2BKOA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkoA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkoA02
4GVLA 4J90A 1SUMB 1T8BA 2BKOA 3JXOA 2OLTA 1LNQA 1T72A 4J7CA 3RBZA 4L75A 4RO0A 4XTTA 2OGUA 2AEMA 2AEJA 2BKPA 2IIUA 4L74A 4EI2A 3KXDA 4L73A 1XWMA 3RBXA 4J91A 2BKNA 4J9VA 2AEFA 3L4BC 3L39A 4G65A 4L76A 1VCTA 2FY8A 4J9UE 4YS2A 4Q25A 2I0MA
chains in the Genus database with same CATH superfamily
3UUMA 4HT5A 3ZTQA 4NLYA 4X65F 4IG0B 4DV7F 2YNHB 2JNJA 1HX8A 4QH1A 4YOEA 3JTPA 3T5JA 2DNGA 2G1HA 1U02A 1FKPB 3MAQA 4JV0A 4ED2A 1HNVB 3FZLB 4DPUA 1N88A 4X62F 1SIZA 2ZDOA 2WBLA 1N5VA 4A97A 1RZMA 2O1PA 1HHTP 1VMBA 4BJNA 1ZKEA 1NKCA 1H7CA 4NCGA 2HWIA 3EDUA 2FY8A 3NS6A 2DO0A 2C2NA 2RKIB 3CIMA 4DV1F 4C8LA 4LMJA 2AJ0A 2WTFA 1N54B 1CJUB 1UCUA 2VBXA 2JQ9A 4HHUA 2UP1A 4QU7A 5KG1A 1YJWS 2BKPA 3N9UC 3OL7A 1N34F 3CC7S 1NK9A 2VQFT 5D77A 2YKPA 3UU4A 4ID5A 4TY8B 2XGQA 3GILA 5KFOA 1YJNS 4LFCF 4F67A 2POKA 3AXJB 1HL6A 4QWAA 2M52A 4O3QA 4QIWD 1F5AA 4ILLA 2QYGA 3G82A 3CD0A 3R5JB 2LSKA 4I64A 5E3CA 3TANA 4WU2A 3H59A 2L8KA 4C9DA 2LQ9A 4YB6A 3MMAB 5ETLA 1J5ET 4MYUA 3H5UA 4WZXA 2D5UA 2WP9A 2DR6A 1HCIA 1JLAA 3D0IE 4D3GA 3MR3A 2X0HA 2XS5A 4UOHA 4GK0E 5AQHB 4PCQA 2VG5A 2DR8A 3HLUA 4Z8XA 2XQ8A 4AUKA 3DRPA 4ZPBA 2LDIA 2AJQA 4DR7J 4J9MA 2VC1A 4AKLA 3C15B 4C0BA 4IOAQ 4DDFA 5H9FK 4OHXA 2L9DA 3CX6B 5I3UB 1VFJA 2XSJB 4EI2A 3NS7B 4KGVB 2ALZA 2N82B 4NXNF 3K7RA 1RI7A 2NXUA 3UU8A 2QYCA 2XYGB 2MQOA 2XNRA 3M32A 3BO4A 2HBZB 1U1RA 2WOMB 4L0RA 4KO0A 2ZH6A 1SL1A 1K44A 4ZOSA 4DN9A 3GIIA 3U1LA 5HAOA 2E5JA 4KPCA 5E33A 1AA1B 3OUYA 2GQ2A 2DNOA 2B51A 4UUXA 3MEEB 1QAYA 5LMNT 4ITSA 3CMES 4K4SA 5IT0A 2FB0A 3TZWA 2GO9A 4B3SJ 4FYDA 3CMAS 4CO1A 2OP5A 2BE2B 4WW0A 4LFBF 1N56A 4B3TJ 3TX8A 3JYTA 3M32B 4LF7J 5JJBA 4A8SA 4HFEA 3K17A 3RYFE 2LEAA 1FFGB 4L3KA 1MWYA 1SQGA 1R43A 2DBBA 1U49A 2QLJB 1NXIA 3QFHA 1HNWJ 4NOHA 2BRKA 3BBCA 2AZ1A 2HRUA 3VAFA 1ZAXA 2ZBIA 2AQ4A 2A6OA 4F8HA 3V81B 4U2YA 3UQ4A 1LW0B 3TOQA 4LF6F 3JQKA 4DQQA 1RAFB 1KEKA 4V19J 2JVRA 2H51B 3VQSA 3IWNC 4AQFC 3V4IB 4LR9A 1B70B 4Z7YA 4Q43A 2HVDA 1L3KA 3DOKA 1WJ9A 2ZLYA 1VCSA 1MG7A 1KS2A 3CVKA 1NRKA 2GMHA 2Y0SD 3KV4A 9RUBA 2B76A 4K0UA 5C3JA 4B9LA 3ZNJ1 1S6PB 3VAGA 1NKEA 1XWMA 4FF1A 5LT5A 3L4BC 5LXRA 4DR6F 3EXCX 5B0BA 1S57A 4DJBA 2JSXA 2WSCC 4NLWA 4ZS2A 3K5MA 1X5PA 1U0SA 4YDDB 3GA8A 1DU2A 2JJ4D 4EYUA 1MIWA 1ZZNA 3SRZA 3QT8A 4F8RA 4AQYT 2YWHA 2EFGA 4PXDA 3V5SA 2GJ2A 4C11A 3VAKA 3AXMA 4L73A 3CJ4A 2PMZD 2W66A 2QGFB 5FL0A 1JLCB 2PBIA 4K8RA 4NA3A 1BR4A 1PG5B 3H37A 2Q6BA 3GIJA 2Q9QC 4YMEA 3QT5A 2DGQA 1G7CB 3GFHA 3DM2B 2VG6A 3LO3A 2BABA 1T03A 1T9WA 2VJUA 5KFQA 2W67A 1HF8A 3AE2A 2KL8A 5KG0A 1URRA 1NPPA 3QGGA 4CXYA 4C48A 5AE3A 2C28A 4IQXA 4OIXA 2VBZA 5DZ6A 1JMTA 3N9QA 3G8TA 1F2GA 3G06A 2MQLA 1FKPA 2YX1A 2DYAA 4BLGA 4EBEA 5IC4B 2M4MA 1SUQB 2FUPA 2AP6A 3DGPB 1NBEB 1MWZA 1IM4A 3PDYA 2DGOA 5AQNB 2XHEB 2Q79A 1HNXT 4O2AE 2A9UA 1U1PA 1RWKB 4H54A 4HFHA 3DRXA 4LFBJ 2E5LJ 2B56A 5LMNJ 4WBNE 2XY8B 2DGWA 4DL0C 3UCZP 1YX2A 4PNIA 3BDPA 2KFZA 1HR0J 2KYXA 3HHEA 4L74A 3FRYA 4DIDB 4LFAF 3GR1A 4ZA1A 1VBYA 3Q9DA 3I32A 1Q8IA 2HHUA 1HNWF 2HRTA 3ZTSA 4XZCA 3LALA 3NOCA 4N41A 4A48A 4ZLPA 1Y0HA 2IDLA 4G1QB 3OPCA 5E3AA 3M8QB 4CLFA 1MLAA 4NLUA 1RXOB 1U1NA 1B0TA 2OLWA 1JLFA 3NMAA 3PJXA 1AFIA 3MM9B 3KJVA 3MECA 1HQUA 1F3VA 2HZVA 2W2PP 2VQFJ 1T0TV 1RT4B 2M3DA 1SJ1A 2V7JA 2J0WA 1RWMB 3DLKB 1UEUA 3CJKB 5AXLA 5HLFB 2ROPA 4ELTA 1TL3A 5D78A 3LPEA 4LRAA 2YDQA 2VDIA 4DS5A 2PFDA 2BG9A 1S1XA 4YQWA 4P52A 2CVIA 3G86A 1HBMB 1S35A 4OV6A 3LP0B 1L0VA 2OPSA 4RO0A 1LW2A 1SI9A 3RAXA 1WWHA 3M8SA 2YY3A 2OKQA 2BVMA 4DBQA 5D0HA 3CTRA 3MI7X 3KK2B 4OLOA 4K4WA 4NCBA 1O5JA 3DDNA 3WX4A 2YDRA 3DC2A 2ZUGA 3CULA 3Q2TC 4X4NA 4ED7A 1VC0A 1VRTA 2EFNA 2HGMA 5T7LA 5CD4H 1M5KC 2CPZA 1RWXB 2J8SA 4IDKB 3BGLA 3MEGA 4DX6A 3GV5B 5F41A 1XR7A 3Q2SC 1VOMA 1LEOA 4FPRA 1XTZA 3DRRA 5JR9B 4AQYJ 3PW7A 3U27A 3KG1A 2H3EB 5LMUF 2HN2A 2CG4A 1D8YA 4UOFA 1SKWA 2IDOB 4M1KA 2UXBF 2CRLA 4UOGA 2N7YA 3ZZOA 2CHNA 4USMA 2HPJA 4BBYA 4V19X 2UVVA 3QC9A 4KQZA 4KY3A 1X0FA 2CQCA 4Y65A 2WSSV 4ILMA 4ILBA 2KMFA 3HFKA 2BQUA 2V8SV 1AZSB 3AEAA 3L09A 2X66A 4CLSA 4X66J 1XNRF 2XQAA 4WFBQ 4MK7A 2OEMA 2ZC4A 3Q8PB 1RTDA 2YX4A 5D4PA 3KNAA 4TNWA 3QWUA 2VUGA 5M2RA 1LWXA 2X3DA 4OHWA 3ILIA 2W4DA 3BPDA 1QDUB 1PIEA 2AZ3A 1UW4A 3KWMA 1K1QA 2K7KA 4UVCB 2AYEA 3IHRA 4EUVA 5KFCA 3R5BA 1TL1A 1H7XA 3MF5A 4QWNB 4DPYA 3ILJA 3MM6B 3KLIB 3T9NA 2EW9A 3HSZA 2W9CB 2B9XA 2HS4A 2LYVA 2JLGA 3HT0A 2AX0A 1B0VA 3O8WA 3EAMA 4UV8B 3MD3A 2BE7D 3I0SB 3AQOA 1JLEA 1XN9A 1UJ4A 3SFEA 1D9AA 1TFYA 1OO0B 2P9GA 3MWBA 5C8YE 4MYTA 3TEHB 3TAMB 3WI3A 4NXMT 1RTHB 3AD7C 3FEXB 3V6DA 5KFWA 1RAGB 2B0GA 4AXJA 4PFOA 3MTKA 5ABHA 3Q5EA 4JI2F 5DG8A 1VQNS 1QE1B 4B3MT 5CCMA 2R7XA 2JFKA 2R8JA 4PG7A 1RTZA 2IVYA 2XMJA 4ECRA 1JX4A 3UNYA 3PYEA 2R7TA 2GIQA 3PY8A 3AA0B 1P9YA 3MAAB 5LMUT 2CQBA 4DR2F 2IM3A 2IRXA 2QA4G 2WCAA 2IVMA 2ZZNA 2W4XA 2FQQB 2LOSA 3LH2S 2DR9A 2AYGA 2LXIA 5KFXA 4LF4F 4P6QA 3NWIA 2OPQB 5B0EA 5T7LB 2VFVA 5A6PA 1VRTB 3Q2MA 4U7UK 1FA0A 4XK8C 2DXDA 2I38A 2B7CB 3SFUA 3ELHA 2L9QA 4PAAA 2B5JB 2LHRA 2NUUG 1IBMJ 3VR9A 3J7YU 1S7HA 1YJRA 2Y1LB 2B8PA 4F26A 3LPYA 1RTIA 5AJ3F 2XQ5A 4HHHA 4OZJA 1WHVA 3QRPA 1HG2A 2B8QA 4IDKA 2XQ4A 1S5ZA 1IBCB 1F9FA 2Z58B 3KHRA 1RDRA 4CM2A 3NBPA 3MAAA 2ZM2A 4N47A 5E5NA 3B4MA 5LSRA 2XQ9A 1S99A 2RD5C 4OYBA 3KJVB 1JJ2R 3UFCX 2CE7A 1BWEA 5AQIB 5LCYA 4DLGA 2DXFA 2XG8A 2Z2MA 3PUYF 2MXYA 5HMZA 2CQ4A 5ETSA 1RHQB 4QIFA 5L46A 3W62A 3OL6A 2AX1A 3BBFA 1RB0A 4Y3CA 1S1XB 3W9HA 1PJ7A 3S6EA 5E3QA 3CPZA 1ZTWA 1HW9A 2L3LA 5L2LA 4PXCA 1IKYB 5JDHA 4DSEA 4A5XA 4JI8T 1LK5A 3CCLS 1HWUA 3IBFB 1HFAA 3SQGA 3EZ5A 2HMIA 4XDCA 4GC6A 2ZM8A 3DLBA 2B7BB 4IL9A 3HSDA 3QOFA 2YH1A 1VHFA 4O4JE 3W9IA 1NZ8A 2MAWA 2NPIA 3TLUA 2WMOA 1Q78A 3I87A 4IH6A 3IBCB 3KV5A 3TZZA 4ZN3A 1Y3KA 4DO0A 4ZVOB 1OYDA 3LTOA 3O9XA 3ILLA 2SPCA 2PSZA 1HI1A 2NW7A 4KV8A 1RP5A 5F8GA 3L7OA 5G0RA 2UUCT 3QB5K 4E98A 4P7VA 1CS4A 2KB2A 2EVZA 1NJIT 1R8BA 4A98A 5K14B 3KUEA 2J7KA 4S0MA 5DM6Q 4WFNQ 1WYBA 1T03B 1UCNA 4QIEA 3TJ8A 4QIVA 3TYTA 3R6LB 2H54B 1XDPA 2JWNA 1O0PA 1NSQA 3AEGA 4OI4A 2NXNA 4RUHA 5EZYE 2QA7A 2ZBCA 3UDCA 4V1Ak 1Q16B 2WZHA 4DL4A 3K8VA 5FYMA 3RLFF 4A8WA 3RB4A 2EFOA 1N5YA 2EKYA 3I0OA 3U02A 4MTPA 4CN6A 4FNIA 2KG1A 4EV6A 1U1LA 4NLSA 4OMFG 3EZUA 5C25A 3RF1A 2D9DA 4ED3A 4HACA 2KRBA 3NGRA 4AL7A 2ZMAA 3AJ1A 4LBHA 5EUHA 4YHHJ 5HCMA 3AQPA 3D1HA 3OV7A 2R8IA 5GMKa 2EG2A 4AI6A 3IGVA 4P75A 3T1YJ 2KXFA 5BJRA 4WF9Q 3R3TA 5DGBA 1CJTB 2DNRA 4AYBD 5A0YB 1EZ3A 2EWHA 3GIMA 3C19A 3LP0A 2XY5A 2BM1A 1X5OA 1P27B 3I0RB 3VV2B 4F0MA 4CIOA 3V4IA 4MJKA 2QFIA 3E22E 4WK3A 1H74A 2DI4A 3CIZA 1ZPWX 1NWMX 5HLFA 1U2RA 4IDQA 4RW8B 1A7GE 4HWCA 2MQQA 4M5HA 3DLKA 4YR3A 1ZEEA 4NLPA 3N2OA 1K8AT 5H9FJ 1XQIA 3R84B 3ONQA 1PYSB 2UV8G 2EHOA 4RW7B 3Q0AA 4DL7A 3CCVS 4TQSA 1XDOA 3FFIB 1FJGF 2MSTA 2GMJA 4RU2A 3PG9A 3FK4A 4LRBA 4OJHA 2FJWA 4BWJA 2XS7A 1AT1B 2D3UA 3MUTP 5ADXL 1X4BA 1X31C 3KBTA 2A0FB 7AT1B 2IY5B 3JADA 1SCJB 3MTJA 3W8GA 2MEWA 4CLLA 3T1HT 3J7Z5 1LQ9A 3LA0A 1JLBB 2V50A 4UV9B 4KRWA 1CLFA 4EGLA 1NCLA 5HN0A 4ICLA 3J7Yq 3M9MB 3DI6B 4DR1F 1JWWA 4ZOLE 2HNDA 4N7TA 2AKWB 3BO3A 3CDWA 4QWBA 4Y6IA 2BE2A 3GN5A 2W2QP 2J5AA 3C16A 1LVFA 2H65B 1WC4A 2COLA 1R31A 2XSJA 3QRRA 2OI2A 3FUYA 2ZFHA 1KOHA 3MUVP 1S1WB 4G1PA 4TN7B 4N77A 3N9OA 5IYZE 2NYHA 1S9FA 3TUIC 4ED4A 2HK3A 4ILUA 2LLZA 1WHWA 3FFIA 4UEMA 1M90T 3ZSSA 4EZ4A 2HFUA 3D7SB 2R8KA 1BC6A 2J0SD 1O3XA 3W7BA 4GO7X 4ZCMA 2XLKA 3MGJA 1MN9A 2DNKA 1M1GA 5HEJA 3B78A 4X64T 1D8ZA 1D0ZA 4NXNT 4TYAA 5FXWA 1CJKB 4TUYE 3C98B 3I5BA 1ZA2B 4B3TT 4RW8A 3TI0A 2LQ8A 2RDIA 4U2ZA 2VG7A 2WSEC 2ZM6J 3MPUB 1TKXA 3P7IA 4GKJT 2MQ8A 4Q2MA 1TAUA 2RUGA 2KZ7B 4ILCA 2ACXA 4WK1A 3R9LA 2V6XA 3MD1A 1LK7A 3D0GE 2FLOA 4LFAT 4NYZA 4PG8A 1OEDE 4EAHA 2J0XA 3MK7C 3VRBA 1OY6A 2Z6EA 1RHMB 2RU9A 2HNZB 4I67A 1OY9A 2NTXA 2BDPA 2LQ5A 1N5SA 2VPZB 4IQMA 4PG6A 4ZPTR 3I9YA 2I0XA 2W61A 2LVWA 3VGUA 4QOTA 5A8WB 3IFEA 4K4ZA 1WR0A 4ILAA 3PDNA 4P2MA 1D1UA 3RIFA 3KLHB 1X4DA 3PHEA 3CMLA 2DJWA 4ELVA 2CVEA 4FP9A 1S79A 4EO8A 3ZT5A 1WFDA 1VISA 1I94T 1BLUA 2LECA 3OT9A 3MR6A 4NCGB 3CMQA 2WDQA 1NDCA 4OFZA 3H5YA 4J2CA 1FNMA 1M5VC 4OYIA 4F4WA 5A6WA 2F3JA 5HVHA 3S1TA 1DARA 1FRKA 1LW0A 1D0YA 5JDGA 3T8OA 2CBIA 3BGRA 2FGCA 2HLTA 3IEEA 2XO6A 1CJUA 2IC9A 1WDDA 3TLWA 5J2MB 1W2IA 2QRXA 3DLGA 2ILYA 1XMQF 1HI8A 2F4VT 3H2UB 3PRBA 4J5OA 5LMUJ 2YPZA 5KOXA 3UCUP 5I4MA 3JCFA 4P9SA 3PXGa 3KV9A 1XR6A 1XMOJ 1H38A 5HCJA 5J2PA 3VR1A 5DO2A 4UZBA 3TA1A 1NUEA 3DOMA 4ZP7A 3CCQS 4N76A 3GTYX 3BKTA 2VKRA 4X4VA 4WKYA 3HSJA 3PJAA 3W63A 3HKEE 5F8NA 3VVUA 2FDNA 3EDVA 1WSVA 2KSRA 3GJSB 3RR8A 2V8PA 3SOLA 3UDEA 5DQGA 2PC6A 2WBRA 2JDJA 1K9MT 3P4UB 5J1PA 5F8MA 3KLVA 2C2MB 1YVFA 3NGTA 4DMWA 2H4WB 4H4OA 4ZMMA 1S77D 3FHNA 4DV6J 4DR6T 4PWDB 2WWVA 3K2YA 4E0DA 1JLBA 2CZVC 2GFFA 3N5FA 2HMIB 4LVNP 3QGIA 4U7YA 3RIUA 3ZN1B 4P1NA 2QC3A 2CQ2A 2GQCA 3FZFB 1NSKL 3GZ7A 5HATA 3SCLE 1WOPA 1YTYA 2E66A 5KFSA 2I8EA 2J9CA 3KMQA 1PO6A 2HVEA 1FD2A 2CNLB 1GXUA 5BMVE 2YWKA 3ZTRA 1DHMA 2C2DA 4CO2A 3UFGA 2QG9B 2V6AA 1KQGB 4HTIA 2F4FA 3DNCA 1EARA 3IXQA 4OZ1A 4X4UA 5KFLA 4WKRA 5LJ3Y 1HBOB 4PJNA 3W2VA 3I5AA 4QZVB 2DGTA 1BE4A 3NGSA 3UUXB 2MKIA 1S7IA 4Z91A 1XK8A 1VIOA 4B3SF 2K9AA 2HNYB 4GOUA 1R6YA 2F9JA 3A5XA 1UETA 4KSEB 4DSKA 4AIUA 2OPRB 4A46A 1NM2A 2EBGA 2VBWA 3SSSA 5F8HA 2BXJA 1CEZA 1U2FA 1LWFA 1BXNA 2XCPA 1NNDA 4R25A 4FVMA 1QSDA 3FXDB 5KT6A 4USWA 1J27A 4JI4J 2O3DA 3H40A 3UVJA 4ZI2D 4USTA 2FYXA 3ZFVA 3AA1B 1CULA 1JKHB 1W25A 1H2TZ 1TL5A 5L8RC 3OTBA 1FKOB 1CBKA 1FKOA 5DABA 4OZ0A 5H9EK 2IVFB 4NUUA 1WSRA 4C6AA 2PN6A 5CAAA 1U1MA 2XMAA 2NUHA 3CJRA 2VWAA 2JQQA 3FSYA 2AW0A 1CQMA 4GC7A 2CKWA 1T3NA 1YRUA 4BJMA 3D6MB 3RW6A 1N33J 1X9MA 2CAJA 3M6VA 2LFVA 2X68A 2E9XD 3R7SB 3ILOA 1N34J 3Q89A 4OI6A 1HNZJ 4AXPA 2M2BA 4F2SA 3SDEB 5LGNB 2XM1A 3ENAA 1VQYA 3N6MA 3I5CA 2OUGA 1H6KX 3A8YC 2DY9A 3MURP 1QUPA 2CJBA 2DO4A 4DV2T 3V4MA 1U8WA 4WWSA 4DX7A 2Z56B 3IAS9 2YKOA 2FLPA 1XC9A 4NLQA 4L9IA 1NK6A 2XHWA 6AT1B 1DLOB 5BR8J 3HCXA 1YWXA 5L47A 4DR2J 3S01A 4KHPT 2V68A 2BS4A 5K14A 1UFKA 2DCFA 2ZD1B 2XI3A 1FXRA 1LKZA 4A8FA 1Q4RA 2EFVA 1VR6A 2OD4A 3G8QA 2LQJA 4ZPCA 1GEHA 2WQYA 1EAYC 4JI7F 2CXFA 2OLTA 2W9CA 1T72A 2BZBA 3H7HB 1A9NB 4CTAA 5LXYA 4K4UA 4ED1A 1HWIA 5C2GA 3UU3A 1HS7A 4MIWA 4CI2B 3CDUA 2R2TA 3DXBA 4WZMA 1WKLA 1YZ7A 5HP1A 2KVQE 2P9BA 4ED0A 3CQGB 1TL7B 2EC0A 2QA2A 4ZK7M 4OYWA 3MOJB 3PHTA 3NXZA 3NP5A 2CCQA 2V6YB 3MUMP 4DL5A 2QTWA 4DPTA 1R8PA 2MSSA 1WHYA 3BQ0A 1WEXA 3SV4A 1SC6A 2FZKB 3D4JA 2BBEA 1Z1ZA 4NMLA 2V7KA 3OPKA 3TLSA 1QSSA 4K0KF 3EI0A 3O6QA 4MBQA 4BC7A 2GV1A 1FF2A 1NJWA 2RHQB 5IHYA 1FERA 3FZKB 2R2SA 4Q0BA 1G4CA 3KJQB 4ZIWA 1KKHA 1D1BA 1BY9A 3E01B 4R8UA 1TMMA 3KLGA 2JMHA 1FRHA 1MMGA 1FRIA 4F02A 1RACB 2Y1RI 4RNHA 1E1HB 3RBZA 1TP7A 2XMVA 3T41A 2XS2A 2DRAA 1ZOTA 2LOPA 3QSIA 1XNQJ 2E7WA 3M8RA 1SJFA 2FZGB 4EGWA 3BGFA 3KMSA 1RT5A 1H7WA 1B7FA 5GVQA 3K3NA 4ZDNA 2W2MP 4WIIA 1SQEA 4I4BA 3MACA 1VQ5S 4MKVA 3UR3C 4DV0F 3JSMA 2D1CA 1B99A 2C3OA 2HN1A 5FXXA 2XZDB 2N2NA 4JI7T 5BYRA 4ZVUB 3K58A 2W1BA 3MMCB 2HURA 3IRWP 5KMGP 3SIPB 2WRMA 4ES3A 5ETPA 3M2VB 4LIWA 4X4SA 2D9PA 3IA0A 3F57A 2VG7B 3NGKA 5K5MA 3RR7A 1KD1T 2JOQA 2V8HA 2OH2A 2NR0A 1IBLT 4LF8J 3T1YF 2YKMA 2Y0BB 2D3O1 1M7KA 3UN5A 3JC6C 1RU2A 1RHRB 3RH3A 4GYSA 4JI6T 3KLFA 3IA3A 4N78D 4CYUB 4R0JA 4QR1A 2DR5A 1KR4A 5CZXA 2CMRA 3PKMA 5DG9A 2IJRA 1GFWB 2CLYC 3KVBA 1SC4B 5FIIA 2SXLA 3ZMZB 5F9NA 2DVIA 2NP9A 5AXNA 4O3SA 3TARA 4P2XA 1UFWA 4H4MB 1N36J 4H9SE 2CLYB 4WE1B 1M5HA 1RAEB 5HXRA 2A2DA 4LFAJ 2KT3A 1DBDA 1U2CA 5KG6A 3TEGA 4EZ6A 4OYJA 5JDMA 2IUBA 3EVMA 2VOPA 2BANA 3GYNA 2DXEA 2KYZA 2ACZA 3HHLB 3M65A 4F7VA 2HYIB 2A3DA 5D0RA 4HKAA 4DV0J 4YTPA 1RT7A 5D15A 2DPIA 4M63A 4KE5A 2Y1JA 3L3CA 3GCWP 3UU5A 4PJJA 3LOUA 3L3PA 3A8IA 5J2PB 4CQIA 3RRWA 1FNXH 3OLAA 4DSJA 4NA2A 1BMQB 1I94J 4TV9E 1RAIB 2Y3YA 2HHSA 2ZH9A 5AQSB 2YU1A 1UWBB 4DG1B 2VPXB 1KP6A 3AE4A 3L9ZA 2HFVA 3RU0A 1RAAB 4PYAA 4X1YE 5H1SV 2XNQA 1IKXA 1E6VB 5CJ5A 3QQCD 3ITHB 4DR1T 4K0KJ 3HVTA 4RBUA 1H2VZ 2RHSB 2MLXA 1RAJA 5AQPB 4JEHB 2JLFA 3W60A 1FWPA 3Q83A 4C3MA 4YR2A 3AAWB 4M5DA 4C4WA 4IG3B 3LP1B 5GONE 1PC4A 4YSXA 1V5VA 1JLCA 2A2FX 4X4PA 1AYEA 4C97A 4ZZBA 4C11B 3GV8B 3CO0P 4M1PA 5FVKA 4RW9B 3PYFA 2W7OA 3H2LA 3QLHB 4B3RT 3HULA 3D3CJ 4WFXA 1EX8A 1LXJA 2B4UA 4MFRA 2WVCA 2ZH2A 5KFMA 3ET6A 5IT9U 3RIAA 4Q25A 2XUEA 3C3LA 1U4BA 4KFBB 1S59A 4I2PA 4OYOA 2OV9A 4B3MJ 4ZS3A 3K89A 3CIRA 2IA0A 2L08A 1KVIA 2YTCA 1B0PA 3HJVA 5A2QU 3CE8A 3KUGA 2CADA 3P6YC 4OJ3A 1S6PA 4RX6A 4E8UA 4Q8FA 1I5OB 1QUUA 3GG0A 1CJVB 2CM0A 4X4TA 4YDXA 4KHPJ 2OPSB 3EICA 4OJGA 2AD9A 4LF1A 4MIAA 3KXDA 2MKYA 5CZVA 4DV3F 2BG9B 3JS9A 1OPZA 1IAPA 3AAAB 2G0JA 4AXIA 4DR7F 2W8LA 4M5DB 3ISND 2IFXA 3CXCR 1RT2A 3I9ZA 4WNKA 4D3HA 4M5IA 3TKLB 3VCDA 3MR7A 4QH4A 3MECB 3R2DJ 2RRBA 2YKSA 2B3TB 3ZZTA 3PE0A 5KXJA 1X5SA 5EX3A 2MZJA 2HHVA 2QZ8A 3GMGA 3GIKA 5CYQA 1G1XA 4E2FB 3SCIE 2CQ0A 5J2QA 3BR8A 3OTEA 4RW4A 2PTFA 1Q79A 3D6HB 4USKA 1LFPA 3NOGA 1FDBA 5GAEU 2MTLA 1GK8A 2QLFB 1HYSA 2ZHBA 5MAOA 3J80U 1L3VA 3N9PA 3AB3B 3OFFA 5JDNA 1WR6A 1O51A 3H42A 3PO4A 5IC6B 3W3SA 2U1AA 4ELUA 2K48A 4XBFB 4USUA 4I55E 2WOMA 5B0AA 4IRCA 3UD5A 4JI2J 3AODA 2UXDJ 1NB2A 2V94A 4ZKAA 2HK2A 1L3TA 3LSVA 2W4CA 3AE5A 1HYSB 2GHWA 2Y1IA 2YKAA 2WW4A 1RT2B 4YJ3E 3FC9A 2EK1A 2ZWOA 1I6ZA 1APSA 5LXTE 2ZOGA 2EFQA 4KJIA 2DCUB 2DGXA 2D0TA 2R7SA 4UIGA 4LSLA 5BXIA 1GNKA 3RYCE 3HHNB 4RW7A 4NLTA 3ONLC 1IBKF 3JC6D 1Q86T 1C1BA 4MH8A 3EVWA 3VZHA 2KJVA 2ZDPA 1I1GA 2GGPB 2MQPA 2XZWA 1VBKA 2RRNA 1UEKA 1U6FA 5LOQA 4EFAC 3M8WA 5JVDE 1U25A 5KG5A 3Q23A 1IJ6A 2EHOD 1MROB 1FEWA 2XM2A 3TA0A 3CSKA 3PM9A 3PCOB 1C0UA 1QLNA 1VQPS 2FY1A 3GSDA 3CUNA 5HSPA 2KZMA 2CHOA 1HLWA 4ZJOA 3ZYMA 2XMMA 4X64J 5LBMA 2DEIA 3CD5A 5A0YA 3T9ZA 1OPIA 1BHNA 3OFGA 1CJTA 1PC5A 4CM0A 1SH2A 1X4FA 4CDIA 1W2BR 1HI0P 3RG6A 2MKKA 2DNYA 2MY7A 5AQOB 4JBWF 2JZ5A 1ZM3A 2B5JA 4ILRA 1TUWA 5KFEA 2KM8B 3N9MA 2M88A 3ZC1A 2ASJA 3KKFA 1HA1A 3D0HE 3LF0A 4Q7AA 5HXSA 4EWTA 3LQVA 2KKHA 2KT5A 3L39A 2Q6CA 3D9BA 3QFWA 2WB4A 3P4WA 3HD2A 2VVSA 1B4SA 2JLEA 4IO9Q 1WC5A 4WYVA 2OGUA 2J8AA 1HG5A 1IN0A 4KI0F 2KU7A 3CDEA 2J7UA 2LT3A 3W2WA 3Q8VA 2IMWP 2I6WA 3AE3A 2UXBT 5C7PA 1RE1B 2A2CA 4YY3J 4DV2F 2HWHA 1UVIA 3TLVA 1YDLA 3GB0A 1YJ7A 5J2NA 1HX1B 1ZYQA 2OPPB 1RU1A 3UNGC 5EK3A 2HWTA 2YKNB 3FBCA 1GH8A 2PEHA 4Q44A 2G2OA 3CW2C 3V5UA 3TAQA 5AXKA 4I0UA 2XLJA 2CPHA 1PJ5A 1KQSR 5KT5A 4JEUB 1ZAVA 1EQ0A 5KFVA 5K8NA 4Y2CA 3AXKA 3KLIA 3VALA 2ZH7A 2UVWA 4I7FA 3O3LA 3OUYB 4NI2A 1PBUA 2BE9B 1V6HA 5LG4A 4CTAB 1QUVA 2C42A 3LK42 2ZOMA 4JI6F 3GYXB 5KG3A 2QX0A 4RLEA 3M05A 3HK2A 4PPDA 2KH9A 1M0SA 2RJZA 4X20E 2B9WA 4FKYA 1SPBP 3T1YT 3CCZA 3FZ2A 1HPZB 5CABA 3KVAA 1X0PA 3ZNUA 4WE1A 1IXKA 3U7JA 1SH3A 2HPLA 2K7JA 1NAFA 1HBNB 4B3ST 2V2VA 4I2QA 4O4RA 2CPFA 2CPDA 1Q8LA 2MTQA 3FMBA 5EWEA 5J2UE 3UCGA 3DRPB 5KG4A 1G6BA 4URSA 3PUWF 3BQKA 3AA8A 5KG7A 3OVSA 5L1KA 2BUNA 3RW7A 2CUYA 3Q8SB 3RYIE 4IE0A 1HHQA 2L48A 2KG0A 2GVDB 1NH8A 4CWBA 4ATNA 2R9LA 4QIGA 3VTIA 3PX6A 3R7BB 3R27A 2MKSA 3OTCA 3GJQB 1T7PA 1H2UX 1Y11A 2ATLA 4O3PA 2N4CA 3C6UA 4PUOA 2CQPA 2BS2A 3W66A 4U72A 1S48A 3HKBE 3HFVA 2MQMA 4LFCJ 1TUGB 1FXDA 3JQJA 4K5RA 3EVYA 4WYLA 3M2VA 2FUG9 3CJ0A 3RI5A 4UR9A 1J2VA 4HHJA 5D3GA 2FVQA 5I3PA 4K4YA 4LFBT 1FT8A 3BF4A 3T1HJ 3OHAA 1NB7A 1HIYA 2IIUA 2BKNA 2GIFA 3P45B 3TRGA 4DV0T 4QCLA 4N5SA 2DNZA 2DWKA 2DPJA 1AUDA 1HBMA 3WIUA 4Y2AA 3VGVA 2IDEA 1OWXA 3QIPA 4X65T 2M8DB 2VKJA 3MJXA 9ATCB 4HKQA 1AW0A 4U7CA 4JYAF 5DQHA 2P9EA 2HS3A 1SIWB 5KFTA 5DDQC 3GPAA 3O1IA 2XCAA 3M2RA 3F2EA 2LKHA 2RDDA 2HNYA 4Q0BB 5B09A 2VL8A 4CLPA 4CQ1A 4I6AA 2XTJP 1RT4A 4CLWA 3VWSA 1KHVA 2PI4A 4UELA 2XAJB 1KFYA 4UF0A 1FRXA 2LSIA 2BM0A 4DMZA 4OZ3A 3O4XE 1GX5A 5FMNA 2ZBRA 2DHHA 4DV6F 2UVRA 4PG4A 2VFUA 4WBOA 1XMOT 3CC2S 3J7A1 2BMBA 3HM9A 3M8ZA 3FSIA 2FGOA 2V6YA 3JSYA 1GTEA 3ETVA 4DV2J 3P4PA 1BGXT 2XSFA 4QWDA 1XBWA 1UZDA 1X79A 1VGYA 2R7WA 3PACA 3EDQB 3EZOA 5LHIB 5AQUB 4RNFA 1WG1A 3IN5A 1EQMA 3PR4A 3AAIA 2DGVA 5HP1B 2BQRA 5I42B 3MZKB 5E7OB 4DV5J 3CF5Q 1IBKT 2CQHA 2HVIA 2CRBA 4H4KC 2O01C 1YJ9S 4C7QA 4RL1A 2FLLA 4IR1A 1XMQJ 2BBJA 1VQ7S 5TAOA 2D69A 3I56S 3NNHA 3ZZUA 4WBFA 1CC8A 4PW8A 2XGPA 2E5IA 2H4YB 2PD1A 4GKKT 4UF0B 3ZXWA 4JV5T 3SV3A 2AE9A 2XQ7A 3DP7A 3MA9A 3UT5E 4FN5A 4HWHA 5KG2A 2H1YA 2B4OA 1NDPA 1UWAA 3DM2A 4P2SA 4E7SA 3T5LA 2XAHB 1YQ4A 3HD1A 4KMCA 3C14B 1FRMA 3FSXA 1R7IA 1SC1B 2IIHA 2RQCA 1VJQA 4DPWA 3UQ7A 5HBMB 4R5PA 4X65J 1ZHCA 1SJRA 4B3OA 1FE4A 2ZHAA 4J9LA 3I82A 1DTQB 2P8IA 1AFJA 4DNDA 2XI2A 2YN6A 4DR6J 2ZJQQ 4TWHA 3IG1A 3X1LB 2I2YA 2HZAA 2ACYA 3HMJG 5D8HB 4EEYA 4Q8EA 2UUAT 2R8GA 5AJ3J 2OIHA 1URNA 3M1VB 3CNQP 2PT0A 2LM2A 3LG7A 3UUNA 4CNZA 1M5SA 2FZCB 3CJ8A 1UA0A 1KVKA 1MMDA 4PUOB 3SWHA 3NGDA 3IR5B 3R5GA 3NZQA 1RT3A 2Z0GA 4HE8A 3EABA 4DV3T 1PAUB 2IM2A 3VR8A 2C3MA 3HVWA 5CA5A 2OEKA 5HROB 3AEBA 1KF6A 3OL8A 3UDLA 2YWFA 4JI1T 2C3UA 4Z7CA 3HJFA 3HT3A 2ROEA 1SB6A 3ZPOA 4YXDA 1XERA 4DV4J 1BQMB 4IH7A 4CXXA 3ZCIA 2CNNB 1TL3B 4ZLJA 2DNLA 2DTJA 3ZLIA 3V81A 2GJFA 2J9DA 1Q53A 3PU8A 3D67A 5ETRA 4UVAB 5DETA 4IYQA 4XAKA 3LDQB 3A3OB 1VQ4S 2V9WA 1HPZA 1IVZA 2X1FA 2OSQA 5IV3A 1IQTA 4H4OB 3V6HA 1JLFB 5DS7A 1Y7PA 4QWCA 2E9ZA 2MZQA 5LM7E 2PFVA 1YD8G 4O4IE 5AQFB 1C1CB 1RJJA 2W8KA 1RHUB 3MM7A 5ADZA 3LJCA 2OFGX 3IO1A 3U1NA 4B3OB 1YJUA 3I96A 1U1QA 5HBMA 3PUXF 4G63A 4NYOA 3C66A 3BSCA 5KFNA 4WIQA 1UKUA 1U09A 1PYOB 3PV8A 3IWXA 4DV5T 4EMDA 4DR5F 4O4LE 4ZEYA 4R0EA 1EIYB 2FLNA 3BSNA 3W9JA 5IZHA 2VV5A 3R8YA 1UA1A 1QTMA 3KHLA 1ICEB 1TK5A 4DL3A 1SUQA 3RAQA 3DRSB 4ZN1A 4H63H 3BGRB 5F3ZA 2RPAA 3RTVA 2ZWPA 4H9OC 3QGHA 3LK2B 4ZVEA 1GAOA 4FS1A 3TQ1A 2HFNA 2F8HA 1KNZA 3DU5A 4DV3J 4QPTA 4DCOB 1SKSA 2GZOA 3J81j 3ZMSB 1S6QB 2EHOB 1J5EF 5C5JA 4UY85 3QO9B 2Q3PA 1IBMT 2D0UA 4IFYB 3C51A 1EJ7L 2M67A 2QYWA 2FHOB 2V2ZA 2YNGB 4DFKA 3CJTA 2XC9A 1IWGA 4DR3J 3PUVF 2Z2ZA 3PTWA 3PIOQ 2XQ3A 1FDDA 1S4FA 2H3RA 2J9DE 2V8VA 4YFUA 4EIWA 4FPIA 3RJMB 2PEBA 3AJ2A 4K4TA 3R6NA 2FHJA 3W5ZA 4GKJF 4X4OA 2UXCT 3UWTA 1R27B 3JAMU 3LAKA 1S9GB 5LOVE 2LSJA 1D9DA 2DD8S 4JI7J 2NW8A 5F0UA 3H20A 2G0UA 3U1MA 1KHWA 3GJRB 2Z57B 2FJEA 2KTQA 1K47A 3TP2A 5IQ6A 2FVCA 2OFHX 3PNIA 3UW1A 2ZM6F 3QO9A 3RB0A 1VRBA 2B4PA 3PX4A 3ZZ0A 5FNVE 5CXTA 1JXVA 2L9NA 3FVYA 1FWKA 1CHUA 2XYHB 4ZPAA 3E08A 4JBCA 5L38A 2LXFA 2UUBJ 4HT7A 4AQGA 2AMCB 5LBQB 3UO0A 3N9NA 4KX6A 4J9SA 2F9DA 3C2PA 2HFSA 4RJVA 3LP2A 1QJHA 3EDRB 5HWYA 2VQFF 2IBOA 4I43B 4DV7T 2BJ1A 3W61A 2V69A 4CO5A 3RYHE 2BVLA 2DWGA 2F5GA 2X0YA 2HNDB 3MZIA 4ECQA 4J9OA 2AEMA 4NZ7A 1XMQT 5KX5E 2VK9A 4L76A 3GR0A 3A12A 3BREA 4ICLB 4OYZA 3P8CD 4MKBA 2CZ4A 2PO4A 2HAIA 5L4EA 5HMXA 4DF8A 2C3YA 3FQKA 1CS4B 4I1TA 2LEBA 2AT1B 1IM6A 4CN1A 1TKZB 3RRHA 5JQGE 2M5YA 4O3RA 1TKTA 1DTTA 2JIWA 1OMSA 4OYKA 4PKDB 5KFYA 2DGUA 5THWA 3G9CA 4DUZF 4HTEA 2DHXA 5AT1B 1IKVA 3KK1A 2ODVA 1GX6A 4EXTA 1AXQA 1KSPA 2G13A 4WU3A 4HFVA 3JB9k 5HQ8A 3E3XA 4U9RA 4HWFA 3NS5A 1OEDB 1JLGB 3M8PB 1XEZA 2VQET 4DR5T 4DV5F 3UN3A 4CO3A 1WC3A 1RLCL 4N8NA 3R97A 1QY7A 2HAFA 5I3QA 3QIDA 3HKDE 1U24A 4HYKA 4ISSA 4DX8H 1NO8A 1T11A 4NI2B 4I7FB 2NZ4A 4DR4T 4RNOA 4ERRA 3OBVE 2BJ7A 1N4LA 3NY0A 4F6RC 4IOBA 3RBEA 4W4MA 4B9TA 4MT1A 3I0RA 4DR4F 4X5TA 4K59A 3MFHA 1S94A 2KO1A 3OTDA 4BAYB 3ZCJA 1VQ9S 4HH1A 1CJVA 4PAGA 3H4BA 3L8RA 3S8SA 1HMVA 1KRPA 1X4AA 4WFZA 1HW8A 3A13A 2YU2A 2KVIA 5ETMA 3CX7B 5LJ5Y 2XSBA 2YKNA 3EYZA 1QD1A 1DURA 5AQVB 1IBMF 4HEA9 3ULHA 3QK6A 1Z0PA 1TL4A 4URQU 2YQ0A 3K8WA 2CA5A 3B6BA 1RTIB 2R3VA 2JMKA 5J1NA 2Y6XA 2F40A 3F41A 5CQGA 2QA4S 1Q5YA 2IYGA 4PEOA 4BWMA 3ZMUB 4W92B 1FDNA 4LF8F 4OX8A 2DH8A 1TVRB 4J7CA 3DTOA 4ZVSB 3VGSA 1QSLA 2VL1A 1N32F 2F8EX 4PXBA 3CT9A 1RBAA 4CT8A 1X7VA 2NSCA 3RQUA 2DB1A 2AJ2A 1C0TA 3UFEA 2XQ6A 4AKIA 1VC6A 3EE3A 1TFWA 1K0TA 2YVSA 1WTFA 3EX7B 3RIUC 3RGIA 4A4JA 5FLXY 2W01A 4FF4A 3SFDA 3OFEA 2UU9J 4B9MA 3GP9A 4JI3J 3HDSA 2MPKA 3R6GB 1WI8A 2RIJA 3DLEA 3MM8B 1NHVA 3VKHA 1ITPA 1UVKA 1FXLA 2BW7A 1KBRA 4HL9A 1W0AA 2DHSA 4C8MA 3PJAJ 4LREA 3FZMB 5FDLA 1UP1A 1W7WA 2DIVA 2WU5A 3LWLA 3HHLA 2BS3A 1FTRA 2CPEA 5F8LA 4ZLNA 1NENA 3D68A 2HQIA 4KGZB 1RBOB 4M5KA 5FJ4A 4CLUA 2CJXB 1KTVA 2QLWA 4DUZT 1HR0F 4TZ4C 5J1EB 3HL6A 2MJUA 2H9ZA 1QTNB 1F9HA 1YRXA 3HHKA 1T02A 2GS8A 4IE7A 3RKOA 2X1BA 1FE0A 2KNDA 1S9EB 5ETWA 4ZXLA 2V0NA 4PK4A 1GMUA 2W0GA 2BJDA 1RWPB 4F2RA 1CC7A 5JXSA 4B02A 4QXCB 3ANWB 3GONA 4ZCLA 2P6SA 4OZLA 3SQGB 1GMVA 3I6PA 2RRAA 2BX6A 4F04B 4YEAA 8ATCB 1IKYA 5JDFA 1RTDB 3MEKA 4ETXA 2Y48B 3AEDA 1T05A 3K5LA 1V3ZA 1ZPVA 3THTA 3PZPA 2J9EA 3N2GE 1KONA 5G4DA 1U8SA 1LOUA 2RF2A 4ER8A 1IQZA 1OSCA 1YI2S 2OTLS 5CYQB 4YP3A 3QJPA 2W2OP 3PYGA 2RP4A 5HEGA 1RHJB 3KLEB 5HXCA 1S0OA 5F3TA 4KTQA 4EZHA 5A1LA 4A8XA 4CI0B 1TELA 1HWJA 3GE9A 4RZRA 3D6TB 1K73T 4JV1A 4JI3T 3CGIA 5B7WA 1FJ7A 3AD8C 2VFRA 3R1HA 3TUPA 5ABFA 3LBXB 4DS4A 2A6MA 1NAQA 3DYAA 3QB5A 1T7SA 3RYLA 2A3JA 4IR9A 4HWDA 2E5VA 5FXVA 4KUMB 3M6XA 3N5BA 2IMLA 3WBZA 5RUBA 5FY7A 3G6ES 1IR2A 3QRQA 3MCNA 1RA6A 2XHCA 1UJ5A 1VI7A 2W4PA 4CLZA 2G1DA 1YLXA 5E0OA 4P09A 2G2YA 2OPQA 4O3NA 2G9OA 4J9PA 2ZBPA 3DMJA 2VZ9A 2J0QD 1VLOA 4LVOP 4IRKA 1U7LA 3FCHA 5FXZA 2V26A 3MPYA 2ZZTA 1HWKA 5CB4E 2MJNA 1S9GA 4AL6A 4CLTA 4ASKA 1HD1A 3I0SA 3BH7B 3C64A 4MHCA 3I4HX 1RYRA 3PKYA 4ECUA 5GMEA 4DHVA 4N8OA 3SSQA 4ZVRB 4JI1F 4OI2A 4EK2A 4LF6J 3ABVA 3MMJA 3ENWA 2JVOA 2ADBA 2BACA 4G1QA 4Z37A 3ENVA 1F60B 2UXDF 4LRCA 1TR0A 2CA9A 5M4YA 4XDDA 2XAQB 4O4GA 2QSFA 3NEKA 3NNAA 3CD7A 2VPWB 1OEDC 3AAEB 4DCPB 4LRDA 3U78A 1U1OA 3L7PA 3K0JA 2ZD1A 3ZYKA 4GIWA 2QRRA 2WVDA 1JLQB 5CYMB 2ZE2A 3ISNC 2YXLA 4OYAA 2EBEA 4ANJA 3MM6A 4X66T 4YY3T 3GYGA 3DLHA 4I4TE 3SSRA 5J2NB 2I0MA 2UUWA 1ZZFA 3FDSA 3UQSA 1TL1B 3D66A 1NJXA 1VQ6S 1REVB 1RABB 3TAPA 4QYRA 2KFYA 1UVLA 1AZSA 4U7IA 5FL1A 2E2AA 4F3QA 2C5KT 2IJNA 2BDEA 3PEHA 4AD6A 2W9AA 1VQLS 4MAKA 1KWMA 3NAHA 3ZC4A 2VF3A 4Y2IA 5C2CA 3FZBA 5IWAJ 1SKUB 2EC2A 3WIVA 5LNKA 2UUBT 3OL9A 3P49B 4U7UD 4ISTA 5KOWA 4IH5A 2WK4A 2UU9F 3PR5B 5CHCB 4ZIVA 2E9TA 1MMNA 4LT6A 3SI8A 1IJFB 1E2AA 2QL7B 3CPWR 2VKDA 4JV5J 3KG0A 1KQFB 3M9NB 3H5XA 4DR2T 5JVHQ 1CQNA 4DCJB 2HSEB 2WAQD 3TUZC 2LKZA 5CA0E 1J5EJ 4NRTA 7FDRA 3GCXP 1KLMB 1LNQA 1CULB 1AB8A 2QL9B 3UVJB 2O67A 5KT3A 5DGAA 2CQGA 4QX7B 3SMZA 1NK8A 2NTYA 1TZ0A 1FJEB 1E7PA 5L39A 4WP9A 1QVFR 4JI4T 3QT7A 2ZNYA 5LP6E 2EK6A 4MFBA 3VAMA 5BR8T 3IP0A 2I59A 3KK2A 2DL1A 3H4DA 2W62A 1F5BA 2GX8A 1HTJF 2CZ9A 2WDVA 3FXEB 1T8BA 3BM7A 5DG7A 4CN4A 4YSYA 1IR0A 2OAUA 3D54A 3IM9A 3IM8A 3BS9A 1H98A 2C2ZB 2CQ1A 3GMIA 1EETA 3BN4A 3MDFA 5L4HA 1N32J 1SVDA 1RT5B 1JQGA 3AB4B 2E44A 4ANEA 4DSIA 1FK9B 2CQ3A 2FHJD 5HYAA 3GJTB 3PW0A 1N5TA 1M1KT 2HZCA 2LSYA 1MNEA 2RQMA 3GFYA 3PFEA 1RAOA 3KLGB 3B57A 5L3CB 2XYPB 1D1CA 4UT4A 2R7QA 1L3SA 2E9XB 2MQNA 1JLGA 1H0HB 2IC3A 4ZVTB 4PWDA 4DQSA 3DDIA 2GAGC 1FX2A 4QYZJ 4JUZA 3ZMVB 1VRQC 5M2PA 4O44A 4H63V 3IG1B 3POTB 3G96A 5FD1A 4URGA 5AE2A 2BEFA 4ZI7E 2BG9E 1ZM4A 2PG8A 3FBFA 1Y4ZB 1WYCA 5GAEI 4IDNA 3PX0A 2MY8A 3DFEA 2M6IA 4K7QA 3IWLA 1XZYA 3C4XA 1S0MA 1ELOA 2LRLA 4I56A 1X4CA 4Z2XA 4ZVQB 5IV4A 2MHNA 5EN1A 5E41A 1R0CB 4MLKA 2DHRA 3ANWA 3MR5A 4O8SA 1VQKS 4OK0A 1M5PC 4KAIA 1TL7A 4GMKA 3JTOA 4OHYA 3RKGA 4JI8F 3DGPA 3BZQA 4UZCA 1Z8UA 5DQWA 2UXCF 1RTJA 3UDVA 1EP4A 4F4KA 1RT1B 1UEVA 1FDAA 2UUCF 4NEZA 1X9WA 3ZC0A 1X60A 2NXEA 2MHEA 3RBDA 1ZAWA 1RUSA 5JUMA 1X4HA 1Q82T 3AA9A 5T14A 1RSCA 2IW5B 2V2KA 3T6JA 1MW7A 4AE5A 2WSFC 4Y0FA 3R1LA 3CEDA 1B64A 2AXDS 2RVJA 4U3CA 2B43A 4X1IE 4F4XA 1Q95G 1NEEA 4NUVA 2DH9A 1RQ0A 4ZVPB 1JLAB 1NJYA 4CLKA 3QWPA 3OYZA 1DY3A 4BDPA 3KJNB 3TO8A 3AJDA 3PU3A 1JK9B 4IE6A 3AOBA 4JYAT 1Y5NB 4JI4F 2XWXA 2X9YA 2PDAA 4F3MA 3VAJA 2X9HA 1ZM9A 4KFBA 1QAIA 4RPFA 2BRLA 1SJQA 4OI3A 3ET6B 1HWLA 3TZYA 1WTBA 5AFUL 2HBYB 2K5BB 2FJAB 5CCLA 1R0AA 2RSQA 4K2XA 2F63A 1KC8T 2BOPA 4FYWB 4C0HA 1JNRB 4U74A 4L6V3 4DUYT 2VVNA 1Q0NA 2VA2A 2JQHA 2B9EA 2V67A 1OXZA 4DR3T 3C6TA 2FBWA 3SDEA 4F25A 3CQCB 1UGOA 2HIQA 2K24A 2YBVA 4DUZJ 5JR9C 4J9NA 3LP1A 4O4HE 2HEKA 1VIXA 4FJOA 4TV8E 1ZH5A 3T19A 1U47A 2OJ3A 4FNHA 4NWBA 1WD6A 2FJDB 2ZVIA 4ALZA 3QIPB 3ZZRA 1KNRA 2KT9A 1HARA 3BQ1A 4QR2A 1ZBTA 2UXCJ 3A3NB 4CO0A 3QUJA 1HNXF 4GYRA 3DKDA 4FXWA 2XMWA 4FYXB 3NVOA 1EB0A 3I4PA 1WKJA 3Q24A 4PQAA 3QAEA 3CCSS 2Z2LA 5K8OA 2MBGA 2VURA 3MEEA 4G1IA 4KBIA 2CDRB 1FHTA 3IAM9 4RNNA 1QSYA 5L3BB 4JI6J 3OKQA 3AVRA 5GAHI 3TR5A 4MIBA 2OA5A 3NGUA 3IF8B 3LAMA 3MXHP 3N5LA 4JI1J 5D6GA 5AQQB 3US5A 1F9EB 1VQ8S 5ETQA 4QPXA 2WONA 4G2AA 2WCXA 4KT0C 4F4AA 5KFDA 1WG4A 5DDRC 3CJQA 3FJ2A 2PMWA 2RT3A 4IO1A 5L3EB 1WOSA 1UVNA 4DQPA 2I1RA 4CNYA 4CYUA 3N9LA 2GAHC 2GJIA 3W15B 3KLFB 1A6LA 3LK3B 3KHGA 4FF3A 3EGZA 4TNOA 5IT9Y 2DHAA 4M94A 1VDHA 2ZH1A 5K9FA 1GT8A 1XNRT 4KIAA 3H3AA 2N7CA 5F8JA 2W9BB 2NXCA 5U47A 2XY6A 2HFOA 2DLRA 3PIPQ 3BO2A 4YB5A 3KUHA 4O3OA 2GHPA 3CCRS 1DTTB 1XIQA 1YXRA 4WTYA 1LWCB 1D1AA 1MWQA 4MKAA 1VC5A 4TNVA 2E7XA 1O6XA 5JVGQ 2M9KA 3KK3A 4HEAA 2X1GA 1XNQT 3H90A 2FVSA 2V7MA 3G6XA 1HNIB 4ZPWR 4YLHA 4K4XA 4NPOA 4O0IA 1AJ3A 4YTMA 2Z2YB 1ZTTA 4EYYR 1LKXA 5KFKA 5GADI 5J2MA 1HD0A 1FEHA 2CJ9A 4TLQA 4F4ZA 5LHHB 3KJFB 3RUBL 2AJ4A 2WVEA 3M9OB 4JV5F 5LB7B 4ZVGA 1DJ0A 4J91A 3CD6S 3D1OA 3L95X 1LXNA 3BKFA 2XZEA 4R8UB 4OJ1A 3ZTPA 3QZ7A 2YNFB 3MAHA 2Y8YA 3OSNA 2DH7A 4B3RJ 3HXMA 4OLPA 4PFPA 4HGAA 1R8HA 3Q8RB 3VVTA 3BSAA 4Q45A 2XEXA 2J4GA 4F50A 1RBLA 4DV1J 2PFFB 1G73A 2MMYA 2C2OB 5LMNF 1WF1A 3P5TL 3I9WA 1HNVA 3Q8QB 3IS9A 5EX0A 1RISA 4IE4A 3CVRA 4KC5A 5LJNA 3MCMA 3KLHA 3RGLA 4YY3F 4JB8B 2VBYA 5HVFA 1MNDA 3X1DA 4IFVA 5K8MA 4EZ9A 4ECTA 2YQ3A 3RQWA 2PIIA 4UVBB 2ASYA 4IKAA 4C91A 3UN2A 2X3GA 3JSRA 3SXLA 1Q81T 4ECVA 3AOCA 1R8CA 4UOCA 1G3OA 2KN4A 1OJ4A 2UXDT 1JNRA 1HHSA 1TTHB 2HHPA 3SEOA 1R3NA 2AYMA 4NA1A 3AFGA 4X4RA 4O0NA 5A8KA 3Q22A 4EBCA 2QT7A 2BOAA 4DOZA 2W9BA 4PYDA 3G6VA 2HGNA 4B9NA 4DWIA 1NPKA 2C3PA 1WLXA 3EHZA 3M30B 4B17A 1Y00A 1DQAA 5I42A 2HVHA 1J5OA 4OI0A 3P50A 1UW9A 4ANDA 4A47A 3DU6A 2KJWA 1SXLA 3D5MA 2U2FA 3KTQA 3KOAA 3FCVA 2JH3A 3BB5A 1WC0A 3W8PA 1C1BB 4LF9F 2Q9QA 2V5CA 4B3RF 1KFSA 1FRJA 2PA3A 1Q8BA 2NQPA 2RH3A 1P6TA 1GTHA 5B08A 1NSPA 2QJ3A 1S1WA 5DQVA 2J1DG 1DFDA 4ECZA 4U96A 2R42A 5HMYA 2GCFA 4ED5A 3TLTA 2LRKA 3O2IA 2HKEA 4IT4A 2F7VA 5L3FB 2J6SA 1EHWA 4JOUA 2HQCA 2X0LB 1HQEA 3POTA 3K5PA 1BQNA 4LF5J 5SUHA 3NBPB 3FQLA 3RHWA 4B6XA 2ZJPQ 3EM1A 4J90A 3N2KE 1FX4A 3ZMTB 1VQMS 2JRSA 1F5CA 4FYVB 4DVDA 1FK9A 1N8RT 2RAQA 2YQ1A 3UU6A 3AB2B 1UL3A 2EXUA 2I5JA 3MM5B 4HTJA 5KFRA 4GVBB 3RC3A 2VODA 4P71A 3N6NA 5A8RB 3PRDA 2ZHOA 4NASA 2HLUA 3ICLA 4DR4J 1Z4UA 4X2BA 4UTGA 3VF0B 1WC1A 5KAKA 2HHHF 1O8BA 4DPXA 2H48B 1PBAA 3GSIA 3I55S 1SA0E 2N4DA 4HDGA 2AHOB 3A8EA 5JDQA 3HZGA 3U3IA 3C6TB 2YNIB 3GQCA 2FVRA 3C46A 4DI6A 3AE6A 3W5YA 4TKTA 4QWEA 3W2VB 2G0IA 3K5NA 4PWUA 3RB6A 1I3OB 4TU8A 2RMLA 4H4KA 2YK0A 3WDOA 4DEZA 3I0QA 2QA1A 3S4UA 2M6BA 4U31A 2HRYA 1Z2ZA 2N3LA 2XSAA 5J0ZA 1RTHA 3V6DB 5DDOC 5LA6E 4W90B 1HBNA 7FD1A 2VJVA 5ETNA 1WORA 2R6GF 3AEEA 2V7LA 3G6YA 4UQTA 3AE7A 2UVUA 1RK8A 3SCJE 3MMBB 4WJBA 2HIYA 2R8HA 4X84A 3G8SA 3BH6B 3FBEA 3P4SA 4DU7A 1MU2A 3QNWB 4PR6A 2ADCA 5LYJE 4F0KA 2FHKA 3IMQJ 2ZBQA 2DRDA 2XMKA 2XM3A 4LFCT 4GRSA 5KFZA 4IG3A 5KFFA 1U4QA 3AA7B 4R5PB 4M5LA 3QAUA 2QV6A 1EP4B 1XNRJ 3C14A 3DOMB 1WF2A 3QYYA 4AL5A 5LSOA 4OL8A 4ETZA 2AU0A 1F2HA 1I6JA 3OYXA 3HVTB 3DOLA 3M2UA 2KRRA 2VKZG 2JEJA 2UU9T 3ZTOA 5K8PA 3VRAA 3EVOA 4KHMA 2KXPB 2X51A 4ZS6A 5ABEA 2GW8A 4NLRA 4KV8B 3HHDA 4M5JA 4NLOA 4USIA 5FP3A 4BC9A 4RWXA 2DR7A 1REVA 3MPDA 2NPFA 4YHHT 3PTRB 4ZI2C 1S1UA 3MEDA 2VH7A 2DNNA 5LJMA 2R2UA 1N6QA 1VCTA 1QVGR 1K0VA 3VZIA 4Z90A 5KFUA 4HI2A 4ES1A 3M7VA 3S7RA 3UUBA 1S1TA 4F3OA 4OYMA 1N52B 2E5GA 3CX8B 2P6TA 2KWIB 1N5QA 2DGSA 1U6ZA 2CJQA 2VA3A 4HVZA 5ETKA 5A8WA 2O5DA 1S6OA 3DMJB 2H88A 4CZZB 3CJ5A 4ED6A 2DEJA 2IM1A 3HR0A 2VDHA 1R8AA 3ZEFB 3HVAA 1ULRA 1N36T 4I6WA 3CWJA 4IIJE 5KFJA 5B0CA 1HNWT 2E8IA 1Y01A 2V63A 1DRZA 5H6RB 4A8YA 2VL0A 2V8DA 3OJUA 2YOEA 3AT1B 4FXDA 1YKHB 2JFDA 1RKJA 2Q66A 3CO9A 4HLBA 1BR1A 1NMEB 4DV4F 3OVUA 3T5KA 1P1TA 4HI1A 3MHYA 1S1VA 3LW5C 1S6UA 1T8EA 5BYQA 3ETMA 3F73A 2UXBJ 2BZ2A 2QVAA 4AKGA 1EKSA 3JQMA 1RA7A 1U0HA 5GAGU 1L5UA 1E6YB 1RYSA 5HXEA 2MKCA 5JDLA 4ZHRB 8AT1B 2GA7A 5LL6d 4N56A 1ZP0A 2GHVC 2GC8A 4ZLLA 2ZH3A 5KFBA 4PPZA 5IQQA 4FDFA 5EWGA 1Q5VA 2VOOA 4LSLB 2C22A 2G4BA 1FVSA 5L3GB 5JRCA 2H5JB 2HS0A 3IGNA 5EWFA 2DCLA 5LG3A 2RDJA 3CCUS 4DF4A 3GN5B 3NNCA 4J37A 3CKDA 1VYAA 1C4CA 4RKUC 1VQSA 2BVZA 4WFAQ 3Q8UA 4QQBA 2R4FA 3KV6A 4QXHB 4G3IA 2W24A 2UUAJ 5B0GA 3A7MA 2GK9A 3BBBA 1WI6A 4DUTA 1S1UB 4ENOA 3PURA 4ZJQA 4AFFA 3AVSA 1UK5A 1S9EA 1NZAA 2C1EB 4NMXA 3RBXA 1HBUB 2A1BA 5FY0A 5AXMA 2YWGA 3B54A 4M5NA 2K3WA 2CQIA 1T05B 3CJSA 2MDAA 1M5OC 1QM9A 2VPYB 5D0EA 4NX9A 3PRVA 4USHA 3PW5A 3WHIA 3K1SA 2B9YA 2CWXA 4EO6A 3HFZB 2FJXA 2GQQA 2RILA 3R5AA 1T9VA 4O4GB 1J5OB 3EGVA 1T9TA 4KKOB 1YJTA 1F3FA 1RWVB 3M30A 1XMBA 1FKAF 1FMVA 5ITHA 2V5DA 3AD9C 1NSAA 5C42A 1D09B 5EDWA 2RB7A 4RBVA 1OY8A 2ZZMA 4A8QA 2ZVSA 4BA9A 3SS1A 2W00A 4C0OC 4HR2A 2QMXA 2LCWA 2LP4A 1HR0T 1JJCB 1MU2B 5AQLB 3DN9A 1FJGT 1S12A 3FEZA 4HN9A 2QN6B 3K3OA 4NEYA 1ZS6A 3MMBA 1LWEA 1RCXB 1BUXA 3RB3A 4JLEA 3NZPA 4X1KE 4L75A 2W2NP 1EZZB 3CK6A 4ZI3C 1WKKA 3AE1A 2FTRA 5FDLB 4I2PB 1WDTA 2K8GA 2VKOA 2MZTA 4IFVB 3CQXC 3H98A 2UXXB 2J47A 5C25B 4COFA 3VAHA 3GLJA 4RUCA 2QO3A 1Y5IB 5FY1A 2E1RA 1LFWA 2QL5B 2V2QA 3TQEA 5E2QA 1TU0B 2E1CA 2K3KA 1MSWD 3FNNA 2CNKB 3W2WB 1VK8A 3O1LA 1N0VC 1YHQS 1YSJA 3FRZA 2CWYA 2CPIA 4I68A 3SBMA 3UD4P 4ADZA 3LBXA 1C0TB 1FO1A 5ABFB 1IUJA 4EOZB 1V5IB 2WVFA 3F44A 4XIUA 2H5IB 5HVGA 3GU0A 3Q5DA 4NZ0A 2N3OA 1MIVA 2P9CA 3DGVA 2YPYA 2IA6A 1Y64B 3W64A 1RKIA 4AKHA 4LF5T 3KLEA 4EYIB 2D3OR 4UXNB 2AF6A 1LWEB 1IKXB 3PUGA 4DFMA 1TK8A 4LF8T 3AECA 2I5JB 5EK4A 1JKHA 2KFNA 2KDOA 3F0NA 2KI2A 5G0RB 4K2JA 4V1Av 1W26A 4CH7A 3UI3A 3H8YA 3MR2A 5BYSA 3HPOA 3PW2A 4TY9A 3D2WA 2A18A 5B0DA 2WZIA 5IS2A 1LWCA 1NLKL 5C42B 3OR1B 4KPYA 1VJWA 2F4VJ 4C3KA 1IJ5A 3DJBA 2FIUA 2VASA 5J1GA 1QAXA 3HA4A 2E9RX 4JI0J 4C90A 2LMIA 1FESA 4IDOA 4JI5F 2GO8A 4LJMA 4FF2A 3PO5A 1SJ3P 3H5SA 2LE8A 4A8OA 2LSGA 2BANB 4ECWA 3BYPA 4NLVA 2ROGA 2DIUA 2QFJA 1HQEB 4B9SA 4RW6B 1OEDA 2R7RA 2AYBA 4WFYA 3CJ2A 4QKNA 2E9XC 3BYRA 1VRUB 2LXUA 2VKHA 4L72B 3EUHA 5IUXA 5AQKB 3RX6A 4GKKF 4DZ6A 2ZOFA 4WZQA 3HVRA 3R7NB 2VICA 5I3UA 2D74B 4RWWA 1XMOF 2FC8A 3R5DA 1N36F 4HFDA 1FI4A 4GO5X 2IPOB 3D0TA 4Y00A 3LWMA 2LJLA 4IE5A 3DCAA 4G65A 3UTKA 4PJLA 4F4YA 2WHOA 4FKXA 3FCWA 6FDRA 1ACMB 2Z4PA 4HDHA 3G4SS 4A8MP 3CC4S 4RW6A 5D4LA 3RRGA 2F8MA 3WAJA 2CIMA 4LF9T 3M8PA 4JP8A 2X1AA 1CSJA 3NWRA 1JB0C 4HFBA 1S0NA 3LGHA 4Y2KA 4ZHQE 2C5IT 4UY8T 3OTOF 4OHVA 2YKMB 1PYTA 5LGTB 1IKVB 3MMAA 3JAMY 2WMNA 1SC3B 3KK1B 1AROP 1YBTA 1BR0A 4OYXA 3MKDA 2HHWA 3MM8A 3DLEB 2GMLA 2HG4A 2AGOA 3HHLD 2ODUA 2LA6A 1TKZA 1WUUA 1RGVA 4C8OA 2VFTA 4MK9A 5IWAF 2JEIA 4KYZA 4UW2A 2DNPA 1W09A 3JSMB 4NL5A 4TVAB 3MPWA 4HWIB 3VKGA 4ID5B 2GVZB 1Q7YT 1KK7A 1F0XA 4ZI3D 4NRUA 2QMUB 1U0HB 4ZP8A 3CWZB 3BDEA 2KINB 4RBTA 2N9DA 3BR9A 1DAXA 1S4EA 2C2KB 2FJDA 2UXNB 4MK8A 3LP2B 2M8HA 3VGTA 2RKIA 4KGXB 3E01A 1NHUA 1D0EA 4QXBB 2CJKA 2OMLA 4A8KA 3FGVA 2L3MA 4KP3C 2FVPA 1IWAA 5F8IA 4I6YA 4LF4J 2JQKA 4TU9A 2V8GA 1FTCA 3GWHA 2YNFA 5KT2A 3SFGA 3KFWX 4ZP9A 5DQIA 1I94F 2JC0A 2FJAA 4OQJA 5JTGA 4QHOA 1VHIA 2ZH8A 4PJMA 2FJEB 3H25A 4YN3B 2YNHA 3TVZA 3BGUA 4WXOA 1T94A 8RUCA 2DNMA 3TJAA 5F8PA 1Q1KA 2VC0A 1YK9A 3V6JA 5M2UA 1HNZF 3KK3B 3FB2A 1NDLA 3NG8A 4FYYB 2JJ9A 3D3BJ 4LSNA 1TV6B 1R0BG 2M70A 4OV1A 5LSLA 1CG2A 2HHQA 3MCSA 1P9QC 4PQUB 4DV6T 4LF2A 5IM0A 3BJYA 4ED8A 2DRBA 3HKZD 2XY7A 3QATA 1NKBA 2XAFB 2XMTA 4FS2A 5JREA 3IR7B 2WB1D 4C8ZA 1YKEB 3DRSA 4B3TF 3FKBA 3NRBA 3E2EA 2YINA 3X3UA 4AISA 5BR8F 1S6QA 1E6VA 2UUAF 3PUZF 1YZ6A 5T41A 3ZYLA 2OTJS 5AQJB 1PILA 2K3IA 1K1SA 1NK0A 1FJGJ 1SQFA 4WXWA 2BYCA 1DQ9A 5CA1E 2HHTA 3AEFA 3QNUA 3IRXA 1Q8KA 2VHGA 4IUFA 4LF9J 3C16B 5HEOA 5H6QB 2R2RA 3MM7B 2APOA 2NW9A 1JXEA 4KB7A 2K1RB 3GIRA 1FIOA 2AV5A 4OZ5A 1N48A 4O44B 1PKUA 5L9NA 2CPXA 4MMOA 1SJ4P 4LF4T 3J81Y 3ADAC 3QPIA 3LANA 5JR9A 3HZEA 2V4QA 4ANCA 1BQXA 2QLXA 4H4MA 2JEFA 1US7B 2UUCJ 2WVBA 2CPYA 2BKOA 1HKAA 3N01A 1J5WA 3C15A 5JRCB 4O23A 1P1LA 5AE1A 2CNOB 3NRYA 2HFZA 2PMHA 1NH7A 4H9RC 4E7ZA 1XNQF 1C1CA 3IBWA 4PG5A 4EEDA 3HI2A 5HJYA 2QIFA 5IOLA 4DUYF 4ZVHA 2D3ZA 2CFXA 4ZHRA 5HO4A 2C2EA 3IBPA 4USVA 3NCRA 1E6YA 3B13A 2MYFA 1YITS 5DRKA 1UVJA 4OZ2A 4LF7F 2IAJA 5GMDA 3N79A 2IC6A 4XPCA 2FHMA 2YNIA 1WHXA 2R7OA 2H89A 2OELA 2V34A 2NS1B 3O1JA 4TQRA 2H7OA 1NHKL 4WP8A 4TYBA 2YKQA 5A2QY 4J9KA 5KFAA 2XULA 1LRZA 2XAGB 1WG5A 2Q43A 4QYZK 2OPRA 2XPKA 2DNXA 3K5OA 2Z30B 2UUTA 5DJBA 1OSDA 4A56A 3QZ8A 3H0PA 4Q2LA 2AJ1A 3A8JA 3KG4A 3N6LA 3TUJC 2WU2A 2MPUA 1SV5B 3MMCA 1OIAA 1RAHB 2KLQA 3KDOA 4QR0A 5KFIA 1YRTA 3EMTA 3AXJA 5ETTA 3L7UA 4JUYA 4C8NA 2BW2A 3VU7H 2IAJB 2PE8A 2HQGA 3MM9A 2LU2A 2MLYA 5HROA 1ZM2A 4ZITA 4OX6A 3TX0A 3VAIA 3P4QA 1X8DA 5HK4A 3KYLA 4DFPA 3P5BP 3UR0A 3M8QA 1R0AB 5FVLA 3A1YG 1YIJS 2IHR1 2AGQA 4C8YA 4FI5A 4PK6A 3J7YI 2A10A 1N33F 3SQOP 4OX7A 1NK7A 5HXHA 2YNGA 3GG1A 4RUAA 1S1TB 3J7AN 1X9SA 2BG9C 2JL9A 1TUVA 2NZCA 1OS5A 4B9UA 2V7IA 2IM0A 3PUQA 1WELA 4F36A 4M5MA 2B4VA 3OSPA 5LHGB 5FKYA 3M6WA 2ZJRQ 4OHFA 2E7VA 4J9VA 5ETVA 3ZT6A 5KFHA 4OHZA 3QMQA 2NXJA 2H5EA 1OWAA 3JSBA 2CDQA 4YHJA 1FVQA 4K4VA 1PAEX 4DSFA 2FPHX 1A0OB 1AUSL 4IG0A 1RT6B 4C8KA 3T1AA 1X9BA 3OLBA 2EHOC 1S10A 2F1FA 3M2UB 2ZE2B 1M62A 3BV8A 5KFGA 2X67A 5L9XA 4U67Q 1SL0A 4CH0S 2RQKA 3DLGB 4P74A 2VG6B 1RT6A 3EPGA 2QGSA 4DV1T 3KDNA 1JNZB 3ZN0B 1N33T 3UD3P 3AHPA 2DNHA 5HJXA 3EJMA 1U1KA 2IRUA 2ZUAA 3I1AA 4C2MA 4U95A 2FJBA 4I0WA 4EU0A 4DR3F 4NCAA 4DPOA 4K0KT 4ECSA 4TX5A 2UV8A 2HHHJ 2WZ1A 1CVJA 4NE9C 4ZPDA 5HEUA 4ECYA 3BKUA 3V6KA 4CP5A 3V2UC 2IC3B 3AE8A 2JC1A 2E9XA 2JEGA 1FNOA 2V4JB 1T98A 1GMWA 3PV0F 3ZSTA 2AEJA 2ZNZA 4AT1B 1KQKA 2AWZA 4IHJE 3R2CJ 5H9EJ 4IREA 1BD6A 2HNZA 1YBAA 3CCJS 1I51B 4U8VA 3PJWA 2ZH4A 6FD1A 2CJYB 2J76E 2HBQB 2NSBA 2XASB 1SV5A 2MB0B 1J1JA 4LF6T 3K59A 5D3GB 4Y34A 1JXLA 2QEXS 1QAJA 3CCTA 3KDSE 3FEYB 5IT4A 1WCRA 2YWWA 1LV5A 2WM9A 1MIYA 1CJKA 2V5HG 1V9DA 3O5TB 2CYYA 1RWNB 4NLXA 3T1HF 3CCMS 3TWZA 5A8RA 2VB6A 3AA6B 3BN7A 2HGLA 1KOOA 1R6VA 2RU3A 1JIHA 3C6UB 3RRCA 2XBPA 2G0CA 1KLMA 1YG0A 3ZZZA 1U45A 1IR1A 3OXLA 4QJVA 3WQPA 1F6TA 2GVDA 1FFSB 4UQGA 3NRXA 5GAGI 3P3DA 3NWGA 2QSWA 3KBUA 3T3FA 4JI0F 5HEHA 3FBLA 5L3DB 1LWFB 4DN0A 3HHLC 4UF4A 2IRYA 2L9WA 5KTQA 5JH7E 4I2QB 2EG1A 1Y5LB 3M3ZB 4EEBA 2XTLA 1Y3JA 5CYJA 2W7AA 3DI6A 1BQNB 3Q8YA 3R5CA 3ONXA 2MKHA 2LA4A 1M1HA 4IOCQ 3TJ9A 1H73A 2W7PA 2XMUA 2ZH5A 2IJFA 3D6FB 3JAFA 4DX5A 4HH0A 2JPFA 3OBIA 3ZZPA 4I50E 5IM0B 1SKRA 4QX8B 1WRDA 3GV7B 2CQDA 4JI2T 2P2CB 2WONB 4LSNB 5DDPC 4X66F 5CYMA 4B08A 3NKYA 2DKOB 2JRKA 1VRUA 3OXGA 4O2BE 3UULA 3UE2A 1OYEA 5CH7B 1PSDA 1G8XA 1CPZA 4X62J 4P7TA 2WBMA 5CD4A 3J7ZT 5A8KB 3NMRA 4RR5A 1IBLJ 4KR0B 4ZCKA 2BV3A 4PQUA 4NXNJ 2D41A 4LF7T 1L3UA 1TV6A 1UX4A 1NPRA 2YDSA 4Q5VA 2V1DB 3JXOA 2CXLA 2FD2A 4H9PC 3MXZA 1D3WA 4DU8A 2FC9A 3J81U 3LUYA 1IBKJ 1WEZA 2LLYA 3WX8A 1NDKA 2OPPA 1TMJA 2KHCA 1NEKA 2BJ9A 4L3NA 1PCAA 4NLGA 1VBZA 3ZT7A 4QW8A 3B4DA 1KVJA 3HKWA 5D0GA 3RC8A 4CH1A 1HNXJ 4GKKJ 3SZ2A 5C24B 1S97A 4UUWA 1N5YB 1W0BA 2LU1A 4YJ2E 4OI1A 3C4ZA 2OHDA 2EPIA 2LM9A 2LDYA 4C3LA 4QW9A 3I31A 3A3PB 2VQEJ 3A4TA 1SE7A 3FZHB 3Q86A 3OVBA 4ES2A 2WB5A 3HI9A 2HW3A 1TKDA 1C4AA 2P5VA 2JX2A 2DITA 2D2SA 5F3JA 2ES0A 3DLLQ 2HHXA 3QT6A 3SCKE 3BQ2A 3M8YA 4FBTA 2GVZA 4DR7T 4BS2A 1T9UA 1KDNA 4DZDA 1HNIA 1MN7A 1SHZC 2VD3A 3ETUA 4OZNA 1FFWB 4ZZCA 3DXSX 3NAIA 2MYSA 2GGPA 2X9XA 2L41A 5CGMA 1BR2A 2HQ3A 2AIRB 4I69A 2Y8WA 3LGNA 3A8KA 2GIRA 4AQYF 5HQMA 1LW2B 3B5MA 1TKXB 2ZITA 2KXHA 4X62T 3NCPA 4TWFA 2O66A 4KH0B 3ESLA 5HL7Q 3TA2A 2PJQA 3C4WA 2CXDA 2NREA 5KT7A 1V3RA 2J7WA 1YBUA 3NBXX 2E1AA 1MROA 4M8LA 3E0ZA 1RT1A 3DHXA 4DQIA 1B7TA 1RTJB 2XQYA 1KEYA 1YJVA 2OO4A 3DDKA 1DQ8A 4ID8A 3EGWB 2W2UA 3BGOP 4P73A 1IKWA 3OXFA 2NLWA 4GKJJ 2BJ8A 5C2TA 1W9RA 2KHDA 1R8IA 3F31A 3CDBA 2E29A 1UURA 1X4GA 1RWUA 5AQGB 1WC6A 3BEGB 4DV7J 4YS2A 4KHRA 4DV4T 3O1HA 5GADU 1OQ3A 2OD6A 2MZ1A 1GQEA 4EYHB 3HX9A 4NZ6A 3BK9A 2CG8A 1GXTA 3WAKA 3Q5WA 2DNQA 4J9UE 4RW4B 2ILZA 1NJZA 2X7IA 4EB6E 2ASLA 2KWHA 2LKGA 2FJVA 4M95A 3K3QC 2N1GA 4WPAA 3MPVA 2RS2A 1D9FA 2Q9QD 3H2VE 2PI5A 5ETOA 4P0BA 4DL6A 4U8YA 2C0SA 2HPUA 3ZO7A 1VK3A 3QGPA 3EUNA 2V9KA 3OR1A 4M5GA 1PGZA 5LGUB 1FMWA 4XO0A 1ZOYA 3PVXA 4NYPA 2ZKTA 1UFLA 3QSYB 3OTOJ 5DZ7A 3CB4A 4TN2A 5J2QB 2DY1A 2KXNB 1PJ6A 2GNKA 1U6BA 4TU7A 3HP6A 3J9X1 3HSGA 2KM8C 5IXUA 2HH7A 4NXMF 5C24A 2IMOA 4PXEA 3ZKRA 3AY0A 4DXLA 4LF5F 1QLBA 2C5JA 4WYWA 4MFBB 3CCWA 2OSRA 3T6BA 2CPJA 2Q1LA 3RPUA 1U26A 4IGUA 3LGMA 1S1VB 2QMWA 1KFDA 2RNEA 1N32T 2LHNA 4OYPA 2J6UA 4CI3B 1KN6A 1SBRA 2PGCA 3TVYA 4MALA 4LRFA 3OHBA 2MGZB 1T9YA 3QLHA 2ZM0A 4Y28C 4RW9A 4JI5J 4X4QA 3HO1A 1LVKA 1QE1A 3W65A 4PWWA 1NK5A 1C0UB 3C50A 4PRFA 3G71S 1B7YB 2UZAA 3FBZA 4GVLA 1ROFA 3AOAA 2CEAA 5AQRB 2E1MC 1FD8A 2BJEA 1P8GA 2ATCB 1D0XA 1YKWA 4HACB 2VQEF 4FXVA 4OX9T 5EGYA 1IBLF 1NU4A 3TAMA 1RHKB 3ZJ1A 1JJ4A 4U33A 1WEYA 3DLJA 3GWCA 5K20B 1HMVB 3BQIA 2NR4A 1JLEB 2UUBF 2CWOA 4IFYA 4KHPF 4LMLA 4JI0T 3ITHA 5CFBA 4OX9F 3WC2A 2G2ZA 3JAEA 3SYZA 4XTTA 3RRKA 3DOKB 1C2PA 4P72A 4FBUA 5B0FA 5F9LA 2AEFA 5JMNA 1REGX 3MEDB 2QE5A 4C98A 2YWEA 5AQTB 1WNEA 3G2XA 4NXMJ 4PABA 2E5LT 3OW2R 2Y9HA 1N34T 4KKOA 2RQ4A 3DRYA 4LQ3A 1VS3A 1Z2LA 3PYDA 3PUAA 2BR0A 4TLRA 3E51A 5HI7A 3EGNA 3THPA 4DQRA 1Q7LB 2ZEJA 1UZHA 1JLQA 1UUSA 1GMWD 3GFXA 1MMLA 2RS8A 4DG1A 1UWBA 2K06A 4J9RA 2HVZA 2KZZA 3KINB 3ONJA 3NL0A 1T3OA 4P10A 5DM7Q 3NKZA 1VQOS 3NLCA 3RAMA 2BBHA 4NLDA 1TK0A 3P96A 4K5SA 3H3MA 2E1PA 1XR5A 2PA8D 1HBUA 2HQFA 5DJQC 1UJ6A 4HFCA 4J9QA 3PFOA 2WAUA 1RT7B 1CUNA 4YB1P 1TAQA 1IJEB 2M0GB 3M6UA 2R7UA 4LUBA 4ZJLA 3TZXA 1N0UA 1HNZT 2MLZA 4YSZA 2ALYB 2CPTA 4QU6A 4KGKA 2IAKA 3OQ2A 1FWLA 1IKWB 1TQLA 4LBPA 2LEHA 4PZVA 4GK5E 5E3RA 3P4RA 3DRRB 1VBXA 2VFSA 5F0WA 4ECXA 4QBUA 3O44A 2NYIA 4W98A 4ZCIA 4NPPA 1XJWB 3W5XA 1UPMB 4L5GA 3PUSA 1EETB 4YT0A 4JV2A 4AKRB 1BQMA 1H3DA 1UPPA 4HFIA 2VG5B 4KGMA 2B1EA 4XAXB 2CJAA 3OJSA 3OFHA 2X9WA 2NCKL 1X5TA 1UAWA 1UTAA 4RU9A 1KTQA 1V3SA 2LQBA 1RT3B 5FLXU 3EWGA 5GAHU 1ZETA 5HAXA 2BJ3A 3IC1A 4EBDA 4YB7A 2OMOA 2HBRB 3VHQA 1RWOB 2MOZA 4X64F 2ASDA 3CJKA 3I9V9 4AQFA 4LR7A 3M1VA 3MOZA 3CCES 5MLCV 3G82B 2V4JA 3ZZYA 4YR0A 2DISA 5DLFA 1FEEA 3KHHA 5KDMC 1HQUB 1UX5A 2DHGA 4WP3A 5IWAT 2ABYA 3EXYA 1N6QB 2ACMA 4YHHF 4TY8A 3ZJ2A 1ZA1B 3LFMA 4BHQA 5KFPA 4WCEQ 4OX9J 2D9OA 2W25A 2RF2B 2F65A 2FJBB 1U5PA 4KH1B 2E5HA 1DZ5A 3GFZA 4LSZB 1H72C 1JNZA 2W63A 2CWKA 5E3PA 5L1LA 5HWXA 2VIHA 2V4RA 3N0VA 4ERDA 1KNPA 2C2RA 2OEJA 1BWVA 4JI3F 2RUSA 5D4OA 5HMWA 2XB2D 2QLBB 3B82A 3DOLB 1S72S 2JHEA 5SZTA 4ZVFA 2H7VC 4KBMB 3E8OA 4ZP6A 2E5LF 1V9OA 2BQ3A 2ERRA 1SH0A 1Y9OA 4YTNA 4JI8J 3IR6B 3Q5XA 4P0AA 5J2TE 2XZTB 3BQLA 1F1BB 5EHHA 2R7VA 3QJJA 3PW4A 2ZC3A 5J1EA 3THVA 2WY2A 4LMZA 4TXSA 2WW8A 5EK2A 4CRJA 5HQLA 1JJHA 2MZSA 4CT9A 3N28A 3PEJA 1HQ2A 4NIQA 4CI1B 3HF5A 3OTOT 4DL2A 1EKRA 2MZRA 3HKCE 2AJFE 3OR2B 4XPEA 5D4NA 1RLDA 4QH5A 2BA9A 3ENQA 4H9QC 1DLOA 1G2EA 4FVCA 4BCAA 3QBCA 5AQMB 3V5RA 1YQHA 5A76A 1S76D 3B8HA 1SL2A 1MMAA 2Z8QA 2ZKUA 4B3MF 1YGYA 3D28A 2VU5A 2MGZA 2AGPA 2RA1A 2RE1A 3OVAA 3K57A 1ZV4X 3P8BB 1S49A 3M4XA 3J80Y 3F56A 4RUBA 4USJC 3M2RB 3VQTA 2NOXA 2HHHT 4F0HA 2YH0A 3CJ3A 4DLEA 3FBBA 4JI5T 1B3TA 1UVMA 5HANA 2XQCA 4IDPA 1X4EA 4H9NC 2XJ7A 2WS3A 3WZ0A 2B6AB 3UPFA 1TVRA 3WC0A 3IS9B 5DLGA 4CXWA 2EEYA 4LIRA 3AH6A 2LEPA 4DR1J 2YEVC 3MM5A 4CZCA 4ZPVR 4DSLA 4RNMA 2IBKA 2WDRA 4DFJA 4LBIA 1YW0A 3JTNA 3CDAA 4YFSA 1OQ6A 3DYAB 4CCHA 2F4VF 2XLIA 2XWYA 2HQDA 3MEGB 1XWLA 2EI5A 2XO7A 4CO4A 3BSOA 4WTOB 2J62A 4PK5A 5L1JA 2EFPA 4KHZF 4K50A 1WF0A 3K8PC 1RADB 3TVKA 4TWDA 2A72A 4GVBA 2DK2A 3OJAA 3BPSP 3VHLA 5ABGA 3JYTB 3N4WA 1KLNA 2K1RA 1DTQA 1HBOA 3MCOA 1SUMB 5KT4A 2VONA 4LR8A 3MFIA 3G87A 2I6HA 3OD2A 2B6AA 2J6TA 2DT9A 4JYAJ 4G6VB 3IRXB 2ZM6T 1FRLA 2M7SA 2EKNA 2I9SA 5F5WA 1T9XA 1WACA 4KO0B 1Y10A 2Q9QB 1T95A 2KT2A 2NWBA 1HFEL 3AE9A 1RCOB 5IFMA 3TW0A 1WOOA 2D7SA 3ISZA 4DUYJ 3NCQA 3EPIA 4IDZA 1UMJA 2WWUA 1U48A 1GXLA 1YQ3A 4DBRA 3FMWA 3PJ9A 2IYIA 1IZNB 4LQ9A 2YX7A 1S0VA 2MKJA 2CXEA 3D1QA 2CBJA 3TNVA 3ETOA 3KNGA 4U6PA 3QJLA 1R89A 1NK4A 3W1YC 1RWWB 1VLYA 4FZVA 4CLYA 1TKTB 4YUDA 4B9VA 4IRDA 4LMKA 3C8YA 3RZAA 4DR5J 3OR2A 4IL4A 4DMVA 3T5HA 2K2PA 4MKYA 4Y2MA 5L1IA 3DHWC 1FJCA 1FCAA 2Y8DA 4P2FA
chains in the Genus database with same CATH topology
4GVLA 4J90A 1SUMB 1T8BA 2BKOA 3JXOA 2OLTA 1LNQA 1T72A 4J7CA 3RBZA 4L75A 4RO0A 4XTTA 2OGUA 2AEMA 2AEJA 2BKPA 2IIUA 4L74A 4EI2A 3KXDA 4L73A 1XWMA 3RBXA 4J91A 2BKNA 4J9VA 2AEFA 3L4BC 3L39A 4G65A 4L76A 1VCTA 2FY8A 4J9UE 4YS2A 4Q25A 2I0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVL A;  4J90 A;  1SUM B;  1T8B A;  2BKO A;  3JXO A;  2OLT A;  1LNQ A;  1T72 A;  4J7C A;  3RBZ A;  4L75 A;  4RO0 A;  4XTT A;  2OGU A;  2AEM A;  2AEJ A;  2BKP A;  2IIU A;  4L74 A;  4EI2 A;  3KXD A;  4L73 A;  1XWM A;  3RBX A;  4J91 A;  2BKN A;  4J9V A;  2AEF A;  3L4B C;  3L39 A;  4G65 A;  4L76 A;  1VCT A;  2FY8 A;  4J9U E;  4YS2 A;  4Q25 A;  2I0M A; 
#chains in the Genus database with same CATH topology
 3UUM A;  4HT5 A;  3ZTQ A;  4NLY A;  4X65 F;  4IG0 B;  4DV7