2BKOA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hypothetical protein
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkoA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkoA02
4L74A 4J90A 4EI2A 4Q25A 3L39A 2OLTA 4J7CA 3L4BC 3RBXA 2BKOA 2AEJA 2AEFA 2OGUA 4J9VA 1T72A 4G65A 2BKNA 4L76A 2IIUA 4GVLA 4RO0A 3JXOA 3KXDA 4YS2A 1SUMB 4J91A 4L75A 2AEMA 1LNQA 4XTTA 2I0MA 1T8BA 3RBZA 2FY8A 2BKPA 1XWMA 4L73A 4J9UE 1VCTA
chains in the Genus database with same CATH superfamily
3OL7A 4LF7T 2UUBJ 4UY85 3W60A 3EVMA 2BKOA 4B3OB 1KOHA 4DFMA 3IMQJ 2Z8QA 2WP9A 1U6ZA 2LEPA 3RR7A 3AJ1A 1OYDA 4HT5A 1RHJB 1NH8A 3PUVF 1RWKB 1SL0A 4ECUA 1GMVA 3QFWA 1KONA 3C14A 3UE2A 1RWOB 3GN5A 2HVHA 2RP4A 1PCAA 4JEHB 2BRKA 3KJFB 3CCMS 2DGXA 2UVVA 3G6ES 4RBTA 5LBMA 4NCAA 4OMFG 2DGUA 4ES3A 3L95X 1MU2A 1NUEA 3PUWF 3UUXB 1R89A 1UZHA 3GMGA 3GFZA 3WX8A 1RHUB 1JLCB 2XNRA 5J0ZA 4OV6A 4IREA 2QTWA 3KLEB 2XM3A 3O44A 2VFTA 5IC6B 4CT8A 1CVJA 1BQMA 4PUOB 5JDLA 2VC1A 2WU2A 5JTGA 3I0SA 3C4WA 1Y00A 1S57A 2BVLA 1RT7A 1BMQB 4M5DA 2KG1A 5D4OA 4CO2A 1JJHA 3OSNA 1HMVA 4O44B 4C8ZA 4OYMA 3OHBA 1ZPWX 4LRCA 3GCXP 2D9PA 3V2UC 4ZDNA 4WIIA 4ECYA 4O3SA 2DI4A 4DUYT 2CNOB 2ASLA 2KXHA 4EBEA 1NHUA 5F3TA 4FYDA 3DLEB 4DR7F 3KLVA 5EX0A 3SCIE 1MMAA 3T6JA 2MQPA 3OJUA 2XSBA 4DQQA 3UU6A 3CDBA 4WTYA 3UCGA 2DY1A 2AJ2A 1U09A 5L3DB 2BJEA 2VKJA 4BCAA 3AXJA 1VJWA 4J9SA 1PJ6A 2KFYA 1TL4A 3F41A 3IBCB 3UFEA 5KFRA 2HHVA 2IFXA 3AQOA 2UXBF 2VA3A 2AGQA 3EVYA 4ZIVA 4JV5F 1HNWT 3P6YC 3R27A 2CJKA 4U7UK 2K9AA 4RW7B 3AOCA 1S97A 2ATCB 4RU9A 4KY3A 3OFEA 3W15B 1RCXB 1IQZA 3DM2A 2CXEA 1YIJS 1NJYA 2VKOA 3Q5EA 3LQVA 2B4UA 3BYPA 4LF6J 1UWBB 4K4UA 4CM0A 1Q86T 1NKCA 2LEAA 3MR6A 1W0AA 2JRSA 1R0BG 4EAHA 1OY8A 2HRUA 2PA8D 1XNRF 3UUNA 4Q25A 4RX6A 6FDRA 1G1XA 2NUHA 3IAS9 4DV2T 4PWDA 1TFWA 3KXDA 2G13A 3GQCA 2E7WA 2C3YA 3PVXA 4DEZA 3C66A 1LKXA 1C0TB 4USWA 4DV0F 3RKOA 4COFA 4X65T 1WI8A 4YSZA 2GMHA 1DLOA 1NK4A 5HEOA 2ZBCA 2J0QD 2XQ9A 3VTIA 2ALZA 9RUBA 1Z0PA 4IYQA 2M0GB 2OPRB 1WTFA 5H9FJ 3T9ZA 4WNKA 3AB4B 3ZSSA 5LGTB 1FNMA 2RQ4A 2YWEA 3KV6A 5KG2A 1HW8A 2ODUA 3LP0A 1VQNS 4U8YA 1Q53A 2H5EA 1VC5A 3CVRA 1EAYC 3K57A 2L9WA 2FHMA 7FD1A 1FNOA 1Q82T 3UO0A 1R8IA 3T1HF 3OJAA 4IH5A 2E9XB 2EFGA 3CJKA 1DTQA 5J2PB 2ZZMA 3ENWA 3FUYA 2LEBA 5GVQA 1QLNA 1IBLT 1VK3A 3JQMA 4HHHA 1JXVA 3PR5B 3R5JB 4WK1A 4Z91A 5HEGA 3VVTA 2K5BB 1BR1A 2YNHB 1OQ6A 5IWAJ 1D0ZA 1KHWA 2HAIA 1SH0A 2HMIB 3MXZA 4UV8B 4WZXA 3QATA 3A13A 1VBYA 1K44A 4TQRA 3P4RA 4ED8A 1S1XB 4DIDB 4ZI3C 4E7SA 1GMUA 2UUBF 4Q43A 1KTQA 3Q2TC 4UF0B 2IJNA 3EPIA 3KG4A 4RL1A 4X64J 1H7CA 3GYNA 4YB1P 4JYAT 4ES1A 2DGOA 5ETPA 5BR8J 4NA1A 3BQ0A 1PKUA 3H2UB 3MZKB 3MM8B 5HQ8A 1EZZB 4Q7AA 3VZHA 2ZC4A 4KKOA 5F8MA 1GQEA 3LBXB 2CPTA 5CABA 5KMGP 2UU9T 3CO9A 4DV3J 2MKKA 5LYJE 2LRLA 4DQPA 1MW7A 3IFEA 1TQLA 4M63A 4K4XA 3RAMA 2QRRA 4TY9A 4K4YA 5KFTA 1NK0A 1GXUA 2W7AA 4KUMB 1XEZA 4WFYA 1UUSA 3RIUA 3W5XA 3ZZYA 5GAEU 1SC4B 1SVDA 4PG4A 3OT9A 1F2GA 3LGHA 1HL6A 1P6TA 1DAXA 3PTWA 3UR3C 2EBGA 3MXHP 5DQIA 2VBYA 5FJ4A 1TMMA 1IKWB 4WYWA 1I5OB 2MGZB 2IYGA 3MGJA 4U74A 1BWVA 3CC2S 3L7PA 4C7QA 4A8SA 4IDOA 3G86A 2E7VA 4DR1T 3U02A 2OHDA 5HROA 1UZDA 1VDHA 5LMNT 1CJUB 4ZA1A 4H4OB 4ZIWA 4ANJA 2BX6A 4E2FB 2WAQD 2ES0A 2M3DA 5LB7B 1LWFB 3M6UA 1WLXA 3PCOB 4KGMA 3RRWA 4WU3A 3J7YU 1WJ9A 4HACB 4HTIA 1Q5YA 4ECXA 5E41A 1U2CA 3OUYB 4UVBB 4I64A 3Q5WA 3B6BA 2ZH5A 2CZ9A 5JVHQ 4C6AA 1S7HA 2W8KA 3QSIA 2F40A 2Z2ZA 4CP5A 2BMBA 5DO2A 1HBOA 2CPHA 4RW8A 2RDJA 4P72A 3JAFA 1WI6A 1YQ4A 4P52A 2BE2A 3PYEA 3W9HA 4LF6F 2BA9A 3EICA 2DR9A 1WSRA 3T1YJ 4TLQA 4PKDB 5CHCB 2OJ3A 1FD2A 3DOKB 3W2WA 2OGUA 1JLAB 4JI2T 3CXCR 5KFWA 3IG1B 2DGVA 4I2PB 4A8YA 5H6RB 3V81B 1U1KA 3MAAB 5KFYA 2BM1A 3KDOA 3C16A 2IMLA 2BG9C 3ET6A 4OX6A 2XTLA 3ZYLA 3ZZPA 1R8HA 5DDQC 3L09A 2IM3A 3T5LA 2BXJA 2R2RA 5HLFA 5ABGA 2PEHA 3HP6A 3GJTB 3V4IB 2FTRA 3B13A 2MQLA 1QAJA 4BC7A 2LFVA 1FEWA 1VC0A 2ZM6T 3DCAA 2ABYA 3KJNB 4LVOP 5AQHB 3NWRA 2Z57B 3GJRB 2MLXA 3LFMA 2XTJP 2E5LJ 4EZHA 3PUQA 1HS7A 4HI1A 4JI4T 4RNHA 4OZLA 1RI7A 2ZH2A 1RTHA 1K1SA 2C2MB 1RA7A 4RWWA 2LQJA 4LF8J 4UZCA 4XAXB 1U7LA 2WVCA 2HFZA 1U0HB 4PAAA 4OZ5A 4CIOA 2QA1A 1VQYA 3ENQA 2W1BA 3DRXA 3SEOA 2JZ5A 1FJ7A 4EXTA 4NZ0A 2XQ4A 5D0RA 2V5CA 1T9YA 4JP8A 5BYRA 1WYBA 2DPIA 2ADCA 3WC0A 3CJ3A 3R5GA 3LG7A 1OWXA 4U8VA 5JR9C 1RXOB 3WBZA 1SQEA 1CBKA 1YBUA 1LWCA 4TN2A 5IWAF 4NLWA 2C3OA 3NS5A 3SDEA 4FNIA 2GVZA 1VCSA 4KPYA 4OYAA 1EP4B 1UEUA 5HEUA 3ZC1A 1OEDA 4AE5A 1SJFA 3G9CA 1Y64B 2H7OA 4IDNA 1R31A 2N7YA 3J80U 2CMRA 4NRTA 5E33A 4RWXA 4C8LA 1US7B 3R1LA 1HHQA 2NZCA 2WONA 4X64F 4ZMMA 1VISA 1Q78A 2WTFA 3AEAA 1UURA 3RH3A 3HZEA 5BR8F 2QLWA 4J9MA 5GMDA 1H2UX 3NOCA 5HWYA 3CE8A 3EGNA 5KFLA 4HH0A 3ANWB 3OBVE 4F4KA 4C8OA 1YRXA 4DV3F 2MLZA 2R7UA 2NYIA 1TUWA 1YI2S 4ZI2C 1WSVA 3WC2A 2ZBQA 5B0AA 5FD1A 1HQEA 3P4WA 3PTRB 3AA7B 5LL6d 2AE9A 2Z30B 3NBPB 3TP2A 1ZZFA 2APOA 5L38A 2M5YA 1AUDA 2QG9B 2YK0A 2MAWA 2R6GF 4JI8J 4KHRA 4GVBB 3VWSA 3RTVA 1S0NA 5CYQB 4P0BA 4JV2A 3H5SA 2QYGA 3SMZA 4QWNB 2AYGA 4ELUA 3IR7B 3GZ7A 4UT4A 2CADA 5J2QA 5AQFB 3CJTA 2C2OB 2AW0A 2PI4A 2OPQB 2XYPB 2KVQE 2B9XA 2AF6A 3BGRB 5ABFB 2E5VA 3JAEA 2J47A 5HMXA 1BR4A 3QOFA 4UVAB 4DL0C 3VU7H 5I3UA 4EUVA 2FUG9 1D3WA 2V4JA 3AD7C 4OJGA 5KFZA 3MMAA 1RT2A 1S6UA 2X9HA 1BQNA 3HFKA 4HKAA 4B3MJ 4HFVA 3G4SS 1VLOA 1KBRA 3SQGA 4N8OA 2WSEC 2ACMA 5EWGA 1ZETA 3KJQB 3E2EA 1Y5NB 3OTOT 2V1DB 3KNGA 5AXMA 1NSAA 1RKIA 1LVKA 4RNMA 3M2UB 4ECRA 4DZ6A 3US5A 3B54A 3VR9A 4LR8A 3QGHA 1ZTTA 3AFGA 5FMNA 1FXDA 4MJKA 3UDVA 1H6KX 3VAJA 5AE1A 1MWZA 2ASDA 2WM9A 4R0JA 2EPIA 2V5HG 3B82A 2A3JA 3MI7X 1R8PA 2VKRA 1ZZNA 4CI0B 4ZS3A 3I9V9 4XDDA 3T1YF 2WB1D 1WR0A 1HBMB 5F41A 5FXZA 2RRAA 2L41A 1PAEX 2DISA 2IY5B 2KDOA 2DJWA 2KXNB 4RUCA 1T3NA 3K0JA 1D0XA 4O3NA 4GO5X 3RB0A 2G2OA 2E29A 3LA0A 2UXBT 5DZ6A 4ERDA 3TEGA 2CJQA 3PRDA 1URNA 1XMBA 4TU8A 3OFFA 2R7WA 2KINB 2WMNA 1YJWS 2VWAA 2HBZB 3MR7A 4Y2AA 3E0ZA 1M5OC 3PO4A 4OI0A 3BV8A 1TELA 2YTCA 3FNNA 3DLJA 3QFHA 1WEZA 1RBAA 2YNFB 1JKHB 3UNGC 5TAOA 1FDNA 3PRBA 3TZZA 2W4DA 2X3DA 2E5LF 1FDBA 1ZM3A 1XNRT 2K3WA 4L3NA 2FJWA 2P9GA 1DU2A 5BMVE 3F73A 4LF8F 2WSSV 2F63A 1U8WA 4AL7A 4HDHA 4IOCQ 4EBCA 2BR0A 2J4GA 3ZO7A 4USMA 3MPWA 3VR1A 4N41A 1JLCA 2RS2A 4AT1B 3UUBA 2NR4A 3RBDA 4CLTA 3K5MA 4I68A 1L3TA 3KLEA 4DBQA 4EO6A 4NCBA 2JOQA 4OYBA 3SQOP 4MHCA 4OI4A 1BC6A 3O4XE 4PUOA 5AQNB 3KMSA 1RLDA 5JVDE 3W8PA 4PPDA 2E7XA 3PX6A 3DLKA 4ZCKA 2B6AB 1XMOJ 5LMUJ 4O44A 4KHZF 2DGQA 2HZCA 3CIRA 2JIWA 2W4CA 1PIEA 4GMKA 1GX5A 1RHMB 4C3LA 4X5TA 5LOVE 2FZCB 2P2CB 4UOFA 1RTZA 4KAIA 3P7IA 4OFZA 2DNPA 1SB6A 4WIQA 5A8WA 3DLEA 3R97A 4Q45A 4OJ3A 3QGGA 2NLWA 4WE1B 5DM6Q 3GIJA 2VQFT 2WVBA 3JC6D 3UU3A 1CS4B 4P2MA 3NL0A 3C98B 1NKEA 5ETTA 4V19X 1QAYA 3VHLA 3KFWX 2BYCA 3BPDA 3OQ2A 2V2KA 3OFGA 1Y5IB 2KM8B 1V3SA 4DS4A 4PCQA 4N8NA 4ZPBA 3NKYA 2QGFB 5F8NA 5J2UE 4CH0S 2UUBT 4TLRA 1W9RA 1B7YB 1HLWA 3PY8A 1Q8IA 3UWTA 2ZBPA 5KFPA 2DYAA 2ODVA 2QVAA 3UCUP 4C8NA 4C90A 3RRKA 3MCSA 4MK8A 2ZE2B 2B9WA 3ZYKA 2YOEA 2V50A 1VOMA 2B4VA 4JI8F 3BN4A 4I7FB 8ATCB 4ILLA 2UXDJ 1MIYA 2KMFA 3M7VA 3DI6A 1AA1B 4JUZA 3MPYA 2IUBA 1WOOA 2VQEJ 2BQ3A 3CCJS 1TL7A 4WKYA 3DLGB 1TV6A 4X20E 4YDDB 5HQLA 2HNDB 2XO6A 1YHQS 1SCJB 4AQGA 2BEFA 4C11A 3KHGA 4QJVA 3TQEA 2R7RA 2G0JA 3W2VB 2OH2A 1Y3JA 5B09A 3EDRB 3I0RA 2MKSA 1HNZJ 5A8KB 2V4QA 4B3MF 2JVOA 4HYKA 2ZVIA 2SXLA 2WY2A 2HNYA 1U1MA 3S6EA 1E6YB 4QKNA 2OPRA 2U1AA 2W01A 1WDTA 2MMYA 1NPPA 4TXSA 3I5BA 2ZD1B 2ZWOA 1N33J 3OTEA 1TKTA 2Q9QA 4NLUA 3BGOP 1PYOB 4CXYA 1IQTA 1UL3A 2CQDA 2MXYA 4CWBA 1FE0A 4NZ7A 2E9XA 4OYPA 2EG2A 3RLFF 3CUNA 4G1QB 4O3QA 4B02A 1S4FA 1YITS 2HHQA 2IVFB 3S01A 3ZCJA 3RRCA 4GC6A 3IA0A 3PG9A 1HBNA 2X7IA 1RDRA 4OV1A 4M5GA 2BE9B 1HPZB 4NASA 3FQKA 4RUBA 1D9AA 1U24A 1X4EA 5HAOA 4KIAA 1SJ1A 1RAIB 4DUZT 2V8SV 3ZKRA 2RVJA 3GSDA 2BBJA 1I1GA 4DF8A 5BXIA 3OXFA 1V6HA 4DG1B 4BAYB 3HT0A 3UVJB 1VRUA 1U47A 1VHIA 3FKBA 2CJ9A 4K2JA 5M2PA 4PYDA 2KO1A 5GMEA 4LMKA 1EQ0A 3POTB 1OWAA 4UW2A 1S1XA 3GG0A 4QW9A 5L4HA 4V19J 3CD0A 5T41A 2VVSA 5E0OA 4H4KC 4UF0A 1FIOA 5AQIB 5IT0A 4PR6A 4ZPDA 5HMYA 2A6MA 2HGMA 1HFEL 3L4BC 1SBRA 4PG7A 4Q5VA 1YJTA 2PIIA 3OR2B 5KT2A 2RAQA 2I2YA 1YVFA 1U25A 3OL6A 3J80Y 3TA1A 3GYXB 3U7JA 3R3TA 4PG8A 4ECVA 2H89A 2D1CA 3HHKA 3PDNA 3AJ2A 2C2KB 4I69A 2XZWA 1ZAWA 2ALYB 1R6VA 3LBXA 1WC4A 4LIRA 3FQLA 2VFSA 2DIUA 4I0UA 2QFJA 1U8SA 2DWGA 4JBWF 1A6LA 4R0EA 4DR5T 3SCLE 3N28A 2KG0A 4DX6A 1A7GE 3RBXA 2Y0BB 3B5MA 3EGWB 4U31A 2Y3YA 1NLKL 4Z90A 3CCTA 2ZHOA 2JEGA 1GNKA 2UUCT 2DRAA 1WACA 2YQ0A 2FB0A 2BOAA 2DD8S 2R3VA 2W2QP 4XPEA 4J7CA 3VCDA 2WDQA 4BS2A 1QM9A 3C19A 1XMOF 5LMUF 4AKLA 4ZPVR 1KR4A 1SXLA 4ISTA 4AL5A 2VODA 2YWGA 1S99A 2R7QA 4EZ9A 1RQ0A 2E5HA 3M9NB 2WW8A 1MG7A 5LGUB 1KWMA 4O0NA 2WSFC 5B0FA 5KFFA 4JI1J 3L9ZA 4ZP9A 5HBMA 1CJUA 4H4OA 2QRXA 3NNHA 4OYWA 3NRYA 1FERA 3H3AA 4C0BA 4F26A 2IRUA 4QQBA 2Z2YB 4L75A 1TL5A 8AT1B 2E1AA 1TUVA 2RU3A 2GO8A 4PXCA 5F8JA 1TK5A 5IWAT 1SHZC 3MKDA 3MR2A 2QMUB 3CD7A 2V5DA 5M2RA 4HACA 5D0GA 4GYSA 4QPTA 3V6DA 1KEYA 1Q0NA 3OUYA 1G7CB 1RT1A 3V6HA 4ZVSB 3DMJB 2W9BB 3MMCA 3C6UB 4ZP8A 2GIQA 5DG9A 2YU2A 1HWKA 2IC3A 4NLOA 1LV5A 4IE5A 3GWHA 1GX6A 2V34A 5HO4A 1AROP 5CYMA 4WCEQ 4X64T 3M9OB 4IG3A 2LQBA 1FKPB 4QXCB 2RKIB 3T19A 3LANA 3F56A 4IDPA 1U4QA 3KG0A 2UXDF 2CHOA 1RWXB 3IG1A 2VQEF 3SXLA 1QE1B 1UEVA 2GZOA 4XDCA 4X62J 1FEHA 2YDRA 2X68A 1X0PA 4DJBA 1LFWA 4ERRA 1NWMX 1YLXA 3AE6A 2F9DA 5K14B 1UWAA 4PXDA 3ZC4A 1VRQC 2DITA 1JMTA 2LP4A 1IWAA 3N9MA 1HNZF 2QFIA 2RA1A 4PK5A 5L3GB 3W64A 4KP3C 4MLKA 3DDKA 1S9EA 4RNNA 3K5PA 4C3KA 2Q9QD 1H7WA 5KOWA 2DEJA 2DNLA 2X0LB 1C4AA 2YINA 4O4LE 2HS3A 1N33F 3KG1A 1IXKA 4C48A 2IHR1 2E9XD 4J37A 5DABA 4USVA 2DNMA 1S35A 1L3SA 3RW6A 1NK9A 4OYOA 1R3NA 1KNPA 4A8FA 3N79A 4C0OC 3M6VA 2FLLA 2XC9A 2IYIA 4RO0A 2XLJA 2XLIA 3TO8A 4JEUB 2B9YA 3VF0B 3UD4P 3TA0A 4K4VA 4HWFA 5L9NA 4O3OA 5JDHA 1RU2A 2VG7A 4H9RC 4HFBA 5GADI 1H38A 1REVB 4B9NA 4ZVGA 5HXEA 1FMWA 3RIUC 2RB7A 1NSPA 4TKTA 2BBEA 4CDIA 1N5QA 2GJ2A 5FNVE 4DV7T 2HLUA 2AZ3A 3MD3A 2Z2MA 3D0TA 4CZCA 5K9FA 1J5WA 1UEKA 2M52A 2M8HA 3BB5A 2JFDA 1RT3B 3TLTA 4HE8A 1IWGA 1TP7A 5CYJA 2ZMAA 3HHLC 2BW2A 3M8QB 4WFBQ 1VS3A 2V6YA 4B17A 2QL9B 5L3FB 4D3GA 4RBVA 1S1VB 2EFQA 3QK6A 2LA6A 2W7PA 4X84A 3CD5A 5CJ5A 2I59A 3FSXA 3IGNA 1N4LA 1FX2A 1CC8A 1QVFR 5HXCA 1T95A 4NPPA 4O4GB 4DPXA 2FZGB 3KUHA 1I3OB 3H3MA 3PUZF 3CJ5A 4LBIA 1IVZA 2IVMA 3ANWA 4MT1A 4C2MA 5A76A 1PBAA 4FKYA 2FJEA 2FLOA 1KF6A 3RQUA 2YKMA 3RYCE 3ENVA 2JNJA 1KQSR 2PEBA 1F0XA 2E5IA 2K3IA 3MEGA 3RYLA 3W5ZA 3KJVB 4OZ0A 1FTCA 2ACYA 3NBPA 4DPYA 2R42A 4TVAB 5D4NA 2HFUA 3BSAA 3S1TA 3W61A 4CZZB 2Z56B 2XI3A 4X1YE 1K47A 5T7LB 2BS4A 2F5GA 4WP8A 4CLWA 4TNWA 1CJVB 1XK8A 4LFCJ 3DJBA 3BGRA 5ABFA 3QLHB 1ZV4X 1LXJA 4CI2B 2XQYA 4HKQA 2Y6XA 5L4EA 1JNZA 3W9IA 3W5YA 4XTTA 1OYEA 3PUYF 3BYRA 4GKJJ 1GK8A 3N9LA 4JI1F 4NZ6A 4ZOSA 1D1AA 1X9SA 3VVUA 4KGXB 2M2BA 2ZOFA 3AOBA 5ETOA 4QIVA 5D8HB 3R8YA 2VOOA 3D0HE 4NIQA 1FRKA 2UV8G 1HHSA 1URRA 3RR8A 1N5YA 1GAOA 2KH9A 4Q8FA 4DLEA 4ZOLE 4YR3A 3BGLA 1ZP0A 5E5NA 1AJ3A 1X0FA 1HF8A 5D0EA 2W4XA 2X9WA 3ZJ2A 3KK1B 3ILJA 1H0HB 3ILOA 1MSWD 1QY7A 5ADZA 5A0YB 1RWVB 4NUUA 3WQPA 2PTFA 1JLFA 3TZWA 1T11A 2YKPA 2MDAA 3PUAA 1IZNB 3GFXA 2ZLYA 2EVZA 5HMWA 4ZHRA 1OPZA 4DL5A 3FZBA 1FXRA 3NG8A 3GMIA 2RH3A 2G4BA 4FXWA 4X62F 4HL9A 2CNNB 4DQIA 4O8SA 1J1JA 2KYXA 4K4WA 1VRTA 2HFVA 1TU0B 1CJTA 1J5OB 2EK6A 3R5BA 4JI6T 4BWJA 1FI4A 1NAFA 2M7SA 1OEDC 3CX8B 2XHCA 1SI9A 3MM7B 2GIFA 3HJFA 4Y34A 2HVIA 2LHRA 1X5PA 2HW3A 1S1WB 1JNRA 1JXEA 3LP2A 3DRRB 4JI8T 1VBZA 3OTDA 1WC6A 3I1AA 2QA7A 1XR7A 3IEEA 3A5XA 4TWFA 1YQ3A 2W8LA 4GC7A 3FFIA 3VHQA 4ECQA 3A8JA 1MNDA 1OSDA 4TY8B 4Y65A 5I42A 3HKEE 1KC8T 1M7KA 2N3OA 3CCVS 4H9SE 5FLXY 2I6WA 5FL1A 4R5PB 5F8PA 3OKQA 3V5UA 4B3SJ 2WCXA 1H7XA 1R8BA 1NZAA 5AQQB 2N3LA 4IR9A 1WTBA 4FPRA 3VZIA 2RHSB 5HMZA 4Y2KA 1NENA 2ZEJA 5LJNA 1B0VA 3K59A 3RI5A 5AQPB 3H4BA 2CJXB 4LRBA 2VKDA 5L39A 1CJKB 2XMJA 3H5UA 2MZRA 3MPVA 3OPCA 5EGYA 5H6QB 1X4CA 1NDCA 1QJHA 2CUYA 1RBOB 2XY8B 1O3XA 4KHPJ 3M05A 5E3QA 2XULA 1W2IA 2FJAB 4ASKA 1N48A 2D3UA 4AFFA 1XNQT 4GYRA 4BA9A 1RT6A 4YDXA 2JEIA 1ZH5A 2JH3A 3K5OA 4G2AA 5JDNA 2AZ1A 1X5OA 4OHVA 2LKZA 3IO1A 3M65A 5DLFA 3NZQA 2MY7A 1VBXA 1JIHA 3RYFE 4I6YA 3VAFA 3ZTQA 4U33A 1WEYA 2CYYA 2HFOA 2OTJS 4ID5A 1EIYB 2XLKA 3R84B 1SPBP 2DXFA 3NEKA 1CQNA 4EO8A 5GAGI 5AJ3J 2JPFA 2ZH3A 5JRCA 3GN5B 2IPOB 3J7Yq 2KRBA 4G1PA 1UCNA 3H2VE 3KNAA 4U3CA 1T7SA 1OQ3A 3ENAA 1YBAA 3TJ9A 2DNGA 3FBLA 4KGKA 2M67A 3FXEB 3T8OA 4I7FA 2CHNA 2FZKB 3C6TA 3SFEA 2HQCA 3RGIA 4IOBA 1AYEA 2ZJRQ 2XY5A 4RW6A 2VC0A 5KFJA 5HXRA 4CO0A 2DNHA 3M2RA 1U1NA 4URGA 4LFCF 3AE2A 2BQUA 4V1Av 2DHRA 4HT7A 3HVTA 1WHVA 3TARA 3IRXA 1XERA 1BQMB 5L1LA 1AFJA 4HFEA 4PQAA 2YVSA 2GW8A 2C5JA 3T5HA 1JLGA 3DOMB 3I0SB 4MIBA 4GKJF 3DLHA 1RT7B 1SQGA 3AQPA 2LSKA 1TR0A 5A8KA 5LSOA 3KYLA 4H9PC 1HMVB 2V7LA 3S7RA 2FGOA 2MZQA 3SI8A 1PC5A 2Y1IA 4DHVA 2UUTA 2KJWA 1MNEA 2VBWA 4DCOB 4OHFA 3KLIA 4WF9Q 3GJQB 4DV6J 5FDLA 3NMRA 1IKVA 4QU6A 4ZN3A 1CQMA 2XQ7A 4O4JE 1WKJA 4XZCA 4NMXA 2OLWA 3TAQA 1RU1A 4E7ZA 1F9EB 1N6QA 5DETA 4JI0T 2XS5A 2V8DA 1SKWA 3Q8PB 3Q0AA 1HPZA 1X4HA 2DCFA 3WIVA 4K5SA 3KHHA 3D3BJ 1J27A 1SKRA 3RYIE 2MHEA 4U7YA 3UVJA 1YZ6A 3D54A 2B5JA 4EMDA 2XZDB 3A8YC 2KSRA 4ED6A 3DM2B 4AKIA 1ICEB 1VIXA 4MBQA 2Z2LA 1HQ2A 2RDIA 2FC9A 3A8IA 4DX7A 1HNIB 1NJIT 4PJJA 1HD0A 1A9NB 4ZP7A 4L9IA 4CXXA 1WWHA 1JJ2R 2WQYA 2ZH4A 3H98A 1FVQA 3HHEA 1S6QB 4S0MA 4B3TJ 2PD1A 3ONQA 2K48A 1N32T 5C2GA 3OR2A 3FCWA 1HG5A 2ZITA 1HQUA 2IIHA 3AXMA 2KFNA 4WKRA 5GAEI 2H3RA 4Y28C 4PABA 2DR5A 1G2EA 1T05A 5KG0A 1WFDA 3QO9A 2WU5A 1YJRA 4ZVQB 5AQLB 1TKDA 3TLSA 3MURP 2G2ZA 5D77A 3BM7A 2NXUA 4MFRA 1ZKEA 1IJ5A 4WBOA 3TZXA 3LP0B 2Q1LA 4B3SF 3PFEA 1GTEA 2FVRA 3EYZA 1UVIA 2YX7A 2VDHA 2WCAA 2KZZA 2V26A 2EXUA 2C2EA 2DHGA 4FPIA 3QZ7A 2I1RA 1DTQB 3B4MA 3FMWA 3UQ4A 2CQCA 1X4DA 2JJ4D 2BZ2A 1N33T 3GB0A 5HJXA 5ADXL 2B7CB 4YQWA 1JLBB 3KLFB 1HX1B 1VQ7S 2OD6A 4ZLLA 4KHPF 3SSSA 2XAQB 3ZTPA 4PW8A 1T8EA 1L0VA 3KWMA 2B0GA 1W25A 2P9BA 1DQAA 3BR8A 3U3IA 1Q8LA 1XMQJ 1S7IA 1WC3A 4J5OA 1SJ3P 2RF2B 4LMZA 5EK3A 5IM0A 2IDEA 3J81U 2ZHBA 4F3OA 2OSQA 3AHPA 4ALZA 2L08A 4IE7A 3NNCA 1QDUB 2F4VJ 2IJFA 3J9X1 3LH2S 2KU7A 4ES2A 1RKJA 5F8IA 4KV8A 4QH4A 5F8GA 4I6WA 1P1LA 2OPPB 3G6VA 2A18A 2CCQA 1T8BA 2W9BA 1A0OB 2RSQA 4CO3A 3KOAA 4JI5J 5AJ3F 5G4DA 5KFBA 1VQ6S 2E9XC 4P10A 1WNEA 2JEFA 1ZBTA 1RBLA 4KKOB 2ZBRA 4YXDA 4PXEA 3MEEA 4AISA 4M5HA 4Y3CA 4OX8A 1Q7YT 5KFCA 2ZOMA 5DGAA 3DLBA 3D0IE 3UU8A 1HTJF 5L1IA 2BM0A 2CQ1A 2NZ4A 1FRLA 2VBZA 3CEDA 4C98A 4EYUA 1P9YA 2VONA 3QJLA 2N7CA 4YP3A 1X9MA 2KVIA 1LNQA 5IT4A 4P9SA 2CQHA 4EEBA 2W67A 2J0WA 3PNIA 4A8OA 2AX0A 3ADAC 3ZJ1A 2F7VA 4KBIA 2ADBA 4O2BE 2BKNA 2X51A 3U78A 3D6FB 3R1HA 1FFWB 3OFHA 1KKHA 2CWOA 2MPUA 4ZVOB 3L7OA 3MFHA 4FBTA 1OO0B 3M6XA 2O3DA 1X4BA 2KHCA 1EJ7L 4F67A 2VHGA 4F4WA 3ZFVA 2BDPA 3ZMUB 2BRLA 1HNVA 5DDOC 4DMWA 4ILAA 3IHRA 5C25B 5HROB 2IRXA 5FVKA 1T94A 2DY9A 3Q9DA 1BR2A 3N6NA 3FBBA 2CJYB 1APSA 2MZSA 2CRBA 3CNQP 2KT2A 3SFGA 2R9LA 4ER8A 2J9CA 4K5RA 2BJDA 2XQ8A 2OMLA 4FYXB 5HANA 4JI1T 3M2VB 3JSMA 4H4MB 2FBWA 1VGYA 2XM2A 2XSJB 2QV6A 1OIAA 2CBJA 3M1VA 5D4PA 1RA6A 4QXHB 3M8PB 4LF5J 3K1SA 1REVA 2JDJA 3CMQA 1R6YA 1HBOB 4RW8B 1LEOA 3ITHA 1F2HA 3R9LA 5B0BA 3ZNUA 1WF1A 1CC7A 2GMLA 4YFSA 1FFSB 3E3XA 1IBMJ 5DDRC 5E3RA 5HEHA 1FWKA 4N78D 3I4PA 4K4TA 1GTHA 3M8QA 5AQVB 4B3TF 3PYDA 5HJYA 4A56A 5GAHU 3C16B 3TJAA 2FVQA 2VH7A 2AV5A 4CYUA 2WK4A 2FYXA 2YQ1A 3GIKA 2UXCJ 2Y1JA 5HLFB 1W7WA 4X62T 4N5SA 2CQBA 4RLEA 2LRKA 2Q43A 1BWEA 3CQXC 2V7KA 4O4GA 2AGOA 3BO3A 3VQSA 1UK5A 2QMWA 2QIFA 2Y8WA 3OL9A 3O9XA 1PC4A 1WKLA 4QX7B 3RG6A 1KD1T 4CLYA 2ZUGA 3B57A 5F3JA 3TVYA 3JAMU 1MLAA 1F9HA 4EB6E 5LG3A 3KJVA 1RTHB 2HURA 4L73A 3D7SB 5ETMA 2F8EX 2WAUA 5F9LA 1R0AB 2C2RA 2AT1B 2AEJA 1XR5A 3G87A 5J2NA 2XWXA 3I9WA 3WI3A 1FTRA 5T7LA 4OZ3A 1E2AA 3K3QC 3NP5A 4GK5E 2BJ8A 2FVPA 4NLRA 5HCJA 2HHUA 3HR0A 2EFVA 2OI2A 1YJ9S 4X66J 4NXNT 1NEKA 3K8WA 2Q79A 3X3UA 3QIPA 3KV9A 5DJBA 3GIIA 2DTJA 5C42A 3BGUA 1XMQF 3AB3B 4U67Q 3F31A 1LWCB 2OKQA 1HR0J 2LXIA 3LF0A 3I87A 3CK6A 4DR4T 2PBIA 2QL7B 3RU0A 2DPJA 4LFBJ 2D74B 2RRBA 2O01C 4ITSA 4MK7A 1QUVA 4K2XA 5C24A 2CBIA 5LHHB 1M1KT 2ACZA 3TOQA 5DJQC 2F4VF 3D1HA 2DT9A 2XMAA 1DTTA 2OAUA 5A6WA 3CC7S 4AD6A 2GV1A 1IR0A 2XY6A 5KG1A 4KE5A 1I51B 2A10A 3FBFA 2LOSA 1GH8A 2MZTA 4C8YA 3AA8A 2X0YA 4ETZA 1S48A 2QA4G 1N34J 2HGLA 3KK1A 2QSFA 4FF2A 4JI5F 5LHGB 4FF4A 3UQ7A 5AXLA 2XB2D 2QA2A 2LM9A 4JI3J 4NYOA 4NXMJ 2IA6A 1S72S 1KQFB 1B7TA 3X1LB 4DFJA 3KTQA 4LJMA 5CFBA 2QLFB 4EZ4A 3D0GE 1FRJA 1XWLA 4ZJLA 2B8QA 2CLYB 1HQEB 2YPYA 2MQNA 4QIEA 4EK2A 1FDDA 3RF1A 1RT5A 1HG2A 4IFVA 2YKAA 2XAFB 5KT7A 3G6YA 4GVLA 4OZNA 1ULRA 1J5OA 2HHPA 2MOZA 1KFYA 2P6TA 3LOUA 3VALA 4P75A 1W09A 2HWIA 1Q79A 5J2QB 2XMWA 3NZPA 2KKHA 4V1Ak 1HWJA 1YRTA 4G63A 5HYAA 1Y3KA 2KZMA 4U2YA 4J91A 3ZZUA 4WPAA 5LBQB 4DN9A 1JLQA 3TNVA 5AQOB 2B51A 2DO4A 3I82A 2W62A 1RT2B 4I67A 1R27B 2NP9A 2PDAA 1BQNB 4O3RA 4WYVA 1Q8BA 1WOSA 2YX4A 3U1NA 3K5LA 4MH8A 2FHJA 4ZVPB 4R5PA 5J2MA 3KHLA 1B4SA 4GKJT 1M5HA 1U5PA 2MKIA 5L8RC 1U6FA 2ZHAA 3PO5A 2AKWB 1O5JA 2WMOA 4WFZA 3P5TL 1RCOB 2WOMA 2RS8A 3JB9k 4B08A 3MM9B 3K3NA 1DURA 4FF1A 3ZNJ1 4LF5F 3ZT6A 4I56A 3UULA 2MYSA 2RT3A 1IKYA 4DR3T 1VYAA 3PHEA 3VRBA 1UJ5A 2LKGA 2ZFHA 3BO4A 3EGVA 2IM0A 5FVLA 2OEJA 4UQGA 5F5WA 1IBMF 2DNRA 1WELA 2BW7A 2GHWA 4DSLA 1XTZA 2FJAA 2EKNA 3PYFA 1EETA 3D5MA 3PIPQ 4ADZA 2XSFA 2M4MA 3GV8B 2V8HA 3TRGA 5KT4A 5LCYA 4YEAA 4IIJE 2P9CA 2QN6B 2UXCF 2XYHB 1ACMB 4DQSA 2D69A 4BJMA 5CH7B 4DDFA 3AVRA 1R7IA 5BYQA 5EX3A 3W1YC 4NLQA 4OHWA 2V6AA 2LDYA 3SFDA 2XQ5A 3BEGB 2C5IT 5AXNA 4HR2A 4DR6T 4QIFA 4L0RA 2DIVA 2RD5C 5JDGA 5HXHA 2XMTA 5IT9U 4JI7J 4FXVA 2BE7D 1RTIB 4ENOA 4F8RA 1HI8A 4IOAQ 2XAHB 4Y0FA 4KH0B 5LHIB 1G8XA 1OS5A 4CLLA 5CA0E 2CWKA 5IS2A 5B0DA 1RWMB 2A9UA 3AY0A 1TUGB 2V94A 3MECB 3EZ5A 1KP6A 4X66F 4KT0C 3FB2A 2GVDB 3Q22A 4OIXA 4B3ST 3P8CD 2ZH1A 3NGDA 2NXEA 1HR0F 1M90T 3DOMA 4CQIA 2XGPA 3DLKB 2GHPA 4LFAT 4LFBF 3LGNA 1FX4A 5L2LA 4DLGA 4KGZB 1O8BA 3WDOA 4FYYB 2ZH8A 3HD2A 3JYTA 1TAUA 3T5JA 1G6BA 5A8WB 1ITPA 2R7SA 1BE4A 1WKKA 3ZZ0A 3N9UC 2KT9A 1FKAF 1FEEA 2OTLS 2E9TA 2HHHJ 3GIRA 2XS7A 1N34F 4OYXA 3LP1B 3Q8UA 3Q8QB 4EYHB 3QNWB 2KB2A 4P2SA 4IG0B 3K3OA 5LSLA 2WW4A 4JI3F 3QJPA 1DQ9A 1FMVA 3HDSA 4NXMF 4OL8A 2A6OA 3EAMA 4UVCB 1RADB 4OX7A 4C9DA 3M9MB 3J81j 3ZZOA 1SV5B 2L3MA 2ZZTA 4X1IE 4CI3B 2XEXA 2DL1A 2PMWA 1H73A 4CT9A 4M5MA 2W0GA 1S0OA 4EGWA 4CQ1A 1C1CB 5IV4A 2F9JA 3AAAB 2W4PA 1HNIA 3HKCE 3ZTOA 3KDNA 1AW0A 3QNUA 1WYCA 4HFCA 3DI6B 3NAIA 2B8PA 2WDVA 1S6QA 1TL7B 2HWTA 1TV6B 2OO4A 1R0CB 1IBKJ 4BHQA 4P1NA 2XMMA 3H37A 3QYYA 3IM8A 3GTYX 4HI2A 4C11B 1T0TV 1NAQA 2HHWA 3AAEB 3GIMA 4DV5J 2RPAA 2ZWPA 2O1PA 1AZSA 3I0RB 3JQJA 3I5AA 2FHJD 5IQQA 2HNYB 2KM8C 3EJMA 4ZS2A 2NUUG 1RK8A 1J5EJ 1S12A 1VQSA 4RPFA 2HBQB 3FRZA 3KINB 4LF9J 4OLOA 4P6QA 1FHTA 4YJ3E 1TKTB 3N5FA 2Q9QB 2B7BB 3L7UA 3HF5A 1JJ4A 4ETXA 1ZA1B 2HPLA 4DPOA 1N5TA 2QYCA 4DV2J 2KRRA 5HP1A 4TV9E 1T03A 5JDFA 3JAMY 2H5JB 2DGTA 2CQ3A 1RABB 1HBNB 1JLBA 5ETWA 3KLFA 1GXTA 3J7Z5 1NDLA 2HPJA 2HFNA 2QLXA 2IVYA 2LE8A 4OZ2A 1K0TA 3D6MB 5HK4A 5DQVA 4FZVA 3UR0A 1LKZA 4HWHA 4PFOA 1YQHA 2RF2A 2VG6A 4TWHA 1VRUB 2A0FB 4F2SA 3Q2MA 3PW2A 5H9EK 3M30B 2RMLA 4DSJA 2VPYB 4OHXA 1AB8A 3VQTA 2DK2A 2PMZD 1IBLJ 3UW1A 1KHVA 2DR7A 1L5UA 5IYZE 1VFJA 1OPIA 2ZH7A 2ILZA 1YKHB 4H9NC 1NB2A 1Z2LA 5DG8A 2RQKA 2HFSA 2OPPA 2FJDA 1V5VA 1NM2A 4FDFA 2FQQB 3MJXA 1S59A 4PJLA 3VAKA 2DNQA 2IC6A 4JI7F 1NBEB 4CLZA 2J9EA 1SJQA 2GJFA 4YTNA 2VPWB 3T6BA 4IDKB 2HS0A 1D1BA 3V6JA 2H7VC 5J1NA 2CRLA 4IL9A 3ETVA 1Z1ZA 1S9FA 1D1UA 3R2CJ 3DGPA 5D6GA 3QMQA 4ZS6A 4MKVA 1MWYA 2OD4A 5SZTA 1MIWA 4OZ1A 4ID8A 3CJ8A 5A8RA 2I5JB 2E1RA 4I2QA 2VL1A 4OX9T 3CMLA 2E2AA 3PW7A 2WBMA 2HH7A 1H98A 2VL0A 2C28A 4LSZB 2RUSA 2E1MC 3ETMA 3MOJB 3ZZRA 3BDPA 5A1LA 2UU9J 3E08A 1DJ0A 4U7CA 1FWLA 2OEKA 1H72C 3V5SA 1R8AA 1QVGR 3GILA 3T1AA 5CB4E 3RRGA 1UA0A 1YK9A 3K17A 3AEGA 6AT1B 4UZBA 2DHSA 5C25A 2JQQA 3TA2A 5HBMB 2EK1A 3N9PA 1D0EA 2CFXA 3MEDA 2HHHF 3Q8RB 1XMQT 4FI5A 1RGVA 3N5BA 3PHTA 4R25A 2QSWA 5JDQA 2DNZA 3F57A 1JLEA 3CQGB 2BVZA 2RJZA 3M2VA 2CPJA 4H4MA 1UW4A 5CZVA 4YR2A 3V6DB 3AT1B 4BBYA 2XSJA 2AYMA 1D0YA 3HI2A 5SUHA 2LMIA 1RT1B 4N77A 3FDSA 1FJGT 3MMCB 3M8PA 2WS3A 3R7SB 4YJ2E 4CLUA 2ZOGA 2AMCB 2IC3B 1NB7A 2NPIA 2J7UA 4AYBD 4QBUA 4DR1J 3A3OB 1YJ7A 2PO4A 4KRWA 2JQHA 4LR7A 4DR2T 3EHZA 5CYMB 3I55S 3QJJA 4NYPA 5LMNJ 3TAMA 4C4WA 3KLGA 2X66A 5D4LA 4X4NA 5K20B 3TANA 4IG3B 3TUJC 2I0MA 1UMJA 3Q8VA 2Y8DA 4KI0F 1LW2B 4F4ZA 1V9DA 4CRJA 3CCES 2R8GA 5FXWA 2OSRA 3U1LA 3R7BB 2NWBA 1PG5B 1PYTA 3DTOA 1CHUA 1YGYA 5KFDA 1IBKF 3A7MA 2CVIA 5E7OB 2FJXA 4TYAA 1M5KC 1QSSA 2HRTA 2JMHA 3HZGA 4DV5F 4QCLA 4X4UA 5EN1A 3HVWA 4JOUA 2YNGA 3ZT5A 4ZN1A 5L3CB 4ED3A 4GKKT 3E8OA 3I4HX 3MM6A 2R2SA 3SV3A 1S9EB 3AEEA 2N9DA 3JTPA 1J5EF 3IBWA 4DPWA 4JI2J 4LF9F 4PQUA 1L3VA 3R5AA 3FZLB 2ZBIA 4EGLA 3PIOQ 3QRQA 2N82B 2E9ZA 4FVCA 3D68A 4ELVA 1R0AA 2NTYA 1KS2A 4DV2F 1TL1A 2DXDA 2Z6EA 3C51A 2AJQA 4UY8T 4ZHQE 2OIHA 2WZHA 1KVKA 2CQPA 4RW9A 5IT9Y 4NLPA 3LJCA 5JR9A 2F65A 3JTNA 2CWYA 4WFXA 4UEMA 3K2YA 2FD2A 2ZM6J 3EM1A 4IO9Q 2VG7B 2W2UA 2JLGA 2J6UA 1IJEB 5DZ7A 1FCAA 5LNKA 3W8GA 1UX5A 2DB1A 3NGRA 1WF2A 2XY7A 1RHKB 3MCMA 2X1BA 4UOGA 4P0AA 3IR6B 4JI4J 3GE9A 4DQRA 5B7WA 2CXDA 4HHJA 3Q5XA 3QC9A 2AJ4A 2VZ9A 5D3GA 3RUBL 2G2YA 4QYRA 2D9DA 3KDSE 4DV1T 2IAJA 1HNXJ 1IBLF 4EIWA 3TUPA 3DOLA 3UFCX 5AE3A 2V6YB 3UN2A 3ZZTA 4PXBA 1QAIA 3AECA 1IBMT 4J9UE 3FZMB 3AH6A 2DGWA 5ETKA 2EFOA 2J7KA 1SL1A 4FKXA 3OVBA 3DP7A 4YY3T 1KQKA 3Q8YA 4DSKA 2HRYA 3MZIA 4ECSA 2VG5A 3ZMVB 3SBMA 1NKBA 3ZMTB 5JREA 3SFUA 3D1OA 2H4YB 1S94A 2UXCT 4TQSA 2WDRA 1SQFA 2FJEB 2MKYA 1IM4A 1WHXA 2YKMB 2YN6A 3IM9A 3NXZA 3ISNC 2GCFA 3MEGB 3H90A 1RHRB 1F5BA 1B0TA 2V67A 3IS9A 2NW8A 4DNDA 1UVNA 4LQ3A 4IL4A 2J1DG 3BQIA 1Z4UA 3A4TA 1N36J 2Y9HA 2HBYB 1WC5A 3TKLB 4IO1A 4QIWD 4AQFC 2DNOA 1QSLA 1M5PC 2CQ0A 2W2OP 2GAHC 2DR8A 3OVAA 3AB2B 4P73A 2UU9F 1NK7A 4OJ1A 2LJLA 2WWVA 2C3MA 2V8VA 2DNXA 2XAJB 1JNZB 3IF8B 3MM5A 5DS7A 4ANDA 2OP5A 3AEDA 5KFHA 4D3HA 5IXUA 2W9CA 4L76A 5FYMA 4DL3A 4HN9A 1ELOA 2E5GA 2PMHA 5KFOA 4LFBT 1GEHA 3UU5A 1N5YB 4KYZA 5IC4B 1FWPA 2MSTA 4RR5A 3MM9A 3RGLA 3ILLA 1SE7A 2J5AA 2VV5A 2BDEA 2MEWA 4QXBB 3CX6B 2ASJA 1LWEB 1FNXH 4LSLA 4DR7T 2R2TA 4ZZBA 4DR1F 4NOHA 2G1DA 3RX6A 5LMNF 1Q5VA 1JLFB 5IQ6A 1SUMB 4QOTA 3LAMA 2E66A 2R4FA 5B0EA 1S79A 4ZHRB 4IH7A 3LTOA 2KT3A 4UV9B 1KVIA 3L39A 5HXSA 1XR6A 4B9LA 1YZ7A 4FP9A 3H42A 3OTOJ 2WBRA 3CIMA 2NXNA 4IE6A 1MIVA 4WBFA 1S0VA 4OJHA 3GA8A 3UTKA 4JV5T 2POKA 1VRTB 1N52B 3FSIA 1CJTB 2J0SD 2HQIA 4NI2A 4HFDA 3C8YA 3HFZB 5KG4A 3IBPA 2V6XA 1JNRB 2EW9A 2P5VA 2YWHA 3LP2B 3PXGa 4USHA 3THVA 2HWHA 1ZOYA 3FCHA 2YX1A 3AE9A 1BGXT 4JI2F 1ZA2B 3ONLC 2KT5A 5KFGA 4O0IA 1X4GA 3FFIB 1DY3A 4ECTA 2GK9A 1UTAA 5I42B 4P7TA 1RTIA 1QSYA 4RW4A 1MROB 5A2QU 2XMVA 1UVMA 3GU0A 5EZYE 2ZNZA 2FY8A 4MFBA 4G1IA 3RB3A 1KRPA 1NCLA 5K8NA 4DV0T 1F3VA 3FXDB 2VFRA 3A1YG 4LIWA 5FL0A 5JDMA 4M8LA 2D3OR 2I9SA 2NW9A 4DO0A 3MECA 4ZCMA 2ZM6F 1UPPA 2GVDA 1SA0E 3SRZA 1YKEB 3CCWA 5F0UA 4DL7A 4ICLA 2KLQA 1L3UA 5C8YE 2MPKA 4JI4F 2IW5B 4TZ4C 4F0KA 1T9TA 2MZ1A 4WK3A 1U0SA 3T1HT 1RWNB 3VAHA 2LOPA 3CO0P 1EB0A 1IJ6A 1HNXF 1QD1A 2D7SA 3C50A 4MTPA 1RT6B 2G1HA 1C1BA 2YNIA 2HHSA 3ZSTA 5BJRA 5LJ3Y 4C0HA 3S8SA 2AYEA 2I6HA 4B6XA 2ZDPA 3Q89A 4UOCA 2MKJA 3P96A 2NCKL 1RAHB 4A47A 3PJAA 3GP9A 3CIZA 2K8GA 4ZI2D 2RE1A 3LP1A 2R7OA 3BJYA 4ZPTR 3HT3A 2XSAA 3I56S 4IG0A 1K1QA 3TWZA 4EV6A 1SIZA 4KMCA 4HH1A 2A2FX 1ZM4A 1EZ3A 2XMKA 4OI6A 4ID5B 1HD1A 4CXWA 4M5JA 5DM7Q 4NA3A 4IQXA 2JWNA 4IT4A 3PW0A 5JRCB 5FIIA 1SV5A 5ETRA 1IBCB 3JSRA 4E8UA 2WVEA 4DU8A 3ICLA 5B0GA 4ZLPA 3HK2A 4HTJA 1AFIA 5LG4A 3H8YA 1U2FA 4DF4A 3ONJA 1C1CA 3FEZA 2VQFJ 4HWDA 3IGVA 2IAKA 2AIRB 3VGVA 2HHXA 1N36F 3C6TB 3QT7A 1UKUA 4HEAA 4RW6B 4JI7T 2FHOB 4ZI7E 4A46A 2L9DA 3T9NA 5JVGQ 3HM9A 4IKAA 3M2RB 4FYWB 4DCPB 1XDPA 2D0UA 3HVTB 3IRXB 3G06A 4KO0A 2EBEA 1JLGB 4CM2A 3G2XA 1GMWA 2WHOA 2HN1A 4KX6A 2KXFA 2MJNA 3QAUA 2C3PA 4QWEA 3W9JA 3BREA 4QPXA 1PAUB 1P1TA 2QZ8A 3VGTA 3KLIB 3P3DA 1S10A 5FDLB 1IKVB 2QC3A 3TLWA 2MY8A 2D3ZA 1NHVA 3C4ZA 2QEXS 1OSCA 1IUJA 3L3CA 4ECWA 3FSYA 5EUHA 3J7A1 1Z8UA 1N6QB 2MKHA 1E1HB 1NH7A 5ABHA 4NEYA 4M5IA 3HHDA 4A8QA 2ZZNA 2XNQA 5RUBA 2HS4A 5JMNA 2LHNA 4U2ZA 4CCHA 4WU2A 3DRPA 2HHHT 4J9LA 1R43A 1X4AA 1Y7PA 4QWAA 4CO1A 2XPKA 3M32B 3R7NB 2XYGB 3R6GB 3DU5A 1FT8A 3HKZD 1D1CA 1RTJA 2M70A 2B5JB 4H4KA 3OTOF 4B9UA 3FCVA 2H65B 3NNAA 3M30A 2XCAA 3RBEA 4EBDA 5KFIA 2GQ2A 3OSPA 2YKNA 3HJVA 2G9OA 2H4WB 1RT4A 1C0UB 3FHNA 1NK5A 1DHMA 1GFWB 1XBWA 1KNZA 1J2VA 7AT1B 4KBMB 4LF6T 4TN7B 3BH6B 1JK9B 3VGSA 4AXJA 4DUZJ 1HQUB 3MR5A 5AQRB 2P9EA 3BS9A 5AQKB 1U1RA 3D6TB 1RAEB 1T05B 1IKXB 3QO9B 2BABA 1IBKT 1SKSA 4L6V3 3CULA 2RRNA 4IDKA 3EDQB 3JXOA 2NXCA 5E3AA 4XIUA 3CWZB 4DV5T 1TKZA 2FLNA 4KTQA 5GONE 3HMJG 4OYZA 1UPMB 4ZVFA 4QZVB 2ZVSA 1HIYA 2E1CA 8RUCA 3MF5A 3CCLS 1RTDA 3LPYA 4UUXA 3U1MA 1J5ET 2I5JA 4LF9T 4U72A 1R8CA 2V69A 4P74A 3CDEA 2E9RX 3AA1B 2HNZA 1NSQA 2QYWA 3D67A 3HSJA 5JH7E 3N6LA 5GAGU 1FRIA 2F4FA 5KTQA 2VA2A 4AQYJ 5C3JA 4H54A 4Q44A 2CZVC 1VQPS 1SIWB 4AKRB 5M4YA 5M2UA 4P2FA 4DR5J 3I0OA 2MKCA 1D8YA 4ZCIA 4YTMA 1S9GA 5IM0B 3D6HB 4IFYB 3M4XA 2QO3A 5EWFA 2W7OA 2MB0B 1VR6A 2XQ3A 2VKHA 2UUCJ 4PJMA 4CLKA 2B1EA 5G0RB 3TR5A 3AE3A 3I31A 1F9FA 3UUMA 5EHHA 3AE1A 2MQQA 4KV8B 3Q83A 1WOPA 2WRMA 4ZVTB 2XJ7A 4X4PA 1Q16B 3CDUA 4LF1A 1IJFB 2OPSA 5AXKA 4MYUA 5GAHI 2M88A 2X1AA 4NCGA 3OYXA 2IRYA 4U7IA 2B43A 4AIUA 4DFKA 3T3FA 1ZTWA 4K0KJ 3KLHA 3W65A 2W63A 2D2SA 2VQFF 3B4DA 2HVZA 5LXRA 3MEEB 1UFKA 1N5SA 2KFZA 1LW2A 2V7MA 5L3EB 3GLJA 4O3PA 3BBFA 5BR8T 3DRSA 3QIDA 3QQCD 1RAAB 3T5KA 2QX0A 2UXNB 3QUJA 5D0HA 2GHVC 1FE4A 2H88A 2VUGA 1WC1A 3KUGA 4DV3T 1FFGB 2X9XA 4XPCA 4YSYA 1WG5A 4LRDA 1GMWD 4OHZA 1XJWB 4BJNA 2CG4A 4ILRA 2CQIA 2HSEB 1TVRB 4DCJB 1B0PA 2PI5A 2HQ3A 1FKOA 4ZCLA 1ROFA 1FJEB 5HN0A 4N56A 3OYZA 2BANA 3AEBA 1S77D 3EDUA 4DN0A 4C97A 3NGUA 4X4OA 4A8WA 1HNVB 1X60A 4MIAA 3ZTSA 3K5NA 2F1FA 4Y6IA 5K8PA 2W00A 3CCQS 2ERRA 2K7KA 5A6PA 4BLGA 2KNDA 2UZAA 1EQMA 4Q0BA 4M94A 2EHOB 1RHQB 3JSMB 2VOPA 3A3PB 4NEZA 1YTYA 4DOZA 4A4JA 5A2QY 5MAOA 1E6VA 3HKBE 4K0UA 3C15A 3M1VB 4YLHA 3IR5B 1SC3B 3PYGA 3ZZZA 1YD8G 1Y9OA 3QB5A 2AJFE 3ITHB 2NXJA 3BDEA 2N4CA 4FF3A 3HHLA 4YHJA 1KLNA 2KJVA 2GA7A 4EFAC 1KN6A 4J9NA 4KR0B 4NLXA 2JMKA 4MKAA 1N0VC 4R8UB 1RWWB 2EFPA 5IV3A 4O4IE 1T9XA 2FIUA 3N0VA 4LF2A 5CAAA 4EOZB 3V4MA 4CTAA 3D28A 3AOAA 3DU6A 2X67A 4Y2CA 3T1YT 1CLFA 2DR6A 4DUZF 1M1GA 1VK8A 3KK3B 4CYUB 1NK8A 4O23A 3H40A 3G82A 3I96A 4RUAA 2B9EA 4LVNP 4DV7J 2G0UA 4NPOA 3FGVA 5LT5A 3MAHA 2V7IA 3TUZC 2MHNA 3PJAJ 5CXTA 1SUQA 1NK6A 2JC0A 1N56A 1HW9A 3P45B 2EKYA 2C2ZB 5IFMA 4ILBA 1LWXA 2LM2A 3Q86A 2Y48B 2YKOA 4HLBA 1YX2A 1DZ5A 3H25A 3CF5Q 1K73T 4YUDA 4MAKA 4ECZA 1QTNB 2WVDA 4YB7A 2E5LT 3ESLA 3K8PC 4C8KA 5J2NB 1FRHA 1TL3A 4TV8E 3OR1A 4ZKAA 3AE7A 2VKZG 3CCUS 5ETLA 3MMBA 4NYZA 4LF8T 2YDQA 2EI5A 3FZ2A 1RWUA 2VPXB 1NNDA 2AX1A 4AQYF 1W2BR 3QIPB 4F36A 1IR1A 2YH1A 3M8WA 1X7VA 3B8HA 3K7RA 5C42B 2AJ1A 3MTKA 5CA1E 1VQOS 4DR5F 2PFDA 4LMLA 2LA4A 3MA9A 4F4YA 1RISA 1XZYA 3BGFA 1PO6A 4QH5A 2J6TA 2C1EB 5C24B 1G73A 1LXNA 2UUCF 4NRUA 1HI0P 2RQMA 1XC9A 1DTTB 4KGVB 2JSXA 4OYKA 4H9QC 3L8RA 4NLGA 1N5VA 3RIFA 3D66A 2WB5A 1PSDA 4PNIA 2PN6A 3RQWA 1XN9A 1VQKS 1HNXT 4F3QA 1B99A 2K06A 3WHIA 1HBUA 1LWEA 4K4ZA 5ETQA 4KFBA 2CQ4A 2COLA 4K0KF 2JVRA 2CPEA 3EX7B 5H1SV 5KFAA 2WZ1A 4I4BA 3N9QA 5J1EA 4YOEA 1NJXA 4YSXA 5LXTE 2ASYA 1FA0A 3A8EA 2ZH9A 1F3FA 4RZRA 3NAHA 3A12A 1JJCB 2A3DA 3CQCB 1RT5B 3HLUA 2KI2A 4IFVB 4A8KA 2CNKB 2C2DA 2LQ9A 1NJZA 2FPHX 2BBHA 3KV4A 1ZHCA 1S1TB 5AQJB 5H9FK 2YPZA 4Q8EA 1WRDA 4OHYA 1HCIA 1LK7A 2JQ9A 3LWLA 4EEYA 2ROEA 5KG5A 2XBPA 5E2QA 1N36T 1RWPB 2V68A 1Q7LB 4ZPWR 2ACXA 2NREA 4USTA 4DS5A 4HGAA 3RB6A 4X4RA 1JLQB 2X1FA 4I43B 2EC0A 4UOHA 2OLTA 2MZJA 3V6KA 2UUAJ 2DKOB 4UUWA 1MN7A 2WWUA 4DV4J 4F7VA 3E51A 3KBTA 4MALA 4PG6A 4G6VB 4M5LA 3JC6C 4ZITA 3LALA 1UJ4A 2ZJQQ 1YDLA 1MROA 5DLGA 1U6BA 1QUUA 1BLUA 3FMBA 1ZM2A 5J2MB 1XDOA 4ZVHA 4JI6J 2FJBB 1G4CA 3OTBA 2BQRA 5E3PA 3DYAA 1DARA 2XHEB 4B3MT 4G3IA 2UVUA 2WOMB 1KLMA 4FXDA 1WORA 4WXOA 2CLYC 3O5TB 2YXLA 3HHLD 2ZM0A 4AKGA 1IKYB 2K7JA 4RBUA 3QGIA 2DH9A 2BG9E 4M5NA 2NTXA 3F44A 3MWBA 3PDYA 5EDWA 3LK2B 3W63A 2Y0SD 1F5AA 5THWA 2YH0A 3AXKA 4AI6A 1LW0A 1XWMA 3HHNB 3SWHA 3HKWA 4YFUA 1EETB 5DQWA 2J76E 1RZMA 5LXYA 3PRVA 2CDRB 2OMOA 1WD6A 5ETNA 5HVFA 3WAJA 5AQSB 3EDVA 1X31C 4J9PA 1KVJA 3P4SA 3N6MA 4IRKA 1HKAA 5KT3A 2IDOB 2BJ9A 3U27A 2R8JA 4BDPA 4DZDA 1B7FA 5EK2A 3VKGA 4NA2A 2LQ5A 4W4MA 4P2XA 2GX8A 3C3LA 4X4TA 2Z4PA 4O2AE 5KOXA 4DV7F 1RJJA 1C4CA 2E44A 4F0MA 2CG8A 4EEDA 3KK2A 1UGOA 4NLYA 1F5CA 4I4TE 2I0XA 4HDGA 4I6AA 3AODA 4JBCA 1H3DA 1XNQJ 5HVHA 1CULB 1WHWA 3ULHA 3PUXF 2GGPA 2FJVA 4Z37A 1OMSA 4IUFA 3HFVA 2CPFA 4W90B 1VCTA 1S1UB 3HVAA 2ZC3A 2G0CA 2WBLA 4H63V 1T98A 5C5JA 1UAWA 2CVEA 2IIUA 3PX0A 2Y8YA 2RDDA 3CCSS 1RAOA 3I0QA 1GT8A 1QUPA 4N76A 2ZM8A 1VIOA 1IR2A 5I4MA 2LVWA 2JEJA 2EC2A 3CTRA 1K0VA 3CSKA 4B3OA 4X1KE 2B3TB 3SYZA 3I6PA 3D3CJ 3HSDA 4ILMA 3MMJA 1T7PA 1VI7A 3Q2SC 1U26A 3MUMP 2R7VA 5E3CA 3IAM9 3EUNA 4A5XA 3UFGA 4OI3A 2CJAA 1LFPA 5CA5A 3JYTB 1NU4A 3PZPA 4UELA 3GG1A 4NLSA 2ZKUA 3FEYB 1WR6A 2VBXA 3PFOA 1XMOT 3N01A 5LMUT 2ZNYA 2JJ9A 4JB8B 4EZ6A 3JSYA 1RSCA 4MKYA 1EHWA 4EI2A 1AUSL 4L5GA 1U48A 1S5ZA 5HSPA 2VJUA 2D41A 3KMQA 3D9BA 4P7VA 3KUEA 4Y00A 5J1GA 2VFUA 4WP9A 3QT6A 3NCQA 4KC5A 1MMDA 2LDIA 4CH1A 3N5LA 3M32A 3ZN1B 4G65A 1VHFA 3VAGA 3VAIA 3IWLA 1NSKL 5FY7A 3NY0A 1Y5LB 3SCJE 3AE4A 2AYBA 5ITHA 3OW2R 3ZEFB 4QIGA 2HZVA 2EFNA 4FJOA 2HAFA 2K1RB 2W2NP 3DXBA 2EEYA 4H63H 4F4XA 4JI0J 3THTA 1C0UA 1RYSA 1NDPA 1NRKA 4FYVB 2B4PA 4ED1A 3OVUA 2BZBA 3DHWC 2M6IA 2GAGC 2AQ4A 1FD8A 4B3RJ 3AA9A 2ZDOA 2AEFA 1VMBA 5HQMA 2UXDT 3LWMA 4DL2A 3OL8A 2FUPA 2VQET 1T02A 3AA6B 1MMLA 1AZSB 1IKXA 2UUAF 2JC1A 3NMAA 2YQ3A 4DV4F 1LRZA 3AA0B 1BR0A 1PGZA 2YWKA 4IRCA 3JQKA 1IN0A 5B0CA 3HKDE 2GNKA 4JI6F 1X5SA 4RW7A 3HULA 3RIAA 4TNOA 3MUVP 1HNZT 1YW0A 3CDAA 3DDIA 3KVBA 2IM1A 3DC2A 1N32J 1UWBA 2RUGA 1U49A 5LP6E 1KK7A 4F02A 3RYHE 3BPSP 4E98A 2IDLA 3AD8C 5HP1B 4HHUA 1FO1A 1T03B 2VF3A 3TW0A 1HHTP 3DHXA 1M5SA 2F3JA 4UF4A 3J7YI 4CLPA 4WZQA 5F3ZA 4B9VA 5HVGA 3Q24A 3OXGA 3CJ4A 3AE8A 4GOUA 1ZYQA 1C0TA 5L47A 4DSEA 1SKUB 5KX5E 4I55E 1REGX 4Y2IA 2VG6B 1NXIA 4M1PA 4ZLJA 2J9DE 4HFHA 2HHTA 3JTOA 2XM1A 5IHYA 2IBOA 4IFYA 3ZN0B 2YWFA 4A8MP 2HVEA 2VU5A 5B08A 4LRAA 4F8HA 3FC9A 5G0RA 2X9YA 2DWKA 2YY3A 3NWIA 4ZPAA 4B9SA 3TVKA 2DGSA 3N4WA 4WBNE 3Q5DA 2BOPA 2L8KA 4QWDA 3HI9A 2B56A 5J2PA 4USUA 2FJDB 4QR1A 2Q9QC 2DHAA 3MEKA 3SSRA 2DO0A 3NGTA 1XNQF 3KKFA 2VURA 2Z58B 1Y0HA 2PE8A 1X9BA 1V9OA 2CAJA 2XZTB 2ZUAA 1YJNS 2NPFA 3QSYB 2SPCA 4PWUA 3BSOA 1O6XA 4A98A 2ROGA 5LJMA 4I0WA 2V9WA 1LOUA 2YNHA 1VBKA 3DGPB 4QYZJ 3O1HA 2HMIA 3R2DJ 4IH6A 3UDEA 1S6OA 3P8BB 2W24A 1W0BA 2JQKA 4FBUA 5A8RB 1HYSB 2OA5A 1NPKA 1V3ZA 1DBDA 1QAXA 2BACA 2YBVA 4I2QB 1FRXA 3IRWP 3DDNA 2JX2A 3ZYMA 4ANCA 4F2RA 3AEFA 3CCZA 1ZEEA 2PT0A 1TVRA 2Q6BA 5CCLA 3Q23A 1RE1B 2DNKA 3H5YA 1BHNA 4DSFA 3RZAA 2AEMA 3GFYA 5FLXU 4URSA 4CNZA 1C2PA 1TK8A 4P09A 3NLCA 3N9OA 5AE2A 1IAPA 1PJ7A 2DRBA 2X3GA 4QU7A 3MM8A 3UD3P 4DV6F 4FS2A 5KFEA 2KWHA 5KFKA 4KHMA 2BVMA 2VFVA 3A8KA 4AQYT 1M62A 4M1KA 3MEDB 3GV5B 4YHHJ 5LSRA 2BS2A 2CJBA 3MACA 1JLEB 2EHOA 4TWDA 2XQCA 4LT6A 1DQ8A 2JFKA 3WZ0A 1CSJA 1NEEA 3KHRA 1DFDA 2XCPA 1WF0A 3O6QA 2GO9A 2VASA 1S6PB 2MSSA 1CG2A 2YDSA 5MLCV 2H48B 2O66A 3TAMB 3KLGB 1IKWA 2R8HA 1VQLS 2MGZA 2Y1LB 3DKDA 4R8UA 1YJVA 3FVYA 2FGCA 3WX4A 1UA1A 2BG9B 1TK0A 1KTVA 4JI0F 2R7XA 2BJ1A 3D2WA 4K0KT 2BV3A 5KFUA 1U1LA 2O5DA 4JV0A 1RUSA 1VJQA 4ED2A 1S49A 4TYBA 2R8IA 4B3RF 3UN5A 1LWFA 1WC0A 3M6WA 4L74A 5KAKA 2CA9A 3KK3A 1TMJA 3BQKA 3SOLA 3UT5E 2HVDA 5DDPC 3UU4A 3CT9A 5AQUB 1FK9B 3ETUA 3CMAS 4YMEA 4NL5A 3G6XA 2HK2A 2YNGB 3HA4A 5LA6E 2PFFB 2N1GA 3MM6B 3KV5A 4W98A 4PK4A 4JLEA 2H9ZA 1UCUA 2LXFA 2WB4A 1BD6A 2D0TA 1Q4RA 5FXXA 1T9VA 2FLPA 1YRUA 2KHDA 4F25A 4O4RA 3N2KE 3PV8A 4PQUB 4AUKA 4DPTA 4LSNB 3LW5C 3AVSA 2A2CA 1N32F 4LF4J 1FRMA 4YB6A 4Q2MA 1TL1B 1Q8KA 3CW2C 4USKA 2C22A 3UDLA 3DOKA 5JQGE 1H2TZ 1JLAA 5EK4A 3PURA 1OJ4A 4ZPCA 3ZC0A 2GFFA 3KBUA 4I2PA 4RW9B 3V81A 5AQGB 4NUVA 5JR9B 3MAAA 4QHOA 1N88A 2CQ2A 3RC3A 2QJ3A 1Q81T 2QGSA 3QB5K 5BYSA 1EKRA 1KEKA 2V8GA 4ED0A 3O1IA 1NHKL 2HN2A 1PILA 3NWGA 2KXPB 1WUUA 4U96A 4LBPA 1NDKA 4PG5A 2FY1A 2LSGA 1OY9A 1NJWA 3V4IA 1M5VC 2V2VA 5EWEA 2PG8A 2PJQA 3NRBA 2M9KA 5D3GB 4AXPA 3Q8SB 3OBIA 1UVLA 3PW5A 5KG6A 2QMXA 5C7PA 3MPUB 2DRDA 2IAJB 4WJBA 5AQTB 3BBBA 3DOLB 3MCOA 3QGPA 3JSBA 4LR9A 1RACB 1U0HA 4LREA 4NXNJ 3O1LA 5KFQA 3KVAA 3NBXX 3TLUA 1LQ9A 1RB0A 3H0PA 4J9QA 1ZOTA 3BKFA 2WVFA 5HEJA 4DX8H 2AU0A 2H5IB 3CD6S 3IN5A 4DR4J 1NO8A 2VG5B 3WAKA 1DRZA 2EG1A 4OLPA 1BQXA 1N0UA 5D15A 4Y2MA 3H2LA 2QL5B 2CE7A 3FRYA 3R5CA 5IZHA 2W66A 2NS1B 1X5TA 3QRPA 1VQMS 2LT3A 3PJWA 5AT1B 3RC8A 4F4AA 2LYVA 2Z0GA 2FHKA 1EP4A 4AL6A 2RQCA 2AHOB 4UQTA 3IWNC 3UCZP 2D3O1 4HWCA 4QH1A 3IS9B 3WIUA 1K8AT 2HGNA 2CXLA 4WFAQ 3CB4A 3CDWA 4IR1A 1SL2A 1S1TA 4NLVA 3TAPA 1KFDA 2P8IA 3W66A 3DFEA 1FESA 1UFLA 1UW9A 3GJSB 5AFUL 1E7PA 4DU7A 2C5KT 2GQQA 3OTCA 2LSYA 3RJMB 5H9EJ 2J6SA 5KFVA 1TTHB 3AAWB 3I32A 3GV7B 2ZH6A 4UIGA 1WG1A 1HA1A 3OLAA 5CCMA 1TKXB 3IXQA 3OXLA 1WEXA 3MM5B 4LFCT 3DNCA 4GRSA 4EYIB 1I6JA 2W9CB 1RP5A 2MQ8A 3FEXB 3PJXA 2EHOD 2HQGA 4XK8C 4YHHF 3ISZA 3M8ZA 2LU1A 4F04B 4DXLA 2FJBA 1YJUA 2J62A 1T3OA 3AE5A 3IP0A 4WW0A 3UDCA 3MD1A 4O4HE 4GVBA 3RRHA 4QYZK 5CYQA 4DVDA 1U02A 3PX4A 2UV8A 4LSLB 3M8SA 2DCLA 3RW7A 2OPQA 3NKZA 1SJRA 2XGQA 4XO0A 2CPZA 4NE9C 4RNOA 2E8IA 2UP1A 2XO7A 2VJVA 3SV4A 3ELHA 3PACA 4ZZCA 4U95A 3DLLQ 3QWUA 5J2TE 2JLFA 3GR1A 4YN3B 3QWPA 2R8KA 1WG4A 4UXNB 1UETA 4J9VA 1HWLA 1P27B 4M95A 4E0DA 1RLCL 4DWIA 3CJRA 2MTQA 2V4RA 3X1DA 4NWBA 4QW8A 3P4PA 4TU7A 5IUXA 1KQGB 3C46A 2PA3A 4OYIA 3C4XA 2CA5A 4H9OC 3VR8A 4USJC 4NI2B 2F8HA 4DR3J 3F2EA 3D1QA 2CDQA 3J81Y 1U45A 2JLEA 3M2UA 5HI7A 3B78A 2K3KA 5I3PA 4WWSA 1VLYA 5IOLA 3BQ2A 4W92B 3AD9C 1KDNA 2PGCA 2LCWA 3PM9A 4MMOA 3HVRA 1OY6A 2NSCA 3A3NB 4RKUC 1CULA 2BUNA 4PPZA 2L9NA 4LF4F 1I94J 4RW4B 1HBMA 1NPRA 3RBZA 4HEA9 4DUTA 4OI1A 2ZKTA 4MFBB 1S1UA 3S4UA 5KT5A 4LF7J 5KFMA 3MFIA 3H4DA 3OJSA 3GFHA 1W26A 2UUAT 2IM2A 3BO2A 4DV4T 2N2NA 3AAIA 2K24A 1BY9A 4ZK7M 1MN9A 5KDMC 4ANEA 1ZM9A 1HX8A 3JCFA 1VRBA 7FDRA 4WFNQ 4DR6J 4DMVA 2W61A 3SZ2A 4ICLB 2W2MP 1RAJA 3ZPOA 4BWMA 5T14A 1X79A 3M8RA 1D9FA 1M0SA 1PJ5A 1S4EA 2CM0A 2YNFA 2UVRA 2RU9A 2VDIA 3BQ1A 1JKHA 2UUWA 2AP6A 2QLBB 4L72B 5L9XA 2G0IA 2KTQA 5F8HA 4PK6A 4K4SA 2XAGB 3CMES 5J1PA 1C1BB 2MYFA 2C42A 2YNIB 5HCMA 4KHPT 5KXJA 3VAMA 2LSIA 4QWBA 4NXNF 2HQDA 2VD3A 3GPAA 3R5DA 4UTGA 4WZMA 1UP1A 4JUYA 3LAKA 1Y10A 4OK0A 4HWIB 3CGIA 3NS6A 5FP3A 1T72A 3CC4S 5KG3A 4DR4F 1Y4ZB 3VRAA 1B64A 4LFAJ 5LJ5Y 2GQCA 2GIRA 2VL8A 2PSZA 2LEHA 3VKHA 4Z2XA 4DUYJ 4NLTA 3E01B 3PUGA 2DVIA 2GJIA 3ZT7A 3QBCA 1HWUA 2BJ7A 4MK9A 2QA4S 2B6AA 3LUYA 4OZJA 3P5BP 4ZJOA 2BJ3A 3EGZA 2QT7A 4IRDA 3P49B 3EUHA 3EVOA 3RHWA 4TU9A 4ZJQA 4GIWA 2XMUA 1YG0A 2K1RA 5KG7A 1OXZA 3TZYA 5KFNA 2DXEA 4X4QA 5DGBA 4J9RA 4WE1A 1K9MT 3BH7B 1CS4A 1KNRA 2HG4A 3FK4A 3UI3A 2CWXA 3MDFA 1HNWJ 2D9OA 3DGVA 4AKHA 4KO0B 2VK9A 4X4SA 2HIQA 3M8YA 2XQ6A 4ATNA 2PC6A 2CZ4A 2LSJA 3PKYA 1WCRA 2H1YA 2RILA 5K8MA 1B3TA 2XUEA 3RAXA 3F0NA 3PE0A 1NMEB 2CPDA 1JQGA 3C14B 2CPYA 2WZIA 3ABVA 1KSPA 4WXWA 3EMTA 4AXIA 3HX9A 4J9KA 4YT0A 3NRXA 3IBFB 3MPDA 2NYHA 3IWXA 5LGNB 3PR4A 3OV7A 1D09B 2ZE2A 2V0NA 3DRYA 2MJUA 1MU2B 3LGMA 1BXNA 2UXXB 1AXQA 2HQFA 3O2IA 1CEZA 1RAFB 1JWWA 2LQ8A 2ZM2A 3GSIA 4DV6T 2CQGA 2VIHA 1HARA 3CJ0A 3DLGA 5FY0A 3BN7A 2HNDA 3H7HB 4X65J 5L1JA 4DSIA 3CJQA 4K7QA 1GXLA 3DRPB 2HK3A 3UNYA 3NCPA 3NOGA 1Y01A 2XQAA 3PEHA 3GR0A 3W2VA 1OEDE 3QT8A 2N4DA 3MOZA 1VQ5S 4M5DB 2KL8A 4MKBA 1RTJB 3BBCA 3FZKB 5DRKA 3G71S 4KSEB 3JADA 2FC8A 2J8SA 5F8LA 3R6NA 1E6YA 1Q95G 4TX5A 4BC9A 5K8OA 4QWCA 3UQSA 2YKNB 4J9OA 3H20A 1SC6A 2QLJB 1YXRA 1RT4B 2ZD1A 2RIJA 1SH3A 2ZJPQ 4DR3F 5L1KA 3ZLIA 3CJSA 2MQMA 1IM6A 3BZQA 3GWCA 4KJIA 2PFVA 3TVZA 4G1QA 3AXJB 3LDQB 2WSCC 5KFSA 2E1PA 3ZXWA 3CX7B 2DH7A 5KFXA 2BKPA 4B3TT 5AQMB 2IC9A 3G8SA 1FXLA 3E22E 4CN4A 4CH7A 2LKHA 4B3RT 4KPCA 5D78A 4GO7X 1TZ0A 3C2PA 1I94F 4QX8B 1NZ8A 2XS2A 2FVSA 3V5RA 2NR0A 3G8QA 2R2UA 4XBFB 4LF7F 4DG1A 1TKZB 2V2QA 2W9AA 1VQ8S 4QR2A 2V2ZA 2FDNA 1F1BB 1HFAA 1D9DA 1QLBA 3POTA 3SIPB 4CN1A 1AT1B 3SSQA 1RTDB 2IBKA 4ILUA 3ZCIA 4MIWA 1HWIA 1HYSA 4K50A 4DL6A 1U1OA 4JYAJ 3I9YA 1P9QC 4DR6F 4ZEYA 2HNZB 5DG7A 1FDAA 4URQU 1M1HA 3BKUA 3QRRA 2BS3A 2YWWA 3N2GE 3PJ9A 4PWDB 4Z8XA 4IDQA 3PU8A 2VICA 4F6RC 4IE0A 4U9RA 3NGKA 1DLOB 3OLBA 2UVWA 4CO4A 3LK42 3P50A 1S9GB 3BSNA 3EI0A 3MCNA 3MK7C 2MQOA 2KWIB 3OHAA 1EX8A 1FVSA 1YWXA 3HPOA 2XWYA 4OX9J 4PYAA 3FZHB 2IMWP 2C2NA 4WTOB 2L9QA 4DL4A 2J0XA 4LFAF 3M3ZB 3P4QA 3HSGA 2V8PA 4KB7A 2HEKA 3CJKB 4NLDA 2OPSB 3GCWP 3THPA 2Y1RI 4IE4A 2RNEA 3TX8A 2F4VT 1JXLA 4DUYF 3CKDA 4NCGB 3W62A 2FVCA 3BKTA 4PFPA 4YB5A 4ZVRB 3BR9A 4USIA 4Z7YA 2AGPA 1MMGA 3T41A 3OVSA 2VPZB 1S6PA 3FBZA 3PKMA 3HCXA 5K5MA 3KLHB 4YS2A 1MMNA 2KN4A 3PW4A 5L3BB 4JI5T 2BG9A 2VB6A 2J7WA 2JRKA 3DRSB 4F50A 4RUHA 3ILIA 1O51A 1ZS6A 3ZMZB 1Q1KA 3C64A 4ED5A 5ETSA 4ZP6A 4PWWA 3NCRA 1FJGJ 3ZMSB 1WDDA 3HO1A 1HNWF 3FZFB 1T9UA 3AJDA 2KZ7B 1ZPVA 3W3SA 2AWZA 3TQ1A 1L3KA 1FK9A 3SCKE 3CPWR 4DR2J 2XG8A 3BQLA 3DMJA 6FD1A 1FKOB 3C6UA 3CVKA 4J2CA 3MUTP 1UX4A 3HXMA 2BANB 2DHXA 4U7UD 4LSNA 2CPIA 3EE3A 5JXSA 1UFWA 1X4FA 1ZAXA 1UVKA 2KYZA 2CPXA 1FKPA 4RJVA 2RKIA 3TEHB 3N9NA 2XASB 1X9WA 4M5KA 4Q0BB 1KOOA 3EWGA 3K89A 1QE1A 4RNFA 1JX4A 4DFPA 4X65F 2AD9A 1U4BA 1E6VB 4GKKJ 3C15B 3NVOA 3LSVA 4YHHT 1O0PA 5K14A 3CJ2A 4A8XA 1LVFA 5L46A 4ZI3D 2B4OA 3BK9A 2NSBA 2CNLB 4KH1B 4CLFA 5CQGA 3HHLB 4DBRA 2OFGX 3FBEA 1KFSA 4LF5T 3GYGA 5LOQA 4ED7A 2MTLA 4TNVA 4ELTA 2L48A 4CI1B 3TJ8A 4CTAB 4HFIA 2O67A 1H74A 3ZTRA 4UR9A 1SH2A 4NX9A 2F8MA 4I1TA 3TUIC 1V3RA 2CEAA 1F6TA 1RYRA 3BSCA 3G82B 3TI0A 2OELA 1YBTA 3EVWA 3EPGA 5ETVA 3N2OA 3LO3A 2LU2A 4LMJA 2V9KA 2EHOC 1SUQB 4ZXLA 1U2RA 1X8DA 1U1QA 4DV1J 5F9NA 4DMZA 3HSZA 1QTMA 4MYTA 5ABEA 4IQMA 1Z2ZA 3O1JA 4B9TA 4FNHA 3H5XA 2MLYA 2BE2B 4CLSA 2B76A 1RT3A 4AQFA 1I6ZA 1MWQA 3W2WB 4JYAF 2DBBA 2CIMA 4YY3J 1TL3B 4Z7CA 3OR1B 2HIYA 4DI6A 3MMBB 4LBHA 4LF4T 2VVNA 4ISSA 2LECA 1S1VA 1UJ6A 3ET6B 4X2BA 3PUSA 3I9ZA 4OI2A 4PEOA 4EWTA 4WP3A 2U2FA 1PBUA 4K8RA 4PJNA 5C2TA 1QSDA 5DQGA 3UN3A 5DQHA 1TKXA 1U1PA 3DXSX 4X66T 3ETOA 4LRFA 5CD4A 5U47A 2GC8A 4CNYA 4FVMA 1P8GA 2H54B 1N8RT 5CD4H 2A1BA 3IA3A 2DEIA 1Y11A 1HI1A 3MTJA 3RB4A 2EWHA 1HR0T 3FJ2A 2HLTA 2DLRA 4X4VA 4OX9F 3EZUA 2C0SA 4LUBA 4LQ9A 1S76D 2AJ0A 1EKSA 5KT6A 3IC1A 1XQIA 1VQ4S 4YTPA 1PYSB 1HBUB 2R7TA 2DCUB 3JS9A 3P4UB 5JUMA 4L3KA 4N47A 3L3PA 1YKWA 4J90A 1F60B 4C8MA 1CJVA 4KFBB 2DHHA 3W7BA 4F0HA 4IDZA 3QLHA 1V5IB 1CUNA 2P6SA 4ZVEA 4Q2LA 5J1EB 1RAGB 2XI2A 2A72A 1N34T 2YKQA 3EZOA 3PV0F 2DH8A 4CO5A 3SDEB 5JJBA 2H51B 2GVZB 4JI3T 4CN6A 2HZAA 4RU2A 3NS7B 2YEVC 4F3MA 3TYTA 3UD5A 1OEDB 4NXMT 2Q66A 1SJ4P 1XIQA 3SS1A 3RKGA 9ATCB 3HD1A 2OUGA 2K2PA 1FJGF 2CKWA 3CCRS 3O3LA 2J9DA 5F0WA 4K59A 4A48A 3R6LB 4PRFA 4DR7J 4A97A 2IMOA 4ZVUB 2E5JA 3ONXA 5I3QA 4DR2F 2WONB 3CPZA 2YU1A 5GADU 2OEMA 2YKSA 3J7ZT 2ATLA 4OYJA 5CZXA 2JL9A 2X1GA 4DX5A 2NOXA 3MAQA 3K8VA 1TFYA 2GS8A 2V63A 3D4JA 4HVZA 2I8EA 2LLZA 5A0YA 3OPKA 2UXBJ 5FY1A 1VC6A 3G96A 1EARA 4P71A 4B9MA 4GK0E 4JV5J 4XAKA 2X0HA 2HYIB 1T9WA 2L3LA 3TX0A 3OD2A 3RAQA 1FJCA 1G3OA 2NQPA 2V7JA 3VGUA 3DYAB 2HPUA 1CPZA 3MHYA 1UVJA 2MBGA 4PZVA 1VQ9S 1KLMB 4GKKF 5CGMA 2HBRB 2Q3PA 2CXFA 3NGSA 4C3MA 2J8AA 5FKYA 3QAEA 4NMLA 2M8DB 3VV2B 5HAXA 3PU3A 3MM7A 4EYYR 4FN5A 5GMKa 3CWJA 1S1WA 1WHYA 1XNRJ 2RHQB 3I5CA 4U6PA 3TLVA 4DPUA 1FF2A 3RPUA 2Q6CA 4I50E 2OV9A 2GMJA 3DRRA 3G8TA 4ILCA 2A2DA 2M6BA 1LK5A 5C2CA 4IHJE 3H59A 3LK3B 1H2VZ 5I3UB 2V4JB 1LW0B 4DV0J 3MMAB 4HTEA 4JV1A 2W2PP 2NW7A 4TY8A 3EXCX 3QPIA 5HATA 3SQGB 2IA0A 1YSJA 2DNYA 3LPEA 2LLYA 5HL7Q 2OFHX 1S0MA 2H3EB 3GONA 3ISND 3QT5A 3PEJA 2JHEA 4FS1A 2DNNA 3KK2B 4C91A 3T1HJ 4TUYE 3J7AN 5FXVA 3DN9A 1B70B 2C3UA 1D8ZA 1CJKA 2IJRA 4QR0A 1TAQA 3E01A 4DV1F 2XHWA 4EU0A 2HKEA 3HL6A 2QE5A 4PAGA 4ZLNA 1N54B 2GGPB 4IGUA 3EABA 5LM7E 3BF4A 2D5UA 1ZAVA 4KQZA 2ROPA 4YR0A 3O8WA 1SC1B 2W25A 4OQJA 4YY3F 3EXYA 3QZ8A 2AXDS 4N7TA 5HWXA 3FBCA 4WYLA 2I38A 1I94T 2XZEA 2LXUA 1JB0C 3UPFA 3K58A 1BUXA 4ED4A 3MR3A 2ILYA
chains in the Genus database with same CATH topology
4L74A 4J90A 4EI2A 4Q25A 3L39A 2OLTA 4J7CA 3L4BC 3RBXA 2BKOA 2AEJA 2AEFA 2OGUA 4J9VA 1T72A 4G65A 2BKNA 4L76A 2IIUA 4GVLA 4RO0A 3JXOA 3KXDA 4YS2A 1SUMB 4J91A 4L75A 2AEMA 1LNQA 4XTTA 2I0MA 1T8BA 3RBZA 2FY8A 2BKPA 1XWMA 4L73A 4J9UE 1VCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L74 A;  4J90 A;  4EI2 A;  4Q25 A;  3L39 A;  2OLT A;  4J7C A;  3L4B C;  3RBX A;  2BKO A;  2AEJ A;  2AEF A;  2OGU A;  4J9V A;  1T72 A;  4G65 A;  2BKN A;  4L76 A;  2IIU A;  4GVL A;  4RO0 A;  3JXO A;  3KXD A;  4YS2 A;  1SUM B;  4J91 A;  4L75 A;  2AEM A;  1LNQ A;  4XTT A;  2I0M A;  1T8B A;  3RBZ A;  2FY8 A;  2BKP A;  1XWM A;  4L73 A;  4J9U E;  1VCT A; 
#chains in the Genus database with same CATH topology
 3OL7 A;  4