3UULA

Crystal structure of first n-terminal utrophin spectrin repeat
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
115
structure length
115
Chain Sequence
b'DLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEDVKEQFATHETFMMELSAHQSSVGSVLQAGNQLMTQGTLSDEEEFEIQEQMTLLNARWEALRVESMERQSRLHDALMELQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords utrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 53
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uulA00
3EDVA 1AJ3A 1WLXA 2SPCA 3LBXB 3UUNA 2ODVA 1CUNA 3F31A 1HCIA 3UUMA 2ODUA 1U5PA 1U4QA 1QUUA 3LBXA 1S35A 1OWAA 3PE0A 3UULA 3FB2A
chains in the Genus database with same CATH superfamily
2BVMA 4X62T 2SPCA 3Q5WA 2JIWA 3C4WA 4ILBA 3P7IA 4EGWA 3TLUA 3HA4A 3F2EA 2NR4A 2V1DB 4Z90A 4IE4A 4B3TT 1WYCA 3I0QA 1FIOA 3OYZA 4B3RT 2H89A 4H9PC 4DMVA 1N33T 2VB6A 3RIUA 3JC6D 4CXWA 3TLSA 3AA7B 4F6RC 3PURA 4EIWA 1YD8G 2C5JA 2WDQA 5HWXA 1XDOA 4DUZT 2D2SA 5LA6E 4JV5T 3RQUA 2CBJA 3UQ4A 4NXNT 2JMKA 2JMHA 4L5GA 1B7TA 5JREA 2M67A 5AQPB 5LHIB 1CHUA 1U4QA 4B3MT 3CQGB 2XQAA 4AKRB 4DO0A 2P9BA 4X1YE 4PNIA 1KEYA 3PUQA 2H7OA 4PJNA 2CXFA 2LKHA 2PG8A 1DU2A 3LFMA 3PJAA 2D5UA 1T7SA 3FXDB 5HXHA 4A5XA 4GYSA 4KP3C 3RIAA 4GKJT 1HNZT 4CN4A 4YSXA 4A97A 4DR7T 5AQOB 2M6BA 2OA5A 3VR8A 3LK3B 5LXTE 5JRCA 3OYXA 3OPCA 2LRLA 2CXLA 5AQRB 2MOZA 1I6ZA 3CX8B 3ZN0B 5FXXA 2PBIA 5LNKA 3QUJA 4UV8B 5HXEA 4YXDA 4BJMA 2KXPB 3PUXF 2DI4A 2XTLA 4JI8T 2Q9QA 4OFZA 3H3AA 2X9XA 3MA9A 4YJ2E 5BR8T 4MHCA 2KWHA 4BJNA 2ZM0A 5JDNA 2E9XB 4LF8T 5M4YA 2J47A 3B13A 2G0UA 3NRYA 4UXNB 1OEDB 3HKEE 3O9XA 3CX6B 3ZMUB 5L3GB 1UGOA 2UXNB 4ZOLE 5HXRA 3RRWA 2XSAA 3MKDA 3EVYA 2XAQB 3FB2A 3PUGA 5LYJE 2LHNA 3Q5EA 4U7YA 4ANJA 5C3JA 3KFWX 2XQ9A 3AEAA 4HFIA 1IJ6A 4Q25A 5HEOA 3CVRA 3RYFE 1W09A 4U31A 2VKJA 3DTOA 4ZI2C 2WSSV 3ONJA 5LCYA 1D1CA 2KLQA 3NKZA 3K3OA 2OLTA 2I59A 4AQYT 2BKNA 4H63H 4ZXLA 5AQIB 3M3ZB 1E1HB 1HFAA 4HWCA 5J2UE 5L3EB 3I0OA 4B6XA 4DV6T 2LHRA 2X9WA 5HXCA 2Q9QD 1E2AA 2WQYA 2FJDA 1YKHB 4DR3T 3KBUA 3L8RA 4H9OC 4CXXA 5DQVA 2OV9A 1T8BA 3A7MA 4FJOA 2XM2A 5EZYE 5LBMA 3C50A 2UXCT 3N9MA 2E9XD 1HG5A 2BDEA 4GK5E 2V7MA 2V6YB 3PUSA 3N9PA 3CQCB 1IJ5A 2WZHA 3PDYA 3FZKB 3ZSSA 4JLEA 3C51A 5JDQA 5F3JA 5LMNT 2LKGA 5LJNA 4YY3T 2VKHA 4TX5A 5FL1A 2XQ7A 4QX7B 2PTFA 3N9OA 1KNPA 4EV6A 3UFEA 5KX5E 5KDMC 4QX8B 4YLHA 2JPFA 4UELA 2YDSA 2YU1A 4DV2T 3A5XA 4EB6E 2L9QA 3P4PA 3RQWA 2R6GF 4F8HA 3ANWA 1BR2A 3E0ZA 4QH1A 3C98B 3IA3A 4TWFA 3AE7A 1BR4A 3KBTA 3P4RA 4TZ4C 2CCQA 2X0LB 1Z0PA 5FP3A 4AKLA 1T98A 2CWYA 3ONLC 4HWDA 3J9X1 2C0SA 4YTNA 3RPUA 4LF7T 2ES0A 2W66A 4WZXA 1KK7A 1JNZA 3Q5DA 4CN6A 5JVDE 4HWHA 1I94T 2I0MA 2A2FX 2E5VA 1HNXT 4IDZA 4ASKA 2BS3A 4AQGA 3N2KE 3NRXA 4TNVA 5L3BB 3ESLA 2X67A 3SFDA 2XUEA 2HHHT 4HE8A 2WB5A 5FVLA 3L3PA 4DV5T 3DJBA 3UQ7A 2V8SV 2BG9B 3ONXA 5KMGP 3PJAJ 2NTXA 5FYMA 2I6HA 2LSYA 2EHOB 2KWIB 1O3XA 3X1DA 3MZKB 3ZJ2A 3MJXA 3ZMVB 3AE1A 1UX5A 3I1AA 1W9RA 1X79A 3EDVA 1SA0E 3I9WA 4I50E 3AA0B 5EK3A 3AEFA 5BMVE 2VASA 4LF5T 1US7B 1D0XA 2LOPA 2JQHA 2W4XA 4HWFA 2X68A 2WY2A 3RKOA 2E2AA 2X51A 4AISA 1J5ET 5AQKB 4JI4T 3AE8A 2XQ4A 1NAFA 2Y8DA 3UUXB 5FMNA 4HWIB 2ZMAA 4P0BA 1HX8A 2A3DA 3EAMA 2XQ5A 3LG7A 3RLFF 2LSJA 4O4HE 5HYAA 3B57A 3BQKA 1MNDA 4G2AA 1MMGA 3SS1A 1HNWT 4G63A 1MMDA 5L3FB 2YINA 4JYAT 2AXDS 3AB3B 4IDQA 5ABHA 2JQQA 3AE6A 1S94A 3N5LA 3Q2MA 3NZPA 2WAUA 3AEEA 4YTPA 2DLRA 2XAFB 3RKGA 2J62A 2KNDA 5FVKA 4QWNB 4JEUB 4U2ZA 4K0KT 3GWHA 3KV9A 3ZSTA 4EYUA 4HN9A 3PU8A 2MYSA 4YSYA 3RC8A 2WU2A 4YHJA 1NWMX 2XASB 4P0AA 1NENA 4UVAB 2XQ8A 3F31A 1YXRA 1HG2A 4IE0A 2X0YA 1U5PA 5JQGE 1GQEA 3LBXA 4N78D 2XHEB 5C2TA 1MMNA 5J1GA 3ZMSB 2FJEA 3JCFA 4GIWA 3TLWA 1YKEB 2W63A 5FXWA 3OVUA 4U74A 2IDOB 4QH4A 3VRBA 4BAYB 4AKGA 1J5WA 2YEVC 1ZOYA 4ZS3A 1VOMA 1W0AA 5FY1A 3K1SA 3FZHB 3UU5A 4ILUA 5IUXA 3PV0F 3GA8A 2NOXA 1E7PA 3J7Yq 5LHGB 5IHYA 4JI3T 1IAPA 4TV8E 1OWAA 1Z8UA 3HKCE 4UVCB 3FBZA 2H88A 4XZCA 1IBKT 4WNKA 3C64A 2HN1A 5LJMA 4H63V 3K3NA 3L09A 4O2BE 4KUMB 3AEBA 1QSDA 2VQFT 2LE8A 4QXHB 5AQVB 3T1YT 3UU4A 3ZLIA 3R6NA 2LRKA 4ZEYA 2JQ9A 3CKDA 2UXBT 1SE7A 4JI1T 5IWAT 2ODVA 3WAKA 5JRCB 3CK6A 3MXZA 3VKHA 3LSVA 5ABFA 3B5MA 2XM1A 4ISTA 5LGNB 1UCUA 2X66A 3NVOA 1ZEEA 2L8KA 5ABEA 1OEDE 2Q9QB 4ILAA 3OTOT 2Y48B 3LK42 4ZI3C 4X1IE 4ZI2D 1M7KA 5JR9C 4I55E 4NUVA 2H7VC 3RHWA 5KXJA 5HWYA 5FXZA 4EYYR 1X9BA 3CPZA 5ETWA 3HL6A 4PAGA 4CI2B 2V6XA 3QK6A 4HKAA 5TAOA 2CXDA 2A72A 2JJ9A 4IDPA 4UVBB 4CZZB 4PFPA 2E8IA 4COFA 2YKSA 4CN1A 4E7ZA 2WZIA 3SWHA 1SUMB 2VKDA 3QOFA 3AA6B 4IGUA 4AKIA 2KT9A 1KF6A 1H7CA 3ZPOA 2WMOA 4GK0E 5AQJB 1WLXA 5HEJA 3EUHA 5F8PA 2K5BB 3ABVA 1MNEA 2MTQA 3HKDE 3UUMA 4KHPT 3RI5A 2BVLA 4DR5T 3ZCIA 4OX9T 2IUBA 2VKOA 5AFUL 3KINB 2DCFA 2N1GA 1N36T 3UUNA 4ZZCA 3TKLB 5LB7B 2LM9A 3N2GE 2VL8A 1UX4A 3AECA 3LJCA 4I0UA 1N32T 2LEHA 3ZT5A 2WU5A 3VRAA 5EK2A 2CHOA 2WP9A 4ADZA 3MK7C 2NW7A 2QVAA 3P8CD 4DBRA 4YHHT 3WI3A 5L4EA 4DV0T 5JTGA 4UEMA 4LF4T 5CFBA 1XMOT 4JBWF 3IEEA 4YSZA 2ZM8A 2D9DA 1D1AA 3I9YA 2LSKA 3T8OA 4EZHA 3ANWB 5J2TE 3EABA 2IHR1 2K24A 4U7IA 1N34T 3ZC1A 3F57A 5CA0E 4TWDA 4BA9A 2HH7A 4IIJE 4EXTA 2B1EA 3GN5B 5LBQB 1WYBA 2VL0A 3M65A 2LSGA 4OHFA 3UU6A 4JI0T 3GN5A 4DV4T 2FUPA 3P4SA 4PFOA 2GK9A 1FMVA 3NBXX 2K9AA 1VRBA 4UV9B 1OEDC 3OBVE 2LJLA 4GYRA 5JDHA 3D0TA 2QGSA 4CXYA 5AQTB 3KVBA 2JRKA 3ZKRA 5L47A 3P4QA 5JH7E 4IDNA 5CGMA 2QRXA 2W67A 2IC9A 3UU3A 4YFSA 2CM0A 3S4UA 5A1LA 2BG9E 2CRBA 3QB5K 4PJLA 3C4XA 3AE2A 4OYJA 3UTKA 2QA7A 3VHLA 2XPKA 1WR6A 2C5KT 5CB4E 3MACA 3O4XE 1M62A 2NW8A 2ODUA 4DR4T 5AQHB 2V7KA 4DV7T 3PUZF 4AKHA 4NXMT 2HPJA 3LDQB 3CWZB 5LG3A 4X64T 2K48A 2D0TA 4IHJE 2XAGB 3PTRB 2VVNA 4IE7A 1XZYA 3KDSE 1Y64B 5HAXA 3E08A 4WYVA 2CE7A 1W0BA 1VCTA 2DHRA 2W00A 1MIWA 3CIRA 2J1DG 2UUAT 2J4GA 4XBFB 2CA5A 2FJBA 3GMIA 2V7JA 1LKXA 3HR0A 2XY8B 2MPKA 3O1JA 3VU7H 2DNXA 4DV3T 4HFBA 4JUYA 3EI0A 4H9QC 5IYZE 3G06A 1BR0A 2WDVA 4QKNA 2HN2A 3RC3A 5LHHB 2HPLA 3ZCJA 3PUWF 4PK5A 4LMKA 4LMJA 3BQLA 2C5IT 3ETVA 4X65T 1IBLT 5JR9B 5FXVA 5AQQB 4TNWA 1WR0A 3R84B 2W62A 5JR9A 2MAWA 3CQXC 1D1BA 2XJ7A 2X9YA 2XSBA 2KINB 2BKOA 1JNRA 5E0OA 2E5LT 2BBHA 4LF9T 3LBXB 3U3IA 4FI5A 3CX7B 1FMWA 4AIUA 3AE9A 5LP6E 3AAAB 3AXJA 4QHOA 3PE0A 4MFRA 4DBQA 2CMRA 3PUYF 4P1NA 4TUYE 3FBLA 1R8IA 2UXXB 4I43B 1J1JA 3PUAA 3RIFA 1ZHCA 3KV4A 4EEDA 3A8YC 4K0UA 4X1KE 3QC9A 2LM2A 3U78A 2CLYC 3KV5A 4L0RA 4WW0A 4IE6A 3ZMZB 1YQ4A 3ZEFB 1HX1B 3IHRA 4YJ3E 4I4TE 4O8SA 2BG9C 4UF0B 2VURA 3JADA 2WWVA 3RRCA 3EHZA 4C91A 4QXBB 2KZ7B 4ZI3D 2EHOC 3UT5E 5FY7A 1LVFA 5JDFA 1IBMT 1CUNA 1VCSA 4UF0A 3ZT6A 3ZC0A 5L2LA 2V26A 1FEWA 4OK0A 5HEGA 3QB5A 2KMFA 3ZYLA 1XWMA 5ABGA 2ACXA 2LT3A 5FNVE 5L3DB 1XMQT 4AQFC 3E22E 5ABFB 3N9NA 1KNZA 1MIYA 2VWAA 2WDRA 4MALA 2UU9T 1T72A 3AE4A 4JEHB 4L9IA 4EAHA 3P4WA 3UU8A 3AAEB 4HEAA 2W0GA 3N9LA 4TV9E 5HXSA 3TLVA 3RYHE 4HFEA 3LK2B 2XZEA 3JC6C 4DVDA 4LF6T 2CEAA 4WBNE 4H9RC 4O4IE 1D0YA 2NWBA 4U33A 1LRZA 4IL4A 1HR0T 1XNQT 4DIDB 2IC6A 4U2YA 3FZLB 3AAIA 4HTEA 4A98A 2YN6A 2PFVA 4IREA 4ZI7E 5JDLA 1G73A 2F4VT 5LGUB 2VQET 1AJ3A 5JDGA 3NWIA 4X20E 1WCRA 2YK0A 5HEUA 3DP7A 4ZS2A 2UXDT 2CPTA 2WCAA 4J2CA 1HF8A 4AI6A 3UFGA 2AE9A 5LGTB 2E9XA 2XQ3A 1UURA 2A9UA 3ZYKA 4Z8XA 1OEDA 4IT4A 1HTJF 3RYIE 4EEBA 3KV6A 2PJQA 2UUCT 5HEHA 4DR6T 5AQSB 4CQIA 4LMLA 4ISSA 5DABA 5FY0A 3L39A 3RIUC 3UUBA 4P09A 1D0ZA 4HFCA 3IBPA 4YTMA 5HCJA 2NTYA 5CJ5A 1UK5A 3BQIA 4TWHA 2FBWA 4LFBT 2X0HA 2DWGA 1IZNB 3ZMTB 2YDRA 2YDQA 4DV1T 1NEKA 2CWOA 2L3LA 4PJJA 4ILCA 5FKYA 3VR9A 3O1HA 4NPPA 1UUSA 2NP9A 2IIUA 2KSRA 3QNUA 1ZKEA 3IF8B 2VVSA 1BR1A 3Q5XA 3C4ZA 2N9DA 2ZLYA 4LFAT 4HFHA 1FJGT 4C90A 3AE5A 2BS4A 4MBQA 2RP4A 2CHNA 4U72A 1G8XA 3FHNA 3BK9A 2IMLA 2WBLA 3JAEA 4EOZB 5AQNB 5CA1E 1Y01A 4QXCB 3WAJA 4KI0F 4GKKT 4DMWA 4U3CA 4B3ST 1LVKA 2V7IA 2K3WA 4QH5A 2V6YA 4MLKA 4UIGA 5FL0A 3HKBE 3N2OA 3AVSA 4TN7B 1SHZC 2YU2A 2JQKA 1YW0A 1HS7A 2LOSA 2Q9QC 3UULA 1ZV4X 5LG4A 2BZBA 4DNDA 3RGLA 1KNRA 4O2AE 4UR9A 2Y6XA 2E9XC 3K8PC 2YOEA 3T1HT 4WBOA 3ZN1B 1OXZA 4ERRA 4HGAA 3W15B 4YT0A 4CI1B 2M6IA 5AQUB 3RX6A 1S35A 5AQFB 5H6QB 2MBGA 4O4LE 3SOLA 4KMCA 2DL1A 2LSIA 4AXPA 4KX6A 3NZQA 5AQGB 1WFDA 4JI5T 5AQMB 3RYCE 1KFYA 2WWUA 4IE5A 3P50A 3AEGA 3RH3A 3V5SA 4X5TA 3ETUA 4XAXB 4DR2T 2RPAA 5DJQC 3ZT7A 4X66T 3TLTA 2LLYA 4OYKA 2CLYB 4EZ4A 3KVAA 4NIQA 3ZJ1A 5H6RB 3AEDA 1ZP0A 4PK4A 4PK6A 2XAJB 2W61A 3JAFA 4GOUA 5AQLB 2H3RA 4NUUA 4DR1T 3Q9DA 2BKPA 2BBJA 4ZHQE 1EZ3A 5LMUT 3SRZA 2ZM2A 4KHZF 4IDOA 2XQYA 2X9HA 2W2UA 2V7LA 4HFDA 3AVRA 3H3MA 3EDUA 2CBIA 2BG9A 3K3QC 1MMAA 2BS2A 5GONE 3N9QA 2EHOA 1V9DA 2XQ6A 4JI6T 5DQWA 5L3CB 2WMNA 3PU3A 2ACZA 3ZYMA 2QYWA 1HCIA 3OKQA 4IL9A 2UUBT 2V5CA 4AQFA 4V1Av 2N2NA 2FJAA 2ZM6T 2DWKA 3O1IA 4H9SE 2RA1A 1L0VA 4DUYT 3CMLA 2NW9A 5C8YE 2WS3A 4ZZBA 5ADXL 1XDPA 4O4JE 3SFEA 4JI7T 3AA1B 1XNRT 1QUUA 2IAKA 1WRDA 4Z91A 4A56A 3FZMB 3OJAA 2IW5B 1MIVA 2Z6EA 4M1PA 3RF1A 4E7SA 3FXEB 4LFCT 4PW8A 3V5UA 5F5WA 5EK4A 4PJMA 2B76A 2VK9A 1QLBA 3HI2A 4H9NC 2WM9A 3AXJB 3AE3A 5J0ZA 4JI2T 5L4HA 3PUVF 5HCMA 5JDMA 4KBMB 2EHOD 1YQ3A 3VKGA 4CI3B 4HFVA 2XAHB 2V5DA 3H37A 2D0UA 5LOVE 3FZFB
chains in the Genus database with same CATH topology
3L3PA 2BVMA 1AJ3A 3WI3A 3DJBA 2SPCA 5JDGA 3Q5WA 3ONXA 5KMGP 3C4WA 4UEMA 3P7IA 2NTXA 3HA4A 3F2EA 5FYMA 4X20E 2V1DB 2LSYA 2YK0A 2EHOB 2KWIB 1O3XA 3MZKB 3IEEA 3ZJ2A 3MJXA 4IE4A 2ZM8A 3ZMVB 1UX5A 1WYCA 3I0QA 1FIOA 3DP7A 3OYZA 3I1AA 1D1AA 1X79A 3I9YA 2LSKA 3EDVA 4ZS2A 1SA0E 3T8OA 3I9WA 4EZHA 3ANWB 5J2TE 4H9PC 4I50E 4J2CA 3AA0B 1HF8A 5EK3A 4DMVA 2K24A 2VB6A 5BMVE 4AI6A 2VASA 3JC6D 4CXWA 3ZC1A 3F57A 5CA0E 5LGTB 2E9XA 3AA7B 4F6RC 1US7B 1D0XA 2LOPA 3PURA 4BA9A 4EIWA 1YD8G 2HH7A 2X68A 4IIJE 3ZYKA 2C5JA 4EXTA 2B1EA 4Z8XA 3GN5B 3RKOA 1HTJF 5LBQB 3RYIE 2X51A 5HWXA 3KV6A 1WYBA 3M65A 2PJQA 2D2SA 5LA6E 2LSGA 4CQIA 1NAFA 2Y8DA 4OHFA 3UUXB 4ISSA 5FMNA 5DABA 5FY0A 2JMKA 2JMHA 2ZMAA 1B7TA 3GN5A 4L5GA 5JREA 4P0BA 1HX8A 2M67A 4P09A 2A3DA 5LHIB 4PFOA 1D0ZA 1U4QA 2GK9A 1FMVA 3CQGB 3LG7A 3NBXX 2LSJA 3IBPA 4O4HE 4AKRB 2K9AA 1VRBA 4UV9B 2NTYA 3OBVE 4DO0A 2P9BA 4X1YE 5HYAA 3BQKA 3B57A 2LJLA 3BQIA 1MNDA 4G2AA 1MMGA 4GYRA 4PNIA 3SS1A 5JDHA 3D0TA 2QGSA 4CXYA 3PUQA 4G63A 3KVBA 2JRKA 2DWGA 5JH7E 2H7OA 1IZNB 4PJNA 1MMDA 3ZMTB 2CXFA 5L3FB 2YINA 3AB3B 2PG8A 2IC9A 2CWOA 2L3LA 4PJJA 4YFSA 2CM0A 3LFMA 3S4UA 5A1LA 2JQQA 1S94A 2D5UA 3N5LA 3Q2MA 4PJLA 3NZPA 2WAUA 3C4XA 3O1HA 3FXDB 4OYJA 2NP9A 5HXHA 3UTKA 2DLRA 2QA7A 2XAFB 4GYSA 3VHLA 1ZKEA 2KNDA 3IF8B 1WR6A 2C5KT 4KP3C 5CB4E 1BR1A 3Q5XA 3C4ZA 3MACA 4QWNB 3O4XE 2NW8A 2N9DA 4JEUB 2ZLYA 2ODUA 2OA5A 3GWHA 3KV9A 4EYUA 3LK3B 4HN9A 4C90A 5LXTE 5JRCA 3PU8A 3OYXA 2MYSA 2RP4A 2CXLA 4MBQA 4U72A 1G8XA 3RC8A 3FHNA 2MOZA 3BK9A 2V7KA 4YHJA 3CX8B 2WBLA 3ZN0B 4EOZB 5FXXA 1NWMX 2XASB 5CA1E 4AKHA 4P0AA 4UVAB 2HPJA 3F31A 2PBIA 4QXCB 1HG2A 5LNKA 3WAJA 3QUJA 4UV8B 3CWZB 5HXEA 2K48A 4BJMA 2KXPB 2D0TA 2DI4A 4IHJE 4IE0A 2XAGB 2XTLA 3PTRB 1U5PA 4DMWA 2Q9QA 5JQGE 4IE7A 4OFZA 3LBXA 3H3AA 2X9XA 4N78D 1LVKA 2XHEB 3MA9A 4YJ2E 1MMNA 2V7IA 4MHCA 5J1GA 2KWHA 3ZMSB 4BJNA 2ZM0A 5JDNA 4MLKA 3KDSE 2E9XB 4UIGA 5M4YA 1Y64B 5HAXA 3E08A 3B13A 2G0UA 3HKBE 3NRYA 4GIWA 2CE7A 1YKEB 4UXNB 3HKEE 3N2OA 3O9XA 3CX6B 3ZMUB 2W63A 5L3GB 5FXWA 2DHRA 3AVSA 4U74A 4TN7B 1SHZC 2W00A 2YU2A 2UXNB 1YW0A 1MIWA 4ZOLE 4BAYB 5HXRA 3RRWA 3MKDA 2J1DG 1HS7A 2LOSA 2Q9QC 4AKGA 3EVYA 3UULA 4XBFB 2XAQB 3FB2A 3PUGA 2YEVC 5LYJE 1ZV4X 2CA5A 2LHNA 4ZS3A 1VOMA 5LG4A 3GMIA 2V7JA 1LKXA 2BZBA 5FY1A 4ANJA 3KFWX 4ILUA 3HR0A 3GA8A 4DNDA 2NOXA 3J7Yq 5LHGB 5IHYA 1IJ6A 1IAPA 3O1JA 3CVRA 3RYFE 4O2AE 3VU7H 2Y6XA 4TV8E 2DNXA 2E9XC 3K8PC 1OWAA 3HKCE 4UVCB 3FBZA 4JUYA 4XZCA 2VKJA 4WNKA 3DTOA 4ZI2C 2WSSV 4WBOA 4H9QC 5IYZE 1D1CA 2KLQA 3C64A 5LCYA 3ZN1B 5LJMA 1BR0A 3K3OA 4QKNA 2I59A 4H63V 3RC3A 3K3NA 5LHHB 2HPLA 3L09A 4O2BE 3ZCJA 1OXZA 4ERRA 4KUMB 4HGAA 3W15B 4H63H 1QSDA 4PK5A 2LE8A 4QXHB 4CI1B 1E1HB 3BQLA 1HFAA 3ZLIA 3RX6A 1S35A 5H6QB 2MBGA 3R6NA 5J2UE 5L3EB 4O4LE 3SOLA 2C5IT 3ETVA 3I0OA 3CKDA 4KMCA 2LSIA 5JR9B 5FXVA 4B6XA 4AXPA 2LHRA 3NZQA 2X9WA 5HXCA 3RYCE 2ODVA 2Q9QD 3R84B 3WAKA 5JRCB 2W62A 1YKHB 2WWUA 3KBUA 4IE5A 3MXZA 3VKHA 5JR9A 3CQXC 4H9OC 3RH3A 3V5SA 4ISTA 3ETUA 1D1BA 4XAXB 5LGNB 4CXXA 1UCUA 2X66A 5DQVA 2X9YA 4FJOA 2KINB 1ZEEA 2L8KA 5DJQC 5EZYE 5LBMA 3C50A 5E0OA 4OYKA 2CLYB 4EZ4A 3KVAA 3N9MA 2Q9QB 2E9XD 1HG5A 2BDEA 3LBXB 3U3IA 3ZJ1A 5H6RB 4GK5E 2V7MA 2Y48B 4PK4A 4FI5A 3CX7B 4PK6A 2XAJB 2W61A 3LK42 4ZI3C 1FMWA 3PUSA 4X1IE 3N9PA 4ZI2D 3CQCB 5JR9C 1IJ5A 3AAAB 4GOUA 5LP6E 4I55E 4NUVA 4QHOA 2H3RA 2H7VC 3PDYA 4JLEA 4NUUA 3C51A 5HWYA 3PE0A 5JDQA 3Q9DA 4MFRA 5F3JA 4DBQA 2CMRA 5FXZA 4EYYR 5LJNA 2VKHA 4TUYE 4ZHQE 1EZ3A 3FBLA 4TX5A 2UXXB 4I43B 3SRZA 3PUAA 2ZM2A 3CPZA 2XQYA 1ZHCA 3KV4A 2X9HA 2V7LA 4QX7B 3AVRA 3N9OA 5ETWA 3EDUA 3HL6A 4PAGA 4K0UA 4X1KE 4CI2B 3QC9A 3U78A 3K3QC 3UFEA 3QK6A 4HKAA 5KX5E 1MMAA 5KDMC 2CLYC 4QX8B 3KV5A 5TAOA 4YLHA 4L0RA 5GONE 2JPFA 3N9QA 2EHOA 1V9DA 4WW0A 2CXDA 2A72A 4UELA 4IE6A 2JJ9A 4UVBB 4CZZB 4PFPA 5DQWA 2YU1A 3ZMZB 5L3CB 2E8IA 3A5XA 4EB6E 2WMNA 3PU3A 2L9QA 3ZYMA 3ZEFB 4E7ZA 3SWHA 1HCIA 3ANWA 1BR2A 3E0ZA 3IHRA 4YJ3E 4I4TE 4O8SA 3OKQA 2VKDA 4IGUA 3AA6B 4AKIA 3C98B 2KT9A 4UF0B 3RRCA 4C91A 4AQFA 4V1Av 2N2NA 4QXBB 1BR4A 1H7CA 2KZ7B 3KBTA 3ZPOA 2WMOA 4ZI3D 2EHOC 2DWKA 4GK0E 4TZ4C 1WLXA 5FY7A 3UT5E 2CCQA 1LVFA 3O1IA 3EUHA 4H9SE 5JDFA 5F8PA 2X0LB 2K5BB 2RA1A 1Z0PA 5FP3A 1CUNA 3CMLA 4UF0A 1T98A 4AKLA 2NW9A 5C8YE 1MNEA 3ZC0A 2CWYA 5ADXL 2MTQA 5L2LA 3HKDE 3UUMA 2V26A 1FEWA 4OK0A 4O4JE 2KMFA 3ZYLA 3J9X1 2BVLA 2C0SA 3AA1B 3ZCIA 2ACXA 3RPUA 2LT3A 1QUUA 2IAKA 5FNVE 2VKOA 2ES0A 5L3DB 4AQFC 3E22E 5AFUL 1WRDA 4A56A 3N9NA 1KNZA 1MIYA 1KK7A 2VWAA 3KINB 4MALA 2DCFA 2N1GA 4JEHB 3UUNA 3OJAA 4L9IA 3TKLB 2LM9A 4EAHA 2IW5B 3N2GE 1MIVA 2Z6EA 5JVDE 4M1PA 3AAEB 4E7SA 4HEAA 2W0GA 2VL8A 3FXEB 3N9LA 4TV9E 5HXSA 4PW8A 3V5UA 1UX4A 3RYHE 2A2FX 5EK4A 4PJMA 2VK9A 4IDZA 3LK2B 3LJCA 4ASKA 3JC6C 4DVDA 3HI2A 4AQGA 3N2KE 2LEHA 4H9NC 3NRXA 2CEAA 4WBNE 4H9RC 2WM9A 4O4IE 1D0YA 2NWBA 1LRZA 5L3BB 3ESLA 2X67A 4ADZA 5EK2A 2IC6A 5JDMA 4KBMB 2EHOD 3MK7C 3VKGA 4CI3B 2NW7A 4HFVA 2XUEA 3AAIA 2XAHB 3P8CD 4HTEA 4HE8A 2PFVA 3H37A 4ZI7E 2D0UA 4DBRA 5LOVE 5JDLA 1G73A 5LGUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EDV A;  1AJ3 A;  1WLX A;  2SPC A;  3LBX B;  3UUN A;  2ODV A;  1CUN A;  3F31 A;  1HCI A;  3UUM A;  2ODU A;  1U5P A;  1U4Q A;  1QUU A;  3LBX A;  1S35 A;  1OWA A;  3PE0 A;  3UUL A;  3FB2 A; 
#chains in the Genus database with same CATH topology
 2BVM A;  4X62 T;  2SPC A;  3Q5W A;  2JIW A;  3C4W A;  4ILB A;  3P7I A;  4EGW A;  3TLU A;  3HA4 A;  3F2E A;  2NR4 A;  2V1D B;  4Z90 A;  4IE4 A;  4B3T T;  1WYC A;  3I0Q A;  1FIO A;  3OYZ A;  4B3R T;  2H89 A;  4H9P C;  4DMV A;  1N33 T;  2VB6 A;  3RIU A;  3JC6 D;  4CXW A;  3TLS A;  3AA7 B;  4F6R C;  3PUR A;  4EIW A;  1YD8 G;  2C5J A;  2WDQ A;  5HWX A;  1XDO A;  4DUZ T;  2D2S A;  5LA6 E;  4JV5 T;  3RQU A;  2CBJ A;  3UQ4 A;  4NXN T;  2JMK A;  2JMH A;  4L5G A;  1B7T A;  5JRE A;  2M67 A;  5AQP B;  5LHI B;  1CHU A;  1U4Q A;  4B3M T;  3CQG B;  2XQA A;  4AKR B;  4DO0 A;  2P9B A;  4X1Y E;  4PNI A;  1KEY A;  3PUQ A;  2H7O A;  4PJN A;  2CXF A;  2LKH A;  2PG8 A;  1DU2 A;  3LFM A;  3PJA A;  2D5U A;  1T7S A;  3FXD B;  5HXH A;  4A5X A;  4GYS A;  4KP3 C;  3RIA A;  4GKJ T;  1HNZ T;  4CN4 A;  4YSX A;  4A97 A;  4DR7 T;  5AQO B;  2M6B A;  2OA5 A;  3VR8 A;  3LK3 B;  5LXT E;  5JRC A;  3OYX A;  3OPC A;  2LRL A;  2CXL A;  5AQR B;  2MOZ A;  1I6Z A;  3CX8 B;  3ZN0 B;  5FXX A;  2PBI A;  5LNK A;  3QUJ A;  4UV8 B;  5HXE A;  4YXD A;  4BJM A;  2KXP B;  3PUX F;  2DI4 A;  2XTL A;  4JI8 T;  2Q9Q A;  4OFZ A;  3H3A A;  2X9X A;  3MA9 A;  4YJ2 E;  5BR8 T;  4MHC A;  2KWH A;  4BJN A;  2ZM0 A;  5JDN A;  2E9X B;  4LF8 T;  5M4Y A;  2J47 A;  3B13 A;  2G0U A;  3NRY A;  4UXN B;  1OED B;  3HKE E;  3O9X A;  3CX6 B;  3ZMU B;  5L3G B;  1UGO A;  2UXN B;  4ZOL E;  5HXR A;  3RRW A;  2XSA A;  3MKD A;  3EVY A;  2XAQ B;  3FB2 A;  3PUG A;  5LYJ E;  2LHN A;  3Q5E A;  4U7Y A;  4ANJ A;  5C3J A;  3KFW X;  2XQ9 A;  3AEA A;  4HFI A;  1IJ6 A;  4Q25 A;  5HEO A;  3CVR A;  3RYF E;  1W09 A;  4U31 A;  2VKJ A;  3DTO A;  4ZI2 C;  2WSS V;  3ONJ A;  5LCY A;  1D1C A;  2KLQ A;  3NKZ A;  3K3O A;  2OLT A;  2I59 A;  4AQY T;  2BKN A;  4H63 H;  4ZXL A;  5AQI B;  3M3Z B;  1E1H B;  1HFA A;  4HWC A;  5J2U E;  5L3E B;  3I0O A;  4B6X A;  4DV6 T;  2LHR A;  2X9W A;  5HXC A;  2Q9Q D;  1E2A A;  2WQY A;  2FJD A;  1YKH B;  4DR3 T;  3KBU A;  3L8R A;  4H9O C;  4CXX A;  5DQV A;  2OV9 A;  1T8B A;  3A7M A;  4FJO A;  2XM2 A;  5EZY E;  5LBM A;  3C50 A;  2UXC T;  3N9M A;  2E9X D;  1HG5 A;  2BDE A;  4GK5 E;  2V7M A;  2V6Y B;  3PUS A;  3N9P A;  3CQC B;  1IJ5 A;  2WZH A;  3PDY A;  3FZK B;  3ZSS A;  4JLE A;  3C51 A;  5JDQ A;  5F3J A;  5LMN T;  2LKG A;  5LJN A;  4YY3 T;  2VKH A;  4TX5 A;  5FL1 A;  2XQ7 A;  4QX7 B;  2PTF A;  3N9O A;  1KNP A;  4EV6 A;  3UFE A;  5KX5 E;  5KDM C;  4QX8 B;  4YLH A;  2JPF A;  4UEL A;  2YDS A;  2YU1 A;  4DV2 T;  3A5X A;  4EB6 E;  2L9Q A;  3P4P A;  3RQW A;  2R6G F;  4F8H A;  3ANW A;  1BR2 A;  3E0Z A;  4QH1 A;  3C98 B;  3IA3 A;  4TWF A;  3AE7 A;  1BR4 A;  3KBT A;  3P4R A;  4TZ4 C;  2CCQ A;  2X0L B;  1Z0P A;  5FP3 A;  4AKL A;  1T98 A;  2CWY A;  3ONL C;  4HWD A;  3J9X 1;  2C0S A;  4YTN A;  3RPU A;  4LF7 T;  2ES0 A;  2W66 A;  4WZX A;  1KK7 A;  1JNZ A;  3Q5D A;  4CN6 A;  5JVD E;  4HWH A;  1I94 T;  2I0M A;  2A2F X;  2E5V A;  1HNX T;  4IDZ A;  4ASK A;  2BS3 A;  4AQG A;  3N2K E;  3NRX A;  4TNV A;  5L3B B;  3ESL A;  2X67 A;  3SFD A;  2XUE A;  2HHH T;  4HE8 A;  2WB5 A;  5FVL A;  3L3P A;  4DV5 T;  3DJB A;  3UQ7 A;  2V8S V;  2BG9 B;  3ONX A;  5KMG P;  3PJA J;  2NTX A;  5FYM A;  2I6H A;  2LSY A;  2EHO B;  2KWI B;  1O3X A;  3X1D A;  3MZK B;  3ZJ2 A;  3MJX A;  3ZMV B;  3AE1 A;  1UX5 A;  3I1A A;  1W9R A;  1X79 A;  3EDV A;  1SA0 E;  3I9W A;  4I50 E;  3AA0 B;  5EK3 A;  3AEF A;  5BMV E;  2VAS A;  4LF5 T;  1US7 B;  1D0X A;  2LOP A;  2JQH A;  2W4X A;  4HWF A;  2X68 A;  2WY2 A;  3RKO A;  2E2A A;  2X51 A;  4AIS A;  1J5E T;  5AQK B;  4JI4 T;  3AE8 A;  2XQ4 A;  1NAF A;  2Y8D A;  3UUX B;  5FMN A;  4HWI B;  2ZMA A;  4P0B A;  1HX8 A;  2A3D A;  3EAM A;  2XQ5 A;  3LG7 A;  3RLF F;  2LSJ A;  4O4H E;  5HYA A;  3B57 A;  3BQK A;  1MND A;  4G2A A;  1MMG A;  3SS1 A;  1HNW T;  4G63 A;  1MMD A;  5L3F B;  2YIN A;  4JYA T;  2AXD S;  3AB3 B;  4IDQ A;  5ABH A;  2JQQ A;  3AE6 A;  1S94 A;  3N5L A;  3Q2M A;  3NZP A;  2WAU A;  3AEE A;  4YTP A;  2DLR A;  2XAF B;  3RKG A;  2J62 A;  2KND A;  5FVK A;  4QWN B;  4JEU B;  4U2Z A;  4K0K T;  3GWH A;  3KV9 A;  3ZST A;  4EYU A;  4HN9 A;  3PU8 A;  2MYS A;  4YSY A;  3RC8 A;  2WU2 A;  4YHJ A;  1NWM X;  2XAS B;  4P0A A;  1NEN A;  4UVA B;  2XQ8 A;  3F31 A;  1YXR A;  1HG2 A;  4IE0 A;  2X0Y A;  1U5P A;  5JQG E;  1GQE A;  3LBX A;  4N78 D;  2XHE B;  5C2T A;  1MMN A;  5J1G A;  3ZMS B;  2FJE A;  3JCF A;  4GIW A;  3TLW A;  1YKE B;  2W63 A;  5FXW A;  3OVU A;  4U74 A;  2IDO B;  4QH4 A;  3VRB A;  4BAY B;  4AKG A;  1J5W A;  2YEV C;  1ZOY A;  4ZS3 A;  1VOM A;  1W0A A;  5FY1 A;  3K1S A;  3FZH B;  3UU5 A;  4ILU A;  5IUX A;  3PV0 F;  3GA8 A;  2NOX A;  1E7P A;  3J7Y q;  5LHG B;  5IHY A;  4JI3 T;  1IAP A;  4TV8 E;  1OWA A;  1Z8U A;  3HKC E;  4UVC B;  3FBZ A;  2H88 A;  4XZC A;  1IBK T;  4WNK A;  3C64 A;  2HN1 A;  5LJM A;  4H63 V;  3K3N A;  3L09 A;  4O2B E;  4KUM B;  3AEB A;  1QSD A;  2VQF T;  2LE8 A;  4QXH B;  5AQV B;  3T1Y T;  3UU4 A;  3ZLI A;  3R6N A;  2LRK A;  4ZEY A;  2JQ9 A;  3CKD A;  2UXB T;  1SE7 A;  4JI1 T;  5IWA T;  2ODV A;  3WAK A;  5JRC B;  3CK6 A;  3MXZ A;  3VKH A;  3LSV A;  5ABF A;  3B5M A;  2XM1 A;  4IST A;  5LGN B;  1UCU A;  2X66 A;  3NVO A;  1ZEE A;  2L8K A;  5ABE A;  1OED E;  2Q9Q B;  4ILA A;  3OTO T;  2Y48 B;  3LK4 2;  4ZI3 C;  4X1I E;  4ZI2 D;  1M7K A;  5JR9 C;  4I55 E;  4NUV A;  2H7V C;  3RHW A;  5KXJ A;  5HWY A;  5FXZ A;  4EYY R;  1X9B A;  3CPZ A;  5ETW A;  3HL6 A;  4PAG A;  4CI2 B;  2V6X A;  3QK6 A;  4HKA A;  5TAO A;  2CXD A;  2A72 A;  2JJ9 A;  4IDP A;  4UVB B;  4CZZ B;  4PFP A;  2E8I A;  4COF A;  2YKS A;  4CN1 A;  4E7Z A;  2WZI A;  3SWH A;  1SUM B;  2VKD A;  3QOF A;  3AA6 B;  4IGU A;  4AKI A;  2KT9 A;  1KF6 A;  1H7C A;  3ZPO A;  2WMO A;  4GK0 E;  5AQJ B;  1WLX A;  5HEJ A;  3EUH A;  5F8P A;  2K5B B;  3ABV A;  1MNE A;  2MTQ A;  3HKD E;  3UUM A;  4KHP T;  3RI5 A;  2BVL A;  4DR5 T;  3ZCI A;  4OX9 T;  2IUB A;  2VKO A;  5AFU L;  3KIN B;  2DCF A;  2N1G A;  1N36 T;  3UUN A;  4ZZC A;  3TKL B;  5LB7 B;  2LM9 A;  3N2G E;  2VL8 A;  1UX4 A;  3AEC A;  3LJC A;  4I0U A;  1N32 T;  2LEH A;  3ZT5 A;  2WU5 A;  3VRA A;  5EK2 A;  2CHO A;  2WP9 A;  4ADZ A;  3MK7 C;  2NW7 A;  2QVA A;  3P8C D;  4DBR A;  4YHH T;  3WI3 A;  5L4E A;  4DV0 T;  5JTG A;  4UEM A;  4LF4 T;  5CFB A;  1XMO T;  4JBW F;  3IEE A;  4YSZ A;  2ZM8 A;  2D9D A;  1D1A A;  3I9Y A;  2LSK A;  3T8O A;  4EZH A;  3ANW B;  5J2T E;  3EAB A;  2IHR 1;  2K24 A;  4U7I A;  1N34 T;  3ZC1 A;  3F57 A;  5CA0 E;  4TWD A;  4BA9 A;  2HH7 A;  4IIJ E;  4EXT A;  2B1E A;  3GN5 B;  5LBQ B;  1WYB A;  2VL0 A;  3M65 A;  2LSG A;  4OHF A;  3UU6 A;  4JI0 T;  3GN5 A;  4DV4 T;  2FUP A;  3P4S A;  4PFO A;  2GK9 A;  1FMV A;  3NBX X;  2K9A A;  1VRB A;  4UV9 B;  1OED C;  3OBV E;  2LJL A;  4GYR A;  5JDH A;  3D0T A;  2QGS A;  4CXY A;  5AQT B;  3KVB A;  2JRK A;  3ZKR A;  5L47 A;  3P4Q A;  5JH7 E;  4IDN A;  5CGM A;  2QRX A;  2W67 A;  2IC9 A;  3UU3 A;  4YFS A;  2CM0 A;  3S4U A;  5A1L A;  2BG9 E;  2CRB A;  3QB5 K;  4PJL A;  3C4X A;  3AE2 A;  4OYJ A;  3UTK A;  2QA7 A;  3VHL A;  2XPK A;  1WR6 A;  2C5K T;  5CB4 E;  3MAC A;  3O4X E;  1M62 A;  2NW8 A;  2ODU A;  4DR4 T;  5AQH B;  2V7K A;  4DV7 T;  3PUZ F;  4AKH A;  4NXM T;  2HPJ A;  3LDQ B;  3CWZ B;  5LG3 A;  4X64 T;  2K48 A;  2D0T A;  4IHJ E;  2XAG B;  3PTR B;  2VVN A;  4IE7 A;  1XZY A;  3KDS E;  1Y64 B;  5HAX A;  3E08 A;  4WYV A;  2CE7 A;  1W0B A;  1VCT A;  2DHR A;  2W00 A;  1MIW A;  3CIR A;  2J1D G;  2UUA T;  2J4G A;  4XBF B;  2CA5 A;  2FJB A;  3GMI A;  2V7J A;  1LKX A;  3HR0 A;  2XY8 B;  2MPK A;  3O1J A;  3VU7 H;  2DNX A;  4DV3 T;  4HFB A;  4JUY A;  3EI0 A;  4H9Q C;  5IYZ E;  3G06 A;  1BR0 A;  2WDV A;  4QKN A;  2HN2 A;  3RC3 A;  5LHH B;  2HPL A;  3ZCJ A;  3PUW F;  4PK5 A;  4LMK A;  4LMJ A;  3BQL A;  2C5I T;  3ETV A;  4X65 T;  1IBL T;  5JR9 B;  5FXV A;  5AQQ B;  4TNW A;  1WR0 A;  3R84 B;  2W62 A;  5JR9 A;  2MAW A;  3CQX C;  1D1B A;  2XJ7 A;  2X9Y A;  2XSB A;  2KIN B;  2BKO A;  1JNR A;  5E0O A;  2E5L T;  2BBH A;  4LF9 T;  3LBX B;  3U3I A;  4FI5 A;  3CX7 B;  1FMW A;  4AIU A;  3AE9 A;  5LP6 E;  3AAA B;  3AXJ A;  4QHO A;  3PE0 A;  4MFR A;  4DBQ A;  2CMR A;  3PUY F;  4P1N A;  4TUY E;  3FBL A;  1R8I A;  2UXX B;  4I43 B;  1J1J A;  3PUA A;  3RIF A;  1ZHC A;  3KV4 A;  4EED A;  3A8Y C;  4K0U A;  4X1K E;  3QC9 A;  2LM2 A;  3U78 A;  2CLY C;  3KV5 A;  4L0R A;  4WW0 A;  4IE6 A;  3ZMZ B;  1YQ4 A;  3ZEF B;  1HX1 B;  3IHR A;  4YJ3 E;  4I4T E;  4O8S A;  2BG9 C;  4UF0 B;  2VUR A;  3JAD A;  2WWV A;  3RRC A;  3EHZ A;  4C91 A;  4QXB B;  2KZ7 B;  4ZI3 D;  2EHO C;  3UT5 E;  5FY7 A;  1LVF A;  5JDF A;  1IBM T;  1CUN A;  1VCS A;  4UF0 A;  3ZT6 A;  3ZC0 A;  5L2L A;  2V26 A;  1FEW A;  4OK0 A;  5HEG A;  3QB5 A;  2KMF A;  3ZYL A;  1XWM A;  5ABG A;  2ACX A;  2LT3 A;  5FNV E;  5L3D B;  1XMQ T;  4AQF C;  3E22 E;  5ABF B;  3N9N A;  1KNZ A;  1MIY A;  2VWA A;  2WDR A;  4MAL A;  2UU9 T;  1T72 A;  3AE4 A;  4JEH B;  4L9I A;  4EAH A;  3P4W A;  3UU8 A;  3AAE B;  4HEA A;  2W0G A;  3N9L A;  4TV9 E;  5HXS A;  3TLV A;  3RYH E;  4HFE A;  3LK2 B;  2XZE A;  3JC6 C;  4DVD A;  4LF6 T;  2CEA A;  4WBN E;  4H9R C;  4O4I E;  1D0Y A;  2NWB A;  4U33 A;  1LRZ A;  4IL4 A;  1HR0 T;  1XNQ T;  4DID B;  2IC6 A;  4U2Y A;  3FZL B;  3AAI A;  4HTE A;  4A98 A;  2YN6 A;  2PFV A;  4IRE A;  4ZI7 E;  5JDL A;  1G73 A;  2F4V T;  5LGU B;  2VQE T;  1AJ3 A;  5JDG A;  3NWI A;  4X20 E;  1WCR A;  2YK0 A;  5HEU A;  3DP7 A;  4ZS2 A;  2UXD T;  2CPT A;  2WCA A;  4J2C A;  1HF8 A;  4AI6 A;  3UFG A;  2AE9 A;  5LGT B;  2E9X A;  2XQ3 A;  1UUR A;  2A9U A;  3ZYK A;  4Z8X A;  1OED A;  4IT4 A;  1HTJ F;  3RYI E;  4EEB A;  3KV6 A;  2PJQ A;  2UUC T;  5HEH A;  4DR6 T;  5AQS B;  4CQI A;  4LML A;  4ISS A;  5DAB A;  5FY0 A;  3L39 A;  3RIU C;  3UUB A;  4P09 A;  1D0Z A;  4HFC A;  3IBP A;  4YTM A;  5HCJ A;  2NTY A;  5CJ5 A;  1UK5 A;  3BQI A;  4TWH A;  2FBW A;  4LFB T;  2X0H A;  2DWG A;  1IZN B;  3ZMT B;  2YDR A;  2YDQ A;  4DV1 T;  1NEK A;  2CWO A;  2L3L A;  4PJJ A;  4ILC A;  5FKY A;  3VR9 A;  3O1H A;  4NPP A;  1UUS A;  2NP9 A;  2IIU A;  2KSR A;  3QNU A;  1ZKE A;  3IF8 B;  2VVS A;  1BR1 A;  3Q5X A;  3C4Z A;  2N9D A;  2ZLY A;  4LFA T;  4HFH A;  1FJG T;  4C90 A;  3AE5 A;  2BS4 A;  4MBQ A;  2RP4 A;  2CHN A;  4U72 A;  1G8X A;  3FHN A;  3BK9 A;  2IML A;  2WBL A;  3JAE A;  4EOZ B;  5AQN B;  5CA1 E;  1Y01 A;  4QXC B;  3WAJ A;  4KI0 F;  4GKK T;  4DMW A;  4U3C A;  4B3S T;  1LVK A;  2V7I A;  2K3W A;  4QH5 A;  2V6Y A;  4MLK A;  4UIG A;  5FL0 A;  3HKB E;  3N2O A;  3AVS A;  4TN7 B;  1SHZ C;  2YU2 A;  2JQK A;  1YW0 A;  1HS7 A;  2LOS A;  2Q9Q C;  3UUL A;  1ZV4 X;  5LG4 A;  2BZB A;  4DND A;  3RGL A;  1KNR A;  4O2A E;  4UR9 A;  2Y6X A;  2E9X C;  3K8P C;  2YOE A;  3T1H T;  4WBO A;  3ZN1 B;  1OXZ A;  4ERR A;  4HGA A;  3W15 B;  4YT0 A;  4CI1 B;  2M6I A;  5AQU B;  3RX6 A;  1S35 A;  5AQF B;  5H6Q B;  2MBG A;  4O4L E;  3SOL A;  4KMC A;  2DL1 A;  2LSI A;  4AXP A;  4KX6 A;  3NZQ A;  5AQG B;  1WFD A;  4JI5 T;  5AQM B;  3RYC E;  1KFY A;  2WWU A;  4IE5 A;  3P50 A;  3AEG A;  3RH3 A;  3V5S A;  4X5T A;  3ETU A;  4XAX B;  4DR2 T;  2RPA A;  5DJQ C;  3ZT7 A;  4X66 T;  3TLT A;  2LLY A;  4OYK A;  2CLY B;  4EZ4 A;  3KVA A;  4NIQ A;  3ZJ1 A;  5H6R B;  3AED A;  1ZP0 A;  4PK4 A;  4PK6 A;  2XAJ B;  2W61 A;  3JAF A;  4GOU A;  5AQL B;  2H3R A;  4NUU A;  4DR1 T;  3Q9D A;  2BKP A;  2BBJ A;  4ZHQ E;  1EZ3 A;  5LMU T;  3SRZ A;  2ZM2 A;  4KHZ F;  4IDO A;  2XQY A;  2X9H A;  2W2U A;  2V7L A;  4HFD A;  3AVR A;  3H3M A;  3EDU A;  2CBI A;  2BG9 A;  3K3Q C;  1MMA A;  2BS2 A;  5GON E;  3N9Q A;  2EHO A;  1V9D A;  2XQ6 A;  4JI6 T;  5DQW A;  5L3C B;  2WMN A;  3PU3 A;  2ACZ A;  3ZYM A;  2QYW A;  1HCI A;  3OKQ A;  4IL9 A;  2UUB T;  2V5C A;  4AQF A;  4V1A v;  2N2N A;  2FJA A;  2ZM6 T;  2DWK A;  3O1I A;  4H9S E;  2RA1 A;  1L0V A;  4DUY T;  3CML A;  2NW9 A;  5C8Y E;  2WS3 A;  4ZZB A;  5ADX L;  1XDP A;  4O4J E;  3SFE A;  4JI7 T;  3AA1 B;  1XNR T;  1QUU A;  2IAK A;  1WRD A;  4Z91 A;  4A56 A;  3FZM B;  3OJA A;  2IW5 B;  1MIV A;  2Z6E A;  4M1P A;  3RF1 A;  4E7S A;  3FXE B;  4LFC T;  4PW8 A;  3V5U A;  5F5W A;  5EK4 A;  4PJM A;  2B76 A;  2VK9 A;  1QLB A;  3HI2 A;  4H9N C;  2WM9 A;  3AXJ B;  3AE3 A;  5J0Z A;  4JI2 T;  5L4H A;  3PUV F;  5HCM A;  5JDM A;  4KBM B;  2EHO D;  1YQ3 A;  3VKG A;  4CI3 B;  4HFV A;  2XAH B;  2V5D A;  3H37 A;  2D0U A;  5LOV E;  3FZF B; 
#chains in the Genus database with same CATH homology
 3L3P A;  2BVM A;  1AJ3 A;  3WI3 A;  3DJB A;  2SPC A;  5JDG A;  3Q5W A;  3ONX A;  5KMG P;  3C4W A;  4UEM A;  3P7I A;  2NTX A;  3HA4 A;  3F2E A;  5FYM A;  4X20 E;  2V1D B;  2LSY A;  2YK0 A;  2EHO B;  2KWI B;  1O3X A;  3MZK B;  3IEE A;  3ZJ2 A;  3MJX A;  4IE4 A;  2ZM8 A;  3ZMV B;  1UX5 A;  1WYC A;  3I0Q A;  1FIO A;  3DP7 A;  3OYZ A;  3I1A A;  1D1A A;  1X79 A;  3I9Y A;  2LSK A;  3EDV A;  4ZS2 A;  1SA0 E;  3T8O A;  3I9W A;  4EZH A;  3ANW B;  5J2T E;  4H9P C;  4I50 E;  4J2C A;  3AA0 B;  1HF8 A;  5EK3 A;  4DMV A;  2K24 A;  2VB6 A;  5BMV E;  4AI6 A;  2VAS A;  3JC6 D;  4CXW A;  3ZC1 A;  3F57 A;  5CA0 E;  5LGT B;  2E9X A;  3AA7 B;  4F6R C;  1US7 B;  1D0X A;  2LOP A;  3PUR A;  4BA9 A;  4EIW A;  1YD8 G;  2HH7 A;  2X68 A;  4IIJ E;  3ZYK A;  2C5J A;  4EXT A;  2B1E A;  4Z8X A;  3GN5 B;  3RKO A;  1HTJ F;  5LBQ B;  3RYI E;  2X51 A;  5HWX A;  3KV6 A;  1WYB A;  3M65 A;  2PJQ A;  2D2S A;  5LA6 E;  2LSG A;  4CQI A;  1NAF A;  2Y8D A;  4OHF A;  3UUX B;  4ISS A;  5FMN A;  5DAB A;  5FY0 A;  2JMK A;  2JMH A;  2ZMA A;  1B7T A;  3GN5 A;  4L5G A;  5JRE A;  4P0B A;  1HX8 A;  2M67 A;  4P09 A;  2A3D A;  5LHI B;  4PFO A;  1D0Z A;  1U4Q A;  2GK9 A;  1FMV A;  3CQG B;  3LG7 A;  3NBX X;  2LSJ A;  3IBP A;  4O4H E;  4AKR B;  2K9A A;  1VRB A;  4UV9 B;  2NTY A;  3OBV E;  4DO0 A;  2P9B A;  4X1Y E;  5HYA A;  3BQK A;  3B57 A;  2LJL A;  3BQI A;  1MND A;  4G2A A;  1MMG A;  4GYR A;  4PNI A;  3SS1 A;  5JDH A;  3D0T A;  2QGS A;  4CXY A;  3PUQ A;  4G63 A;  3KVB A;  2JRK A;  2DWG A;  5JH7 E;  2H7O A;  1IZN B;  4PJN A;  1MMD A;  3ZMT B;  2CXF A;  5L3F B;  2YIN A;  3AB3 B;  2PG8 A;  2IC9 A;  2CWO A;  2L3L A;  4PJJ A;  4YFS A;  2CM0 A;  3LFM A;  3S4U A;  5A1L A;  2JQQ A;  1S94 A;  2D5U A;  3N5L A;  3Q2M A;  4PJL A;  3NZP A;  2WAU A;  3C4X A;  3O1H A;  3FXD B;  4OYJ A;  2NP9 A;  5HXH A;  3UTK A;  2DLR A;  2QA7 A;  2XAF B;  4GYS A;  3VHL A;  1ZKE A;  2KND A;  3IF8 B;  1WR6 A;  2C5K T;  4KP3 C;  5CB4 E;  1BR1 A;  3Q5X A;  3C4Z A;  3MAC A;  4QWN B;  3O4X E;  2NW8 A;  2N9D A;  4JEU B;  2ZLY A;  2ODU A;  2OA5 A;  3GWH A;  3KV9 A;  4EYU A;  3LK3 B;  4HN9 A;  4C90 A;  5LXT E;  5JRC A;  3PU8 A;  3OYX A;  2MYS A;  2RP4 A;  2CXL A;  4MBQ A;  4U72 A;  1G8X A;  3RC8 A;  3FHN A;  2MOZ A;  3BK9 A;  2V7K A;  4YHJ A;  3CX8 B;  2WBL A;  3ZN0 B;  4EOZ B;  5FXX A;  1NWM X;  2XAS B;  5CA1 E;  4AKH A;  4P0A A;  4UVA B;  2HPJ A;  3F31 A;  2PBI A;  4QXC B;  1HG2 A;  5LNK A;  3WAJ A;  3QUJ A;  4UV8 B;  3CWZ B;  5HXE A;  2K48 A;  4BJM A;  2KXP B;  2D0T A;  2DI4 A;  4IHJ E;  4IE0 A;  2XAG B;  2XTL A;  3PTR B;  1U5P A;  4DMW A;  2Q9Q A;  5JQG E;  4IE7 A;  4OFZ A;  3LBX A;  3H3A A;  2X9X A;  4N78 D;  1LVK A;  2XHE B;  3MA9 A;  4YJ2 E;  1MMN A;  2V7I A;  4MHC A;  5J1G A;  2KWH A;  3ZMS B;  4BJN A;  2ZM0 A;  5JDN A;  4MLK A;  3KDS E;  2E9X B;  4UIG A;  5M4Y A;  1Y64 B;  5HAX A;  3E08 A;  3B13 A;  2G0U A;  3HKB E;  3NRY A;  4GIW A;  2CE7 A;  1YKE B;  4UXN B;  3HKE E;  3N2O A;  3O9X A;  3CX6 B;  3ZMU B;  2W63 A;  5L3G B;  5FXW A;  2DHR A;  3AVS A;  4U74 A;  4TN7 B;  1SHZ C;  2W00 A;  2YU2 A;  2UXN B;  1YW0 A;  1MIW A;  4ZOL E;  4BAY B;  5HXR A;  3RRW A;  3MKD A;  2J1D G;  1HS7 A;  2LOS A;  2Q9Q C;  4AKG A;  3EVY A;  3UUL A;  4XBF B;  2XAQ B;  3FB2 A;  3PUG A;  2YEV C;  5LYJ E;  1ZV4 X;  2CA5 A;  2LHN A;  4ZS3 A;  1VOM A;  5LG4 A;  3GMI A;  2V7J A;  1LKX A;  2BZB A;  5FY1 A;  4ANJ A;  3KFW X;  4ILU A;  3HR0 A;  3GA8 A;  4DND A;  2NOX A;  3J7Y q;  5LHG B;  5IHY A;  1IJ6 A;  1IAP A;  3O1J A;  3CVR A;  3RYF E;  4O2A E;  3VU7 H;  2Y6X A;  4TV8 E;  2DNX A;  2E9X C;  3K8P C;  1OWA A;  3HKC E;  4UVC B;  3FBZ A;  4JUY A;  4XZC A;  2VKJ A;  4WNK A;  3DTO A;  4ZI2 C;  2WSS V;  4WBO A;  4H9Q C;  5IYZ E;  1D1C A;  2KLQ A;  3C64 A;  5LCY A;  3ZN1 B;  5LJM A;  1BR0 A;  3K3O A;  4QKN A;  2I59 A;  4H63 V;  3RC3 A;  3K3N A;  5LHH B;  2HPL A;  3L09 A;  4O2B E;  3ZCJ A;  1OXZ A;  4ERR A;  4KUM B;  4HGA A;  3W15 B;  4H63 H;  1QSD A;  4PK5 A;  2LE8 A;  4QXH B;  4CI1 B;  1E1H B;  3BQL A;  1HFA A;  3ZLI A;  3RX6 A;  1S35 A;  5H6Q B;  2MBG A;  3R6N A;  5J2U E;  5L3E B;  4O4L E;  3SOL A;  2C5I T;  3ETV A;  3I0O A;  3CKD A;  4KMC A;  2LSI A;  5JR9 B;  5FXV A;  4B6X A;  4AXP A;  2LHR A;  3NZQ A;  2X9W A;  5HXC A;  3RYC E;  2ODV A;  2Q9Q D;  3R84 B;  3WAK A;  5JRC B;  2W62 A;  1YKH B;  2WWU A;  3KBU A;  4IE5 A;  3MXZ A;  3VKH A;  5JR9 A;  3CQX C;  4H9O C;  3RH3 A;  3V5S A;  4IST A;  3ETU A;  1D1B A;  4XAX B;  5LGN B;  4CXX A;  1UCU A;  2X66 A;  5DQV A;  2X9Y A;  4FJO A;  2KIN B;  1ZEE A;  2L8K A;  5DJQ C;  5EZY E;  5LBM A;  3C50 A;  5E0O A;  4OYK A;  2CLY B;  4EZ4 A;  3KVA A;  3N9M A;  2Q9Q B;  2E9X D;  1HG5 A;  2BDE A;  3LBX B;  3U3I A;  3ZJ1 A;  5H6R B;  4GK5 E;  2V7M A;  2Y48 B;  4PK4 A;  4FI5 A;  3CX7 B;  4PK6 A;  2XAJ B;  2W61 A;  3LK4 2;  4ZI3 C;  1FMW A;  3PUS A;  4X1I E;  3N9P A;  4ZI2 D;  3CQC B;  5JR9 C;  1IJ5 A;  3AAA B;  4GOU A;  5LP6 E;  4I55 E;  4NUV A;  4QHO A;  2H3R A;  2H7V C;  3PDY A;  4JLE A;  4NUU A;  3C51 A;  5HWY A;  3PE0 A;  5JDQ A;  3Q9D A;  4MFR A;  5F3J A;  4DBQ A;  2CMR A;  5FXZ A;  4EYY R;  5LJN A;  2VKH A;  4TUY E;  4ZHQ E;  1EZ3 A;  3FBL A;  4TX5 A;  2UXX B;  4I43 B;  3SRZ A;  3PUA A;  2ZM2 A;  3CPZ A;  2XQY A;  1ZHC A;  3KV4 A;  2X9H A;  2V7L A;  4QX7 B;  3AVR A;  3N9O A;  5ETW A;  3EDU A;  3HL6 A;  4PAG A;  4K0U A;  4X1K E;  4CI2 B;  3QC9 A;  3U78 A;  3K3Q C;  3UFE A;  3QK6 A;  4HKA A;  5KX5 E;  1MMA A;  5KDM C;  2CLY C;  4QX8 B;  3KV5 A;  5TAO A;  4YLH A;  4L0R A;  5GON E;  2JPF A;  3N9Q A;  2EHO A;  1V9D A;  4WW0 A;  2CXD A;  2A72 A;  4UEL A;  4IE6 A;  2JJ9 A;  4UVB B;  4CZZ B;  4PFP A;  5DQW A;  2YU1 A;  3ZMZ B;  5L3C B;  2E8I A;  3A5X A;  4EB6 E;  2WMN A;  3PU3 A;  2L9Q A;  3ZYM A;  3ZEF B;  4E7Z A;  3SWH A;  1HCI A;  3ANW A;  1BR2 A;  3E0Z A;  3IHR A;  4YJ3 E;  4I4T E;  4O8S A;  3OKQ A;  2VKD A;  4IGU A;  3AA6 B;  4AKI A;  3C98 B;  2KT9 A;  4UF0 B;  3RRC A;  4C91 A;  4AQF A;  4V1A v;  2N2N A;  4QXB B;  1BR4 A;  1H7C A;  2KZ7 B;  3KBT A;  3ZPO A;  2WMO A;  4ZI3 D;  2EHO C;  2DWK A;  4GK0 E;  4TZ4 C;  1WLX A;  5FY7 A;  3UT5 E;  2CCQ A;  1LVF A;  3O1I A;  3EUH A;  4H9S E;  5JDF A;  5F8P A;  2X0L B;  2K5B B;  2RA1 A;  1Z0P A;  5FP3 A;  1CUN A;  3CML A;  4UF0 A;  1T98 A;  4AKL A;  2NW9 A;  5C8Y E;  1MNE A;  3ZC0 A;  2CWY A;  5ADX L;  2MTQ A;  5L2L A;  3HKD E;  3UUM A;  2V26 A;  1FEW A;  4OK0 A;  4O4J E;  2KMF A;  3ZYL A;  3J9X 1;  2BVL A;  2C0S A;  3AA1 B;  3ZCI A;  2ACX A;  3RPU A;  2LT3 A;  1QUU A;  2IAK A;  5FNV E;  2VKO A;  2ES0 A;  5L3D B;  4AQF C;  3E22 E;  5AFU L;  1WRD A;  4A56 A;  3N9N A;  1KNZ A;  1MIY A;  1KK7 A;  2VWA A;  3KIN B;  4MAL A;  2DCF A;  2N1G A;  4JEH B;  3UUN A;  3OJA A;  4L9I A;  3TKL B;  2LM9 A;  4EAH A;  2IW5 B;  3N2G E;  1MIV A;  2Z6E A;  5JVD E;  4M1P A;  3AAE B;  4E7S A;  4HEA A;  2W0G A;  2VL8 A;  3FXE B;  3N9L A;  4TV9 E;  5HXS A;  4PW8 A;  3V5U A;  1UX4 A;  3RYH E;  2A2F X;  5EK4 A;  4PJM A;  2VK9 A;  4IDZ A;  3LK2 B;  3LJC A;  4ASK A;  3JC6 C;  4DVD A;  3HI2 A;  4AQG A;  3N2K E;  2LEH A;  4H9N C;  3NRX A;  2CEA A;  4WBN E;  4H9R C;  2WM9 A;  4O4I E;  1D0Y A;  2NWB A;  1LRZ A;  5L3B B;  3ESL A;  2X67 A;  4ADZ A;  5EK2 A;  2IC6 A;  5JDM A;  4KBM B;  2EHO D;  3MK7 C;  3VKG A;  4CI3 B;  2NW7 A;  4HFV A;  2XUE A;  3AAI A;  2XAH B;  3P8C D;  4HTE A;  4HE8 A;  2PFV A;  3H37 A;  4ZI7 E;  2D0U A;  4DBR A;  5LOV E;  5JDL A;  1G73 A;  5LGU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...