4N78D

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
529
structure length
202
Chain Sequence
b'HTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRSDARSVLLEAIRKGIQLRKVEEIENDVATILSRRIAVEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 57
structure length 202
sequence length 529
ec nomenclature
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78D01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4n78D02
3VP9A 3OJAB 3P8CD 3U1AA 4O9BA 5BU8B 1WT6A 3C9IA 2JEEA 4N3YB 1IC2A 4ZKPA 4I1LA 3BATA 3N7NA 5KTBA 3BASA 2POHA 5BU5A 1NKNA 4GIFA 1X79B 3N4XA 3HRNA 2FXMA 3U59A 3VP8A 3U1CA 4N78D 4ZKUA 5BVZA
chains in the Genus database with same CATH superfamily
1N73B 2PBIA 2QYWA 1NTKE 2JJLA 2G0UA 5FL1A 4ILBA 1HNXT 3AEBC 1NTZG 4BAYB 2J58A 5FXWA 2MBGA 2KSEA 3UUNA 2IBZD 5FYMA 1UX5A 4DBRA 1MMNA 3M9BA 2FYUD 2IX7C 5GTHH 4I2LC 2CM0A 3RF1A 2Y9YA 5HEOA 1LKXA 1VL2A 5DQVA 1OFCX 1NU1E 4A56A 1KILD 4NXMT 2E5YA 1SS1A 4DJGA 5AVXB 1SE7A 2IW5B 2PRRA 5AW0B 1YJWP 4IGUA 5AQFB 4YXDC 2VKJA 3CC2P 2PP6A 4TT3H 5LHIB 3KV4A 4L76A 1KTMA 2MJZA 3RYFE 1VQ5P 4PK6A 1YQ3C 3RL0g 3CCSP 3KINB 5C8YE 2WU2A 3WU2H 4BRYA 1VQ8P 3MIWA 4W7YA 2XM1A 1T2KC 4P09A 5AQSB 1S9KE 2DL1A 2MOZA 5AQOB 4H44C 3M0DA 5FY7A 5KLVK 1A02F 2CXFA 2KP8A 2J47A 2W2UA 4IIJE 3G3ZA 3PJAJ 3UU6A 3RK3C 4AUWA 5KLVD 4AKGA 2LKMA 2CLYC 2DNXA 1GK6A 2V7LA 1MMDA 4QH5A 1AFOA 4OHFA 5AQGB 3AA7B 1KQFB 3L75G 4H63H 1IFDA 1GL2C 4YFSA 2WDRA 1VPCA 2DCFA 2KLVA 1E5WA 1KB9I 3PUYF 4X20E 4Z8XA 3SRZA 1S5LE 5L3BB 3II6A 5A1LA 4NUUA 4U3FJ 1NOHA 5KAIH 2LHNA 5L4HA 1YTZT 2WSSH 1U4QA 1BR4A 2J1DG 4GODA 2VQET 3RRWA 4K0KT 4XA4A 3JAEA 4A5XA 2JQQA 1BCCG 4KHZF 3OJAB 3C50A 1T2KD 2CWYA 1HVVA 2W61A 3D6YA 3G4SP 4H44D 1QVFO 1SQBJ 1OW6A 3HL6A 3M9HA 3RK3D 1GMJA 2E9XA 2MPKA 4DV1T 2Y9ZA 3OAKA 3LW5J 4D6TE 4DV3T 4H9PC 3L73J 4IL6X 4IDNA 4PJ0H 1VF5D 2WZ7A 2K9AA 2NP9A 3RKGA 4DMWA 1KB9D 1EZVG 1M56D 3H1HJ 1T3JA 5FNVE 2KLUA 3Q5SA 2WPVB 2Y48B 4UV8B 1FZCB 2C0WA 1OEDB 1R8EA 2KT9A 4J2CA 1LT9B 4IFDK 4C90A 2NW8A 4ILUA 4H13B 4EDFA 4UB6H 1SQBD 4ADZA 2ZMAA 3UT5E 1S72P 4IREA 3QB5A 3F5HA 3O1JA 5B66H 2JJ9A 3KFWX 2F4VT 3FBLA 4E7SA 3EWKA 2V7KA 3PLNA 2WSFJ 1RE4C 1J5WA 3CPWO 5L47A 2XUEA 3MJXA 2YO2A 1VOMA 2ZYDA 1HH0A 1OWAA 1OW7A 4LF4T 4KHPT 1NTKJ 1PFIA 3RYCE 4EZ4A 1E7PA 2K24A 1QGKB 3AE7C 2YDSA 3HE4A 1JY2N 5LGUB 3PTRB 1VQLP 4UIGA 3HUSC 2FFDC 2PG8A 2CXDA 4RJTA 3SOLA 1SQQE 3O8ZA 3BQKA 3OPCA 1NU1J 2BKNA 3K3QC 3KV9A 4OYJA 1Q2NA 4KJMA 1GQEA 5APXA 3L70E 2W66A 3CVRA 3IA3A 5CA0E 1RF0A 3DP7A 3O4XE 1JCDA 4TWHA 2K88A 4UVAB 2YDQA 2V8SV 1NTKD 1A02J 5HWYA 4COFA 3ZN0B 2WMNA 3RYHE 2ES0A 2LM2A 3NRXA 4WWIA 3L72G 5KLIC 4AQFA 2HH7A 2IFNA 2Q6QA 3EVYA 1NH4A 3ZJ1A 5H6QB 4IL6E 2C0SA 2R44A 3RYIE 1NU1D 2OTJP 3BQLA 4DIDB 1Q7YQ 3AB3B 3H1JG 5AW1B 1FU1A 2D2CB 2IYOA 2V5DA 1RF1A 2BG9A 1LWUA 3L36A 2KMFA 2LSGA 2K9JA 5AFUL 4Y99C 3ZMZB 4RO0A 1UIIA 3ANWA 5CBNA 1DD3A 4NPPA 2JKVA 1OW8A 2VQFT 3KPEA 1NTZE 1S9KD 3Q5PA 1J1EB 1IBMT 1S1CX 1Y8AA 3KVAA 4AKIA 1D7MA 1PGJA 3EI0A 2GM4A 1FEWA 3H1KG 4IFMA 1HGVA 3MZWB 5CBOA 1R5LA 3HA4A 3GG2A 3I9WA 4DNDA 3AECA 4D6TJ 2J5UA 3K5BA 4RESB 2K9YA 1W9RA 4GT1A 3AE5A 1BR2A 3VOPA 1N32T 1IJ6A 2JQKA 3A2AA 1S35A 5CA1E 5CJ5A 5C39A 3A5XA 1WR6A 2XQ5A 4HFBA 1US7B 3H1LE 1GU5A 5LHHB 1EDJA 2L9QA 1YQ4A 1G73A 3HE4B 4P0BA 1IJ5A 1BGYG 4TZ4C 4O4JE 3GHGC 2ZT9B 3BATA 2JPFA 2YEVC 3T1YT 3SFDC 2KZIA 1VQMP 3OVUA 3CCJP 4O8SA 5TAOA 3V2PA 2LKGA 2OYHB 3ZCIA 2XPKA 2YXRB 3CI9A 4ZXLA 1KQSO 4UELA 3M0AA 5CCGC 5JDGA 1YJ9P 3WUUA 5TISH 3N2OA 3H1IG 3M65A 4UV9B 3TLUA 4R4MA 1MFTA 1Q81Q 5F3JA 4I4TE 2Y8DA 1IZNB 3PDYA 3C9IA 3FWLA 3L37A 4D6TD 3SFEA 1IFPA 3UU5A 3FXDB 5JRCB 4NPEA 4YSZA 2P9BA 3BK9A 1VQ7P 3USSA 3KBUA 3FZFB 1L0NK 3RI5A 5L2LA 2G8YA 1EDLA 4EI2A 3LIEA 2VURA 1ZKEA 3GA8A 4TWFA 1L4AA 2YXQB 3AEGC 3PP5A 4O2AE 1WRGA 3AXJA 1FZGA 1KYOE 4HFHA 3KDSE 2UWJE 3B71A 1LP1B 4JPZB 1RF1B 2BG9B 1LWUB 2XASB 1SFCC 5BMVE 3Q5XA 2K9JB 3IN6A 5LA6E 2QGSA 2WQYA 1ZR2A 2BKOA 3C4XA 4NPDA 4FI5A 4ZZBA 3VMAA 3U59A 3F89A 3ANWB 3JCUE 2K5BB 1N2DC 3AA1B 4AIUA 2XQ3A 1PP9G 3FZKB 2LXBA 3L70J 3CCQP 2N9BA 3PRJA 3PH0A 3CLQA 1KD1Q 1KN7A 1BDCA 4A98A 3P4PA 4JI8T 3ONXA 2WDQA 1VQOP 1FZEA 2QJKC 3VR9A 3VTPC 4KHXA 2LSIA 4W7ZA 1JTHA 1LVFA 3E7KA 2XTLA 2OGUA 1AV1A 1MFZA 2OYIC 2XQAA 4AI6A 1VDFA 1Q90D 2KLQA 1O3XA 2E2AA 2X0YA 1SQXK 3LK2B 4DR4T 2MTQA 1SQQK 3WUVA 4JI5T 3RIFA 2W83C 4ASVA 2ZYGA 4P0AA 3RKOA 4JI6T 2DI4A 2V7QH 1SQQD 3O1HA 3ZJ2A 4CXXA 1FOSF 1SFCD 4AQGA 3Q9DA 5JREA 2H3RA 5LG3A 1NO4A 1FOSE 3V5SA 3UUMA 2YN6A 3VMZA 4U2ZA 2QSIA 2VRSA 3L70D 2PTFA 2ZXXA 1NJIQ 2XU6A 3IFMA 3HE5A 1NTZJ 2C0XA 3V6IA 2E5TA 3TK1A 1FIOA 2B87B 3AE2C 1R5SA 1R8IA 1W0BA 1JNZA 2J62A 2XY8B 5E79H 2O1KA 2KOGA 3CMEP 5AVWB 1G1IA 1JMMA 5KKZB 1PL5A 1N7LA 3ZMVB 3M91A 3AAEB 1NTMG 2XM2A 3UFGA 1KFYA 5AQNB 3O1IA 1WCRA 4A97A 3JC22 3D71A 1UURA 1L4AB 3H1LJ 1OZHA 2H7OA 3N2GE 3OW2O 3L74G 1RQUA 1HG2A 4Z90A 3CD6P 4B3RT 1NTZK 4I1LA 3G6EP 5FP3A 1LTJB 3BASA 3NTNA 4WW0A 1RE3A 1XTGB 5M4YA 4MALA 2HPCB 2BG9E 1NTZD 3CQGB 3EDUA 4U7JA 2XQ4A 4H63V 1P84H 1S2EA 5AVRB 5C2TA 1LTAC 1FZAA 1JY2P 1EC5A 1OXZA 2GK9A 3CCUP 1KFMA 3RX6A 1KORA 4WY4B 3CMLA 4F6RC 2O01N 3EAMA 5AVTB 2X51A 3RBZA 2LSKA 1N73A 2LSJA 3P7KA 1OMIA 2E9XC 4PK4A 3JC6C 2BS2A 2FXPA 2POHA 4JQ0D 3QH9A 1JTHB 4LF9T 5LGTB 2JO1A 1OVVA 3H1LD 2X0LB 1L2PA 2Q9QA 4OFZA 3B4SA 4C46A 4YJ3E 5LJNA 5BVZA 2MAWA 4LGDE 4OGQC 4DT0A 2E74B 4WVZA 4HN9A 1KYOI 3G9RA 1ZEEA 1DEEG 4AYCA 3PUAA 2DHRA 2A45H 2D2CC 3UU3A 2VB6A 3A8YC 3H1KE 4PW8A 1XMOT 2WDVA 3UFEA 1T3UA 2FJAA 2QA7A 1SQXG 2C5IT 5KAIE 3P32A 1YIJP 3HE5B 1EZVI 3MGNA 2V4HA 3BRTB 3W68A 4HFVA 3AE6A 2E9XD 3PU3A 1BGYE 5JR9A 3JC6D 4BXLA 4ZI3C 1S5LX 1JO5A 5AQJB 3RPUA 1N33T 2JIWA 2FBWA 3AEDA 3OA7A 3A7MA 3EHZA 1UK5A 5AW2B 2K1AA 4NPFX 4CN6A 3MD0A 2A9UA 4DR6T 2H89C 3Q2MA 1Q82Q 3SWFA 4OGQD 3H1IE 1KYOD 5AQHB 4HKZH 2PFXA 2UU9T 4ZHQE 1KNPA 2D2CD 2LHRA 3ZC1A 3PHLA 4EOZB 2XHEB 2MYSA 3ZDMA 2UXBT 2OTLP 1M1KQ 3C4WA 1M7LA 3B5NB 3T8OA 2CMRA 1ZP0A 3M9QA 2WB5A 4IDPA 1IFNA 5KJ7A 4R4LA 4HE8A 3ZKRA 1MIYA 5LBQB 3I9YA 4EZHA 2FXMA 5LCYA 3NWIA 3L3PA 3TSIA 4DR5T 3DJBA 3KHUA 2WWVA 2R6GF 2PAJA 4UB6E 3QOFA 3QUJA 2LOSA 3GMIA 3I1AA 5H2FH 4ZI3D 5KXJA 3A0BH 5KLVJ 1N36T 1D0XA 2P10A 5B66E 4IE6A 2PFVA 1ZXGA 2C9LY 2XQ6A 3EDVA 1QVGO 1Y47A 1FZCA 2CPSA 1OEDA 5E0OA 3HD7C 3P4QA 1LT9A 1LTSC 5EK2A 2Q9QB 1HJBA 4AQFC 4O2BE 3NFQA 1PP9E 1S94A 3C8VA 2NW9A 1BDDA 5BR8T 2WM9A 2YINA 2ZVOB 4IE4A 3F57A 1RF1C 2BG9C 2VK9A 3CX5H 2BCCE 1HWTC 4YSYA 5K5GB 5C3JA 4JV5T 5IHYA 1VQ6P 1HS7A 3Q5RA 3AE1C 1QL2A 5DJUB 1GK4A 5JDMA 4C7NB 3HTKB 3T1HT 3N9LA 4EGWA 3UU8A 1K8AQ 1G2CA 2B89A 1QX8A 1CZQA 1NHLA 2AEJA 5JR9B 1NENA 1L0LG 1IFIA 1VF5C 1WYBA 2E75B 4HB1A 3AECC 3HD7D 4TV8E 3I55P 3AVRA 3KZIH 1M90Q 2KIKA 1XWMA 1G8XA 3H32A 5AQUB 5JDFA 4I7ZB 3RK2B 4QH4A 4H9RC 2WT7B 4EB6E 2R3CA 2ZVNB 1JY2O 4ILCA 5AW7B 3VMYA 3VN0A 3NRYA 5L8RJ 2B9BA 2B88A 2WPRA 1FJKA 3RGLA 3H1KJ 5FVKA 4MN4C 2DW3A 2YDRA 4IE0A 2W0GA 4L74A 3J7Yq 2RMZA 2LJLA 3CWBG 1E2AA 4HTEA 2IPPA 2QJPB 4DR2T 1J1JA 2WITA 1RHZB 3BCCE 2M5AB 3VMXA 2ZAEB 2E8IA 2XQ8A 2HN1A 3P7IA 4PAGA 4QXCB 4M3LA 2X9XA 2V6YA 3LW5H 2JP3A 4ZNCA 1LTBC 3H3AA 3R4YA 4DBQA 3MHVA 1CW5A 3IHRA 3TLVA 2FJBA 1J1DB 3UIAA 3SFEC 2NR4A 2XV5A 2XDJA 3L74E 4PK5A 4Z1MH 4ISTA 4C7RA 2SPCA 5KKZC 2KINB 1L0NE 3WMM0 2A45G 2KZJA 2UUBT 3TKLB 1NKNA 3UU4A 4X65T 3O9XA 1CHUA 2ZYAA 1QSDA 2LRKA 1Q86Q 1N86A 2K37A 3EUHA 2KWHA 3H1IJ 5KAFH 3FXEA 5FXZA 2ZM6T 1L4AC 5EK3A 1E79H 3H1KD 3T97A 3RIUA 1H88A 5L3DB 2KS1B 2WMMA 3C98B 2N1TB 2UXCT 3CQCB 4G2AA 1MMGA 2WQYC 4AISA 4DV2T 3N7NA 2LR2A 1YXRA 1K04A 4DO0A 1M1JB 4DV7T 2FYNB 2N2NA 2FY8A 3I56P 3ABVA 5APWA 3QK6A 3HKEE 1FS0E 1BGYD 1GD2E 1AJ3A 2LOPA 3ZMSB 1N8RQ 1G2CB 2BBHA 5TISE 2YNYA 4HWHA 4PJLA 4U3CA 2AEFA 2H88C 1YI2P 4HFCA 3LK42 1URQA 4LFAT 4YHJA 1Y01A 3OBVE 2CPBA 4L0RA 5J2TE 2QIWA 3H1ID 2YO3A 3H32B 2HLOA 1SQXE 5HEHA 2B76A 5AQVB 4TWDA 1L4AD 3K1SA 4X66T 5KMGP 2X9WA 4ZZCA 2XAGB 3KBTA 2XQ7A 1RY3A 3AEAA 2OYHA 3AEEA 5L3GB 2W62A 2CPTA 2ZLYA 5L3FB 4GYSA 2C5JA 4UF0B 4XZCA 1CSBA 5IYZE 3L39A 1XDPA 3ZSTA 1KQGB 2BCCJ 3FWNA 5FXXA 1LNQA 2M0BA 3TLWA 3K3OA 4YPCA 4UVBB 2LRLA 3RL0B 3AE4C 3FXDA 2XKMA 2VKDA 5JRCA 3GW6A 3Q5WA 1M57D 2V6YB 1KC8Q 1NWQA 2CE7A 3BQIA 2BKPA 4IOIH 4LMLA 4DUZT 3N2KE 2LLYA 2QJYC 1NAFA 2Y0DA 3OKQA 5FL0A 3IEEA 3K8PC 2ACZA 1QLBA 4B3ST 1PP9D 2O01J 5AW3B 4ANJA 1OEDE 1M7KA 1Y64B 1LP1A 2JR8A 2RP4A 3B13A 3UQ4A 2JDIH 1NGMB 3N9OA 2YIUB 3FXEB 4X64T 2NZ2A 1VQKP 2JMHA 3ZPOA 1BSHA 4N6JA 1FDMA 3T97B 2YK0A 2CXLA 4YT0A 1YW0A 2BCCD 2M6BA 1SQPK 3FBZA 3UULA 1RE3C 5FKYA 1X22A 4C91A 4HWDA 5JDNA 3W67A 1ZV8A 4ZKPA 1JB0J 2FXOA 1MZ9A 2ODVA 3BCCJ 4MLKA 4TUYE 3O6QA 4JBWF 3JSVC 5LGNB 4K0UA 3ZCJA 1XNQT 3PJAA 1AQTA 2C9NY 4U3FG 1N73C 4W80A 2ZFCA 4HWIB 5B5EH 4QH1A 5JDQA 1W0AA 4WBOA 1JM0A 1URQB 1LJ2A 2HN2A 3L74J 3AE9A 1X9BA 3ONLC 1L0NJ 4EYYR 3A7OA 1LGHB 2G3AA 2E76B 3VRAA 3CXHH 1GL2A 2NOXA 2WSEH 3CL3D 3ETUA 3P8CE 3S4UA 2BVMA 1HR0T 1S4XA 5CJ4A 1HJ0A 3E1RA 2B1EA 5AVVB 4YY3T 2I1JA 5F8PA 1NTMK 4ZI7E 1DEBA 4GKJT 2YKOA 4JI7T 2L5GB 3L73G 2QE7H 4QHOA 1KILB 3L75E 3ETVA 3BCCD 4YTPA 1T6AA 2B87A 1L0LE 3GF7A 4JYCA 3VKHA 3H1HG 2KNDA 4JF7A 1FJGT 3H37A 5BU5A 4UB8H 4IDQA 5IUXA 3AE8A 3SWHA 3L74D 1P84E 1VQNP 2NPSA 2JWDA 4YXWH 2WPSA 3AE6C 2WBLA 4CZZB 5JR9C 3FZMB 1HG5A 1L0ND 1BCCE 4IE5A 2DWGA 3LBXB 2FBWC 3AEDC 2V7MA 3HKBE 3CWBE 3GMAA 2YMYA 3V2RA 1SQXJ 2CA5A 4QKNA 1AJYA 1SQQJ 1LTJA 2BDEA 3RK2C 1HUCA 2HPCA 1DX7A 5CB4E 1M8OB 3V2NA 4EXTA 2KXPB 1J2JB 1IO4A 3WAJA 1ZP0C 4WY4A 1EZVE 3LFMA 5HCJA 3CX6B 5KJ7C 4BJNA 4GDOA 2QJPC 4JYAT 5APYA 2M6IA 4E7ZA 4LF7T 1T8BA 5HXCA 3O6QB 2A06G 3AE3A 3L4FA 2OA5A 1IJDB 4H44B 4ERRA 4CI2B 5AQPB 4H0LB 1SQPG 1J1DC 3RK3B 2E75D 2WZHA 2CLYB 5AVZB 2XJ7A 2UUCT 1SQXD 4O4LE 5AW4B 3C4ZA 2GUVA 1FZCC 1ZV4X 2XZRA 4PD4H 1OEDC 1GL2B 4ZS3A 4CPGA 3RK2D 2KSRA 1LT9C 3N9PA 1WLXA 4YJ2E 4ZI2C 5DQWA 2AXTH 1FZFA 5DJQC 4H9SE 2LXCB 2E43A 2QG4A 4HWFA 4V1Av 4H13C 3X1DA 3CQXC 1H8AA 2HPLA 5AVUB 2QA4P 5EFWB 5KJ7D 5ADXL 3MUDA 2GUSA 2FUPA 5BU8B 2I59A 1GW4A 3M0DC 1SQVK 1PPJG 2K3RA 1SA0E 2WY2A 4GYRA 3N5LA 1NVOA 3D6ZA 2CHNA 2JQ9A 1FAVA 2NPSB 4WBNE 3L71G 4F8HA 1E1HB 1KF6A 5J2UE 2WSCJ 1LTTC 5AVYB 4LF5T 2L8KA 5CJ0A 1IK9A 3TGUG 3PV0F 4NUVA 1ZOYA 1FMWA 2WCAA 3LSVA 2RA1A 4EYUA 5H2FE 4GOFA 2IYPA 4CN1A 4XBFB 2X67A 4ZI2D 4EOTA 4TNVA 1ZLLA 3MP7B 5GTHE 4KUMB 3B5NA 2R5DA 1SVFA 4H13D 4B86A 1DD4A 2MKVA 4JI3T 3KDPB 5FY0A 5KDMC 3WAKA 5JQGE 4GK0E 3AAIA 4D6TG 4DR3T 5AW6B 3L72E 3L75J 5LOVE 4Y28J 2O3JA 3TDKA 4IE7A 3WU2E 2FJDA 3RL0C 2XQ9A 1PGOA 3CX5E 3H1JE 2M3BA 3U3IA 1H7CA 4X1IE 1U7JA 3ESLA 2ZM0A 2WTYA 1P84I 2I0MA 3KV5A 5ABEA 3RC8A 3PUXF 3VP8A 1WFDA 2E5LT 1W5CE 5LXTE 4DV0T 5J1GA 4YLHA 1BCCJ 2V1DB 1QLED 3P8CD 3B57A 3PUSA 3CWBJ 4N3YB 2AE9A 3NVOA 2XQYA 2EHOA 1RH5B 5JDHA 4H9QC 1D1CA 1HTJF 2VVSA 1L0LK 3KZIE 5APTA 3HUSB 2FFDB 4GIFA 3SFDA 3L75D 2CRBA 1HX1B 1L0LD 4U3FE 5AW8B 1MIVA 1L0VA 3ZMUB 2W8ZA 5L3CB 4C7NA 3BRVB 4TN7B 3HTKA 1J1EC 4JI4T 1YYCA 2QEXP 1MIWA 5CCGA 5ABFB 2R32A 3Q2YA 1JOCA 3RL0D 2R3SA 2A45I 2N9DA 1X0TA 4U2YA 3ZYMA 1HF9A 1FJPA 1P84D 4DMVA 4DV5T 4QXBB 3ABVC 3JCFA 3ITKA 3U78A 1MV8A 4L73A 2YOEA 1LVKA 5CCHA 1BCCD 5GTIH 3V4QA 4X62T 1HNWT 3N9MA 4CI1B 4LMKA 1URQC 3CWBD 3L73E 2WT7A 2I8DA 3VRBA 1BE3G 4BWNA 4PJ0E 1SQVG 2HR3A 3L70G 3NBXX 4ZEYA 2E76C 2OARA 5KX5E 3C1LA 2M3EA 3EFGA 3H1HE 2ZT9C 4AQYT 4QX7B 5HEUA 2DWKA 4EV6A 1EXIA 5CGMA 2ZM8A 1NYHA 3AEAC 3RBXA 2OYHC 1CUNA 4KX6A 4EEDA 1X79B 2CWOA 3P8MC 1IFJA 1EZVD 2M5AA 3TLSA 3KXDA 2ZJSE 3I5CA 5KAFE 4WB4A 2ZXEB 4Y99B 3ZEFB 1RF0C 5HXHA 2BEZF 1JNRA 2W4XA 5L3EB 3FGAD 2WS3A 1IBKT 1HGZA 3UQ7A 3PUQA 3FZHB 5F5WA 1HCIA 4P1NA 4CQIA 3M06A 2XSAA 1GU4A 2HODB 3MXZA 1ZR4A 4BJMA 4QMAA 3IR9A 1URQD 4ASWA 2HYNA 2OTKE 1T8ZA 2BBJA 1RQVA 3U1CA 4JLEA 3S1KA 5FY1A 2Y6XA 3CPZA 3MZKB 2OYIA 5DABA 2E76D 1X8YA 1GDTA 5AQLB 4RKUJ 2ZT9D 2FYUK 3S4RA 4L75A 5AQKB 1HTLC 4UXNB 1XNRT 2KS1A 2EHOB 2N1TA 5AQQB 2A06E 1LWUC 2LE8A 1MNDA 2P58A 5CHXA 2M8RA 3GHGB 2YU2A 1J5ET 2LM9A 2E5VA 3CX8B 5AVQB 2WVRA 3V5UA 4DOJA 3HKDE 1GW3A 3FX0A 2Q5UA 3F31A 1M1JA 3PUGA 3RQUA 3ZC0A 1SQPE 1PGPA 1IAPA 3PUWF 2BZBA 1KFNA 3L72J 3A3YB 1WYCA 1ZRTE 4ILAA 3AA0B 3R84B 2P67A 5JDLA 3H1LG 1S3JA 2Y0EA 2NTYA 3CX5I 3AE2A 3H1JJ 3HKCE 1SUMB 2JQHA 3AE5C 2ZM2A 2KK7A 4H0LC 1M62A 2AEMA 1DH3A 1KB9H 4LFBT 1GTWA 2QRXA 2WU5A 4B3TT 1H0TA 3A0HH 4IL9A 4GIWA 3AE9C 1EDIA 2RKLA 4ZKUA 2VKHA 1XZYA 1YQ4C 1PGQA 5APUA 2I6HA 3UUXB 3CCVP 2H7VC 4UF0A 2H43A 1WT6A 1PPJE 4PV1B 4OK0A 5HEGA 1SLQA 4AXPA 3H6PA 1JMBA 5JVDE 2XZEA 1JY3N 4HFIA 3L72D 1NTME 1H89A 3L71E 3F2EA 1SFCB 3TNUB 4XE5B 3TGUE 1JCCA 1N7SA 4YTPC 1XMQT 4YTNA 4PJMA 4HGAA 3CX5D 3H1JD 2A2FX 2IMLA 2YMKA 2W6JH 4U33A 2CHOA 1KQLA 2WMOA 4WZXA 1BGYJ 4LF8T 2WWWA 4HH2A 4H0LD 3AE8C 1HNZT 1MNEA 2NPSC 3QWOC 2QJKB 1UX4A 3RLFF 3ZMTB 5M1BA 2Z6EA 2IZ1A 2W27A 1ZN5A 4H9NC 4HKAA 3AEFA 2P2UA 2WWUA 2OYIB 5B5EE 1GL2D 1T72A 2JMKA 1HF8A 3L35A 1LTJC 4U3FD 3CXHE 3CX7B 5J0ZA 2RN0A 5ABHA 2WSFH 1NEKA 1OVUA 4A7PA 1SQBK 1K73Q 3KQGA 2IBZG 4WY4C 4WNKA 3G06A 2FYUG 3LG7A 4I50E 4U31A 3P50A 4MHCA 2BASA 3NMDA 4BRYB 1PIXA 2KUBA 2V7IA 1N34T 3CCMP 3N9NA 3AE3C 2OQQA 2NPSD 2XAHB 2X68A 4X1KE 4OH8B 4IT4A 3L73D 4UB8E 3CMAP 3PE0A 2QM8A 4HFEA 4KI0F 1H0TB 5APSA 2C5KT 2IC9A 3ZT6A 1BSNA 4HWCA 3LK3B 3RH3A 2W6BA 1PP9J 3H1HD 1AVOA 4GK5E 4QX8B 2UXNB 2E74C 2H89A 2X66A 3M3ZB 5LBMA 3H25A 3PURA 3Q3DA 3VHLA 3B5MA 3ZYKA 1W09A 1MKMA 1KILA 3V2QA 1VCSA 5KLVG 4UR9A 1WRDA 5LMUT 2P7JA 1FDOA 1MUUA 3C64A 4KT0J 3NZPA 1AQ5A 3VKGA 2XNDH 1SQPJ 4WY4D 2Z5IA 3HRNA 2V6XA 1N7SB 2X9YA 2IZ0A 3MUDC 4ZOLE 2V7JA 4OWFA 2LT3A 3RQWA 3V4WA 1BE3E 4I0UA 4TLFA 1VCTA 4XFJA 4K35A 4FJOA 1SQVE 1G1JA 3MTUE 1KEYA 3KV6A 4U72A 1IK7A 3LBXA 4EEBA 2UUAT 2Q1KA 1NTKK 3FB2A 4IDOA 4JI1T 3H3MA 4DV4T 2L3LA 5KTBA 2W63A 3AEBA 3R2PA 2E9XB 3OYXA 2O01H 1UGOA 4LC1A 3TYYA 2VASA 2XAFB 2FJEA 1EDKA 1X9VA 4LLHA 1S5LH 2VVNA 3W15B 1ZOYC 3LDQB 4DZOA 3NXSA 5TJHA 3OYZA 4I55E 2E74D 2XAJB 3I0OA 1AA0A 1KMIZ 3HD7A 3DTOA 5LHGB 3NZQA 3SWYA 2A06D 3UUBA 1NU1K 3PUZF 4HEAA 1FC2C 4B6XA 2XNXA 4LF6T 4OGQB 3MACA 3PU8A 2JWAA 4B3MT 3B5NC 4YXDA 1WR0A 2IDOB 2IHR1 1SQPD 3JAFA 4PD4E 3CC7P 1SP4A 5HXSA 2VWAA 2P1JA 1YQ3A 3VR8A 1NTMJ 2AXTE 3L71J 3PTZA 1ZW0A 1ZRTD 4EIJA 3MK7C 3FZLB 3TGUJ 1NWMX 4DUYT 4EAHA 2UXDT 1BR0A 5HWXA 2QM7A 3AE1A 3SWKA 1EZ3A 4HFDA 3TF5A 2ACXA 2VL0A 5HXEA 2E42A 1YKEB 5E79E 4PFOA 3IF8B 4JUYA 3EABA 4JYBA 5AVSB 2KI7B 3JADA 4JI0T 1YJNP 3WI3A 1SQBG 1OX3A 2Q9QC 1U7MA 4UEMA 4H9OC 5JTGA 1PPJD 4Q25A 3J9X1 5FMNA 4DCKA 4ZMDA 1UIXA 2V26A 3D70A 2XSBA 5AQIB 5ETWA 2CBIA 4PFPA 3B5ND 4JI2T 3N9QA 4QWNB 2EHOC 2DLRA 1LT1A 2CBJA 2RH0A 3FHNA 1NTMD 2W00A 1IFMA 3L71D 2V5CA 3MA9A 4N78E 3CXHI 3E08A 4NIQA 2KZ7B 3IF4A 3TGUD 2WSEJ 4U7IA 5HEJA 1WMKA 3PJSK 1YITP 2IAKA 4PNIA 3QNUA 4GKGA 5HAXA 1QEXA 1VQ9P 5CFBA 3E0ZA 2RPAA 1LTIC 3Q5DA 5H6RB 4NXNT 1D0ZA 2N9YB 3D0TA 2D9DA 1UUSA 2YKQA 2E75C 3ZT7A 2VL8A 2HHHT 5LNKA 3VU7H 5CCHC 4XAXB 2Y0CA 2Q9QD 2OLTA 2M67A 2AXCA 1I94T 4GKKT 4IDZA 4I7ZC 3EFFK 2H8PD 2UXXB 4DV6T 1FBMA 3HD7B 5FVLA 4U74A 1W2EA 2HFED 2EHOD 5JH7E 3E22E 3OTOT 4YHHT 3CXHD 1HFAA 2PJQA 3KVBA 3E1IA 2KB7P 4PV1C 3PUVF 1NTKG 4O4IE 1XTCC 3Q5EA 5AQMB 2X0HA 5ABGA 4IHJE 1NAYA 4L9IA 5LJMA 2KSJA 5AW9B 1YTZI 1UCUA 3AVSA 4AQRD 1JNMA 2K48A 5CCGD 3NKZA 3N4XA 2IIUA 1DIPA 3RC3A 3ZYLA 1RE4A 2OV9A 4CXWA 1NU1G 2YU1A 4DR1T 2Z4EA 1BE3J 1SQVJ 1Z0PA 1IBLT 1JY3P 1K9MQ 3QC9A 3L8RA 5CCHD 2KYVA 3EQ2A 1YKHB 3ONJA 2ITAA 2K3WA 4IL6H 2H88A 4G63A 2LEHA 4KP3C 4L5GA 3LIDA 1VRBA 4IL4A 1YD8G 2XAQB 1MMAA 2JRKA 2IUBA 1VF5B 1FE6A 2I1KA 3L09A 2BCCG 3AE7A 4MFRA 3B8EB 3MKDA 2L91A 4OVNF 5GTIE 1V9DA 1ZHCA 3GN5A 4PJNA 2IBZE 3HUSA 2FFDA 1FMVA 2FYUE 1KK7A 1VQ4P 4KMCA 4PV1D 4OX9T 1D1BA 2X9HA 2WAUA 4UVCB 4AKLA 2N1TC 2V7QJ 2O1JA 2WZIA 1T98A 1LRZA 4YTMA 4PD4I 1KILE 4U7YA 4O9BA 5ABFA 1U5PA 4CN4A 2JEEA 4BA9A 3SSUA 1I6ZA 3CCEP 1M1JC 5HYAA 1T7SA 2FYNC 1OVRA 4PJJA 1BE3D 4X5TA 1SQVD 2Z5HA 3GWHA 4WBAA 3AE4A 5DJTB 1K05A 1DU2A 2WSCH 2J4GA 5CMZA 3S9OA 1QUUA 5GONE 1USDA 4JBZA 1BR1A 3A0BE 5KLVE 3IBPA 5EZYE 1FDIA 2KNCA 4TNWA 3IAOA 2FKWB 2IDBA 2VKOA 4LMJA 3LJCA 4TX5A 1Z56A 4X1YE 3BCCG 3P4SA 3SS1A 2BEQD 1X79A 2QVAA 5AQTB 2BS4A 2N1TD 1QL1A 2CEAA 4PD4D 3GF3A 2H7HA 2WPQA 1FZBA 3AXJB 4QXHB 4ISSA 1NKZB 3TLTA 1L0LJ 1HX8A 3P4RA 3RHWA 3CWZB 2Q7CA 1IC2A 3RRCA 3AA6B 1GZLA 1USEA 1HBWA 1CI6A 1U57A 4AKHA 2D0TA 5EK4A 1L0NG 4GOUA 4IFFA 1N7SC 5LP6E 2HODA 2W90A 1KNZA 4M1PA 4MBQA 3ZLIA 3Q1MA 3BVHA 4GOEA 3RK3E 4TV9E 5HCMA 1LTGC 4WYVA 3A5TA 5LYJE 4JEUB 3U1AA 2D2SA 4LFCT 5APVA 3HR0A 2NRGA 2WSSV 1AVYA 1KYOH 1VQPP 4K3AA 3P4WA 5FXVA 2NW7A 3AEFC 1TU3F 3GN5B 4OYKA 1W2BO 1KB9E 2YIUC 3GHGA 4AKRB 2NWBA 2D0UA 3A0HE 1JUNA 3JCUH 3RIUC 4N78D 4KBMB 4Z91A 5AQRB 4HJGH 1JEKA 1YHQP 2W67A 3ZT5A 1PZQA 1EXJA 5HXRA 3RGUA 1KZUB 5IWAT 1OIPA 1B7TA 5LB7B 2HG5D 3GLMA 3ZN1B 3I0QA 2GA1A 4YSXA 2D5UA 2N1GA 2LSYA 3RIAA 1N7SD 1SQBE 2PGDA 2BVLA 2IFMA 2FYZA 2YKPA 3G71P 4CXYA 1D0YA 2BS3A 2WP9A 2AXDS 1SQQG 2CK3H 3CCRP 2SPZA 3CCLP 2YKSA 3KYQA 1PV3A 3AAAB 1YBKA 5L4EA 4JEHB 2J59M 1XDOA 2A3DA 4EYYQ 3CIRA 5AW5B 3V5BA 5LG4A 2Q9IA 4I43B 2OYOA 4HYTB 5KLIB 4EIWA 2QJYB 3VYIA 2KNCB 2A72A 3WUTA 2Q3IA 3K3NA 3AEGA 1Y9BA 5APQA 1EQ7A 2IBZI 4CI3B 3AEEC 2LKHA 4ASKA 2R5BA 2FYUJ 1ZMEC 1D1AA 2CCQA 1SFCA 3TNUA 2ODUA 3CC4P 3VP9A 1JY3O 1KILC 4I6MC 2HPJA 3CK6A 3R6NA 4ZS2A 1SHZC 3OJAA 3UTKA 3ZSSA 4O4HE 1CI6B 4DVDA 4DR7T 3QB5K 1Z8UA 3CKDA 3HI2A 2NTXA 2W6AA 2Q3EA 1KV4A 1KNRA 3C51A 5LMNT 2IC6A 2KWIB
chains in the Genus database with same CATH topology
1N73B 2PBIA 2JJLA 2G0UA 4BAYB 2J58A 5FXWA 2MBGA 3UUNA 5FYMA 1UX5A 4DBRA 1MMNA 3M9BA 2IX7C 4I2LC 2CM0A 1LKXA 5DQVA 4A56A 1KILD 5AVXB 2IW5B 5AW0B 4IGUA 2VKJA 2PP6A 5LHIB 3KV4A 2MJZA 3RYFE 4PK6A 3KINB 5C8YE 3MIWA 4W7YA 1T2KC 4P09A 1S9KE 2MOZA 3M0DA 5FY7A 5KLVK 1A02F 2CXFA 2KP8A 4IIJE 3G3ZA 3RK3C 4AUWA 4AKGA 2LKMA 2CLYC 2DNXA 1GK6A 2V7LA 1MMDA 1AFOA 4OHFA 3AA7B 4H63H 1IFDA 1GL2C 4YFSA 1VPCA 2DCFA 2KLVA 1E5WA 4X20E 4Z8XA 3SRZA 5L3BB 3II6A 5A1LA 4NUUA 1NOHA 2LHNA 1YTZT 1U4QA 1BR4A 2J1DG 3RRWA 4XA4A 2JQQA 3OJAB 3C50A 1T2KD 2CWYA 1HVVA 2W61A 3HL6A 3M9HA 3RK3D 2E9XA 3OAKA 4H9PC 2NP9A 2WZ7A 2K9AA 4DMWA 1T3JA 5FNVE 2Y48B 4UV8B 1FZCB 2C0WA 2KT9A 4J2CA 1LT9B 4IFDK 4C90A 2NW8A 4ILUA 4ADZA 2ZMAA 3UT5E 3O1JA 2JJ9A 3KFWX 3FBLA 4E7SA 2V7KA 1RE4C 2XUEA 3MJXA 2YO2A 1VOMA 1HH0A 1OWAA 1PFIA 3RYCE 4EZ4A 2K24A 3HE4A 1JY2N 5LGUB 3PTRB 4UIGA 3HUSC 2FFDC 2PG8A 2CXDA 3SOLA 3O8ZA 3BQKA 3K3QC 3KV9A 4OYJA 5APXA 3CVRA 5CA0E 1RF0A 3DP7A 3O4XE 1JCDA 4UVAB 1A02J 5HWYA 3ZN0B 2WMNA 3RYHE 2ES0A 3NRXA 4AQFA 2HH7A 2IFNA 3EVYA 1NH4A 3ZJ1A 5H6QB 2C0SA 3RYIE 3BQLA 3AB3B 5AW1B 1FU1A 1RF1A 1LWUA 3L36A 2KMFA 2LSGA 5AFUL 4Y99C 3ZMZB 3ANWA 3KPEA 1S9KD 1J1EB 3KVAA 4AKIA 2GM4A 1FEWA 4IFMA 1HGVA 3HA4A 3I9WA 4DNDA 4RESB 4GT1A 1BR2A 3VOPA 1IJ6A 3A2AA 1S35A 5CA1E 3A5XA 1WR6A 1US7B 5LHHB 1GU5A 2L9QA 1G73A 3HE4B 4P0BA 1IJ5A 4TZ4C 4O4JE 3GHGC 3BATA 2JPFA 2YEVC 4O8SA 5TAOA 3V2PA 2OYHB 3ZCIA 3CI9A 4UELA 3M0AA 5CCGC 5JDGA 3N2OA 3M65A 4UV9B 5F3JA 4I4TE 2Y8DA 1IZNB 3PDYA 3C9IA 3L37A 3FXDB 5JRCB 2P9BA 3BK9A 3KBUA 1L0NK 5L2LA 3LIEA 1ZKEA 3GA8A 1L4AA 3PP5A 4O2AE 1WRGA 1FZGA 3KDSE 1RF1B 2XASB 1LWUB 1SFCC 5BMVE 3Q5XA 5LA6E 2QGSA 1ZR2A 3C4XA 4FI5A 3U59A 3ANWB 2K5BB 1N2DC 3AA1B 2N9BA 3CLQA 3ONXA 1FZEA 3VTPC 4KHXA 2LSIA 4W7ZA 1JTHA 1LVFA 2XTLA 1MFZA 2OYIC 4AI6A 1VDFA 2KLQA 1O3XA 1SQXK 3LK2B 2MTQA 1SQQK 4P0AA 3RKOA 2DI4A 3O1HA 3ZJ2A 4CXXA 1FOSF 1SFCD 4AQGA 3Q9DA 5JREA 2H3RA 1NO4A 1FOSE 3V5SA 3UUMA 3VMZA 2VRSA 2XU6A 3IFMA 3HE5A 2C0XA 3TK1A 1FIOA 2O1KA 2KOGA 5AVWB 1G1IA 1JMMA 1N7LA 3ZMVB 3M91A 3AAEB 3O1IA 1L4AB 2H7OA 3N2GE 1HG2A 1NTZK 4I1LA 5FP3A 1LTJB 3BASA 3NTNA 4WW0A 1RE3A 1XTGB 5M4YA 4MALA 2HPCB 3CQGB 3EDUA 4H63V 5AVRB 1LTAC 1FZAA 1JY2P 1OXZA 2GK9A 1KFMA 3RX6A 4WY4B 4F6RC 3CMLA 5AVTB 2X51A 2LSKA 1N73A 2LSJA 3P7KA 2E9XC 4PK4A 3JC6C 2POHA 1JTHB 5LGTB 2X0LB 2Q9QA 4OFZA 4C46A 4YJ3E 5LJNA 5BVZA 4LGDE 4HN9A 1ZEEA 4AYCA 3PUAA 2DHRA 2A45H 2VB6A 4PW8A 3UFEA 1T3UA 2QA7A 2C5IT 3P32A 3HE5B 3MGNA 3BRTB 4HFVA 2E9XD 3PU3A 5JR9A 3JC6D 4ZI3C 3RPUA 1JO5A 3OA7A 5AW2B 3MD0A 3Q2MA 3SWFA 4ZHQE 2LHRA 3ZC1A 4EOZB 2XHEB 2MYSA 3C4WA 1M7LA 3B5NB 3T8OA 2CMRA 3M9QA 1IFNA 5KJ7A 4HE8A 1MIYA 5LBQB 3I9YA 4EZHA 2FXMA 5LCYA 3L3PA 3TSIA 3DJBA 2PAJA 3QUJA 2LOSA 3GMIA 3I1AA 4ZI3D 1D0XA 4IE6A 2PFVA 2C9LY 3EDVA 1FZCA 2CPSA 5E0OA 3HD7C 1LT9A 1LTSC 5EK2A 2Q9QB 1HJBA 4AQFC 4O2BE 3NFQA 1S94A 2NW9A 2WM9A 2YINA 4IE4A 3F57A 1RF1C 2VK9A 1HWTC 5IHYA 1HS7A 1QL2A 1GK4A 5JDMA 4C7NB 3HTKB 3N9LA 1G2CA 1CZQA 1NHLA 5JR9B 1IFIA 1WYBA 3HD7D 4TV8E 3AVRA 1G8XA 3H32A 5JDFA 3RK2B 4H9RC 2WT7B 4EB6E 2R3CA 1JY2O 5AW7B 3VMYA 3VN0A 3NRYA 2WPRA 1FJKA 4IE0A 2W0GA 3J7Yq 2LJLA 4HTEA 2IPPA 2WITA 2E8IA 3VMXA 4PAGA 4QXCB 3P7IA 4M3LA 2X9XA 3LW5H 1LTBC 3H3AA 4DBQA 1CW5A 3IHRA 1J1DB 3UIAA 2XV5A 2XDJA 4PK5A 4ISTA 4C7RA 2SPCA 2KINB 3WMM0 2A45G 3TKLB 1NKNA 3O9XA 1QSDA 1N86A 3EUHA 2KWHA 5FXZA 1L4AC 5EK3A 3T97A 1H88A 5L3DB 3C98B 2N1TB 3CQCB 4G2AA 1MMGA 3N7NA 4DO0A 1M1JB 2N2NA 5APWA 3QK6A 3HKEE 1GD2E 1AJ3A 2LOPA 3ZMSB 1G2CB 2YNYA 4PJLA 3LK42 1URQA 4YHJA 3OBVE 2CPBA 4L0RA 5J2TE 2YO3A 3H32B 2HLOA 1L4AD 5KMGP 2X9WA 2XAGB 3KBTA 1RY3A 2OYHA 5L3GB 2W62A 2ZLYA 5L3FB 4GYSA 2C5JA 4UF0B 4XZCA 1CSBA 5IYZE 5FXXA 3K3OA 4UVBB 3RL0B 2XKMA 2VKDA 5JRCA 3Q5WA 1NWQA 2CE7A 3BQIA 3N2KE 1NAFA 3OKQA 3IEEA 3K8PC 5AW3B 4ANJA 1Y64B 2RP4A 3B13A 3N9OA 3FXEB 2JMHA 3ZPOA 4N6JA 1FDMA 2YK0A 2CXLA 1YW0A 3FBZA 1SQPK 3UULA 1RE3C 4C91A 5JDNA 1ZV8A 4ZKPA 1MZ9A 2ODVA 4MLKA 4TUYE 5LGNB 4K0UA 3ZCJA 2C9NY 1N73C 4W80A 2ZFCA 5JDQA 4WBOA 1URQB 4EYYR 3A7OA 1LGHB 1GL2A 2NOXA 2WSEH 3CL3D 3ETUA 3P8CE 3S4UA 2BVMA 5CJ4A 2B1EA 5AVVB 2I1JA 5F8PA 1NTMK 4ZI7E 1DEBA 2YKOA 2L5GB 4QHOA 1KILB 3ETVA 4JYCA 3VKHA 2KNDA 4JF7A 3H37A 5BU5A 3SWHA 2NPSA 2WPSA 2WBLA 4CZZB 5JR9C 1HG5A 4IE5A 2DWGA 3LBXB 2V7MA 3HKBE 2YMYA 3V2RA 2CA5A 4QKNA 1LTJA 2BDEA 3RK2C 1HUCA 2HPCA 1DX7A 5CB4E 3V2NA 4EXTA 2KXPB 1J2JB 1IO4A 3WAJA 4WY4A 3LFMA 3CX6B 5KJ7C 4BJNA 5APYA 4E7ZA 5HXCA 3L4FA 2OA5A 1IJDB 4ERRA 4CI2B 1J1DC 3RK3B 2CLYB 5AVZB 4O4LE 5AW4B 3C4ZA 2GUVA 1FZCC 1ZV4X 2XZRA 4ZS3A 1GL2B 3RK2D 1LT9C 3N9PA 1WLXA 4YJ2E 4ZI2C 5DQWA 1FZFA 5DJQC 4H9SE 2E43A 4V1Av 3CQXC 1H8AA 2HPLA 5AVUB 5ADXL 5KJ7D 3MUDA 2GUSA 5BU8B 2I59A 1GW4A 3M0DC 1SQVK 1SA0E 4GYRA 3N5LA 1FAVA 2NPSB 4WBNE 1E1HB 5J2UE 1LTTC 5AVYB 2L8KA 5CJ0A 1IK9A 4NUVA 1FMWA 2RA1A 4EYUA 4XBFB 2X67A 4ZI2D 4EOTA 1ZLLA 4KUMB 3B5NA 2R5DA 1SVFA 4B86A 3KDPB 5FY0A 5KDMC 3WAKA 5JQGE 4GK0E 3AAIA 5AW6B 5LOVE 4IE7A 3RL0C 2M3BA 3U3IA 1H7CA 4X1IE 3ESLA 2ZM0A 2WTYA 3KV5A 3RC8A 3VP8A 5LXTE 5J1GA 4YLHA 2V1DB 3P8CD 3B57A 3PUSA 4N3YB 2XQYA 2EHOA 5JDHA 4H9QC 1D1CA 1HTJF 1L0LK 5APTA 3HUSB 2FFDB 4GIFA 5AW8B 1MIVA 3ZMUB 5L3CB 4C7NA 3BRVB 4TN7B 3HTKA 1J1EC 1YYCA 1MIWA 5CCGA 2R32A 1JOCA 3RL0D 2A45I 2N9DA 3ZYMA 4DMVA 1FJPA 4QXBB 3U78A 1MV8A 1LVKA 5CCHA 3V4QA 3N9MA 4CI1B 1URQC 2WT7A 3NBXX 2OARA 5KX5E 3EFGA 4QX7B 2DWKA 2ZM8A 2OYHC 1CUNA 1X79B 2CWOA 3P8MC 1IFJA 3I5CA 4WB4A 2ZXEB 4Y99B 3ZEFB 1RF0C 5HXHA 5L3EB 1HGZA 3PUQA 1HCIA 4CQIA 3M06A 1GU4A 2HODB 3MXZA 1ZR4A 4BJMA 3IR9A 1URQD 2HYNA 1T8ZA 3U1CA 4JLEA 5FY1A 2Y6XA 3CPZA 3MZKB 2OYIA 5DABA 1X8YA 1GDTA 2FYUK 4UXNB 1HTLC 2EHOB 2N1TA 1LWUC 2LE8A 1MNDA 2YU2A 5CHXA 2M8RA 3GHGB 2LM9A 3CX8B 5AVQB 3V5UA 4DOJA 3HKDE 1GW3A 3PUGA 2Q5UA 3F31A 1M1JA 3ZC0A 1IAPA 2BZBA 1KFNA 3A3YB 1WYCA 3AA0B 3R84B 2P67A 5JDLA 2NTYA 3HKCE 2ZM2A 1DH3A 1GTWA 4GIWA 4ZKUA 2VKHA 5APUA 3UUXB 2H7VC 4UF0A 2H43A 1WT6A 4OK0A 1SLQA 4AXPA 3H6PA 5JVDE 1JY3N 1H89A 3F2EA 1SFCB 3TNUB 4XE5B 1JCCA 1N7SA 4PJMA 4HGAA 2A2FX 1KQLA 2WMOA 2WWWA 4HH2A 1MNEA 2NPSC 1UX4A 3ZMTB 2Z6EA 2W27A 1ZN5A 4H9NC 4HKAA 2P2UA 2WWUA 2OYIB 1GL2D 2JMKA 1HF8A 3L35A 1LTJC 3CX7B 2WSFH 1SQBK 3KQGA 4WY4C 4WNKA 3LG7A 4I50E 4MHCA 2BASA 3NMDA 2V7IA 3N9NA 2NPSD 2XAHB 2X68A 4X1KE 4OH8B 3PE0A 2QM8A 2C5KT 5APSA 2IC9A 3LK3B 3RH3A 2W6BA 4GK5E 4QX8B 2UXNB 2X66A 5LBMA 3PURA 3VHLA 3ZYKA 1KILA 3V2QA 1WRDA 2P7JA 1MUUA 3C64A 3NZPA 1AQ5A 3VKGA 4WY4D 2Z5IA 3HRNA 1N7SB 2X9YA 4ZOLE 2V7JA 2LT3A 3V4WA 4FJOA 1G1JA 3MTUE 3KV6A 4U72A 3LBXA 1NTKK 3FB2A 2L3LA 5KTBA 2W63A 3R2PA 2E9XB 3OYXA 2O01H 4LC1A 3TYYA 2VASA 2XAFB 1X9VA 4LLHA 3W15B 4DZOA 3NXSA 3OYZA 4I55E 2XAJB 3I0OA 3HD7A 3DTOA 5LHGB 3NZQA 3SWYA 1NU1K 4HEAA 4B6XA 2XNXA 3MACA 3PU8A 3B5NC 1SP4A 5HXSA 2VWAA 2P1JA 4EIJA 3MK7C 1NWMX 4EAHA 1BR0A 5HWXA 2QM7A 1EZ3A 2ACXA 5HXEA 2E42A 1YKEB 4PFOA 3IF8B 4JUYA 4JYBA 5AVSB 3WI3A 2Q9QC 4UEMA 4H9OC 3J9X1 5FMNA 2V26A 5ETWA 4PFPA 3B5ND 3N9QA 4QWNB 2EHOC 2DLRA 3FHNA 2W00A 1IFMA 3MA9A 4N78E 3E08A 2KZ7B 2IAKA 4PNIA 4GKGA 5HAXA 3E0ZA 1LTIC 5H6RB 1D0ZA 3D0TA 2YKQA 2VL8A 5LNKA 3VU7H 5CCHC 4XAXB 2Q9QD 2M67A 4IDZA 2H8PD 2UXXB 1FBMA 3HD7B 4U74A 1W2EA 2HFED 2EHOD 5JH7E 3E22E 1HFAA 2PJQA 3KVBA 3E1IA 2KB7P 4O4IE 1XTCC 4IHJE 4L9IA 5LJMA 2KSJA 5AW9B 1YTZI 1UCUA 3AVSA 4AQRD 1JNMA 2K48A 5CCGD 3N4XA 3RC3A 3ZYLA 1RE4A 4CXWA 2YU1A 2Z4EA 1Z0PA 1JY3P 3QC9A 5CCHD 2KYVA 3EQ2A 1YKHB 4G63A 2LEHA 4KP3C 4L5GA 3LIDA 1VRBA 1YD8G 2XAQB 1MMAA 2JRKA 2I1KA 3L09A 4MFRA 3B8EB 3MKDA 1V9DA 1ZHCA 3GN5A 4PJNA 3HUSA 2FFDA 1FMVA 1KK7A 4KMCA 1D1BA 2X9HA 2WAUA 4UVCB 4AKLA 2N1TC 2O1JA 1T98A 1LRZA 4O9BA 1U5PA 2JEEA 4BA9A 1M1JC 5HYAA 4PJJA 2Z5HA 3GWHA 4WBAA 2WSCH 5CMZA 1QUUA 5GONE 1BR1A 3IBPA 5EZYE 2FKWB 2VKOA 3LJCA 4TX5A 1Z56A 4X1YE 3SS1A 1X79A 2N1TD 1QL1A 2CEAA 2H7HA 2WPQA 1FZBA 4QXHB 4ISSA 1NKZB 1HX8A 3CWZB 2Q7CA 1IC2A 3RRCA 3AA6B 1GZLA 1HBWA 4AKHA 1CI6A 2D0TA 5EK4A 4GOUA 4IFFA 1N7SC 5LP6E 2HODA 1KNZA 4M1PA 4MBQA 3ZLIA 3BVHA 4TV9E 1LTGC 3A5TA 5LYJE 4JEUB 3U1AA 2D2SA 5APVA 3HR0A 2WSSV 5FXVA 2NW7A 3GN5B 4OYKA 3GHGA 4AKRB 2NWBA 2D0UA 1JUNA 4N78D 4KBMB 5HXRA 1KZUB 1B7TA 2HG5D 3ZN1B 3I0QA 2D5UA 2N1GA 2LSYA 1N7SD 2BVLA 2IFMA 2FYZA 2YKPA 4CXYA 1D0YA 3KYQA 3AAAB 4JEHB 2J59M 2A3DA 5AW5B 3V5BA 5LG4A 2Q9IA 4I43B 4HYTB 4EIWA 3VYIA 2A72A 2Q3IA 3K3NA 5APQA 1EQ7A 4CI3B 4ASKA 2R5BA 1D1AA 2CCQA 1SFCA 3TNUA 2ODUA 1JY3O 1KILC 3R6NA 4I6MC 3VP9A 2HPJA 4ZS2A 1SHZC 3OJAA 3UTKA 4O4HE 1CI6B 4DVDA 3CKDA 3HI2A 2NTXA 2W6AA 3C51A 2IC6A 2KWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP9 A;  3OJA B;  3P8C D;  3U1A A;  4O9B A;  5BU8 B;  1WT6 A;  3C9I A;  2JEE A;  4N3Y B;  1IC2 A;  4ZKP A;  4I1L A;  3BAT A;  3N7N A;  5KTB A;  3BAS A;  2POH A;  5BU5 A;  1NKN A;  4GIF A;  1X79 B;  3N4X A;  3HRN A;  2FXM A;  3U59 A;  3VP8 A;  3U1C A;  4N78 D;  4ZKU A;  5BVZ A; 
#chains in the Genus database with same CATH topology
 1N73 B;  2PBI A;  2QYW A;  1NTK E;  2JJL A;  2G0U A;  5FL1 A;  4ILB A;  1HNX T;  3AEB C;  1NTZ G;  4BAY B;  2J58 A;  5FXW A;  2MBG A;  2KSE A;  3UUN A;  2IBZ D;  5FYM A;  1UX5 A;  4DBR A;  1MMN A;  3M9B A;  2FYU D;  2IX7 C;  5GTH H;  4I2L C;  2CM0 A;  3RF1 A;  2Y9Y A;  5HEO A;  1LKX A;  1VL2 A;  5DQV A;  1OFC X;  1NU1 E;  4A56 A;  1KIL D;  4NXM T;  2E5Y A;  1SS1 A;  4DJG A;  5AVX B;  1SE7 A;  2IW5 B;  2PRR A;  5AW0 B;  1YJW P;  4IGU A;  5AQF B;  4YXD C;  2VKJ A;  3CC2 P;  2PP6 A;  4TT3 H;  5LHI B;  3KV4 A;  4L76 A;  1KTM A;  2MJZ A;  3RYF E;  1VQ5 P;  4PK6 A;  1YQ3 C;  3RL0 g;  3CCS P;  3KIN B;  5C8Y E;  2WU2 A;  3WU2 H;  4BRY A;  1VQ8 P;  3MIW A;  4W7Y A;  2XM1 A;  1T2K C;  4P09 A;  5AQS B;  1S9K E;  2DL1 A;  2MOZ A;  5AQO B;  4H44 C;  3M0D A;  5FY7 A;  5KLV K;  1A02 F;  2CXF A;  2KP8 A;  2J47 A;  2W2U A;  4IIJ E;  3G3Z A;  3PJA J;  3UU6 A;  3RK3 C;  4AUW A;  5KLV D;  4AKG A;  2LKM A;  2CLY C;  2DNX A;  1GK6 A;  2V7L A;  1MMD A;  4QH5 A;  1AFO A;  4OHF A;  5AQG B;  3AA7 B;  1KQF B;  3L75 G;  4H63 H;  1IFD A;  1GL2 C;  4YFS A;  2WDR A;  1VPC A;  2DCF A;  2KLV A;  1E5W A;  1KB9 I;  3PUY F;  4X20 E;  4Z8X A;  3SRZ A;  1S5L E;  5L3B B;  3II6 A;  5A1L A;  4NUU A;  4U3F J;  1NOH A;  5KAI H;  2LHN A;  5L4H A;  1YTZ T;  2WSS H;  1U4Q A;  1BR4 A;  2J1D G;  4GOD A;  2VQE T;  3RRW A;  4K0K T;  4XA4 A;  3JAE A;  4A5X A;  2JQQ A;  1BCC G;  4KHZ F;  3OJA B;  3C50 A;  1T2K D;  2CWY A;  1HVV A;  2W61 A;  3D6Y A;  3G4S P;  4H44 D;  1QVF O;  1SQB J;  1OW6 A;  3HL6 A;  3M9H A;  3RK3 D;  1GMJ A;  2E9X A;  2MPK A;  4DV1 T;  2Y9Z A;  3OAK A;  3LW5 J;  4D6T E;  4DV3 T;  4H9P C;  3L73 J;  4IL6 X;  4IDN A;  4PJ0 H;  1VF5 D;  2WZ7 A;  2K9A A;  2NP9 A;  3RKG A;  4DMW A;  1KB9 D;  1EZV G;  1M56 D;  3H1H J;  1T3J A;  5FNV E;  2KLU A;  3Q5S A;  2WPV B;  2Y48 B;  4UV8 B;  1FZC B;  2C0W A;  1OED B;  1R8E A;  2KT9 A;  4J2C A;  1LT9 B;  4IFD K;  4C90 A;  2NW8 A;  4ILU A;  4H13 B;  4EDF A;  4UB6 H;  1SQB D;  4ADZ A;  2ZMA A;  3UT5 E;  1S72 P;  4IRE A;  3QB5 A;  3F5H A;  3O1J A;  5B66 H;  2JJ9 A;  3KFW X;  2F4V T;  3FBL A;  4E7S A;  3EWK A;  2V7K A;  3PLN A;  2WSF J;  1RE4 C;  1J5W A;  3CPW O;  5L47 A;  2XUE A;  3MJX A;  2YO2 A;  1VOM A;  2ZYD A;  1HH0 A;  1OWA A;  1OW7 A;  4LF4 T;  4KHP T;  1NTK J;  1PFI A;  3RYC E;  4EZ4 A;  1E7P A;  2K24 A;  1QGK B;  3AE7 C;  2YDS A;  3HE4 A;  1JY2 N;  5LGU B;  3PTR B;  1VQL P;  4UIG A;  3HUS C;  2FFD C;  2PG8 A;  2CXD A;  4RJT A;  3SOL A;  1SQQ E;  3O8Z A;  3BQK A;  3OPC A;  1NU1 J;  2BKN A;  3K3Q C;  3KV9 A;  4OYJ A;  1Q2N A;  4KJM A;  1GQE A;  5APX A;  3L70 E;  2W66 A;  3CVR A;  3IA3 A;  5CA0 E;  1RF0 A;  3DP7 A;  3O4X E;  1JCD A;  4TWH A;  2K88 A;  4UVA B;  2YDQ A;  2V8S V;  1NTK D;  1A02 J;  5HWY A;  4COF A;  3ZN0 B;  2WMN A;  3RYH E;  2ES0 A;  2LM2 A;  3NRX A;  4WWI A;  3L72 G;  5KLI C;  4AQF A;  2HH7 A;  2IFN A;  2Q6Q A;  3EVY A;  1NH4 A;  3ZJ1 A;  5H6Q B;  4IL6 E;  2C0S A;  2R44 A;  3RYI E;  1NU1 D;  2OTJ P;  3BQL A;  4DID B;  1Q7Y Q;  3AB3 B;  3H1J G;  5AW1 B;  1FU1 A;  2D2C B;  2IYO A;  2V5D A;  1RF1 A;  2BG9 A;  1LWU A;  3L36 A;  2KMF A;  2LSG A;  2K9J A;  5AFU L;  4Y99 C;  3ZMZ B;  4RO0 A;  1UII A;  3ANW A;  5CBN A;  1DD3 A;  4NPP A;  2JKV A;  1OW8 A;  2VQF T;  3KPE A;  1NTZ E;  1S9K D;  3Q5P A;  1J1E B;  1IBM T;  1S1C X;  1Y8A A;  3KVA A;  4AKI A;  1D7M A;  1PGJ A;  3EI0 A;  2GM4 A;  1FEW A;  3H1K G;  4IFM A;  1HGV A;  3MZW B;  5CBO A;  1R5L A;  3HA4 A;  3GG2 A;  3I9W A;  4DND A;  3AEC A;  4D6T J;  2J5U A;  3K5B A;  4RES B;  2K9Y A;  1W9R A;  4GT1 A;  3AE5 A;  1BR2 A;  3VOP A;  1N32 T;  1IJ6 A;  2JQK A;  3A2A A;  1S35 A;  5CA1 E;  5CJ5 A;  5C39 A;  3A5X A;  1WR6 A;  2XQ5 A;  4HFB A;  1US7 B;  3H1L E;  1GU5 A;  5LHH B;  1EDJ A;  2L9Q A;  1YQ4 A;  1G73 A;  3HE4 B;  4P0B A;  1IJ5 A;  1BGY G;  4TZ4 C;  4O4J E;  3GHG C;  2ZT9 B;  3BAT A;  2JPF A;  2YEV C;  3T1Y T;  3SFD C;  2KZI A;  1VQM P;  3OVU A;  3CCJ P;  4O8S A;  5TAO A;  3V2P A;  2LKG A;  2OYH B;  3ZCI A;  2XPK A;  2YXR B;  3CI9 A;  4ZXL A;  1KQS O;  4UEL A;  3M0A A;  5CCG C;  5JDG A;  1YJ9 P;  3WUU A;  5TIS H;  3N2O A;  3H1I G;  3M65 A;  4UV9 B;  3TLU A;  4R4M A;  1MFT A;  1Q81 Q;  5F3J A;  4I4T E;  2Y8D A;  1IZN B;  3PDY A;  3C9I A;  3FWL A;  3L37 A;  4D6T D;  3SFE A;  1IFP A;  3UU5 A;  3FXD B;  5JRC B;  4NPE A;  4YSZ A;  2P9B A;  3BK9 A;  1VQ7 P;  3USS A;  3KBU A;  3FZF B;  1L0N K;  3RI5 A;  5L2L A;  2G8Y A;  1EDL A;  4EI2 A;  3LIE A;  2VUR A;  1ZKE A;  3GA8 A;  4TWF A;  1L4A A;  2YXQ B;  3AEG C;  3PP5 A;  4O2A E;  1WRG A;  3AXJ A;  1FZG A;  1KYO E;  4HFH A;  3KDS E;  2UWJ E;  3B71 A;  1LP1 B;  4JPZ B;  1RF1 B;  2BG9 B;  1LWU B;  2XAS B;  1SFC C;  5BMV E;  3Q5X A;  2K9J B;  3IN6 A;  5LA6 E;  2QGS A;  2WQY A;  1ZR2 A;  2BKO A;  3C4X A;  4NPD A;  4FI5 A;  4ZZB A;  3VMA A;  3U59 A;  3F89 A;  3ANW B;  3JCU E;  2K5B B;  1N2D C;  3AA1 B;  4AIU A;  2XQ3 A;  1PP9 G;  3FZK B;  2LXB A;  3L70 J;  3CCQ P;  2N9B A;  3PRJ A;  3PH0 A;  3CLQ A;  1KD1 Q;  1KN7 A;  1BDC A;  4A98 A;  3P4P A;  4JI8 T;  3ONX A;  2WDQ A;  1VQO P;  1FZE A;  2QJK C;  3VR9 A;  3VTP C;  4KHX A;  2LSI A;  4W7Z A;  1JTH A;  1LVF A;  3E7K A;  2XTL A;  2OGU A;  1AV1 A;  1MFZ A;  2OYI C;  2XQA A;  4AI6 A;  1VDF A;  1Q90 D;  2KLQ A;  1O3X A;  2E2A A;  2X0Y A;  1SQX K;  3LK2 B;  4DR4 T;  2MTQ A;  1SQQ K;  3WUV A;  4JI5 T;  3RIF A;  2W83 C;  4ASV A;  2ZYG A;  4P0A A;  3RKO A;  4JI6 T;  2DI4 A;  2V7Q H;  1SQQ D;  3O1H A;  3ZJ2 A;  4CXX A;  1FOS F;  1SFC D;  4AQG A;  3Q9D A;  5JRE A;  2H3R A;  5LG3 A;  1NO4 A;  1FOS E;  3V5S A;  3UUM A;  2YN6 A;  3VMZ A;  4U2Z A;  2QSI A;  2VRS A;  3L70 D;  2PTF A;  2ZXX A;  1NJI Q;  2XU6 A;  3IFM A;  3HE5 A;  1NTZ J;  2C0X A;  3V6I A;  2E5T A;  3TK1 A;  1FIO A;  2B87 B;  3AE2 C;  1R5S A;  1R8I A;  1W0B A;  1JNZ A;  2J62 A;  2XY8 B;  5E79 H;  2O1K A;  2KOG A;  3CME P;  5AVW B;  1G1I A;  1JMM A;  5KKZ B;  1PL5 A;  1N7L A;  3ZMV B;  3M91 A;  3AAE B;  1NTM G;  2XM2 A;  3UFG A;  1KFY A;  5AQN B;  3O1I A;  1WCR A;  4A97 A;  3JC2 2;  3D71 A;  1UUR A;  1L4A B;  3H1L J;  1OZH A;  2H7O A;  3N2G E;  3OW2 O;  3L74 G;  1RQU A;  1HG2 A;  4Z90 A;  3CD6 P;  4B3R T;  1NTZ K;  4I1L A;  3G6E P;  5FP3 A;  1LTJ B;  3BAS A;  3NTN A;  4WW0 A;  1RE3 A;  1XTG B;  5M4Y A;  4MAL A;  2HPC B;  2BG9 E;  1NTZ D;  3CQG B;  3EDU A;  4U7J A;  2XQ4 A;  4H63 V;  1P84 H;  1S2E A;  5AVR B;  5C2T A;  1LTA C;  1FZA A;  1JY2 P;  1EC5 A;  1OXZ A;  2GK9 A;  3CCU P;  1KFM A;  3RX6 A;  1KOR A;  4WY4 B;  3CML A;  4F6R C;  2O01 N;  3EAM A;  5AVT B;  2X51 A;  3RBZ A;  2LSK A;  1N73 A;  2LSJ A;  3P7K A;  1OMI A;  2E9X C;  4PK4 A;  3JC6 C;  2BS2 A;  2FXP A;  2POH A;  4JQ0 D;  3QH9 A;  1JTH B;  4LF9 T;  5LGT B;  2JO1 A;  1OVV A;  3H1L D;  2X0L B;  1L2P A;  2Q9Q A;  4OFZ A;  3B4S A;  4C46 A;  4YJ3 E;  5LJN A;  5BVZ A;  2MAW A;  4LGD E;  4OGQ C;  4DT0 A;  2E74 B;  4WVZ A;  4HN9 A;  1KYO I;  3G9R A;  1ZEE A;  1DEE G;  4AYC A;  3PUA A;  2DHR A;  2A45 H;  2D2C C;  3UU3 A;  2VB6 A;  3A8Y C;  3H1K E;  4PW8 A;  1XMO T;  2WDV A;  3UFE A;  1T3U A;  2FJA A;  2QA7 A;  1SQX G;  2C5I T;  5KAI E;  3P32 A;  1YIJ P;  3HE5 B;  1EZV I;  3MGN A;  2V4H A;  3BRT B;  3W68 A;  4HFV A;  3AE6 A;  2E9X D;  3PU3 A;  1BGY E;  5JR9 A;  3JC6 D;  4BXL A;  4ZI3 C;  1S5L X;  1JO5 A;  5AQJ B;  3RPU A;  1N33 T;  2JIW A;  2FBW A;  3AED A;  3OA7 A;  3A7M A;  3EHZ A;  1UK5 A;  5AW2 B;  2K1A A;  4NPF X;  4CN6 A;  3MD0 A;  2A9U A;  4DR6 T;  2H89 C;  3Q2M A;  1Q82 Q;  3SWF A;  4OGQ D;  3H1I E;  1KYO D;  5AQH B;  4HKZ H;  2PFX A;  2UU9 T;  4ZHQ E;  1KNP A;  2D2C D;  2LHR A;  3ZC1 A;  3PHL A;  4EOZ B;  2XHE B;  2MYS A;  3ZDM A;  2UXB T;  2OTL P;  1M1K Q;  3C4W A;  1M7L A;  3B5N B;  3T8O A;  2CMR A;  1ZP0 A;  3M9Q A;  2WB5 A;  4IDP A;  1IFN A;  5KJ7 A;  4R4L A;  4HE8 A;  3ZKR A;  1MIY A;  5LBQ B;  3I9Y A;  4EZH A;  2FXM A;  5LCY A;  3NWI A;  3L3P A;  3TSI A;  4DR5 T;  3DJB A;  3KHU A;  2WWV A;  2R6G F;  2PAJ A;  4UB6 E;  3QOF A;  3QUJ A;  2LOS A;  3GMI A;  3I1A A;  5H2F H;  4ZI3 D;  5KXJ A;  3A0B H;  5KLV J;  1N36 T;  1D0X A;  2P10 A;  5B66 E;  4IE6 A;  2PFV A;  1ZXG A;  2C9L Y;  2XQ6 A;  3EDV A;  1QVG O;  1Y47 A;  1FZC A;  2CPS A;  1OED A;  5E0O A;  3HD7 C;  3P4Q A;  1LT9 A;  1LTS C;  5EK2 A;  2Q9Q B;  1HJB A;  4AQF C;  4O2B E;  3NFQ A;  1PP9 E;  1S94 A;  3C8V A;  2NW9 A;  1BDD A;  5BR8 T;  2WM9 A;  2YIN A;  2ZVO B;  4IE4 A;  3F57 A;  1RF1 C;  2BG9 C;  2VK9 A;  3CX5 H;  2BCC E;  1HWT C;  4YSY A;  5K5G B;  5C3J A;  4JV5 T;  5IHY A;  1VQ6 P;  1HS7 A;  3Q5R A;  3AE1 C;  1QL2 A;  5DJU B;  1GK4 A;  5JDM A;  4C7N B;  3HTK B;  3T1H T;  3N9L A;  4EGW A;  3UU8 A;  1K8A Q;  1G2C A;  2B89 A;  1QX8 A;  1CZQ A;  1NHL A;  2AEJ A;  5JR9 B;  1NEN A;  1L0L G;  1IFI A;  1VF5 C;  1WYB A;  2E75 B;  4HB1 A;  3AEC C;  3HD7 D;  4TV8 E;  3I55 P;  3AVR A;  3KZI H;  1M90 Q;  2KIK A;  1XWM A;  1G8X A;  3H32 A;  5AQU B;  5JDF A;  4I7Z B;  3RK2 B;  4QH4 A;  4H9R C;  2WT7 B;  4EB6 E;  2R3C A;  2ZVN B;  1JY2 O;  4ILC A;  5AW7 B;  3VMY A;  3VN0 A;  3NRY A;  5L8R J;  2B9B A;  2B88 A;  2WPR A;  1FJK A;  3RGL A;  3H1K J;  5FVK A;  4MN4 C;  2DW3 A;  2YDR A;  4IE0 A;  2W0G A;  4L74 A;  3J7Y q;  2RMZ A;  2LJL A;  3CWB G;  1E2A A;  4HTE A;  2IPP A;  2QJP B;  4DR2 T;  1J1J A;  2WIT A;  1RHZ B;  3BCC E;  2M5A B;  3VMX A;  2ZAE B;  2E8I A;  2XQ8 A;  2HN1 A;  3P7I A;  4PAG A;  4QXC B;  4M3L A;  2X9X A;  2V6Y A;  3LW5 H;  2JP3 A;  4ZNC A;  1LTB C;  3H3A A;  3R4Y A;  4DBQ A;  3MHV A;  1CW5 A;  3IHR A;  3TLV A;  2FJB A;  1J1D B;  3UIA A;  3SFE C;  2NR4 A;  2XV5 A;  2XDJ A;  3L74 E;  4PK5 A;  4Z1M H;  4IST A;  4C7R A;  2SPC A;  5KKZ C;  2KIN B;  1L0N E;  3WMM 0;  2A45 G;  2KZJ A;  2UUB T;  3TKL B;  1NKN A;  3UU4 A;  4X65 T;  3O9X A;  1CHU A;  2ZYA A;  1QSD A;  2LRK A;  1Q86 Q;  1N86 A;  2K37 A;  3EUH A;  2KWH A;  3H1I J;  5KAF H;  3FXE A;  5FXZ A;  2ZM6 T;  1L4A C;  5EK3 A;  1E79 H;  3H1K D;  3T97 A;  3RIU A;  1H88 A;  5L3D B;  2KS1 B;  2WMM A;  3C98 B;  2N1T B;  2UXC T;  3CQC B;  4G2A A;  1MMG A;  2WQY C;  4AIS A;  4DV2 T;  3N7N A;  2LR2 A;  1YXR A;  1K04 A;  4DO0 A;  1M1J B;  4DV7 T;  2FYN B;  2N2N A;  2FY8 A;  3I56 P;  3ABV A;  5APW A;  3QK6 A;  3HKE E;  1FS0 E;  1BGY D;  1GD2 E;  1AJ3 A;  2LOP A;  3ZMS B;  1N8R Q;  1G2C B;  2BBH A;  5TIS E;  2YNY A;  4HWH A;  4PJL A;  4U3C A;  2AEF A;  2H88 C;  1YI2 P;  4HFC A;  3LK4 2;  1URQ A;  4LFA T;  4YHJ A;  1Y01 A;  3OBV E;  2CPB A;  4L0R A;  5J2T E;  2QIW A;  3H1I D;  2YO3 A;  3H32 B;  2HLO A;  1SQX E;  5HEH A;  2B76 A;  5AQV B;  4TWD A;  1L4A D;  3K1S A;  4X66 T;  5KMG P;  2X9W A;  4ZZC A;  2XAG B;  3KBT A;  2XQ7 A;  1RY3 A;  3AEA A;  2OYH A;  3AEE A;  5L3G B;  2W62 A;  2CPT A;  2ZLY A;  5L3F B;  4GYS A;  2C5J A;  4UF0 B;  4XZC A;  1CSB A;  5IYZ E;  3L39 A;  1XDP A;  3ZST A;  1KQG B;  2BCC J;  3FWN A;  5FXX A;  1LNQ A;  2M0B A;  3TLW A;  3K3O A;  4YPC A;  4UVB B;  2LRL A;  3RL0 B;  3AE4 C;  3FXD A;  2XKM A;  2VKD A;  5JRC A;  3GW6 A;  3Q5W A;  1M57 D;  2V6Y B;  1KC8 Q;  1NWQ A;  2CE7 A;  3BQI A;  2BKP A;  4IOI H;  4LML A;  4DUZ T;  3N2K E;  2LLY A;  2QJY C;  1NAF A;  2Y0D A;  3OKQ A;  5FL0 A;  3IEE A;  3K8P C;  2ACZ A;  1QLB A;  4B3S T;  1PP9 D;  2O01 J;  5AW3 B;  4ANJ A;  1OED E;  1M7K A;  1Y64 B;  1LP1 A;  2JR8 A;  2RP4 A;  3B13 A;  3UQ4 A;  2JDI H;  1NGM B;  3N9O A;  2YIU B;  3FXE B;  4X64 T;  2NZ2 A;  1VQK P;  2JMH A;  3ZPO A;  1BSH A;  4N6J A;  1FDM A;  3T97 B;  2YK0 A;  2CXL A;  4YT0 A;  1YW0 A;  2BCC D;  2M6B A;  1SQP K;  3FBZ A;  3UUL A;  1RE3 C;  5FKY A;  1X22 A;  4C91 A;  4HWD A;  5JDN A;  3W67 A;  1ZV8 A;  4ZKP A;  1JB0 J;  2FXO A;  1MZ9 A;  2ODV A;  3BCC J;  4MLK A;  4TUY E;  3O6Q A;  4JBW F;  3JSV C;  5LGN B;  4K0U A;  3ZCJ A;  1XNQ T;  3PJA A;  1AQT A;  2C9N Y;  4U3F G;  1N73 C;  4W80 A;  2ZFC A;  4HWI B;  5B5E H;  4QH1 A;  5JDQ A;  1W0A A;  4WBO A;  1JM0 A;  1URQ B;  1LJ2 A;  2HN2 A;  3L74 J;  3AE9 A;  1X9B A;  3ONL C;  1L0N J;  4EYY R;  3A7O A;  1LGH B;  2G3A A;  2E76 B;  3VRA A;  3CXH H;  1GL2 A;  2NOX A;  2WSE H;  3CL3 D;  3ETU A;  3P8C E;  3S4U A;  2BVM A;  1HR0 T;  1S4X A;  5CJ4 A;  1HJ0 A;  3E1R A;  2B1E A;  5AVV B;  4YY3 T;  2I1J A;  5F8P A;  1NTM K;  4ZI7 E;  1DEB A;  4GKJ T;  2YKO A;  4JI7 T;  2L5G B;  3L73 G;  2QE7 H;  4QHO A;  1KIL B;  3L75 E;  3ETV A;  3BCC D;  4YTP A;  1T6A A;  2B87 A;  1L0L E;  3GF7 A;  4JYC A;  3VKH A;  3H1H G;  2KND A;  4JF7 A;  1FJG T;  3H37 A;  5BU5 A;  4UB8 H;  4IDQ A;  5IUX A;  3AE8 A;  3SWH A;  3L74 D;  1P84 E;  1VQN P;  2NPS A;  2JWD A;  4YXW H;  2WPS A;  3AE6 C;  2WBL A;  4CZZ B;  5JR9 C;  3FZM B;  1HG5 A;  1L0N D;  1BCC E;  4IE5 A;  2DWG A;  3LBX B;  2FBW C;  3AED C;  2V7M A;  3HKB E;  3CWB E;  3GMA A;  2YMY A;  3V2R A;  1SQX J;  2CA5 A;  4QKN A;  1AJY A;  1SQQ J;  1LTJ A;  2BDE A;  3RK2 C;  1HUC A;  2HPC A;  1DX7 A;  5CB4 E;  1M8O B;  3V2N A;  4EXT A;  2KXP B;  1J2J B;  1IO4 A;  3WAJ A;  1ZP0 C;  4WY4 A;  1EZV E;  3LFM A;  5HCJ A;  3CX6 B;  5KJ7 C;  4BJN A;  4GDO A;  2QJP C;  4JYA T;  5APY A;  2M6I A;  4E7Z A;  4LF7 T;  1T8B A;  5HXC A;  3O6Q B;  2A06 G;  3AE3 A;  3L4F A;  2OA5 A;  1IJD B;  4H44 B;  4ERR A;  4CI2 B;  5AQP B;  4H0L B;  1SQP G;  1J1D C;  3RK3 B;  2E75 D;  2WZH A;  2CLY B;  5AVZ B;  2XJ7 A;  2UUC T;  1SQX D;  4O4L E;  5AW4 B;  3C4Z A;  2GUV A;  1FZC C;  1ZV4 X;  2XZR A;  4PD4 H;  1OED C;  1GL2 B;  4ZS3 A;  4CPG A;  3RK2 D;  2KSR A;  1LT9 C;  3N9P A;  1WLX A;  4YJ2 E;  4ZI2 C;  5DQW A;  2AXT H;  1FZF A;  5DJQ C;  4H9S E;  2LXC B;  2E43 A;  2QG4 A;  4HWF A;  4V1A v;  4H13 C;  3X1D A;  3CQX C;  1H8A A;  2HPL A;  5AVU B;  2QA4 P;  5EFW B;  5KJ7 D;  5ADX L;  3MUD A;  2GUS A;  2FUP A;  5BU8 B;  2I59 A;  1GW4 A;  3M0D C;  1SQV K;  1PPJ G;  2K3R A;  1SA0 E;  2WY2 A;  4GYR A;  3N5L A;  1NVO A;  3D6Z A;  2CHN A;  2JQ9 A;  1FAV A;  2NPS B;  4WBN E;  3L71 G;  4F8H A;  1E1H B;  1KF6 A;  5J2U E;  2WSC J;  1LTT C;  5AVY B;  4LF5 T;  2L8K A;  5CJ0 A;  1IK9 A;  3TGU G;  3PV0 F;  4NUV A;  1ZOY A;  1FMW A;  2WCA A;  3LSV A;  2RA1 A;  4EYU A;  5H2F E;  4GOF A;  2IYP A;  4CN1 A;  4XBF B;  2X67 A;  4ZI2 D;  4EOT A;  4TNV A;  1ZLL A;  3MP7 B;  5GTH E;  4KUM B;  3B5N A;  2R5D A;  1SVF A;  4H13 D;  4B86 A;  1DD4 A;  2MKV A;  4JI3 T;  3KDP B;  5FY0 A;  5KDM C;  3WAK A;  5JQG E;  4GK0 E;  3AAI A;  4D6T G;  4DR3 T;  5AW6 B;  3L72 E;  3L75 J;  5LOV E;  4Y28 J;  2O3J A;  3TDK A;  4IE7 A;  3WU2 E;  2FJD A;  3RL0 C;  2XQ9 A;  1PGO A;  3CX5 E;  3H1J E;  2M3B A;  3U3I A;  1H7C A;  4X1I E;  1U7J A;  3ESL A;  2ZM0 A;  2WTY A;  1P84 I;  2I0M A;  3KV5 A;  5ABE A;  3RC8 A;  3PUX F;  3VP8 A;  1WFD A;  2E5L T;  1W5C E;  5LXT E;  4DV0 T;  5J1G A;  4YLH A;  1BCC J;  2V1D B;  1QLE D;  3P8C D;  3B57 A;  3PUS A;  3CWB J;  4N3Y B;  2AE9 A;  3NVO A;  2XQY A;  2EHO A;  1RH5 B;  5JDH A;  4H9Q C;  1D1C A;  1HTJ F;  2VVS A;  1L0L K;  3KZI E;  5APT A;  3HUS B;  2FFD B;  4GIF A;  3SFD A;  3L75 D;  2CRB A;  1HX1 B;  1L0L D;  4U3F E;  5AW8 B;  1MIV A;  1L0V A;  3ZMU B;  2W8Z A;  5L3C B;  4C7N A;  3BRV B;  4TN7 B;  3HTK A;  1J1E C;  4JI4 T;  1YYC A;  2QEX P;  1MIW A;  5CCG A;  5ABF B;  2R32 A;  3Q2Y A;  1JOC A;  3RL0 D;  2R3S A;  2A45 I;  2N9D A;  1X0T A;  4U2Y A;  3ZYM A;  1HF9 A;  1FJP A;  1P84 D;  4DMV A;  4DV5 T;  4QXB B;  3ABV C;  3JCF A;  3ITK A;  3U78 A;  1MV8 A;  4L73 A;  2YOE A;  1LVK A;  5CCH A;  1BCC D;  5GTI H;  3V4Q A;  4X62 T;  1HNW T;  3N9M A;  4CI1 B;  4LMK A;  1URQ C;  3CWB D;  3L73 E;  2WT7 A;  2I8D A;  3VRB A;  1BE3 G;  4BWN A;  4PJ0 E;  1SQV G;  2HR3 A;  3L70 G;  3NBX X;  4ZEY A;  2E76 C;  2OAR A;  5KX5 E;  3C1L A;  2M3E A;  3EFG A;  3H1H E;  2ZT9 C;  4AQY T;  4QX7 B;  5HEU A;  2DWK A;  4EV6 A;  1EXI A;  5CGM A;  2ZM8 A;  1NYH A;  3AEA C;  3RBX A;  2OYH C;  1CUN A;  4KX6 A;  4EED A;  1X79 B;  2CWO A;  3P8M C;  1IFJ A;  1EZV D;  2M5A A;  3TLS A;  3KXD A;  2ZJS E;  3I5C A;  5KAF E;  4WB4 A;  2ZXE B;  4Y99 B;  3ZEF B;  1RF0 C;  5HXH A;  2BEZ F;  1JNR A;  2W4X A;  5L3E B;  3FGA D;  2WS3 A;  1IBK T;  1HGZ A;  3UQ7 A;  3PUQ A;  3FZH B;  5F5W A;  1HCI A;  4P1N A;  4CQI A;  3M06 A;  2XSA A;  1GU4 A;  2HOD B;  3MXZ A;  1ZR4 A;  4BJM A;  4QMA A;  3IR9 A;  1URQ D;  4ASW A;  2HYN A;  2OTK E;  1T8Z A;  2BBJ A;  1RQV A;  3U1C A;  4JLE A;  3S1K A;  5FY1 A;  2Y6X A;  3CPZ A;  3MZK B;  2OYI A;  5DAB A;  2E76 D;  1X8Y A;  1GDT A;  5AQL B;  4RKU J;  2ZT9 D;  2FYU K;  3S4R A;  4L75 A;  5AQK B;  1HTL C;  4UXN B;  1XNR T;  2KS1 A;  2EHO B;  2N1T A;  5AQQ B;  2A06 E;  1LWU C;  2LE8 A;  1MND A;  2P58 A;  5CHX A;  2M8R A;  3GHG B;  2YU2 A;  1J5E T;  2LM9 A;  2E5V A;  3CX8 B;  5AVQ B;  2WVR A;  3V5U A;  4DOJ A;  3HKD E;  1GW3 A;  3FX0 A;  2Q5U A;  3F31 A;  1M1J A;  3PUG A;  3RQU A;  3ZC0 A;  1SQP E;  1PGP A;  1IAP A;  3PUW F;  2BZB A;  1KFN A;  3L72 J;  3A3Y B;  1WYC A;  1ZRT E;  4ILA A;  3AA0 B;  3R84 B;  2P67 A;  5JDL A;  3H1L G;  1S3J A;  2Y0E A;  2NTY A;  3CX5 I;  3AE2 A;  3H1J J;  3HKC E;  1SUM B;  2JQH A;  3AE5 C;  2ZM2 A;  2KK7 A;  4H0L C;  1M62 A;  2AEM A;  1DH3 A;  1KB9 H;  4LFB T;  1GTW A;  2QRX A;  2WU5 A;  4B3T T;  1H0T A;  3A0H H;  4IL9 A;  4GIW A;  3AE9 C;  1EDI A;  2RKL A;  4ZKU A;  2VKH A;  1XZY A;  1YQ4 C;  1PGQ A;  5APU A;  2I6H A;  3UUX B;  3CCV P;  2H7V C;  4UF0 A;  2H43 A;  1WT6 A;  1PPJ E;  4PV1 B;  4OK0 A;  5HEG A;  1SLQ A;  4AXP A;  3H6P A;  1JMB A;  5JVD E;  2XZE A;  1JY3 N;  4HFI A;  3L72 D;  1NTM E;  1H89 A;  3L71 E;  3F2E A;  1SFC B;  3TNU B;  4XE5 B;  3TGU E;  1JCC A;  1N7S A;  4YTP C;  1XMQ T;  4YTN A;  4PJM A;  4HGA A;  3CX5 D;  3H1J D;  2A2F X;  2IML A;  2YMK A;  2W6J H;  4U33 A;  2CHO A;  1KQL A;  2WMO A;  4WZX A;  1BGY J;  4LF8 T;  2WWW A;  4HH2 A;  4H0L D;  3AE8 C;  1HNZ T;  1MNE A;  2NPS C;  3QWO C;  2QJK B;  1UX4 A;  3RLF F;  3ZMT B;  5M1B A;  2Z6E A;  2IZ1 A;  2W27 A;  1ZN5 A;  4H9N C;  4HKA A;  3AEF A;  2P2U A;  2WWU A;  2OYI B;  5B5E E;  1GL2 D;  1T72 A;  2JMK A;  1HF8 A;  3L35 A;  1LTJ C;  4U3F D;  3CXH E;  3CX7 B;  5J0Z A;  2RN0 A;  5ABH A;  2WSF H;  1NEK A;  1OVU A;  4A7P A;  1SQB K;  1K73 Q;  3KQG A;  2IBZ G;  4WY4 C;  4WNK A;  3G06 A;  2FYU G;  3LG7 A;  4I50 E;  4U31 A;  3P50 A;  4MHC A;  2BAS A;  3NMD A;  4BRY B;  1PIX A;  2KUB A;  2V7I A;  1N34 T;  3CCM P;  3N9N A;  3AE3 C;  2OQQ A;  2NPS D;  2XAH B;  2X68 A;  4X1K E;  4OH8 B;  4IT4 A;  3L73 D;  4UB8 E;  3CMA P;  3PE0 A;  2QM8 A;  4HFE A;  4KI0 F;  1H0T B;  5APS A;  2C5K T;  2IC9 A;  3ZT6 A;  1BSN A;  4HWC A;  3LK3 B;  3RH3 A;  2W6B A;  1PP9 J;  3H1H D;  1AVO A;  4GK5 E;  4QX8 B;  2UXN B;  2E74 C;  2H89 A;  2X66 A;  3M3Z B;  5LBM A;  3H25 A;  3PUR A;  3Q3D A;  3VHL A;  3B5M A;  3ZYK A;  1W09 A;  1MKM A;  1KIL A;  3V2Q A;  1VCS A;  5KLV G;  4UR9 A;  1WRD A;  5LMU T;  2P7J A;  1FDO A;  1MUU A;  3C64 A;  4KT0 J;  3NZP A;  1AQ5 A;  3VKG A;  2XND H;  1SQP J;  4WY4 D;  2Z5I A;  3HRN A;  2V6X A;  1N7S B;  2X9Y A;  2IZ0 A;  3MUD C;  4ZOL E;  2V7J A;  4OWF A;  2LT3 A;  3RQW A;  3V4W A;  1BE3 E;  4I0U A;  4TLF A;  1VCT A;  4XFJ A;  4K35 A;  4FJO A;  1SQV E;  1G1J A;  3MTU E;  1KEY A;  3KV6 A;  4U72 A;  1IK7 A;  3LBX A;  4EEB A;  2UUA T;  2Q1K A;  1NTK K;  3FB2 A;  4IDO A;  4JI1 T;  3H3M A;  4DV4 T;  2L3L A;  5KTB A;  2W63 A;  3AEB A;  3R2P A;  2E9X B;  3OYX A;  2O01 H;  1UGO A;  4LC1 A;  3TYY A;  2VAS A;  2XAF B;  2FJE A;  1EDK A;  1X9V A;  4LLH A;  1S5L H;  2VVN A;  3W15 B;  1ZOY C;  3LDQ B;  4DZO A;  3NXS A;  5TJH A;  3OYZ A;  4I55 E;  2E74 D;  2XAJ B;  3I0O A;  1AA0 A;  1KMI Z;  3HD7 A;  3DTO A;  5LHG B;  3NZQ A;  3SWY A;  2A06 D;  3UUB A;  1NU1 K;  3PUZ F;  4HEA A;  1FC2 C;  4B6X A;  2XNX A;  4LF6 T;  4OGQ B;  3MAC A;  3PU8 A;  2JWA A;  4B3M T;  3B5N C;  4YXD A;  1WR0 A;  2IDO B;  2IHR 1;  1SQP D;  3JAF A;  4PD4 E;  3CC7 P;  1SP4 A;  5HXS A;  2VWA A;  2P1J A;  1YQ3 A;  3VR8 A;  1NTM J;  2AXT E;  3L71 J;  3PTZ A;  1ZW0 A;  1ZRT D;  4EIJ A;  3MK7 C;  3FZL B;  3TGU J;  1NWM X;  4DUY T;  4EAH A;  2UXD T;  1BR0 A;  5HWX A;  2QM7 A;  3AE1 A;  3SWK A;  1EZ3 A;  4HFD A;  3TF5 A;  2ACX A;  2VL0 A;  5HXE A;  2E42 A;  1YKE B;  5E79 E;  4PFO A;  3IF8 B;  4JUY A;  3EAB A;  4JYB A;  5AVS B;  2KI7 B;  3JAD A;  4JI0 T;  1YJN P;  3WI3 A;  1SQB G;  1OX3 A;  2Q9Q C;  1U7M A;  4UEM A;  4H9O C;  5JTG A;  1PPJ D;  4Q25 A;  3J9X 1;  5FMN A;  4DCK A;  4ZMD A;  1UIX A;  2V26 A;  3D70 A;  2XSB A;  5AQI B;  5ETW A;  2CBI A;  4PFP A;  3B5N D;  4JI2 T;  3N9Q A;  4QWN B;  2EHO C;  2DLR A;  1LT1 A;  2CBJ A;  2RH0 A;  3FHN A;  1NTM D;  2W00 A;  1IFM A;  3L71 D;  2V5C A;  3MA9 A;  4N78 E;  3CXH I;  3E08 A;  4NIQ A;  2KZ7 B;  3IF4 A;  3TGU D;  2WSE J;  4U7I A;  5HEJ A;  1WMK A;  3PJS K;  1YIT P;  2IAK A;  4PNI A;  3QNU A;  4GKG A;  5HAX A;  1QEX A;  1VQ9 P;  5CFB A;  3E0Z A;  2RPA A;  1LTI C;  3Q5D A;  5H6R B;  4NXN T;  1D0Z A;  2N9Y B;  3D0T A;  2D9D A;  1UUS A;  2YKQ A;  2E75 C;  3ZT7 A;  2VL8 A;  2HHH T;  5LNK A;  3VU7 H;  5CCH C;  4XAX B;  2Y0C A;  2Q9Q D;  2OLT A;  2M67 A;  2AXC A;  1I94 T;  4GKK T;  4IDZ A;  4I7Z C;  3EFF K;  2H8P D;  2UXX B;  4DV6 T;  1FBM A;  3HD7 B;  5FVL A;  4U74 A;  1W2E A;  2HFE D;  2EHO D;  5JH7 E;  3E22 E;  3OTO T;  4YHH T;  3CXH D;  1HFA A;  2PJQ A;  3KVB A;  3E1I A;  2KB7 P;  4PV1 C;  3PUV F;  1NTK G;  4O4I E;  1XTC C;  3Q5E A;  5AQM B;  2X0H A;  5ABG A;  4IHJ E;  1NAY A;  4L9I A;  5LJM A;  2KSJ A;  5AW9 B;  1YTZ I;  1UCU A;  3AVS A;  4AQR D;  1JNM A;  2K48 A;  5CCG D;  3NKZ A;  3N4X A;  2IIU A;  1DIP A;  3RC3 A;  3ZYL A;  1RE4 A;  2OV9 A;  4CXW A;  1NU1 G;  2YU1 A;  4DR1 T;  2Z4E A;  1BE3 J;  1SQV J;  1Z0P A;  1IBL T;  1JY3 P;  1K9M Q;  3QC9 A;  3L8R A;  5CCH D;  2KYV A;  3EQ2 A;  1YKH B;  3ONJ A;  2ITA A;  2K3W A;  4IL6 H;  2H88 A;  4G63 A;  2LEH A;  4KP3 C;  4L5G A;  3LID A;  1VRB A;  4IL4 A;  1YD8 G;  2XAQ B;  1MMA A;  2JRK A;  2IUB A;  1VF5 B;  1FE6 A;  2I1K A;  3L09 A;  2BCC G;  3AE7 A;  4MFR A;  3B8E B;  3MKD A;  2L91 A;  4OVN F;  5GTI E;  1V9D A;  1ZHC A;  3GN5 A;  4PJN A;  2IBZ E;  3HUS A;  2FFD A;  1FMV A;  2FYU E;  1KK7 A;  1VQ4 P;  4KMC A;  4PV1 D;  4OX9 T;  1D1B A;  2X9H A;  2WAU A;  4UVC B;  4AKL A;  2N1T C;  2V7Q J;  2O1J A;  2WZI A;  1T98 A;  1LRZ A;  4YTM A;  4PD4 I;  1KIL E;  4U7Y A;  4O9B A;  5ABF A;  1U5P A;  4CN4 A;  2JEE A;  4BA9 A;  3SSU A;  1I6Z A;  3CCE P;  1M1J C;  5HYA A;  1T7S A;  2FYN C;  1OVR A;  4PJJ A;  1BE3 D;  4X5T A;  1SQV D;  2Z5H A;  3GWH A;  4WBA A;  3AE4 A;  5DJT B;  1K05 A;  1DU2 A;  2WSC H;  2J4G A;  5CMZ A;  3S9O A;  1QUU A;  5GON E;  1USD A;  4JBZ A;  1BR1 A;  3A0B E;  5KLV E;  3IBP A;  5EZY E;  1FDI A;  2KNC A;  4TNW A;  3IAO A;  2FKW B;  2IDB A;  2VKO A;  4LMJ A;  3LJC A;  4TX5 A;  1Z56 A;  4X1Y E;  3BCC G;  3P4S A;  3SS1 A;  2BEQ D;  1X79 A;  2QVA A;  5AQT B;  2BS4 A;  2N1T D;  1QL1 A;  2CEA A;  4PD4 D;  3GF3 A;  2H7H A;  2WPQ A;  1FZB A;  3AXJ B;  4QXH B;  4ISS A;  1NKZ B;  3TLT A;  1L0L J;  1HX8 A;  3P4R A;  3RHW A;  3CWZ B;  2Q7C A;  1IC2 A;  3RRC A;  3AA6 B;  1GZL A;  1USE A;  1HBW A;  1CI6 A;  1U57 A;  4AKH A;  2D0T A;  5EK4 A;  1L0N G;  4GOU A;  4IFF A;  1N7S C;  5LP6 E;  2HOD A;  2W90 A;  1KNZ A;  4M1P A;  4MBQ A;  3ZLI A;  3Q1M A;  3BVH A;  4GOE A;  3RK3 E;  4TV9 E;  5HCM A;  1LTG C;  4WYV A;  3A5T A;  5LYJ E;  4JEU B;  3U1A A;  2D2S A;  4LFC T;  5APV A;  3HR0 A;  2NRG A;  2WSS V;  1AVY A;  1KYO H;  1VQP P;  4K3A A;  3P4W A;  5FXV A;  2NW7 A;  3AEF C;  1TU3 F;  3GN5 B;  4OYK A;  1W2B O;  1KB9 E;  2YIU C;  3GHG A;  4AKR B;  2NWB A;  2D0U A;  3A0H E;  1JUN A;  3JCU H;  3RIU C;  4N78 D;  4KBM B;  4Z91 A;  5AQR B;  4HJG H;  1JEK A;  1YHQ P;  2W67 A;  3ZT5 A;  1PZQ A;  1EXJ A;  5HXR A;  3RGU A;  1KZU B;  5IWA T;  1OIP A;  1B7T A;  5LB7 B;  2HG5 D;  3GLM A;  3ZN1 B;  3I0Q A;  2GA1 A;  4YSX A;  2D5U A;  2N1G A;  2LSY A;  3RIA A;  1N7S D;  1SQB E;  2PGD A;  2BVL A;  2IFM A;  2FYZ A;  2YKP A;  3G71 P;  4CXY A;  1D0Y A;  2BS3 A;  2WP9 A;  2AXD S;  1SQQ G;  2CK3 H;  3CCR P;  2SPZ A;  3CCL P;  2YKS A;  3KYQ A;  1PV3 A;  3AAA B;  1YBK A;  5L4E A;  4JEH B;  2J59 M;  1XDO A;  2A3D A;  4EYY Q;  3CIR A;  5AW5 B;  3V5B A;  5LG4 A;  2Q9I A;  4I43 B;  2OYO A;  4HYT B;  5KLI B;  4EIW A;  2QJY B;  3VYI A;  2KNC B;  2A72 A;  3WUT A;  2Q3I A;  3K3N A;  3AEG A;  1Y9B A;  5APQ A;  1EQ7 A;  2IBZ I;  4CI3 B;  3AEE C;  2LKH A;  4ASK A;  2R5B A;  2FYU J;  1ZME C;  1D1A A;  2CCQ A;  1SFC A;  3TNU A;  2ODU A;  3CC4 P;  3VP9 A;  1JY3 O;  1KIL C;  4I6M C;  2HPJ A;  3CK6 A;  3R6N A;  4ZS2 A;  1SHZ C;  3OJA A;  3UTK A;  3ZSS A;  4O4H E;  1CI6 B;  4DVD A;  4DR7 T;  3QB5 K;  1Z8U A;  3CKD A;  3HI2 A;  2NTX A;  2W6A A;  2Q3E A;  1KV4 A;  1KNR A;  3C51 A;  5LMN T;  2IC6 A;  2KWI B; 
#chains in the Genus database with same CATH homology
 1N73 B;  2PBI A;  2JJL A;  2G0U A;  4BAY B;  2J58 A;  5FXW A;  2MBG A;  3UUN A;  5FYM A;  1UX5 A;  4DBR A;  1MMN A;  3M9B A;  2IX7 C;  4I2L C;  2CM0 A;  1LKX A;  5DQV A;  4A56 A;  1KIL D;  5AVX B;  2IW5 B;  5AW0 B;  4IGU A;  2VKJ A;  2PP6 A;  5LHI B;  3KV4 A;  2MJZ A;  3RYF E;  4PK6 A;  3KIN B;  5C8Y E;  3MIW A;  4W7Y A;  1T2K C;  4P09 A;  1S9K E;  2MOZ A;  3M0D A;  5FY7 A;  5KLV K;  1A02 F;  2CXF A;  2KP8 A;  4IIJ E;  3G3Z A;  3RK3 C;  4AUW A;  4AKG A;  2LKM A;  2CLY C;  2DNX A;  1GK6 A;  2V7L A;  1MMD A;  1AFO A;  4OHF A;  3AA7 B;  4H63 H;  1IFD A;  1GL2 C;  4YFS A;  1VPC A;  2DCF A;  2KLV A;  1E5W A;  4X20 E;  4Z8X A;  3SRZ A;  5L3B B;  3II6 A;  5A1L A;  4NUU A;  1NOH A;  2LHN A;  1YTZ T;  1U4Q A;  1BR4 A;  2J1D G;  3RRW A;  4XA4 A;  2JQQ A;  3OJA B;  3C50 A;  1T2K D;  2CWY A;  1HVV A;  2W61 A;  3HL6 A;  3M9H A;  3RK3 D;  2E9X A;  3OAK A;  4H9P C;  2NP9 A;  2WZ7 A;  2K9A A;  4DMW A;  1T3J A;  5FNV E;  2Y48 B;  4UV8 B;  1FZC B;  2C0W A;  2KT9 A;  4J2C A;  1LT9 B;  4IFD K;  4C90 A;  2NW8 A;  4ILU A;  4ADZ A;  2ZMA A;  3UT5 E;  3O1J A;  2JJ9 A;  3KFW X;  3FBL A;  4E7S A;  2V7K A;  1RE4 C;  2XUE A;  3MJX A;  2YO2 A;  1VOM A;  1HH0 A;  1OWA A;  1PFI A;  3RYC E;  4EZ4 A;  2K24 A;  3HE4 A;  1JY2 N;  5LGU B;  3PTR B;  4UIG A;  3HUS C;  2FFD C;  2PG8 A;  2CXD A;  3SOL A;  3O8Z A;  3BQK A;  3K3Q C;  3KV9 A;  4OYJ A;  5APX A;  3CVR A;  5CA0 E;  1RF0 A;  3DP7 A;  3O4X E;  1JCD A;  4UVA B;  1A02 J;  5HWY A;  3ZN0 B;  2WMN A;  3RYH E;  2ES0 A;  3NRX A;  4AQF A;  2HH7 A;  2IFN A;  3EVY A;  1NH4 A;  3ZJ1 A;  5H6Q B;  2C0S A;  3RYI E;  3BQL A;  3AB3 B;  5AW1 B;  1FU1 A;  1RF1 A;  1LWU A;  3L36 A;  2KMF A;  2LSG A;  5AFU L;  4Y99 C;  3ZMZ B;  3ANW A;  3KPE A;  1S9K D;  1J1E B;  3KVA A;  4AKI A;  2GM4 A;  1FEW A;  4IFM A;  1HGV A;  3HA4 A;  3I9W A;  4DND A;  4RES B;  4GT1 A;  1BR2 A;  3VOP A;  1IJ6 A;  3A2A A;  1S35 A;  5CA1 E;  3A5X A;  1WR6 A;  1US7 B;  5LHH B;  1GU5 A;  2L9Q A;  1G73 A;  3HE4 B;  4P0B A;  1IJ5 A;  4TZ4 C;  4O4J E;  3GHG C;  3BAT A;  2JPF A;  2YEV C;  4O8S A;  5TAO A;  3V2P A;  2OYH B;  3ZCI A;  3CI9 A;  4UEL A;  3M0A A;  5CCG C;  5JDG A;  3N2O A;  3M65 A;  4UV9 B;  5F3J A;  4I4T E;  2Y8D A;  1IZN B;  3PDY A;  3C9I A;  3L37 A;  3FXD B;  5JRC B;  2P9B A;  3BK9 A;  3KBU A;  1L0N K;  5L2L A;  3LIE A;  1ZKE A;  3GA8 A;  1L4A A;  3PP5 A;  4O2A E;  1WRG A;  1FZG A;  3KDS E;  1RF1 B;  2XAS B;  1LWU B;  1SFC C;  5BMV E;  3Q5X A;  5LA6 E;  2QGS A;  1ZR2 A;  3C4X A;  4FI5 A;  3U59 A;  3ANW B;  2K5B B;  1N2D C;  3AA1 B;  2N9B A;  3CLQ A;  3ONX A;  1FZE A;  3VTP C;  4KHX A;  2LSI A;  4W7Z A;  1JTH A;  1LVF A;  2XTL A;  1MFZ A;  2OYI C;  4AI6 A;  1VDF A;  2KLQ A;  1O3X A;  1SQX K;  3LK2 B;  2MTQ A;  1SQQ K;  4P0A A;  3RKO A;  2DI4 A;  3O1H A;  3ZJ2 A;  4CXX A;  1FOS F;  1SFC D;  4AQG A;  3Q9D A;  5JRE A;  2H3R A;  1NO4 A;  1FOS E;  3V5S A;  3UUM A;  3VMZ A;  2VRS A;  2XU6 A;  3IFM A;  3HE5 A;  2C0X A;  3TK1 A;  1FIO A;  2O1K A;  2KOG A;  5AVW B;  1G1I A;  1JMM A;  1N7L A;  3ZMV B;  3M91 A;  3AAE B;  3O1I A;  1L4A B;  2H7O A;  3N2G E;  1HG2 A;  1NTZ K;  4I1L A;  5FP3 A;  1LTJ B;  3BAS A;  3NTN A;  4WW0 A;  1RE3 A;  1XTG B;  5M4Y A;  4MAL A;  2HPC B;  3CQG B;  3EDU A;  4H63 V;  5AVR B;  1LTA C;  1FZA A;  1JY2 P;  1OXZ A;  2GK9 A;  1KFM A;  3RX6 A;  4WY4 B;  4F6R C;  3CML A;  5AVT B;  2X51 A;  2LSK A;  1N73 A;  2LSJ A;  3P7K A;  2E9X C;  4PK4 A;  3JC6 C;  2POH A;  1JTH B;  5LGT B;  2X0L B;  2Q9Q A;  4OFZ A;  4C46 A;  4YJ3 E;  5LJN A;  5BVZ A;  4LGD E;  4HN9 A;  1ZEE A;  4AYC A;  3PUA A;  2DHR A;  2A45 H;  2VB6 A;  4PW8 A;  3UFE A;  1T3U A;  2QA7 A;  2C5I T;  3P32 A;  3HE5 B;  3MGN A;  3BRT B;  4HFV A;  2E9X D;  3PU3 A;  5JR9 A;  3JC6 D;  4ZI3 C;  3RPU A;  1JO5 A;  3OA7 A;  5AW2 B;  3MD0 A;  3Q2M A;  3SWF A;  4ZHQ E;  2LHR A;  3ZC1 A;  4EOZ B;  2XHE B;  2MYS A;  3C4W A;  1M7L A;  3B5N B;  3T8O A;  2CMR A;  3M9Q A;  1IFN A;  5KJ7 A;  4HE8 A;  1MIY A;  5LBQ B;  3I9Y A;  4EZH A;  2FXM A;  5LCY A;  3L3P A;  3TSI A;  3DJB A;  2PAJ A;  3QUJ A;  2LOS A;  3GMI A;  3I1A A;  4ZI3 D;  1D0X A;  4IE6 A;  2PFV A;  2C9L Y;  3EDV A;  1FZC A;  2CPS A;  5E0O A;  3HD7 C;  1LT9 A;  1LTS C;  5EK2 A;  2Q9Q B;  1HJB A;  4AQF C;  4O2B E;  3NFQ A;  1S94 A;  2NW9 A;  2WM9 A;  2YIN A;  4IE4 A;  3F57 A;  1RF1 C;  2VK9 A;  1HWT C;  5IHY A;  1HS7 A;  1QL2 A;  1GK4 A;  5JDM A;  4C7N B;  3HTK B;  3N9L A;  1G2C A;  1CZQ A;  1NHL A;  5JR9 B;  1IFI A;  1WYB A;  3HD7 D;  4TV8 E;  3AVR A;  1G8X A;  3H32 A;  5JDF A;  3RK2 B;  4H9R C;  2WT7 B;  4EB6 E;  2R3C A;  1JY2 O;  5AW7 B;  3VMY A;  3VN0 A;  3NRY A;  2WPR A;  1FJK A;  4IE0 A;  2W0G A;  3J7Y q;  2LJL A;  4HTE A;  2IPP A;  2WIT A;  2E8I A;  3VMX A;  4PAG A;  4QXC B;  3P7I A;  4M3L A;  2X9X A;  3LW5 H;  1LTB C;  3H3A A;  4DBQ A;  1CW5 A;  3IHR A;  1J1D B;  3UIA A;  2XV5 A;  2XDJ A;  4PK5 A;  4IST A;  4C7R A;  2SPC A;  2KIN B;  3WMM 0;  2A45 G;  3TKL B;  1NKN A;  3O9X A;  1QSD A;  1N86 A;  3EUH A;  2KWH A;  5FXZ A;  1L4A C;  5EK3 A;  3T97 A;  1H88 A;  5L3D B;  3C98 B;  2N1T B;  3CQC B;  4G2A A;  1MMG A;  3N7N A;  4DO0 A;  1M1J B;  2N2N A;  5APW A;  3QK6 A;  3HKE E;  1GD2 E;  1AJ3 A;  2LOP A;  3ZMS B;  1G2C B;  2YNY A;  4PJL A;  3LK4 2;  1URQ A;  4YHJ A;  3OBV E;  2CPB A;  4L0R A;  5J2T E;  2YO3 A;  3H32 B;  2HLO A;  1L4A D;  5KMG P;  2X9W A;  2XAG B;  3KBT A;  1RY3 A;  2OYH A;  5L3G B;  2W62 A;  2ZLY A;  5L3F B;  4GYS A;  2C5J A;  4UF0 B;  4XZC A;  1CSB A;  5IYZ E;  5FXX A;  3K3O A;  4UVB B;  3RL0 B;  2XKM A;  2VKD A;  5JRC A;  3Q5W A;  1NWQ A;  2CE7 A;  3BQI A;  3N2K E;  1NAF A;  3OKQ A;  3IEE A;  3K8P C;  5AW3 B;  4ANJ A;  1Y64 B;  2RP4 A;  3B13 A;  3N9O A;  3FXE B;  2JMH A;  3ZPO A;  4N6J A;  1FDM A;  2YK0 A;  2CXL A;  1YW0 A;  3FBZ A;  1SQP K;  3UUL A;  1RE3 C;  4C91 A;  5JDN A;  1ZV8 A;  4ZKP A;  1MZ9 A;  2ODV A;  4MLK A;  4TUY E;  5LGN B;  4K0U A;  3ZCJ A;  2C9N Y;  1N73 C;  4W80 A;  2ZFC A;  5JDQ A;  4WBO A;  1URQ B;  4EYY R;  3A7O A;  1LGH B;  1GL2 A;  2NOX A;  2WSE H;  3CL3 D;  3ETU A;  3P8C E;  3S4U A;  2BVM A;  5CJ4 A;  2B1E A;  5AVV B;  2I1J A;  5F8P A;  1NTM K;  4ZI7 E;  1DEB A;  2YKO A;  2L5G B;  4QHO A;  1KIL B;  3ETV A;  4JYC A;  3VKH A;  2KND A;  4JF7 A;  3H37 A;  5BU5 A;  3SWH A;  2NPS A;  2WPS A;  2WBL A;  4CZZ B;  5JR9 C;  1HG5 A;  4IE5 A;  2DWG A;  3LBX B;  2V7M A;  3HKB E;  2YMY A;  3V2R A;  2CA5 A;  4QKN A;  1LTJ A;  2BDE A;  3RK2 C;  1HUC A;  2HPC A;  1DX7 A;  5CB4 E;  3V2N A;  4EXT A;  2KXP B;  1J2J B;  1IO4 A;  3WAJ A;  4WY4 A;  3LFM A;  3CX6 B;  5KJ7 C;  4BJN A;  5APY A;  4E7Z A;  5HXC A;  3L4F A;  2OA5 A;  1IJD B;  4ERR A;  4CI2 B;  1J1D C;  3RK3 B;  2CLY B;  5AVZ B;  4O4L E;  5AW4 B;  3C4Z A;  2GUV A;  1FZC C;  1ZV4 X;  2XZR A;  4ZS3 A;  1GL2 B;  3RK2 D;  1LT9 C;  3N9P A;  1WLX A;  4YJ2 E;  4ZI2 C;  5DQW A;  1FZF A;  5DJQ C;  4H9S E;  2E43 A;  4V1A v;  3CQX C;  1H8A A;  2HPL A;  5AVU B;  5ADX L;  5KJ7 D;  3MUD A;  2GUS A;  5BU8 B;  2I59 A;  1GW4 A;  3M0D C;  1SQV K;  1SA0 E;  4GYR A;  3N5L A;  1FAV A;  2NPS B;  4WBN E;  1E1H B;  5J2U E;  1LTT C;  5AVY B;  2L8K A;  5CJ0 A;  1IK9 A;  4NUV A;  1FMW A;  2RA1 A;  4EYU A;  4XBF B;  2X67 A;  4ZI2 D;  4EOT A;  1ZLL A;  4KUM B;  3B5N A;  2R5D A;  1SVF A;  4B86 A;  3KDP B;  5FY0 A;  5KDM C;  3WAK A;  5JQG E;  4GK0 E;  3AAI A;  5AW6 B;  5LOV E;  4IE7 A;  3RL0 C;  2M3B A;  3U3I A;  1H7C A;  4X1I E;  3ESL A;  2ZM0 A;  2WTY A;  3KV5 A;  3RC8 A;  3VP8 A;  5LXT E;  5J1G A;  4YLH A;  2V1D B;  3P8C D;  3B57 A;  3PUS A;  4N3Y B;  2XQY A;  2EHO A;  5JDH A;  4H9Q C;  1D1C A;  1HTJ F;  1L0L K;  5APT A;  3HUS B;  2FFD B;  4GIF A;  5AW8 B;  1MIV A;  3ZMU B;  5L3C B;  4C7N A;  3BRV B;  4TN7 B;  3HTK A;  1J1E C;  1YYC A;  1MIW A;  5CCG A;  2R32 A;  1JOC A;  3RL0 D;  2A45 I;  2N9D A;  3ZYM A;  4DMV A;  1FJP A;  4QXB B;  3U78 A;  1MV8 A;  1LVK A;  5CCH A;  3V4Q A;  3N9M A;  4CI1 B;  1URQ C;  2WT7 A;  3NBX X;  2OAR A;  5KX5 E;  3EFG A;  4QX7 B;  2DWK A;  2ZM8 A;  2OYH C;  1CUN A;  1X79 B;  2CWO A;  3P8M C;  1IFJ A;  3I5C A;  4WB4 A;  2ZXE B;  4Y99 B;  3ZEF B;  1RF0 C;  5HXH A;  5L3E B;  1HGZ A;  3PUQ A;  1HCI A;  4CQI A;  3M06 A;  1GU4 A;  2HOD B;  3MXZ A;  1ZR4 A;  4BJM A;  3IR9 A;  1URQ D;  2HYN A;  1T8Z A;  3U1C A;  4JLE A;  5FY1 A;  2Y6X A;  3CPZ A;  3MZK B;  2OYI A;  5DAB A;  1X8Y A;  1GDT A;  2FYU K;  4UXN B;  1HTL C;  2EHO B;  2N1T A;  1LWU C;  2LE8 A;  1MND A;  2YU2 A;  5CHX A;  2M8R A;  3GHG B;  2LM9 A;  3CX8 B;  5AVQ B;  3V5U A;  4DOJ A;  3HKD E;  1GW3 A;  3PUG A;  2Q5U A;  3F31 A;  1M1J A;  3ZC0 A;  1IAP A;  2BZB A;  1KFN A;  3A3Y B;  1WYC A;  3AA0 B;  3R84 B;  2P67 A;  5JDL A;  2NTY A;  3HKC E;  2ZM2 A;  1DH3 A;  1GTW A;  4GIW A;  4ZKU A;  2VKH A;  5APU A;  3UUX B;  2H7V C;  4UF0 A;  2H43 A;  1WT6 A;  4OK0 A;  1SLQ A;  4AXP A;  3H6P A;  5JVD E;  1JY3 N;  1H89 A;  3F2E A;  1SFC B;  3TNU B;  4XE5 B;  1JCC A;  1N7S A;  4PJM A;  4HGA A;  2A2F X;  1KQL A;  2WMO A;  2WWW A;  4HH2 A;  1MNE A;  2NPS C;  1UX4 A;  3ZMT B;  2Z6E A;  2W27 A;  1ZN5 A;  4H9N C;  4HKA A;  2P2U A;  2WWU A;  2OYI B;  1GL2 D;  2JMK A;  1HF8 A;  3L35 A;  1LTJ C;  3CX7 B;  2WSF H;  1SQB K;  3KQG A;  4WY4 C;  4WNK A;  3LG7 A;  4I50 E;  4MHC A;  2BAS A;  3NMD A;  2V7I A;  3N9N A;  2NPS D;  2XAH B;  2X68 A;  4X1K E;  4OH8 B;  3PE0 A;  2QM8 A;  2C5K T;  5APS A;  2IC9 A;  3LK3 B;  3RH3 A;  2W6B A;  4GK5 E;  4QX8 B;  2UXN B;  2X66 A;  5LBM A;  3PUR A;  3VHL A;  3ZYK A;  1KIL A;  3V2Q A;  1WRD A;  2P7J A;  1MUU A;  3C64 A;  3NZP A;  1AQ5 A;  3VKG A;  4WY4 D;  2Z5I A;  3HRN A;  1N7S B;  2X9Y A;  4ZOL E;  2V7J A;  2LT3 A;  3V4W A;  4FJO A;  1G1J A;  3MTU E;  3KV6 A;  4U72 A;  3LBX A;  1NTK K;  3FB2 A;  2L3L A;  5KTB A;  2W63 A;  3R2P A;  2E9X B;  3OYX A;  2O01 H;  4LC1 A;  3TYY A;  2VAS A;  2XAF B;  1X9V A;  4LLH A;  3W15 B;  4DZO A;  3NXS A;  3OYZ A;  4I55 E;  2XAJ B;  3I0O A;  3HD7 A;  3DTO A;  5LHG B;  3NZQ A;  3SWY A;  1NU1 K;  4HEA A;  4B6X A;  2XNX A;  3MAC A;  3PU8 A;  3B5N C;  1SP4 A;  5HXS A;  2VWA A;  2P1J A;  4EIJ A;  3MK7 C;  1NWM X;  4EAH A;  1BR0 A;  5HWX A;  2QM7 A;  1EZ3 A;  2ACX A;  5HXE A;  2E42 A;  1YKE B;  4PFO A;  3IF8 B;  4JUY A;  4JYB A;  5AVS B;  3WI3 A;  2Q9Q C;  4UEM A;  4H9O C;  3J9X 1;  5FMN A;  2V26 A;  5ETW A;  4PFP A;  3B5N D;  3N9Q A;  4QWN B;  2EHO C;  2DLR A;  3FHN A;  2W00 A;  1IFM A;  3MA9 A;  4N78 E;  3E08 A;  2KZ7 B;  2IAK A;  4PNI A;  4GKG A;  5HAX A;  3E0Z A;  1LTI C;  5H6R B;  1D0Z A;  3D0T A;  2YKQ A;  2VL8 A;  5LNK A;  3VU7 H;  5CCH C;  4XAX B;  2Q9Q D;  2M67 A;  4IDZ A;  2H8P D;  2UXX B;  1FBM A;  3HD7 B;  4U74 A;  1W2E A;  2HFE D;  2EHO D;  5JH7 E;  3E22 E;  1HFA A;  2PJQ A;  3KVB A;  3E1I A;  2KB7 P;  4O4I E;  1XTC C;  4IHJ E;  4L9I A;  5LJM A;  2KSJ A;  5AW9 B;  1YTZ I;  1UCU A;  3AVS A;  4AQR D;  1JNM A;  2K48 A;  5CCG D;  3N4X A;  3RC3 A;  3ZYL A;  1RE4 A;  4CXW A;  2YU1 A;  2Z4E A;  1Z0P A;  1JY3 P;  3QC9 A;  5CCH D;  2KYV A;  3EQ2 A;  1YKH B;  4G63 A;  2LEH A;  4KP3 C;  4L5G A;  3LID A;  1VRB A;  1YD8 G;  2XAQ B;  1MMA A;  2JRK A;  2I1K A;  3L09 A;  4MFR A;  3B8E B;  3MKD A;  1V9D A;  1ZHC A;  3GN5 A;  4PJN A;  3HUS A;  2FFD A;  1FMV A;  1KK7 A;  4KMC A;  1D1B A;  2X9H A;  2WAU A;  4UVC B;  4AKL A;  2N1T C;  2O1J A;  1T98 A;  1LRZ A;  4O9B A;  1U5P A;  2JEE A;  4BA9 A;  1M1J C;  5HYA A;  4PJJ A;  2Z5H A;  3GWH A;  4WBA A;  2WSC H;  5CMZ A;  1QUU A;  5GON E;  1BR1 A;  3IBP A;  5EZY E;  2FKW B;  2VKO A;  3LJC A;  4TX5 A;  1Z56 A;  4X1Y E;  3SS1 A;  1X79 A;  2N1T D;  1QL1 A;  2CEA A;  2H7H A;  2WPQ A;  1FZB A;  4QXH B;  4ISS A;  1NKZ B;  1HX8 A;  3CWZ B;  2Q7C A;  1IC2 A;  3RRC A;  3AA6 B;  1GZL A;  1HBW A;  4AKH A;  1CI6 A;  2D0T A;  5EK4 A;  4GOU A;  4IFF A;  1N7S C;  5LP6 E;  2HOD A;  1KNZ A;  4M1P A;  4MBQ A;  3ZLI A;  3BVH A;  4TV9 E;  1LTG C;  3A5T A;  5LYJ E;  4JEU B;  3U1A A;  2D2S A;  5APV A;  3HR0 A;  2WSS V;  5FXV A;  2NW7 A;  3GN5 B;  4OYK A;  3GHG A;  4AKR B;  2NWB A;  2D0U A;  1JUN A;  4N78 D;  4KBM B;  5HXR A;  1KZU B;  1B7T A;  2HG5 D;  3ZN1 B;  3I0Q A;  2D5U A;  2N1G A;  2LSY A;  1N7S D;  2BVL A;  2IFM A;  2FYZ A;  2YKP A;  4CXY A;  1D0Y A;  3KYQ A;  3AAA B;  4JEH B;  2J59 M;  2A3D A;  5AW5 B;  3V5B A;  5LG4 A;  2Q9I A;  4I43 B;  4HYT B;  4EIW A;  3VYI A;  2A72 A;  2Q3I A;  3K3N A;  5APQ A;  1EQ7 A;  4CI3 B;  4ASK A;  2R5B A;  1D1A A;  2CCQ A;  1SFC A;  3TNU A;  2ODU A;  1JY3 O;  1KIL C;  3R6N A;  4I6M C;  3VP9 A;  2HPJ A;  4ZS2 A;  1SHZ C;  3OJA A;  3UTK A;  4O4H E;  1CI6 B;  4DVD A;  3CKD A;  3HI2 A;  2NTX A;  2W6A A;  3C51 A;  2IC6 A;  2KWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...