZKP A;  1IC2 A;  5BU8 B; 
#chains in the Genus database with same CATH topology
 3CX7 B;  1SQV E;  1E7P A;  2FYU J;  3OJA B;  3PV0 F;  1KB9 E;  3B8E B;  2X0L B;  4JLE A;  2VQF T;  2HOD A;  2AE9 A;  2KSR A;  3PUQ A;  2QSI A;  1AJY A;  1UIX A;  1LT9 A;  3RPU A;  4U7J A;  3BVH A;  2C5K T;  4P09 A;  1AV1 A;  1NAF A;  4HTE A;  5HXR A;  1VQL P;  3L37 A;  3RK3 E;  4X1K E;  5AQR B;  3L72 G;  3CME P;  3LBX A;  2EHO B;  2LOP A;  1QGK B;  1XWM A;  2XHE B;  3CWB D;  1S94 A;  4YSX A;  4U2Y A;  1R8I A;  1HS7 A;  3II6 A;  1KF6 A;  5LGU B;  3M0D A;  3H1L E;  1PIX A;  4EEB A;  4ASV A;  1S5L E;  3L73 E;  4JV5 T;  5ABH A;  3AEC A;  2DW3 A;  5B66 H;  3T1H T;  3JAD A;  5CCG C;  2QVA A;  3HUS C;  3BAS A;  1AFO A;  1JNM A;  4NPF X;  1VQ9 P;  3I1A A;  2HH7 A;  3N9L A;  1LT1 A;  4WYV A;  1N7S D;  4WNK A;  2WWW A;  3RYC E;  2I1J A;  3KV4 A;  3F31 A;  2BCC D;  1KIL B;  3CC7 P;  3AEA A;  3CML A;  5KLI C;  3P8C E;  2K1A A;  1RF1 C;  3IN6 A;  2M3E A;  2BKN A;  3O1I A;  4U2Z A;  4A5X A;  1IFI A;  3B71 A;  3EI0 A;  3L70 G;  3L09 A;  3A0B H;  3AA7 B;  1ZW0 A;  5E79 H;  3EDV A;  4TWH A;  3HD7 B;  5AQU B;  4PK4 A;  5M4Y A;  1S2E A;  4KT0 J;  2IC6 A;  4WY4 A;  4U3F D;  1OW8 A;  3PHL A;  1LTG C;  4DV3 T;  5EK4 A;  3HTK B;  4D6T G;  3RIU A;  3I9W A;  5JR9 A;  1HH0 A;  2K3R A;  5DJQ C;  1L4A B;  4DUY T;  1LTS C;  3ZT5 A;  1P84 H;  4ILC A;  3N7N A;  1HBW A;  2VL0 A;  4KHZ F;  1L0L K;  2WAU A;  3JAF A;  3KYQ A;  4L74 A;  1KQF B;  3TGU J;  4IE7 A;  3T97 B;  1N7L A;  5FP3 A;  1SQV G;  4OH8 B;  1CHU A;  1OED C;  4JI5 T;  5CBN A;  5AW0 B;  2H7V C;  3VR9 A;  2JO1 A;  2Z5H A;  1NH4 A;  1IFN A;  2P7J A;  1FS0 E;  3VRA A;  1EDL A;  3HKD E;  3AEG C;  2XPK A;  5LBM A;  2IIU A;  2ZM0 A;  2YKO A;  3EFG A;  4PJL A;  2QA4 P;  2BZB A;  2A45 I;  2FJB A;  3L35 A;  4NPP A;  4NPD A;  2IYP A;  1VQO P;  2YKS A;  3CQC B;  3WAK A;  2WM9 A;  2WSE H;  5BVZ A;  1GW3 A;  2NPS C;  2XJ7 A;  3H3M A;  3PUG A;  2E74 C;  1L0L D;  1ZOY A;  4LML A;  4HFB A;  2KS1 A;  4TLF A;  3H1L G;  4CN1 A;  2Y8D A;  4F8H A;  5HWY A;  3OTO T;  3L73 G;  1BE3 E;  2HPL A;  1JB0 J;  2ZLY A;  3IFM A;  2LSI A;  3SOL A;  3H1K D;  2BG9 A;  3JC6 C;  2G0U A;  3Q9D A;  3H32 B;  2X9W A;  1YIJ P;  3H1H J;  2AEJ A;  4WVZ A;  1Q82 Q;  4UVB B;  3FBZ A;  3E7K A;  4E7S A;  1HJB A;  2X0H A;  4QKN A;  3RK3 C;  2B88 A;  3AE5 C;  4JPZ B;  1NO4 A;  2R5D A;  4X64 T;  2KK7 A;  1SQQ E;  2ZXX A;  2BDE A;  5LHH B;  2G3A A;  3CVR A;  2ES0 A;  2YKP A;  2J47 A;  4ILB A;  2BVM A;  3UU5 A;  1R5L A;  3IF4 A;  3R2P A;  4I0U A;  2KZ7 B;  4UV9 B;  4K3A A;  3SFE C;  2XM1 A;  4NUV A;  3PUZ F;  1YQ3 A;  1Q81 Q;  2KZI A;  2C0S A;  2OTL P;  4KHX A;  1H0T B;  2NWB A;  2FFD A;  1T3J A;  3CPZ A;  3N2O A;  3CCR P;  2Z5I A;  4H44 D;  4PK6 A;  3SWH A;  2XZE A;  1S72 P;  2E76 D;  2PTF A;  3PUA A;  1EDJ A;  3N9O A;  1PGO A;  5KAI E;  3CC2 P;  4LF8 T;  4Y99 B;  3RL0 g;  4ANJ A;  2NZ2 A;  4DMW A;  4AKH A;  2PAJ A;  1A02 F;  5KLV K;  3OYX A;  2OYH C;  1S5L H;  2XQ7 A;  1PPJ E;  3L3P A;  1JM0 A;  3MHV A;  2F4V T;  2D2S A;  1VF5 C;  3ZJ2 A;  1AVO A;  2QE7 H;  3H1J J;  2KLQ A;  2HFE D;  1N8R Q;  1GW4 A;  1GK6 A;  1OFC X;  4LF5 T;  1UCU A;  2LHN A;  3IA3 A;  2JR8 A;  1Z0P A;  4WY4 D;  1LTJ B;  3JCF A;  4P0B A;  5AQV B;  3ZT6 A;  2ZYD A;  1MFT A;  2XQ5 A;  3RRW A;  3A7M A;  3V4Q A;  3Q5D A;  2JKV A;  1RE3 C;  3NXS A;  3QNU A;  2WVR A;  5BMV E;  1ZEE A;  2LKH A;  1U7M A;  1ZRT E;  3BRV B;  2RA1 A;  1NGM B;  3D6Y A;  4M1P A;  3G06 A;  3FB2 A;  1S4X A;  3V5S A;  2IZ0 A;  4KX6 A;  4UVA B;  1FBM A;  2YEV C;  1DEB A;  2I0M A;  1GL2 B;  3VMY A;  2M8R A;  2RMZ A;  1J1D C;  5KLV D;  3P4P A;  3CX5 E;  3E08 A;  1WMK A;  2WMO A;  4LGD E;  4NPE A;  2XV5 A;  1WYC A;  1BE3 G;  3LID A;  1SQB E;  2N1T B;  3CCJ P;  1J1J A;  2LXC B;  4JI7 T;  1NTM E;  2GUS A;  4ZMD A;  3CC4 P;  1JY2 O;  1PP9 E;  1VL2 A;  1KZU B;  3UFE A;  1YTZ T;  4UB8 E;  5JRC B;  1UK5 A;  1VOM A;  2GUV A;  5CHX A;  3ETU A;  1IFM A;  1KIL E;  2PJQ A;  4P1N A;  1JNZ A;  4TV8 E;  2SPZ A;  1JUN A;  2LHR A;  4HH2 A;  2C9N Y;  3NWI A;  4U74 A;  2UXN B;  2L3L A;  3FXD A;  5ADX L;  3FWN A;  1YIT P;  4JYA T;  3CX6 B;  3NZQ A;  1JY2 N;  2I1K A;  3GWH A;  3SFD A;  2V4H A;  4HFI A;  4TN7 B;  1J5W A;  1S35 A;  1KN7 A;  3ZCJ A;  1RQV A;  3PJS K;  2XAS B;  3PE0 A;  3G71 P;  2H7O A;  2FJA A;  4RO0 A;  3EWK A;  3GN5 A;  3UTK A;  3RYI E;  3AE8 A;  5HWX A;  4H9Q C;  4QHO A;  2LOS A;  5CFB A;  4TX5 A;  3N2G E;  1FZB A;  2IYO A;  4PNI A;  4ZI3 D;  1KNP A;  3TNU B;  4H9N C;  2LXB A;  4HWD A;  2W6B A;  1FJG T;  1L0V A;  3N5L A;  1MUU A;  1NJI Q;  4OYJ A;  5AQN B;  1LTI C;  1IFD A;  5EZY E;  4GKG A;  1HJ0 A;  1HTJ F;  1KYO E;  4ILA A;  5APU A;  5JVD E;  3HI2 A;  4QXH B;  3VR8 A;  1PPJ G;  2WS3 A;  4C91 A;  1BSN A;  2J59 M;  2HLO A;  1HGV A;  4DR5 T;  4IDN A;  3UUM A;  2XM2 A;  4UF0 B;  3AE7 C;  1FDO A;  1HUC A;  1U4Q A;  3EVY A;  1M1K Q;  1R5S A;  4U33 A;  3P7I A;  3ANW B;  3T1Y T;  2BS4 A;  2RPA A;  1K8A Q;  2Q9Q B;  2ZM6 T;  3P4W A;  1XNQ T;  5APQ A;  3GHG C;  3BQI A;  1NTK E;  2Y0C A;  2IAK A;  2CK3 H;  1MMA A;  3AE6 C;  2XAQ B;  4O2B E;  5AQT B;  1KQS O;  2XKM A;  2QGS A;  4WZX A;  5AW8 B;  3BK9 A;  3I5C A;  2ZMA A;  4I4T E;  3NRX A;  1HF8 A;  1Y01 A;  1A02 J;  4IL6 X;  2P9B A;  3EAB A;  3M0A A;  1SQB G;  2D2C D;  2OQQ A;  5CCG A;  1EXI A;  3TLV A;  3HUS A;  3UU3 A;  3S9O A;  1SQP E;  1HG5 A;  1NTM G;  1W0B A;  1PP9 G;  3CWB J;  1KQG B;  2K24 A;  1VRB A;  1GMJ A;  1N73 B;  2JJ9 A;  3J9X 1;  5BR8 T;  1NU1 K;  2YNY A;  2JWA A;  3KBU A;  1WRG A;  2EHO C;  4KHP T;  1RF1 A;  2VKO A;  4AYC A;  1NTZ E;  3B57 A;  5L3F B;  1GZL A;  1S9K E;  2W0G A;  3CCQ P;  1D0Y A;  2QM8 A;  3UUN A;  3S1K A;  1UUS A;  1EC5 A;  3BCC D;  5L47 A;  4TV9 E;  3BQK A;  2BKO A;  1RH5 B;  2ZYG A;  3AED C;  1UX4 A;  3PRJ A;  2VVN A;  1M1J B;  2OGU A;  2XTL A;  2YDQ A;  2QRX A;  4FI5 A;  3GF7 A;  4XFJ A;  2BCC J;  2O01 J;  1L0N J;  3I56 P;  4L0R A;  4UEL A;  4DO0 A;  2WPQ A;  4CQI A;  4JBZ A;  3HKE E;  3V2P A;  4DND A;  4IDQ A;  4B3S T;  3JC2 2;  1DU2 A;  3ONX A;  3G4S P;  3L74 E;  1KIL C;  3RQW A;  1PFI A;  3C1L A;  5B5E E;  1NEK A;  1NU1 D;  1EZV D;  4H9S E;  4AKL A;  3CPW O;  3NRY A;  2ITA A;  2WWV A;  3PUV F;  3CX5 H;  1X9B A;  4U3F J;  4O8S A;  4ERR A;  1OW7 A;  1OED A;  4PD4 E;  1RY3 A;  2ZVN B;  5GTH H;  4UV8 B;  3RC3 A;  3HD7 C;  2VWA A;  3LW5 H;  2P10 A;  2E5V A;  3CLQ A;  2XQ3 A;  1N36 T;  5FVL A;  3AEG A;  3FHN A;  1K73 Q;  4HWC A;  4DOJ A;  2W62 A;  2Y9Z A;  5LHI B;  4BJN A;  2H89 C;  1GQE A;  2W8Z A;  4MHC A;  3CCU P;  1NTK G;  4BWN A;  2XZR A;  3F2E A;  5B66 E;  3SWY A;  2WZH A;  1BSH A;  1W9R A;  3SWF A;  3RK2 D;  3IHR A;  2UUA T;  2NPS A;  2WT7 A;  2QJY B;  3AEE C;  5ETW A;  5DQV A;  2CBJ A;  1IAP A;  4O4H E;  2XDJ A;  4EYY Q;  1G2C A;  2R32 A;  1RF0 C;  4ZKU A;  3AVS A;  3CL3 D;  2L8K A;  2M6B A;  4F6R C;  5F8P A;  1JMB A;  1IO4 A;  1SQP G;  4JI4 T;  1HWT C;  3HRN A;  3KV5 A;  4TWF A;  2K5B B;  2POH A;  3UUX B;  3LJC A;  1L0L J;  4JI1 T;  3VKG A;  5APY A;  2CA5 A;  2A06 D;  3AE5 A;  2HYN A;  2IBZ I;  5E79 E;  2BBJ A;  3PUS A;  3AAI A;  4AQG A;  2AEF A;  1NTZ G;  1ZHC A;  4UEM A;  1WLX A;  2LSY A;  3H1I D;  3H1K J;  1UX5 A;  2LM2 A;  1X0T A;  2X9H A;  3L72 E;  5APT A;  4CN4 A;  2UXD T;  2AXT E;  1M8O B;  4W7Y A;  2KI7 B;  2C5J A;  4JI2 T;  3N9M A;  2JP3 A;  2K9Y A;  1N86 A;  3GG2 A;  5CCG D;  4HFC A;  4OFZ A;  5L3B B;  1M7L A;  1U7J A;  3HA4 A;  4EOZ B;  1IBK T;  1VQK P;  3IEE A;  1ZV8 A;  3L74 G;  1T72 A;  1BDC A;  3I55 P;  2XQ4 A;  3RLF F;  4DID B;  2XUE A;  3CCM P;  3AE9 A;  5JDQ A;  4L76 A;  1P84 D;  2OYH A;  1LT9 B;  2LKM A;  1PGP A;  3ONL C;  1VQM P;  3GMI A;  1NWQ A;  4B3T T;  5LJM A;  1J5E T;  2E75 B;  4EYY R;  3RX6 A;  1T6A A;  3OW2 O;  1FOS F;  4Z1M H;  4PJN A;  1KFY A;  3A5X A;  5LMN T;  1X8Y A;  5HEO A;  4YJ2 E;  3R84 B;  1CZQ A;  2Y9Y A;  3EQ2 A;  4XA4 A;  2UXX B;  4TNW A;  1SUM B;  1RE3 A;  1QX8 A;  3P8M C;  4QXC B;  1PL5 A;  1E5W A;  2O3J A;  5KX5 E;  4H44 B;  4K0K T;  1BCC E;  2CMR A;  4Y99 C;  4D6T E;  2E76 B;  2V6Y B;  4JI6 T;  5HEG A;  1NOH A;  1SQV K;  2ZFC A;  3VMZ A;  1YQ4 A;  2W90 A;  3RBZ A;  4OGQ B;  4C7N A;  3L70 D;  2P58 A;  3N9N A;  3RL0 D;  3NBX X;  1KQL A;  2O1J A;  3VU7 H;  1G1I A;  1R8E A;  1GU4 A;  4XZC A;  5LG3 A;  1AQT A;  3R6N A;  1LTJ C;  3K3O A;  1FDI A;  1DX7 A;  3P32 A;  1OW6 A;  5HCJ A;  5B5E H;  4DMV A;  4IL9 A;  2FJD A;  5AQP B;  4JI3 T;  3C9I A;  1AQ5 A;  3U59 A;  5CBO A;  1UII A;  2H88 C;  4QMA A;  5KJ7 C;  5KLV J;  2E9X B;  2VUR A;  1UUR A;  4PD4 H;  5LA6 E;  2W6A A;  3MGN A;  5H2F H;  4BJM A;  2WMM A;  3FGA D;  3C51 A;  1Q2N A;  4LC1 A;  3CI9 A;  2Q7C A;  2ZT9 B;  1GL2 C;  1MZ9 A;  3HE5 A;  3ZYM A;  2WMN A;  2XY8 B;  1SQV D;  2E74 D;  3VMA A;  3KZI H;  3U1A A;  1YXR A;  5DQW A;  4X1Y E;  4EZH A;  2N1T C;  1KB9 D;  3CXH I;  1FZC B;  4Z91 A;  4BA9 A;  1HNW T;  1JCD A;  5C39 A;  4PW8 A;  2WU5 A;  4YTM A;  1Y47 A;  3JC6 D;  1YJW P;  5C2T A;  3W68 A;  4AXP A;  2FJE A;  3NKZ A;  3QUJ A;  5HXS A;  1Y8A A;  1LTB C;  3P4Q A;  3RK3 D;  4JF7 A;  4LFC T;  1H7C A;  5LB7 B;  5JQG E;  3A3Y B;  1BR4 A;  2IW5 B;  3RKO A;  3E1I A;  3K1S A;  2CLY B;  4GT1 A;  1L0N E;  1ZLL A;  3H1L D;  2W63 A;  2V7K A;  2KMF A;  3RKG A;  5FY7 A;  2JDI H;  3AE7 A;  1NKN A;  3L73 D;  2I59 A;  3ZT7 A;  1D7M A;  4N78 E;  2IFN A;  5FYM A;  5LHG B;  3EHZ A;  2ZYA A;  1NAY A;  3LIE A;  1SQX E;  2IZ1 A;  4JQ0 D;  3VP9 A;  4LF4 T;  3GHG A;  3WUV A;  4X65 T;  3AE6 A;  5AVR B;  3CQG B;  4CPG A;  1BCC G;  3C8V A;  5IYZ E;  3P8C D;  2WDR A;  4TNV A;  2AXT H;  4QX8 B;  3AEF C;  3KV6 A;  3OJA A;  4UIG A;  1H88 A;  2MAW A;  1FEW A;  2NTX A;  4EYU A;  3USS A;  3O1J A;  4GOF A;  1CUN A;  2VKD A;  3KDP B;  2WDQ A;  1N32 T;  1VF5 D;  1MNE A;  2FXM A;  3WMM 0;  5L4E A;  3L75 E;  3GF3 A;  3ZLI A;  3FZL B;  1FZG A;  4TWD A;  3O6Q B;  2JPF A;  4HWI B;  1LGH B;  1QSD A;  2XAH B;  2Q9Q C;  3FZF B;  4U3C A;  4DV5 T;  2W00 A;  2DCF A;  3M06 A;  2OAR A;  3FX0 A;  2WBL A;  3Q5E A;  2A45 G;  5HXE A;  5FNV E;  3Q1M A;  5K5G B;  3AED A;  2P1J A;  1URQ B;  2KND A;  3QOF A;  2D5U A;  2YDR A;  5GTI E;  1KV4 A;  1D1B A;  5LYJ E;  2CBI A;  3CMA P;  2WPR A;  1N73 C;  3N9Q A;  3L71 E;  2PFX A;  2D2C B;  1SQQ K;  3LSV A;  2JRK A;  1IZN B;  1W0A A;  1KIL A;  1S1C X;  1W09 A;  2YKQ A;  5AQI B;  2VB6 A;  2FBW C;  3BCC J;  1XTG B;  5JH7 E;  3VYI A;  4W7Z A;  1OVR A;  5DJT B;  3SRZ A;  2NTY A;  3D0T A;  2V8S V;  4DR1 T;  4MLK A;  2DNX A;  1L0N G;  2QG4 A;  3HD7 A;  1JMM A;  1BR2 A;  3M9B A;  2C9L Y;  1M1J C;  3NFQ A;  1N34 T;  1BE3 D;  1JTH B;  4OWF A;  1NU1 J;  3E22 E;  4N3Y B;  3NZP A;  4IFF A;  2KXP B;  2DL1 A;  4G63 A;  1LVK A;  4IT4 A;  1SQX G;  4DZO A;  2MOZ A;  2H89 A;  3AE4 C;  2HPC B;  2OTK E;  4ZEY A;  3CCL P;  2JEE A;  1SQQ D;  1K05 A;  3MZW B;  1O3X A;  2A45 H;  2IC9 A;  1H8A A;  3AEE A;  3T97 A;  2Q3I A;  1X22 A;  3VRB A;  3M9H A;  5KTB A;  3ZDM A;  1RF0 A;  5L3C B;  3LK4 2;  4DV2 T;  4XBF B;  4YSZ A;  2XAJ B;  4PFO A;  2CCQ A;  5AQS B;  2CEA A;  2NRG A;  3L75 G;  2A2F X;  1ZR2 A;  2BVL A;  2N9D A;  3GW6 A;  3FXD B;  5LG4 A;  1PGJ A;  3V5B A;  2WWU A;  4BRY B;  2XQA A;  1KC8 Q;  3AA6 B;  1YKE B;  3PJA J;  1JY3 O;  2PRR A;  2CXF A;  1XDO A;  2PGD A;  3QWO C;  3RIA A;  3ZN0 B;  4BXL A;  1TU3 F;  2QJY C;  2O01 H;  4IDO A;  2Z4E A;  3OBV E;  2OYI B;  1GTW A;  1PPJ D;  2KSE A;  3RHW A;  2V7I A;  1SQB K;  3AA0 B;  1NYH A;  5LNK A;  3MP7 B;  2FYU E;  2WSC J;  4WBO A;  4DBQ A;  2KT9 A;  1NTM K;  1JY3 N;  1VQ4 P;  4A7P A;  4MAL A;  3H32 A;  4AKI A;  2ACX A;  1KFN A;  2IDB A;  4DT0 A;  3FXE A;  3L71 G;  3V4W A;  3H1I J;  4HKZ H;  4ILU A;  3KVB A;  4YJ3 E;  5GTH E;  3QC9 A;  4O4I E;  4UB6 H;  1ZRT D;  2WSS V;  1US7 B;  5BU5 A;  3ESL A;  4Q25 A;  5AQQ B;  1HX8 A;  3K8P C;  1BGY J;  2CXD A;  2V5C A;  1H0T A;  3CX5 D;  4EXT A;  4U72 A;  1SQB D;  3PH0 A;  2L5G B;  2RH0 A;  2R3C A;  1FMV A;  2BBH A;  4QH1 A;  5FY0 A;  4DV6 T;  1NTM D;  2Y0E A;  2V5D A;  1PP9 D;  2HN1 A;  2NR4 A;  4EAH A;  3ZCI A;  5HEU A;  4YXD C;  1SP4 A;  1CI6 B;  4OK0 A;  1D1C A;  1SFC B;  2W2U A;  1KIL D;  3B5N B;  4DJG A;  1IC2 A;  1LT9 C;  3M3Z B;  1KFM A;  4AQF C;  2CM0 A;  4HB1 A;  2KLU A;  4N6J A;  5L3G B;  3UIA A;  5APW A;  2VKJ A;  2ZM2 A;  5CA0 E;  2ZJS E;  2E75 C;  5GTI H;  5EFW B;  2V7Q J;  3Q5P A;  2E8I A;  2MTQ A;  5E0O A;  4PV1 B;  4H0L D;  2PG8 A;  3ZMZ B;  3ZEF B;  3HE4 B;  1WR0 A;  1RE4 C;  4H13 D;  1LTJ A;  3VN0 A;  2V7L A;  1QEX A;  4YHH T;  3M0D C;  5ABF B;  2XNX A;  1NTK K;  5LGT B;  2LM9 A;  3K3N A;  2X0Y A;  4ZKP A;  2QEX P;  4H44 C;  3AEC C;  4I7Z B;  2H88 A;  1EXJ A;  3L70 J;  3RGU A;  4PK5 A;  2E76 C;  3L4F A;  4NXN T;  5AW9 B;  4GK0 E;  3D70 A;  2RP4 A;  2KNC B;  4LF7 T;  5HCM A;  3AXJ B;  1KYO D;  1IK7 A;  1GL2 A;  3PTZ A;  1NVO A;  4QH5 A;  4OGQ C;  3Q5W A;  3TGU E;  2M5A B;  5AQO B;  4ZI7 E;  5C3J A;  2JQK A;  1T2K D;  2N1T A;  1FOS E;  4IL6 E;  1Y9B A;  2FYU G;  5F3J A;  2Q3E A;  1SQP K;  5CJ4 A;  2WQY C;  3AEA C;  2OLT A;  4GOE A;  4IHJ E;  4AUW A;  1ZN5 A;  3O9X A;  2M6I A;  1EZ3 A;  3ITK A;  2V7J A;  2O01 N;  3I0O A;  3JAE A;  2Y48 B;  3RL0 B;  5JRC A;  3L36 A;  5L3E B;  1FMW A;  2ZAE B;  2E9X C;  1SQV J;  1NTK D;  3FWL A;  3CIR A;  1NTZ K;  2WIT A;  3ZMV B;  5HXH A;  2NW8 A;  1WYB A;  3HKC E;  4COF A;  1E2A A;  2ZT9 C;  1X79 A;  2FYN B;  4DUZ T;  2RN0 A;  4OX9 T;  2XQ6 A;  2CWY A;  2IBZ E;  1QLE D;  3TK1 A;  1IJ5 A;  1FZC C;  1LP1 B;  1QUU A;  4IE6 A;  2N2N A;  2OV9 A;  4DV1 T;  5F5W A;  2WSS H;  1SQP D;  1NHL A;  1OMI A;  3TNU A;  4HYT B;  2Z6E A;  5J1G A;  3H1H E;  4BAY B;  5JDM A;  4LF9 T;  5AVY B;  3H1L J;  3HR0 A;  4H63 V;  3GMA A;  5H6R B;  2Q6Q A;  3SWK A;  3L73 J;  1LWU B;  2CLY C;  2E42 A;  3AEF A;  1NTZ D;  3NVO A;  3JSV C;  1S9K D;  5LP6 E;  1YJN P;  2KIK A;  3W15 B;  3DTO A;  2QIW A;  2Q9I A;  1D1A A;  3AAE B;  1FDM A;  3OVU A;  2XQ9 A;  4WW0 A;  1N7S B;  2QJP B;  2YXR B;  2IPP A;  2CPB A;  4AKR B;  3ANW A;  1ZOY C;  1VCS A;  3UFG A;  2WZ7 A;  5H2F E;  2UUC T;  1SLQ A;  2GA1 A;  4KUM B;  2NW9 A;  4AQY T;  1FAV A;  2SPC A;  3QK6 A;  3H6P A;  3KZI E;  3L74 D;  1DH3 A;  1ZME C;  3D71 A;  1BR0 A;  3TKL B;  5AQK B;  2CPT A;  5AW6 B;  2RKL A;  1XZY A;  1L4A C;  3CKD A;  5JTG A;  3TGU G;  1I6Z A;  4PD4 D;  3W67 A;  1VQP P;  2N9Y B;  2NP9 A;  3OAK A;  3M91 A;  1MMG A;  2QYW A;  4DV4 T;  4EV6 A;  2O1K A;  3ETV A;  5HYA A;  3H1J E;  3DP7 A;  1VQ6 P;  5AQJ B;  2KIN B;  2LEH A;  4C46 A;  2VQE T;  1N73 A;  3MUD C;  5H6Q B;  4CN6 A;  1U57 A;  1YQ3 C;  1ZKE A;  4YY3 T;  2DHR A;  2FBW A;  5IHY A;  1LRZ A;  3M65 A;  3C4X A;  1S3J A;  4YLH A;  2DWG A;  2E5Y A;  2MPK A;  4L5G A;  3WI3 A;  3BRT B;  4MFR A;  5J2U E;  2K9J B;  1IJD B;  4HKA A;  4UXN B;  4GOD A;  5HXC A;  4EGW A;  2IBZ G;  1GL2 D;  1URQ C;  2OA5 A;  1GU5 A;  1M1J A;  2FY8 A;  2ODV A;  4UR9 A;  2UXB T;  2N1T D;  2E43 A;  2YIU B;  2YIN A;  1LKX A;  1LTT C;  1FIO A;  4OHF A;  2H3R A;  3F5H A;  4TUY E;  2X67 A;  3P50 A;  2YO2 A;  2HN2 A;  3SFE A;  2B87 B;  4P0A A;  1FJK A;  1LTA C;  2D2C C;  1J1D B;  3F89 A;  4IFD K;  4IE0 A;  3AE4 A;  3TSI A;  3UU8 A;  4LFA T;  3H1H G;  1XNR T;  1SVF A;  3CXH E;  3G6E P;  1NKZ B;  4MN4 C;  1SE7 A;  5FL0 A;  2B9B A;  4KP3 C;  1BGY E;  3MJX A;  1H89 A;  4V1A v;  1LNQ A;  5TIS H;  1BE3 J;  1W5C E;  4IL6 H;  2GM4 A;  1I94 T;  2MKV A;  4NIQ A;  1EZV I;  3L72 D;  2HOD B;  3PLN A;  4DBR A;  4Z8X A;  3MD0 A;  4YPC A;  1MIW A;  3CWZ B;  5LBQ B;  1SQQ J;  2M67 A;  2MJZ A;  2N9B A;  1G73 A;  1YKH B;  4OYK A;  1QVF O;  5HEH A;  4IRE A;  4B6X A;  1BDD A;  1M7K A;  3LBX B;  4LF6 T;  4ZZB A;  1HGZ A;  5LCY A;  4AIU A;  4G2A A;  4GIF A;  4X5T A;  3CCE P;  4X66 T;  2J62 A;  4IE5 A;  2LKG A;  3PUR A;  5CCH C;  2WTY A;  1D0X A;  2DLR A;  4ZI2 C;  2K9A A;  1FZF A;  5CJ5 A;  3RC8 A;  1UGO A;  5EK2 A;  3H1J G;  4PJJ A;  1FZE A;  3N4X A;  3WUU A;  2L9Q A;  2OYO A;  3KQG A;  3NTN A;  1KEY A;  2FUP A;  4E7Z A;  1VDF A;  5TAO A;  4M3L A;  5JRE A;  5LJN A;  2LSG A;  3Q5R A;  2B1E A;  1BCC D;  1MV8 A;  4D6T D;  4GIW A;  1ZP0 C;  3P4S A;  2OYI C;  3C64 A;  2K37 A;  2JQ9 A;  2YOE A;  5FMN A;  4EDF A;  2WPV B;  2CHO A;  3MA9 A;  4L75 A;  4WY4 B;  1IFJ A;  4HWH A;  2W6J H;  1EDI A;  3H1I G;  2D0T A;  1E1H B;  4J2C A;  2CWO A;  4KJM A;  5JR9 B;  2NPS D;  3NMD A;  5AVS B;  2J58 A;  3FBL A;  4XE5 B;  4YXD A;  3CWB E;  5KAF E;  3VHL A;  1KTM A;  3RYF E;  3TF5 A;  2LT3 A;  1BGY G;  2ZVO B;  2VAS A;  5FXX A;  4IIJ E;  2WPS A;  1SQB J;  3K5B A;  3S4R A;  5CGM A;  2UU9 T;  4AQF A;  4EOT A;  1L0N K;  3PDY A;  5JDF A;  3ZST A;  4HFV A;  1NTM J;  2Q1K A;  2HPJ A;  3LW5 J;  1G1J A;  3J7Y q;  4WBA A;  2B89 A;  1PP9 J;  2HHH T;  1P84 I;  2UXC T;  4HFH A;  5JDH A;  3A2A A;  3PU3 A;  1RE4 A;  4EED A;  1SQX K;  2BCC E;  2XU6 A;  1OIP A;  1JOC A;  3ZC1 A;  3BAT A;  4H9O C;  1K9M Q;  4JEU B;  2KOG A;  2KYV A;  3U1C A;  2V6Y A;  2WSC H;  5ABG A;  1SFC C;  3B5N C;  2JMK A;  5AQH B;  5DAB A;  1S5L X;  2KS1 B;  3AEB C;  2FKW B;  3IAO A;  3EDU A;  4A98 A;  4U3F E;  4GOU A;  3LG7 A;  4HEA A;  3QB5 A;  5KKZ B;  1L0N D;  2BG9 B;  4PV1 C;  2WQY A;  3RRC A;  2JWD A;  4UB6 E;  3KDS E;  3ZPO A;  4N78 D;  1W2B O;  4DV7 T;  3CXH H;  1VQN P;  2X9X A;  4RJT A;  2BEQ D;  4CXW A;  5FXV A;  3MKD A;  1SQX D;  4H0L B;  2E9X A;  4I7Z C;  4IST A;  3ZMS B;  4H13 B;  1J1E B;  5AW7 B;  5AFU L;  4NXM T;  3TDK A;  3TYY A;  3AE2 C;  4HJG H;  3MXZ A;  2X9Y A;  2PFV A;  2ODU A;  2EHO A;  5AW5 B;  4LMK A;  2FFD B;  3JCU E;  1FZC A;  2OTJ P;  1VQ8 P;  2BKP A;  3VTP C;  5HAX A;  2YMY A;  3UQ7 A;  2BEZ F;  5DJU B;  1NTK J;  1E79 H;  3L75 D;  5AW1 B;  3B13 A;  5AW2 B;  4U31 A;  3RL0 C;  1MFZ A;  3V5U A;  2WSF J;  3AE1 C;  1KB9 I;  5AQG B;  3ABV C;  3AA1 B;  1JY3 P;  1ZXG A;  3CWB G;  3CCV P;  4EIJ A;  5M1B A;  1L0L E;  2V7Q H;  5L8R J;  4MBQ A;  3ZKR A;  4ZS2 A;  3MIW A;  3QH9 A;  3C4W A;  1N2D C;  5AQL B;  2P2U A;  2FYN C;  3Q5S A;  3AE3 C;  3C50 A;  3CQX C;  1JEK A;  1JO5 A;  4TZ4 C;  1SQP J;  2PP6 A;  3H1K E;  1XMQ T;  1K04 A;  4TT3 H;  3GA8 A;  3I9Y A;  5J0Z A;  4O9B A;  1EDK A;  1M57 D;  1USD A;  1DEE G;  2FYZ A;  2XQY A;  1Q86 Q;  4O2A E;  1HR0 T;  2BCC G;  1ZR4 A;  1NTZ J;  3OKQ A;  3L71 D;  4I6M C;  4DVD A;  2BS3 A;  1QL2 A;  3HL6 A;  4QWN B;  1SA0 E;  5JDG A;  4ZZC A;  3HTK A;  1JY2 P;  1QVG O;  4C7R A;  5L3D B;  1MKM A;  1LWU C;  4OVN F;  4DR3 T;  2LSJ A;  5CA1 E;  4IOI H;  1HNX T;  3VP8 A;  3D6Z A;  1L4A A;  3FXE B;  1V9D A;  4QX7 B;  3WUT A;  2LR2 A;  4U3F G;  1Z56 A;  3M9Q A;  3QB5 K;  3OYZ A;  2R6G F;  5FXZ A;  2QM7 A;  4ZXL A;  4ZHQ E;  2V26 A;  2E75 D;  1N7S C;  4CXX A;  2QJP C;  1NEN A;  1T98 A;  2W67 A;  2WCA A;  3L74 J;  3O6Q A;  3ONJ A;  1KB9 H;  4EB6 E;  5CB4 E;  2QJK B;  1YTZ I;  4HFD A;  1AJ3 A;  5KAF H;  3L8R A;  2HR3 A;  3MUD A;  1HVV A;  2LE8 A;  3AB3 B;  1FJP A;  2XAF B;  2JIW A;  1FU1 A;  4PJ0 E;  1RQU A;  3RI5 A;  5AW3 B;  2H43 A;  3ZC0 A;  3AAA B;  2K3W A;  2JQQ A;  3LFM A;  3MTU E;  1OX3 A;  2XSA A;  2KWI B;  3KIN B;  2FYU K;  4A97 A;  1URQ A;  2UUB T;  4YTP C;  4OGQ D;  1AVY A;  3BQL A;  2YO3 A;  2CXL A;  4AI6 A;  1YBK A;  1MIV A;  3GN5 B;  5JDL A;  2HG5 D;  3AE9 C;  5AVZ B;  3OPC A;  3CK6 A;  4X1I E;  1PZQ A;  2VL8 A;  4HE8 A;  3ZMT B;  1M90 Q;  2X51 A;  3S4U A;  5KDM C;  1EQ7 A;  3VKH A;  3H37 A;  1IBL T;  2D0U A;  3RK2 B;  4KBM B;  3L39 A;  1IBM T;  2H8P D;  5ABE A;  1L0L G;  3KVA A;  1VQ7 P;  3MK7 C;  1N33 T;  4XAX B;  3EFF K;  2KP8 A;  2J1D G;  3N9P A;  2E9X D;  1SHZ C;  5KLV E;  2E2A A;  4ZOL E;  2VRS A;  4O4L E;  3U78 A;  3I0Q A;  2LLY A;  4AKG A;  3H1K G;  2ZT9 D;  2CPS A;  3KXD A;  3EUH A;  4EZ4 A;  1LJ2 A;  5AVT B;  3IBP A;  5AVV B;  3TLT A;  4HN9 A;  2FYU D;  2EHO D;  1JTH A;  2CRB A;  2YIU C;  2A3D A;  1LVF A;  1YQ4 C;  1VQ5 P;  5AQM B;  5BU8 B;  2J4G A;  4GYS A;  2LJL A;  2Y0D A;  2HPC A;  3ZYK A;  4CZZ B;  3CD6 P;  1XDP A;  2PBI A;  3MZK B;  3PUW F;  2W4X A;  2X66 A;  1IJ6 A;  3UUB A;  3L72 J;  2YXQ B;  1VCT A;  4EI2 A;  2XND H;  2ZM8 A;  3G3Z A;  3JCU H;  3O1H A;  3GLM A;  4HGA A;  2AXD S;  4WWI A;  5CCH A;  2NW7 A;  3Q2M A;  3CX8 B;  5L2L A;  3V2Q A;  1SQQ G;  3WU2 E;  3HUS B;  2YU2 A;  3ZMU B;  1KNZ A;  2LRL A;  2LSK A;  4U7I A;  2N1G A;  3G9R A;  4K35 A;  2BG9 E;  2R44 A;  2VK9 A;  5FVK A;  3P4R A;  2P67 A;  1X79 B;  1YD8 G;  4KMC A;  4BRY A;  5FY1 A;  1J2J B;  2WZI A;  3LK2 B;  2IFM A;  4W80 A;  5KLI B;  3HD7 D;  1RF1 B;  2YDS A;  2L91 A;  2A9U A;  4DR2 T;  3A0H E;  2B76 A;  1WT6 A;  1ZP0 A;  3UU6 A;  2OYI A;  4B3R T;  2W27 A;  5KJ7 A;  2I6H A;  1L4A D;  3F57 A;  2WSE J;  1YJ9 P;  2CE7 A;  4QXB B;  5LMU T;  4YHJ A;  3RH3 A;  4QH4 A;  3PJA A;  4YTN A;  5IWA T;  4L9I A;  2C0W A;  4JEH B;  5FXW A;  1U5P A;  5TJH A;  4I43 B;  1BCC J;  5TIS E;  1GD2 E;  1KMI Z;  1IFP A;  4D6T J;  4C90 A;  3UT5 E;  2JJL A;  2WU2 A;  4GYR A;  1MMN A;  4X62 T;  4CI2 B;  4JI8 T;  4K0U A;  1KD1 Q;  5KLV G;  1OED B;  1L2P A;  1T3U A;  2IDO B;  4O4J E;  2QA7 A;  3SS1 A;  3T8O A;  5APS A;  4LMJ A;  1YI2 P;  3OA7 A;  3TGU D;  1HFA A;  1WCR A;  4WY4 C;  2MYS A;  1MMD A;  4I50 E;  3TLS A;  3ZJ1 A;  4DR7 T;  1ZV4 X;  2JMH A;  1URQ D;  4IGU A;  3O4X E;  3RIU C;  1HX1 B;  4YXW H;  5JDN A;  5JR9 C;  2LRK A;  4PJ0 H;  3UQ4 A;  4DR6 T;  4LLH A;  2IUB A;  3RBX A;  3KPE A;  3CX5 I;  2NOX A;  1CSB A;  1QL1 A;  3E1R A;  1CI6 A;  3H25 A;  2IML A;  3CCS P;  1SFC A;  3B5N A;  2NPS B;  2WT7 B;  2E74 B;  3PUX F;  3BCC E;  3ZYL A;  4KI0 F;  2FXO A;  3AEB A;  1G2C B;  5KAI H;  2DI4 A;  2M0B A;  5L4H A;  1HTL C;  4B86 A;  1WRD A;  2KSJ A;  4X20 E;  1MND A;  2KLV A;  2IBZ D;  2C0X A;  3B5M A;  4DR4 T;  3HE4 A;  3PU8 A;  3P7K A;  2ACZ A;  3X1D A;  3KBT A;  3PTR B;  1Z8U A;  3IR9 A;  1HG2 A;  1WFD A;  3Q5X A;  3ZN1 B;  3K3Q C;  5ABF A;  1OWA A;  3RK3 B;  2XSB A;  5AQF B;  4JBW F;  1NU1 E;  3SSU A;  1EZV E;  4UF0 A;  1DIP A;  2VVS A;  4Y28 J;  3H1H D;  4AIS A;  2YN6 A;  1JNR A;  1HF9 A;  3O8Z A;  3FZM B;  2UWJ E;  4ZNC A;  4FJO A;  2I8D A;  3PUY F;  2KNC A;  2Q9Q A;  3AXJ A;  3AE2 A;  5AVU B;  4IFM A;  2M5A A;  1DD4 A;  2IX7 C;  1JCC A;  2VKH A;  1XTC C;  2KZJ A;  5KKZ C;  1GDT A;  5HEJ A;  1KOR A;  1W2E A;  2AXC A;  3A8Y C;  2BG9 C;  1T8Z A;  4ZI3 C;  1SQX J;  5CCH D;  3LK3 B;  4IE4 A;  4YT0 A;  1KYO I;  4ZI2 D;  4ADZ A;  1MIY A;  1B7T A;  1PGQ A;  3AE1 A;  5GON E;  3ABV A;  3PP5 A;  4H0L C;  4AQR D;  5AVQ B;  2KB7 P;  4Z90 A;  3ZSS A;  2H7H A;  1BR1 A;  5EK3 A;  4H13 C;  4CXY A;  3KHU A;  1J1E C;  1G8X A;  2OYH B;  4UB8 H;  1AA0 A;  1OZH A;  5FKY A;  2XQ8 A;  4CI3 B;  4I55 E;  4DV0 T;  1VF5 B;  3WU2 H;  3AE3 A;  4WB4 A;  1YHQ P;  4RES B;  4ISS A;  5KXJ A;  4I2L C;  3KV9 A;  5LOV E;  3L75 J;  2E5T A;  2FFD C;  5J2T E;  2WY2 A;  3AVR A;  1LP1 A;  2K48 A;  5A1L A;  2C5I T;  1OVU A;  5KJ7 D;  1IK9 A;  1OXZ A;  2BAS A;  1FZA A;  4DCK A;  5C8Y E;  2A06 E;  1GK4 A;  2V1D B;  1HCI A;  3H1J D;  2FXP A;  3VMX A;  1T2K C;  3IF8 B;  3A5T A;  1M62 A;  3RIF A;  4JI0 T;  2R5B A;  3E0Z A;  3UUL A;  2A72 A;  4CI1 B;  3RGL A;  1VPC A;  3A0H H;  3H1I E;  4UVC B;  3EAM A;  1YYC A;  2WDV A;  5KMG P;  4EIW A;  1LWU A;  1PV3 A;  3BCC G;  1RHZ B;  2IHR 1;  4JYB A;  4GKJ T;  1NWM X;  4C7N B;  5CMZ A;  2YMK A;  4HFE A;  2GK9 A;  3HKB E;  4IL4 A;  5FL1 A;  4JYC A;  5IUX A;  3A0B E;  1KYO H;  2W66 A;  4JUY A;  4R4L A;  1Y64 B;  3WAJ A;  3L71 J;  2J5U A;  2YU1 A;  1N7S A;  3B4S A;  2XAG B;  3FZK B;  4RKU J;  1CW5 A;  5AVW B;  2G8Y A;  3DJB A;  4ASK A;  3V2R A;  3Q3D A;  1OVV A;  3V6I A;  1KK7 A;  1NU1 G;  1EZV G;  2V7M A;  2YK0 A;  1X9V A;  1T8B A;  1P84 E;  3C4Z A;  4B3M T;  3TLW A;  3CXH D;  4H63 H;  1WR6 A;  5LXT E;  3FZH B;  3RF1 A;  4GDO A;  3C98 B;  2WB5 A;  1BGY D;  2K88 A;  3HE5 B;  1SFC D;  5CJ0 A;  3B5N D;  2Y6X A;  4ZS3 A;  4GKK T;  2KUB A;  2W61 A;  5APX A;  3UU4 A;  2DWK A;  2JQH A;  2WSF H;  3H3A A;  4LFB T;  4YTP A;  3N2K E;  4H9R C;  4PAG A;  1DD3 A;  1KNR A;  3U3I A;  4PV1 D;  4IDP A;  2QJK C;  2ZXE B;  4PD4 I;  5LGN B;  4IDZ A;  4I1L A;  5APV A;  5AVX B;  2V6X A;  1M56 D;  3KFW X;  3LDQ B;  3VOP A;  1D0Z A;  4L73 A;  2E5L T;  3RQU A;  4U7Y A;  3L70 E;  2X68 A;  2W83 C;  3A7O A;  2K9J A;  5AW4 B;  1OED E;  3SFD C;  4PJM A;  2R3S A;  4ASW A;  3TLU A;  4NUU A;  4R4M A;  2Q9Q D;  4YFS A;  1USE A;  1Q7Y Q;  3R4Y A;  2M3B A;  4HWF A;  4GK5 E;  4H9P C;  3AE8 C;  2WP9 A;  2MBG A;  3V2N A;  1T7S A;  2CHN A;  2D9D A;  3RYH E;  2A06 G;  2B87 A;  4PFP A;  2BS2 A;  3GHG B;  1Q90 D;  4YSY A;  3RK2 C;  1HNZ T;  4WBN E;  1FE6 A;  3MAC A;  2AEM A;  2Q5U A;  1XMO T;  1FC2 C;  3Q2Y A;  1YW0 A;  1SS1 A;  1QLB A;  2KWH A;  4A56 A; 
#chains in the Genus database with same CATH homology
 3CX7 B;  3OJA B;  3B8E B;  2X0L B;  4JLE A;  2HOD A;  3PUQ A;  1LT9 A;  3RPU A;  3BVH A;  2C5K T;  4P09 A;  1NAF A;  4HTE A;  5HXR A;  3L37 A;  4X1K E;  3LBX A;  2EHO B;  2LOP A;  2XHE B;  1S94 A;  1HS7 A;  3II6 A;  5LGU B;  3M0D A;  5CCG C;  3HUS C;  3BAS A;  1AFO A;  1JNM A;  3I1A A;  2HH7 A;  3N9L A;  1N7S D;  4WNK A;  2WWW A;  3RYC E;  2I1J A;  3KV4 A;  3F31 A;  1KIL B;  3CML A;  3P8C E;  1RF1 C;  3O1I A;  1IFI A;  3L09 A;  3AA7 B;  3EDV A;  3HD7 B;  5M4Y A;  4PK4 A;  2IC6 A;  4WY4 A;  1LTG C;  5EK4 A;  3HTK B;  3I9W A;  5JR9 A;  1HH0 A;  5DJQ C;  1L4A B;  1LTS C;  3N7N A;  1HBW A;  1L0L K;  2WAU A;  3KYQ A;  4IE7 A;  1N7L A;  5FP3 A;  4OH8 B;  5AW0 B;  2H7V C;  2Z5H A;  1NH4 A;  1IFN A;  2P7J A;  3HKD E;  5LBM A;  2ZM0 A;  2YKO A;  3EFG A;  4PJL A;  2BZB A;  2A45 I;  3L35 A;  3CQC B;  3WAK A;  2WM9 A;  2WSE H;  5BVZ A;  1GW3 A;  2NPS C;  3PUG A;  2Y8D A;  5HWY A;  2HPL A;  2ZLY A;  3IFM A;  2LSI A;  3SOL A;  3JC6 C;  2G0U A;  3Q9D A;  3H32 B;  2X9W A;  4UVB B;  3FBZ A;  4E7S A;  1HJB A;  4QKN A;  3RK3 C;  1NO4 A;  2R5D A;  2BDE A;  5LHH B;  3CVR A;  2ES0 A;  2YKP A;  2BVM A;  3R2P A;  2KZ7 B;  4UV9 B;  4NUV A;  2C0S A;  4KHX A;  2NWB A;  2FFD A;  1T3J A;  3CPZ A;  3N2O A;  2Z5I A;  4PK6 A;  3SWH A;  3PUA A;  3N9O A;  4Y99 B;  4ANJ A;  4AKH A;  4DMW A;  2PAJ A;  1A02 F;  5KLV K;  3OYX A;  2OYH C;  3L3P A;  2D2S A;  3ZJ2 A;  2KLQ A;  2HFE D;  1GW4 A;  1GK6 A;  1UCU A;  2LHN A;  1Z0P A;  4WY4 D;  1LTJ B;  4P0B A;  3RRW A;  3V4Q A;  1RE3 C;  3NXS A;  5BMV E;  1ZEE A;  3BRV B;  2RA1 A;  4M1P A;  3FB2 A;  3V5S A;  4UVA B;  1FBM A;  2YEV C;  1DEB A;  1GL2 B;  3VMY A;  2M8R A;  1J1D C;  3E08 A;  2WMO A;  4LGD E;  2XV5 A;  1WYC A;  3LID A;  2N1T B;  2GUS A;  1JY2 O;  3UFE A;  1KZU B;  1YTZ T;  5JRC B;  1VOM A;  2GUV A;  5CHX A;  3ETU A;  1IFM A;  2PJQ A;  4TV8 E;  1JUN A;  2LHR A;  4HH2 A;  2C9N Y;  4U74 A;  2UXN B;  2L3L A;  5ADX L;  3CX6 B;  3NZQ A;  1JY2 N;  2I1K A;  3GWH A;  4TN7 B;  1S35 A;  3ZCJ A;  2XAS B;  3PE0 A;  2H7O A;  3GN5 A;  3UTK A;  3RYI E;  5HWX A;  4H9Q C;  4QHO A;  2LOS A;  4TX5 A;  3N2G E;  1FZB A;  4PNI A;  4ZI3 D;  3TNU B;  4H9N C;  2W6B A;  3N5L A;  1MUU A;  4OYJ A;  1LTI C;  1IFD A;  5EZY E;  4GKG A;  1HTJ F;  5APU A;  5JVD E;  3HI2 A;  4QXH B;  4C91 A;  2J59 M;  2HLO A;  1HGV A;  3UUM A;  4UF0 B;  1U4Q A;  1HUC A;  3EVY A;  3P7I A;  3ANW B;  2Q9Q B;  5APQ A;  3GHG C;  3BQI A;  2IAK A;  1MMA A;  2XAQ B;  4O2B E;  2XKM A;  2QGS A;  5AW8 B;  3BK9 A;  3I5C A;  2ZMA A;  4I4T E;  3NRX A;  1HF8 A;  1A02 J;  2P9B A;  3M0A A;  5CCG A;  3HUS A;  1HG5 A;  2K24 A;  3J9X 1;  1VRB A;  1N73 B;  2JJ9 A;  1NU1 K;  2YNY A;  3KBU A;  1WRG A;  2EHO C;  1RF1 A;  2VKO A;  4AYC A;  3B57 A;  5L3F B;  1GZL A;  1S9K E;  2W0G A;  1D0Y A;  2QM8 A;  3UUN A;  4TV9 E;  3BQK A;  1UX4 A;  1M1J B;  2XTL A;  4FI5 A;  4L0R A;  4UEL A;  4DO0 A;  2WPQ A;  4CQI A;  3HKE E;  3V2P A;  4DND A;  3ONX A;  1KIL C;  1PFI A;  4H9S E;  4AKL A;  3NRY A;  4O8S A;  4ERR A;  1RY3 A;  4UV8 B;  3RC3 A;  3HD7 C;  2VWA A;  3LW5 H;  3CLQ A;  3FHN A;  4DOJ A;  2W62 A;  5LHI B;  4BJN A;  4MHC A;  2XZR A;  3F2E A;  3SWY A;  3SWF A;  3RK2 D;  3IHR A;  2NPS A;  2WT7 A;  5ETW A;  5DQV A;  1IAP A;  4O4H E;  2XDJ A;  1G2C A;  2R32 A;  1RF0 C;  4ZKU A;  3AVS A;  3CL3 D;  2L8K A;  4F6R C;  5F8P A;  1IO4 A;  1HWT C;  3HRN A;  3KV5 A;  2K5B B;  2POH A;  3UUX B;  3LJC A;  3VKG A;  5APY A;  2CA5 A;  2HYN A;  3PUS A;  3AAI A;  4AQG A;  1ZHC A;  4UEM A;  1WLX A;  2LSY A;  1UX5 A;  2X9H A;  5APT A;  4W7Y A;  2C5J A;  3N9M A;  1N86 A;  5CCG D;  4OFZ A;  5L3B B;  1M7L A;  3HA4 A;  4EOZ B;  3IEE A;  1ZV8 A;  2XUE A;  5JDQ A;  2OYH A;  1LT9 B;  2LKM A;  3GMI A;  1NWQ A;  5LJM A;  4EYY R;  3RX6 A;  1FOS F;  4PJN A;  3A5X A;  1X8Y A;  4YJ2 E;  3R84 B;  1CZQ A;  3EQ2 A;  4XA4 A;  2UXX B;  1RE3 A;  3P8M C;  4QXC B;  1E5W A;  5KX5 E;  2CMR A;  4Y99 C;  1NOH A;  1SQV K;  2ZFC A;  3VMZ A;  4C7N A;  3N9N A;  3RL0 D;  3NBX X;  1KQL A;  2O1J A;  3VU7 H;  1G1I A;  1GU4 A;  4XZC A;  3R6N A;  1LTJ C;  3K3O A;  1DX7 A;  3P32 A;  4DMV A;  3C9I A;  1AQ5 A;  3U59 A;  5KJ7 C;  2E9X B;  5LA6 E;  2W6A A;  3MGN A;  4BJM A;  3C51 A;  4LC1 A;  3CI9 A;  2Q7C A;  1GL2 C;  1MZ9 A;  3HE5 A;  3ZYM A;  2WMN A;  3U1A A;  5DQW A;  4X1Y E;  4EZH A;  2N1T C;  1FZC B;  4BA9 A;  1JCD A;  4PW8 A;  3JC6 D;  4AXP A;  3QUJ A;  5HXS A;  1LTB C;  3RK3 D;  4JF7 A;  1H7C A;  5JQG E;  3A3Y B;  1BR4 A;  2IW5 B;  3RKO A;  3E1I A;  2CLY B;  4GT1 A;  1ZLL A;  2W63 A;  2V7K A;  2KMF A;  5FY7 A;  1NKN A;  2I59 A;  4N78 E;  2IFN A;  5FYM A;  5LHG B;  3LIE A;  3VP9 A;  3GHG A;  5AVR B;  3CQG B;  5IYZ E;  3P8C D;  4QX8 B;  3KV6 A;  3OJA A;  4UIG A;  1H88 A;  1FEW A;  2NTX A;  4EYU A;  3O1J A;  2VKD A;  1CUN A;  3KDP B;  1MNE A;  2FXM A;  3WMM 0;  3ZLI A;  1FZG A;  2JPF A;  1LGH B;  1QSD A;  2XAH B;  2Q9Q C;  2W00 A;  2DCF A;  3M06 A;  2OAR A;  2WBL A;  2A45 G;  5HXE A;  5FNV E;  2P1J A;  1URQ B;  2KND A;  2D5U A;  1D1B A;  5LYJ E;  2WPR A;  1N73 C;  3N9Q A;  1SQQ K;  2JRK A;  1IZN B;  1KIL A;  2YKQ A;  2VB6 A;  1XTG B;  5JH7 E;  3VYI A;  4W7Z A;  3SRZ A;  2NTY A;  3D0T A;  4MLK A;  2DNX A;  3HD7 A;  1JMM A;  1BR2 A;  3M9B A;  2C9L Y;  1M1J C;  3NFQ A;  1JTH B;  3E22 E;  4N3Y B;  3NZP A;  4IFF A;  2KXP B;  4G63 A;  1LVK A;  4DZO A;  2MOZ A;  2HPC B;  2JEE A;  1O3X A;  2A45 H;  2IC9 A;  1H8A A;  3T97 A;  2Q3I A;  3M9H A;  5KTB A;  1RF0 A;  5L3C B;  3LK4 2;  4XBF B;  2XAJ B;  4PFO A;  2CCQ A;  2CEA A;  2A2F X;  1ZR2 A;  2BVL A;  2N9D A;  3FXD B;  5LG4 A;  3V5B A;  2WWU A;  3AA6 B;  1YKE B;  1JY3 O;  2CXF A;  3ZN0 B;  2O01 H;  2Z4E A;  3OBV E;  2OYI B;  1GTW A;  2V7I A;  1SQB K;  3AA0 B;  5LNK A;  4WBO A;  4DBQ A;  2KT9 A;  1NTM K;  1JY3 N;  4MAL A;  3H32 A;  4AKI A;  2ACX A;  1KFN A;  3V4W A;  4ILU A;  3KVB A;  4YJ3 E;  3QC9 A;  4O4I E;  2WSS V;  1US7 B;  5BU5 A;  3ESL A;  1HX8 A;  3K8P C;  2CXD A;  4EXT A;  4U72 A;  2L5G B;  2R3C A;  1FMV A;  5FY0 A;  4EAH A;  3ZCI A;  1SP4 A;  1CI6 B;  4OK0 A;  1D1C A;  1SFC B;  1KIL D;  3B5N B;  1IC2 A;  1LT9 C;  1KFM A;  4AQF C;  2CM0 A;  4N6J A;  5L3G B;  3UIA A;  5APW A;  2VKJ A;  2ZM2 A;  5CA0 E;  2E8I A;  2MTQ A;  5E0O A;  2PG8 A;  3ZMZ B;  3ZEF B;  3HE4 B;  1RE4 C;  2V7L A;  1LTJ A;  3VN0 A;  3M0D C;  5LGT B;  2XNX A;  1NTK K;  2LM9 A;  3K3N A;  4ZKP A;  4PK5 A;  3L4F A;  5AW9 B;  4GK0 E;  2RP4 A;  1GL2 A;  3Q5W A;  4ZI7 E;  1T2K D;  2N1T A;  1FOS E;  5F3J A;  1SQP K;  5CJ4 A;  4IHJ E;  4AUW A;  1ZN5 A;  3O9X A;  1EZ3 A;  2V7J A;  3I0O A;  2Y48 B;  3RL0 B;  5JRC A;  3L36 A;  5L3E B;  1FMW A;  2E9X C;  1NTZ K;  2WIT A;  3ZMV B;  5HXH A;  2NW8 A;  1WYB A;  3HKC E;  1X79 A;  2CWY A;  3TK1 A;  1IJ5 A;  1FZC C;  1QUU A;  4IE6 A;  2N2N A;  1NHL A;  3TNU A;  4HYT B;  2Z6E A;  5J1G A;  4BAY B;  5JDM A;  5AVY B;  3HR0 A;  4H63 V;  5H6R B;  1LWU B;  2CLY C;  2E42 A;  1S9K D;  5LP6 E;  3W15 B;  3DTO A;  2Q9I A;  1D1A A;  3AAE B;  1FDM A;  4WW0 A;  1N7S B;  2IPP A;  2CPB A;  4AKR B;  3ANW A;  2WZ7 A;  1SLQ A;  4KUM B;  2NW9 A;  1FAV A;  2SPC A;  3QK6 A;  3H6P A;  1DH3 A;  1BR0 A;  3TKL B;  5AW6 B;  1L4A C;  3CKD A;  2NP9 A;  3OAK A;  3M91 A;  1MMG A;  2O1K A;  3ETV A;  5HYA A;  3DP7 A;  2KIN B;  2LEH A;  4C46 A;  1N73 A;  5H6Q B;  1ZKE A;  2DHR A;  5IHY A;  1LRZ A;  3M65 A;  3C4X A;  4YLH A;  2DWG A;  4L5G A;  3WI3 A;  3BRT B;  4MFR A;  5J2U E;  1IJD B;  4HKA A;  4UXN B;  5HXC A;  1GL2 D;  1URQ C;  2OA5 A;  1GU5 A;  1M1J A;  2ODV A;  2N1T D;  2E43 A;  2YIN A;  1LKX A;  1LTT C;  1FIO A;  4OHF A;  2H3R A;  4TUY E;  2X67 A;  2YO2 A;  4P0A A;  1FJK A;  1LTA C;  4IFD K;  1J1D B;  4IE0 A;  3TSI A;  1SVF A;  1NKZ B;  4KP3 C;  4V1A v;  3MJX A;  1H89 A;  2GM4 A;  2HOD B;  4DBR A;  4Z8X A;  3MD0 A;  1MIW A;  3CWZ B;  5LBQ B;  2M67 A;  2MJZ A;  2N9B A;  1G73 A;  1YKH B;  4OYK A;  4B6X A;  3LBX B;  1HGZ A;  5LCY A;  4G2A A;  4GIF A;  4IE5 A;  3PUR A;  5CCH C;  2WTY A;  1D0X A;  2DLR A;  4ZI2 C;  2K9A A;  1FZF A;  3RC8 A;  5EK2 A;  4PJJ A;  1FZE A;  3N4X A;  2L9Q A;  3KQG A;  3NTN A;  4E7Z A;  1VDF A;  5TAO A;  4M3L A;  5JRE A;  5LJN A;  2LSG A;  2B1E A;  1MV8 A;  4GIW A;  2OYI C;  3C64 A;  5FMN A;  3MA9 A;  4WY4 B;  1IFJ A;  2D0T A;  4J2C A;  1E1H B;  2CWO A;  5JR9 B;  2NPS D;  3NMD A;  5AVS B;  2J58 A;  3FBL A;  4XE5 B;  3VHL A;  3RYF E;  2LT3 A;  2VAS A;  5FXX A;  4IIJ E;  2WPS A;  4AQF A;  4EOT A;  1L0N K;  3PDY A;  5JDF A;  4HFV A;  2HPJ A;  1G1J A;  3J7Y q;  4WBA A;  5JDH A;  3A2A A;  3PU3 A;  1RE4 A;  1SQX K;  2XU6 A;  1JOC A;  3ZC1 A;  3BAT A;  4H9O C;  4JEU B;  2KOG A;  2KYV A;  3U1C A;  2WSC H;  1SFC C;  3B5N C;  2JMK A;  5DAB A;  2FKW B;  3EDU A;  4GOU A;  4HEA A;  3LG7 A;  3RRC A;  3KDS E;  3ZPO A;  4N78 D;  2X9X A;  4CXW A;  5FXV A;  2E9X A;  4IST A;  3ZMS B;  1J1E B;  5AW7 B;  5AFU L;  3TYY A;  3MXZ A;  2X9Y A;  2PFV A;  2ODU A;  2EHO A;  5AW5 B;  2FFD B;  1FZC A;  3VTP C;  5HAX A;  2YMY A;  5AW1 B;  3B13 A;  5AW2 B;  3RL0 C;  1MFZ A;  3V5U A;  3AA1 B;  1JY3 P;  4EIJ A;  4MBQ A;  4ZS2 A;  3MIW A;  3C4W A;  1N2D C;  2P2U A;  3C50 A;  3CQX C;  1JO5 A;  4TZ4 C;  2PP6 A;  3GA8 A;  3I9Y A;  4O9B A;  2XQY A;  2FYZ A;  4O2A E;  1ZR4 A;  3OKQ A;  4I6M C;  4DVD A;  1QL2 A;  3HL6 A;  4QWN B;  1SA0 E;  5JDG A;  3HTK A;  1JY2 P;  4C7R A;  5L3D B;  1LWU C;  2LSJ A;  5CA1 E;  3VP8 A;  1L4A A;  3FXE B;  1V9D A;  4QX7 B;  1Z56 A;  3M9Q A;  3OYZ A;  5FXZ A;  2QM7 A;  4ZHQ E;  2V26 A;  1N7S C;  4CXX A;  1T98 A;  4EB6 E;  5CB4 E;  1YTZ I;  1AJ3 A;  3MUD A;  1HVV A;  2LE8 A;  3AB3 B;  1FJP A;  2XAF B;  1FU1 A;  5AW3 B;  2H43 A;  3ZC0 A;  3AAA B;  2JQQ A;  3LFM A;  3MTU E;  2KWI B;  3KIN B;  2FYU K;  1URQ A;  3BQL A;  2YO3 A;  2CXL A;  4AI6 A;  1MIV A;  3GN5 B;  5JDL A;  2HG5 D;  5AVZ B;  4X1I E;  3ZMT B;  2VL8 A;  4HE8 A;  3S4U A;  2X51 A;  5KDM C;  1EQ7 A;  3VKH A;  3H37 A;  2D0U A;  3RK2 B;  4KBM B;  2H8P D;  3KVA A;  3MK7 C;  4XAX B;  2KP8 A;  2J1D G;  3N9P A;  2E9X D;  1SHZ C;  4ZOL E;  2VRS A;  4O4L E;  3U78 A;  3I0Q A;  4AKG A;  2CPS A;  3EUH A;  4EZ4 A;  5AVT B;  3IBP A;  5AVV B;  4HN9 A;  2EHO D;  1JTH A;  2A3D A;  1LVF A;  5BU8 B;  4GYS A;  2LJL A;  2HPC A;  3ZYK A;  4CZZ B;  2PBI A;  3MZK B;  2X66 A;  1IJ6 A;  2ZM8 A;  3G3Z A;  3O1H A;  4HGA A;  2NW7 A;  5CCH A;  3Q2M A;  3CX8 B;  5L2L A;  3V2Q A;  3HUS B;  2YU2 A;  3ZMU B;  1KNZ A;  2LSK A;  2N1G A;  2VK9 A;  2P67 A;  1X79 B;  1YD8 G;  4KMC A;  5FY1 A;  1J2J B;  3LK2 B;  2IFM A;  4W80 A;  3HD7 D;  1RF1 B;  1WT6 A;  2OYI A;  2W27 A;  5KJ7 A;  1L4A D;  3F57 A;  2CE7 A;  4QXB B;  4YHJ A;  3RH3 A;  4L9I A;  2C0W A;  4JEH B;  5FXW A;  1U5P A;  4I43 B;  1GD2 E;  4C90 A;  3UT5 E;  2JJL A;  4GYR A;  1MMN A;  4CI2 B;  4K0U A;  1T3U A;  3SS1 A;  4O4J E;  2QA7 A;  3T8O A;  5APS A;  3OA7 A;  1HFA A;  4WY4 C;  2MYS A;  1MMD A;  4I50 E;  3ZJ1 A;  1ZV4 X;  2JMH A;  1URQ D;  4IGU A;  3O4X E;  5JDN A;  5JR9 C;  4LLH A;  3KPE A;  2NOX A;  1CSB A;  1QL1 A;  1CI6 A;  1SFC A;  3B5N A;  2NPS B;  2WT7 B;  3ZYL A;  1G2C B;  2DI4 A;  1HTL C;  4B86 A;  1WRD A;  2KSJ A;  4X20 E;  1MND A;  2KLV A;  2C0X A;  3HE4 A;  3PU8 A;  3P7K A;  3KBT A;  3PTR B;  3IR9 A;  1HG2 A;  3Q5X A;  3ZN1 B;  3K3Q C;  1OWA A;  3RK3 B;  4UF0 A;  3O8Z A;  4FJO A;  2Q9Q A;  5AVU B;  4IFM A;  2IX7 C;  1JCC A;  2VKH A;  1XTC C;  1GDT A;  1W2E A;  1T8Z A;  4ZI3 C;  5CCH D;  3LK3 B;  4IE4 A;  4ZI2 D;  4ADZ A;  1MIY A;  1B7T A;  5GON E;  3PP5 A;  4AQR D;  5AVQ B;  2KB7 P;  2H7H A;  1BR1 A;  5EK3 A;  4CXY A;  1J1E C;  1G8X A;  2OYH B;  4CI3 B;  4I55 E;  4WB4 A;  4RES B;  4ISS A;  4I2L C;  3KV9 A;  5LOV E;  2FFD C;  5J2T E;  3AVR A;  2K48 A;  5A1L A;  2C5I T;  5KJ7 D;  1IK9 A;  1OXZ A;  2BAS A;  1FZA A;  5C8Y E;  1GK4 A;  2V1D B;  1HCI A;  3VMX A;  1T2K C;  3IF8 B;  3A5T A;  2R5B A;  3E0Z A;  3UUL A;  2A72 A;  4CI1 B;  1VPC A;  4UVC B;  1YYC A;  5KMG P;  4EIW A;  1LWU A;  4JYB A;  1NWM X;  4C7N B;  5CMZ A;  2GK9 A;  3HKB E;  4JYC A;  4JUY A;  1Y64 B;  3WAJ A;  2YU1 A;  1N7S A;  2XAG B;  1CW5 A;  5AVW B;  3DJB A;  4ASK A;  3V2R A;  1KK7 A;  2V7M A;  2YK0 A;  1X9V A;  3C4Z A;  4H63 H;  1WR6 A;  5LXT E;  3C98 B;  3HE5 B;  1SFC D;  5CJ0 A;  4ZS3 A;  3B5N D;  2Y6X A;  2W61 A;  5APX A;  2DWK A;  2WSF H;  3H3A A;  3N2K E;  4H9R C;  4PAG A;  3U3I A;  2ZXE B;  5LGN B;  4IDZ A;  4I1L A;  5APV A;  5AVX B;  3KFW X;  3VOP A;  1D0Z A;  2X68 A;  3A7O A;  5AW4 B;  4PJM A;  4NUU A;  2Q9Q D;  4YFS A;  2M3B A;  4GK5 E;  4H9P C;  2MBG A;  3V2N A;  3RYH E;  4PFP A;  3GHG B;  3RK2 C;  4WBN E;  3MAC A;  2Q5U A;  1YW0 A;  3MKD A;  2KWH A;  4A56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...