2BKOA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkoA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkoA02
2IIUA 1T72A 1T8BA 1VCTA 3JXOA 4J90A 2BKNA 2I0MA 4YS2A 2AEMA 1SUMB 4L74A 4L73A 4J7CA 4XTTA 3L39A 4Q25A 2OLTA 2BKOA 2AEFA 2BKPA 4J9VA 3RBXA 4L76A 3RBZA 4RO0A 1LNQA 4GVLA 2OGUA 4L75A 3KXDA 3L4BC 4J9UE 2AEJA 4J91A 4EI2A 1XWMA 2FY8A 4G65A
chains in the Genus database with same CATH superfamily
1RAHB 4IDKA 2HGLA 3BQLA 4J9RA 4V19J 4YJ2E 4CCHA 2LCWA 2PMZD 2HNZA 1G2EA 4O8SA 1U1OA 1WNEA 2ZC3A 3QFWA 5L3FB 3THPA 3RB3A 3RGIA 2BDPA 1CEZA 1IM6A 4DR4F 1NK0A 1M0SA 3QNWB 2ZHBA 2AEMA 3PO5A 3MM7B 3NOCA 3J7ZT 3CJ0A 5FXWA 2DNYA 4XDCA 4JI2F 1CLFA 5JDGA 1CS4B 2X51A 4N5SA 3C8YA 2UV8G 2CPYA 2VICA 4Y2MA 3N9UC 4CN1A 2E7VA 2R2SA 4TY8B 1LKXA 2I2YA 3WX4A 3F56A 1HI0P 5CA1E 3SBMA 4EO6A 3EI0A 1FRHA 2RDDA 1AT1B 2QFIA 1TMMA 2IAJA 4Y28C 2E9XB 2XM3A 3LPEA 4F36A 2C3MA 2GK9A 5DDPC 2N1GA 5DZ6A 4PXDA 5AQHB 2GIFA 3TAMB 4CI1B 4ZLPA 1O3XA 4ZP8A 1GEHA 3L09A 3EPIA 3KBUA 2ZEJA 4DN0A 5HVFA 2ZBCA 5DRKA 2GHWA 3CCZA 4AD6A 1NU4A 1GK8A 4LR7A 2NTXA 3GJSB 4EZHA 2AJ4A 2QGFB 4H54A 1SV5A 4DL3A 3EZUA 1HBOA 3J7AN 1RISA 1NLKL 3KLGA 4OYMA 3HL6A 4A48A 3IRWP 2R7TA 3W1YC 3KJVB 3LK3B 4RLEA 2UVWA 2W4CA 3KK3A 1TL3B 5AQGB 3P4RA 4ECTA 5AE2A 3BQIA 3CJ8A 3PR5B 1HHTP 1WKLA 2HN1A 1VRTA 1TFYA 3L3CA 5A8WB 1TU0B 5IC4B 4RW4B 4TLRA 5K20B 2XHCA 5LSOA 2QYCA 2QC3A 3L4BC 1J5OA 3RYCE 2LE8A 3MEGA 3DOMB 1RCXB 4DR7J 4CLTA 4MLKA 3QOFA 5F8LA 3W8GA 3G86A 3M8QA 3BO3A 1SV5B 1MW7A 5IV4A 4X62F 3RRCA 1NEEA 2J0XA 4N8OA 2W66A 4X2BA 3QLHB 4LF5J 2DY9A 2XQ8A 2V34A 3DOLB 2EI5A 1P8GA 2YWWA 2ZHOA 4NLPA 1PSDA 4UVCB 3I9YA 4DR2T 3QIPA 5DGAA 2W2OP 5HYAA 3CJQA 2QX0A 4X20E 2E1AA 3N6MA 2CQIA 3NWIA 2PEBA 2HZCA 5LMNT 1N0UA 5HMWA 1EX8A 1S0VA 3LF0A 5KG0A 3GR0A 4QR0A 2YKMB 4ANCA 2HWHA 2RQCA 2F9JA 3CIZA 4ECZA 4FZVA 3EDUA 2UUCT 4TLQA 5IHYA 4LF7T 3PX4A 2DGTA 4AQFA 2BA9A 2ZOFA 4DV2T 3P50A 3MM7A 4LRAA 2DNZA 2VFRA 4ZCLA 4B3MT 4LF9F 4A56A 3PRBA 5F3ZA 4WTYA 1VQYA 1VOMA 4GVLA 1RT2B 3QZ7A 4HWDA 1EKSA 1FJCA 3UR0A 1U1RA 4UVAB 1RBAA 4ZHQE 2DJWA 5ADXL 3GG0A 5KT2A 3AAAB 3G8SA 2XGPA 2YU1A 1C4CA 3AB2B 1KVKA 4DCJB 2XUEA 2DNMA 2WVCA 3KV6A 2DHRA 1PJ5A 3C4WA 1VCSA 4JI7J 1CJTB 2YXLA 2PI4A 4OIXA 4A4JA 2PE8A 1LWXA 1VJQA 4DN9A 2VPXB 3VGTA 4LMZA 2MLXA 4DG1A 2AGQA 4TU9A 3EWGA 2WVFA 4ED5A 4GK5E 3SSQA 4DV3J 3MD3A 4K4ZA 2P9BA 3MR2A 2W0GA 1PAUB 2HURA 2UXBJ 3OFFA 4U7UK 3Q8UA 4IOCQ 4FI5A 3V4IB 3M30B 2MSSA 5ABEA 3MM6A 3LANA 4IDOA 3FK4A 5LMUT 1KF6A 4ITSA 1WI8A 3CVKA 2CJYB 4DR5J 4Y34A 4ZZCA 1W2IA 3D0IE 1I94F 2W2UA 2LA4A 4C11A 2G0IA 3UU6A 3O4XE 1XERA 4RUCA 2MJNA 4USMA 4XPEA 2DGSA 2MZRA 2E44A 2ERRA 2CPIA 2FJXA 3ITHA 4KKOB 3HLUA 3OD2A 1PYSB 2VFTA 2XG8A 4B9LA 5K9FA 3TO8A 2F8EX 2J6TA 4DFJA 4JV0A 1EARA 1RTIB 2FJAA 3C14A 2RAQA 3ETOA 2CNOB 5D4PA 3UUBA 2E5LT 1MLAA 4Q2MA 3HKEE 3EABA 1DJ0A 3D6MB 2A72A 3G8QA 4AYBD 4KHZF 4UXNB 3P6YC 4JYAF 3O1LA 5JDHA 3GWHA 1O6XA 1K44A 2JX2A 4A8OA 1G4CA 4E2FB 5AFUL 2ZZNA 3IBWA 3MM5B 1KLMB 4MJKA 4P75A 3MEEB 2IMLA 3AJ1A 3SFGA 2OJ3A 2VVNA 1VHFA 3QAUA 1QD1A 2W63A 1KHWA 1RADB 4MK7A 3AOBA 3MM9A 2LRKA 2OPPA 2MPKA 2HFUA 3MXZA 4PABA 3M2VB 1RTDA 5CYQB 3U1NA 1NDKA 5HAXA 5DQHA 5KT3A 2D9DA 4JI8T 2QMXA 3GV5B 2FJAB 4C6AA 3UTKA 4HLBA 4G63A 1N48A 5CCMA 2VBXA 2XLIA 3KG1A 2RIJA 4QWDA 3EM1A 3VF0B 1ULRA 1FWLA 4WW0A 1BQMA 1HD1A 3KV9A 3RPUA 3QMQA 2WSSV 3K8VA 2EXUA 5IT0A 2QA7A 1UWBA 4F0MA 4XAXB 5A1LA 1P27B 4E7SA 2BM0A 2EW9A 4MKAA 2XZWA 4ISTA 2HQFA 5DLFA 3BGOP 4N41A 3IBCB 5IT4A 4R25A 4I2PA 3VTIA 5CFBA 1SB6A 3TP2A 2R7OA 4HR2A 2FHKA 3W9IA 3ANWB 1NENA 1E6YA 3IHRA 3BZQA 5LT5A 3A1YG 4QYRA 3PTWA 4F02A 2O5DA 5K14A 2BKNA 2HNZB 2WU5A 1CC8A 1HNZT 8AT1B 1E6VA 4IDKB 4QKNA 1RUSA 4ZVRB 2MKSA 4IO1A 1B3TA 4JI0J 2ZC4A 4FKXA 2YX1A 2K2PA 4TU8A 2V69A 4F67A 2C2EA 2LP4A 2UUAF 4LREA 1TVRA 3P8CD 5BJRA 4F0HA 1N56A 2VPZB 4ZS2A 2V6YB 1D9DA 3FFIA 3JYTB 3DRRB 4YDDB 3OW2R 1C2PA 2I8EA 2J9CA 1HBNA 2HFOA 2LOPA 2X9YA 3V6KA 1Q0NA 2J6SA 3ONLC 2J0SD 3HSGA 4YS2A 3CC7S 1YSJA 5HL7Q 1TQLA 4W4MA 3D1OA 3ZN0B 1XNQJ 1LRZA 4KKOA 2H3EB 1HFAA 3UULA 2KVIA 2ALZA 3E0ZA 5LA6E 4EFAC 2FVRA 4QWBA 2HGMA 4M63A 2V4JB 4PPDA 2QGSA 2Q6BA 3P4SA 5FNVE 3WC2A 2VG7B 1EETB 3OL9A 5J2QB 1X31C 3DM2A 3QGGA 1HA1A 2IA0A 1H7WA 2NYIA 2FHOB 5M2UA 3LK42 2B0GA 4CNZA 3IWXA 4AL5A 2ZMAA 4IL4A 5IV3A 3JAFA 2N82B 4AI6A 4GC7A 4L76A 3PR4A 1X4HA 4O4GA 3CMQA 1S9FA 2IVYA 2R2TA 2A2CA 4F4WA 2WONA 1RAEB 1HNVB 2K3IA 5K8PA 2DO0A 1C0TA 3KWMA 1U45A 5KFTA 4G1IA 5GMDA 4HDHA 1XDPA 5GAEI 3FBCA 3IA0A 3LO3A 2V2VA 4DLEA 2K3KA 4OZ2A 1WHYA 4LF6J 2X1FA 2BG9C 4ZK7M 1T03A 1LOUA 2UXDJ 5L3DB 2FIUA 1Y9OA 3OVAA 3BSOA 1B70B 2J7KA 2VQET 4CO4A 4ECSA 1QSLA 4NLQA 1BE4A 1A7GE 4ZDNA 4DV7T 5HBMA 4RUHA 3S01A 2YVSA 1KVJA 3CEDA 2IC9A 3MM8A 3TLVA 1RABB 2R6GF 3KLHA 4JI0T 4IDPA 2RUGA 2UU9F 4OI4A 1U09A 3BBFA 5ITHA 4LBPA 4JEHB 4FPRA 3DRRA 1ZPVA 1LWEB 4O4RA 3PXGa 2CPFA 1BWEA 4CDIA 2CADA 1XMQT 5KT4A 2AGPA 3RF1A 2IAJB 5B08A 3QZ8A 5HP1B 1G73A 4DR6J 2IM2A 4U7CA 5LGTB 2XAJB 2JLFA 2EK1A 5IQ6A 1EETA 3FCWA 1WCRA 1KQKA 4WFXA 3NNCA 3H5UA 4NLUA 3BH7B 5HCJA 2V7IA 3H37A 2R8HA 3R8YA 4B3SF 3ICLA 1LNQA 3D66A 4O23A 2FD2A 3Q2TC 3EPGA 4Y2CA 4PJMA 3MDFA 1EHWA 3FBLA 1B64A 3M8ZA 4ZLNA 2WMOA 4OZLA 2G1DA 4WTOB 1D9AA 2KVQE 1V9DA 1RWKB 4DR4T 1ZTWA 2KT9A 4N56A 2V6YA 1S35A 3J81Y 4O2AE 2EFQA 2ACMA 3GYGA 3D1HA 2AZ3A 2CQ1A 4GVBA 4RBVA 2HN2A 2YKNB 2W25A 4CLLA 1X60A 2KO1A 1S59A 3DFEA 1CJUA 3OL8A 1DAXA 1OSDA 2EC2A 3EZ5A 5HK4A 3RIAA 5JVDE 4C0OC 2CJAA 4WFYA 5FL0A 2Y8DA 2BJ7A 4IH5A 1Q5VA 2NQPA 2BBEA 3ZCIA 2DKOB 3MMCA 4JI3J 4AKLA 4YTPA 2DISA 2YNIB 3JB9k 1RKIA 4NCAA 5KFYA 2MKCA 1UEKA 3I9WA 3Q5WA 3OR1B 3TVKA 1Q95G 3DOKA 2BG9B 1H38A 1UPMB 3BGLA 3SSRA 3P5BP 3CTRA 2P9CA 4X4QA 2VKDA 2GIRA 4P6QA 1AYEA 1T02A 2GA7A 1YKEB 4PG6A 3FGVA 3D1QA 2VODA 4NASA 2DNKA 4KH0B 1Y4ZB 3PDYA 4IKAA 2YDSA 4ILUA 1I3OB 3FQKA 1Z2LA 5J1PA 3GILA 4LF4T 2HZVA 2DCFA 2JSXA 4QPTA 4JLEA 2DWKA 1D1AA 4ED1A 4O3PA 1REVB 1WC0A 4ZVPB 3JAMY 2BM1A 3GV7B 4IQXA 4MIAA 3WQPA 3BKUA 1AA1B 1RWXB 1S12A 4I55E 4EEDA 4KO0A 4BWJA 4C9DA 2DWGA 3VR1A 4YTNA 1RT3B 4KRWA 2ZM6T 7AT1B 1T8EA 5JMNA 4OYIA 2ZDOA 4E98A 1X4GA 4NXMJ 4X62T 1LFWA 1X4EA 3MEEA 5I3UB 2P9GA 1C0UA 4ZPBA 2E1PA 4URSA 4DSJA 1YJWS 4O0IA 4YN3B 2G9OA 5I4MA 1F3VA 1CS4A 4X66F 4HVZA 4MK8A 1IBMF 4DR2F 2KH9A 4KHMA 4GKKT 2FB0A 3W2WB 4IFYA 4EXTA 1HWIA 4X5TA 2QA4S 2CPTA 4UR9A 1WHXA 3AQPA 3KUHA 1UAWA 3K3NA 4UZCA 5T41A 2QRXA 2XI2A 3BN7A 3K0JA 2AEFA 5A6PA 2WY2A 3T5LA 2FHJD 1F0XA 5ABHA 3SFUA 3KUEA 2VQFJ 1RI7A 4C2MA 3UU5A 5DLGA 1U6ZA 3N5FA 4KT0C 2HK2A 4R5PA 1YRUA 1NBEB 3VAMA 4JI6F 2E9XD 2ZITA 4DFPA 4X4VA 4Y3CA 2BACA 2BANB 3ONXA 1XR7A 2W00A 4I2QA 2CXFA 4DV4F 3AE3A 3R6LB 4ZP6A 4LR8A 1FESA 2F4VT 3NBPB 2OI2A 2HQCA 1FJ7A 3I5CA 1EZZB 4RBTA 2Y48B 1VQ5S 3A3PB 2RQ4A 3MOZA 3PFEA 2RJZA 1LW2B 4LRFA 1RT7A 3LPYA 3MOJB 4P74A 4OYWA 3UCGA 1NH8A 5F0WA 1V3SA 3TUZC 1U47A 1QVFR 3MAAA 4CM2A 2WW4A 1SA0E 4JI3T 1S9EA 2MTLA 2RSQA 4I4BA 4MFBA 4U2YA 4FNHA 3TJ9A 3DLKB 1SKRA 1NKCA 3MAHA 4GKJF 4AL6A 1IKXA 3DP7A 1J2VA 1Y11A 2M0GB 2IIUA 2OD6A 2UVRA 4JI4J 3D2WA 3BREA 2X0LB 5I3PA 1RT4A 2I1RA 2WZHA 3P7IA 3QIPB 4YR3A 2JRSA 5LMUF 1KNRA 3OYXA 3JQJA 3F57A 5ETOA 3TEHB 3I96A 2MZTA 3FKBA 2B8QA 4GC6A 3CJ3A 1VMBA 1DFDA 3TZWA 1FMWA 5EWEA 3ZZOA 2NPFA 1FKAF 4I7FA 2SXLA 5DM7Q 4BJMA 3R97A 4DV1T 2WCAA 3SMZA 4QXHB 4WJBA 3WC0A 4KGZB 3SV4A 1R0AB 2UVUA 3V2UC 1CJVB 4H9QC 2AW0A 2CQ3A 4AL7A 1NPPA 5LJ5Y 1RWNB 5L1JA 4LMJA 5B0DA 2KM8C 1SI9A 1J5OB 3GMGA 1H74A 3VZIA 4H9NC 4ZN3A 4PFPA 1JLQB 3AE7A 3HA4A 1WOPA 2CDRB 1X5TA 4QIWD 2XMJA 4OJGA 4ZI3D 2UV8A 4YB6A 2YNGA 2ATCB 4Z7YA 2FJBA 1DU2A 2W8KA 3TI0A 4C7QA 1XWLA 4FXDA 1APSA 2I0MA 4DPXA 4FXVA 3O3LA 4Q0BA 1U1LA 3AA6B 4J9VA 2AJ2A 1S49A 4KB7A 4F4XA 1FRJA 4CI3B 3MEDA 5DQIA 4M5GA 1D0XA 4DUYT 3UU3A 4NL5A 4LF8J 1RYSA 4B9NA 3SSSA 1S94A 3K59A 2GW8A 4RW4A 1IWAA 2HNDB 2V2QA 2XAHB 3PW5A 3TUIC 4PG7A 1FDDA 5ETTA 1UVIA 3DLJA 4FS2A 3RH3A 4J9OA 1RAJA 2HBRB 4K2JA 3DCAA 3DXSX 2RB7A 5JR9C 2V26A 5JRCA 1FRIA 5B0CA 4NPOA 4M5DB 4FF1A 3VZHA 1OS5A 3QAEA 3PUWF 4OX8A 4DI6A 1YRTA 2MLYA 2U1AA 1Y10A 1MROB 4YY3J 1XNRF 3ZT7A 1EJ7L 2ZD1B 2CRLA 3H98A 1X4AA 4EGWA 2G2YA 2BZ2A 5AXMA 4BA9A 2NXCA 1WD6A 3SQGA 4JV5F 3HFVA 4NLSA 1WJ9A 2KZZA 5A8KB 4L5GA 5H9FJ 3ADAC 2E9XA 4B3MJ 3RTVA 3L7OA 2UUTA 4OYZA 4ELVA 2YNFA 4NI2B 5LMNF 4K0UA 1SJQA 3FRZA 2CUYA 4AQGA 5IXUA 2I0XA 3O1HA 1Q79A 3CQCB 4I43B 3Q86A 4PRFA 2GO8A 1SHZC 1R8AA 1SE7A 1T05A 3K57A 2UUAT 2Z2YB 3UFCX 2W1BA 1EZ3A 4M95A 2OFGX 4YOEA 3JAEA 3GFZA 2DNQA 4Q25A 2JC0A 5E3QA 4HFVA 5IFMA 3C6TB 3ETUA 4DR7F 1IR0A 3PEHA 1QVGR 5H6RB 1U0SA 2X66A 5D0RA 3KV5A 5AQQB 3RYHE 5AE3A 3ZC0A 1S0MA 1ZAWA 4KHPJ 5B0GA 1GXTA 4HEA9 1NMEB 3DLKA 2R9LA 1W0AA 4DMWA 5LP6E 2GV1A 4NLDA 5DG7A 3K3OA 4I64A 2B7CB 5BR8F 3HPOA 1O51A 1DY3A 4ZVSB 4IQMA 3NAIA 2DBBA 2BYCA 2VG5B 2E9XC 2CPJA 2PBIA 3AD8C 2XNQA 3PW0A 1S6OA 3NKZA 4WFNQ 2ZH5A 3W9JA 5CQGA 4CO2A 3PV8A 4YHJA 3VAHA 1W0BA 4B6XA 1VC6A 2VKRA 3J80U 4XTTA 2NXJA 1NK7A 4B3RF 1KQSR 3V6DB 3CMLA 1LK5A 5F8NA 3NNHA 3DMJA 4U7YA 1Y5IB 2RUSA 3C2PA 1UFLA 1VRQC 4QIVA 1CJUB 4U2ZA 4UTGA 2DNOA 1NDLA 2CJQA 2PJQA 2O3DA 5ETNA 4DU7A 2EG2A 4WE1A 2WK4A 4X4TA 1KC8T 5HMYA 3PEJA 3MM6B 2FLPA 4JI2J 3AB3B 4DL7A 3I0QA 2HVZA 3WAJA 4DF4A 1TKZB 2EK6A 2DYAA 1DTQB 5C42A 5HSPA 2B3TB 1F9HA 2XY5A 1GMUA 3LP2A 1WRDA 2CJ9A 1PYOB 1FF2A 1WUUA 5IWAF 2V50A 4ANJA 3AOCA 2W2MP 1RAIB 1YRXA 3UUMA 3AEAA 1KK7A 3B57A 2PG8A 4EZ4A 4PR6A 3PKMA 1FJEB 2HNYA 2UUAJ 1RHMB 5F8MA 5LGNB 2VBZA 2WWUA 1S7HA 5C7PA 5JDFA 3R27A 2RE1A 4C8YA 1UFWA 4AKHA 4JI5T 3U7JA 3VHQA 4LF7F 2LYVA 5HXRA 4JI8F 3RC8A 2DXDA 2AGOA 3TAQA 3PU3A 1MNDA 1TTHB 1T72A 2KU7A 4WP9A 3M32A 5IT9Y 1XMQJ 3ZT5A 4MK9A 5KOXA 4BDPA 2CJKA 1LVFA 3KG4A 1OQ3A 4MKVA 2M9KA 4OX9J 5LSLA 4L9IA 3ZN1B 5KFGA 2YQ3A 4KV8B 1AROP 1R27B 4FYXB 2GC8A 3Q2SC 5LXYA 1J5EJ 3RBDA 3NBPA 1WYCA 5HROB 2LEBA 1WC6A 2JFDA 3D68A 4TNOA 3MR3A 3KVBA 1I5OB 2I59A 4DX7A 3VR8A 3I87A 2DRBA 1WR0A 3CB4A 1RHUB 4GKKJ 2CJXB 4C98A 1CJVA 3RIUA 3CD5A 3EX7B 4MFBB 4AQYJ 3O44A 1OXZA 3H25A 1GMVA 3UW1A 3CCJS 3AA7B 1XMOT 2YNHB 2YKOA 3N9NA 3M8QB 2Y8YA 3U3IA 1H98A 4O4IE 3JSMA 3TVZA 3NWRA 4WBOA 1YHQS 1UCUA 1WEXA 1RWMB 1VBKA 3FMWA 1VQLS 1U24A 1ZZFA 2V2ZA 1YZ7A 3BV8A 1HBMB 2MLZA 2HLUA 1RKJA 5C5JA 3PJWA 4HKQA 2UXXB 4JI2T 1T8BA 4P1NA 2AJQA 1RK8A 1FFWB 2ZNZA 3H2VE 2FVSA 2CBIA 2DL1A 4JI7T 4USHA 1KNPA 3PW4A 2QYWA 4NA1A 4F50A 3ISZA 1OY6A 4P52A 1M90T 3JADA 1TELA 1D0EA 4PXBA 5KG4A 5DJQC 4AE5A 2B5JA 2V6XA 3QPIA 3LFMA 3K5PA 4F3OA 4M5IA 1Z4UA 2QJ3A 2CMRA 3RRKA 2DB1A 2IW5B 4DMVA 4PWDA 2YKAA 2OAUA 3Q0AA 2C3OA 4F4YA 4QH1A 3IWNC 3T1YT 5HCMA 4NE9C 1WI6A 2E29A 3GU0A 3IR6B 5DQGA 3TLWA 4GMKA 3MHYA 3A13A 4DX8H 4OYOA 4X4SA 4TY9A 3W8PA 2VPWB 2ZE2A 1IAPA 2NOXA 1FD8A 4TU7A 1DQAA 5LSRA 4OZ0A 2M5YA 2AJFE 5CZVA 4P72A 1J5EF 1FD2A 1YGYA 4IFVB 3UN3A 4NZ6A 3KLIA 1R6VA 3A8JA 3RJMB 1HX8A 2LDYA 2IRUA 3SCIE 2BVLA 4U3CA 3SOLA 3NLCA 4BWMA 1XZYA 1MIWA 1SJFA 1UA0A 4TZ4C 2D3O1 3PURA 2XI3A 1MSWD 2VKOA 4B3OB 2JVRA 5KT7A 3AHPA 3K8WA 4FYYB 5E2QA 4DQPA 2F4VJ 4Q8FA 2XS5A 2IPOB 5ADZA 4YFUA 2A0FB 2JQHA 1D1CA 3ZZPA 4RU2A 1TMJA 2FJEA 4A98A 3KDSE 3MK7C 1B0PA 1ZS6A 1UGOA 5KFOA 3THVA 4WP8A 5KDMC 1FDNA 1HKAA 3KVAA 3F31A 2IM1A 4HKAA 5L1LA 2RT3A 2FZKB 5AQPB 2WQYA 3V6DA 5EX0A 1PC5A 2MY8A 1N33F 4H9OC 4ECRA 2BS2A 1DQ9A 3CC2S 4KSEB 4R8UA 5DO2A 2LHRA 1GTEA 2EHOD 2LSKA 4LIRA 2RKIA 3RB0A 2C5JA 1IJFB 1REVA 4DUTA 3WI3A 2HFZA 5L2LA 2D41A 2OV9A 1HNXT 2ZJPQ 4DPWA 4R0EA 4K4XA 4I56A 4HTEA 1D8YA 5DJBA 2C2KB 4YFSA 2DY1A 1WG4A 4KH1B 3QJPA 2NS1B 3D4JA 1IR1A 4F25A 4ZPWR 2Z6EA 1DTTB 3WHIA 1ZETA 1L3TA 4DV1J 3US5A 3HD1A 3H2LA 3D9BA 2DGUA 2WVEA 5FVLA 4F04B 3PUQA 3LP2B 4DV7J 1Z0PA 2KXHA 5K14B 4C48A 4HHUA 3C6TA 5KFQA 4H9PC 5LYJE 1X5PA 3WX8A 2GCFA 1TL7A 2C0SA 5KFKA 3GYNA 2E5JA 4NLWA 1TKTA 2AHOB 4Y6IA 3IR5B 4Y65A 3PYEA 3N2OA 3H3MA 5KFRA 4ZS3A 2L08A 2GVZA 2M8HA 3NKYA 4C3LA 3FCVA 2MQLA 2VFSA 1I94J 4DV5J 4X4UA 3NGUA 4TQRA 2DH8A 3GONA 2VH7A 2VG6B 3CDBA 3Q8YA 2BBHA 2NLWA 3KNAA 4B3TT 2K06A 4EB6E 1R8CA 2PMHA 1VDHA 1NK8A 1UZHA 4V1Ak 4TVAB 4BC7A 3CVRA 2LEHA 2V9WA 4CH1A 1UFKA 1DLOB 2MKHA 4I50E 3AXKA 3I9V9 1G7CB 2GHPA 4EBDA 3ET6B 4TNWA 2JMHA 2YBVA 4H63H 4NWBA 3PW7A 2XSBA 1WORA 2EPIA 2Q1LA 2HAIA 4WIIA 4HGAA 4NIQA 2F9DA 2CNNB 2WWVA 3L3PA 3BEGB 3OXGA 3JTPA 3IM9A 4B9UA 4OI1A 4UW2A 1SL0A 2LQ9A 1R0AA 2UXCF 4JI8J 4WZXA 3TARA 4AFFA 3SFEA 4P0AA 4OX9T 3HSDA 4X4RA 2EFPA 1GX6A 2LEPA 4TYBA 4ECXA 2AU0A 1OJ4A 4QWNB 3Q83A 4ECVA 5DG8A 2LRLA 3C19A 3FDSA 3GIKA 3Q23A 1JNZB 2W7OA 2HNDA 2BG9A 2QG9B 2K8GA 1QE1A 4CYUA 3BR9A 1LEOA 2LHNA 2RU3A 5HWYA 1IKYA 2BJDA 2DR6A 2KTQA 2ACYA 2PD1A 3OXLA 2M4MA 2RD5C 1UX4A 4ATNA 1XMQF 1CPZA 4MKBA 1S57A 4LFAT 2J6UA 3Q5EA 2RHSB 4KGMA 5DDQC 4YHHF 4ZZBA 3CE8A 3ITHB 3PIPQ 4M94A 2XQ4A 2G2ZA 2QLJB 4ICLB 4OLPA 2I6HA 3D0HE 2KT3A 4OZ1A 4UF4A 1JLAB 1RGVA 3PY8A 3EUNA 4D3HA 2VC1A 2RF2A 1W26A 2QMUB 3QBCA 3DTOA 3D67A 1Q8BA 2FHMA 4LFCJ 1HYSB 1RWPB 4KGVB 3MCSA 3DM2B 4YMEA 3KV4A 3ZZRA 3GIRA 4AISA 4CTAB 1XMBA 1T3OA 4DJBA 5H9EK 1U8WA 3VAKA 5AQTB 3HK2A 1S1VB 2UXCJ 6FD1A 2Y9HA 3CDAA 2ZOGA 3R7BB 1C4AA 5C2GA 2KWHA 5F8HA 4P0BA 1FKPB 4DL4A 5KFPA 2FGCA 1J5WA 5GAHU 2FC9A 3M9NB 4HH1A 3BN4A 2ZKUA 3EGZA 4JI1F 1SQGA 2G0UA 1GXUA 3MXHP 1LV5A 2FVCA 4QIEA 3AAEB 4NZ7A 4DR5T 1SH2A 2CZVC 4GVBB 4TWDA 4PQUA 4DS4A 2W2NP 2YTCA 2H1YA 1D1UA 2DXEA 4QPXA 3P8BB 5ETMA 7FD1A 1AZSA 5AQFB 1JLQA 1NZAA 2KYXA 4K8RA 1X9SA 2ADBA 4QW9A 5L4HA 1X5OA 3MCOA 1ZAXA 5BR8T 1M7KA 1TUVA 1KFDA 3NXZA 2Z8QA 4K4YA 2HEKA 1KN6A 4JI3F 1HNVA 2QLBB 5B09A 1RACB 4O4GB 3K1SA 3VVTA 2EEYA 4B9SA 2WSEC 2C5KT 1RTDB 1UJ4A 5LXTE 2RU9A 3DLLQ 4DUZT 3W2WA 2Z2LA 3J81j 2XASB 5CAAA 5JJBA 5C2TA 4CLYA 3CQXC 1QTMA 4F4AA 1VQNS 2VJVA 5TAOA 3X1DA 2JPFA 3CJTA 4WP3A 4A8SA 3PZPA 4ZVGA 2J5AA 2OKQA 3R5BA 4X1YE 3R9LA 1BQNB 2V4QA 3PX6A 2Q9QA 4FN5A 3TA1A 2GVZB 2J9EA 3OTOJ 3QO9A 4AKRB 2UXBF 3GG1A 5HXSA 3OTCA 2ZLYA 3RHWA 4CO3A 3GN5B 2CQ4A 1S1VA 3GPAA 5AE1A 3OTBA 1IJ6A 5D3GB 2J76E 2MKJA 1XK8A 4GIWA 4DV0F 4QWAA 3C15B 1WF2A 2OO4A 4URQU 2I5JB 5A8WA 5CABA 5B0FA 2LT3A 1F1BB 4UELA 2XZDB 1NHUA 2QLFB 3M4XA 4I2QB 2IIHA 2GNKA 1VQ4S 5HROA 2NYHA 1N36T 2GFFA 4U96A 1UEUA 2XWYA 2D69A 3P4QA 5THWA 3BGFA 3KDOA 2W2PP 2H5JB 2Y1LB 1FNXH 1R43A 3A4TA 3OFGA 4MYTA 1NEKA 2XYPB 4HTIA 1VS3A 5L3BB 1FVSA 4LFCT 3NEKA 1ZM9A 2EFVA 5J0ZA 1KLNA 2BMBA 1VQSA 4BHQA 4KO0B 2GMLA 2APOA 4DMZA 2LMIA 4EYHB 2HYIB 3D54A 2D0TA 2XM2A 4Q7AA 1LW0B 4DV6T 4LMLA 3PACA 3ZSSA 4JI6T 2MQNA 4JB8B 3A8EA 1F60B 5B0AA 1OO0B 4DV4T 4DR1J 2KINB 3AY0A 4LF8T 4DG1B 4PG5A 5H9FK 1BQXA 4WFAQ 1SKSA 2F4VF 2HWIA 1N5QA 5CZXA 4BAYB 1ZM3A 3CO0P 1S6QB 1VISA 3M1VA 5L9NA 3H5YA 4GO7X 1S79A 3K5NA 4NLOA 3A3OB 3VQTA 3FEYB 4NA3A 4XZCA 4DL2A 3ZYLA 3OTEA 1HWKA 1LFPA 3QYYA 2KRBA 5FY1A 2FJDB 5L8RC 3AXJB 1V5IB 1FFGB 4ILMA 5HEHA 3CIRA 2FZGB 2Y6XA 1SH3A 3FSIA 4Y2AA 3NGTA 3MMCB 1OEDE 3BR8A 2A3JA 4YUDA 2R8GA 2XQCA 1YDLA 2QL9B 5AQVB 2YKSA 1S6PB 3LG7A 1FKOB 4HWFA 3RUBL 3BM7A 4I68A 4RJVA 3KHLA 3TUPA 2FVQA 3H4DA 4KTQA 2J0WA 5JRCB 2KT5A 3UUXB 2YKNA 2CQGA 3M6XA 5ETLA 4AXJA 1CJTA 4IE6A 2CWOA 2V68A 3Q5XA 2PTFA 2AT1B 2WTFA 4C4WA 1RDRA 2V2KA 2UUBJ 4KQZA 2CE7A 1R8BA 4ES3A 1HX1B 5CYMA 1SC6A 1Y00A 3QSYB 1S9GA 4P7TA 3ONJA 1ZV4X 3F2EA 2HS3A 1FE4A 1NPRA 1IBKF 1S76D 2PI5A 3HVTB 4HH0A 4EI2A 2IJRA 5D6GA 3FCHA 1WTBA 4YT0A 4OHVA 2DEJA 4A46A 2G4BA 1PBUA 4H4OB 1XJWB 3HHLD 3K5OA 2OSQA 2VONA 3HULA 2UXNB 4EYUA 1UJ5A 3M8YA 1NSAA 2Z30B 3E51A 3EGVA 4RW9B 3M7VA 3ENQA 4YB1P 1IKWA 4EV6A 3TJAA 3PNIA 4ZKAA 4B9TA 1WF0A 3AH6A 5DDOC 4TN2A 4FPIA 3NGDA 2DH7A 4XDDA 3TZZA 2ACZA 2VG7A 4MHCA 2B51A 4I67A 2X9WA 3OQ2A 3NRXA 2F4FA 2WAQD 2CA5A 1FERA 2RPAA 2L9NA 3CPZA 3FRYA 3ZEFB 1F2GA 1FXDA 3JQKA 4EK2A 4JV5J 5D0HA 1FJGF 4PJNA 4CH0S 2CPZA 4ZITA 5ETWA 4O44A 1X0FA 1T7PA 1AW0A 4IOAQ 4IT4A 2BQ3A 3A8KA 3KG0A 3QWPA 1BR4A 2KM8B 1IKYB 2DCUB 3A8YC 3QGPA 3PRVA 1NDPA 1T9TA 3M05A 2BW2A 1OWXA 3V5UA 1JLCA 2KFZA 2XWXA 3SDEA 1WTFA 1C1CA 5HQMA 4DR1T 4C0HA 5GADI 3KK3B 3UD4P 2WSCC 3FZFB 4YR2A 3C14B 4P71A 3DGPA 4CN4A 1ZEEA 3T5HA 5T7LA 4X1KE 3LSVA 2E5VA 2DPIA 3PYGA 3HVTA 5IM0B 4CO5A 4TUYE 2XY7A 2WB4A 1UVLA 3M8SA 2E1RA 1CSJA 1K8AT 5DDRC 1VQ6S 3DLEA 2WOMA 1HNXF 1SH0A 1VLOA 4HYKA 2XC9A 4CXYA 4LF5T 4IG0B 2HSEB 2MEWA 1B7YB 1M5OC 1JNRB 1MNEA 3EDVA 1KQFB 2CRBA 2W9CA 2F7VA 4OX6A 2K9AA 1VBZA 3FB2A 1LQ9A 1N6QA 4L3KA 5JDNA 4KV8A 4DX5A 2OEMA 4QXBB 1Y3JA 4LFBT 2ZBQA 1C0UB 5LG4A 2L9QA 2XQ9A 4AQFC 1DRZA 3K8PC 4FDFA 2LKHA 2D3ZA 5LHHB 5HMXA 3PFOA 3FZHB 5ABFA 4LMKA 2W4DA 3CCSS 3N5LA 2G0CA 2NW9A 3SV3A 2A6OA 2Q9QD 2GIQA 4H4MB 2CBJA 2FVPA 2NZ4A 1RSCA 5SUHA 2ZM6F 2H9ZA 2QA2A 4Y2IA 4ZVUB 1V9OA 2B6AB 5KG1A 2NWBA 3GMIA 4QR1A 4R5PB 2LQBA 3K2YA 5FIIA 2B76A 3IGNA 3KLFA 1DTTA 4JV1A 1S1WA 4RZRA 2KLQA 2B9YA 1IKVA 3CO9A 4CI2B 2DT9A 4A97A 2V63A 2R2RA 3THTA 2R8JA 1KEYA 3HVRA 4JI1J 4DPTA 2MB0B 4X84A 5HJXA 3HKDE 4KP3C 3BH6B 4OI2A 1W25A 5DQWA 4IDNA 3RR7A 4DV1F 2ODUA 1K1SA 1TK8A 4KBIA 4RL1A 1KRPA 1T9UA 2F8MA 3D7SB 3D0GE 1N4LA 4A8FA 4WXWA 1M5VC 4V1Av 5C24A 3VWSA 4W98A 4RPFA 3RKGA 3S7RA 2ZBIA 2DVIA 4M5KA 4CT8A 5KFZA 3CPWR 2EKNA 1RQ0A 1Q7LB 1BR2A 2C2MB 3X3UA 1EQMA 4CQ1A 3D3CJ 4QQBA 3D5MA 2M3DA 2UU9T 2FUG9 2XAQB 2HQIA 2DHHA 3J7YI 2VVSA 2MQMA 2XZTB 1YBTA 1BGXT 4E8UA 1U4QA 2HVEA 1N32T 2YH0A 3BJYA 4B02A 3OVBA 4I6WA 2JLEA 3QJLA 4KYZA 2NP9A 3DYAA 2RMLA 3E08A 4DL5A 2IY5B 2JQKA 2CQBA 1FIOA 2NW8A 3CGIA 2LJLA 4IE0A 3W2VB 2E7XA 2YQ0A 4ASKA 4ZPAA 1BQNA 1CC7A 3LP0B 4OZ3A 1SQEA 2HPUA 3OBIA 1JJCB 3AVSA 2AE9A 3CWZB 2PSZA 1IN0A 5LOVE 2FJEB 2YDRA 4DDFA 3SRZA 1NO8A 3GSIA 4PJJA 2JEGA 4EO8A 2CKWA 2WDVA 5CHCB 2CDQA 1RXOB 2H4WB 1P1LA 5C42B 4C8ZA 1S10A 1VRUB 1SUMB 1UWAA 1ROFA 4IR1A 1X7VA 2L48A 5J1NA 4ERDA 3QC9A 1TL7B 4X65F 5HXEA 2WBMA 4AKIA 2RHQB 1LWFB 1IQTA 1HNIB 4OQJA 1EP4B 2X0HA 4DUZJ 3TX8A 4ZJQA 3AA9A 2OFHX 3CC4S 2W01A 1SC1B 3UR3C 2OEKA 2ZE2B 4PFOA 2D0UA 2HBZB 2WS3A 4C91A 4NI2A 3OKQA 3TWZA 2B4VA 3M2UB 2QRRA 2C3PA 5FXVA 4HL9A 5M2RA 1FKOA 4LBHA 2HHHT 1JLFB 2DIVA 1FNMA 2AX0A 4LSLA 2BEFA 1U5PA 4LSZB 3ZTSA 3E01A 3M30A 3N01A 4Q45A 4U95A 2P5VA 1TP7A 2Q3PA 4OLOA 3RYFE 4USKA 4DR3T 3K58A 2NTYA 2F8HA 2RNEA 1VR6A 3OR2A 3C46A 3QRRA 3LJCA 2IMOA 5D0GA 1S6UA 4DUYF 2W9BA 2C2DA 1VQMS 2OPSB 1W9RA 4AQYT 2X67A 3VGUA 2B56A 3AEBA 4G65A 3DU6A 2XMUA 1XNQT 1VC5A 4DR7T 3ISNC 4DV7F 4LRBA 4NCGA 1KTVA 3W2VA 2OEJA 3OPCA 4JYAT 1VGYA 2XMWA 1EIYB 4RR5A 4DPUA 4DV5T 4PUOB 2VBWA 1ACMB 2IC6A 2BJ1A 2LDIA 2CQDA 4USUA 1RZMA 3P5TL 1AXQA 3V5SA 2HIYA 3ZMSB 1HCIA 4ED6A 3KJQB 3JSMB 3N5BA 3LALA 1MG7A 2J7UA 3NS5A 3LBXB 3OYZA 4YJ3E 4KE5A 2KT2A 3CCTA 1JKHA 2EFNA 4USWA 4HWIB 3AJDA 1PJ6A 3BK9A 3BF4A 3WIUA 4JI4F 1CBKA 1T9WA 1TKXB 3V6HA 4JV5T 3CF5Q 3KLEB 2GGPB 1R8HA 5AQUB 3DRPB 1RYRA 2R3VA 4LF6T 4QWEA 4IH7A 3MFHA 3NP5A 4GRSA 5JTGA 3BBCA 1I1GA 3V5RA 3C6UB 1KS2A 1V5VA 3AA8A 3QT8A 5HVHA 4DZDA 2X9HA 4ZJLA 3T1HJ 4P2SA 1JLGB 3BBBA 2CFXA 2G1HA 1VLYA 4FVCA 5KG6A 1HF8A 3LK2B 4QBUA 5HWXA 4DCOB 5FXZA 2X7IA 4LFBJ 5EZYE 2PN6A 3AFGA 3PUXF 3LAKA 3VAJA 2BX6A 1Q82T 3MMAA 1HFEL 2BV3A 2PFFB 2BKPA 2QL7B 2V67A 4ZCIA 2B7BB 3W5ZA 5KFDA 1HHQA 4MTPA 3ZZZA 4WU2A 2CG8A 2LXIA 4KUMB 1FRKA 2OP5A 5LJNA 2LLYA 2BE2A 4PAGA 4ZMMA 2W9CB 3HVWA 3ZNJ1 2AKWB 2OSRA 3KINB 4QW8A 3DLBA 4RW7B 2R7XA 1FT8A 3DDIA 3CIMA 1RU2A 4DO0A 1RTHA 2JEFA 1YJNS 4YXDA 5JQGE 2AX1A 1F5CA 1U0HB 1S0OA 2UVVA 1JB0C 1YW0A 3HKZD 3KHGA 1FRLA 1UK5A 4ZLLA 4F26A 2WB5A 3T41A 2WZ1A 2QMWA 4HFHA 1NJXA 2IHR1 3LQVA 2XTLA 1TL4A 4DSIA 3GR1A 1RTJB 5B0BA 3UU4A 1T11A 1WDTA 5KFIA 1IBCB 1HG2A 3MMBB 4PYAA 1BUXA 1VBYA 3D6HB 1YG0A 3U27A 1BY9A 4TV8E 1FDAA 2MJUA 3MM9B 2KSRA 2O67A 3PUAA 3FZMB 4CLWA 4FNIA 2WAUA 4QHOA 2XMMA 3MECB 4OHXA 3NS7B 4UOGA 3KLEA 5HJYA 4TY8A 1Q8KA 2DRAA 1HQEB 2IDOB 3TAPA 2A10A 5FLXY 2XO6A 2FLLA 3V81A 1S72S 2K1RA 5G0RB 4ZP7A 2XQ6A 3ZMUB 2JDJA 4K4WA 4NA2A 4DQRA 1OY8A 5HEOA 3K17A 3RQUA 1S1UA 3HD2A 2CQ2A 1LK7A 3MEGB 2Q6CA 1FRMA 3PUZF 4KBMB 2GJFA 2CAJA 2K48A 4O4JE 2WM9A 1DHMA 2OMOA 2BJ3A 3JC6D 2IYGA 3E8OA 1RT6B 4J9KA 1RT5B 4GKKF 2CPEA 5H6QB 1MMGA 2W2QP 2MXYA 1IJEB 4P7VA 3QNUA 3HHEA 4J2CA 3DI6B 3BQ0A 5D78A 4IHJE 1N5SA 4WZMA 1CG2A 2NREA 5A6WA 4ILAA 5KG3A 4DSEA 2PMWA 4OL8A 5AJ3F 4OYAA 1SJ4P 3HMJG 4NUVA 2HHTA 4JI5F 3R2CJ 4HT5A 3AAIA 2K3WA 1QSSA 4A8MP 1WOSA 2HGNA 1IR2A 1N88A 4C8NA 3RBXA 4DUZF 1YJUA 3B8HA 5F8PA 4X64T 2RVJA 2NR0A 2ASJA 2KI2A 1JLFA 4FF2A 4Z8XA 1N34F 3QO9B 5DZ7A 4ZOSA 1T9YA 5E3CA 1D3WA 2V8PA 4NXMT 1IKVB 3ZT6A 2ROPA 2L9DA 2RRBA 5F8IA 1K73T 2XAFB 2FJWA 2QL5B 3H8YA 3EVMA 2W9BB 4ILBA 3M6UA 4EZ9A 2JQQA 2KYZA 3DMJB 3GCXP 3PTRB 2COLA 3FBBA 2WDQA 2UXBT 3R1LA 3V4MA 3GCWP 2ZH9A 1FTRA 2JOQA 4YHHT 2JIWA 5KFEA 4U67Q 3G6ES 3I0SB 3FQLA 3TQ1A 1YJ7A 4LFAJ 4XIUA 4URGA 3CCRS 4ALZA 1U1PA 3UCUP 3LAMA 4Z37A 3MUTP 2V8VA 2NUHA 4G3IA 3UE2A 1OYDA 2VIHA 5FY0A 4X1IE 4ER8A 3T3FA 1N36F 4RWXA 3M2UA 1XMOF 4E0DA 4ED4A 2CQHA 2V7KA 3OL7A 1ZBTA 4KI0F 5A2QY 2W4XA 4C11B 4HI1A 3GJTB 3IF8B 3O5TB 1TZ0A 1Z2ZA 5F41A 2MKKA 3LGHA 3Q8RB 2CQCA 1HWLA 2ROEA 1UVMA 1IBLT 3MMBA 2HLTA 1CHUA 4J37A 3MFIA 3QGIA 2NXNA 3G71S 2KMFA 3B5MA 2ZH7A 2WBLA 4DV6F 1WSVA 2AJ0A 1H0HB 2DNXA 3IS9A 5GONE 2YH1A 4NMLA 4UF0B 4RUBA 4YDXA 1H72C 3SZ2A 5BXIA 5KT5A 4C3MA 3OTDA 3BO2A 2ADCA 5LXRA 2HHVA 3EXYA 3I4HX 1AZSB 1E7PA 3IGVA 2WHOA 4HFIA 1HLWA 1Q7YT 3ABVA 3BKFA 1AUDA 3P4UB 7FDRA 3MUVP 4UIGA 3W61A 4ECQA 3MA9A 2OLTA 3B6BA 3TANA 1RT2A 2GGPA 2H51B 3QGHA 3RRHA 2XQ3A 4G1PA 1ZA1B 3HT0A 2IMWP 4KPCA 2FGOA 5EWGA 4ZLJA 4WPAA 3RG6A 1HI1A 1FTCA 3VKHA 3UUNA 1X4DA 2RA1A 3AODA 4HHJA 1KEKA 2XSFA 3AB4B 2E8IA 3EXCX 2WDRA 3VALA 2ZM8A 3ETVA 5E3AA 1JLBB 1ZOTA 3T19A 2BS4A 2FQQB 1HBUA 1YXRA 1FRXA 1OIAA 3CDEA 4PEOA 4LBIA 1U49A 4PJLA 4NUUA 4KGXB 3CCUS 3DKDA 1UKUA 2V8SV 4UVBB 2AYBA 2EC0A 3RAXA 3L8RA 3U1LA 4AXIA 2ASYA 1IKWB 4DNDA 2X3GA 3M8WA 2D2SA 3OTOT 5GAEU 4GK0E 3TVYA 4X66T 2HG4A 1C0TB 2VJUA 3VRBA 2M6BA 5J2PA 1ZM2A 2QZ8A 1WC3A 2MYFA 3LOUA 2HHUA 3RR8A 2LQJA 2I38A 4X4OA 4DV2J 2KHCA 2D3UA 1UEVA 3NY0A 3N0VA 5KFFA 2JEJA 1RAGB 3HSJA 1TV6B 1SKWA 4O3SA 4CO1A 1HG5A 4WBNE 1RHKB 4Z91A 3RIFA 1RWOB 4JEUB 5GAGU 2RS2A 1XMOJ 4DPYA 4FYVB 1NWMX 4L73A 5KFNA 2ATLA 4NPPA 2B8PA 4OMFG 3T1HF 1EAYC 2DIUA 1IVZA 2CZ4A 2MZSA 2ZBRA 4PWDB 1I51B 2MHNA 4M5MA 3QLHA 3TUJC 4ZPCA 3RRWA 2VL1A 2JFKA 2AP6A 3PCOB 3JSBA 5ETSA 3C98B 4O2BE 5ABGA 5IS2A 2PC6A 1B99A 1X8DA 3GTYX 3NS6A 5D15A 3A7MA 1BR1A 4L3NA 3KK2B 1NAQA 3L7PA 1FVQA 1HBNB 5FY7A 5HEGA 2Z0GA 2A3DA 1IBMJ 2EVZA 3EE3A 4M5LA 4BCAA 4KGKA 2PFDA 2C2ZB 1M62A 4X65T 3M9OB 1Z1ZA 4TQSA 4OI3A 3E22E 2H3RA 3GP9A 4F2SA 5HAOA 3BO4A 4UY85 1O0PA 4QWCA 3O8WA 2H7VC 3N9PA 2JVOA 4CWBA 2CEAA 2Y3YA 4B3TF 3MCNA 5M4YA 3BQ2A 4N7TA 4ADZA 2P9EA 5L1KA 2X3DA 2O66A 4KJIA 4CI0B 4NYPA 2ASLA 1MWQA 2HK3A 3RZAA 5BYQA 1ELOA 1FE0A 3GQCA 3CULA 2J7WA 4LUBA 4FBTA 3FFIB 3PJ9A 4HFEA 3KDNA 1WHVA 1XC9A 5LGUB 4N47A 2IDLA 2OPQA 4QCLA 2W9AA 3AT1B 2BANA 1TAQA 4WK1A 4GOUA 5AXNA 1X4BA 1TFWA 5AXKA 1B7TA 4K0KJ 4DIDB 1DARA 5LNKA 2DNLA 5EWFA 2M67A 1R0BG 4IO9Q 4PKDB 1V6HA 4DR5F 4NCBA 3TZXA 1D09B 2R7UA 2HAFA 2QEXS 1N54B 2V6AA 4RW6B 1K47A 4PPZA 1IBKT 4ECUA 3OUYA 4GKJJ 3M32B 1H6KX 5D77A 5F8GA 4OHYA 3L9ZA 4A8WA 2FHJA 2NUUG 2GQCA 4CXWA 4OYJA 3S8SA 2AZ1A 2A1BA 1WC4A 5D0EA 4WZQA 1CJKB 4XPCA 1ZHCA 1VI7A 1T0TV 4A8QA 1HW9A 4O3OA 4QX7B 3BSCA 3J7YU 3VCDA 3DN9A 2FPHX 3KLVA 2RP4A 5E0OA 3V81B 2NXUA 1FDBA 1DZ5A 5LMUJ 4AIUA 2H88A 1EQ0A 5EK4A 2GAHC 5IQQA 1HNZJ 1HNWJ 1BXNA 2XPKA 1HNXJ 1WACA 1RAAB 2MSTA 2YOEA 1NJZA 2MHEA 3AEDA 3UU8A 5F8JA 3FUYA 4DR6T 2VASA 1NDCA 3IS9B 1TK0A 2QE5A 3H90A 3GZ7A 4B3OA 1KBRA 1YQ4A 3ZYKA 2HRYA 1RAFB 5CYMB 1N33J 4JBWF 1QSYA 1UPPA 2VOOA 1WC5A 4F3QA 4CN6A 1SUQB 4ISSA 3R6NA 3ILOA 2GJ2A 5U47A 1FNOA 3MZIA 1FWKA 5CXTA 2JMKA 1RHRB 1FXLA 4DFKA 2H89A 3EDRB 3KUGA 1X0PA 3B82A 1R0CB 1NXIA 3W7BA 4B9MA 1H2VZ 2N2NA 3BGRA 1FA0A 3RIUC 2ZBPA 2A18A 1S6QA 4QYZJ 1HI8A 1WELA 2V94A 6FDRA 2ZVSA 3HSZA 3JSRA 3T5KA 2EBEA 4O4LE 3TA2A 4DF8A 2ZUAA 1A0OB 1UMJA 3AE8A 4ELUA 2ZUGA 5KFBA 1FMVA 3V6JA 4K0KT 1B7FA 2BR0A 3ZTOA 3DC2A 2JHEA 2KXNB 4F4ZA 3HKCE 4Y2KA 2PFVA 2F63A 1YJVA 5CCLA 3BB5A 2FJDA 1YITS 3CCLS 2HHSA 2B5JB 3H5SA 2KDOA 2YPZA 3TEGA 4XBFB 2VL8A 2IYIA 4EIWA 2Q9QC 2C2RA 2O01C 1H7XA 4EGLA 5KFWA 2HQDA 4WYWA 2V5HG 3ZZ0A 2DR9A 2YWFA 3QQCD 1P9YA 2VKZG 4TN7B 3X1LB 1N6QB 1RU1A 3M2RB 1RWWB 5DS7A 1D0YA 4Z7CA 1HW8A 3TLSA 4CLUA 4DOZA 1RLCL 3A8IA 2XO7A 2B1EA 2G2OA 3PG9A 2Z4PA 4FF4A 1WEYA 1LWCA 2XMTA 2ZM6J 3H2UB 1LXNA 2XCAA 3GIMA 2OIHA 1KFYA 2N4CA 3AECA 3MKDA 4R0JA 3GJQB 3M3ZB 3M6VA 3J9X1 3MUMP 3TX0A 2LKZA 1TR0A 3K3QC 2YKMA 2CIMA 3ELHA 3R5AA 3UVJA 3UDEA 4U7IA 2J47A 1MN9A 3CWJA 1F5BA 4DLGA 3QT5A 4DV3T 4Y0FA 4ED7A 3GFYA 3OPKA 3JYTA 3R1HA 4MALA 2HFSA 1NH7A 5KFMA 3OFEA 3JQMA 2QFJA 3PE0A 1PC4A 8ATCB 3M2RA 4LJMA 2KHDA 1D0ZA 2CXDA 4DR3F 1N5YA 1NK5A 1H2TZ 2ZH4A 2E9RX 4ZI2D 4F8HA 4DV6J 4ICLA 4OJ3A 1FK9B 1VFJA 4RNFA 4IR9A 1WSRA 4U6PA 1PYTA 1YKHB 4KR0B 1UVJA 3OXFA 5ETPA 3O1IA 4J9LA 3LP1A 1QUPA 1X9BA 4UV8B 3C16B 1NHKL 1S9GB 4HDGA 3ZCJA 3EVOA 5HBMB 4RNNA 4HTJA 2MGZA 4MKYA 1Q78A 2GJIA 2YY3A 2JL9A 4CZZB 5HLFB 3E01B 4J9MA 2LEAA 3T1YJ 3K7RA 1OEDA 1NSPA 1V3RA 4WF9Q 4BJNA 1TVRB 5IWAT 2IM3A 3HI9A 3ZC4A 4IGUA 3T9ZA 2X1GA 3HJFA 2XHWA 3KLGB 4RNHA 1TUWA 5J2MA 1NK4A 3ENWA 2F5GA 4LFAF 1H73A 1YD8G 3MPDA 4IREA 3HHKA 3I31A 4NOHA 3TZYA 1N32J 3AVRA 1U2CA 1EP4A 4HN9A 1TK5A 3B78A 4JI4T 5J2NB 4PWUA 4DSFA 1XNRJ 2E2AA 3DOMA 1LKZA 4DQQA 4F8RA 1JXLA 5LJ3Y 3KJFB 5JDMA 2XHEB 4MH8A 2R7QA 5I3QA 3UI3A 4IRKA 4DL0C 4NRTA 1U2RA 3H5XA 2G0JA 2R7RA 2VFUA 2AYGA 4CLZA 1S77D 2DITA 3U02A 2XMVA 1VC0A 1IKXB 5CD4H 2LSJA 1GMWA 3ENVA 1T3NA 5I3UA 3NBXX 1VBXA 1C1BA 5HN0A 4QU6A 1FX4A 4YSXA 4ZA1A 3VRAA 4ZP9A 4LF2A 1FK9A 1LWFA 3S4UA 4I7FB 1N0VC 1LW2A 4U7UD 4JI1T 3TW0A 5EK3A 4C8MA 3S6EA 3I0SA 3HXMA 5FJ4A 2P8IA 3P4WA 1MWYA 3SI8A 4H63V 5HI7A 1H3DA 3HHLB 5ETKA 1YVFA 3CJ2A 2MKIA 1J27A 4RW9A 1EB0A 5JR9A 3EYZA 1YJTA 5KFSA 5KFXA 2ZWOA 3CQGB 5AXLA 3IWLA 6AT1B 1WKJA 4CLSA 1RT5A 4DBQA 1OSCA 5I42B 3UFGA 4U72A 5HEUA 1CQNA 2HQ3A 1PJ7A 4U33A 3MTJA 4OFZA 4ID8A 2I5JA 1HPZA 1ZAVA 4PK4A 1TL1B 3RB4A 3IA3A 2R7SA 4AQYF 4K5RA 2DLRA 3QT6A 1TL1A 1XNQF 4DEZA 2R7VA 4B08A 5BR8J 2P2CB 3A3NB 3KLIB 2VL0A 2O1PA 1IJ5A 1UURA 2VOPA 1RLDA 5DG9A 3MPUB 1O8BA 1A6LA 3TOQA 2YWGA 1OYEA 1G3OA 5GAGI 1T7SA 2VC0A 4PG4A 3AOAA 2HKEA 2IUBA 1G1XA 4NLVA 4ZVFA 1N5TA 2MTQA 4EYYR 3PHEA 5E5NA 3CJ5A 1RTZA 4ZVOB 2BS3A 1HWJA 2CPXA 4X4NA 5KX5E 3H3AA 1W2BR 5AQRB 2ZVIA 3IXQA 4ZVQB 3HKWA 2ZZTA 1VHIA 1DQ8A 2OELA 2CXEA 1Z8UA 2F1FA 4IFVA 5DETA 2KL8A 2ACXA 4A8XA 4IRDA 3PDNA 4ZI7E 2ZM0A 3NVOA 3HFZB 2J62A 2CA9A 1QAIA 3Q8VA 4NXNT 4G1QA 5A76A 1KVIA 4WCEQ 2HPLA 4U8VA 1NHVA 9ATCB 4LFCF 2Q79A 4X64J 3UO0A 4DFMA 4ED3A 3LWMA 1FO1A 2YWKA 5L4EA 5DGBA 2IJNA 2V7JA 2YNGB 2HBYB 4A47A 4K2XA 1CJKA 2V8DA 5HLFA 3MR5A 3TQEA 1NKBA 1MU2A 4MIBA 3KK1B 3RLFF 2YNIA 1UW9A 3R7NB 4LFBF 4NEZA 5JREA 1Q1KA 3E2EA 3BDEA 4DV0J 3OT9A 1IZNB 3N6LA 1S99A 3N79A 4HACA 3FEXB 4IUFA 1RHJB 1C1BB 1W09A 3FBEA 1BD6A 2VDIA 1HR0F 4FF3A 4MFRA 2XSJA 4X66J 3W62A 4BC9A 2C2NA 3CDWA 1T03B 1Y0HA 2VKJA 5A8KA 1I6JA 5EHHA 3I5AA 2B9WA 3L39A 3BSAA 2RF2B 1FHTA 4B3RJ 2N4DA 1SJ1A 4CLFA 4USJC 1SBRA 3LP1B 5CA0E 3NAHA 3IO1A 1UUSA 3DLGB 2C3UA 4ZPDA 4OX7A 3I0RA 1I6ZA 3EVYA 4OV1A 1FKPA 3IAS9 2BQUA 4DR3J 2KXPB 2XYGB 2M2BA 3VGVA 2CQ0A 3GFHA 2GQ2A 3LBXA 2UUBF 5GMKa 5EGYA 3N9OA 3HT3A 1JX4A 5LHIB 1SC3B 4AKGA 2FUPA 4CO0A 4E7ZA 5ETRA 5JDLA 3OVUA 3HHLC 2KFYA 4EBCA 1S97A 3AXMA 5HP1A 5IUXA 1G6BA 4M1KA 3BQKA 3DRPA 3UDVA 3DRYA 2LSGA 3L95X 3ZJ1A 3CKDA 3N9LA 1R31A 2GMHA 4JYAJ 2GAGC 3ZKRA 5J1GA 1IBKJ 4ILRA 5JH7E 2MDAA 3UVJB 5KFLA 4RNOA 3SCLE 4Q43A 4FXWA 2ILYA 1QM9A 2BRKA 2F3JA 2W67A 3BPDA 5F0UA 3MURP 2L3MA 4DPOA 3ZTQA 3I0RB 5EDWA 4WYVA 2BE9B 1QSDA 3MM8B 2R4FA 3KLFB 5IYZE 2XLKA 1K0VA 4Q0BB 3T5JA 4BS2A 3M6WA 1N5VA 1N5YB 5KG2A 5KT6A 2Y1RI 1T9XA 3JTNA 2BJ8A 2E1CA 3QUJA 1JNRA 4DQSA 3RAQA 4PQAA 3RRGA 5J2UE 3PX0A 3AE1A 4MMOA 4D3GA 4OX9F 3MI7X 4YTMA 3UNGC 1TV6A 2MMYA 1YBAA 4UUXA 3Q24A 4JUYA 2CWYA 2OPRA 1U1NA 3I56S 3I9ZA 3H4BA 3MMAB 1SKUB 1KQGB 4YB5A 1HS7A 4DX6A 4LF7J 2V7LA 2RDJA 4B17A 1S1TA 4KX6A 2JEIA 1WLXA 1S7IA 3QJJA 1MU2B 1ZH5A 2JWNA 5A0YB 3TNVA 4B3SJ 1VRBA 2Z2ZA 2VA3A 4USTA 1B4SA 2A9UA 5EN1A 1HMVB 3EJMA 1RE1B 4DR1F 1FXRA 1YX2A 2CWKA 2HS4A 3AJ2A 4RW8B 3CJSA 2LFVA 2XSJB 3KKFA 3GV8B 4O4HE 3PU8A 3K5LA 3NCRA 3ZZYA 2IJFA 5AQJB 1VQ9S 4LF6F 4O44B 2G13A 5T7LB 2FC8A 2H54B 5EUHA 4M1PA 1XR5A 4LF9J 2EHOA 3DU5A 4LRDA 2VBYA 2WZIA 2CNLB 3F0NA 2QLXA 3WDOA 3T1AA 3CJKA 3ZNUA 1XEZA 2DGWA 1JWWA 4ECWA 3SDEB 3Q89A 3DLHA 2X9XA 4NLXA 3TLUA 1AUSL 5CH7B 2DD8S 3TYTA 3AD9C 2FJVA 2PA3A 3UFEA 2X1AA 4PYDA 2WRMA 3VAGA 4K50A 4PXEA 3ESLA 3OLAA 4HACB 2WP9A 3AE9A 4CLPA 2FY8A 3K5MA 3QRQA 3FEZA 3AA0B 2F40A 1UZDA 3PJXA 1FCAA 2M70A 4AT1B 3M9MB 3RAMA 4ID5A 2K7KA 3G96A 4DV5F 5CYJA 3CK6A 1NSKL 5KOWA 1REGX 4NYOA 2RKIB 2VU5A 2CLYB 4AUKA 1WG1A 3DRSB 1X9WA 2E5GA 4I4TE 2BVMA 2KKHA 2Y1IA 1IM4A 4N78D 2X0YA 4OHFA 3KFWX 3EZOA 5C3JA 4ECYA 1JNZA 2MBGA 1JIHA 5KFCA 4ZPTR 3PYDA 3CX7B 3ILIA 3JCFA 1Y5LB 1P1TA 5E33A 1CQMA 2QLWA 3PUVF 1KR4A 4G6VB 2A2FX 3EGWB 2EBGA 4CT9A 5EX3A 5B0EA 3CCMS 2WBRA 3ZO7A 4UF0A 3SFDA 3T8OA 1HMVA 3OHBA 3IRXA 1FJGT 4UV9B 1KWMA 4H4MA 2XSAA 4ETZA 2ROGA 3GB0A 3SIPB 3AE6A 5FXXA 4DU8A 2RQKA 5AQOB 4EU0A 2D74B 2V0NA 1FEHA 5J2TE 2DHGA 2Z56B 4QH4A 3ZZUA 5G0RA 1B0TA 4F4KA 2VG5A 1BMQB 1HQ2A 1ZKEA 4RW6A 1S4FA 2L8KA 3NZPA 4DV0T 4QX8B 1Y5NB 5AQNB 4IE4A 4H9RC 1XIQA 3MTKA 1HQUB 5L39A 2OGUA 2V5CA 3NGKA 1Q86T 4DS5A 2WU2A 2ZDPA 4JI0F 2DH9A 1SIWB 3DYAB 1U25A 4QZVB 2BE2B 2XAGB 2OLWA 1N32F 2I6WA 3Q2MA 5IZHA 4C0BA 2DGOA 4YHHJ 2V8HA 4MT1A 2HVIA 3OLBA 2VWAA 3ZMTB 2EHOB 3WAKA 2R2UA 2FLNA 3CMES 3BS9A 1X4CA 4OZNA 2IRYA 1YIJS 5K5MA 3I4PA 3CUNA 4YY3F 3MWBA 1L3VA 4HFDA 2HW3A 1P6TA 3QWUA 4X64F 2BABA 5C24B 1T9VA 3DHXA 2PT0A 4LF1A 1ZA2B 2KN4A 3IBFB 2YK0A 1U2FA 4NXMF 4LF8F 1WKKA 3W64A 3W65A 1K9MT 1LW0A 2AWZA 4QIFA 2MZJA 1NNDA 2EKYA 4UOFA 1R8IA 4TX5A 3F73A 4QH5A 4F0KA 1VIXA 2AYMA 3EICA 1YK9A 2JLGA 3PV0F 3I32A 3QRPA 3RI5A 4FKYA 1RWVB 3KJNB 5LHGB 2OH2A 3OFHA 3I82A 3TA0A 2KJWA 1VCTA 3W9HA 2OPRB 3DGPB 3NRYA 2A6MA 4A5XA 1JLGA 1GTHA 3MPVA 2J9DE 4ELTA 2X68A 4LR9A 3OBVE 2DXFA 1WEZA 1KNZA 3R2DJ 2V8GA 3L7UA 5KG5A 4DCPB 1RT4B 2QSWA 2LXFA 2UUCJ 3AE2A 2XQ7A 4K0KF 2UZAA 2IVFB 4IL9A 2FYXA 1BWVA 2YU2A 4YB7A 2ES0A 4XO0A 3CJKB 1LVKA 1HL6A 4UZBA 2N3OA 5D8HB 3PUGA 1HQUA 3D3BJ 4RUAA 1MMNA 1WHWA 5KFVA 4IH6A 1MMAA 5J1EA 4QU7A 2VB6A 1H2UX 2DNPA 4TNVA 4KFBB 2B43A 4NYZA 1QUUA 2YQ1A 4L74A 1O5JA 3SQOP 5C2CA 4ZCKA 2AJ1A 3MEDB 1WFDA 5C25A 1IUJA 1VQ8S 2M8DB 2GVDB 1KOOA 3E3XA 1JXEA 1ZYQA 3LGMA 3C50A 1Q8LA 2BQRA 5JDQA 3IMQJ 4KMCA 1KONA 4C8OA 1CULA 3M8PA 4HWCA 2OTLS 5ETQA 2BOAA 1UWBB 3UDLA 4CZCA 1SJ3P 2N3LA 3HX9A 3NWGA 3P3DA 1Q4RA 3GIIA 1S0NA 4PNIA 2VG6A 2JJ4D 4TV9E 3RW6A 3EHZA 4DQIA 2LM9A 2ZH2A 5L46A 2CZ9A 4ANDA 5E3PA 3CNQP 1HNIA 4WNKA 1UTAA 3CCES 3KMSA 4DV3F 2FTRA 1MIVA 4RKUC 1S1XA 4ZVHA 4IDZA 3VGSA 4UOHA 1VRTB 3AEEA 1KSPA 3IG1B 3DGVA 3A12A 2CNKB 2VQFF 4DR6F 3ILJA 2IDEA 2B4OA 4IDQA 4KIAA 4EWTA 3C16A 3AA1B 3ENAA 1BHNA 3LDQB 4P2FA 1R8PA 4OV6A 2CJBA 3VVUA 5KFAA 3NG8A 3M65A 3UQ7A 4UT4A 3G6YA 4OI6A 2E66A 4RBUA 3PUSA 3HI2A 9RUBA 3OJSA 2N9DA 2LSIA 3DOKB 4ZOLE 3OL6A 2DR7A 5LOQA 1IBLF 4PK5A 3G87A 3OTOF 2WVDA 3NGRA 4J9PA 2J8SA 3B13A 2YWEA 1NK9A 1NZ8A 5F3TA 5K8MA 1JLCB 2DTJA 4ILCA 2LU2A 2XM1A 1PAEX 4I6YA 4M8LA 3GSDA 2GMJA 4W90B 4EYIB 2YX7A 3IBPA 2CPHA 2EG1A 1X4FA 2HNYB 3Q5DA 2ZNYA 4CIOA 3J81U 3MJXA 1SXLA 2VHGA 3LP0A 1S9EB 1HR0T 3RKOA 4IIJE 4U8YA 5FD1A 4LF5F 3GWCA 5B7WA 4ZEYA 2V7MA 1BC6A 1S5ZA 3DLGA 5HEJA 2DNHA 4DV2F 3BYPA 4DSLA 2QA1A 4J9UE 2AYEA 1DTQA 1WF1A 1SL2A 3C4ZA 4DUYJ 1MMLA 4PK6A 4KY3A 2V4RA 1EKRA 2VD3A 1UP1A 3G4SS 2HIQA 2H5IB 2DGXA 3FSXA 4RO0A 4EMDA 2CXLA 1YTYA 5I42A 3MZKB 1RHQB 3N6NA 3T6JA 3BKTA 1JK9B 4H4KA 2XQYA 3S1TA 3B54A 1E2AA 2AV5A 1R3NA 1M5SA 4OYBA 1VYAA 2YNFB 2CYYA 2VF3A 2BZBA 1Y01A 4F2RA 3H59A 4OK0A 3JXOA 3IG1A 3NGSA 3MR6A 4C90A 2YEVC 2QYGA 4LQ3A 1GXLA 5JXSA 3ZTRA 1PG5B 5MLCV 3P96A 1HD0A 2IRXA 3SYZA 1YJRA 4L75A 3WZ0A 2KZ7B 1QDUB 3VQSA 1YZ6A 1VQPS 3GN5A 3RYLA 2BG9E 2AIRB 1MROA 1WR6A 4PW8A 1U1KA 4IRCA 1IWGA 4CP5A 3RQWA 1J1JA 4B9VA 2HHPA 3UN5A 3VKGA 5FP3A 4M5NA 2M6IA 3I55S 4P73A 3QT7A 1PKUA 1H7CA 2POKA 2HQGA 2V5DA 3LUYA 3R7SB 2C42A 2NSCA 2OPQB 5KTQA 1Y64B 1SL1A 1N36J 3C3LA 2CM0A 2VQEF 5DQVA 5L47A 2E5LF 2VPYB 4HWHA 2IM0A 2N7YA 4DR4J 3LA0A 2AMCB 3CJRA 1PGZA 4ZIVA 2R8IA 2HHWA 2GQQA 2H4YB 2XZEA 4ZI3C 5J1EB 3IFEA 2VURA 2J8AA 3MM5A 2PDAA 3IM8A 1D9FA 4JV2A 1QAJA 1YQHA 1XN9A 2OHDA 4ENOA 3I1AA 4RW7A 4JI6J 5C8YE 4XK8C 2BJ9A 4ZI2C 2UU9J 2OUGA 1N34J 4OJHA 1S1XB 2B4UA 1NSQA 2NR4A 3MPYA 3IAM9 3V4IA 4UQTA 1PO6A 2ZKTA 3IC1A 4FJOA 1OY9A 2KG1A 1QTNB 3UCZP 1RJJA 5C25B 4H4KC 3CX6B 1Q53A 3MGJA 5IM0A 3GA8A 1XWMA 1IBMT 2DK2A 4N76A 2DEIA 2D5UA 4Z90A 3MAAB 2BDEA 2DR8A 4MAKA 3CSKA 1RB0A 4OYXA 1FEWA 4NRUA 2X1BA 4CLKA 2YDQA 1V3ZA 2CQPA 1T94A 2MPUA 4MIWA 2VQEJ 2HRUA 2JNJA 2Q66A 2XLJA 1PILA 1FFSB 2UXDF 4DSKA 5GADU 3NRBA 4O3QA 3UD3P 3KK1A 2KB2A 3MECA 1C1CB 1AFIA 2AD9A 2ZH6A 1Q5YA 1JMTA 2JC1A 4IG0A 1MIYA 1TAUA 5IWAJ 4P09A 5LG3A 3PHTA 1XR6A 2JRKA 5L3GB 1UCNA 1E1HB 4HFCA 4MBQA 5AQLB 1SC4B 3TKLB 2GVDA 2LQ5A 4ZXLA 2C3YA 1KDNA 2HHHF 3C64A 5CJ5A 2FDNA 5GVQA 4ZHRA 2IBOA 2DHSA 1GQEA 4KC5A 2D7SA 2LKGA 1UX5A 3FMBA 3DDKA 3FXDB 2ZH8A 4LVNP 4QIGA 3FZBA 5AJ3J 2E9ZA 3HHDA 3ZC1A 3TAMA 2NPIA 5FVKA 1U48A 1PCAA 2VV5A 1Q8IA 1QE1B 4CYUB 4J5OA 2BJEA 2FJBB 4USVA 1X79A 2XTJP 3KOAA 1NCLA 2LQ8A 1UVKA 4KHPF 5FLXU 3W15B 3GLJA 1OEDC 3W5YA 3DLEB 2HFNA 2BKOA 3G6VA 2E9TA 3I6PA 3WBZA 4UUWA 2B9EA 4ZJOA 1ZP0A 3ZZTA 1QLBA 5AQSB 1Q16B 2YX4A 1M1KT 3QFHA 2UP1A 2HZAA 1BLUA 2VFVA 3RW7A 3AAWB 1QAYA 3O1JA 2W4PA 4YSZA 1T98A 2HFVA 1N34T 5LL6d 2MQQA 3CDUA 5LJMA 2NCKL 2C1EB 1KTQA 3OV7A 4QR2A 3ZFVA 1ZTTA 2J4GA 1RTHB 5KMGP 3JC6C 3R5JB 1AJ3A 4LSLB 3PJAA 1KFSA 2HPJA 2DGVA 2DRDA 4J9NA 2ZH1A 1VQOS 5SZTA 3PRDA 3EGNA 5KFJA 4USIA 1ZM4A 3DOLA 4PCQA 4CRJA 3RYIE 3JTOA 3BGRB 5IOLA 3FZKB 2R8KA 4OYPA 1M5KC 2YKPA 4COFA 3GE9A 4H9SE 1RA7A 1U6FA 2HH7A 3ILLA 2HHQA 1N8RT 2P6TA 1YWXA 1RA6A 2HHXA 3HVAA 4DVDA 3BSNA 1TKTB 3N4WA 2NZCA 2Y1JA 1HNWT 4MYUA 2QTWA 4K4SA 1NB2A 2PIIA 3HO1A 2W7PA 3C6UA 4I1TA 4ED8A 5A8RA 1T95A 2QIFA 2K7JA 3NCQA 3VV2B 3KYLA 1UW4A 5KFUA 2BVZA 4B3MF 2XULA 1SVDA 5T14A 2XEXA 1JJ4A 2XQAA 1KP6A 2F65A 5LM7E 2OA5A 1MMDA 2KWIB 2XY6A 1IXKA 1F5AA 4A8YA 3OR2B 3SWHA 4S0MA 2XS7A 3TJ8A 4NXNJ 3OR1A 2JJ9A 4X62J 5D4NA 1ICEB 4K5SA 3WIVA 5KAKA 3KHHA 3RBZA 3RGLA 3SQGB 2H7OA 2KRRA 4C3KA 4UEMA 1NM2A 4NMXA 3AE5A 1TL5A 3HZEA 4Z2XA 3G9CA 3AXJA 5GMEA 1WWHA 2JQ9A 2EFOA 3ISND 4ZN1A 2Q9QB 5IC6B 2HWTA 3AE4A 4HHHA 3H42A 2P6SA 2NW7A 3PKYA 4G1QB 2XMKA 4PWWA 4ILLA 3N28A 3NZQA 1RCOB 4YQWA 2W24A 3B4DA 2MQ8A 4EOZB 3SEOA 2PO4A 5GAHI 3D6TB 1RP5A 1S6PA 5ETVA 3IN5A 3FC9A 3R6GB 3VR9A 1WC1A 3C15A 1K0TA 1LWEA 2BOPA 1L5UA 2B4PA 2RDIA 4EEYA 5CYQA 3DXBA 4YEAA 1R7IA 5HVGA 3KK2A 2W7AA 4PXCA 3Q22A 1HWUA 2CVEA 3TLTA 1DBDA 3G82B 1M1GA 3HM9A 1PBAA 1XBWA 2M52A 3MF5A 3KNGA 3UPFA 3HHNB 3IP0A 5RUBA 2IFXA 1VK3A 2DHAA 3F44A 2IBKA 1U0HA 1ZPWX 4OYKA 2E5HA 4NLGA 2C5IT 5HANA 4FYWB 1SIZA 4XAKA 4RU9A 2EWHA 2SPCA 2WCXA 2L41A 2BUNA 4ANEA 2BW7A 2FY1A 3GIJA 3I5BA 3UD5A 1ZOYA 3A5XA 2QA4G 3BYRA 1YJ9S 2VDHA 2W62A 1OEDB 3OVSA 3DRXA 3KBTA 2MY7A 4RX6A 3RU0A 1F9FA 2HVDA 2BE7D 4LF4J 1YI2S 1QY7A 2V9KA 4CNYA 2OD4A 5D3GA 1S1TB 1JLEB 1ZZNA 1SQFA 3P49B 2CHOA 1ITPA 2J1DG 3ETMA 2E7WA 1F9EB 2VKHA 2LSYA 1T05B 2DO4A 1UL3A 4U9RA 4LVOP 1OQ6A 1IQZA 2UUCF 1RT1B 5J2MB 3M1VB 3T1HT 2WW8A 3UQSA 1WG5A 2C22A 4WWSA 3CMAS 4LF9T 4I0WA 1SCJB 5LB7B 1YQ3A 4UQGA 4WK3A 4Y00A 3OSNA 1FX2A 3HF5A 3KMQA 1QUVA 3R5CA 3QB5A 3NMAA 4FYDA 3M8PB 1R89A 4IOBA 2ALYB 2MAWA 1X5SA 2ZJRQ 5J2QA 1UETA 2VQFT 5A0YA 1B0VA 3HFKA 1FWPA 5AQMB 4OI0A 3RBEA 2A2DA 2B9XA 2DHXA 2ZHAA 4BBYA 2J0QD 2DNNA 1CVJA 5M2PA 3W66A 2ZD1A 4JBCA 3POTB 4OHWA 3NNAA 5DM6Q 1HTJF 4KFBA 3G8TA 3KXDA 2LA6A 4WU3A 3J7A1 5FMNA 1NK6A 5A2QU 2D9OA 4C97A 3LWLA 4JOUA 2ZWPA 3QK6A 1LWCB 2WMNA 3T6BA 2XB2D 4P2MA 4F3MA 1RWUA 2QN6B 4PUOA 1HNZF 2LM2A 1OPIA 1OWAA 3KHRA 4CH7A 1NJYA 4GO5X 3CJ4A 5FDLB 3MACA 2D9PA 2KXFA 3MCMA 3PJAJ 3EAMA 2C28A 2MGZB 4IE5A 3Q8QB 1JKHB 2VUGA 3TR5A 3AEFA 5CB4E 2MQPA 2GS8A 4N8NA 5FYMA 5JVHQ 4Q2LA 1L3KA 4OHZA 1NB7A 1JLEA 4WBFA 1SJRA 2GZOA 1JXVA 1HIYA 2YKQA 1DURA 3CT9A 4DL6A 4YSYA 4Q8EA 1F2HA 2M88A 2LU1A 3D28A 3EMTA 1M1HA 1XDOA 2M7SA 3SCKE 2JH3A 2RRAA 4NCGB 3MEKA 3VHLA 2I9SA 2DPJA 2NSBA 4J9SA 3LGNA 1HBUB 2ZJQQ 1URNA 1BQMB 4ERRA 1URRA 4EUVA 4ZHRB 3OJAA 4TYAA 3R5GA 3I0OA 2WSFC 1TKZA 5L3CB 2ZH3A 1RBOB 5CD4A 1VQ7S 3MAQA 2CLYC 5HMZA 3W3SA 3PW2A 5D4LA 4OZJA 2QV6A 3O2IA 3Q8PB 3ET6A 1VRUA 5FL1A 2WVBA 3UT5E 5HATA 4DBRA 4NZ0A 3CW2C 2N7CA 1DLOA 1D8ZA 4IYQA 4PQUB 4OJ1A 2L9WA 4ED0A 2XMAA 3SS1A 3ZYMA 3O6QA 2DNRA 2MZ1A 4NLYA 1TKXA 3EDQB 2ZZMA 2V4JA 3DI6A 3RC3A 2KFNA 4NEYA 4QXCB 2ODVA 2RRNA 3JS9A 5HXCA 1US7B 1U4BA 4F6RC 3QATA 1NAFA 3C4XA 2UXCT 4K7QA 2BRLA 2IAKA 4HI2A 3CCWA 2XYHB 1LXJA 5A8RB 1L3UA 3DRSA 2PA8D 3ZXWA 1GFWB 3FZLB 3QB5K 1Y3KA 3UWTA 4YP3A 4EEBA 3FZ2A 3N9MA 3PUYF 4TKTA 3IR7B 1FI4A 1WYBA 2Z57B 3DJBA 5HQLA 3BGUA 2LXUA 3M8RA 3UN2A 1JJHA 2EFGA 2DR5A 3Q9DA 4WYLA 3HKBE 3NCPA 3KJVA 3UDCA 2Q43A 3T1YF 3HZGA 2Y0BB 2RS8A 3CXCR 3OJUA 5KFHA 5F3JA 2XQ5A 3F41A 1P9QC 3ZSTA 3IEEA 3H20A 3MMJA 3HHLA 1RT7B 1GT8A 3CX8B 3LH2S 1GNKA 4KAIA 2IC3B 1FJGJ 1VK8A 3N2GE 4X4PA 2L3LA 4K4UA 1U26A 3CD6S 2NXEA 1RTJA 4YY3T 2HVHA 5G4DA 4GKJT 4L6V3 2VA2A 2XCPA 3NL0A 1OMSA 1J5ET 2GO9A 3K89A 3RX6A 2AQ4A 4PZVA 4QOTA 2BBJA 2UUWA 4HEAA 4QJVA 5LCYA 1S1WB 4C8KA 4M5DA 1YBUA 2XS2A 2E1MC 4F7VA 4N77A 2UXDT 2OPSA 4RW8A 3ZPOA 2RILA 3J80Y 4J9QA 2HS0A 1XNRT 2GX8A 5H9EJ 2FBWA 5F5WA 3UNYA 5AQIB 1HARA 3H0PA 5K8OA 1NRKA 4J7CA 3ANWA 1E6YB 2C2OB 2R7WA 3SCJE 3FSYA 3R84B 3PVXA 2XJ7A 3CD7A 1S1UB 3MPWA 5LBQB 5FKYA 2EHOC 3C51A 1N33T 5MAOA 5DABA 1I94T 1JQGA 3OHAA 1L0VA 3T9NA 3EUHA 2ASDA 3W63A 2MYSA 1KLMA 1U6BA 2Z58B 3C66A 4ZIWA 2U2FA 1OPZA 1A9NB 2LOSA 2AXDS 3FBFA 2OTJS 5JUMA 4I0UA 2MZQA 5BMVE 2DCLA 3BPSP 3OSPA 3FHNA 1FEEA 4NLRA 2VZ9A 4LT6A 5J2NA 4LIWA 3KTQA 1S4EA 1GX5A 1NUEA 4ID5B 3FBZA 2W61A 4LSNA 3G6XA 4R8UB 1JLBA 2GHVC 3QSIA 2CCQA 1S48A 3OUYB 4NLTA 1NPKA 4ZVEA 4WKRA 1X9MA 4GYSA 4UY8T 2ZOMA 4C8LA 3TRGA 2RH3A 3P45B 3W60A 1GAOA 3LTOA 4CTAA 1U1QA 5FDLA 3G06A 2HRTA 1GMWD 4G2AA 3HDSA 3ZLIA 1MN7A 4CXXA 4TWHA 3FJ2A 1HR0J 3DNCA 3U1MA 4ETXA 4K4VA 2Y8WA 2HMIB 3CCQS 3D6FB 4DXLA 2PGCA 3J7Z5 5LMNJ 3FNNA 4IG3B 5EK2A 2XY8B 3DDNA 1RTIA 2KNDA 4LQ9A 2QO3A 1KD1T 4X65J 4B3ST 1L3SA 5ABFB 2AF6A 3FVYA 4LRCA 5BYRA 2QT7A 5E7OB 4L0RA 1KKHA 4LSNB 2CWXA 4U74A 1QLNA 2KG0A 1SPBP 4NXNF 4OZ5A 1MWZA 4GYRA 2AEJA 2IA6A 4YLHA 4WFZA 3FXEB 1XTZA 2MKYA 1HNWF 4CM0A 1GH8A 3HCXA 4L72B 3MR7A 4FP9A 1NKEA 4FBUA 2W8LA 1BR0A 4DZ6A 3N9QA 5BYSA 2R42A 5KXJA 5KG7A 3O9XA 1U8SA 2WOMB 1TL3A 2XNRA 2ABYA 2YPYA 8RUCA 1F6TA 1HBMA 1HBOB 3R3TA 1RT1A 3N2KE 3VU7H 3LW5C 3Q8SB 1F3FA 2Z2MA 2HBQB 3PIOQ 2E5IA 1E6VB 1WDDA 4V19X 2YINA 1RBLA 3U78A 1M5HA 3GFXA 1W7WA 4JI5J 4A8KA 3G82A 3ZJ2A 4TXSA 2H48B 1IBLJ 4ZVTB 3GYXB 4DWIA 1HQEA 4DR2J 4M5HA 2CVIA 2K24A 3ZMZB 2JZ5A 4K59A 2B6AA 1PIEA 2FLOA 1R6YA 5K8NA 5LBMA 2ZM2A 4FS1A 5HXHA 3EVWA 4Q44A 4WE1B 1CULB 3VAFA 4BLGA 2MQOA 3HJVA 4CQIA 3P4PA 3BQ1A 4P9SA 3MD1A 1NJIT 2RQMA 1UJ6A 3JAMU 4RNMA 4FVMA 4HE8A 4LF4F 4B3RT 1XQIA 5J2PB 2CG4A 1AFJA 3KLHB 2UUBT 1Q81T 3POTA 3ONQA 3AD7C 2XGQA 4WIQA 3B4MA 4ZCMA 5L9XA 4EAHA 4UOCA 4IG3A 4I6AA 4WKYA 5L3EB 2DI4A 1KHVA 3R5DA 4IFYB 4B3TJ 5CA5A 4ZS6A 3IRXB 3QIDA 1UVNA 1HYSA 5L1IA 2LLZA 1Y7PA 1JJ2R 4ED2A 3ULHA 1VJWA 3HR0A 3NMRA 1JLAA 5JR9B 1CUNA 5F9LA 3GJRB 4WXOA 4O3NA 1YLXA 2CPDA 4EBEA 4Q5VA 2OMLA 4H4OA 3VAIA 5L38A 1QJHA 2ILZA 4NX9A 3DHWC 2YNHA 1QAXA 1M5PC 3AEGA 2LVWA 3PO4A 2WONB 1RT3A 4JUZA 3CD0A 5HO4A 4PG8A 3ZTPA 1KOHA 3PYFA 4J91A 3W5XA 4PAAA 2LECA 4U31A 2HHHJ 4TWFA 1RAOA 2MOZA 3CCVS 3M2VA 3UQ4A 3JSYA 2CHNA 5E3RA 1HPZB 3AQOA 2D3OR 2HMIA 4P2XA 2OPPB 2IC3A 4WFBQ 1U02A 3G2XA 2VK9A 4KHPT 1K1QA 4K4TA 1YKWA 4KPYA 4JI7F 3SXLA 2KZMA 5HQ8A 2K5BB 3ZMVB 5IT9U 4I69A 2BXJA 4O0NA 4JP8A 3HP6A 1G8XA 5AT1B 4DV4J 5CGMA 2QVAA 1HHSA 1N52B 5H1SV 3RB6A 2Y0SD 2FZCB 1TKDA 3BDPA 5JVGQ 2J9DA 2D1CA 4W92B 1RT6A 3D0TA 3J7Yq 2DNGA 4ES1A 4QYZK 2IVMA 4AXPA 4RWWA 3NOGA 2PEHA 4ZPVR 1VQKS 2YWHA 1SUQA 4KHRA 4YR0A 1WOOA 5F9NA 5D4OA 1TUGB 2V1DB 4IE7A 2WB1D 1U1MA 4I2PB 4EZ6A 4DHVA 1UA1A 4J90A 4HFBA 2QSFA 2H65B 3H7HB 4HT7A 1AB8A 2K1RB 2E5LJ 1U7LA 1VIOA 4M5JA 2DGQA 2ZFHA 3H40A 3PM9A 5AQKB 4ES2A 5E41A 1NJWA 2YN6A 4O3RA 2KJVA 4P10A 2XBPA 2H5EA 1D1BA
chains in the Genus database with same CATH topology
2IIUA 1T72A 1T8BA 1VCTA 3JXOA 4J90A 2BKNA 2I0MA 4YS2A 2AEMA 1SUMB 4L74A 4L73A 4J7CA 4XTTA 3L39A 4Q25A 2OLTA 2BKOA 2AEFA 2BKPA 4J9VA 3RBXA 4L76A 3RBZA 4RO0A 1LNQA 4GVLA 2OGUA 4L75A 3KXDA 3L4BC 4J9UE 2AEJA 4J91A 4EI2A 1XWMA 2FY8A 4G65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IIU A;  1T72 A;  1T8B A;  1VCT A;  3JXO A;  4J90 A;  2BKN A;  2I0M A;  4YS2 A;  2AEM A;  1SUM B;  4L74 A;  4L73 A;  4J7C A;  4XTT A;  3L39 A;  4Q25 A;  2OLT A;  2BKO A;  2AEF A;  2BKP A;  4J9V A;  3RBX A;  4L76 A;  3RBZ A;  4RO0 A;  1LNQ A;  4GVL A;  2OGU A;  4L75 A;  3KXD A;  3L4B C;  4J9U E;  2AEJ A;  4J91 A;  4EI2 A;  1XWM A;  2FY8 A;  4G65 A; 
#chains in the Genus database with same CATH topology
 1RAH B;  4IDK A;  2HGL A;  3BQL A;  4J9R A;  4V19 J;  4YJ2