3UULA

Crystal structure of first n-terminal utrophin spectrin repeat
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
115
structure length
115
Chain Sequence
DLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELSAHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALMELQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords utrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Rattus norvegicus
total genus 53
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uulA00
2SPCA 3FB2A 3PE0A 1U4QA 3UUNA 3F31A 3EDVA 3LBXA 1OWAA 2ODUA 1WLXA 3LBXB 3UULA 2ODVA 1QUUA 1HCIA 3UUMA 1S35A 1AJ3A 1CUNA 1U5PA
chains in the Genus database with same CATH superfamily
3N2KE 2VK9A 1T98A 3QNUA 2X0LB 3QC9A 5LHIB 4G63A 5LBQB 3PUWF 3C4XA 3UUMA 5HAXA 1MMNA 4ZS2A 4YLHA 3N9MA 5BMVE 2V7IA 5AQUB 3BQKA 2XZEA 1WFDA 4EIWA 2XQYA 2XAHB 2E5LT 3SOLA 4DV7T 3B57A 4IE6A 3OTOT 4AQGA 4ADZA 1D1BA 4K0UA 4C90A 3RYHE 4XAXB 2I0MA 4I50E 4IE7A 1YKHB 4ZI7E 2ODVA 3PJAA 2JRKA 3ZC0A 4WW0A 3UQ7A 3AEFA 2LKHA 4UXNB 4LFBT 5HXSA 2LOPA 3RIAA 4JEHB 4PJNA 4WZXA 3UTKA 1QSDA 2E8IA 4DVDA 2MTQA 3I0OA 2H89A 1OEDE 5CB4E 2B76A 3CX6B 4HWIB 2QVAA 3EAMA 5LHGB 3ZT5A 5FY7A 1YQ4A 3RHWA 4GIWA 4FI5A 4U7YA 2BDEA 1EZ3A 3P4SA 3C50A 3LSVA 4DR1T 2JMHA 3Q9DA 3AE7A 3ZSSA 5KMGP 4O2AE 2LM2A 2X51A 1KNPA 4COFA 4DNDA 2CXDA 1NWMX 1UX5A 2BZBA 2C5JA 2L8KA 2ZM2A 2W4XA 5C3JA 5AQNB 3RI5A 2YK0A 4HFCA 5L3BB 1WRDA 4JYAT 2BVMA 3C64A 5ADXL 4JI8T 3TLVA 2LKGA 3UULA 4PFPA 3PUQA 3IBPA 5KX5E 3D0TA 1G8XA 4YJ3E 1MMDA 4AKIA 1ZHCA 4O4LE 2WB5A 5JR9C 2E2AA 5L3DB 5IHYA 2IDOB 4KI0F 2A2FX 3CX7B 4HWCA 1XMOT 4EXTA 4YSZA 3UUBA 3UFGA 1D0YA 3RH3A 2CBIA 3PTRB 5DABA 4WYVA 3MJXA 1BR1A 3HL6A 2CEAA 2ACZA 4EZHA 1T7SA 1W09A 3PUYF 5JRCB 2WBLA 2XHEB 2V6YA 2MPKA 3RQUA 3H3MA 5F8PA 5M4YA 4L9IA 4NUUA 4DV0T 4UVBB 4HWFA 3PJAJ 3HKCE 4B3MT 2W62A 3CX8B 4PK6A 2ZM0A 3N9NA 5LOVE 3PURA 3FBZA 4U33A 5FMNA 3QOFA 2I59A 3EI0A 5HEOA 1UURA 5AQIB 3ESLA 3IA3A 2RP4A 3AEBA 1IBKT 2VL0A 4IHJE 3KV5A 2X68A 4IIJE 4UEMA 4CI1B 2UUCT 5LG4A 2ZLYA 4TV8E 5JR9A 2NW7A 2LM9A 5JR9B 3NBXX 2YU2A 4UVCB 3RKOA 4I55E 3ZN0B 2CPTA 4QH4A 4ZI3C 3F2EA 3AB3B 2CRBA 4ZS3A 5LP6E 4O4JE 4H63H 4P0BA 4JV5T 4HFBA 3RX6A 5L2LA 3AE5A 2WZHA 3K3OA 4NUVA 1MIVA 4V1Av 4HFHA 1OXZA 4EOZB 2XAGB 4HWDA 2DNXA 3LBXA 4X1KE 2PG8A 3LBXB 2WCAA 3SFDA 3CWZB 4EV6A 2UUAT 3HI2A 5LYJE 2QA7A 3FXEB 4ILCA 5HXHA 4O4IE 3WI3A 1D1CA 5L3GB 4PJLA 3KBTA 3LJCA 4PFOA 4HFEA 4JI0T 4KP3C 3SFEA 2C5IT 4CN1A 3ZKRA 4OHFA 5E0OA 1HNXT 4YFSA 5FY0A 3V5UA 4DUZT 2E9XC 4Q25A 3PUSA 2WDQA 2ZMAA 4YHHT 4L5GA 2KZ7B 2XM1A 3OJAA 4LF9T 5AQRB 3J9X1 4B3ST 5JDQA 3E08A 4U2YA 1UK5A 3NWIA 2IHR1 3VKGA 4X5TA 2PTFA 4EYYR 1DU2A 3AEEA 1QLBA 2LE8A 3AXJA 3UUNA 2VVSA 2K48A 3T8OA 2MOZA 5HEUA 5HXCA 2V5DA 3RC3A 4DV4T 5LA6E 5LGNB 5KDMC 5AQSB 3RYFE 3V5SA 1CUNA 3I1AA 4UF0A 3PUGA 2E5VA 4QXHB 2UUBT 4JEUB 4UF0B 3FZHB 3KV9A 4YXDA 2DWKA 3ZJ1A 5FL1A 4P09A 2KLQA 2LSGA 4LMKA 2XSBA 2D0TA 4KMCA 3ZYKA 3AEDA 3VHLA 3P4RA 2CXLA 5J2TE 2VASA 4F6RC 3LFMA 4H9NC 3AAAB 4L0RA 4LF6T 2K9AA 1IBLT 4MBQA 1FJGT 5ABHA 5C8YE 1ZOYA 2XQ3A 3R6NA 3ZMZB 4YHJA 3ZYMA 4K0KT 4AIUA 2W66A 3VKHA 3B5MA 1U4QA 2NTXA 4IDPA 4PJJA 2XTLA 2DI4A 3O1HA 3Q5DA 5HXRA 4AQYT 4LF7T 2E9XD 4KUMB 3EDUA 2G0UA 1D1AA 2FJDA 3PU8A 5J2UE 2XM2A 4CXYA 3P4PA 3SS1A 3OYZA 2CBJA 5FVKA 4B3RT 1W0BA 5JH7E 2BKNA 5AQFB 1IZNB 2LSJA 4U31A 1HNZT 2R6GF 5JDFA 2GK9A 4UV8B 2VKHA 3SRZA 4F8HA 3H3AA 3TKLB 4FJOA 3ZPOA 3AE9A 3G06A 2FBWA 2UXXB 3RRCA 3RLFF 5JVDE 1Y64B 2XY8B 2VQFT 3CVRA 4OK0A 4ZZBA 5JQGE 1HFAA 2LSKA 4UVAB 1L0VA 1AJ3A 3ONJA 5AQQB 4HTEA 3R84B 4WBNE 2KWIB 2CHOA 5ETWA 3C4ZA 2V7MA 2HHHT 5LCYA 2Q9QC 2XAQB 3H37A 4HFDA 2VKJA 2X0HA 1HCIA 3RIUC 5HWYA 2WQYA 3MKDA 3ANWA 1MIYA 4A98A 3ANWB 3KV6A 4ZHQE 1IJ5A 2V7JA 2KINB 2W0GA 3CKDA 3CQCB 2OLTA 1LVFA 3QK6A 3VRBA 4DBQA 4IE4A 5DQVA 4TN7B 4CXXA 5LBMA 3SWHA 2WWVA 4EAHA 3N9PA 1FEWA 3RC8A 3RYIE 2V5CA 3OYXA 1Z0PA 2BS4A 2PFVA 1NENA 5C2TA 1N34T 2KWHA 3NZQA 4QX7B 3PUZF 4AI6A 4M1PA 1SE7A 5CA1E 2M67A 3AVRA 5EZYE 5CFBA 4ILUA 4ZI2C 3AE1A 3N9QA 1CHUA 2D5UA 5FXWA 3ZC1A 4TNVA 2K24A 2DL1A 2D0UA 1H7CA 5L3CB 4OX9T 5L47A 1V9DA 1LKXA 2Q9QA 2J62A 3NZPA 3FHNA 2Q9QB 1YXRA 2YDSA 3L09A 4HEAA 4OYKA 3CIRA 3RIUA 4JI1T 4DIDB 4DR4T 4H9RC 2WY2A 2LEHA 4XZCA 5F3JA 2KNDA 3Q5EA 3PDYA 3IEEA 2CCQA 3NRXA 4DR7T 2CMRA 2Q9QD 4HWHA 4ZZCA 2LRLA 5IWAT 5LGUB 4MALA 4I0UA 3N9OA 3RPUA 4ASKA 3LDQB 1OWAA 1VCSA 5AQHB 5J1GA 1W0AA 2WSSV 1ZV4X 5AQOB 2VQET 4N78D 1HG2A 3BQIA 2V7LA 4EYUA 3GWHA 4DV5T 2IAKA 3CPZA 3RKGA 2AXDS 2BBJA 1SA0E 5ABFA 2H88A 2WM9A 4YTPA 1S94A 2WAUA 5ABFB 2QYWA 4JI7T 2WMOA 2RA1A 2IC9A 4BJMA 3ZJ2A 2LT3A 4ZI2D 3AA1B 2X66A 2UXBT 1XDPA 1HNWT 4YSXA 4JBWF 5JDNA 2LHRA 5HCJA 3L39A 2BKOA 5LXTE 4IREA 3Q5XA 2V6YB 4A56A 2ZM8A 3LG7A 3OPCA 2WU5A 3RGLA 1J5WA 2XQ9A 3TLSA 3VR9A 3PUXF 4G2AA 4YT0A 4JI6T 4DMWA 2CXFA 2IC6A 3BQLA 4IL9A 1Z8UA 5LJNA 4LF5T 2SPCA 3CMLA 1MNEA 2MAWA 5LB7B 5L3FB 2NW9A 5FXVA 2BG9C 2LJLA 5DQWA 1GQEA 5AQJB 3AAEB 1U5PA 3LK2B 4AKRB 4BAYB 2YEVC 3KDSE 2HN2A 1YD8G 2XUEA 1KFYA 3KINB 4J2CA 3C51A 3UFEA 5HYAA 3EHZA 2OV9A 2X9HA 2A9UA 3P4WA 4JI3T 5J0ZA 2CLYC 5CGMA 2NWBA 4O2BE 2MBGA 4QWNB 2XQAA 2J1DG 3ZMVB 3FB2A 3AEGA 4U3CA 4HFVA 3N2OA 1ZEEA 4I4TE 1HF8A 1WR0A 3DJBA 4LMJA 4CQIA 4XBFB 1XWMA 4JI2T 3T1HT 2ACXA 2V7KA 2D9DA 4GOUA 5EK4A 3NKZA 3ZEFB 2K3WA 4E7ZA 4ANJA 3MXZA 4LF4T 1SUMB 3E0ZA 5LG3A 3KVAA 4A5XA 1D0XA 3ONXA 1E2AA 1X79A 2BG9A 3AE4A 1BR4A 4DR5T 3RRWA 2BG9B 2JQQA 4EZ4A 4BA9A 3VR8A 5A1LA 3PE0A 1KNRA 4Z90A 4ILAA 3PU3A 2L9QA 3IHRA 2YDRA 4JI4T 4NXNT 3C98B 2IW5B 2JIWA 1HG5A 5ABGA 2CLYB 2X9YA 4NIQA 5FKYA 4E7SA 5AQTB 3LK42 3UU8A 3DP7A 2FJEA 3AXJB 1MIWA 3C4WA 4MFRA 4GKJT 2V1DB 1QUUA 2XQ7A 1WYCA 2EHOC 2LSYA 2JQ9A 4Z91A 5FP3A 1LRZA 2YDQA 1YW0A 3K3NA 3JAFA 2DHRA 3E22E 2BS2A 5IUXA 3AA7B 3KV4A 4H9SE 2QRXA 3T1YT 4B6XA 2HH7A 2D2SA 4QKNA 4DV1T 3FXDB 1VCTA 2WDVA 2P9BA 1KEYA 3A7MA 5FYMA 4ZOLE 4HE8A 2RPAA 5FL0A 4DV6T 2E9XA 2E9XB 1HX1B 4QXBB 2Y48B 4CN6A 4UIGA 3N2GE 3U3IA 1UGOA 4AXPA 1O3XA 5JDHA 1J1JA 3OVUA 3ZN1B 2NOXA 3NVOA 1XDOA 3GN5A 4H9OC 3O1JA 1OEDC 2N1GA 3RIFA 3GN5B 2NR4A 2KXPB 2JJ9A 2LRKA 2BBHA 2EHOA 4P0AA 4IE0A 2EHOB 5LNKA 5AQLB 3UQ4A 5JDMA 5LGTB 5H6RB 3JC6C 3WAKA 2JQKA 2B1EA 1MMAA 4OFZA 4OYJA 1HX8A 3CQGB 1BR0A 3UU6A 3UU5A 2X9WA 3GMIA 3UU3A 2EHOD 2F4VT 3J7Yq 2HN1A 4AKHA 3ETVA 4YTMA 1HTJF 2VWAA 5L4EA 3P7IA 4WBOA 4YSYA 3ZYLA 2NP9A 3OBVE 1N36T 2N2NA 2IIUA 4X1YE 4O4HE 1XMQT 2VB6A 4GK0E 2BS3A 2UXNB 2I6HA 2YN6A 2WWUA 3FZMB 4QXCB 4CN4A 2WMNA 1XNRT 2XAJB 4X1IE 5AQPB 4EEBA 2UXDT 1OEDA 3I9YA 3ZT7A 5L3EB 2XQ4A 1VOMA 1ZKEA 3MA9A 1OEDB 2L3LA 4B3TT 4LF8T 4ISSA 5HEJA 2HPJA 4JUYA 3W15B 1N33T 4X66T 3O9XA 5JTGA 3AVSA 5HCMA 3MACA 2W63A 2V6XA 3A8YC 4IT4A 1FIOA 2AE9A 3TLUA 3QB5K 2Y8DA 1ZP0A 3PUAA 4CI2B 4MLKA 2CWOA 3S4UA 4AISA 3AECA 4QH5A 3JC6D 1WYBA 2JPFA 2WP9A 4IE5A 1IBMT 2IMLA 3IF8B 2WS3A 4H63V 4TUYE 3ZT6A 4IDQA 1E7PA 4Z8XA 1E1HB 4PK4A 2VL8A 3U78A 1NEKA 2DLRA 1N32T 2X9XA 2BVLA 3HA4A 4TWDA 3CQXC 3AA0B 1I6ZA 4IDOA 2XSAA 2X67A 3I9WA 5JDLA 4NXMT 2K5BB 1YQ3A 3BK9A 5AQMB 3VU7H 3QUJA 5L4HA 2X0YA 2CM0A 3PUVF 2N9DA 2W2UA 2VKDA 3ZMSB 2VKOA 3A5XA 5EK2A 2MYSA 1J5ET 3ZCJA 5FXXA 2ES0A 4PNIA 3HKEE 3RQWA 1R8IA 1M62A 5FXZA 3O1IA 2XQ6A 2ZM6T 2WU2A 2BKPA 3AEAA 1XZYA 4CZZB 4IDNA 1X9BA 4QX8B 4UR9A 4PJMA 5F5WA 4KHZF 4TWHA 3Q2MA 1MMGA 4H9QC 4KHPT 2C5KT 5BR8T 2J4GA 3AE8A 4X20E 1UUSA 1UX4A 2PJQA 4TV9E 1NAFA 1HR0T 4DR6T 2FUPA 4DV3T 5HXEA 2JQHA 3O4XE 4H9PC 4YTNA 3FZKB 5HEGA 3ZSTA 4QH1A 4PW8A 1W9RA 4NPPA 4U72A 4I43B 1T8BA 1I94T 4WNKA 4DUYT 3ONLC 4DR3T 3I0QA 5LJMA 2M6BA 2UXCT 4ZXLA 3VRAA 5JDGA 1VRBA 4GK5E 1UCUA 2CA5A 2KSRA 5KXJA 2VURA 3Q5WA 3P4QA 4DO0A 4X64T 3GA8A 1FMWA 5JRCA 3EUHA 2YU1A 3P50A 2OA5A 4AKLA 4LFAT 2XPKA 2KT9A 1LVKA 4AQFC 5TAOA 4LMLA 3JADA 4JI5T 3HKBE 2WDRA 3KFWX 1HS7A 1MNDA 3B13A 1KF6A 3FZFB 4EGWA 4ERRA 2LSIA 3F57A 2YINA 3N5LA 3RYCE 3L3PA 4CI3B 2Y6XA 3LK3B 1BR2A 1JNRA 3K1SA 4ILBA 2YKSA 5H6QB 4TZ4C 4U74A 3CK6A 3AAIA 3N9LA 3QB5A 4DBRA 2CWYA 4X62T 3AE6A 1B7TA 3M3ZB 3ZCIA 1XNQT 2H7VC 2PBIA 3MZKB 4TNWA 4IGUA 4HKAA 2CE7A 3KVBA 3WAJA 2C0SA 4DR2T 5AQKB 5IYZE 4DV2T 3OKQA 4IL4A 4AQFA 5GONE 4JLEA 2CHNA 2LLYA 4MHCA 4AKGA 3DTOA 3ZLIA 2WZIA 4UELA 3PV0F 5JREA 2DCFA 3EABA 4EEDA 3ZMUB 1YKEB 4PK5A 5DJQC 3UUXB 3ZMTB 2ODUA 2NTYA 4YY3T 1IAPA 1Y01A 1WCRA 4YJ2E 5HWXA 2H7OA 4TX5A 4HFIA 5ABEA 4ZEYA 2V8SV 5LMNT 1M7KA 3M65A 1G73A 5LMUT 3F31A 4BJNA 3EDVA 1WR6A 1US7B 5CA0E 4EB6E 3JCFA 4KBMB 4HGAA 2XQ5A 3AA6B 2FJBA 2J47A 4PAGA 3MK7C 4ZI3D 2XASB 2KMFA 4QHOA 4U7IA 1S35A 2A3DA 2QGSA 4ISTA 2HPLA 3JAEA 4U2ZA 2XJ7A 3FZLB 3K8PC 2BG9E 2XAFB 2M6IA 2IUBA 5AFUL 3UT5E 3RF1A 2W61A 3KBUA 1JNZA 2JMKA 5FVLA 4GYSA 3AE3A 4IDZA 4GYRA 3TLTA 2XQ8A 5EK3A 3P8CD 2Z6EA 4TWFA 3HR0A 3FBLA 4LFCT 4A97A 1WLXA 5HEHA 5FY1A 3UU4A 2W00A 5LHHB 4KX6A 2VVNA 2LOSA 2W67A 1D0ZA 2DWGA 5CJ5A 4C91A 3ABVA 3K3QC 2A72A 2H3RA 3NRYA 4O8SA 4P1NA 1FMVA 3TLWA 4GKKT 3L8RA 1KK7A 1SHZC 3EVYA 2LHNA 3ETUA 2UU9T 2FJAA 1T72A 3HKDE 3X1DA 2YOEA 4CXWA 4DMVA 1KNZA 2NW8A 4HN9A 2V26A 4X65T 5AQGB 3AE2A 1IJ6A 4UV9B 5AQVB 5FNVE
chains in the Genus database with same CATH topology
3N2KE 2DWKA 4QX8B 1YD8G 2XUEA 2VK9A 4PJMA 1T98A 3KINB 4J2CA 2X0LB 3C51A 3QC9A 3UFEA 5HYAA 3ZJ1A 3Q2MA 1MMGA 5LHIB 4G63A 2X9HA 4H9QC 5LBQB 4P09A 2CLYC 3C4XA 2NWBA 3UUMA 2KLQA 2LSGA 4O2BE 5HAXA 1MMNA 4ZS2A 2C5KT 2MBGA 4YLHA 2D0TA 4QWNB 4KMCA 3ZYKA 4X20E 3N9MA 3VHLA 5BMVE 2J1DG 5J2TE 2CXLA 1UX4A 3ZMVB 2PJQA 3FB2A 2V7IA 4TV9E 1NAFA 3BQKA 4HFVA 2VASA 3N2OA 4EIWA 3LFMA 4F6RC 2XQYA 1ZEEA 4I4TE 4H9NC 3AAAB 2XAHB 4L0RA 5HXEA 1HF8A 2K9AA 3SOLA 3DJBA 3O4XE 3B57A 4H9PC 4MBQA 4CQIA 4XBFB 4IE6A 5C8YE 2ACXA 4AQGA 2V7KA 4PW8A 4ADZA 1D1BA 4K0UA 3R6NA 3ZMZB 4YHJA 4GOUA 4U72A 4C90A 5EK4A 3ZYMA 4I43B 3RYHE 3ZEFB 3VKHA 4XAXB 1U4QA 4E7ZA 4WNKA 4ANJA 2NTXA 4I50E 4IE7A 3MXZA 1YKHB 4PJJA 2XTLA 2DI4A 3O1HA 3I0QA 3E0ZA 4ZI7E 5LJMA 2ODVA 5HXRA 3KVAA 2E9XD 1D0XA 4KUMB 3ONXA 5JDGA 1X79A 2JRKA 1VRBA 3EDUA 4GK5E 1BR4A 2G0UA 1UCUA 1D1AA 4WW0A 3RRWA 3ZC0A 2CA5A 2JQQA 4UXNB 3PU8A 4EZ4A 5J2UE 5HXSA 4CXYA 4BA9A 2LOPA 5A1LA 3PE0A 3SS1A 3OYZA 3Q5WA 4JEHB 4PJNA 4DO0A 3PU3A 3GA8A 2L9QA 5JH7E 1FMWA 5JRCA 3EUHA 2YU1A 3IHRA 1QSDA 2E8IA 1IZNB 3UTKA 4DVDA 2MTQA 3I0OA 2OA5A 4AKLA 2LSJA 5CB4E 2KT9A 1LVKA 3C98B 3CX6B 5TAOA 4AQFC 2IW5B 1HG5A 2CLYB 2X9YA 4E7SA 5JDFA 2GK9A 5LHGB 3LK42 3HKBE 3KFWX 1HS7A 3DP7A 4UV8B 5FY7A 2VKHA 3SRZA 1MNDA 1MIWA 3C4WA 3B13A 4GIWA 4MFRA 4FI5A 3H3AA 2BDEA 1EZ3A 3C50A 2V1DB 1QUUA 4ERRA 2JMHA 2LSIA 1WYCA 2EHOC 3F57A 3Q9DA 4FJOA 3TKLB 2YINA 2LSYA 5KMGP 3ZPOA 5FP3A 1LRZA 4O2AE 3N5LA 1YW0A 3RYCE 2UXXB 2X51A 3L3PA 3RRCA 3K3NA 4CI3B 2Y6XA 3LK3B 1Y64B 5JVDE 1BR2A 2DHRA 3E22E 3CVRA 4OK0A 4DNDA 5H6QB 2CXDA 1NWMX 4TZ4C 3AA7B 1UX5A 2BZBA 2C5JA 2L8KA 3KV4A 4U74A 5JQGE 1HFAA 2LSKA 2ZM2A 4UVAB 4H9SE 3AAIA 4B6XA 3N9LA 1AJ3A 2HH7A 2YK0A 4HTEA 3R84B 4WBNE 2D2SA 4DBRA 4QKNA 2CWYA 2KWIB 1B7TA 5L3BB 3ZCIA 3FXDB 1WRDA 5ETWA 3C4ZA 2BVMA 2V7MA 3C64A 2P9BA 5ADXL 5FYMA 4ZOLE 4HE8A 5LCYA 2Q9QC 2XAQB 3H37A 2VKJA 3UULA 2H7VC 2E9XA 4PFPA 3PUQA 2PBIA 3MZKB 1HCIA 4IGUA 4HKAA 2CE7A 2E9XB 3KVBA 5HWYA 3IBPA 3MKDA 5KX5E 4QXBB 2Y48B 3ANWA 3WAJA 2C0SA 1MIYA 3D0TA 1G8XA 4YJ3E 4UIGA 1MMDA 3ANWB 3KV6A 1ZHCA 5IYZE 4ZHQE 4AKIA 4O4LE 1IJ5A 3N2GE 5JR9C 2V7JA 3OKQA 5L3DB 5IHYA 3U3IA 4AQFA 2KINB 5GONE 4JLEA 2W0GA 3CKDA 3CQCB 1LVFA 4AXPA 2A2FX 1O3XA 5JDHA 3CX7B 4MHCA 3QK6A 4AKGA 3DTOA 3ZN1B 3ZLIA 2NOXA 4DBQA 4IE4A 3GN5A 4H9OC 3O1JA 4TN7B 2N1GA 5DQVA 5LBMA 3SWHA 4CXXA 4EXTA 4UELA 3GN5B 4EAHA 3N9PA 1FEWA 2KXPB 2JJ9A 1D0YA 2EHOA 5JREA 4P0AA 3RC8A 3RH3A 3RYIE 2DCFA 3OYXA 1Z0PA 4IE0A 2EHOB 3PTRB 2PFVA 5LNKA 5DABA 5JDMA 3ZMUB 3MJXA 1YKEB 2KWHA 1BR1A 3NZQA 4QX7B 4PK5A 5LGTB 5DJQC 3HL6A 5H6RB 3JC6C 3UUXB 2ODUA 2NTYA 3ZMTB 4AI6A 3WAKA 4M1PA 5CA1E 1IAPA 2M67A 2CEAA 3AVRA 2B1EA 5EZYE 4EZHA 4YJ2E 4ILUA 4ZI2C 5HWXA 2H7OA 1MMAA 5JRCB 4TX5A 2WBLA 3N9QA 2XHEB 4OFZA 4OYJA 1HX8A 3CQGB 1BR0A 5F8PA 2D5UA 4L9IA 4NUUA 2X9WA 4UVBB 5FXWA 5M4YA 3GMIA 3HKCE 3ZC1A 3M65A 1G73A 2EHOD 2K24A 2W62A 3CX8B 4PK6A 3F31A 2ZM0A 4BJNA 3N9NA 3EDVA 2D0UA 5LOVE 3PURA 3J7Yq 3FBZA 1H7CA 1WR6A 5FMNA 5L3CB 3ETVA 4AKHA 2I59A 1V9DA 1US7B 1HTJF 1LKXA 2VWAA 2Q9QA 5CA0E 4EB6E 3NZPA 3P7IA 4KBMB 4WBOA 3FHNA 2Q9QB 4HGAA 3ESLA 2RP4A 3L09A 3ZYLA 4HEAA 4OYKA 3AA6B 2NP9A 3OBVE 2N2NA 4X1YE 4IHJE 3KV5A 2X68A 4PAGA 4IIJE 4O4HE 4H9RC 4UEMA 2VB6A 4CI1B 2LEHA 4GK0E 2UXNB 4XZCA 5F3JA 2KNDA 3MK7C 5LG4A 2ZLYA 2WWUA 4TV8E 4QXCB 2WMNA 4ZI3D 5JR9A 2XASB 2KMFA 3PDYA 2NW7A 2LM9A 4QHOA 5JR9B 3NBXX 2XAJB 1S35A 2YU2A 4UVCB 3IEEA 4X1IE 2CCQA 3NRXA 2CMRA 3RKOA 2A3DA 4I55E 2Q9QD 2QGSA 3ZN0B 4ISTA 4ZI3C 3F2EA 3AB3B 2HPLA 3I9YA 5L3EB 5LGUB 1VOMA 1ZKEA 3MA9A 4MALA 2L3LA 4ZS3A 3N9OA 3RPUA 5LP6E 4ISSA 4ASKA 4O4JE 2HPJA 4H63H 4JUYA 3K8PC 4P0BA 1OWAA 3W15B 5J1GA 2WSSV 3O9XA 1ZV4X 3RX6A 5L2LA 2XAFB 3AVSA 5AFUL 3K3OA 3UT5E 4N78D 1HG2A 3BQIA 3MACA 2W63A 4NUVA 1MIVA 4V1Av 2W61A 3KBUA 1OXZA 2V7LA 4EOZB 1FIOA 2XAGB 4EYUA 3GWHA 2JMKA 2IAKA 2DNXA 4GYSA 3CPZA 3LBXA 4X1KE 2PG8A 2Y8DA 1SA0E 3LBXB 4CI2B 3PUAA 2WM9A 4MLKA 4IDZA 1S94A 2WAUA 4GYRA 3CWZB 2CWOA 3S4UA 5EK3A 2WMOA 3P8CD 2RA1A 2IC9A 2Z6EA 3JC6D 1WYBA 3HI2A 4BJMA 2JPFA 5LYJE 4IE5A 3HR0A 3ZJ2A 3IF8B 4H63V 3FBLA 4TUYE 2QA7A 3FXEB 2LT3A 4ZI2D 5HXHA 3AA1B 4O4IE 2X66A 3WI3A 1D1CA 4Z8XA 5L3GB 1E1HB 4PJLA 1WLXA 3KBTA 3LJCA 4PK4A 4PFOA 5FY1A 5JDNA 2VL8A 3U78A 4KP3C 2LHRA 2C5IT 2W00A 2DLRA 4OHFA 5E0OA 2X9XA 2BVLA 5LHHB 3HA4A 4YFSA 5FY0A 5LXTE 3V5UA 3CQXC 3AA0B 2LOSA 3Q5XA 4A56A 1D0ZA 2DWGA 2E9XC 2ZM8A 3LG7A 3PUSA 2ZMAA 2X67A 4L5GA 2KZ7B 3I9WA 3OJAA 5JDLA 4C91A 3J9X1 5JDQA 3K3QC 2A72A 2K5BB 4G2AA 3E08A 3BK9A 3VU7H 4DMWA 2CXFA 2H3RA 2IC6A 3QUJA 3NRYA 4O8SA 1FMVA 3BQLA 3VKGA 2CM0A 5LJNA 2N9DA 4EYYR 1KK7A 1SHZC 3EVYA 2VKDA 2LHNA 3ZMSB 2VKOA 3ETUA 3A5XA 2LE8A 5EK2A 2MYSA 2SPCA 3HKDE 3ZCJA 3UUNA 3CMLA 1MNEA 5FXXA 2ES0A 2K48A 4PNIA 3T8OA 4CXWA 2MOZA 5HXCA 3HKEE 4DMVA 5L3FB 5FXZA 2NW9A 3RC3A 1KNZA 3O1IA 5FXVA 5LA6E 2NW8A 5LGNB 2LJLA 4HN9A 5DQWA 5KDMC 3RYFE 2V26A 3V5SA 1CUNA 1IJ6A 3AAEB 3I1AA 4UF0A 1U5PA 3PUGA 3LK2B 4AKRB 4QXHB 4UV9B 4BAYB 4JEUB 2YEVC 5FNVE 4CZZB 3KDSE 4UF0B 3KV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SPC A;  3FB2 A;  3PE0 A;  1U4Q A;  3UUN A;  3F31 A;  3EDV A;  3LBX A;  1OWA A;  2ODU A;  1WLX A;  3LBX B;  3UUL A;  2ODV A;  1QUU A;  1HCI A;  3UUM A;  1S35 A;  1AJ3 A;  1CUN A;  1U5P A; 
#chains in the Genus database with same CATH topology
 3N2K E;  2VK9 A;  1T98 A;  3QNU A;  2X0L B;  3QC9 A;  5LHI B;  4G63 A;  5LBQ B;  3PUW F;  3C4X A;  3UUM A;  5HAX A;  1MMN A;  4ZS2 A;  4YLH A;  3N9M A;  5BMV E;  2V7I A;  5AQU B;  3BQK A;  2XZE A;  1WFD A;  4EIW A;  2XQY A;  2XAH B;  2E5L T;  3SOL A;  4DV7 T;  3B57 A;  4IE6 A;  3OTO T;  4AQG A;  4ADZ A;  1D1B A;  4K0U A;  4C90 A;  3RYH E;  4XAX B;  2I0M A;  4I50 E;  4IE7 A;  1YKH B;  4ZI7 E;  2ODV A;  3PJA A;  2JRK A;  3ZC0 A;  4WW0 A;  3UQ7 A;  3AEF A;  2LKH A;  4UXN B;  4LFB T;  5HXS A;  2LOP A;  3RIA A;  4JEH B;  4PJN A;  4WZX A;  3UTK A;  1QSD A;  2E8I A;  4DVD A;  2MTQ A;  3I0O A;  2H89 A;  1OED E;  5CB4 E;  2B76 A;  3CX6 B;  4HWI B;  2QVA A;  3EAM A;  5LHG B;  3ZT5 A;  5FY7 A;  1YQ4 A;  3RHW A;  4GIW A;  4FI5 A;  4U7Y A;  2BDE A;  1EZ3 A;  3P4S A;  3C50 A;  3LSV A;  4DR1 T;  2JMH A;  3Q9D A;  3AE7 A;  3ZSS A;  5KMG P;  4O2A E;  2LM2 A;  2X51 A;  1KNP A;  4COF A;  4DND A;  2CXD A;  1NWM X;  1UX5 A;  2BZB A;  2C5J A;  2L8K A;  2ZM2 A;  2W4X A;  5C3J A;  5AQN B;  3RI5 A;  2YK0 A;  4HFC A;  5L3B B;  1WRD A;  4JYA T;  2BVM A;  3C64 A;  5ADX L;  4JI8 T;  3TLV A;  2LKG A;  3UUL A;  4PFP A;  3PUQ A;  3IBP A;  5KX5 E;  3D0T A;  1G8X A;  4YJ3 E;  1MMD A;  4AKI A;  1ZHC A;  4O4L E;  2WB5 A;  5JR9 C;  2E2A A;  5L3D B;  5IHY A;  2IDO B;  4KI0 F;  2A2F X;  3CX7 B;  4HWC A;  1XMO T;  4EXT A;  4YSZ A;  3UUB A;  3UFG A;  1D0Y A;  3RH3 A;  2CBI A;  3PTR B;  5DAB A;  4WYV A;  3MJX A;  1BR1 A;  3HL6 A;  2CEA A;  2ACZ A;  4EZH A;  1T7S A;  1W09 A;  3PUY F;  5JRC B;  2WBL A;  2XHE B;  2V6Y A;  2MPK A;  3RQU A;  3H3M A;  5F8P A;  5M4Y A;  4L9I A;  4NUU A;  4DV0 T;  4UVB B;  4HWF A;  3PJA J;  3HKC E;  4B3M T;  2W62 A;  3CX8 B;  4PK6 A;  2ZM0 A;  3N9N A;  5LOV E;  3PUR A;  3FBZ A;  4U33 A;  5FMN A;  3QOF A;  2I59 A;  3EI0 A;  5HEO A;  1UUR A;  5AQI B;  3ESL A;  3IA3 A;  2RP4 A;  3AEB A;  1IBK T;  2VL0 A;  4IHJ E;  3KV5 A;  2X68 A;  4IIJ E;  4UEM A;  4CI1 B;  2UUC T;  5LG4 A;  2ZLY A;  4TV8 E;  5JR9 A;  2NW7 A;  2LM9 A;  5JR9 B;  3NBX X;  2YU2 A;  4UVC B;  3RKO A;  4I55 E;  3ZN0 B;  2CPT A;  4QH4 A;  4ZI3 C;  3F2E A;  3AB3 B;  2CRB A;  4ZS3 A;  5LP6 E;  4O4J E;  4H63 H;  4P0B A;  4JV5 T;  4HFB A;  3RX6 A;  5L2L A;  3AE5 A;  2WZH A;  3K3O A;  4NUV A;  1MIV A;  4V1A v;  4HFH A;  1OXZ A;  4EOZ B;  2XAG B;  4HWD A;  2DNX A;  3LBX A;  4X1K E;  2PG8 A;  3LBX B;  2WCA A;  3SFD A;  3CWZ B;  4EV6 A;  2UUA T;  3HI2 A;  5LYJ E;  2QA7 A;  3FXE B;  4ILC A;  5HXH A;  4O4I E;  3WI3 A;  1D1C A;  5L3G B;  4PJL A;  3KBT A;  3LJC A;  4PFO A;  4HFE A;  4JI0 T;  4KP3 C;  3SFE A;  2C5I T;  4CN1 A;  3ZKR A;  4OHF A;  5E0O A;  1HNX T;  4YFS A;  5FY0 A;  3V5U A;  4DUZ T;  2E9X C;  4Q25 A;  3PUS A;  2WDQ A;  2ZMA A;  4YHH T;  4L5G A;  2KZ7 B;  2XM1 A;  3OJA A;  4LF9 T;  5AQR B;  3J9X 1;  4B3S T;  5JDQ A;  3E08 A;  4U2Y A;  1UK5 A;  3NWI A;  2IHR 1;  3VKG A;  4X5T A;  2PTF A;  4EYY R;  1DU2 A;  3AEE A;  1QLB A;  2LE8 A;  3AXJ A;  3UUN A;  2VVS A;  2K48 A;  3T8O A;  2MOZ A;  5HEU A;  5HXC A;  2V5D A;  3RC3 A;  4DV4 T;  5LA6 E;  5LGN B;  5KDM C;  5AQS B;  3RYF E;  3V5S A;  1CUN A;  3I1A A;  4UF0 A;  3PUG A;  2E5V A;  4QXH B;  2UUB T;  4JEU B;  4UF0 B;  3FZH B;  3KV9 A;  4YXD A;  2DWK A;  3ZJ1 A;  5FL1 A;  4P09 A;  2KLQ A;  2LSG A;  4LMK A;  2XSB A;  2D0T A;  4KMC A;  3ZYK A;  3AED A;  3VHL A;  3P4R A;  2CXL A;  5J2T E;  2VAS A;  4F6R C;  3LFM A;  4H9N C;  3AAA B;  4L0R A;  4LF6 T;  2K9A A;  1IBL T;  4MBQ A;  1FJG T;  5ABH A;  5C8Y E;  1ZOY A;  2XQ3 A;  3R6N A;  3ZMZ B;  4YHJ A;  3ZYM A;  4K0K T;  4AIU A;  2W66 A;  3VKH A;  3B5M A;  1U4Q A;  2NTX A;  4IDP A;  4PJJ A;  2XTL A;  2DI4 A;  3O1H A;  3Q5D A;  5HXR A;  4AQY T;  4LF7 T;  2E9X D;  4KUM B;  3EDU A;  2G0U A;  1D1A A;  2FJD A;  3PU8 A;  5J2U E;  2XM2 A;  4CXY A;  3P4P A;  3SS1 A;  3OYZ A;  2CBJ A;  5FVK A;  4B3R T;  1W0B A;  5JH7 E;  2BKN A;  5AQF B;  1IZN B;  2LSJ A;  4U31 A;  1HNZ T;  2R6G F;  5JDF A;  2GK9 A;  4UV8 B;  2VKH A;  3SRZ A;  4F8H A;  3H3A A;  3TKL B;  4FJO A;  3ZPO A;  3AE9 A;  3G06 A;  2FBW A;  2UXX B;  3RRC A;  3RLF F;  5JVD E;  1Y64 B;  2XY8 B;  2VQF T;  3CVR A;  4OK0 A;  4ZZB A;  5JQG E;  1HFA A;  2LSK A;  4UVA B;  1L0V A;  1AJ3 A;  3ONJ A;  5AQQ B;  4HTE A;  3R84 B;  4WBN E;  2KWI B;  2CHO A;  5ETW A;  3C4Z A;  2V7M A;  2HHH T;  5LCY A;  2Q9Q C;  2XAQ B;  3H37 A;  4HFD A;  2VKJ A;  2X0H A;  1HCI A;  3RIU C;  5HWY A;  2WQY A;  3MKD A;  3ANW A;  1MIY A;  4A98 A;  3ANW B;  3KV6 A;  4ZHQ E;  1IJ5 A;  2V7J A;  2KIN B;  2W0G A;  3CKD A;  3CQC B;  2OLT A;  1LVF A;  3QK6 A;  3VRB A;  4DBQ A;  4IE4 A;  5DQV A;  4TN7 B;  4CXX A;  5LBM A;  3SWH A;  2WWV A;  4EAH A;  3N9P A;  1FEW A;  3RC8 A;  3RYI E;  2V5C A;  3OYX A;  1Z0P A;  2BS4 A;  2PFV A;  1NEN A;  5C2T A;  1N34 T;  2KWH A;  3NZQ A;  4QX7 B;  3PUZ F;  4AI6 A;  4M1P A;  1SE7 A;  5CA1 E;  2M67 A;  3AVR A;  5EZY E;  5CFB A;  4ILU A;  4ZI2 C;  3AE1 A;  3N9Q A;  1CHU A;  2D5U A;  5FXW A;  3ZC1 A;  4TNV A;  2K24 A;  2DL1 A;  2D0U A;  1H7C A;  5L3C B;  4OX9 T;  5L47 A;  1V9D A;  1LKX A;  2Q9Q A;  2J62 A;  3NZP A;  3FHN A;  2Q9Q B;  1YXR A;  2YDS A;  3L09 A;  4HEA A;  4OYK A;  3CIR A;  3RIU A;  4JI1 T;  4DID B;  4DR4 T;  4H9R C;  2WY2 A;  2LEH A;  4XZC A;  5F3J A;  2KND A;  3Q5E A;  3PDY A;  3IEE A;  2CCQ A;  3NRX A;  4DR7 T;  2CMR A;  2Q9Q D;  4HWH A;  4ZZC A;  2LRL A;  5IWA T;  5LGU B;  4MAL A;  4I0U A;  3N9O A;  3RPU A;  4ASK A;  3LDQ B;  1OWA A;  1VCS A;  5AQH B;  5J1G A;  1W0A A;  2WSS V;  1ZV4 X;  5AQO B;  2VQE T;  4N78 D;  1HG2 A;  3BQI A;  2V7L A;  4EYU A;  3GWH A;  4DV5 T;  2IAK A;  3CPZ A;  3RKG A;  2AXD S;  2BBJ A;  1SA0 E;  5ABF A;  2H88 A;  2WM9 A;  4YTP A;  1S94 A;  2WAU A;  5ABF B;  2QYW A;  4JI7 T;  2WMO A;  2RA1 A;  2IC9 A;  4BJM A;  3ZJ2 A;  2LT3 A;  4ZI2 D;  3AA1 B;  2X66 A;  2UXB T;  1XDP A;  1HNW T;  4YSX A;  4JBW F;  5JDN A;  2LHR A;  5HCJ A;  3L39 A;  2BKO A;  5LXT E;  4IRE A;  3Q5X A;  2V6Y B;  4A56 A;  2ZM8 A;  3LG7 A;  3OPC A;  2WU5 A;  3RGL A;  1J5W A;  2XQ9 A;  3TLS A;  3VR9 A;  3PUX F;  4G2A A;  4YT0 A;  4JI6 T;  4DMW A;  2CXF A;  2IC6 A;  3BQL A;  4IL9 A;  1Z8U A;  5LJN A;  4LF5 T;  2SPC A;  3CML A;  1MNE A;  2MAW A;  5LB7 B;  5L3F B;  2NW9 A;  5FXV A;  2BG9 C;  2LJL A;  5DQW A;  1GQE A;  5AQJ B;  3AAE B;  1U5P A;  3LK2 B;  4AKR B;  4BAY B;  2YEV C;  3KDS E;  2HN2 A;  1YD8 G;  2XUE A;  1KFY A;  3KIN B;  4J2C A;  3C51 A;  3UFE A;  5HYA A;  3EHZ A;  2OV9 A;  2X9H A;  2A9U A;  3P4W A;  4JI3 T;  5J0Z A;  2CLY C;  5CGM A;  2NWB A;  4O2B E;  2MBG A;  4QWN B;  2XQA A;  2J1D G;  3ZMV B;  3FB2 A;  3AEG A;  4U3C A;  4HFV A;  3N2O A;  1ZEE A;  4I4T E;  1HF8 A;  1WR0 A;  3DJB A;  4LMJ A;  4CQI A;  4XBF B;  1XWM A;  4JI2 T;  3T1H T;  2ACX A;  2V7K A;  2D9D A;  4GOU A;  5EK4 A;  3NKZ A;  3ZEF B;  2K3W A;  4E7Z A;  4ANJ A;  3MXZ A;  4LF4 T;  1SUM B;  3E0Z A;  5LG3 A;  3KVA A;  4A5X A;  1D0X A;  3ONX A;  1E2A A;  1X79 A;  2BG9 A;  3AE4 A;  1BR4 A;  4DR5 T;  3RRW A;  2BG9 B;  2JQQ A;  4EZ4 A;  4BA9 A;  3VR8 A;  5A1L A;  3PE0 A;  1KNR A;  4Z90 A;  4ILA A;  3PU3 A;  2L9Q A;  3IHR A;  2YDR A;  4JI4 T;  4NXN T;  3C98 B;  2IW5 B;  2JIW A;  1HG5 A;  5ABG A;  2CLY B;  2X9Y A;  4NIQ A;  5FKY A;  4E7S A;  5AQT B;  3LK4 2;  3UU8 A;  3DP7 A;  2FJE A;  3AXJ B;  1MIW A;  3C4W A;  4MFR A;  4GKJ T;  2V1D B;  1QUU A;  2XQ7 A;  1WYC A;  2EHO C;  2LSY A;  2JQ9 A;  4Z91 A;  5FP3 A;  1LRZ A;  2YDQ A;  1YW0 A;  3K3N A;  3JAF A;  2DHR A;  3E22 E;  2BS2 A;  5IUX A;  3AA7 B;  3KV4 A;  4H9S E;  2QRX A;  3T1Y T;  4B6X A;  2HH7 A;  2D2S A;  4QKN A;  4DV1 T;  3FXD B;  1VCT A;  2WDV A;  2P9B A;  1KEY A;  3A7M A;  5FYM A;  4ZOL E;  4HE8 A;  2RPA A;  5FL0 A;  4DV6 T;  2E9X A;  2E9X B;  1HX1 B;  4QXB B;  2Y48 B;  4CN6 A;  4UIG A;  3N2G E;  3U3I A;  1UGO A;  4AXP A;  1O3X A;  5JDH A;  1J1J A;  3OVU A;  3ZN1 B;  2NOX A;  3NVO A;  1XDO A;  3GN5 A;  4H9O C;  3O1J A;  1OED C;  2N1G A;  3RIF A;  3GN5 B;  2NR4 A;  2KXP B;  2JJ9 A;  2LRK A;  2BBH A;  2EHO A;  4P0A A;  4IE0 A;  2EHO B;  5LNK A;  5AQL B;  3UQ4 A;  5JDM A;  5LGT B;  5H6R B;  3JC6 C;  3WAK A;  2JQK A;  2B1E A;  1MMA A;  4OFZ A;  4OYJ A;  1HX8 A;  3CQG B;  1BR0 A;  3UU6 A;  3UU5 A;  2X9W A;  3GMI A;  3UU3 A;  2EHO D;  2F4V T;  3J7Y q;  2HN1 A;  4AKH A;  3ETV A;  4YTM A;  1HTJ F;  2VWA A;  5L4E A;  3P7I A;  4WBO A;  4YSY A;  3ZYL A;  2NP9 A;  3OBV E;  1N36 T;  2N2N A;  2IIU A;  4X1Y E;  4O4H E;  1XMQ T;  2VB6 A;  4GK0 E;  2BS3 A;  2UXN B;  2I6H A;  2YN6 A;  2WWU A;  3FZM B;  4QXC B;  4CN4 A;  2WMN A;  1XNR T;  2XAJ B;  4X1I E;  5AQP B;  4EEB A;  2UXD T;  1OED A;  3I9Y A;  3ZT7 A;  5L3E B;  2XQ4 A;  1VOM A;  1ZKE A;  3MA9 A;  1OED B;  2L3L A;  4B3T T;  4LF8 T;  4ISS A;  5HEJ A;  2HPJ A;  4JUY A;  3W15 B;  1N33 T;  4X66 T;  3O9X A;  5JTG A;  3AVS A;  5HCM A;  3MAC A;  2W63 A;  2V6X A;  3A8Y C;  4IT4 A;  1FIO A;  2AE9 A;  3TLU A;  3QB5 K;  2Y8D A;  1ZP0 A;  3PUA A;  4CI2 B;  4MLK A;  2CWO A;  3S4U A;  4AIS A;  3AEC A;  4QH5 A;  3JC6 D;  1WYB A;  2JPF A;  2WP9 A;  4IE5 A;  1IBM T;  2IML A;  3IF8 B;  2WS3 A;  4H63 V;  4TUY E;  3ZT6 A;  4IDQ A;  1E7P A;  4Z8X A;  1E1H B;  4PK4 A;  2VL8 A;  3U78 A;  1NEK A;  2DLR A;  1N32 T;  2X9X A;  2BVL A;  3HA4 A;  4TWD A;  3CQX C;  3AA0 B;  1I6Z A;  4IDO A;  2XSA A;  2X67 A;  3I9W A;  5JDL A;  4NXM T;  2K5B B;  1YQ3 A;  3BK9 A;  5AQM B;  3VU7 H;  3QUJ A;  5L4H A;  2X0Y A;  2CM0 A;  3PUV F;  2N9D A;  2W2U A;  2VKD A;  3ZMS B;  2VKO A;  3A5X A;  5EK2 A;  2MYS A;  1J5E T;  3ZCJ A;  5FXX A;  2ES0 A;  4PNI A;  3HKE E;  3RQW A;  1R8I A;  1M62 A;  5FXZ A;  3O1I A;  2XQ6 A;  2ZM6 T;  2WU2 A;  2BKP A;  3AEA A;  1XZY A;  4CZZ B;  4IDN A;  1X9B A;  4QX8 B;  4UR9 A;  4PJM A;  5F5W A;  4KHZ F;  4TWH A;  3Q2M A;  1MMG A;  4H9Q C;  4KHP T;  2C5K T;  5BR8 T;  2J4G A;  3AE8 A;  4X20 E;  1UUS A;  1UX4 A;  2PJQ A;  4TV9 E;  1NAF A;  1HR0 T;  4DR6 T;  2FUP A;  4DV3 T;  5HXE A;  2JQH A;  3O4X E;  4H9P C;  4YTN A;  3FZK B;  5HEG A;  3ZST A;  4QH1 A;  4PW8 A;  1W9R A;  4NPP A;  4U72 A;  4I43 B;  1T8B A;  1I94 T;  4WNK A;  4DUY T;  3ONL C;  4DR3 T;  3I0Q A;  5LJM A;  2M6B A;  2UXC T;  4ZXL A;  3VRA A;  5JDG A;  1VRB A;  4GK5 E;  1UCU A;  2CA5 A;  2KSR A;  5KXJ A;  2VUR A;  3Q5W A;  3P4Q A;  4DO0 A;  4X64 T;  3GA8 A;  1FMW A;  5JRC A;  3EUH A;  2YU1 A;  3P50 A;  2OA5 A;  4AKL A;  4LFA T;  2XPK A;  2KT9 A;  1LVK A;  4AQF C;  5TAO A;  4LML A;  3JAD A;  4JI5 T;  3HKB E;  2WDR A;  3KFW X;  1HS7 A;  1MND A;  3B13 A;  1KF6 A;  3FZF B;  4EGW A;  4ERR A;  2LSI A;  3F57 A;  2YIN A;  3N5L A;  3RYC E;  3L3P A;  4CI3 B;  2Y6X A;  3LK3 B;  1BR2 A;  1JNR A;  3K1S A;  4ILB A;  2YKS A;  5H6Q B;  4TZ4 C;  4U74 A;  3CK6 A;  3AAI A;  3N9L A;  3QB5 A;  4DBR A;  2CWY A;  4X62 T;  3AE6 A;  1B7T A;  3M3Z B;  3ZCI A;  1XNQ T;  2H7V C;  2PBI A;  3MZK B;  4TNW A;  4IGU A;  4HKA A;  2CE7 A;  3KVB A;  3WAJ A;  2C0S A;  4DR2 T;  5AQK B;  5IYZ E;  4DV2 T;  3OKQ A;  4IL4 A;  4AQF A;  5GON E;  4JLE A;  2CHN A;  2LLY A;  4MHC A;  4AKG A;  3DTO A;  3ZLI A;  2WZI A;  4UEL A;  3PV0 F;  5JRE A;  2DCF A;  3EAB A;  4EED A;  3ZMU B;  1YKE B;  4PK5 A;  5DJQ C;  3UUX B;  3ZMT B;  2ODU A;  2NTY A;  4YY3 T;  1IAP A;  1Y01 A;  1WCR A;  4YJ2 E;  5HWX A;  2H7O A;  4TX5 A;  4HFI A;  5ABE A;  4ZEY A;  2V8S V;  5LMN T;  1M7K A;  3M65 A;  1G73 A;  5LMU T;  3F31 A;  4BJN A;  3EDV A;  1WR6 A;  1US7 B;  5CA0 E;  4EB6 E;  3JCF A;  4KBM B;  4HGA A;  2XQ5 A;  3AA6 B;  2FJB A;  2J47 A;  4PAG A;  3MK7 C;  4ZI3 D;  2XAS B;  2KMF A;  4QHO A;  4U7I A;  1S35 A;  2A3D A;  2QGS A;  4IST A;  2HPL A;  3JAE A;  4U2Z A;  2XJ7 A;  3FZL B;  3K8P C;  2BG9 E;  2XAF B;  2M6I A;  2IUB A;  5AFU L;  3UT5 E;  3RF1 A;  2W61 A;  3KBU A;  1JNZ A;  2JMK A;  5FVL A;  4GYS A;  3AE3 A;  4IDZ A;  4GYR A;  3TLT A;  2XQ8 A;  5EK3 A;  3P8C D;  2Z6E A;  4TWF A;  3HR0 A;  3FBL A;  4LFC T;  4A97 A;  1WLX A;  5HEH A;  5FY1 A;  3UU4 A;  2W00 A;  5LHH B;  4KX6 A;  2VVN A;  2LOS A;  2W67 A;  1D0Z A;  2DWG A;  5CJ5 A;  4C91 A;  3ABV A;  3K3Q C;  2A72 A;  2H3R A;  3NRY A;  4O8S A;  4P1N A;  1FMV A;  3TLW A;  4GKK T;  3L8R A;  1KK7 A;  1SHZ C;  3EVY A;  2LHN A;  3ETU A;  2UU9 T;  2FJA A;  1T72 A;  3HKD E;  3X1D A;  2YOE A;  4CXW A;  4DMV A;  1KNZ A;  2NW8 A;  4HN9 A;  2V26 A;  4X65 T;  5AQG B;  3AE2 A;  1IJ6 A;  4UV9 B;  5AQV B;  5FNV E; 
#chains in the Genus database with same CATH homology
 3N2K E;  2DWK A;  4QX8 B;  1YD8 G;  2XUE A;  2VK9 A;  4PJM A;  1T98 A;  3KIN B;  4J2C A;  2X0L B;  3C51 A;  3QC9 A;  3UFE A;  5HYA A;  3ZJ1 A;  3Q2M A;  1MMG A;  5LHI B;  4G63 A;  2X9H A;  4H9Q C;  5LBQ B;  4P09 A;  2CLY C;  3C4X A;  2NWB A;  3UUM A;  2KLQ A;  2LSG A;  4O2B E;  5HAX A;  1MMN A;  4ZS2 A;  2C5K T;  2MBG A;  4YLH A;  2D0T A;  4QWN B;  4KMC A;  3ZYK A;  4X20 E;  3N9M A;  3VHL A;  5BMV E;  2J1D G;  5J2T E;  2CXL A;  1UX4 A;  3ZMV B;  2PJQ A;  3FB2 A;  2V7I A;  4TV9 E;  1NAF A;  3BQK A;  4HFV A;  2VAS A;  3N2O A;  4EIW A;  3LFM A;  4F6R C;  2XQY A;  1ZEE A;  4I4T E;  4H9N C;  3AAA B;  2XAH B;  4L0R A;  5HXE A;  1HF8 A;  2K9A A;  3SOL A;  3DJB A;  3O4X E;  3B57 A;  4H9P C;  4MBQ A;  4CQI A;  4XBF B;  4IE6 A;  5C8Y E;  2ACX A;  4AQG A;  2V7K A;  4PW8 A;  4ADZ A;  1D1B A;  4K0U A;  3R6N A;  3ZMZ B;  4YHJ A;  4GOU A;  4U72 A;  4C90 A;  5EK4 A;  3ZYM A;  4I43 B;  3RYH E;  3ZEF B;  3VKH A;  4XAX B;  1U4Q A;  4E7Z A;  4WNK A;  4ANJ A;  2NTX A;  4I50 E;  4IE7 A;  3MXZ A;  1YKH B;  4PJJ A;  2XTL A;  2DI4 A;  3O1H A;  3I0Q A;  3E0Z A;  4ZI7 E;  5LJM A;  2ODV A;  5HXR A;  3KVA A;  2E9X D;  1D0X A;  4KUM B;  3ONX A;  5JDG A;  1X79 A;  2JRK A;  1VRB A;  3EDU A;  4GK5 E;  1BR4 A;  2G0U A;  1UCU A;  1D1A A;  4WW0 A;  3RRW A;  3ZC0 A;  2CA5 A;  2JQQ A;  4UXN B;  3PU8 A;  4EZ4 A;  5J2U E;  5HXS A;  4CXY A;  4BA9 A;  2LOP A;  5A1L A;  3PE0 A;  3SS1 A;  3OYZ A;  3Q5W A;  4JEH B;  4PJN A;  4DO0 A;  3PU3 A;  3GA8 A;  2L9Q A;  5JH7 E;  1FMW A;  5JRC A;  3EUH A;  2YU1 A;  3IHR A;  1QSD A;  2E8I A;  1IZN B;  3UTK A;  4DVD A;  2MTQ A;  3I0O A;  2OA5 A;  4AKL A;  2LSJ A;  5CB4 E;  2KT9 A;  1LVK A;  3C98 B;  3CX6 B;  5TAO A;  4AQF C;  2IW5 B;  1HG5 A;  2CLY B;  2X9Y A;  4E7S A;  5JDF A;  2GK9 A;  5LHG B;  3LK4 2;  3HKB E;  3KFW X;  1HS7 A;  3DP7 A;  4UV8 B;  5FY7 A;  2VKH A;  3SRZ A;  1MND A;  1MIW A;  3C4W A;  3B13 A;  4GIW A;  4MFR A;  4FI5 A;  3H3A A;  2BDE A;  1EZ3 A;  3C50 A;  2V1D B;  1QUU A;  4ERR A;  2JMH A;  2LSI A;  1WYC A;  2EHO C;  3F57 A;  3Q9D A;  4FJO A;  3TKL B;  2YIN A;  2LSY A;  5KMG P;  3ZPO A;  5FP3 A;  1LRZ A;  4O2A E;  3N5L A;  1YW0 A;  3RYC E;  2UXX B;  2X51 A;  3L3P A;  3RRC A;  3K3N A;  4CI3 B;  2Y6X A;  3LK3 B;  1Y64 B;  5JVD E;  1BR2 A;  2DHR A;  3E22 E;  3CVR A;  4OK0 A;  4DND A;  5H6Q B;  2CXD A;  1NWM X;  4TZ4 C;  3AA7 B;  1UX5 A;  2BZB A;  2C5J A;  2L8K A;  3KV4 A;  4U74 A;  5JQG E;  1HFA A;  2LSK A;  2ZM2 A;  4UVA B;  4H9S E;  3AAI A;  4B6X A;  3N9L A;  1AJ3 A;  2HH7 A;  2YK0 A;  4HTE A;  3R84 B;  4WBN E;  2D2S A;  4DBR A;  4QKN A;  2CWY A;  2KWI B;  1B7T A;  5L3B B;  3ZCI A;  3FXD B;  1WRD A;  5ETW A;  3C4Z A;  2BVM A;  2V7M A;  3C64 A;  2P9B A;  5ADX L;  5FYM A;  4ZOL E;  4HE8 A;  5LCY A;  2Q9Q C;  2XAQ B;  3H37 A;  2VKJ A;  3UUL A;  2H7V C;  2E9X A;  4PFP A;  3PUQ A;  2PBI A;  3MZK B;  1HCI A;  4IGU A;  4HKA A;  2CE7 A;  2E9X B;  3KVB A;  5HWY A;  3IBP A;  3MKD A;  5KX5 E;  4QXB B;  2Y48 B;  3ANW A;  3WAJ A;  2C0S A;  1MIY A;  3D0T A;  1G8X A;  4YJ3 E;  4UIG A;  1MMD A;  3ANW B;  3KV6 A;  1ZHC A;  5IYZ E;  4ZHQ E;  4AKI A;  4O4L E;  1IJ5 A;  3N2G E;  5JR9 C;  2V7J A;  3OKQ A;  5L3D B;  5IHY A;  3U3I A;  4AQF A;  2KIN B;  5GON E;  4JLE A;  2W0G A;  3CKD A;  3CQC B;  1LVF A;  4AXP A;  2A2F X;  1O3X A;  5JDH A;  3CX7 B;  4MHC A;  3QK6 A;  4AKG A;  3DTO A;  3ZN1 B;  3ZLI A;  2NOX A;  4DBQ A;  4IE4 A;  3GN5 A;  4H9O C;  3O1J A;  4TN7 B;  2N1G A;  5DQV A;  5LBM A;  3SWH A;  4CXX A;  4EXT A;  4UEL A;  3GN5 B;  4EAH A;  3N9P A;  1FEW A;  2KXP B;  2JJ9 A;  1D0Y A;  2EHO A;  5JRE A;  4P0A A;  3RC8 A;  3RH3 A;  3RYI E;  2DCF A;  3OYX A;  1Z0P A;  4IE0 A;  2EHO B;  3PTR B;  2PFV A;  5LNK A;  5DAB A;  5JDM A;  3ZMU B;  3MJX A;  1YKE B;  2KWH A;  1BR1 A;  3NZQ A;  4QX7 B;  4PK5 A;  5LGT B;  5DJQ C;  3HL6 A;  5H6R B;  3JC6 C;  3UUX B;  2ODU A;  2NTY A;  3ZMT B;  4AI6 A;  3WAK A;  4M1P A;  5CA1 E;  1IAP A;  2M67 A;  2CEA A;  3AVR A;  2B1E A;  5EZY E;  4EZH A;  4YJ2 E;  4ILU A;  4ZI2 C;  5HWX A;  2H7O A;  1MMA A;  5JRC B;  4TX5 A;  2WBL A;  3N9Q A;  2XHE B;  4OFZ A;  4OYJ A;  1HX8 A;  3CQG B;  1BR0 A;  5F8P A;  2D5U A;  4L9I A;  4NUU A;  2X9W A;  4UVB B;  5FXW A;  5M4Y A;  3GMI A;  3HKC E;  3ZC1 A;  3M65 A;  1G73 A;  2EHO D;  2K24 A;  2W62 A;  3CX8 B;  4PK6 A;  3F31 A;  2ZM0 A;  4BJN A;  3N9N A;  3EDV A;  2D0U A;  5LOV E;  3PUR A;  3J7Y q;  3FBZ A;  1H7C A;  1WR6 A;  5FMN A;  5L3C B;  3ETV A;  4AKH A;  2I59 A;  1V9D A;  1US7 B;  1HTJ F;  1LKX A;  2VWA A;  2Q9Q A;  5CA0 E;  4EB6 E;  3NZP A;  3P7I A;  4KBM B;  4WBO A;  3FHN A;  2Q9Q B;  4HGA A;  3ESL A;  2RP4 A;  3L09 A;  3ZYL A;  4HEA A;  4OYK A;  3AA6 B;  2NP9 A;  3OBV E;  2N2N A;  4X1Y E;  4IHJ E;  3KV5 A;  2X68 A;  4PAG A;  4IIJ E;  4O4H E;  4H9R C;  4UEM A;  2VB6 A;  4CI1 B;  2LEH A;  4GK0 E;  2UXN B;  4XZC A;  5F3J A;  2KND A;  3MK7 C;  5LG4 A;  2ZLY A;  2WWU A;  4TV8 E;  4QXC B;  2WMN A;  4ZI3 D;  5JR9 A;  2XAS B;  2KMF A;  3PDY A;  2NW7 A;  2LM9 A;  4QHO A;  5JR9 B;  3NBX X;  2XAJ B;  1S35 A;  2YU2 A;  4UVC B;  3IEE A;  4X1I E;  2CCQ A;  3NRX A;  2CMR A;  3RKO A;  2A3D A;  4I55 E;  2Q9Q D;  2QGS A;  3ZN0 B;  4IST A;  4ZI3 C;  3F2E A;  3AB3 B;  2HPL A;  3I9Y A;  5L3E B;  5LGU B;  1VOM A;  1ZKE A;  3MA9 A;  4MAL A;  2L3L A;  4ZS3 A;  3N9O A;  3RPU A;  5LP6 E;  4ISS A;  4ASK A;  4O4J E;  2HPJ A;  4H63 H;  4JUY A;  3K8P C;  4P0B A;  1OWA A;  3W15 B;  5J1G A;  2WSS V;  3O9X A;  1ZV4 X;  3RX6 A;  5L2L A;  2XAF B;  3AVS A;  5AFU L;  3K3O A;  3UT5 E;  4N78 D;  1HG2 A;  3BQI A;  3MAC A;  2W63 A;  4NUV A;  1MIV A;  4V1A v;  2W61 A;  3KBU A;  1OXZ A;  2V7L A;  4EOZ B;  1FIO A;  2XAG B;  4EYU A;  3GWH A;  2JMK A;  2IAK A;  2DNX A;  4GYS A;  3CPZ A;  3LBX A;  4X1K E;  2PG8 A;  2Y8D A;  1SA0 E;  3LBX B;  4CI2 B;  3PUA A;  2WM9 A;  4MLK A;  4IDZ A;  1S94 A;  2WAU A;  4GYR A;  3CWZ B;  2CWO A;  3S4U A;  5EK3 A;  2WMO A;  3P8C D;  2RA1 A;  2IC9 A;  2Z6E A;  3JC6 D;  1WYB A;  3HI2 A;  4BJM A;  2JPF A;  5LYJ E;  4IE5 A;  3HR0 A;  3ZJ2 A;  3IF8 B;  4H63 V;  3FBL A;  4TUY E;  2QA7 A;  3FXE B;  2LT3 A;  4ZI2 D;  5HXH A;  3AA1 B;  4O4I E;  2X66 A;  3WI3 A;  1D1C A;  4Z8X A;  5L3G B;  1E1H B;  4PJL A;  1WLX A;  3KBT A;  3LJC A;  4PK4 A;  4PFO A;  5FY1 A;  5JDN A;  2VL8 A;  3U78 A;  4KP3 C;  2LHR A;  2C5I T;  2W00 A;  2DLR A;  4OHF A;  5E0O A;  2X9X A;  2BVL A;  5LHH B;  3HA4 A;  4YFS A;  5FY0 A;  5LXT E;  3V5U A;  3CQX C;  3AA0 B;  2LOS A;  3Q5X A;  4A56 A;  1D0Z A;  2DWG A;  2E9X C;  2ZM8 A;  3LG7 A;  3PUS A;  2ZMA A;  2X67 A;  4L5G A;  2KZ7 B;  3I9W A;  3OJA A;  5JDL A;  4C91 A;  3J9X 1;  5JDQ A;  3K3Q C;  2A72 A;  2K5B B;  4G2A A;  3E08 A;  3BK9 A;  3VU7 H;  4DMW A;  2CXF A;  2H3R A;  2IC6 A;  3QUJ A;  3NRY A;  4O8S A;  1FMV A;  3BQL A;  3VKG A;  2CM0 A;  5LJN A;  2N9D A;  4EYY R;  1KK7 A;  1SHZ C;  3EVY A;  2VKD A;  2LHN A;  3ZMS B;  2VKO A;  3ETU A;  3A5X A;  2LE8 A;  5EK2 A;  2MYS A;  2SPC A;  3HKD E;  3ZCJ A;  3UUN A;  3CML A;  1MNE A;  5FXX A;  2ES0 A;  2K48 A;  4PNI A;  3T8O A;  4CXW A;  2MOZ A;  5HXC A;  3HKE E;  4DMV A;  5L3F B;  5FXZ A;  2NW9 A;  3RC3 A;  1KNZ A;  3O1I A;  5FXV A;  5LA6 E;  2NW8 A;  5LGN B;  2LJL A;  4HN9 A;  5DQW A;  5KDM C;  3RYF E;  2V26 A;  3V5S A;  1CUN A;  1IJ6 A;  3AAE B;  3I1A A;  4UF0 A;  1U5P A;  3PUG A;  3LK2 B;  4AKR B;  4QXH B;  4UV9 B;  4BAY B;  4JEU B;  2YEV C;  5FNV E;  4CZZ B;  3KDS E;  4UF0 B;  3KV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...