4JI8T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji8T00
4KHPT 4LFBT 1I94T 4DV0T 1XMOT 3T1HT 1XNQT 2HHHT 4JI8T 1HNZT 4DV6T 4YHHT 4B3RT 2UXCT 2UUCT 4NXNT 4JI1T 1IBLT 1IBKT 4JI5T 3OTOT 1XMQT 4JI3T 1HNWT 4LF5T 4X62T 4LF7T 4DV4T 4GKJT 1J5ET 4X65T 4LF6T 4B3TT 2E5LT 4JI4T 4DR2T 4DUZT 1N32T 4LF4T 5LMUT 3T1YT 4DV2T 4DV7T 2UXBT 4NXMT 4DR1T 4DV3T 4GKKT 4X64T 2ZM6T 4JI0T 4LFCT 1FJGT 4JV5T 1HR0T 1XNRT 4LF9T 1IBMT 4DR5T 2F4VT 4AQYT 5BR8T 4B3MT 4JYAT 4K0KT 1N36T 4LFAT 4DR7T 1HNXT 4DR3T 1N34T 4JI6T 4OX9T 4B3ST 2UXDT 2VQFT 4DR4T 4X66T 4DUYT 1N33T 4DR6T 4YY3T 5LMNT 4JI7T 2VQET 2UUAT 2UU9T 4DV5T 4LF8T 4DV1T 2UUBT 5IWAT 4JI2T
chains in the Genus database with same CATH superfamily
3QB5K 3ZSSA 5LJMA 3AEDA 3AE7A 4LMKA 2YDRA 1XNQT 2DNXA 4HFDA 5IHYA 2WCAA 4ASKA 4AKHA 2XQYA 5FKYA 3LDQB 2K9AA 5HXHA 3AB3B 3HL6A 1ZKEA 1KEYA 1J1JA 1SUMB 2RP4A 2FBWA 2EHOC 3N9NA 1JNZA 2PTFA 1OXZA 3CMLA 1T98A 2CA5A 3RIUA 1YXRA 3SS1A 3AECA 3CQGB 3IF8B 3G06A 2C0SA 3VRBA 2JQQA 2LSKA 4CN1A 4PJNA 3N9MA 4DR1T 5DABA 4DV3T 4EZHA 1H7CA 3AE9A 3KDSE 1YW0A 3U3IA 2IUBA 5BR8T 4ZI2C 1EZ3A 1WLXA 2XAGB 4QH1A 4LFAT 3A7MA 4XZCA 5FMNA 5L3CB 2YKSA 4PJLA 2WWVA 5JRCB 2BBJA 2A9UA 1YQ4A 2W4XA 1BR4A 4O2AE 4KBMB 4KHZF 2V5DA 2UUBT 4ZEYA 1HG2A 1D1CA 4HGAA 2QA7A 1WR0A 1YQ3A 4Z8XA 4P09A 4HWIB 2BKPA 2MAWA 2I6HA 4TX5A 5JVDE 4QH4A 2V6YB 2V8SV 2H88A 4B3RT 1MIVA 3P4RA 2ZM0A 2XQ9A 5LBMA 3WI3A 4JI1T 4ZI3D 3UU4A 3OTOT 3PV0F 1UX5A 1D1BA 2XPKA 2Q9QD 3LG7A 3L3PA 4AKGA 2ES0A 3K1SA 4H9PC 4A56A 3RLFF 4IDOA 3AAIA 4IE6A 2BS4A 3DTOA 2OV9A 2JIWA 2HH7A 2BG9E 3NRYA 5LGTB 4GKKT 4H9NC 4WYVA 4LFCT 1WFDA 3LK2B 2LM9A 4TV9E 4IHJE 4H63H 2VKDA 2X0HA 2JQ9A 4ZHQE 5L4EA 1OEDA 2J4GA 3R6NA 4B3ST 5FYMA 3UU6A 2HN1A 4YY3T 4L5GA 3RC8A 5HCMA 2X0LB 3N2OA 1XZYA 2WDRA 3JC6C 4P0AA 4HN9A 2W62A 2X0YA 5FY7A 2V7MA 3LSVA 2YN6A 3HR0A 3EVYA 2NW7A 3PUQA 1HCIA 3GMIA 2XQ3A 3RC3A 4UV9B 5ABFA 2K24A 5CGMA 3ZT6A 2WSSV 4EEDA 3FBZA 3UUMA 4LF5T 2BKNA 3C4ZA 2V6YA 5KX5E 2PG8A 4IDNA 2XUEA 2CM0A 2K3WA 3EI0A 5C3JA 2MPKA 5FL1A 2VURA 3TLSA 2E9XD 2XQ5A 1QUUA 2NTXA 2RA1A 2IW5B 1LRZA 4YSXA 4X1YE 2W63A 4DBRA 3Q5EA 2CXDA 1X9BA 4U7IA 2I59A 4U31A 4U74A 2ODUA 5L3DB 3AEBA 2VASA 3B57A 4AQFA 1W0AA 4YSZA 4V1Av 3P4PA 2X9WA 2VQET 3N2KE 3N9PA 2W61A 4UVCB 5HWXA 1V9DA 1Y01A 4AI6A 4EYUA 2VVNA 2ODVA 3AXJA 3R84B 2WQYA 4O4IE 3CX6B 3X1DA 4MLKA 4JI8T 3PDYA 4TUYE 3HKEE 5JDHA 2C5IT 2CBJA 4OK0A 4YHJA 5FNVE 1E1HB 1XMQT 5L3EB 2AE9A 4CI3B 3RHWA 4TN7B 1BR1A 5F5WA 4A97A 3N9QA 3ZLIA 5FVLA 2E5LT 5LG3A 3RQWA 1HF8A 1D1AA 3KV9A 3NBXX 3NRXA 2WZIA 3H3AA 5GONE 4WBNE 3AEGA 4EEBA 3SWHA 5E0OA 3V5SA 2WMOA 1MNDA 2N9DA 4QXBB 2ZMAA 2VVSA 2ZM6T 4IDZA 3Q5XA 5LB7B 5J2TE 4FJOA 1OEDC 1XNRT 2Z6EA 4ZI3C 1LVFA 2QRXA 4DR7T 3JCFA 3EDVA 5LCYA 3LFMA 5JREA 4YFSA 5LYJE 2UXXB 3I0OA 3AA0B 4JBWF 5TAOA 4KHPT 2LHRA 3LK3B 3T1HT 1T7SA 5CFBA 3M65A 4QH5A 4YXDA 1UCUA 4EXTA 4UXNB 4XAXB 1ZHCA 3KBUA 4XBFB 2V1DB 4TZ4C 1B7TA 3CIRA 2X67A 4G63A 4GKJT 5FP3A 1OWAA 3ANWB 4X1KE 2X51A 5ABEA 3PUAA 2BBHA 5AQTB 3M3ZB 4IREA 3ETUA 3RH3A 2XTLA 5LMUT 2LLYA 5HYAA 4KI0F 3VKGA 3QC9A 4COFA 1LKXA 1Z0PA 3F31A 2XAJB 4YTPA 3NZPA 5JH7E 3VU7H 1KNZA 3RF1A 3CVRA 2W2UA 3LK42 4AQFC 3EDUA 3FHNA 2N1GA 3CQXC 2CBIA 4ADZA 4MHCA 3MA9A 3QB5A 5LA6E 4AXPA 3OYXA 1HS7A 3J9X1 1UK5A 4TWDA 3HKDE 4IE5A 2UUAT 1U4QA 3AEFA 3FZMB 2DWKA 3FBLA 2YEVC 2WAUA 2JPFA 4ILBA 5CB4E 1IAPA 2FJDA 2BZBA 4U2YA 4CXWA 2HHHT 2XQ8A 4ZS2A 3UUBA 3PUZF 5LHGB 1R8IA 2L9QA 2UXCT 4PAGA 4CQIA 3WAKA 3AE3A 5HEOA 2KZ7B 4I50E 2WU2A 5HCJA 2D0UA 4DV4T 2V7LA 3IHRA 4WW0A 3NZQA 1J5WA 5HEJA 4LF6T 5CJ5A 3RIAA 5A1LA 4DR2T 4DUZT 5J0ZA 2WDQA 4LMJA 4TV8E 2VK9A 4PK4A 2DL1A 1E7PA 5HXRA 1O3XA 3ANWA 4ZI7E 1US7B 4EB6E 4X20E 5C8YE 5LGUB 2PJQA 1E2AA 2CLYB 3PUXF 3UQ4A 2CE7A 1HTJF 4O2BE 4LF9T 4UR9A 3FXEB 1JNRA 5EK3A 3AE4A 5FVKA 2UXDT 4A98A 1OEDB 3QK6A 4FI5A 1IJ5A 5FXVA 2MYSA 4GIWA 3BQKA 3PUVF 5DQWA 4LF8T 5HXCA 2Q9QB 4JLEA 2IHR1 4LFBT 1I94T 1NWMX 3PURA 3N5LA 4EAHA 1XMOT 3L39A 2JQKA 3ZYLA 2BS2A 3FZLB 2NOXA 4DV6T 4YHHT 4UV8B 5ABFB 4AQGA 1IBLT 3VHLA 2WP9A 3O1HA 1SE7A 1IBKT 2MOZA 4MFRA 3PJAA 2KNDA 5AQJB 5J2UE 2LHNA 3BQLA 1J5ET 3I0QA 5L3GB 4ZS3A 3ZJ1A 4ZZCA 4YTMA 2VB6A 3ZC0A 2ACZA 3JAEA 3RYFE 1VCTA 4DV2T 4DV7T 2M6BA 5KMGP 2J62A 3CQCB 4EV6A 4NXMT 2V5CA 2YOEA 4L0RA 3OPCA 1UUSA 3ONXA 4HFBA 2HPJA 5LP6E 1YKHB 4DNDA 4I43B 3HKCE 2JRKA 2LOPA 4QXCB 1DU2A 5AQFB 4DR4T 4AKIA 4X1IE 4DMWA 4QKNA 2LSJA 4J2CA 1MIWA 1QLBA 3RYIE 3PUGA 3LBXB 2LJLA 3RYHE 2H7VC 3JAFA 3AXJB 2XAQB 2VL0A 2NP9A 3UU3A 4UELA 4BAYB 2I0MA 1VCSA 3O9XA 2Q9QA 4PJJA 5JR9B 5L3BB 2E9XB 3CKDA 1HFAA 4NUUA 2MBGA 4KP3C 4DBQA 2BS3A 5AQKB 1XDOA 4GYRA 3ZN0B 3EUHA 4BJNA 4NPPA 5H6RB 5IYZE 4HWFA 2JMKA 5AQOB 2M6IA 3A8YC 4AISA 2XJ7A 1G73A 2UXBT 2NR4A 4UF0B 3RIUC 3SOLA 2PFVA 3K8PC 5L47A 1HR0T 2LSIA 5EK2A 2CMRA 1N34T 2VQFT 5JDNA 3F57A 4QWNB 3KV5A 2ZM8A 1UGOA 2CRBA 1WRDA 2IDOB 3K3NA 2VL8A 4AKLA 2K5BB 3F2EA 4IE7A 3ZSTA 4X5TA 4CI2B 4PFOA 3SFEA 2W66A 3CK6A 5HXSA 4TNVA 4ILAA 3TLWA 3LBXA 4OYJA 1UURA 4HFVA 4HWCA 2DHRA 2K48A 3RQUA 5AQLB 4LF7T 4I55E 1CUNA 5KXJA 1VOMA 5AQNB 5JR9A 3B13A 3RI5A 2E9XA 2OA5A 4JI4T 3PU3A 4CI1B 2IC6A 2Y48B 2C5JA 4M1PA 4OYKA 2CXFA 3UU5A 2L3LA 2RPAA 1W9RA 1QSDA 4P0BA 3VR9A 1Z8UA 4ISTA 1T8BA 5LG4A 5AQHB 1XWMA 4X64T 5JDLA 4JI0T 2LE8A 2L8KA 3C64A 3Q5WA 1GQEA 2HN2A 3QUJA 3P4WA 3C50A 2CLYC 2KLQA 4I0UA 4UF0A 2H7OA 2LT3A 2FJBA 4IGUA 4DR6T 4DMVA 2KWHA 3B5MA 4JI7T 3Q9DA 4B6XA 2WS3A 3KVBA 3N2GE 3P4QA 4CZZB 4MBQA 2V7JA 3DJBA 2LRLA 1OEDE 3OKQA 2W0GA 5AQUB 4HKAA 4DV0T 4QHOA 2X9YA 2Q9QC 4ANJA 5AFUL 2LM2A 2XY8B 1M62A 3AE8A 3D0TA 2BG9B 3RRCA 3P7IA 4NUVA 3KINB 3N9LA 4DO0A 4KX6A 3CX8B 2LKHA 1SHZC 4Q25A 2QVAA 2ACXA 3KVAA 2VKJA 4BJMA 2CWOA 1HG5A 3E0ZA 2E8IA 5FXZA 2KWIB 3FZHB 4YJ2E 1ZEEA 3T1YT 1U5PA 4L9IA 2W67A 3ZEFB 3BQIA 3MXZA 4GYSA 1S35A 2XQAA 4N78D 2V26A 3VKHA 4WZXA 4PFPA 1MIYA 4F6RC 3I9WA 3UUXB 4DR3T 1ZV4X 5IUXA 2X9HA 4YT0A 4X66T 2W00A 2N2NA 4ZZBA 3GA8A 5AQQB 2YDSA 5LNKA 3RRWA 4HTEA 5FY1A 3GWHA 3TLVA 4EGWA 1G8XA 2IIUA 5EK4A 4UVAB 4DVDA 5CA0E 2YINA 3RKGA 3JC6D 4NXNT 3I1AA 4H63V 3EAMA 2PBIA 2BDEA 3L09A 3OVUA 1ZOYA 3C98B 5JR9C 2E9XC 4OHFA 4GK5E 4ISSA 2BG9A 4B3TT 3ZMVB 3IEEA 3V5UA 1N32T 2WDVA 3C4XA 2LSGA 3UT5E 4ZOLE 2IMLA 3FZFB 2FUPA 5HXEA 4EZ4A 3OJAA 3ZT7A 4EYYR 3VRAA 4HEAA 2KSRA 1FJGT 3K3QC 2P9BA 4WNKA 2XM2A 4JYAT 1MMAA 5ABHA 1YKEB 3ONLC 2D2SA 1N33T 4PW8A 2XAHB 2JMHA 1KFYA 2LKGA 2UU9T 3AA1B 5AQPB 4CXXA 2NW8A 5ABGA 2XASB 4O4LE 2J1DG 3UU8A 4Z91A 4C91A 2CWYA 4G2AA 2CEAA 4GOUA 4H9OC 2KMFA 3KV6A 1I6ZA 4IDQA 3ZYKA 2A2FX 2FJEA 4JEHB 3HA4A 3ZT5A 4IT4A 1IJ6A 2VKHA 3MKDA 1WYBA 4C90A 4PNIA 3L8RA 4A5XA 5LOVE 2LOSA 1HX8A 3UFEA 3PU8A 1UX4A 3GN5A 3MZKB 3DP7A 3KFWX 2ZLYA 3W15B 4TNWA 3BK9A 4YLHA 4CN6A 3PUWF 2XHEB 3ZJ2A 1ZP0A 4JEUB 3LJCA 2NTYA 2CCQA 4UEMA 1AJ3A 1LVKA 2IAKA 5AQRB 4AKRB 4K0UA 3RX6A 5AQVB 4U33A 2CPTA 2X68A 4QX8B 4DR5T 2Y8DA 3ETVA 1X79A 5BMVE 4E7ZA 1M7KA 3AVSA 3U78A 2J47A 3S4UA 4DUYT 4NIQA 3AEAA 3ZMSB 4ERRA 4YTNA 3J7Yq 3KBTA 2D5UA 4H9RC 3SRZA 3I9YA 3UULA 1MNEA 5LXTE 5FXWA 3P8CD 2WMNA 3PUYF 1FIOA 2R6GF 3AAEB 5JDMA 5M4YA 4IIJE 3O1IA 5AQMB 3Q5DA 2UUCT 5KDMC 4LMLA 1KK7A 4CXYA 4JI5T 1W0BA 3VR8A 2BG9C 2WWUA 4F8HA 3ESLA 1MMDA 2C5KT 4KMCA 2QYWA 2YK0A 3SFDA 1BR2A 3EHZA 5L2LA 4AIUA 3MK7C 1D0YA 2BKOA 4PJMA 2JQHA 5L4HA 2UXNB 3RGLA 4E7SA 3AE1A 4HFEA 3E08A 2V7KA 5AQIB 2A3DA 3MJXA 3PTRB 4H9SE 5JQGE 5EZYE 4QX7B 4I4TE 3ZYMA 3OYZA 5FY0A 5JDFA 2MTQA 1IBMT 1MMNA 2F4VT 2OLTA 1T72A 2XSBA 5JRCA 1S94A 2G0UA 4HFHA 2KXPB 3AA7B 4OX9T 3TLTA 2VKOA 4ILCA 5LBQB 5JTGA 2X9XA 3ZCJA 3RPUA 5LMNT 5LHIB 3Q2MA 3TLUA 2V7IA 5LGNB 4IL4A 4DV5T 4EOZB 4TWFA 3QNUA 4DV1T 1KNPA 4JI2T 5HEGA 1CHUA 2WU5A 4U7YA 3C51A 2HPLA 4CN4A 2XAFB 4GK0E 2IC9A 1HNZT 5CA1E 5LJNA 3FXDB 1W09A 4UIGA 2NWBA 2EHOB 3PE0A 4PK6A 2H3RA 4JI3T 2B1EA 4X62T 4HWDA 2WZHA 3AE6A 4IE4A 1NENA 3UTKA 5J1GA 5ETWA 4O4HE 2WBLA 3PUSA 3ZMUB 2CHOA 4WBOA 3RKOA 2D9DA 4LF4T 2XM1A 3JADA 1YD8G 3NVOA 4O4JE 4PK5A 1D0XA 1D0ZA 4IE0A 1KNRA 2NW9A 2DCFA 3RIFA 4JV5T 3IBPA 3E22E 2BVLA 1N36T 1HNXT 2D0TA 4JI6T 2EHOD 3AEEA 3K3OA 4YSYA 2A72A 1WYCA 1KF6A 3HKBE 4IL9A 4DIDB 5HEHA 3N9OA 3AE5A 5HEUA 2XQ6A 1IZNB 3AE2A 2DI4A 5C2TA 2H89A 4KUMB 4ILUA 1NAFA 2AXDS 2KINB 4HFIA 4OFZA 2XSAA 3RYCE 2CHNA 4ZI2D 2V6XA 5FXXA 3ZMZB 5FL0A 3ZPOA 2WB5A 3P4SA 4U2ZA 1HNWT 4U3CA 3H3MA 3O1JA 2KT9A 2YDQA 3ZKRA 5AQSB 1VRBA 3QOFA 5JDGA 3ABVA 3FB2A 3CPZA 2EHOA 5H6QB 5ADXL 2E5VA 2SPCA 4UVBB 2YU1A 3ONJA 3IA3A 4HWHA 2Y6XA 3NKZA 5HAXA 4U72A 4QXHB 2X66A 3FZKB 3AVRA 5LHHB 3CX7B 4EIWA 3O4XE 4AQYT 3AAAB 4JUYA 4B3MT 5L3FB 4TWHA 4H9QC 3NWIA 1NEKA 5JDQA 3ZCIA 2DLRA 2XQ4A 2DWGA 3A5XA 4HE8A 5DJQC 5F3JA 3ZC1A 1SA0E 4IDPA 2B76A 4Z90A 1L0VA 2VWAA 4P1NA 3UFGA 3PJAJ 2M67A 2FJAA 2WM9A 1XDPA 3EABA 2JJ9A 4BA9A 5DQVA 3ZN1B 3CWZB 2WY2A 4O8SA 2CXLA 3TKLB 4ZXLA 5AQGB 3T8OA 3UQ7A 4X65T 2LRKA 1WCRA 4HFCA 3GN5B 1FEWA 3C4WA 3HI2A 4YJ3E 1HX1B 1WR6A 2E2AA 1FMVA 3H37A 1Y64B 3ZMTB 2LSYA 2ZM2A 3WAJA 3MACA 1BR0A 2BVMA 2YU2A 2LEHA 5F8PA 1MMGA 1FMWA 2QGSA 4K0KT 2GK9A 3AA6B 2XQ7A 4MALA 3KV4A 2XZEA 3UUNA 5HWYA 3P50A 3OBVE 5IWAT
chains in the Genus database with same CATH topology
4KHPT 4LFBT 1I94T 4DV0T 1XMOT 3T1HT 1XNQT 2HHHT 4JI8T 1HNZT 4DV6T 4YHHT 4B3RT 2UXCT 2UUCT 4NXNT 4JI1T 1IBLT 1IBKT 4JI5T 3OTOT 1XMQT 4JI3T 1HNWT 4LF5T 4X62T 4LF7T 4DV4T 4GKJT 1J5ET 4X65T 4LF6T 4B3TT 2E5LT 4JI4T 4DR2T 4DUZT 1N32T 4LF4T 5LMUT 3T1YT 4DV2T 4DV7T 2UXBT 4NXMT 4DR1T 4DV3T 4GKKT 4X64T 2ZM6T 4JI0T 4LFCT 1FJGT 4JV5T 1HR0T 1XNRT 4LF9T 1IBMT 4DR5T 2F4VT 4AQYT 5BR8T 4B3MT 4JYAT 4K0KT 1N36T 4LFAT 4DR7T 1HNXT 4DR3T 1N34T 4JI6T 4OX9T 4B3ST 2UXDT 2VQFT 4DR4T 4X66T 4DUYT 1N33T 4DR6T 4YY3T 5LMNT 4JI7T 2VQET 2UUAT 2UU9T 4DV5T 4LF8T 4DV1T 2UUBT 5IWAT 4JI2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP T;  4LFB T;  1I94 T;  4DV0 T;  1XMO T;  3T1H T;  1XNQ T;  2HHH T;  4JI8 T;  1HNZ T;  4DV6 T;  4YHH T;  4B3R T;  2UXC T;  2UUC T;  4NXN T;  4JI1 T;  1IBL T;  1IBK T;  4JI5 T;  3OTO T;  1XMQ T;  4JI3 T;  1HNW T;  4LF5 T;  4X62 T;  4LF7 T;  4DV4 T;  4GKJ T;  1J5E T;  4X65 T;  4LF6 T;  4B3T T;  2E5L T;  4JI4 T;  4DR2 T;  4DUZ T;  1N32 T;  4LF4 T;  5LMU T;  3T1Y T;  4DV2 T;  4DV7 T;  2UXB T;  4NXM T;  4DR1 T;  4DV3 T;  4GKK T;  4X64 T;  2ZM6 T;  4JI0 T;  4LFC T;  1FJG T;  4JV5 T;  1HR0 T;  1XNR T;  4LF9 T;  1IBM T;  4DR5 T;  2F4V T;  4AQY T;  5BR8 T;  4B3M T;  4JYA T;  4K0K T;  1N36 T;  4LFA T;  4DR7 T;  1HNX T;  4DR3 T;  1N34 T;  4JI6 T;  4OX9 T;  4B3S T;  2UXD T;  2VQF T;  4DR4 T;  4X66 T;  4DUY T;  1N33 T;  4DR6 T;  4YY3 T;  5LMN T;  4JI7 T;  2VQE T;  2UUA T;  2UU9 T;  4DV5 T;  4LF8 T;  4DV1 T;  2UUB T;  5IWA T;  4JI2 T; 
#chains in the Genus database with same CATH topology
 3QB5 K;  3ZSS A;  5LJM A;  3AED A;  3AE7 A;  4LMK A;  2YDR A;  1XNQ T;  2DNX A;  4HFD A;  5IHY A;  2WCA A;  4ASK A;  4AKH A;  2XQY A;  5FKY A;  3LDQ B;  2K9A A;  5HXH A;  3AB3 B;  3HL6 A;  1ZKE A;  1KEY A;  1J1J A;  1SUM B;  2RP4 A;  2FBW A;  2EHO C;  3N9N A;  1JNZ A;  2PTF A;  1OXZ A;  3CML A;  1T98 A;  2CA5 A;  3RIU A;  1YXR A;  3SS1 A;  3AEC A;  3CQG B;  3IF8 B;  3G06 A;  2C0S A;  3VRB A;  2JQQ A;  2LSK A;  4CN1 A;  4PJN A;  3N9M A;  4DR1 T;  5DAB A;  4DV3 T;  4EZH A;  1H7C A;  3AE9 A;  3KDS E;  1YW0 A;  3U3I A;  2IUB A;  5BR8 T;  4ZI2 C;  1EZ3 A;  1WLX A;  2XAG B;  4QH1 A;  4LFA T;  3A7M A;  4XZC A;  5FMN A;  5L3C B;  2YKS A;  4PJL A;  2WWV A;  5JRC B;  2BBJ A;  2A9U A;  1YQ4 A;  2W4X A;  1BR4 A;  4O2A E;  4KBM B;  4KHZ F;  2V5D A;  2UUB T;  4ZEY A;  1HG2 A;  1D1C A;  4HGA A;  2QA7 A;  1WR0 A;  1YQ3 A;  4Z8X A;  4P09 A;  4HWI B;  2BKP A;  2MAW A;  2I6H A;  4TX5 A;  5JVD E;  4QH4 A;  2V6Y B;  2V8S V;  2H88 A;  4B3R T;  1MIV A;  3P4R A;  2ZM0 A;  2XQ9 A;  5LBM A;  3WI3 A;  4JI1 T;  4ZI3 D;  3UU4 A;  3OTO T;  3PV0 F;  1UX5 A;  1D1B A;  2XPK A;  2Q9Q D;  3LG7 A;  3L3P A;  4AKG A;  2ES0 A;  3K1S A;  4H9P C;  4A56 A;  3RLF F;  4IDO A;  3AAI A;  4IE6 A;  2BS4 A;  3DTO A;  2OV9 A;  2JIW A;  2HH7 A;  2BG9 E;  3NRY A;  5LGT B;  4GKK T;  4H9N C;  4WYV A;  4LFC T;  1WFD A;  3LK2 B;  2LM9 A;  4TV9 E;  4IHJ E;  4H63 H;  2VKD A;  2X0H A;  2JQ9 A;  4ZHQ E;  5L4E A;  1OED A;  2J4G A;  3R6N A;  4B3S T;  5FYM A;  3UU6 A;  2HN1 A;  4YY3 T;  4L5G A;  3RC8 A;  5HCM A;  2X0L B;  3N2O A;  1XZY A;  2WDR A;  3JC6 C;  4P0A A;  4HN9 A;  2W62 A;  2X0Y A;  5FY7 A;  2V7M A;  3LSV A;  2YN6 A;  3HR0 A;  3EVY A;  2NW7 A;  3PUQ A;  1HCI A;  3GMI A;  2XQ3 A;  3RC3 A;  4UV9 B;  5ABF A;  2K24 A;  5CGM A;  3ZT6 A;  2WSS V;  4EED A;  3FBZ A;  3UUM A;  4LF5 T;  2BKN A;  3C4Z A;  2V6Y A;  5KX5 E;  2PG8 A;  4IDN A;  2XUE A;  2CM0 A;  2K3W A;  3EI0 A;  5C3J A;  2MPK A;  5FL1 A;  2VUR A;  3TLS A;  2E9X D;  2XQ5 A;  1QUU A;  2NTX A;  2RA1 A;  2IW5 B;  1LRZ A;  4YSX A;  4X1Y E;  2W63 A;  4DBR A;  3Q5E A;  2CXD A;  1X9B A;  4U7I A;  2I59 A;  4U31 A;  4U74 A;  2ODU A;  5L3D B;  3AEB A;  2VAS A;  3B57 A;  4AQF A;  1W0A A;  4YSZ A;  4V1A v;  3P4P A;  2X9W A;  2VQE T;  3N2K E;  3N9P A;  2W61 A;  4UVC B;  5HWX A;  1V9D A;  1Y01 A;  4AI6 A;  4EYU A;  2VVN A;  2ODV A;  3AXJ A;  3R84 B;  2WQY A;  4O4I E;  3CX6 B;  3X1D A;  4MLK A;  4JI8 T;  3PDY A;  4TUY E;  3HKE E;  5JDH A;  2C5I T;  2CBJ A;  4OK0 A;  4YHJ A;  5FNV E;  1E1H B;  1XMQ T;  5L3E B;  2AE9 A;  4CI3 B;  3RHW A;  4TN7 B;  1BR1 A;  5F5W A;  4A97 A;  3N9Q A;  3ZLI A;  5FVL A;  2E5L T;  5LG3 A;  3RQW A;  1HF8 A;  1D1A A;  3KV9 A;  3NBX X;  3NRX A;  2WZI A;  3H3A A;  5GON E;  4WBN E;  3AEG A;  4EEB A;  3SWH A;  5E0O A;  3V5S A;  2WMO A;  1MND A;  2N9D A;  4QXB B;  2ZMA A;  2VVS A;  2ZM6 T;  4IDZ A;  3Q5X A;  5LB7 B;  5J2T E;  4FJO A;  1OED C;  1XNR T;  2Z6E A;  4ZI3 C;  1LVF A;  2QRX A;  4DR7 T;  3JCF A;  3EDV A;  5LCY A;  3LFM A;  5JRE A;  4YFS A;  5LYJ E;  2UXX B;  3I0O A;  3AA0 B;  4JBW F;  5TAO A;  4KHP T;  2LHR A;  3LK3 B;  3T1H T;  1T7S A;  5CFB A;  3M65 A;  4QH5 A;  4YXD A;  1UCU A;  4EXT A;  4UXN B;  4XAX B;  1ZHC A;  3KBU A;  4XBF B;  2V1D B;  4TZ4 C;  1B7T A;  3CIR A;  2X67 A;  4G63 A;  4GKJ T;  5FP3 A;  1OWA A;  3ANW B;  4X1K E;  2X51 A;  5ABE A;  3PUA A;  2BBH A;  5AQT B;  3M3Z B;  4IRE A;  3ETU A;  3RH3 A;  2XTL A;  5LMU T;  2LLY A;  5HYA A;  4KI0 F;  3VKG A;  3QC9 A;  4COF A;  1LKX A;  1Z0P A;  3F31 A;  2XAJ B;  4YTP A;  3NZP A;  5JH7 E;  3VU7 H;  1KNZ A;  3RF1 A;  3CVR A;  2W2U A;  3LK4 2;  4AQF C;  3EDU A;  3FHN A;  2N1G A;  3CQX C;  2CBI A;  4ADZ A;  4MHC A;  3MA9 A;  3QB5 A;  5LA6 E;  4AXP A;  3OYX A;  1HS7 A;  3J9X 1;  1UK5 A;  4TWD A;  3HKD E;  4IE5 A;  2UUA T;  1U4Q A;  3AEF A;  3FZM B;  2DWK A;  3FBL A;  2YEV C;  2WAU A;  2JPF A;  4ILB A;  5CB4 E;  1IAP A;  2FJD A;  2BZB A;  4U2Y A;  4CXW A;  2HHH T;  2XQ8 A;  4ZS2 A;  3UUB A;  3PUZ F;  5LHG B;  1R8I A;  2L9Q A;  2UXC T;  4PAG A;  4CQI A;  3WAK A;  3AE3 A;  5HEO A;  2KZ7 B;  4I50 E;  2WU2 A;  5HCJ A;  2D0U A;  4DV4 T;  2V7L A;  3IHR A;  4WW0 A;  3NZQ A;  1J5W A;  5HEJ A;  4LF6 T;  5CJ5 A;  3RIA A;  5A1L A;  4DR2 T;  4DUZ T;  5J0Z A;  2WDQ A;  4LMJ A;  4TV8 E;  2VK9 A;  4PK4 A;  2DL1 A;  1E7P A;  5HXR A;  1O3X A;  3ANW A;  4ZI7 E;  1US7 B;  4EB6 E;  4X20 E;  5C8Y E;  5LGU B;  2PJQ A;  1E2A A;  2CLY B;  3PUX F;  3UQ4 A;  2CE7 A;  1HTJ F;  4O2B E;  4LF9 T;  4UR9 A;  3FXE B;  1JNR A;  5EK3 A;  3AE4 A;  5FVK A;  2UXD T;  4A98 A;  1OED B;  3QK6 A;  4FI5 A;  1IJ5 A;  5FXV A;  2MYS A;  4GIW A;  3BQK A;  3PUV F;  5DQW A;  4LF8 T;  5HXC A;  2Q9Q B;  4JLE A;  2IHR 1;  4LFB T;  1I94 T;  1NWM X;  3PUR A;  3N5L A;  4EAH A;  1XMO T;  3L39 A;  2JQK A;  3ZYL A;  2BS2 A;  3FZL B;  2NOX A;  4DV6 T;  4YHH T;  4UV8 B;  5ABF B;  4AQG A;  1IBL T;  3VHL A;  2WP9 A;  3O1H A;  1SE7 A;  1IBK T;  2MOZ A;  4MFR A;  3PJA A;  2KND A;  5AQJ B;  5J2U E;  2LHN A;  3BQL A;  1J5E T;  3I0Q A;  5L3G B;  4ZS3 A;  3ZJ1 A;  4ZZC A;  4YTM A;  2VB6 A;  3ZC0 A;  2ACZ A;  3JAE A;  3RYF E;  1VCT A;  4DV2 T;  4DV7 T;  2M6B A;  5KMG P;  2J62 A;  3CQC B;  4EV6 A;  4NXM T;  2V5C A;  2YOE A;  4L0R A;  3OPC A;  1UUS A;  3ONX A;  4HFB A;  2HPJ A;  5LP6 E;  1YKH B;  4DND A;  4I43 B;  3HKC E;  2JRK A;  2LOP A;  4QXC B;  1DU2 A;  5AQF B;  4DR4 T;  4AKI A;  4X1I E;  4DMW A;  4QKN A;  2LSJ A;  4J2C A;  1MIW A;  1QLB A;  3RYI E;  3PUG A;  3LBX B;  2LJL A;  3RYH E;  2H7V C;  3JAF A;  3AXJ B;  2XAQ B;  2VL0 A;  2NP9 A;  3UU3 A;  4UEL A;  4BAY B;  2I0M A;  1VCS A;  3O9X A;  2Q9Q A;  4PJJ A;  5JR9 B;  5L3B B;  2E9X B;  3CKD A;  1HFA A;  4NUU A;  2MBG A;  4KP3 C;  4DBQ A;  2BS3 A;  5AQK B;  1XDO A;  4GYR A;  3ZN0 B;  3EUH A;  4BJN A;  4NPP A;  5H6R B;  5IYZ E;  4HWF A;  2JMK A;  5AQO B;  2M6I A;  3A8Y C;  4AIS A;  2XJ7 A;  1G73 A;  2UXB T;  2NR4 A;  4UF0 B;  3RIU C;  3SOL A;  2PFV A;  3K8P C;  5L47 A;  1HR0 T;  2LSI A;  5EK2 A;  2CMR A;  1N34 T;  2VQF T;  5JDN A;  3F57 A;  4QWN B;  3KV5 A;  2ZM8 A;  1UGO A;  2CRB A;  1WRD A;  2IDO B;  3K3N A;  2VL8 A;  4AKL A;  2K5B B;  3F2E A;  4IE7 A;  3ZST A;  4X5T A;  4CI2 B;  4PFO A;  3SFE A;  2W66 A;  3CK6 A;  5HXS A;  4TNV A;  4ILA A;  3TLW A;  3LBX A;  4OYJ A;  1UUR A;  4HFV A;  4HWC A;  2DHR A;  2K48 A;  3RQU A;  5AQL B;  4LF7 T;  4I55 E;  1CUN A;  5KXJ A;  1VOM A;  5AQN B;  5JR9 A;  3B13 A;  3RI5 A;  2E9X A;  2OA5 A;  4JI4 T;  3PU3 A;  4CI1 B;  2IC6 A;  2Y48 B;  2C5J A;  4M1P A;  4OYK A;  2CXF A;  3UU5 A;  2L3L A;  2RPA A;  1W9R A;  1QSD A;  4P0B A;  3VR9 A;  1Z8U A;  4IST A;  1T8B A;  5LG4 A;  5AQH B;  1XWM A;  4X64 T;  5JDL A;  4JI0 T;  2LE8 A;  2L8K A;  3C64 A;  3Q5W A;  1GQE A;  2HN2 A;  3QUJ A;  3P4W A;  3C50 A;  2CLY C;  2KLQ A;  4I0U A;  4UF0 A;  2H7O A;  2LT3 A;  2FJB A;  4IGU A;  4DR6 T;  4DMV A;  2KWH A;  3B5M A;  4JI7 T;  3Q9D A;  4B6X A;  2WS3 A;  3KVB A;  3N2G E;  3P4Q A;  4CZZ B;  4MBQ A;  2V7J A;  3DJB A;  2LRL A;  1OED E;  3OKQ A;  2W0G A;  5AQU B;  4HKA A;  4DV0 T;  4QHO A;  2X9Y A;  2Q9Q C;  4ANJ A;  5AFU L;  2LM2 A;  2XY8 B;  1M62 A;  3AE8 A;  3D0T A;  2BG9 B;  3RRC A;  3P7I A;  4NUV A;  3KIN B;  3N9L A;  4DO0 A;  4KX6 A;  3CX8 B;  2LKH A;  1SHZ C;  4Q25 A;  2QVA A;  2ACX A;  3KVA A;  2VKJ A;  4BJM A;  2CWO A;  1HG5 A;  3E0Z A;  2E8I A;  5FXZ A;  2KWI B;  3FZH B;  4YJ2 E;  1ZEE A;  3T1Y T;  1U5P A;  4L9I A;  2W67 A;  3ZEF B;  3BQI A;  3MXZ A;  4GYS A;  1S35 A;  2XQA A;  4N78 D;  2V26 A;  3VKH A;  4WZX A;  4PFP A;  1MIY A;  4F6R C;  3I9W A;  3UUX B;  4DR3 T;  1ZV4 X;  5IUX A;  2X9H A;  4YT0 A;  4X66 T;  2W00 A;  2N2N A;  4ZZB A;  3GA8 A;  5AQQ B;  2YDS A;  5LNK A;  3RRW A;  4HTE A;  5FY1 A;  3GWH A;  3TLV A;  4EGW A;  1G8X A;  2IIU A;  5EK4 A;  4UVA B;  4DVD A;  5CA0 E;  2YIN A;  3RKG A;  3JC6 D;  4NXN T;  3I1A A;  4H63 V;  3EAM A;  2PBI A;  2BDE A;  3L09 A;  3OVU A;  1ZOY A;  3C98 B;  5JR9 C;  2E9X C;  4OHF A;  4GK5 E;  4ISS A;  2BG9 A;  4B3T T;  3ZMV B;  3IEE A;  3V5U A;  1N32 T;  2WDV A;  3C4X A;  2LSG A;  3UT5 E;  4ZOL E;  2IML A;  3FZF B;  2FUP A;  5HXE A;  4EZ4 A;  3OJA A;  3ZT7 A;  4EYY R;  3VRA A;  4HEA A;  2KSR A;  1FJG T;  3K3Q C;  2P9B A;  4WNK A;  2XM2 A;  4JYA T;  1MMA A;  5ABH A;  1YKE B;  3ONL C;  2D2S A;  1N33 T;  4PW8 A;  2XAH B;  2JMH A;  1KFY A;  2LKG A;  2UU9 T;  3AA1 B;  5AQP B;  4CXX A;  2NW8 A;  5ABG A;  2XAS B;  4O4L E;  2J1D G;  3UU8 A;  4Z91 A;  4C91 A;  2CWY A;  4G2A A;  2CEA A;  4GOU A;  4H9O C;  2KMF A;  3KV6 A;  1I6Z A;  4IDQ A;  3ZYK A;  2A2F X;  2FJE A;  4JEH B;  3HA4 A;  3ZT5 A;  4IT4 A;  1IJ6 A;  2VKH A;  3MKD A;  1WYB A;  4C90 A;  4PNI A;  3L8R A;  4A5X A;  5LOV E;  2LOS A;  1HX8 A;  3UFE A;  3PU8 A;  1UX4 A;  3GN5 A;  3MZK B;  3DP7 A;  3KFW X;  2ZLY A;  3W15 B;  4TNW A;  3BK9 A;  4YLH A;  4CN6 A;  3PUW F;  2XHE B;  3ZJ2 A;  1ZP0 A;  4JEU B;  3LJC A;  2NTY A;  2CCQ A;  4UEM A;  1AJ3 A;  1LVK A;  2IAK A;  5AQR B;  4AKR B;  4K0U A;  3RX6 A;  5AQV B;  4U33 A;  2CPT A;  2X68 A;  4QX8 B;  4DR5 T;  2Y8D A;  3ETV A;  1X79 A;  5BMV E;  4E7Z A;  1M7K A;  3AVS A;  3U78 A;  2J47 A;  3S4U A;  4DUY T;  4NIQ A;  3AEA A;  3ZMS B;  4ERR A;  4YTN A;  3J7Y q;  3KBT A;  2D5U A;  4H9R C;  3SRZ A;  3I9Y A;  3UUL A;  1MNE A;  5LXT E;  5FXW A;  3P8C D;  2WMN A;  3PUY F;  1FIO A;  2R6G F;  3AAE B;  5JDM A;  5M4Y A;  4IIJ E;  3O1I A;  5AQM B;  3Q5D A;  2UUC T;  5KDM C;  4LML A;  1KK7 A;  4CXY A;  4JI5 T;  1W0B A;  3VR8 A;  2BG9 C;  2WWU A;  4F8H A;  3ESL A;  1MMD A;  2C5K T;  4KMC A;  2QYW A;  2YK0 A;  3SFD A;  1BR2 A;  3EHZ A;  5L2L A;  4AIU A;  3MK7 C;  1D0Y A;  2BKO A;  4PJM A;  2JQH A;  5L4H A;  2UXN B;  3RGL A;  4E7S A;  3AE1 A;  4HFE A;  3E08 A;  2V7K A;  5AQI B;  2A3D A;  3MJX A;  3PTR B;  4H9S E;  5JQG E;  5EZY E;  4QX7 B;  4I4T E;  3ZYM A;  3OYZ A;  5FY0 A;  5JDF A;  2MTQ A;  1IBM T;  1MMN A;  2F4V T;  2OLT A;  1T72 A;  2XSB A;  5JRC A;  1S94 A;  2G0U A;  4HFH A;  2KXP B;  3AA7 B;  4OX9 T;  3TLT A;  2VKO A;  4ILC A;  5LBQ B;  5JTG A;  2X9X A;  3ZCJ A;  3RPU A;  5LMN T;  5LHI B;  3Q2M A;  3TLU A;  2V7I A;  5LGN B;  4IL4 A;  4DV5 T;  4EOZ B;  4TWF A;  3QNU A;  4DV1 T;  1KNP A;  4JI2 T;  5HEG A;  1CHU A;  2WU5 A;  4U7Y A;  3C51 A;  2HPL A;  4CN4 A;  2XAF B;  4GK0 E;  2IC9 A;  1HNZ T;  5CA1 E;  5LJN A;  3FXD B;  1W09 A;  4UIG A;  2NWB A;  2EHO B;  3PE0 A;  4PK6 A;  2H3R A;  4JI3 T;  2B1E A;  4X62 T;  4HWD A;  2WZH A;  3AE6 A;  4IE4 A;  1NEN A;  3UTK A;  5J1G A;  5ETW A;  4O4H E;  2WBL A;  3PUS A;  3ZMU B;  2CHO A;  4WBO A;  3RKO A;  2D9D A;  4LF4 T;  2XM1 A;  3JAD A;  1YD8 G;  3NVO A;  4O4J E;  4PK5 A;  1D0X A;  1D0Z A;  4IE0 A;  1KNR A;  2NW9 A;  2DCF A;  3RIF A;  4JV5 T;  3IBP A;  3E22 E;  2BVL A;  1N36 T;  1HNX T;  2D0T A;  4JI6 T;  2EHO D;  3AEE A;  3K3O A;  4YSY A;  2A72 A;  1WYC A;  1KF6 A;  3HKB E;  4IL9 A;  4DID B;  5HEH A;  3N9O A;  3AE5 A;  5HEU A;  2XQ6 A;  1IZN B;  3AE2 A;  2DI4 A;  5C2T A;  2H89 A;  4KUM B;  4ILU A;  1NAF A;  2AXD S;  2KIN B;  4HFI A;  4OFZ A;  2XSA A;  3RYC E;  2CHN A;  4ZI2 D;  2V6X A;  5FXX A;  3ZMZ B;  5FL0 A;  3ZPO A;  2WB5 A;  3P4S A;  4U2Z A;  1HNW T;  4U3C A;  3H3M A;  3O1J A;  2KT9 A;  2YDQ A;  3ZKR A;  5AQS B;  1VRB A;  3QOF A;  5JDG A;  3ABV A;  3FB2 A;  3CPZ A;  2EHO A;  5H6Q B;  5ADX L;  2E5V A;  2SPC A;  4UVB B;  2YU1 A;  3ONJ A;  3IA3 A;  4HWH A;  2Y6X A;  3NKZ A;  5HAX A;  4U72 A;  4QXH B;  2X66 A;  3FZK B;  3AVR A;  5LHH B;  3CX7 B;  4EIW A;  3O4X E;  4AQY T;  3AAA B;  4JUY A;  4B3M T;  5L3F B;  4TWH A;  4H9Q C;  3NWI A;  1NEK A;  5JDQ A;  3ZCI A;  2DLR A;  2XQ4 A;  2DWG A;  3A5X A;  4HE8 A;  5DJQ C;  5F3J A;  3ZC1 A;  1SA0 E;  4IDP A;  2B76 A;  4Z90 A;  1L0V A;  2VWA A;  4P1N A;  3UFG A;  3PJA J;  2M67 A;  2FJA A;  2WM9 A;  1XDP A;  3EAB A;  2JJ9 A;  4BA9 A;  5DQV A;  3ZN1 B;  3CWZ B;  2WY2 A;  4O8S A;  2CXL A;  3TKL B;  4ZXL A;  5AQG B;  3T8O A;  3UQ7 A;  4X65 T;  2LRK A;  1WCR A;  4HFC A;  3GN5 B;  1FEW A;  3C4W A;  3HI2 A;  4YJ3 E;  1HX1 B;  1WR6 A;  2E2A A;  1FMV A;  3H37 A;  1Y64 B;  3ZMT B;  2LSY A;  2ZM2 A;  3WAJ A;  3MAC A;  1BR0 A;  2BVM A;  2YU2 A;  2LEH A;  5F8P A;  1MMG A;  1FMW A;  2QGS A;  4K0K T;  2GK9 A;  3AA6 B;  2XQ7 A;  4MAL A;  3KV4 A;  2XZE A;  3UUN A;  5HWY A;  3P50 A;  3OBV E;  5IWA T; 
#chains in the Genus database with same CATH homology
 4KHP T;  4LFB T;  1I94 T;  4DV0 T;  1XMO T;  3T1H T;  1XNQ T;  2HHH T;  4JI8 T;  1HNZ T;  4DV6 T;  4YHH T;  4B3R T;  2UXC T;  2UUC T;  4NXN T;  4JI1 T;  1IBL T;  1IBK T;  4JI5 T;  3OTO T;  1XMQ T;  4JI3 T;  1HNW T;  4LF5 T;  4X62 T;  4LF7 T;  4DV4 T;  4GKJ T;  1J5E T;  4X65 T;  4LF6 T;  4B3T T;  2E5L T;  4JI4 T;  4DR2 T;  4DUZ T;  1N32 T;  4LF4 T;  5LMU T;  3T1Y T;  4DV2 T;  4DV7 T;  2UXB T;  4NXM T;  4DR1 T;  4DV3 T;  4GKK T;  4X64 T;  2ZM6 T;  4JI0 T;  4LFC T;  1FJG T;  4JV5 T;  1HR0 T;  1XNR T;  4LF9 T;  1IBM T;  4DR5 T;  2F4V T;  4AQY T;  5BR8 T;  4B3M T;  4JYA T;  4K0K T;  1N36 T;  4LFA T;  4DR7 T;  1HNX T;  4DR3 T;  1N34 T;  4JI6 T;  4OX9 T;  4B3S T;  2UXD T;  2VQF T;  4DR4 T;  4X66 T;  4DUY T;  1N33 T;  4DR6 T;  4YY3 T;  5LMN T;  4JI7 T;  2VQE T;  2UUA T;  2UU9 T;  4DV5 T;  4LF8 T;  4DV1 T;  2UUB T;  5IWA T;  4JI2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...