4N78D

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
529
structure length
202
Chain Sequence
HTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRSDARSVLLEAIRKGIQLRKVEEIENDVATILSRRIAVEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
total genus 57
structure length 202
sequence length 529
ec nomenclature
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78D01
1.20.58.1570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4n78D02
2JEEA 5BU8B 4O9BA 2POHA 4N3YB 3C9IA 3U59A 1X79B 3VP8A 3HRNA 4I1LA 1IC2A 4N78D 3VP9A 4GIFA 3N7NA 3U1CA 5BU5A 3BATA 3P8CD 3N4XA 3U1AA 5BVZA 4ZKPA 3BASA 4ZKUA 5KTBA 2FXMA 1WT6A 3OJAB 1NKNA
chains in the Genus database with same CATH superfamily
2BCCG 3Q5XA 4GKKT 5DJUB 2CWOA 3M91A 2KLVA 2K9AA 5L4EA 1EDLA 1NAFA 3G6EP 1IC2A 1X9BA 1ZMEC 2KNCB 2FYUJ 3ZYLA 1HTLC 3OYXA 4U7YA 1YW0A 2DHRA 1LTJA 3OJAB 2Y6XA 4ZOLE 2XQ4A 1ZLLA 3OA7A 3Q2YA 5TISE 1Z8UA 3TNUA 1BCCJ 5AW6B 1JY2O 3L35A 1R5SA 3HRNA 4W7ZA 3RIAA 2HHHT 1W0AA 3Q9DA 4TN7B 1HJ0A 3A2AA 1KQSO 2JJ9A 3VMZA 3L71G 4WY4D 1KTMA 2LKGA 3KV6A 1T3JA 3ITKA 1N86A 2H7HA 3L3PA 4KHZF 5AQPB 3KVAA 3EFGA 1BSNA 1ZRTE 3A3YB 2NWBA 5FY1A 1JM0A 5JRCA 5KX5E 1EZVE 2V7MA 3ZC1A 2N1TD 2V7LA 1VQMP 4GKGA 1NH4A 5JR9A 3TNUB 5B5EE 2SPZA 4AQFC 1OMIA 1FDOA 3M0DC 3H1IE 5CMZA 2W62A 4H63V 1KK7A 2AXDS 2P2UA 4L0RA 4EEBA 1M56D 2J5UA 4H13B 1BR2A 3RYCE 3MP7B 1CUNA 4UVBB 2A72A 1BE3G 3P4WA 1NTMD 3C50A 2Q7CA 3VP8A 1Q7YQ 1JEKA 3T1HT 1JY3N 4WVZA 2IPPA 3VMXA 3L73D 1E79H 4OWFA 5KAFH 1ZN5A 1N32T 1J1DC 3DJBA 4I2LC 4A5XA 3HE5B 3L70E 1LT1A 3CX5E 4YHHT 2V8SV 2ZLYA 1L0VA 2JQKA 3BQIA 4PJNA 2WZHA 3IEEA 4OGQB 2A45G 1LT9C 2IZ0A 2QSIA 2E74B 2BBHA 3AEBC 2AXTH 1X79B 2E75B 5CCHC 3B13A 3PUSA 1LTTC 2JDIH 1S35A 5KLVG 2LEHA 3F5HA 1SQPD 1JY2N 1IFNA 3AE5C 2XTLA 2Q1KA 3HR0A 4UB6E 4WYVA 1E5WA 4CZZB 4DR2T 2OTJP 3HKDE 1SQXD 1HX1B 3VN0A 2C0XA 2W27A 3CC2P 4OYJA 1ZR4A 2UUAT 3UTKA 1KYOD 2A3DA 4YTPA 2WMNA 2VK9A 4EXTA 5LXTE 2Q9IA 3TSIA 5HXRA 4JI8T 5AQTB 1S3JA 2Y8DA 2KS1B 1ZR2A 2V7JA 3UULA 4QX8B 3WAJA 2ES0A 3CMAP 3FZHB 1LT9A 3H1HG 3AXJB 2BKOA 1NHLA 1HS7A 4DMWA 2HR3A 1M7LA 1X9VA 3P8CE 4RKUJ 4O4IE 1WRGA 5EK2A 5LHHB 4DZOA 3QWOC 3H1KG 4H0LD 2BDEA 1K73Q 1P84I 2CXLA 4AQGA 1W5CE 3IF8B 1SQQJ 3AAEB 5KXJA 4U7IA 1S5LE 5K5GB 2JO1A 4GIWA 1N8RQ 2VB6A 3RI5A 4CN4A 3KBTA 2JQQA 1NTKK 3L72E 5DJTB 1WR6A 1YIJP 4IE7A 2N1TB 3AE9A 1BE3D 3U78A 2BCCE 3NBXX 3M0DA 2W2UA 4NPPA 1JY3O 1WYCA 3MUDC 2W6JH 2I6HA 5LNKA 1OIPA 4YTPC 1LTGC 1SQXG 2CPBA 4IE6A 1G1IA 3R2PA 2KT9A 3HKBE 5JR9C 2KLQA 3RRWA 1XNQT 2MKVA 4XFJA 2D0TA 3V4WA 3ZJ1A 4KJMA 3U3IA 4EIJA 3FWNA 1BCCE 5CFBA 3R84B 2W8ZA 5LHGB 2P1JA 1PP9J 1NYHA 1RY3A 2WP9A 5KKZB 3OPCA 5FMNA 3GG2A 2XJ7A 2K9JA 3GF3A 5CCHA 2HPJA 3L8RA 1EDJA 4O2BE 4I43B 1JUNA 4WB4A 3SOLA 2CLYB 4D6TD 5EK3A 5AQLB 5LOVE 4CXWA 1ZOYC 2XKMA 3LIEA 2X0HA 4AQYT 4GK0E 3N2KE 3B8EB 4HKAA 3T97A 3P4PA 1FEWA 1KQLA 2X9WA 3ETVA 3RGLA 3NXSA 1X0TA 1LP1B 5LYJE 2DNXA 3RKGA 1YJ9P 4O8SA 3RPUA 2NRGA 3PUZF 4AKIA 4Y28J 1JTHA 3K3OA 2V6YB 1CI6B 2FJBA 3F89A 3I56P 1NU1K 1BE3J 1X79A 1HUCA 5CJ4A 1EDIA 3VKHA 4YTNA 4BJMA 2WB5A 3A8YC 3CMLA 4TUYE 1XMOT 4PJ0H 4UIGA 1PGPA 1MUUA 4DBRA 1NU1E 1NTKD 1NWMX 2Q3IA 1NGMB 4AQFA 2NPSC 2M8RA 3GN5A 3G71P 3Q5RA 3CWZB 1J1EC 1ZV8A 4QKNA 3ZMSB 3PTZA 1IJ6A 1SFCC 4QXCB 1ZEEA 2J4GA 1OZHA 3A5XA 4BJNA 3K1SA 3L75D 2O1KA 1KNRA 4RJTA 5LP6E 1L0LE 2C9LY 2ZT9C 2AE9A 2B1EA 5FXVA 3ZMZB 2KZ7B 1USEA 1GL2D 1M57D 3ONXA 1KB9D 3RQUA 3ZC0A 2N1GA 3KXDA 1AJYA 2CHNA 3UIAA 1SQQG 4U3CA 1FU1A 1L0ND 4X62T 2LHRA 1RF0C 3V5UA 4I7ZC 3KDPB 4ZHQE 2BASA 1K8AQ 3BVHA 1MMGA 4B86A 1FIOA 1W2EA 1OEDC 1GW3A 3I5CA 3WAKA 4ZNCA 2HN1A 4N78E 1YTZT 4ZMDA 1GK4A 1MMDA 3VR8A 5BU8B 4JF7A 3O1IA 3QB5K 5APSA 2YKPA 3AE3A 3JC6D 2FYNB 2KNCA 1M1KQ 3OBVE 3M3ZB 5AW2B 3AAIA 5KDMC 2W83C 4IFDK 1KZUB 2OARA 1UCUA 2LSGA 3UU4A 4LMJA 3QNUA 3TLTA 5BVZA 3A0BE 1EXJA 1E1HB 1HNXT 3E1IA 3C4ZA 2OYHC 5AQKB 1Y47A 2BCCJ 1LJ2A 2W90A 2P67A 3M0AA 3OAKA 3LW5J 2H3RA 3G9RA 4LF5T 3ONLC 5KJ7C 1NTKJ 3RYHE 1XNRT 4CN1A 1N73A 1PGJA 2EHOD 1ZP0A 5DJQC 3R4YA 1ZHCA 5AW7B 1NU1D 3PDYA 1LNQA 3FXEB 5ABEA 3HE5A 4ZEYA 2A06G 2I1KA 4P09A 5FY0A 3L73G 2EHOA 2XNXA 2J59M 2K5BB 1Y64B 3EUHA 2WSCJ 2Q9QA 2YXRB 4YXDC 5HCJA 5H2FH 3AVRA 3QB5A 3TLSA 2BZBA 3HKCE 4YFSA 2BKPA 4CQIA 3BQKA 3U59A 5HXSA 1S9KD 1YI2P 5LJNA 4IE5A 3LBXA 3CCRP 1KB9E 1T6AA 4ISTA 5GTHH 1LTBC 4U3FE 4P1NA 2ZVNB 3GHGA 2VQFT 1N73B 4IDOA 4X5TA 1PIXA 4D6TJ 1UIXA 2QM7A 4ZI3D 3IBPA 2NR4A 3HUSA 3CD6P 3ZT6A 4I55E 4P0BA 1OW7A 1XWMA 2MBGA 2OV9A 1G2CB 3HD7D 1OWAA 4E7ZA 3H37A 3KV5A 3B71A 3HUSC 1FJPA 5LBMA 3CCLP 4TLFA 1W2BO 3FWLA 3HKEE 3VP9A 2QJPB 4K3AA 5AQOB 2E74D 1SHZC 5GTIE 4KUMB 2JPFA 4OGQD 3F2EA 3HD7A 4HEAA 1LTSC 2XM1A 2ZT9D 4DO0A 4IT4A 5KJ7D 2XHEB 5AVWB 2QYWA 4IE4A 3VRBA 5FY7A 1RE3A 2HG5D 3NZPA 2MYSA 3KYQA 2EHOC 4HB1A 3KQGA 5JDLA 3AAAB 5LB7B 3E0ZA 4UV9B 4DBQA 4A56A 1AQTA 4H9QC 2DI4A 2E5VA 1NU1G 4BXLA 4I4TE 2L9QA 3CWBD 1VQ8P 1BGYE 4B3TT 4HFIA 2D5UA 1T2KD 4IREA 1MIWA 2WITA 3CX5I 3SS1A 1TU3F 2IBZG 5E79H 1FZAA 5FXZA 2X9HA 2V7KA 1SQBE 1T3UA 4ZZCA 2L8KA 4WBOA 5CCHD 5JQGE 3H1HJ 2X9XA 3WI3A 1HNWT 3E7KA 1YJWP 4COFA 2QGSA 4DV3T 1J2JB 1J1JA 2FUPA 1N36T 1SQPK 3NKZA 3WMM0 3MD0A 2XAFB 4IFFA 2XQ9A 2JMKA 2KXPB 3L74E 1OEDA 2AEFA 3Q5WA 4HTEA 3TLWA 4H13C 2E5YA 2NOXA 4FJOA 1PGOA 3AE8A 3MXZA 3EQ2A 2K88A 1T72A 3VMAA 3BK9A 2BG9A 4LF4T 3IAOA 3ANWB 4KP3C 2LLYA 1UUSA 1BCCG 1EZVI 4EOZB 4YT0A 1JCCA 3GW6A 1VQ6P 2M5AA 3FGAD 1KV4A 1Y8AA 2ZJSE 1K05A 1YQ4C 3GMIA 4YPCA 2FJEA 2XAJB 3PJAA 4PD4D 2CPTA 3L72D 3AB3B 3KINB 2BVMA 3P8CD 2NPSA 4ADZA 3N4XA 4GKJT 2FFDC 4EDFA 1JNMA 3PURA 3P8MC 1KILE 3NVOA 4LMLA 2YDRA 1Q82Q 1JOCA 1MMNA 4DR4T 4DV1T 4MN4C 4PJJA 3AA1B 1K9MQ 4JI5T 3GLMA 1VQ5P 3H32A 1KNZA 2FY8A 1RE4A 1DIPA 3AEFC 4UR9A 1H0TA 1SQBG 4X1KE 1HH0A 1N7LA 1B7TA 2LSJA 1MV8A 4Q25A 4BAYB 3HD7B 2OYIB 5C8YE 3F57A 2ZXEB 1L0LD 4ASKA 2ZYDA 2YMYA 2A2FX 3ETUA 4JPZB 4LFBT 1CI6A 1YBKA 2O01H 3LJCA 3CMEP 3EDUA 1SQBD 2E42A 2HODA 2PGDA 1PP9E 3IF4A 1SQBJ 1NTZG 2DLRA 2XV5A 1R8IA 3ZPOA 1XZYA 2B89A 5CGMA 3RKOA 4DV6T 2LR2A 2XQ5A 2CWYA 1VF5C 3RC8A 1ZOYA 1KFYA 4QH1A 2R32A 2XQ3A 4KHPT 1JMBA 5AQQB 3V2RA 3UT5E 3UUMA 1KYOI 1N7SA 2V7QJ 2XU6A 3HTKB 4PW8A 5C2TA 1SS1A 3P7IA 4YLHA 3RF1A 1PP9D 1FJKA 1CHUA 3I9WA 4DMVA 1LWUB 2G0UA 1VPCA 1T2KC 4X1IE 3TF5A 4U3FJ 3A7OA 4UB8H 2KOGA 3NMDA 3VMYA 5LGTB 3OJAA 1SQQE 2D2CD 3L75E 3F31A 3RK2C 3WUUA 3ZLIA 2FBWC 3JADA 4TT3H 3L70G 2FYNC 2OQQA 4H0LB 2CBIA 3AE9C 2X68A 3OKQA 2IBZI 4IHJE 2ZM0A 2ZVOB 3H1LG 3ZCJA 3CCVP 1IBLT 2LM9A 2Y9ZA 1W0BA 3ZCIA 5F5WA 2WQYA 4DR1T 1PZQA 4AKHA 1VOMA 1XDPA 3Q5EA 4K0UA 1H0TB 2IYOA 2IYPA 4O2AE 1NTMK 5C3JA 1NWQA 4DIDB 2CCQA 5C39A 3PRJA 2VRSA 3LBXB 1FZEA 4LFCT 5AQIB 1DEEG 1IFDA 1NAYA 4H9SE 4IIJE 1SQVJ 1BCCD 2Q6QA 1AJ3A 4YSXA 3TGUJ 3LK3B 2OTLP 1FJGT 3JSVC 1HWTC 3EAMA 1P84D 4U74A 1CW5A 4GOUA 3RBZA 5APTA 2IHR1 5CBOA 2QVAA 4OX9T 2A06E 2V6XA 4U3FD 4UVCB 5TJHA 1FOSE 1WMKA 1NU1J 2KI7B 2YOEA 2BS4A 1FDIA 4WY4B 2N1TA 4JI6T 4C7NB 2VVNA 2MTQA 2VWAA 5FNVE 1Z56A 5IWAT 1QL2A 3B5NB 1LT9B 3AXJA 3AEBA 4LMKA 5HWYA 2XNDH 3EWKA 3UU6A 1X22A 4G2AA 4IL4A 2OYIA 3RK2D 4WWIA 3S4UA 4CI1B 2Q5UA 3AE4C 1YKEB 4KX6A 4N3YB 5AQUB 3FBZA 2R3CA 4N6JA 1VQ7P 3V5BA 2GUSA 4JLEA 1HF9A 3PUGA 4HWDA 2PFXA 1SFCD 3O6QA 5HEJA 4MBQA 5AVVB 3RL0D 5JTGA 2B87B 2QJYB 2L3LA 4F6RC 2OGUA 3L72G 2WDVA 1VQKP 4HFCA 1D1AA 1NTMG 2KMFA 4AI6A 5HEGA 2E76B 3SWHA 4X66T 5FXXA 1KFNA 1WFDA 4UELA 5H6QB 4AISA 1LVFA 2UU9T 4B3ST 4L5GA 4XA4A 2OYOA 5DQWA 5J1GA 1J1DB 1DX7A 2XQ7A 3WU2E 4OVNF 1L2PA 4PD4I 4ZS2A 2E5LT 3CX7B 5L8RJ 3H3MA 3BRVB 2BBJA 5L47A 3FX0A 3C51A 1IO4A 5EFWB 2H88A 2YO3A 4TX5A 1NO4A 2CXFA 1UGOA 1GU5A 5CCGD 3ZSSA 3MHVA 4X65T 1CZQA 1NTZK 3ZMTB 1KD1Q 4DV4T 1HFAA 5JR9B 1YQ3C 2FYUE 2R5BA 4L76A 3S9OA 2HPLA 1HCIA 3H3AA 3C4XA 3ZMUB 1XMQT 1IZNB 4IDZA 1ZKEA 2FYZA 2V7IA 1N7SB 4AKRB 2BEZF 4ZXLA 1LTJC 2FYUK 5H2FE 4IDNA 4UVAB 1BGYJ 4CN6A 3D6ZA 1GZLA 3L71J 3SFEC 2WY2A 2XAGB 2YINA 4ZS3A 1MIVA 4IL6H 2NTXA 1KN7A 3RL0C 2LOSA 2WSSV 2VQET 5A1LA 2UWJE 4HKZH 1KILC 2NTYA 3TK1A 3L70D 2LE8A 1S2EA 3H1JE 5KMGP 4PV1C 1PFIA 2RP4A 5AQVB 4ILBA 3AE2A 3LW5H 1VL2A 2XDJA 2FXPA 2E9XB 2L5GB 1BE3E 2FKWB 3VYIA 3N5LA 5L3FB 3II6A 4PV1B 1D0YA 3RGUA 3FZFB 1VRBA 3H1LE 3ANWA 4KHXA 2XQYA 3J7Yq 1G8XA 4NUUA 5LGUB 3H1KJ 4IDQA 1YYCA 4IOIH 2HPCA 1RF1C 3JCUE 3FHNA 4JBZA 4PJ0E 2X51A 3V4QA 2Z6EA 4HGAA 2I59A 3C98B 3P50A 1T7SA 2KWIB 3H1LD 2G3AA 2QJKC 3NZQA 4YJ2E 1K04A 1GK6A 1LTJB 3FXEA 3M9QA 2HN2A 1S1CX 4C91A 1VQPP 3G06A 3AEDC 3TLVA 2J1DG 3P4RA 3P32A 2KIKA 3CCSP 2KK7A 2A45H 3L71E 3SWYA 3IR9A 1RQUA 4ASWA 1KILB 2MJZA 1NTZE 3AEEA 2JEEA 2GM4A 3SFEA 1SQPG 3KVBA 2C5KT 3ZT7A 2E9XC 3UQ7A 2W61A 4TNVA 2VKJA 5HXEA 4KI0F 5HEHA 1FZBA 1M1JC 2O3JA 4JI2T 3V6IA 4DCKA 2BS2A 5LMNT 2WMMA 1KILD 2I8DA 2BCCD 2GUVA 3QC9A 1Q86Q 3AEAA 3ABVC 1YQ3A 5APVA 1NKNA 1L4AA 2W67A 1V9DA 2KLUA 5CCGC 1OFCX 1T8ZA 1JTHB 3O6QB 4O9BA 2JMHA 1MMAA 3H1JJ 2HLOA 2WCAA 5CA1E 2V26A 4HWHA 1RQVA 3MACA 3L74J 5KLIB 4XZCA 2R3SA 3JC6C 4TNWA 3RC3A 4O4HE 2H43A 3A0BH 2CBJA 2HYNA 2H88C 4JUYA 4TWDA 4GOFA 2H7VC 1EDKA 4ILCA 4PFOA 3PU3A 4K35A 1NTKG 2CRBA 5ABGA 3P4QA 2HH7A 3Q3DA 5L3CB 1YTZI 4OFZA 1L0NJ 2D9DA 4GK5E 2RN0A 1KQFB 2ITAA 3P7KA 4L9IA 2LRLA 3H1JG 4PAGA 5AW8B 1H88A 1L0LJ 1URQA 2JWAA 3H1LJ 4PV1D 3AE7A 5FP3A 2XUEA 4IL6X 4GYRA 5FVLA 1XTGB 1MKMA 1D7MA 1H89A 2JIWA 3BQLA 5L4HA 3RIUA 3UFGA 4TZ4C 2X9YA 3RRCA 1GL2B 4LC1A 3QUJA 4IGUA 3AEGA 3D71A 1NEKA 3AE4A 3RX6A 4WY4C 1ZW0A 2XZEA 2OYIC 4A97A 3AE1C 3KPEA 2W6AA 2FYUG 2XQ8A 1SUMB 2KINB 3AECC 2P7JA 3MK7C 1DEBA 2I1JA 1IJ5A 1AV1A 3G3ZA 2A45I 1BGYG 1BSHA 1T8BA 5JDMA 4HN9A 4XBFB 3C8VA 4X20E 1KQGB 3CIRA 4DV5T 3T1YT 1QSDA 2BEQD 3PUAA 2D0UA 3H25A 2N1TC 1Y9BA 2E5TA 3A0HH 3MKDA 5BU5A 5F3JA 4L73A 4W80A 1SQBK 2E2AA 1GL2A 2WTYA 1KC8Q 4Z1MH 1HX8A 1L0NE 2Z5HA 3CI9A 2Z5IA 3WU2H 2XSBA 3MGNA 2W00A 3MA9A 4JEUB 2WSSH 3NRXA 1AQ5A 2YDQA 3UUNA 4H44D 3KHUA 5ETWA 3S1KA 1H7CA 4PFPA 4H9OC 1SQVD 4MLKA 2KWHA 2IFMA 3O8ZA 4PK6A 4HFBA 3RQWA 5IHYA 2C0WA 4JYAT 2ZYAA 4C90A 2X66A 4QXBB 4NXMT 3RK3E 1PPJG 3FXDB 1EC5A 4UB6H 5GONE 4HFEA 2UUCT 3PJAJ 4HE8A 5APUA 3JCUH 4UEMA 1JY3P 2WQYC 2K3WA 3NRYA 3UUXB 2WWVA 1SQQK 4HWFA 2JKVA 1LP1A 3SSUA 2BG9E 1LTIC 2Y0EA 4TWFA 2K9JB 2XSAA 2WPQA 3SWFA 1WRDA 4C7RA 2DWGA 5LBQB 4DV7T 1QVGO 2FBWA 4A98A 3HUSB 1J5ET 1X8YA 2IMLA 2Q9QD 3D6YA 1Q90D 3RH3A 1N2DC 3ONJA 2K37A 2AXCA 3PU8A 1RH5B 4BRYA 2JQ9A 4IL9A 4JI0T 1DU2A 3ZN1B 1R8EA 3L72J 3BCCG 3AA6B 4NPEA 2Y48B 2PFVA 1U7MA 5CBNA 2B88A 3L74G 4QMAA 2EHOB 2WSFJ 2QEXP 2YKOA 1N7SC 1BR4A 1VQLP 3DP7A 3LK42 3JCFA 2XAHB 4YTMA 5JDFA 3P4SA 2POHA 4RO0A 2IAKA 5JDQA 4OH8B 3NWIA 1HNZT 4LF9T 3CPWO 3K8PC 1L4AB 4HJGH 2M3EA 2OA5A 2W4XA 3N9QA 4YY3T 1YHQP 3ZEFB 4PK5A 3ZDMA 5FL1A 2YDSA 4ZKUA 2XY8B 3GWHA 2WU2A 1MFTA 3CXHE 4GDOA 2D2CC 2BG9B 5LA6E 1EQ7A 4AKLA 1W09A 3PP5A 3HI2A 1U5PA 2VURA 3EI0A 1N33T 3ZYMA 2XAQB 2M3BA 3OYZA 2V7QH 2VKHA 3GN5B 5BR8T 1QLBA 1L0NK 3USSA 1EZVD 2CXDA 1HGZA 1GU4A 5AQSB 1IFMA 5E0OA 4B3RT 2ODUA 3AEFA 2Z4EA 3W67A 1RE4C 3M06A 2ACZA 1FBMA 4OK0A 2OTKE 4ASVA 2WSCH 1LWUA 3K3NA 3GF7A 3Q1MA 2QJKB 2E76D 4DV2T 2WU5A 2W6BA 4HFDA 5AFUL 2PRRA 3H1KD 1YXRA 3IA3A 4DOJA 3PHLA 1YQ4A 4G63A 4YHJA 2M6IA 3U1CA 1U4QA 1OEDE 3CXHH 1SFCB 2FYUD 4U2ZA 4TV8E 3O9XA 2LHNA 4DVDA 3GHGB 4H44C 1EXIA 4C46A 2N2NA 4UXNB 2DWKA 1SLQA 1BGYD 4A7PA 3GMAA 2VL0A 3QK6A 2D2CB 5CJ0A 2BG9C 4PD4E 2XPKA 3M9HA 4EGWA 4L74A 4FI5A 4WY4A 4EZ4A 3B57A 4DR7T 4EZHA 1BR1A 5LG3A 2C9NY 3HL6A 4C7NA 5GTIH 1Y01A 3AEGC 1YKHB 2YKSA 4HWCA 1M90Q 1NVOA 2WMOA 1KFMA 1S4XA 3N7NA 4I7ZB 2R6GF 3MZKB 4GYSA 4U3FG 4UF0B 2FJAA 3IFMA 2H89C 2ZYGA 1GMJA 2KS1A 4X1YE 3MIWA 4XAXB 2YO2A 5AW3B 2VKOA 2NPSB 1S72P 1DD3A 4TWHA 2UUBT 5HYAA 5AVZB 2BVLA 4LF8T 3W15B 5AQMB 3H1ID 1FZCC 5DQVA 4ZI2D 5J2TE 3BATA 5CHXA 5L2LA 2NPSD 3I9YA 4ZKPA 1KB9H 5GTHE 2IC6A 2QRXA 5AW1B 5EZYE 1YD8G 4YSYA 3SFDC 1AFOA 2QJPC 3PV0F 4PJLA 2LM2A 4HH2A 4WBAA 2JR8A 3E08A 5AW9B 1OW6A 3TYYA 2Y0DA 1IK9A 3RYIE 5AVQB 5CCGA 4B6XA 5HEOA 2M67A 2BS3A 1HG2A 2KSRA 3V5SA 1UX4A 4MALA 5ABFB 3KDSE 3N9PA 1HBWA 1RF1B 1LTAC 4AKGA 4BRYB 3RIUC 2ODVA 1QUUA 5ABHA 3B5ND 5JREA 3AE7C 5ABFA 1MIYA 3PUYF 1URQC 4U33A 3L37A 2KB7P 1A02F 5LHIB 5JDHA 2OYHB 2KSEA 5LG4A 1WCRA 2D2SA 4MFRA 3RIFA 1T98A 2UXNB 4GOEA 3KBUA 5L3BB 2N9YB 3CX6B 2E75D 2N9BA 4GT1A 4Z91A 3AEDA 3RBXA 1D0ZA 3GHGC 4H44B 2ZXXA 2ZAEB 2IBZE 3BCCJ 5L3DB 5AVUB 5JVDE 4R4LA 5EK4A 3H1HE 5LMUT 1SQXK 3CC7P 1IFIA 3TGUD 2CPSA 2YMKA 4MHCA 1VQOP 5KTBA 1GDTA 4IL6E 2ZFCA 3HTKA 1NOHA 2WDRA 4JYBA 1WT6A 1PPJD 3LDQB 1HJBA 3UU8A 1L4AC 2PBIA 3K3QC 1KYOE 2WPVB 2V4HA 1D1BA 1ZP0C 2RH0A 3H1HD 1HF8A 3ZJ2A 4UF0A 1N73C 3PLNA 5APYA 1NTZD 4D6TE 2VVSA 2LKMA 4WBNE 5B66E 1M1JA 2MOZA 3FZMB 2YIUC 4U2YA 1Q2NA 1VQNP 4ZI7E 3AA0B 1NTME 1J5WA 5AQHB 4H0LC 3K5BA 3L39A 3PUWF 2O1JA 5AQJB 5AQRB 3AEEC 3EDVA 4DR5T 1QLED 4H63H 3M65A 1SVFA 1KMIZ 3OTOT 4Y99B 1IJDB 1FOSF 5M1BA 1HTJF 3CXHI 3KV9A 3CVRA 2E74C 3MZWB 2X0YA 2WAUA 2K48A 2Q9QB 3C4WA 3VU7H 3PUXF 4UB8E 4CI3B 5J0ZA 4IFMA 2CA5A 3LG7A 5LGNB 4KBMB 5KLVJ 1NTKE 2DCFA 1RHZB 1RF0A 1WR0A 4EV6A 4JI1T 2NW9A 4EEDA 1IFPA 2W66A 5JDGA 5KKZC 1M7KA 4PD4H 3ZMVB 2IW5B 2PTFA 2P9BA 3A5TA 3KZIE 3A7MA 3CQGB 4BA9A 5L3EB 2UXXB 3N9NA 3ZYKA 1GQEA 1QL1A 1WLXA 2ZMAA 3PUVF 4DJGA 3ZN0B 3D70A 1L4AD 3AE2C 2WM9A 3CL3D 2RKLA 3OVUA 4OHFA 2H8PD 4U7JA 2JWDA 2LSYA 1KILA 4R4MA 1G73A 1XTCC 1SQQD 3KFWX 2A9UA 5FL0A 2PG8A 1LVKA 2DL1A 4EYUA 4DR3T 1HGVA 2N9DA 3CCEP 1UIIA 2V6YA 2DW3A 3B4SA 3ESLA 2NZ2A 3L73J 1XDOA 4QH5A 1VCSA 1FMVA 4E7SA 3EHZA 2Y9YA 1OW8A 2W63A 1JNZA 5AVTB 3B5MA 5AVSB 2HPCB 2KNDA 3D0TA 4WZXA 2B87A 4H13D 2WSEJ 2IFNA 2WDQA 3GA8A 4F8HA 5KLVK 1KORA 2QM8A 1I94T 3I55P 5JRCB 4ILAA 3UQ4A 2CEAA 4YSZA 2O01J 3DTOA 1AVOA 2XASB 3L75G 2VASA 5KAIH 3E22E 2ZM6T 5KLVE 1HVVA 2LJLA 3T97B 1G1JA 2QG4A 3PH0A 5LCYA 4LF6T 5AW0B 1Z0PA 2CK3H 1D1CA 4QX7B 4ILUA 1FZFA 2IX7C 3C64A 4NXNT 1USDA 4YXWH 4D6TG 2IDBA 3SFDA 2NW7A 2HODB 2YXQB 2QA7A 3H1IJ 4JI4T 2Y0CA 1MFZA 3L4FA 2FFDB 1L0LK 1BR0A 1M62A 1G2CA 2C5JA 2IZ1A 2XZRA 1KNPA 4O4LE 4LF7T 4JBWF 2VKDA 4AQRD 4EB6E 1A02J 1FZCA 3VHLA 4AIUA 3MUDA 4HWIB 3N9LA 1ZRTD 4P0AA 4NUVA 1R5LA 2K24A 1W9RA 4NPFX 2KYVA 1NENA 3N2GE 4I0UA 4M1PA 2LXBA 1SE7A 2V5DA 3EABA 2WPSA 1FZCB 2SPCA 2GA1A 1U7JA 5JH7E 2H89A 3C9IA 4ERRA 1D0XA 3L75J 1M8OB 5CB4E 4U72A 1CSBA 1VQ9P 3UFEA 1VCTA 4QWNB 3KZIH 2PP6A 2ACXA 2YK0A 2QE7H 5TAOA 1IBKT 1UURA 1VF5D 1EZVG 1N7SD 4ANJA 2JQHA 5IYZE 4LGDE 4HFVA 1KB9I 3PJSK 1FE6A 2RA1A 5AQGB 1QGKB 3C1LA 4JEHB 3RYFE 3L09A 4OYKA 3FZKB 3BCCE 2CE7A 1AVYA 2WS3A 4O4JE 3CX5D 3VR9A 2IDOB 2CHOA 4DUZT 1VDFA 2K9YA 4EI2A 1NKZB 1OEDB 5KLVD 4AXPA 2MPKA 3RK3B 4HYTB 3AE5A 3LSVA 2UXBT 2UXDT 4M3LA 1IK7A 2AXTE 3CCJP 3BCCD 5BMVE 1LWUC 1JNRA 5CA0E 1I6ZA 5AVRB 5J2UE 3L74D 2W0GA 1SQVG 2V1DB 3V2NA 4EYYR 4N78D 1PL5A 3X1DA 3ZT5A 3CC4P 4PK4A 1SQXE 2LRKA 3UU5A 3JAEA 3U1AA 4JYCA 2FJDA 4DR6T 5APWA 5AVXB 2YNYA 1DD4A 3E1RA 2LKHA 2HFED 1OVUA 1MNEA 3PE0A 5FXWA 2XM2A 3RLFF 1OXZA 5AW5B 5AQNB 3QH9A 4EIWA 3L36A 4H9PC 3Q5DA 2ZM2A 2LXCB 1VF5B 3NFQA 2K3RA 3H1JD 4QXHB 2V5CA 2C5IT 2NP9A 1KYOH 2AEMA 1H8AA 3H1KE 2E9XD 5AQFB 3L70J 1KEYA 2QA4P 2WT7B 5HEUA 3CCMP 3EVYA 3WUVA 2CMRA 5HXCA 4NIQA 4LFAT 1QEXA 2FFDA 3TKLB 1JB0J 2YEVC 4DT0A 3AVSA 1BDCA 5LJMA 3AA7B 1WYBA 2LSIA 2ZM8A 4YJ3E 1S5LX 5M4YA 4JI7T 2OLTA 1PGQA 1QVFO 4IDPA 2P10A 3RK2B 3J9X1 4GIFA 4CI2B 5HXHA 4KMCA 3IHRA 2WZ7A 3N9OA 1URQD 4Z8XA 2E8IA 3T8OA 2YIUB 1QX8A 3W68A 2RPAA 3O4XE 4H9NC 4Y99C 2YN6A 4EOTA 2IBZD 3TLUA 2O01N 3UU3A 3N9MA 3VRAA 3LFMA 4I1LA 2WZIA 5KAFE 2G8YA 2I0MA 4V1Av 3WUTA 4U31A 2WPRA 3CQCB 1ZV4X 2J62A 5B66H 2IC9A 2H7OA 4J2CA 3BRTB 5AVYB 4DV0T 1FZGA 5KAIE 3ZKRA 1GTWA 4ZZBA 1YITP 2JP3A 3RL0g 1KF6A 4WNKA 1NJIQ 1BDDA 3V2PA 2LOPA 2P58A 3L71D 2WBLA 1FMWA 4QHOA 2XQAA 3CQXC 1AA0A 3I0QA 5B5EH 1Q81Q 1GD2E 1N34T 3Q5SA 1GL2C 4L75A 5HAXA 2WWWA 5FVKA 3H1IG 1P84H 3Q2MA 3FZLB 3RHWA 3V2QA 4EAHA 1GW4A 1JCDA 1E2AA 3L73E 4IE0A 3S4RA 3CWBJ 2MAWA 1FC2C 2IIUA 3I0OA 4ISSA 1PV3A 4DUYT 2UXCT 3H6PA 4ZI2C 3AECA 1JO5A 3TGUG 4WW0A 3CWBE 2M6BA 5FYMA 3AE1A 3N2OA 1LKXA 4JI3T 4DNDA 1IBMT 4QH4A 1SP4A 2JRKA 3MJXA 3CX5H 2PAJA 3AE8C 2R44A 2B76A 3O1JA 1U57A 3CX8B 3CLQA 3H32B 2LT3A 3OW2O 2WWUA 1FS0E 4NPDA 1IAPA 4K0KT 2VL8A 1SQPE 3CPZA 3QOFA 1PP9G 2A06D 1MZ9A 3EFFK 2WSEH 2WT7A 1OX3A 2E76C 3VOPA 2J58A 1ZXGA 1YJNP 2CLYC 1P84E 1E7PA 5JDNA 1UX5A 2LSKA 4BWNA 3LIDA 2J47A 3MTUE 4HFHA 4KT0J 3I1AA 1UK5A 5IUXA 2CM0A 3VKGA 3CWBG 1OVVA 1HR0T 3TGUE 1OVRA 1PPJE 3AE6C 2KP8A 3B5NC 2F4VT 2KZJA 3CCQP 2GK9A 1SQVK 3TDKA 3UUBA 4GODA 1JY2P 3PTRB 4JQ0D 4PJMA 4JV5T 4AYCA 3ZSTA 2PJQA 3RK3C 1SQVE 4H9RC 4W7YA 2Q9QC 2YKQA 3FB2A 3CCUP 3PUQA 3R6NA 1L0LG 1NTMJ 1L0NG 2KZIA 1EZ3A 4EYYQ 2AEJA 5F8PA 3JC22 1RE3C 2Q3EA 4UV8B 5ADXL 3SRZA 2B9BA 3HE4B 1S5LH 1FDMA 5KLIC 2QJYC 1NTZJ 3ABVA 3HD7C 3AEAC 3NTNA 3KV4A 1DH3A 4CXXA 4I50E 1US7B 5KJ7A 4LLHA 3B5NA 3O1HA 3AE6A 2WVRA 1LRZA 3CXHD 2FXMA 2OYHA 2E9XA 3G4SP 1SQXJ 2QIWA 2ZT9B 3HA4A 2L91A 4X64T 3FBLA 2BKNA 3IN6A 3CKDA 4XE5B 1JMMA 1S9KE 1M1JB 1SA0E 3SWKA 2KSJA 4AUWA 1MNDA 5L3GB 3AE3C 1LGHB 1S94A 3JAFA 3HE4A 2XQ6A 3A0HE 2E43A 5APQA 2WSFH 4RESB 3LK2B 3CK6A 4PNIA 1HG5A 4I6MC 1VQ4P 4CXYA 4ZI3C 5FKYA 5H6RB 5APXA 2JJLA 2M0BA 5HCMA 5CJ5A 4TV9E 1URQB 4YXDA 5AW4B 4CPGA 1O3XA 1FAVA 2RMZA 1RF1A 3M9BA 5E79E 4Z90A 2R5DA 2NW8A 3VTPC 1IFJA 1SQPJ 2YU1A 2X67A 3RK3D 2C0SA 4B3MT 5DABA 1J1EB 3BASA 2X0LB 2YU2A 5HWXA 4OGQC 3Q5PA 1SFCA 2M5AB 5TISH 2KUBA 2IUBA 2K1AA 3RL0B 3FXDA 2FXOA 2E75C
chains in the Genus database with same CATH topology
4OHFA 2H8PD 3Q5XA 2HH7A 1MIWA 2WITA 2LSYA 1KILA 3M91A 2CWOA 3SS1A 1G73A 2KLVA 2K9AA 1XTCC 3KFWX 1NAFA 4EYUA 2PG8A 1IC2A 1FZAA 1YTZI 1LVKA 1HGVA 2N9DA 4OFZA 5FXZA 5L3CB 2X9HA 2V7KA 4GK5E 1T3UA 3P7KA 4L9IA 5LHIB 2L8KA 1HTLC 3OYXA 5AW8B 4PAGA 3ESLA 1H88A 4WBOA 3ZYLA 1URQA 5CCHD 5JQGE 2X9XA 5FP3A 3WI3A 1FMVA 4E7SA 2XUEA 4GYRA 1YW0A 2DHRA 1LTJA 1XTGB 3OJAB 1H89A 2W63A 3BQLA 5AVTB 2QGSA 5AVSB 1J2JB 2Y6XA 4TZ4C 1SQPK 2HPCB 4ZOLE 2KNDA 3D0TA 1ZLLA 3WMM0 3MD0A 2XAFB 3OA7A 2X9YA 4IFFA 3RRCA 1GL2B 3TNUA 2JMKA 2IFNA 4LC1A 2KXPB 3GA8A 5AW6B 5KLVK 2QM8A 1JY2O 3Q5WA 3QUJA 4HTEA 3L35A 2NOXA 4IGUA 4MALA 4FJOA 5JRCB 3HRNA 4W7ZA 2CEAA 3MXZA 3EQ2A 3Q9DA 4TN7B 4DVDA 3RX6A 4WY4C 5L3EB 3DTOA 2XASB 3BK9A 3A2AA 2VASA 2OYIC 3E22E 2JJ9A 3VMZA 4WY4D 3KPEA 2W6AA 3KV6A 1HVVA 2LJLA 1T3JA 3ANWB 1G1JA 3L3PA 1N86A 2H7HA 4KP3C 2KINB 5LCYA 2P7JA 3MK7C 4EOZB 1JCCA 1DEBA 2I1JA 5AW0B 1IJ5A 3G3ZA 1D1CA 2A45I 3EFGA 1Z0PA 3KVAA 1FZFA 2IX7C 3C64A 3A3YB 4HN9A 4ILUA 2NWBA 4X20E 5FY1A 5JDMA 4XBFB 5JRCA 1QSDA 2NW7A 2HODB 2QA7A 3PUAA 5KX5E 2D0UA 2N1TC 3GMIA 2XAJB 1MFZA 3L4FA 2V7MA 2FFDB 1L0LK 1BR0A 3ZC1A 2N1TD 1G2CA 2V7LA 2C5JA 2XZRA 1NH4A 4GKGA 3MKDA 3AB3B 5BU5A 3KINB 4O4LE 4W80A 5JR9A 2VKDA 1SQBK 2BVMA 1GL2A 3P8CD 3TNUB 2WTYA 2NPSA 4AQRD 3N4XA 1HX8A 4ADZA 4AQFC 1A02J 2Z5HA 2FFDC 4EB6E 1JNMA 3CI9A 1FZCA 2Z5IA 3PURA 3P8MC 3VHLA 3MUDA 5LG4A 3MGNA 2W00A 3MA9A 3N9LA 4JEUB 4P0AA 4NUVA 1JOCA 3M0DC 5CMZA 1MMNA 2W62A 1AQ5A 2K24A 1KK7A 3NRXA 4H63V 3AA1B 4PJJA 5ETWA 3UUNA 2KYVA 1H7CA 2P2UA 4PFPA 4L0RA 3N2GE 4H9OC 4MLKA 4M1PA 2KWHA 2IFMA 3O8ZA 4PK6A 3H32A 5HYAA 1KNZA 1BR2A 1RE4A 2WPSA 3RYCE 1FZCB 2SPCA 4X1KE 1HH0A 2C0WA 1CUNA 1N7LA 1B7TA 2A72A 1MV8A 3C9IA 2LSJA 3C50A 4UVBB 4ERRA 2Q7CA 3VP8A 1D0XA 4C90A 4BAYB 1JY3N 3HD7B 2OYIB 2X66A 4QXBB 3F57A 5C8YE 2IPPA 2ZXEB 3VMXA 3FXDB 4U72A 5CB4E 4ASKA 2A2FX 2YMYA 3ETUA 1CSBA 5GONE 1ZN5A 1CI6A 2O01H 3UFEA 3LJCA 3EDUA 1J1DC 4QWNB 4HE8A 5APUA 3DJBA 2PP6A 2ACXA 4I2LC 2E42A 2YK0A 4UEMA 2HODA 1JY3P 3HE5B 3NRYA 3UUXB 2DLRA 2ZLYA 2XV5A 3BQIA 5TAOA 3ZPOA 1SQQK 4PJNA 1N7SD 4ANJA 1LTIC 5IYZE 3RKOA 4LGDE 3IEEA 2CWYA 2A45G 1LT9C 4HFVA 2WPQA 3RC8A 2RA1A 3SWFA 1WRDA 4C7RA 2DWGA 2R32A 5LBQB 4JEHB 3RYFE 1X79B 3L09A 3HUSB 4OYKA 3V2RA 1X8YA 2CE7A 5CCHC 3B13A 3PUSA 2Q9QD 3UUMA 1N7SA 1LTTC 4O4JE 3UT5E 3RH3A 1N2DC 2XU6A 3HTKB 1S35A 4PW8A 2LEHA 3PU8A 3P7IA 4YLHA 1VDFA 1JY2N 1FJKA 1IFNA 2XTLA 3I9WA 1NKZB 3HR0A 1LWUB 2G0UA 3ZN1B 1E5WA 4DMVA 4CZZB 3AA6B 1VPCA 1T2KC 4X1IE 3A7OA 3HKDE 4AXPA 3RK3B 2Y48B 4HYTB 2PFVA 2KOGA 3NMDA 3VMYA 3VN0A 5LGTB 2C0XA 2W27A 4OYJA 1ZR4A 3OJAA 5IHYA 4M3LA 3UTKA 5BMVE 2EHOB 1LWUC 2A3DA 5CA0E 2YKOA 1N7SC 5AVRB 1BR4A 2VK9A 2WMNA 2Q9IA 2XAHB 3DP7A 3TSIA 3RK2C 3F31A 3LK42 5HXRA 5J2UE 3O9XA 2POHA 2IAKA 2W0GA 5JDQA 4OH8B 2V1DB 3ZLIA 2Y8DA 3V2NA 1ZR2A 2V7JA 3UULA 4QX8B 4EYYR 4N78D 2X68A 3K8PC 3WAJA 3OKQA 1L4AB 4IHJE 2ES0A 2ZM0A 4PK4A 1LT9A 2OA5A 3ZCJA 1NHLA 3N9QA 2LM9A 3ZEFB 1HS7A 4DMWA 5LXTE 1M7LA 4PK5A 1X9VA 3U1AA 3ZCIA 4ZKUA 4JYCA 3P8CE 3GWHA 4O4IE 1WRGA 5LA6E 5EK2A 5LHHB 1EQ7A 5APWA 4DZOA 4AKLA 5AVXB 2YNYA 3PP5A 3HI2A 1U5PA 4AKHA 1VOMA 2HFED 1MNEA 2BDEA 3ZYMA 3PE0A 2XAQB 2M3BA 3OYZA 4K0UA 5FXWA 2VKHA 1OXZA 5AW5B 3GN5B 4O2AE 1NTMK 1L0NK 4AQGA 2CXLA 3L36A 1NWQA 4EIWA 2CCQA 4H9PC 2ZM2A 3IF8B 3NFQA 2VRSA 2CXDA 3AAEB 1FZEA 1HGZA 1GU4A 3LBXB 4QXHB 1IFMA 2C5IT 4GIWA 5E0OA 1IFDA 2NP9A 4H9SE 2ODUA 2VB6A 2Z4EA 1H8AA 3KBTA 1RE4C 2JQQA 1NTKK 4IIJE 1AJ3A 2E9XD 3M06A 1WR6A 4IE7A 5HXSA 2N1TB 4EXTA 3U78A 1FBMA 2WT7B 3NBXX 3VKGA 3LK3B 3EVYA 4OK0A 2CMRA 1HWTC 3M0DA 5HXCA 4U74A 1CW5A 1JY3O 1WYCA 4GOUA 5LNKA 5APTA 1LTGC 2FFDA 2WSCH 2CPBA 4IE6A 1LWUA 2YEVC 3K3NA 1G1IA 3TKLB 3R2PA 2KT9A 3AVSA 3HKBE 5JR9C 5LJMA 2KLQA 3AA7B 4UVCB 1WYBA 2LSIA 2ZM8A 4YJ3E 1FOSE 2D0TA 3RRWA 5M4YA 3V4WA 3ZJ1A 3U3IA 4EIJA 2W6BA 5AFUL 4WY4B 2N1TA 3RK2B 4DOJA 3J9X1 3R84B 5LHGB 4G63A 4GIFA 4YHJA 4CI2B 2P1JA 3U1CA 5HXHA 4C7NB 1U4QA 4KMCA 1RY3A 3IHRA 2WZ7A 2MTQA 5FMNA 2VWAA 1SFCB 1Z56A 3N9OA 1URQD 5CCHA 2E8IA 2HPJA 4TV8E 2LHNA 4Z8XA 1QL2A 3T8OA 3B5NB 3GHGB 3NZPA 4O2BE 4C46A 4WB4A 1LT9B 1JUNA 2N2NA 2CLYB 4I43B 3SOLA 5HWYA 4UXNB 5EK3A 2DWKA 3O4XE 1SLQA 5LOVE 4CXWA 4G2AA 3QK6A 2XKMA 3LIEA 5CJ0A 4GK0E 4H9NC 4Y99C 2OYIA 3M9HA 4EOTA 3RK2D 3N2KE 3B8EB 4FI5A 4WY4A 4HKAA 3B57A 3S4UA 4EZ4A 2Q5UA 4EZHA 4CI1B 1BR1A 3T97A 3N9MA 2C9NY 1YKEB 3HL6A 4C7NA 1FEWA 1KQLA 4N3YB 1YKHB 2X9WA 2R3CA 3NXSA 3ETVA 3FBZA 4I1LA 3LFMA 4N6JA 2WMOA 4V1Av 5LYJE 1KFMA 2DNXA 3V5BA 3N7NA 2GUSA 3RPUA 4JLEA 4O8SA 2WPRA 3PUGA 3CQCB 5JDFA 3MZKB 4AKIA 4GYSA 1SFCD 1ZV4X 1JTHA 2IC9A 4MBQA 4UF0B 3H3AA 5AVVB 3IFMA 3RL0D 2H7OA 3BRTB 3K3OA 4J2CA 5AVYB 1CI6B 1FZGA 1GTWA 3MIWA 2L3LA 1NU1K 4X1YE 4XAXB 4F6RC 1X79A 1HUCA 5CJ4A 3VKHA 1D1AA 2YO2A 2KMFA 4AI6A 5AW3B 2VKOA 4WNKA 4BJMA 2NPSB 3SWHA 3CMLA 3V2PA 2LOPA 4TUYE 4UIGA 2WBLA 1FMWA 4QHOA 1KFNA 5AVZB 4UELA 5FXXA 2BVLA 1MUUA 3CQXC 5H6QB 3W15B 1LVFA 4DBRA 3I0QA 1FZCC 1NWMX 4L5GA 1GD2E 2Q3IA 5DQVA 4AQFA 4ZI2D 4XA4A 2NPSC 5DQWA 5J2TE 5J1GA 1J1DB 1DX7A 1GL2C 3BATA 2M8RA 5CHXA 2WWWA 2NPSD 3I9YA 5HAXA 5L2LA 3GN5A 4ZS2A 3CWZB 4ZKPA 1J1EC 3Q2MA 1ZV8A 3CX7B 4QKNA 2IC6A 3ZMSB 3V2QA 1IJ6A 1SFCC 4QXCB 1GW4A 5AW1B 1ZEEA 5EZYE 3A5XA 4BJNA 4EAHA 1JCDA 2O1KA 3BRVB 5LP6E 1YD8G 4IE0A 3C51A 1IO4A 2C9LY 1AFOA 2YO3A 3I0OA 4ISSA 4TX5A 1NO4A 2B1EA 2CXFA 5FXVA 3ZMZB 3H6PA 4PJLA 2KZ7B 4ZI2C 4HH2A 4WBAA 1JO5A 1GU5A 3E08A 1GL2D 5AW9B 5CCGD 3ONXA 4WW0A 3ZC0A 2N1GA 5FYMA 3TYYA 3UIAA 1IK9A 3N2OA 1LKXA 1CZQA 4DNDA 1FU1A 1NTZK 1SP4A 5AVQB 5CCGA 2JRKA 2LHRA 3RYIE 3ZMTB 3MJXA 1RF0C 3V5UA 2PAJA 4B6XA 3KDPB 2M67A 4ZHQE 2BASA 1HG2A 3BVHA 1HFAA 1MMGA 4B86A 3V5SA 2R5BA 1FIOA 3CX8B 3O1JA 5JR9B 2HPLA 3CLQA 1HCIA 1UX4A 1W2EA 3H32B 1IZNB 2LT3A 1GW3A 2WWUA 3I5CA 3C4XA 4IDZA 1IAPA 1ZKEA 3KDSE 2FYZA 2V7IA 3N9PA 3WAKA 1N7SB 4N78E 1YTZT 4QX7B 2VL8A 1HBWA 4AKRB 1RF1B 1GK4A 1MMDA 3CPZA 1LTAC 5BU8B 4JF7A 3O1IA 4AKGA 2ODVA 1MZ9A 1LTJC 5APSA 2FYUK 2WSEH 2YKPA 1QUUA 3JC6D 2WT7A 3OBVE 3B5ND 3VOPA 2J58A 4UVAB 5JREA 5AW2B 1MIYA 1URQC 3AAIA 5KDMC 3L37A 1GZLA 2KB7P 1A02F 2CLYC 4IFDK 2YINA 2XAGB 1KZUB 4ZS3A 5JDHA 2OARA 2OYHB 1MIVA 1UCUA 1UX5A 2LSGA 2LSKA 5JDNA 2D2SA 2NTXA 5JH7E 3LIDA 3RL0C 4MFRA 2LOSA 5BVZA 1T98A 3MTUE 2UXNB 2WSSV 3KBUA 5L3BB 5A1LA 3I1AA 1E1HB 2CM0A 3CX6B 1KILC 3E1IA 3TK1A 2OYHC 2LE8A 2NTYA 3C4ZA 2N9BA 5KMGP 4GT1A 1PFIA 2RP4A 2P67A 3M0AA 3OAKA 1D0ZA 3GHGC 3B5NC 2KP8A 2H3RA 3LW5H 2XDJA 5KJ7C 2E9XB 5L3DB 2GK9A 1SQVK 2L5GB 2FKWB 3VYIA 5AVUB 3N5LA 5JVDE 3RYHE 3II6A 5L3FB 1N73A 1JY2P 3PTRB 1D0YA 2EHOD 4PJMA 1VRBA 5DJQC 5EK4A 1ZHCA 4AYCA 1SQXK 5AW7B 2PJQA 3ANWA 5FNVE 4KHXA 3RK3C 2XQYA 3PDYA 1G8XA 1IFIA 3J7Yq 2CPSA 3FXEB 4MHCA 4NUUA 4H9RC 5LGUB 3HE5A 4W7YA 2Q9QC 5KTBA 1GDTA 2I1KA 2YKQA 3FB2A 2ZFCA 3HTKA 1NOHA 4P09A 4JYBA 1WT6A 1YYCA 3PUQA 5FY0A 3R6NA 2EHOA 2XNXA 2J59M 2K5BB 1Y64B 3EUHA 2HPCA 1RF1C 3FHNA 1EZ3A 5JDGA 2Q9QA 2X51A 5F8PA 1RE3C 4UV8B 1HJBA 3V4QA 2Z6EA 5ADXL 3SRZA 3AVRA 4HGAA 2I59A 3C98B 1L4AC 2PBIA 3K3QC 2BZBA 3HE4B 3HKCE 2KWIB 1FDMA 4YFSA 1D1BA 4CQIA 1HF8A 3HD7C 3ZJ2A 3NTNA 3BQKA 3U59A 3KV4A 3NZQA 1S9KD 1N73C 4UF0A 1GK6A 1LTJB 1DH3A 3M9QA 4YJ2E 5APYA 4CXXA 5LJNA 4IE5A 4I50E 3ZMUB 2LKMA 1US7B 3LBXA 5KJ7A 1M1JA 4LLHA 2MOZA 4C91A 4WBNE 4ISTA 1LTBC 3B5NA 3GHGA 3O1HA 1N73B 4ZI7E 1LRZA 2J1DG 3AA0B 2FXMA 2QM7A 3P32A 2OYHA 2E9XA 4ZI3D 3HA4A 3IBPA 2A45H 2O1JA 3SWYA 3IR9A 3HUSA 4I55E 4P0BA 3FBLA 2MBGA 3EDVA 1KILB 1G2CB 2MJZA 3HD7D 1OWAA 4H63H 3M65A 3CKDA 4E7ZA 2JEEA 4XE5B 2GM4A 1SVFA 1JMMA 1S9KE 3H37A 3KV5A 4Y99B 1IJDB 3HUSC 1FOSF 3KVBA 1FJPA 1M1JB 1SA0E 5LBMA 2KSJA 1HTJF 2C5KT 4AUWA 2E9XC 3KV9A 3CVRA 2W61A 1MNDA 5L3GB 2VKJA 5HXEA 3HKEE 1LGHB 3VP9A 2WAUA 1SHZC 2K48A 4DBQA 1S94A 2Q9QB 1FZBA 3HE4A 3C4WA 2JPFA 4KUMB 1M1JC 3VU7H 2E43A 5APQA 3F2EA 2WSFH 4RESB 3LK2B 4PNIA 4CI3B 1KILD 1HG5A 4IFMA 2GUVA 4I6MC 2CA5A 3LG7A 3QC9A 5LGNB 3HD7A 4HEAA 4KBMB 1LTSC 4CXYA 4ZI3C 5APVA 2DCFA 1NKNA 1L4AA 5APXA 5H6RB 1V9DA 4DO0A 1RF0A 2JJLA 5KJ7D 2XHEB 5AVWB 4IE4A 4TV9E 5CCGC 1URQB 2NW9A 5FY7A 1RE3A 1T8ZA 2HG5D 1JTHB 5AW4B 4O9BA 1O3XA 1FAVA 2JMHA 2MYSA 1RF1A 3M9BA 1MMAA 3KYQA 2R5DA 2EHOC 2HLOA 2NW8A 5CA1E 3VTPC 2V26A 5F3JA 3ZMVB 1IFJA 2IW5B 3KQGA 2YU1A 3MACA 2X67A 3RK3D 2C0SA 3AAAB 3JC6C 4XZCA 5JDLA 2P9BA 3A5TA 5DABA 3RC3A 4O4HE 1J1EB 2H43A 3E0ZA 2HYNA 3CQGB 4UV9B 4JUYA 4BA9A 3BASA 2X0LB 2UXXB 4A56A 4H9QC 2YU2A 2H7VC 3N9NA 3ZYKA 5HWXA 1QL1A 2DI4A 1WLXA 2ZMAA 1SFCA 4I4TE 4PFOA 2L9QA 3PU3A 3ZN0B 3RL0B 1L4AD 2WM9A 3CL3D 2D5UA 1T2KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEE A;  5BU8 B;  4O9B A;  2POH A;  4N3Y B;  3C9I A;  3U59 A;  1X79 B;  3VP8 A;  3HRN A;  4I1L A;  1IC2 A;  4N78 D;  3VP9 A;  4GIF A;  3N7N A;  3U1C A;  5BU5 A;  3BAT A;  3P8C D;  3N4X A;  3U1A A;  5BVZ A;  4ZKP A;  3BAS A;  4ZKU A;  5KTB A;  2FXM A;  1WT6 A;  3OJA B;  1NKN A; 
#chains in the Genus database with same CATH topology
 2BCC G;  3Q5X A;  4GKK T;  5DJU B;  2CWO A;  3M91 A;  2KLV A;  2K9A A;  5L4E A;  1EDL A;  1NAF A;  3G6E P;  1IC2 A;  1X9B A;  1ZME C;  2KNC B;  2FYU J;  3ZYL A;  1HTL C;  3OYX A;  4U7Y A;  1YW0 A;  2DHR A;  1LTJ A;  3OJA B;  2Y6X A;  4ZOL E;  2XQ4 A;  1ZLL A;  3OA7 A;  3Q2Y A;  5TIS E;  1Z8U A;  3TNU A;  1BCC J;  5AW6 B;  1JY2 O;  3L35 A;  1R5S A;  3HRN A;  4W7Z A;  3RIA A;  2HHH T;  1W0A A;  3Q9D A;  4TN7 B;  1HJ0 A;  3A2A A;  1KQS O;  2JJ9 A;  3VMZ A;  3L71 G;  4WY4 D;  1KTM A;  2LKG A;  3KV6 A;  1T3J A;  3ITK A;  1N86 A;  2H7H A;  3L3P A;  4KHZ F;  5AQP B;  3KVA A;  3EFG A;  1BSN A;  1ZRT E;  3A3Y B;  2NWB A;  5FY1 A;  1JM0 A;  5JRC A;  5KX5 E;  1EZV E;  2V7M A;  3ZC1 A;  2N1T D;  2V7L A;  1VQM P;  4GKG A;  1NH4 A;  5JR9 A;  3TNU B;  5B5E E;  2SPZ A;  4AQF C;  1OMI A;  1FDO A;  3M0D C;  3H1I E;  5CMZ A;  2W62 A;  4H63 V;  1KK7 A;  2AXD S;  2P2U A;  4L0R A;  4EEB A;  1M56 D;  2J5U A;  4H13 B;  1BR2 A;  3RYC E;  3MP7 B;  1CUN A;  4UVB B;  2A72 A;  1BE3 G;  3P4W A;  1NTM D;  3C50 A;  2Q7C A;  3VP8 A;  1Q7Y Q;  1JEK A;  3T1H T;  1JY3 N;  4WVZ A;  2IPP A;  3VMX A;  3L73 D;  1E79 H;  4OWF A;  5KAF H;  1ZN5 A;  1N32 T;  1J1D C;  3DJB A;  4I2L C;  4A5X A;  3HE5 B;  3L70 E;  1LT1 A;  3CX5 E;  4YHH T;  2V8S V;  2ZLY A;  1L0V A;  2JQK A;  3BQI A;  4PJN A;  2WZH A;  3IEE A;  4OGQ B;  2A45 G;  1LT9 C;  2IZ0 A;  2QSI A;  2E74 B;  2BBH A;  3AEB C;  2AXT H;  1X79 B;  2E75 B;  5CCH C;  3B13 A;  3PUS A;  1LTT C;  2JDI H;  1S35 A;  5KLV G;  2LEH A;  3F5H A;  1SQP D;  1JY2 N;  1IFN A;  3AE5 C;  2XTL A;  2Q1K A;  3HR0 A;  4UB6 E;  4WYV A;  1E5W A;  4CZZ B;  4DR2 T;  2OTJ P;  3HKD E;  1SQX D;  1HX1 B;  3VN0 A;  2C0X A;  2W27 A;  3CC2 P;  4OYJ A;  1ZR4 A;  2UUA T;  3UTK A;  1KYO D;  2A3D A;  4YTP A;  2WMN A;  2VK9 A;  4EXT A;  5LXT E;  2Q9I A;  3TSI A;  5HXR A;  4JI8 T;  5AQT B;  1S3J A;  2Y8D A;  2KS1 B;  1ZR2 A;  2V7J A;  3UUL A;  4QX8 B;  3WAJ A;  2ES0 A;  3CMA P;  3FZH B;  1LT9 A;  3H1H G;  3AXJ B;  2BKO A;  1NHL A;  1HS7 A;  4DMW A;  2HR3 A;  1M7L A;  1X9V A;  3P8C E;  4RKU J;  4O4I E;  1WRG A;  5EK2 A;  5LHH B;  4DZO A;  3QWO C;  3H1K G;  4H0L D;  2BDE A;  1K73 Q;  1P84 I;  2CXL A;  4AQG A;  1W5C E;  3IF8 B;  1SQQ J;  3AAE B;  5KXJ A;  4U7I A;  1S5L E;  5K5G B;  2JO1 A;  4GIW A;  1N8R Q;  2VB6 A;  3RI5 A;  4CN4 A;  3KBT A;  2JQQ A;  1NTK K;  3L72 E;  5DJT B;  1WR6 A;  1YIJ P;  4IE7 A;  2N1T B;  3AE9 A;  1BE3 D;  3U78 A;  2BCC E;  3NBX X;  3M0D A;  2W2U A;  4NPP A;  1JY3 O;  1WYC A;  3MUD C;  2W6J H;  2I6H A;  5LNK A;  1OIP A;  4YTP C;  1LTG C;  1SQX G;  2CPB A;  4IE6 A;  1G1I A;  3R2P A;  2KT9 A;  3HKB E;  5JR9 C;  2KLQ A;  3RRW A;  1XNQ T;  2MKV A;  4XFJ A;  2D0T A;  3V4W A;  3ZJ1 A;  4KJM A;  3U3I A;  4EIJ A;  3FWN A;  1BCC E;  5CFB A;  3R84 B;  2W8Z A;  5LHG B;  2P1J A;  1PP9 J;  1NYH A;  1RY3 A;  2WP9 A;  5KKZ B;  3OPC A;  5FMN A;  3GG2 A;  2XJ7 A;  2K9J A;  3GF3 A;  5CCH A;  2HPJ A;  3L8R A;  1EDJ A;  4O2B E;  4I43 B;  1JUN A;  4WB4 A;  3SOL A;  2CLY B;  4D6T D;  5EK3 A;  5AQL B;  5LOV E;  4CXW A;  1ZOY C;  2XKM A;  3LIE A;  2X0H A;  4AQY T;  4GK0 E;  3N2K E;  3B8E B;  4HKA A;  3T97 A;  3P4P A;  1FEW A;  1KQL A;  2X9W A;  3ETV A;  3RGL A;  3NXS A;  1X0T A;  1LP1 B;  5LYJ E;  2DNX A;  3RKG A;  1YJ9 P;  4O8S A;  3RPU A;  2NRG A;  3PUZ F;  4AKI A;  4Y28 J;  1JTH A;  3K3O A;  2V6Y B;  1CI6 B;  2FJB A;  3F89 A;  3I56 P;  1NU1 K;  1BE3 J;  1X79 A;  1HUC A;  5CJ4 A;  1EDI A;  3VKH A;  4YTN A;  4BJM A;  2WB5 A;  3A8Y C;  3CML A;  4TUY E;  1XMO T;  4PJ0 H;  4UIG A;  1PGP A;  1MUU A;  4DBR A;  1NU1 E;  1NTK D;  1NWM X;  2Q3I A;  1NGM B;  4AQF A;  2NPS C;  2M8R A;  3GN5 A;  3G71 P;  3Q5R A;  3CWZ B;  1J1E C;  1ZV8 A;  4QKN A;  3ZMS B;  3PTZ A;  1IJ6 A;  1SFC C;  4QXC B;  1ZEE A;  2J4G A;  1OZH A;  3A5X A;  4BJN A;  3K1S A;  3L75 D;  2O1K A;  1KNR A;  4RJT A;  5LP6 E;  1L0L E;  2C9L Y;  2ZT9 C;  2AE9 A;  2B1E A;  5FXV A;  3ZMZ B;  2KZ7 B;  1USE A;  1GL2 D;  1M57 D;  3ONX A;  1KB9 D;  3RQU A;  3ZC0 A;  2N1G A;  3KXD A;  1AJY A;  2CHN A;  3UIA A;  1SQQ G;  4U3C A;  1FU1 A;  1L0N D;  4X62 T;  2LHR A;  1RF0 C;  3V5U A;  4I7Z C;  3KDP B;  4ZHQ E;  2BAS A;  1K8A Q;  3BVH A;  1MMG A;  4B86 A;  1FIO A;  1W2E A;  1OED C;  1GW3 A;  3I5C A;  3WAK A;  4ZNC A;  2HN1 A;  4N78 E;  1YTZ T;  4ZMD A;  1GK4 A;  1MMD A;  3VR8 A;  5BU8 B;  4JF7 A;  3O1I A;  3QB5 K;  5APS A;  2YKP A;  3AE3 A;  3JC6 D;  2FYN B;  2KNC A;  1M1K Q;  3OBV E;  3M3Z B;  5AW2 B;  3AAI A;  5KDM C;  2W83 C;  4IFD K;  1KZU B;  2OAR A;  1UCU A;  2LSG A;  3UU4 A;  4LMJ A;  3QNU A;  3TLT A;  5BVZ A;  3A0B E;  1EXJ A;  1E1H B;  1HNX T;  3E1I A;  3C4Z A;  2OYH C;  5AQK B;  1Y47 A;  2BCC J;  1LJ2 A;  2W90 A;  2P67 A;  3M0A A;  3OAK A;  3LW5 J;  2H3R A;  3G9R A;  4LF5 T;  3ONL C;  5KJ7 C;  1NTK J;  3RYH E;  1XNR T;  4CN1 A;  1N73 A;  1PGJ A;  2EHO D;  1ZP0 A;  5DJQ C;  3R4Y A;  1ZHC A;  5AW7 B;  1NU1 D;  3PDY A;  1LNQ A;  3FXE B;  5ABE A;  3HE5 A;  4ZEY A;  2A06 G;  2I1K A;  4P09 A;  5FY0 A;  3L73 G;  2EHO A;  2XNX A;  2J59 M;  2K5B B;  1Y64 B;  3EUH A;  2WSC J;  2Q9Q A;  2YXR B;  4YXD C;  5HCJ A;  5H2F H;  3AVR A;  3QB5 A;  3TLS A;  2BZB A;  3HKC E;  4YFS A;  2BKP A;  4CQI A;  3BQK A;  3U59 A;  5HXS A;  1S9K D;  1YI2 P;  5LJN A;  4IE5 A;  3LBX A;  3CCR P;  1KB9 E;  1T6A A;  4IST A;  5GTH H;  1LTB C;  4U3F E;  4P1N A;  2ZVN B;  3GHG A;  2VQF T;  1N73 B;  4IDO A;  4X5T A;  1PIX A;  4D6T J;  1UIX A;  2QM7 A;  4ZI3 D;  3IBP A;  2NR4 A;  3HUS A;  3CD6 P;  3ZT6 A;  4I55 E;  4P0B A;  1OW7 A;  1XWM A;  2MBG A;  2OV9 A;  1G2C B;  3HD7 D;  1OWA A;  4E7Z A;  3H37 A;  3KV5 A;  3B71 A;  3HUS C;  1FJP A;  5LBM A;  3CCL P;  4TLF A;  1W2B O;  3FWL A;  3HKE E;  3VP9 A;  2QJP B;  4K3A A;  5AQO B;  2E74 D;  1SHZ C;  5GTI E;  4KUM B;  2JPF A;  4OGQ D;  3F2E A;  3HD7 A;  4HEA A;  1LTS C;  2XM1 A;  2ZT9 D;  4DO0 A;  4IT4 A;  5KJ7 D;  2XHE B;  5AVW B;  2QYW A;  4IE4 A;  3VRB A;  5FY7 A;  1RE3 A;  2HG5 D;  3NZP A;  2MYS A;  3KYQ A;  2EHO C;  4HB1 A;  3KQG A;  5JDL A;  3AAA B;  5LB7 B;  3E0Z A;  4UV9 B;  4DBQ A;  4A56 A;  1AQT A;  4H9Q C;  2DI4 A;  2E5V A;  1NU1 G;  4BXL A;  4I4T E;  2L9Q A;  3CWB D;  1VQ8 P;  1BGY E;  4B3T T;  4HFI A;  2D5U A;  1T2K D;  4IRE A;  1MIW A;  2WIT A;  3CX5 I;  3SS1 A;  1TU3 F;  2IBZ G;  5E79 H;  1FZA A;  5FXZ A;  2X9H A;  2V7K A;  1SQB E;  1T3U A;  4ZZC A;  2L8K A;  4WBO A;  5CCH D;  5JQG E;  3H1H J;  2X9X A;  3WI3 A;  1HNW T;  3E7K A;  1YJW P;  4COF A;  2QGS A;  4DV3 T;  1J2J B;  1J1J A;  2FUP A;  1N36 T;  1SQP K;  3NKZ A;  3WMM 0;  3MD0 A;  2XAF B;  4IFF A;  2XQ9 A;  2JMK A;  2KXP B;  3L74 E;  1OED A;  2AEF A;  3Q5W A;  4HTE A;  3TLW A;  4H13 C;  2E5Y A;  2NOX A;  4FJO A;  1PGO A;  3AE8 A;  3MXZ A;  3EQ2 A;  2K88 A;  1T72 A;  3VMA A;  3BK9 A;  2BG9 A;  4LF4 T;  3IAO A;  3ANW B;  4KP3 C;  2LLY A;  1UUS A;  1BCC G;  1EZV I;  4EOZ B;  4YT0 A;  1JCC A;  3GW6 A;  1VQ6 P;  2M5A A;  3FGA D;  1KV4 A;  1Y8A A;  2ZJS E;  1K05 A;  1YQ4 C;  3GMI A;  4YPC A;  2FJE A;  2XAJ B;  3PJA A;  4PD4 D;  2CPT A;  3L72 D;  3AB3 B;  3KIN B;  2BVM A;  3P8C D;  2NPS A;  4ADZ A;  3N4X A;  4GKJ T;  2FFD C;  4EDF A;  1JNM A;  3PUR A;  3P8M C;  1KIL E;  3NVO A;  4LML A;  2YDR A;  1Q82 Q;  1JOC A;  1MMN A;  4DR4 T;  4DV1 T;  4MN4 C;  4PJJ A;  3AA1 B;  1K9M Q;  4JI5 T;  3GLM A;  1VQ5 P;  3H32 A;  1KNZ A;  2FY8 A;  1RE4 A;  1DIP A;  3AEF C;  4UR9 A;  1H0T A;  1SQB G;  4X1K E;  1HH0 A;  1N7L A;  1B7T A;  2LSJ A;  1MV8 A;  4Q25 A;  4BAY B;  3HD7 B;  2OYI B;  5C8Y E;  3F57 A;  2ZXE B;  1L0L D;  4ASK A;  2ZYD A;  2YMY A;  2A2F X;  3ETU A;  4JPZ B;  4LFB T;  1CI6 A;  1YBK A;  2O01 H;  3LJC A;  3CME P;  3EDU A;  1SQB D;  2E42 A;  2HOD A;  2PGD A;  1PP9 E;  3IF4 A;  1SQB J;  1NTZ G;  2DLR A;  2XV5 A;  1R8I A;  3ZPO A;  1XZY A;  2B89 A;  5CGM A;  3RKO A;  4DV6 T;  2LR2 A;  2XQ5 A;  2CWY A;  1VF5 C;  3RC8 A;  1ZOY A;  1KFY A;  4QH1 A;  2R32 A;  2XQ3 A;  4KHP T;  1JMB A;  5AQQ B;  3V2R A;  3UT5 E;  3UUM A;  1KYO I;  1N7S A;  2V7Q J;  2XU6 A;  3HTK B;  4PW8 A;  5C2T A;  1SS1 A;  3P7I A;  4YLH A;  3RF1 A;  1PP9 D;  1FJK A;  1CHU A;  3I9W A;  4DMV A;  1LWU B;  2G0U A;  1VPC A;  1T2K C;  4X1I E;  3TF5 A;  4U3F J;  3A7O A;  4UB8 H;  2KOG A;  3NMD A;  3VMY A;  5LGT B;  3OJA A;  1SQQ E;  2D2C D;  3L75 E;  3F31 A;  3RK2 C;  3WUU A;  3ZLI A;  2FBW C;  3JAD A;  4TT3 H;  3L70 G;  2FYN C;  2OQQ A;  4H0L B;  2CBI A;  3AE9 C;  2X68 A;  3OKQ A;  2IBZ I;  4IHJ E;  2ZM0 A;  2ZVO B;  3H1L G;  3ZCJ A;  3CCV P;  1IBL T;  2LM9 A;  2Y9Z A;  1W0B A;  3ZCI A;  5F5W A;  2WQY A;  4DR1 T;  1PZQ A;  4AKH A;  1VOM A;  1XDP A;  3Q5E A;  4K0U A;  1H0T B;  2IYO A;  2IYP A;  4O2A E;  1NTM K;  5C3J A;  1NWQ A;  4DID B;  2CCQ A;  5C39 A;  3PRJ A;  2VRS A;  3LBX B;  1FZE A;  4LFC T;  5AQI B;  1DEE G;  1IFD A;  1NAY A;  4H9S E;  4IIJ E;  1SQV J;  1BCC D;  2Q6Q A;  1AJ3 A;  4YSX A;  3TGU J;  3LK3 B;  2OTL P;  1FJG T;  3JSV C;  1HWT C;  3EAM A;  1P84 D;  4U74 A;  1CW5 A;  4GOU A;  3RBZ A;  5APT A;  2IHR 1;  5CBO A;  2QVA A;  4OX9 T;  2A06 E;  2V6X A;  4U3F D;  4UVC B;  5TJH A;  1FOS E;  1WMK A;  1NU1 J;  2KI7 B;  2YOE A;  2BS4 A;  1FDI A;  4WY4 B;  2N1T A;  4JI6 T;  4C7N B;  2VVN A;  2MTQ A;  2VWA A;  5FNV E;  1Z56 A;  5IWA T;  1QL2 A;  3B5N B;  1LT9 B;  3AXJ A;  3AEB A;  4LMK A;  5HWY A;  2XND H;  3EWK A;  3UU6 A;  1X22 A;  4G2A A;  4IL4 A;  2OYI A;  3RK2 D;  4WWI A;  3S4U A;  4CI1 B;  2Q5U A;  3AE4 C;  1YKE B;  4KX6 A;  4N3Y B;  5AQU B;  3FBZ A;  2R3C A;  4N6J A;  1VQ7 P;  3V5B A;  2GUS A;  4JLE A;  1HF9 A;  3PUG A;  4HWD A;  2PFX A;  1SFC D;  3O6Q A;  5HEJ A;  4MBQ A;  5AVV B;  3RL0 D;  5JTG A;  2B87 B;  2QJY B;  2L3L A;  4F6R C;  2OGU A;  3L72 G;  2WDV A;  1VQK P;  4HFC A;  1D1A A;  1NTM G;  2KMF A;  4AI6 A;  5HEG A;  2E76 B;  3SWH A;  4X66 T;  5FXX A;  1KFN A;  1WFD A;  4UEL A;  5H6Q B;  4AIS A;  1LVF A;  2UU9 T;  4B3S T;  4L5G A;  4XA4 A;  2OYO A;  5DQW A;  5J1G A;  1J1D B;  1DX7 A;  2XQ7 A;  3WU2 E;  4OVN F;  1L2P A;  4PD4 I;  4ZS2 A;  2E5L T;  3CX7 B;  5L8R J;  3H3M A;  3BRV B;  2BBJ A;  5L47 A;  3FX0 A;  3C51 A;  1IO4 A;  5EFW B;  2H88 A;  2YO3 A;  4TX5 A;  1NO4 A;  2CXF A;  1UGO A;  1GU5 A;  5CCG D;  3ZSS A;  3MHV A;  4X65 T;  1CZQ A;  1NTZ K;  3ZMT B;  1KD1 Q;  4DV4 T;  1HFA A;  5JR9 B;  1YQ3 C;  2FYU E;  2R5B A;  4L76 A;  3S9O A;  2HPL A;  1HCI A;  3H3A A;  3C4X A;  3ZMU B;  1XMQ T;  1IZN B;  4IDZ A;  1ZKE A;  2FYZ A;  2V7I A;  1N7S B;  4AKR B;  2BEZ F;  4ZXL A;  1LTJ C;  2FYU K;  5H2F E;  4IDN A;  4UVA B;  1BGY J;  4CN6 A;  3D6Z A;  1GZL A;  3L71 J;  3SFE C;  2WY2 A;  2XAG B;  2YIN A;  4ZS3 A;  1MIV A;  4IL6 H;  2NTX A;  1KN7 A;  3RL0 C;  2LOS A;  2WSS V;  2VQE T;  5A1L A;  2UWJ E;  4HKZ H;  1KIL C;  2NTY A;  3TK1 A;  3L70 D;  2LE8 A;  1S2E A;  3H1J E;  5KMG P;  4PV1 C;  1PFI A;  2RP4 A;  5AQV B;  4ILB A;  3AE2 A;  3LW5 H;  1VL2 A;  2XDJ A;  2FXP A;  2E9X B;  2L5G B;  1BE3 E;  2FKW B;  3VYI A;  3N5L A;  5L3F B;  3II6 A;  4PV1 B;  1D0Y A;  3RGU A;  3FZF B;  1VRB A;  3H1L E;  3ANW A;  4KHX A;  2XQY A;  3J7Y q;  1G8X A;  4NUU A;  5LGU B;  3H1K J;  4IDQ A;  1YYC A;  4IOI H;  2HPC A;  1RF1 C;  3JCU E;  3FHN A;  4JBZ A;  4PJ0 E;  2X51 A;  3V4Q A;  2Z6E A;  4HGA A;  2I59 A;  3C98 B;  3P50 A;  1T7S A;  2KWI B;  3H1L D;  2G3A A;  2QJK C;  3NZQ A;  4YJ2 E;  1K04 A;  1GK6 A;  1LTJ B;  3FXE A;  3M9Q A;  2HN2 A;  1S1C X;  4C91 A;  1VQP P;  3G06 A;  3AED C;  3TLV A;  2J1D G;  3P4R A;  3P32 A;  2KIK A;  3CCS P;  2KK7 A;  2A45 H;  3L71 E;  3SWY A;  3IR9 A;  1RQU A;  4ASW A;  1KIL B;  2MJZ A;  1NTZ E;  3AEE A;  2JEE A;  2GM4 A;  3SFE A;  1SQP G;  3KVB A;  2C5K T;  3ZT7 A;  2E9X C;  3UQ7 A;  2W61 A;  4TNV A;  2VKJ A;  5HXE A;  4KI0 F;  5HEH A;  1FZB A;  1M1J C;  2O3J A;  4JI2 T;  3V6I A;  4DCK A;  2BS2 A;  5LMN T;  2WMM A;  1KIL D;  2I8D A;  2BCC D;  2GUV A;  3QC9 A;  1Q86 Q;  3AEA A;  3ABV C;  1YQ3 A;  5APV A;  1NKN A;  1L4A A;  2W67 A;  1V9D A;  2KLU A;  5CCG C;  1OFC X;  1T8Z A;  1JTH B;  3O6Q B;  4O9B A;  2JMH A;  1MMA A;  3H1J J;  2HLO A;  2WCA A;  5CA1 E;  2V26 A;  4HWH A;  1RQV A;  3MAC A;  3L74 J;  5KLI B;  4XZC A;  2R3S A;  3JC6 C;  4TNW A;  3RC3 A;  4O4H E;  2H43 A;  3A0B H;  2CBJ A;  2HYN A;  2H88 C;  4JUY A;  4TWD A;  4GOF A;  2H7V C;  1EDK A;  4ILC A;  4PFO A;  3PU3 A;  4K35 A;  1NTK G;  2CRB A;  5ABG A;  3P4Q A;  2HH7 A;  3Q3D A;  5L3C B;  1YTZ I;  4OFZ A;  1L0N J;  2D9D A;  4GK5 E;  2RN0 A;  1KQF B;  2ITA A;  3P7K A;  4L9I A;  2LRL A;  3H1J G;  4PAG A;  5AW8 B;  1H88 A;  1L0L J;  1URQ A;  2JWA A;  3H1L J;  4PV1 D;  3AE7 A;  5FP3 A;  2XUE A;  4IL6 X;  4GYR A;  5FVL A;  1XTG B;  1MKM A;  1D7M A;  1H89 A;  2JIW A;  3BQL A;  5L4H A;  3RIU A;  3UFG A;  4TZ4 C;  2X9Y A;  3RRC A;  1GL2 B;  4LC1 A;  3QUJ A;  4IGU A;  3AEG A;  3D71 A;  1NEK A;  3AE4 A;  3RX6 A;  4WY4 C;  1ZW0 A;  2XZE A;  2OYI C;  4A97 A;  3AE1 C;  3KPE A;  2W6A A;  2FYU G;  2XQ8 A;  1SUM B;  2KIN B;  3AEC C;  2P7J A;  3MK7 C;  1DEB A;  2I1J A;  1IJ5 A;  1AV1 A;  3G3Z A;  2A45 I;  1BGY G;  1BSH A;  1T8B A;  5JDM A;  4HN9 A;  4XBF B;  3C8V A;  4X20 E;  1KQG B;  3CIR A;  4DV5 T;  3T1Y T;  1QSD A;  2BEQ D;  3PUA A;  2D0U A;  3H25 A;  2N1T C;  1Y9B A;  2E5T A;  3A0H H;  3MKD A;  5BU5 A;  5F3J A;  4L73 A;  4W80 A;  1SQB K;  2E2A A;  1GL2 A;  2WTY A;  1KC8 Q;  4Z1M H;  1HX8 A;  1L0N E;  2Z5H A;  3CI9 A;  2Z5I A;  3WU2 H;  2XSB A;  3MGN A;  2W00 A;  3MA9 A;  4JEU B;  2WSS H;  3NRX A;  1AQ5 A;  2YDQ A;  3UUN A;  4H44 D;  3KHU A;  5ETW A;  3S1K A;  1H7C A;  4PFP A;  4H9O C;  1SQV D;  4MLK A;  2KWH A;  2IFM A;  3O8Z A;  4PK6 A;  4HFB A;  3RQW A;  5IHY A;  2C0W A;  4JYA T;  2ZYA A;  4C90 A;  2X66 A;  4QXB B;  4NXM T;  3RK3 E;  1PPJ G;  3FXD B;  1EC5 A;  4UB6 H;  5GON E;  4HFE A;  2UUC T;  3PJA J;  4HE8 A;  5APU A;  3JCU H;  4UEM A;  1JY3 P;  2WQY C;  2K3W A;  3NRY A;  3UUX B;  2WWV A;  1SQQ K;  4HWF A;  2JKV A;  1LP1 A;  3SSU A;  2BG9 E;  1LTI C;  2Y0E A;  4TWF A;  2K9J B;  2XSA A;  2WPQ A;  3SWF A;  1WRD A;  4C7R A;  2DWG A;  5LBQ B;  4DV7 T;  1QVG O;  2FBW A;  4A98 A;  3HUS B;  1J5E T;  1X8Y A;  2IML A;  2Q9Q D;  3D6Y A;  1Q90 D;  3RH3 A;  1N2D C;  3ONJ A;  2K37 A;  2AXC A;  3PU8 A;  1RH5 B;  4BRY A;  2JQ9 A;  4IL9 A;  4JI0 T;  1DU2 A;  3ZN1 B;  1R8E A;  3L72 J;  3BCC G;  3AA6 B;  4NPE A;  2Y48 B;  2PFV A;  1U7M A;  5CBN A;  2B88 A;  3L74 G;  4QMA A;  2EHO B;  2WSF J;  2QEX P;  2YKO A;  1N7S C;  1BR4 A;  1VQL P;  3DP7 A;  3LK4 2;  3JCF A;  2XAH B;  4YTM A;  5JDF A;  3P4S A;  2POH A;  4RO0 A;  2IAK A;  5JDQ A;  4OH8 B;  3NWI A;  1HNZ T;  4LF9 T;  3CPW O;  3K8P C;  1L4A B;  4HJG H;  2M3E A;  2OA5 A;  2W4X A;  3N9Q A;  4YY3 T;  1YHQ P;  3ZEF B;  4PK5 A;  3ZDM A;  5FL1 A;  2YDS A;  4ZKU A;  2XY8 B;  3GWH A;  2WU2 A;  1MFT A;  3CXH E;  4GDO A;  2D2C C;  2BG9 B;  5LA6 E;  1EQ7 A;  4AKL A;  1W09 A;  3PP5 A;  3HI2 A;  1U5P A;  2VUR A;  3EI0 A;  1N33 T;  3ZYM A;  2XAQ B;  2M3B A;  3OYZ A;  2V7Q H;  2VKH A;  3GN5 B;  5BR8 T;  1QLB A;  1L0N K;  3USS A;  1EZV D;  2CXD A;  1HGZ A;  1GU4 A;  5AQS B;  1IFM A;  5E0O A;  4B3R T;  2ODU A;  3AEF A;  2Z4E A;  3W67 A;  1RE4 C;  3M06 A;  2ACZ A;  1FBM A;  4OK0 A;  2OTK E;  4ASV A;  2WSC H;  1LWU A;  3K3N A;  3GF7 A;  3Q1M A;  2QJK B;  2E76 D;  4DV2 T;  2WU5 A;  2W6B A;  4HFD A;  5AFU L;  2PRR A;  3H1K D;  1YXR A;  3IA3 A;  4DOJ A;  3PHL A;  1YQ4 A;  4G63 A;  4YHJ A;  2M6I A;  3U1C A;  1U4Q A;  1OED E;  3CXH H;  1SFC B;  2FYU D;  4U2Z A;  4TV8 E;  3O9X A;  2LHN A;  4DVD A;  3GHG B;  4H44 C;  1EXI A;  4C46 A;  2N2N A;  4UXN B;  2DWK A;  1SLQ A;  1BGY D;  4A7P A;  3GMA A;  2VL0 A;  3QK6 A;  2D2C B;  5CJ0 A;  2BG9 C;  4PD4 E;  2XPK A;  3M9H A;  4EGW A;  4L74 A;  4FI5 A;  4WY4 A;  4EZ4 A;  3B57 A;  4DR7 T;  4EZH A;  1BR1 A;  5LG3 A;  2C9N Y;  3HL6 A;  4C7N A;  5GTI H;  1Y01 A;  3AEG C;  1YKH B;  2YKS A;  4HWC A;  1M90 Q;  1NVO A;  2WMO A;  1KFM A;  1S4X A;  3N7N A;  4I7Z B;  2R6G F;  3MZK B;  4GYS A;  4U3F G;  4UF0 B;  2FJA A;  3IFM A;  2H89 C;  2ZYG A;  1GMJ A;  2KS1 A;  4X1Y E;  3MIW A;  4XAX B;  2YO2 A;  5AW3 B;  2VKO A;  2NPS B;  1S72 P;  1DD3 A;  4TWH A;  2UUB T;  5HYA A;  5AVZ B;  2BVL A;  4LF8 T;  3W15 B;  5AQM B;  3H1I D;  1FZC C;  5DQV A;  4ZI2 D;  5J2T E;  3BAT A;  5CHX A;  5L2L A;  2NPS D;  3I9Y A;  4ZKP A;  1KB9 H;  5GTH E;  2IC6 A;  2QRX A;  5AW1 B;  5EZY E;  1YD8 G;  4YSY A;  3SFD C;  1AFO A;  2QJP C;  3PV0 F;  4PJL A;  2LM2 A;  4HH2 A;  4WBA A;  2JR8 A;  3E08 A;  5AW9 B;  1OW6 A;  3TYY A;  2Y0D A;  1IK9 A;  3RYI E;  5AVQ B;  5CCG A;  4B6X A;  5HEO A;  2M67 A;  2BS3 A;  1HG2 A;  2KSR A;  3V5S A;  1UX4 A;  4MAL A;  5ABF B;  3KDS E;  3N9P A;  1HBW A;  1RF1 B;  1LTA C;  4AKG A;  4BRY B;  3RIU C;  2ODV A;  1QUU A;  5ABH A;  3B5N D;  5JRE A;  3AE7 C;  5ABF A;  1MIY A;  3PUY F;  1URQ C;  4U33 A;  3L37 A;  2KB7 P;  1A02 F;  5LHI B;  5JDH A;  2OYH B;  2KSE A;  5LG4 A;  1WCR A;  2D2S A;  4MFR A;  3RIF A;  1T98 A;  2UXN B;  4GOE A;  3KBU A;  5L3B B;  2N9Y B;  3CX6 B;  2E75 D;  2N9B A;  4GT1 A;  4Z91 A;  3AED A;  3RBX A;  1D0Z A;  3GHG C;  4H44 B;  2ZXX A;  2ZAE B;  2IBZ E;  3BCC J;  5L3D B;  5AVU B;  5JVD E;  4R4L A;  5EK4 A;  3H1H E;  5LMU T;  1SQX K;  3CC7 P;  1IFI A;  3TGU D;  2CPS A;  2YMK A;  4MHC A;  1VQO P;  5KTB A;  1GDT A;  4IL6 E;  2ZFC A;  3HTK A;  1NOH A;  2WDR A;  4JYB A;  1WT6 A;  1PPJ D;  3LDQ B;  1HJB A;  3UU8 A;  1L4A C;  2PBI A;  3K3Q C;  1KYO E;  2WPV B;  2V4H A;  1D1B A;  1ZP0 C;  2RH0 A;  3H1H D;  1HF8 A;  3ZJ2 A;  4UF0 A;  1N73 C;  3PLN A;  5APY A;  1NTZ D;  4D6T E;  2VVS A;  2LKM A;  4WBN E;  5B66 E;  1M1J A;  2MOZ A;  3FZM B;  2YIU C;  4U2Y A;  1Q2N A;  1VQN P;  4ZI7 E;  3AA0 B;  1NTM E;  1J5W A;  5AQH B;  4H0L C;  3K5B A;  3L39 A;  3PUW F;  2O1J A;  5AQJ B;  5AQR B;  3AEE C;  3EDV A;  4DR5 T;  1QLE D;  4H63 H;  3M65 A;  1SVF A;  1KMI Z;  3OTO T;  4Y99 B;  1IJD B;  1FOS F;  5M1B A;  1HTJ F;  3CXH I;  3KV9 A;  3CVR A;  2E74 C;  3MZW B;  2X0Y A;  2WAU A;  2K48 A;  2Q9Q B;  3C4W A;  3VU7 H;  3PUX F;  4UB8 E;  4CI3 B;  5J0Z A;  4IFM A;  2CA5 A;  3LG7 A;  5LGN B;  4KBM B;  5KLV J;  1NTK E;  2DCF A;  1RHZ B;  1RF0 A;  1WR0 A;  4EV6 A;  4JI1 T;  2NW9 A;  4EED A;  1IFP A;  2W66 A;  5JDG A;  5KKZ C;  1M7K A;  4PD4 H;  3ZMV B;  2IW5 B;  2PTF A;  2P9B A;  3A5T A;  3KZI E;  3A7M A;  3CQG B;  4BA9 A;  5L3E B;  2UXX B;  3N9N A;  3ZYK A;  1GQE A;  1QL1 A;  1WLX A;  2ZMA A;  3PUV F;  4DJG A;  3ZN0 B;  3D70 A;  1L4A D;  3AE2 C;  2WM9 A;  3CL3 D;  2RKL A;  3OVU A;  4OHF A;  2H8P D;  4U7J A;  2JWD A;  2LSY A;  1KIL A;  4R4M A;  1G73 A;  1XTC C;  1SQQ D;  3KFW X;  2A9U A;  5FL0 A;  2PG8 A;  1LVK A;  2DL1 A;  4EYU A;  4DR3 T;  1HGV A;  2N9D A;  3CCE P;  1UII A;  2V6Y A;  2DW3 A;  3B4S A;  3ESL A;  2NZ2 A;  3L73 J;  1XDO A;  4QH5 A;  1VCS A;  1FMV A;  4E7S A;  3EHZ A;  2Y9Y A;  1OW8 A;  2W63 A;  1JNZ A;  5AVT B;  3B5M A;  5AVS B;  2HPC B;  2KND A;  3D0T A;  4WZX A;  2B87 A;  4H13 D;  2WSE J;  2IFN A;  2WDQ A;  3GA8 A;  4F8H A;  5KLV K;  1KOR A;  2QM8 A;  1I94 T;  3I55 P;  5JRC B;  4ILA A;  3UQ4 A;  2CEA A;  4YSZ A;  2O01 J;  3DTO A;  1AVO A;  2XAS B;  3L75 G;  2VAS A;  5KAI H;  3E22 E;  2ZM6 T;  5KLV E;  1HVV A;  2LJL A;  3T97 B;  1G1J A;  2QG4 A;  3PH0 A;  5LCY A;  4LF6 T;  5AW0 B;  1Z0P A;  2CK3 H;  1D1C A;  4QX7 B;  4ILU A;  1FZF A;  2IX7 C;  3C64 A;  4NXN T;  1USD A;  4YXW H;  4D6T G;  2IDB A;  3SFD A;  2NW7 A;  2HOD B;  2YXQ B;  2QA7 A;  3H1I J;  4JI4 T;  2Y0C A;  1MFZ A;  3L4F A;  2FFD B;  1L0L K;  1BR0 A;  1M62 A;  1G2C A;  2C5J A;  2IZ1 A;  2XZR A;  1KNP A;  4O4L E;  4LF7 T;  4JBW F;  2VKD A;  4AQR D;  4EB6 E;  1A02 J;  1FZC A;  3VHL A;  4AIU A;  3MUD A;  4HWI B;  3N9L A;  1ZRT D;  4P0A A;  4NUV A;  1R5L A;  2K24 A;  1W9R A;  4NPF X;  2KYV A;  1NEN A;  3N2G E;  4I0U A;  4M1P A;  2LXB A;  1SE7 A;  2V5D A;  3EAB A;  2WPS A;  1FZC B;  2SPC A;  2GA1 A;  1U7J A;  5JH7 E;  2H89 A;  3C9I A;  4ERR A;  1D0X A;  3L75 J;  1M8O B;  5CB4 E;  4U72 A;  1CSB A;  1VQ9 P;  3UFE A;  1VCT A;  4QWN B;  3KZI H;  2PP6 A;  2ACX A;  2YK0 A;  2QE7 H;  5TAO A;  1IBK T;  1UUR A;  1VF5 D;  1EZV G;  1N7S D;  4ANJ A;  2JQH A;  5IYZ E;  4LGD E;  4HFV A;  1KB9 I;  3PJS K;  1FE6 A;  2RA1 A;  5AQG B;  1QGK B;  3C1L A;  4JEH B;  3RYF E;  3L09 A;  4OYK A;  3FZK B;  3BCC E;  2CE7 A;  1AVY A;  2WS3 A;  4O4J E;  3CX5 D;  3VR9 A;  2IDO B;  2CHO A;  4DUZ T;  1VDF A;  2K9Y A;  4EI2 A;  1NKZ B;  1OED B;  5KLV D;  4AXP A;  2MPK A;  3RK3 B;  4HYT B;  3AE5 A;  3LSV A;  2UXB T;  2UXD T;  4M3L A;  1IK7 A;  2AXT E;  3CCJ P;  3BCC D;  5BMV E;  1LWU C;  1JNR A;  5CA0 E;  1I6Z A;  5AVR B;  5J2U E;  3L74 D;  2W0G A;  1SQV G;  2V1D B;  3V2N A;  4EYY R;  4N78 D;  1PL5 A;  3X1D A;  3ZT5 A;  3CC4 P;  4PK4 A;  1SQX E;  2LRK A;  3UU5 A;  3JAE A;  3U1A A;  4JYC A;  2FJD A;  4DR6 T;  5APW A;  5AVX B;  2YNY A;  1DD4 A;  3E1R A;  2LKH A;  2HFE D;  1OVU A;  1MNE A;  3PE0 A;  5FXW A;  2XM2 A;  3RLF F;  1OXZ A;  5AW5 B;  5AQN B;  3QH9 A;  4EIW A;  3L36 A;  4H9P C;  3Q5D A;  2ZM2 A;  2LXC B;  1VF5 B;  3NFQ A;  2K3R A;  3H1J D;  4QXH B;  2V5C A;  2C5I T;  2NP9 A;  1KYO H;  2AEM A;  1H8A A;  3H1K E;  2E9X D;  5AQF B;  3L70 J;  1KEY A;  2QA4 P;  2WT7 B;  5HEU A;  3CCM P;  3EVY A;  3WUV A;  2CMR A;  5HXC A;  4NIQ A;  4LFA T;  1QEX A;  2FFD A;  3TKL B;  1JB0 J;  2YEV C;  4DT0 A;  3AVS A;  1BDC A;  5LJM A;  3AA7 B;  1WYB A;  2LSI A;  2ZM8 A;  4YJ3 E;  1S5L X;  5M4Y A;  4JI7 T;  2OLT A;  1PGQ A;  1QVF O;  4IDP A;  2P10 A;  3RK2 B;  3J9X 1;  4GIF A;  4CI2 B;  5HXH A;  4KMC A;  3IHR A;  2WZ7 A;  3N9O A;  1URQ D;  4Z8X A;  2E8I A;  3T8O A;  2YIU B;  1QX8 A;  3W68 A;  2RPA A;  3O4X E;  4H9N C;  4Y99 C;  2YN6 A;  4EOT A;  2IBZ D;  3TLU A;  2O01 N;  3UU3 A;  3N9M A;  3VRA A;  3LFM A;  4I1L A;  2WZI A;  5KAF E;  2G8Y A;  2I0M A;  4V1A v;  3WUT A;  4U31 A;  2WPR A;  3CQC B;  1ZV4 X;  2J62 A;  5B66 H;  2IC9 A;  2H7O A;  4J2C A;  3BRT B;  5AVY B;  4DV0 T;  1FZG A;  5KAI E;  3ZKR A;  1GTW A;  4ZZB A;  1YIT P;  2JP3 A;  3RL0 g;  1KF6 A;  4WNK A;  1NJI Q;  1BDD A;  3V2P A;  2LOP A;  2P58 A;  3L71 D;  2WBL A;  1FMW A;  4QHO A;  2XQA A;  3CQX C;  1AA0 A;  3I0Q A;  5B5E H;  1Q81 Q;  1GD2 E;  1N34 T;  3Q5S A;  1GL2 C;  4L75 A;  5HAX A;  2WWW A;  5FVK A;  3H1I G;  1P84 H;  3Q2M A;  3FZL B;  3RHW A;  3V2Q A;  4EAH A;  1GW4 A;  1JCD A;  1E2A A;  3L73 E;  4IE0 A;  3S4R A;  3CWB J;  2MAW A;  1FC2 C;  2IIU A;  3I0O A;  4ISS A;  1PV3 A;  4DUY T;  2UXC T;  3H6P A;  4ZI2 C;  3AEC A;  1JO5 A;  3TGU G;  4WW0 A;  3CWB E;  2M6B A;  5FYM A;  3AE1 A;  3N2O A;  1LKX A;  4JI3 T;  4DND A;  1IBM T;  4QH4 A;  1SP4 A;  2JRK A;  3MJX A;  3CX5 H;  2PAJ A;  3AE8 C;  2R44 A;  2B76 A;  3O1J A;  1U57 A;  3CX8 B;  3CLQ A;  3H32 B;  2LT3 A;  3OW2 O;  2WWU A;  1FS0 E;  4NPD A;  1IAP A;  4K0K T;  2VL8 A;  1SQP E;  3CPZ A;  3QOF A;  1PP9 G;  2A06 D;  1MZ9 A;  3EFF K;  2WSE H;  2WT7 A;  1OX3 A;  2E76 C;  3VOP A;  2J58 A;  1ZXG A;  1YJN P;  2CLY C;  1P84 E;  1E7P A;  5JDN A;  1UX5 A;  2LSK A;  4BWN A;  3LID A;  2J47 A;  3MTU E;  4HFH A;  4KT0 J;  3I1A A;  1UK5 A;  5IUX A;  2CM0 A;  3VKG A;  3CWB G;  1OVV A;  1HR0 T;  3TGU E;  1OVR A;  1PPJ E;  3AE6 C;  2KP8 A;  3B5N C;  2F4V T;  2KZJ A;  3CCQ P;  2GK9 A;  1SQV K;  3TDK A;  3UUB A;  4GOD A;  1JY2 P;  3PTR B;  4JQ0 D;  4PJM A;  4JV5 T;  4AYC A;  3ZST A;  2PJQ A;  3RK3 C;  1SQV E;  4H9R C;  4W7Y A;  2Q9Q C;  2YKQ A;  3FB2 A;  3CCU P;  3PUQ A;  3R6N A;  1L0L G;  1NTM J;  1L0N G;  2KZI A;  1EZ3 A;  4EYY Q;  2AEJ A;  5F8P A;  3JC2 2;  1RE3 C;  2Q3E A;  4UV8 B;  5ADX L;  3SRZ A;  2B9B A;  3HE4 B;  1S5L H;  1FDM A;  5KLI C;  2QJY C;  1NTZ J;  3ABV A;  3HD7 C;  3AEA C;  3NTN A;  3KV4 A;  1DH3 A;  4CXX A;  4I50 E;  1US7 B;  5KJ7 A;  4LLH A;  3B5N A;  3O1H A;  3AE6 A;  2WVR A;  1LRZ A;  3CXH D;  2FXM A;  2OYH A;  2E9X A;  3G4S P;  1SQX J;  2QIW A;  2ZT9 B;  3HA4 A;  2L91 A;  4X64 T;  3FBL A;  2BKN A;  3IN6 A;  3CKD A;  4XE5 B;  1JMM A;  1S9K E;  1M1J B;  1SA0 E;  3SWK A;  2KSJ A;  4AUW A;  1MND A;  5L3G B;  3AE3 C;  1LGH B;  1S94 A;  3JAF A;  3HE4 A;  2XQ6 A;  3A0H E;  2E43 A;  5APQ A;  2WSF H;  4RES B;  3LK2 B;  3CK6 A;  4PNI A;  1HG5 A;  4I6M C;  1VQ4 P;  4CXY A;  4ZI3 C;  5FKY A;  5H6R B;  5APX A;  2JJL A;  2M0B A;  5HCM A;  5CJ5 A;  4TV9 E;  1URQ B;  4YXD A;  5AW4 B;  4CPG A;  1O3X A;  1FAV A;  2RMZ A;  1RF1 A;  3M9B A;  5E79 E;  4Z90 A;  2R5D A;  2NW8 A;  3VTP C;  1IFJ A;  1SQP J;  2YU1 A;  2X67 A;  3RK3 D;  2C0S A;  4B3M T;  5DAB A;  1J1E B;  3BAS A;  2X0L B;  2YU2 A;  5HWX A;  4OGQ C;  3Q5P A;  1SFC A;  2M5A B;  5TIS H;  2KUB A;  2IUB A;  2K1A A;  3RL0 B;  3FXD A;  2FXO A;  2E75 C; 
#chains in the Genus database with same CATH homology
 4OHF A;  2H8P D;  3Q5X A;  2HH7 A;  1MIW A;  2WIT A;  2LSY A;  1KIL A;  3M91 A;  2CWO A;  3SS1 A;  1G73 A;  2KLV A;  2K9A A;  1XTC C;  3KFW X;  1NAF A;  4EYU A;  2PG8 A;  1IC2 A;  1FZA A;  1YTZ I;  1LVK A;  1HGV A;  2N9D A;  4OFZ A;  5FXZ A;  5L3C B;  2X9H A;  2V7K A;  4GK5 E;  1T3U A;  3P7K A;  4L9I A;  5LHI B;  2L8K A;  1HTL C;  3OYX A;  5AW8 B;  4PAG A;  3ESL A;  1H88 A;  4WBO A;  3ZYL A;  1URQ A;  5CCH D;  5JQG E;  2X9X A;  5FP3 A;  3WI3 A;  1FMV A;  4E7S A;  2XUE A;  4GYR A;  1YW0 A;  2DHR A;  1LTJ A;  1XTG B;  3OJA B;  1H89 A;  2W63 A;  3BQL A;  5AVT B;  2QGS A;  5AVS B;  1J2J B;  2Y6X A;  4TZ4 C;  1SQP K;  2HPC B;  4ZOL E;  2KND A;  3D0T A;  1ZLL A;  3WMM 0;  3MD0 A;  2XAF B;  3OA7 A;  2X9Y A;  4IFF A;  3RRC A;  1GL2 B;  3TNU A;  2JMK A;  2IFN A;  4LC1 A;  2KXP B;  3GA8 A;  5AW6 B;  5KLV K;  2QM8 A;  1JY2 O;  3Q5W A;  3QUJ A;  4HTE A;  3L35 A;  2NOX A;  4IGU A;  4MAL A;  4FJO A;  5JRC B;  3HRN A;  4W7Z A;  2CEA A;  3MXZ A;  3EQ2 A;  3Q9D A;  4TN7 B;  4DVD A;  3RX6 A;  4WY4 C;  5L3E B;  3DTO A;  2XAS B;  3BK9 A;  3A2A A;  2VAS A;  2OYI C;  3E22 E;  2JJ9 A;  3VMZ A;  4WY4 D;  3KPE A;  2W6A A;  3KV6 A;  1HVV A;  2LJL A;  1T3J A;  3ANW B;  1G1J A;  3L3P A;  1N86 A;  2H7H A;  4KP3 C;  2KIN B;  5LCY A;  2P7J A;  3MK7 C;  4EOZ B;  1JCC A;  1DEB A;  2I1J A;  5AW0 B;  1IJ5 A;  3G3Z A;  1D1C A;  2A45 I;  3EFG A;  1Z0P A;  3KVA A;  1FZF A;  2IX7 C;  3C64 A;  3A3Y B;  4HN9 A;  4ILU A;  2NWB A;  4X20 E;  5FY1 A;  5JDM A;  4XBF B;  5JRC A;  1QSD A;  2NW7 A;  2HOD B;  2QA7 A;  3PUA A;  5KX5 E;  2D0U A;  2N1T C;  3GMI A;  2XAJ B;  1MFZ A;  3L4F A;  2V7M A;  2FFD B;  1L0L K;  1BR0 A;  3ZC1 A;  2N1T D;  1G2C A;  2V7L A;  2C5J A;  2XZR A;  1NH4 A;  4GKG A;  3MKD A;  3AB3 B;  5BU5 A;  3KIN B;  4O4L E;  4W80 A;  5JR9 A;  2VKD A;  1SQB K;  2BVM A;  1GL2 A;  3P8C D;  3TNU B;  2WTY A;  2NPS A;  4AQR D;  3N4X A;  1HX8 A;  4ADZ A;  4AQF C;  1A02 J;  2Z5H A;  2FFD C;  4EB6 E;  1JNM A;  3CI9 A;  1FZC A;  2Z5I A;  3PUR A;  3P8M C;  3VHL A;  3MUD A;  5LG4 A;  3MGN A;  2W00 A;  3MA9 A;  3N9L A;  4JEU B;  4P0A A;  4NUV A;  1JOC A;  3M0D C;  5CMZ A;  1MMN A;  2W62 A;  1AQ5 A;  2K24 A;  1KK7 A;  3NRX A;  4H63 V;  3AA1 B;  4PJJ A;  5ETW A;  3UUN A;  2KYV A;  1H7C A;  2P2U A;  4PFP A;  4L0R A;  3N2G E;  4H9O C;  4MLK A;  4M1P A;  2KWH A;  2IFM A;  3O8Z A;  4PK6 A;  3H32 A;  5HYA A;  1KNZ A;  1BR2 A;  1RE4 A;  2WPS A;  3RYC E;  1FZC B;  2SPC A;  4X1K E;  1HH0 A;  2C0W A;  1CUN A;  1N7L A;  1B7T A;  2A72 A;  1MV8 A;  3C9I A;  2LSJ A;  3C50 A;  4UVB B;  4ERR A;  2Q7C A;  3VP8 A;  1D0X A;  4C90 A;  4BAY B;  1JY3 N;  3HD7 B;  2OYI B;  2X66 A;  4QXB B;  3F57 A;  5C8Y E;  2IPP A;  2ZXE B;  3VMX A;  3FXD B;  4U72 A;  5CB4 E;  4ASK A;  2A2F X;  2YMY A;  3ETU A;  1CSB A;  5GON E;  1ZN5 A;  1CI6 A;  2O01 H;  3UFE A;  3LJC A;  3EDU A;  1J1D C;  4QWN B;  4HE8 A;  5APU A;  3DJB A;  2PP6 A;  2ACX A;  4I2L C;  2E42 A;  2YK0 A;  4UEM A;  2HOD A;  1JY3 P;  3HE5 B;  3NRY A;  3UUX B;  2DLR A;  2ZLY A;  2XV5 A;  3BQI A;  5TAO A;  3ZPO A;  1SQQ K;  4PJN A;  1N7S D;  4ANJ A;  1LTI C;  5IYZ E;  3RKO A;  4LGD E;  3IEE A;  2CWY A;  2A45 G;  1LT9 C;  4HFV A;  2WPQ A;  3RC8 A;  2RA1 A;  3SWF A;  1WRD A;  4C7R A;  2DWG A;  2R32 A;  5LBQ B;  4JEH B;  3RYF E;  1X79 B;  3L09 A;  3HUS B;  4OYK A;  3V2R A;  1X8Y A;  2CE7 A;  5CCH C;  3B13 A;  3PUS A;  2Q9Q D;  3UUM A;  1N7S A;  1LTT C;  4O4J E;  3UT5 E;  3RH3 A;  1N2D C;  2XU6 A;  3HTK B;  1S35 A;  4PW8 A;  2LEH A;  3PU8 A;  3P7I A;  4YLH A;  1VDF A;  1JY2 N;  1FJK A;  1IFN A;  2XTL A;  3I9W A;  1NKZ B;  3HR0 A;  1LWU B;  2G0U A;  3ZN1 B;  1E5W A;  4DMV A;  4CZZ B;  3AA6 B;  1VPC A;  1T2K C;  4X1I E;  3A7O A;  3HKD E;  4AXP A;  3RK3 B;  2Y48 B;  4HYT B;  2PFV A;  2KOG A;  3NMD A;  3VMY A;  3VN0 A;  5LGT B;  2C0X A;  2W27 A;  4OYJ A;  1ZR4 A;  3OJA A;  5IHY A;  4M3L A;  3UTK A;  5BMV E;  2EHO B;  1LWU C;  2A3D A;  5CA0 E;  2YKO A;  1N7S C;  5AVR B;  1BR4 A;  2VK9 A;  2WMN A;  2Q9I A;  2XAH B;  3DP7 A;  3TSI A;  3RK2 C;  3F31 A;  3LK4 2;  5HXR A;  5J2U E;  3O9X A;  2POH A;  2IAK A;  2W0G A;  5JDQ A;  4OH8 B;  2V1D B;  3ZLI A;  2Y8D A;  3V2N A;  1ZR2 A;  2V7J A;  3UUL A;  4QX8 B;  4EYY R;  4N78 D;  2X68 A;  3K8P C;  3WAJ A;  3OKQ A;  1L4A B;  4IHJ E;  2ES0 A;  2ZM0 A;  4PK4 A;  1LT9 A;  2OA5 A;  3ZCJ A;  1NHL A;  3N9Q A;  2LM9 A;  3ZEF B;  1HS7 A;  4DMW A;  5LXT E;  1M7L A;  4PK5 A;  1X9V A;  3U1A A;  3ZCI A;  4ZKU A;  4JYC A;  3P8C E;  3GWH A;  4O4I E;  1WRG A;  5LA6 E;  5EK2 A;  5LHH B;  1EQ7 A;  5APW A;  4DZO A;  4AKL A;  5AVX B;  2YNY A;  3PP5 A;  3HI2 A;  1U5P A;  4AKH A;  1VOM A;  2HFE D;  1MNE A;  2BDE A;  3ZYM A;  3PE0 A;  2XAQ B;  2M3B A;  3OYZ A;  4K0U A;  5FXW A;  2VKH A;  1OXZ A;  5AW5 B;  3GN5 B;  4O2A E;  1NTM K;  1L0N K;  4AQG A;  2CXL A;  3L36 A;  1NWQ A;  4EIW A;  2CCQ A;  4H9P C;  2ZM2 A;  3IF8 B;  3NFQ A;  2VRS A;  2CXD A;  3AAE B;  1FZE A;  1HGZ A;  1GU4 A;  3LBX B;  4QXH B;  1IFM A;  2C5I T;  4GIW A;  5E0O A;  1IFD A;  2NP9 A;  4H9S E;  2ODU A;  2VB6 A;  2Z4E A;  1H8A A;  3KBT A;  1RE4 C;  2JQQ A;  1NTK K;  4IIJ E;  1AJ3 A;  2E9X D;  3M06 A;  1WR6 A;  4IE7 A;  5HXS A;  2N1T B;  4EXT A;  3U78 A;  1FBM A;  2WT7 B;  3NBX X;  3VKG A;  3LK3 B;  3EVY A;  4OK0 A;  2CMR A;  1HWT C;  3M0D A;  5HXC A;  4U74 A;  1CW5 A;  1JY3 O;  1WYC A;  4GOU A;  5LNK A;  5APT A;  1LTG C;  2FFD A;  2WSC H;  2CPB A;  4IE6 A;  1LWU A;  2YEV C;  3K3N A;  1G1I A;  3TKL B;  3R2P A;  2KT9 A;  3AVS A;  3HKB E;  5JR9 C;  5LJM A;  2KLQ A;  3AA7 B;  4UVC B;  1WYB A;  2LSI A;  2ZM8 A;  4YJ3 E;  1FOS E;  2D0T A;  3RRW A;  5M4Y A;  3V4W A;  3ZJ1 A;  3U3I A;  4EIJ A;  2W6B A;  5AFU L;  4WY4 B;  2N1T A;  3RK2 B;  4DOJ A;  3J9X 1;  3R84 B;  5LHG B;  4G63 A;  4GIF A;  4YHJ A;  4CI2 B;  2P1J A;  3U1C A;  5HXH A;  4C7N B;  1U4Q A;  4KMC A;  1RY3 A;  3IHR A;  2WZ7 A;  2MTQ A;  5FMN A;  2VWA A;  1SFC B;  1Z56 A;  3N9O A;  1URQ D;  5CCH A;  2E8I A;  2HPJ A;  4TV8 E;  2LHN A;  4Z8X A;  1QL2 A;  3T8O A;  3B5N B;  3GHG B;  3NZP A;  4O2B E;  4C46 A;  4WB4 A;  1LT9 B;  1JUN A;  2N2N A;  2CLY B;  4I43 B;  3SOL A;  5HWY A;  4UXN B;  5EK3 A;  2DWK A;  3O4X E;  1SLQ A;  5LOV E;  4CXW A;  4G2A A;  3QK6 A;  2XKM A;  3LIE A;  5CJ0 A;  4GK0 E;  4H9N C;  4Y99 C;  2OYI A;  3M9H A;  4EOT A;  3RK2 D;  3N2K E;  3B8E B;  4FI5 A;  4WY4 A;  4HKA A;  3B57 A;  3S4U A;  4EZ4 A;  2Q5U A;  4EZH A;  4CI1 B;  1BR1 A;  3T97 A;  3N9M A;  2C9N Y;  1YKE B;  3HL6 A;  4C7N A;  1FEW A;  1KQL A;  4N3Y B;  1YKH B;  2X9W A;  2R3C A;  3NXS A;  3ETV A;  3FBZ A;  4I1L A;  3LFM A;  4N6J A;  2WMO A;  4V1A v;  5LYJ E;  1KFM A;  2DNX A;  3V5B A;  3N7N A;  2GUS A;  3RPU A;  4JLE A;  4O8S A;  2WPR A;  3PUG A;  3CQC B;  5JDF A;  3MZK B;  4AKI A;  4GYS A;  1SFC D;  1ZV4 X;  1JTH A;  2IC9 A;  4MBQ A;  4UF0 B;  3H3A A;  5AVV B;  3IFM A;  3RL0 D;  2H7O A;  3BRT B;  3K3O A;  4J2C A;  5AVY B;  1CI6 B;  1FZG A;  1GTW A;  3MIW A;  2L3L A;  1NU1 K;  4X1Y E;  4XAX B;  4F6R C;  1X79 A;  1HUC A;  5CJ4 A;  3VKH A;  1D1A A;  2YO2 A;  2KMF A;  4AI6 A;  5AW3 B;  2VKO A;  4WNK A;  4BJM A;  2NPS B;  3SWH A;  3CML A;  3V2P A;  2LOP A;  4TUY E;  4UIG A;  2WBL A;  1FMW A;  4QHO A;  1KFN A;  5AVZ B;  4UEL A;  5FXX A;  2BVL A;  1MUU A;  3CQX C;  5H6Q B;  3W15 B;  1LVF A;  4DBR A;  3I0Q A;  1FZC C;  1NWM X;  4L5G A;  1GD2 E;  2Q3I A;  5DQV A;  4AQF A;  4ZI2 D;  4XA4 A;  2NPS C;  5DQW A;  5J2T E;  5J1G A;  1J1D B;  1DX7 A;  1GL2 C;  3BAT A;  2M8R A;  5CHX A;  2WWW A;  2NPS D;  3I9Y A;  5HAX A;  5L2L A;  3GN5 A;  4ZS2 A;  3CWZ B;  4ZKP A;  1J1E C;  3Q2M A;  1ZV8 A;  3CX7 B;  4QKN A;  2IC6 A;  3ZMS B;  3V2Q A;  1IJ6 A;  1SFC C;  4QXC B;  1GW4 A;  5AW1 B;  1ZEE A;  5EZY E;  3A5X A;  4BJN A;  4EAH A;  1JCD A;  2O1K A;  3BRV B;  5LP6 E;  1YD8 G;  4IE0 A;  3C51 A;  1IO4 A;  2C9L Y;  1AFO A;  2YO3 A;  3I0O A;  4ISS A;  4TX5 A;  1NO4 A;  2B1E A;  2CXF A;  5FXV A;  3ZMZ B;  3H6P A;  4PJL A;  2KZ7 B;  4ZI2 C;  4HH2 A;  4WBA A;  1JO5 A;  1GU5 A;  3E08 A;  1GL2 D;  5AW9 B;  5CCG D;  3ONX A;  4WW0 A;  3ZC0 A;  2N1G A;  5FYM A;  3TYY A;  3UIA A;  1IK9 A;  3N2O A;  1LKX A;  1CZQ A;  4DND A;  1FU1 A;  1NTZ K;  1SP4 A;  5AVQ B;  5CCG A;  2JRK A;  2LHR A;  3RYI E;  3ZMT B;  3MJX A;  1RF0 C;  3V5U A;  2PAJ A;  4B6X A;  3KDP B;  2M67 A;  4ZHQ E;  2BAS A;  1HG2 A;  3BVH A;  1HFA A;  1MMG A;  4B86 A;  3V5S A;  2R5B A;  1FIO A;  3CX8 B;  3O1J A;  5JR9 B;  2HPL A;  3CLQ A;  1HCI A;  1UX4 A;  1W2E A;  3H32 B;  1IZN B;  2LT3 A;  1GW3 A;  2WWU A;  3I5C A;  3C4X A;  4IDZ A;  1IAP A;  1ZKE A;  3KDS E;  2FYZ A;  2V7I A;  3N9P A;  3WAK A;  1N7S B;  4N78 E;  1YTZ T;  4QX7 B;  2VL8 A;  1HBW A;  4AKR B;  1RF1 B;  1GK4 A;  1MMD A;  3CPZ A;  1LTA C;  5BU8 B;  4JF7 A;  3O1I A;  4AKG A;  2ODV A;  1MZ9 A;  1LTJ C;  5APS A;  2FYU K;  2WSE H;  2YKP A;  1QUU A;  3JC6 D;  2WT7 A;  3OBV E;  3B5N D;  3VOP A;  2J58 A;  4UVA B;  5JRE A;  5AW2 B;  1MIY A;  1URQ C;  3AAI A;  5KDM C;  3L37 A;  1GZL A;  2KB7 P;  1A02 F;  2CLY C;  4IFD K;  2YIN A;  2XAG B;  1KZU B;  4ZS3 A;  5JDH A;  2OAR A;  2OYH B;  1MIV A;  1UCU A;  1UX5 A;  2LSG A;  2LSK A;  5JDN A;  2D2S A;  2NTX A;  5JH7 E;  3LID A;  3RL0 C;  4MFR A;  2LOS A;  5BVZ A;  1T98 A;  3MTU E;  2UXN B;  2WSS V;  3KBU A;  5L3B B;  5A1L A;  3I1A A;  1E1H B;  2CM0 A;  3CX6 B;  1KIL C;  3E1I A;  3TK1 A;  2OYH C;  2LE8 A;  2NTY A;  3C4Z A;  2N9B A;  5KMG P;  4GT1 A;  1PFI A;  2RP4 A;  2P67 A;  3M0A A;  3OAK A;  1D0Z A;  3GHG C;  3B5N C;  2KP8 A;  2H3R A;  3LW5 H;  2XDJ A;  5KJ7 C;  2E9X B;  5L3D B;  2GK9 A;  1SQV K;  2L5G B;  2FKW B;  3VYI A;  5AVU B;  3N5L A;  5JVD E;  3RYH E;  3II6 A;  5L3F B;  1N73 A;  1JY2 P;  3PTR B;  1D0Y A;  2EHO D;  4PJM A;  1VRB A;  5DJQ C;  5EK4 A;  1ZHC A;  4AYC A;  1SQX K;  5AW7 B;  2PJQ A;  3ANW A;  5FNV E;  4KHX A;  3RK3 C;  2XQY A;  3PDY A;  1G8X A;  1IFI A;  3J7Y q;  2CPS A;  3FXE B;  4MHC A;  4NUU A;  4H9R C;  5LGU B;  3HE5 A;  4W7Y A;  2Q9Q C;  5KTB A;  1GDT A;  2I1K A;  2YKQ A;  3FB2 A;  2ZFC A;  3HTK A;  1NOH A;  4P09 A;  4JYB A;  1WT6 A;  1YYC A;  3PUQ A;  5FY0 A;  3R6N A;  2EHO A;  2XNX A;  2J59 M;  2K5B B;  1Y64 B;  3EUH A;  2HPC A;  1RF1 C;  3FHN A;  1EZ3 A;  5JDG A;  2Q9Q A;  2X51 A;  5F8P A;  1RE3 C;  4UV8 B;  1HJB A;  3V4Q A;  2Z6E A;  5ADX L;  3SRZ A;  3AVR A;  4HGA A;  2I59 A;  3C98 B;  1L4A C;  2PBI A;  3K3Q C;  2BZB A;  3HE4 B;  3HKC E;  2KWI B;  1FDM A;  4YFS A;  1D1B A;  4CQI A;  1HF8 A;  3HD7 C;  3ZJ2 A;  3NTN A;  3BQK A;  3U59 A;  3KV4 A;  3NZQ A;  1S9K D;  1N73 C;  4UF0 A;  1GK6 A;  1LTJ B;  1DH3 A;  3M9Q A;  4YJ2 E;  5APY A;  4CXX A;  5LJN A;  4IE5 A;  4I50 E;  3ZMU B;  2LKM A;  1US7 B;  3LBX A;  5KJ7 A;  1M1J A;  4LLH A;  2MOZ A;  4C91 A;  4WBN E;  4IST A;  1LTB C;  3B5N A;  3GHG A;  3O1H A;  1N73 B;  4ZI7 E;  1LRZ A;  2J1D G;  3AA0 B;  2FXM A;  2QM7 A;  3P32 A;  2OYH A;  2E9X A;  4ZI3 D;  3HA4 A;  3IBP A;  2A45 H;  2O1J A;  3SWY A;  3IR9 A;  3HUS A;  4I55 E;  4P0B A;  3FBL A;  2MBG A;  3EDV A;  1KIL B;  1G2C B;  2MJZ A;  3HD7 D;  1OWA A;  4H63 H;  3M65 A;  3CKD A;  4E7Z A;  2JEE A;  4XE5 B;  2GM4 A;  1SVF A;  1JMM A;  1S9K E;  3H37 A;  3KV5 A;  4Y99 B;  1IJD B;  3HUS C;  1FOS F;  3KVB A;  1FJP A;  1M1J B;  1SA0 E;  5LBM A;  2KSJ A;  1HTJ F;  2C5K T;  4AUW A;  2E9X C;  3KV9 A;  3CVR A;  2W61 A;  1MND A;  5L3G B;  2VKJ A;  5HXE A;  3HKE E;  1LGH B;  3VP9 A;  2WAU A;  1SHZ C;  2K48 A;  4DBQ A;  1S94 A;  2Q9Q B;  1FZB A;  3HE4 A;  3C4W A;  2JPF A;  4KUM B;  1M1J C;  3VU7 H;  2E43 A;  5APQ A;  3F2E A;  2WSF H;  4RES B;  3LK2 B;  4PNI A;  4CI3 B;  1KIL D;  1HG5 A;  4IFM A;  2GUV A;  4I6M C;  2CA5 A;  3LG7 A;  3QC9 A;  5LGN B;  3HD7 A;  4HEA A;  4KBM B;  1LTS C;  4CXY A;  4ZI3 C;  5APV A;  2DCF A;  1NKN A;  1L4A A;  5APX A;  5H6R B;  1V9D A;  4DO0 A;  1RF0 A;  2JJL A;  5KJ7 D;  2XHE B;  5AVW B;  4IE4 A;  4TV9 E;  5CCG C;  1URQ B;  2NW9 A;  5FY7 A;  1RE3 A;  1T8Z A;  2HG5 D;  1JTH B;  5AW4 B;  4O9B A;  1O3X A;  1FAV A;  2JMH A;  2MYS A;  1RF1 A;  3M9B A;  1MMA A;  3KYQ A;  2R5D A;  2EHO C;  2HLO A;  2NW8 A;  5CA1 E;  3VTP C;  2V26 A;  5F3J A;  3ZMV B;  1IFJ A;  2IW5 B;  3KQG A;  2YU1 A;  3MAC A;  2X67 A;  3RK3 D;  2C0S A;  3AAA B;  3JC6 C;  4XZC A;  5JDL A;  2P9B A;  3A5T A;  5DAB A;  3RC3 A;  4O4H E;  1J1E B;  2H43 A;  3E0Z A;  2HYN A;  3CQG B;  4UV9 B;  4JUY A;  4BA9 A;  3BAS A;  2X0L B;  2UXX B;  4A56 A;  4H9Q C;  2YU2 A;  2H7V C;  3N9N A;  3ZYK A;  5HWX A;  1QL1 A;  2DI4 A;  1WLX A;  2ZMA A;  1SFC A;  4I4T E;  4PFO A;  2L9Q A;  3PU3 A;  3ZN0 B;  3RL0 B;  1L4A D;  2WM9 A;  3CL3 D;  2D5U A;  1T2K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...