3ZJ2A

Structure of nab2p tandem zinc finger 34
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
GSVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIKEVKPISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
publication title Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zj2A00
5L2LA 3ZJ1A 2LHNA 3ZJ2A
chains in the Genus database with same CATH superfamily
4TN7B 2F4VT 3ETUA 4KHPT 4XAXB 4JUYA 4JI0T 1E2AA 3GWHA 1M7KA 1X9BA 3ZC0A 4UELA 5JR9A 1YQ3A 1MMDA 2PJQA 2JQ9A 5J2UE 3CPZA 2ZLYA 3K8PC 4ZOLE 4JI6T 2CBJA 3KV5A 1N36T 2LSGA 2IAKA 1W9RA 1MIWA 4QXCB 5JTGA 2V8SV 2IW5B 2BBJA 3EABA 3NKZA 2FJBA 1HG5A 2PBIA 3ZYKA 2CLYB 2LKGA 3L39A 5AQLB 1ZEEA 3H37A 3CX6B 3KVBA 4DUZT 1T8BA 2JPFA 2JQQA 3PUAA 1OWAA 4KBMB 2A2FX 2LRKA 3RI5A 4H9PC 2ES0A 3HKCE 4TNWA 2X9WA 4JEHB 1FMWA 4O4IE 1IBMT 3LFMA 3A7MA 1BR0A 3CKDA 1WFDA 3NRXA 1D0XA 5HAXA 1OXZA 2XPKA 2CXDA 3AA1B 3IF8B 3C4XA 3UUXB 3VRBA 4JEUB 4CI1B 1J5ET 5JVDE 4UVAB 3OBVE 3RX6A 4HWHA 4DV3T 3K3NA 4UVCB 3QK6A 3BQIA 2XHEB 3CWZB 2ZM0A 4ERRA 4WZXA 1QSDA 3OPCA 2JIWA 3ZMZB 4QXHB 3KV9A 5JQGE 4AKGA 4IE0A 1U5PA 2E9XD 3C64A 1IZNB 3O4XE 2MBGA 4AIUA 1HS7A 2BKPA 1Z8UA 5LA6E 3K3OA 5AQHB 4B3MT 2VK9A 4K0UA 2JQKA 4ZZBA 3UULA 2BKNA 3DTOA 1H7CA 3AXJA 3KV4A 4GK0E 3I0QA 2K5BB 3TKLB 1XDPA 1T98A 3ANWA 1IBKT 4PK4A 3IEEA 2QA7A 3IA3A 4UVBB 4AQFC 4DR1T 3K3QC 5FKYA 2D5UA 3CQCB 4QX8B 5AQKB 4HFDA 2V7LA 3PUVF 3LSVA 4JV5T 5LCYA 3ZLIA 2X68A 4HFBA 1MIVA 2V5CA 4LF6T 2X67A 2PG8A 2HN2A 1WYBA 5EK4A 5AQIB 2ZM6T 2M6BA 1HG2A 4JLEA 2C5JA 4DR7T 5JH7E 2ODUA 5A1LA 4EIWA 2WB5A 4A5XA 5FMNA 3LG7A 3AAAB 1KF6A 4O8SA 3VRAA 3RIUA 2J4GA 2MAWA 4GOUA 5IUXA 2K24A 5KMGP 3ZMSB 4BAYB 1N32T 3PJAA 2CHNA 2CXFA 3ZJ2A 3RH3A 3C98B 3W15B 2YK0A 2LSJA 5LBQB 4QX7B 3PUYF 4YFSA 4EEBA 5CB4E 4U7YA 2UUAT 3N9NA 4IE5A 3RYCE 3C50A 4QHOA 2FJEA 3P4RA 4YSZA 3RC3A 5L3BB 3MACA 3AE5A 3SWHA 2CHOA 2P9BA 4TZ4C 5FXWA 4MALA 2BVMA 2MPKA 2KWHA 3ZT7A 2WWVA 3C4WA 4DV6T 1HF8A 5KX5E 3RIFA 2WZHA 4DUYT 1LVKA 4X65T 3AECA 3VR8A 1D1AA 4XZCA 3V5UA 4HFIA 2VASA 2B76A 3X1DA 4OYKA 5C3JA 2UXXB 4DR3T 1IAPA 5TAOA 2B1EA 5HWXA 4ILCA 1FIOA 2BBHA 2W62A 2MTQA 2E9XB 2BG9C 2CA5A 4ISTA 5KDMC 1HCIA 2LJLA 4J2CA 3RF1A 3UUBA 4DO0A 4UV8B 3CQXC 3Q9DA 2VKOA 5HXHA 3PUZF 3ABVA 3FZLB 5AQGB 4DMVA 2E5LT 3ZYLA 4C91A 2Y8DA 3PURA 5HEHA 3QNUA 3RYIE 3E22E 2V6XA 1L0VA 1VRBA 4WYVA 1IJ5A 5C2TA 3EHZA 2XASB 2I59A 1O3XA 1YXRA 2YEVC 4H9NC 1IJ6A 3AEEA 3MZKB 1I94T 4TV9E 1R8IA 2CWOA 4IE4A 2VWAA 4BJNA 3ZYMA 4QXBB 4JI1T 3C4ZA 2K48A 3UU5A 2YKSA 1OEDB 2H88A 3AE7A 4DR6T 3GN5B 3UUNA 2NP9A 3Q5WA 5LMUT 1QUUA 2LLYA 1J1JA 1QLBA 3KDSE 2N2NA 4AQYT 5EK3A 4WBNE 3OTOT 3BK9A 2XQ3A 4UEMA 5LJMA 1HNZT 5FXZA 4Z8XA 4LMJA 3FB2A 3FHNA 4WW0A 5JDQA 3O1HA 1ZHCA 2LM9A 3FBZA 1SE7A 3I9WA 5DQWA 2DL1A 2KINB 4HWCA 4X62T 2JJ9A 5HXCA 5HYAA 3AE6A 3SRZA 1US7B 5ABGA 3LK3B 2CE7A 2XQYA 4X66T 3UU6A 4UR9A 1KNRA 4B6XA 2BS3A 2N1GA 4JI7T 3VKHA 1MIYA 5JRCB 3L3PA 5DABA 2KLQA 2V7MA 4UV9B 2ZMAA 3N9MA 2VVSA 1E7PA 3ZC1A 2FJAA 1MNEA 1ZKEA 4JYAT 2V1DB 2WP9A 3AA6B 2W63A 2AE9A 2ACXA 3HA4A 1BR4A 4GIWA 3PU8A 4MHCA 2E9XA 3D0TA 2FJDA 1XNQT 3B57A 3VU7H 2H7VC 4IL4A 4DNDA 2EHOB 4EB6E 3RC8A 4O4HE 3Q5EA 3WAKA 1WR6A 4XBFB 3JAFA 3MK7C 5FNVE 2HPJA 2XSAA 4X1YE 1IBLT 4PJLA 4YHHT 5LB7B 5DJQC 5IYZE 5FXVA 3TLTA 2XZEA 3P4QA 3AE9A 5ABEA 2DLRA 3RRWA 1UK5A 2Z6EA 3TLVA 5JDMA 1KNZA 5LJNA 4JI4T 2WDVA 2NW7A 3RKGA 5JDGA 2KXPB 2WDQA 4DR5T 4LFBT 2H89A 2N9DA 3FXEB 3ZN0B 5FY7A 3HKEE 4IDZA 2D2SA 3QOFA 4JBWF 1OEDA 3RLFF 3GN5A 3UU4A 2ZM2A 4COFA 2HHHT 2J1DG 5JR9C 4G2AA 3SFEA 3SS1A 3ZCJA 4CXYA 1D1CA 3NRYA 3ZKRA 5JREA 1AJ3A 3JC6D 4ZI2D 2BZBA 3VR9A 3UTKA 3CQGB 2UUBT 2CXLA 2Q9QD 2XAGB 4TWFA 3ZT6A 3ZN1B 4HFEA 4HN9A 4X20E 1XMQT 2X51A 2X9YA 2LSIA 2UXDT 2QVAA 1DU2A 4QH1A 4PAGA 3HI2A 5F5WA 1VCSA 2KT9A 3CK6A 5AQUB 1ZV4X 1YW0A 4AKIA 5L3CB 4CZZB 5L3EB 5HCMA 3MKDA 1J5WA 1HR0T 2YU2A 5BR8T 5KXJA 5ABFB 4K0KT 4LFAT 4GYRA 5JRCA 4AXPA 3UT5E 3UU8A 2C0SA 3EI0A 2BS2A 3ONXA 2Y48B 3HKDE 2LKHA 4AKHA 2K9AA 2KNDA 3KFWX 3EVYA 3KBUA 4U7IA 1LVFA 1EZ3A 2IIUA 4G63A 3SFDA 2V6YB 2XAHB 5DQVA 1WLXA 4AISA 5FL1A 4TWHA 3PUXF 2BG9E 2XM2A 2NW8A 4OYJA 2LSKA 2IC6A 4TUYE 4Z90A 2EHOA 3PUQA 2M6IA 5ADXL 4TX5A 4YY3T 2RPAA 3S4UA 3RPUA 2NWBA 1LRZA 4YTNA 5HEGA 1JNZA 4C90A 3EDUA 4LMKA 2X0LB 4U2YA 3RKOA 3AAIA 5LGNB 2HPLA 4NPPA 2NR4A 5F3JA 2NW9A 2VQET 2H3RA 2UXCT 3ONLC 2YN6A 3JCFA 4HTEA 3AEFA 4P0BA 1HX1B 2XQ8A 1NENA 1MMAA 2HH7A 5LGUB 2RA1A 4CN1A 2I0MA 1GQEA 4PFOA 3BQLA 3U3IA 5AQSB 4DVDA 2IUBA 2ZM8A 3AE4A 1BR1A 4KMCA 2LRLA 2DWKA 3NZQA 3RIUC 2CBIA 5AQJB 1HFAA 5FYMA 3EAMA 2Q9QB 2KMFA 5HWYA 3T1HT 2R6GF 1G73A 2CLYC 2QRXA 4IDOA 3RGLA 5LYJE 5JDFA 5FXXA 4HE8A 3RYHE 4I55E 4CI2B 2VQFT 4DIDB 4U33A 3PTRB 2AXDS 2BKOA 2WWUA 5L3DB 4ZS2A 1NWMX 3TLSA 3TLWA 2Y6XA 3AB3B 5ABFA 5M4YA 2W67A 3B13A 5FY0A 4DV4T 4EYYR 3P4SA 4LF5T 3N2KE 2QGSA 1LKXA 4ZI3D 5C8YE 4DBRA 3CVRA 3RRCA 2EHOD 3N9PA 1S94A 4O4LE 3O9XA 4QH4A 4IE7A 1V9DA 2KSRA 2D0TA 3V5SA 4HKAA 4Q25A 1W0AA 2DNXA 3IBPA 3OVUA 2UUCT 2J47A 2XUEA 3PV0F 4I4TE 2LM2A 2VURA 2XAJB 3CX8B 5H6QB 5LG4A 2I6HA 2M67A 3QB5A 5CFBA 2WU2A 5AQQB 5FP3A 4HWDA 4F8HA 3IHRA 4O2AE 3AA7B 1JNRA 3KV6A 5CJ5A 2H7OA 2NTXA 3A5XA 5L47A 4TV8E 2PTFA 5JDHA 2XQ6A 2DWGA 4KHZF 4A97A 5CA0E 3FZFB 5IHYA 3DP7A 4DV2T 2XQAA 4A98A 3SOLA 1NEKA 4YT0A 2E8IA 3H3MA 4DV0T 4IREA 1YQ4A 1HNWT 4ADZA 4P0AA 3ZCIA 4QH5A 4YHJA 5ETWA 4OK0A 3ETVA 1SA0E 2W4XA 2VB6A 3L09A 2XSBA 1Y01A 2DHRA 1HNXT 2KWIB 2CPTA 2KZ7B 1SUMB 5AQMB 4LF7T 4BA9A 3JAEA 4GKKT 3AEDA 1D0ZA 3M65A 5L3GB 5AQNB 2BS4A 3FZMB 4GKJT 3ZPOA 1MMNA 3NZPA 2Q9QA 3VKGA 2WY2A 4M1PA 3O1IA 2XQ9A 3ZMVB 3UFEA 1T72A 4I43B 1ZOYA 3RYFE 4V1Av 2ACZA 3N9OA 3AA0B 3QC9A 4JI3T 4OX9T 4E7ZA 5AQOB 3LDQB 3AE3A 2YDQA 3OYXA 3E08A 2CM0A 1UCUA 4LMLA 4ILBA 5HEOA 4PJMA 4TNVA 4IL9A 5L3FB 1B7TA 3F2EA 4ZZCA 2JMKA 3ESLA 2IDOB 3FBLA 4H63H 5ABHA 3R84B 2SPCA 2VVNA 3RHWA 3AEAA 4A56A 2WMOA 2UXNB 2A9UA 4X5TA 3PUGA 5LNKA 3AVRA 2NOXA 2FBWA 1MMGA 4QWNB 4TWDA 4ILAA 1U4QA 2E9XC 5LP6E 4PFPA 2E2AA 1WR0A 5CA1E 4HFHA 5HXRA 3P8CD 1CUNA 1Y64B 5LHHB 3NWIA 4X1IE 3HKBE 4YTPA 5LHIB 4LF8T 5AQRB 1W0BA 3KVAA 2VKJA 3ZSSA 1UUSA 3EDVA 2OLTA 4O2BE 3N2GE 2BVLA 1UX4A 1T7SA 1UX5A 3KBTA 3N5LA 2A3DA 2WZIA 3UUMA 3P4PA 3ZMUB 4H63V 2YDRA 4H9QC 5AQTB 3P7IA 5FL0A 4IGUA 4JI8T 1G8XA 4GK5E 4X1KE 4GYSA 5LGTB 4U74A 2NTYA 3T1YT 2GK9A 2JQHA 4PJJA 2LHNA 1OEDC 1HTJF 5J1GA 5HEJA 1YKHB 2DCFA 3AVSA 2OV9A 3GA8A 1KEYA 3PUWF 4PNIA 5EK2A 4JI2T 3WI3A 4NUUA 4DV1T 2BG9B 2D9DA 4ZHQE 1XMOT 4OHFA 2CWYA 4ZS3A 4L0RA 5FVKA 4IIJE 5LOVE 4U3CA 2YU1A 5EZYE 3LJCA 5GONE 4QKNA 4U31A 4Z91A 4LF9T 5AQPB 3CIRA 3AE1A 3N2OA 1N34T 4AQGA 4CN6A 4FI5A 1MNDA 4B3TT 3J7Yq 4F6RC 1BR2A 3FXDB 4P09A 2MYSA 4HFVA 2G0UA 2YOEA 2CEAA 4AQFA 4PK5A 4UIGA 1WYCA 4MLKA 2DI4A 3P4WA 3H3AA 4B3ST 4EGWA 4PK6A 4L5GA 4HWFA 2WS3A 4AKRB 5AFUL 4AKLA 4ISSA 4H9OC 2WCAA 4CN4A 2X0YA 4IT4A 4LF4T 3MA9A 3HL6A 3L8RA 4NIQA 4MFRA 5L4EA 4E7SA 2CRBA 2VL8A 3PUSA 3QB5K 4YJ3E 2YINA 2WSSV 2XQ4A 3I1AA 4EV6A 4PW8A 4HWIB 2W61A 3UFGA 3F57A 4ZI3C 1KFYA 3UU3A 2EHOC 4X64T 3TLUA 5AQFB 5CGMA 2BDEA 4KI0F 4ZI7E 3LK42 3ZT5A 4NUVA 4DV5T 3ZSTA 2QYWA 2WAUA 1CHUA 3I0OA 5L4HA 1FJGT 4UXNB 5HEUA 5LHGB 4EOZB 2X66A 3OKQA 3UQ4A 3FZHB 5J2TE 2X0HA 4IE6A 3J9X1 2CMRA 2LOSA 2XJ7A 3RQUA 5JDLA 2IMLA 4ZEYA 1UURA 1HX8A 4KX6A 4WNKA 5LXTE 2V7JA 4FJOA 2VL0A 4MBQA 3NBXX 4KUMB 4IDNA 2WMNA 5LMNT 2UXBT 3PJAJ 4WBOA 3F31A 2WBLA 3ZEFB 4U2ZA 3RQWA 2HN1A 3FZKB 4EEDA 2XAQB 1VOMA 4JI5T 2BG9A 3OYZA 4H9RC 4YLHA 4NXMT 1UGOA 2XY8B 3O1JA 3Q2MA 3N9LA 4U72A 4N78D 4YJ2E 4AI6A 3AE2A 3ZJ1A 3C51A 4EZ4A 2E5VA 4EYUA 1XDOA 5FY1A 2IHR1 3M3ZB 5BMVE 2XTLA 2IC9A 2WDRA 5JDNA 4IHJE 3G06A 4ILUA 2VKHA 2W0GA 3UQ7A 3K1SA 2JRKA 2WU5A 2J62A 1S35A 5HCJA 2V6YA 2XAFB 4P1NA 4UF0B 5AQVB 2L3LA 3OJAA 3PE0A 4DMWA 2WQYA 3ZMTB 4CXWA 4DV7T 3A8YC 3I9YA 3LBXB 3T8OA 2LEHA 2K3WA 5LBMA 2D0UA 3EUHA 2ODVA 5J0ZA 2MOZA 2CCQA 2RP4A 2LOPA 5JR9B 2LT3A 5L2LA 1YD8G 1YKEB 2L8KA 4I50E 1X79A 1XWMA 4YSXA 3ONJA 4DR4T 4IDPA 4CXXA 3KINB 3PDYA 3DJBA 1WCRA 5LG3A 5H6RB 1Z0PA 2JMHA 2XQ7A 4KP3C 4YTMA 3Q5XA 3R6NA 1WRDA 1XZYA 2V7IA 2PFVA 2WM9A 1FMVA 2C5IT 4H9SE 3E0ZA 1I6ZA 2OA5A 3VHLA 1ZP0A 3MJXA 3LK2B 3MXZA 1M62A 5F8PA 4EAHA 3Q5DA 3NVOA 1KK7A 3AEBA 4EXTA 3AEGA 2W2UA 2UU9T 3QUJA 4I0UA 1E1HB 3AAEB 5IWAT 5HXSA 1OEDE 2V5DA 4CI3B 2XQ5A 4ASKA 3U78A 2V26A 4PJNA 4YXDA 3JADA 2LHRA 1D0YA 4EZHA 4DR2T 4B3RT 4L9IA 1FEWA 4DBQA 2VKDA 2A72A 5HXEA 3JC6C 4IDQA 4ZI2C 3WAJA 4ZXLA 3RIAA 2X9XA 3CX7B 4YSYA 2L9QA 2X9HA 4OFZA 3P50A 4HGAA 1XNRT 1SHZC 2Q9QC 4CQIA 2W00A 2W66A 2V7KA 1W09A 4HFCA 3CMLA 3HR0A 1NAFA 4LFCT 2C5KT 4ANJA 2YDSA 1KNPA 5E0OA 3AXJB 4O4JE 3GMIA 1VCTA 2XM1A 1D1BA 3ANWB 4BJMA 4NXNT 1N33T 5FVLA 3N9QA 4UF0A 2FUPA 2LE8A 3B5MA 3BQKA 4HEAA 3AE8A 3PU3A 2LSYA 3LBXA
chains in the Genus database with same CATH topology
4AQFA 4TN7B 4PK5A 4UIGA 1WYCA 5EK3A 4MLKA 2DI4A 3ETUA 3H3AA 5JDFA 5LYJE 4WBNE 4PK6A 4L5GA 3BK9A 4UEMA 5FXXA 5LJMA 4XAXB 4JUYA 4AKRB 4HE8A 3RYHE 5AFUL 3GWHA 4AKLA 4I55E 4CI2B 5FXZA 4Z8XA 3ZC0A 3FB2A 4UELA 5JR9A 4ISSA 3FHNA 3PTRB 1MMDA 4WW0A 4H9OC 5JDQA 3O1HA 1ZHCA 2LM9A 2WWUA 3FBZA 5L3DB 3I9WA 2PJQA 5DQWA 4ZS2A 1NWMX 5J2UE 2KINB 3CPZA 2Y6XA 2ZLYA 3AB3B 3K8PC 4ZOLE 3MA9A 3HL6A 3KV5A 2JJ9A 2LSGA 5M4YA 2IAKA 5HXCA 3B13A 4MFRA 1MIWA 4QXCB 5FY0A 2IW5B 5HYAA 4E7SA 4EYYR 2VL8A 3PUSA 3SRZA 1US7B 1HG5A 2PBIA 3N2KE 2QGSA 4YJ3E 2YINA 3ZYKA 2CLYB 1LKXA 4ZI3D 5C8YE 4DBRA 2WSSV 3CVRA 3LK3B 2CE7A 2XQYA 3RRCA 3I1AA 2EHOD 1ZEEA 3N9PA 1S94A 3H37A 4O4LE 4PW8A 3O9XA 4B6XA 4IE7A 1V9DA 3CX6B 2N1GA 3KVBA 2W61A 2D0TA 3F57A 4ZI3C 3V5SA 2JPFA 2JQQA 4HKAA 3PUAA 1OWAA 3VKHA 1MIYA 5JRCB 2EHOC 4KBMB 2A2FX 2DNXA 3L3PA 4H9PC 5DABA 2ES0A 3IBPA 3HKCE 2X9WA 2KLQA 4JEHB 2BDEA 4I4TE 2XUEA 4ZI7E 2V7MA 4UV9B 1FMWA 4O4IE 3LFMA 2ZMAA 1BR0A 3LK42 3CKDA 2XAJB 3CX8B 5H6QB 3NRXA 4NUVA 1D0XA 5HAXA 5LG4A 3N9MA 3ZC1A 1MNEA 2M67A 1ZKEA 5FP3A 1OXZA 2V1DB 3AA6B 2W63A 2CXDA 2WAUA 3AA1B 3IF8B 3IHRA 3C4XA 3UUXB 4O2AE 3AA7B 2ACXA 4JEUB 3I0OA 3HA4A 3KV6A 4CI1B 1BR4A 2H7OA 4GIWA 3PU8A 4UXNB 2NTXA 5LHGB 5JVDE 4UVAB 4MHCA 4EOZB 2E9XA 3A5XA 3D0TA 3OBVE 3RX6A 2X66A 3K3NA 4UVCB 3B57A 4TV8E 3QK6A 3VU7H 2H7VC 3BQIA 3OKQA 5JDHA 5J2TE 4DNDA 2XHEB 3CWZB 2EHOB 2ZM0A 4EB6E 4IE6A 2DWGA 4ERRA 3RC8A 4O4HE 3J9X1 2CMRA 2LOSA 3WAKA 1WR6A 4XBFB 1QSDA 5JDLA 3MK7C 5FNVE 2HPJA 4X1YE 4PJLA 3ZMZB 5CA0E 4QXHB 5IHYA 1HX8A 3KV9A 3DP7A 5JQGE 4AKGA 4WNKA 5LXTE 2V7JA 4FJOA 4MBQA 4IE0A 5DJQC 1U5PA 3NBXX 5IYZE 4KUMB 5FXVA 2E9XD 2WMNA 3C64A 1IZNB 3SOLA 3O4XE 2MBGA 1HS7A 2DLRA 3RRWA 4WBOA 2E8IA 5LA6E 3F31A 2Z6EA 2WBLA 3ZEFB 3K3OA 5JDMA 1KNZA 5LJNA 2VK9A 4ADZA 4K0UA 2XAQB 4P0AA 1VOMA 3ZCIA 4YHJA 5ETWA 4OK0A 3OYZA 3UULA 3ETVA 2NW7A 3DTOA 1SA0E 1H7CA 2VB6A 3L09A 3KV4A 5JDGA 2KXPB 4H9RC 2DHRA 4GK0E 3I0QA 2KWIB 4YLHA 2K5BB 3TKLB 3O1JA 1T98A 3Q2MA 3N9LA 3ANWA 4U72A 2KZ7B 2N9DA 4N78D 3FXEB 3ZN0B 4YJ2E 5FY7A 4PK4A 4AI6A 4BA9A 3HKEE 4IDZA 3IEEA 2QA7A 4UVBB 1D0ZA 3M65A 3ZJ1A 3C51A 4AQFC 4EZ4A 2D2SA 5L3GB 4EYUA 3K3QC 5FY1A 3GN5A 2D5UA 2ZM2A 5BMVE 3ZPOA 2XTLA 1MMNA 2IC9A 3CQCB 4QX8B 5JDNA 2J1DG 3NZPA 2Q9QA 4IHJE 4ILUA 3VKGA 5JR9C 2VKHA 2W0GA 4G2AA 4M1PA 2V7LA 3O1IA 2JRKA 3ZMVB 3UFEA 1S35A 3SS1A 4I43B 3ZCJA 5LCYA 4CXYA 3RYFE 4V1Av 2X68A 1D1CA 2XAFB 3ZLIA 1MIVA 2X67A 3NRYA 4UF0B 5JREA 2L3LA 2PG8A 1AJ3A 3OJAA 3PE0A 3JC6D 4ZI2D 2BZBA 1WYBA 4DMWA 3N9OA 5EK4A 3ZMTB 3AA0B 3QC9A 3UTKA 1HG2A 3CQGB 4CXWA 2CXLA 4JLEA 2C5JA 4E7ZA 2Q9QD 3I9YA 5JH7E 2ODUA 5A1LA 4EIWA 3OYXA 2XAGB 3LBXB 2LEHA 5FMNA 3LG7A 3T8OA 3ZN1B 3AAAB 3E08A 4O8SA 2CM0A 1UCUA 4GOUA 4HN9A 4X20E 4PJMA 2X51A 2X9YA 5LBMA 2LSIA 2D0UA 2K24A 3EUHA 2ODVA 5KMGP 5L3FB 1B7TA 3F2EA 4PAGA 5CA1E 2MOZA 2CCQA 3ZMSB 4BAYB 3HI2A 2JMKA 3ESLA 2RP4A 2LOPA 2CXFA 2KT9A 2LT3A 5JR9B 5L2LA 1YD8G 3FBLA 4H63H 1ZV4X 1YW0A 3ZJ2A 4AKIA 3R84B 5L3CB 2SPCA 3RH3A 1YKEB 2L8KA 3C98B 3W15B 4I50E 4CZZB 1X79A 2YK0A 5L3EB 2LSJA 5LBQB 4A56A 4QX7B 4YFSA 3MKDA 4CXXA 3PU3A 3KINB 2WMOA 2YU2A 3PDYA 2UXNB 5CB4E 4GYRA 3N9NA 4IE5A 5JRCA 3DJBA 3PUGA 4AXPA 3AVRA 3C50A 4QHOA 3RYCE 5LNKA 5H6RB 3UT5E 2NOXA 1MMGA 2C0SA 3ONXA 2Y48B 1Z0PA 3HKDE 3RC3A 4QWNB 2JMHA 4AKHA 2K9AA 2KNDA 4KP3C 5L3BB 1U4QA 2E9XC 3KFWX 3Q5XA 3R6NA 1WRDA 3MACA 5LP6E 4PFPA 3SWHA 3EVYA 3KBUA 2V7IA 2P9BA 2PFVA 4TZ4C 2WM9A 5FXWA 1FMVA 1LVFA 4MALA 1EZ3A 2C5IT 5HXRA 4H9SE 2BVMA 3E0ZA 3P8CD 4G63A 1CUNA 1Y64B 2KWHA 5LHHB 2OA5A 2XAHB 3C4WA 5DQVA 4X1IE 1HF8A 5KX5E 3HKBE 3VHLA 1WLXA 5LHIB 3KVAA 3MJXA 1LVKA 2VKJA 3LK2B 1D1AA 3MXZA 5F8PA 4XZCA 2NW8A 4OYJA 4EAHA 3V5UA 3EDVA 2VASA 2LSKA 4O2BE 1KK7A 4OYKA 2IC6A 3N2GE 4TUYE 2BVLA 1UX4A 2UXXB 2EHOA 1IAPA 5TAOA 2B1EA 4EXTA 5HWXA 3PUQA 1UX5A 3KBTA 3N5LA 3QUJA 2A3DA 5ADXL 4TX5A 3UUMA 1FIOA 3S4UA 3ZMUB 2W62A 3RPUA 2NWBA 4H63V 1E1HB 3AAEB 2MTQA 1LRZA 5HXSA 2E9XB 4CI3B 4C90A 4ASKA 3EDUA 2CA5A 4H9QC 2X0LB 2V26A 4ISTA 3U78A 4PJNA 5KDMC 3P7IA 1HCIA 4IGUA 2LJLA 1G8XA 2LHRA 4GK5E 4J2CA 4X1KE 3RKOA 4GYSA 3AAIA 5LGNB 1D0YA 4EZHA 5LGTB 4DO0A 4L9IA 1FEWA 3CQXC 3Q9DA 2VKOA 4U74A 4UV8B 2HPLA 5HXHA 2NTYA 5F3JA 2NW9A 2GK9A 4DBQA 2VKDA 2H3RA 2A72A 4DMVA 4PJJA 2LHNA 3ZYLA 1HTJF 4C91A 5HXEA 3JC6C 4ZI2C 3WAJA 4HTEA 2Y8DA 2X9XA 4P0BA 3PURA 5J1GA 3CX7B 1YKHB 2L9QA 2DCFA 2X9HA 3RYIE 3AVSA 4OFZA 3E22E 4HGAA 1VRBA 1SHZC 3GA8A 1IJ5A 2Q9QC 4CQIA 4PNIA 5EK2A 2W00A 1MMAA 2V7KA 2XASB 3CMLA 2HH7A 3HR0A 2I59A 1O3XA 1NAFA 5LGUB 3WI3A 2C5KT 2RA1A 2YEVC 4H9NC 4NUUA 4ANJA 1IJ6A 4PFOA 5E0OA 3MZKB 4ZHQE 3BQLA 4O4JE 4TV9E 3GMIA 3U3IA 4DVDA 4OHFA 2CWOA 4IE4A 2CWYA 4ZS3A 4L0RA 2ZM8A 4IIJE 1D1BA 2VWAA 4BJNA 1BR1A 3ZYMA 5LOVE 2YU1A 3ANWB 4KMCA 4BJMA 5EZYE 3LJCA 5GONE 4QKNA 4QXBB 3C4ZA 2DWKA 2K48A 3N2OA 3NZQA 4AQGA 3GN5B 4FI5A 3UUNA 1HFAA 5FYMA 3N9QA 1MNDA 4UF0A 2NP9A 3Q5WA 3J7Yq 4F6RC 1BR2A 1QUUA 2Q9QB 2KMFA 3FXDB 4P09A 2MYSA 5HWYA 4HFVA 2LE8A 2G0UA 3BQKA 3KDSE 4HEAA 1G73A 2N2NA 2CLYC 2CEAA 2LSYA 3LBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L2L A;  3ZJ1 A;  2LHN A;  3ZJ2 A; 
#chains in the Genus database with same CATH topology
 4TN7 B;  2F4V T;  3ETU A;  4KHP T;  4XAX B;  4JUY A;  4JI0 T;  1E2A A;  3GWH A;  1M7K A;  1X9B A;  3ZC0 A;  4UEL A;  5JR9 A;  1YQ3 A;  1MMD A;  2PJQ A;  2JQ9 A;  5J2U E;  3CPZ A;  2ZLY A;  3K8P C;  4ZOL E;  4JI6 T;  2CBJ A;  3KV5 A;  1N36 T;  2LSG A;  2IAK A;  1W9R A;  1MIW A;  4QXC B;  5JTG A;  2V8S V;  2IW5 B;  2BBJ A;  3EAB A;  3NKZ A;  2FJB A;  1HG5 A;  2PBI A;  3ZYK A;  2CLY B;  2LKG A;  3L39 A;  5AQL B;  1ZEE A;  3H37 A;  3CX6 B;  3KVB A;  4DUZ T;  1T8B A;  2JPF A;  2JQQ A;  3PUA A;  1OWA A;  4KBM B;  2A2F X;  2LRK A;  3RI5 A;  4H9P C;  2ES0 A;  3HKC E;  4TNW A;  2X9W A;  4JEH B;  1FMW A;  4O4I E;  1IBM T;  3LFM A;  3A7M A;  1BR0 A;  3CKD A;  1WFD A;  3NRX A;  1D0X A;  5HAX A;  1OXZ A;  2XPK A;  2CXD A;  3AA1 B;  3IF8 B;  3C4X A;  3UUX B;  3VRB A;  4JEU B;  4CI1 B;  1J5E T;  5JVD E;  4UVA B;  3OBV E;  3RX6 A;  4HWH A;  4DV3 T;  3K3N A;  4UVC B;  3QK6 A;  3BQI A;  2XHE B;  3CWZ B;  2ZM0 A;  4ERR A;  4WZX A;  1QSD A;  3OPC A;  2JIW A;  3ZMZ B;  4QXH B;  3KV9 A;  5JQG E;  4AKG A;  4IE0 A;  1U5P A;  2E9X D;  3C64 A;  1IZN B;  3O4X E;  2MBG A;  4AIU A;  1HS7 A;  2BKP A;  1Z8U A;  5LA6 E;  3K3O A;  5AQH B;  4B3M T;  2VK9 A;  4K0U A;  2JQK A;  4ZZB A;  3UUL A;  2BKN A;  3DTO A;  1H7C A;  3AXJ A;  3KV4 A;  4GK0 E;  3I0Q A;  2K5B B;  3TKL B;  1XDP A;  1T98 A;  3ANW A;  1IBK T;  4PK4 A;  3IEE A;  2QA7 A;  3IA3 A;  4UVB B;  4AQF C;  4DR1 T;  3K3Q C;  5FKY A;  2D5U A;  3CQC B;  4QX8 B;  5AQK B;  4HFD A;  2V7L A;  3PUV F;  3LSV A;  4JV5 T;  5LCY A;  3ZLI A;  2X68 A;  4HFB A;  1MIV A;  2V5C A;  4LF6 T;  2X67 A;  2PG8 A;  2HN2 A;  1WYB A;  5EK4 A;  5AQI B;  2ZM6 T;  2M6B A;  1HG2 A;  4JLE A;  2C5J A;  4DR7 T;  5JH7 E;  2ODU A;  5A1L A;  4EIW A;  2WB5 A;  4A5X A;  5FMN A;  3LG7 A;  3AAA B;  1KF6 A;  4O8S A;  3VRA A;  3RIU A;  2J4G A;  2MAW A;  4GOU A;  5IUX A;  2K24 A;  5KMG P;  3ZMS B;  4BAY B;  1N32 T;  3PJA A;  2CHN A;  2CXF A;  3ZJ2 A;  3RH3 A;  3C98 B;  3W15 B;  2YK0 A;  2LSJ A;  5LBQ B;  4QX7 B;  3PUY F;  4YFS A;  4EEB A;  5CB4 E;  4U7Y A;  2UUA T;  3N9N A;  4IE5 A;  3RYC E;  3C50 A;  4QHO A;  2FJE A;  3P4R A;  4YSZ A;  3RC3 A;  5L3B B;  3MAC A;  3AE5 A;  3SWH A;  2CHO A;  2P9B A;  4TZ4 C;  5FXW A;  4MAL A;  2BVM A;  2MPK A;  2KWH A;  3ZT7 A;  2WWV A;  3C4W A;  4DV6 T;  1HF8 A;  5KX5 E;  3RIF A;  2WZH A;  4DUY T;  1LVK A;  4X65 T;  3AEC A;  3VR8 A;  1D1A A;  4XZC A;  3V5U A;  4HFI A;  2VAS A;  2B76 A;  3X1D A;  4OYK A;  5C3J A;  2UXX B;  4DR3 T;  1IAP A;  5TAO A;  2B1E A;  5HWX A;  4ILC A;  1FIO A;  2BBH A;  2W62 A;  2MTQ A;  2E9X B;  2BG9 C;  2CA5 A;  4IST A;  5KDM C;  1HCI A;  2LJL A;  4J2C A;  3RF1 A;  3UUB A;  4DO0 A;  4UV8 B;  3CQX C;  3Q9D A;  2VKO A;  5HXH A;  3PUZ F;  3ABV A;  3FZL B;  5AQG B;  4DMV A;  2E5L T;  3ZYL A;  4C91 A;  2Y8D A;  3PUR A;  5HEH A;  3QNU A;  3RYI E;  3E22 E;  2V6X A;  1L0V A;  1VRB A;  4WYV A;  1IJ5 A;  5C2T A;  3EHZ A;  2XAS B;  2I59 A;  1O3X A;  1YXR A;  2YEV C;  4H9N C;  1IJ6 A;  3AEE A;  3MZK B;  1I94 T;  4TV9 E;  1R8I A;  2CWO A;  4IE4 A;  2VWA A;  4BJN A;  3ZYM A;  4QXB B;  4JI1 T;  3C4Z A;  2K48 A;  3UU5 A;  2YKS A;  1OED B;  2H88 A;  3AE7 A;  4DR6 T;  3GN5 B;  3UUN A;  2NP9 A;  3Q5W A;  5LMU T;  1QUU A;  2LLY A;  1J1J A;  1QLB A;  3KDS E;  2N2N A;  4AQY T;  5EK3 A;  4WBN E;  3OTO T;  3BK9 A;  2XQ3 A;  4UEM A;  5LJM A;  1HNZ T;  5FXZ A;  4Z8X A;  4LMJ A;  3FB2 A;  3FHN A;  4WW0 A;  5JDQ A;  3O1H A;  1ZHC A;  2LM9 A;  3FBZ A;  1SE7 A;  3I9W A;  5DQW A;  2DL1 A;  2KIN B;  4HWC A;  4X62 T;  2JJ9 A;  5HXC A;  5HYA A;  3AE6 A;  3SRZ A;  1US7 B;  5ABG A;  3LK3 B;  2CE7 A;  2XQY A;  4X66 T;  3UU6 A;  4UR9 A;  1KNR A;  4B6X A;  2BS3 A;  2N1G A;  4JI7 T;  3VKH A;  1MIY A;  5JRC B;  3L3P A;  5DAB A;  2KLQ A;  2V7M A;  4UV9 B;  2ZMA A;  3N9M A;  2VVS A;  1E7P A;  3ZC1 A;  2FJA A;  1MNE A;  1ZKE A;  4JYA T;  2V1D B;  2WP9 A;  3AA6 B;  2W63 A;  2AE9 A;  2ACX A;  3HA4 A;  1BR4 A;  4GIW A;  3PU8 A;  4MHC A;  2E9X A;  3D0T A;  2FJD A;  1XNQ T;  3B57 A;  3VU7 H;  2H7V C;  4IL4 A;  4DND A;  2EHO B;  4EB6 E;  3RC8 A;  4O4H E;  3Q5E A;  3WAK A;  1WR6 A;  4XBF B;  3JAF A;  3MK7 C;  5FNV E;  2HPJ A;  2XSA A;  4X1Y E;  1IBL T;  4PJL A;  4YHH T;  5LB7 B;  5DJQ C;  5IYZ E;  5FXV A;  3TLT A;  2XZE A;  3P4Q A;  3AE9 A;  5ABE A;  2DLR A;  3RRW A;  1UK5 A;  2Z6E A;  3TLV A;  5JDM A;  1KNZ A;  5LJN A;  4JI4 T;  2WDV A;  2NW7 A;  3RKG A;  5JDG A;  2KXP B;  2WDQ A;  4DR5 T;  4LFB T;  2H89 A;  2N9D A;  3FXE B;  3ZN0 B;  5FY7 A;  3HKE E;  4IDZ A;  2D2S A;  3QOF A;  4JBW F;  1OED A;  3RLF F;  3GN5 A;  3UU4 A;  2ZM2 A;  4COF A;  2HHH T;  2J1D G;  5JR9 C;  4G2A A;  3SFE A;  3SS1 A;  3ZCJ A;  4CXY A;  1D1C A;  3NRY A;  3ZKR A;  5JRE A;  1AJ3 A;  3JC6 D;  4ZI2 D;  2BZB A;  3VR9 A;  3UTK A;  3CQG B;  2UUB T;  2CXL A;  2Q9Q D;  2XAG B;  4TWF A;  3ZT6 A;  3ZN1 B;  4HFE A;  4HN9 A;  4X20 E;  1XMQ T;  2X51 A;  2X9Y A;  2LSI A;  2UXD T;  2QVA A;  1DU2 A;  4QH1 A;  4PAG A;  3HI2 A;  5F5W A;  1VCS A;  2KT9 A;  3CK6 A;  5AQU B;  1ZV4 X;  1YW0 A;  4AKI A;  5L3C B;  4CZZ B;  5L3E B;  5HCM A;  3MKD A;  1J5W A;  1HR0 T;  2YU2 A;  5BR8 T;  5KXJ A;  5ABF B;  4K0K T;  4LFA T;  4GYR A;  5JRC A;  4AXP A;  3UT5 E;  3UU8 A;  2C0S A;  3EI0 A;  2BS2 A;  3ONX A;  2Y48 B;  3HKD E;  2LKH A;  4AKH A;  2K9A A;  2KND A;  3KFW X;  3EVY A;  3KBU A;  4U7I A;  1LVF A;  1EZ3 A;  2IIU A;  4G63 A;  3SFD A;  2V6Y B;  2XAH B;  5DQV A;  1WLX A;  4AIS A;  5FL1 A;  4TWH A;  3PUX F;  2BG9 E;  2XM2 A;  2NW8 A;  4OYJ A;  2LSK A;  2IC6 A;  4TUY E;  4Z90 A;  2EHO A;  3PUQ A;  2M6I A;  5ADX L;  4TX5 A;  4YY3 T;  2RPA A;  3S4U A;  3RPU A;  2NWB A;  1LRZ A;  4YTN A;  5HEG A;  1JNZ A;  4C90 A;  3EDU A;  4LMK A;  2X0L B;  4U2Y A;  3RKO A;  3AAI A;  5LGN B;  2HPL A;  4NPP A;  2NR4 A;  5F3J A;  2NW9 A;  2VQE T;  2H3R A;  2UXC T;  3ONL C;  2YN6 A;  3JCF A;  4HTE A;  3AEF A;  4P0B A;  1HX1 B;  2XQ8 A;  1NEN A;  1MMA A;  2HH7 A;  5LGU B;  2RA1 A;  4CN1 A;  2I0M A;  1GQE A;  4PFO A;  3BQL A;  3U3I A;  5AQS B;  4DVD A;  2IUB A;  2ZM8 A;  3AE4 A;  1BR1 A;  4KMC A;  2LRL A;  2DWK A;  3NZQ A;  3RIU C;  2CBI A;  5AQJ B;  1HFA A;  5FYM A;  3EAM A;  2Q9Q B;  2KMF A;  5HWY A;  3T1H T;  2R6G F;  1G73 A;  2CLY C;  2QRX A;  4IDO A;  3RGL A;  5LYJ E;  5JDF A;  5FXX A;  4HE8 A;  3RYH E;  4I55 E;  4CI2 B;  2VQF T;  4DID B;  4U33 A;  3PTR B;  2AXD S;  2BKO A;  2WWU A;  5L3D B;  4ZS2 A;  1NWM X;  3TLS A;  3TLW A;  2Y6X A;  3AB3 B;  5ABF A;  5M4Y A;  2W67 A;  3B13 A;  5FY0 A;  4DV4 T;  4EYY R;  3P4S A;  4LF5 T;  3N2K E;  2QGS A;  1LKX A;  4ZI3 D;  5C8Y E;  4DBR A;  3CVR A;  3RRC A;  2EHO D;  3N9P A;  1S94 A;  4O4L E;  3O9X A;  4QH4 A;  4IE7 A;  1V9D A;  2KSR A;  2D0T A;  3V5S A;  4HKA A;  4Q25 A;  1W0A A;  2DNX A;  3IBP A;  3OVU A;  2UUC T;  2J47 A;  2XUE A;  3PV0 F;  4I4T E;  2LM2 A;  2VUR A;  2XAJ B;  3CX8 B;  5H6Q B;  5LG4 A;  2I6H A;  2M67 A;  3QB5 A;  5CFB A;  2WU2 A;  5AQQ B;  5FP3 A;  4HWD A;  4F8H A;  3IHR A;  4O2A E;  3AA7 B;  1JNR A;  3KV6 A;  5CJ5 A;  2H7O A;  2NTX A;  3A5X A;  5L47 A;  4TV8 E;  2PTF A;  5JDH A;  2XQ6 A;  2DWG A;  4KHZ F;  4A97 A;  5CA0 E;  3FZF B;  5IHY A;  3DP7 A;  4DV2 T;  2XQA A;  4A98 A;  3SOL A;  1NEK A;  4YT0 A;  2E8I A;  3H3M A;  4DV0 T;  4IRE A;  1YQ4 A;  1HNW T;  4ADZ A;  4P0A A;  3ZCI A;  4QH5 A;  4YHJ A;  5ETW A;  4OK0 A;  3ETV A;  1SA0 E;  2W4X A;  2VB6 A;  3L09 A;  2XSB A;  1Y01 A;  2DHR A;  1HNX T;  2KWI B;  2CPT A;  2KZ7 B;  1SUM B;  5AQM B;  4LF7 T;  4BA9 A;  3JAE A;  4GKK T;  3AED A;  1D0Z A;  3M65 A;  5L3G B;  5AQN B;  2BS4 A;  3FZM B;  4GKJ T;  3ZPO A;  1MMN A;  3NZP A;  2Q9Q A;  3VKG A;  2WY2 A;  4M1P A;  3O1I A;  2XQ9 A;  3ZMV B;  3UFE A;  1T72 A;  4I43 B;  1ZOY A;  3RYF E;  4V1A v;  2ACZ A;  3N9O A;  3AA0 B;  3QC9 A;  4JI3 T;  4OX9 T;  4E7Z A;  5AQO B;  3LDQ B;  3AE3 A;  2YDQ A;  3OYX A;  3E08 A;  2CM0 A;  1UCU A;  4LML A;  4ILB A;  5HEO A;  4PJM A;  4TNV A;  4IL9 A;  5L3F B;  1B7T A;  3F2E A;  4ZZC A;  2JMK A;  3ESL A;  2IDO B;  3FBL A;  4H63 H;  5ABH A;  3R84 B;  2SPC A;  2VVN A;  3RHW A;  3AEA A;  4A56 A;  2WMO A;  2UXN B;  2A9U A;  4X5T A;  3PUG A;  5LNK A;  3AVR A;  2NOX A;  2FBW A;  1MMG A;  4QWN B;  4TWD A;  4ILA A;  1U4Q A;  2E9X C;  5LP6 E;  4PFP A;  2E2A A;  1WR0 A;  5CA1 E;  4HFH A;  5HXR A;  3P8C D;  1CUN A;  1Y64 B;  5LHH B;  3NWI A;  4X1I E;  3HKB E;  4YTP A;  5LHI B;  4LF8 T;  5AQR B;  1W0B A;  3KVA A;  2VKJ A;  3ZSS A;  1UUS A;  3EDV A;  2OLT A;  4O2B E;  3N2G E;  2BVL A;  1UX4 A;  1T7S A;  1UX5 A;  3KBT A;  3N5L A;  2A3D A;  2WZI A;  3UUM A;  3P4P A;  3ZMU B;  4H63 V;  2YDR A;  4H9Q C;  5AQT B;  3P7I A;  5FL0 A;  4IGU A;  4JI8 T;  1G8X A;  4GK5 E;  4X1K E;  4GYS A;  5LGT B;  4U74 A;  2NTY A;  3T1Y T;  2GK9 A;  2JQH A;  4PJJ A;  2LHN A;  1OED C;  1HTJ F;  5J1G A;  5HEJ A;  1YKH B;  2DCF A;  3AVS A;  2OV9 A;  3GA8 A;  1KEY A;  3PUW F;  4PNI A;  5EK2 A;  4JI2 T;  3WI3 A;  4NUU A;  4DV1 T;  2BG9 B;  2D9D A;  4ZHQ E;  1XMO T;  4OHF A;  2CWY A;  4ZS3 A;  4L0R A;  5FVK A;  4IIJ E;  5LOV E;  4U3C A;  2YU1 A;  5EZY E;  3LJC A;  5GON E;  4QKN A;  4U31 A;  4Z91 A;  4LF9 T;  5AQP B;  3CIR A;  3AE1 A;  3N2O A;  1N34 T;  4AQG A;  4CN6 A;  4FI5 A;  1MND A;  4B3T T;  3J7Y q;  4F6R C;  1BR2 A;  3FXD B;  4P09 A;  2MYS A;  4HFV A;  2G0U A;  2YOE A;  2CEA A;  4AQF A;  4PK5 A;  4UIG A;  1WYC A;  4MLK A;  2DI4 A;  3P4W A;  3H3A A;  4B3S T;  4EGW A;  4PK6 A;  4L5G A;  4HWF A;  2WS3 A;  4AKR B;  5AFU L;  4AKL A;  4ISS A;  4H9O C;  2WCA A;  4CN4 A;  2X0Y A;  4IT4 A;  4LF4 T;  3MA9 A;  3HL6 A;  3L8R A;  4NIQ A;  4MFR A;  5L4E A;  4E7S A;  2CRB A;  2VL8 A;  3PUS A;  3QB5 K;  4YJ3 E;  2YIN A;  2WSS V;  2XQ4 A;  3I1A A;  4EV6 A;  4PW8 A;  4HWI B;  2W61 A;  3UFG A;  3F57 A;  4ZI3 C;  1KFY A;  3UU3 A;  2EHO C;  4X64 T;  3TLU A;  5AQF B;  5CGM A;  2BDE A;  4KI0 F;  4ZI7 E;  3LK4 2;  3ZT5 A;  4NUV A;  4DV5 T;  3ZST A;  2QYW A;  2WAU A;  1CHU A;  3I0O A;  5L4H A;  1FJG T;  4UXN B;  5HEU A;  5LHG B;  4EOZ B;  2X66 A;  3OKQ A;  3UQ4 A;  3FZH B;  5J2T E;  2X0H A;  4IE6 A;  3J9X 1;  2CMR A;  2LOS A;  2XJ7 A;  3RQU A;  5JDL A;  2IML A;  4ZEY A;  1UUR A;  1HX8 A;  4KX6 A;  4WNK A;  5LXT E;  2V7J A;  4FJO A;  2VL0 A;  4MBQ A;  3NBX X;  4KUM B;  4IDN A;  2WMN A;  5LMN T;  2UXB T;  3PJA J;  4WBO A;  3F31 A;  2WBL A;  3ZEF B;  4U2Z A;  3RQW A;  2HN1 A;  3FZK B;  4EED A;  2XAQ B;  1VOM A;  4JI5 T;  2BG9 A;  3OYZ A;  4H9R C;  4YLH A;  4NXM T;  1UGO A;  2XY8 B;  3O1J A;  3Q2M A;  3N9L A;  4U72 A;  4N78 D;  4YJ2 E;  4AI6 A;  3AE2 A;  3ZJ1 A;  3C51 A;  4EZ4 A;  2E5V A;  4EYU A;  1XDO A;  5FY1 A;  2IHR 1;  3M3Z B;  5BMV E;  2XTL A;  2IC9 A;  2WDR A;  5JDN A;  4IHJ E;  3G06 A;  4ILU A;  2VKH A;  2W0G A;  3UQ7 A;  3K1S A;  2JRK A;  2WU5 A;  2J62 A;  1S35 A;  5HCJ A;  2V6Y A;  2XAF B;  4P1N A;  4UF0 B;  5AQV B;  2L3L A;  3OJA A;  3PE0 A;  4DMW A;  2WQY A;  3ZMT B;  4CXW A;  4DV7 T;  3A8Y C;  3I9Y A;  3LBX B;  3T8O A;  2LEH A;  2K3W A;  5LBM A;  2D0U A;  3EUH A;  2ODV A;  5J0Z A;  2MOZ A;  2CCQ A;  2RP4 A;  2LOP A;  5JR9 B;  2LT3 A;  5L2L A;  1YD8 G;  1YKE B;  2L8K A;  4I50 E;  1X79 A;  1XWM A;  4YSX A;  3ONJ A;  4DR4 T;  4IDP A;  4CXX A;  3KIN B;  3PDY A;  3DJB A;  1WCR A;  5LG3 A;  5H6R B;  1Z0P A;  2JMH A;  2XQ7 A;  4KP3 C;  4YTM A;  3Q5X A;  3R6N A;  1WRD A;  1XZY A;  2V7I A;  2PFV A;  2WM9 A;  1FMV A;  2C5I T;  4H9S E;  3E0Z A;  1I6Z A;  2OA5 A;  3VHL A;  1ZP0 A;  3MJX A;  3LK2 B;  3MXZ A;  1M62 A;  5F8P A;  4EAH A;  3Q5D A;  3NVO A;  1KK7 A;  3AEB A;  4EXT A;  3AEG A;  2W2U A;  2UU9 T;  3QUJ A;  4I0U A;  1E1H B;  3AAE B;  5IWA T;  5HXS A;  1OED E;  2V5D A;  4CI3 B;  2XQ5 A;  4ASK A;  3U78 A;  2V26 A;  4PJN A;  4YXD A;  3JAD A;  2LHR A;  1D0Y A;  4EZH A;  4DR2 T;  4B3R T;  4L9I A;  1FEW A;  4DBQ A;  2VKD A;  2A72 A;  5HXE A;  3JC6 C;  4IDQ A;  4ZI2 C;  3WAJ A;  4ZXL A;  3RIA A;  2X9X A;  3CX7 B;  4YSY A;  2L9Q A;  2X9H A;  4OFZ A;  3P50 A;  4HGA A;  1XNR T;  1SHZ C;  2Q9Q C;  4CQI A;  2W00 A;  2W66 A;  2V7K A;  1W09 A;  4HFC A;  3CML A;  3HR0 A;  1NAF A;  4LFC T;  2C5K T;  4ANJ A;  2YDS A;  1KNP A;  5E0O A;  3AXJ B;  4O4J E;  3GMI A;  1VCT A;  2XM1 A;  1D1B A;  3ANW B;  4BJM A;  4NXN T;  1N33 T;  5FVL A;  3N9Q A;  4UF0 A;  2FUP A;  2LE8 A;  3B5M A;  3BQK A;  4HEA A;  3AE8 A;  3PU3 A;  2LSY A;  3LBX A; 
#chains in the Genus database with same CATH homology
 4AQF A;  4TN7 B;  4PK5 A;  4UIG A;  1WYC A;  5EK3 A;  4MLK A;  2DI4 A;  3ETU A;  3H3A A;  5JDF A;  5LYJ E;  4WBN E;  4PK6 A;  4L5G A;  3BK9 A;  4UEM A;  5FXX A;  5LJM A;  4XAX B;  4JUY A;  4AKR B;  4HE8 A;  3RYH E;  5AFU L;  3GWH A;  4AKL A;  4I55 E;  4CI2 B;  5FXZ A;  4Z8X A;  3ZC0 A;  3FB2 A;  4UEL A;  5JR9 A;  4ISS A;  3FHN A;  3PTR B;  1MMD A;  4WW0 A;  4H9O C;  5JDQ A;  3O1H A;  1ZHC A;  2LM9 A;  2WWU A;  3FBZ A;  5L3D B;  3I9W A;  2PJQ A;  5DQW A;  4ZS2 A;  1NWM X;  5J2U E;  2KIN B;  3CPZ A;  2Y6X A;  2ZLY A;  3AB3 B;  3K8P C;  4ZOL E;  3MA9 A;  3HL6 A;  3KV5 A;  2JJ9 A;  2LSG A;  5M4Y A;  2IAK A;  5HXC A;  3B13 A;  4MFR A;  1MIW A;  4QXC B;  5FY0 A;  2IW5 B;  5HYA A;  4E7S A;  4EYY R;  2VL8 A;  3PUS A;  3SRZ A;  1US7 B;  1HG5 A;  2PBI A;  3N2K E;  2QGS A;  4YJ3 E;  2YIN A;  3ZYK A;  2CLY B;  1LKX A;  4ZI3 D;  5C8Y E;  4DBR A;  2WSS V;  3CVR A;  3LK3 B;  2CE7 A;  2XQY A;  3RRC A;  3I1A A;  2EHO D;  1ZEE A;  3N9P A;  1S94 A;  3H37 A;  4O4L E;  4PW8 A;  3O9X A;  4B6X A;  4IE7 A;  1V9D A;  3CX6 B;  2N1G A;  3KVB A;  2W61 A;  2D0T A;  3F57 A;  4ZI3 C;  3V5S A;  2JPF A;  2JQQ A;  4HKA A;  3PUA A;  1OWA A;  3VKH A;  1MIY A;  5JRC B;  2EHO C;  4KBM B;  2A2F X;  2DNX A;  3L3P A;  4H9P C;  5DAB A;  2ES0 A;  3IBP A;  3HKC E;  2X9W A;  2KLQ A;  4JEH B;  2BDE A;  4I4T E;  2XUE A;  4ZI7 E;  2V7M A;  4UV9 B;  1FMW A;  4O4I E;  3LFM A;  2ZMA A;  1BR0 A;  3LK4 2;  3CKD A;  2XAJ B;  3CX8 B;  5H6Q B;  3NRX A;  4NUV A;  1D0X A;  5HAX A;  5LG4 A;  3N9M A;  3ZC1 A;  1MNE A;  2M67 A;  1ZKE A;  5FP3 A;  1OXZ A;  2V1D B;  3AA6 B;  2W63 A;  2CXD A;  2WAU A;  3AA1 B;  3IF8 B;  3IHR A;  3C4X A;  3UUX B;  4O2A E;  3AA7 B;  2ACX A;  4JEU B;  3I0O A;  3HA4 A;  3KV6 A;  4CI1 B;  1BR4 A;  2H7O A;  4GIW A;  3PU8 A;  4UXN B;  2NTX A;  5LHG B;  5JVD E;  4UVA B;  4MHC A;  4EOZ B;  2E9X A;  3A5X A;  3D0T A;  3OBV E;  3RX6 A;  2X66 A;  3K3N A;  4UVC B;  3B57 A;  4TV8 E;  3QK6 A;  3VU7 H;  2H7V C;  3BQI A;  3OKQ A;  5JDH A;  5J2T E;  4DND A;  2XHE B;  3CWZ B;  2EHO B;  2ZM0 A;  4EB6 E;  4IE6 A;  2DWG A;  4ERR A;  3RC8 A;  4O4H E;  3J9X 1;  2CMR A;  2LOS A;  3WAK A;  1WR6 A;  4XBF B;  1QSD A;  5JDL A;  3MK7 C;  5FNV E;  2HPJ A;  4X1Y E;  4PJL A;  3ZMZ B;  5CA0 E;  4QXH B;  5IHY A;  1HX8 A;  3KV9 A;  3DP7 A;  5JQG E;  4AKG A;  4WNK A;  5LXT E;  2V7J A;  4FJO A;  4MBQ A;  4IE0 A;  5DJQ C;  1U5P A;  3NBX X;  5IYZ E;  4KUM B;  5FXV A;  2E9X D;  2WMN A;  3C64 A;  1IZN B;  3SOL A;  3O4X E;  2MBG A;  1HS7 A;  2DLR A;  3RRW A;  4WBO A;  2E8I A;  5LA6 E;  3F31 A;  2Z6E A;  2WBL A;  3ZEF B;  3K3O A;  5JDM A;  1KNZ A;  5LJN A;  2VK9 A;  4ADZ A;  4K0U A;  2XAQ B;  4P0A A;  1VOM A;  3ZCI A;  4YHJ A;  5ETW A;  4OK0 A;  3OYZ A;  3UUL A;  3ETV A;  2NW7 A;  3DTO A;  1SA0 E;  1H7C A;  2VB6 A;  3L09 A;  3KV4 A;  5JDG A;  2KXP B;  4H9R C;  2DHR A;  4GK0 E;  3I0Q A;  2KWI B;  4YLH A;  2K5B B;  3TKL B;  3O1J A;  1T98 A;  3Q2M A;  3N9L A;  3ANW A;  4U72 A;  2KZ7 B;  2N9D A;  4N78 D;  3FXE B;  3ZN0 B;  4YJ2 E;  5FY7 A;  4PK4 A;  4AI6 A;  4BA9 A;  3HKE E;  4IDZ A;  3IEE A;  2QA7 A;  4UVB B;  1D0Z A;  3M65 A;  3ZJ1 A;  3C51 A;  4AQF C;  4EZ4 A;  2D2S A;  5L3G B;  4EYU A;  3K3Q C;  5FY1 A;  3GN5 A;  2D5U A;  2ZM2 A;  5BMV E;  3ZPO A;  2XTL A;  1MMN A;  2IC9 A;  3CQC B;  4QX8 B;  5JDN A;  2J1D G;  3NZP A;  2Q9Q A;  4IHJ E;  4ILU A;  3VKG A;  5JR9 C;  2VKH A;  2W0G A;  4G2A A;  4M1P A;  2V7L A;  3O1I A;  2JRK A;  3ZMV B;  3UFE A;  1S35 A;  3SS1 A;  4I43 B;  3ZCJ A;  5LCY A;  4CXY A;  3RYF E;  4V1A v;  2X68 A;  1D1C A;  2XAF B;  3ZLI A;  1MIV A;  2X67 A;  3NRY A;  4UF0 B;  5JRE A;  2L3L A;  2PG8 A;  1AJ3 A;  3OJA A;  3PE0 A;  3JC6 D;  4ZI2 D;  2BZB A;  1WYB A;  4DMW A;  3N9O A;  5EK4 A;  3ZMT B;  3AA0 B;  3QC9 A;  3UTK A;  1HG2 A;  3CQG B;  4CXW A;  2CXL A;  4JLE A;  2C5J A;  4E7Z A;  2Q9Q D;  3I9Y A;  5JH7 E;  2ODU A;  5A1L A;  4EIW A;  3OYX A;  2XAG B;  3LBX B;  2LEH A;  5FMN A;  3LG7 A;  3T8O A;  3ZN1 B;  3AAA B;  3E08 A;  4O8S A;  2CM0 A;  1UCU A;  4GOU A;  4HN9 A;  4X20 E;  4PJM A;  2X51 A;  2X9Y A;  5LBM A;  2LSI A;  2D0U A;  2K24 A;  3EUH A;  2ODV A;  5KMG P;  5L3F B;  1B7T A;  3F2E A;  4PAG A;  5CA1 E;  2MOZ A;  2CCQ A;  3ZMS B;  4BAY B;  3HI2 A;  2JMK A;  3ESL A;  2RP4 A;  2LOP A;  2CXF A;  2KT9 A;  2LT3 A;  5JR9 B;  5L2L A;  1YD8 G;  3FBL A;  4H63 H;  1ZV4 X;  1YW0 A;  3ZJ2 A;  4AKI A;  3R84 B;  5L3C B;  2SPC A;  3RH3 A;  1YKE B;  2L8K A;  3C98 B;  3W15 B;  4I50 E;  4CZZ B;  1X79 A;  2YK0 A;  5L3E B;  2LSJ A;  5LBQ B;  4A56 A;  4QX7 B;  4YFS A;  3MKD A;  4CXX A;  3PU3 A;  3KIN B;  2WMO A;  2YU2 A;  3PDY A;  2UXN B;  5CB4 E;  4GYR A;  3N9N A;  4IE5 A;  5JRC A;  3DJB A;  3PUG A;  4AXP A;  3AVR A;  3C50 A;  4QHO A;  3RYC E;  5LNK A;  5H6R B;  3UT5 E;  2NOX A;  1MMG A;  2C0S A;  3ONX A;  2Y48 B;  1Z0P A;  3HKD E;  3RC3 A;  4QWN B;  2JMH A;  4AKH A;  2K9A A;  2KND A;  4KP3 C;  5L3B B;  1U4Q A;  2E9X C;  3KFW X;  3Q5X A;  3R6N A;  1WRD A;  3MAC A;  5LP6 E;  4PFP A;  3SWH A;  3EVY A;  3KBU A;  2V7I A;  2P9B A;  2PFV A;  4TZ4 C;  2WM9 A;  5FXW A;  1FMV A;  1LVF A;  4MAL A;  1EZ3 A;  2C5I T;  5HXR A;  4H9S E;  2BVM A;  3E0Z A;  3P8C D;  4G63 A;  1CUN A;  1Y64 B;  2KWH A;  5LHH B;  2OA5 A;  2XAH B;  3C4W A;  5DQV A;  4X1I E;  1HF8 A;  5KX5 E;  3HKB E;  3VHL A;  1WLX A;  5LHI B;  3KVA A;  3MJX A;  1LVK A;  2VKJ A;  3LK2 B;  1D1A A;  3MXZ A;  5F8P A;  4XZC A;  2NW8 A;  4OYJ A;  4EAH A;  3V5U A;  3EDV A;  2VAS A;  2LSK A;  4O2B E;  1KK7 A;  4OYK A;  2IC6 A;  3N2G E;  4TUY E;  2BVL A;  1UX4 A;  2UXX B;  2EHO A;  1IAP A;  5TAO A;  2B1E A;  4EXT A;  5HWX A;  3PUQ A;  1UX5 A;  3KBT A;  3N5L A;  3QUJ A;  2A3D A;  5ADX L;  4TX5 A;  3UUM A;  1FIO A;  3S4U A;  3ZMU B;  2W62 A;  3RPU A;  2NWB A;  4H63 V;  1E1H B;  3AAE B;  2MTQ A;  1LRZ A;  5HXS A;  2E9X B;  4CI3 B;  4C90 A;  4ASK A;  3EDU A;  2CA5 A;  4H9Q C;  2X0L B;  2V26 A;  4IST A;  3U78 A;  4PJN A;  5KDM C;  3P7I A;  1HCI A;  4IGU A;  2LJL A;  1G8X A;  2LHR A;  4GK5 E;  4J2C A;  4X1K E;  3RKO A;  4GYS A;  3AAI A;  5LGN B;  1D0Y A;  4EZH A;  5LGT B;  4DO0 A;  4L9I A;  1FEW A;  3CQX C;  3Q9D A;  2VKO A;  4U74 A;  4UV8 B;  2HPL A;  5HXH A;  2NTY A;  5F3J A;  2NW9 A;  2GK9 A;  4DBQ A;  2VKD A;  2H3R A;  2A72 A;  4DMV A;  4PJJ A;  2LHN A;  3ZYL A;  1HTJ F;  4C91 A;  5HXE A;  3JC6 C;  4ZI2 C;  3WAJ A;  4HTE A;  2Y8D A;  2X9X A;  4P0B A;  3PUR A;  5J1G A;  3CX7 B;  1YKH B;  2L9Q A;  2DCF A;  2X9H A;  3RYI E;  3AVS A;  4OFZ A;  3E22 E;  4HGA A;  1VRB A;  1SHZ C;  3GA8 A;  1IJ5 A;  2Q9Q C;  4CQI A;  4PNI A;  5EK2 A;  2W00 A;  1MMA A;  2V7K A;  2XAS B;  3CML A;  2HH7 A;  3HR0 A;  2I59 A;  1O3X A;  1NAF A;  5LGU B;  3WI3 A;  2C5K T;  2RA1 A;  2YEV C;  4H9N C;  4NUU A;  4ANJ A;  1IJ6 A;  4PFO A;  5E0O A;  3MZK B;  4ZHQ E;  3BQL A;  4O4J E;  4TV9 E;  3GMI A;  3U3I A;  4DVD A;  4OHF A;  2CWO A;  4IE4 A;  2CWY A;  4ZS3 A;  4L0R A;  2ZM8 A;  4IIJ E;  1D1B A;  2VWA A;  4BJN A;  1BR1 A;  3ZYM A;  5LOV E;  2YU1 A;  3ANW B;  4KMC A;  4BJM A;  5EZY E;  3LJC A;  5GON E;  4QKN A;  4QXB B;  3C4Z A;  2DWK A;  2K48 A;  3N2O A;  3NZQ A;  4AQG A;  3GN5 B;  4FI5 A;  3UUN A;  1HFA A;  5FYM A;  3N9Q A;  1MND A;  4UF0 A;  2NP9 A;  3Q5W A;  3J7Y q;  4F6R C;  1BR2 A;  1QUU A;  2Q9Q B;  2KMF A;  3FXD B;  4P09 A;  2MYS A;  5HWY A;  4HFV A;  2LE8 A;  2G0U A;  3BQK A;  3KDS E;  4HEA A;  1G73 A;  2N2N A;  2CLY C;  2CEA A;  2LSY A;  3LBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...