3ZJ2A

Structure of nab2p tandem zinc finger 34
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
b'GSVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIKEVKPISQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
publication title Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zj2A00
2LHNA 3ZJ2A 3ZJ1A 5L2LA
chains in the Genus database with same CATH superfamily
1ZV4X 2VVSA 5L3DB 4TZ4C 2V6YB 2X68A 1IBLT 2NTYA 3B5MA 1KNZA 4CN6A 4JUYA 2B76A 3N9MA 3WAJA 5CA1E 2QRXA 3ZT5A 2LHRA 5AQKB 5C3JA 3NRXA 3LJCA 4UEMA 2CBIA 2BBJA 1D1CA 1NWMX 5IYZE 2CMRA 5H6RB 3EI0A 1UK5A 3EUHA 4N78D 3LK2B 3CQGB 5AQUB 3LK3B 2XQ5A 2VKOA 4ZI2C 5HWXA 1XNRT 3ZJ1A 4P1NA 1YQ4A 2LSYA 5HCMA 2PJQA 3AEGA 2LHNA 5LGNB 1ZP0A 5JR9B 5L3FB 3AE9A 5AQNB 2DWKA 1UUSA 1KNPA 3NWIA 4XZCA 2H3RA 4H9OC 2YKSA 2JIWA 2HN1A 2K9AA 4PNIA 3PUVF 5L3EB 2CE7A 5FY7A 3PUWF 5ABFA 4CN1A 4P09A 2Z6EA 2P9BA 2BS2A 1N32T 2VWAA 2Q9QA 4ZI3D 4KP3C 4CXYA 3TLSA 3ZYMA 5LMUT 2RP4A 2UXXB 2WSSV 3PUGA 4NUUA 3ONJA 1SHZC 2R6GF 2I59A 2KSRA 4ZI7E 2FJAA 3T1YT 3U78A 5AQLB 4NUVA 1YXRA 4GKKT 4HKAA 4CI1B 2VKDA 1KNRA 1QSDA 5EK2A 2C5JA 5JDLA 5LG3A 4HFDA 3C64A 3AE8A 5AQPB 5AQMB 4LMJA 3MXZA 4QX7B 4DR6T 3RYIE 1V9DA 3AE3A 4AI6A 3OBVE 3NRYA 2QVAA 2KXPB 5FXVA 4LF4T 4DVDA 1WLXA 4M1PA 1E1HB 4KMCA 4IGUA 4IE6A 5LMNT 4B3MT 2UXDT 2YDRA 1QLBA 3KVAA 1UX4A 3K3NA 2LM2A 2Y6XA 2IMLA 2SPCA 3FZFB 1CUNA 4PW8A 3F57A 4KHZF 3O1HA 4FJOA 2V7KA 3KBUA 1J1JA 2A3DA 4QX8B 5EK3A 1BR1A 2XPKA 2JQQA 4OX9T 4ERRA 3HI2A 1WCRA 4WYVA 1WYBA 3CX6B 2VURA 4U2YA 2BG9C 3ZCIA 4QH1A 2CHNA 2V7IA 2I0MA 2XQ9A 2WU5A 2KWIB 4ZS3A 4A97A 2N9DA 2WU2A 2KNDA 5F5WA 2BZBA 2XQ6A 3P4WA 5LA6E 3AECA 2AXDS 4UVCB 2DHRA 4YJ3E 2VL8A 2OA5A 3QOFA 4DUYT 1HTJF 2MBGA 4IL9A 3AA7B 2X66A 5AQSB 3ZLIA 4PAGA 1LVFA 5E0OA 1MNEA 1HX1B 2VVNA 5L47A 2KINB 2YK0A 4B3ST 4Z8XA 4FI5A 4DV1T 2BKNA 3P50A 4AIUA 5AFUL 4GIWA 2XAHB 5JDNA 4CI3B 2WMNA 4ZS2A 4IHJE 5ABFB 1I6ZA 2DCFA 3O1JA 2Q9QB 2X67A 3H3MA 2FBWA 2UXBT 3JC6C 4L5GA 1HNWT 3TLWA 5CA0E 1YD8G 3KV4A 3NKZA 4F6RC 5AQTB 3TLVA 5LYJE 3E22E 2YN6A 4ASKA 2IC9A 4ILBA 3B13A 3RPUA 5AQHB 5LHGB 5J2TE 5FNVE 4HEAA 2DNXA 3PDYA 1HCIA 3ZT6A 3PJAJ 3R84B 3TLTA 5FL1A 2W61A 2PBIA 5IUXA 3GN5A 1NENA 5A1LA 2W66A 4PK5A 4TNVA 4OFZA 5HXEA 2W2UA 3QK6A 5IWAT 4NPPA 5HXSA 2JMHA 4LMKA 1YKHB 3O1IA 3SFDA 3WI3A 4DV5T 3PTRB 2LM9A 4YSZA 4L9IA 5L3GB 3G06A 4A5XA 4I0UA 2MAWA 3RKGA 5F3JA 2LKGA 1MMDA 5FY1A 4DV7T 3RRWA 3TLUA 2XAFB 3Q9DA 2D5UA 2LE8A 4BA9A 3NVOA 3ZSTA 2V5CA 3M3ZB 3UT5E 4U72A 3VRBA 1R8IA 4IIJE 1HNXT 2YU2A 4DMVA 3AE7A 2E5LT 5FL0A 2WM9A 2CXLA 1MMAA 4GOUA 4DV2T 2JQ9A 5AQGB 2XQYA 2PG8A 3QUJA 4AXPA 3RIUC 1IBKT 2LSGA 4QH5A 4TWHA 4HGAA 5JREA 4OYJA 4B3TT 4TNWA 3F2EA 1M62A 1ZOYA 3RYCE 3LBXA 3EDVA 3BQKA 4AKLA 2VK9A 5FXXA 4CQIA 2BVMA 3C4ZA 4B3RT 1UCUA 1HFAA 1HS7A 4WBNE 2L8KA 3AE1A 3CMLA 2YU1A 3AA1B 3SOLA 2HPLA 3CIRA 5JRCA 2WWVA 3V5UA 4KX6A 3PU3A 3T1HT 4LMLA 3DJBA 4H9QC 2K24A 5FP3A 5HEUA 3FHNA 1LKXA 5LB7B 3DTOA 4JLEA 2E2AA 3IHRA 1GQEA 5ABEA 2UUBT 5ETWA 3CVRA 2LSJA 1WYCA 3X1DA 2D2SA 2LSKA 1XMOT 1W0BA 2BG9E 2N1GA 3P4QA 5KDMC 3O9XA 3RC8A 3C4WA 1Z0PA 5LCYA 3RIAA 3GN5B 2VKJA 2W67A 5JDHA 2ES0A 3FXEB 4HWDA 1LRZA 1XDPA 4EEBA 2MYSA 3C50A 4KBMB 5KXJA 2FJEA 5TAOA 4CN4A 2LSIA 4U7IA 3PUQA 5AQJB 2J62A 3QC9A 3U3IA 4LFAT 5L4HA 3KV6A 4IDZA 4MHCA 1YQ3A 2X0LB 2CLYB 3CX8B 2C5KT 5JDQA 4IDOA 2ZM2A 4ZHQE 3ONXA 4HFCA 4WNKA 3ABVA 4YTMA 3AEAA 4G63A 5LG4A 3R6NA 4EGWA 3K8PC 2UXCT 1E2AA 4AQFC 3KFWX 5LJNA 2BS3A 1D1AA 4EAHA 2QA7A 1M7KA 2MOZA 1EZ3A 2JQKA 3ONLC 4IL4A 2M6IA 3VKHA 3F31A 3VR8A 4UR9A 2LJLA 4JI5T 4TX5A 3CQCB 4AISA 3FBLA 3RYFE 3L09A 4HFVA 4KUMB 2XJ7A 4DBRA 3E0ZA 3AXJA 2KLQA 3ZKRA 4YFSA 1O3XA 3AAIA 2H88A 2WDQA 4IDPA 5LHHB 4JEUB 2V1DB 2DLRA 3LBXB 1XZYA 3CK6A 2J4GA 5JTGA 1W09A 5FXWA 4JV5T 2A9UA 1JNZA 2Y8DA 4J2CA 1XNQT 3UTKA 2M67A 5JDMA 4JI0T 2K3WA 3CQXC 4A98A 1HR0T 4JEHB 2BBHA 1FEWA 1G8XA 1IZNB 2WDRA 3ZJ2A 5JRCB 2H7VC 3RQWA 3FXDB 3N2GE 2V26A 3Q5WA 3NZPA 3OTOT 3J7Yq 2H7OA 5HXCA 2HH7A 5EK4A 1E7PA 1H7CA 3PJAA 3P4RA 3A8YC 4DNDA 1HNZT 2LOPA 2MTQA 2J47A 5IHYA 1AJ3A 4ZZBA 3AVRA 2D9DA 2OLTA 5FYMA 2WMOA 1FJGT 4DR2T 1J5ET 2EHOB 4IT4A 2LEHA 3CPZA 2X0HA 2W0GA 5AQIB 1OEDC 5M4YA 4KHPT 5L3CB 1G73A 4UF0A 4V1Av 3LDQB 2XM1A 2XSBA 2VQFT 2YOEA 3VHLA 2CM0A 4E7SA 3GWHA 5HYAA 2OV9A 3NBXX 3KV5A 3RYHE 1SUMB 3OYXA 1U5PA 4X1YE 4CXWA 2WZIA 4H9RC 4ILAA 4DR1T 5AQRB 4U31A 4H9SE 1ZEEA 3H3AA 4OYKA 4HTEA 3A5XA 1T8BA 1FMVA 3Q5XA 3S4UA 1J5WA 3J9X1 2LRLA 3ZT7A 3KDSE 2A72A 1OXZA 3DP7A 4U33A 2JMKA 3N2KE 3UUXB 5GONE 4DUZT 2LRKA 4TUYE 2WCAA 3AEFA 3PUZF 2BG9A 1MNDA 4UIGA 2M6BA 4IDQA 4ZI3C 4GK0E 2JRKA 1MIYA 3PUXF 4NXMT 3MACA 4ISTA 2RPAA 1HX8A 3E08A 2MPKA 3AAAB 3AVSA 4BJMA 1MMGA 4I50E 2EHOD 1B7TA 2E9XD 3UQ4A 3Q2MA 2CXDA 1T7SA 2CCQA 4O2AE 5ABGA 1N36T 1N34T 1S94A 2QYWA 3AXJB 3PU8A 3ZMZB 4UVBB 5AQVB 2V7JA 5AQFB 4C91A 4UV8B 4QH4A 4DO0A 1VCTA 5ABHA 5HXHA 1WFDA 2XZEA 2NW7A 5H6QB 5JR9C 2D0UA 2YDQA 3WAKA 4EYYR 1IBMT 2I6HA 4YHHT 3C51A 4O4LE 2CA5A 4PJLA 1KF6A 2CEAA 3MJXA 2LOSA 5L4EA 2E8IA 3EHZA 2VB6A 1I94T 4F8HA 2E5VA 4YTPA 3UUBA 4DR3T 4WBOA 2YEVC 4I4TE 4HWFA 4H9NC 4X66T 2B1EA 2CRBA 3RHWA 3I0OA 3UUMA 4P0BA 2A2FX 3VU7H 4UF0B 4GK5E 4P0AA 4LF9T 3KV9A 1ZHCA 1Y64B 4TV8E 4LF5T 4CI2B 2WP9A 4ZI2D 3ZMSB 3L39A 3RH3A 4IDNA 2KMFA 4MFRA 4WW0A 3I9YA 4I43B 5J1GA 2H89A 3UU8A 3IA3A 3KINB 1HG5A 4IE4A 4JI8T 3RX6A 1NEKA 2XQ8A 3UU5A 4CXXA 1KFYA 5LNKA 2BVLA 2ZM6T 3N9OA 4O2BE 2ZLYA 5L3BB 4G2AA 3QNUA 1XWMA 2CWYA 3UU6A 4IE5A 4JYAT 5J0ZA 3LFMA 3AB3B 2BG9B 5CGMA 4TV9E 4JI1T 1XMQT 2AE9A 2XUEA 3ZYKA 4ZXLA 2ZMAA 3SFEA 3CWZB 3RQUA 2BS4A 4AQYT 2W4XA 2RA1A 2V7MA 2X9HA 4QWNB 2K5BB 4IREA 5HEHA 3MA9A 3IF8B 3AA6B 3ZC0A 1IJ5A 2XHEB 1KK7A 1T72A 4NIQA 3FBZA 3RIUA 3K1SA 4DBQA 1U4QA 5HWYA 3L3PA 4ILCA 3CKDA 2XSAA 1VCSA 3BQLA 2C0SA 4H63H 1W0AA 2EHOA 3MKDA 5JDGA 5DABA 4ZOLE 5JVDE 4C90A 2E9XA 5KX5E 2NOXA 1OEDE 5JDFA 3PUAA 2IIUA 1Z8UA 1MIVA 4HWIB 4KI0F 4QXCB 4UXNB 2YINA 4IE7A 3SS1A 3I9WA 1FIOA 2ODUA 4YLHA 3OYZA 2ACXA 3N5LA 2XM2A 4PJNA 4X5TA 2ZM8A 4DMWA 2C5IT 1JNRA 1W9RA 5JQGE 5F8PA 4GKJT 4JI2T 1US7B 2ZM0A 3ZCJA 3A7MA 4I55E 4TWFA 4DV3T 3HKDE 2BDEA 3MK7C 4GYRA 5LJMA 4DIDB 2Q9QC 2V7LA 3ZPOA 4EYUA 3ZEFB 2LKHA 3LK42 3RLFF 4HFEA 2G0UA 3OKQA 1UGOA 4ANJA 3FZMB 4YSYA 4BAYB 2DI4A 3GA8A 3JCFA 4QKNA 5FMNA 3T8OA 4PJMA 1KEYA 2WB5A 3PUYF 3NZQA 4DV6T 4LF6T 3P8CD 4ADZA 4DR7T 1MMNA 4DR4T 4O4JE 5DQVA 3B57A 4UVAB 1D1BA 4DV4T 3AE4A 4PK4A 4HWCA 3V5SA 3ANWA 3K3QC 3GMIA 4TN7B 2N2NA 4AKIA 4JBWF 3HR0A 4HFBA 1BR2A 2QGSA 3OPCA 2K48A 2IDOB 4HWHA 5JH7E 4HE8A 2BKOA 1WRDA 3QB5A 3N9NA 1BR0A 4EEDA 2UUAT 1FMWA 4AKRB 3JC6D 4AQFA 2DL1A 2D0TA 4YY3T 2XQAA 5LHIB 3ESLA 2L3LA 3AEBA 2PTFA 3I1AA 2DWGA 3P7IA 5LBMA 4Z90A 3RKOA 5HEJA 3KVBA 2X0YA 3UFGA 1YW0A 1D0YA 5FY0A 5FKYA 1X9BA 1YKEB 2WQYA 3UQ7A 4K0UA 1OWAA 2PFVA 2WZHA 4HN9A 2V5DA 4DV0T 4QXBB 1BR4A 4MLKA 4DR5T 1WR6A 3RI5A 2E9XB 4AQGA 2V6XA 5DQWA 5BMVE 5L2LA 2F4VT 2FJDA 1T98A 1LVKA 4L0RA 3VKGA 2WWUA 5LOVE 4MALA 1X79A 3W15B 4QXHB 4COFA 3ETVA 2WS3A 3ETUA 4OHFA 1N33T 3ZYLA 3KBTA 3O4XE 2CBJA 1D0ZA 3AEDA 2WDVA 4BJNA 3K3OA 1IAPA 1ZKEA 2IAKA 4LF7T 5KMGP 5CB4E 3PV0F 3ZMTB 2UU9T 2XQ7A 2JPFA 4E7ZA 2BKPA 4XBFB 3CX7B 1SA0E 1MIWA 1UX5A 4X20E 2WY2A 4YJ2E 2L9QA 4LF8T 2NP9A 1OEDA 2HN2A 2XTLA 1VOMA 3FZLB 3PURA 2X9WA 3HL6A 5DJQC 4X64T 1SE7A 4UV9B 2KT9A 2NR4A 5LP6E 4YTNA 4EOZB 2XASB 2HHHT 3P4PA 3JAFA 4PJJA 3C98B 1DU2A 3N9PA 4JI4T 3C4XA 4YSXA 4EB6E 4YT0A 4X1IE 3ANWB 3D0TA 5FVKA 2W63A 3RC3A 3RIFA 5AQOB 2YDSA 4B6XA 3JADA 2X9YA 2ACZA 4Z91A 2CXFA 3HKCE 2NTXA 5CFBA 4X62T 1UURA 5LXTE 4K0KT 3ZN0B 3EVYA 4IE0A 2NW8A 4XAXB 3AE2A 3IEEA 2CLYC 4EV6A 4GYSA 3OVUA 3ZMVB 3LG7A 3AE5A 5FVLA 4U74A 2V6YA 3ZSSA 1VRBA 3HKBE 1HG2A 5LGUB 2JJ9A 3AA0B 1S35A 3FZKB 2W00A 4LFCT 2NW9A 3VRAA 4LFBT 3TKLB 4EZHA 3ZMUB 2CHOA 1QUUA 4U7YA 2XAQB 3AE6A 3Q5EA 2KZ7B 3EDUA 3OJAA 4YHJA 2VL0A 2WBLA 1L0VA 4EZ4A 4CZZB 1IJ6A 2XAJB 4H63V 2IW5B 3SWHA 1CHUA 2IC6A 3L8RA 3RRCA 4PFOA 5JR9A 5HEOA 4NXNT 4O4HE 4PK6A 5HAXA 4U3CA 3PUSA 5EZYE 3SRZA 4UELA 3UFEA 4ISSA 2ODVA 3VR9A 2Q9QD 2X51A 4U2ZA 2XQ4A 1WR0A 5HXRA 3UUNA 3ZN1B 2VKHA 4JI6T 2XY8B 4HFHA 3N9LA 3AAEB 4AKGA 3RF1A 3MZKB 4YXDA 2X9XA 2Y48B 5HCJA 3N9QA 2LLYA 5J2UE 4OK0A 2NWBA 3I0QA 3FB2A 5C2TA 4O4IE 3AEEA 2J1DG 3H37A 3EAMA 4TWDA 1OEDB 5C8YE 3EABA 2CPTA 5HEGA 4HFIA 4QHOA 3LSVA 5CJ5A 2HPJA 4ZZCA 2KWHA 4X1KE 4H9PC 3QB5K 5BR8T 5LBQB 2LT3A 2V8SV 2FUPA 2IHR1 3IBPA 2EHOC 4EIWA 5LGTB 3N2OA 2E9XC 4A56A 4ILUA 3BQIA 4JI7T 2GK9A 1XDOA 4Q25A 2IUBA 3PE0A 2WAUA 3M65A 5ADXL 3ZC1A 4ZEYA 4JI3T 5FXZA 2VQET 3RGLA 3Q5DA 3HA4A 3UU3A 3JAEA 3BK9A 4MBQA 4EXTA 2W62A 2XQ3A 2XAGB 2VASA 2JQHA 4WZXA 2UUCT 1D0XA 4AKHA 3P4SA 2FJBA 3UU4A 5AQQB 3UULA 1HF8A 4X65T 1Y01A 4PFPA 4O8SA 2CWOA 2UXNB 3HKEE 3FZHB 1NAFA
chains in the Genus database with same CATH topology
1MIYA 1ZV4X 5L3DB 3MACA 4TZ4C 3UT5E 4U72A 2X68A 4IIJE 2NTYA 5LHIB 1KNZA 3ESLA 2YU2A 4DMVA 2L3LA 4ISTA 3I1AA 2DWGA 4JUYA 3P7IA 5LBMA 3RKOA 3N9MA 3WAJA 1HX8A 3KVBA 5CA1E 3E08A 2LHRA 1YW0A 1D0YA 5FY0A 3AAAB 4BJMA 3AVSA 1MMGA 2WM9A 3LJCA 3NRXA 4I50E 2EHOD 1YKEB 2CXLA 1MMAA 4GOUA 4UEMA 1B7TA 2E9XD 3Q2MA 2CXDA 2XQYA 4K0UA 1OWAA 2PG8A 2PFVA 1D1CA 2CCQA 4HN9A 3QUJA 4AXPA 1NWMX 5IYZE 2CMRA 4O2AE 5H6RB 4QXBB 3EUHA 2LSGA 1BR4A 1S94A 4MLKA 4N78D 3PU8A 3ZMZB 3LK2B 3CQGB 1WR6A 4UVBB 4HGAA 3LK3B 5JREA 4OYJA 2VKOA 4ZI2C 2V7JA 5HWXA 3ZJ1A 2E9XB 4C91A 4UV8B 3F2EA 4AQGA 2LSYA 3RYCE 3LBXA 2PJQA 5DQWA 2LHNA 3EDVA 5BMVE 3BQKA 4AKLA 5LGNB 5L2LA 4DO0A 5JR9B 2VK9A 5L3FB 1T98A 5FXXA 1LVKA 4CQIA 2BVMA 4L0RA 5HXHA 3VKGA 3C4ZA 2WWUA 5LOVE 2DWKA 4MALA 1UCUA 1X79A 2NW7A 3W15B 1HFAA 5H6QB 1HS7A 5JR9C 4QXHB 4XZCA 3ETVA 2D0UA 3ETUA 2H3RA 4H9OC 4WBNE 2K9AA 4OHFA 4PNIA 3WAKA 2L8KA 3CMLA 4EYYR 2YU1A 3AA1B 3SOLA 5L3EB 2HPLA 2CE7A 3C51A 3ZYLA 3KBTA 5FY7A 3O4XE 2CA5A 4O4LE 4PJLA 1D0ZA 2CEAA 5JRCA 3V5UA 3MJXA 4P09A 4BJNA 2LOSA 2Z6EA 2P9BA 3PU3A 2E8IA 2VWAA 2Q9QA 3K3OA 4ZI3D 1IAPA 4KP3C 4CZZB 4CXYA 1ZKEA 2IAKA 5KMGP 2VB6A 5CB4E 3ZMTB 3ZYMA 2RP4A 3DJBA 4H9QC 2JPFA 2K24A 4E7ZA 5FP3A 2UXXB 2WSSV 3PUGA 4WBOA 4XBFB 3CX7B 2YEVC 4NUUA 1SA0E 1SHZC 3FHNA 1MIWA 1UX5A 2I59A 4I4TE 1LKXA 4ZI7E 3DTOA 4JLEA 4X20E 4YJ2E 3IHRA 2L9QA 3U78A 2NP9A 4NUVA 4H9NC 2XTLA 5ETWA 3CVRA 2B1EA 1VOMA 4HKAA 4CI1B 2VKDA 2LSJA 3PURA 1WYCA 3I0OA 2X9WA 3UUMA 1QSDA 4P0BA 3HL6A 2A2FX 5DJQC 5EK2A 2C5JA 3VU7H 5JDLA 4UF0B 3C64A 4GK5E 4P0AA 3KV9A 2D2SA 2LSKA 4UV9B 2KT9A 1ZHCA 3MXZA 1Y64B 5LP6E 4QX7B 4EOZB 2XASB 2N1GA 4TV8E 4CI2B 5KDMC 4PJJA 3O9XA 3C98B 3RC8A 3C4WA 3RYIE 1Z0PA 4ZI2D 5LCYA 3N9PA 1V9DA 3ZMSB 4AI6A 3GN5B 3OBVE 3NRYA 2VKJA 3RH3A 2KXPB 5JDHA 2KMFA 3C4XA 5FXVA 2ES0A 3FXEB 4DVDA 4EB6E 1WLXA 1LRZA 4MFRA 3I9YA 4WW0A 4I43B 5J1GA 4X1IE 3ANWB 2MYSA 3C50A 3D0TA 4M1PA 4KBMB 1E1HB 5TAOA 2W63A 4KMCA 3RC3A 3KINB 4IGUA 1HG5A 4IE6A 2LSIA 3PUQA 4IE4A 4B6XA 3KVAA 3RX6A 3QC9A 3U3IA 2X9YA 1UX4A 3K3NA 2Y6XA 3KV6A 4IDZA 2SPCA 4MHCA 4CXXA 1CUNA 5LNKA 2BVLA 2CXFA 3HKCE 3N9OA 4PW8A 3F57A 4O2BE 2NTXA 2X0LB 2ZLYA 2CLYB 3CX8B 3O1HA 4G2AA 5L3BB 2C5KT 5LXTE 4FJOA 3ZN0B 3EVYA 2CWYA 2V7KA 4IE5A 5JDQA 3KBUA 4IE0A 2NW8A 2ZM2A 4XAXB 4ZHQE 2A3DA 3LFMA 3ONXA 4QX8B 5EK3A 3AB3B 3IEEA 2CLYC 4WNKA 4GYSA 4TV9E 1BR1A 3ZMVB 3LG7A 4G63A 2JQQA 2XUEA 3ZYKA 4ERRA 5LG4A 3R6NA 2ZMAA 3HI2A 1WYBA 3CX6B 4U74A 3K8PC 3ZCIA 4AQFC 3CWZB 1VRBA 3KFWX 5LJNA 2V7IA 3HKBE 1HG2A 2RA1A 1D1AA 2V7MA 4EAHA 2KWIB 4ZS3A 2X9HA 4QWNB 5LGUB 2JJ9A 3AA0B 1S35A 2QA7A 2N9DA 2K5BB 2W00A 2KNDA 3IF8B 2MOZA 3MA9A 1EZ3A 3AA6B 3VKHA 3F31A 3ZC0A 2LJLA 2NW9A 1IJ5A 2BZBA 2XHEB 1KK7A 4TX5A 3CQCB 3FBZA 3FBLA 3TKLB 5LA6E 3RYFE 4DBQA 4UVCB 1U4QA 4EZHA 5HWYA 3ZMUB 3L09A 4HFVA 2DHRA 1QUUA 2XAQB 4YJ3E 2VL8A 3L3PA 4KUMB 3CKDA 2OA5A 4DBRA 3BQLA 2KZ7B 3E0ZA 1HTJF 3EDUA 2C0SA 4H63H 3OJAA 2KLQA 4YHJA 2MBGA 2WBLA 4EZ4A 4YFSA 2EHOA 1O3XA 3AAIA 3MKDA 5LHHB 5JDGA 5DABA 1IJ6A 2XAJB 4JEUB 4ZOLE 3AA7B 2E9XA 4H63V 2X66A 5JVDE 3ZLIA 4C90A 2IW5B 2V1DB 5KX5E 2DLRA 2NOXA 1LVFA 3LBXB 4PAGA 5JDFA 3SWHA 3PUAA 5E0OA 1MNEA 2IC6A 3RRCA 4PFOA 1MIVA 2KINB 5FXWA 2YK0A 4QXCB 4UXNB 2YINA 5JR9A 4IE7A 3SS1A 3I9WA 2Y8DA 1FIOA 2ODUA 4J2CA 4O4HE 4PK6A 5HAXA 3PUSA 4YLHA 3OYZA 5EZYE 3SRZA 4UELA 3UFEA 4ISSA 2ACXA 2ODVA 3N5LA 3UTKA 4PJNA 2ZM8A 4DMWA 4Z8XA 2Q9QD 2M67A 4FI5A 5JDMA 2X51A 2C5IT 5AFUL 3CQXC 4GIWA 5HXRA 4JEHB 3UUNA 3ZN1B 2XAHB 2VKHA 5JDNA 5F8PA 1FEWA 1G8XA 5JQGE 1IZNB 4CI3B 3ZJ2A 1US7B 2WMNA 5JRCB 2H7VC 3N9LA 4ZS2A 4IHJE 3FXDB 2ZM0A 3ZCJA 3N2GE 4I55E 3AAEB 2V26A 4AKGA 3Q5WA 3NZPA 2DCFA 3J7Yq 3O1JA 2Q9QB 3MZKB 3HKDE 2X9XA 2H7OA 2BDEA 3MK7C 2Y48B 2X67A 5HXCA 3N9QA 4GYRA 2HH7A 5EK4A 1H7CA 5J2UE 3JC6C 4L5GA 4OK0A 5LJMA 5CA0E 2Q9QC 2NWBA 1YD8G 3I0QA 3KV4A 4DNDA 2V7LA 3FB2A 3ZPOA 4EYUA 4F6RC 2LOPA 3ZEFB 2MTQA 5IHYA 1AJ3A 4O4IE 2J1DG 3AVRA 3LK42 5LYJE 3E22E 3H37A 5FYMA 4ASKA 2G0UA 5C8YE 2IC9A 2WMOA 3OKQA 4ANJA 3B13A 3RPUA 5J2TE 5LHGB 4BAYB 5FNVE 4HEAA 2DI4A 2EHOB 3GA8A 4QHOA 2DNXA 2HPJA 2LEHA 3CPZA 2W0GA 5M4YA 2KWHA 4QKNA 4X1KE 5L3CB 5FMNA 1G73A 4H9PC 3PDYA 3T8OA 4PJMA 4UF0A 4V1Av 5LBQB 2LT3A 1HCIA 3IBPA 2EHOC 4EIWA 3R84B 5LGTB 3N2OA 2CM0A 2E9XC 3NZQA 3VHLA 4A56A 4E7SA 3GWHA 5HYAA 4ILUA 3P8CD 2W61A 3NBXX 3BQIA 3KV5A 3RYHE 3OYXA 2GK9A 1U5PA 4X1YE 4CXWA 4ADZA 2PBIA 1MMNA 4H9RC 4O4JE 3PE0A 5DQVA 3GN5A 3B57A 4UVAB 1D1BA 2WAUA 5A1LA 4PK4A 3M65A 5ADXL 3V5SA 4PK5A 3ZC1A 3ANWA 3K3QC 5FXZA 4H9SE 1ZEEA 4OFZA 3H3AA 5HXEA 3QK6A 4OYKA 3GMIA 4TN7B 4HTEA 3A5XA 5HXSA 2JMHA 3HA4A 2N2NA 1FMVA 4AKIA 3Q5XA 3HR0A 4GK0E 4MBQA 3BK9A 4EXTA 3S4UA 1YKHB 1BR2A 3J9X1 3O1IA 3WI3A 2W62A 3PTRB 3KDSE 2LM9A 2VASA 2XAGB 1D0XA 2A72A 1OXZA 4L9IA 4AKHA 2QGSA 5L3GB 3DP7A 2K48A 2JMKA 3UULA 5F3JA 5JH7E 3N2KE 4HE8A 3UUXB 1WRDA 1HF8A 1MMDA 5FY1A 5GONE 4TUYE 3RRWA 3N9NA 1BR0A 1FMWA 4AKRB 3JC6D 4PFPA 2XAFB 1MNDA 2CWOA 2UXNB 3Q9DA 3HKEE 4O8SA 4UIGA 4AQFA 4ZI3C 2D5UA 2LE8A 2JRKA 4BA9A 2D0TA 1NAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHN A;  3ZJ2 A;  3ZJ1 A;  5L2L A; 
#chains in the Genus database with same CATH topology
 1ZV4 X;  2VVS A;  5L3D B;  4TZ4 C;  2V6Y B;  2X68 A;  1IBL T;  2NTY A;  3B5M A;  1KNZ A;  4CN6 A;  4JUY A;  2B76 A;  3N9M A;  3WAJ A;  5CA1 E;  2QRX A;  3ZT5 A;  2LHR A;  5AQK B;  5C3J A;  3NRX A;  3LJC A;  4UEM A;  2CBI A;  2BBJ A;  1D1C A;  1NWM X;  5IYZ E;  2CMR A;  5H6R B;  3EI0 A;  1UK5 A;  3EUH A;  4N78 D;  3LK2 B;  3CQG B;  5AQU B;  3LK3 B;  2XQ5 A;  2VKO A;  4ZI2 C;  5HWX A;  1XNR T;  3ZJ1 A;  4P1N A;  1YQ4 A;  2LSY A;  5HCM A;  2PJQ A;  3AEG A;  2LHN A;  5LGN B;  1ZP0 A;  5JR9 B;  5L3F B;  3AE9 A;  5AQN B;  2DWK A;  1UUS A;  1KNP A;  3NWI A;  4XZC A;  2H3R A;  4H9O C;  2YKS A;  2JIW A;  2HN1 A;  2K9A A;  4PNI A;  3PUV F;  5L3E B;  2CE7 A;  5FY7 A;  3PUW F;  5ABF A;  4CN1 A;  4P09 A;  2Z6E A;  2P9B A;  2BS2 A;  1N32 T;  2VWA A;  2Q9Q A;  4ZI3 D;  4KP3 C;  4CXY A;  3TLS A;  3ZYM A;  5LMU T;  2RP4 A;  2UXX B;  2WSS V;  3PUG A;  4NUU A;  3ONJ A;  1SHZ C;  2R6G F;  2I59 A;  2KSR A;  4ZI7 E;  2FJA A;  3T1Y T;  3U78 A;  5AQL B;  4NUV A;  1YXR A;  4GKK T;  4HKA A;  4CI1 B;  2VKD A;  1KNR A;  1QSD A;  5EK2 A;  2C5J A;  5JDL A;  5LG3 A;  4HFD A;  3C64 A;  3AE8 A;  5AQP B;  5AQM B;  4LMJ A;  3MXZ A;  4QX7 B;  4DR6 T;  3RYI E;  1V9D A;  3AE3 A;  4AI6 A;  3OBV E;  3NRY A;  2QVA A;  2KXP B;  5FXV A;  4LF4 T;  4DVD A;  1WLX A;  4M1P A;  1E1H B;  4KMC A;  4IGU A;  4IE6 A;  5LMN T;  4B3M T;  2UXD T;  2YDR A;  1QLB A;  3KVA A;  1UX4 A;  3K3N A;  2LM2 A;  2Y6X A;  2IML A;  2SPC A;  3FZF B;  1CUN A;  4PW8 A;  3F57 A;  4KHZ F;  3O1H A;  4FJO A;  2V7K A;  3KBU A;  1J1J A;  2A3D A;  4QX8 B;  5EK3 A;  1BR1 A;  2XPK A;  2JQQ A;  4OX9 T;  4ERR A;  3HI2 A;  1WCR A;  4WYV A;  1WYB A;  3CX6 B;  2VUR A;  4U2Y A;  2BG9 C;  3ZCI A;  4QH1 A;  2CHN A;  2V7I A;  2I0M A;  2XQ9 A;  2WU5 A;  2KWI B;  4ZS3 A;  4A97 A;  2N9D A;  2WU2 A;  2KND A;  5F5W A;  2BZB A;  2XQ6 A;  3P4W A;  5LA6 E;  3AEC A;  2AXD S;  4UVC B;  2DHR A;  4YJ3 E;  2VL8 A;  2OA5 A;  3QOF A;  4DUY T;  1HTJ F;  2MBG A;  4IL9 A;  3AA7 B;  2X66 A;  5AQS B;  3ZLI A;  4PAG A;  1LVF A;  5E0O A;  1MNE A;  1HX1 B;  2VVN A;  5L47 A;  2KIN B;  2YK0 A;  4B3S T;  4Z8X A;  4FI5 A;  4DV1 T;  2BKN A;  3P50 A;  4AIU A;  5AFU L;  4GIW A;  2XAH B;  5JDN A;  4CI3 B;  2WMN A;  4ZS2 A;  4IHJ E;  5ABF B;  1I6Z A;  2DCF A;  3O1J A;  2Q9Q B;  2X67 A;  3H3M A;  2FBW A;  2UXB T;  3JC6 C;  4L5G A;  1HNW T;  3TLW A;  5CA0 E;  1YD8 G;  3KV4 A;  3NKZ A;  4F6R C;  5AQT B;  3TLV A;  5LYJ E;  3E22 E;  2YN6 A;  4ASK A;  2IC9 A;  4ILB A;  3B13 A;  3RPU A;  5AQH B;  5LHG B;  5J2T E;  5FNV E;  4HEA A;  2DNX A;  3PDY A;  1HCI A;  3ZT6 A;  3PJA J;  3R84 B;  3TLT A;  5FL1 A;  2W61 A;  2PBI A;  5IUX A;  3GN5 A;  1NEN A;  5A1L A;  2W66 A;  4PK5 A;  4TNV A;  4OFZ A;  5HXE A;  2W2U A;  3QK6 A;  5IWA T;  4NPP A;  5HXS A;  2JMH A;  4LMK A;  1YKH B;  3O1I A;  3SFD A;  3WI3 A;  4DV5 T;  3PTR B;  2LM9 A;  4YSZ A;  4L9I A;  5L3G B;  3G06 A;  4A5X A;  4I0U A;  2MAW A;  3RKG A;  5F3J A;  2LKG A;  1MMD A;  5FY1 A;  4DV7 T;  3RRW A;  3TLU A;  2XAF B;  3Q9D A;  2D5U A;  2LE8 A;  4BA9 A;  3NVO A;  3ZST A;  2V5C A;  3M3Z B;  3UT5 E;  4U72 A;  3VRB A;  1R8I A;  4IIJ E;  1HNX T;  2YU2 A;  4DMV A;  3AE7 A;  2E5L T;  5FL0 A;  2WM9 A;  2CXL A;  1MMA A;  4GOU A;  4DV2 T;  2JQ9 A;  5AQG B;  2XQY A;  2PG8 A;  3QUJ A;  4AXP A;  3RIU C;  1IBK T;  2LSG A;  4QH5 A;  4TWH A;  4HGA A;  5JRE A;  4OYJ A;  4B3T T;  4TNW A;  3F2E A;  1M62 A;  1ZOY A;  3RYC E;  3LBX A;  3EDV A;  3BQK A;  4AKL A;  2VK9 A;  5FXX A;  4CQI A;  2BVM A;  3C4Z A;  4B3R T;  1UCU A;  1HFA A;  1HS7 A;  4WBN E;  2L8K A;  3AE1 A;  3CML A;  2YU1 A;  3AA1 B;  3SOL A;  2HPL A;  3CIR A;  5JRC A;  2WWV A;  3V5U A;  4KX6 A;  3PU3 A;  3T1H T;  4LML A;  3DJB A;  4H9Q C;  2K24 A;  5FP3 A;  5HEU A;  3FHN A;  1LKX A;  5LB7 B;  3DTO A;  4JLE A;  2E2A A;  3IHR A;  1GQE A;  5ABE A;  2UUB T;  5ETW A;  3CVR A;  2LSJ A;  1WYC A;  3X1D A;  2D2S A;  2LSK A;  1XMO T;  1W0B A;  2BG9 E;  2N1G A;  3P4Q A;  5KDM C;  3O9X A;  3RC8 A;  3C4W A;  1Z0P A;  5LCY A;  3RIA A;  3GN5 B;  2VKJ A;  2W67 A;  5JDH A;  2ES0 A;  3FXE B;  4HWD A;  1LRZ A;  1XDP A;  4EEB A;  2MYS A;  3C50 A;  4KBM B;  5KXJ A;  2FJE A;  5TAO A;  4CN4 A;  2LSI A;  4U7I A;  3PUQ A;  5AQJ B;  2J62 A;  3QC9 A;  3U3I A;  4LFA T;  5L4H A;  3KV6 A;  4IDZ A;  4MHC A;  1YQ3 A;  2X0L B;  2CLY B;  3CX8 B;  2C5K T;  5JDQ A;  4IDO A;  2ZM2 A;  4ZHQ E;  3ONX A;  4HFC A;  4WNK A;  3ABV A;  4YTM A;  3AEA A;  4G63 A;  5LG4 A;  3R6N A;  4EGW A;  3K8P C;  2UXC T;  1E2A A;  4AQF C;  3KFW X;  5LJN A;  2BS3 A;  1D1A A;  4EAH A;  2QA7 A;  1M7K A;  2MOZ A;  1EZ3 A;  2JQK A;  3ONL C;  4IL4 A;  2M6I A;  3VKH A;  3F31 A;  3VR8 A;  4UR9 A;  2LJL A;  4JI5 T;  4TX5 A;  3CQC B;  4AIS A;  3FBL A;  3RYF E;  3L09 A;  4HFV A;  4KUM B;  2XJ7 A;  4DBR A;  3E0Z A;  3AXJ A;  2KLQ A;  3ZKR A;  4YFS A;  1O3X A;  3AAI A;  2H88 A;  2WDQ A;  4IDP A;  5LHH B;  4JEU B;  2V1D B;  2DLR A;  3LBX B;  1XZY A;  3CK6 A;  2J4G A;  5JTG A;  1W09 A;  5FXW A;  4JV5 T;  2A9U A;  1JNZ A;  2Y8D A;  4J2C A;  1XNQ T;  3UTK A;  2M67 A;  5JDM A;  4JI0 T;  2K3W A;  3CQX C;  4A98 A;  1HR0 T;  4JEH B;  2BBH A;  1FEW A;  1G8X A;  1IZN B;  2WDR A;  3ZJ2 A;  5JRC B;  2H7V C;  3RQW A;  3FXD B;  3N2G E;  2V26 A;  3Q5W A;  3NZP A;  3OTO T;  3J7Y q;  2H7O A;  5HXC A;  2HH7 A;  5EK4 A;  1E7P A;  1H7C A;  3PJA A;  3P4R A;  3A8Y C;  4DND A;  1HNZ T;  2LOP A;  2MTQ A;  2J47 A;  5IHY A;  1AJ3 A;  4ZZB A;  3AVR A;  2D9D A;  2OLT A;  5FYM A;  2WMO A;  1FJG T;  4DR2 T;  1J5E T;  2EHO B;  4IT4 A;  2LEH A;  3CPZ A;  2X0H A;  2W0G A;  5AQI B;  1OED C;  5M4Y A;  4KHP T;  5L3C B;  1G73 A;  4UF0 A;  4V1A v;  3LDQ B;  2XM1 A;  2XSB A;  2VQF T;  2YOE A;  3VHL A;  2CM0 A;  4E7S A;  3GWH A;  5HYA A;  2OV9 A;  3NBX X;  3KV5 A;  3RYH E;  1SUM B;  3OYX A;  1U5P A;  4X1Y E;  4CXW A;  2WZI A;  4H9R C;  4ILA A;  4DR1 T;  5AQR B;  4U31 A;  4H9S E;  1ZEE A;  3H3A A;  4OYK A;  4HTE A;  3A5X A;  1T8B A;  1FMV A;  3Q5X A;  3S4U A;  1J5W A;  3J9X 1;  2LRL A;  3ZT7 A;  3KDS E;  2A72 A;  1OXZ A;  3DP7 A;  4U33 A;  2JMK A;  3N2K E;  3UUX B;  5GON E;  4DUZ T;  2LRK A;  4TUY E;  2WCA A;  3AEF A;  3PUZ F;  2BG9 A;  1MND A;  4UIG A;  2M6B A;  4IDQ A;  4ZI3 C;  4GK0 E;  2JRK A;  1MIY A;  3PUX F;  4NXM T;  3MAC A;  4IST A;  2RPA A;  1HX8 A;  3E08 A;  2MPK A;  3AAA B;  3AVS A;  4BJM A;  1MMG A;  4I50 E;  2EHO D;  1B7T A;  2E9X D;  3UQ4 A;  3Q2M A;  2CXD A;  1T7S A;  2CCQ A;  4O2A E;  5ABG A;  1N36 T;  1N34 T;  1S94 A;  2QYW A;  3AXJ B;  3PU8 A;  3ZMZ B;  4UVB B;  5AQV B;  2V7J A;  5AQF B;  4C91 A;  4UV8 B;  4QH4 A;  4DO0 A;  1VCT A;  5ABH A;  5HXH A;  1WFD A;  2XZE A;  2NW7 A;  5H6Q B;  5JR9 C;  2D0U A;  2YDQ A;  3WAK A;  4EYY R;  1IBM T;  2I6H A;  4YHH T;  3C51 A;  4O4L E;  2CA5 A;  4PJL A;  1KF6 A;  2CEA A;  3MJX A;  2LOS A;  5L4E A;  2E8I A;  3EHZ A;  2VB6 A;  1I94 T;  4F8H A;  2E5V A;  4YTP A;  3UUB A;  4DR3 T;  4WBO A;  2YEV C;  4I4T E;  4HWF A;  4H9N C;  4X66 T;  2B1E A;  2CRB A;  3RHW A;  3I0O A;  3UUM A;  4P0B A;  2A2F X;  3VU7 H;  4UF0 B;  4GK5 E;  4P0A A;  4LF9 T;  3KV9 A;  1ZHC A;  1Y64 B;  4TV8 E;  4LF5 T;  4CI2 B;  2WP9 A;  4ZI2 D;  3ZMS B;  3L39 A;  3RH3 A;  4IDN A;  2KMF A;  4MFR A;  4WW0 A;  3I9Y A;  4I43 B;  5J1G A;  2H89 A;  3UU8 A;  3IA3 A;  3KIN B;  1HG5 A;  4IE4 A;  4JI8 T;  3RX6 A;  1NEK A;  2XQ8 A;  3UU5 A;  4CXX A;  1KFY A;  5LNK A;  2BVL A;  2ZM6 T;  3N9O A;  4O2B E;  2ZLY A;  5L3B B;  4G2A A;  3QNU A;  1XWM A;  2CWY A;  3UU6 A;  4IE5 A;  4JYA T;  5J0Z A;  3LFM A;  3AB3 B;  2BG9 B;  5CGM A;  4TV9 E;  4JI1 T;  1XMQ T;  2AE9 A;  2XUE A;  3ZYK A;  4ZXL A;  2ZMA A;  3SFE A;  3CWZ B;  3RQU A;  2BS4 A;  4AQY T;  2W4X A;  2RA1 A;  2V7M A;  2X9H A;  4QWN B;  2K5B B;  4IRE A;  5HEH A;  3MA9 A;  3IF8 B;  3AA6 B;  3ZC0 A;  1IJ5 A;  2XHE B;  1KK7 A;  1T72 A;  4NIQ A;  3FBZ A;  3RIU A;  3K1S A;  4DBQ A;  1U4Q A;  5HWY A;  3L3P A;  4ILC A;  3CKD A;  2XSA A;  1VCS A;  3BQL A;  2C0S A;  4H63 H;  1W0A A;  2EHO A;  3MKD A;  5JDG A;  5DAB A;  4ZOL E;  5JVD E;  4C90 A;  2E9X A;  5KX5 E;  2NOX A;  1OED E;  5JDF A;  3PUA A;  2IIU A;  1Z8U A;  1MIV A;  4HWI B;  4KI0 F;  4QXC B;  4UXN B;  2YIN A;  4IE7 A;  3SS1 A;  3I9W A;  1FIO A;  2ODU A;  4YLH A;  3OYZ A;  2ACX A;  3N5L A;  2XM2 A;  4PJN A;  4X5T A;  2ZM8 A;  4DMW A;  2C5I T;  1JNR A;  1W9R A;  5JQG E;  5F8P A;  4GKJ T;  4JI2 T;  1US7 B;  2ZM0 A;  3ZCJ A;  3A7M A;  4I55 E;  4TWF A;  4DV3 T;  3HKD E;  2BDE A;  3MK7 C;  4GYR A;  5LJM A;  4DID B;  2Q9Q C;  2V7L A;  3ZPO A;  4EYU A;  3ZEF B;  2LKH A;  3LK4 2;  3RLF F;  4HFE A;  2G0U A;  3OKQ A;  1UGO A;  4ANJ A;  3FZM B;  4YSY A;  4BAY B;  2DI4 A;  3GA8 A;  3JCF A;  4QKN A;  5FMN A;  3T8O A;  4PJM A;  1KEY A;  2WB5 A;  3PUY F;  3NZQ A;  4DV6 T;  4LF6 T;  3P8C D;  4ADZ A;  4DR7 T;  1MMN A;  4DR4 T;  4O4J E;  5DQV A;  3B57 A;  4UVA B;  1D1B A;  4DV4 T;  3AE4 A;  4PK4 A;  4HWC A;  3V5S A;  3ANW A;  3K3Q C;  3GMI A;  4TN7 B;  2N2N A;  4AKI A;  4JBW F;  3HR0 A;  4HFB A;  1BR2 A;  2QGS A;  3OPC A;  2K48 A;  2IDO B;  4HWH A;  5JH7 E;  4HE8 A;  2BKO A;  1WRD A;  3QB5 A;  3N9N A;  1BR0 A;  4EED A;  2UUA T;  1FMW A;  4AKR B;  3JC6 D;  4AQF A;  2DL1 A;  2D0T A;  4YY3 T;  2XQA A;  5LHI B;  3ESL A;  2L3L A;  3AEB A;  2PTF A;  3I1A A;  2DWG A;  3P7I A;  5LBM A;  4Z90 A;  3RKO A;  5HEJ A;  3KVB A;  2X0Y A;  3UFG A;  1YW0 A;  1D0Y A;  5FY0 A;  5FKY A;  1X9B A;  1YKE B;  2WQY A;  3UQ7 A;  4K0U A;  1OWA A;  2PFV A;  2WZH A;  4HN9 A;  2V5D A;  4DV0 T;  4QXB B;  1BR4 A;  4MLK A;  4DR5 T;  1WR6 A;  3RI5 A;  2E9X B;  4AQG A;  2V6X A;  5DQW A;  5BMV E;  5L2L A;  2F4V T;  2FJD A;  1T98 A;  1LVK A;  4L0R A;  3VKG A;  2WWU A;  5LOV E;  4MAL A;  1X79 A;  3W15 B;  4QXH B;  4COF A;  3ETV A;  2WS3 A;  3ETU A;  4OHF A;  1N33 T;  3ZYL A;  3KBT A;  3O4X E;  2CBJ A;  1D0Z A;  3AED A;  2WDV A;  4BJN A;  3K3O A;  1IAP A;  1ZKE A;  2IAK A;  4LF7 T;  5KMG P;  5CB4 E;  3PV0 F;  3ZMT B;  2UU9 T;  2XQ7 A;  2JPF A;  4E7Z A;  2BKP A;  4XBF B;  3CX7 B;  1SA0 E;  1MIW A;  1UX5 A;  4X20 E;  2WY2 A;  4YJ2 E;  2L9Q A;  4LF8 T;  2NP9 A;  1OED A;  2HN2 A;  2XTL A;  1VOM A;  3FZL B;  3PUR A;  2X9W A;  3HL6 A;  5DJQ C;  4X64 T;  1SE7 A;  4UV9 B;  2KT9 A;  2NR4 A;  5LP6 E;  4YTN A;  4EOZ B;  2XAS B;  2HHH T;  3P4P A;  3JAF A;  4PJJ A;  3C98 B;  1DU2 A;  3N9P A;  4JI4 T;  3C4X A;  4YSX A;  4EB6 E;  4YT0 A;  4X1I E;  3ANW B;  3D0T A;  5FVK A;  2W63 A;  3RC3 A;  3RIF A;  5AQO B;  2YDS A;  4B6X A;  3JAD A;  2X9Y A;  2ACZ A;  4Z91 A;  2CXF A;  3HKC E;  2NTX A;  5CFB A;  4X62 T;  1UUR A;  5LXT E;  4K0K T;  3ZN0 B;  3EVY A;  4IE0 A;  2NW8 A;  4XAX B;  3AE2 A;  3IEE A;  2CLY C;  4EV6 A;  4GYS A;  3OVU A;  3ZMV B;  3LG7 A;  3AE5 A;  5FVL A;  4U74 A;  2V6Y A;  3ZSS A;  1VRB A;  3HKB E;  1HG2 A;  5LGU B;  2JJ9 A;  3AA0 B;  1S35 A;  3FZK B;  2W00 A;  4LFC T;  2NW9 A;  3VRA A;  4LFB T;  3TKL B;  4EZH A;  3ZMU B;  2CHO A;  1QUU A;  4U7Y A;  2XAQ B;  3AE6 A;  3Q5E A;  2KZ7 B;  3EDU A;  3OJA A;  4YHJ A;  2VL0 A;  2WBL A;  1L0V A;  4EZ4 A;  4CZZ B;  1IJ6 A;  2XAJ B;  4H63 V;  2IW5 B;  3SWH A;  1CHU A;  2IC6 A;  3L8R A;  3RRC A;  4PFO A;  5JR9 A;  5HEO A;  4NXN T;  4O4H E;  4PK6 A;  5HAX A;  4U3C A;  3PUS A;  5EZY E;  3SRZ A;  4UEL A;  3UFE A;  4ISS A;  2ODV A;  3VR9 A;  2Q9Q D;  2X51 A;  4U2Z A;  2XQ4 A;  1WR0 A;  5HXR A;  3UUN A;  3ZN1 B;  2VKH A;  4JI6 T;  2XY8 B;  4HFH A;  3N9L A;  3AAE B;  4AKG A;  3RF1 A;  3MZK B;  4YXD A;  2X9X A;  2Y48 B;  5HCJ A;  3N9Q A;  2LLY A;  5J2U E;  4OK0 A;  2NWB A;  3I0Q A;  3FB2 A;  5C2T A;  4O4I E;  3AEE A;  2J1D G;  3H37 A;  3EAM A;  4TWD A;  1OED B;  5C8Y E;  3EAB A;  2CPT A;  5HEG A;  4HFI A;  4QHO A;  3LSV A;  5CJ5 A;  2HPJ A;  4ZZC A;  2KWH A;  4X1K E;  4H9P C;  3QB5 K;  5BR8 T;  5LBQ B;  2LT3 A;  2V8S V;  2FUP A;  2IHR 1;  3IBP A;  2EHO C;  4EIW A;  5LGT B;  3N2O A;  2E9X C;  4A56 A;  4ILU A;  3BQI A;  4JI7 T;  2GK9 A;  1XDO A;  4Q25 A;  2IUB A;  3PE0 A;  2WAU A;  3M65 A;  5ADX L;  3ZC1 A;  4ZEY A;  4JI3 T;  5FXZ A;  2VQE T;  3RGL A;  3Q5D A;  3HA4 A;  3UU3 A;  3JAE A;  3BK9 A;  4MBQ A;  4EXT A;  2W62 A;  2XQ3 A;  2XAG B;  2VAS A;  2JQH A;  4WZX A;  2UUC T;  1D0X A;  4AKH A;  3P4S A;  2FJB A;  3UU4 A;  5AQQ B;  3UUL A;  1HF8 A;  4X65 T;  1Y01 A;  4PFP A;  4O8S A;  2CWO A;  2UXN B;  3HKE E;  3FZH B;  1NAF A; 
#chains in the Genus database with same CATH homology
 1MIY A;  1ZV4 X;  5L3D B;  3MAC A;  4TZ4 C;  3UT5 E;  4U72 A;  2X68 A;  4IIJ E;  2NTY A;  5LHI B;  1KNZ A;  3ESL A;  2YU2 A;  4DMV A;  2L3L A;  4IST A;  3I1A A;  2DWG A;  4JUY A;  3P7I A;  5LBM A;  3RKO A;  3N9M A;  3WAJ A;  1HX8 A;  3KVB A;  5CA1 E;  3E08 A;  2LHR A;  1YW0 A;  1D0Y A;  5FY0 A;  3AAA B;  4BJM A;  3AVS A;  1MMG A;  2WM9 A;  3LJC A;  3NRX A;  4I50 E;  2EHO D;  1YKE B;  2CXL A;  1MMA A;  4GOU A;  4UEM A;  1B7T A;  2E9X D;  3Q2M A;  2CXD A;  2XQY A;  4K0U A;  1OWA A;  2PG8 A;  2PFV A;  1D1C A;  2CCQ A;  4HN9 A;  3QUJ A;  4AXP A;  1NWM X;  5IYZ E;  2CMR A;  4O2A E;  5H6R B;  4QXB B;  3EUH A;  2LSG A;  1BR4 A;  1S94 A;  4MLK A;  4N78 D;  3PU8 A;  3ZMZ B;  3LK2 B;  3CQG B;  1WR6 A;  4UVB B;  4HGA A;  3LK3 B;  5JRE A;  4OYJ A;  2VKO A;  4ZI2 C;  2V7J A;  5HWX A;  3ZJ1 A;  2E9X B;  4C91 A;  4UV8 B;  3F2E A;  4AQG A;  2LSY A;  3RYC E;  3LBX A;  2PJQ A;  5DQW A;  2LHN A;  3EDV A;  5BMV E;  3BQK A;  4AKL A;  5LGN B;  5L2L A;  4DO0 A;  5JR9 B;  2VK9 A;  5L3F B;  1T98 A;  5FXX A;  1LVK A;  4CQI A;  2BVM A;  4L0R A;  5HXH A;  3VKG A;  3C4Z A;  2WWU A;  5LOV E;  2DWK A;  4MAL A;  1UCU A;  1X79 A;  2NW7 A;  3W15 B;  1HFA A;  5H6Q B;  1HS7 A;  5JR9 C;  4QXH B;  4XZC A;  3ETV A;  2D0U A;  3ETU A;  2H3R A;  4H9O C;  4WBN E;  2K9A A;  4OHF A;  4PNI A;  3WAK A;  2L8K A;  3CML A;  4EYY R;  2YU1 A;  3AA1 B;  3SOL A;  5L3E B;  2HPL A;  2CE7 A;  3C51 A;  3ZYL A;  3KBT A;  5FY7 A;  3O4X E;  2CA5 A;  4O4L E;  4PJL A;  1D0Z A;  2CEA A;  5JRC A;  3V5U A;  3MJX A;  4P09 A;  4BJN A;  2LOS A;  2Z6E A;  2P9B A;  3PU3 A;  2E8I A;  2VWA A;  2Q9Q A;  3K3O A;  4ZI3 D;  1IAP A;  4KP3 C;  4CZZ B;  4CXY A;  1ZKE A;  2IAK A;  5KMG P;  2VB6 A;  5CB4 E;  3ZMT B;  3ZYM A;  2RP4 A;  3DJB A;  4H9Q C;  2JPF A;  2K24 A;  4E7Z A;  5FP3 A;  2UXX B;  2WSS V;  3PUG A;  4WBO A;  4XBF B;  3CX7 B;  2YEV C;  4NUU A;  1SA0 E;  1SHZ C;  3FHN A;  1MIW A;  1UX5 A;  2I59 A;  4I4T E;  1LKX A;  4ZI7 E;  3DTO A;  4JLE A;  4X20 E;  4YJ2 E;  3IHR A;  2L9Q A;  3U78 A;  2NP9 A;  4NUV A;  4H9N C;  2XTL A;  5ETW A;  3CVR A;  2B1E A;  1VOM A;  4HKA A;  4CI1 B;  2VKD A;  2LSJ A;  3PUR A;  1WYC A;  3I0O A;  2X9W A;  3UUM A;  1QSD A;  4P0B A;  3HL6 A;  2A2F X;  5DJQ C;  5EK2 A;  2C5J A;  3VU7 H;  5JDL A;  4UF0 B;  3C64 A;  4GK5 E;  4P0A A;  3KV9 A;  2D2S A;  2LSK A;  4UV9 B;  2KT9 A;  1ZHC A;  3MXZ A;  1Y64 B;  5LP6 E;  4QX7 B;  4EOZ B;  2XAS B;  2N1G A;  4TV8 E;  4CI2 B;  5KDM C;  4PJJ A;  3O9X A;  3C98 B;  3RC8 A;  3C4W A;  3RYI E;  1Z0P A;  4ZI2 D;  5LCY A;  3N9P A;  1V9D A;  3ZMS B;  4AI6 A;  3GN5 B;  3OBV E;  3NRY A;  2VKJ A;  3RH3 A;  2KXP B;  5JDH A;  2KMF A;  3C4X A;  5FXV A;  2ES0 A;  3FXE B;  4DVD A;  4EB6 E;  1WLX A;  1LRZ A;  4MFR A;  3I9Y A;  4WW0 A;  4I43 B;  5J1G A;  4X1I E;  3ANW B;  2MYS A;  3C50 A;  3D0T A;  4M1P A;  4KBM B;  1E1H B;  5TAO A;  2W63 A;  4KMC A;  3RC3 A;  3KIN B;  4IGU A;  1HG5 A;  4IE6 A;  2LSI A;  3PUQ A;  4IE4 A;  4B6X A;  3KVA A;  3RX6 A;  3QC9 A;  3U3I A;  2X9Y A;  1UX4 A;  3K3N A;  2Y6X A;  3KV6 A;  4IDZ A;  2SPC A;  4MHC A;  4CXX A;  1CUN A;  5LNK A;  2BVL A;  2CXF A;  3HKC E;  3N9O A;  4PW8 A;  3F57 A;  4O2B E;  2NTX A;  2X0L B;  2ZLY A;  2CLY B;  3CX8 B;  3O1H A;  4G2A A;  5L3B B;  2C5K T;  5LXT E;  4FJO A;  3ZN0 B;  3EVY A;  2CWY A;  2V7K A;  4IE5 A;  5JDQ A;  3KBU A;  4IE0 A;  2NW8 A;  2ZM2 A;  4XAX B;  4ZHQ E;  2A3D A;  3LFM A;  3ONX A;  4QX8 B;  5EK3 A;  3AB3 B;  3IEE A;  2CLY C;  4WNK A;  4GYS A;  4TV9 E;  1BR1 A;  3ZMV B;  3LG7 A;  4G63 A;  2JQQ A;  2XUE A;  3ZYK A;  4ERR A;  5LG4 A;  3R6N A;  2ZMA A;  3HI2 A;  1WYB A;  3CX6 B;  4U74 A;  3K8P C;  3ZCI A;  4AQF C;  3CWZ B;  1VRB A;  3KFW X;  5LJN A;  2V7I A;  3HKB E;  1HG2 A;  2RA1 A;  1D1A A;  2V7M A;  4EAH A;  2KWI B;  4ZS3 A;  2X9H A;  4QWN B;  5LGU B;  2JJ9 A;  3AA0 B;  1S35 A;  2QA7 A;  2N9D A;  2K5B B;  2W00 A;  2KND A;  3IF8 B;  2MOZ A;  3MA9 A;  1EZ3 A;  3AA6 B;  3VKH A;  3F31 A;  3ZC0 A;  2LJL A;  2NW9 A;  1IJ5 A;  2BZB A;  2XHE B;  1KK7 A;  4TX5 A;  3CQC B;  3FBZ A;  3FBL A;  3TKL B;  5LA6 E;  3RYF E;  4DBQ A;  4UVC B;  1U4Q A;  4EZH A;  5HWY A;  3ZMU B;  3L09 A;  4HFV A;  2DHR A;  1QUU A;  2XAQ B;  4YJ3 E;  2VL8 A;  3L3P A;  4KUM B;  3CKD A;  2OA5 A;  4DBR A;  3BQL A;  2KZ7 B;  3E0Z A;  1HTJ F;  3EDU A;  2C0S A;  4H63 H;  3OJA A;  2KLQ A;  4YHJ A;  2MBG A;  2WBL A;  4EZ4 A;  4YFS A;  2EHO A;  1O3X A;  3AAI A;  3MKD A;  5LHH B;  5JDG A;  5DAB A;  1IJ6 A;  2XAJ B;  4JEU B;  4ZOL E;  3AA7 B;  2E9X A;  4H63 V;  2X66 A;  5JVD E;  3ZLI A;  4C90 A;  2IW5 B;  2V1D B;  5KX5 E;  2DLR A;  2NOX A;  1LVF A;  3LBX B;  4PAG A;  5JDF A;  3SWH A;  3PUA A;  5E0O A;  1MNE A;  2IC6 A;  3RRC A;  4PFO A;  1MIV A;  2KIN B;  5FXW A;  2YK0 A;  4QXC B;  4UXN B;  2YIN A;  5JR9 A;  4IE7 A;  3SS1 A;  3I9W A;  2Y8D A;  1FIO A;  2ODU A;  4J2C A;  4O4H E;  4PK6 A;  5HAX A;  3PUS A;  4YLH A;  3OYZ A;  5EZY E;  3SRZ A;  4UEL A;  3UFE A;  4ISS A;  2ACX A;  2ODV A;  3N5L A;  3UTK A;  4PJN A;  2ZM8 A;  4DMW A;  4Z8X A;  2Q9Q D;  2M67 A;  4FI5 A;  5JDM A;  2X51 A;  2C5I T;  5AFU L;  3CQX C;  4GIW A;  5HXR A;  4JEH B;  3UUN A;  3ZN1 B;  2XAH B;  2VKH A;  5JDN A;  5F8P A;  1FEW A;  1G8X A;  5JQG E;  1IZN B;  4CI3 B;  3ZJ2 A;  1US7 B;  2WMN A;  5JRC B;  2H7V C;  3N9L A;  4ZS2 A;  4IHJ E;  3FXD B;  2ZM0 A;  3ZCJ A;  3N2G E;  4I55 E;  3AAE B;  2V26 A;  4AKG A;  3Q5W A;  3NZP A;  2DCF A;  3J7Y q;  3O1J A;  2Q9Q B;  3MZK B;  3HKD E;  2X9X A;  2H7O A;  2BDE A;  3MK7 C;  2Y48 B;  2X67 A;  5HXC A;  3N9Q A;  4GYR A;  2HH7 A;  5EK4 A;  1H7C A;  5J2U E;  3JC6 C;  4L5G A;  4OK0 A;  5LJM A;  5CA0 E;  2Q9Q C;  2NWB A;  1YD8 G;  3I0Q A;  3KV4 A;  4DND A;  2V7L A;  3FB2 A;  3ZPO A;  4EYU A;  4F6R C;  2LOP A;  3ZEF B;  2MTQ A;  5IHY A;  1AJ3 A;  4O4I E;  2J1D G;  3AVR A;  3LK4 2;  5LYJ E;  3E22 E;  3H37 A;  5FYM A;  4ASK A;  2G0U A;  5C8Y E;  2IC9 A;  2WMO A;  3OKQ A;  4ANJ A;  3B13 A;  3RPU A;  5J2T E;  5LHG B;  4BAY B;  5FNV E;  4HEA A;  2DI4 A;  2EHO B;  3GA8 A;  4QHO A;  2DNX A;  2HPJ A;  2LEH A;  3CPZ A;  2W0G A;  5M4Y A;  2KWH A;  4QKN A;  4X1K E;  5L3C B;  5FMN A;  1G73 A;  4H9P C;  3PDY A;  3T8O A;  4PJM A;  4UF0 A;  4V1A v;  5LBQ B;  2LT3 A;  1HCI A;  3IBP A;  2EHO C;  4EIW A;  3R84 B;  5LGT B;  3N2O A;  2CM0 A;  2E9X C;  3NZQ A;  3VHL A;  4A56 A;  4E7S A;  3GWH A;  5HYA A;  4ILU A;  3P8C D;  2W61 A;  3NBX X;  3BQI A;  3KV5 A;  3RYH E;  3OYX A;  2GK9 A;  1U5P A;  4X1Y E;  4CXW A;  4ADZ A;  2PBI A;  1MMN A;  4H9R C;  4O4J E;  3PE0 A;  5DQV A;  3GN5 A;  3B57 A;  4UVA B;  1D1B A;  2WAU A;  5A1L A;  4PK4 A;  3M65 A;  5ADX L;  3V5S A;  4PK5 A;  3ZC1 A;  3ANW A;  3K3Q C;  5FXZ A;  4H9S E;  1ZEE A;  4OFZ A;  3H3A A;  5HXE A;  3QK6 A;  4OYK A;  3GMI A;  4TN7 B;  4HTE A;  3A5X A;  5HXS A;  2JMH A;  3HA4 A;  2N2N A;  1FMV A;  4AKI A;  3Q5X A;  3HR0 A;  4GK0 E;  4MBQ A;  3BK9 A;  4EXT A;  3S4U A;  1YKH B;  1BR2 A;  3J9X 1;  3O1I A;  3WI3 A;  2W62 A;  3PTR B;  3KDS E;  2LM9 A;  2VAS A;  2XAG B;  1D0X A;  2A72 A;  1OXZ A;  4L9I A;  4AKH A;  2QGS A;  5L3G B;  3DP7 A;  2K48 A;  2JMK A;  3UUL A;  5F3J A;  5JH7 E;  3N2K E;  4HE8 A;  3UUX B;  1WRD A;  1HF8 A;  1MMD A;  5FY1 A;  5GON E;  4TUY E;  3RRW A;  3N9N A;  1BR0 A;  1FMW A;  4AKR B;  3JC6 D;  4PFP A;  2XAF B;  1MND A;  2CWO A;  2UXN B;  3Q9D A;  3HKE E;  4O8S A;  4UIG A;  4AQF A;  4ZI3 C;  2D5U A;  2LE8 A;  2JRK A;  4BA9 A;  2D0T A;  1NAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...