2BKOA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkoA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkoA02
3L4BC 1XWMA 3KXDA 2OGUA 4GVLA 2OLTA 4L73A 2IIUA 2BKNA 2AEFA 1VCTA 3L39A 1SUMB 2BKOA 1LNQA 4G65A 4J9UE 2AEMA 4YS2A 4Q25A 4RO0A 4XTTA 2BKPA 3RBXA 4J9VA 4J90A 2AEJA 2FY8A 4L74A 4EI2A 2I0MA 4L75A 1T72A 4J7CA 4J91A 3RBZA 1T8BA 3JXOA 4L76A
chains in the Genus database with same CATH superfamily
4EWTA 2MJUA 3PUAA 4AKGA 3OTOF 2OD6A 2WOMA 2R2UA 2K48A 2DWKA 3JAMU 3V81B 4K4YA 4J90A 2AIRB 3UNYA 3R6LB 2JQ9A 4X4UA 1XMQT 1G3OA 1KLMB 2VFSA 4BDPA 5K14B 4CXYA 5F8MA 1IBMF 3NNAA 2B4VA 2KI2A 2DHSA 4ECZA 4DO0A 4G1QB 1BMQB 3PJ9A 1YTYA 4HN9A 5A6PA 3EPGA 4B3RF 4ZI2D 4F2SA 1ZH5A 1MU2A 3O1IA 1X4GA 2AX0A 2WSFC 2HHVA 2KSRA 4K0KJ 3ZMZB 2ZM6J 2ALZA 3FCWA 4LSLB 4JI4J 4AKHA 1U25A 4H4OA 3M8YA 2MQOA 1IKXA 3FBBA 2OIHA 3LP0A 2VG7A 2MGZB 2LSJA 4M95A 1UUSA 2WP9A 3CC2S 1HMVB 2CJQA 1U0HA 1MSWD 1IAPA 2Q9QB 3MKDA 2V67A 4RUBA 2XQAA 1FTCA 4YY3F 2RQMA 1N0VC 1YWXA 2XSJB 2D7SA 3VVTA 1TZ0A 3HI2A 2XM1A 3KHHA 3AAAB 1HWIA 4DLEA 2J0WA 1HBNA 2UXCT 1UX5A 1P8GA 2R7TA 4F0MA 1S9EB 2LEBA 4MMOA 3CQXC 3PRBA 3GIMA 5B0GA 3QJLA 3H40A 2C3YA 3OR2B 5FIIA 2OTJS 2KZZA 1AZSA 2AEMA 2XZDB 5BJRA 3TX8A 3BGOP 2BBJA 4DCOB 4L75A 4YDXA 4FNHA 5ADXL 2ZMAA 2QA7A 4NXMT 4R25A 3OFHA 4QX8B 3DC2A 2B51A 1BUXA 5IV3A 2HVDA 4AL5A 3CEDA 2MY8A 2CDRB 2V2QA 3VGSA 2EVZA 2KG0A 2JL9A 3VV2B 3H7HB 5ETQA 2LQJA 5HXCA 1WI8A 2HMIA 2HZCA 3CO9A 1IBKT 2J1DG 2UXNB 2C3PA 4DR3J 1SKUB 1ICEB 2OHDA 5GAHI 1N4LA 4UELA 4GYSA 4K0UA 2X9XA 5HO4A 3J80Y 1J5OB 4DL7A 4KR0B 5KFMA 2CJYB 1SB6A 3R7NB 3PX0A 4FYWB 5LGTB 2JJ4D 3WHIA 3FEXB 4DR6T 2DISA 3VRBA 1TKTA 2AGPA 4M5MA 4HVZA 1TAQA 3UUNA 4P75A 1J1JA 4IG0A 4Q43A 2E9TA 2EKNA 4OHZA 4FS2A 1NH7A 1C1CA 1WOOA 4P71A 4P1NA 2XMVA 1VBXA 3QWPA 4JUYA 2E9XB 2RDDA 4QHOA 4KHPF 1HX8A 2UXDJ 2HKEA 4DR1J 1JWWA 3GSDA 2A2DA 2WRMA 4IDPA 3IA3A 3MUMP 3BS9A 2WVFA 2JLFA 2ZH1A 4G65A 1EKRA 2H3RA 5BYSA 2YH1A 1TUGB 3TVYA 2OPQB 3Q0AA 2XY7A 3HULA 3RJMB 2RA1A 2CQ1A 3POTB 1K1SA 1O51A 2J6TA 3HJVA 4AKRB 2IRYA 2XCAA 2DXEA 3DNCA 3LK3B 1K9MT 3W3SA 3AAWB 1VBYA 3J80U 5CCMA 4ILRA 4DZDA 3S4UA 4NLPA 2AJ2A 2ODVA 2J0XA 1MN9A 3MECB 3QGGA 1DTQB 5L1JA 2HFUA 2G2YA 1WG4A 2ACZA 4ANEA 4M94A 4WK3A 3DLLQ 2YWGA 2NR4A 1HNXT 2R7XA 5IXUA 3G6ES 4OYWA 5EWGA 4B3MJ 5AQMB 5KT5A 4ILBA 1T8EA 3TANA 1RWWB 3A12A 4CXXA 1TU0B 3OT9A 3TNVA 5FD1A 4FXWA 2HS3A 4CLPA 3NRXA 5LHGB 3TJAA 5KG2A 4RLEA 2W7OA 3PR4A 4DL5A 3P7IA 4IHJE 2HK3A 2VQEJ 2HGMA 2DNZA 4X62T 2B4OA 2YKQA 1HNIB 4QWDA 2DRBA 3N2GE 3ZTRA 1LFWA 4PJNA 1S4FA 3HHKA 4QR2A 3OFGA 2ILYA 4A56A 4NLQA 4XIUA 2WB5A 1XIQA 2W2QP 5THWA 1PILA 3IBWA 3AQOA 1XDPA 1SC3B 1N32T 3D6HB 5T7LA 3IGNA 2H89A 1OIAA 2XB2D 3TEGA 3T8OA 4TNOA 4PPZA 1VQYA 4C48A 4F8HA 2DR6A 1JXVA 2BR0A 1G6BA 3I5AA 4USUA 1RCOB 2DB1A 3T9ZA 3CCJS 3EZ5A 3MEDA 1VHFA 3BQ2A 3WX4A 2CQ3A 3EM1A 2O01C 3P5TL 1K0VA 1KONA 3IF8B 3ELHA 4ZVGA 4OHXA 4S0MA 2GMJA 1ZPVA 2XHCA 3GLJA 4YT0A 3CCTA 3LANA 2HQ3A 3TP2A 1RE1B 2ROEA 5K5MA 2QIFA 3B4MA 1U1NA 3H0PA 1OYDA 3AEGA 2FQQB 3BF4A 3KUEA 5CXTA 5JDQA 3M32A 3KHLA 3MD1A 3MR7A 1YJRA 2R8KA 3FUYA 4WWSA 2YXLA 2F4VT 2LOSA 1TK8A 3JQMA 4WCEQ 1FX2A 2GQ2A 3MEGA 3D0GE 2C3MA 2PMWA 4MK7A 2HHWA 5KX5E 2JEIA 1NLKL 2G0JA 5KG6A 2HLUA 4A5XA 1YXRA 3AODA 4JI3J 4IT4A 1UETA 3RAXA 3HHLD 2HHPA 4HE8A 2X7IA 4ZI2C 3QOFA 1T9WA 4KH0B 3I1AA 4LF4T 2OJ3A 4CZZB 1E2AA 3MAHA 3MF5A 3AFGA 3D0HE 2CNLB 3MR2A 2GQCA 4B3TT 5GAGU 3CO0P 1V3SA 3J7Z5 1S1XB 2LA4A 4JI0F 2V7LA 2IM0A 2K7KA 2QC3A 4DMVA 1Q16B 1LEOA 5EK4A 1UZDA 4H4MA 4UT4A 1ZM3A 4DFJA 3FNNA 3DDKA 1R31A 4UZBA 2IMOA 2PFDA 4DR7T 5JR9B 1TUWA 2EK1A 4MTPA 3MM9B 1UEKA 2ASDA 3PV8A 1U6FA 1SL0A 1RTZA 3C2PA 1N36J 2GVZB 4YSXA 1I94J 1TK5A 1FRJA 2CQHA 2ZBRA 2W9AA 5KG4A 4MYUA 3UNGC 3UPFA 2R7OA 3G06A 3T1YJ 3OR1A 4KO0A 4CH7A 4C97A 4OHFA 3GWHA 3UR3C 4O44B 1C0TA 2IY5B 2ZWOA 3ZSSA 5ABFB 3OVSA 5CB4E 1SI9A 2IC9A 2F63A 1EZZB 4MLKA 2DGOA 4NLWA 3QZ8A 4DL4A 2QL7B 1OSCA 3H37A 2RD5C 1YZ7A 4FF1A 4I4TE 1EQ0A 1IKYA 3ZJ1A 1AXQA 4I2QB 3KLFB 2RKIB 2W2MP 3OLBA 3RIFA 1UP1A 4OYAA 4U2YA 3DI6B 2KT9A 4Q8EA 1TKZB 1NK8A 4EEDA 4LBIA 2LP4A 1V5VA 3TAPA 2C3OA 3RW7A 3FC9A 2XMTA 2QSWA 3AY0A 1YBTA 3G2XA 5KG3A 2BOPA 1EP4A 2ZNZA 2DEIA 4ZJQA 2FHMA 4PG6A 2LRLA 4ZITA 1JLQB 2FGCA 1WOPA 5LT5A 1WF1A 3QBCA 1CEZA 1JNZA 2IC3B 1WEXA 3UQ7A 3OW2R 2AJ0A 3TA1A 2CJ9A 2VOOA 4RU9A 2YU1A 3T1HJ 3BYRA 1U09A 2E44A 4FZVA 3Q24A 1SL2A 3HVWA 4ICLB 5KG7A 3M8QA 3P8CD 1DQAA 2J6SA 3CPZA 2VU5A 6FDRA 4G2AA 5EWFA 2LKGA 4LF5J 4J9MA 2R7SA 3ZLIA 1PCAA 1RT2B 2CWOA 3Q5XA 3AQPA 3QPIA 2D2SA 5ETWA 3H5UA 4ED3A 4Q25A 5FLXY 2HK2A 2YINA 4RBUA 4CNZA 4WFXA 3KLIB 2CQ0A 4CH1A 2LKHA 3MCSA 3ITHB 2HNYB 2KFZA 3KV9A 1GT8A 5IM0B 1B70B 3LP1A 1SJFA 2J8AA 1WHXA 3ZKRA 3KVBA 1KK7A 3TEHB 3RU0A 2KT5A 4NMLA 3PW2A 2WU5A 5JREA 3D5MA 1T95A 4DUTA 2Q6BA 1RAAB 4NEYA 1S6QA 4ZVEA 5A8WA 2QA2A 3TUPA 4MIBA 1RAHB 3G71S 4OHVA 3EABA 1J2VA 5HXSA 1FJEB 3TLTA 4A8SA 2GA7A 3VAFA 3TJ9A 1IKWA 3TJ8A 2JWNA 2GHVC 3NVOA 4YB6A 3KBUA 3EJMA 2VG6A 3CCRS 2V6AA 2BJ3A 3L3CA 2Y9HA 4GVLA 2YOEA 2OP5A 2CLYB 5LNKA 1QUUA 2BQRA 3HKZD 1UZHA 3PX4A 3MR3A 3UFEA 4DN0A 4UF4A 2DNOA 2IAJB 3ILIA 5ETRA 2UUCF 1UAWA 3N28A 3TZXA 3DN9A 4DUZJ 1WSRA 2HPUA 5FLXU 3VU7H 1X4CA 4RZRA 3I9WA 3HVTB 3GCWP 1VK3A 2ZDOA 1VC5A 3RR8A 1XNQJ 1CJTB 1XMQF 1F9HA 4JI6J 5F8HA 4WYWA 2CHNA 4FXVA 4C4WA 4TUYE 1OY9A 3HCXA 1Y5IB 3G6XA 4X20E 2HSEB 1O6XA 5C8YE 3D6MB 1SJ3P 3V81A 2RVJA 3IBCB 3QB5K 3OJAA 4ZDNA 4WP3A 2BJDA 3M6UA 3H98A 4U7IA 2WVCA 3MD3A 5K8OA 1WNEA 5D4LA 1UEVA 4F3QA 1S0VA 1M5KC 5K14A 5JTGA 4ED1A 1G1XA 5KFJA 5L1IA 4KY3A 5B0CA 1K1QA 5HROA 5HQLA 2ZJRQ 1M62A 4URQU 1VC0A 3ISNC 2Q3PA 3IS9B 2MZJA 3LP2A 3I55S 4NPPA 4F4YA 1NU4A 4JI6F 1GNKA 1VI7A 3HFKA 3ZZTA 5E3AA 4NZ7A 2ASLA 4EU0A 3K3QC 3RIUC 3FZMB 4WFYA 4EO6A 2D0UA 2OMOA 2J0SD 2WMOA 2V34A 3QSIA 5EZYE 4I1TA 4KRWA 4NIQA 3I0QA 2B76A 5D77A 3DRYA 4CYUA 2HGLA 4X4OA 3I0SB 1B7YB 2UXCF 3AD8C 1H38A 2ZEJA 1HMVA 3LPYA 2IBOA 3OFFA 1HI0P 1CS4B 3CDBA 1RK8A 1TMJA 4IG3B 3PEHA 1ZM4A 2XSJA 4F6RC 2GZOA 2CA5A 5HWXA 2DY9A 5FDLB 3F31A 5J2MB 2CG8A 1B7TA 3E51A 2ROGA 1S9EA 3E2EA 1YQ4A 4UF0B 4DBQA 3N4WA 4NXMF 2VJUA 3HHLC 3K5MA 1YJ9S 2BJ9A 4UOHA 3C6TA 4RW7A 3K5LA 4I64A 1BC6A 2J0QD 3OR2A 1R43A 4DX7A 1Q5YA 2D3ZA 2CZ4A 2VPYB 3KMSA 1IBKF 4ZJLA 4V1Av 5F8IA 4TU7A 3G6YA 4IE5A 4ECWA 4B9MA 2OPPA 1JLGB 4ZVUB 1DZ5A 1L3KA 3FMBA 3PTRB 4ED5A 1T3NA 2Y6XA 4OHWA 1RADB 5JRCB 5DZ6A 3I5BA 2C2DA 4DR6F 1KQFB 2L41A 2HHHT 2ZH6A 4RWWA 3FXEB 4NCAA 2BYCA 1PKUA 2D41A 2M88A 3L95X 4P72A 2MLZA 1R3NA 2CPDA 1SKWA 1MLAA 2HVZA 4DR2J 2OEMA 4CM0A 1REVA 2OFHX 1UA1A 3QO9B 2Z0GA 5F0WA 2B4PA 2VQFT 3C6UB 2ZC4A 2XG8A 2DXDA 3LALA 2EWHA 3VR9A 4DSIA 1RU1A 3MM5A 4IFYA 4EO8A 1FKOB 1H6KX 4X64T 4C11B 3C4XA 4HGAA 4DSLA 1RAFB 3MTJA 3J7A1 1FO1A 3WAJA 4X4QA 2OAUA 2BM1A 2OLTA 4HTIA 3KDSE 3OL7A 3I87A 3W64A 1SQGA 1BHNA 2HHSA 4BWMA 1CJUB 2V50A 3POTA 3PIPQ 3OV7A 3EYZA 4X65T 2BW7A 4NXNT 5I42B 1UCNA 2LSKA 4HFEA 2CNOB 2P9GA 3PUZF 1HQUB 2QGSA 4PQAA 5C7PA 2KH9A 4YTPA 3PV0F 1HNXF 4JI7J 1DTQA 3CCZA 2BZ2A 4LRDA 3PUYF 5HANA 1VJQA 5GADU 5K8NA 4DV3T 4C8LA 4K4VA 1RBLA 4EMDA 3ZEFB 4IOBA 3OSPA 5L3FB 1YG0A 5AQOB 3HK2A 3PW5A 2VFRA 2OFGX 5HN0A 5IWAJ 5EDWA 3QIPB 3CIMA 1PYTA 3DOKA 3K2YA 3R3TA 4X62F 1KSPA 1W2IA 1Q8LA 3KK1A 4H9RC 4ATNA 3AXJB 3B82A 1SIWB 4V19X 2LQ9A 1T0TV 2YQ1A 5HVHA 4MIAA 1FFGB 5LGUB 2WZIA 2VICA 4ELUA 1U4QA 1KKHA 2DHAA 2P9CA 1DFDA 1UPMB 2DBBA 4X4SA 3VQTA 2MQLA 2NYIA 2Q9QD 5B0DA 4X84A 1KQSR 4IDQA 3N5LA 2MKYA 1RAIB 4Q44A 2Y3YA 2XHEB 3R5CA 4ZCLA 1S76D 3RF1A 1TL5A 2VKZG 4NLUA 1FF2A 2VFUA 4C8MA 3TQ1A 3C3LA 5G0RB 2WVEA 3W5XA 4KGMA 3C8YA 3ZO7A 2CPYA 3D68A 3K57A 4GKKT 2DRDA 2Y8WA 3DLGB 4C3LA 4ED7A 2R8HA 5EX0A 4D3HA 1GTEA 3C98B 1F2HA 4ILUA 3IGVA 3RX6A 2X0LB 3OLAA 3WI3A 1WC1A 3JYTB 5HL7Q 2NXCA 4HFHA 2HBZB 2NWBA 4OI4A 2HNZA 3T3FA 4QR0A 1RU2A 4BAYB 2ACMA 1LRZA 1ZOTA 4OZ3A 3HVRA 2Q6CA 5KFNA 1KC8T 3NBPB 2E7VA 2AJFE 2YDQA 3C64A 4PXCA 3IAS9 2IYGA 1FEHA 3EUHA 1QE1B 4HFDA 1JXEA 3KV6A 2HIQA 4KBIA 4LQ9A 5KFPA 2WSSV 2Y48B 2UVVA 2XQ3A 2XAGB 3V5RA 2W2OP 3G8QA 1LW0A 2LRKA 4N41A 4YMEA 3MMBB 2VBWA 1Z0PA 1HHTP 1AW0A 5A6WA 3P6YC 3MGJA 1NWMX 1SE7A 2AJ1A 1JKHA 4WZMA 3NZQA 5L3CB 4IDOA 4LRBA 3EGWB 4ILLA 4U7CA 4GKJT 1TFYA 2BBHA 4NLRA 1S6UA 3UUXB 4DFMA 2E7XA 4XPEA 1T9UA 1RAJA 2F40A 3GIRA 4LF4F 2KXPB 5DS7A 4O3RA 2NUUG 2E1AA 3RIUA 2H4YB 3HFVA 4Q8FA 3C15B 2V26A 2EHOC 3A5XA 1FWKA 5D3GB 2VG5A 1A9NB 5H9FK 4B3TF 1F6TA 1U8WA 1HWJA 3RYFE 2EK6A 4BS2A 3UT5E 2UVRA 1YD8G 5DJQC 1FRKA 4C9DA 3U7JA 4QXHB 2A18A 2DY1A 4RW6B 4DR7F 2KT3A 3L7PA 3PDNA 1XR6A 1BE4A 3Q2TC 1S1XA 3CDAA 1KWMA 1VGYA 2XQ7A 4P9SA 4IO1A 4R0JA 2AP6A 5HI7A 4PJLA 4URSA 1W2BR 2DR7A 3IR6B 3MM9A 2W7AA 2A3JA 5J2PB 4USKA 4IQMA 1FKPA 2XQCA 3EWGA 2AYGA 3LAMA 2PGCA 1IBLJ 1U49A 3GJRB 3R1HA 2E1PA 3HHLA 4W92B 3P4SA 2GO8A 3JTNA 2XY6A 1UFWA 1J5ET 1CULB 1TTHB 1UVLA 3IG1A 4KV8A 2IMLA 5HCMA 4DV5T 1T3OA 2OI2A 3MM6B 4B9VA 2AJQA 2CBIA 4ZVFA 2NYHA 2RF2B 3UWTA 4FF3A 2XO6A 5HXEA 3AEDA 3RQUA 1NSAA 4KIAA 2RS8A 4CIOA 4DQQA 4O44A 3PEJA 4A97A 4MK8A 2W4CA 1OXZA 2LLYA 5HEUA 4PWWA 4CLLA 2IRUA 5KOWA 1RJJA 3K0JA 3EZOA 4OI6A 2N2NA 3M7VA 3KLGB 3CCVS 4U33A 4AE5A 1CPZA 4CN6A 3CJRA 3KLFA 3HXMA 1URNA 2X1FA 3SCJE 4DSEA 2BDEA 2ZHOA 1BQMB 4UY8T 1YHQS 1KVIA 1TKZA 3B6BA 4GRSA 2FJDB 4DV2J 2O3DA 4UQTA 1KQGB 3N9UC 2HWTA 3D1HA 1VQPS 5KFSA 3LGNA 3CMES 2GJ2A 4UOFA 2DH9A 3UR0A 3OJUA 2V4QA 3VZIA 2WAQD 3M6WA 3TO8A 1L5UA 5A8RA 5LSRA 8RUCA 2KHCA 5DZ7A 1VIXA 2IC3A 3QLHB 2YKSA 1KP6A 2PJQA 3O6QA 2Q43A 2MLYA 2AE9A 3J81Y 2XLJA 1S7IA 2DYAA 3LW5C 4PWUA 5AQGB 2YKNB 4AXPA 4ICLA 5A8KB 3FFIB 1RT7A 2HQDA 4ZHQE 4CWBA 4KT0C 5L2LA 2H48B 1AB8A 2DRAA 4X1IE 1F60B 1AUSL 1LW2A 2NXUA 1Q1KA 4K4WA 2RRAA 3C14B 1RT2A 3RYHE 2EEYA 2BVMA 2GNKA 4YJ2E 4IKAA 4LR8A 4ELVA 2W7PA 2V5CA 5BXIA 1XC9A 5HJXA 3JSMB 1RA6A 3KLIA 4RJVA 1CLFA 2HNYA 4DPTA 3Q9DA 3O1HA 3EGZA 1RHKB 2YPYA 2JH3A 4LRAA 2L9NA 5KFKA 1YQ3A 5LHIB 2HS4A 1GEHA 2RU9A 1UW4A 4GVBB 1NHKL 2UZAA 3KDNA 4CO4A 3PUXF 4UVBB 3SDEA 3M9OB 2R2TA 1Q78A 3CULA 4UUXA 1S57A 2F9DA 3D67A 4KFBB 2F5GA 3HFZB 4LF6J 2HGNA 3KFWX 2CCQA 3PR5B 3NGTA 3SFEA 3DRRB 4H9NC 1JQGA 2J8SA 3J81U 3SFDA 1S48A 2CJXB 1RUSA 3R5DA 2HHTA 2X0HA 1HPZA 3RB6A 2E66A 2WDVA 3W9IA 4XO0A 4ZLNA 3MCMA 2VVNA 4NE9C 4U96A 3QWUA 3EVYA 4EEBA 4Q45A 3V5UA 1HWLA 5HP1B 4OZ1A 1QUPA 2DD8S 3FBLA 2LJLA 5LGNB 1LXJA 1OSDA 2LA6A 2MB0B 3RR7A 3PM9A 2MTLA 1WC4A 3HMJG 3P96A 4OZ2A 3GTYX 2AKWB 4LFCJ 4AKLA 5HLFB 4ECYA 5C25B 4WU3A 2P5VA 4PFOA 1UA0A 4JB8B 2HW3A 3IRWP 2KNDA 2ZM0A 2K3WA 4A8MP 3CW2C 2JC0A 4LFAT 2BACA 2W9BB 1UURA 2HNDB 1SUMB 3AEAA 3ZCJA 2DT9A 3AOAA 4O4LE 2AU0A 1T9YA 1FA0A 5JDGA 3BH6B 4DF8A 5KT3A 1S9GA 3IS9A 4QCLA 1X0FA 2YX7A 1XMBA 4IQXA 2HPLA 1U1LA 2LM9A 1U1KA 2YK0A 4LFCF 4NI2B 3ONLC 3DFEA 4IDKA 4CO1A 3GJSB 2KZ7B 3W9HA 3LK42 3MMCB 2QYCA 3JTPA 4UV9B 1GMVA 1RABB 1F5CA 2RQ4A 1YW0A 3AAIA 2WHOA 4PABA 2D9OA 1FERA 1ZA2B 4ZHRA 5D8HB 1HI1A 4ZXLA 5LMUT 1IBCB 8AT1B 5LCYA 4OI3A 1HBUA 2EHOA 1X4DA 3QMQA 1R0BG 1P6TA 2FUG9 2PE8A 2DCUB 2DWGA 5KFVA 2FJBB 5JDNA 5AQIB 4PFPA 3CWZB 4RO0A 3AD7C 3ENQA 3R97A 2B6AA 3JAFA 4WZXA 1D9FA 3DDIA 5J2MA 4A8WA 4JI8T 4RKUC 1BWEA 2W2UA 3VVUA 4PG4A 3EGNA 4WTYA 2Z8QA 2XZWA 2V2ZA 3L3PA 3T5HA 3U3IA 3PTWA 1DRZA 1UJ6A 5AQKB 5HAOA 4A8YA 2LXIA 1S1VB 3MEEA 4CLUA 4TV9E 1U0SA 2V8PA 3HI9A 1VQNS 1M5HA 4PUOB 1Z8UA 1F5AA 2OV9A 3TOQA 3H5YA 1F2GA 2FB0A 1FMVA 3F0NA 3C4WA 1CJKB 1IKVA 4NLVA 2QN6B 5JRCA 3LOUA 3CK6A 1SJ1A 3OJSA 4O4RA 3ZXWA 1QAYA 4TYAA 5K8PA 4MKAA 3AAEB 3FVYA 3IR5B 4ILCA 3KK2A 2VQFF 4DV0T 1WI6A 1F1BB 5AQTB 3D7SB 4N8NA 4ID5B 1NKCA 2YNHB 4L73A 1R0AB 2MQQA 4X64F 4JLEA 1VR6A 4FF4A 4ED2A 4USWA 3MMAA 5HYAA 1X4HA 2VDHA 2F8EX 2D9PA 4AQYJ 1APSA 1I1GA 3KTQA 5DQGA 2EFVA 2WW4A 3TUIC 5F0UA 2MSSA 3IBFB 2WB4A 1M1HA 1H7CA 5LM7E 4WKRA 2XZEA 4O2BE 1LXNA 2Z57B 1SC1B 3MHYA 4MFBA 4MKVA 2BANA 3F2EA 3B78A 4X65F 1C0UA 4NXNF 2LQ5A 3CGIA 4CTAB 4EBDA 1WC0A 4MIWA 2HS0A 4P6QA 1ZAVA 5DDOC 3OPCA 5AJ3J 1EZ3A 3JAEA 4B3ST 3ZN0B 3PE0A 2CMRA 3GU0A 4DV3F 2WBRA 1EETB 2CZVC 4PXDA 1T7PA 3VGVA 7FDRA 3Q8SB 2HFNA 2I38A 2DHHA 5C2CA 4C0BA 4HFCA 4EOZB 1JJ2R 5IQ6A 4DX5A 1JLCB 1UWAA 2C5JA 2XWXA 4NYOA 1PBUA 2XBPA 2MAWA 4NZ6A 2JLGA 2VJVA 2AZ1A 5MLCV 4FS1A 2YQ3A 4P2MA 4LMLA 3B54A 2YN6A 4OZLA 3RIAA 1XNRT 3HKCE 1VMBA 2FPHX 4YB7A 1UW9A 3MPDA 4JYAT 3FK4A 1GMWD 4I2PA 4Y28C 2DVIA 3CT9A 1SQEA 5KFRA 5J0ZA 3UUMA 5CYMB 4GKKF 4QWAA 2UXBJ 2D9DA 3SCIE 1W9RA 4AD6A 2X3DA 3FRYA 4HWFA 1XMOJ 2BRLA 3WZ0A 4IE0A 2EPIA 1S99A 2VA3A 4L3KA 4G1PA 1REGX 2V8GA 3PY8A 3DOLA 2XY5A 3UDLA 2R8GA 3UU5A 1ROFA 3THPA 1VISA 4C91A 1NH8A 3QATA 1LWFB 3A8EA 3RRKA 4Q2LA 2X68A 1FK9B 2XSBA 4BLGA 4OZ0A 1RYSA 5JDFA 3ENAA 2IHR1 1G4CA 5CD4H 2WOMB 4M5DB 1I6JA 2HWHA 4J7CA 3HVAA 3QAUA 3HPOA 1YVFA 3FRZA 3AA9A 5BR8T 4PXBA 4JBWF 4DUYJ 4DX8H 4JV2A 3C4ZA 1QE1A 1KTQA 3A1YG 5JVGQ 2MDAA 5ITHA 4CT9A 4DQRA 3HZEA 2CADA 3WDOA 3R7SB 5HMYA 2A6MA 2ZWPA 4OI0A 3AE5A 1Q95G 1MU2B 1N33T 4GKJF 2AEFA 4LF8J 2NR0A 3Q8UA 1VCSA 2W9CB 3RHWA 1WFDA 2HFSA 1ITPA 4GK0E 3ZPOA 3KDOA 3ONXA 3J81j 5EK3A 3QT5A 5IT9Y 5AQUB 2BS2A 2UV8A 1MIYA 4JI1J 1KTVA 5CCLA 5HVGA 2POKA 1N6QA 3LP0B 1ZYQA 2H51B 3LGHA 3MR6A 4UOGA 1U0HB 2IVMA 3A3OB 4IH6A 3QZ7A 4X1YE 2FIUA 3GIKA 2BJ7A 2W66A 4J9QA 2RT3A 1R6YA 3SQGA 2KRRA 1VBZA 1HBNB 1R8AA 2LSGA 3D1OA 1WRDA 2XM3A 4F4AA 4A46A 4ZVSB 1QY7A 5E3QA 4X66J 1B3TA 2BE7D 4JV5T 2ZFHA 1BR0A 4MJKA 1J5EF 3QQCD 2NXJA 2H3EB 4OQJA 3FMWA 5J2PA 1AZSB 2OUGA 4DV5F 4M5IA 4DV1J 2JIWA 2CAJA 3MCNA 5LMNJ 1S1WB 4C8ZA 3TZYA 3V6HA 1HFAA 4A8XA 3TKLB 4HWHA 3DRXA 2UXXB 4YSZA 2NPIA 5IT9U 5CYJA 2FGOA 4K4TA 2ZOGA 4ZLJA 1OPIA 4P73A 3IP0A 3O2IA 2CXDA 5GAHU 2M67A 4E2FB 2DGVA 2JLEA 2X1GA 3W60A 3BV8A 1WF2A 2X0YA 1FDDA 4KJIA 3DMJB 3M8PA 2WVDA 3FBFA 1BQNA 4U7UD 4USHA 3IBPA 2JRSA 4IFVA 2VC0A 1FVQA 4PK4A 4NEZA 2APOA 3R5BA 2YH0A 2VODA 4XTTA 2ZBIA 2B9YA 4LF9J 4O4HE 3RKOA 4P52A 2BM0A 2BBEA 4DQIA 2FJDA 2QA4G 3P45B 2R4FA 1DURA 3OHBA 3SFGA 4QH5A 2MZTA 4F67A 2E1MC 3M8WA 2JQQA 3Q2MA 3MUTP 2QX0A 4LVOP 3CMLA 5LG3A 1V5IB 4KYZA 2UUAT 4XDCA 4JI2J 4WTOB 2LCWA 1UK5A 3L8RA 4GMKA 4MKYA 5DQWA 3ZT6A 5KFCA 5J2TE 1JLAA 4FI5A 2JRKA 4ZP8A 3AJDA 2CFXA 2YKNA 4LF9F 3N6LA 4L3NA 3FFIA 2V6XA 1RAOA 2LLZA 4TNVA 3UCUP 4QKNA 4WP8A 5DRKA 3BZQA 3NXZA 4X4PA 2XCPA 3AB4B 3QGIA 5HMXA 2XPKA 1NHUA 3P50A 4MH8A 3CJ2A 1XZYA 3BGRA 2RRNA 2EFGA 2BJ1A 2ZDPA 1SJ4P 4AT1B 3BBBA 3FDSA 3E3XA 1QTNB 1PAUB 1OYEA 3BGFA 3PNIA 1OY6A 2GVDB 4LFBJ 4KB7A 4ZIWA 1P27B 3JSBA 3RC8A 3IM8A 4JV0A 2UUBT 1TV6B 2VL1A 1UFLA 1HNZJ 4GVBA 4RUHA 2LM2A 2HPJA 2AXDS 4OX9J 4KX6A 2LYVA 1FI4A 1X9BA 2EC2A 4LF7J 5JJBA 2E2AA 5D4PA 1WEZA 2BG9C 4M63A 2QLFB 4XK8C 1HD0A 2BRKA 3DDNA 5H6QB 2AYMA 4B3OA 2RMLA 2JFDA 3DRRA 3OQ2A 2HYIB 3A8KA 3DOMB 1X9SA 1URRA 3BO3A 1OEDC 3ANWA 4ZI3D 1Q5VA 4UW2A 5KFZA 3LQVA 4PQUA 1OS5A 3EHZA 2HN2A 1H0HB 5L3GB 1F3VA 1T02A 4ZN1A 4YHHJ 1XWMA 3H4DA 2WSEC 2YKOA 2PA8D 1Y4ZB 2KMFA 3BJYA 2AD9A 2A2FX 2XTLA 1RWKB 3W62A 2LHNA 3I4PA 3HL6A 1EX8A 3A3NB 3JQKA 5DM7Q 4U67Q 4AYBD 3PO5A 2JFKA 4LFAF 5ETLA 4LREA 2DNNA 2H5EA 1SIZA 2DNPA 1YJNS 3OVBA 3M3ZB 3KLVA 3THVA 3EXCX 4BHQA 1L3VA 1LVFA 2W63A 4XZCA 2XAQB 1T98A 2HHUA 2W9BA 4A4JA 2DO4A 2HNDA 4X4TA 2KO1A 1X4AA 1D0XA 3ENVA 2VPZB 4F0HA 4LQ3A 3AVRA 1UGOA 3BQKA 1VQ4S 4L74A 2Q66A 2UU9J 2OSQA 1U48A 3OPKA 3DLJA 3UD3P 3VAKA 4DV6J 3H59A 3O1LA 3QRQA 4E7ZA 3SSSA 2RQCA 3MEGB 2DK2A 1OWXA 3ZZYA 3THTA 3MMCA 5LMUF 2B0GA 5J1EA 3NGSA 3I9V9 4QYZK 2HH7A 3M1VA 1FRIA 1KDNA 3NAIA 4MAKA 3H4BA 4XAXB 4H63H 2W2PP 4P10A 2LT3A 2DNMA 2QSFA 2YNGB 1R8BA 1Q82T 1NB2A 2ZH8A 4QH1A 2ZD1B 2FVPA 5J2NA 5LXRA 3TQEA 4JI8F 2QO3A 4P2XA 3SOLA 5M2UA 1DY3A 5CA1E 4DL3A 1V6HA 3BEGB 4H4MB 4M8LA 2BA9A 3G86A 2CNKB 2DPIA 2HBYB 5KT7A 3NKYA 2XZTB 1VQ8S 3UDVA 5KFLA 2XM2A 4AIUA 2G2ZA 1NKBA 2AV5A 3FGVA 2GAHC 3V6JA 1Y3KA 4HT7A 4ZCKA 1FMWA 3PZPA 1FXDA 3QUJA 4JI5T 3ILLA 5I3UA 2C5IT 2PO4A 4OX8A 1S1VA 1IWAA 4ANDA 2R7UA 3OR1B 2E1RA 4PUOA 1M90T 3P5BP 2BXJA 4KO0B 5DQIA 1RTDA 4DV4J 2W24A 3I31A 2DH7A 1QSDA 5ETSA 3ILOA 3EPIA 2EG2A 5E0OA 3VAGA 5C5JA 3CJ8A 4JOUA 3EUNA 1IKYB 2JEJA 1Q8KA 1CJVA 3L7OA 2YWEA 3VCDA 2D5UA 4ID5A 1GK8A 1D9DA 2HLTA 3RH3A 3KG1A 3Q23A 4HWDA 4DR5T 4RX6A 1NJIT 5D4OA 4DDFA 2HWIA 3KBTA 1EP4B 3PIOQ 2ZBCA 3NS5A 4OV6A 4R8UA 2LVWA 1KHVA 2VK9A 3BGUA 1JNZB 3OKQA 4QYRA 3DRPB 5KFWA 3MI7X 4UZCA 4B3SF 3AA1B 4K5SA 3M2UB 2CPEA 5CAAA 1NHVA 5AE3A 2XULA 1T94A 4NLOA 2XASB 3ZYLA 2GFFA 3A13A 3ET6A 3HHEA 3KJVA 4YLHA 2ZH2A 2BG9E 4QW8A 4EZ9A 3RPUA 4QXCB 2QV6A 2EBEA 3D6FB 1EETA 4A98A 3SIPB 4ECXA 2CYYA 5HQ8A 2X1BA 3UO0A 2R7VA 3ETUA 4PYDA 2KZMA 4ETZA 2BMBA 2KWIB 4U31A 3S7RA 5KMGP 1AFJA 1JLCA 2AGQA 3LP1B 1KEKA 2M52A 1L3UA 4LF7T 1A7GE 1XNRF 5KFXA 3ZZRA 2GHPA 1R8CA 2B8QA 4P2SA 4JYAF 5F3ZA 1V9OA 1YIJS 2WS3A 1VYAA 1RAGB 5LG4A 2QFJA 2D0TA 4PWDA 1S6QB 5FNVE 2QJ3A 1FJGJ 3N5FA 1MWZA 2HZVA 3VGTA 3KHRA 1WKKA 2YKAA 3N6MA 2VB6A 3ZZ0A 1MROA 3Q83A 1YRTA 1IKWB 4NLXA 2W25A 5K20B 5KAKA 1U5PA 2HRUA 1B0VA 3PURA 3QFHA 2HURA 4QH4A 1NSPA 3OTOJ 2VOPA 4P74A 1BR1A 2FVCA 4CO0A 2BABA 2BG9A 5C42B 2VKOA 1ZZNA 3AD9C 3WC0A 2P6SA 1U8SA 3OTCA 2NW9A 2DL1A 5D0GA 2I59A 1ZAXA 2WB1D 4OHYA 4ZMMA 1U1QA 3NGUA 3OUYA 4FKXA 4HHHA 1OEDA 1SL1A 2YQ0A 5FP3A 1IBMJ 2G4BA 2EG1A 2KYZA 2BE2A 1CUNA 3MXHP 1Z4UA 4B3RJ 4HLBA 2CWXA 3L7UA 5BR8F 4JBCA 3W65A 3K58A 1D1AA 2LQ8A 2OGUA 1GMWA 5IS2A 2H7OA 2M8DB 2UUTA 2Y1LB 3ZTPA 2V6YA 3TA2A 4M5DA 1U1OA 4ZI3C 2XLKA 2DITA 3IXQA 2R2RA 1R8PA 1X4EA 3GFYA 1TFWA 4RWXA 4DEZA 3Q8QB 3HP6A 2RUGA 2W1BA 2RSQA 3VKGA 4FBUA 4X2BA 1N33F 2CIMA 1SUQA 3BGLA 3ZFVA 2IJRA 2WSCC 1WLXA 3VR8A 2QEXS 4F2RA 4CM2A 5FMNA 2KHDA 3CCUS 3PJAJ 2DNQA 4A48A 2P9BA 5HROB 2IVFB 1QUVA 2WDRA 4ZS2A 4YUDA 2FJEA 2HRTA 3LP2B 2KM8C 4URGA 2FJAA 2G0IA 2ZH9A 2FHJA 4YY3J 2ZH3A 1HR0T 2H4WB 2W9CA 4NYPA 2BKNA 4WK1A 4KHMA 5CGMA 2E5JA 3VKHA 4Y65A 5SZTA 3Q8VA 5ETVA 3CVRA 1RHQB 4CI3B 4DR4T 4L9IA 3T5LA 1YJ7A 3DLBA 3QJJA 3S6EA 4BWJA 3R1LA 4NUUA 2DTJA 1YSJA 1NPKA 5KFTA 1UX4A 4OJ1A 3MCOA 2B5JA 1VQKS 5A2QY 5IC6B 2DPJA 4WIIA 4CYUB 4F50A 4G63A 1TELA 2FUPA 2ODUA 2BS4A 3K5PA 3ZC4A 5HVFA 2M3DA 4Y2KA 4C8YA 4LSZB 1U47A 4JV5F 5KG0A 4DV7T 1RQ0A 3LAKA 2CEAA 2H88A 2ACYA 2NXEA 4O3OA 3P49B 4J9NA 3KNAA 2NZCA 2LECA 3MM7B 1VOMA 3A7MA 4OI2A 7FD1A 2R9LA 1R0CB 2ZZNA 3LO3A 1QSLA 1WELA 3ADAC 4HFVA 4MALA 3PVXA 3LTOA 3C6TB 4RW7B 2JSXA 1HYSB 2LU2A 1HQEA 4IOCQ 1LOUA 5H9EK 3H25A 3X3UA 2DR8A 2DGQA 2P9EA 1S1WA 2QYGA 3JXOA 4UEMA 3MTKA 2L9QA 2OPPB 2G1HA 2E7WA 1Y10A 4KHPJ 4H63V 4KH1B 4U7YA 2V1DB 4KUMB 2P2CB 1P1TA 1EAYC 2XMMA 3KMQA 5A2QU 4F3MA 2XI3A 4BC9A 2QRXA 1RWXB 2A72A 1G8XA 1F9EB 3EXYA 3I9ZA 1HD1A 4CP5A 1IXKA 2CJBA 3SCLE 1GXUA 1SC6A 4NA1A 2RU3A 5IV4A 3M8SA 1SQFA 1VRTA 3DMJA 4N47A 1HNWT 4LMJA 1TL4A 1REVB 2E5LT 2V8SV 4NLTA 2VKJA 1XR7A 3BQLA 1X0PA 1Y00A 4E0DA 4WYVA 1LFPA 3CJ0A 1GX6A 2HIYA 3U27A 4WNKA 4YB1P 3CNQP 1E6VB 1ZPWX 3MM5B 4IFYB 4N77A 2KYXA 2XQ6A 2KN4A 5AQVB 5B0AA 3GPAA 3CC7S 3MZKB 2AT1B 1PBAA 2FD2A 2UUAF 2V69A 1HF8A 4BJMA 1IWGA 2KRBA 2K5BB 3MDFA 4RNHA 1V3RA 5KDMC 4TU9A 5EWEA 3Q8YA 4DXLA 3BO2A 3MAAA 3QJPA 2HQFA 3M2VA 2K3IA 4NOHA 4WE1B 3SFUA 1FJCA 1N34T 1PO6A 5DG9A 3H2UB 2NQPA 5DG8A 2RPAA 4CRJA 3CUNA 3MFHA 2B43A 3FHNA 3E22E 1KHWA 2OMLA 4EEYA 1S1UB 1IJEB 2OPSB 4W90B 4P0AA 3J7AN 2UUBF 3M2RA 1PIEA 4KMCA 3PX6A 5LJNA 2HQGA 4U7UK 2IW5B 3NRBA 4G6VB 1KRPA 2KINB 4W4MA 1B7FA 3HA4A 1BWVA 3DOKB 4KGVB 2GVDA 3KK1B 2MZRA 2JQKA 1TV6A 3BO4A 2R42A 5GONE 2AEJA 1XDOA 1KFSA 2HHXA 4HACA 3DXSX 2VFVA 2QLBB 3ESLA 2ZZTA 2P8IA 2NZ4A 3H3MA 1FRXA 1QD1A 4ZVRB 2DO0A 3F56A 4YS2A 2BZBA 1BXNA 3G82B 3PJAA 5FY0A 3DOMA 3KNGA 3GR1A 3RB0A 4FF2A 1U2FA 1Q0NA 2RRBA 2DH8A 1V3ZA 2K8GA 3P4QA 4YR2A 2W67A 1H7WA 3ZT5A 2BVLA 2V94A 3IEEA 1C4AA 2VBYA 1YK9A 2ASJA 3EDVA 5AE1A 5HQMA 1NCLA 2NTYA 5AQFB 2W00A 1NPRA 1YGYA 2QFIA 3V5SA 1N5TA 3HR0A 4OYOA 1SJQA 4O3PA 2CQCA 3NCRA 1LQ9A 1X9MA 2HNZB 4HFBA 4RW9A 3AE1A 3FEZA 4ANCA 5ETKA 2OEKA 4YJ3E 5LOVE 1HHQA 3AEBA 5IZHA 1CC8A 1Q81T 2D69A 2VA2A 5B0FA 1R8HA 3AE4A 4MK9A 2XMUA 2VURA 1Y11A 1N0UA 2Z2YB 1VQ9S 3K17A 3LSVA 1RHMB 2A3DA 5F8LA 4K0KT 5ETNA 2ZM6T 4LMKA 4BCAA 4JI4T 1LW0B 3W2VA 3D4JA 1DAXA 4CXWA 2C1EB 1JKHB 1NB7A 1QM9A 4IREA 1RT5A 4F0KA 1TK0A 1RHJB 2DXFA 1K0TA 3M4XA 4JI0J 2BJEA 4L0RA 3GV7B 2W01A 4F36A 3ICLA 1LWCB 3HZGA 3OSNA 2DGUA 1LKZA 1CQNA 3M6XA 3H90A 3GQCA 3L39A 3QYYA 5KG5A 3CCES 1WG1A 3VAHA 2VG5B 4KE5A 2OELA 2LFVA 3AJ2A 4C3KA 2ROPA 2YNGA 3AXMA 5AE2A 4HH0A 1JNRA 5HK4A 4HDGA 2ZD1A 1HBMB 4ZIVA 1N52B 3HSJA 1MG7A 2BQUA 3ABVA 2X67A 3D6TB 1NENA 3J7YU 3S8SA 4KSEB 3SZ2A 4M1KA 3D0IE 2FZGB 3HF5A 1FNMA 1NAQA 4FPRA 2LE8A 2LSIA 2L3LA 4JI5F 2BOAA 1UCUA 3ZMSB 3KVAA 2B4UA 1FKPB 2IYIA 3HHLB 5GMKa 5CYQA 4AL6A 1Z2ZA 4PPDA 2LU1A 3IRXA 4DR3T 1HWKA 5MAOA 3IG1B 3IN5A 3MXZA 1TL3A 5JH7E 4KV8B 2CKWA 4X1KE 1LK7A 1RTIA 2XMKA 4OJGA 3AE8A 3PHEA 2UVUA 5EX3A 1RWPB 2PN6A 2HZAA 1OWAA 4IR1A 3TZZA 4FYDA 2C3UA 4FDFA 1UMJA 4OZNA 5L3EB 2CQIA 2MY7A 5LA6E 1FDAA 2KFYA 1SV5A 4ISTA 4DR5F 1NM2A 1WWHA 1RB0A 3L4BC 5TAOA 2UXDT 4Q5VA 1VQMS 4DHVA 2RE1A 4DR1T 5LJ3Y 1NEKA 4K50A 3GILA 1S35A 3E0ZA 2JX2A 3R84B 1RLCL 1O5JA 1PJ5A 2VPWB 1FWLA 2XMJA 2ZBPA 1ZETA 4YTMA 1FWPA 4ENOA 4ZZBA 2GGPA 3CCQS 2CQBA 1EIYB 3CMAS 3LJCA 4HKAA 2DNHA 4QIFA 3WQPA 2VF3A 4IO9Q 4H9SE 2WDQA 4IIJE 1SXLA 5A8RB 3BR9A 2RS2A 3CJ4A 4PZVA 3DRPA 4CH0S 4QWCA 2CJAA 2XAJB 4EFAC 1DLOA 3ZNUA 4MFRA 1NO8A 1FT8A 1SC4B 5F3TA 2RDJA 1WKLA 3M2UA 4QW9A 4HI2A 3SV4A 4NA2A 1BY9A 4ZPCA 1RT7B 4TU8A 4LT6A 5JMNA 2M70A 3U02A 1LW2B 3FBCA 3G8TA 2KJVA 2NPFA 4QU7A 4EGWA 2HQCA 2GJIA 3HHNB 4GK5E 3H5SA 4IRDA 3LBXA 4PAAA 1WYCA 4RR5A 5SUHA 4BBYA 2ZHAA 2CXEA 3IR7B 3KINB 4AI6A 4B3MT 3GIJA 4I50E 2J7WA 1XK8A 3D9BA 4TY8A 2E8IA 5DG7A 3MWBA 4IE6A 1R7IA 2VQET 1KQKA 2IPOB 3KOAA 4O3NA 2J9EA 2CBJA 4HEAA 2UUCJ 1R6VA 3CDUA 2CVEA 3UULA 4KP3C 3TAQA 1HHSA 5IOLA 5HMZA 2I1RA 5AQHB 3SDEB 2D3O1 4QJVA 5CABA 4NRTA 5K9FA 1VHIA 3D66A 1G7CB 2B9WA 1XMQJ 3ZC1A 5B09A 5IQQA 5DGBA 1FKAF 3B8HA 5C42A 3K3OA 1RKIA 1HPZB 2MYSA 2G1DA 1ZKEA 4I55E 2K3KA 3QB5A 1H2VZ 1B99A 2U2FA 3DM2A 3HDSA 1S94A 3DP7A 5DJBA 3PJXA 2DGXA 2L9WA 2R8IA 2NLWA 2GHWA 3C66A 2XLIA 1VCTA 1IQTA 1N54B 1DTTA 2A6OA 1FRHA 1T11A 4F4KA 1NK7A 5GVQA 2X66A 4U6PA 2EI5A 1N48A 4DIDB 1WORA 2CXFA 1FNOA 3GA8A 3AEEA 1C1BB 3ZTQA 1YKEB 3BDEA 1U7LA 5BYQA 2EFNA 1HR0F 5L1LA 4UVCB 2ZLYA 5LHHB 2Z2ZA 2A10A 2XSAA 3NOCA 4QWNB 2UXCJ 2HRYA 3CX8B 3JSRA 1JLBA 1D0YA 1S9GB 5DLGA 1NK4A 4DR4F 3O1JA 3HHDA 4ILAA 4HHUA 4JI3T 3GYNA 4N5SA 4IDNA 3CB4A 3GMGA 1RT1B 4TNWA 3MAQA 1WC6A 4IDKB 3H42A 5E2QA 2XTJP 4O4IE 3B13A 1BGXT 2Y8YA 1WSVA 4KI0F 4NXMJ 3CQCB 4ZHRB 3DXBA 2UUWA 1U02A 2DGTA 2DCFA 2V8HA 4JEHB 4O23A 4CLTA 4H4KC 4PR6A 4CLSA 4DV7F 1HBUB 2EFOA 2MHEA 2EHOB 4HKQA 1TMMA 1IBKJ 4MYTA 1HCIA 4UOCA 2K9AA 1NNDA 3SS1A 3DU6A 3RBXA 4HDHA 4O8SA 2F9JA 3EDQB 3SWHA 1UFKA 4EBEA 3GWCA 2B6AB 3BSNA 2GIFA 1OQ6A 3US5A 1N36T 1GQEA 1T9VA 4UTGA 5H9FJ 2VKDA 3MM7A 4TQRA 1MMNA 1I94T 1IUJA 1OO0B 4QWBA 2IC6A 3T5KA 4DR6J 2WCXA 4OYKA 4CO3A 1NSKL 3EAMA 1CQMA 1HBOA 3ZZPA 2DHRA 2IDLA 4FN5A 1HYSA 2VWAA 3T1YT 1Q8BA 7AT1B 5LSLA 4E7SA 5KOXA 4DU7A 1WDTA 2PA3A 1HW8A 2KL8A 3CVKA 2O5DA 2I5JA 3MEEB 2M5YA 3R9LA 4LIWA 3UN3A 1RHUB 3OVAA 4KKOA 2LHRA 5HJYA 3R6NA 1RA7A 1IKVB 3C16A 3AA7B 3IMQJ 2V63A 1T9TA 1HNWF 1ZBTA 3UI3A 2E5LF 3SQOP 1JX4A 3ULHA 5KFQA 3PRDA 2LDYA 4G1IA 4USMA 2JEFA 4WFZA 3FZLB 2X9HA 2IBKA 3KK2B 1HIYA 2CA9A 2NP9A 1YKWA 1SPBP 2YWHA 1UVJA 4V19J 4OFZA 4DL0C 3UQSA 4TQSA 3TVKA 4DL2A 3KG0A 2R7QA 1TL1A 3W2WB 4OYMA 4C8KA 2XUEA 3MMAB 5CA5A 1R8IA 1UWBB 1E6VA 3G8SA 2QRRA 3K8WA 4DS5A 2HAFA 4ZP9A 1Z2LA 4CNYA 4CLKA 3NMRA 4OYZA 3ZMVB 2CUYA 3T1HT 2YWWA 5KG1A 1HNXJ 3V6DB 2PD1A 3QGHA 2B9XA 2OPRA 2W4DA 4MFBB 2BANB 4QU6A 2J4GA 3GMIA 3HKDE 2WQYA 2WVBA 4ADZA 4LF5T 1N34F 3NZPA 1C0UB 4N56A 4PK5A 3SBMA 2LOPA 4AKIA 1M0SA 4DZ6A 2CZ9A 3CX6B 3N2OA 1UJ5A 4EI2A 4X62J 4A8OA 4C98A 5CD4A 3VZHA 4WE1A 2N7YA 4ZOSA 2J9DE 3HKWA 3CJ3A 2HVHA 1YRXA 3OXLA 4ZVHA 3RI5A 1GFWB 5I3PA 1D1BA 4USTA 4QZVB 2RHSB 2Q79A 1ZEEA 2ZVSA 4ZVPB 3KV4A 1SH3A 3KLEB 3S01A 4TV8E 4RNOA 1S1UA 1RZMA 2OPSA 1KVKA 1QAIA 1WYBA 1TP7A 5HWYA 3NCQA 3FBZA 3QGPA 2IMWP 3GN5B 4TZ4C 5BYRA 1N32J 4ZPAA 4QXBB 3VHLA 4ZJOA 2C2MB 4RUAA 4OL8A 1P1LA 3PUGA 2G13A 2HN1A 2QLWA 1S6PA 3NP5A 5L4EA 1RTHA 2CE7A 2CQ2A 1GAOA 2ZBQA 2VKRA 5A0YB 1N8RT 4WYLA 1HL6A 1JLEA 4B9UA 4LR7A 4F25A 4CT8A 1YJWS 1Y5LB 1KR4A 4I2PB 5GAEI 2ADCA 2M0GB 5FXXA 2IM3A 3BQIA 2N3LA 4RUCA 2J9DA 1QLNA 5F9NA 4LBPA 3VF0B 3Q5WA 5L46A 3P8BB 1D1UA 4QBUA 4HFIA 3G82A 1HI8A 2Y1JA 1N32F 4XBFB 5J2QB 3DHXA 4DUZT 1IJFB 1MIWA 1PJ7A 4Y6IA 2XHWA 5DGAA 3NNHA 1EB0A 3D3BJ 2DNKA 3CCSS 2H9ZA 1X31C 2R6GF 3DOLB 1XNQT 3A8JA 3RW6A 3N9PA 3QK6A 2XQ4A 4JI6T 1N56A 3FSXA 2C2RA 3KWMA 2R2SA 3UVJB 1HTJF 4CZCA 2MBGA 2BKPA 2F4VJ 2DNRA 2IJFA 3R5AA 1RWOB 1RTJA 2HAIA 1FHTA 2GS8A 3NEKA 2CPFA 3MM8B 4K0KF 4ED6A 2ZM6F 4EZ4A 5T41A 4LVNP 3UN2A 4JI4F 2V7MA 5E3PA 4OYPA 4UV8B 4LF4J 2NCKL 5ABHA 2WWVA 4J9KA 3NBXX 3T5JA 4FJOA 1NSQA 3BQ1A 3AVSA 2JC1A 4DWIA 1BR4A 3N6NA 3J7ZT 1VJWA 4B3TJ 3FZFB 3E8OA 3RG6A 3PRVA 3UDEA 3ZMTB 3BKFA 3Q2SC 1VQ6S 5A1LA 2F4VF 1U24A 2CXLA 3EVOA 4DR7J 2XQ8A 5KFAA 4I7FA 4QIGA 1EARA 3GONA 3PXGa 1FNXH 2N1GA 2V4JB 3V4IA 4KPYA 2E9XD 5JDHA 4TVAB 1LWCA 3G6VA 4KGXB 2MXYA 1N6QB 2IM2A 2NUHA 1EKSA 1KOOA 1GX5A 3ONJA 2DNLA 3GE9A 2GIRA 2V9KA 2W8LA 4C8NA 2E5IA 3ZYKA 3M9MB 2DHGA 1OJ4A 4I67A 4H4KA 1HFEL 3LGMA 3MURP 3AOBA 3FEYB 3SQGB 1HBMA 2EFPA 4HWIB 5G4DA 1WCRA 1DQ9A 2ATLA 4RBTA 5AQNB 1RWVB 1FEWA 1YLXA 2M7SA 1YZ6A 1X7VA 3J7YI 4HI1A 1X5SA 5DDRC 1JK9B 2RH3A 4KGZB 4DR3F 4C90A 3IA0A 3TZWA 2XQ9A 3AE3A 4YFSA 1I6ZA 5HEOA 5EHHA 1LWEB 3GV5B 3QRPA 3VALA 3NL0A 4AXJA 1SBRA 3PKMA 1HNVB 1UPPA 2GIQA 4R0EA 2D74B 2FDNA 3UCGA 3M8RA 4GYRA 3QT6A 2NW7A 2NS1B 4DQSA 3FZBA 4BC7A 3PW7A 3W15B 4EGLA 4DR2T 2UXDF 4DG1A 5KFEA 3CE8A 1KNZA 4DR1F 3HX9A 2A0FB 3DJBA 3UFGA 1ZOYA 2PMHA 3M8PB 2QMUB 4PG8A 2JNJA 1BQNB 2OSRA 2R7WA 1FRLA 2WZ1A 4YTNA 4IFVB 2QLXA 1HARA 2IVYA 4F3OA 3EE3A 5EUHA 3Q5EA 1XBWA 3R2DJ 4DX6A 1K8AT 4DLGA 4B08A 2XAHB 5B08A 3OD2A 3IHRA 3CPWR 4ES2A 2C2ZB 1U1MA 4E8UA 3KK3A 2CPIA 1QTMA 2PSZA 2E9RX 1LNQA 4WF9Q 2CQGA 1I3OB 5HEGA 3QFWA 3UU6A 2DIUA 4DQPA 3HKBE 1JLAB 2DNXA 1M1KT 2VH7A 4FYXB 3EZUA 3EDUA 3RRHA 4JI7T 2XYPB 1T05A 1WC3A 4L5GA 4B3MF 1WACA 3H5XA 2ALYB 1AA1B 4ZA1A 5IWAT 2VQEF 1FXLA 4DCJB 2IAKA 5C24A 3BGRB 2XYGB 4EYIB 1O0PA 3NLCA 3MPYA 2IFXA 2SXLA 2KWHA 2W4XA 1M5SA 3QSYB 1M1GA 1X60A 3ISND 2E9ZA 2AMCB 3R27A 1KFDA 3NMAA 1FD8A 1DJ0A 1N5YA 4AISA 1VRUB 1WKJA 1KN6A 5HAXA 3ZZUA 1K47A 3N2KE 1H98A 2IA0A 3HT3A 2VASA 4UVAB 5AXLA 1TL7A 3O4XE 5KFUA 3LUYA 2E1CA 1RAEB 5L38A 5DETA 3G96A 4B3OB 3OTEA 4HL9A 4RW8B 2KG1A 5D15A 4XDDA 4DNDA 1VC6A 2XWYA 1KD1T 4Z37A 2UP1A 2F3JA 4DPXA 4U95A 1ZHCA 2JEGA 3ANWB 4K8RA 4MKBA 4OX6A 2ZVIA 2AYEA 4PQUB 3M05A 1YITS 5CJ5A 2H1YA 2XS2A 1RP5A 4QPXA 5HBMA 3QRRA 2FTRA 4NL5A 5ETMA 2ZHBA 2M9KA 1RT3A 4RU2A 2OEJA 4F02A 2O1PA 2Q9QC 3TI0A 2J9CA 5E3CA 3AE7A 3D3CJ 3R8YA 3RBDA 2MOZA 2PBIA 2VZ9A 5BMVE 3TLVA 5AQRB 5HCJA 4Y3CA 2ZJQQ 4EUVA 2P6TA 2CVIA 3BDPA 1NKEA 1S1TA 1YJVA 2CWKA 3MMJA 3KXDA 5F8GA 3C50A 1C1BA 3DYAA 4P09A 2MEWA 1JLFA 2YKMB 3PW4A 1TKXB 5T14A 3KV5A 4YSYA 4P2FA 2YVSA 4YXDA 2VBZA 4JI3F 3KJQB 3PCOB 2YNFA 1Q7YT 2WWUA 4N7TA 1X9WA 4CO2A 4YEAA 2G0CA 2V2VA 5LJ5Y 2CPXA 4IGUA 4EAHA 2HFVA 2BQ3A 1SH2A 3B4DA 2CQPA 3LPEA 1FVSA 1GXLA 2LSYA 1RT1A 4F7VA 3W66A 3U78A 2C2OB 2UV8G 4RL1A 4NPOA 4TXSA 5J1EB 1W25A 1VRQC 2J6UA 4U8YA 2XGQA 3M1VB 3NCPA 1WHYA 4DPWA 2QGFB 4Q0BA 1QJHA 4H54A 4I68A 4M1PA 2DNYA 5FY1A 3PUQA 1IM6A 1OY8A 2ZKUA 1NEEA 5J2NB 1N36F 2M2BA 4CQ1A 2V2KA 5AQQB 1I94F 4RBVA 5LB7B 1W0AA 5F8NA 2FHKA 3J9X1 4ZPVR 2HHHJ 5EK2A 2PEHA 2E9XC 1IBLT 2FLPA 4C0HA 3T1YF 4ZVOB 3I5CA 3HLUA 1QAJA 3VHQA 2Q1LA 2PT0A 3CKDA 1WD6A 4H9OC 2BVZA 4R5PA 1X4BA 3RRCA 6FD1A 1VQSA 1S72S 2OH2A 3SI8A 2XMAA 3LWLA 2VQFJ 3CD6S 4TX5A 4LSNB 5I3UB 4X64J 2WK4A 4LIRA 2HHHF 3TR5A 2VONA 3EVWA 4WFBQ 3HD2A 1RTDB 4IUFA 3ZSTA 1HLWA 3N9MA 4I56A 4RPFA 2DIVA 3H8YA 4UQGA 3TAMB 5KTQA 3NAHA 1WR0A 3ZCIA 3CD0A 4KC5A 3W9JA 2GJFA 1YKHB 4I4BA 4UY85 2G9OA 3MR5A 3TLWA 2XS7A 1CJVB 1TAUA 1DHMA 1JJ4A 4X65J 4DV2T 4NXNJ 4OLOA 3N9OA 6AT1B 5CFBA 3RGIA 2R7RA 2AWZA 2N7CA 3DHWC 4Y34A 2BX6A 4AQGA 3OBIA 3BM7A 3T1HF 3W2WA 5L4HA 2MQ8A 5L9NA 1UWBA 3CX7B 3JSYA 2VPXB 4L6V3 4DV3J 3Q8RB 4LF5F 1WTBA 5ADZA 4DFPA 2MQPA 3DRSA 4QR1A 3OHAA 4R8UB 4U72A 3V6DA 5F8JA 2X9YA 4DSFA 4HTJA 1D9AA 3C51A 4IE7A 3A8YC 3I0RA 5K8MA 2LEPA 2RILA 4B02A 1U26A 5AXNA 3V6KA 3O9XA 3JC6D 4ED8A 2E29A 1RDRA 3I9YA 1FTRA 1UVNA 3ET6B 2ES0A 3KJVB 3BPDA 2MMYA 2XQYA 4P7TA 3D54A 3PYGA 2B3TB 4NCGA 1L3TA 2BEFA 1UVMA 4NLGA 3P3DA 1CG2A 3KLEA 3DLHA 4WBNE 4F4ZA 4HHJA 4LJMA 3BBCA 2I2YA 4GKKJ 3CDEA 3U1NA 4ECSA 2XO7A 4DOZA 3ZTSA 4O3SA 3A4TA 1VQ7S 9ATCB 3GN5A 3MA9A 3MZIA 5HXRA 3HM9A 1N88A 1RT4B 2GCFA 4USVA 4PWDB 4LUBA 4LF6T 4B9LA 3F44A 1VQOS 2I9SA 3W8PA 5A0YA 4TLQA 1KLMA 4OYXA 2W61A 3NWGA 1RYRA 2FY1A 1MROB 4TYBA 1LKXA 3K3NA 2JOQA 5IHYA 2XQ5A 5FXZA 3CIRA 2EHOD 4DUZF 4G1QA 4X4RA 1H7XA 2XAFB 2BG9B 4DN9A 5DM6Q 1Y3JA 3RTVA 1XNQF 3OL9A 1QSSA 4EB6E 4LF1A 5C3JA 4J9LA 1U45A 5JUMA 4ZEYA 5J2QA 4LSLA 1FFSB 5IYZE 1I5OB 3OUYB 3PU8A 1OEDB 2C2NA 2R3VA 5L8RC 2LEHA 4OYIA 2HQIA 1NZAA 4J9SA 4LMZA 2BE2B 4ZLLA 5F5WA 3R6GB 3WAKA 2X1AA 4LFCT 4Y2MA 5AXMA 4I0WA 5FJ4A 3U1MA 2MGZA 3PYFA 4GKJJ 3UVJA 1NZ8A 1KFYA 4EBCA 3AE6A 2YDRA 3FB2A 2V6YB 2MKJA 2Q9QA 2RQKA 2H54B 2VC1A 2IUBA 2YEVC 2QLJB 4YQWA 1M5VC 4NCBA 3MM8A 3I56S 2XEXA 3NNCA 1SHZC 5JR9C 3PFOA 5GMEA 3O8WA 1SUQB 4NMXA 3OL8A 4PKDB 4YR3A 2NTXA 5C2GA 3OYZA 2PIIA 4QQBA 3RB3A 2ERRA 1SJRA 5DQVA 4PW8A 4JUZA 2RAQA 2FJEB 2F65A 2FJAB 5I4MA 4B6XA 1RACB 1NDLA 1MNEA 3ZYMA 3ZMUB 3VTIA 1M5PC 4TN7B 2V4JA 2CQDA 3H2LA 4DJBA 1TQLA 3RZAA 4AXIA 1FEEA 3KG4A 3FXDB 5D78A 1Q7LB 3UFCX 2B5JB 4AUKA 1J5EJ 4K5RA 2QTWA 4DV5J 3ZJ2A 1Y5NB 1QDUB 3W7BA 1J5OA 4ID8A 2JVOA 1MWQA 2MPUA 1VS3A 1UEUA 4Z91A 2J5AA 3CMQA 3KHGA 3HD1A 4WPAA 3GJQB 3N5BA 4HYKA 1T03B 5LYJE 4QYZJ 1H3DA 3EI0A 3FKBA 2CG4A 2KB2A 3LG7A 3ETOA 5DO2A 2WBMA 1HG2A 2E9XA 3TARA 1QLBA 1HQEB 3A8IA 3X1DA 2BDPA 2GQQA 1LWEA 5CHCB 2MJNA 4JEUB 1MIVA 2XJ7A 1HNVA 2RHQB 4D3GA 4DR2F 3MOJB 1XERA 3SEOA 3T41A 4M5JA 2YWFA 4TY9A 2SPCA 2OPQA 4KPCA 4M5LA 2YNIB 2V7IA 5RUBA 3TUJC 4M5GA 2A1BA 3IWXA 3GFXA 3WC2A 2BE9B 4AQFC 2COLA 4ZPBA 4NRUA 3LA0A 3E08A 5LBQB 2DJWA 2AHOB 2XYHB 4RNFA 2I8EA 1VRTB 4CDIA 1AYEA 1H2TZ 3MECA 2EFQA 4N8OA 3CD7A 2FLLA 1KLNA 2YTCA 4AQYT 3CSKA 4PJJA 4LRFA 3NS6A 3SXLA 2W62A 2B7BB 2DCLA 2M6IA 1IQZA 4Q7AA 4QPTA 2L48A 4KQZA 3CJSA 2K2PA 1RXOB 3VAIA 5CH7B 2QVAA 3NGDA 2VL8A 5LSOA 1DARA 1L3SA 3GG1A 2PTFA 1PSDA 2HG4A 3L09A 4JI7F 1YBAA 2CLYC 2X9WA 1HNIA 3MAAB 4XAKA 2IIUA 3M2VB 3RLFF 4ITSA 2CJKA 2EW9A 5FKYA 1RGVA 4J9UE 4IRCA 2K06A 5IWAF 1UVKA 5HMWA 2HFZA 3AH6A 3JB9k 2NREA 2AZ3A 3CJQA 1FE4A 3N9LA 3I82A 5IT4A 3TA0A 1MNDA 2AGOA 3QNWB 5L1KA 3QIDA 3GB0A 4CN1A 1LVKA 3BSCA 1SKRA 4IH5A 4PEOA 5M2PA 4K4SA 1S7HA 4DBRA 1B4SA 3FCVA 4WP9A 2J7KA 4Y2IA 1HW9A 4ZVTB 1MMLA 5AQPB 3JC6C 3M2RB 3P4RA 1Y0HA 4ETXA 4K4XA 4OJ3A 1D09B 2YU2A 4YB5A 4AFFA 1GXTA 1VRUA 5HEJA 3RB4A 1VQLS 4NZ0A 5M2RA 2UXBT 4HACB 2NW8A 3UU4A 4F4XA 4CI1B 1T9XA 1Q8IA 2MKHA 3S1TA 4WJBA 1XMOT 5F8PA 2C0SA 2N4CA 3UTKA 2W4PA 5GMDA 1T72A 4OK0A 2Z2MA 4RW8A 3AA8A 4PG7A 3KKFA 4LFAJ 1SH0A 1RBAA 1NK9A 4DSJA 3LDQB 4ERDA 2IIHA 4K59A 2F8HA 4CLFA 1E7PA 4TN2A 1EQMA 2YY3A 2F4FA 4ECUA 5EN1A 4TWDA 3FZKB 2FYXA 2AX1A 3E01B 2YX1A 2OD4A 2FJWA 2WW8A 4UIGA 1GMUA 1F9FA 3UU3A 5KXJA 2HHQA 2M8HA 3F57A 4O0NA 4DUYT 2WU2A 2ATCB 4RW9B 1QAXA 3CCLS 3G9CA 4YOEA 2WY2A 2E5GA 4JP8A 3BBFA 2Z2LA 4YR0A 5GAGI 4DMWA 4M5HA 2VD3A 5LMUJ 3H20A 4LF8T 2KKHA 2MHNA 3W1YC 2FBWA 3DKDA 3BKTA 3U1LA 4EIWA 2YKMA 5JR9A 1W26A 1TKXA 3W2VB 5KFOA 4GC7A 3RUBL 2ZUGA 3UD5A 2EKYA 1B0PA 1BLUA 2NXNA 2XMWA 2GVZA 4JI1T 4JI8J 1RT5B 3T9NA 4FVMA 2ZC3A 1KF6A 2H5IB 3DGPB 2KM8B 5DDQC 2QA4S 2X51A 1LWXA 4ER8A 4ILMA 1QVFR 3QT7A 4PCQA 2ZM2A 4O4GB 2FVSA 2KVIA 2B56A 3HSGA 2GW8A 3D0TA 3IO1A 1RWMB 5ABFA 2MZQA 3MPUB 2KT2A 4CLYA 3AT1B 3HSDA 2KVQE 4Y0FA 1HKAA 3T6BA 1JNRB 3M30B 2LQBA 1YX2A 1IBLF 2D3OR 4ZOLE 4X66T 4U3CA 4I2QA 2RJZA 4J9OA 2RKIA 4Y2CA 2M4MA 4DV1T 2ZKTA 1H73A 2D3UA 3DI6A 2B8PA 5F3JA 4EK2A 5LMNT 4J2CA 4DV0J 4J37A 3UUBA 3PUWF 3TW0A 5JQGE 1IM4A 5CA0E 1FFWB 3N01A 3GYXB 4EYUA 4CI2B 1YI2S 5CYQB 3FQKA 3UQ4A 1JLQA 3IRXB 5I3QA 2YDSA 4LSNA 4ED0A 1TL3B 4FYYB 4HT5A 4ES1A 3TVZA 1GTHA 1RTIB 2HVEA 4QX7B 1J5WA 3HKEE 3WX8A 1NK0A 3UDCA 5ETOA 5D0EA 2CPHA 2N9DA 5H9EJ 4DV0F 1HS7A 2FJXA 4DV2F 4K2JA 3TAMA 2J7UA 4I6AA 2MSTA 3NG8A 2VV5A 1SV5B 4J9RA 3EDRB 4LF9T 4AQFA 3BREA 3PYDA 1U1RA 4UR9A 3PU3A 1X5TA 1V9DA 3SYZA 1IR1A 4B3SJ 1NJXA 4OZ5A 3ITHA 3VAMA 1WTFA 4CCHA 4QIWD 1G73A 5IM0A 1K44A 4OIXA 4MBQA 2PFVA 2GGPB 2QMWA 3K8PC 2DGSA 4ZS6A 4JI2T 4QIEA 2M6BA 4PXEA 2XS5A 2I6HA 1S6OA 1NDCA 2W2NP 1QVGR 3PACA 3MEKA 4QWEA 1XN9A 1S0NA 3FQLA 4LBHA 1MW7A 1Z1ZA 3PG9A 2PI4A 3ZT7A 4Z2XA 1DLOB 4IL9A 4U8VA 2Z56B 2VVSA 2QG9B 1D8ZA 2GX8A 2V8VA 1XNRJ 4OYBA 1CSJA 5B0BA 2BW2A 1YJUA 4HH1A 3DU5A 1FX4A 4JYAJ 1H72C 2K1RB 4C2MA 1Q79A 2ACXA 4RW4B 1TKDA 2FJVA 5KT4A 3NKZA 3EGVA 3RRGA 5KT2A 2IAJA 4WZQA 4DPOA 2PG8A 2Y1IA 3PHTA 4HEA9 1S0MA 3LBXB 3BB5A 3R5GA 4F8RA 4LFBT 4I43B 2BUNA 3HVTA 1NJYA 5CZVA 1KNRA 1OEDE 4B17A 2D1CA 1TVRB 3T1AA 1HNZT 1ELOA 3OTDA 3D28A 1S59A 4TY8B 4LF6F 2GV1A 4OX9T 4YDDB 3TUZC 4K4ZA 1CJTA 2CPZA 1JXLA 4G3IA 1UJ4A 1YJTA 2RNEA 3N0VA 5ETTA 4NLDA 5DLFA 1VK8A 1DU2A 3H2VE 1FCAA 4ZLPA 5D0HA 1MMAA 4ANJA 1RHRB 1RT4A 2MZSA 2U1AA 3PDYA 3CWJA 2NSCA 1SCJB 3PYEA 3CJ5A 4IR9A 3WIVA 1U4BA 5LJMA 2F7VA 1C4CA 2MQNA 5BR8J 2FLOA 2XI2A 4P7VA 2HBRB 3AEFA 4YHHT 3W8GA 4QOTA 5C2TA 2QA1A 5LBMA 3VR1A 4DPYA 1P9YA 5HATA 2FLNA 2FZCB 1FDBA 3TX0A 2AYBA 2MKIA 1N33J 2VL0A 3DM2B 2E5VA 5H6RB 1TUVA 3VQSA 2R8JA 4PG5A 5AXKA 4OMFG 4CQIA 3ILJA 1WEYA 3NWRA 3DLEB 2AF6A 2MYFA 1DTTB 3I0SA 4DS4A 4NWBA 3CJKB 1HWUA 3MK7C 1HG5A 2UVWA 1MWYA 2JQHA 3MPWA 5IUXA 3IWLA 1CS4A 2IJNA 1LV5A 4IG3A 3IAM9 1Q86T 2CHOA 3GFHA 3AOCA 1U6ZA 2XNQA 2ZH7A 4LRCA 4C3MA 1AFIA 3OTBA 4Z7YA 2WTFA 3SMZA 2V7JA 5FDLA 1Y01A 2UU9T 2MPKA 4DV6T 5LP6E 3MFIA 4UF0A 1W7WA 3T6JA 1F3FA 1ZM9A 1JLBB 4NYZA 1Y7PA 2YPZA 2B9EA 2MKKA 4EYHB 9RUBA 3BN4A 4YFUA 3RRWA 3RYIE 4JV5J 1U2CA 1RT6B 3B57A 1F5BA 4NASA 1BQXA 4Q2MA 2AQ4A 3KJNB 3GP9A 2KLQA 2MZ1A 1N5VA 4WU2A 4IYQA 4WFAQ 3TLSA 1JLGA 3L9ZA 3P4WA 3ONQA 1UL3A 5H1SV 1KOHA 1XQIA 5FL1A 3FSIA 1BR2A 2BV3A 2XY8B 4W98A 5F41A 1F0XA 1SVDA 4ALZA 3EICA 5J2UE 3VGUA 1CHUA 5E7OB 2HEKA 2GC8A 4HTEA 2YKPA 1T03A 4N76A 3FSYA 4X5TA 3OL6A 3QO9A 2MKCA 3NGRA 2Y8DA 3BR8A 3C6UA 4ECTA 1RISA 4MHCA 1E6YB 1A0OB 1FKOA 4ISSA 2VFTA 5IC4B 2C5KT 4P0BA 1MMGA 2ZE2B 1HBOB 3KYLA 3GG0A 4ES3A 2L8KA 4C11A 1XEZA 2XGPA 4A8KA 2MLXA 3CDWA 1KBRA 5D0RA 3CQGB 4EZHA 4DV4T 1NK6A 3RKGA 4HWCA 3NGKA 2I5JB 2DKOB 3KLHB 4O2AE 2PI5A 4F04B 4I6YA 4WKYA 3N9NA 5AQJB 4KKOB 5FY7A 2QMXA 4ZPDA 3SCKE 1IN0A 2YNIA 1YQHA 3ZZOA 4RNNA 4JV1A 3C16B 1HA1A 1CJUA 4ZK7M 3C46A 2UUAJ 1C2PA 2LKZA 3DLKB 2W0GA 3KUHA 5I42A 4AQYF 1NJZA 3M65A 4F26A 1NUEA 1R27B 5JDLA 1HQUA 3P4PA 4Y00A 1M5OC 4Z7CA 3GYGA 3KJFB 3QNUA 2ZZMA 1ULRA 5GADI 3P4UB 1S9FA 4MT1A 1RBOB 5DDPC 5EGYA 2IM1A 1TL1B 2KTQA 2WONB 2LMIA 2V68A 4ZN3A 4U74A 1J27A 3QC9A 4O3QA 3QIPA 4TLRA 1VFJA 3IFEA 1FDNA 5AJ3F 2RIJA 5ETPA 3WIUA 3CCMS 3NOGA 2KDOA 1NDPA 4K7QA 2DR9A 3AXJA 3Q5DA 5FVLA 4DPUA 2RUSA 4KHZF 2I6WA 2F1FA 3R5JB 2OPRB 5J1GA 3ETMA 5B0EA 4ECVA 4ASKA 4I6WA 2UUBJ 4IH7A 1OPZA 3I6PA 1CBKA 2JMHA 2JVRA 5E41A 3HSZA 1OQ3A 4EYYR 1QSYA 2GK9A 4U9RA 1PC5A 5G0RA 5AFUL 5JVDE 2CRBA 1ZTWA 4CI0B 1NXIA 3DLGA 3SSQA 4PNIA 1Q4RA 4BJNA 4PRFA 2N4DA 5HXHA 2FHJD 2C2KB 3CC4S 1WC5A 3JYTA 3CIZA 2G0UA 3Q8PB 5JVHQ 3LK2B 1FJGT 3RC3A 4OI1A 2LXUA 2UXBF 1PC4A 1I51B 3IWNC 4OJHA 1IVZA 4ZKAA 3K1SA 2I0XA 1S6PB 3NBPA 1RTHB 3N79A 2IDEA 3TRGA 3ZNJ1 1XMOF 1UVIA 3TYTA 4J5OA 3OTOT 1OMSA 3W5ZA 1U1PA 1JLEB 3GCXP 3PFEA 1SKSA 3O5TB 1XWLA 1ZS6A 2FY8A 4DFKA 4KBMB 2EXUA 3WBZA 5GAEU 2CPJA 2XNRA 4I0UA 1VIOA 4GO7X 3SSRA 1AROP 3PJWA 4IRKA 2GAGC 4LF2A 3MMBA 1WDDA 1IBMT 5JXSA 4DI6A 5AQSB 2HFOA 3RGLA 3BH7B 4FNIA 5KT6A 4XPCA 4H4OB 4B3RT 2CRLA 4K4UA 3G87A 1WHWA 1KVJA 2H7VC 1D3WA 2JDJA 3E01A 2DEJA 4DUYF 2ZM8A 1IKXB 4H9QC 2IDOB 3BN7A 1X79A 4USJC 1VDHA 4HR2A 5J1PA 1X8DA 3GIIA 3EX7B 2VG7B 2Z58B 3BQ0A 3C15A 1XJWB 5D3GA 2H5JB 2J47A 2V5DA 1WR6A 2CQ4A 2BJ8A 2JJ9A 1S4EA 1NK5A 2CM0A 4YHJA 1RTJB 2VUGA 4LF8F 3JCFA 3D2WA 2F8MA 3CCWA 3RAQA 1N5SA 2QE5A 2PEBA 1N5QA 4RW6A 3CF5Q 3PW0A 3DGVA 2BS3A 3W61A 3GR0A 4E98A 1IZNB 1X4FA 2V7KA 3NY0A 2LEAA 2NOXA 2VKHA 4YY3T 4JI1F 1JB0C 1U2RA 2OA5A 3AHPA 4USIA 3X1LB 4O4JE 3AECA 3V2UC 4A8QA 3JTOA 2CDQA 3KUGA 5DABA 5L3BB 1AT1B 2WAUA 2C22A 1VRBA 3OXFA 4KGKA 2FZKB 3J7Yq 4I7FB 5E5NA 5AQLB 1CULA 1XTZA 3DGPA 1NMEB 3V4IB 5FXWA 3MM6A 1PGZA 2XSFA 5LXTE 4L76A 3M6VA 4O4GA 4PJMA 2HMIB 2RF2A 3JADA 3IM9A 4JI5J 2FVQA 4X66F 2QYWA 5JDMA 3BSOA 3OXGA 3OYXA 4X4NA 4OV1A 3O3LA 3F41A 2PMZD 5KFGA 2HBQB 4DV1F 3IC1A 3M30A 3SV3A 3KLGA 2WM9A 1TKTB 4H9PC 5LMNF 2DNGA 4M5KA 1S49A 4TWHA 1IR2A 3HO1A 2PFFB 4IG0B 4F4WA 5KFHA 2YBVA 1DBDA 3GZ7A 4PK6A 1C1CB 4DMZA 1BQMA 2FHOB 4B9TA 1JJHA 3OVUA 5L3DB 3K8VA 1WOSA 5E3RA 2DR5A 1Y9OA 3SRZA 3ZTOA 5KFDA 5D4NA 4WXWA 5DQHA 4I69A 4DVDA 2IRXA 4ZCMA 2RDIA 4DR5J 1WHVA 2MQMA 3HJFA 1ACMB 3OBVE 3CJTA 4KHPT 2QT7A 3MOZA 2V9WA 1B0TA 3O44A 4ZPTR 2VDIA 4GIWA 3DCAA 3FBEA 3QLHA 1ZM2A 1S10A 2ABYA 4ERRA 1RCXB 2YWKA 2V0NA 1H74A 3NS7B 3I32A 1BD6A 5M4YA 4C7QA 1ZTTA 5A8KA 4A8FA 3I4HX 3AJ1A 4DG1B 1NAFA 4UXNB 2V4RA 4M5NA 2A2CA 1UKUA 5LL6d 3MACA 3C14A 1G2EA 4FP9A 3GSIA 1YBUA 4Y2AA 3FJ2A 4ECQA 2FC8A 4QIVA 1UTAA 3N9QA 5A76A 2ZJPQ 5L47A 1S5ZA 1XR5A 4FVCA 4KHRA 2KXNB 3JSMA 4B9SA 5IFMA 2Y0BB 3NWIA 2PDAA 2DHXA 4JI2F 2Z6EA 3RQWA 2KU7A 1AUDA 2X3GA 2ZNYA 3LF0A 3ISZA 2PC6A 3W5YA 1IJ6A 4ZS3A 3TWZA 5L9XA 3KK3B 2KJWA 3EVMA 4DSKA 1M7KA 1WF0A 2BKOA 4WBFA 1D1CA 5KFBA 4DF4A 4NA3A 3B5MA 4DU8A 4J9VA 1T7SA 2XC9A 2Z30B 4KFBA 3NRYA 3MUVP 3PO4A 3UCZP 5U47A 1D0ZA 3JS9A 4EV6A 2A9UA 4O0IA 2GO9A 3D1QA 2JMKA 3VAJA 2K1RA 4RW4A 4LFBF 1T05B 1FD2A 2CPTA 1NPPA 4NUVA 3A3PB 3Q89A 1KEYA 3RAMA 3AA0B 1HNZF 3RBEA 1KNPA 4KAIA 4OX9F 1YDLA 1X5OA 5IT0A 5F9LA 5T7LB 5HP1A 1O3XA 1DQ8A 4Z8XA 2L3MA 1Q53A 4LF7F 5C24B 2B1EA 1EJ7L 1RWUA 2GMHA 3FCHA 4COFA 1TVRA 8ATCB 2OLWA 2Y1RI 4DCPB 5AT1B 3FZHB 1N5YB 3LFMA 1S97A 1PG5B 2HVIA 3MEDB 5HLFA 5ABGA 3ZZZA 5C25A 1D8YA 1HX1B 1LK5A 2I0MA 4C0OC 2IA6A 3DTOA 4YHHF 1S0OA 5J1NA 1WJ9A 1TL7B 4ZP6A 2ZOMA 2YX4A 4PYAA 2G2OA 3VRAA 4CLWA 2KXHA 1GH8A 4DL6A 3M32B 2AW0A 3UD4P 2AJ4A 4N78D 4KTQA 3ENWA 3BYPA 3CTRA 3RYLA 5KFIA 4ED4A 2VHGA 5HBMB 3C19A 4NI2A 1E1HB 1JMTA 3CXCR 4EZ6A 1HR0J 1RT3B 3CD5A 3AE9A 3QAEA 3AE2A 1IR0A 1A6LA 3DLEA 1P9QC 1EHWA 4WFNQ 4DR4J 4ZPWR 3CJKA 3LH2S 5KFFA 3PKYA 3RYCE 2O66A 3EMTA 3MPVA 1H2UX 2OO4A 4A47A 1WUUA 1SA0E 2UU9F 2EBGA 2FJBA 4DV6F 4FBTA 2ZOFA 3ETVA 1S1TB 3TLUA 3BSAA 3M8ZA 3MJXA 2FVRA 3DYAB 4WW0A 1JLFB 2DGWA 1RI7A 3I96A 4OZJA 1US7B 2C28A 1S79A 2CWYA 4WBOA 2J76E 2YNFB 2Z4PA 3OFEA 4JI0T 4DV7J 2LXFA 1RLDA 3AB3B 1CC7A 1JJCB 5L39A 2O67A 2NSBA 2N3OA 2H65B 4X4VA 1MMDA 2JPFA 4GC6A 3R2CJ 4U2ZA 3ZN1B 3AA6B 1ZAWA 4YP3A 3K59A 1D0EA 1U6BA 3W63A 2ZH4A 1CVJA 1RT6A 2N82B 2WMNA 4K2XA 2VBXA 1W09A 1ZV4X 1FIOA 5LXYA 2QL9B 5FL0A 2Y0SD 2V8DA 4CLZA 2L9DA 3VWSA 2VIHA 1CJKA 4WXOA 2K7JA 1C0TB 1O8BA 1WG5A 3F73A 4Q0BB 2B7CB 1TR0A 4UUWA 1VBKA 1K73T 4WIQA 1KS2A 1FE0A 3Q86A 2ASYA 5CQGA 3V4MA 3HT0A 1JIHA 4CO5A 4B9NA 1NDKA 4TKTA 2JZ5A 1FJ7A 4ZI7E 2J62A 3PUSA 2YNHA 1R0AA 1PAEX 4CN4A 4OLPA 2W8KA 4FPIA 4RNMA 1VQ5S 1HNWJ 1B64A 2E5LJ 4DV4F 1E6YA 4EXTA 4C8OA 3UE2A 3GFZA 4R5PB 1FESA 2ZE2A 1NJWA 1T8BA 3GJTB 1ZZFA 1AJ3A 4BA9A 3FZ2A 4Z90A 2WBLA 4J9PA 3K5NA 2WCAA 1IJ5A 3AB2B 4ELTA 2E5HA 3GV8B 4IOAQ 3UU8A 1ZP0A 3PUVF 3KLHA 2DI4A 4FXDA 2ZUAA 5B7WA 1ZA1B 1Y64B 4CTAA 4V1Ak 3M8QB 2WZHA 2KFNA 4FYVB 1FRMA 1HQ2A 5E33A 3G4SS 2ILZA 2MKSA 4NLSA 4ZCIA 4GO5X 1RKJA 3JQJA 3DLKA 2RB7A 4ZP7A 4NLYA 5KFYA 2ZH5A 1W0BA 3BK9A 3H3AA 1NBEB 3BPSP 3K5OA 1N34J 1L0VA 1S12A 4IE4A 3I0OA 1RWNB 3LWMA 2K24A 5FXVA 4OX7A 2QZ8A 2RP4A 5LOQA 2WONA 4J91A 2QL5B 4NX9A 3JAMY 3Q22A 1X5PA 2JHEA 4AL7A 3UN5A 3R7BB 2GMLA 3K7RA 5A8WB 4IDZA 4FKYA 3DRSB 5CZXA 3ZC0A 5FYMA 5FVKA 2ZITA 1PYOB 2MTQA 1YRUA 2KXFA 1FXRA 3T19A 3UW1A 3I0RB 4PAGA 4ZZCA 1RSCA 2OKQA 2VG6B 4ZVQB 4TWFA 5CYMA 2ADBA 1PYSB 4C6AA 3K89A 5HSPA 4YN3B 4GOUA 2C2EA 3M9NB 1MN7A 3RBZA 2C42A 1VLYA 1VLOA 2FC9A 2LDIA 5ABEA 2V5HG 3QT8A 2DLRA 1PJ6A 2EC0A 1R89A 2OTLS 5HEHA 1S77D 4NCGB 1FJGF 4L72B 4LR9A 5D6GA 2CNNB 4OYJA 3AXKA 4ECRA 2L08A 1LWFA 1NRKA 3BKUA 4IL4A 1FK9A 2UUCT
chains in the Genus database with same CATH topology
3L4BC 1XWMA 3KXDA 2OGUA 4GVLA 2OLTA 4L73A 2IIUA 2BKNA 2AEFA 1VCTA 3L39A 1SUMB 2BKOA 1LNQA 4G65A 4J9UE 2AEMA 4YS2A 4Q25A 4RO0A 4XTTA 2BKPA 3RBXA 4J9VA 4J90A 2AEJA 2FY8A 4L74A 4EI2A 2I0MA 4L75A 1T72A 4J7CA 4J91A 3RBZA 1T8BA 3JXOA 4L76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4B C;  1XWM A;  3KXD A;  2OGU A;  4GVL A;  2OLT A;  4L73 A;  2IIU A;  2BKN A;  2AEF A;  1VCT A;  3L39 A;  1SUM B;  2BKO A;  1LNQ A;  4G65 A;  4J9U E;  2AEM A;  4YS2 A;  4Q25 A;  4RO0 A;  4XTT A;  2BKP A;  3RBX A;  4J9V A;  4J90 A;  2AEJ A;  2FY8 A;  4L74 A;  4EI2 A;  2I0M A;  4L75 A;  1T72 A;  4J7C A;  4J91 A;  3RBZ A;  1T8B A;  3JXO A;  4L76 A; 
#chains in the Genus database with same CATH topology
 4EWT A;  2MJU A;  3PUA A;  4