3UULA

Crystal structure of first n-terminal utrophin spectrin repeat
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
115
structure length
115
Chain Sequence
DLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELSAHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALMELQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords utrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 53
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uulA00
3F31A 3EDVA 1AJ3A 3UUMA 1HCIA 2SPCA 1CUNA 1OWAA 2ODVA 1WLXA 3UUNA 3LBXB 2ODUA 3FB2A 3PE0A 3LBXA 1U4QA 3UULA 1U5PA 1QUUA 1S35A
chains in the Genus database with same CATH superfamily
3CX8B 4YTPA 5LNKA 2NW7A 3HKDE 2LKGA 2LSGA 2CCQA 1XNRT 5AQMB 2HH7A 2WSSV 1R8IA 3RH3A 3D0TA 1IBLT 1UX5A 4YSZA 3NVOA 4DBQA 4LFBT 4HGAA 2BS4A 1MNEA 3P4RA 4AKRB 4IGUA 3H37A 3N9OA 4AKLA 4DO0A 4OYJA 5JR9C 3K3QC 3MA9A 4LF4T 1G8XA 2QYWA 3J9X1 4JI1T 5HAXA 3HA4A 3F57A 1FMWA 4ZOLE 4KBMB 4YFSA 5JDGA 3VHLA 3P50A 3RRCA 3FZKB 4IE5A 2P9BA 2CEAA 4LF8T 1J5WA 5F5WA 1HR0T 2W2UA 4YLHA 3PU3A 2XSBA 3R6NA 3I1AA 4L0RA 1XNQT 1O3XA 3O4XE 3AB3B 5ADXL 4EIWA 4JI3T 5FVKA 4H9OC 3L09A 4EV6A 3W15B 3VRAA 2W61A 3VR9A 2XAJB 3UFEA 2XY8B 4Z91A 2IDOB 5HEHA 1YQ3A 3ZN1B 2V7IA 4AIUA 1M7KA 1XMOT 4DV4T 2CWOA 3AA7B 4PK6A 1W9RA 2WP9A 4BJMA 2E9XA 3K1SA 3OVUA 4WBOA 3EVYA 3B13A 1SUMB 2G0UA 5LOVE 1J5ET 3N2GE 4EZ4A 2JQHA 3O1HA 3TLTA 1JNRA 2E8IA 2N1GA 5FY7A 4CI2B 5AQOB 5JRCB 3CPZA 4AQYT 2WZIA 1US7B 5C3JA 3ZEFB 2X68A 4F8HA 2JQ9A 4GKKT 3KVBA 1HNWT 1KNPA 2H88A 2NW8A 4PK4A 4ZHQE 5DQWA 4HFIA 3ZMTB 2CXDA 5KMGP 3C50A 3LSVA 4GOUA 4O2BE 5LG4A 5LGUB 3ZMUB 4PW8A 3UTKA 3LJCA 3RGLA 3VU7H 1IBMT 4ZXLA 2XQ8A 4B3TT 4WYVA 3AVSA 3TKLB 2CE7A 4P09A 5ABHA 2QRXA 4UR9A 3UU6A 3EDUA 5HXEA 3RC3A 3UULA 4UVAB 3KV5A 3F31A 3N9QA 3T8OA 1W09A 2BG9A 3WAKA 4TZ4C 1XMQT 3T1HT 2LM2A 3TLSA 4A5XA 3BK9A 2YU2A 3C4XA 3N2OA 2LM9A 3CQGB 2JJ9A 5FY1A 3N9PA 3KDSE 3JAFA 1IAPA 2WAUA 2YDQA 4XZCA 5M4YA 1QSDA 4GYRA 4QX7B 2CM0A 3A5XA 4TUYE 4X1YE 5GONE 4EEBA 3GN5A 4U31A 4X5TA 3ZPOA 1NWMX 2NP9A 4TN7B 1I6ZA 2X9XA 2YKSA 1YXRA 2BKNA 5FVLA 2SPCA 2N9DA 4OYKA 4AQFC 4MHCA 3ZLIA 5HEJA 2ZLYA 4YY3T 4LF5T 4LMJA 3RF1A 5ABGA 4UV9B 2BKOA 1BR4A 3DTOA 2X0LB 1HF8A 2V6XA 4HEAA 1MIWA 1Z0PA 4ADZA 5L3DB 3ZJ2A 2ZMAA 3AA1B 3X1DA 2K3WA 4O4HE 3RIAA 3AAAB 4X1KE 1OEDA 2MPKA 1E1HB 4DUYT 5LJMA 2WB5A 2BZBA 2KZ7B 3U78A 2VKOA 4B3RT 3CVRA 4H9NC 4HFCA 5FMNA 3LG7A 2B76A 2BBHA 2V6YA 4U3CA 4WNKA 5L4HA 2J47A 2DLRA 3QUJA 2KNDA 3FBZA 2D0UA 1IJ5A 2LOPA 1ZOYA 4ZZCA 2E2AA 5J2TE 4OHFA 2CRBA 4YJ3E 3PUQA 4X1IE 4NPPA 4LF6T 2WWUA 2OA5A 3AE7A 1GQEA 4DV2T 1VCTA 2AE9A 3C4WA 4NXNT 4ERRA 1D1BA 1QUUA 1S35A 1MMAA 3N5LA 1WYCA 5TAOA 3MACA 5L3FB 2KSRA 3AE6A 2MBGA 2IW5B 2XQ9A 3CIRA 3OBVE 5FXVA 4TWHA 3ANWA 3PDYA 4TV8E 2VQFT 4IDZA 1NAFA 1WYBA 2A3DA 3OTOT 4A97A 3ZN0B 3IA3A 2I6HA 2C5KT 4EAHA 5JQGE 3E08A 3JC6D 2RP4A 5LBQB 4PJNA 1KNZA 3L8RA 3P7IA 3A8YC 2W0GA 5ABFB 3ZSTA 5KX5E 5HXCA 3PUWF 5LBMA 3ZT5A 4HWIB 1OXZA 2XASB 4HWCA 4BJNA 5HXRA 3ZT6A 2NOXA 3RPUA 5FKYA 5JH7E 4H63V 1L0VA 3TLWA 4C91A 1FEWA 3I0QA 2H89A 2XUEA 4I4TE 4UVBB 2UXXB 4UF0A 3GA8A 5AQNB 2R6GF 5JDNA 3PUSA 2CHOA 2K48A 5HWXA 5J0ZA 3QOFA 4CI1B 4H9PC 4JI8T 5AQQB 4IE6A 4CN1A 2VL0A 4DR4T 3ESLA 2WDQA 5LHHB 3AXJA 2WMOA 3EDVA 2CLYC 3SS1A 2H3RA 5FXZA 4Z90A 2IC6A 3QB5K 3N9LA 3RHWA 3ZYKA 3LBXA 3HKBE 2YU1A 1U4QA 4PFOA 2BBJA 1E2AA 3AE8A 2UUCT 2FJBA 1T72A 4KMCA 4G2AA 1FJGT 4NXMT 2K24A 2MAWA 4JBWF 5IWAT 4HFDA 3P4QA 3K8PC 2FJDA 3EUHA 4O2AE 1IJ6A 3PUXF 1AJ3A 4H9RC 3P4SA 2JQQA 1QLBA 3UU3A 5AFUL 2EHOD 2VASA 3OYZA 3ONJA 3CX6B 3RYIE 2EHOA 5AQPB 3EABA 2VKHA 2Q9QB 4Q25A 2HPLA 1UURA 2YINA 5AQGB 1D0XA 5JDHA 5CFBA 1WR0A 4HKAA 4ZI2D 5JREA 3RIUA 1HS7A 3C4ZA 4DV0T 2XM2A 1YKHB 3RYHE 4AI6A 2Y8DA 3P8CD 4B3ST 2WU2A 4NUVA 2KXPB 4COFA 3RIFA 3PUYF 4UV8B 2CLYB 4DV3T 3WI3A 3E0ZA 5LYJE 2CWYA 3RQWA 1JNZA 5FL0A 3T1YT 3E22E 3UFGA 2DI4A 2UU9T 2V8SV 4EOZB 2VQET 2ACXA 5CGMA 2V7LA 5DABA 4DR6T 5IYZE 2X9YA 3ZSSA 3P4WA 4AKIA 3H3MA 4ZI7E 5L3EB 4P1NA 1XDPA 3WAJA 4I50E 4U74A 3AECA 3GN5B 2V7KA 1T7SA 3NZPA 1D1CA 2IAKA 4IE0A 1YKEB 4TX5A 5CJ5A 4KI0F 4TV9E 5DJQC 3MZKB 2E9XD 2WDVA 2NW9A 4H9QC 4C90A 4IREA 3SFDA 4I0UA 5AQLB 1MMGA 2XQAA 5FXWA 2JPFA 3RYCE 2LSYA 2PJQA 2LOSA 1SA0E 2ZM0A 5JR9B 2VL8A 4ZS3A 4YJ2E 2DL1A 3GWHA 2E5VA 4IE4A 4DV1T 3CK6A 3K3NA 1N32T 3UU5A 2C5JA 1UX4A 2LJLA 4DV7T 3BQIA 2UUAT 2J4GA 3JC6C 2DWGA 4O4JE 2K9AA 3HR0A 4HFBA 4IDQA 3AE5A 2V7JA 3PTRB 2M67A 3L39A 2DWKA 2QVAA 4CQIA 1SE7A 4ISTA 4X64T 2FJAA 3LK2B 2V6YB 3RI5A 3RQUA 4L9IA 2L9QA 3JCFA 4CZZB 4L5GA 4G63A 2HN1A 2H7VC 2X9HA 5LHGB 4KP3C 1MNDA 2CXFA 3ONXA 5HEUA 3PV0F 3DJBA 1ZP0A 4P0BA 4ZS2A 2DHRA 3CWZB 4LFAT 5HXHA 4OK0A 1HTJF 4EEDA 3FZHB 4KX6A 4N78D 4I55E 5KDMC 2CPTA 5LJNA 4X20E 1ZHCA 3ABVA 4ILBA 2CHNA 5EK4A 4GK0E 3QNUA 3ZYMA 1HX8A 3Q5WA 1BR0A 1OWAA 2ODVA 2XTLA 4HE8A 5AQSB 1SHZC 3CQXC 3L3PA 2LEHA 2IUBA 2VVSA 3KV9A 3NZQA 2IHR1 2MTQA 3MK7C 4JI2T 5LA6E 4IIJE 4DV6T 5JTGA 2FBWA 3V5SA 1HNZT 1N36T 3EAMA 4ZEYA 5AQRB 1ZKEA 2XAFB 5H6QB 4HWHA 4LFCT 1KF6A 2QA7A 2XQ4A 5LG3A 5HEOA 5JRCA 3TLUA 2A72A 2E5LT 1M62A 2EHOC 4GK5E 4HFVA 2JIWA 3ZKRA 4YSYA 5LMNT 2VKJA 3PURA 2W4XA 3RRWA 2RA1A 3QB5A 2ZM8A 4IT4A 1I94T 4MBQA 2V7MA 4ZI2C 4EXTA 3RIUC 4DIDB 2WZHA 2OV9A 2D9DA 4U7YA 2XJ7A 5FNVE 4JI4T 4LMLA 4AKGA 3CKDA 1J1JA 5HEGA 1D1AA 3V5UA 5L2LA 4TWFA 2BKPA 2KT9A 2WDRA 4B6XA 4YHJA 3ZC1A 2VKDA 1IBKT 3I9WA 3KINB 5J2UE 4OFZA 2LT3A 3UQ4A 5L47A 1E7PA 4EB6E 5JDQA 1BR2A 4KHZF 1KEYA 1IZNB 1V9DA 4UVCB 5DQVA 2WM9A 2CBJA 3OPCA 2XSAA 2LRLA 1BR1A 5EK3A 1UK5A 5ETWA 4F6RC 2PBIA 2W66A 2Y6XA 4NUUA 4JV5T 2E9XC 4PK5A 2XQ3A 1UUSA 2GK9A 2UXNB 4ANJA 4M1PA 1FIOA 2CA5A 4HTEA 5BMVE 1G73A 2AXDS 1HG5A 1ZEEA 4O8SA 2CMRA 4YTMA 2A9UA 4DR7T 3AE4A 4IHJE 2FJEA 4ZZBA 4IE7A 5H6RB 3HI2A 3KV4A 3TLVA 4CXWA 1W0BA 3N9NA 4ISSA 4IDOA 4UELA 2XM1A 4HFEA 5LXTE 2NR4A 1YD8G 4QXCB 3O9XA 3FB2A 5AQHB 4BA9A 4K0UA 3SFEA 5J1GA 2X9WA 2PFVA 5HCJA 2KWHA 3IHRA 2H7OA 3HKCE 1KNRA 4MLKA 1MIVA 5AQKB 3NRXA 3PJAJ 3HKEE 2BG9C 3FBLA 2RPAA 2UXBT 4GIWA 1WFDA 2B1EA 3P4PA 3G06A 2D2SA 3I9YA 5AQTB 3N2KE 3RKOA 4DUZT 4UIGA 4QX8B 5EZYE 2XAHB 2X51A 4DVDA 1VRBA 3RLFF 1S94A 4AQFA 2E9XB 2WS3A 3AEFA 3IEEA 2QGSA 3KFWX 4HWDA 4ZI3D 3KBUA 5JDLA 4HN9A 1Y64B 4O4IE 5JDFA 2LHRA 1KFYA 2XAQB 3NKZA 4CXYA 3AE9A 5FP3A 5HXSA 2JMKA 4QH4A 4QKNA 5F8PA 3M65A 2ZM6T 2LKHA 3ZMSB 2ACZA 5ABEA 4QHOA 1OEDE 2YEVC 2N2NA 5ABFA 1XWMA 2YOEA 3B5MA 2K5BB 2BVLA 1U5PA 5FXXA 3PUVF 3ZCJA 5L3GB 3SRZA 4U2ZA 1NENA 4U7IA 3Q2MA 3AEGA 2LSJA 1OEDC 3RKGA 4JI6T 1ZV4X 2F4VT 5AQIB 2V26A 2FUPA 3LK3B 2BG9B 1HNXT 4EZHA 3FZLB 4IL4A 3PU8A 4ILCA 2IIUA 3CX7B 2PTFA 3ZMZB 1UGOA 4KUMB 3PE0A 3OKQA 4AISA 2C5IT 3F2EA 3R84B 2DNXA 3SWHA 4E7ZA 4U72A 2YN6A 4IL9A 1HX1B 4I43B 3NRYA 3Q5XA 4QXHB 1NEKA 4AXPA 1X79A 4DMVA 3UUXB 3SOLA 4MALA 4DMWA 4FI5A 4U33A 4EYUA 2IC9A 1YQ4A 1VOMA 2WU5A 3M3ZB 3AE2A 1WLXA 4E7SA 2J1DG 3AE1A 1LVKA 3LFMA 1XZYA 5IHYA 5CA0E 4X65T 1WCRA 2IMLA 4DV5T 3MXZA 2XQ6A 3PUAA 3MKDA 3OJAA 4XBFB 2LLYA 1D0YA 4AKHA 5EK2A 3FXEB 2MOZA 5JDMA 2OLTA 3Q9DA 4DR5T 3AEAA 3AE3A 3BQLA 2C0SA 1OEDB 3KVAA 2LSIA 4LF9T 2JRKA 1B7TA 2Q9QD 1MMDA 2M6BA 2Q9QA 2X0YA 3CQCB 3VRBA 3LK42 2WY2A 2WCAA 5C2TA 4PJLA 1EZ3A 3AA6B 1H7CA 5AQJB 2UXDT 4PFPA 4O4LE 5HCMA 2M6IA 2ES0A 4A98A 3K3OA 4EYYR 3AVRA 1HFAA 5JVDE 3U3IA 1T98A 4CI3B 4CXXA 4K0KT 3JADA 3DP7A 1N34T 3UU4A 3UQ7A 3O1IA 1LKXA 2J62A 5L3CB 2KWIB 5L4EA 3IF8B 4TNWA 4MFRA 1FMVA 2VWAA 2V1DB 4LF7T 4JUYA 3ETUA 4A56A 1WRDA 5FY0A 4DBRA 4ILUA 3AA0B 3A7MA 2NWBA 3ANWB 2WBLA 2NTYA 3UUNA 2XQ7A 3PUGA 4QXBB 2YDSA 4QH5A 5F3JA 3FZMB 4UXNB 3IBPA 3ZYLA 5LGNB 1KK7A 1Y01A 3ZT7A 3MJXA 4GYSA 4IDPA 5LHIB 4DR2T 2BS2A 3UUMA 5BR8T 4PJMA 4JEUB 1MIYA 4PJJA 5CB4E 2X67A 1CUNA 1Z8UA 3KV6A 4JEHB 2VURA 4ZI3C 3Q5EA 3KBTA 3AAIA 1W0AA 4JI5T 2XHEB 5HWYA 4QWNB 2D0TA 2LHNA 3AEEA 5JR9A 2WWVA 4WBNE 1MMNA 2LSKA 4EGWA 1UCUA 4YTNA 2HN2A 4YSXA 3ZC0A 4DR3T 4X66T 4UF0B 2UUBT 2XZEA 1CHUA 2DCFA 1X9BA 4HWFA 4V1Av 2NTXA 5LGTB 3Q5DA 4YT0A 4UEMA 3AEDA 5A1LA 2L3LA 2CXLA 2BDEA 3AXJB 3CMLA 2X66A 5LB7B 3OYXA 2ZM2A 3B57A 4NIQA 2JMHA 5FYMA 4QH1A 4YHHT 3ZCIA 3EI0A 4WW0A 3LBXB 3BQKA 2L8KA 3ETVA 3RYFE 2KINB 2KMFA 3LDQB 3PJAA 4IDNA 5AQVB 1HG2A 2JQKA 2W67A 2LRKA 3ZMVB 5LP6E 4B3MT 3AAEB 2XQ5A 4P0AA 3FZFB 5FL1A 4TNVA 5AQFB 4JI0T 2W62A 3C64A 1HCIA 3UU8A 4TWDA 3UUBA 1T8BA 3O1JA 3AEBA 1WR6A 2EHOB 2XAGB 2A2FX 4ASKA 2W63A 2I59A 5E0OA 4AQGA 2WQYA 4DNDA 4XAXB 2BVMA 2HHHT 4GKJT 2VVNA 2CBIA 3ZJ1A 2BS3A 2WMNA 2UXCT 5C8YE 4HFHA 2I0MA 3FHNA 4JLEA 5CA1E 2YDRA 3S4UA 4CN4A 3GMIA 4YXDA 4CN6A 4BAYB 3VKHA 5KXJA 2X0HA 1DU2A 4FJOA 3UT5E 3QK6A 2MYSA 4ILAA 2VK9A 3RX6A 5L3BB 2KLQA 4WZXA 2Q9QC 4JI7T 3C51A 2BG9E 4DR1T 2W00A 5HYAA 3VR8A 3I0OA 1XDOA 3NWIA 1YW0A 2Z6EA 3HL6A 5IUXA 4JYAT 3N9MA 4H9SE 4LMKA 3EHZA 2V5CA 5AQUB 4KHPT 4Z8XA 2ODUA 3C98B 4OX9T 5LMUT 2XPKA 2LE8A 3QC9A 3ONLC 4J2CA 1D0ZA 5LCYA 3VKGA 3FXDB 1N33T 4PNIA 1VCSA 1LVFA 3NBXX 3JAEA 2XQYA 2Y48B 1LRZA 4U2YA 4H63H 3J7Yq 2V5DA 2HPJA 2D5UA 4PAGA 3RC8A 2PG8A 3H3AA 3PUZF 4X62T 2VB6A 2YK0A
chains in the Genus database with same CATH topology
2C5KT 4EAHA 3MK7C 3E08A 5JQGE 3JC6D 3CX8B 3PUAA 5LA6E 4IIJE 3MKDA 3OJAA 5LNKA 2RP4A 5LBQB 4PJNA 4XBFB 1D0YA 4AKHA 5EK2A 3V5SA 1KNZA 3FXEB 2NW7A 2MOZA 3HKDE 3P7IA 2LSGA 2CCQA 5JDMA 3Q9DA 2W0GA 2HH7A 1ZKEA 2WSSV 2XAFB 3BQLA 2C0SA 3RH3A 5KX5E 5H6QB 5HXCA 5LBMA 3D0TA 1UX5A 1OXZA 2XASB 3KVAA 2QA7A 4BJNA 2LSIA 5HXRA 4DBQA 5JRCA 4HGAA 2JRKA 1B7TA 2Q9QD 1MMDA 2A72A 2NOXA 2Q9QA 3RPUA 5JH7E 2EHOC 4H63V 1MNEA 4GK5E 4HFVA 4C91A 4AKRB 3CQCB 4IGUA 3H37A 3N9OA 1FEWA 4AKLA 3I0QA 3LK42 2VKJA 3PURA 4PJLA 4DO0A 4OYJA 3RRWA 1EZ3A 3AA6B 1H7CA 2RA1A 5JR9C 3K3QC 2XUEA 4PFPA 2ZM8A 3MA9A 4I4TE 4UVBB 4O4LE 2UXXB 4UF0A 1G8XA 3GA8A 3J9X1 5JDNA 3PUSA 5HAXA 4MBQA 3HA4A 2K48A 2V7MA 2ES0A 5HWXA 3F57A 4ZI2C 4EXTA 3K3OA 4EYYR 1FMWA 3AVRA 4ZOLE 4KBMB 4CI1B 1HFAA 4H9PC 5JVDE 4YFSA 5FNVE 4IE6A 3U3IA 1T98A 4CI3B 4CXXA 5JDGA 3ESLA 3VHLA 4AKGA 3CKDA 3RRCA 1D1AA 3V5UA 4IE5A 3DP7A 5L2LA 2P9BA 2CEAA 5LHHB 2KT9A 3O1IA 1LKXA 5L3CB 2WMOA 2KWIB 3IF8B 3EDVA 4MFRA 3PU3A 4YLHA 4B6XA 4YHJA 3R6NA 2CLYC 3I1AA 4L0RA 3SS1A 2VKDA 3ZC1A 2H3RA 5FXZA 1FMVA 1O3XA 3O4XE 2IC6A 2VWAA 3AB3B 2V1DB 3I9WA 3KINB 3N9LA 4OFZA 5J2UE 2LT3A 4JUYA 5ADXL 3ZYKA 3LBXA 3HKBE 4EIWA 2YU1A 1U4QA 4PFOA 3ETUA 4A56A 4EB6E 1WRDA 4H9OC 5FY0A 3L09A 5JDQA 1BR2A 3W15B 4DBRA 4ILUA 2W61A 3AA0B 4KMCA 2NWBA 4G2AA 2XAJB 3UFEA 3ANWB 1IZNB 2K24A 2WBLA 1V9DA 2NTYA 4UVCB 3ZN1B 3UUNA 3PUGA 4QXBB 5DQVA 2V7IA 5F3JA 2WM9A 2CWOA 3AA7B 4UXNB 3IBPA 4PK6A 3K8PC 3ZYLA 5LGNB 1BR1A 3EUHA 5EK3A 1KK7A 5ETWA 4BJMA 2E9XA 4O2AE 1IJ6A 3MJXA 4F6RC 2PBIA 4GYSA 5LHIB 1AJ3A 2Y6XA 3UUMA 4WBOA 3EVYA 4PJMA 4JEUB 3B13A 1MIYA 2G0UA 4H9RC 4PJJA 5LOVE 3N2GE 2JQQA 5CB4E 2X67A 1CUNA 4EZ4A 4NUUA 3O1HA 5AFUL 2EHOD 2E9XC 2VASA 3OYZA 4PK5A 3CX6B 3RYIE 2E8IA 2EHOA 3KV6A 4JEHB 2N1GA 5FY7A 4ZI3C 4CI2B 2GK9A 3KBTA 5JRCB 2UXNB 3CPZA 4ANJA 4M1PA 1FIOA 1US7B 2CA5A 2VKHA 3AAIA 2Q9QB 3ZEFB 2X68A 4HTEA 2XHEB 5BMVE 2HPLA 4QWNB 5HWYA 2D0TA 2LHNA 3KVBA 5JR9A 4WBNE 2YINA 1G73A 1MMNA 2LSKA 1HG5A 1D0XA 1ZEEA 4O8SA 1UCUA 5JDHA 2CMRA 2NW8A 4HKAA 4PK4A 4ZHQE 5DQWA 4ZI2D 3ZC0A 3ZMTB 2CXDA 5KMGP 3C50A 5JREA 4IHJE 4GOUA 1HS7A 3C4ZA 4UF0B 4O2BE 5LG4A 5LGUB 3ZMUB 1YKHB 3RYHE 4PW8A 3UTKA 4IE7A 5H6RB 4AI6A 2DCFA 3HI2A 3KV4A 3LJCA 3VU7H 4CXWA 3N9NA 4ISSA 4V1Av 2Y8DA 3P8CD 2NTXA 4UELA 3AVSA 5LGTB 4UEMA 5LXTE 4NUVA 3TKLB 2KXPB 5A1LA 2L3LA 1YD8G 2CE7A 4QXCB 3O9XA 2CXLA 4P09A 4UV8B 2BDEA 2CLYB 3FB2A 4BA9A 3WI3A 3EDUA 5HXEA 3CMLA 2X66A 4K0UA 3RC3A 3UULA 4UVAB 3E0ZA 5LYJE 3KV5A 3OYXA 5J1GA 2X9WA 2CWYA 2PFVA 2ZM2A 3B57A 2KWHA 2JMHA 3F31A 3IHRA 3N9QA 5FYMA 3T8OA 2H7OA 3HKCE 3E22E 3WAKA 4MLKA 1MIVA 4TZ4C 3NRXA 3ZCIA 2DI4A 4WW0A 3LBXB 3BQKA 3HKEE 3BK9A 2L8KA 4EOZB 2YU2A 3C4XA 3ETVA 3RYFE 2KINB 3N2OA 2ACXA 2KMFA 3FBLA 2LM9A 2V7LA 5DABA 3CQGB 5IYZE 2X9YA 2JJ9A 4GIWA 5FY1A 3N9PA 3KDSE 1HG2A 2B1EA 4AKIA 2D2SA 4ZI7E 5L3EB 1IAPA 3I9YA 2WAUA 4XZCA 3ZMVB 5LP6E 3WAJA 3N2KE 4I50E 5M4YA 4U74A 3RKOA 1QSDA 3AAEB 3GN5B 4GYRA 4QX7B 2CM0A 2V7KA 3A5XA 4TUYE 4X1YE 4P0AA 5GONE 3NZPA 4UIGA 3GN5A 1D1CA 4QX8B 2IAKA 4IE0A 5EZYE 1YKEB 2XAHB 2X51A 4TX5A 1VRBA 4DVDA 1S94A 4AQFA 3ZPOA 1NWMX 2E9XB 3IEEA 4TV9E 2QGSA 5DJQC 3MZKB 2E9XD 2NP9A 4TN7B 3KFWX 2W62A 2NW9A 2X9XA 3C64A 4H9QC 4ZI3D 4C90A 1HCIA 3KBUA 5JDLA 2SPCA 2N9DA 4OYKA 4AQFC 3O1JA 4MHCA 1WR6A 3ZLIA 2EHOB 4HN9A 1MMGA 1Y64B 2XAGB 4O4IE 5JDFA 2A2FX 2ZLYA 2W63A 4ASKA 2I59A 2LHRA 5E0OA 5FXWA 4AQGA 2XAQB 4XAXB 4DNDA 2JPFA 4CXYA 2BVMA 3RYCE 2LSYA 4UV9B 5FP3A 3ZJ1A 2PJQA 2LOSA 2WMNA 1SA0E 2JMKA 1BR4A 2ZM0A 5HXSA 5JR9B 2VL8A 3DTOA 4ZS3A 5C8YE 4YJ2E 2X0LB 1HF8A 3FHNA 4HEAA 1MIWA 4JLEA 4QKNA 5CA1E 5F8PA 1Z0PA 3GWHA 3S4UA 3M65A 4ADZA 5L3DB 3GMIA 3ZJ2A 4IE4A 3ZMSB 2ZMAA 4QHOA 3AA1B 3K3NA 2YEVC 4BAYB 3VKHA 2N2NA 2C5JA 1UX4A 2LJLA 4O4HE 3BQIA 3AAAB 3JC6C 4X1KE 2DWGA 4O4JE 4FJOA 2K5BB 2BVLA 2K9AA 3HR0A 1U5PA 3UT5E 5FXXA 3QK6A 2MYSA 1E1HB 3ZCJA 5L3GB 2V7JA 3PTRB 2M67A 3SRZA 5LJMA 2BZBA 2DWKA 2KZ7B 2VK9A 3Q2MA 4CQIA 4ISTA 3RX6A 2LSJA 3U78A 2VKOA 5L3BB 3CVRA 2KLQA 1ZV4X 3LK2B 4H9NC 5FMNA 3LG7A 2Q9QC 4L9IA 2V26A 2L9QA 3C51A 4CZZB 4L5GA 3LK3B 4WNKA 4G63A 2W00A 2H7VC 2X9HA 5HYAA 2DLRA 4EZHA 3QUJA 5LHGB 2KNDA 3FBZA 2D0UA 3I0OA 3PU8A 1IJ5A 4KP3C 3CX7B 1MNDA 3ZMZB 1YW0A 2Z6EA 4KUMB 2LOPA 3PE0A 3HL6A 2CXFA 3ONXA 3DJBA 3OKQA 3N9MA 5J2TE 4H9SE 4P0BA 4OHFA 4ZS2A 2C5IT 2DHRA 3CWZB 3F2EA 4OK0A 4YJ3E 3R84B 1HTJF 2DNXA 3PUQA 5HXHA 4X1IE 3SWHA 4E7ZA 4U72A 4N78D 4I55E 2WWUA 2OA5A 5KDMC 4I43B 3C4WA 5LJNA 3NRYA 4Z8XA 2ODUA 4X20E 1ZHCA 3C98B 3Q5XA 4QXHB 4ERRA 2LE8A 3QC9A 5EK4A 4GK0E 4AXPA 1X79A 1D1BA 1QUUA 1S35A 4DMVA 4J2CA 1MMAA 1D0ZA 3N5LA 5LCYA 1WYCA 3VKGA 3ZYMA 3UUXB 3SOLA 4MALA 5TAOA 4DMWA 3FXDB 4FI5A 3MACA 5L3FB 4EYUA 4PNIA 1HX8A 2IC9A 2MBGA 2IW5B 3Q5WA 1LVFA 3NBXX 1BR0A 1VOMA 1OWAA 2XQYA 3OBVE 1WLXA 2ODVA 2J1DG 2XTLA 5FXVA 1LVKA 3ANWA 3PDYA 4HE8A 4TV8E 4E7SA 3LFMA 4IDZA 2Y48B 1LRZA 1SHZC 4H63H 3CQXC 5IHYA 3J7Yq 3L3PA 5CA0E 2LEHA 3KV9A 1NAFA 1WYBA 2A3DA 2HPJA 2D5UA 4PAGA 3NZQA 3RC8A 3ZN0B 2PG8A 2MTQA 3MXZA 3H3AA 2VB6A 2YK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F31 A;  3EDV A;  1AJ3 A;  3UUM A;  1HCI A;  2SPC A;  1CUN A;  1OWA A;  2ODV A;  1WLX A;  3UUN A;  3LBX B;  2ODU A;  3FB2 A;  3PE0 A;  3LBX A;  1U4Q A;  3UUL A;  1U5P A;  1QUU A;  1S35 A; 
#chains in the Genus database with same CATH topology
 3CX8 B;  4YTP A;  5LNK A;  2NW7 A;  3HKD E;  2LKG A;  2LSG A;  2CCQ A;  1XNR T;  5AQM B;  2HH7 A;  2WSS V;  1R8I A;  3RH3 A;  3D0T A;  1IBL T;  1UX5 A;  4YSZ A;  3NVO A;  4DBQ A;  4LFB T;  4HGA A;  2BS4 A;  1MNE A;  3P4R A;  4AKR B;  4IGU A;  3H37 A;  3N9O A;  4AKL A;  4DO0 A;  4OYJ A;  5JR9 C;  3K3Q C;  3MA9 A;  4LF4 T;  1G8X A;  2QYW A;  3J9X 1;  4JI1 T;  5HAX A;  3HA4 A;  3F57 A;  1FMW A;  4ZOL E;  4KBM B;  4YFS A;  5JDG A;  3VHL A;  3P50 A;  3RRC A;  3FZK B;  4IE5 A;  2P9B A;  2CEA A;  4LF8 T;  1J5W A;  5F5W A;  1HR0 T;  2W2U A;  4YLH A;  3PU3 A;  2XSB A;  3R6N A;  3I1A A;  4L0R A;  1XNQ T;  1O3X A;  3O4X E;  3AB3 B;  5ADX L;  4EIW A;  4JI3 T;  5FVK A;  4H9O C;  3L09 A;  4EV6 A;  3W15 B;  3VRA A;  2W61 A;  3VR9 A;  2XAJ B;  3UFE A;  2XY8 B;  4Z91 A;  2IDO B;  5HEH A;  1YQ3 A;  3ZN1 B;  2V7I A;  4AIU A;  1M7K A;  1XMO T;  4DV4 T;  2CWO A;  3AA7 B;  4PK6 A;  1W9R A;  2WP9 A;  4BJM A;  2E9X A;  3K1S A;  3OVU A;  4WBO A;  3EVY A;  3B13 A;  1SUM B;  2G0U A;  5LOV E;  1J5E T;  3N2G E;  4EZ4 A;  2JQH A;  3O1H A;  3TLT A;  1JNR A;  2E8I A;  2N1G A;  5FY7 A;  4CI2 B;  5AQO B;  5JRC B;  3CPZ A;  4AQY T;  2WZI A;  1US7 B;  5C3J A;  3ZEF B;  2X68 A;  4F8H A;  2JQ9 A;  4GKK T;  3KVB A;  1HNW T;  1KNP A;  2H88 A;  2NW8 A;  4PK4 A;  4ZHQ E;  5DQW A;  4HFI A;  3ZMT B;  2CXD A;  5KMG P;  3C50 A;  3LSV A;  4GOU A;  4O2B E;  5LG4 A;  5LGU B;  3ZMU B;  4PW8 A;  3UTK A;  3LJC A;  3RGL A;  3VU7 H;  1IBM T;  4ZXL A;  2XQ8 A;  4B3T T;  4WYV A;  3AVS A;  3TKL B;  2CE7 A;  4P09 A;  5ABH A;  2QRX A;  4UR9 A;  3UU6 A;  3EDU A;  5HXE A;  3RC3 A;  3UUL A;  4UVA B;  3KV5 A;  3F31 A;  3N9Q A;  3T8O A;  1W09 A;  2BG9 A;  3WAK A;  4TZ4 C;  1XMQ T;  3T1H T;  2LM2 A;  3TLS A;  4A5X A;  3BK9 A;  2YU2 A;  3C4X A;  3N2O A;  2LM9 A;  3CQG B;  2JJ9 A;  5FY1 A;  3N9P A;  3KDS E;  3JAF A;  1IAP A;  2WAU A;  2YDQ A;  4XZC A;  5M4Y A;  1QSD A;  4GYR A;  4QX7 B;  2CM0 A;  3A5X A;  4TUY E;  4X1Y E;  5GON E;  4EEB A;  3GN5 A;  4U31 A;  4X5T A;  3ZPO A;  1NWM X;  2NP9 A;  4TN7 B;  1I6Z A;  2X9X A;  2YKS A;  1YXR A;  2BKN A;  5FVL A;  2SPC A;  2N9D A;  4OYK A;  4AQF C;  4MHC A;  3ZLI A;  5HEJ A;  2ZLY A;  4YY3 T;  4LF5 T;  4LMJ A;  3RF1 A;  5ABG A;  4UV9 B;  2BKO A;  1BR4 A;  3DTO A;  2X0L B;  1HF8 A;  2V6X A;  4HEA A;  1MIW A;  1Z0P A;  4ADZ A;  5L3D B;  3ZJ2 A;  2ZMA A;  3AA1 B;  3X1D A;  2K3W A;  4O4H E;  3RIA A;  3AAA B;  4X1K E;  1OED A;  2MPK A;  1E1H B;  4DUY T;  5LJM A;  2WB5 A;  2BZB A;  2KZ7 B;  3U78 A;  2VKO A;  4B3R T;  3CVR A;  4H9N C;  4HFC A;  5FMN A;  3LG7 A;  2B76 A;  2BBH A;  2V6Y A;  4U3C A;  4WNK A;  5L4H A;  2J47 A;  2DLR A;  3QUJ A;  2KND A;  3FBZ A;  2D0U A;  1IJ5 A;  2LOP A;  1ZOY A;  4ZZC A;  2E2A A;  5J2T E;  4OHF A;  2CRB A;  4YJ3 E;  3PUQ A;  4X1I E;  4NPP A;  4LF6 T;  2WWU A;  2OA5 A;  3AE7 A;  1GQE A;  4DV2 T;  1VCT A;  2AE9 A;  3C4W A;  4NXN T;  4ERR A;  1D1B A;  1QUU A;  1S35 A;  1MMA A;  3N5L A;  1WYC A;  5TAO A;  3MAC A;  5L3F B;  2KSR A;  3AE6 A;  2MBG A;  2IW5 B;  2XQ9 A;  3CIR A;  3OBV E;  5FXV A;  4TWH A;  3ANW A;  3PDY A;  4TV8 E;  2VQF T;  4IDZ A;  1NAF A;  1WYB A;  2A3D A;  3OTO T;  4A97 A;  3ZN0 B;  3IA3 A;  2I6H A;  2C5K T;  4EAH A;  5JQG E;  3E08 A;  3JC6 D;  2RP4 A;  5LBQ B;  4PJN A;  1KNZ A;  3L8R A;  3P7I A;  3A8Y C;  2W0G A;  5ABF B;  3ZST A;  5KX5 E;  5HXC A;  3PUW F;  5LBM A;  3ZT5 A;  4HWI B;  1OXZ A;  2XAS B;  4HWC A;  4BJN A;  5HXR A;  3ZT6 A;  2NOX A;  3RPU A;  5FKY A;  5JH7 E;  4H63 V;  1L0V A;  3TLW A;  4C91 A;  1FEW A;  3I0Q A;  2H89 A;  2XUE A;  4I4T E;  4UVB B;  2UXX B;  4UF0 A;  3GA8 A;  5AQN B;  2R6G F;  5JDN A;  3PUS A;  2CHO A;  2K48 A;  5HWX A;  5J0Z A;  3QOF A;  4CI1 B;  4H9P C;  4JI8 T;  5AQQ B;  4IE6 A;  4CN1 A;  2VL0 A;  4DR4 T;  3ESL A;  2WDQ A;  5LHH B;  3AXJ A;  2WMO A;  3EDV A;  2CLY C;  3SS1 A;  2H3R A;  5FXZ A;  4Z90 A;  2IC6 A;  3QB5 K;  3N9L A;  3RHW A;  3ZYK A;  3LBX A;  3HKB E;  2YU1 A;  1U4Q A;  4PFO A;  2BBJ A;  1E2A A;  3AE8 A;  2UUC T;  2FJB A;  1T72 A;  4KMC A;  4G2A A;  1FJG T;  4NXM T;  2K24 A;  2MAW A;  4JBW F;  5IWA T;  4HFD A;  3P4Q A;  3K8P C;  2FJD A;  3EUH A;  4O2A E;  1IJ6 A;  3PUX F;  1AJ3 A;  4H9R C;  3P4S A;  2JQQ A;  1QLB A;  3UU3 A;  5AFU L;  2EHO D;  2VAS A;  3OYZ A;  3ONJ A;  3CX6 B;  3RYI E;  2EHO A;  5AQP B;  3EAB A;  2VKH A;  2Q9Q B;  4Q25 A;  2HPL A;  1UUR A;  2YIN A;  5AQG B;  1D0X A;  5JDH A;  5CFB A;  1WR0 A;  4HKA A;  4ZI2 D;  5JRE A;  3RIU A;  1HS7 A;  3C4Z A;  4DV0 T;  2XM2 A;  1YKH B;  3RYH E;  4AI6 A;  2Y8D A;  3P8C D;  4B3S T;  2WU2 A;  4NUV A;  2KXP B;  4COF A;  3RIF A;  3PUY F;  4UV8 B;  2CLY B;  4DV3 T;  3WI3 A;  3E0Z A;  5LYJ E;  2CWY A;  3RQW A;  1JNZ A;  5FL0 A;  3T1Y T;  3E22 E;  3UFG A;  2DI4 A;  2UU9 T;  2V8S V;  4EOZ B;  2VQE T;  2ACX A;  5CGM A;  2V7L A;  5DAB A;  4DR6 T;  5IYZ E;  2X9Y A;  3ZSS A;  3P4W A;  4AKI A;  3H3M A;  4ZI7 E;  5L3E B;  4P1N A;  1XDP A;  3WAJ A;  4I50 E;  4U74 A;  3AEC A;  3GN5 B;  2V7K A;  1T7S A;  3NZP A;  1D1C A;  2IAK A;  4IE0 A;  1YKE B;  4TX5 A;  5CJ5 A;  4KI0 F;  4TV9 E;  5DJQ C;  3MZK B;  2E9X D;  2WDV A;  2NW9 A;  4H9Q C;  4C90 A;  4IRE A;  3SFD A;  4I0U A;  5AQL B;  1MMG A;  2XQA A;  5FXW A;  2JPF A;  3RYC E;  2LSY A;  2PJQ A;  2LOS A;  1SA0 E;  2ZM0 A;  5JR9 B;  2VL8 A;  4ZS3 A;  4YJ2 E;  2DL1 A;  3GWH A;  2E5V A;  4IE4 A;  4DV1 T;  3CK6 A;  3K3N A;  1N32 T;  3UU5 A;  2C5J A;  1UX4 A;  2LJL A;  4DV7 T;  3BQI A;  2UUA T;  2J4G A;  3JC6 C;  2DWG A;  4O4J E;  2K9A A;  3HR0 A;  4HFB A;  4IDQ A;  3AE5 A;  2V7J A;  3PTR B;  2M67 A;  3L39 A;  2DWK A;  2QVA A;  4CQI A;  1SE7 A;  4IST A;  4X64 T;  2FJA A;  3LK2 B;  2V6Y B;  3RI5 A;  3RQU A;  4L9I A;  2L9Q A;  3JCF A;  4CZZ B;  4L5G A;  4G63 A;  2HN1 A;  2H7V C;  2X9H A;  5LHG B;  4KP3 C;  1MND A;  2CXF A;  3ONX A;  5HEU A;  3PV0 F;  3DJB A;  1ZP0 A;  4P0B A;  4ZS2 A;  2DHR A;  3CWZ B;  4LFA T;  5HXH A;  4OK0 A;  1HTJ F;  4EED A;  3FZH B;  4KX6 A;  4N78 D;  4I55 E;  5KDM C;  2CPT A;  5LJN A;  4X20 E;  1ZHC A;  3ABV A;  4ILB A;  2CHN A;  5EK4 A;  4GK0 E;  3QNU A;  3ZYM A;  1HX8 A;  3Q5W A;  1BR0 A;  1OWA A;  2ODV A;  2XTL A;  4HE8 A;  5AQS B;  1SHZ C;  3CQX C;  3L3P A;  2LEH A;  2IUB A;  2VVS A;  3KV9 A;  3NZQ A;  2IHR 1;  2MTQ A;  3MK7 C;  4JI2 T;  5LA6 E;  4IIJ E;  4DV6 T;  5JTG A;  2FBW A;  3V5S A;  1HNZ T;  1N36 T;  3EAM A;  4ZEY A;  5AQR B;  1ZKE A;  2XAF B;  5H6Q B;  4HWH A;  4LFC T;  1KF6 A;  2QA7 A;  2XQ4 A;  5LG3 A;  5HEO A;  5JRC A;  3TLU A;  2A72 A;  2E5L T;  1M62 A;  2EHO C;  4GK5 E;  4HFV A;  2JIW A;  3ZKR A;  4YSY A;  5LMN T;  2VKJ A;  3PUR A;  2W4X A;  3RRW A;  2RA1 A;  3QB5 A;  2ZM8 A;  4IT4 A;  1I94 T;  4MBQ A;  2V7M A;  4ZI2 C;  4EXT A;  3RIU C;  4DID B;  2WZH A;  2OV9 A;  2D9D A;  4U7Y A;  2XJ7 A;  5FNV E;  4JI4 T;  4LML A;  4AKG A;  3CKD A;  1J1J A;  5HEG A;  1D1A A;  3V5U A;  5L2L A;  4TWF A;  2BKP A;  2KT9 A;  2WDR A;  4B6X A;  4YHJ A;  3ZC1 A;  2VKD A;  1IBK T;  3I9W A;  3KIN B;  5J2U E;  4OFZ A;  2LT3 A;  3UQ4 A;  5L47 A;  1E7P A;  4EB6 E;  5JDQ A;  1BR2 A;  4KHZ F;  1KEY A;  1IZN B;  1V9D A;  4UVC B;  5DQV A;  2WM9 A;  2CBJ A;  3OPC A;  2XSA A;  2LRL A;  1BR1 A;  5EK3 A;  1UK5 A;  5ETW A;  4F6R C;  2PBI A;  2W66 A;  2Y6X A;  4NUU A;  4JV5 T;  2E9X C;  4PK5 A;  2XQ3 A;  1UUS A;  2GK9 A;  2UXN B;  4ANJ A;  4M1P A;  1FIO A;  2CA5 A;  4HTE A;  5BMV E;  1G73 A;  2AXD S;  1HG5 A;  1ZEE A;  4O8S A;  2CMR A;  4YTM A;  2A9U A;  4DR7 T;  3AE4 A;  4IHJ E;  2FJE A;  4ZZB A;  4IE7 A;  5H6R B;  3HI2 A;  3KV4 A;  3TLV A;  4CXW A;  1W0B A;  3N9N A;  4ISS A;  4IDO A;  4UEL A;  2XM1 A;  4HFE A;  5LXT E;  2NR4 A;  1YD8 G;  4QXC B;  3O9X A;  3FB2 A;  5AQH B;  4BA9 A;  4K0U A;  3SFE A;  5J1G A;  2X9W A;  2PFV A;  5HCJ A;  2KWH A;  3IHR A;  2H7O A;  3HKC E;  1KNR A;  4MLK A;  1MIV A;  5AQK B;  3NRX A;  3PJA J;  3HKE E;  2BG9 C;  3FBL A;  2RPA A;  2UXB T;  4GIW A;  1WFD A;  2B1E A;  3P4P A;  3G06 A;  2D2S A;  3I9Y A;  5AQT B;  3N2K E;  3RKO A;  4DUZ T;  4UIG A;  4QX8 B;  5EZY E;  2XAH B;  2X51 A;  4DVD A;  1VRB A;  3RLF F;  1S94 A;  4AQF A;  2E9X B;  2WS3 A;  3AEF A;  3IEE A;  2QGS A;  3KFW X;  4HWD A;  4ZI3 D;  3KBU A;  5JDL A;  4HN9 A;  1Y64 B;  4O4I E;  5JDF A;  2LHR A;  1KFY A;  2XAQ B;  3NKZ A;  4CXY A;  3AE9 A;  5FP3 A;  5HXS A;  2JMK A;  4QH4 A;  4QKN A;  5F8P A;  3M65 A;  2ZM6 T;  2LKH A;  3ZMS B;  2ACZ A;  5ABE A;  4QHO A;  1OED E;  2YEV C;  2N2N A;  5ABF A;  1XWM A;  2YOE A;  3B5M A;  2K5B B;  2BVL A;  1U5P A;  5FXX A;  3PUV F;  3ZCJ A;  5L3G B;  3SRZ A;  4U2Z A;  1NEN A;  4U7I A;  3Q2M A;  3AEG A;  2LSJ A;  1OED C;  3RKG A;  4JI6 T;  1ZV4 X;  2F4V T;  5AQI B;  2V26 A;  2FUP A;  3LK3 B;  2BG9 B;  1HNX T;  4EZH A;  3FZL B;  4IL4 A;  3PU8 A;  4ILC A;  2IIU A;  3CX7 B;  2PTF A;  3ZMZ B;  1UGO A;  4KUM B;  3PE0 A;  3OKQ A;  4AIS A;  2C5I T;  3F2E A;  3R84 B;  2DNX A;  3SWH A;  4E7Z A;  4U72 A;  2YN6 A;  4IL9 A;  1HX1 B;  4I43 B;  3NRY A;  3Q5X A;  4QXH B;  1NEK A;  4AXP A;  1X79 A;  4DMV A;  3UUX B;  3SOL A;  4MAL A;  4DMW A;  4FI5 A;  4U33 A;  4EYU A;  2IC9 A;  1YQ4 A;  1VOM A;  2WU5 A;  3M3Z B;  3AE2 A;  1WLX A;  4E7S A;  2J1D G;  3AE1 A;  1LVK A;  3LFM A;  1XZY A;  5IHY A;  5CA0 E;  4X65 T;  1WCR A;  2IML A;  4DV5 T;  3MXZ A;  2XQ6 A;  3PUA A;  3MKD A;  3OJA A;  4XBF B;  2LLY A;  1D0Y A;  4AKH A;  5EK2 A;  3FXE B;  2MOZ A;  5JDM A;  2OLT A;  3Q9D A;  4DR5 T;  3AEA A;  3AE3 A;  3BQL A;  2C0S A;  1OED B;  3KVA A;  2LSI A;  4LF9 T;  2JRK A;  1B7T A;  2Q9Q D;  1MMD A;  2M6B A;  2Q9Q A;  2X0Y A;  3CQC B;  3VRB A;  3LK4 2;  2WY2 A;  2WCA A;  5C2T A;  4PJL A;  1EZ3 A;  3AA6 B;  1H7C A;  5AQJ B;  2UXD T;  4PFP A;  4O4L E;  5HCM A;  2M6I A;  2ES0 A;  4A98 A;  3K3O A;  4EYY R;  3AVR A;  1HFA A;  5JVD E;  3U3I A;  1T98 A;  4CI3 B;  4CXX A;  4K0K T;  3JAD A;  3DP7 A;  1N34 T;  3UU4 A;  3UQ7 A;  3O1I A;  1LKX A;  2J62 A;  5L3C B;  2KWI B;  5L4E A;  3IF8 B;  4TNW A;  4MFR A;  1FMV A;  2VWA A;  2V1D B;  4LF7 T;  4JUY A;  3ETU A;  4A56 A;  1WRD A;  5FY0 A;  4DBR A;  4ILU A;  3AA0 B;  3A7M A;  2NWB A;  3ANW B;  2WBL A;  2NTY A;  3UUN A;  2XQ7 A;  3PUG A;  4QXB B;  2YDS A;  4QH5 A;  5F3J A;  3FZM B;  4UXN B;  3IBP A;  3ZYL A;  5LGN B;  1KK7 A;  1Y01 A;  3ZT7 A;  3MJX A;  4GYS A;  4IDP A;  5LHI B;  4DR2 T;  2BS2 A;  3UUM A;  5BR8 T;  4PJM A;  4JEU B;  1MIY A;  4PJJ A;  5CB4 E;  2X67 A;  1CUN A;  1Z8U A;  3KV6 A;  4JEH B;  2VUR A;  4ZI3 C;  3Q5E A;  3KBT A;  3AAI A;  1W0A A;  4JI5 T;  2XHE B;  5HWY A;  4QWN B;  2D0T A;  2LHN A;  3AEE A;  5JR9 A;  2WWV A;  4WBN E;  1MMN A;  2LSK A;  4EGW A;  1UCU A;  4YTN A;  2HN2 A;  4YSX A;  3ZC0 A;  4DR3 T;  4X66 T;  4UF0 B;  2UUB T;  2XZE A;  1CHU A;  2DCF A;  1X9B A;  4HWF A;  4V1A v;  2NTX A;  5LGT B;  3Q5D A;  4YT0 A;  4UEM A;  3AED A;  5A1L A;  2L3L A;  2CXL A;  2BDE A;  3AXJ B;  3CML A;  2X66 A;  5LB7 B;  3OYX A;  2ZM2 A;  3B57 A;  4NIQ A;  2JMH A;  5FYM A;  4QH1 A;  4YHH T;  3ZCI A;  3EI0 A;  4WW0 A;  3LBX B;  3BQK A;  2L8K A;  3ETV A;  3RYF E;  2KIN B;  2KMF A;  3LDQ B;  3PJA A;  4IDN A;  5AQV B;  1HG2 A;  2JQK A;  2W67 A;  2LRK A;  3ZMV B;  5LP6 E;  4B3M T;  3AAE B;  2XQ5 A;  4P0A A;  3FZF B;  5FL1 A;  4TNV A;  5AQF B;  4JI0 T;  2W62 A;  3C64 A;  1HCI A;  3UU8 A;  4TWD A;  3UUB A;  1T8B A;  3O1J A;  3AEB A;  1WR6 A;  2EHO B;  2XAG B;  2A2F X;  4ASK A;  2W63 A;  2I59 A;  5E0O A;  4AQG A;  2WQY A;  4DND A;  4XAX B;  2BVM A;  2HHH T;  4GKJ T;  2VVN A;  2CBI A;  3ZJ1 A;  2BS3 A;  2WMN A;  2UXC T;  5C8Y E;  4HFH A;  2I0M A;  3FHN A;  4JLE A;  5CA1 E;  2YDR A;  3S4U A;  4CN4 A;  3GMI A;  4YXD A;  4CN6 A;  4BAY B;  3VKH A;  5KXJ A;  2X0H A;  1DU2 A;  4FJO A;  3UT5 E;  3QK6 A;  2MYS A;  4ILA A;  2VK9 A;  3RX6 A;  5L3B B;  2KLQ A;  4WZX A;  2Q9Q C;  4JI7 T;  3C51 A;  2BG9 E;  4DR1 T;  2W00 A;  5HYA A;  3VR8 A;  3I0O A;  1XDO A;  3NWI A;  1YW0 A;  2Z6E A;  3HL6 A;  5IUX A;  4JYA T;  3N9M A;  4H9S E;  4LMK A;  3EHZ A;  2V5C A;  5AQU B;  4KHP T;  4Z8X A;  2ODU A;  3C98 B;  4OX9 T;  5LMU T;  2XPK A;  2LE8 A;  3QC9 A;  3ONL C;  4J2C A;  1D0Z A;  5LCY A;  3VKG A;  3FXD B;  1N33 T;  4PNI A;  1VCS A;  1LVF A;  3NBX X;  3JAE A;  2XQY A;  2Y48 B;  1LRZ A;  4U2Y A;  4H63 H;  3J7Y q;  2V5D A;  2HPJ A;  2D5U A;  4PAG A;  3RC8 A;  2PG8 A;  3H3A A;  3PUZ F;  4X62 T;  2VB6 A;  2YK0 A; 
#chains in the Genus database with same CATH homology
 2C5K T;  4EAH A;  3MK7 C;  3E08 A;  5JQG E;  3JC6 D;  3CX8 B;  3PUA A;  5LA6 E;  4IIJ E;  3MKD A;  3OJA A;  5LNK A;  2RP4 A;  5LBQ B;  4PJN A;  4XBF B;  1D0Y A;  4AKH A;  5EK2 A;  3V5S A;  1KNZ A;  3FXE B;  2NW7 A;  2MOZ A;  3HKD E;  3P7I A;  2LSG A;  2CCQ A;  5JDM A;  3Q9D A;  2W0G A;  2HH7 A;  1ZKE A;  2WSS V;  2XAF B;  3BQL A;  2C0S A;  3RH3 A;  5KX5 E;  5H6Q B;  5HXC A;  5LBM A;  3D0T A;  1UX5 A;  1OXZ A;  2XAS B;  3KVA A;  2QA7 A;  4BJN A;  2LSI A;  5HXR A;  4DBQ A;  5JRC A;  4HGA A;  2JRK A;  1B7T A;  2Q9Q D;  1MMD A;  2A72 A;  2NOX A;  2Q9Q A;  3RPU A;  5JH7 E;  2EHO C;  4H63 V;  1MNE A;  4GK5 E;  4HFV A;  4C91 A;  4AKR B;  3CQC B;  4IGU A;  3H37 A;  3N9O A;  1FEW A;  4AKL A;  3I0Q A;  3LK4 2;  2VKJ A;  3PUR A;  4PJL A;  4DO0 A;  4OYJ A;  3RRW A;  1EZ3 A;  3AA6 B;  1H7C A;  2RA1 A;  5JR9 C;  3K3Q C;  2XUE A;  4PFP A;  2ZM8 A;  3MA9 A;  4I4T E;  4UVB B;  4O4L E;  2UXX B;  4UF0 A;  1G8X A;  3GA8 A;  3J9X 1;  5JDN A;  3PUS A;  5HAX A;  4MBQ A;  3HA4 A;  2K48 A;  2V7M A;  2ES0 A;  5HWX A;  3F57 A;  4ZI2 C;  4EXT A;  3K3O A;  4EYY R;  1FMW A;  3AVR A;  4ZOL E;  4KBM B;  4CI1 B;  1HFA A;  4H9P C;  5JVD E;  4YFS A;  5FNV E;  4IE6 A;  3U3I A;  1T98 A;  4CI3 B;  4CXX A;  5JDG A;  3ESL A;  3VHL A;  4AKG A;  3CKD A;  3RRC A;  1D1A A;  3V5U A;  4IE5 A;  3DP7 A;  5L2L A;  2P9B A;  2CEA A;  5LHH B;  2KT9 A;  3O1I A;  1LKX A;  5L3C B;  2WMO A;  2KWI B;  3IF8 B;  3EDV A;  4MFR A;  3PU3 A;  4YLH A;  4B6X A;  4YHJ A;  3R6N A;  2CLY C;  3I1A A;  4L0R A;  3SS1 A;  2VKD A;  3ZC1 A;  2H3R A;  5FXZ A;  1FMV A;  1O3X A;  3O4X E;  2IC6 A;  2VWA A;  3AB3 B;  2V1D B;  3I9W A;  3KIN B;  3N9L A;  4OFZ A;  5J2U E;  2LT3 A;  4JUY A;  5ADX L;  3ZYK A;  3LBX A;  3HKB E;  4EIW A;  2YU1 A;  1U4Q A;  4PFO A;  3ETU A;  4A56 A;  4EB6 E;  1WRD A;  4H9O C;  5FY0 A;  3L09 A;  5JDQ A;  1BR2 A;  3W15 B;  4DBR A;  4ILU A;  2W61 A;  3AA0 B;  4KMC A;  2NWB A;  4G2A A;  2XAJ B;  3UFE A;  3ANW B;  1IZN B;  2K24 A;  2WBL A;  1V9D A;  2NTY A;  4UVC B;  3ZN1 B;  3UUN A;  3PUG A;  4QXB B;  5DQV A;  2V7I A;  5F3J A;  2WM9 A;  2CWO A;  3AA7 B;  4UXN B;  3IBP A;  4PK6 A;  3K8P C;  3ZYL A;  5LGN B;  1BR1 A;  3EUH A;  5EK3 A;  1KK7 A;  5ETW A;  4BJM A;  2E9X A;  4O2A E;  1IJ6 A;  3MJX A;  4F6R C;  2PBI A;  4GYS A;  5LHI B;  1AJ3 A;  2Y6X A;  3UUM A;  4WBO A;  3EVY A;  4PJM A;  4JEU B;  3B13 A;  1MIY A;  2G0U A;  4H9R C;  4PJJ A;  5LOV E;  3N2G E;  2JQQ A;  5CB4 E;  2X67 A;  1CUN A;  4EZ4 A;  4NUU A;  3O1H A;  5AFU L;  2EHO D;  2E9X C;  2VAS A;  3OYZ A;  4PK5 A;  3CX6 B;  3RYI E;  2E8I A;  2EHO A;  3KV6 A;  4JEH B;  2N1G A;  5FY7 A;  4ZI3 C;  4CI2 B;  2GK9 A;  3KBT A;  5JRC B;  2UXN B;  3CPZ A;  4ANJ A;  4M1P A;  1FIO A;  1US7 B;  2CA5 A;  2VKH A;  3AAI A;  2Q9Q B;  3ZEF B;  2X68 A;  4HTE A;  2XHE B;  5BMV E;  2HPL A;  4QWN B;  5HWY A;  2D0T A;  2LHN A;  3KVB A;  5JR9 A;  4WBN E;  2YIN A;  1G73 A;  1MMN A;  2LSK A;  1HG5 A;  1D0X A;  1ZEE A;  4O8S A;  1UCU A;  5JDH A;  2CMR A;  2NW8 A;  4HKA A;  4PK4 A;  4ZHQ E;  5DQW A;  4ZI2 D;  3ZC0 A;  3ZMT B;  2CXD A;  5KMG P;  3C50 A;  5JRE A;  4IHJ E;  4GOU A;  1HS7 A;  3C4Z A;  4UF0 B;  4O2B E;  5LG4 A;  5LGU B;  3ZMU B;  1YKH B;  3RYH E;  4PW8 A;  3UTK A;  4IE7 A;  5H6R B;  4AI6 A;  2DCF A;  3HI2 A;  3KV4 A;  3LJC A;  3VU7 H;  4CXW A;  3N9N A;  4ISS A;  4V1A v;  2Y8D A;  3P8C D;  2NTX A;  4UEL A;  3AVS A;  5LGT B;  4UEM A;  5LXT E;  4NUV A;  3TKL B;  2KXP B;  5A1L A;  2L3L A;  1YD8 G;  2CE7 A;  4QXC B;  3O9X A;  2CXL A;  4P09 A;  4UV8 B;  2BDE A;  2CLY B;  3FB2 A;  4BA9 A;  3WI3 A;  3EDU A;  5HXE A;  3CML A;  2X66 A;  4K0U A;  3RC3 A;  3UUL A;  4UVA B;  3E0Z A;  5LYJ E;  3KV5 A;  3OYX A;  5J1G A;  2X9W A;  2CWY A;  2PFV A;  2ZM2 A;  3B57 A;  2KWH A;  2JMH A;  3F31 A;  3IHR A;  3N9Q A;  5FYM A;  3T8O A;  2H7O A;  3HKC E;  3E22 E;  3WAK A;  4MLK A;  1MIV A;  4TZ4 C;  3NRX A;  3ZCI A;  2DI4 A;  4WW0 A;  3LBX B;  3BQK A;  3HKE E;  3BK9 A;  2L8K A;  4EOZ B;  2YU2 A;  3C4X A;  3ETV A;  3RYF E;  2KIN B;  3N2O A;  2ACX A;  2KMF A;  3FBL A;  2LM9 A;  2V7L A;  5DAB A;  3CQG B;  5IYZ E;  2X9Y A;  2JJ9 A;  4GIW A;  5FY1 A;  3N9P A;  3KDS E;  1HG2 A;  2B1E A;  4AKI A;  2D2S A;  4ZI7 E;  5L3E B;  1IAP A;  3I9Y A;  2WAU A;  4XZC A;  3ZMV B;  5LP6 E;  3WAJ A;  3N2K E;  4I50 E;  5M4Y A;  4U74 A;  3RKO A;  1QSD A;  3AAE B;  3GN5 B;  4GYR A;  4QX7 B;  2CM0 A;  2V7K A;  3A5X A;  4TUY E;  4X1Y E;  4P0A A;  5GON E;  3NZP A;  4UIG A;  3GN5 A;  1D1C A;  4QX8 B;  2IAK A;  4IE0 A;  5EZY E;  1YKE B;  2XAH B;  2X51 A;  4TX5 A;  1VRB A;  4DVD A;  1S94 A;  4AQF A;  3ZPO A;  1NWM X;  2E9X B;  3IEE A;  4TV9 E;  2QGS A;  5DJQ C;  3MZK B;  2E9X D;  2NP9 A;  4TN7 B;  3KFW X;  2W62 A;  2NW9 A;  2X9X A;  3C64 A;  4H9Q C;  4ZI3 D;  4C90 A;  1HCI A;  3KBU A;  5JDL A;  2SPC A;  2N9D A;  4OYK A;  4AQF C;  3O1J A;  4MHC A;  1WR6 A;  3ZLI A;  2EHO B;  4HN9 A;  1MMG A;  1Y64 B;  2XAG B;  4O4I E;  5JDF A;  2A2F X;  2ZLY A;  2W63 A;  4ASK A;  2I59 A;  2LHR A;  5E0O A;  5FXW A;  4AQG A;  2XAQ B;  4XAX B;  4DND A;  2JPF A;  4CXY A;  2BVM A;  3RYC E;  2LSY A;  4UV9 B;  5FP3 A;  3ZJ1 A;  2PJQ A;  2LOS A;  2WMN A;  1SA0 E;  2JMK A;  1BR4 A;  2ZM0 A;  5HXS A;  5JR9 B;  2VL8 A;  3DTO A;  4ZS3 A;  5C8Y E;  4YJ2 E;  2X0L B;  1HF8 A;  3FHN A;  4HEA A;  1MIW A;  4JLE A;  4QKN A;  5CA1 E;  5F8P A;  1Z0P A;  3GWH A;  3S4U A;  3M65 A;  4ADZ A;  5L3D B;  3GMI A;  3ZJ2 A;  4IE4 A;  3ZMS B;  2ZMA A;  4QHO A;  3AA1 B;  3K3N A;  2YEV C;  4BAY B;  3VKH A;  2N2N A;  2C5J A;  1UX4 A;  2LJL A;  4O4H E;  3BQI A;  3AAA B;  3JC6 C;  4X1K E;  2DWG A;  4O4J E;  4FJO A;  2K5B B;  2BVL A;  2K9A A;  3HR0 A;  1U5P A;  3UT5 E;  5FXX A;  3QK6 A;  2MYS A;  1E1H B;  3ZCJ A;  5L3G B;  2V7J A;  3PTR B;  2M67 A;  3SRZ A;  5LJM A;  2BZB A;  2DWK A;  2KZ7 B;  2VK9 A;  3Q2M A;  4CQI A;  4IST A;  3RX6 A;  2LSJ A;  3U78 A;  2VKO A;  5L3B B;  3CVR A;  2KLQ A;  1ZV4 X;  3LK2 B;  4H9N C;  5FMN A;  3LG7 A;  2Q9Q C;  4L9I A;  2V26 A;  2L9Q A;  3C51 A;  4CZZ B;  4L5G A;  3LK3 B;  4WNK A;  4G63 A;  2W00 A;  2H7V C;  2X9H A;  5HYA A;  2DLR A;  4EZH A;  3QUJ A;  5LHG B;  2KND A;  3FBZ A;  2D0U A;  3I0O A;  3PU8 A;  1IJ5 A;  4KP3 C;  3CX7 B;  1MND A;  3ZMZ B;  1YW0 A;  2Z6E A;  4KUM B;  2LOP A;  3PE0 A;  3HL6 A;  2CXF A;  3ONX A;  3DJB A;  3OKQ A;  3N9M A;  5J2T E;  4H9S E;  4P0B A;  4OHF A;  4ZS2 A;  2C5I T;  2DHR A;  3CWZ B;  3F2E A;  4OK0 A;  4YJ3 E;  3R84 B;  1HTJ F;  2DNX A;  3PUQ A;  5HXH A;  4X1I E;  3SWH A;  4E7Z A;  4U72 A;  4N78 D;  4I55 E;  2WWU A;  2OA5 A;  5KDM C;  4I43 B;  3C4W A;  5LJN A;  3NRY A;  4Z8X A;  2ODU A;  4X20 E;  1ZHC A;  3C98 B;  3Q5X A;  4QXH B;  4ERR A;  2LE8 A;  3QC9 A;  5EK4 A;  4GK0 E;  4AXP A;  1X79 A;  1D1B A;  1QUU A;  1S35 A;  4DMV A;  4J2C A;  1MMA A;  1D0Z A;  3N5L A;  5LCY A;  1WYC A;  3VKG A;  3ZYM A;  3UUX B;  3SOL A;  4MAL A;  5TAO A;  4DMW A;  3FXD B;  4FI5 A;  3MAC A;  5L3F B;  4EYU A;  4PNI A;  1HX8 A;  2IC9 A;  2MBG A;  2IW5 B;  3Q5W A;  1LVF A;  3NBX X;  1BR0 A;  1VOM A;  1OWA A;  2XQY A;  3OBV E;  1WLX A;  2ODV A;  2J1D G;  2XTL A;  5FXV A;  1LVK A;  3ANW A;  3PDY A;  4HE8 A;  4TV8 E;  4E7S A;  3LFM A;  4IDZ A;  2Y48 B;  1LRZ A;  1SHZ C;  4H63 H;  3CQX C;  5IHY A;  3J7Y q;  3L3P A;  5CA0 E;  2LEH A;  3KV9 A;  1NAF A;  1WYB A;  2A3D A;  2HPJ A;  2D5U A;  4PAG A;  3NZQ A;  3RC8 A;  3ZN0 B;  2PG8 A;  2MTQ A;  3MXZ A;  3H3A A;  2VB6 A;  2YK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...