3UULA

Crystal structure of first n-terminal utrophin spectrin repeat
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
115
structure length
115
Chain Sequence
DLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELSAHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALMELQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords utrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 53
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uulA00
1CUNA 2ODVA 1OWAA 1HCIA 3LBXB 2ODUA 3EDVA 3UUMA 1WLXA 3UULA 1S35A 1QUUA 3FB2A 1U5PA 3LBXA 2SPCA 3UUNA 3PE0A 3F31A 1AJ3A 1U4QA
chains in the Genus database with same CATH superfamily
2XQ9A 3F2EA 3Q5XA 2QA7A 2ZM8A 4H9QC 2DWGA 1D0YA 3SS1A 2JMKA 2CCQA 2WS3A 4M1PA 3EDUA 4L5GA 3KVBA 2VQET 2FJEA 5HEGA 4EIWA 2X9XA 3RIUA 1WR6A 4TWFA 2X66A 3ZJ2A 3AXJB 3KV4A 4YTPA 1OEDE 2PFVA 1IZNB 3LDQB 2WB5A 3S4UA 4ZI7E 4N78D 4AQFC 2A2FX 2WDQA 4CI1B 2ES0A 1ZKEA 2W00A 5CA0E 4J2CA 1T72A 1FIOA 1VOMA 1US7B 4ZS3A 1DU2A 3SOLA 5ADXL 2XQ6A 3RQWA 2XQYA 4KX6A 4X5TA 3V5SA 1SA0E 2Z6EA 2OV9A 4U2YA 1D1CA 3QK6A 4O4IE 3ZEFB 2XAGB 3NKZA 2D2SA 4IT4A 2YDRA 2K3WA 1ZEEA 4OYKA 4MBQA 2V7JA 1NAFA 2K24A 4JI3T 4DV7T 4NIQA 4JI8T 3AA6B 2WP9A 4H9RC 2CBIA 3MJXA 4P1NA 5H6QB 2AXDS 4HFHA 1U5PA 2VWAA 2X51A 1XZYA 2DHRA 5DABA 3UQ4A 2JQKA 5JDMA 1MMGA 2WAUA 2V8SV 2CLYC 4Z8XA 3QOFA 4FI5A 3C50A 3C4ZA 1WLXA 4AKRB 2EHOD 3GN5A 1W0AA 4LMLA 4X62T 2W4XA 5FY7A 3CPZA 2I6HA 4A5XA 5GONE 5TAOA 2BG9A 5KMGP 4HWHA 2KNDA 4IDQA 4B3TT 1SE7A 4EOZB 4BAYB 3AA7B 2CLYB 4Q25A 4EYUA 4HFDA 4AQYT 3PUGA 4E7SA 4HFBA 4GYRA 2FJBA 5F5WA 2YK0A 4CXYA 4GK5E 4C90A 4WBOA 1BR2A 2VURA 2G0UA 4ZXLA 3AE8A 3Q5DA 2W66A 3LK42 2M67A 1XMOT 1HNWT 5JR9A 4V1Av 3FZHB 4B3ST 3HKDE 5L3EB 2WDVA 3BK9A 3ZLIA 4MHCA 4YY3T 3UU6A 1KEYA 4HFVA 5IUXA 3CMLA 5JDQA 3NRXA 4MALA 2CWOA 5H6RB 1FMWA 2XSBA 4QHOA 5LJNA 2MOZA 4H9OC 4GKJT 3X1DA 3QB5A 3IEEA 3SWHA 2LJLA 3CVRA 2IMLA 5AQTB 2L9QA 2VL0A 2WSSV 4QX7B 3RIAA 4DR1T 1SHZC 1LVFA 2KWHA 1YD8G 2XY8B 3O1JA 1IJ6A 2ODUA 5HXCA 1CHUA 1BR4A 3QNUA 3L09A 5HWYA 2E8IA 2LLYA 2X9YA 3UFEA 4JEUB 3F57A 4ZEYA 2Y6XA 3CX6B 2A9UA 2UUCT 4KUMB 4HWIB 2FJDA 4PK5A 3FBLA 2WWVA 5J2UE 4QH5A 5J1GA 1XNQT 2BG9E 5JRCB 4IDPA 3UTKA 1HCIA 1LVKA 5FY0A 2YINA 1KK7A 1MIVA 1IBMT 2PG8A 4GKKT 3CQGB 1UX5A 3GMIA 4X20E 3T1HT 5HXEA 2BBJA 3RGLA 3P8CD 3RKOA 5HXSA 3N9PA 1L0VA 2ZM2A 3LFMA 2X68A 2VVSA 5AQNB 2LSGA 4COFA 2IC6A 4X1KE 2RP4A 2XQ5A 2FBWA 2WQYA 2H7OA 5JDGA 5LG3A 5L3DB 2HHHT 3PJAJ 4XBFB 4IREA 5LB7B 4YJ2E 2V6YB 4LF6T 1HX1B 2NTYA 1UX4A 2XQ3A 3R84B 3I0QA 2M6BA 5AQFB 4CN6A 2YU2A 2YEVC 1UCUA 4JI1T 5LJMA 5HEJA 1KNRA 3UFGA 4EV6A 3RIFA 3C4WA 1S35A 3PUAA 3J7Yq 2YDQA 5DQWA 4DMVA 3Q5WA 1E1HB 3PUVF 5LA6E 4WNKA 4AI6A 4ZS2A 4DVDA 5L2LA 4AQFA 3ANWB 4NPPA 3VKHA 4JEHB 2NR4A 2LT3A 4IIJE 3T8OA 3ZC0A 4X1IE 1D0ZA 3HI2A 3I0OA 1OEDA 2FUPA 4DR5T 2LRKA 4DO0A 4X1YE 1I6ZA 2YOEA 3CX7B 5HWXA 3AA1B 3E22E 3TLSA 4IE6A 1QUUA 2WU5A 4CI3B 1V9DA 2CM0A 3ZT6A 5DQVA 2MPKA 3PUZF 2EHOA 3PTRB 5FL0A 2V1DB 2DWKA 4O8SA 3V5UA 2LEHA 3NZQA 2QYWA 3AAEB 4X64T 4I4TE 2Q9QC 4TWDA 3OVUA 4EB6E 3NBXX 2DCFA 4EEDA 3JADA 5IWAT 3ZC1A 5HEHA 5JVDE 2IW5B 4B6XA 4MLKA 4UELA 4DV1T 1IJ5A 4DR7T 1D1AA 4DV0T 5FMNA 3ZYLA 2CEAA 4DV4T 1Y01A 3PUSA 4UF0B 1MNEA 4YSXA 4OK0A 4E7ZA 2ODVA 2LOPA 4ZZCA 3EUHA 2J62A 3BQIA 3OBVE 4A97A 4LMJA 3AAAB 2BZBA 2Q9QB 1J1JA 1HX8A 4DR3T 3I1AA 3CKDA 3HKEE 3LSVA 1UK5A 2Q9QD 2WMOA 3FXDB 3DJBA 3SRZA 1MMDA 5ABEA 4UEMA 3P4SA 4CXWA 1T98A 2XQ7A 3F31A 2H3RA 2JQHA 3ETVA 3VR8A 2D0UA 3UT5E 2UXCT 2BS3A 2C5KT 4DUYT 2CRBA 3CQCB 4LF8T 4F8HA 2LSIA 5IYZE 4OFZA 4AIUA 2ACXA 4DV6T 3AE1A 1W9RA 3OYZA 4DV5T 2C5IT 3HR0A 1NENA 4YSZA 1FMVA 4AKIA 4PJMA 2VK9A 3EABA 2NTXA 4YXDA 2CXLA 2BS4A 1O3XA 4IL4A 3RHWA 2NW8A 3AVRA 2AE9A 3ZYKA 4H63V 3TLUA 4ISSA 2OLTA 3AEBA 3OPCA 2KINB 4WZXA 2YN6A 1J5ET 1AJ3A 5ABFA 2ZMAA 3TLTA 4EZHA 4ZI2C 3RYCE 4IE4A 4DBRA 2LRLA 2JQ9A 3ZT7A 5JRCA 3VHLA 3L39A 4TWHA 3ZKRA 4UV8B 2NW9A 5LBQB 4G2AA 5AQIB 3AB3B 5LCYA 3UUNA 2BVMA 4EGWA 2CXFA 3PDYA 2JJ9A 1OWAA 4QH1A 4PK6A 3NWIA 3KFWX 4NXNT 3PURA 2HN1A 4I43B 3AE6A 4DR4T 5AQGB 3AE9A 1WR0A 2HN2A 3RYHE 3P4QA 4B3RT 2E2AA 4AKGA 2UXXB 2LSKA 1KNZA 3N9LA 4TX5A 4YHHT 4ZZBA 3L8RA 5BR8T 3K3OA 3N2KE 4NUUA 5HXRA 5AQUB 2X0LB 2JQQA 1S94A 2WZHA 1I94T 1YKHB 5LBMA 4ADZA 5LGTB 3TKLB 2IHR1 3U78A 5JTGA 2XAQB 4MFRA 4HEAA 2F4VT 2NOXA 2XQAA 1QLBA 3E0ZA 2D9DA 2V6XA 2M6IA 2OA5A 2X9WA 3UULA 2BDEA 2WDRA 3AAIA 2DI4A 3NVOA 2W0GA 3AA0B 4ILUA 1WYBA 2X0HA 3KV5A 3ANWA 3B57A 2XPKA 3AECA 3E08A 4LFBT 5JQGE 5HCJA 2BBHA 4XAXB 4KP3C 5FNVE 4GOUA 3IF8B 1HG2A 1OXZA 5FP3A 3I9WA 3VU7H 4DBQA 5LXTE 2E5LT 2KXPB 3AEAA 4O4LE 1WFDA 2ZLYA 2VKDA 3PUWF 4H9NC 1T7SA 2QVAA 2XJ7A 3FB2A 2XASB 3RRWA 4HGAA 1YW0A 1MMAA 1QSDA 3K3QC 4UV9B 4U31A 3CIRA 3GWHA 3QC9A 1JNRA 4YJ3E 1YQ3A 2K5BB 1YQ4A 3I9YA 4HN9A 1KF6A 3UU5A 5ABHA 4P0AA 3BQLA 4UF0A 4CI2B 5LP6E 5DJQC 4LF7T 1R8IA 3CK6A 3WAJA 3ZMVB 3PUXF 1XWMA 4TNWA 5LHGB 2Q9QA 2IAKA 4PNIA 3DP7A 2VB6A 4IE0A 4H63H 2BKPA 2IIUA 4P0BA 2H88A 3AE2A 3A5XA 2I0MA 2CA5A 5L3CB 2VKHA 2MTQA 5LNKA 2ZM6T 2XZEA 4A98A 2LKGA 3BQKA 1X9BA 4ANJA 2V7IA 2X67A 3ABVA 2CE7A 3P7IA 4Z91A 1KNPA 3JC6C 2HPJA 2W67A 1Z0PA 4PAGA 3WI3A 3ZT5A 2RPAA 2VASA 2CXDA 3SFDA 5LGUB 3PU8A 4AISA 2X0YA 4YTMA 3AXJA 4P09A 3LBXB 2LHNA 1E7PA 4QX8B 2QGSA 4ZHQE 1T8BA 4PW8A 4I55E 4ASKA 2R6GF 4UVAB 4UVBB 3JC6D 2WWUA 2C5JA 2LM2A 5AQMB 1X79A 3PUQA 5L3GB 4JI7T 3TLVA 2WMNA 3EI0A 2WM9A 1G8XA 2UU9T 4IHJE 1LKXA 2MAWA 4ILAA 1SUMB 3U3IA 3AEFA 4DMWA 4EEBA 3PV0F 1VCSA 4H9PC 5FVLA 3PUYF 4O2AE 4QKNA 3FZFB 1UUSA 2PTFA 4U7IA 2ACZA 3LK3B 3ZJ1A 3B13A 2CWYA 3P50A 4HWFA 2UUAT 5CJ5A 1NWMX 2WZIA 1EZ3A 5JREA 3UUMA 2VVNA 4OX9T 3ZPOA 5LG4A 4HFEA 2XM1A 3ZMTB 4HFCA 4GK0E 2JPFA 4HE8A 4WYVA 4ZI3C 4IDZA 3O4XE 3R6NA 2IUBA 5KX5E 3N9QA 3N9MA 1HS7A 5L47A 4YFSA 4JI5T 2FJAA 3VR9A 4U7YA 2A3DA 4PK4A 4ILBA 3H3AA 3ZSSA 4JBWF 3RH3A 5FXWA 3OYXA 3P4PA 5HAXA 1N34T 5EK3A 4CQIA 5FY1A 3WAKA 3AE5A 4LFCT 1FEWA 5LMUT 5E0OA 2PBIA 1Y64B 2PJQA 2XTLA 3AEDA 5AQRB 2Y8DA 3JAFA 3RLFF 4ZI3D 3EHZA 4DR2T 1XDOA 2CMRA 2B1EA 3EVYA 3RC8A 4HKAA 4YHJA 2BVLA 2DNXA 2NP9A 3GA8A 1Z8UA 3UU8A 4DNDA 4AKLA 3PE0A 2D0TA 1E2AA 5KDMC 2Y48B 3FZKB 1MIYA 5AQSB 4TV9E 2YDSA 3AE7A 2VKOA 5L3BB 2V7KA 4CXXA 3N9OA 1M7KA 5HEOA 4HFIA 1N33T 5JH7E 4JI6T 4GIWA 5F8PA 4A56A 3CX8B 2XUEA 3RX6A 1WYCA 3A7MA 5JDFA 3P4WA 2V5DA 2RA1A 5J2TE 3K3NA 5AQQB 3OTOT 1W09A 2W63A 4H9SE 3C4XA 5C8YE 3RC3A 5LHHB 2WCAA 2W62A 3ZN0B 2E9XC 4EAHA 4WBNE 4KHZF 2NWBA 5CB4E 1IAPA 5AQLB 4C91A 5FXZA 5AQOB 2MBGA 3FHNA 4JI0T 4PFOA 4LF5T 5EK2A 3ZCIA 3RQUA 4JUYA 1FJGT 5FVKA 5LGNB 5FXXA 1JNZA 4UVCB 3UUXB 2H89A 2HPLA 2N2NA 3LG7A 4CN4A 4OYJA 4YT0A 1HNZT 5L4EA 2ZM0A 2LKHA 2E9XB 4I0UA 1OEDC 4U72A 5CGMA 1CUNA 5L4HA 2E9XD 4DV3T 1ZV4X 4IE5A 2D5UA 2LSJA 4B3MT 4YLHA 3HA4A 2SPCA 3FXEB 4ZOLE 2EHOC 4ISTA 2NW7A 5ABGA 4ZI2D 2C0SA 1XDPA 3TLWA 3VKGA 2K9AA 5JDLA 2UUBT 1MMNA 2L8KA 2BKOA 3O9XA 5AFUL 4U33A 1OEDB 2HH7A 1GQEA 5JDNA 3LBXA 5HCMA 2W61A 5F3JA 4QXHB 4JI4T 3QB5K 5CA1E 4U3CA 3D0TA 3PU3A 2JIWA 2V6YA 3J9X1 2KLQA 2EHOB 4AKHA 5FYMA 3VRBA 1YKEB 4KMCA 3H37A 1HF8A 4DV2T 2N1GA 4EYYR 2A72A 3CWZB 4EZ4A 1B7TA 2J47A 2BKNA 3IA3A 3ESLA 3N5LA 2UXDT 4X65T 3LK2B 5A1LA 4TN7B 4NXMT 4NUVA 2CBJA 3K1SA 1LRZA 4U2ZA 1YXRA 3IBPA 3AVSA 3RIUC 4BA9A 3OJAA 4X66T 2LE8A 2JMHA 3A8YC 3QUJA 4LF9T 5LYJE 5HYAA 2GK9A 4OHFA 5CFBA 2DLRA 5J0ZA 2K48A 4O4JE 1VCTA 1HTJF 4K0UA 4LFAT 4JV5T 4IL9A 5AQKB 3EDVA 3UU4A 1NEKA 4G63A 2V7MA 4UIGA 3KBUA 3C51A 4JI2T 3W15B 5C3JA 3K8PC 1XNRT 4KI0F 2L3LA 1D1BA 4JLEA 5EK4A 4WW0A 4O4HE 2CHNA 3JCFA 2W2UA 5IHYA 3UU3A 3FZLB 3AE4A 5M4YA 4KHPT 3C98B 3MACA 5AQPB 4L9IA 2I59A 5AQJB 2P9BA 3ETUA 3P4RA 4DR6T 3ONXA 1HG5A 1N36T 5JDHA 2UXNB 3O1IA 4TUYE 3LJCA 5ABFB 3ZCJA 4LMKA 3RKGA 3RF1A 2KT9A 5AQHB 4QXCB 3Q2MA 3HL6A 4IE7A 5ETWA 4KBMB 3MXZA 1BR1A 1WRDA 2KWIB 4PFPA 1KFYA 3ZMZB 1UGOA 3DTOA 2DL1A 3T1YT 4IDNA 2XQ4A 4IDOA 2V7LA 3ZN1B 3MKDA 4PJNA 3SFEA 2IDOB 2H7VC 3L3PA 1IBLT 4ILCA 2XHEB 1UURA 4CZZB 3PJAA 2E5VA 4TNVA 3AE3A 1U4QA 2WY2A 3KVAA 2IC9A 2BG9C 4HWCA 4ERRA 3AEGA 2WBLA 3MZKB 1HFAA 2KSRA 1ZHCA 3KV9A 1M62A 4HTEA 2V26A 3UUBA 3ZYMA 2B76A 4XZCA 3N2OA 5FKYA 3GN5B 1J5WA 3ZMUB 4PJLA 4QH4A 3MK7C 2CHOA 3KV6A 1ZOYA 2BG9B 5JR9C 2LHRA 4U74A 4QWNB 4DIDB 2J1DG 3UQ7A 3RPUA 1D0XA 5LHIB 3ONJA 3IHRA 4LF4T 4FJOA 1MIWA 2XSAA 2JRKA 4HWDA 2E9XA 4PJJA 5AQVB 4BJNA 4YTNA 5LOVE 3FBZA 5HEUA 3ZSTA 4GYSA 3B5MA 4L0RA 3ZMSB 5BMVE 2VQFT 4DUZT 2XAHB 1XMQT 5JR9B 1G73A 2X9HA 1VRBA 3H3MA 3FZMB 4F6RC 1H7CA 3ONLC 2YKSA 4UR9A 3CQXC 3G06A 2UXBT 3RI5A 1ZP0A 4O2BE 1W0BA 3NRYA 5EZYE 2BS2A 2N9DA 2LSYA 3Q5EA 3AEEA 3M65A 4AXPA 5L3FB 3VRAA 2XM2A 3RRCA 1BR0A 4TZ4C 1IBKT 3NZPA 2XQ8A 3N2GE 5LMNT 3Q9DA 3EAMA 2MYSA 2VKJA 4JYAT 4K0KT 2YU1A 3C64A 3HKCE 2QRXA 3M3ZB 3JAEA 2XAFB 2KZ7B 4AQGA 5HXHA 3KBTA 3RYIE 5C2TA 4QXBB 4BJMA 2LM9A 2VL8A 3KDSE 1HR0T 2CPTA 1MNDA 5FXVA 5KXJA 4YSYA 4IGUA 3MA9A 2LOSA 1N32T 2J4GA 3N9NA 4EXTA 5FL1A 4TV8E 4I50E 2KMFA 1WCRA 3HKBE 2XAJB 4UXNB 3OKQA 3RYFE 4CN1A 1HNXT 3KINB 2V5CA 3O1HA 2WU2A 4Z90A
chains in the Genus database with same CATH topology
5F3JA 5LA6E 4QXHB 4WNKA 3F2EA 4HN9A 5CA1E 4AI6A 3Q5XA 2QA7A 2ZM8A 3D0TA 3PU3A 4H9QC 4ZS2A 3J9X1 4DVDA 4P0AA 2DWGA 2KLQA 1D0YA 3SS1A 5L2LA 2JMKA 2CCQA 2EHOB 3BQLA 4M1PA 3ANWB 4AQFA 4AKHA 4UF0A 5FYMA 3VKHA 4JEHB 3EDUA 1YKEB 4L5GA 3KVBA 4CI2B 2LT3A 4KMCA 3H37A 5LP6E 5DJQC 4EIWA 2X9XA 1HF8A 4IIJE 3WAJA 3T8OA 2N1GA 3ZC0A 3ZMVB 4X1IE 4EYYR 2A72A 1WR6A 5LHGB 2Q9QA 3CWZB 4EZ4A 2IAKA 1B7TA 4PNIA 3DP7A 1D0ZA 3HI2A 2X66A 3I0OA 3ESLA 3ZJ2A 3N5LA 2VB6A 4IE0A 4H63H 4DO0A 4X1YE 4P0BA 3KV4A 3CX7B 5HWXA 3LK2B 5A1LA 4TN7B 4NUVA 3AA1B 3E22E 3A5XA 4IE6A 1QUUA 2CA5A 5L3CB 2VKHA 2PFVA 1IZNB 1LRZA 4CI3B 1V9DA 2CM0A 2MTQA 5LNKA 3BQKA 5DQVA 4ANJA 2V7IA 2EHOA 3PTRB 3S4UA 4ZI7E 2X67A 4N78D 2CE7A 3P7IA 3JC6C 2A2FX 2V1DB 4AQFC 2HPJA 1Z0PA 4PAGA 4CI1B 2ES0A 1ZKEA 2W00A 5CA0E 2DWKA 4J2CA 3WI3A 4O8SA 3V5UA 3IBPA 2LEHA 3NZQA 1FIOA 1VOMA 3AVSA 3AAEB 1US7B 4ZS3A 4I4TE 2VASA 4BA9A 3OJAA 2Q9QC 2LE8A 2CXDA 2JMHA 2DCFA 3NBXX 3SOLA 4EB6E 3ZC1A 5LGUB 5ADXL 3PU8A 3QUJA 2XQYA 4P09A 5JVDE 3LBXB 2IW5B 3V5SA 2LHNA 1SA0E 4B6XA 2Z6EA 4MLKA 5LYJE 5HYAA 4UELA 4QX8B 1D1CA 2GK9A 4OHFA 1IJ5A 3QK6A 1D1AA 2DLRA 4O4IE 2QGSA 3ZEFB 4ZHQE 5FMNA 4PW8A 2XAGB 3ZYLA 2D2SA 4I55E 2CEAA 2K48A 4O4JE 3PUSA 1ZEEA 4UF0B 4ASKA 1MNEA 4OYKA 4UVAB 4OK0A 1HTJF 4MBQA 4UVBB 3JC6D 2WWUA 2C5JA 4K0UA 4E7ZA 2ODVA 2V7JA 1NAFA 2K24A 2LOPA 3EUHA 3BQIA 3OBVE 3EDVA 1X79A 3AA6B 3PUQA 4G63A 5L3GB 3AAAB 4H9RC 2V7MA 2BZBA 2Q9QB 3MJXA 1HX8A 3I1AA 4UIGA 3KBUA 3C51A 3W15B 5H6QB 3CKDA 3HKEE 2Q9QD 2WMNA 2WMOA 3DJBA 3FXDB 3K8PC 3SRZA 1MMDA 2WM9A 1G8XA 4UEMA 1U5PA 4IHJE 1LKXA 4CXWA 1T98A 2L3LA 1D1BA 2VWAA 2X51A 2H3RA 3ETVA 2DHRA 3F31A 4JLEA 3U3IA 5DABA 2D0UA 3UT5E 5EK4A 4DMWA 4WW0A 4O4HE 5JDMA 2C5KT 1MMGA 2WAUA 4Z8XA 2CLYC 4FI5A 4H9PC 5IHYA 3CQCB 3C50A 3C4ZA 1WLXA 5M4YA 4AKRB 3C98B 2LSIA 3MACA 5IYZE 4L9IA 2I59A 4O2AE 4QKNA 4OFZA 2EHOD 2ACXA 2P9BA 3GN5A 3ETUA 3LK3B 3OYZA 3ZJ1A 3ONXA 1HG5A 3B13A 5FY7A 2CWYA 3CPZA 5JDHA 2UXNB 2C5IT 5GONE 3HR0A 5TAOA 3O1IA 4TUYE 3LJCA 5KMGP 2KNDA 1NWMX 3ZCJA 1EZ3A 5JREA 1FMVA 3UUMA 4AKIA 2KT9A 4PJMA 2VK9A 3ZPOA 5LG4A 4QXCB 3Q2MA 3HL6A 4IE7A 2NTXA 5ETWA 3ZMTB 4GK0E 2CXLA 4EOZB 2JPFA 4KBMB 3MXZA 4BAYB 1O3XA 3AA7B 1BR1A 1WRDA 4HE8A 2CLYB 4ZI3C 4IDZA 2KWIB 4PFPA 4EYUA 3O4XE 3R6NA 3ZMZB 3DTOA 3PUGA 4E7SA 5KX5E 3N9QA 3N9MA 2NW8A 4GYRA 1HS7A 3AVRA 4YFSA 2V7LA 2A3DA 3ZYKA 4PK4A 2YK0A 4CXYA 4H63V 4GK5E 4C90A 4WBOA 3ZN1B 1BR2A 3MKDA 4ISSA 4PJNA 2G0UA 3H3AA 2H7VC 3L3PA 2KINB 3LK42 2M67A 2XHEB 3RH3A 4CZZB 5FXWA 5JR9A 3OYXA 4V1Av 1AJ3A 5HAXA 1U4QA 5EK3A 2ZMAA 3HKDE 2IC9A 3KVAA 5FY1A 4CQIA 4EZHA 5L3EB 4ZI2C 3WAKA 3BK9A 3RYCE 4IE4A 2WBLA 4DBRA 4ERRA 3ZLIA 3MZKB 1FEWA 1HFAA 4MHCA 5E0OA 1ZHCA 2PBIA 1Y64B 2PJQA 3KV9A 4HTEA 2V26A 5JRCA 2XTLA 4HFVA 2Y8DA 3VHLA 3CMLA 5JDQA 4ZI3D 4UV8B 3ZYMA 2NW9A 3NRXA 5LBQB 4G2AA 4MALA 2CWOA 3AB3B 2CMRA 5H6RB 5LCYA 1FMWA 3UUNA 2BVMA 2B1EA 4XZCA 2CXFA 3PDYA 2JJ9A 4QHOA 3N2OA 3GN5B 5LJNA 1OWAA 3EVYA 4PK6A 2MOZA 3RC8A 3KFWX 4H9OC 4HKAA 4YHJA 3PURA 3IEEA 3ZMUB 4I43B 2BVLA 2DNXA 4PJLA 3SWHA 2LJLA 3CVRA 2NP9A 3GA8A 3MK7C 2L9QA 4DNDA 3KV6A 2WSSV 4QX7B 5JR9C 2LHRA 4U74A 4QWNB 4AKLA 1SHZC 3PE0A 2D0TA 2J1DG 5KDMC 1LVFA 3RPUA 1D0XA 3RYHE 2KWHA 2Y48B 5LHIB 1YD8G 3IHRA 3O1JA 1IJ6A 2ODUA 5HXCA 1BR4A 1MIYA 3L09A 5HWYA 4AKGA 2UXXB 2LSKA 2E8IA 1KNZA 3N9LA 4FJOA 1MIWA 4TX5A 2X9YA 4TV9E 3UFEA 4JEUB 2JRKA 3F57A 2E9XA 3K3OA 3N2KE 4PJJA 4NUUA 2VKOA 5HXRA 4BJNA 5LOVE 2Y6XA 2X0LB 2JQQA 1S94A 3CX6B 5L3BB 3FBZA 2V7KA 1YKHB 4CXXA 5LBMA 4GYSA 4ADZA 4L0RA 5LGTB 3ZMSB 5BMVE 3N9OA 3TKLB 2XAHB 4KUMB 5JR9B 1G73A 3U78A 5JH7E 4GIWA 5F8PA 2X9HA 4A56A 1VRBA 2XAQB 3CX8B 4MFRA 4PK5A 3FBLA 2XUEA 4HEAA 3RX6A 1WYCA 5J2UE 5JDFA 4F6RC 1H7CA 2NOXA 2RA1A 5J1GA 5J2TE 3K3NA 5JRCB 3E0ZA 3CQXC 2W63A 4H9SE 3UTKA 3C4XA 5C8YE 3RC3A 5LHHB 1HCIA 4O2BE 1LVKA 5FY0A 2W62A 2YINA 2OA5A 3ZN0B 1KK7A 2E9XC 3NRYA 1MIVA 5EZYE 4EAHA 4WBNE 2PG8A 2N9DA 2NWBA 2X9WA 2LSYA 3CQGB 3UULA 2BDEA 5CB4E 1IAPA 3AAIA 3M65A 4AXPA 2DI4A 4C91A 2W0GA 3AA0B 5L3FB 5FXZA 4ILUA 2MBGA 1UX5A 1WYBA 3FHNA 3GMIA 3RRCA 1BR0A 4TZ4C 4X20E 5HXEA 3KV5A 3ANWA 3B57A 4PFOA 3NZPA 3P8CD 3RKOA 5HXSA 5EK2A 3ZCIA 3N9PA 2ZM2A 3LFMA 4JUYA 5LGNB 2X68A 5FXXA 3E08A 3N2GE 4UVCB 3Q9DA 3UUXB 5JQGE 2MYSA 4XAXB 2HPLA 4KP3C 2LSGA 2N2NA 2VKJA 5FNVE 4GOUA 3LG7A 2YU1A 3C64A 3HKCE 3IF8B 4OYJA 1HG2A 2IC6A 2XAFB 1OXZA 2ZM0A 2KZ7B 4X1KE 2E9XB 2RP4A 4U72A 1CUNA 4AQGA 5FP3A 3I9WA 2E9XD 2H7OA 5HXHA 3VU7H 4DBQA 5LXTE 5JDGA 3KBTA 5L3DB 2KXPB 1ZV4X 3RYIE 4IE5A 4O4LE 4XBFB 2D5UA 2ZLYA 4H9NC 2VKDA 2LSJA 4QXBB 4BJMA 4YJ2E 2LM9A 2VL8A 3KDSE 4YLHA 2NTYA 3HA4A 3FB2A 2SPCA 1UX4A 3FXEB 2XASB 4ZOLE 2EHOC 1MNDA 4ISTA 3I0QA 5FXVA 3R84B 3RRWA 2NW7A 4HGAA 4ZI2D 1YW0A 4IGUA 1MMAA 2YU2A 2YEVC 3MA9A 2C0SA 2LOSA 1QSDA 3K3QC 1UCUA 4UV9B 5LJMA 3VKGA 2K9AA 3N9NA 4EXTA 5JDLA 4TV8E 1MMNA 2L8KA 4I50E 2KMFA 5AFUL 3O9XA 2HH7A 3C4WA 3HKBE 2XAJB 1S35A 3PUAA 3J7Yq 4UXNB 3OKQA 3RYFE 3GWHA 3KINB 5JDNA 3LBXA 3QC9A 5DQWA 4DMVA 4YJ3E 3O1HA 2K5BB 2W61A 3Q5WA 1E1HB 3I9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUN A;  2ODV A;  1OWA A;  1HCI A;  3LBX B;  2ODU A;  3EDV A;  3UUM A;  1WLX A;  3UUL A;  1S35 A;  1QUU A;  3FB2 A;  1U5P A;  3LBX A;  2SPC A;  3UUN A;  3PE0 A;  3F31 A;  1AJ3 A;  1U4Q A; 
#chains in the Genus database with same CATH topology
 2XQ9 A;  3F2E A;  3Q5X A;  2QA7 A;  2ZM8 A;  4H9Q C;  2DWG A;  1D0Y A;  3SS1 A;  2JMK A;  2CCQ A;  2WS3 A;  4M1P A;  3EDU A;  4L5G A;  3KVB A;  2VQE T;  2FJE A;  5HEG A;  4EIW A;  2X9X A;  3RIU A;  1WR6 A;  4TWF A;  2X66 A;  3ZJ2 A;  3AXJ B;  3KV4 A;  4YTP A;  1OED E;  2PFV A;  1IZN B;  3LDQ B;  2WB5 A;  3S4U A;  4ZI7 E;  4N78 D;  4AQF C;  2A2F X;  2WDQ A;  4CI1 B;  2ES0 A;  1ZKE A;  2W00 A;  5CA0 E;  4J2C A;  1T72 A;  1FIO A;  1VOM A;  1US7 B;  4ZS3 A;  1DU2 A;  3SOL A;  5ADX L;  2XQ6 A;  3RQW A;  2XQY A;  4KX6 A;  4X5T A;  3V5S A;  1SA0 E;  2Z6E A;  2OV9 A;  4U2Y A;  1D1C A;  3QK6 A;  4O4I E;  3ZEF B;  2XAG B;  3NKZ A;  2D2S A;  4IT4 A;  2YDR A;  2K3W A;  1ZEE A;  4OYK A;  4MBQ A;  2V7J A;  1NAF A;  2K24 A;  4JI3 T;  4DV7 T;  4NIQ A;  4JI8 T;  3AA6 B;  2WP9 A;  4H9R C;  2CBI A;  3MJX A;  4P1N A;  5H6Q B;  2AXD S;  4HFH A;  1U5P A;  2VWA A;  2X51 A;  1XZY A;  2DHR A;  5DAB A;  3UQ4 A;  2JQK A;  5JDM A;  1MMG A;  2WAU A;  2V8S V;  2CLY C;  4Z8X A;  3QOF A;  4FI5 A;  3C50 A;  3C4Z A;  1WLX A;  4AKR B;  2EHO D;  3GN5 A;  1W0A A;  4LML A;  4X62 T;  2W4X A;  5FY7 A;  3CPZ A;  2I6H A;  4A5X A;  5GON E;  5TAO A;  2BG9 A;  5KMG P;  4HWH A;  2KND A;  4IDQ A;  4B3T T;  1SE7 A;  4EOZ B;  4BAY B;  3AA7 B;  2CLY B;  4Q25 A;  4EYU A;  4HFD A;  4AQY T;  3PUG A;  4E7S A;  4HFB A;  4GYR A;  2FJB A;  5F5W A;  2YK0 A;  4CXY A;  4GK5 E;  4C90 A;  4WBO A;  1BR2 A;  2VUR A;  2G0U A;  4ZXL A;  3AE8 A;  3Q5D A;  2W66 A;  3LK4 2;  2M67 A;  1XMO T;  1HNW T;  5JR9 A;  4V1A v;  3FZH B;  4B3S T;  3HKD E;  5L3E B;  2WDV A;  3BK9 A;  3ZLI A;  4MHC A;  4YY3 T;  3UU6 A;  1KEY A;  4HFV A;  5IUX A;  3CML A;  5JDQ A;  3NRX A;  4MAL A;  2CWO A;  5H6R B;  1FMW A;  2XSB A;  4QHO A;  5LJN A;  2MOZ A;  4H9O C;  4GKJ T;  3X1D A;  3QB5 A;  3IEE A;  3SWH A;  2LJL A;  3CVR A;  2IML A;  5AQT B;  2L9Q A;  2VL0 A;  2WSS V;  4QX7 B;  3RIA A;  4DR1 T;  1SHZ C;  1LVF A;  2KWH A;  1YD8 G;  2XY8 B;  3O1J A;  1IJ6 A;  2ODU A;  5HXC A;  1CHU A;  1BR4 A;  3QNU A;  3L09 A;  5HWY A;  2E8I A;  2LLY A;  2X9Y A;  3UFE A;  4JEU B;  3F57 A;  4ZEY A;  2Y6X A;  3CX6 B;  2A9U A;  2UUC T;  4KUM B;  4HWI B;  2FJD A;  4PK5 A;  3FBL A;  2WWV A;  5J2U E;  4QH5 A;  5J1G A;  1XNQ T;  2BG9 E;  5JRC B;  4IDP A;  3UTK A;  1HCI A;  1LVK A;  5FY0 A;  2YIN A;  1KK7 A;  1MIV A;  1IBM T;  2PG8 A;  4GKK T;  3CQG B;  1UX5 A;  3GMI A;  4X20 E;  3T1H T;  5HXE A;  2BBJ A;  3RGL A;  3P8C D;  3RKO A;  5HXS A;  3N9P A;  1L0V A;  2ZM2 A;  3LFM A;  2X68 A;  2VVS A;  5AQN B;  2LSG A;  4COF A;  2IC6 A;  4X1K E;  2RP4 A;  2XQ5 A;  2FBW A;  2WQY A;  2H7O A;  5JDG A;  5LG3 A;  5L3D B;  2HHH T;  3PJA J;  4XBF B;  4IRE A;  5LB7 B;  4YJ2 E;  2V6Y B;  4LF6 T;  1HX1 B;  2NTY A;  1UX4 A;  2XQ3 A;  3R84 B;  3I0Q A;  2M6B A;  5AQF B;  4CN6 A;  2YU2 A;  2YEV C;  1UCU A;  4JI1 T;  5LJM A;  5HEJ A;  1KNR A;  3UFG A;  4EV6 A;  3RIF A;  3C4W A;  1S35 A;  3PUA A;  3J7Y q;  2YDQ A;  5DQW A;  4DMV A;  3Q5W A;  1E1H B;  3PUV F;  5LA6 E;  4WNK A;  4AI6 A;  4ZS2 A;  4DVD A;  5L2L A;  4AQF A;  3ANW B;  4NPP A;  3VKH A;  4JEH B;  2NR4 A;  2LT3 A;  4IIJ E;  3T8O A;  3ZC0 A;  4X1I E;  1D0Z A;  3HI2 A;  3I0O A;  1OED A;  2FUP A;  4DR5 T;  2LRK A;  4DO0 A;  4X1Y E;  1I6Z A;  2YOE A;  3CX7 B;  5HWX A;  3AA1 B;  3E22 E;  3TLS A;  4IE6 A;  1QUU A;  2WU5 A;  4CI3 B;  1V9D A;  2CM0 A;  3ZT6 A;  5DQV A;  2MPK A;  3PUZ F;  2EHO A;  3PTR B;  5FL0 A;  2V1D B;  2DWK A;  4O8S A;  3V5U A;  2LEH A;  3NZQ A;  2QYW A;  3AAE B;  4X64 T;  4I4T E;  2Q9Q C;  4TWD A;  3OVU A;  4EB6 E;  3NBX X;  2DCF A;  4EED A;  3JAD A;  5IWA T;  3ZC1 A;  5HEH A;  5JVD E;  2IW5 B;  4B6X A;  4MLK A;  4UEL A;  4DV1 T;  1IJ5 A;  4DR7 T;  1D1A A;  4DV0 T;  5FMN A;  3ZYL A;  2CEA A;  4DV4 T;  1Y01 A;  3PUS A;  4UF0 B;  1MNE A;  4YSX A;  4OK0 A;  4E7Z A;  2ODV A;  2LOP A;  4ZZC A;  3EUH A;  2J62 A;  3BQI A;  3OBV E;  4A97 A;  4LMJ A;  3AAA B;  2BZB A;  2Q9Q B;  1J1J A;  1HX8 A;  4DR3 T;  3I1A A;  3CKD A;  3HKE E;  3LSV A;  1UK5 A;  2Q9Q D;  2WMO A;  3FXD B;  3DJB A;  3SRZ A;  1MMD A;  5ABE A;  4UEM A;  3P4S A;  4CXW A;  1T98 A;  2XQ7 A;  3F31 A;  2H3R A;  2JQH A;  3ETV A;  3VR8 A;  2D0U A;  3UT5 E;  2UXC T;  2BS3 A;  2C5K T;  4DUY T;  2CRB A;  3CQC B;  4LF8 T;  4F8H A;  2LSI A;  5IYZ E;  4OFZ A;  4AIU A;  2ACX A;  4DV6 T;  3AE1 A;  1W9R A;  3OYZ A;  4DV5 T;  2C5I T;  3HR0 A;  1NEN A;  4YSZ A;  1FMV A;  4AKI A;  4PJM A;  2VK9 A;  3EAB A;  2NTX A;  4YXD A;  2CXL A;  2BS4 A;  1O3X A;  4IL4 A;  3RHW A;  2NW8 A;  3AVR A;  2AE9 A;  3ZYK A;  4H63 V;  3TLU A;  4ISS A;  2OLT A;  3AEB A;  3OPC A;  2KIN B;  4WZX A;  2YN6 A;  1J5E T;  1AJ3 A;  5ABF A;  2ZMA A;  3TLT A;  4EZH A;  4ZI2 C;  3RYC E;  4IE4 A;  4DBR A;  2LRL A;  2JQ9 A;  3ZT7 A;  5JRC A;  3VHL A;  3L39 A;  4TWH A;  3ZKR A;  4UV8 B;  2NW9 A;  5LBQ B;  4G2A A;  5AQI B;  3AB3 B;  5LCY A;  3UUN A;  2BVM A;  4EGW A;  2CXF A;  3PDY A;  2JJ9 A;  1OWA A;  4QH1 A;  4PK6 A;  3NWI A;  3KFW X;  4NXN T;  3PUR A;  2HN1 A;  4I43 B;  3AE6 A;  4DR4 T;  5AQG B;  3AE9 A;  1WR0 A;  2HN2 A;  3RYH E;  3P4Q A;  4B3R T;  2E2A A;  4AKG A;  2UXX B;  2LSK A;  1KNZ A;  3N9L A;  4TX5 A;  4YHH T;  4ZZB A;  3L8R A;  5BR8 T;  3K3O A;  3N2K E;  4NUU A;  5HXR A;  5AQU B;  2X0L B;  2JQQ A;  1S94 A;  2WZH A;  1I94 T;  1YKH B;  5LBM A;  4ADZ A;  5LGT B;  3TKL B;  2IHR 1;  3U78 A;  5JTG A;  2XAQ B;  4MFR A;  4HEA A;  2F4V T;  2NOX A;  2XQA A;  1QLB A;  3E0Z A;  2D9D A;  2V6X A;  2M6I A;  2OA5 A;  2X9W A;  3UUL A;  2BDE A;  2WDR A;  3AAI A;  2DI4 A;  3NVO A;  2W0G A;  3AA0 B;  4ILU A;  1WYB A;  2X0H A;  3KV5 A;  3ANW A;  3B57 A;  2XPK A;  3AEC A;  3E08 A;  4LFB T;  5JQG E;  5HCJ A;  2BBH A;  4XAX B;  4KP3 C;  5FNV E;  4GOU A;  3IF8 B;  1HG2 A;  1OXZ A;  5FP3 A;  3I9W A;  3VU7 H;  4DBQ A;  5LXT E;  2E5L T;  2KXP B;  3AEA A;  4O4L E;  1WFD A;  2ZLY A;  2VKD A;  3PUW F;  4H9N C;  1T7S A;  2QVA A;  2XJ7 A;  3FB2 A;  2XAS B;  3RRW A;  4HGA A;  1YW0 A;  1MMA A;  1QSD A;  3K3Q C;  4UV9 B;  4U31 A;  3CIR A;  3GWH A;  3QC9 A;  1JNR A;  4YJ3 E;  1YQ3 A;  2K5B B;  1YQ4 A;  3I9Y A;  4HN9 A;  1KF6 A;  3UU5 A;  5ABH A;  4P0A A;  3BQL A;  4UF0 A;  4CI2 B;  5LP6 E;  5DJQ C;  4LF7 T;  1R8I A;  3CK6 A;  3WAJ A;  3ZMV B;  3PUX F;  1XWM A;  4TNW A;  5LHG B;  2Q9Q A;  2IAK A;  4PNI A;  3DP7 A;  2VB6 A;  4IE0 A;  4H63 H;  2BKP A;  2IIU A;  4P0B A;  2H88 A;  3AE2 A;  3A5X A;  2I0M A;  2CA5 A;  5L3C B;  2VKH A;  2MTQ A;  5LNK A;  2ZM6 T;  2XZE A;  4A98 A;  2LKG A;  3BQK A;  1X9B A;  4ANJ A;  2V7I A;  2X67 A;  3ABV A;  2CE7 A;  3P7I A;  4Z91 A;  1KNP A;  3JC6 C;  2HPJ A;  2W67 A;  1Z0P A;  4PAG A;  3WI3 A;  3ZT5 A;  2RPA A;  2VAS A;  2CXD A;  3SFD A;  5LGU B;  3PU8 A;  4AIS A;  2X0Y A;  4YTM A;  3AXJ A;  4P09 A;  3LBX B;  2LHN A;  1E7P A;  4QX8 B;  2QGS A;  4ZHQ E;  1T8B A;  4PW8 A;  4I55 E;  4ASK A;  2R6G F;  4UVA B;  4UVB B;  3JC6 D;  2WWU A;  2C5J A;  2LM2 A;  5AQM B;  1X79 A;  3PUQ A;  5L3G B;  4JI7 T;  3TLV A;  2WMN A;  3EI0 A;  2WM9 A;  1G8X A;  2UU9 T;  4IHJ E;  1LKX A;  2MAW A;  4ILA A;  1SUM B;  3U3I A;  3AEF A;  4DMW A;  4EEB A;  3PV0 F;  1VCS A;  4H9P C;  5FVL A;  3PUY F;  4O2A E;  4QKN A;  3FZF B;  1UUS A;  2PTF A;  4U7I A;  2ACZ A;  3LK3 B;  3ZJ1 A;  3B13 A;  2CWY A;  3P50 A;  4HWF A;  2UUA T;  5CJ5 A;  1NWM X;  2WZI A;  1EZ3 A;  5JRE A;  3UUM A;  2VVN A;  4OX9 T;  3ZPO A;  5LG4 A;  4HFE A;  2XM1 A;  3ZMT B;  4HFC A;  4GK0 E;  2JPF A;  4HE8 A;  4WYV A;  4ZI3 C;  4IDZ A;  3O4X E;  3R6N A;  2IUB A;  5KX5 E;  3N9Q A;  3N9M A;  1HS7 A;  5L47 A;  4YFS A;  4JI5 T;  2FJA A;  3VR9 A;  4U7Y A;  2A3D A;  4PK4 A;  4ILB A;  3H3A A;  3ZSS A;  4JBW F;  3RH3 A;  5FXW A;  3OYX A;  3P4P A;  5HAX A;  1N34 T;  5EK3 A;  4CQI A;  5FY1 A;  3WAK A;  3AE5 A;  4LFC T;  1FEW A;  5LMU T;  5E0O A;  2PBI A;  1Y64 B;  2PJQ A;  2XTL A;  3AED A;  5AQR B;  2Y8D A;  3JAF A;  3RLF F;  4ZI3 D;  3EHZ A;  4DR2 T;  1XDO A;  2CMR A;  2B1E A;  3EVY A;  3RC8 A;  4HKA A;  4YHJ A;  2BVL A;  2DNX A;  2NP9 A;  3GA8 A;  1Z8U A;  3UU8 A;  4DND A;  4AKL A;  3PE0 A;  2D0T A;  1E2A A;  5KDM C;  2Y48 B;  3FZK B;  1MIY A;  5AQS B;  4TV9 E;  2YDS A;  3AE7 A;  2VKO A;  5L3B B;  2V7K A;  4CXX A;  3N9O A;  1M7K A;  5HEO A;  4HFI A;  1N33 T;  5JH7 E;  4JI6 T;  4GIW A;  5F8P A;  4A56 A;  3CX8 B;  2XUE A;  3RX6 A;  1WYC A;  3A7M A;  5JDF A;  3P4W A;  2V5D A;  2RA1 A;  5J2T E;  3K3N A;  5AQQ B;  3OTO T;  1W09 A;  2W63 A;  4H9S E;  3C4X A;  5C8Y E;  3RC3 A;  5LHH B;  2WCA A;  2W62 A;  3ZN0 B;  2E9X C;  4EAH A;  4WBN E;  4KHZ F;  2NWB A;  5CB4 E;  1IAP A;  5AQL B;  4C91 A;  5FXZ A;  5AQO B;  2MBG A;  3FHN A;  4JI0 T;  4PFO A;  4LF5 T;  5EK2 A;  3ZCI A;  3RQU A;  4JUY A;  1FJG T;  5FVK A;  5LGN B;  5FXX A;  1JNZ A;  4UVC B;  3UUX B;  2H89 A;  2HPL A;  2N2N A;  3LG7 A;  4CN4 A;  4OYJ A;  4YT0 A;  1HNZ T;  5L4E A;  2ZM0 A;  2LKH A;  2E9X B;  4I0U A;  1OED C;  4U72 A;  5CGM A;  1CUN A;  5L4H A;  2E9X D;  4DV3 T;  1ZV4 X;  4IE5 A;  2D5U A;  2LSJ A;  4B3M T;  4YLH A;  3HA4 A;  2SPC A;  3FXE B;  4ZOL E;  2EHO C;  4IST A;  2NW7 A;  5ABG A;  4ZI2 D;  2C0S A;  1XDP A;  3TLW A;  3VKG A;  2K9A A;  5JDL A;  2UUB T;  1MMN A;  2L8K A;  2BKO A;  3O9X A;  5AFU L;  4U33 A;  1OED B;  2HH7 A;  1GQE A;  5JDN A;  3LBX A;  5HCM A;  2W61 A;  5F3J A;  4QXH B;  4JI4 T;  3QB5 K;  5CA1 E;  4U3C A;  3D0T A;  3PU3 A;  2JIW A;  2V6Y A;  3J9X 1;  2KLQ A;  2EHO B;  4AKH A;  5FYM A;  3VRB A;  1YKE B;  4KMC A;  3H37 A;  1HF8 A;  4DV2 T;  2N1G A;  4EYY R;  2A72 A;  3CWZ B;  4EZ4 A;  1B7T A;  2J47 A;  2BKN A;  3IA3 A;  3ESL A;  3N5L A;  2UXD T;  4X65 T;  3LK2 B;  5A1L A;  4TN7 B;  4NXM T;  4NUV A;  2CBJ A;  3K1S A;  1LRZ A;  4U2Z A;  1YXR A;  3IBP A;  3AVS A;  3RIU C;  4BA9 A;  3OJA A;  4X66 T;  2LE8 A;  2JMH A;  3A8Y C;  3QUJ A;  4LF9 T;  5LYJ E;  5HYA A;  2GK9 A;  4OHF A;  5CFB A;  2DLR A;  5J0Z A;  2K48 A;  4O4J E;  1VCT A;  1HTJ F;  4K0U A;  4LFA T;  4JV5 T;  4IL9 A;  5AQK B;  3EDV A;  3UU4 A;  1NEK A;  4G63 A;  2V7M A;  4UIG A;  3KBU A;  3C51 A;  4JI2 T;  3W15 B;  5C3J A;  3K8P C;  1XNR T;  4KI0 F;  2L3L A;  1D1B A;  4JLE A;  5EK4 A;  4WW0 A;  4O4H E;  2CHN A;  3JCF A;  2W2U A;  5IHY A;  3UU3 A;  3FZL B;  3AE4 A;  5M4Y A;  4KHP T;  3C98 B;  3MAC A;  5AQP B;  4L9I A;  2I59 A;  5AQJ B;  2P9B A;  3ETU A;  3P4R A;  4DR6 T;  3ONX A;  1HG5 A;  1N36 T;  5JDH A;  2UXN B;  3O1I A;  4TUY E;  3LJC A;  5ABF B;  3ZCJ A;  4LMK A;  3RKG A;  3RF1 A;  2KT9 A;  5AQH B;  4QXC B;  3Q2M A;  3HL6 A;  4IE7 A;  5ETW A;  4KBM B;  3MXZ A;  1BR1 A;  1WRD A;  2KWI B;  4PFP A;  1KFY A;  3ZMZ B;  1UGO A;  3DTO A;  2DL1 A;  3T1Y T;  4IDN A;  2XQ4 A;  4IDO A;  2V7L A;  3ZN1 B;  3MKD A;  4PJN A;  3SFE A;  2IDO B;  2H7V C;  3L3P A;  1IBL T;  4ILC A;  2XHE B;  1UUR A;  4CZZ B;  3PJA A;  2E5V A;  4TNV A;  3AE3 A;  1U4Q A;  2WY2 A;  3KVA A;  2IC9 A;  2BG9 C;  4HWC A;  4ERR A;  3AEG A;  2WBL A;  3MZK B;  1HFA A;  2KSR A;  1ZHC A;  3KV9 A;  1M62 A;  4HTE A;  2V26 A;  3UUB A;  3ZYM A;  2B76 A;  4XZC A;  3N2O A;  5FKY A;  3GN5 B;  1J5W A;  3ZMU B;  4PJL A;  4QH4 A;  3MK7 C;  2CHO A;  3KV6 A;  1ZOY A;  2BG9 B;  5JR9 C;  2LHR A;  4U74 A;  4QWN B;  4DID B;  2J1D G;  3UQ7 A;  3RPU A;  1D0X A;  5LHI B;  3ONJ A;  3IHR A;  4LF4 T;  4FJO A;  1MIW A;  2XSA A;  2JRK A;  4HWD A;  2E9X A;  4PJJ A;  5AQV B;  4BJN A;  4YTN A;  5LOV E;  3FBZ A;  5HEU A;  3ZST A;  4GYS A;  3B5M A;  4L0R A;  3ZMS B;  5BMV E;  2VQF T;  4DUZ T;  2XAH B;  1XMQ T;  5JR9 B;  1G73 A;  2X9H A;  1VRB A;  3H3M A;  3FZM B;  4F6R C;  1H7C A;  3ONL C;  2YKS A;  4UR9 A;  3CQX C;  3G06 A;  2UXB T;  3RI5 A;  1ZP0 A;  4O2B E;  1W0B A;  3NRY A;  5EZY E;  2BS2 A;  2N9D A;  2LSY A;  3Q5E A;  3AEE A;  3M65 A;  4AXP A;  5L3F B;  3VRA A;  2XM2 A;  3RRC A;  1BR0 A;  4TZ4 C;  1IBK T;  3NZP A;  2XQ8 A;  3N2G E;  5LMN T;  3Q9D A;  3EAM A;  2MYS A;  2VKJ A;  4JYA T;  4K0K T;  2YU1 A;  3C64 A;  3HKC E;  2QRX A;  3M3Z B;  3JAE A;  2XAF B;  2KZ7 B;  4AQG A;  5HXH A;  3KBT A;  3RYI E;  5C2T A;  4QXB B;  4BJM A;  2LM9 A;  2VL8 A;  3KDS E;  1HR0 T;  2CPT A;  1MND A;  5FXV A;  5KXJ A;  4YSY A;  4IGU A;  3MA9 A;  2LOS A;  1N32 T;  2J4G A;  3N9N A;  4EXT A;  5FL1 A;  4TV8 E;  4I50 E;  2KMF A;  1WCR A;  3HKB E;  2XAJ B;  4UXN B;  3OKQ A;  3RYF E;  4CN1 A;  1HNX T;  3KIN B;  2V5C A;  3O1H A;  2WU2 A;  4Z90 A; 
#chains in the Genus database with same CATH homology
 5F3J A;  5LA6 E;  4QXH B;  4WNK A;  3F2E A;  4HN9 A;  5CA1 E;  4AI6 A;  3Q5X A;  2QA7 A;  2ZM8 A;  3D0T A;  3PU3 A;  4H9Q C;  4ZS2 A;  3J9X 1;  4DVD A;  4P0A A;  2DWG A;  2KLQ A;  1D0Y A;  3SS1 A;  5L2L A;  2JMK A;  2CCQ A;  2EHO B;  3BQL A;  4M1P A;  3ANW B;  4AQF A;  4AKH A;  4UF0 A;  5FYM A;  3VKH A;  4JEH B;  3EDU A;  1YKE B;  4L5G A;  3KVB A;  4CI2 B;  2LT3 A;  4KMC A;  3H37 A;  5LP6 E;  5DJQ C;  4EIW A;  2X9X A;  1HF8 A;  4IIJ E;  3WAJ A;  3T8O A;  2N1G A;  3ZC0 A;  3ZMV B;  4X1I E;  4EYY R;  2A72 A;  1WR6 A;  5LHG B;  2Q9Q A;  3CWZ B;  4EZ4 A;  2IAK A;  1B7T A;  4PNI A;  3DP7 A;  1D0Z A;  3HI2 A;  2X66 A;  3I0O A;  3ESL A;  3ZJ2 A;  3N5L A;  2VB6 A;  4IE0 A;  4H63 H;  4DO0 A;  4X1Y E;  4P0B A;  3KV4 A;  3CX7 B;  5HWX A;  3LK2 B;  5A1L A;  4TN7 B;  4NUV A;  3AA1 B;  3E22 E;  3A5X A;  4IE6 A;  1QUU A;  2CA5 A;  5L3C B;  2VKH A;  2PFV A;  1IZN B;  1LRZ A;  4CI3 B;  1V9D A;  2CM0 A;  2MTQ A;  5LNK A;  3BQK A;  5DQV A;  4ANJ A;  2V7I A;  2EHO A;  3PTR B;  3S4U A;  4ZI7 E;  2X67 A;  4N78 D;  2CE7 A;  3P7I A;  3JC6 C;  2A2F X;  2V1D B;  4AQF C;  2HPJ A;  1Z0P A;  4PAG A;  4CI1 B;  2ES0 A;  1ZKE A;  2W00 A;  5CA0 E;  2DWK A;  4J2C A;  3WI3 A;  4O8S A;  3V5U A;  3IBP A;  2LEH A;  3NZQ A;  1FIO A;  1VOM A;  3AVS A;  3AAE B;  1US7 B;  4ZS3 A;  4I4T E;  2VAS A;  4BA9 A;  3OJA A;  2Q9Q C;  2LE8 A;  2CXD A;  2JMH A;  2DCF A;  3NBX X;  3SOL A;  4EB6 E;  3ZC1 A;  5LGU B;  5ADX L;  3PU8 A;  3QUJ A;  2XQY A;  4P09 A;  5JVD E;  3LBX B;  2IW5 B;  3V5S A;  2LHN A;  1SA0 E;  4B6X A;  2Z6E A;  4MLK A;  5LYJ E;  5HYA A;  4UEL A;  4QX8 B;  1D1C A;  2GK9 A;  4OHF A;  1IJ5 A;  3QK6 A;  1D1A A;  2DLR A;  4O4I E;  2QGS A;  3ZEF B;  4ZHQ E;  5FMN A;  4PW8 A;  2XAG B;  3ZYL A;  2D2S A;  4I55 E;  2CEA A;  2K48 A;  4O4J E;  3PUS A;  1ZEE A;  4UF0 B;  4ASK A;  1MNE A;  4OYK A;  4UVA B;  4OK0 A;  1HTJ F;  4MBQ A;  4UVB B;  3JC6 D;  2WWU A;  2C5J A;  4K0U A;  4E7Z A;  2ODV A;  2V7J A;  1NAF A;  2K24 A;  2LOP A;  3EUH A;  3BQI A;  3OBV E;  3EDV A;  1X79 A;  3AA6 B;  3PUQ A;  4G63 A;  5L3G B;  3AAA B;  4H9R C;  2V7M A;  2BZB A;  2Q9Q B;  3MJX A;  1HX8 A;  3I1A A;  4UIG A;  3KBU A;  3C51 A;  3W15 B;  5H6Q B;  3CKD A;  3HKE E;  2Q9Q D;  2WMN A;  2WMO A;  3DJB A;  3FXD B;  3K8P C;  3SRZ A;  1MMD A;  2WM9 A;  1G8X A;  4UEM A;  1U5P A;  4IHJ E;  1LKX A;  4CXW A;  1T98 A;  2L3L A;  1D1B A;  2VWA A;  2X51 A;  2H3R A;  3ETV A;  2DHR A;  3F31 A;  4JLE A;  3U3I A;  5DAB A;  2D0U A;  3UT5 E;  5EK4 A;  4DMW A;  4WW0 A;  4O4H E;  5JDM A;  2C5K T;  1MMG A;  2WAU A;  4Z8X A;  2CLY C;  4FI5 A;  4H9P C;  5IHY A;  3CQC B;  3C50 A;  3C4Z A;  1WLX A;  5M4Y A;  4AKR B;  3C98 B;  2LSI A;  3MAC A;  5IYZ E;  4L9I A;  2I59 A;  4O2A E;  4QKN A;  4OFZ A;  2EHO D;  2ACX A;  2P9B A;  3GN5 A;  3ETU A;  3LK3 B;  3OYZ A;  3ZJ1 A;  3ONX A;  1HG5 A;  3B13 A;  5FY7 A;  2CWY A;  3CPZ A;  5JDH A;  2UXN B;  2C5I T;  5GON E;  3HR0 A;  5TAO A;  3O1I A;  4TUY E;  3LJC A;  5KMG P;  2KND A;  1NWM X;  3ZCJ A;  1EZ3 A;  5JRE A;  1FMV A;  3UUM A;  4AKI A;  2KT9 A;  4PJM A;  2VK9 A;  3ZPO A;  5LG4 A;  4QXC B;  3Q2M A;  3HL6 A;  4IE7 A;  2NTX A;  5ETW A;  3ZMT B;  4GK0 E;  2CXL A;  4EOZ B;  2JPF A;  4KBM B;  3MXZ A;  4BAY B;  1O3X A;  3AA7 B;  1BR1 A;  1WRD A;  4HE8 A;  2CLY B;  4ZI3 C;  4IDZ A;  2KWI B;  4PFP A;  4EYU A;  3O4X E;  3R6N A;  3ZMZ B;  3DTO A;  3PUG A;  4E7S A;  5KX5 E;  3N9Q A;  3N9M A;  2NW8 A;  4GYR A;  1HS7 A;  3AVR A;  4YFS A;  2V7L A;  2A3D A;  3ZYK A;  4PK4 A;  2YK0 A;  4CXY A;  4H63 V;  4GK5 E;  4C90 A;  4WBO A;  3ZN1 B;  1BR2 A;  3MKD A;  4ISS A;  4PJN A;  2G0U A;  3H3A A;  2H7V C;  3L3P A;  2KIN B;  3LK4 2;  2M67 A;  2XHE B;  3RH3 A;  4CZZ B;  5FXW A;  5JR9 A;  3OYX A;  4V1A v;  1AJ3 A;  5HAX A;  1U4Q A;  5EK3 A;  2ZMA A;  3HKD E;  2IC9 A;  3KVA A;  5FY1 A;  4CQI A;  4EZH A;  5L3E B;  4ZI2 C;  3WAK A;  3BK9 A;  3RYC E;  4IE4 A;  2WBL A;  4DBR A;  4ERR A;  3ZLI A;  3MZK B;  1FEW A;  1HFA A;  4MHC A;  5E0O A;  1ZHC A;  2PBI A;  1Y64 B;  2PJQ A;  3KV9 A;  4HTE A;  2V26 A;  5JRC A;  2XTL A;  4HFV A;  2Y8D A;  3VHL A;  3CML A;  5JDQ A;  4ZI3 D;  4UV8 B;  3ZYM A;  2NW9 A;  3NRX A;  5LBQ B;  4G2A A;  4MAL A;  2CWO A;  3AB3 B;  2CMR A;  5H6R B;  5LCY A;  1FMW A;  3UUN A;  2BVM A;  2B1E A;  4XZC A;  2CXF A;  3PDY A;  2JJ9 A;  4QHO A;  3N2O A;  3GN5 B;  5LJN A;  1OWA A;  3EVY A;  4PK6 A;  2MOZ A;  3RC8 A;  3KFW X;  4H9O C;  4HKA A;  4YHJ A;  3PUR A;  3IEE A;  3ZMU B;  4I43 B;  2BVL A;  2DNX A;  4PJL A;  3SWH A;  2LJL A;  3CVR A;  2NP9 A;  3GA8 A;  3MK7 C;  2L9Q A;  4DND A;  3KV6 A;  2WSS V;  4QX7 B;  5JR9 C;  2LHR A;  4U74 A;  4QWN B;  4AKL A;  1SHZ C;  3PE0 A;  2D0T A;  2J1D G;  5KDM C;  1LVF A;  3RPU A;  1D0X A;  3RYH E;  2KWH A;  2Y48 B;  5LHI B;  1YD8 G;  3IHR A;  3O1J A;  1IJ6 A;  2ODU A;  5HXC A;  1BR4 A;  1MIY A;  3L09 A;  5HWY A;  4AKG A;  2UXX B;  2LSK A;  2E8I A;  1KNZ A;  3N9L A;  4FJO A;  1MIW A;  4TX5 A;  2X9Y A;  4TV9 E;  3UFE A;  4JEU B;  2JRK A;  3F57 A;  2E9X A;  3K3O A;  3N2K E;  4PJJ A;  4NUU A;  2VKO A;  5HXR A;  4BJN A;  5LOV E;  2Y6X A;  2X0L B;  2JQQ A;  1S94 A;  3CX6 B;  5L3B B;  3FBZ A;  2V7K A;  1YKH B;  4CXX A;  5LBM A;  4GYS A;  4ADZ A;  4L0R A;  5LGT B;  3ZMS B;  5BMV E;  3N9O A;  3TKL B;  2XAH B;  4KUM B;  5JR9 B;  1G73 A;  3U78 A;  5JH7 E;  4GIW A;  5F8P A;  2X9H A;  4A56 A;  1VRB A;  2XAQ B;  3CX8 B;  4MFR A;  4PK5 A;  3FBL A;  2XUE A;  4HEA A;  3RX6 A;  1WYC A;  5J2U E;  5JDF A;  4F6R C;  1H7C A;  2NOX A;  2RA1 A;  5J1G A;  5J2T E;  3K3N A;  5JRC B;  3E0Z A;  3CQX C;  2W63 A;  4H9S E;  3UTK A;  3C4X A;  5C8Y E;  3RC3 A;  5LHH B;  1HCI A;  4O2B E;  1LVK A;  5FY0 A;  2W62 A;  2YIN A;  2OA5 A;  3ZN0 B;  1KK7 A;  2E9X C;  3NRY A;  1MIV A;  5EZY E;  4EAH A;  4WBN E;  2PG8 A;  2N9D A;  2NWB A;  2X9W A;  2LSY A;  3CQG B;  3UUL A;  2BDE A;  5CB4 E;  1IAP A;  3AAI A;  3M65 A;  4AXP A;  2DI4 A;  4C91 A;  2W0G A;  3AA0 B;  5L3F B;  5FXZ A;  4ILU A;  2MBG A;  1UX5 A;  1WYB A;  3FHN A;  3GMI A;  3RRC A;  1BR0 A;  4TZ4 C;  4X20 E;  5HXE A;  3KV5 A;  3ANW A;  3B57 A;  4PFO A;  3NZP A;  3P8C D;  3RKO A;  5HXS A;  5EK2 A;  3ZCI A;  3N9P A;  2ZM2 A;  3LFM A;  4JUY A;  5LGN B;  2X68 A;  5FXX A;  3E08 A;  3N2G E;  4UVC B;  3Q9D A;  3UUX B;  5JQG E;  2MYS A;  4XAX B;  2HPL A;  4KP3 C;  2LSG A;  2N2N A;  2VKJ A;  5FNV E;  4GOU A;  3LG7 A;  2YU1 A;  3C64 A;  3HKC E;  3IF8 B;  4OYJ A;  1HG2 A;  2IC6 A;  2XAF B;  1OXZ A;  2ZM0 A;  2KZ7 B;  4X1K E;  2E9X B;  2RP4 A;  4U72 A;  1CUN A;  4AQG A;  5FP3 A;  3I9W A;  2E9X D;  2H7O A;  5HXH A;  3VU7 H;  4DBQ A;  5LXT E;  5JDG A;  3KBT A;  5L3D B;  2KXP B;  1ZV4 X;  3RYI E;  4IE5 A;  4O4L E;  4XBF B;  2D5U A;  2ZLY A;  4H9N C;  2VKD A;  2LSJ A;  4QXB B;  4BJM A;  4YJ2 E;  2LM9 A;  2VL8 A;  3KDS E;  4YLH A;  2NTY A;  3HA4 A;  3FB2 A;  2SPC A;  1UX4 A;  3FXE B;  2XAS B;  4ZOL E;  2EHO C;  1MND A;  4IST A;  3I0Q A;  5FXV A;  3R84 B;  3RRW A;  2NW7 A;  4HGA A;  4ZI2 D;  1YW0 A;  4IGU A;  1MMA A;  2YU2 A;  2YEV C;  3MA9 A;  2C0S A;  2LOS A;  1QSD A;  3K3Q C;  1UCU A;  4UV9 B;  5LJM A;  3VKG A;  2K9A A;  3N9N A;  4EXT A;  5JDL A;  4TV8 E;  1MMN A;  2L8K A;  4I50 E;  2KMF A;  5AFU L;  3O9X A;  2HH7 A;  3C4W A;  3HKB E;  2XAJ B;  1S35 A;  3PUA A;  3J7Y q;  4UXN B;  3OKQ A;  3RYF E;  3GWH A;  3KIN B;  5JDN A;  3LBX A;  3QC9 A;  5DQW A;  4DMV A;  4YJ3 E;  3O1H A;  2K5B B;  2W61 A;  3Q5W A;  1E1H B;  3I9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...