4N78D

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
529
structure length
202
Chain Sequence
HTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRSDARSVLLEAIRKGIQLRKVEEIENDVATILSRRIAVEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 57
structure length 202
sequence length 529
ec nomenclature
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78D01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4n78D02
1WT6A 3U1AA 3BASA 2JEEA 3C9IA 5KTBA 4GIFA 4O9BA 3OJAB 2POHA 4I1LA 3VP9A 4N3YB 2FXMA 4N78D 3U1CA 3N4XA 4ZKUA 3P8CD 3VP8A 3BATA 5BU8B 5BU5A 3U59A 3N7NA 5BVZA 4ZKPA 3HRNA 1X79B 1NKNA 1IC2A
chains in the Genus database with same CATH superfamily
3KDSE 3L73G 1T2KD 2CXDA 1ZR2A 1J1DB 3L72G 5AVQB 5F5WA 2WP9A 1PP9D 3AE6C 4HWCA 3I0OA 2WCAA 5L3GB 5ABEA 4PD4D 4WY4B 3B5NC 3EVYA 2HN1A 5AW3B 5LOVE 2XSBA 1KN7A 1FEWA 1OVVA 3AXJB 4O4IE 4U7IA 1HG5A 3MA9A 3K8PC 5F8PA 1L0LJ 1VQ8P 4PK6A 1IFDA 3TDKA 3QK6A 4I6MC 4ZKPA 3HD7B 4XA4A 1AA0A 3ZC0A 3P8CE 4ASWA 3NMDA 3Q2YA 2NW9A 2R5BA 5CJ0A 3TGUE 2E5VA 1IBMT 1WR0A 1ZXGA 1W5CE 3M91A 1SLQA 1UIXA 4DBQA 2P10A 4I1LA 2E9XD 2FBWA 5FNVE 3AE5A 1KFYA 3M0DA 1M8OB 4UVAB 3RPUA 4CXWA 1SQPK 3C1LA 1HWTC 2EHOB 2KWHA 2HODB 1RE4A 2UUAT 3VR9A 2BCCG 4JI3T 1OX3A 1GDTA 1T3UA 1G2CA 3JCUH 1P84H 5FP3A 3MK7C 3FXDA 1SFCD 4OFZA 4HB1A 1J5WA 4DV7T 5FYMA 1MMAA 3W15B 4N6JA 5LMUT 4H44D 1HTLC 1QLBA 3HUSC 4H63H 2WZIA 4D6TJ 2QEXP 2NP9A 4ZZCA 2E5LT 2VVSA 4AKRB 4PNIA 2GA1A 3RL0B 4KBMB 1MV8A 5JR9A 5AVTB 4UVBB 2M6BA 2P2UA 1ZOYC 4CI3B 1HGZA 3WU2E 4KP3C 2CLYB 4NUVA 4QX7B 2UXDT 1ZP0C 5AVXB 2H43A 1HS7A 2FXPA 2NZ2A 3HTKB 1VOMA 4LF9T 1SQQK 3M9BA 4GKGA 1W09A 3SWHA 3VYIA 4KHPT 1GL2B 4H13D 1GU4A 3M0AA 1AJYA 2A06D 5E79E 2A06G 5C2TA 3GMAA 2HYNA 4LLHA 3A0BE 1SUMB 3QB5A 3U1AA 3ZSSA 1UX4A 1D1CA 1VL2A 4GIFA 3A8YC 5L4EA 1L4AD 2C9LY 3AE2A 4HFHA 3B57A 1W0AA 2MOZA 1NTZE 3ZN0B 4EV6A 5TJHA 1UK5A 4TZ4C 2OYIA 3CX6B 3HA4A 3K5BA 4IDOA 3RK2D 5DJTB 3L75J 1N7SC 2XAFB 4IDNA 5LYJE 4KMCA 4HGAA 3USSA 4H0LC 4PD4E 3VN0A 2XQ7A 5H2FE 2V6YA 2W90A 5AW2B 3SOLA 2NOXA 3NRXA 2BVMA 3BCCG 3FWNA 3RL0D 3S4UA 4B3MT 2Y0DA 2IBZI 3ITKA 5AFUL 4C7RA 2K9YA 1OEDB 2BEZF 2WB5A 4JYAT 3HKCE 1T3JA 1R8EA 2XZEA 3OTOT 2Z6EA 5TISH 4PJJA 2Q7CA 5AQRB 2YU1A 2NTXA 1NTMG 1VQOP 3CX7B 2P7JA 3JCFA 2DNXA 3RYFE 3MGNA 5HXHA 3O6QA 2VKDA 4KT0J 2KB7P 1Y9BA 1RF0A 4ZI3C 3LBXA 2OARA 2VURA 3H32A 5HEOA 5GTHE 2CHOA 1VQ4P 1YQ3A 1JOCA 2L8KA 4CZZB 2DCFA 4GT1A 3SS1A 1SQBE 1ZRTE 1SQVG 2CPSA 4HH2A 1NHLA 4U74A 3H1IJ 3MHVA 5J2TE 4AKGA 1YQ4A 1LGHB 2K9JA 1L0NE 1H88A 4JEUB 5IUXA 4OH8B 1KEYA 4IT4A 1U5PA 1YJ9P 1OXZA 4RJTA 1N33T 1S2EA 3PUAA 3F5HA 3CCVP 2IBZD 4IE0A 1OW7A 1SQPJ 4ZXLA 2XASB 2PBIA 1MFTA 1AV1A 3UU3A 4YT0A 1KQLA 3O4XE 3CXHH 3CCQP 4XAXB 4ISSA 2IUBA 5BVZA 1RF1B 3P4PA 4YSZA 1GU5A 3GHGC 1MMDA 1JMBA 4MFRA 2X9WA 1T2KC 2OQQA 2WMOA 3EABA 2QYWA 4QXCB 3LW5H 2BG9E 3OJAA 4YTNA 3IF8B 3T1YT 1JY3P 4YSXA 2WS3A 3Q5PA 2LM9A 3EDVA 3PUYF 1QSDA 1BGYG 4HFVA 1KILA 3OPCA 5LGNB 4XZCA 1KMIZ 3F57A 1FJKA 4JI1T 4Y99C 4X66T 3OA7A 3PDYA 2X0YA 4DV0T 1M62A 1EDIA 1NWQA 1FZFA 4TV9E 2RMZA 3CQXC 3H1KG 2PGDA 2W6AA 1URQC 2YU2A 1VCSA 3OYXA 5HWXA 2WSSV 3D6ZA 2GM4A 1EZVI 5C8YE 3SWYA 3MIWA 5B66E 3RIFA 3AEGA 3Q5SA 4B86A 2CPTA 2L9QA 1SQQJ 5LCYA 2XY8B 4KHZF 2IYPA 1LTSC 2WPRA 2DL1A 3PJAA 3I5CA 3ZPOA 1NKZB 2D0UA 3GF7A 2AXCA 1MNEA 1GQEA 5KLVE 2VRSA 1DH3A 1BCCD 3L70J 3ZEFB 1SFCC 3IHRA 3C4ZA 4IE5A 2QJPB 5C3JA 2C0XA 2JWDA 2AEFA 4H44C 2POHA 5L8RJ 4MALA 5AQQB 5AW4B 3PJAJ 1N8RQ 3HKEE 3M06A 4RKUJ 2CWOA 1NU1D 4J2CA 4WZXA 1QVGO 3SFDC 4U3FG 3AE3A 3TNUB 4JLEA 3RYHE 3B5NB 1J5ET 4IDQA 3A7MA 3G9RA 2B87A 3WUVA 3NXSA 3KBTA 3UU5A 5J2UE 1CUNA 2ODVA 3A5TA 1EZVG 2XQAA 1AQ5A 3RHWA 1FBMA 4X1IE 2BVLA 1GMJA 4BA9A 4DMVA 4DR3T 1HG2A 3RX6A 3CWBE 2PFVA 2FYUE 5CMZA 5DQVA 2FFDC 3E7KA 1CHUA 4K0UA 4H13C 4IFDK 2BG9C 2W0GA 1FAVA 2YDQA 3ZCIA 1FJGT 2DLRA 1FZAA 2GUVA 3JAFA 1DEEG 3FXEB 2J4GA 1NTKD 1NTKG 3EQ2A 2FJDA 1AJ3A 2NPSA 1VQ9P 2HH7A 3L73J 1NTMK 1L4AC 3L72J 1RE3C 2LJLA 2V5DA 3JSVC 2XUEA 4ILAA 4XFJA 1JNZA 3NZPA 3EWKA 3J7Yq 4B3TT 3RK2C 1ZV8A 2PJQA 5JQGE 3HE4A 3AEDA 5AQGB 1S35A 1FDMA 3HUSB 1KYOI 5L3FB 1IC2A 2H7OA 3C51A 5AQVB 1SQVK 2LR2A 3AEBA 2YINA 3BASA 4ASVA 5ABFB 2ZM2A 3L71D 3II6A 3ZYLA 4U7JA 1PV3A 1SQXG 4PFPA 3ZCJA 3LW5J 2OA5A 1I94T 4GKJT 4L74A 4NXNT 4NPPA 1UUSA 3B5ND 4JPZB 2W61A 3AEEA 2ES0A 3RF1A 2IIUA 4C46A 3TLSA 2VQFT 3RLFF 2K5BB 2KOGA 2BCCJ 3IAOA 3LIDA 1K9MQ 2V6XA 1N86A 4PFOA 3ZMVB 1BR2A 4DZOA 4E7SA 4OX9T 2IPPA 3GF3A 3A5XA 5EZYE 4F8HA 3CK6A 1BE3D 2LOPA 3V2QA 5AQOB 4EYYQ 1EC5A 5BR8T 4AI6A 4WY4A 3C64A 1OZHA 4IDPA 2LRKA 4GK0E 2H7HA 4O4LE 3CCSP 3KXDA 2B9BA 4GYSA 1FZGA 2R6GF 3HD7A 5HXSA 2A2FX 1KYOD 3AEFC 2WMMA 1VQ5P 5AQPB 4BJNA 1NU1E 2RP4A 1LTJC 2C5JA 2XHEB 5FY7A 4U7YA 1G73A 4DO0A 1YD8G 4EGWA 2JMHA 3CMLA 2Q3EA 4H0LB 5CCGD 1L0VA 2CK3H 1WYCA 5FY1A 2EHOA 2HODA 4AKLA 2XAJB 4YY3T 1OWAA 5BU5A 3JAEA 5HCJA 1G1IA 4ANJA 2KNCB 2W2UA 2ZLYA 1L0LK 3O1JA 4NIQA 3AVRA 1Y8AA 4IL6H 5KLIC 2CHNA 3UTKA 2XQ6A 4EZHA 4R4MA 2E5TA 3L74G 4QHOA 2ZM6T 3AECA 1AVOA 3NRYA 2ITAA 2J62A 1JEKA 4UB8H 1LKXA 3LG7A 1Q2NA 4TNVA 3RIUA 3V4WA 1QVFO 3G6EP 5KAFH 5AVWB 5AVRB 5APYA 2W8ZA 3K3NA 1FOSE 3BK9A 2XSAA 5LA6E 1XMOT 2JR8A 2LXBA 3PTZA 2M67A 1VQ7P 3P4QA 4GDOA 3VKHA 1YTZI 3BCCJ 4B3RT 2UU9T 3HTKA 5AQTB 5TAOA 2XAGB 4M3LA 4O2BE 2I1JA 2B89A 3G06A 3I55P 4BRYB 1GD2E 3P8CD 2LKHA 2WWWA 2Z5IA 3TGUD 3WMM0 3IF4A 1GL2A 2X9YA 3ZT7A 5LG3A 1SS1A 1XTCC 4PAGA 5K5GB 4C90A 4DNDA 4H0LD 2XM1A 4QH5A 1NAYA 2K3WA 2QE7H 1ZLLA 2J59M 2K9AA 1PFIA 2XTLA 1NTMJ 1VQPP 5DJUB 2N2NA 2NR4A 4YXDA 2X66A 2JQ9A 3SWFA 5L3CB 3O9XA 3UIAA 2W63A 1HF8A 1Z0PA 3N5LA 4IGUA 5FXXA 2YN6A 3B4SA 4O8SA 1BE3E 2KUBA 4H9SE 4WYVA 3N9LA 3KZIH 2Q3IA 1ZHCA 3L75E 3ZC1A 1SQVJ 5FXVA 3TSIA 4CN6A 2BDEA 3CCMP 1J1JA 3RGUA 4WW0A 3CX5H 2R32A 1VRBA 5LJNA 4Y99B 2P67A 2Q1KA 3T97B 4C91A 4ADZA 3Q2MA 3VMZA 2IX7C 2XNXA 2QJKC 3V5UA 3E22E 1FJPA 1OEDA 2LHNA 3CCJP 5L3DB 1CI6B 1URQB 1KFNA 2WDVA 4PD4I 5LHHB 2OYHA 4AKIA 4BAYB 1XDOA 4I7ZC 2V7MA 2L3LA 2D5UA 2LOSA 3AE1A 2AXTE 3H1HG 1NENA 1K8AQ 3AEAC 4GOFA 2ACZA 3QB5K 3CMEP 3UUBA 3JC6D 2UUCT 2R3CA 1T6AA 4L73A 1VQMP 4TN7B 3QUJA 3EFGA 3IFMA 5BMVE 5AQUB 2WM9A 3VRAA 3SFEA 2QSIA 4QWNB 3RGLA 1T7SA 5DJQC 1BSNA 5AW0B 2KT9A 3ONXA 3RK3E 5AQMB 1USEA 2DI4A 3U78A 1JM0A 4EIJA 3BQLA 3H1JD 2WSEH 1YIJP 1NTZG 1KNZA 3H1KJ 1XMQT 3PUVF 3JCUE 1HF9A 4EOZB 1EDKA 5JR9C 2IYOA 1G1JA 3P50A 1PP9G 1WYBA 3PJSK 4I2LC 5HEJA 3G3ZA 2V7JA 5L3EB 4AQFA 1LTBC 3KFWX 4CI1B 1KK7A 1HTJF 1RF1A 2JJLA 3ABVC 4CI2B 4MBQA 1IFPA 3L4FA 1KTMA 1WRGA 4L0RA 2O01N 2K37A 3AB3B 5CJ4A 2HPCB 1URQD 2OLTA 4HTEA 4ZOLE 2FFDB 2LKMA 2KZIA 4H9PC 4H13B 2BG9B 1EXIA 2NW8A 3KINB 3CCEP 2YO3A 3RQUA 1L4AB 5HAXA 1USDA 1M1JC 1Y01A 1E7PA 2E42A 4U3FJ 1KF6A 1N73A 2IZ1A 2YKPA 2YK0A 3N9QA 5FKYA 1NAFA 4ILUA 2JJ9A 3RK2B 2X0HA 4TWHA 2ZT9D 4X1YE 3RRCA 5IWAT 3EAMA 1SQBD 1ZRTD 1IFMA 5CCGC 1SQBG 3ANWB 2FXMA 1Q82Q 4OYKA 3K3QC 4H9NC 2KSJA 4N78D 1FZCA 2X9XA 1S72P 1SQQE 1X9VA 1RQUA 4UV8B 2ZYDA 3PHLA 3N2GE 4PV1D 1L0ND 2MPKA 2MBGA 1K04A 2UUBT 1Y64B 3N2OA 2KINB 1M1KQ 3CC4P 5CBOA 1MIWA 2VB6A 4EYYR 5KJ7A 3H1LD 1IJ5A 1KQFB 4HFBA 1HNZT 1NTKJ 2OTJP 2V1DB 4IOIH 2JRKA 3AE7A 1SA0E 1FS0E 4NUUA 3V2NA 3ZMSB 2X0LB 5E0OA 3OKQA 2QJYC 4KX6A 3I9WA 3P7KA 3AE6A 3QWOC 2YNYA 3TNUA 3DJBA 1BR4A 5CCHD 4X64T 4NXMT 2J1DG 1JO5A 1YQ3C 1MNDA 5JVDE 5TISE 4OK0A 4YFSA 1Q81Q 3KVBA 2ZXEB 1Q86Q 1YW0A 4L76A 3O1HA 1SVFA 1S3JA 3H1JE 1OVUA 2QGSA 2W00A 4UB6H 4P09A 1SQXJ 3Q3DA 3B5MA 1SE7A 1S1CX 5GTIH 1NO4A 1LTJB 3AE8C 2PRRA 3Q5EA 1Z56A 4A56A 1IZNB 4BWNA 2N1TB 3G71P 3RQWA 3FXEA 4PJNA 2R44A 3TLTA 1VDFA 3NVOA 4L5GA 4NPDA 5APVA 2ACXA 2WSEJ 2V4HA 2XZRA 3KV9A 3I0QA 3L72E 5EFWB 4WBNE 1HFAA 2BKNA 1LTTC 1LP1A 5KLVD 5LGTB 2NTYA 5KLIB 1LJ2A 4OGQD 2D0TA 4O4HE 5L4HA 2NWBA 4LFBT 2VWAA 3HUSA 5ABGA 3MUDC 4HJGH 4PW8A 1K73Q 2H88C 4PJ0E 2KI7B 2C0SA 3CXHE 3D0TA 2WU5A 2KXPB 2W67A 4GODA 1GK4A 4ZNCA 3CKDA 4YTPA 3H6PA 4AQYT 2BASA 3FX0A 1ZOYA 1KB9H 4XE5B 2Q9QD 3LK42 3CPWO 3CVRA 3UUNA 5JDNA 5E79H 3K3OA 2QRXA 4EI2A 2I6HA 3A0BH 3CCUP 1ZP0A 1YKEB 4Z1MH 3PH0A 5HEGA 3AEGC 3CCLP 4N78E 2WZHA 3TF5A 2RH0A 2IDBA 3GN5B 3JC6C 3DP7A 3CWBD 1N2DC 4EEBA 1D0XA 4YSYA 2FYUD 3L3PA 4GK5E 3L74J 2N1TD 3H1LE 2IBZG 4GOEA 3B8EB 1GZLA 4H9RC 2UXNB 4PD4H 3C4XA 2FKWB 5H2FH 1U7MA 5AW8B 4U2YA 2ZM0A 1AVYA 1KORA 2XKMA 3LK2B 4HWHA 1S5LH 1RQVA 3KV5A 1N7SA 5KKZC 3UUXB 3MJXA 4WBAA 4JBWF 3ZT5A 3FBZA 5CA0E 5CA1E 1PIXA 3L8RA 5M4YA 1NOHA 1H0TA 2WDRA 3HKDE 2P58A 2KNCA 2JWAA 5DABA 2QJKB 5IYZE 4HE8A 2KP8A 1W9RA 1X79B 1TU3F 3A7OA 1ZKEA 2A72A 4HFDA 4DV1T 5GTHH 4PK4A 1QL1A 2BBJA 1N34T 3FZKB 3A0HH 4I7ZB 3VMAA 1ZR4A 4P1NA 2ZVOB 3IN6A 4O9BA 4LF4T 3S9OA 3P7IA 4PK5A 2PG8A 3D6YA 4Z91A 3V6IA 3PU3A 3PUXF 1N32T 1W2BO 2IFMA 1A02F 1FIOA 4JI0T 5H6QB 5AQLB 2D2SA 4IE6A 4LFAT 4DBRA 2O1JA 4IDZA 4LMJA 5FXWA 1DX7A 3AA7B 1M7KA 2GUSA 1BCCG 2WMNA 2K24A 5JDFA 1R8IA 1FDOA 4YHJA 5JTGA 2ZMAA 3FBLA 5HXCA 2ZT9C 3AA0B 3K1SA 4DIDB 4EZ4A 3BCCE 1JTHB 3HI2A 3PTRB 1L0LD 1X8YA 4PV1C 3DTOA 5JR9B 1NU1G 5HXEA 2MAWA 2WT7B 4IREA 3G4SP 5ETWA 1M7LA 5APUA 3H1HJ 2XNDH 1S9KD 4UELA 3SSUA 3UUMA 1NTME 3OW2O 3V2PA 2V26A 3VMXA 1LT9A 3GHGA 2V7LA 4Z8XA 5JDMA 1D1AA 4JI7T 2KK7A 3IR9A 3P4RA 3N4XA 2YOEA 2YO2A 3OAKA 2XPKA 3V5SA 5JDGA 2HG5D 3LFMA 4A97A 1YITP 5GONE 3P4SA 1U7JA 1HBWA 5APSA 5CCHC 2LSYA 4AIUA 2NW7A 2JO1A 1IK7A 1SQVE 1GW4A 5AW9B 4TT3H 1H89A 4LC1A 3T97A 1NTZJ 1M1JB 4ERRA 3UU6A 3AE9C 4YJ2E 4D6TD 2JMKA 1MMNA 4HWIB 1PP9J 2KZJA 1CI6A 1PL5A 5EK3A 4EIWA 2KLVA 3UFGA 3A2AA 2OYIB 3RI5A 1PPJD 2RA1A 4TUYE 4DR6T 3FB2A 2KS1B 2QA7A 2E9XA 4EXTA 3M65A 2N9YB 3UFEA 3EUHA 5EK2A 5ABHA 1H8AA 1EDLA 1KZUB 4AQRD 4DR2T 3BRTB 2JEEA 2XDJA 4UV9B 1YI2P 2AEMA 3KV6A 2BZBA 3KYQA 1NWMX 4HYTB 4DV3T 3L71G 4I4TE 4A98A 1SFCA 3QNUA 4AUWA 2X67A 3EHZA 3UQ4A 2CM0A 3RC3A 5JREA 3H3MA 3ZJ2A 1LTAC 4AQGA 2E8IA 4OGQC 5B5EH 4KUMB 1IFNA 3RK3B 1BGYE 1FDIA 2QIWA 3HRNA 3S4RA 1LWUC 4RESB 5JRCB 2QJYB 3SFDA 3V5BA 1XTGB 3O6QB 1D0YA 3I1AA 5HEUA 4JEHB 3H1KE 2V8SV 1KQSO 3LBXB 3MZKB 2WWVA 1BE3G 1HUCA 3HL6A 1L2PA 4IL6E 5AVSB 2Q9QC 3L75D 2LEHA 2FJEA 2KNDA 1SQBJ 2L91A 2BEQD 5KAIH 3I9YA 1FMVA 3AE4C 3AXJA 1GK6A 2XQ3A 2G3AA 3N2KE 3L09A 1IJDB 2LT3A 1L0LE 4FI5A 4KHXA 4HFIA 2HPCA 2K9JB 2Y9ZA 2FFDA 1D1BA 2D9DA 1XZYA 2LSKA 2YKSA 4PJMA 1QGKB 2BG9A 1VF5D 3RH3A 1NJIQ 2N1TC 1YJWP 1S9KE 4H9OC 1I6ZA 2IDOB 1IBLT 1L4AA 1RE3A 4K3AA 5APTA 5KMGP 4DOJA 4LGDE 2YKOA 5CJ5A 2CCQA 5LBQB 1W2EA 2ZFCA 4U3FE 2Y6XA 3PE0A 1CW5A 2MYSA 3J9X1 3WI3A 3LK3B 3MP7B 4DV4T 4JBZA 3OJAB 5ADXL 3RK3D 3ANWA 3CL3D 1KC8Q 2Q5UA 3Q5RA 2K3RA 1XWMA 3L36A 3ZMZB 3GG2A 2E75D 3WUUA 3LDQB 1OW8A 2Z5HA 3H1ID 2H89C 3PURA 1XNRT 3CX8B 4EEDA 4D6TE 3AA1B 4YPCA 1OFCX 1P84D 3ETUA 1Q7YQ 4X62T 1FZBA 1EQ7A 1PPJE 1T8ZA 2MTQA 1SQPD 1V9DA 4IL6X 2OYHC 3CIRA 4QH1A 4LFCT 2W27A 2F4VT 3FZLB 4UF0B 4HKZH 4EAHA 5CBNA 2W66A 3CX5E 4DV5T 4WB4A 2VASA 2LXCB 5AW1B 2WSSH 3RKOA 3WAJA 3TGUG 5JDHA 4OWFA 3R2PA 2WSCJ 2W62A 1HVVA 1BSHA 2ZYAA 4ZHQE 3M3ZB 4UVCB 3VRBA 4DR7T 2UXBT 1US7B 3ZT6A 3AEFA 1HNWT 1BR1A 1NTKK 3TYYA 1MUUA 4AYCA 4TWFA 1IK9A 2I59A 4AISA 2XQ8A 5KKZB 1T72A 4KJMA 3UT5E 3C8VA 5HWYA 3IEEA 4LMKA 2FYZA 2KIKA 3B71A 5LGUB 3I56P 4FJOA 4X65T 4LF6T 5KTBA 3PUZF 1SQQD 1JCDA 3MTUE 5AQSB 1KILD 3IA3A 3BVHA 3FZMB 1GTWA 3EI0A 5CFBA 4DUZT 3AAIA 1KNPA 2K88A 2CBIA 2ZVNB 4ZKUA 2XQ5A 3ZYKA 4Z90A 4W80A 3VR8A 3R6NA 1SQXK 2Q9IA 3TLVA 3PUWF 5LG4A 1OVRA 4DV6T 2CWYA 2FBWC 3W67A 3FGAD 4CXXA 2KSEA 3AE5C 5AQHB 4MHCA 3M0DC 1HR0T 3RBXA 4JI4T 1RE4C 5APWA 4MN4C 1E79H 1N73C 1WFDA 5AQJB 3ZJ1A 2B88A 2OV9A 3NBXX 4AXPA 5M1BA 4B6XA 2G8YA 4QX8B 3CXHI 3R4YA 2ZT9B 2WQYA 2YDRA 3HE5B 1DD4A 1BDCA 3GN5A 3H1JG 3H1IE 4PV1B 1HJ0A 2N9BA 2VL0A 4UEMA 1WCRA 2LKGA 1YHQP 1P84E 5LB7B 1G8XA 3VP9A 2IC9A 3VMYA 2WDQA 4NPEA 3CD6P 2FYNC 1SQPE 5BU8B 2HFED 5LHGB 4WNKA 4DUYT 2QM8A 3PUGA 1LRZA 5CHXA 2PP6A 1KYOH 3L73D 1YKHB 4HEAA 2V7QH 2IMLA 3L72D 1IAPA 1OIPA 2E74C 4EOTA 2FJBA 2HHHT 1BCCJ 3F2EA 1VQNP 2CXLA 3RYCE 3JADA 4YXWH 2AXTH 2LHRA 4YJ3E 4YTMA 2M5AB 3PUSA 2WZ7A 3CXHD 4K0KT 1DEBA 2H8PD 2J58A 2NPSD 2XM2A 1BDDA 3KDPB 3WAKA 4I50E 4G2AA 1NU1J 2D2CC 3UQ7A 1X79A 4LF7T 3AE2C 5EK4A 1UX5A 1WR6A 3F89A 5AQFB 2OYIC 2E43A 4DR5T 1ZW0A 2I0MA 1MFZA 3P4WA 1VF5C 3UULA 1T98A 3MKDA 3AEAA 4V1Av 2CBJA 4ZS3A 2XQ4A 2ZXXA 3D70A 2YIUB 2FJAA 2WPSA 1NEKA 3TLWA 2BCCD 2AEJA 1KILE 3U59A 1L0NG 2JKVA 3H37A 4P0BA 2VKJA 4UB6E 4ZMDA 4E7ZA 1CSBA 5GTIE 1H7CA 1S4XA 4WVZA 1A02J 3R84B 3H1LG 3Q5XA 3L70E 4EYUA 4OGQB 5F3JA 2XQ9A 5AQNB 2XJ7A 3RK3C 2OGUA 1JTHA 1LWUB 3RIAA 3PUQA 2E75C 4DVDA 4YTPC 4CN1A 1XNQT 2WT7A 2WWUA 2PAJA 2I8DA 2HPJA 1KFMA 1HX8A 1RF0C 2BKOA 2Q9QB 3FZHB 1PGQA 5FL1A 3B5NA 2R3SA 4WY4D 1WMKA 2VK9A 3CC2P 5AQIB 1M56D 3H1HE 3OYZA 2FY8A 3ABVA 2FXOA 4KI0F 3HD7D 2JIWA 5L2LA 2JP3A 2W6JH 1AFOA 2CPBA 3L71J 5CB4E 1S94A 1YQ4C 1J1EC 5AQKB 1KB9E 4C7NB 3NWIA 2M0BA 2QVAA 2C9NY 4DR4T 2RKLA 2EHOD 2L5GB 1Q90D 1M1JA 4B3ST 3GA8A 1JY2N 4ZS2A 2VQET 4COFA 4L75A 3L73E 4DCKA 1Z8UA 2C0WA 3N9MA 2W83C 4JI2T 2MKVA 2AE9A 1BE3J 3KHUA 3HR0A 1HNXT 1PP9E 5KLVG 2KS1A 3WU2H 4X20E 5CCGA 1FZEA 1X9BA 3VHLA 4Y28J 5L47A 2M3EA 2HN2A 4OHFA 3ONLC 3BCCD 3CQCB 2WVRA 3V2RA 5ABFA 2XAHB 2V7QJ 2WAUA 5FVKA 3Q9DA 3EFFK 1KILC 2HR3A 2W4XA 5APQA 2JQQA 1KV4A 4XBFB 1S5LE 3P32A 1NTZK 5HEHA 2A9UA 4QXHB 3ZN1B 1MMGA 4YLHA 3BQKA 2N9DA 1WRDA 2QA4P 2OYHB 2LE8A 2ODUA 3CQGB 2YMKA 4CQIA 1NTMD 2ZM8A 4I0UA 4P0AA 2O01H 2IW5B 2G0UA 2K48A 5JRCA 4X5TA 4WBOA 2WBLA 1X0TA 2BCCE 3W68A 3N9NA 2QG4A 4TNWA 2BS2A 3L35A 5FXZA 1CZQA 2YMYA 4HWDA 3CWBG 1GL2D 1QL2A 2RN0A 2LSGA 2FYUG 3U3IA 2H7VC 4ZZBA 3A0HE 3CWZB 2E76C 1RY3A 1SQVD 1LNQA 1QLED 1E2AA 3CCRP 1IJ6A 5KDMC 1UIIA 1SP4A 1EZ3A 2AXDS 4ILBA 3FHNA 2P1JA 3AE8A 4QXBB 1PGOA 3O8ZA 4IFFA 1K05A 1ZV4X 4DV2T 4W7YA 1EDJA 2HLOA 2JDIH 3VTPC 3AE3C 4IIJE 4A5XA 1DU2A 1HJBA 3V4QA 1WLXA 4X1KE 1KD1Q 4ZEYA 4PJ0H 2UWJE 1RH5B 3VP8A 3TK1A 3H3AA 2LM2A 1SQBK 2O1KA 3PRJA 3JC22 2X9HA 1LT9C 1JY2O 1RHZB 3TGUJ 2A45I 4JUYA 3OBVE 5H6RB 3GWHA 2LSIA 1L0NK 4HFCA 3VU7H 2X68A 3E1IA 1S5LX 3C9IA 3L39A 2I1KA 3TKLB 3CC7P 4LMLA 2PFXA 5LBMA 4Q25A 2A06E 3MUDA 1N36T 2H88A 4IHJE 2YXRB 1FU1A 4U2ZA 2M8RA 1BGYD 3KQGA 3RRWA 4QMAA 4LF5T 3BATA 3ZYMA 2NPSC 3M9HA 4JV5T 1YYCA 3ONJA 2WTYA 3H1KD 1G2CB 1N73B 4O4JE 3FXDB 5CGMA 2MJZA 2DWGA 2CEAA 4YHHT 3BQIA 5AVVB 3MZWB 4UF0A 1FOSF 2E9XC 1U57A 1M90Q 1JNMA 1ZEEA 1BR0A 5DQWA 3AEDC 3GW6A 3KPEA 4N3YB 2ZAEB 3AAEB 1FZCB 4BRYA 4TV8E 1IBKT 2J5UA 4JI8T 3AEBC 1L0LG 3NTNA 1IO4A 1JCCA 2KMFA 1SHZC 1JUNA 4IE4A 4K35A 4UXNB 1VQKP 1R5LA 5J1GA 2A45G 3LSVA 5IHYA 2FYNB 1MIYA 4AKHA 3ESLA 3AEEC 3KV4A 5HYAA 3CX5I 1IFIA 2XV5A 2KLUA 3QH9A 3NFQA 3T1HT 1LVFA 2RPAA 3VKGA 1LTIC 1NVOA 2XQYA 4DMWA 2YXQB 3CI9A 1J1DC 2M3BA 2M6IA 2Q6QA 2E74B 1LTGC 4U3FD 5AVUB 1R5SA 1OW6A 1X22A 4ILCA 3RBZA 4LF8T 5KLVK 5B66H 5J0ZA 4WY4C 2SPZA 2OTLP 5B5EE 1DIPA 2C5KT 1EZVD 2O01J 2YEVC 3H1JJ 3SRZA 5HCMA 2WSFH 3QC9A 5LMNT 2D2CB 3Q1MA 3HD7C 2NRGA 4D6TG 1YBKA 1M57D 3GLMA 4ZI2D 3AVSA 1URQA 5LJMA 1IFJA 5FVLA 3B13A 3RKGA 5LNKA 1PPJG 2IBZE 2KSRA 2JQKA 1VF5B 4OYJA 2WSCH 1YJNP 5KAIE 3PP5A 3E0ZA 1YXRA 2GK9A 1PGJA 2V5CA 3KBUA 2YIUC 2EHOC 2V6YB 3CX5D 4GOUA 2ZJSE 3IBPA 2KYVA 3M9QA 3CMAP 3ZMUB 1AQTA 1OEDE 5AW7B 1PZQA 5FMNA 2E5YA 1LP1B 5KJ7D 1QX8A 4HN9A 5LXTE 1VCTA 2FYUK 2WY2A 2UXCT 1UGOA 3HE5A 3C4WA 3MD0A 3AECC 2UXXB 4IL4A 3ZSTA 1FE6A 4UIGA 4DR1T 4GKKT 2E75B 1GW3A 2DW3A 5HXRA 3RIUC 4TWDA 3Q5WA 4CN4A 5AVYB 2E74D 3RL0C 2CXFA 4R4LA 1SQXD 3ZLIA 3MXZA 3AA6B 1LT1A 2KZ7B 3UU4A 1T8BA 2K1AA 1JB0J 2B1EA 3H32B 4JF7A 2BKPA 1VPCA 2Z4EA 2C5IT 3L75G 4PJLA 4DT0A 2CLYC 5AW6B 1MIVA 3EDUA 1ZMEC 1D0ZA 2IZ0A 1EXJA 1U4QA 2YKQA 3NZQA 3ZMTB 4JQ0D 4IFMA 4UB8E 1VQ6P 1L0NJ 2D2CD 1JY3N 2YDSA 5AVZB 1P84I 1O3XA 4F6RC 4JYBA 1WT6A 2E2AA 5KAFE 1J1EB 3E1RA 3H1LJ 4O2AE 5CCHA 4H9QC 3VOPA 1GL2C 2O3JA 1BCCE 4HKAA 2Y9YA 3U1CA 2M5AA 4U72A 2IAKA 5L3BB 1FMWA 2KLQA 3P8MC 5LHIB 4BJMA 5C39A 3AE9A 4NPFX 1JMMA 1Y47A 2JPFA 1D7MA 3N7NA 4YXDC 1HGVA 3D71A 1W0BA 4H63V 1LVKA 3UU8A 1N7SB 3H25A 2FUPA 1MKMA 5KX5E 4WWIA 2X51A 1NGMB 3GMIA 4U3CA 5JDQA 4MLKA 3A3YB 3AAAB 2A3DA 1EZVE 2BBHA 2LLYA 1H0TB 4TLFA 1KILB 3H1IG 3OVUA 1MZ9A 1UCUA 2PTFA 3NKZA 3O1IA 4W7ZA 3FWLA 4DJGA 3N9PA 2CA5A 4HFEA 2QM7A 1OEDC 1NU1K 4JYCA 3L74D 5FY0A 2N1GA 1J2JB 3KZIE 3E08A 1B7TA 1SQPG 4IE7A 3RC8A 1DD3A 4M1PA 1NTKE 3PLNA 1LWUA 2WSFJ 3AE1C 2P9BA 5A1LA 3KVAA 5LP6E 2VKOA 2SPCA 4JI5T 5KLVJ 2HPLA 4EDFA 1HH0A 2A45H 2Q9QA 3ETVA 3CLQA 3C98B 3PV0F 2E76B 3AE4A 1HCIA 3SFEC 3ZDMA 1JNRA 4QH4A 3RL0g 2OTKE 2WQYC 2R5DA 4JI6T 2XU6A 4QKNA 4CPGA 1PGPA 2DHRA 3HKBE 1JY3O 2B76A 4IL9A 4TX5A 1LTJA 1KQGB 3L71E 4C7NA 4CXYA 1SQXE 1VQLP 1N7SD 2CE7A 2WU2A 3T8OA 2N1TA 3RYIE 4OVNF 1HX1B 4EB6E 3CPZA 2LSJA 4A7PA 3X1DA 3ZKRA 5JH7E 2JQHA 2XAQB 2B87B 4AQFC 4GIWA 1SQQG 4ISTA 4UR9A 4BXLA 1KB9I 2BS4A 1LT9B 3GHGB 3TLUA 1RF1C 4U33A 3CWBJ 3S1KA 3N9OA 2FYUJ 2VL8A 1E5WA 2Y0EA 1NYHA 2IC6A 2LRLA 5AW5B 3BRVB 4U31A 3L70D 1YTZT 3L70G 2Y8DA 1N7LA 3LIEA 1E1HB 2H89A 4ZI7E 2NPSB 2CMRA 4I43B 1KYOE 4I55E 4GYRA 4ZI3D 2VVNA 2DWKA 3LJCA 5JDLA 3L37A 1FC2C 4ZI2C 2OYOA 3F31A 2BS3A 4ASKA 2E76D 2Y0CA 2KWIB 2V7IA 1JY2P 4RO0A 1NH4A 2ZYGA 2H3RA 3H1HD 3QOFA 2E9XB 2W6BA 2WPQA 3SWKA 2V7KA 3HE4B 1KNRA 3MACA 2WPVB 3WUTA 1FZCC 1QUUA 4L9IA 1OMIA 3FZFB 1KB9D 1ZN5A 2IFNA 2WITA 3Q5DA 3PU8A 2J47A 1SFCB 5FL0A 3C50A 1XDPA 2CRBA 5KJ7C 2IHR1 3L74E 2Y48B 2QJPC 1BGYJ 1UURA 4G63A 4H44B 5KXJA 1QEXA 5APXA 2VKHA 4HWFA 3AE7C 1NKNA 1NTZD
chains in the Genus database with same CATH topology
3KDSE 1T2KD 2CXDA 1ZR2A 1J1DB 5AVQB 3I0OA 5L3GB 3EVYA 4WY4B 3B5NC 5AW3B 5LOVE 1FEWA 4O4IE 1HG5A 3MA9A 3K8PC 5F8PA 4PK6A 1IFDA 3QK6A 4I6MC 4ZKPA 3HD7B 4XA4A 3ZC0A 3P8CE 3NMDA 2NW9A 2R5BA 5CJ0A 3M91A 1SLQA 4DBQA 4I1LA 2E9XD 5FNVE 3M0DA 4UVAB 3RPUA 4CXWA 1SQPK 1HWTC 2EHOB 2KWHA 2HODB 1RE4A 1GDTA 1T3UA 1G2CA 5FP3A 3MK7C 1SFCD 4OFZA 5FYMA 1MMAA 3W15B 4N6JA 1HTLC 3HUSC 4H63H 2NP9A 4AKRB 4PNIA 3RL0B 4KBMB 5JR9A 1MV8A 5AVTB 4UVBB 2P2UA 4CI3B 1HGZA 4KP3C 2CLYB 4NUVA 4QX7B 5AVXB 2H43A 1HS7A 3HTKB 1VOMA 1SQQK 3M9BA 4GKGA 3SWHA 3VYIA 1GL2B 1GU4A 3M0AA 2HYNA 4LLHA 3U1AA 1UX4A 1D1CA 4GIFA 1L4AD 2C9LY 3B57A 2MOZA 3ZN0B 4TZ4C 2OYIA 3CX6B 3HA4A 3RK2D 1N7SC 2XAFB 5LYJE 4KMCA 4HGAA 3VN0A 5AW2B 3SOLA 2NOXA 3NRXA 2BVMA 3RL0D 3S4UA 5AFUL 4C7RA 3HKCE 1T3JA 2Z6EA 4PJJA 2Q7CA 2YU1A 2NTXA 3CX7B 2P7JA 2DNXA 3RYFE 3MGNA 5HXHA 2VKDA 2KB7P 1RF0A 4ZI3C 3LBXA 2OARA 3H32A 1JOCA 2L8KA 4CZZB 2DCFA 4GT1A 3SS1A 2CPSA 4HH2A 1NHLA 4U74A 5J2TE 4AKGA 1LGHB 1H88A 4JEUB 4OH8B 1U5PA 1OXZA 3PUAA 4IE0A 2XASB 2PBIA 1KQLA 3O4XE 4XAXB 4ISSA 5BVZA 1RF1B 1GU5A 3GHGC 1MMDA 4MFRA 2X9WA 1T2KC 2WMOA 4QXCB 3LW5H 3OJAA 3IF8B 1JY3P 2LM9A 3EDVA 1QSDA 4HFVA 1KILA 5LGNB 4XZCA 3F57A 1FJKA 4Y99C 3OA7A 3PDYA 1NWQA 1FZFA 4TV9E 3CQXC 2W6AA 1URQC 2YU2A 3OYXA 5HWXA 2WSSV 2GM4A 5C8YE 3SWYA 3MIWA 4B86A 2L9QA 5LCYA 1LTSC 2WPRA 3ZPOA 3I5CA 1NKZB 2D0UA 1MNEA 2VRSA 1DH3A 3ZEFB 1SFCC 3IHRA 3C4ZA 4IE5A 2C0XA 2POHA 4MALA 5AW4B 3HKEE 3M06A 2CWOA 4J2CA 3TNUB 4JLEA 3RYHE 3B5NB 3KBTA 3NXSA 5J2UE 1CUNA 2ODVA 3A5TA 1AQ5A 1FBMA 4X1IE 2BVLA 4BA9A 4DMVA 1HG2A 3RX6A 2PFVA 5CMZA 5DQVA 2FFDC 4K0UA 2W0GA 4IFDK 3ZCIA 1FAVA 2DLRA 1FZAA 2GUVA 3FXEB 3EQ2A 1AJ3A 2NPSA 2HH7A 1NTMK 1L4AC 1RE3C 2LJLA 2XUEA 3NZPA 3J7Yq 3RK2C 1ZV8A 2PJQA 5JQGE 3HE4A 1S35A 1FDMA 3HUSB 5L3FB 1IC2A 2H7OA 3C51A 1SQVK 2YINA 3BASA 2ZM2A 3II6A 3ZYLA 3ZCJA 4PFPA 2OA5A 3B5ND 2W61A 2ES0A 4C46A 2K5BB 2KOGA 3LIDA 4PFOA 1N86A 3ZMVB 1BR2A 4DZOA 4E7SA 2IPPA 3A5XA 5EZYE 2LOPA 3V2QA 4AI6A 4WY4A 3C64A 4GK0E 2H7HA 4O4LE 4GYSA 1FZGA 3HD7A 5HXSA 2A2FX 4BJNA 2RP4A 1LTJC 2C5JA 2XHEB 5FY7A 1G73A 4DO0A 1YD8G 2JMHA 3CMLA 5CCGD 1WYCA 5FY1A 2EHOA 2HODA 4AKLA 2XAJB 1OWAA 5BU5A 1G1IA 4ANJA 2ZLYA 1L0LK 3O1JA 3AVRA 3UTKA 4EZHA 4QHOA 3NRYA 1LKXA 3LG7A 3V4WA 5AVWB 5AVRB 5APYA 3K3NA 1FOSE 3BK9A 5LA6E 2M67A 3VKHA 1YTZI 3HTKA 5TAOA 2XAGB 4M3LA 4O2BE 2I1JA 1GD2E 3P8CD 2WWWA 2Z5IA 3WMM0 1GL2A 2X9YA 1XTCC 4PAGA 4C90A 4DNDA 1ZLLA 2J59M 2K9AA 1PFIA 2XTLA 2N2NA 2X66A 3SWFA 5L3CB 3O9XA 3UIAA 2W63A 1HF8A 1Z0PA 3N5LA 4IGUA 5FXXA 4O8SA 4H9SE 3N9LA 2Q3IA 1ZHCA 3ZC1A 5FXVA 3TSIA 2BDEA 4WW0A 2R32A 1VRBA 5LJNA 4Y99B 2P67A 4C91A 4ADZA 3Q2MA 3VMZA 2IX7C 2XNXA 3V5UA 3E22E 1FJPA 2LHNA 5L3DB 1CI6B 1URQB 1KFNA 5LHHB 2OYHA 4AKIA 4BAYB 2V7MA 2L3LA 2D5UA 2LOSA 3JC6D 2R3CA 4TN7B 3QUJA 3EFGA 3IFMA 5BMVE 2WM9A 4QWNB 5DJQC 5AW0B 2KT9A 3ONXA 2DI4A 3U78A 4EIJA 3BQLA 2WSEH 1KNZA 4EOZB 5JR9C 1G1JA 1WYBA 4I2LC 3G3ZA 2V7JA 5L3EB 4AQFA 1LTBC 3KFWX 4CI1B 1KK7A 1HTJF 1RF1A 2JJLA 4CI2B 4MBQA 3L4FA 1WRGA 4L0RA 3AB3B 5CJ4A 2HPCB 1URQD 4HTEA 4ZOLE 2FFDB 2LKMA 4H9PC 2NW8A 3KINB 2YO3A 1L4AB 5HAXA 1M1JC 2E42A 1N73A 2YKPA 2YK0A 3N9QA 1NAFA 4ILUA 2JJ9A 3RK2B 4X1YE 3RRCA 1IFMA 5CCGC 3ANWB 2FXMA 4OYKA 3K3QC 4H9NC 2KSJA 4N78D 1FZCA 2X9XA 1X9VA 4UV8B 3N2GE 2MBGA 1Y64B 3N2OA 2KINB 1MIWA 2VB6A 4EYYR 5KJ7A 1IJ5A 2V1DB 2JRKA 1SA0E 4NUUA 3V2NA 3ZMSB 2X0LB 5E0OA 3OKQA 3I9WA 3P7KA 2YNYA 3TNUA 3DJBA 1BR4A 5CCHD 2J1DG 1JO5A 1MNDA 5JVDE 4OK0A 4YFSA 3KVBA 2ZXEB 1YW0A 3O1HA 1SVFA 2QGSA 2W00A 4P09A 1NO4A 1LTJB 1Z56A 4A56A 1IZNB 2N1TB 4PJNA 1VDFA 4L5GA 5APVA 2ACXA 2XZRA 3KV9A 3I0QA 4WBNE 1HFAA 1LTTC 5LGTB 2NTYA 4O4HE 2D0TA 2NWBA 2VWAA 3HUSA 4PW8A 2C0SA 3D0TA 2KXPB 1GK4A 3CKDA 3H6PA 2BASA 4XE5B 2Q9QD 3LK42 3CVRA 3UUNA 5JDNA 3K3OA 1YKEB 4N78E 3GN5B 3JC6C 3DP7A 1N2DC 1D0XA 3L3PA 4GK5E 2N1TD 3B8EB 1GZLA 4H9RC 2UXNB 3C4XA 2FKWB 5AW8B 2ZM0A 2XKMA 3LK2B 3KV5A 1N7SA 3UUXB 3MJXA 4WBAA 3FBZA 5CA0E 5CA1E 5M4YA 1NOHA 3HKDE 5DABA 5IYZE 4HE8A 2KP8A 1ZKEA 1X79B 3A7OA 2A72A 4PK4A 1QL1A 1ZR4A 4O9BA 3P7IA 4PK5A 2PG8A 3PU3A 2IFMA 1A02F 1FIOA 5H6QB 2D2SA 4IE6A 4DBRA 2O1JA 4IDZA 5FXWA 1DX7A 3AA7B 2GUSA 2WMNA 2K24A 5JDFA 4YHJA 2ZMAA 3FBLA 5HXCA 3AA0B 4EZ4A 1JTHB 3HI2A 3PTRB 1X8YA 3DTOA 5JR9B 5HXEA 2WT7B 5ETWA 1M7LA 5APUA 1S9KD 4UELA 3UUMA 3V2PA 2V26A 3VMXA 1LT9A 3GHGA 2V7LA 4Z8XA 5JDMA 1D1AA 3IR9A 3N4XA 2YO2A 3OAKA 3V5SA 5JDGA 2HG5D 3LFMA 5GONE 1HBWA 5APSA 5CCHC 2LSYA 2NW7A 1GW4A 5AW9B 1H89A 4LC1A 3T97A 1M1JB 4ERRA 4YJ2E 2JMKA 1MMNA 1CI6A 5EK3A 4EIWA 2KLVA 3A2AA 2OYIB 2RA1A 4TUYE 3FB2A 2QA7A 2E9XA 4EXTA 3M65A 3UFEA 3EUHA 5EK2A 1H8AA 1KZUB 4AQRD 3BRTB 2JEEA 2XDJA 4UV9B 3KV6A 2BZBA 3KYQA 1NWMX 4HYTB 4I4TE 1SFCA 4AUWA 2X67A 2CM0A 3RC3A 5JREA 3ZJ2A 1LTAC 4AQGA 2E8IA 4KUMB 1IFNA 3RK3B 3HRNA 1LWUC 4RESB 5JRCB 3V5BA 1XTGB 1D0YA 3I1AA 4JEHB 3LBXB 3MZKB 1HUCA 3HL6A 2Q9QC 5AVSB 2LEHA 2KNDA 3I9YA 1FMVA 1GK6A 3N2KE 3L09A 1IJDB 2LT3A 4FI5A 4KHXA 2HPCA 2FFDA 1D1BA 4PJMA 2LSKA 3RH3A 2N1TC 1S9KE 4H9OC 1L4AA 1RE3A 5APTA 5KMGP 4DOJA 4LGDE 2YKOA 2CCQA 5LBQB 1W2EA 2ZFCA 2Y6XA 3PE0A 1CW5A 2MYSA 3J9X1 3WI3A 3LK3B 3OJAB 5ADXL 3RK3D 3ANWA 3CL3D 2Q5UA 3L36A 3ZMZB 2Z5HA 3PURA 3CX8B 3AA1B 3ETUA 1FZBA 1EQ7A 1T8ZA 2MTQA 1V9DA 2OYHC 2W27A 4UF0B 4EAHA 4WB4A 2VASA 5AW1B 3RKOA 3WAJA 5JDHA 3R2PA 2W62A 1HVVA 4ZHQE 4UVCB 1US7B 1BR1A 1NTKK 3TYYA 1MUUA 4AYCA 1IK9A 2I59A 3UT5E 3IEEA 2FYZA 5LGUB 4FJOA 5KTBA 1JCDA 3MTUE 1KILD 3BVHA 1GTWA 3AAIA 4ZKUA 3ZYKA 4W80A 3R6NA 1SQXK 2Q9IA 5LG4A 2CWYA 4CXXA 4MHCA 3M0DC 1RE4C 5APWA 1N73C 3ZJ1A 3NBXX 4AXPA 4B6XA 4QX8B 3HE5B 3GN5A 2N9BA 4UEMA 1G8XA 3VP9A 2IC9A 3VMYA 5BU8B 2HFED 5LHGB 4WNKA 2QM8A 3PUGA 1LRZA 5CHXA 2PP6A 1YKHB 4HEAA 1IAPA 4EOTA 3F2EA 2CXLA 3RYCE 2LHRA 4YJ3E 3PUSA 2WZ7A 1DEBA 2H8PD 2J58A 2NPSD 3KDPB 3WAKA 4I50E 4G2AA 1X79A 5EK4A 1UX5A 1WR6A 2OYIC 2E43A 1MFZA 3UULA 1T98A 3MKDA 4V1Av 4ZS3A 2WPSA 3U59A 3H37A 4P0BA 2VKJA 4E7ZA 1CSBA 1H7CA 1A02J 3R84B 3Q5XA 4EYUA 5F3JA 3RK3C 1JTHA 1LWUB 3PUQA 4DVDA 2WT7A 2WWUA 2PAJA 2HPJA 1KFMA 1HX8A 1RF0C 2Q9QB 3B5NA 4WY4D 2VK9A 3OYZA 3HD7D 5L2LA 1AFOA 2CPBA 5CB4E 1S94A 1J1EC 4C7NB 2C9NY 2EHOD 2L5GB 1M1JA 3GA8A 1JY2N 4ZS2A 2C0WA 3N9MA 3HR0A 4X20E 5CCGA 1FZEA 3VHLA 4OHFA 3CQCB 3V2RA 2XAHB 2WAUA 3Q9DA 1KILC 5APQA 2JQQA 4XBFB 3P32A 1NTZK 4QXHB 3ZN1B 1MMGA 4YLHA 3BQKA 2N9DA 1WRDA 2OYHB 2LE8A 2ODUA 3CQGB 4CQIA 2ZM8A 4P0AA 2O01H 2IW5B 2G0UA 2K48A 5JRCA 4WBOA 2WBLA 3N9NA 3L35A 5FXZA 1CZQA 2YMYA 1GL2D 1QL2A 2LSGA 3U3IA 2H7VC 3CWZB 1RY3A 1IJ6A 5KDMC 1SP4A 1EZ3A 3FHNA 2P1JA 4QXBB 3O8ZA 4IFFA 1ZV4X 4W7YA 2HLOA 3VTPC 4IIJE 1HJBA 3V4QA 1WLXA 4X1KE 3VP8A 3TK1A 3H3AA 1SQBK 2O1KA 2X9HA 1LT9C 1JY2O 2A45I 4JUYA 3OBVE 5H6RB 3GWHA 2LSIA 1L0NK 3VU7H 2X68A 3E1IA 3C9IA 2I1KA 3TKLB 5LBMA 3MUDA 4IHJE 1FU1A 2M8RA 3KQGA 3RRWA 3BATA 3ZYMA 2NPSC 3M9HA 1YYCA 2WTYA 1G2CB 1N73B 4O4JE 3FXDB 2MJZA 2DWGA 2CEAA 3BQIA 5AVVB 4UF0A 1FOSF 2E9XC 1ZEEA 1JNMA 1BR0A 5DQWA 3KPEA 4N3YB 3AAEB 1FZCB 4TV8E 3NTNA 1IO4A 1JCCA 2KMFA 1SHZC 1JUNA 4IE4A 4UXNB 5J1GA 2A45G 5IHYA 1MIYA 4AKHA 3ESLA 3KV4A 5HYAA 1IFIA 2XV5A 3NFQA 1LVFA 3VKGA 1LTIC 2XQYA 4DMWA 3CI9A 1J1DC 2M3BA 5AVUB 1LTGC 5KLVK 4WY4C 2C5KT 2YEVC 3SRZA 2WSFH 3QC9A 3HD7C 4ZI2D 3AVSA 1URQA 5LJMA 1IFJA 3B13A 5LNKA 4OYJA 2WSCH 3PP5A 3E0ZA 2GK9A 3KBUA 2EHOC 4GOUA 3IBPA 2KYVA 3M9QA 3ZMUB 5AW7B 5FMNA 5KJ7D 4HN9A 5LXTE 2FYUK 3HE5A 3C4WA 3MD0A 2UXXB 4UIGA 1GW3A 5HXRA 3Q5WA 5AVYB 3RL0C 2CXFA 3ZLIA 3MXZA 3AA6B 2KZ7B 2B1EA 3H32B 4JF7A 2C5IT 1VPCA 2Z4EA 4PJLA 2CLYC 5AW6B 1MIVA 3EDUA 1D0ZA 1U4QA 3NZQA 2YKQA 3ZMTB 4IFMA 1JY3N 5AVZB 1O3XA 4F6RC 4JYBA 1WT6A 1J1EB 4O2AE 5CCHA 4H9QC 3VOPA 1GL2C 4HKAA 3U1CA 4U72A 2IAKA 5L3BB 1FMWA 2KLQA 3P8MC 5LHIB 4BJMA 1JMMA 2JPFA 3N7NA 1HGVA 4H63V 1LVKA 1N7SB 5KX5E 2X51A 3GMIA 5JDQA 4MLKA 3A3YB 3AAAB 2A3DA 1KILB 1MZ9A 1UCUA 3O1IA 4W7ZA 3N9PA 2CA5A 2QM7A 1NU1K 4JYCA 5FY0A 2N1GA 1J2JB 3E08A 1B7TA 4IE7A 3RC8A 4M1PA 1LWUA 2P9BA 5A1LA 3KVAA 5LP6E 2VKOA 2SPCA 2HPLA 1HH0A 2A45H 2Q9QA 3ETVA 3CLQA 3C98B 1HCIA 2R5DA 2XU6A 4QKNA 2DHRA 3HKBE 1JY3O 4TX5A 1LTJA 4C7NA 4CXYA 1N7SD 2CE7A 3T8OA 2N1TA 3RYIE 4EB6E 3CPZA 2LSJA 5JH7E 2XAQB 4AQFC 4GIWA 4ISTA 1LT9B 3GHGB 1RF1C 3N9OA 2VL8A 1E5WA 2IC6A 5AW5B 3BRVB 1YTZT 2Y8DA 1N7LA 3LIEA 1E1HB 4ZI7E 2NPSB 2CMRA 4I43B 4I55E 4GYRA 4ZI3D 2DWKA 3LJCA 5JDLA 3L37A 4ZI2C 3F31A 4ASKA 2KWIB 2V7IA 1JY2P 1NH4A 2H3RA 2E9XB 2W6BA 2WPQA 2V7KA 3HE4B 3MACA 1FZCC 1QUUA 4L9IA 2IFNA 1ZN5A 2WITA 3PU8A 1SFCB 3C50A 5KJ7C 2Y48B 4G63A 5APXA 2VKHA 1NKNA 5HWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT6 A;  3U1A A;  3BAS A;  2JEE A;  3C9I A;  5KTB A;  4GIF A;  4O9B A;  3OJA B;  2POH A;  4I1L A;  3VP9 A;  4N3Y B;  2FXM A;  4N78 D;  3U1C A;  3N4X A;  4ZKU A;  3P8C D;  3VP8 A;  3BAT A;  5BU8 B;  5BU5 A;  3U59 A;  3N7N A;  5BVZ A;  4ZKP A;  3HRN A;  1X79 B;  1NKN A;  1IC2 A; 
#chains in the Genus database with same CATH topology
 3KDS E;  3L73 G;  1T2K D;  2CXD A;  1ZR2 A;  1J1D B;  3L72 G;  5AVQ B;  5F5W A;  2WP9 A;  1PP9 D;  3AE6 C;  4HWC A;  3I0O A;  2WCA A;  5L3G B;  5ABE A;  4PD4 D;  4WY4 B;  3B5N C;  3EVY A;  2HN1 A;  5AW3 B;  5LOV E;  2XSB A;  1KN7 A;  1FEW A;  1OVV A;  3AXJ B;  4O4I E;  4U7I A;  1HG5 A;  3MA9 A;  3K8P C;  5F8P A;  1L0L J;  1VQ8 P;  4PK6 A;  1IFD A;  3TDK A;  3QK6 A;  4I6M C;  4ZKP A;  3HD7 B;  4XA4 A;  1AA0 A;  3ZC0 A;  3P8C E;  4ASW A;  3NMD A;  3Q2Y A;  2NW9 A;  2R5B A;  5CJ0 A;  3TGU E;  2E5V A;  1IBM T;  1WR0 A;  1ZXG A;  1W5C E;  3M91 A;  1SLQ A;  1UIX A;  4DBQ A;  2P10 A;  4I1L A;  2E9X D;  2FBW A;  5FNV E;  3AE5 A;  1KFY A;  3M0D A;  1M8O B;  4UVA B;  3RPU A;  4CXW A;  1SQP K;  3C1L A;  1HWT C;  2EHO B;  2KWH A;  2HOD B;  1RE4 A;  2UUA T;  3VR9 A;  2BCC G;  4JI3 T;  1OX3 A;  1GDT A;  1T3U A;  1G2C A;  3JCU H;  1P84 H;  5FP3 A;  3MK7 C;  3FXD A;  1SFC D;  4OFZ A;  4HB1 A;  1J5W A;  4DV7 T;  5FYM A;  1MMA A;  3W15 B;  4N6J A;  5LMU T;  4H44 D;  1HTL C;  1QLB A;  3HUS C;  4H63 H;  2WZI A;  4D6T J;  2QEX P;  2NP9 A;  4ZZC A;  2E5L T;  2VVS A;  4AKR B;  4PNI A;  2GA1 A;  3RL0 B;  4KBM B;  1MV8 A;  5JR9 A;  5AVT B;  4UVB B;  2M6B A;  2P2U A;  1ZOY C;  4CI3 B;  1HGZ A;  3WU2 E;  4KP3 C;  2CLY B;  4NUV A;  4QX7 B;  2UXD T;  1ZP0 C;  5AVX B;  2H43 A;  1HS7 A;  2FXP A;  2NZ2 A;  3HTK B;  1VOM A;  4LF9 T;  1SQQ K;  3M9B A;  4GKG A;  1W09 A;  3SWH A;  3VYI A;  4KHP T;  1GL2 B;  4H13 D;  1GU4 A;  3M0A A;  1AJY A;  2A06 D;  5E79 E;  2A06 G;  5C2T A;  3GMA A;  2HYN A;  4LLH A;  3A0B E;  1SUM B;  3QB5 A;  3U1A A;  3ZSS A;  1UX4 A;  1D1C A;  1VL2 A;  4GIF A;  3A8Y C;  5L4E A;  1L4A D;  2C9L Y;  3AE2 A;  4HFH A;  3B57 A;  1W0A A;  2MOZ A;  1NTZ E;  3ZN0 B;  4EV6 A;  5TJH A;  1UK5 A;  4TZ4 C;  2OYI A;  3CX6 B;  3HA4 A;  3K5B A;  4IDO A;  3RK2 D;  5DJT B;  3L75 J;  1N7S C;  2XAF B;  4IDN A;  5LYJ E;  4KMC A;  4HGA A;  3USS A;  4H0L C;  4PD4 E;  3VN0 A;  2XQ7 A;  5H2F E;  2V6Y A;  2W90 A;  5AW2 B;  3SOL A;  2NOX A;  3NRX A;  2BVM A;  3BCC G;  3FWN A;  3RL0 D;  3S4U A;  4B3M T;  2Y0D A;  2IBZ I;  3ITK A;  5AFU L;  4C7R A;  2K9Y A;  1OED B;  2BEZ F;  2WB5 A;  4JYA T;  3HKC E;  1T3J A;  1R8E A;  2XZE A;  3OTO T;  2Z6E A;  5TIS H;  4PJJ A;  2Q7C A;  5AQR B;  2YU1 A;  2NTX A;  1NTM G;  1VQO P;  3CX7 B;  2P7J A;  3JCF A;  2DNX A;  3RYF E;  3MGN A;  5HXH A;  3O6Q A;  2VKD A;  4KT0 J;  2KB7 P;  1Y9B A;  1RF0 A;  4ZI3 C;  3LBX A;  2OAR A;  2VUR A;  3H32 A;  5HEO A;  5GTH E;  2CHO A;  1VQ4 P;  1YQ3 A;  1JOC A;  2L8K A;  4CZZ B;  2DCF A;  4GT1 A;  3SS1 A;  1SQB E;  1ZRT E;  1SQV G;  2CPS A;  4HH2 A;  1NHL A;  4U74 A;  3H1I J;  3MHV A;  5J2T E;  4AKG A;  1YQ4 A;  1LGH B;  2K9J A;  1L0N E;  1H88 A;  4JEU B;  5IUX A;  4OH8 B;  1KEY A;  4IT4 A;  1U5P A;  1YJ9 P;  1OXZ A;  4RJT A;  1N33 T;  1S2E A;  3PUA A;  3F5H A;  3CCV P;  2IBZ D;  4IE0 A;  1OW7 A;  1SQP J;  4ZXL A;  2XAS B;  2PBI A;  1MFT A;  1AV1 A;  3UU3 A;  4YT0 A;  1KQL A;  3O4X E;  3CXH H;  3CCQ P;  4XAX B;  4ISS A;  2IUB A;  5BVZ A;  1RF1 B;  3P4P A;  4YSZ A;  1GU5 A;  3GHG C;  1MMD A;  1JMB A;  4MFR A;  2X9W A;  1T2K C;  2OQQ A;  2WMO A;  3EAB A;  2QYW A;  4QXC B;  3LW5 H;  2BG9 E;  3OJA A;  4YTN A;  3IF8 B;  3T1Y T;  1JY3 P;  4YSX A;  2WS3 A;  3Q5P A;  2LM9 A;  3EDV A;  3PUY F;  1QSD A;  1BGY G;  4HFV A;  1KIL A;  3OPC A;  5LGN B;  4XZC A;  1KMI Z;  3F57 A;  1FJK A;  4JI1 T;  4Y99 C;  4X66 T;  3OA7 A;  3PDY A;  2X0Y A;  4DV0 T;  1M62 A;  1EDI A;  1NWQ A;  1FZF A;  4TV9 E;  2RMZ A;  3CQX C;  3H1K G;  2PGD A;  2W6A A;  1URQ C;  2YU2 A;  1VCS A;  3OYX A;  5HWX A;  2WSS V;  3D6Z A;  2GM4 A;  1EZV I;  5C8Y E;  3SWY A;  3MIW A;  5B66 E;  3RIF A;  3AEG A;  3Q5S A;  4B86 A;  2CPT A;  2L9Q A;  1SQQ J;  5LCY A;  2XY8 B;  4KHZ F;  2IYP A;  1LTS C;  2WPR A;  2DL1 A;  3PJA A;  3I5C A;  3ZPO A;  1NKZ B;  2D0U A;  3GF7 A;  2AXC A;  1MNE A;  1GQE A;  5KLV E;  2VRS A;  1DH3 A;  1BCC D;  3L70 J;  3ZEF B;  1SFC C;  3IHR A;  3C4Z A;  4IE5 A;  2QJP B;  5C3J A;  2C0X A;  2JWD A;  2AEF A;  4H44 C;  2POH A;  5L8R J;  4MAL A;  5AQQ B;  5AW4 B;  3PJA J;  1N8R Q;  3HKE E;  3M06 A;  4RKU J;  2CWO A;  1NU1 D;  4J2C A;  4WZX A;  1QVG O;  3SFD C;  4U3F G;  3AE3 A;  3TNU B;  4JLE A;  3RYH E;  3B5N B;  1J5E T;  4IDQ A;  3A7M A;  3G9R A;  2B87 A;  3WUV A;  3NXS A;  3KBT A;  3UU5 A;  5J2U E;  1CUN A;  2ODV A;  3A5T A;  1EZV G;  2XQA A;  1AQ5 A;  3RHW A;  1FBM A;  4X1I E;  2BVL A;  1GMJ A;  4BA9 A;  4DMV A;  4DR3 T;  1HG2 A;  3RX6 A;  3CWB E;  2PFV A;  2FYU E;  5CMZ A;  5DQV A;  2FFD C;  3E7K A;  1CHU A;  4K0U A;  4H13 C;  4IFD K;  2BG9 C;  2W0G A;  1FAV A;  2YDQ A;  3ZCI A;  1FJG T;  2DLR A;  1FZA A;  2GUV A;  3JAF A;  1DEE G;  3FXE B;  2J4G A;  1NTK D;  1NTK G;  3EQ2 A;  2FJD A;  1AJ3 A;  2NPS A;  1VQ9 P;  2HH7 A;  3L73 J;  1NTM K;  1L4A C;  3L72 J;  1RE3 C;  2LJL A;  2V5D A;  3JSV C;  2XUE A;  4ILA A;  4XFJ A;  1JNZ A;  3NZP A;  3EWK A;  3J7Y q;  4B3T T;  3RK2 C;  1ZV8 A;  2PJQ A;  5JQG E;  3HE4 A;  3AED A;  5AQG B;  1S35 A;  1FDM A;  3HUS B;  1KYO I;  5L3F B;  1IC2 A;  2H7O A;  3C51 A;  5AQV B;  1SQV K;  2LR2 A;  3AEB A;  2YIN A;  3BAS A;  4ASV A;  5ABF B;  2ZM2 A;  3L71 D;  3II6 A;  3ZYL A;  4U7J A;  1PV3 A;  1SQX G;  4PFP A;  3ZCJ A;  3LW5 J;  2OA5 A;  1I94 T;  4GKJ T;  4L74 A;  4NXN T;  4NPP A;  1UUS A;  3B5N D;  4JPZ B;  2W61 A;  3AEE A;  2ES0 A;  3RF1 A;  2IIU A;  4C46 A;  3TLS A;  2VQF T;  3RLF F;  2K5B B;  2KOG A;  2BCC J;  3IAO A;  3LID A;  1K9M Q;  2V6X A;  1N86 A;  4PFO A;  3ZMV B;  1BR2 A;  4DZO A;  4E7S A;  4OX9 T;  2IPP A;  3GF3 A;  3A5X A;  5EZY E;  4F8H A;  3CK6 A;  1BE3 D;  2LOP A;  3V2Q A;  5AQO B;  4EYY Q;  1EC5 A;  5BR8 T;  4AI6 A;  4WY4 A;  3C64 A;  1OZH A;  4IDP A;  2LRK A;  4GK0 E;  2H7H A;  4O4L E;  3CCS P;  3KXD A;  2B9B A;  4GYS A;  1FZG A;  2R6G F;  3HD7 A;  5HXS A;  2A2F X;  1KYO D;  3AEF C;  2WMM A;  1VQ5 P;  5AQP B;  4BJN A;  1NU1 E;  2RP4 A;  1LTJ C;  2C5J A;  2XHE B;  5FY7 A;  4U7Y A;  1G73 A;  4DO0 A;  1YD8 G;  4EGW A;  2JMH A;  3CML A;  2Q3E A;  4H0L B;  5CCG D;  1L0V A;  2CK3 H;  1WYC A;  5FY1 A;  2EHO A;  2HOD A;  4AKL A;  2XAJ B;  4YY3 T;  1OWA A;  5BU5 A;  3JAE A;  5HCJ A;  1G1I A;  4ANJ A;  2KNC B;  2W2U A;  2ZLY A;  1L0L K;  3O1J A;  4NIQ A;  3AVR A;  1Y8A A;  4IL6 H;  5KLI C;  2CHN A;  3UTK A;  2XQ6 A;  4EZH A;  4R4M A;  2E5T A;  3L74 G;  4QHO A;  2ZM6 T;  3AEC A;  1AVO A;  3NRY A;  2ITA A;  2J62 A;  1JEK A;  4UB8 H;  1LKX A;  3LG7 A;  1Q2N A;  4TNV A;  3RIU A;  3V4W A;  1QVF O;  3G6E P;  5KAF H;  5AVW B;  5AVR B;  5APY A;  2W8Z A;  3K3N A;  1FOS E;  3BK9 A;  2XSA A;  5LA6 E;  1XMO T;  2JR8 A;  2LXB A;  3PTZ A;  2M67 A;  1VQ7 P;  3P4Q A;  4GDO A;  3VKH A;  1YTZ I;  3BCC J;  4B3R T;  2UU9 T;  3HTK A;  5AQT B;  5TAO A;  2XAG B;  4M3L A;  4O2B E;  2I1J A;  2B89 A;  3G06 A;  3I55 P;  4BRY B;  1GD2 E;  3P8C D;  2LKH A;  2WWW A;  2Z5I A;  3TGU D;  3WMM 0;  3IF4 A;  1GL2 A;  2X9Y A;  3ZT7 A;  5LG3 A;  1SS1 A;  1XTC C;  4PAG A;  5K5G B;  4C90 A;  4DND A;  4H0L D;  2XM1 A;  4QH5 A;  1NAY A;  2K3W A;  2QE7 H;  1ZLL A;  2J59 M;  2K9A A;  1PFI A;  2XTL A;  1NTM J;  1VQP P;  5DJU B;  2N2N A;  2NR4 A;  4YXD A;  2X66 A;  2JQ9 A;  3SWF A;  5L3C B;  3O9X A;  3UIA A;  2W63 A;  1HF8 A;  1Z0P A;  3N5L A;  4IGU A;  5FXX A;  2YN6 A;  3B4S A;  4O8S A;  1BE3 E;  2KUB A;  4H9S E;  4WYV A;  3N9L A;  3KZI H;  2Q3I A;  1ZHC A;  3L75 E;  3ZC1 A;  1SQV J;  5FXV A;  3TSI A;  4CN6 A;  2BDE A;  3CCM P;  1J1J A;  3RGU A;  4WW0 A;  3CX5 H;  2R32 A;  1VRB A;  5LJN A;  4Y99 B;  2P67 A;  2Q1K A;  3T97 B;  4C91 A;  4ADZ A;  3Q2M A;  3VMZ A;  2IX7 C;  2XNX A;  2QJK C;  3V5U A;  3E22 E;  1FJP A;  1OED A;  2LHN A;  3CCJ P;  5L3D B;  1CI6 B;  1URQ B;  1KFN A;  2WDV A;  4PD4 I;  5LHH B;  2OYH A;  4AKI A;  4BAY B;  1XDO A;  4I7Z C;  2V7M A;  2L3L A;  2D5U A;  2LOS A;  3AE1 A;  2AXT E;  3H1H G;  1NEN A;  1K8A Q;  3AEA C;  4GOF A;  2ACZ A;  3QB5 K;  3CME P;  3UUB A;  3JC6 D;  2UUC T;  2R3C A;  1T6A A;  4L73 A;  1VQM P;  4TN7 B;  3QUJ A;  3EFG A;  3IFM A;  5BMV E;  5AQU B;  2WM9 A;  3VRA A;  3SFE A;  2QSI A;  4QWN B;  3RGL A;  1T7S A;  5DJQ C;  1BSN A;  5AW0 B;  2KT9 A;  3ONX A;  3RK3 E;  5AQM B;  1USE A;  2DI4 A;  3U78 A;  1JM0 A;  4EIJ A;  3BQL A;  3H1J D;  2WSE H;  1YIJ P;  1NTZ G;  1KNZ A;  3H1K J;  1XMQ T;  3PUV F;  3JCU E;  1HF9 A;  4EOZ B;  1EDK A;  5JR9 C;  2IYO A;  1G1J A;  3P50 A;  1PP9 G;  1WYB A;  3PJS K;  4I2L C;  5HEJ A;  3G3Z A;  2V7J A;  5L3E B;  4AQF A;  1LTB C;  3KFW X;  4CI1 B;  1KK7 A;  1HTJ F;  1RF1 A;  2JJL A;  3ABV C;  4CI2 B;  4MBQ A;  1IFP A;  3L4F A;  1KTM A;  1WRG A;  4L0R A;  2O01 N;  2K37 A;  3AB3 B;  5CJ4 A;  2HPC B;  1URQ D;  2OLT A;  4HTE A;  4ZOL E;  2FFD B;  2LKM A;  2KZI A;  4H9P C;  4H13 B;  2BG9 B;  1EXI A;  2NW8 A;  3KIN B;  3CCE P;  2YO3 A;  3RQU A;  1L4A B;  5HAX A;  1USD A;  1M1J C;  1Y01 A;  1E7P A;  2E42 A;  4U3F J;  1KF6 A;  1N73 A;  2IZ1 A;  2YKP A;  2YK0 A;  3N9Q A;  5FKY A;  1NAF A;  4ILU A;  2JJ9 A;  3RK2 B;  2X0H A;  4TWH A;  2ZT9 D;  4X1Y E;  3RRC A;  5IWA T;  3EAM A;  1SQB D;  1ZRT D;  1IFM A;  5CCG C;  1SQB G;  3ANW B;  2FXM A;  1Q82 Q;  4OYK A;  3K3Q C;  4H9N C;  2KSJ A;  4N78 D;  1FZC A;  2X9X A;  1S72 P;  1SQQ E;  1X9V A;  1RQU A;  4UV8 B;  2ZYD A;  3PHL A;  3N2G E;  4PV1 D;  1L0N D;  2MPK A;  2MBG A;  1K04 A;  2UUB T;  1Y64 B;  3N2O A;  2KIN B;  1M1K Q;  3CC4 P;  5CBO A;  1MIW A;  2VB6 A;  4EYY R;  5KJ7 A;  3H1L D;  1IJ5 A;  1KQF B;  4HFB A;  1HNZ T;  1NTK J;  2OTJ P;  2V1D B;  4IOI H;  2JRK A;  3AE7 A;  1SA0 E;  1FS0 E;  4NUU A;  3V2N A;  3ZMS B;  2X0L B;  5E0O A;  3OKQ A;  2QJY C;  4KX6 A;  3I9W A;  3P7K A;  3AE6 A;  3QWO C;  2YNY A;  3TNU A;  3DJB A;  1BR4 A;  5CCH D;  4X64 T;  4NXM T;  2J1D G;  1JO5 A;  1YQ3 C;  1MND A;  5JVD E;  5TIS E;  4OK0 A;  4YFS A;  1Q81 Q;  3KVB A;  2ZXE B;  1Q86 Q;  1YW0 A;  4L76 A;  3O1H A;  1SVF A;  1S3J A;  3H1J E;  1OVU A;  2QGS A;  2W00 A;  4UB6 H;  4P09 A;  1SQX J;  3Q3D A;  3B5M A;  1SE7 A;  1S1C X;  5GTI H;  1NO4 A;  1LTJ B;  3AE8 C;  2PRR A;  3Q5E A;  1Z56 A;  4A56 A;  1IZN B;  4BWN A;  2N1T B;  3G71 P;  3RQW A;  3FXE A;  4PJN A;  2R44 A;  3TLT A;  1VDF A;  3NVO A;  4L5G A;  4NPD A;  5APV A;  2ACX A;  2WSE J;  2V4H A;  2XZR A;  3KV9 A;  3I0Q A;  3L72 E;  5EFW B;  4WBN E;  1HFA A;  2BKN A;  1LTT C;  1LP1 A;  5KLV D;  5LGT B;  2NTY A;  5KLI B;  1LJ2 A;  4OGQ D;  2D0T A;  4O4H E;  5L4H A;  2NWB A;  4LFB T;  2VWA A;  3HUS A;  5ABG A;  3MUD C;  4HJG H;  4PW8 A;  1K73 Q;  2H88 C;  4PJ0 E;  2KI7 B;  2C0S A;  3CXH E;  3D0T A;  2WU5 A;  2KXP B;  2W67 A;  4GOD A;  1GK4 A;  4ZNC A;  3CKD A;  4YTP A;  3H6P A;  4AQY T;  2BAS A;  3FX0 A;  1ZOY A;  1KB9 H;  4XE5 B;  2Q9Q D;  3LK4 2;  3CPW O;  3CVR A;  3UUN A;  5JDN A;  5E79 H;  3K3O A;  2QRX A;  4EI2 A;  2I6H A;  3A0B H;  3CCU P;  1ZP0 A;  1YKE B;  4Z1M H;  3PH0 A;  5HEG A;  3AEG C;  3CCL P;  4N78 E;  2WZH A;  3TF5 A;  2RH0 A;  2IDB A;  3GN5 B;  3JC6 C;  3DP7 A;  3CWB D;  1N2D C;  4EEB A;  1D0X A;  4YSY A;  2FYU D;  3L3P A;  4GK5 E;  3L74 J;  2N1T D;  3H1L E;  2IBZ G;  4GOE A;  3B8E B;  1GZL A;  4H9R C;  2UXN B;  4PD4 H;  3C4X A;  2FKW B;  5H2F H;  1U7M A;  5AW8 B;  4U2Y A;  2ZM0 A;  1AVY A;  1KOR A;  2XKM A;  3LK2 B;  4HWH A;  1S5L H;  1RQV A;  3KV5 A;  1N7S A;  5KKZ C;  3UUX B;  3MJX A;  4WBA A;  4JBW F;  3ZT5 A;  3FBZ A;  5CA0 E;  5CA1 E;  1PIX A;  3L8R A;  5M4Y A;  1NOH A;  1H0T A;  2WDR A;  3HKD E;  2P58 A;  2KNC A;  2JWA A;  5DAB A;  2QJK B;  5IYZ E;  4HE8 A;  2KP8 A;  1W9R A;  1X79 B;  1TU3 F;  3A7O A;  1ZKE A;  2A72 A;  4HFD A;  4DV1 T;  5GTH H;  4PK4 A;  1QL1 A;  2BBJ A;  1N34 T;  3FZK B;  3A0H H;  4I7Z B;  3VMA A;  1ZR4 A;  4P1N A;  2ZVO B;  3IN6 A;  4O9B A;  4LF4 T;  3S9O A;  3P7I A;  4PK5 A;  2PG8 A;  3D6Y A;  4Z91 A;  3V6I A;  3PU3 A;  3PUX F;  1N32 T;  1W2B O;  2IFM A;  1A02 F;  1FIO A;  4JI0 T;  5H6Q B;  5AQL B;  2D2S A;  4IE6 A;  4LFA T;  4DBR A;  2O1J A;  4IDZ A;  4LMJ A;  5FXW A;  1DX7 A;  3AA7 B;  1M7K A;  2GUS A;  1BCC G;  2WMN A;  2K24 A;  5JDF A;  1R8I A;  1FDO A;  4YHJ A;  5JTG A;  2ZMA A;  3FBL A;  5HXC A;  2ZT9 C;  3AA0 B;  3K1S A;  4DID B;  4EZ4 A;  3BCC E;  1JTH B;  3HI2 A;  3PTR B;  1L0L D;  1X8Y A;  4PV1 C;  3DTO A;  5JR9 B;  1NU1 G;  5HXE A;  2MAW A;  2WT7 B;  4IRE A;  3G4S P;  5ETW A;  1M7L A;  5APU A;  3H1H J;  2XND H;  1S9K D;  4UEL A;  3SSU A;  3UUM A;  1NTM E;  3OW2 O;  3V2P A;  2V26 A;  3VMX A;  1LT9 A;  3GHG A;  2V7L A;  4Z8X A;  5JDM A;  1D1A A;  4JI7 T;  2KK7 A;  3IR9 A;  3P4R A;  3N4X A;  2YOE A;  2YO2 A;  3OAK A;  2XPK A;  3V5S A;  5JDG A;  2HG5 D;  3LFM A;  4A97 A;  1YIT P;  5GON E;  3P4S A;  1U7J A;  1HBW A;  5APS A;  5CCH C;  2LSY A;  4AIU A;  2NW7 A;  2JO1 A;  1IK7 A;  1SQV E;  1GW4 A;  5AW9 B;  4TT3 H;  1H89 A;  4LC1 A;  3T97 A;  1NTZ J;  1M1J B;  4ERR A;  3UU6 A;  3AE9 C;  4YJ2 E;  4D6T D;  2JMK A;  1MMN A;  4HWI B;  1PP9 J;  2KZJ A;  1CI6 A;  1PL5 A;  5EK3 A;  4EIW A;  2KLV A;  3UFG A;  3A2A A;  2OYI B;  3RI5 A;  1PPJ D;  2RA1 A;  4TUY E;  4DR6 T;  3FB2 A;  2KS1 B;  2QA7 A;  2E9X A;  4EXT A;  3M65 A;  2N9Y B;  3UFE A;  3EUH A;  5EK2 A;  5ABH A;  1H8A A;  1EDL A;  1KZU B;  4AQR D;  4DR2 T;  3BRT B;  2JEE A;  2XDJ A;  4UV9 B;  1YI2 P;  2AEM A;  3KV6 A;  2BZB A;  3KYQ A;  1NWM X;  4HYT B;  4DV3 T;  3L71 G;  4I4T E;  4A98 A;  1SFC A;  3QNU A;  4AUW A;  2X67 A;  3EHZ A;  3UQ4 A;  2CM0 A;  3RC3 A;  5JRE A;  3H3M A;  3ZJ2 A;  1LTA C;  4AQG A;  2E8I A;  4OGQ C;  5B5E H;  4KUM B;  1IFN A;  3RK3 B;  1BGY E;  1FDI A;  2QIW A;  3HRN A;  3S4R A;  1LWU C;  4RES B;  5JRC B;  2QJY B;  3SFD A;  3V5B A;  1XTG B;  3O6Q B;  1D0Y A;  3I1A A;  5HEU A;  4JEH B;  3H1K E;  2V8S V;  1KQS O;  3LBX B;  3MZK B;  2WWV A;  1BE3 G;  1HUC A;  3HL6 A;  1L2P A;  4IL6 E;  5AVS B;  2Q9Q C;  3L75 D;  2LEH A;  2FJE A;  2KND A;  1SQB J;  2L91 A;  2BEQ D;  5KAI H;  3I9Y A;  1FMV A;  3AE4 C;  3AXJ A;  1GK6 A;  2XQ3 A;  2G3A A;  3N2K E;  3L09 A;  1IJD B;  2LT3 A;  1L0L E;  4FI5 A;  4KHX A;  4HFI A;  2HPC A;  2K9J B;  2Y9Z A;  2FFD A;  1D1B A;  2D9D A;  1XZY A;  2LSK A;  2YKS A;  4PJM A;  1QGK B;  2BG9 A;  1VF5 D;  3RH3 A;  1NJI Q;  2N1T C;  1YJW P;  1S9K E;  4H9O C;  1I6Z A;  2IDO B;  1IBL T;  1L4A A;  1RE3 A;  4K3A A;  5APT A;  5KMG P;  4DOJ A;  4LGD E;  2YKO A;  5CJ5 A;  2CCQ A;  5LBQ B;  1W2E A;  2ZFC A;  4U3F E;  2Y6X A;  3PE0 A;  1CW5 A;  2MYS A;  3J9X 1;  3WI3 A;  3LK3 B;  3MP7 B;  4DV4 T;  4JBZ A;  3OJA B;  5ADX L;  3RK3 D;  3ANW A;  3CL3 D;  1KC8 Q;  2Q5U A;  3Q5R A;  2K3R A;  1XWM A;  3L36 A;  3ZMZ B;  3GG2 A;  2E75 D;  3WUU A;  3LDQ B;  1OW8 A;  2Z5H A;  3H1I D;  2H89 C;  3PUR A;  1XNR T;  3CX8 B;  4EED A;  4D6T E;  3AA1 B;  4YPC A;  1OFC X;  1P84 D;  3ETU A;  1Q7Y Q;  4X62 T;  1FZB A;  1EQ7 A;  1PPJ E;  1T8Z A;  2MTQ A;  1SQP D;  1V9D A;  4IL6 X;  2OYH C;  3CIR A;  4QH1 A;  4LFC T;  2W27 A;  2F4V T;  3FZL B;  4UF0 B;  4HKZ H;  4EAH A;  5CBN A;  2W66 A;  3CX5 E;  4DV5 T;  4WB4 A;  2VAS A;  2LXC B;  5AW1 B;  2WSS H;  3RKO A;  3WAJ A;  3TGU G;  5JDH A;  4OWF A;  3R2P A;  2WSC J;  2W62 A;  1HVV A;  1BSH A;  2ZYA A;  4ZHQ E;  3M3Z B;  4UVC B;  3VRB A;  4DR7 T;  2UXB T;  1US7 B;  3ZT6 A;  3AEF A;  1HNW T;  1BR1 A;  1NTK K;  3TYY A;  1MUU A;  4AYC A;  4TWF A;  1IK9 A;  2I59 A;  4AIS A;  2XQ8 A;  5KKZ B;  1T72 A;  4KJM A;  3UT5 E;  3C8V A;  5HWY A;  3IEE A;  4LMK A;  2FYZ A;  2KIK A;  3B71 A;  5LGU B;  3I56 P;  4FJO A;  4X65 T;  4LF6 T;  5KTB A;  3PUZ F;  1SQQ D;  1JCD A;  3MTU E;  5AQS B;  1KIL D;  3IA3 A;  3BVH A;  3FZM B;  1GTW A;  3EI0 A;  5CFB A;  4DUZ T;  3AAI A;  1KNP A;  2K88 A;  2CBI A;  2ZVN B;  4ZKU A;  2XQ5 A;  3ZYK A;  4Z90 A;  4W80 A;  3VR8 A;  3R6N A;  1SQX K;  2Q9I A;  3TLV A;  3PUW F;  5LG4 A;  1OVR A;  4DV6 T;  2CWY A;  2FBW C;  3W67 A;  3FGA D;  4CXX A;  2KSE A;  3AE5 C;  5AQH B;  4MHC A;  3M0D C;  1HR0 T;  3RBX A;  4JI4 T;  1RE4 C;  5APW A;  4MN4 C;  1E79 H;  1N73 C;  1WFD A;  5AQJ B;  3ZJ1 A;  2B88 A;  2OV9 A;  3NBX X;  4AXP A;  5M1B A;  4B6X A;  2G8Y A;  4QX8 B;  3CXH I;  3R4Y A;  2ZT9 B;  2WQY A;  2YDR A;  3HE5 B;  1DD4 A;  1BDC A;  3GN5 A;  3H1J G;  3H1I E;  4PV1 B;  1HJ0 A;  2N9B A;  2VL0 A;  4UEM A;  1WCR A;  2LKG A;  1YHQ P;  1P84 E;  5LB7 B;  1G8X A;  3VP9 A;  2IC9 A;  3VMY A;  2WDQ A;  4NPE A;  3CD6 P;  2FYN C;  1SQP E;  5BU8 B;  2HFE D;  5LHG B;  4WNK A;  4DUY T;  2QM8 A;  3PUG A;  1LRZ A;  5CHX A;  2PP6 A;  1KYO H;  3L73 D;  1YKH B;  4HEA A;  2V7Q H;  2IML A;  3L72 D;  1IAP A;  1OIP A;  2E74 C;  4EOT A;  2FJB A;  2HHH T;  1BCC J;  3F2E A;  1VQN P;  2CXL A;  3RYC E;  3JAD A;  4YXW H;  2AXT H;  2LHR A;  4YJ3 E;  4YTM A;  2M5A B;  3PUS A;  2WZ7 A;  3CXH D;  4K0K T;  1DEB A;  2H8P D;  2J58 A;  2NPS D;  2XM2 A;  1BDD A;  3KDP B;  3WAK A;  4I50 E;  4G2A A;  1NU1 J;  2D2C C;  3UQ7 A;  1X79 A;  4LF7 T;  3AE2 C;  5EK4 A;  1UX5 A;  1WR6 A;  3F89 A;  5AQF B;  2OYI C;  2E43 A;  4DR5 T;  1ZW0 A;  2I0M A;  1MFZ A;  3P4W A;  1VF5 C;  3UUL A;  1T98 A;  3MKD A;  3AEA A;  4V1A v;  2CBJ A;  4ZS3 A;  2XQ4 A;  2ZXX A;  3D70 A;  2YIU B;  2FJA A;  2WPS A;  1NEK A;  3TLW A;  2BCC D;  2AEJ A;  1KIL E;  3U59 A;  1L0N G;  2JKV A;  3H37 A;  4P0B A;  2VKJ A;  4UB6 E;  4ZMD A;  4E7Z A;  1CSB A;  5GTI E;  1H7C A;  1S4X A;  4WVZ A;  1A02 J;  3R84 B;  3H1L G;  3Q5X A;  3L70 E;  4EYU A;  4OGQ B;  5F3J A;  2XQ9 A;  5AQN B;  2XJ7 A;  3RK3 C;  2OGU A;  1JTH A;  1LWU B;  3RIA A;  3PUQ A;  2E75 C;  4DVD A;  4YTP C;  4CN1 A;  1XNQ T;  2WT7 A;  2WWU A;  2PAJ A;  2I8D A;  2HPJ A;  1KFM A;  1HX8 A;  1RF0 C;  2BKO A;  2Q9Q B;  3FZH B;  1PGQ A;  5FL1 A;  3B5N A;  2R3S A;  4WY4 D;  1WMK A;  2VK9 A;  3CC2 P;  5AQI B;  1M56 D;  3H1H E;  3OYZ A;  2FY8 A;  3ABV A;  2FXO A;  4KI0 F;  3HD7 D;  2JIW A;  5L2L A;  2JP3 A;  2W6J H;  1AFO A;  2CPB A;  3L71 J;  5CB4 E;  1S94 A;  1YQ4 C;  1J1E C;  5AQK B;  1KB9 E;  4C7N B;  3NWI A;  2M0B A;  2QVA A;  2C9N Y;  4DR4 T;  2RKL A;  2EHO D;  2L5G B;  1Q90 D;  1M1J A;  4B3S T;  3GA8 A;  1JY2 N;  4ZS2 A;  2VQE T;  4COF A;  4L75 A;  3L73 E;  4DCK A;  1Z8U A;  2C0W A;  3N9M A;  2W83 C;  4JI2 T;  2MKV A;  2AE9 A;  1BE3 J;  3KHU A;  3HR0 A;  1HNX T;  1PP9 E;  5KLV G;  2KS1 A;  3WU2 H;  4X20 E;  5CCG A;  1FZE A;  1X9B A;  3VHL A;  4Y28 J;  5L47 A;  2M3E A;  2HN2 A;  4OHF A;  3ONL C;  3BCC D;  3CQC B;  2WVR A;  3V2R A;  5ABF A;  2XAH B;  2V7Q J;  2WAU A;  5FVK A;  3Q9D A;  3EFF K;  1KIL C;  2HR3 A;  2W4X A;  5APQ A;  2JQQ A;  1KV4 A;  4XBF B;  1S5L E;  3P32 A;  1NTZ K;  5HEH A;  2A9U A;  4QXH B;  3ZN1 B;  1MMG A;  4YLH A;  3BQK A;  2N9D A;  1WRD A;  2QA4 P;  2OYH B;  2LE8 A;  2ODU A;  3CQG B;  2YMK A;  4CQI A;  1NTM D;  2ZM8 A;  4I0U A;  4P0A A;  2O01 H;  2IW5 B;  2G0U A;  2K48 A;  5JRC A;  4X5T A;  4WBO A;  2WBL A;  1X0T A;  2BCC E;  3W68 A;  3N9N A;  2QG4 A;  4TNW A;  2BS2 A;  3L35 A;  5FXZ A;  1CZQ A;  2YMY A;  4HWD A;  3CWB G;  1GL2 D;  1QL2 A;  2RN0 A;  2LSG A;  2FYU G;  3U3I A;  2H7V C;  4ZZB A;  3A0H E;  3CWZ B;  2E76 C;  1RY3 A;  1SQV D;  1LNQ A;  1QLE D;  1E2A A;  3CCR P;  1IJ6 A;  5KDM C;  1UII A;  1SP4 A;  1EZ3 A;  2AXD S;  4ILB A;  3FHN A;  2P1J A;  3AE8 A;  4QXB B;  1PGO A;  3O8Z A;  4IFF A;  1K05 A;  1ZV4 X;  4DV2 T;  4W7Y A;  1EDJ A;  2HLO A;  2JDI H;  3VTP C;  3AE3 C;  4IIJ E;  4A5X A;  1DU2 A;  1HJB A;  3V4Q A;  1WLX A;  4X1K E;  1KD1 Q;  4ZEY A;  4PJ0 H;  2UWJ E;  1RH5 B;  3VP8 A;  3TK1 A;  3H3A A;  2LM2 A;  1SQB K;  2O1K A;  3PRJ A;  3JC2 2;  2X9H A;  1LT9 C;  1JY2 O;  1RHZ B;  3TGU J;  2A45 I;  4JUY A;  3OBV E;  5H6R B;  3GWH A;  2LSI A;  1L0N K;  4HFC A;  3VU7 H;  2X68 A;  3E1I A;  1S5L X;  3C9I A;  3L39 A;  2I1K A;  3TKL B;  3CC7 P;  4LML A;  2PFX A;  5LBM A;  4Q25 A;  2A06 E;  3MUD A;  1N36 T;  2H88 A;  4IHJ E;  2YXR B;  1FU1 A;  4U2Z A;  2M8R A;  1BGY D;  3KQG A;  3RRW A;  4QMA A;  4LF5 T;  3BAT A;  3ZYM A;  2NPS C;  3M9H A;  4JV5 T;  1YYC A;  3ONJ A;  2WTY A;  3H1K D;  1G2C B;  1N73 B;  4O4J E;  3FXD B;  5CGM A;  2MJZ A;  2DWG A;  2CEA A;  4YHH T;  3BQI A;  5AVV B;  3MZW B;  4UF0 A;  1FOS F;  2E9X C;  1U57 A;  1M90 Q;  1JNM A;  1ZEE A;  1BR0 A;  5DQW A;  3AED C;  3GW6 A;  3KPE A;  4N3Y B;  2ZAE B;  3AAE B;  1FZC B;  4BRY A;  4TV8 E;  1IBK T;  2J5U A;  4JI8 T;  3AEB C;  1L0L G;  3NTN A;  1IO4 A;  1JCC A;  2KMF A;  1SHZ C;  1JUN A;  4IE4 A;  4K35 A;  4UXN B;  1VQK P;  1R5L A;  5J1G A;  2A45 G;  3LSV A;  5IHY A;  2FYN B;  1MIY A;  4AKH A;  3ESL A;  3AEE C;  3KV4 A;  5HYA A;  3CX5 I;  1IFI A;  2XV5 A;  2KLU A;  3QH9 A;  3NFQ A;  3T1H T;  1LVF A;  2RPA A;  3VKG A;  1LTI C;  1NVO A;  2XQY A;  4DMW A;  2YXQ B;  3CI9 A;  1J1D C;  2M3B A;  2M6I A;  2Q6Q A;  2E74 B;  1LTG C;  4U3F D;  5AVU B;  1R5S A;  1OW6 A;  1X22 A;  4ILC A;  3RBZ A;  4LF8 T;  5KLV K;  5B66 H;  5J0Z A;  4WY4 C;  2SPZ A;  2OTL P;  5B5E E;  1DIP A;  2C5K T;  1EZV D;  2O01 J;  2YEV C;  3H1J J;  3SRZ A;  5HCM A;  2WSF H;  3QC9 A;  5LMN T;  2D2C B;  3Q1M A;  3HD7 C;  2NRG A;  4D6T G;  1YBK A;  1M57 D;  3GLM A;  4ZI2 D;  3AVS A;  1URQ A;  5LJM A;  1IFJ A;  5FVL A;  3B13 A;  3RKG A;  5LNK A;  1PPJ G;  2IBZ E;  2KSR A;  2JQK A;  1VF5 B;  4OYJ A;  2WSC H;  1YJN P;  5KAI E;  3PP5 A;  3E0Z A;  1YXR A;  2GK9 A;  1PGJ A;  2V5C A;  3KBU A;  2YIU C;  2EHO C;  2V6Y B;  3CX5 D;  4GOU A;  2ZJS E;  3IBP A;  2KYV A;  3M9Q A;  3CMA P;  3ZMU B;  1AQT A;  1OED E;  5AW7 B;  1PZQ A;  5FMN A;  2E5Y A;  1LP1 B;  5KJ7 D;  1QX8 A;  4HN9 A;  5LXT E;  1VCT A;  2FYU K;  2WY2 A;  2UXC T;  1UGO A;  3HE5 A;  3C4W A;  3MD0 A;  3AEC C;  2UXX B;  4IL4 A;  3ZST A;  1FE6 A;  4UIG A;  4DR1 T;  4GKK T;  2E75 B;  1GW3 A;  2DW3 A;  5HXR A;  3RIU C;  4TWD A;  3Q5W A;  4CN4 A;  5AVY B;  2E74 D;  3RL0 C;  2CXF A;  4R4L A;  1SQX D;  3ZLI A;  3MXZ A;  3AA6 B;  1LT1 A;  2KZ7 B;  3UU4 A;  1T8B A;  2K1A A;  1JB0 J;  2B1E A;  3H32 B;  4JF7 A;  2BKP A;  1VPC A;  2Z4E A;  2C5I T;  3L75 G;  4PJL A;  4DT0 A;  2CLY C;  5AW6 B;  1MIV A;  3EDU A;  1ZME C;  1D0Z A;  2IZ0 A;  1EXJ A;  1U4Q A;  2YKQ A;  3NZQ A;  3ZMT B;  4JQ0 D;  4IFM A;  4UB8 E;  1VQ6 P;  1L0N J;  2D2C D;  1JY3 N;  2YDS A;  5AVZ B;  1P84 I;  1O3X A;  4F6R C;  4JYB A;  1WT6 A;  2E2A A;  5KAF E;  1J1E B;  3E1R A;  3H1L J;  4O2A E;  5CCH A;  4H9Q C;  3VOP A;  1GL2 C;  2O3J A;  1BCC E;  4HKA A;  2Y9Y A;  3U1C A;  2M5A A;  4U72 A;  2IAK A;  5L3B B;  1FMW A;  2KLQ A;  3P8M C;  5LHI B;  4BJM A;  5C39 A;  3AE9 A;  4NPF X;  1JMM A;  1Y47 A;  2JPF A;  1D7M A;  3N7N A;  4YXD C;  1HGV A;  3D71 A;  1W0B A;  4H63 V;  1LVK A;  3UU8 A;  1N7S B;  3H25 A;  2FUP A;  1MKM A;  5KX5 E;  4WWI A;  2X51 A;  1NGM B;  3GMI A;  4U3C A;  5JDQ A;  4MLK A;  3A3Y B;  3AAA B;  2A3D A;  1EZV E;  2BBH A;  2LLY A;  1H0T B;  4TLF A;  1KIL B;  3H1I G;  3OVU A;  1MZ9 A;  1UCU A;  2PTF A;  3NKZ A;  3O1I A;  4W7Z A;  3FWL A;  4DJG A;  3N9P A;  2CA5 A;  4HFE A;  2QM7 A;  1OED C;  1NU1 K;  4JYC A;  3L74 D;  5FY0 A;  2N1G A;  1J2J B;  3KZI E;  3E08 A;  1B7T A;  1SQP G;  4IE7 A;  3RC8 A;  1DD3 A;  4M1P A;  1NTK E;  3PLN A;  1LWU A;  2WSF J;  3AE1 C;  2P9B A;  5A1L A;  3KVA A;  5LP6 E;  2VKO A;  2SPC A;  4JI5 T;  5KLV J;  2HPL A;  4EDF A;  1HH0 A;  2A45 H;  2Q9Q A;  3ETV A;  3CLQ A;  3C98 B;  3PV0 F;  2E76 B;  3AE4 A;  1HCI A;  3SFE C;  3ZDM A;  1JNR A;  4QH4 A;  3RL0 g;  2OTK E;  2WQY C;  2R5D A;  4JI6 T;  2XU6 A;  4QKN A;  4CPG A;  1PGP A;  2DHR A;  3HKB E;  1JY3 O;  2B76 A;  4IL9 A;  4TX5 A;  1LTJ A;  1KQG B;  3L71 E;  4C7N A;  4CXY A;  1SQX E;  1VQL P;  1N7S D;  2CE7 A;  2WU2 A;  3T8O A;  2N1T A;  3RYI E;  4OVN F;  1HX1 B;  4EB6 E;  3CPZ A;  2LSJ A;  4A7P A;  3X1D A;  3ZKR A;  5JH7 E;  2JQH A;  2XAQ B;  2B87 B;  4AQF C;  4GIW A;  1SQQ G;  4IST A;  4UR9 A;  4BXL A;  1KB9 I;  2BS4 A;  1LT9 B;  3GHG B;  3TLU A;  1RF1 C;  4U33 A;  3CWB J;  3S1K A;  3N9O A;  2FYU J;  2VL8 A;  1E5W A;  2Y0E A;  1NYH A;  2IC6 A;  2LRL A;  5AW5 B;  3BRV B;  4U31 A;  3L70 D;  1YTZ T;  3L70 G;  2Y8D A;  1N7L A;  3LIE A;  1E1H B;  2H89 A;  4ZI7 E;  2NPS B;  2CMR A;  4I43 B;  1KYO E;  4I55 E;  4GYR A;  4ZI3 D;  2VVN A;  2DWK A;  3LJC A;  5JDL A;  3L37 A;  1FC2 C;  4ZI2 C;  2OYO A;  3F31 A;  2BS3 A;  4ASK A;  2E76 D;  2Y0C A;  2KWI B;  2V7I A;  1JY2 P;  4RO0 A;  1NH4 A;  2ZYG A;  2H3R A;  3H1H D;  3QOF A;  2E9X B;  2W6B A;  2WPQ A;  3SWK A;  2V7K A;  3HE4 B;  1KNR A;  3MAC A;  2WPV B;  3WUT A;  1FZC C;  1QUU A;  4L9I A;  1OMI A;  3FZF B;  1KB9 D;  1ZN5 A;  2IFN A;  2WIT A;  3Q5D A;  3PU8 A;  2J47 A;  1SFC B;  5FL0 A;  3C50 A;  1XDP A;  2CRB A;  5KJ7 C;  2IHR 1;  3L74 E;  2Y48 B;  2QJP C;  1BGY J;  1UUR A;  4G63 A;  4H44 B;  5KXJ A;  1QEX A;  5APX A;  2VKH A;  4HWF A;  3AE7 C;  1NKN A;  1NTZ D; 
#chains in the Genus database with same CATH homology
 3KDS E;  1T2K D;  2CXD A;  1ZR2 A;  1J1D B;  5AVQ B;  3I0O A;  5L3G B;  3EVY A;  4WY4 B;  3B5N C;  5AW3 B;  5LOV E;  1FEW A;  4O4I E;  1HG5 A;  3MA9 A;  3K8P C;  5F8P A;  4PK6 A;  1IFD A;  3QK6 A;  4I6M C;  4ZKP A;  3HD7 B;  4XA4 A;  3ZC0 A;  3P8C E;  3NMD A;  2NW9 A;  2R5B A;  5CJ0 A;  3M91 A;  1SLQ A;  4DBQ A;  4I1L A;  2E9X D;  5FNV E;  3M0D A;  4UVA B;  3RPU A;  4CXW A;  1SQP K;  1HWT C;  2EHO B;  2KWH A;  2HOD B;  1RE4 A;  1GDT A;  1T3U A;  1G2C A;  5FP3 A;  3MK7 C;  1SFC D;  4OFZ A;  5FYM A;  1MMA A;  3W15 B;  4N6J A;  1HTL C;  3HUS C;  4H63 H;  2NP9 A;  4AKR B;  4PNI A;  3RL0 B;  4KBM B;  5JR9 A;  1MV8 A;  5AVT B;  4UVB B;  2P2U A;  4CI3 B;  1HGZ A;  4KP3 C;  2CLY B;  4NUV A;  4QX7 B;  5AVX B;  2H43 A;  1HS7 A;  3HTK B;  1VOM A;  1SQQ K;  3M9B A;  4GKG A;  3SWH A;  3VYI A;  1GL2 B;  1GU4 A;  3M0A A;  2HYN A;  4LLH A;  3U1A A;  1UX4 A;  1D1C A;  4GIF A;  1L4A D;  2C9L Y;  3B57 A;  2MOZ A;  3ZN0 B;  4TZ4 C;  2OYI A;  3CX6 B;  3HA4 A;  3RK2 D;  1N7S C;  2XAF B;  5LYJ E;  4KMC A;  4HGA A;  3VN0 A;  5AW2 B;  3SOL A;  2NOX A;  3NRX A;  2BVM A;  3RL0 D;  3S4U A;  5AFU L;  4C7R A;  3HKC E;  1T3J A;  2Z6E A;  4PJJ A;  2Q7C A;  2YU1 A;  2NTX A;  3CX7 B;  2P7J A;  2DNX A;  3RYF E;  3MGN A;  5HXH A;  2VKD A;  2KB7 P;  1RF0 A;  4ZI3 C;  3LBX A;  2OAR A;  3H32 A;  1JOC A;  2L8K A;  4CZZ B;  2DCF A;  4GT1 A;  3SS1 A;  2CPS A;  4HH2 A;  1NHL A;  4U74 A;  5J2T E;  4AKG A;  1LGH B;  1H88 A;  4JEU B;  4OH8 B;  1U5P A;  1OXZ A;  3PUA A;  4IE0 A;  2XAS B;  2PBI A;  1KQL A;  3O4X E;  4XAX B;  4ISS A;  5BVZ A;  1RF1 B;  1GU5 A;  3GHG C;  1MMD A;  4MFR A;  2X9W A;  1T2K C;  2WMO A;  4QXC B;  3LW5 H;  3OJA A;  3IF8 B;  1JY3 P;  2LM9 A;  3EDV A;  1QSD A;  4HFV A;  1KIL A;  5LGN B;  4XZC A;  3F57 A;  1FJK A;  4Y99 C;  3OA7 A;  3PDY A;  1NWQ A;  1FZF A;  4TV9 E;  3CQX C;  2W6A A;  1URQ C;  2YU2 A;  3OYX A;  5HWX A;  2WSS V;  2GM4 A;  5C8Y E;  3SWY A;  3MIW A;  4B86 A;  2L9Q A;  5LCY A;  1LTS C;  2WPR A;  3ZPO A;  3I5C A;  1NKZ B;  2D0U A;  1MNE A;  2VRS A;  1DH3 A;  3ZEF B;  1SFC C;  3IHR A;  3C4Z A;  4IE5 A;  2C0X A;  2POH A;  4MAL A;  5AW4 B;  3HKE E;  3M06 A;  2CWO A;  4J2C A;  3TNU B;  4JLE A;  3RYH E;  3B5N B;  3KBT A;  3NXS A;  5J2U E;  1CUN A;  2ODV A;  3A5T A;  1AQ5 A;  1FBM A;  4X1I E;  2BVL A;  4BA9 A;  4DMV A;  1HG2 A;  3RX6 A;  2PFV A;  5CMZ A;  5DQV A;  2FFD C;  4K0U A;  2W0G A;  4IFD K;  3ZCI A;  1FAV A;  2DLR A;  1FZA A;  2GUV A;  3FXE B;  3EQ2 A;  1AJ3 A;  2NPS A;  2HH7 A;  1NTM K;  1L4A C;  1RE3 C;  2LJL A;  2XUE A;  3NZP A;  3J7Y q;  3RK2 C;  1ZV8 A;  2PJQ A;  5JQG E;  3HE4 A;  1S35 A;  1FDM A;  3HUS B;  5L3F B;  1IC2 A;  2H7O A;  3C51 A;  1SQV K;  2YIN A;  3BAS A;  2ZM2 A;  3II6 A;  3ZYL A;  3ZCJ A;  4PFP A;  2OA5 A;  3B5N D;  2W61 A;  2ES0 A;  4C46 A;  2K5B B;  2KOG A;  3LID A;  4PFO A;  1N86 A;  3ZMV B;  1BR2 A;  4DZO A;  4E7S A;  2IPP A;  3A5X A;  5EZY E;  2LOP A;  3V2Q A;  4AI6 A;  4WY4 A;  3C64 A;  4GK0 E;  2H7H A;  4O4L E;  4GYS A;  1FZG A;  3HD7 A;  5HXS A;  2A2F X;  4BJN A;  2RP4 A;  1LTJ C;  2C5J A;  2XHE B;  5FY7 A;  1G73 A;  4DO0 A;  1YD8 G;  2JMH A;  3CML A;  5CCG D;  1WYC A;  5FY1 A;  2EHO A;  2HOD A;  4AKL A;  2XAJ B;  1OWA A;  5BU5 A;  1G1I A;  4ANJ A;  2ZLY A;  1L0L K;  3O1J A;  3AVR A;  3UTK A;  4EZH A;  4QHO A;  3NRY A;  1LKX A;  3LG7 A;  3V4W A;  5AVW B;  5AVR B;  5APY A;  3K3N A;  1FOS E;  3BK9 A;  5LA6 E;  2M67 A;  3VKH A;  1YTZ I;  3HTK A;  5TAO A;  2XAG B;  4M3L A;  4O2B E;  2I1J A;  1GD2 E;  3P8C D;  2WWW A;  2Z5I A;  3WMM 0;  1GL2 A;  2X9Y A;  1XTC C;  4PAG A;  4C90 A;  4DND A;  1ZLL A;  2J59 M;  2K9A A;  1PFI A;  2XTL A;  2N2N A;  2X66 A;  3SWF A;  5L3C B;  3O9X A;  3UIA A;  2W63 A;  1HF8 A;  1Z0P A;  3N5L A;  4IGU A;  5FXX A;  4O8S A;  4H9S E;  3N9L A;  2Q3I A;  1ZHC A;  3ZC1 A;  5FXV A;  3TSI A;  2BDE A;  4WW0 A;  2R32 A;  1VRB A;  5LJN A;  4Y99 B;  2P67 A;  4C91 A;  4ADZ A;  3Q2M A;  3VMZ A;  2IX7 C;  2XNX A;  3V5U A;  3E22 E;  1FJP A;  2LHN A;  5L3D B;  1CI6 B;  1URQ B;  1KFN A;  5LHH B;  2OYH A;  4AKI A;  4BAY B;  2V7M A;  2L3L A;  2D5U A;  2LOS A;  3JC6 D;  2R3C A;  4TN7 B;  3QUJ A;  3EFG A;  3IFM A;  5BMV E;  2WM9 A;  4QWN B;  5DJQ C;  5AW0 B;  2KT9 A;  3ONX A;  2DI4 A;  3U78 A;  4EIJ A;  3BQL A;  2WSE H;  1KNZ A;  4EOZ B;  5JR9 C;  1G1J A;  1WYB A;  4I2L C;  3G3Z A;  2V7J A;  5L3E B;  4AQF A;  1LTB C;  3KFW X;  4CI1 B;  1KK7 A;  1HTJ F;  1RF1 A;  2JJL A;  4CI2 B;  4MBQ A;  3L4F A;  1WRG A;  4L0R A;  3AB3 B;  5CJ4 A;  2HPC B;  1URQ D;  4HTE A;  4ZOL E;  2FFD B;  2LKM A;  4H9P C;  2NW8 A;  3KIN B;  2YO3 A;  1L4A B;  5HAX A;  1M1J C;  2E42 A;  1N73 A;  2YKP A;  2YK0 A;  3N9Q A;  1NAF A;  4ILU A;  2JJ9 A;  3RK2 B;  4X1Y E;  3RRC A;  1IFM A;  5CCG C;  3ANW B;  2FXM A;  4OYK A;  3K3Q C;  4H9N C;  2KSJ A;  4N78 D;  1FZC A;  2X9X A;  1X9V A;  4UV8 B;  3N2G E;  2MBG A;  1Y64 B;  3N2O A;  2KIN B;  1MIW A;  2VB6 A;  4EYY R;  5KJ7 A;  1IJ5 A;  2V1D B;  2JRK A;  1SA0 E;  4NUU A;  3V2N A;  3ZMS B;  2X0L B;  5E0O A;  3OKQ A;  3I9W A;  3P7K A;  2YNY A;  3TNU A;  3DJB A;  1BR4 A;  5CCH D;  2J1D G;  1JO5 A;  1MND A;  5JVD E;  4OK0 A;  4YFS A;  3KVB A;  2ZXE B;  1YW0 A;  3O1H A;  1SVF A;  2QGS A;  2W00 A;  4P09 A;  1NO4 A;  1LTJ B;  1Z56 A;  4A56 A;  1IZN B;  2N1T B;  4PJN A;  1VDF A;  4L5G A;  5APV A;  2ACX A;  2XZR A;  3KV9 A;  3I0Q A;  4WBN E;  1HFA A;  1LTT C;  5LGT B;  2NTY A;  4O4H E;  2D0T A;  2NWB A;  2VWA A;  3HUS A;  4PW8 A;  2C0S A;  3D0T A;  2KXP B;  1GK4 A;  3CKD A;  3H6P A;  2BAS A;  4XE5 B;  2Q9Q D;  3LK4 2;  3CVR A;  3UUN A;  5JDN A;  3K3O A;  1YKE B;  4N78 E;  3GN5 B;  3JC6 C;  3DP7 A;  1N2D C;  1D0X A;  3L3P A;  4GK5 E;  2N1T D;  3B8E B;  1GZL A;  4H9R C;  2UXN B;  3C4X A;  2FKW B;  5AW8 B;  2ZM0 A;  2XKM A;  3LK2 B;  3KV5 A;  1N7S A;  3UUX B;  3MJX A;  4WBA A;  3FBZ A;  5CA0 E;  5CA1 E;  5M4Y A;  1NOH A;  3HKD E;  5DAB A;  5IYZ E;  4HE8 A;  2KP8 A;  1ZKE A;  1X79 B;  3A7O A;  2A72 A;  4PK4 A;  1QL1 A;  1ZR4 A;  4O9B A;  3P7I A;  4PK5 A;  2PG8 A;  3PU3 A;  2IFM A;  1A02 F;  1FIO A;  5H6Q B;  2D2S A;  4IE6 A;  4DBR A;  2O1J A;  4IDZ A;  5FXW A;  1DX7 A;  3AA7 B;  2GUS A;  2WMN A;  2K24 A;  5JDF A;  4YHJ A;  2ZMA A;  3FBL A;  5HXC A;  3AA0 B;  4EZ4 A;  1JTH B;  3HI2 A;  3PTR B;  1X8Y A;  3DTO A;  5JR9 B;  5HXE A;  2WT7 B;  5ETW A;  1M7L A;  5APU A;  1S9K D;  4UEL A;  3UUM A;  3V2P A;  2V26 A;  3VMX A;  1LT9 A;  3GHG A;  2V7L A;  4Z8X A;  5JDM A;  1D1A A;  3IR9 A;  3N4X A;  2YO2 A;  3OAK A;  3V5S A;  5JDG A;  2HG5 D;  3LFM A;  5GON E;  1HBW A;  5APS A;  5CCH C;  2LSY A;  2NW7 A;  1GW4 A;  5AW9 B;  1H89 A;  4LC1 A;  3T97 A;  1M1J B;  4ERR A;  4YJ2 E;  2JMK A;  1MMN A;  1CI6 A;  5EK3 A;  4EIW A;  2KLV A;  3A2A A;  2OYI B;  2RA1 A;  4TUY E;  3FB2 A;  2QA7 A;  2E9X A;  4EXT A;  3M65 A;  3UFE A;  3EUH A;  5EK2 A;  1H8A A;  1KZU B;  4AQR D;  3BRT B;  2JEE A;  2XDJ A;  4UV9 B;  3KV6 A;  2BZB A;  3KYQ A;  1NWM X;  4HYT B;  4I4T E;  1SFC A;  4AUW A;  2X67 A;  2CM0 A;  3RC3 A;  5JRE A;  3ZJ2 A;  1LTA C;  4AQG A;  2E8I A;  4KUM B;  1IFN A;  3RK3 B;  3HRN A;  1LWU C;  4RES B;  5JRC B;  3V5B A;  1XTG B;  1D0Y A;  3I1A A;  4JEH B;  3LBX B;  3MZK B;  1HUC A;  3HL6 A;  2Q9Q C;  5AVS B;  2LEH A;  2KND A;  3I9Y A;  1FMV A;  1GK6 A;  3N2K E;  3L09 A;  1IJD B;  2LT3 A;  4FI5 A;  4KHX A;  2HPC A;  2FFD A;  1D1B A;  4PJM A;  2LSK A;  3RH3 A;  2N1T C;  1S9K E;  4H9O C;  1L4A A;  1RE3 A;  5APT A;  5KMG P;  4DOJ A;  4LGD E;  2YKO A;  2CCQ A;  5LBQ B;  1W2E A;  2ZFC A;  2Y6X A;  3PE0 A;  1CW5 A;  2MYS A;  3J9X 1;  3WI3 A;  3LK3 B;  3OJA B;  5ADX L;  3RK3 D;  3ANW A;  3CL3 D;  2Q5U A;  3L36 A;  3ZMZ B;  2Z5H A;  3PUR A;  3CX8 B;  3AA1 B;  3ETU A;  1FZB A;  1EQ7 A;  1T8Z A;  2MTQ A;  1V9D A;  2OYH C;  2W27 A;  4UF0 B;  4EAH A;  4WB4 A;  2VAS A;  5AW1 B;  3RKO A;  3WAJ A;  5JDH A;  3R2P A;  2W62 A;  1HVV A;  4ZHQ E;  4UVC B;  1US7 B;  1BR1 A;  1NTK K;  3TYY A;  1MUU A;  4AYC A;  1IK9 A;  2I59 A;  3UT5 E;  3IEE A;  2FYZ A;  5LGU B;  4FJO A;  5KTB A;  1JCD A;  3MTU E;  1KIL D;  3BVH A;  1GTW A;  3AAI A;  4ZKU A;  3ZYK A;  4W80 A;  3R6N A;  1SQX K;  2Q9I A;  5LG4 A;  2CWY A;  4CXX A;  4MHC A;  3M0D C;  1RE4 C;  5APW A;  1N73 C;  3ZJ1 A;  3NBX X;  4AXP A;  4B6X A;  4QX8 B;  3HE5 B;  3GN5 A;  2N9B A;  4UEM A;  1G8X A;  3VP9 A;  2IC9 A;  3VMY A;  5BU8 B;  2HFE D;  5LHG B;  4WNK A;  2QM8 A;  3PUG A;  1LRZ A;  5CHX A;  2PP6 A;  1YKH B;  4HEA A;  1IAP A;  4EOT A;  3F2E A;  2CXL A;  3RYC E;  2LHR A;  4YJ3 E;  3PUS A;  2WZ7 A;  1DEB A;  2H8P D;  2J58 A;  2NPS D;  3KDP B;  3WAK A;  4I50 E;  4G2A A;  1X79 A;  5EK4 A;  1UX5 A;  1WR6 A;  2OYI C;  2E43 A;  1MFZ A;  3UUL A;  1T98 A;  3MKD A;  4V1A v;  4ZS3 A;  2WPS A;  3U59 A;  3H37 A;  4P0B A;  2VKJ A;  4E7Z A;  1CSB A;  1H7C A;  1A02 J;  3R84 B;  3Q5X A;  4EYU A;  5F3J A;  3RK3 C;  1JTH A;  1LWU B;  3PUQ A;  4DVD A;  2WT7 A;  2WWU A;  2PAJ A;  2HPJ A;  1KFM A;  1HX8 A;  1RF0 C;  2Q9Q B;  3B5N A;  4WY4 D;  2VK9 A;  3OYZ A;  3HD7 D;  5L2L A;  1AFO A;  2CPB A;  5CB4 E;  1S94 A;  1J1E C;  4C7N B;  2C9N Y;  2EHO D;  2L5G B;  1M1J A;  3GA8 A;  1JY2 N;  4ZS2 A;  2C0W A;  3N9M A;  3HR0 A;  4X20 E;  5CCG A;  1FZE A;  3VHL A;  4OHF A;  3CQC B;  3V2R A;  2XAH B;  2WAU A;  3Q9D A;  1KIL C;  5APQ A;  2JQQ A;  4XBF B;  3P32 A;  1NTZ K;  4QXH B;  3ZN1 B;  1MMG A;  4YLH A;  3BQK A;  2N9D A;  1WRD A;  2OYH B;  2LE8 A;  2ODU A;  3CQG B;  4CQI A;  2ZM8 A;  4P0A A;  2O01 H;  2IW5 B;  2G0U A;  2K48 A;  5JRC A;  4WBO A;  2WBL A;  3N9N A;  3L35 A;  5FXZ A;  1CZQ A;  2YMY A;  1GL2 D;  1QL2 A;  2LSG A;  3U3I A;  2H7V C;  3CWZ B;  1RY3 A;  1IJ6 A;  5KDM C;  1SP4 A;  1EZ3 A;  3FHN A;  2P1J A;  4QXB B;  3O8Z A;  4IFF A;  1ZV4 X;  4W7Y A;  2HLO A;  3VTP C;  4IIJ E;  1HJB A;  3V4Q A;  1WLX A;  4X1K E;  3VP8 A;  3TK1 A;  3H3A A;  1SQB K;  2O1K A;  2X9H A;  1LT9 C;  1JY2 O;  2A45 I;  4JUY A;  3OBV E;  5H6R B;  3GWH A;  2LSI A;  1L0N K;  3VU7 H;  2X68 A;  3E1I A;  3C9I A;  2I1K A;  3TKL B;  5LBM A;  3MUD A;  4IHJ E;  1FU1 A;  2M8R A;  3KQG A;  3RRW A;  3BAT A;  3ZYM A;  2NPS C;  3M9H A;  1YYC A;  2WTY A;  1G2C B;  1N73 B;  4O4J E;  3FXD B;  2MJZ A;  2DWG A;  2CEA A;  3BQI A;  5AVV B;  4UF0 A;  1FOS F;  2E9X C;  1ZEE A;  1JNM A;  1BR0 A;  5DQW A;  3KPE A;  4N3Y B;  3AAE B;  1FZC B;  4TV8 E;  3NTN A;  1IO4 A;  1JCC A;  2KMF A;  1SHZ C;  1JUN A;  4IE4 A;  4UXN B;  5J1G A;  2A45 G;  5IHY A;  1MIY A;  4AKH A;  3ESL A;  3KV4 A;  5HYA A;  1IFI A;  2XV5 A;  3NFQ A;  1LVF A;  3VKG A;  1LTI C;  2XQY A;  4DMW A;  3CI9 A;  1J1D C;  2M3B A;  5AVU B;  1LTG C;  5KLV K;  4WY4 C;  2C5K T;  2YEV C;  3SRZ A;  2WSF H;  3QC9 A;  3HD7 C;  4ZI2 D;  3AVS A;  1URQ A;  5LJM A;  1IFJ A;  3B13 A;  5LNK A;  4OYJ A;  2WSC H;  3PP5 A;  3E0Z A;  2GK9 A;  3KBU A;  2EHO C;  4GOU A;  3IBP A;  2KYV A;  3M9Q A;  3ZMU B;  5AW7 B;  5FMN A;  5KJ7 D;  4HN9 A;  5LXT E;  2FYU K;  3HE5 A;  3C4W A;  3MD0 A;  2UXX B;  4UIG A;  1GW3 A;  5HXR A;  3Q5W A;  5AVY B;  3RL0 C;  2CXF A;  3ZLI A;  3MXZ A;  3AA6 B;  2KZ7 B;  2B1E A;  3H32 B;  4JF7 A;  2C5I T;  1VPC A;  2Z4E A;  4PJL A;  2CLY C;  5AW6 B;  1MIV A;  3EDU A;  1D0Z A;  1U4Q A;  3NZQ A;  2YKQ A;  3ZMT B;  4IFM A;  1JY3 N;  5AVZ B;  1O3X A;  4F6R C;  4JYB A;  1WT6 A;  1J1E B;  4O2A E;  5CCH A;  4H9Q C;  3VOP A;  1GL2 C;  4HKA A;  3U1C A;  4U72 A;  2IAK A;  5L3B B;  1FMW A;  2KLQ A;  3P8M C;  5LHI B;  4BJM A;  1JMM A;  2JPF A;  3N7N A;  1HGV A;  4H63 V;  1LVK A;  1N7S B;  5KX5 E;  2X51 A;  3GMI A;  5JDQ A;  4MLK A;  3A3Y B;  3AAA B;  2A3D A;  1KIL B;  1MZ9 A;  1UCU A;  3O1I A;  4W7Z A;  3N9P A;  2CA5 A;  2QM7 A;  1NU1 K;  4JYC A;  5FY0 A;  2N1G A;  1J2J B;  3E08 A;  1B7T A;  4IE7 A;  3RC8 A;  4M1P A;  1LWU A;  2P9B A;  5A1L A;  3KVA A;  5LP6 E;  2VKO A;  2SPC A;  2HPL A;  1HH0 A;  2A45 H;  2Q9Q A;  3ETV A;  3CLQ A;  3C98 B;  1HCI A;  2R5D A;  2XU6 A;  4QKN A;  2DHR A;  3HKB E;  1JY3 O;  4TX5 A;  1LTJ A;  4C7N A;  4CXY A;  1N7S D;  2CE7 A;  3T8O A;  2N1T A;  3RYI E;  4EB6 E;  3CPZ A;  2LSJ A;  5JH7 E;  2XAQ B;  4AQF C;  4GIW A;  4IST A;  1LT9 B;  3GHG B;  1RF1 C;  3N9O A;  2VL8 A;  1E5W A;  2IC6 A;  5AW5 B;  3BRV B;  1YTZ T;  2Y8D A;  1N7L A;  3LIE A;  1E1H B;  4ZI7 E;  2NPS B;  2CMR A;  4I43 B;  4I55 E;  4GYR A;  4ZI3 D;  2DWK A;  3LJC A;  5JDL A;  3L37 A;  4ZI2 C;  3F31 A;  4ASK A;  2KWI B;  2V7I A;  1JY2 P;  1NH4 A;  2H3R A;  2E9X B;  2W6B A;  2WPQ A;  2V7K A;  3HE4 B;  3MAC A;  1FZC C;  1QUU A;  4L9I A;  2IFN A;  1ZN5 A;  2WIT A;  3PU8 A;  1SFC B;  3C50 A;  5KJ7 C;  2Y48 B;  4G63 A;  5APX A;  2VKH A;  1NKN A;  5HWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...