2BKOA

Structure analysis of unknown function protein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
b'YEPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLEGVELHPVIKETILEGEEIIGKIQVYPESVIVGKTLGELDLATNTGVWIIAVRRGKRWIFGPNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PH0236
publication title Crystal Analysis of Putative Potassium Channel Related Protein from Pyrococcus Horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Hypothetical protein
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01895 PhoU PhoU domain
A PF02080 TrkA_C TrkA-C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphate transport system protein phou homolog 2; domain 2 2bkoA01
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 2bkoA02
2AEMA 2I0MA 4EI2A 4G65A 4Q25A 4GVLA 4J7CA 4J9UE 4RO0A 2AEJA 4XTTA 2OLTA 1SUMB 1XWMA 4YS2A 2FY8A 3RBZA 4L76A 2BKPA 1T8BA 2AEFA 4L74A 4J9VA 4L75A 3L4BC 3RBXA 1VCTA 4L73A 2BKOA 2IIUA 1LNQA 3L39A 4J90A 2OGUA 1T72A 3KXDA 2BKNA 4J91A 3JXOA
chains in the Genus database with same CATH superfamily
4RW7B 2ZUGA 3ITHB 3MAHA 2D9OA 4TNWA 4TYBA 3W61A 1VJWA 5FL1A 2PSZA 5JJBA 2BOAA 4CLLA 4DR4T 3C2PA 3OV7A 2X7IA 3IG1A 2CA9A 4WZMA 2PBIA 1NDKA 3ISZA 3KLHB 4IGUA 2IYGA 2YNFB 2JVRA 3IN5A 3OL8A 3IWLA 3KMSA 3K59A 2RPAA 1YJTA 1XR6A 3DLEA 4ILMA 2R4FA 3IP0A 4PRFA 2BMBA 1FI4A 4KV8A 1APSA 1HARA 5AXLA 5H9FJ 2Y1RI 2E1CA 1U24A 5BR8T 3IXQA 3VGVA 3PVXA 4HWHA 4CO0A 3I82A 5L9NA 1AUDA 1MW7A 1Y9OA 2XAJB 3R6NA 2NSBA 3B8HA 3CB4A 2VA3A 4DR3T 1FKOA 1FCAA 1XNQJ 3BDEA 3V6DB 2K3WA 5D3GA 2K1RB 4A97A 1S9FA 1HG5A 1P8GA 3T8OA 3W63A 1FE0A 4NCBA 4M1PA 2HYIB 2Y8DA 2XLIA 1NLKL 3JC6D 4K0KF 4ZVQB 2R7WA 2JQ9A 1ZKEA 5BYQA 4J9OA 5KTQA 2XQ9A 3DOKA 2CA5A 4UUWA 3RIFA 1VHFA 2ZWOA 3CDBA 1RAAB 4LMZA 4IE0A 2AJQA 1OWAA 3AE4A 3RIUC 2A18A 1Q5YA 1RDRA 1FKPB 5L46A 1X9MA 1T7PA 4YTNA 1J5ET 3EGWB 2VBYA 3IA3A 3J7AN 1T9VA 4F67A 2W67A 1TL3A 2DH8A 1Q1KA 5KFBA 1V5VA 2E1PA 3RTVA 2WSSV 3JSRA 3J80Y 2GJFA 3M1VB 3JAFA 2UU9J 3FGVA 3A12A 4JYAF 2RH3A 1N5VA 5M2PA 2MKHA 2C3PA 4RWXA 3CMLA 2YWFA 5G4DA 2NUHA 2PFDA 5L38A 1MNDA 3UU4A 2CDQA 1XWMA 5JDGA 2VDHA 2R42A 3BSNA 3BYRA 2HHWA 2P9EA 1FK9A 4C2MA 2R2RA 5FY1A 2F4VF 3DI6A 4CN1A 1CC8A 2XQ8A 5CYQB 4DVDA 1MG7A 2ZC4A 4C0HA 9ATCB 2BW2A 3HSGA 4O3OA 4GRSA 3R27A 2C5IT 2NZCA 3IA0A 3T1HF 3RAMA 1ZYQA 3QJPA 5GADU 1S12A 2JX2A 4HEAA 4B9MA 4EZHA 2CJAA 2XCPA 1YBTA 3R97A 4FKYA 5IQ6A 1TP7A 1KLMB 1PBAA 2RU3A 4MJKA 2V67A 2WVBA 2XS5A 5ABFA 4PNIA 1N5SA 2CNOB 5JVHQ 4OZ3A 4N8OA 1BWVA 2OP5A 3ZYMA 1S1VB 2ZHAA 4FN5A 2Z56B 4DUYT 2XYGB 3HHLA 4H4KC 3PUZF 2MPKA 2BW7A 4C3KA 4X4NA 1BD6A 2V8DA 4QIGA 5M2RA 4JI1J 3HDSA 1CQNA 2DNNA 1IKWB 1N36J 4DV3J 4JI4F 2BVLA 1FD8A 2F8EX 3J81U 3CCTA 2LE8A 4ANJA 3VTIA 3IEEA 3E08A 2FGCA 4QIFA 5THWA 1U0HB 1VQ4S 3AT1B 1HFAA 1WC6A 4LF4T 1FJCA 4ALZA 3PUWF 4GVLA 5FY0A 3WC2A 1D8ZA 4NA3A 3HT3A 1EZ3A 4OJHA 2UUBJ 4HFCA 2C2MB 2DO0A 3RZAA 2JRKA 3RRGA 2MJUA 4HYKA 2QA4S 2X9HA 3MXHP 1S9EB 5AQJB 2OMOA 2EKYA 2DEJA 3CQXC 2MKCA 4IQXA 3AOCA 1AFIA 5C42B 2A2CA 3T5JA 3BGRB 4LF9J 2IUBA 1RT3A 2ASDA 1I94T 5D4NA 3TUPA 2ASJA 2CPTA 3K17A 1BR1A 2NXNA 3K89A 4JI7J 1EQ0A 2QMXA 3TEHB 3ETOA 5JDMA 2MZTA 1Z0PA 1GMVA 2RKIA 4DV1J 1ZM9A 2JC0A 4ES2A 5A0YB 4AQYF 5AQQB 1AA1B 2WVFA 1DLOB 1BQMB 4DQPA 5J1NA 5FXXA 2N4CA 3VGTA 5CABA 1VRTA 4DCOB 3ENAA 4YEAA 2DNMA 2ZBIA 4LSZB 2HK2A 4JI5J 3KLGA 4EK2A 4IOBA 3MEDA 4DCPB 1W7WA 2ASYA 4H63V 3PM9A 3MXZA 3PKMA 1MMLA 3ZTSA 4YDDB 1IR1A 3OPCA 3BH7B 3HHEA 3C6TB 5DABA 3TZWA 5CCLA 1T03A 1HNVA 2KXPB 4GIWA 2O01C 3BBCA 2VVSA 1LW2B 3BV8A 1AFJA 4RBVA 3TUJC 4C8KA 4FF3A 5CQGA 1OPIA 1REVA 3N9MA 4DS4A 3N5FA 3DKDA 5TAOA 3CO0P 2WONA 2EHOB 4M1KA 5HQMA 3P4PA 5GAEI 2DGSA 1L0VA 4WK1A 4DR7T 2F7VA 1WEXA 1LFWA 2AYBA 4X4OA 3ZMUB 1NH7A 1GTEA 4B3SF 3D66A 3H5YA 2CWOA 5J2UE 3P50A 4WYLA 3ET6A 4MALA 2B3TB 1Q95G 4QIVA 2LEHA 3KK1A 4DSEA 2WB4A 3ZLIA 2BZBA 4TYAA 3CD5A 4DV6T 3GCXP 1LVKA 1FFSB 1ZM2A 3M8RA 2Q43A 3MZIA 1VRBA 2LEBA 1JLCB 2CPIA 2M5YA 3CMES 2I1RA 3UFEA 2RQKA 3SFDA 4GYRA 2NCKL 1MN9A 5LP6E 1VQ5S 4A47A 2XSFA 4YDXA 2EC0A 5FD1A 2YKQA 4ECWA 3MECA 3QNUA 3Q5XA 4RR5A 3GP9A 4MFBB 4LFBJ 5DJQC 1KVKA 1AYEA 4IG0B 3IRWP 2Q6BA 3QOFA 2BX6A 4M5JA 5AE1A 3FBLA 2PFVA 4ED6A 4UY85 2P6SA 2CZ9A 2HHSA 3LP0A 3U3IA 4YHJA 3NXZA 2VPXB 4I1TA 1URRA 2YWKA 3MZKB 5I3UB 1UUSA 3V5UA 1BUXA 2LXUA 4GKJJ 1XMBA 2MLYA 2XB2D 2VBXA 4NIQA 1NSPA 2B56A 2PMWA 1I51B 1FVSA 2IVMA 2HRYA 1XIQA 1G73A 5KFAA 4ED8A 3EUHA 4PQUA 3HFZB 4WE1B 4LJMA 3A8IA 3CJ5A 2DHSA 1VQPS 1IBLF 4ZA1A 2V4QA 4V19X 4NE9C 3Q8SB 2HVZA 5ETLA 1FWKA 2ODVA 1OJ4A 2I2YA 4UV9B 2M3DA 4K7QA 5CYMA 1HX8A 4URQU 3BJYA 3X1LB 1D1CA 1MWYA 5KG5A 2BV3A 1TL7A 1E6YA 1SC1B 3TJ8A 4JI8J 2AU0A 2EHOD 4IE4A 3B4MA 3CDAA 1NK9A 3HSZA 1LWFB 4FF2A 1T94A 2LOSA 2MKYA 2XWXA 3OTOF 1HHQA 1SA0E 2LLYA 4OZ0A 1FXRA 3VAGA 2YOEA 3IC1A 4ZI2D 2B76A 1RT1B 2CAJA 4AUKA 3HL6A 2N1GA 1M90T 4WP3A 2I59A 4F4AA 3UTKA 1T9YA 1UEVA 4U7CA 4CH1A 4P09A 1B4SA 2EBEA 4PG8A 3TZZA 4B9LA 3D0TA 5AQIB 2DCLA 4J9NA 3H25A 3MEEA 4LF7T 2KT3A 3W7BA 4DV2F 3S1TA 4DXLA 1RAHB 2NW8A 3TNVA 3L09A 2IC6A 1JXEA 2W2MP 2H5EA 4X4UA 2HVIA 4HDGA 4J9KA 4A8MP 3GSDA 2XC9A 2CIMA 3DNCA 1H7WA 3MI7X 4JLEA 3GFXA 3M30A 4K4YA 3N9LA 2J9DE 1VMBA 2ZH3A 1RUSA 2ZH2A 1SI9A 3PURA 1T98A 1YJVA 2D0TA 4O4LE 1YQ4A 2DRDA 4F4XA 1QD1A 3HVAA 1A0OB 2UXXB 4ZPAA 1Q7YT 3N0VA 4TKTA 4DR6J 2I5JB 4WKYA 4HFIA 5CJ5A 3TANA 4MIBA 4G6VB 3ONQA 3TLVA 3SCKE 4QKNA 1RP5A 1HQUA 5KX5E 2EKNA 2I0MA 4NLQA 3MR3A 2QFIA 1SQEA 2DRAA 5F9NA 3PCOB 1SIZA 5DG8A 1U6FA 3LALA 1DTTB 2CKWA 4MKBA 1CLFA 1TL4A 3BEGB 2CPHA 2W00A 1OEDA 3EE3A 1HR0F 4TXSA 3CIRA 2E66A 2VURA 4QQBA 4X66T 4K5SA 2R7UA 4KBMB 2ZZMA 4EYUA 1R0CB 3W64A 4WFYA 3HKDE 5F5WA 3SWHA 2ZOGA 5LXYA 3ZMSB 4PG7A 2HNZA 3FC9A 1RTIA 1RTDB 1I1GA 2F1FA 1J27A 4L6V3 3M8PB 3VCDA 3HLUA 5EK3A 5GONE 1ZETA 5E2QA 3HXMA 2L9DA 4LBHA 2GV1A 2HHVA 4PG5A 5EX3A 4NUVA 2V7LA 3MD1A 4Q0BA 5IM0A 5K8MA 1HFEL 5KFYA 2FJWA 4URGA 2CPJA 2GHPA 3G96A 3EXYA 2HNYA 3LP1B 3UNYA 4P9SA 5JREA 4JI2F 1NZ8A 1TK5A 2QN6B 2GS8A 2VA2A 4TZ4C 1VFJA 2QA2A 1T8EA 1XWLA 4KKOB 3Q2TC 1HBMA 4A8YA 1SXLA 1C4AA 2DISA 3W15B 4MKVA 4NPOA 3POTB 4DR2T 2QZ8A 3H2UB 3MKDA 4LRDA 1ELOA 1BQXA 3RG6A 1RT2B 3M6XA 2XAFB 2RU9A 3CVKA 3NVOA 4ZP8A 3GILA 4NLSA 1RWNB 5LGUB 3LPYA 1P27B 1HQEA 4KHPF 3BQ2A 4HH1A 3HJVA 3AY0A 3DRSB 1TFWA 1ITPA 5HWYA 5LMNF 3I9WA 1URNA 2P9GA 1TUWA 2XWYA 1NAFA 1VYAA 3M32B 3SSQA 2XMWA 2NYHA 1HYSA 3I4HX 2RD5C 4WU3A 3EGZA 1LWCB 4CCHA 2DNZA 4L9IA 2HPUA 3H2VE 2Q9QC 2BS2A 5FNVE 3GSIA 1S6OA 4AL7A 4LSLB 2E7WA 2HQFA 2CVEA 1G3OA 2PIIA 2J7WA 3AE5A 3GWHA 1X4GA 3BSCA 1KQFB 4FXVA 4ERDA 1PYTA 1X4HA 3GMIA 1NZAA 4CLWA 3RW6A 3SDEB 1NDCA 4PR6A 3OFFA 3CXCR 2Y3YA 2LDYA 1FDNA 3PU3A 5HYAA 3UD4P 3HO1A 2W25A 3EPGA 4RKUC 2UUCJ 4IDZA 3JTOA 3BN4A 2MQPA 4RNHA 3H3AA 1UVNA 1NJIT 2JH3A 4DFPA 4RNNA 2B4VA 3VAMA 3KWMA 2RRNA 2Q66A 3QGPA 3F57A 3RYHE 3T1AA 2ZH4A 4DV0J 4DQQA 3U02A 3K3NA 5FKYA 4B6XA 4AL6A 3DRRB 2FJAB 1Q8KA 4K0KT 3RQUA 2GHVC 3GJTB 3PIPQ 3Q23A 1OQ6A 3HVTB 2LECA 1JX4A 3W9JA 4TX5A 4BJNA 3FBFA 2P5VA 4A8KA 1NNDA 1DARA 1JKHA 5E5NA 3GV8B 1FRIA 1LOUA 5HL7Q 4JI4J 3D0HE 3AQOA 2FLPA 1Y11A 4O0NA 5K14B 2XQ5A 4P71A 5ETTA 1H2VZ 4EO8A 5DM6Q 3EVOA 1RTJB 3V81B 4OX6A 1S79A 3Q2SC 3P4WA 4K4TA 4I0WA 3KKFA 4HWFA 4JYAT 1R31A 3H7HB 2D9PA 1S6QB 2XGQA 2KB2A 3HHDA 2LSJA 3PFOA 3V6KA 3MFHA 3M8YA 2QA4G 1SL2A 5C24B 2GVDB 2HHHT 3KFWX 2F4VT 3MR2A 2UXDJ 2KM8C 3BSOA 3TWZA 3TLSA 2HPJA 2F9DA 4F36A 2H4YB 4WFNQ 1B99A 2F5GA 4IH7A 3M7VA 4QWAA 1U8WA 3DLLQ 3K3OA 4ZP6A 4OYXA 3N6NA 4UELA 3T1HT 2V8VA 3GR1A 3O6QA 4XAXB 5K8PA 3M65A 4DL6A 1UVIA 1EETB 2B43A 4H9SE 5JQGE 2Z4PA 2VG6A 3NMAA 2J7KA 4EEYA 3LGMA 1ZV4X 4BCAA 3MACA 3UWTA 4YLHA 4QH4A 3FEZA 3EJMA 5AJ3F 2MXYA 3KK3B 2J9CA 3AEDA 4COFA 2QYWA 4DMZA 3IR7B 2OA5A 5C5JA 1QAYA 2ZFHA 3NAHA 4CRJA 4ZDNA 3AJ2A 3G9CA 1RADB 4YQWA 2WRMA 3AE1A 1LFPA 4ZLNA 1X5SA 3OJUA 1HWUA 3KLIA 1G2EA 4ELVA 1GMWA 3KV4A 1KEKA 1FX2A 1DQAA 4X4RA 2M2BA 3EGNA 1N52B 4WCEQ 1S76D 2C2RA 1IKVA 3RHWA 1YJUA 5LSRA 3T41A 3LW5C 4A8WA 2ALZA 5KOWA 2QSFA 5AT1B 1X9WA 4HHJA 1IQTA 1UW9A 4NI2A 2ILYA 1X79A 3ABVA 2XGPA 5HQ8A 3I5CA 5AQLB 2E5LF 3DGVA 2LEPA 2V8GA 4DF8A 4U7YA 5LXTE 3ZJ2A 2DI4A 2LU1A 1HHTP 1UEKA 1UKUA 2DVIA 4LF1A 4MH8A 4TWHA 3AH6A 1X4DA 2RVJA 1HWLA 4RWWA 5HEJA 1TKXB 4Y6IA 1VQOS 2IW5B 1RBOB 2E9XC 5JDHA 1V9DA 1OS5A 2YPZA 1Q8BA 1BR4A 1IWGA 4AQYT 4I50E 5D0EA 3W60A 1KQSR 2WMOA 3J7YI 4J2CA 4OYOA 2BG9E 3MURP 3GIJA 3R84B 2XQCA 1EHWA 3A5XA 2CJ9A 3Q22A 4U31A 4QXBB 4WBOA 1ZA2B 1SPBP 5H6RB 4H4OA 4IH5A 3UT5E 4TQSA 3BBBA 5A76A 1SJ3P 3UDLA 3PDYA 3LO3A 4FBTA 1G6BA 1D09B 1LVFA 5CCMA 3D1HA 3NL0A 2MPUA 5DG9A 5LA6E 1KRPA 2CXDA 2WU5A 1QUPA 1ZOYA 3QWPA 1HBNB 1UFKA 1YX2A 1Z4UA 2WBLA 5J2MB 1SE7A 2YDRA 2AXDS 2J47A 2V7KA 1UX5A 3OR1A 2WSCC 2AEJA 2WW8A 4YY3J 1NJYA 3TLWA 5KMGP 1XC9A 4ZVFA 1JWWA 4ICLA 2WOMB 3NRYA 2C2NA 3U1MA 2HHPA 3CC4S 3PUVF 3MEGB 3MMCA 1OQ3A 4B3ST 1EX8A 3JQKA 1IBMF 2HFZA 3NGDA 3ZN0B 1S7HA 4IDOA 4UY8T 4RJVA 1BLUA 3LANA 4TU7A 1N0UA 2JQQA 1YRXA 2W2QP 3P49B 3W62A 5IXUA 2FJDA 1VQ8S 2XQ3A 2AEFA 3E0ZA 3I31A 2NP9A 1E6VA 2PMHA 4UVBB 3F73A 2UVWA 1XNQT 3AVRA 4ZK7M 1XERA 4CN6A 1NUEA 4UXNB 1MROB 2QGSA 2KLQA 3TJ9A 4LF8J 4D3GA 1X4FA 3C98B 2YNGA 3P4SA 4USHA 3IWNC 4TV9E 1UWBB 1N6QA 5HVGA 2CJYB 1S0VA 5KFQA 5G0RB 2MTQA 1QJHA 3OLAA 3AXKA 2EXUA 2HFOA 1MMDA 4XTTA 1FJEB 2QGFB 3OSPA 4KO0A 5HQLA 3DLGA 4ZVGA 3ZZUA 3RB3A 5DQWA 3DTOA 4B17A 2R9LA 2IMWP 3BO2A 3UQSA 4HT5A 2LVWA 3EI0A 4BWJA 4CTAA 3QT8A 2K06A 2DJWA 1WC0A 2IM0A 1FRXA 2M67A 2ALYB 1IBCB 3IS9B 4WFXA 3WIVA 1YJ7A 2R7QA 3WX8A 5LHHB 3GZ7A 4L76A 2CADA 2W9AA 2J7UA 4ZS3A 1N5YA 5B0EA 3QT7A 1HI0P 1WC4A 2B0GA 1IBLT 3H42A 2E7VA 1QLBA 2ABYA 3J7A1 1BQNB 2W63A 2XASB 4LMLA 5A8KA 3SS1A 2JLGA 2OTLS 4LREA 3MM9B 3FZ2A 2HZAA 3MMJA 2RUGA 3P5TL 2LLZA 4PABA 3KK2B 2QMUB 3U27A 1TUVA 3T1YF 3ZO7A 3FK4A 3BPDA 3T9ZA 3PJAA 4ZS2A 3G82B 3OTOT 1X5PA 2KSRA 2WTFA 3QFWA 3MPYA 4EBDA 2HWIA 5A8RB 2ZH9A 2LHNA 2OEMA 3J81Y 8RUCA 5LMUF 5FP3A 1FXDA 5HROB 3K0JA 4H63H 1Q0NA 2WAUA 4PK4A 2IAKA 4WYVA 3L3PA 1FNXH 3N6MA 4WF9Q 3AJDA 1RT4B 3NOGA 3LBXA 4B02A 2R7SA 2J5AA 4YR2A 1XMOF 3QIDA 3A13A 3ILIA 4DV2T 2WZ1A 2ZEJA 2VH7A 4YHHF 4IDPA 2EEYA 2HMIB 4NLWA 1HHSA 4UR9A 3PYDA 4GMKA 1X0PA 3JQJA 2ROPA 4YJ3E 1F3VA 4DV3T 4MYUA 3QSIA 3G06A 3ZNJ1 5LM7E 4QH1A 4Q2LA 3D5MA 3QUJA 5IYZE 4ZOSA 4EGWA 5B0CA 2K7JA 3KDSE 2I9SA 1QSYA 3CJ2A 3MMAA 3ZEFB 1MLAA 4DX5A 3A1YG 2J8AA 4RU9A 3N01A 1IJEB 4ELTA 4F0HA 3C14B 4HFHA 2FLLA 1U6BA 3US5A 3J7YU 4EZ6A 2HBYB 2BYCA 2DNXA 3BQKA 2HZVA 2RDJA 2GVZA 3V4IA 2W4CA 1QE1B 1RISA 4HN9A 3K3QC 2VQFF 1HR0T 3UNGC 4LRAA 4HFEA 4MLKA 1JLAA 2Q9QB 1RWOB 1FESA 3GB0A 1H2UX 3QIPA 1N34F 2ZM6T 2IC3A 5LOVE 2R8KA 5DM7Q 4AE5A 1H7CA 1EAYC 2GC8A 2R7TA 2AQ4A 4OYKA 5KG7A 3ZZRA 4IYQA 3FRYA 1T05B 4O3SA 2AT1B 5D0HA 2HWTA 4UVCB 1QVFR 4L0RA 1EZZB 4F2RA 3CULA 1NKEA 3UDVA 2V9KA 2H88A 4O4IE 5JDQA 3OTCA 2P2CB 4NLXA 1L3UA 4UQGA 4IDKB 1VQLS 2HG4A 3N5LA 1ZM4A 4OYWA 3UN5A 2QSWA 4YB1P 3RGIA 2C5JA 4IG3B 3HD1A 4JI2T 4CIOA 2DH7A 3CCJS 5IZHA 3DGPA 3RRWA 2OPPA 3E01A 2I38A 1X4CA 4U72A 3NWRA 1IQZA 2FY8A 3AD8C 2J1DG 2YBVA 3HMJG 1ICEB 4O0IA 3P5BP 4AL5A 3D0GE 4NEYA 4PUOA 1IJ6A 3G6ES 1MWZA 2LXFA 3PX4A 3PKYA 2LSYA 3LG7A 3I5BA 3H98A 4KHPT 4CLUA 4W4MA 4CLYA 4LRBA 4FYYB 3KUEA 1IR2A 2XQYA 1K1SA 3FZMB 2KNDA 2FVCA 4P2SA 2QRRA 1RT6A 2MKKA 3CCLS 2DL1A 3M2VB 3KYLA 3UUBA 5LG4A 3OL9A 1KFDA 4JV5J 3LK3B 3PDNA 2R8IA 2DNLA 5FVKA 4EEDA 1C2PA 1KNPA 3GIRA 2MDAA 2MLZA 1LW0A 1Z2LA 5E3AA 1CJKB 2XO7A 4NMXA 8AT1B 2VFRA 2FVRA 1VK3A 1KC8T 1U25A 3IRXA 2KHCA 4FYDA 3DDNA 1RQ0A 3UFCX 2KM8B 1S1WA 1CJUB 5DDOC 5C2TA 1S1TA 2HHUA 2Q9QD 4Z91A 4OJ1A 3MOZA 3PW2A 3S8SA 3H20A 2DYAA 1YXRA 3HR0A 4DMVA 3DM2B 2VL1A 1D1AA 4RBUA 4P72A 3I55S 3TX8A 2HRUA 3HSJA 1UVJA 1W2BR 2LEAA 5IV3A 3JSBA 3MPUB 1D0XA 1PJ7A 2ZC3A 3NNAA 3EX7B 2AX1A 4CXYA 3OVUA 1DHMA 2KZMA 3VAJA 1MU2B 3CSKA 4YS2A 1T9UA 2OPQA 5CZVA 3MM8B 4PYDA 2CDRB 1B7FA 3OTEA 4KP3C 1JLEA 4DV4F 2J4GA 2KRRA 2DB1A 4QWNB 2HQCA 3N2GE 1NU4A 1VC6A 3DOLA 4CI3B 4UOGA 3ZC0A 2XM1A 4JI6J 1I5OB 3ISNC 1DQ9A 1BXNA 1W25A 1AT1B 1N48A 3CT9A 3AFGA 3SIPB 4QR2A 1PJ5A 1SVDA 4HFVA 2CQHA 2Z6EA 3FHNA 4B9SA 4NXMJ 2HS4A 4J9SA 3NBXX 5JRCB 4ED2A 2W9BA 3C15A 2J9DA 1VGYA 5AQNB 2MZJA 4ZITA 2VBZA 3W8PA 1N54B 3JCFA 1BMQB 4QX8B 5C25A 3Q5EA 1MWQA 1U4QA 4KHRA 3N6LA 3T5HA 2F8MA 2DXEA 5L3EB 1R8AA 3OL7A 2VFVA 1NHVA 4TY8B 2JEJA 2AYEA 1M5PC 3KDOA 1B0TA 3OJSA 4W98A 3QLHB 3LQVA 1NK8A 2NS1B 2G2ZA 1HBOA 4LF5F 2L3LA 1DQ8A 1BR2A 2NOXA 1KTVA 3QT5A 2SPCA 1F60B 2AE9A 2DEIA 2ZDPA 3LF0A 1HI8A 2QIFA 3OYXA 5C8YE 4ZVEA 5FDLB 4I4BA 3FMWA 4DR5T 5IC4B 1PKUA 3M6UA 2W7OA 2E9XB 2R8HA 4X4SA 2A0FB 2AJ0A 3OBVE 1G4CA 1R27B 4XDDA 4IHJE 4EFAC 3CCZA 1K0TA 4HWCA 4Q8FA 5B09A 4LF6T 3A3NB 4M95A 1HNIB 1E7PA 3W5XA 1M1HA 2BKOA 3KBUA 3CCES 2LQ8A 3ETMA 3RUBL 5HCJA 1J2VA 3ETUA 3EZOA 1JJ4A 3VAFA 4YXDA 2CPXA 1VRQC 2DHGA 4IT4A 4ECVA 2YTCA 2PI4A 5GAHI 4C0BA 3UVJA 1ZHCA 2DIVA 4L73A 2RRAA 5JXSA 2NWBA 3I32A 4YSXA 3OTBA 4A8FA 1FIOA 4PPDA 3PIOQ 3DXBA 1WACA 2FGOA 2ZWPA 3BGUA 1KEYA 2YH0A 2UUAF 4IFVA 2VPZB 1HKAA 2H48B 3PJAJ 3RU0A 1FDDA 5HATA 5T7LA 5DGAA 4QCLA 1OY8A 4A98A 4DX7A 2V68A 3NRBA 2CJBA 3ZJ1A 3HI2A 2GO8A 3G87A 2E2AA 3ANWA 4ATNA 2KXNB 4DQRA 3KJVA 4K0UA 1RU1A 3HULA 2HIQA 3VRAA 2DR8A 2E5LT 3MAAA 1U0SA 3CJQA 3E8OA 5B7WA 5ITHA 5I3QA 1MNEA 2WB5A 2Q3PA 1JLBA 3NOCA 4Q7AA 2FJBB 5IT9U 1X7VA 3AJ1A 3TAPA 4Y2MA 1S7IA 1HPZA 3J7Yq 3ONJA 2GK9A 2DXDA 4ANDA 2LKGA 2RILA 4JI0F 2MKIA 3P8CD 3J81j 1B7YB 3KV9A 4KX6A 4URSA 4Y0FA 2CPZA 4B3RJ 4FZVA 2BRKA 2U1AA 1VJQA 2K3IA 1YI2S 2RB7A 3R5JB 2F9JA 4WJBA 2E9XD 3RYCE 2CWKA 2AEMA 4NLYA 2YH1A 5L3DB 2GFFA 1S97A 3JTNA 1J5EF 2X9YA 1XNRJ 4OLOA 3OVBA 3QMQA 3Q8UA 2VOPA 5JTGA 2JEFA 5KFCA 3QZ8A 1F5BA 3LP2A 5E41A 1ZM3A 4KSEB 1UFLA 1CBKA 4X65J 2VU5A 2YKOA 5EDWA 2QG9B 3CCVS 2BBHA 2HGMA 4JEHB 3HKCE 1VRUB 1YGYA 1DTQB 1WC1A 3FBBA 3O44A 4NLDA 4OZ5A 2X0LB 5E3CA 5FVLA 2LRLA 2CZVC 2E5GA 4M5DA 4JOUA 3NMRA 3EPIA 3G8QA 2NXUA 5DZ7A 2XAGB 3FBZA 2R8GA 1A7GE 1XBWA 4KFBA 5KFEA 3M2UA 1FXLA 2AYMA 3OVSA 3KHLA 1OWXA 2UUTA 2YKAA 3DDKA 2EVZA 2CRLA 4I7FA 3WC0A 4X64F 1B0PA 2J6TA 2KKHA 1Q79A 1N32J 1TL1A 1KNRA 2VG7B 2AJ2A 4ZVTB 2A6MA 4DG1B 5L47A 2A3DA 1IBMT 2XZTB 3AXJA 2M0GB 3GCWP 4HH0A 5L1KA 3BR9A 5CXTA 4X1IE 2VK9A 1U8SA 2HZCA 4GKKT 5ETOA 4BBYA 2J6SA 2K9AA 3VR9A 1KNZA 2UUCT 2IM1A 3OR2B 2DXFA 5ADZA 1HCIA 1WRDA 5RUBA 1GMUA 4DF4A 2C2EA 3N2KE 3R8YA 2FHJD 5EWGA 4PKDB 2OPRA 2CQPA 3M2RA 2X0YA 2XSBA 3BYPA 4WBNE 5H9FK 3LAMA 1XMOJ 2OEJA 4ZCIA 2EG2A 2BJ1A 2VASA 5HBMB 2H4WB 3I9ZA 1S6PB 4B3TJ 4DU8A 1K9MT 4EZ4A 3PRVA 3VZHA 3HKBE 2C3YA 1WG1A 5I42A 2B6AA 4AQGA 1F6TA 4F4YA 2ZZNA 2FY1A 4I2QB 2HPLA 1S1UB 3K1SA 5IC6B 3EVMA 3VGUA 4BC7A 4LF4F 4N76A 3PUXF 1Q86T 2V0NA 3I0SA 3SFUA 1JKHB 2FC8A 2PD1A 4DPTA 3IM8A 4NLGA 5LYJE 3ADAC 1ZP0A 1C0UB 4EEBA 1KDNA 4H9QC 1Q8LA 1N4LA 4F02A 4AD6A 1U26A 1FVQA 1X5TA 4OX9F 2G1HA 3OJAA 2MEWA 3G8TA 3EUNA 3K7RA 4DBQA 2DITA 5HMZA 2VQFJ 4A8OA 2CPYA 3SEOA 1RHUB 4IOAQ 1T3NA 2HNDA 1R3NA 3OTDA 3VAHA 4M5KA 1JNZA 2V4JA 5AQMB 3T1YT 1Q16B 2BABA 4O44B 5AQTB 3LFMA 1CS4B 2F3JA 2NQPA 1R43A 5GVQA 5ADXL 3RB0A 1U47A 1UWAA 3PUGA 4HTEA 1U1NA 2CUYA 1Q4RA 1VC0A 2XNRA 5AQKB 5JR9C 5JDFA 4OYAA 4DR1J 4J9VA 4Q44A 1H74A 5LMUT 3MM5B 4LBPA 4YN3B 2D3ZA 1XDOA 2AMCB 5KT7A 3CWJA 2B5JA 3TUIC 1PO6A 3PW4A 4GVBB 1QUUA 2RNEA 3UULA 3V6HA 4DQIA 4H4MA 4U8YA 1CULB 3RYLA 1HMVA 1U1MA 3BKUA 5BYRA 4YHHT 2X1AA 3K5OA 4B3MF 4ZPDA 4KGKA 4WTYA 4CYUA 3UN3A 4HWDA 1C0TB 2UXCT 5IS2A 2XY7A 5F3ZA 1FERA 2GNKA 3NAIA 5ABGA 4R0EA 4USKA 3RKGA 5F8JA 4U7UD 3BREA 5KFIA 2R7RA 5ABEA 3BGLA 5J2QB 2YKMA 4P7TA 1D9FA 3NBPA 3AECA 1C1BB 1SL1A 2WS3A 3CX7B 4USTA 5IHYA 2HN1A 1WLXA 2M6BA 5HJYA 4DL5A 5EWEA 4XDCA 1S0MA 1V5IB 4X84A 3NS5A 3OUYB 3DOMA 4AQFC 4ES1A 3SFGA 4O4HE 3RH3A 3EVWA 3FZKB 2H5IB 3RF1A 4EUVA 2P9CA 5JH7E 5BJRA 1J1JA 4LFAF 1N34T 4K4WA 4ZMMA 3Q0AA 2QLWA 1Z2ZA 1RT7A 2GJ2A 2BS3A 2JJ4D 2OSRA 3CE8A 5CA1E 2LXIA 1S72S 3OFEA 4NL5A 1S77D 3ZTRA 2Q6CA 3R5BA 1HBUA 3GWCA 3IR5B 1S59A 3PYGA 4WPAA 3CJKB 5KG4A 5L1JA 1WJ9A 1X9BA 3SCLE 2QL5B 2X9XA 1SQGA 5ETWA 2XSJA 1MMGA 3NLCA 1C4CA 4CN4A 1EP4B 2QA7A 3D9BA 1UL3A 2D41A 3CDUA 5KG1A 4DU7A 4LFCF 4TV8E 1ZS6A 5DQIA 5ETSA 1UW4A 3TI0A 4DV4J 2YU1A 3FCWA 2DGXA 4LVOP 1L3KA 2C3UA 2IPOB 2WVEA 1HWKA 2GCFA 1L3SA 3R2DJ 1AZSA 2YNHA 1LKXA 4YY3T 1D8YA 4RLEA 2WQYA 2UXBJ 2K2PA 5M2UA 2K7KA 4XZCA 3C4XA 4X62J 2DKOB 1S4EA 3P6YC 5KXJA 2HQDA 3C8YA 1IKXA 3A8KA 3IFEA 3CMAS 5J1EB 4J5OA 4AKGA 3UDCA 2W9CB 2HGLA 4KGMA 4J37A 1TR0A 3EDVA 5J2PB 2VQEJ 2YU2A 2JFDA 3UW1A 2MSSA 2RE1A 4HACB 1RTHB 1SH0A 2ZH6A 1NK4A 2UV8A 3GIKA 2R7XA 4I0UA 2EBGA 2HHXA 1RXOB 1HNXJ 4NLVA 2XQ6A 3DLKA 3BKFA 4RNOA 3ZYLA 1ZEEA 4JB8B 2RQ4A 1YKHB 4IRKA 1RHJB 2OEKA 2WVDA 2PT0A 4OYBA 3GV7B 3G2XA 4K4SA 3Q8VA 2V69A 1UVKA 2LM9A 1CJVA 2A3JA 2A9UA 4NXNF 3EGVA 1YDLA 2OMLA 4FJOA 1VOMA 1JJCB 1IWAA 3FJ2A 4RW9B 4DPYA 4RW7A 3ITHA 3B78A 2JLFA 4YB7A 2YNGB 3B82A 3SBMA 3HF5A 5GADI 4KIAA 3TQ1A 2ZD1B 3H4BA 4MIWA 3RAXA 4TQRA 3LGHA 4RO0A 3KLEB 4ZCMA 2ZHBA 4OYIA 2V94A 1Q82T 2BM0A 5JDNA 3KLHA 2YNFA 4LUBA 3QGGA 2XQ7A 2BA9A 1KLNA 5KFRA 1WEYA 3EXCX 1OMSA 3CDWA 4DR4J 2B8QA 3R5AA 5JVGQ 1O0PA 2RHSB 4I6AA 2E5HA 3CUNA 3PV8A 2JHEA 2W62A 5HP1A 5KG6A 4U7IA 2B9WA 1ZPWX 2PO4A 1FNMA 3ISND 4GYSA 2MQOA 4DL0C 2X66A 3IBPA 1JNRB 3PYFA 3V6DA 2K1RA 3MM7B 5AXKA 1W0BA 4A46A 5BR8J 2B8PA 3PV0F 3IMQJ 1XMQF 3IBFB 3U1LA 4X5TA 2VONA 1HNWT 2XY5A 2F63A 4Z90A 4DR3J 4PXCA 2KT9A 2HAIA 2PA8D 3UCGA 4ED7A 4LF5T 5F0UA 2BQUA 4HWIB 4CLTA 1FKPA 1A9NB 3FSYA 3SYZA 4FP9A 3I4PA 1KHWA 1V3SA 2VKRA 1M5KC 5A2QU 3L7PA 4XIUA 2J0XA 1UJ6A 3DC2A 2LU2A 1RT5B 4ZN3A 2D3OR 3M1VA 1PAEX 1NEEA 1M5OC 1KFSA 5E3RA 1GXUA 2WW4A 5IWAF 1JLGB 3NGKA 2RF2B 4PFPA 2DIUA 2RMLA 5CB4E 2XQAA 4QYZJ 1QAJA 3DMJA 2DPJA 2YEVC 4ZI3C 1IBKF 1JK9B 3QGIA 1YBUA 5LHGB 4CH7A 2FVPA 1Y64B 4ZP9A 4IE5A 2YWWA 1H72C 1XN9A 1YRUA 5CYQA 1NRKA 2CBJA 2RP4A 4PWDB 4DV7F 2XZEA 5A8WB 1NMEB 1S1XB 2ODUA 4A8SA 2HLTA 3SSRA 2X68A 3IGNA 1YW0A 2RUSA 1GK8A 2NW9A 1ZAWA 2UUAT 2KJWA 3CF5Q 1KF6A 1AXQA 2OFGX 3G6XA 2VL8A 2JMHA 2DGVA 4QIWD 3V5RA 4M94A 3VR1A 3CX6B 2VC0A 1KLMA 3FMBA 2J76E 5ABHA 4F7VA 4RL1A 1PC4A 3J80U 1DFDA 3FDSA 1QAIA 5FXVA 4XBFB 1H3DA 3FXEB 4CT9A 3CJRA 5L8RC 2GZOA 1S1VA 4JEUB 4XK8C 3B4DA 3NS6A 3GV5B 4OI6A 1VQYA 4JBCA 5ETKA 3QO9B 4K59A 2C1EB 4AKLA 4GC7A 4AIUA 4OHFA 2G0CA 2VFUA 3AB3B 3THPA 4Z8XA 1IKWA 2DHAA 2CQCA 4JI0T 3PYEA 5F41A 4DUYJ 4KE5A 3UDEA 1WF0A 4NLRA 1R89A 3C16B 4RNFA 4J90A 1U0HA 2LRKA 3FSXA 4NCAA 4LMKA 3PXGa 4FS2A 4CXWA 2HGNA 4ZOLE 3C6UB 4DMWA 5GAGI 5IUXA 1KOOA 1NM2A 2MTLA 3A3PB 1NK0A 1WSRA 2HFVA 4FF1A 4O8SA 1TAQA 4PJJA 2DNKA 4C7QA 1SH3A 3DGPB 2MYSA 5L1LA 1S9EA 2BG9C 5LGTB 4LF4J 4PAAA 3QJLA 5C42A 3GE9A 3BGRA 4CXXA 3UO0A 2MQLA 3THTA 1XJWB 2HBQB 2RQMA 2VOOA 1Y00A 4DDFA 2LYVA 5A0YA 2PEHA 3QBCA 5ETRA 1DLOA 1BQMA 1I94J 4O3RA 1U1PA 2C3OA 2HHHF 4QHOA 9RUBA 5IV4A 2GIRA 1PJ6A 4QXCB 4U2YA 1RU2A 2XO6A 1KQKA 3GN5B 4P74A 4X64T 4RUBA 5CGMA 5CZXA 2ADBA 3TVZA 4I43B 4IR1A 5L39A 5HJXA 3AE6A 2FDNA 3OW2R 2DBBA 4P2XA 4C90A 2DO4A 3SI8A 1FJGJ 2XS7A 2WP9A 3T5KA 1D9AA 4ES3A 2R2UA 3MPWA 2WVCA 2EFVA 2BE9B 1DRZA 2IVFB 3C6TA 2DWGA 4M5GA 3RR7A 4ZKAA 1UMJA 2ZITA 4UTGA 1VBXA 3MDFA 1GX5A 2XZDB 4Y65A 5JR9B 1S48A 2CQBA 4USVA 4WK3A 3ZC1A 2XMVA 5EN1A 3KLFB 2EHOA 2XMJA 3G6VA 1DY3A 2XMMA 4NYOA 3HJFA 4CM0A 3GYGA 3TO8A 5IQQA 1NHKL 3W66A 1HS7A 3V6JA 3EHZA 3R1LA 3WZ0A 3W1YC 3KXDA 1TMJA 3LK42 4JI6T 3MR5A 1VK8A 2VKOA 1N5TA 4G1IA 1CJTA 2CXLA 4DR7J 4EU0A 1IJ5A 5HAOA 2XY8B 3HCXA 1FRMA 4I56A 3KV5A 4EYYR 2NLWA 4HGAA 4C97A 4TN7B 2B4PA 3ZCJA 3VVTA 1JLCA 2NYIA 3HFVA 3P4QA 3M6WA 3NEKA 2HSEB 4KI0F 5KDMC 4TNVA 3Q8RB 1S35A 3EDUA 4DV6J 3I9YA 4D3HA 2NTYA 2AKWB 2HBRB 5LG3A 4F04B 5KFKA 3RRHA 4HKAA 3W2VB 3QJJA 4OX9T 2GIFA 1GEHA 2MYFA 1R8PA 4X1YE 2CNLB 3CJSA 1SCJB 4M5NA 1U5PA 2JOQA 1TMMA 4PG6A 2AX0A 2R2SA 1RHMB 2M88A 4ZEYA 2GA7A 1X9SA 4DUTA 4WIQA 5I3UA 7FDRA 1X4BA 4LSNB 3MTJA 3A8EA 3KVBA 3PG9A 1HNZF 3P8BB 4ZCLA 3ENQA 4PK5A 3FCHA 1T9XA 2HQ3A 4R8UB 4ECUA 1VC5A 5HLFB 1UZDA 5H6QB 2LA4A 3N9OA 2FQQB 3PTWA 3JB9k 1ZZNA 5DZ6A 2HHQA 5FYMA 4DUZT 3NS7B 3KHRA 4OHWA 2NW7A 5J2TE 3FFIB 4AT1B 2CVIA 2I0XA 1YZ7A 4DSJA 5AQSB 2LQ9A 2CQDA 4DV5F 2MB0B 1VISA 1EB0A 3CCQS 4B3OB 1LWFA 3SZ2A 2JQHA 1UA0A 3NZQA 5A6WA 2KZ7B 4B3MT 2GW8A 3PE0A 4AYBD 1WG4A 2QLXA 4ER8A 3D0IE 4C0OC 1SUQB 3CWZB 2CPFA 1EJ7L 2WBRA 1NBEB 1KD1T 1T7SA 5IOLA 2HLUA 2MKSA 3VALA 2G9OA 4C8ZA 1PSDA 2GJIA 1VCTA 2HS0A 3PHEA 1U1LA 5LJNA 4AKIA 2VJVA 2R3VA 2XUEA 2QJ3A 2AF6A 2HS3A 5E33A 3CCSS 3SQOP 1FFWB 3MUMP 2QA1A 1U7LA 3UI3A 2CYYA 1TKZB 2R8JA 3UUXB 2DR5A 1Z1ZA 2HFNA 2BE2B 4UF0B 1SC4B 4TUYE 3ZTQA 2B1EA 2KJVA 4NZ6A 2QC3A 1XNQF 4ZI7E 3ELHA 5KT3A 4C8YA 5GAGU 1FFGB 4I64A 4CLFA 4J9LA 4UOFA 2IM2A 4LF7J 4DPOA 3M8ZA 3J7Z5 1JLQB 1SJ1A 2QMWA 4LFAT 1NCLA 1TVRB 4K4UA 4PFOA 1JLBB 4B3RT 3CJ4A 3PEHA 5GMEA 3VQSA 3CC7S 3RPUA 4EO6A 1HPZB 3ZYKA 2I5JA 2RRBA 2XULA 1R0AB 2UVRA 1WKLA 2VKHA 1N8RT 2CEAA 3BQLA 4RW8B 1M7KA 1RBAA 3CCWA 4HHHA 1XZYA 3F31A 2BR0A 4JV1A 3IWXA 1DTTA 3KUHA 5EK2A 2UU9F 1JXVA 2E1AA 1REGX 4LFCT 2QTWA 3H5UA 1E2AA 2KFNA 1BWEA 2V8HA 4P75A 2V34A 3CKDA 2XM2A 1KVJA 2DNQA 3BO4A 2XCAA 1RTDA 4LMJA 4HFBA 2AJ4A 3M8PA 1UCNA 3DDIA 4J7CA 4X66J 2Y1LB 5B0DA 3GG1A 4NCGB 4JI3T 3R7BB 5F8LA 1K8AT 4PJMA 4ED1A 1IJFB 5EWFA 4DL3A 1MIYA 2OV9A 4DBRA 3OKQA 1LRZA 1KBRA 3RBEA 1NB7A 2LJLA 1F0XA 4LQ9A 3LP1A 1TQLA 4ECXA 2Z0GA 1LWXA 4QBUA 3AB2B 2DGWA 3UU6A 3HSDA 2VICA 1QDUB 3SQGB 3FEYB 4KKOA 2COLA 3AAIA 1O3XA 4ZHRB 2FUG9 3POTA 5EX0A 3E22E 4PXBA 1VR6A 1K44A 1RT2A 1E1HB 1UFWA 4P0BA 3JS9A 2FVSA 4Q43A 2WDVA 3VKHA 4V1Ak 1JIHA 3RIUA 2FZKB 4KTQA 4EMDA 4Z7CA 3DRSA 4G65A 4DR2J 2IA0A 2GMLA 4JI1F 4FVCA 4I6WA 1GQEA 4KJIA 1YVFA 4NXNT 2VC1A 4RW6B 4DV3F 4W90B 4GC6A 1KOHA 5HAXA 4NASA 4IIJE 4F8RA 3M32A 4Z7YA 1GT8A 1PAUB 3Q8PB 1X4EA 2N3OA 3V5SA 1LWCA 1S10A 4DWIA 1T8BA 1NJXA 3SV3A 1CC7A 5CH7B 4LSLA 2KFZA 1HD1A 3ZMZB 1N33T 2W2OP 1W0AA 4U74A 3B5MA 4NWBA 1JQGA 4LF9F 2LOPA 3WBZA 4IQMA 2VKDA 4UOCA 3SDEA 1ZAXA 4DSIA 4LR9A 2V5DA 3RR8A 4JI7F 3DRPB 5HO4A 2V50A 4ZLLA 2CNNB 2IJRA 4DV1F 5AQGB 2KYZA 1S9GB 1QTMA 5D6GA 2ZM6F 5K8OA 3JYTB 2H5JB 3GIMA 2QLJB 4EAHA 3S4UA 3ZT7A 4F4WA 2FIUA 4DQSA 1YJRA 3H0PA 5H9EK 3LTOA 4ZVOB 5FJ4A 3ZFVA 3DRRA 1WHXA 1XMQT 4JI5F 4Y2IA 4P2FA 2FJAA 4B08A 4ZVHA 2A6OA 2W7AA 3HP6A 3HVTA 1F9FA 2DPIA 3NNHA 2RAQA 4K4XA 1T95A 4CO2A 2IAJB 2IC9A 1GXTA 1U02A 4C91A 2LQ5A 4P0AA 5J1GA 4H4KA 2JMKA 3AXMA 4E7ZA 2FLNA 3RYFE 3OPKA 4K0KJ 2CPEA 1R0BG 5LBQB 4M63A 3O4XE 2O1PA 4RUAA 3ZCIA 2XJ7A 5K14A 2FVQA 1U2CA 1RTJA 4DSKA 3AE7A 3M8QB 1FEWA 1PG5B 2BE7D 3V81A 2RSQA 2G0IA 3GJSB 3HHLC 4ZZBA 2KFYA 2DLRA 1HW9A 4CI2B 1G1XA 2W61A 4H4MB 4J9PA 5IWAT 3FB2A 1PC5A 4DS5A 1S6QA 3O1HA 1HMVB 1H38A 2Y8YA 4B9TA 5ETNA 3MM6B 1VQSA 5BMVE 1IBKT 2GQCA 4EI2A 2Y48B 2N7YA 5C24A 2GVDA 4JYAJ 2BG9B 1QSSA 2DNHA 4DZ6A 1TL5A 4DV7T 1LWEB 3NCPA 4RW4B 4CDIA 4ZI3D 2BKNA 2OPSB 1UURA 4GK5E 5KFVA 3CVRA 4DPWA 1I3OB 2O5DA 2Z30B 3THVA 5I4MA 2GGPB 2HHHJ 2F4VJ 2IY5B 3CJTA 2G0JA 1S6UA 2ZE2B 4BA9A 3I0RA 2BBJA 1EETA 3RB6A 4O4GB 1ZAVA 3CTRA 1F1BB 4LIRA 1UGOA 4H9NC 5D8HB 3AA8A 3T1HJ 4R5PB 1RB0A 3TA1A 4ZN1A 1IM6A 3H90A 2CBIA 2UUWA 3KK3A 3ZN1B 1IKYB 4E8UA 2CWXA 3D3BJ 4I2PB 5E3QA 1RWUA 2BQRA 5CYJA 5KG3A 5HXHA 2ZOMA 2BJ9A 2NREA 3I5AA 3KINB 5HVFA 1QLNA 4G1QB 1RGVA 4HR2A 1JLFB 1QTNB 4ED0A 1TK8A 1HX1B 2M70A 2D5UA 1CQMA 4AXPA 4FPRA 1KK7A 2M6IA 3ZTOA 2BXJA 2BACA 2E5VA 3RLFF 3RRCA 5JVDE 3BGFA 4CO3A 4IRDA 3MUVP 2LMIA 3WAJA 3AA9A 2GQQA 4OZ1A 3UUNA 2FJEB 2JL9A 2FHOB 2YNIB 1RWXB 2PE8A 2O3DA 4DLEA 2VFSA 5EUHA 1EARA 3K57A 2MQNA 4IFYB 2V9WA 4ZPBA 4PK6A 1MMAA 2P9BA 3RKOA 3KTQA 2YKNB 3A8JA 3IBWA 3EDRB 3I0QA 4UT4A 4I6YA 2ZM2A 2C42A 1S94A 3GFYA 4XO0A 1N5QA 1TKXA 2ZUAA 4YSYA 4I55E 1SV5B 2B7BB 5FLXU 1TKTB 1RAFB 1VI7A 1TAUA 5D77A 4TWDA 5GMKa 2MHNA 1RCXB 2KO1A 3NNCA 1SQFA 4C3LA 1S4FA 5DDQC 2OLTA 4FS1A 4L3NA 3QRPA 2H3RA 1F2GA 2UVUA 3GJQB 1NENA 4I67A 4DR5F 4AQYJ 5F8PA 3LA0A 2ATCB 2B7CB 4KPYA 3AD7C 1RYSA 4BLGA 2MGZB 1RAEB 3JAEA 3NG8A 4NRUA 5LGNB 3FEXB 2V63A 3PR5B 1VQ7S 1S57A 5L4HA 2JDJA 2MZRA 3KJQB 2XY6A 3QZ7A 3W2WB 1JXLA 1HBNA 2B9EA 6FD1A 4LF6F 2OI2A 4K8RA 2XS2A 2LKHA 2K8GA 3ILLA 2K48A 2G13A 2UZAA 3MOJB 5J2MA 3O2IA 1RAJA 2J6UA 3AE3A 2R2TA 5J2NA 2D7SA 4NOHA 1GTHA 3TLUA 4O2BE 3KV6A 5AQHB 3DLBA 4PAGA 5HXEA 2WOMA 3JXOA 4U67Q 1WTBA 1WOOA 5D78A 4BWMA 3MEGA 4L72B 2ZVIA 2H51B 2XHEB 4MHCA 4QW8A 4QX7B 3ZZZA 1D0YA 4KUMB 3UPFA 3ONLC 1IAPA 3Q2MA 3E51A 4ILAA 1WG5A 5LSOA 4B3SJ 1KSPA 2CHOA 5DLGA 2DHXA 2WSFC 4LR7A 5A2QY 4F50A 1NPPA 4W92B 2HQGA 4QR1A 1Y10A 1TV6A 4E0DA 2JEIA 5DQHA 2BANA 4DX6A 4WWSA 1F5CA 2HURA 2OFHX 2V2ZA 2V2KA 1MROA 5HP1B 4FYXB 2PMZD 3DU6A 1UVLA 2V8PA 3BQ0A 4A8XA 5LBMA 1UWBA 4N78D 1HIYA 4KGZB 5G0RA 2YQ3A 2JNJA 4LRCA 2H89A 5AFUL 3JAMU 3AAAB 4E2FB 5DLFA 4USIA 3CX8B 4A48A 1LXJA 2DHRA 2L48A 3WI3A 1QM9A 4OYMA 3NKYA 4JP8A 1RHRB 2W4DA 4G2AA 5HEOA 2WCAA 4NA2A 5L3GB 4KQZA 3DYAB 2EFQA 4C11B 3IS9A 3ZC4A 3MPVA 3K5NA 1HNZT 2E1RA 4N7TA 3H2LA 3OQ2A 1NPKA 1FKAF 2X51A 3K5MA 5EZYE 1FEHA 3C46A 4C98A 2V6YB 2NPFA 3AEFA 1F9EB 1BQNA 4PW8A 1OSCA 2E8IA 2FBWA 2UXNB 4QYRA 2ZHOA 4P1NA 3MMBB 1X31C 1LXNA 3MM9A 2H1YA 4M5HA 2YXLA 3DJBA 3SRZA 5LJ3Y 2EFNA 3RAQA 4DV5T 2IDEA 1WR0A 1IBLJ 3KK2A 2KN4A 3G4SS 3P45B 3I96A 4QW9A 2J9EA 3DMJB 4TVAB 2W7PA 5KFHA 4XPEA 3L9ZA 2EFOA 4EGLA 3G82A 3TAMB 3BM7A 2D74B 1RAGB 1J5OB 2XMUA 2W2UA 2PFFB 3EYZA 3KG1A 3J7ZT 3K8VA 5A8RA 3N79A 4OYPA 5HN0A 5L4EA 2GAGC 1OEDC 4ILLA 5HROA 3OYZA 4AXIA 3DP7A 2ILZA 1WR6A 2VG5A 3OTOJ 2MMYA 4UIGA 1HLWA 3LUYA 1KFYA 5CHCB 2XI2A 2FJXA 4GKKF 3IG1B 2C3MA 1RT4A 2UUCF 1RZMA 2X1GA 1K47A 2IJFA 4CQIA 3DLEB 2HMIA 2YPYA 4KV8B 2DGTA 1NEKA 4DOZA 4DV0F 1FD2A 3OLBA 2LQJA 1Y5IB 1Y3JA 4OMFG 4JV0A 4OX7A 2CG8A 4DV2J 2PGCA 1S49A 2BJEA 2DH9A 4TNOA 2KINB 1V6HA 2AYGA 2G2YA 1FKOB 1DBDA 4M5MA 4WKRA 2R7VA 4Z37A 3GLJA 5D3GB 2Z8QA 1FJ7A 1AB8A 3OT9A 4WW0A 2IJNA 2DD8S 2QLBB 2OD6A 3C14A 1UEUA 3DOKB 2WZHA 4ECYA 1RWMB 2DR9A 4Q2MA 4TWFA 1CHUA 5LL6d 5BYSA 3D1OA 3T19A 2Y6XA 3J9X1 2F65A 2XAHB 1R8IA 2UU9T 1QE1A 2KVQE 4RU2A 5KFZA 2QV6A 2Q9QA 3L39A 1WYBA 4IH6A 1TL3B 3CNQP 4WBFA 4FKXA 5KT6A 1WDDA 1JJ2R 5H9EJ 2YX1A 3QRQA 5CFBA 1HR0J 1GAOA 1SH2A 1T05A 2UXDF 1K1QA 4KT0C 1Z8UA 1YWXA 4DPXA 2ZM6J 2DNPA 5D4LA 1U45A 2C0SA 4ZPTR 2F4FA 2MSTA 3MCOA 1FK9B 2IRXA 3TA2A 4CZZB 1WC5A 5CA0E 4IDKA 2VWAA 3DI6B 3T6BA 1FJGT 3HK2A 4TU8A 4IG3A 3LK2B 5LOQA 3K2YA 1RYRA 1EKSA 3TEGA 4NLTA 5DETA 1UVMA 3DRXA 5GMDA 3KLVA 2KWIB 3NRXA 5KT4A 5AQVB 1YITS 1TFYA 1PYSB 3CW2C 2ROEA 1Q53A 2LM2A 4JI2J 5E0OA 1F5AA 5SZTA 3AA1B 4F0MA 2LT3A 2FYXA 3PW5A 4PWWA 3IHRA 1VHIA 5ABFB 2Y8WA 3IR6B 1G8XA 5DJBA 1VLYA 3VV2B 1KHVA 4JI1T 2UXCF 4ID8A 1BHNA 2FZCB 1N36T 3M9OB 3HZEA 3O1JA 1FRHA 4J9RA 3HHLB 1RWVB 3M2VA 5FY7A 2HIYA 1V3ZA 4KHPJ 2ZOFA 1FNOA 5D15A 4F2SA 4V1Av 1S5ZA 4OI2A 5LMNJ 2YKPA 3WX4A 4OIXA 3U78A 2BEFA 2UUBT 2D9DA 1CJTB 1CJKA 2V2QA 4PJNA 1ZBTA 2MAWA 2JSXA 3ZT5A 1U1QA 2CMRA 3SSSA 3PNIA 1YQ3A 4DO0A 4YB6A 3N9PA 3VAKA 2IBOA 4NRTA 1YLXA 2QL7B 1NSKL 2JVOA 3I1AA 2XQ4A 1CJUA 4LF9T 2ZH7A 2WSEC 4KH0B 1RAIB 1GNKA 4JI7T 3DM2A 2AW0A 3Q5DA 4Y00A 1TKDA 4JUZA 1U09A 3Q5WA 4DV1T 4QPXA 1IN0A 1YBAA 3K8PC 4WZQA 1RT3B 3B54A 3QRRA 4G3IA 4ECTA 1SJQA 3C4ZA 1MU2A 1VDHA 1JJHA 3MM8A 1YIJS 4AI6A 2ZM8A 2RKIB 3C51A 2RS8A 4JI5T 1FMWA 2R7OA 4B9VA 4FI5A 3LJCA 1IVZA 4HTJA 4CNYA 2CQ2A 4CO5A 2NUUG 1VQ6S 1VRTB 4BC9A 3QAEA 3FXDB 4CI1B 4FNIA 4IDNA 2KHDA 1T02A 3D1QA 4HI1A 1PCAA 4KB7A 3KLGB 4KMCA 3MEDB 2CLYC 5T14A 4HT7A 3HZGA 3LOUA 2ADCA 5JRCA 5LT5A 1FTCA 1RKJA 2ZH8A 1RWKB 2VHGA 4KHZF 5B0BA 1UJ5A 5KT2A 1XR5A 1RE1B 3DLJA 2PTFA 4YY3F 4F3MA 3FCVA 3QGHA 4ISTA 4Y28C 4WTOB 4ECQA 4X4PA 4ILBA 3RIAA 1T03B 4LQ3A 1HNVB 2VF3A 4N77A 3WIUA 3GYNA 1DU2A 3QYYA 3QC9A 4TY8A 3MR7A 3RW7A 1TELA 4CT8A 2W2PP 2D3O1 3H37A 4PEOA 1BE4A 3N28A 1REVB 4CI0B 3HHLD 3QLHA 4PXEA 2FD2A 3ETVA 2PJQA 5AE3A 2XMAA 2WONB 1LV5A 1YJ9S 1R8BA 2I6WA 2O67A 3HVRA 2V7IA 1SJ4P 3UN2A 3FZHB 1O51A 2AZ3A 4ZVPB 5FDLA 2XM3A 3ET6B 5FIIA 2E9XA 4WYWA 1P9QC 4EXTA 3T9NA 1T72A 3KK1B 4Y2CA 3VAIA 3VRBA 2H3EB 3AE9A 2M8HA 3MCNA 4ZIWA 2HFUA 2A10A 4CO1A 5F3JA 1HG2A 3PJ9A 2ZBQA 4DR5J 2Y1IA 1K73T 4LF8F 3DHWC 1HNIA 4F25A 2RA1A 4LFBT 1DURA 5DQVA 1FRLA 1VCSA 3FRZA 3TQEA 5KFUA 5F9LA 2IFXA 4ZP7A 4F0KA 3N2OA 4LF6J 2DWKA 3MECB 1N0VC 1ULRA 3KOAA 2N4DA 3PY8A 3QQCD 3CO9A 4N56A 2RJZA 5U47A 1R6VA 2DCUB 4OZ2A 4GKJT 2EG1A 3GJRB 3ZKRA 2CQ4A 3RQWA 3IAS9 1RWPB 1H6KX 4ZIVA 3R1HA 4U8VA 1VQNS 2DR7A 4X1KE 5AJ3J 3OFHA 3LP0B 3C3LA 2EPIA 3HFKA 3ZMTB 2XPKA 1WI8A 1FDAA 4JBWF 5HI7A 3ICLA 4Y34A 2KVIA 3BQIA 3AHPA 3LSVA 4UEMA 3M3ZB 3KJNB 2P8IA 5T41A 4PQUB 3CJ0A 2VODA 3QB5K 6AT1B 1SKWA 3D6MB 3UR0A 3G8SA 1UPPA 1YZ6A 3BPSP 5C3JA 4JI8T 2FHJA 1HWIA 2ZDOA 1Y01A 3M6VA 3X3UA 2FJBA 1HW8A 7FD1A 5CYMB 3FUYA 2AGPA 3KVAA 4OYZA 1TL7B 2WWVA 3HVWA 4IOCQ 2E5LJ 1QSDA 1E6YB 4BDPA 3PZPA 1RLCL 4PQAA 3UR3C 3PW7A 1HNWF 2JC1A 3HI9A 4EWTA 1AUSL 4DHVA 3HHKA 3MK7C 2UP1A 1FE4A 2KG1A 2E1MC 5D0GA 3OD2A 2ZJPQ 2IRUA 3HT0A 5B0AA 4HI2A 1N56A 3NZPA 5GAEU 1Y7PA 1IM4A 4J9UE 4UF4A 1D0EA 3I87A 2YINA 3ILOA 1FTRA 1BY9A 3RI5A 3HM9A 3TX0A 1M62A 4C8NA 4ANCA 1X0FA 3CDEA 4YTPA 3MEEB 4U7UK 4F6RC 1VRUA 3EWGA 2LCWA 2QYGA 1DTQA 3TW0A 1VQKS 5MAOA 3RBZA 3I9V9 1M5VC 2P6TA 5EGYA 1ZH5A 4MTPA 5CAAA 3BBFA 4ETXA 4UZBA 1KS2A 2M9KA 3NGUA 3FKBA 4CLZA 5ETVA 4DR6T 3M30B 2W0GA 3AE2A 1K0VA 4WNKA 4QWBA 4ELUA 4IE6A 2VG7A 2OH2A 4OQJA 1IR0A 1F9HA 3QB5A 4TLQA 2CQGA 2PN6A 2E5JA 4DG1A 3MFIA 1BC6A 4ZPCA 4R0JA 2UVVA 2OUGA 2J0QD 5L2LA 2FPHX 3GFHA 4RX6A 4NLUA 3EABA 1HQUB 2ROGA 4U6PA 1T9TA 1X5OA 2VUGA 3NCQA 1LNQA 2L3MA 2HW3A 2BUNA 2JRSA 3VR8A 2FB0A 4NLPA 4U2ZA 1H7XA 3OR2A 1ZOTA 1H0HB 4J9QA 1IBMJ 2YWHA 5F8HA 3Q8QB 3T3FA 3AEGA 1I6ZA 2HH7A 3ZXWA 4Y2KA 3ZNUA 3OBIA 3OVAA 4HKQA 3PJXA 1OEDB 4GKKJ 4BS2A 3S01A 3RBXA 2YQ1A 2MHEA 2DHHA 2W2NP 1J5WA 2B51A 2X67A 5K5MA 5HSPA 2WDQA 3CQCB 1WOPA 3K5PA 5HBMA 1S6PA 1P9YA 3DXSX 2HNZB 1RTIB 2H9ZA 1Y3KA 1KQGB 1WD6A 4USUA 1KKHA 4OLPA 2Z57B 4ID5A 2E9ZA 3CCRS 1I6JA 4C4WA 3TA0A 4I2QA 1ZTTA 3NWIA 1S1UA 2VPYB 1QVGR 1FX4A 4HFDA 2YDSA 4Q0BB 5IM0B 3HA4A 2WBMA 3DLHA 1T9WA 2BDEA 2HNYB 2X9WA 2N2NA 2DNOA 1V9OA 2ACYA 4J91A 1NDPA 2WDRA 4DL2A 4ZXLA 1C0UA 2HBZB 4EBCA 1OIAA 4ZZCA 2V8SV 3SXLA 5DQGA 1HBMB 3M8SA 4K50A 2XMKA 2Y9HA 4DNDA 2XSAA 5F8IA 2IDOB 2ZJQQ 3HHNB 4OI0A 1GXLA 1NXIA 2CQ0A 1HQEB 4JV5F 3KDNA 3R5DA 1SKUB 4QYZK 4O44A 3F0NA 1CS4A 2HFSA 3O1IA 1EQMA 2YDQA 3OXGA 1OY9A 2JJ9A 5L3FB 2RDDA 4PYAA 2Q1LA 4KHMA 1HYSB 1HI1A 3T1YJ 3R2CJ 2Y1JA 3MM5A 3DHXA 4P6QA 4QU7A 3WAKA 1W26A 2QE5A 2CPDA 2FC9A 4MK8A 3KJFB 2XNQA 3C64A 4GVBA 4IL9A 2LHRA 3A7MA 2WB1D 3PHTA 3I0RB 3L8RA 1FEEA 5B0GA 5LMUJ 4X2BA 1CULA 1M5HA 4USJC 3PR4A 4OJGA 4KGXB 1FA0A 3BK9A 2DNYA 5JDLA 4KR0B 4DV0T 3ESLA 3QAUA 5ETMA 3OXFA 3RBDA 2GAHC 1C0TA 2XAQB 2JLEA 5FLXY 2WK4A 2RQCA 3I6PA 1CSJA 2GMHA 3N9NA 4YHHJ 2GX8A 3FQLA 3CGIA 2KTQA 4JI6F 2LP4A 4FVMA 4RBTA 3TARA 5FMNA 1SC3B 3TUZC 5HEUA 5J2QA 4N47A 3AOBA 5B08A 5KFNA 2UXCJ 2CE7A 2RIJA 3TYTA 1WFDA 4JI4T 4NXMF 3GFZA 1C1BA 1QUVA 2K5BB 5SUHA 1F2HA 4YR0A 2EI5A 3ULHA 5BXIA 1Q8IA 1WNEA 2V5HG 3CC2S 1ZPVA 3UD5A 4H9PC 4FPIA 3CIMA 3OFGA 3OUYA 4RUHA 5HCMA 4I68A 1UPMB 1NK7A 5AQFB 2BZ2A 3IGVA 1HD0A 1SL0A 5K20B 2MOZA 4QIEA 4Y3CA 4J9MA 2LDIA 3N9QA 2KMFA 4CM2A 2ACMA 4QU6A 4MYTA 2LSKA 3BSAA 4GK0E 3F41A 3A8YC 2XBPA 5HMXA 3AD9C 3AEAA 1RK8A 2H65B 1B64A 2DNGA 3OHBA 2UXDT 3NGTA 4ZHQE 1P1TA 2CCQA 3F56A 3LDQB 1N34J 2CJQA 3PO4A 2ZVSA 3CJKA 4UVAB 1HL6A 4YP3A 4Z2XA 4AKHA 2L9WA 1EP4A 2JPFA 1VIOA 4L75A 2IVYA 3HKZD 4HL9A 4ED5A 2V6AA 2NXEA 2MQ8A 4DUZF 4C8OA 2OLWA 4Q25A 3Q8YA 3SCIE 2POKA 3FSIA 1QSLA 5M4YA 5FL0A 1T3OA 5HMYA 5L1IA 2DCFA 2KL8A 3D2WA 4WFZA 4F4ZA 3F2EA 2BJDA 2VG6B 4CLKA 1UAWA 1NWMX 5F0WA 3E3XA 3H4DA 5J2NB 3P3DA 2CLYB 1TZ0A 2WMNA 2B9XA 5J1EA 3EZ5A 2ZNYA 3QK6A 1V3RA 2JWNA 3RRKA 4O2AE 2W9CA 3JAMY 4CLSA 2Z2YB 5J2PA 2XZWA 1SKRA 3CD7A 1HF8A 3Q86A 1W2IA 4IE7A 2M52A 4HACA 4M5IA 1RTHA 2Z2ZA 1SB6A 4C3MA 1R8HA 1WC3A 1RA6A 3KLIB 2WWUA 4A5XA 2MQQA 3UE2A 3L7OA 4AKRB 5AXMA 3RGLA 3HPOA 1U4BA 2QT7A 2OIHA 1IKVB 1UZHA 1EKRA 1H98A 4DX8H 1D9DA 1B3TA 1KWMA 1XQIA 4EV6A 4ZJLA 1YG0A 4NI2B 2KT5A 1TV6B 1UCUA 5KFLA 1C1CA 2ZBCA 2BANB 2ACZA 4FBUA 2VKZG 2WY2A 3BZQA 3VHLA 3CIZA 3M05A 1UP1A 1XTZA 2BS4A 4LRFA 4RW9A 3FNNA 4ZVSB 3NP5A 4B3RF 4DPUA 2CNKB 2EK1A 2W4PA 4NLOA 2DR6A 3BF4A 2VKJA 3T5LA 4NA1A 2ZD1A 2E9TA 4TN2A 1UA1A 4YFSA 4AISA 1CVJA 2KDOA 2M4MA 2XEXA 2YVSA 1PIEA 3KLEA 5C7PA 5I3PA 5DO2A 1XNRF 2J62A 3S6EA 3TR5A 2A72A 3GA8A 3CJ8A 2LFVA 4IDQA 5KFWA 2AHOB 2ZKUA 2DK2A 3H8YA 3U1NA 4X65F 1M1KT 2KXHA 4H4OB 3FZFB 1WF2A 1FMVA 2ZH5A 1MSWD 1LEOA 2WHOA 3K58A 2J0WA 3AA0B 2BVMA 3LWLA 3ZMVB 2HN2A 1OY6A 5B0FA 4OYJA 3CPZA 4OI4A 3U7JA 4F26A 3FQKA 3HD2A 2E7XA 1T0TV 5A1LA 1JNRA 3GQCA 5FXZA 3MM7A 3ILJA 1KTQA 4OL8A 4PWUA 2G2OA 3R5CA 1HWJA 4JI3F 1N32F 1IXKA 3BGOP 2KYXA 1PILA 2YY3A 1JB0C 2VBWA 3OR1B 1F3FA 2OD4A 1NJWA 2ASLA 4CP5A 1YD8G 4QXHB 3IBCB 2VZ9A 3JSMA 4G1PA 4ICLB 3OHAA 4LIWA 5KFOA 2I6HA 3JADA 3MMCB 4NEZA 2RS2A 3DU5A 3MPDA 4HEA9 1HNWJ 1GMWD 3GYXB 3L3CA 3MGJA 3KHHA 3EVYA 2VG5B 3C66A 1CPZA 4LF5J 2LQBA 1RT5A 2IM3A 1Q81T 5JMNA 1YJWS 3AVSA 1X60A 3VWSA 1QY7A 4G63A 4KH1B 1JLGA 2FJDB 2RF2A 4XAKA 4LF8T 2J8SA 3AEEA 4A56A 3DN9A 2BKPA 4B3TF 5KFTA 1E6VB 1NK5A 2ES0A 4E98A 1Y0HA 1H2TZ 3P96A 4IKAA 4BJMA 4DEZA 5L9XA 3O9XA 3A4TA 2N9DA 1GH8A 1WKJA 4M5LA 2BDPA 4USMA 4PWDA 1U1OA 5A8WA 2Z2LA 1S1XA 3MR6A 1AW0A 2EWHA 3RJMB 1N6QB 1SIWB 4YB5A 5LB7B 3UUMA 1RA7A 4ENOA 4WFAQ 2WU2A 2N7CA 3EM1A 3RC8A 2G1DA 2E44A 4MIAA 2SXLA 4KO0B 1RJJA 3DLGB 4DL4A 1N33F 5IT4A 5DS7A 1RABB 1X4AA 1Q78A 4WFBQ 3CK6A 4UV8B 2CQIA 4CTAB 1LK5A 2KG0A 4O23A 1NHUA 4WXWA 3ENWA 1OO0B 2UUAJ 4I4TE 1UJ4A 3D6HB 3PU8A 4QH5A 4ILCA 2MZQA 1N5YB 4ERRA 2KRBA 4F3OA 4YTMA 2JQKA 3QO9A 3K5LA 5K9FA 3X1DA 5A8KB 4OX8A 3H5SA 3CMQA 3ZZPA 3W9IA 3FBCA 5AXNA 3CQGB 4ZJQA 5DRKA 2YWGA 4DR1F 2HHTA 4OFZA 3Q24A 1FO1A 1SBRA 3C16A 4C8MA 4YUDA 2CXFA 7AT1B 2PDAA 3KG4A 2CQ3A 4LT6A 3P4UB 3NCRA 4O3NA 2Y0BB 1NAQA 1ROFA 4DN9A 3C6UA 2KXFA 4OI1A 4JI0J 4ECZA 2IA6A 3G71S 1SJRA 3NY0A 2CM0A 1LQ9A 4FNHA 2C28A 4KPCA 3RX6A 2XMTA 2AV5A 2IHR1 2BM1A 1Y4ZB 2KI2A 2JFKA 4HLBA 2OJ3A 1S0OA 3N4WA 4H9OC 2H7OA 5LHIB 3LBXB 2HKEA 1J5EJ 3PFEA 5LJMA 3G6YA 2YWEA 2Z58B 3C4WA 4QR0A 3CD6S 3D6TB 4DN0A 2MY8A 2KWHA 3TJAA 4QZVB 2V7MA 1Q7LB 3EAMA 1U1KA 4ZPWR 2XG8A 2OELA 4QJVA 3B6BA 5LMNT 4QWEA 3GN5A 3MAQA 1AJ3A 4FDFA 1NH8A 2B4UA 3MCMA 3L7UA 4EYHB 4H9RC 1D1UA 1WELA 1WHWA 4QOTA 2OAUA 1U6ZA 3AA6B 4RNMA 3AAWB 2I8EA 3VU7H 2B4OA 2C5KT 3MMAB 2BJ8A 5FXWA 5F8GA 5DGBA 1OPZA 4X64J 3FZBA 5IT0A 1O5JA 1WI6A 4YT0A 1OYEA 4GOUA 4GO7X 4EB6E 2VDIA 4LF2A 4C6AA 4YOEA 2GVZB 3GPAA 4IR9A 1SHZC 1GX6A 5JR9A 3V4IB 1Y5NB 5AQPB 3V2UC 3UCUP 3KLFA 2VD3A 1M1GA 1JLAB 2C2KB 4MK9A 3QIPB 1JMTA 2IC3B 4C9DA 2DT9A 2D69A 1M5SA 4WU2A 3H40A 1SC6A 3LPEA 4PPZA 4RPFA 2W24A 4A8QA 5KFMA 3TVYA 4AXJA 4OHXA 4DFMA 2OHDA 1W09A 5EK4A 4ED4A 1U2FA 2QO3A 3PACA 2RHQB 4KY3A 3PRBA 1U48A 4Q5VA 1B70B 3P7IA 4PZVA 3ZSSA 3FBEA 5C2GA 3VF0B 4X20E 2UXBF 2ZLYA 2L08A 2OPPB 2NPIA 1ACMB 3CEDA 1WOSA 3E01B 4X62F 3W9HA 3OL6A 2DGOA 2QLFB 5KG0A 3VZIA 2NTXA 3A3OB 3W2VA 1RWWB 2QL9B 1W9RA 4PUOB 4P7VA 2VQEF 3RYIE 3QFHA 4AQFA 2FHMA 2JZ5A 4BHQA 4JV5T 1R8CA 3PRDA 4ECRA 4OX9J 2ZMAA 3O1LA 2CXEA 4N41A 1NO8A 2KT2A 4LSNA 1MN7A 3NWGA 1RT6B 1HNXF 1PYOB 4R25A 4R8UA 1Y5LB 5HLFA 4MAKA 1H73A 1KN6A 2CFXA 4WXOA 3ZT6A 4NYPA 4CH0S 2ZJRQ 5D4OA 3UD3P 1LW0B 1MIWA 1S99A 2D0UA 2DRBA 3BS9A 3GR0A 3AQPA 3PTRB 3FFIA 3W3SA 2NXJA 2MY7A 1X8DA 3ZPOA 2E5IA 4Q45A 5AQRB 4NMLA 1LW2A 2GHWA 4FXDA 3IRXB 4QPTA 1LK7A 2GIQA 1S1WB 1HA1A 4B3OA 2W8LA 4QWDA 1S1TB 2BVZA 4DUZJ 2M8DB 2E9RX 2HEKA 3I0OA 2F40A 5IFMA 5AQOB 2RDIA 2ZM0A 1HTJF 4H54A 2OSQA 1SUQA 4OZNA 2XYHB 3HX9A 2XHWA 1L5UA 2G0UA 1NDLA 3MF5A 1VBYA 2OO4A 3GU0A 2U2FA 4B3MJ 4USWA 1VS3A 3QWUA 2OPQB 4P52A 4DR4F 3IO1A 3DRYA 4LR8A 3N5BA 2HVDA 1JLEB 4NZ0A 4MMOA 3D54A 3Q83A 1YJNS 3VGSA 4NXMT 4RUCA 1YQHA 1IZNB 4F4KA 1TKZA 3DOLB 3MJXA 2HK3A 2QVAA 4CNZA 2BE2A 4UF0A 3NGRA 3BH6B 5LXRA 5J0ZA 3OSNA 1FWPA 4WP9A 3R5GA 5LSLA 5BR8F 2V1DB 2HWHA 2W9BB 2MQMA 3JC6C 4MFBA 1JLQA 3MTKA 3C15B 2W1BA 2OKQA 4AFFA 1TVRA 4IG0A 4DR3F 5KFFA 4IUFA 1RI7A 4DI6A 2AP6A 1Q5VA 1D0ZA 5C25B 2W4XA 3UQ7A 3IAM9 5JUMA 4ANEA 1R0AA 2CWYA 1XR7A 4MFRA 4RW8A 4IL4A 3GTYX 4WIIA 4LFAJ 3O5TB 5HXRA 3PJWA 2XTLA 1YHQS 3DCAA 5A6PA 5KFDA 2IDLA 1HQ2A 1HBOB 4EYIB 3IF8B 3C50A 3BO3A 3TZYA 2H7VC 3MCSA 2NR4A 2L41A 4WE1A 4OV6A 4C8LA 4DFJA 1NJZA 2WM9A 4O3PA 5CD4A 1CEZA 4CLPA 1WKKA 4RZRA 2QEXS 4KGVB 2QX0A 1OSDA 4OI3A 1WYCA 4NUUA 3GONA 4OK0A 2AGQA 2WAQD 4IO1A 3UFGA 1OYDA 4UQTA 1QAXA 3UU5A 4HVZA 1CUNA 2X1FA 2QFJA 4FXWA 3QNWB 4EIWA 4LFCJ 3Q89A 1FDBA 3EDQB 1TU0B 2BQ3A 3EMTA 1LKZA 4OZJA 4E7SA 4NCGA 1UTAA 2M7SA 3GMGA 4L3KA 4ZPVR 5IT9Y 1RHKB 4K4ZA 4P73A 4X4QA 4ILRA 2LA6A 3K8WA 2ZH1A 6FDRA 1RT1A 1IUJA 2W8KA 3BN7A 2GMJA 3UVJB 3M4XA 3D7SB 3LWMA 4JI3J 1WORA 4L5GA 1NK6A 1NKBA 3SQGA 3O8WA 5F3TA 5K8NA 2AZ1A 2IRYA 2ATLA 4IFVB 5KT5A 4ZHRA 4UUXA 1RKIA 5T7LB 2ZBRA 5D0RA 3PX0A 1YK9A 3V4MA 4OHYA 2G4BA 3FVYA 4PJLA 3M8WA 3TAQA 1SKSA 2C2OB 3UQ4A 3VQTA 1RLDA 3ANWB 3W65A 4FYWB 1RBLA 3KJVB 2YX4A 1VQ9S 3ZSTA 1PGZA 3CD0A 5KFGA 4RW6A 3MAAB 3HKEE 2APOA 4DUYF 5CD4H 2WZIA 4HE8A 4ISSA 4ECSA 3TZXA 3H3MA 2DY9A 2PC6A 4LBIA 4N5SA 5KOXA 2VJUA 3PW0A 3RB4A 2CQ1A 4KRWA 4NXNJ 3VVUA 1RAOA 2C2ZB 2CZ4A 4ID5B 5KFXA 4DCJB 2BJ7A 4OJ3A 4TU9A 1DZ5A 4S0MA 1FRJA 4PXDA 4X4VA 1O8BA 1U49A 5HANA 1XNRT 2W01A 4EOZB 4FYVB 1S0NA 5HWXA 4B9UA 4X65T 1L3VA 3N9UC 2ZKTA 5HEGA 3S7RA 2XLKA 3ZZ0A 3W5ZA 4ZVUB 2OGUA 2B9YA 3DRPA 3JTPA 1N88A 1N33J 3TRGA 1S9GA 5KFPA 3I56S 3D67A 5D4PA 3LP2B 2NSCA 4F3QA 4UZCA 3JYTA 2W66A 1I94F 2GQ2A 4OV1A 1B0VA 2XTJP 3MEKA 1EIYB 4N8NA 3LH2S 4ZS6A 2L8KA 2C22A 4U33A 2NXCA 4HDHA 2PI5A 4JV2A 2OTJS 2IYIA 1SUMB 3JQMA 1WCRA 2XYPB 4M5DB 4NYZA 1N32T 4OHZA 5HMWA 4TLRA 2X3GA 2CHNA 2YKSA 2V6XA 3WHIA 4KFBB 3MWBA 3PUYF 3M2UB 1AROP 1NSQA 2E29A 2XLJA 1FJGF 3PEJA 5C2CA 2DGQA 4O3QA 2IAJA 4I7FB 3PO5A 1FWLA 1FF2A 5HXSA 3PX6A 5MLCV 1XMQJ 3C19A 5GAHU 2CRBA 1TL1B 1YRTA 1TUGB 3ZTPA 5CA5A 5L3CB 5EHHA 3NKZA 4K4VA 5DG7A 3BKTA 2QRXA 3T6JA 3TVKA 1UETA 3AXJB 3M8QA 3LGNA 1XEZA 3R6GB 2YK0A 3QSYB 1RACB 2RT3A 4CQ1A 2N3LA 2FLOA 1P6TA 2HRTA 2KH9A 2HVEA 2UV8G 3LAKA 3HKWA 1XMOT 1NPRA 5F8NA 4ZVRB 4F8HA 3ZZOA 2V7JA 5AE2A 2VPWB 3PUQA 1OEDE 3MM6A 3FZLB 5HVHA 4U9RA 4B3TT 2OPRB 3M2RB 3EZUA 4XPCA 5F8MA 1GFWB 3AODA 1N36F 2BG9A 2AJFE 3KMQA 5ETQA 1YTYA 4DR7F 2MJNA 5IWAJ 3F44A 2K24A 1SJFA 4MT1A 2IBKA 4DZDA 1LWEA 5KG2A 3G86A 4RW4A 2GO9A 4P2MA 1IBKJ 2MBGA 3BDPA 1WDTA 2OPSA 2HAFA 2EFPA 2V26A 3UU8A 4YFUA 4V19J 4K5RA 5I42B 2B6AB 2GGPA 2HVHA 2UUBF 2EFGA 2CG4A 3PUAA 3KHGA 2VIHA 1FRKA 2ZE2A 3CCMS 2Z2MA 2L9NA 3KNGA 4DV7J 2L9QA 4U95A 3P4RA 4O4GA 4DV6F 4NX9A 2H54B 2DNRA 3KG0A 4O4JE 3I0SB 5KAKA 4R5PA 1ZA1B 2QYCA 3E2EA 2BRLA 3R7NB 2MZSA 5LJ5Y 4ASKA 2V5CA 4YJ2E 1BR0A 4Y2AA 4DSLA 2VQFT 1M0SA 1IKYA 4ILUA 4EZ9A 1YKEB 2O66A 4I2PA 1VIXA 2R6GF 2ERRA 4PCQA 2AJ1A 4DLGA 2IIUA 1O6XA 2D3UA 3TKLB 4G1QA 5LNKA 2K3KA 4PG4A 4EBEA 2YX7A 3ZZYA 1JLFA 1PBUA 2XI3A 3TOQA 2HNDB 2IMOA 1JNZB 3MHYA 2V4JB 4DR1T 4DIDB 1R6YA 5AQUB 1CG2A 3JSYA 1DAXA 1R7IA 4HHUA 4CO4A 2VFTA 4IREA 1WWHA 5HK4A 1RCOB 2F8HA 4ZLJA 4U96A 2FJEA 5KFSA 2YNIA 3EICA 3CPWR 4IRCA 1RHQB 2EHOC 3VHQA 3R9LA 2Q79A 4IFYA 2PA3A 2B5JB 4DSFA 3SMZA 4NZ7A 2XHCA 2YKNA 3TLTA 2JIWA 4A4JA 4P10A 3WDOA 1RSCA 1KP6A 3KBTA 3H5XA 4ZI2C 2LKZA 4UOHA 2AWZA 3L95X 1SV5A 1WUUA 3L4BC 3QPIA 4KC5A 5E7OB 3SFEA 1TKTA 1WF1A 1WTFA 2VV5A 1YKWA 4ED3A 3M9MB 2MLXA 5J1PA 2EC2A 2ZNZA 5L3BB 1XK8A 2ACXA 4C48A 4OZLA 4CYUB 1TK0A 1OXZA 2LSIA 3R7SB 4ZLPA 1UX4A 2WCXA 1B7TA 2BBEA 2BOPA 2KZZA 2ZBPA 1NKCA 1G7CB 4MK7A 5E3PA 2X1BA 2HQIA 2AD9A 4KBIA 3AB4B 4DL7A 8ATCB 2AGOA 2MGZA 4K2JA 2NZ4A 2PG8A 1FT8A 2YKMB 3GIIA 3D68A 2A2DA 4L74A 4ZCKA 5HXCA 3NBPB 2KU7A 3W2WA 1A6LA 2EK6A 4LF7F 3RC3A 3VKGA 2BJ3A 3ZZTA 2YQ0A 3D4JA 3O3LA 4LFBF 2X0HA 3WQPA 5KFJA 3AOAA 5ETPA 2FHKA 2J0SD 3DOMB 3D3CJ 4M8LA 2MKJA 1XDPA 3AAEB 4ADZA 2YN6A 5DDRC 1C1CB 5DDPC 1ZZFA 2N82B 3AEBA 3R3TA 3ENVA 1NB2A 4GKJF 4O4RA 3ONXA 1T11A 4NPPA 1RT7B 1VLOA 2DTJA 3SV4A 4YR3A 1UK5A 3KUGA 1HBUB 4YSZA 3GG0A 4BAYB 3IM9A 1FHTA 1KVIA 3R6LB 4DV4T 2C2DA 4X4TA 1D3WA 4OHVA 3UCZP 4WP8A 4MKYA 1KONA 3D28A 1NSAA 4DFKA 2XSJB 3NGSA 1U1RA 3CCUS 2FZGB 4I69A 3MD3A 3BQ1A 4U3CA 2V2VA 3M9NB 4K2XA 2UXBT 1MIVA 3SOLA 3Q9DA 4FF4A 4X66F 1P1LA 4JI8F 2VB6A 4DJBA 1ZTWA 4YMEA 3AE8A 2CJKA 4X62T 1YSJA 3SCJE 2MZ1A 3D6FB 4IO9Q 3BR8A 1AZSB 2YNHB 2D2SA 1VBKA 2D1CA 1WEZA 2CJXB 1MMNA 1US7B 4KYZA 1KR4A 4MKAA 3QT6A 4ZJOA 2VL0A 4MBQA 2VQET 3TP2A 3H59A 1IKXB 2VVNA 4Q8EA 3B13A 1BGXT 3DYAA 4GO5X 2AIRB 4C11A 2A1BA 1VQMS 4WZXA 2Y0SD 4UW2A 3MUTP 4TY9A 3JSMB 3BB5A 3KNAA 2PEBA 1HNXT 4CWBA 4QWCA 4ITSA 2A2FX 4ETZA 4LVNP 3UU3A 3QATA 2V6YA 2LSGA 2FTRA 5LCYA 3W8GA 4DR2F 4B9NA 1HNZJ 2IIHA 3MMBA 1RTZA 3B57A 3DLKB 3MA9A 2FUPA 1WHYA 5H1SV 1WSVA 4KAIA 4JUYA 4CZCA 1D1BA 1WHVA 1TTHB 1L3TA 1VBZA 2IMLA 2DY1A 4HTIA 2FJVA 3OXLA 2X3DA 3DFEA 1U2RA 2EW9A 4DR6F 2JEGA 1CJVB 2ZZTA 3W5YA 3TAMA 3CJ3A 3PUSA 1DJ0A 1J5OA 5HEHA 2DGUA 2NR0A 3AA7B 4DV5J 2V4RA
chains in the Genus database with same CATH topology
2AEMA 2I0MA 4EI2A 4G65A 4Q25A 4GVLA 4J7CA 4J9UE 4RO0A 2AEJA 4XTTA 2OLTA 1SUMB 1XWMA 4YS2A 2FY8A 3RBZA 4L76A 2BKPA 1T8BA 2AEFA 4L74A 4J9VA 4L75A 3L4BC 3RBXA 1VCTA 4L73A 2BKOA 2IIUA 1LNQA 3L39A 4J90A 2OGUA 1T72A 3KXDA 2BKNA 4J91A 3JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEM A;  2I0M A;  4EI2 A;  4G65 A;  4Q25 A;  4GVL A;  4J7C A;  4J9U E;  4RO0 A;  2AEJ A;  4XTT A;  2OLT A;  1SUM B;  1XWM A;  4YS2 A;  2FY8 A;  3RBZ A;  4L76 A;  2BKP A;  1T8B A;  2AEF A;  4L74 A;  4J9V A;  4L75 A;  3L4B C;  3RBX A;  1VCT A;  4L73 A;  2BKO A;  2IIU A;  1LNQ A;  3L39 A;  4J90 A;  2OGU A;  1T72 A;  3KXD A;  2BKN A;  4J91 A;  3JXO A; 
#chains in the Genus database with same CATH topology
 4RW7 B;  2ZUG A;