3ZJ2A

Structure of nab2p tandem zinc finger 34
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
GSVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIKEVKPISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
publication title Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zj2A00
3ZJ2A 2LHNA 5L2LA 3ZJ1A
chains in the Genus database with same CATH superfamily
4UF0B 4Z8XA 2MBGA 4HKAA 1IBKT 3UUNA 1XDPA 3CKDA 4Q25A 1YKHB 2D5UA 2YDRA 2CWOA 3L39A 3OJAA 2UUCT 3N9OA 1NEKA 3IF8B 2XSAA 1W09A 3ESLA 5JDHA 2V6YA 4ILAA 4X20E 4YXDA 2BKNA 4PFOA 4HFBA 5FXXA 1VOMA 4JI4T 4HFVA 4ILBA 3HL6A 2BG9E 4U72A 4O4HE 5F8PA 2WQYA 2BKPA 4DR2T 5LJNA 4TWDA 3BQIA 1IAPA 5AQHB 5EK2A 2DNXA 2KWIB 4TWHA 1LVKA 2WWVA 5JRCB 3FXEB 4ISSA 3RX6A 5ABHA 3LBXA 1SHZC 5AQIB 3RYHE 4JI1T 1U5PA 2M6BA 4ZI2D 2FJEA 3O1IA 2DI4A 2NTYA 4IDNA 1LKXA 4QHOA 2RPAA 5LA6E 4HGAA 3CIRA 4QX8B 3EAMA 3QC9A 3HKCE 3VR8A 3RQWA 5L3GB 2YN6A 4EIWA 2N9DA 2NR4A 3FBZA 3UU3A 1BR0A 3N9PA 2QA7A 2DLRA 2M67A 4WYVA 4HEAA 3NRYA 5HAXA 4JI5T 1J5WA 3PUYF 2FBWA 3EI0A 4KUMB 3WAKA 2F4VT 5HEHA 2XAQB 2WS3A 4BA9A 4I50E 3FZLB 4I4TE 3QNUA 5DJQC 3ONXA 4IL4A 3M3ZB 3KBTA 5FL0A 3ZJ2A 3P8CD 2LOPA 1T8BA 4GK5E 5HXEA 2VKHA 2CBIA 4IDQA 3MJXA 1XNQT 2ODVA 1N32T 3NZQA 5KXJA 3JC6D 4ZI3C 3L3PA 3K8PC 1OEDC 2UUAT 4PFPA 4NUVA 5AQJB 3E22E 2BDEA 4X66T 2LKGA 3IEEA 1DU2A 3ONLC 4ANJA 2SPCA 3DJBA 3Q5WA 4H9PC 4JEUB 4L9IA 4ZOLE 3Q9DA 3ZJ1A 4O4IE 4JUYA 2W2UA 4MHCA 1D1CA 2VQET 4F8HA 2W0GA 4B3MT 3FZKB 5L47A 4ZI2C 2XTLA 4QWNB 5JTGA 2Z6EA 1MMAA 2V6YB 4N78D 1YXRA 4IE6A 2BBJA 3HR0A 3NKZA 1M62A 4ILCA 3CQGB 4H9QC 3UFEA 4XBFB 2WBLA 2KNDA 3EUHA 3ZMVB 3UUXB 4DV6T 3PDYA 3ABVA 4DV5T 2XQ6A 3HKDE 4K0UA 4V1Av 5FYMA 3RIFA 3K3OA 4UV9B 2CLYB 2WCAA 4YSXA 4BAYB 4PK5A 4LF7T 4IDPA 3MK7C 3LBXB 5AQLB 1IJ6A 2E5VA 5L3FB 3V5UA 5J2TE 1OXZA 2X9XA 2KXPB 3AEAA 3C98B 2J1DG 2XSBA 3ETVA 2A9UA 4PJNA 5LBMA 3PUQA 5EK4A 3MA9A 4HN9A 3CK6A 4B3ST 3JC6C 3PTRB 2CBJA 3RQUA 4QXHB 3ZEFB 5JR9C 3OTOT 2FJAA 3BQKA 3FZFB 2YOEA 3RF1A 4ZS3A 3G06A 3JADA 3RYFE 3SFDA 2VQFT 2CXFA 3VU7H 1Y01A 3A5XA 1N36T 2OA5A 1OEDA 5LJMA 2V8SV 5AQGB 3T1YT 3CVRA 3NWIA 5C8YE 4CXWA 1SE7A 1EZ3A 2K48A 2FJBA 3EABA 3IA3A 4NIQA 3PJAA 4IDZA 4I43B 3R84B 4EZ4A 2I59A 2VL0A 4B3RT 3AVRA 4IE0A 2A2FX 4WNKA 4YY3T 1KF6A 3AA7B 3AVSA 5HXCA 2L8KA 3KINB 1VCTA 3PJAJ 3KVAA 4PK6A 4GIWA 2XQAA 2GK9A 2Q9QC 4KMCA 5ABGA 2Y6XA 3UU5A 4HFHA 2ES0A 2DWGA 4IIJE 4X1YE 4UIGA 2LRKA 5TAOA 4DBRA 4UR9A 5FY7A 4ZS2A 1BR2A 1KK7A 2W66A 4UELA 3K3QC 5M4YA 2FUPA 2X67A 2BS4A 5AQUB 3DP7A 2NTXA 3ZC0A 1UX4A 3ZPOA 4EGWA 5LNKA 3JAFA 3U3IA 5ADXL 2V6XA 2XQ9A 3RKGA 2XM1A 5LHIB 2E9XD 5LG3A 4Z91A 3UUBA 3EVYA 2UXCT 2LEHA 4HFIA 2UXDT 3M65A 2ZLYA 4WBNE 2PBIA 3K3NA 1XMOT 2CWYA 1IJ5A 1LRZA 1I94T 2PG8A 4DVDA 3OBVE 5HWYA 3AA1B 3AE3A 3P4QA 3CQCB 1UURA 2X9WA 5EZYE 1D1AA 3H3MA 2AE9A 5FMNA 3ZN1B 3AEBA 3UU4A 1HG5A 4AI6A 2LSYA 2A3DA 5HXHA 1J1JA 2WWUA 5KX5E 2V5CA 4YTMA 3PUSA 2W4XA 4AKRB 4HWHA 4J2CA 4TV8E 2OV9A 3MACA 2KT9A 3P4RA 1OEDB 3HKEE 3VR9A 1G8XA 4QH4A 4BJMA 2IC9A 4AQFC 3N9MA 2M6IA 3TLSA 4H9SE 2V26A 4HFCA 2BS2A 4P0BA 3B5MA 2LSIA 2XHEB 3ZN0B 4M1PA 2EHOC 3T8OA 3AE7A 4ZXLA 2CHNA 4ZZBA 5JDNA 1HNXT 3W15B 2E9XC 4EYYR 4A5XA 4OYJA 1ZOYA 5LCYA 5FY0A 4U74A 2BS3A 2ZM8A 3FHNA 2NWBA 1YD8G 3PUWF 1YKEB 3LG7A 2XPKA 2J47A 3C4WA 3N2GE 4K0KT 5FL1A 3GMIA 4B6XA 1G73A 4LMJA 4ZI3D 2D0TA 2KSRA 3P7IA 1UUSA 3PUZF 2H7OA 3PUXF 3AAEB 5DABA 2HPJA 4IDOA 5CGMA 4FJOA 4QXCB 4X62T 2B1EA 2D9DA 1HCIA 1UGOA 2LOSA 4MBQA 2W62A 3N5LA 1GQEA 4UVCB 2XUEA 4P09A 5LG4A 5AQQB 1WYCA 3MZKB 4U7YA 1S35A 3Q5XA 2QRXA 4JI8T 5AQSB 3RRCA 2AXDS 3RKOA 1JNRA 4PW8A 3HKBE 2V7MA 2N1GA 4JBWF 1T72A 5JREA 2KMFA 2JMKA 3ZYKA 4CI1B 2CM0A 1OEDE 4YTPA 3AECA 3I9YA 5AQTB 2MOZA 3EHZA 3WI3A 3KFWX 1U4QA 3FBLA 1HNZT 4H9OC 2LM2A 4DR3T 5LMUT 5HXSA 2YU1A 4WZXA 3AE8A 4AQFA 3AAAB 5J1GA 2BG9C 4OFZA 3JAEA 4QX7B 4O8SA 1FJGT 3PUAA 3KDSE 3TLUA 3HI2A 4AKHA 2EHOA 2H7VC 3RHWA 1N34T 3CX8B 4PNIA 2QVAA 3ANWA 3AE6A 3Q2MA 2E9XA 2V1DB 4IREA 2PJQA 3PV0F 4NXNT 4HWFA 2JRKA 2Q9QB 4JI7T 2I0MA 3O9XA 2XQ8A 5AQPB 4ASKA 3ZMZB 4GK0E 5FVLA 1AJ3A 4PJJA 4BJNA 3RH3A 3ZYLA 1HF8A 2XM2A 4LF4T 3TLVA 2LHRA 3AE9A 3RYIE 3C4ZA 3AAIA 3BQLA 5AQKB 2WDQA 2HN1A 4XZCA 4X1IE 4GYSA 4CI2B 3NRXA 4GOUA 2ZM2A 1FMVA 3OYXA 2JPFA 1V9DA 4COFA 5DQWA 1IBMT 3OKQA 3Q5DA 5H6QB 3UTKA 3UT5E 1ZHCA 3N9QA 2WAUA 3SOLA 1X79A 5ABFA 5J0ZA 4KP3C 4DR1T 3NZPA 1WLXA 4YSZA 2K5BB 3U78A 4XAXB 2XQ3A 5LGUB 5LHHB 2Y48B 4HFDA 5IWAT 4U31A 4H9NC 2VL8A 4FI5A 3KV6A 5HEJA 1ZV4X 2YDSA 2Q9QD 4AKIA 5HYAA 1MIYA 2D2SA 5IUXA 4UEMA 2W67A 4G63A 5HEUA 4EV6A 2DWKA 2D0UA 1Y64B 1KNPA 2WSSV 3AE5A 2Y8DA 2IAKA 3P50A 4UVAB 4LFBT 2VASA 2BG9A 5JH7E 2H89A 4UV8B 4TZ4C 1J5ET 5LB7B 1QLBA 4U33A 1XNRT 2K24A 3AEGA 4DV0T 2UXXB 4DIDB 5LYJE 5CA1E 2HN2A 2W00A 3KV5A 4AIUA 2QGSA 3ZYMA 4KHZF 3C51A 3CMLA 5FP3A 2L9QA 1IBLT 3TKLB 4IGUA 1WR0A 4YLHA 4JI3T 4AXPA 2WU5A 3ZT7A 3TLTA 4CQIA 4TNVA 4KBMB 1MIVA 1FMWA 2CXDA 4YTNA 3A8YC 1XZYA 2X0YA 3ETUA 3C4XA 4MFRA 2EHOB 2C0SA 3ANWB 2V5DA 2CMRA 2UUBT 4JEHB 2E9XB 4H63V 5BMVE 4E7SA 4CI3B 2K9AA 5CJ5A 1JNZA 2YKSA 3RYCE 1CUNA 4DR6T 2E5LT 3I1AA 1MMGA 1VCSA 4IHJE 3ZKRA 1WYBA 4IT4A 4O4JE 2VK9A 3EDVA 2N2NA 4DUZT 2ZM0A 5LMNT 3RRWA 4EXTA 4EEDA 5LOVE 1HG2A 2NW8A 3QB5K 3QUJA 3WAJA 4DV1T 3CWZB 1D0XA 2X0HA 1T98A 4DO0A 1X9BA 1D1BA 3ZT5A 4P1NA 4NXMT 4TUYE 3E08A 4DV3T 3AXJA 3N9NA 2EHOD 5ABFB 4CZZB 2VKJA 4YHHT 5L3CB 5EK3A 4X65T 4TNWA 3CX7B 2WDVA 3KVBA 3UFGA 2XQ4A 1HR0T 2BBHA 4I55E 3PUVF 3KV4A 2VURA 2IMLA 4C90A 5FVKA 4ZEYA 3TLWA 3X1DA 2LE8A 3PUGA 2LRLA 3DTOA 3L8RA 2W61A 2UU9T 5AQOB 5JR9A 4ZHQE 5IHYA 3D0TA 4LMLA 4EYUA 4NUUA 3RC8A 4CN6A 3QOFA 4GYRA 3NBXX 3HA4A 3IBPA 2BKOA 4E7ZA 3FB2A 2HHHT 2BG9B 4TX5A 2YDQA 2LSJA 2CLYC 1XDOA 3L09A 5JDFA 1XMQT 2FJDA 5GONE 2RP4A 1WCRA 4LMKA 2J4GA 5HXRA 3QB5A 3E0ZA 1HFAA 1E1HB 1T7SA 4HE8A 2VVSA 2WDRA 2KWHA 3C64A 3SWHA 2VWAA 4EEBA 5L3BB 3GA8A 2CPTA 3AE4A 1US7B 2JJ9A 3B13A 3ZCJA 1YQ4A 4ISTA 2JQKA 2C5KT 4HWIB 5JVDE 5KMGP 4MLKA 5ETWA 3PE0A 3ZSTA 1FIOA 4U3CA 2JQHA 2Q9QA 4L0RA 5L4HA 2ACZA 3JCFA 2X68A 1WFDA 4DV2T 5HEOA 2WMNA 5DQVA 4EB6E 4CXXA 3UU6A 4AQYT 5J2UE 2LKHA 4NPPA 2WP9A 3GN5A 2E2AA 3UQ7A 1IZNB 3RC3A 4F6RC 4JI6T 4L5GA 3UQ4A 3PURA 4QKNA 4OK0A 4YFSA 5FKYA 5HCMA 4PK4A 5FY1A 2LHNA 4ZZCA 1ZP0A 2BVLA 3LJCA 4CN4A 2WZIA 4OHFA 3AXJB 2X9YA 2PTFA 2JMHA 2YEVC 4CN1A 5JQGE 3FZMB 4JI2T 3AEFA 3FXDB 5AQNB 3RPUA 3H3AA 2YK0A 4P0AA 4EZHA 3PU3A 2MTQA 3QK6A 3VKGA 5C3JA 2ACXA 2ODUA 4JLEA 4HWDA 1HS7A 4KI0F 4QH5A 2CA5A 3MKDA 4IL9A 2X0LB 2VB6A 2XAGB 2VKDA 5JR9B 5JDQA 3UULA 2HH7A 5LP6E 4JYAT 2JQQA 3LDQB 1H7CA 3T1HT 2HPLA 4TWFA 3O4XE 4AQGA 2XQYA 2WZHA 1KFYA 2CXLA 5L4EA 2LSGA 2LLYA 1SA0E 1MIWA 1MNDA 1ZKEA 2KINB 3AB3B 3CQXC 2X9HA 2MPKA 3SRZA 1W0BA 2XQ7A 2NOXA 2I6HA 3ZT6A 5A1LA 1W0AA 5CA0E 4LFAT 3C50A 4O2AE 5E0OA 4LFCT 3VRAA 4G2AA 3K1SA 3RI5A 2IUBA 1D0ZA 2E8IA 1LVFA 2R6GF 4B3TT 3AA6B 2XY8B 4LF5T 3AEEA 2XAJB 2NW7A 2CHOA 2J62A 4DR4T 3A7MA 2LT3A 3IHRA 4DV4T 1Z8UA 5AQRB 4ADZA 4GKKT 3OYZA 4O2BE 5HCJA 1KNRA 3CPZA 5FXVA 4YJ2E 3GN5B 2YU2A 4PJMA 2WU2A 4YHJA 3AE2A 3RLFF 4EAHA 4HWCA 4H9RC 1HTJF 2CRBA 3P4SA 2OLTA 3J7Yq 1E2AA 2PFVA 3N9LA 2X51A 1E7PA 1BR4A 2DL1A 5FXZA 2NW9A 4JV5T 4DR5T 4Z90A 3KV9A 4YT0A 3BK9A 3ZC1A 5F3JA 3R6NA 1CHUA 5CFBA 3ZMUB 1R8IA 2JIWA 2C5JA 4I0UA 3CX6B 4HTEA 2WB5A 3SS1A 5ABEA 3LFMA 2CE7A 3ZMSB 3ZCIA 1D0YA 1WR6A 5L2LA 4JI0T 1OWAA 2IIUA 4ILUA 3KBUA 5HWXA 3P4WA 3H37A 4TV9E 4MALA 1QUUA 2XZEA 3OPCA 4QXBB 4X5TA 4GKJT 2ZM6T 1YW0A 3ONJA 1QSDA 4ERRA 2C5IT 1BR1A 4U2YA 5JDLA 3AEDA 5JDMA 3RIAA 2IC6A 1N33T 5C2TA 4DBQA 1FEWA 4A98A 1UK5A 3UU8A 5LXTE 1ZEEA 5BR8T 3I0OA 4LF8T 4IE7A 3J9X1 3RIUC 1NWMX 5F5WA 3LK3B 2A72A 2KLQA 4IE5A 1W9RA 4H63H 4QH1A 4YJ3E 4KHPT 4AISA 1O3XA 2WY2A 2WM9A 3UUMA 2KZ7B 5LGTB 4DR7T 1UCUA 3I9WA 2DHRA 4PAGA 2QYWA 2LM9A 2V7LA 4UF0A 5FNVE 2WMOA 2NP9A 3VKHA 2L3LA 2MAWA 2XASB 2XQ5A 5KDMC 5LBQB 3PU8A 3S4UA 3LK2B 4ZI7E 2RA1A 4DNDA 5IYZE 3VHLA 4UXNB 2UXNB 3SFEA 3V5SA 5CB4E 4CXYA 2VKOA 1SUMB 5AQVB 3B57A 2YINA 2XJ7A 4OX9T 1NAFA 4U7IA 1UX5A 1MNEA 1Z0PA 2CEAA 4AKGA 4O4LE 4X1KE 5H6RB 3F31A 3EDUA 2XAHB 2LJLA 3O1JA 4A97A 4X64T 1B7TA 1WRDA 5JRCA 2X66A 2VVNA 2BVMA 3Q5EA 3P4PA 4AKLA 2V7IA 4WBOA 5JDGA 2JQ9A 3AE1A 1HX1B 3LK42 4PJLA 4U2ZA 4DMVA 5LGNB 2IDOB 1KNZA 4LF6T 4EOZB 4DMWA 4OYKA 3LSVA 1HNWT 3OVUA 3N2OA 3ZMTB 1YQ3A 2ZMAA 4DUYT 1MMNA 3GWHA 3O1HA 2LSKA 2IW5B 3ZLIA 4C91A 3I0QA 3RIUA 5AFUL 2IHR1 2G0UA 3F57A 5FXWA 1MMDA 4DV7T 1KEYA 1M7KA 2P9BA 3NVOA 1HX8A 4YSYA 2K3WA 4A56A 4WW0A 5HEGA 2DCFA 5AQMB 5LHGB 2MYSA 1S94A 2V7JA 5L3DB 4IE4A 4UVBB 4KX6A 2UXBT 3AA0B 3FZHB 5L3EB 3RGLA 1I6ZA 1NENA 4HFEA 3VRBA 2B76A 1L0VA 2V7KA 3N2KE 4LF9T 3F2EA 1VRBA 3MXZA 3ZSSA 2CCQA 5AQFB 2W63A 4TN7B 2XAFB 2H88A 2H3RA 2BZBA 1XWMA
chains in the Genus database with same CATH topology
5CA0E 2VASA 4UF0B 4Z8XA 3U3IA 3C50A 4O2AE 5E0OA 5ADXL 2MBGA 5JH7E 4HKAA 4G2AA 3UUNA 5LHIB 4UV8B 3CKDA 4TZ4C 2E9XD 2K24A 1YKHB 2D5UA 2CWOA 2UXXB 3EVYA 3OJAA 3N9OA 5LYJE 2LEHA 1D0ZA 2E8IA 5CA1E 1LVFA 3IF8B 3M65A 3AA6B 2ZLYA 2W00A 3KV5A 2QGSA 2XAJB 2NW7A 4WBNE 2PBIA 3ESLA 3K3NA 5JDHA 3ZYMA 4X20E 2CWYA 3C51A 2LT3A 3CMLA 4PFOA 3IHRA 5FP3A 1IJ5A 2L9QA 5FXXA 1LRZA 4ADZA 2PG8A 4DVDA 1VOMA 3OBVE 3TKLB 3OYZA 4IGUA 5HWYA 3AA1B 4YLHA 4HFVA 4O2BE 3CQCB 3CPZA 4AXPA 5FXVA 4YJ2E 3HL6A 4U72A 4O4HE 3GN5B 2YU2A 4CQIA 2X9WA 4KBMB 5EZYE 1MIVA 4PJMA 1FMWA 1D1AA 5F8PA 2CXDA 5LJNA 5FMNA 3BQIA 4YHJA 1IAPA 4EAHA 3ETUA 4H9RC 1HTJF 3ZN1B 3C4XA 4MFRA 2EHOB 5EK2A 1HG5A 2DNXA 2KWIB 2C0SA 1LVKA 4AI6A 2LSYA 3ANWB 2CMRA 5JRCB 3J7Yq 4JEHB 2E9XB 3FXEB 4H63V 5BMVE 4E7SA 2A3DA 2PFVA 3N9LA 2X51A 4CI3B 4ISSA 1BR4A 2NW9A 3LBXA 5FXZA 1SHZC 3RX6A 5HXHA 2K9AA 3RYHE 1U5PA 3KV9A 3BK9A 3ZC1A 5F3JA 2WWUA 4ZI2D 3R6NA 5KX5E 3ZMUB 3RYCE 1CUNA 3PUSA 3O1IA 2C5JA 2DI4A 4AKRB 2NTYA 3CX6B 3I1AA 1LKXA 1MMGA 4J2CA 4QHOA 4HTEA 3MACA 4TV8E 4IHJE 5LA6E 3SS1A 4HGAA 2KT9A 4QX8B 1WYBA 4O4JE 2VK9A 3LFMA 3EDVA 2CE7A 2N2NA 2ZM0A 3HKCE 3QC9A 3HKEE 3ZMSB 3RRWA 1G8XA 4EXTA 4BJMA 5LOVE 1HG2A 2IC9A 3ZCIA 1D0YA 1WR6A 2NW8A 3N9MA 4AQFC 5L3GB 5L2LA 1OWAA 4ILUA 3QUJA 3KBUA 4H9SE 2N9DA 3FBZA 4EIWA 3WAJA 1BR0A 3N9PA 3CWZB 5HWXA 1D0XA 2QA7A 2V26A 3H37A 2DLRA 4TV9E 1T98A 2M67A 4HEAA 4DO0A 3NRYA 4MALA 1D1BA 5HAXA 4P0BA 1QUUA 2LSIA 4KUMB 3WAKA 4TUYE 3E08A 2XHEB 2XAQB 4QXBB 3ZN0B 3N9NA 2EHOD 4M1PA 2EHOC 4CZZB 4BA9A 3T8OA 2VKJA 4I50E 4I4TE 5L3CB 1YW0A 5JDNA 5EK3A 1QSDA 3W15B 4ERRA 2C5IT 2E9XC 1BR1A 3CX7B 5DJQC 4EYYR 3ONXA 4OYJA 3KBTA 3KVBA 5JDLA 3ZJ2A 3P8CD 2LOPA 5LCYA 5FY0A 4U74A 4GK5E 4I55E 2VKHA 5HXEA 5JDMA 2ZM8A 2IC6A 3FHNA 2NWBA 3KV4A 1YD8G 1YKEB 3LG7A 4DBQA 4C90A 3MJXA 1FEWA 3C4WA 3N2GE 2ODVA 2LE8A 3GMIA 3PUGA 4B6XA 3NZQA 1G73A 3DTOA 3JC6D 4ZI3C 2D0TA 2W61A 3L3PA 4ZI3D 5LXTE 1ZEEA 3K8PC 3P7IA 3I0OA 2H7OA 4PFPA 5JR9A 4NUVA 4ZHQE 4IE7A 5IHYA 3J9X1 3AAEB 3D0TA 2HPJA 3E22E 5DABA 4EYUA 4NUUA 3RC8A 2BDEA 1NWMX 3IEEA 4GYRA 3NBXX 3HA4A 4FJOA 3IBPA 3LK3B 2A72A 2KLQA 4QXCB 4IE5A 2B1EA 4H63H 4E7ZA 3FB2A 4ANJA 2SPCA 1HCIA 3DJBA 3Q5WA 4TX5A 4YJ3E 2LOSA 4H9PC 4JEUB 2LSJA 4MBQA 4L9IA 2CLYC 3Q9DA 4ZOLE 3L09A 3ZJ1A 2W62A 1O3XA 3N5LA 5JDFA 4UVCB 4O4IE 2XUEA 4P09A 4JUYA 5LG4A 5GONE 1WYCA 2RP4A 2WM9A 3MZKB 4MHCA 1D1CA 1S35A 2KZ7B 3UUMA 5LGTB 2W0GA 3Q5XA 5HXRA 3E0ZA 1HFAA 1E1HB 1UCUA 3I9WA 4HE8A 2DHRA 4ZI2C 2XTLA 4QWNB 2KWHA 3RRCA 2Z6EA 3C64A 3SWHA 4PAGA 2VWAA 3RKOA 1MMAA 4N78D 5L3BB 3GA8A 4IE6A 4PW8A 3HKBE 1US7B 3HR0A 2V7MA 2LM9A 2V7LA 2JJ9A 3CQGB 2N1GA 4UF0A 3B13A 5JREA 2KMFA 4H9QC 5FNVE 3UFEA 4XBFB 2JMKA 2WMOA 2WBLA 3ZCJA 2KNDA 2NP9A 4ISTA 3EUHA 2L3LA 3ZYKA 4CI1B 3VKHA 3ZMVB 2C5KT 3UUXB 2CM0A 3PDYA 2XASB 5KDMC 3I9YA 5JVDE 5LBQB 5KMGP 4MLKA 3PU8A 5ETWA 3PE0A 3S4UA 3HKDE 3LK2B 1FIOA 2MOZA 4K0UA 3WI3A 3KFWX 1U4QA 3FBLA 4V1Av 5FYMA 2Q9QA 4ZI7E 4H9OC 4L0RA 3K3OA 2RA1A 4DNDA 5IYZE 3VHLA 4UV9B 5HXSA 2CLYB 4UXNB 2UXNB 2X68A 2YU1A 4BAYB 4PK5A 4AQFA 3V5SA 5CB4E 4CXYA 3AAAB 2VKOA 5J1GA 3MK7C 2WMNA 3LBXB 5DQVA 4EB6E 4CXXA 4OFZA 3B57A 4QX7B 2YINA 1IJ6A 5J2UE 1NAFA 1UX5A 4O8SA 3GN5A 1MNEA 1Z0PA 5L3FB 2CEAA 3PUAA 4AKGA 3KDSE 4O4LE 1IZNB 3V5UA 4X1KE 1OXZA 3HI2A 5H6RB 2X9XA 3RC3A 5J2TE 3F31A 4AKHA 2KXPB 3EDUA 2XAHB 2LJLA 3C98B 2EHOA 2H7VC 4F6RC 3O1JA 2J1DG 3ETVA 4PJNA 4L5GA 5LBMA 3CX8B 4PNIA 1B7TA 3ANWA 3PUQA 5EK4A 1WRDA 3PURA 3MA9A 5JRCA 2X66A 3Q2MA 4HN9A 2E9XA 4OK0A 2BVMA 4QKNA 4YFSA 2V1DB 4AKLA 2PJQA 2V7IA 4WBOA 3JC6C 3PTRB 5JDGA 3LK42 4QXHB 4PJLA 4PK4A 2JRKA 4DMVA 2Q9QB 5LGNB 3ZEFB 5JR9C 3O9XA 5FY1A 2LHNA 1KNZA 4ASKA 4EOZB 3BQKA 4DMWA 4OYKA 3ZMZB 4ZS3A 4GK0E 1AJ3A 2BVLA 3LJCA 4PJJA 3RYFE 4BJNA 3RH3A 3ZYLA 4OHFA 1HF8A 3N2OA 3ZMTB 2CXFA 2ZMAA 3VU7H 1MMNA 3GWHA 3A5XA 2OA5A 3O1HA 2X9YA 2LSKA 5LJMA 2IW5B 3ZLIA 4C91A 2LHRA 3I0QA 3RYIE 3CVRA 2JMHA 2YEVC 5C8YE 5JQGE 5AFUL 3C4ZA 3AAIA 3BQLA 3FXDB 2G0UA 4CXWA 3RPUA 3H3AA 2YK0A 4XZCA 4P0AA 3F57A 4GYSA 1EZ3A 3NRXA 4X1IE 4GOUA 2K48A 2ZM2A 5FXWA 4CI2B 4EZHA 3PU3A 2MTQA 1MMDA 1FMVA 3OYXA 2JPFA 3QK6A 4IDZA 3VKGA 4I43B 3R84B 1V9DA 4EZ4A 2I59A 2P9BA 1HX8A 5DQWA 4A56A 4WW0A 3OKQA 2ACXA 3AVRA 2ODUA 4IE0A 2DCFA 5H6QB 3UTKA 2A2FX 4WNKA 4JLEA 3UT5E 5LHGB 1HS7A 1ZHCA 3N9QA 2WAUA 3AA7B 3SOLA 1X79A 3AVSA 2MYSA 2CA5A 1S94A 2V7JA 3MKDA 2X0LB 5L3DB 2VB6A 2XAGB 2L8KA 2VKDA 3KINB 4KP3C 5HXCA 4IE4A 5JR9B 4UVBB 3NZPA 1WLXA 5JDQA 3UULA 2K5BB 2HH7A 3U78A 4XAXB 5LP6E 3AA0B 3KVAA 5LGUB 5LHHB 2Y48B 2JQQA 5L3EB 4H9NC 2VL8A 4PK6A 1H7CA 2HPLA 4GIWA 4FI5A 3KV6A 1ZV4X 2GK9A 2Q9QD 2Q9QC 3O4XE 4AKIA 4KMCA 2XQYA 4AQGA 5HYAA 2Y6XA 1MIYA 2D2SA 2ES0A 2DWGA 4IIJE 2CXLA 4X1YE 2LSGA 2V7KA 4UEMA 4UIGA 5TAOA 1SA0E 4G63A 4DBRA 3N2KE 1MIWA 1MNDA 2DWKA 2D0UA 5FY7A 1ZKEA 2KINB 3AB3B 1Y64B 3F2EA 4ZS2A 1VRBA 3MXZA 3CQXC 1BR2A 2X9HA 1KK7A 2CCQA 2WSSV 3SRZA 2W63A 4UELA 2NOXA 3K3QC 4TN7B 2Y8DA 5M4YA 2IAKA 2XAFB 2X67A 5A1LA 3DP7A 2NTXA 3ZC0A 2H3RA 1UX4A 3ZPOA 2BZBA 4UVAB 5LNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJ2 A;  2LHN A;  5L2L A;  3ZJ1 A; 
#chains in the Genus database with same CATH topology
 4UF0 B;  4Z8X A;  2MBG A;  4HKA A;  1IBK T;  3UUN A;  1XDP A;  3CKD A;  4Q25 A;  1YKH B;  2D5U A;  2YDR A;  2CWO A;  3L39 A;  3OJA A;  2UUC T;  3N9O A;  1NEK A;  3IF8 B;  2XSA A;  1W09 A;  3ESL A;  5JDH A;  2V6Y A;  4ILA A;  4X20 E;  4YXD A;  2BKN A;  4PFO A;  4HFB A;  5FXX A;  1VOM A;  4JI4 T;  4HFV A;  4ILB A;  3HL6 A;  2BG9 E;  4U72 A;  4O4H E;  5F8P A;  2WQY A;  2BKP A;  4DR2 T;  5LJN A;  4TWD A;  3BQI A;  1IAP A;  5AQH B;  5EK2 A;  2DNX A;  2KWI B;  4TWH A;  1LVK A;  2WWV A;  5JRC B;  3FXE B;  4ISS A;  3RX6 A;  5ABH A;  3LBX A;  1SHZ C;  5AQI B;  3RYH E;  4JI1 T;  1U5P A;  2M6B A;  4ZI2 D;  2FJE A;  3O1I A;  2DI4 A;  2NTY A;  4IDN A;  1LKX A;  4QHO A;  2RPA A;  5LA6 E;  4HGA A;  3CIR A;  4QX8 B;  3EAM A;  3QC9 A;  3HKC E;  3VR8 A;  3RQW A;  5L3G B;  2YN6 A;  4EIW A;  2N9D A;  2NR4 A;  3FBZ A;  3UU3 A;  1BR0 A;  3N9P A;  2QA7 A;  2DLR A;  2M67 A;  4WYV A;  4HEA A;  3NRY A;  5HAX A;  4JI5 T;  1J5W A;  3PUY F;  2FBW A;  3EI0 A;  4KUM B;  3WAK A;  2F4V T;  5HEH A;  2XAQ B;  2WS3 A;  4BA9 A;  4I50 E;  3FZL B;  4I4T E;  3QNU A;  5DJQ C;  3ONX A;  4IL4 A;  3M3Z B;  3KBT A;  5FL0 A;  3ZJ2 A;  3P8C D;  2LOP A;  1T8B A;  4GK5 E;  5HXE A;  2VKH A;  2CBI A;  4IDQ A;  3MJX A;  1XNQ T;  2ODV A;  1N32 T;  3NZQ A;  5KXJ A;  3JC6 D;  4ZI3 C;  3L3P A;  3K8P C;  1OED C;  2UUA T;  4PFP A;  4NUV A;  5AQJ B;  3E22 E;  2BDE A;  4X66 T;  2LKG A;  3IEE A;  1DU2 A;  3ONL C;  4ANJ A;  2SPC A;  3DJB A;  3Q5W A;  4H9P C;  4JEU B;  4L9I A;  4ZOL E;  3Q9D A;  3ZJ1 A;  4O4I E;  4JUY A;  2W2U A;  4MHC A;  1D1C A;  2VQE T;  4F8H A;  2W0G A;  4B3M T;  3FZK B;  5L47 A;  4ZI2 C;  2XTL A;  4QWN B;  5JTG A;  2Z6E A;  1MMA A;  2V6Y B;  4N78 D;  1YXR A;  4IE6 A;  2BBJ A;  3HR0 A;  3NKZ A;  1M62 A;  4ILC A;  3CQG B;  4H9Q C;  3UFE A;  4XBF B;  2WBL A;  2KND A;  3EUH A;  3ZMV B;  3UUX B;  4DV6 T;  3PDY A;  3ABV A;  4DV5 T;  2XQ6 A;  3HKD E;  4K0U A;  4V1A v;  5FYM A;  3RIF A;  3K3O A;  4UV9 B;  2CLY B;  2WCA A;  4YSX A;  4BAY B;  4PK5 A;  4LF7 T;  4IDP A;  3MK7 C;  3LBX B;  5AQL B;  1IJ6 A;  2E5V A;  5L3F B;  3V5U A;  5J2T E;  1OXZ A;  2X9X A;  2KXP B;  3AEA A;  3C98 B;  2J1D G;  2XSB A;  3ETV A;  2A9U A;  4PJN A;  5LBM A;  3PUQ A;  5EK4 A;  3MA9 A;  4HN9 A;  3CK6 A;  4B3S T;  3JC6 C;  3PTR B;  2CBJ A;  3RQU A;  4QXH B;  3ZEF B;  5JR9 C;  3OTO T;  2FJA A;  3BQK A;  3FZF B;  2YOE A;  3RF1 A;  4ZS3 A;  3G06 A;  3JAD A;  3RYF E;  3SFD A;  2VQF T;  2CXF A;  3VU7 H;  1Y01 A;  3A5X A;  1N36 T;  2OA5 A;  1OED A;  5LJM A;  2V8S V;  5AQG B;  3T1Y T;  3CVR A;  3NWI A;  5C8Y E;  4CXW A;  1SE7 A;  1EZ3 A;  2K48 A;  2FJB A;  3EAB A;  3IA3 A;  4NIQ A;  3PJA A;  4IDZ A;  4I43 B;  3R84 B;  4EZ4 A;  2I59 A;  2VL0 A;  4B3R T;  3AVR A;  4IE0 A;  2A2F X;  4WNK A;  4YY3 T;  1KF6 A;  3AA7 B;  3AVS A;  5HXC A;  2L8K A;  3KIN B;  1VCT A;  3PJA J;  3KVA A;  4PK6 A;  4GIW A;  2XQA A;  2GK9 A;  2Q9Q C;  4KMC A;  5ABG A;  2Y6X A;  3UU5 A;  4HFH A;  2ES0 A;  2DWG A;  4IIJ E;  4X1Y E;  4UIG A;  2LRK A;  5TAO A;  4DBR A;  4UR9 A;  5FY7 A;  4ZS2 A;  1BR2 A;  1KK7 A;  2W66 A;  4UEL A;  3K3Q C;  5M4Y A;  2FUP A;  2X67 A;  2BS4 A;  5AQU B;  3DP7 A;  2NTX A;  3ZC0 A;  1UX4 A;  3ZPO A;  4EGW A;  5LNK A;  3JAF A;  3U3I A;  5ADX L;  2V6X A;  2XQ9 A;  3RKG A;  2XM1 A;  5LHI B;  2E9X D;  5LG3 A;  4Z91 A;  3UUB A;  3EVY A;  2UXC T;  2LEH A;  4HFI A;  2UXD T;  3M65 A;  2ZLY A;  4WBN E;  2PBI A;  3K3N A;  1XMO T;  2CWY A;  1IJ5 A;  1LRZ A;  1I94 T;  2PG8 A;  4DVD A;  3OBV E;  5HWY A;  3AA1 B;  3AE3 A;  3P4Q A;  3CQC B;  1UUR A;  2X9W A;  5EZY E;  1D1A A;  3H3M A;  2AE9 A;  5FMN A;  3ZN1 B;  3AEB A;  3UU4 A;  1HG5 A;  4AI6 A;  2LSY A;  2A3D A;  5HXH A;  1J1J A;  2WWU A;  5KX5 E;  2V5C A;  4YTM A;  3PUS A;  2W4X A;  4AKR B;  4HWH A;  4J2C A;  4TV8 E;  2OV9 A;  3MAC A;  2KT9 A;  3P4R A;  1OED B;  3HKE E;  3VR9 A;  1G8X A;  4QH4 A;  4BJM A;  2IC9 A;  4AQF C;  3N9M A;  2M6I A;  3TLS A;  4H9S E;  2V26 A;  4HFC A;  2BS2 A;  4P0B A;  3B5M A;  2LSI A;  2XHE B;  3ZN0 B;  4M1P A;  2EHO C;  3T8O A;  3AE7 A;  4ZXL A;  2CHN A;  4ZZB A;  5JDN A;  1HNX T;  3W15 B;  2E9X C;  4EYY R;  4A5X A;  4OYJ A;  1ZOY A;  5LCY A;  5FY0 A;  4U74 A;  2BS3 A;  2ZM8 A;  3FHN A;  2NWB A;  1YD8 G;  3PUW F;  1YKE B;  3LG7 A;  2XPK A;  2J47 A;  3C4W A;  3N2G E;  4K0K T;  5FL1 A;  3GMI A;  4B6X A;  1G73 A;  4LMJ A;  4ZI3 D;  2D0T A;  2KSR A;  3P7I A;  1UUS A;  3PUZ F;  2H7O A;  3PUX F;  3AAE B;  5DAB A;  2HPJ A;  4IDO A;  5CGM A;  4FJO A;  4QXC B;  4X62 T;  2B1E A;  2D9D A;  1HCI A;  1UGO A;  2LOS A;  4MBQ A;  2W62 A;  3N5L A;  1GQE A;  4UVC B;  2XUE A;  4P09 A;  5LG4 A;  5AQQ B;  1WYC A;  3MZK B;  4U7Y A;  1S35 A;  3Q5X A;  2QRX A;  4JI8 T;  5AQS B;  3RRC A;  2AXD S;  3RKO A;  1JNR A;  4PW8 A;  3HKB E;  2V7M A;  2N1G A;  4JBW F;  1T72 A;  5JRE A;  2KMF A;  2JMK A;  3ZYK A;  4CI1 B;  2CM0 A;  1OED E;  4YTP A;  3AEC A;  3I9Y A;  5AQT B;  2MOZ A;  3EHZ A;  3WI3 A;  3KFW X;  1U4Q A;  3FBL A;  1HNZ T;  4H9O C;  2LM2 A;  4DR3 T;  5LMU T;  5HXS A;  2YU1 A;  4WZX A;  3AE8 A;  4AQF A;  3AAA B;  5J1G A;  2BG9 C;  4OFZ A;  3JAE A;  4QX7 B;  4O8S A;  1FJG T;  3PUA A;  3KDS E;  3TLU A;  3HI2 A;  4AKH A;  2EHO A;  2H7V C;  3RHW A;  1N34 T;  3CX8 B;  4PNI A;  2QVA A;  3ANW A;  3AE6 A;  3Q2M A;  2E9X A;  2V1D B;  4IRE A;  2PJQ A;  3PV0 F;  4NXN T;  4HWF A;  2JRK A;  2Q9Q B;  4JI7 T;  2I0M A;  3O9X A;  2XQ8 A;  5AQP B;  4ASK A;  3ZMZ B;  4GK0 E;  5FVL A;  1AJ3 A;  4PJJ A;  4BJN A;  3RH3 A;  3ZYL A;  1HF8 A;  2XM2 A;  4LF4 T;  3TLV A;  2LHR A;  3AE9 A;  3RYI E;  3C4Z A;  3AAI A;  3BQL A;  5AQK B;  2WDQ A;  2HN1 A;  4XZC A;  4X1I E;  4GYS A;  4CI2 B;  3NRX A;  4GOU A;  2ZM2 A;  1FMV A;  3OYX A;  2JPF A;  1V9D A;  4COF A;  5DQW A;  1IBM T;  3OKQ A;  3Q5D A;  5H6Q B;  3UTK A;  3UT5 E;  1ZHC A;  3N9Q A;  2WAU A;  3SOL A;  1X79 A;  5ABF A;  5J0Z A;  4KP3 C;  4DR1 T;  3NZP A;  1WLX A;  4YSZ A;  2K5B B;  3U78 A;  4XAX B;  2XQ3 A;  5LGU B;  5LHH B;  2Y48 B;  4HFD A;  5IWA T;  4U31 A;  4H9N C;  2VL8 A;  4FI5 A;  3KV6 A;  5HEJ A;  1ZV4 X;  2YDS A;  2Q9Q D;  4AKI A;  5HYA A;  1MIY A;  2D2S A;  5IUX A;  4UEM A;  2W67 A;  4G63 A;  5HEU A;  4EV6 A;  2DWK A;  2D0U A;  1Y64 B;  1KNP A;  2WSS V;  3AE5 A;  2Y8D A;  2IAK A;  3P50 A;  4UVA B;  4LFB T;  2VAS A;  2BG9 A;  5JH7 E;  2H89 A;  4UV8 B;  4TZ4 C;  1J5E T;  5LB7 B;  1QLB A;  4U33 A;  1XNR T;  2K24 A;  3AEG A;  4DV0 T;  2UXX B;  4DID B;  5LYJ E;  5CA1 E;  2HN2 A;  2W00 A;  3KV5 A;  4AIU A;  2QGS A;  3ZYM A;  4KHZ F;  3C51 A;  3CML A;  5FP3 A;  2L9Q A;  1IBL T;  3TKL B;  4IGU A;  1WR0 A;  4YLH A;  4JI3 T;  4AXP A;  2WU5 A;  3ZT7 A;  3TLT A;  4CQI A;  4TNV A;  4KBM B;  1MIV A;  1FMW A;  2CXD A;  4YTN A;  3A8Y C;  1XZY A;  2X0Y A;  3ETU A;  3C4X A;  4MFR A;  2EHO B;  2C0S A;  3ANW B;  2V5D A;  2CMR A;  2UUB T;  4JEH B;  2E9X B;  4H63 V;  5BMV E;  4E7S A;  4CI3 B;  2K9A A;  5CJ5 A;  1JNZ A;  2YKS A;  3RYC E;  1CUN A;  4DR6 T;  2E5L T;  3I1A A;  1MMG A;  1VCS A;  4IHJ E;  3ZKR A;  1WYB A;  4IT4 A;  4O4J E;  2VK9 A;  3EDV A;  2N2N A;  4DUZ T;  2ZM0 A;  5LMN T;  3RRW A;  4EXT A;  4EED A;  5LOV E;  1HG2 A;  2NW8 A;  3QB5 K;  3QUJ A;  3WAJ A;  4DV1 T;  3CWZ B;  1D0X A;  2X0H A;  1T98 A;  4DO0 A;  1X9B A;  1D1B A;  3ZT5 A;  4P1N A;  4NXM T;  4TUY E;  3E08 A;  4DV3 T;  3AXJ A;  3N9N A;  2EHO D;  5ABF B;  4CZZ B;  2VKJ A;  4YHH T;  5L3C B;  5EK3 A;  4X65 T;  4TNW A;  3CX7 B;  2WDV A;  3KVB A;  3UFG A;  2XQ4 A;  1HR0 T;  2BBH A;  4I55 E;  3PUV F;  3KV4 A;  2VUR A;  2IML A;  4C90 A;  5FVK A;  4ZEY A;  3TLW A;  3X1D A;  2LE8 A;  3PUG A;  2LRL A;  3DTO A;  3L8R A;  2W61 A;  2UU9 T;  5AQO B;  5JR9 A;  4ZHQ E;  5IHY A;  3D0T A;  4LML A;  4EYU A;  4NUU A;  3RC8 A;  4CN6 A;  3QOF A;  4GYR A;  3NBX X;  3HA4 A;  3IBP A;  2BKO A;  4E7Z A;  3FB2 A;  2HHH T;  2BG9 B;  4TX5 A;  2YDQ A;  2LSJ A;  2CLY C;  1XDO A;  3L09 A;  5JDF A;  1XMQ T;  2FJD A;  5GON E;  2RP4 A;  1WCR A;  4LMK A;  2J4G A;  5HXR A;  3QB5 A;  3E0Z A;  1HFA A;  1E1H B;  1T7S A;  4HE8 A;  2VVS A;  2WDR A;  2KWH A;  3C64 A;  3SWH A;  2VWA A;  4EEB A;  5L3B B;  3GA8 A;  2CPT A;  3AE4 A;  1US7 B;  2JJ9 A;  3B13 A;  3ZCJ A;  1YQ4 A;  4IST A;  2JQK A;  2C5K T;  4HWI B;  5JVD E;  5KMG P;  4MLK A;  5ETW A;  3PE0 A;  3ZST A;  1FIO A;  4U3C A;  2JQH A;  2Q9Q A;  4L0R A;  5L4H A;  2ACZ A;  3JCF A;  2X68 A;  1WFD A;  4DV2 T;  5HEO A;  2WMN A;  5DQV A;  4EB6 E;  4CXX A;  3UU6 A;  4AQY T;  5J2U E;  2LKH A;  4NPP A;  2WP9 A;  3GN5 A;  2E2A A;  3UQ7 A;  1IZN B;  3RC3 A;  4F6R C;  4JI6 T;  4L5G A;  3UQ4 A;  3PUR A;  4QKN A;  4OK0 A;  4YFS A;  5FKY A;  5HCM A;  4PK4 A;  5FY1 A;  2LHN A;  4ZZC A;  1ZP0 A;  2BVL A;  3LJC A;  4CN4 A;  2WZI A;  4OHF A;  3AXJ B;  2X9Y A;  2PTF A;  2JMH A;  2YEV C;  4CN1 A;  5JQG E;  3FZM B;  4JI2 T;  3AEF A;  3FXD B;  5AQN B;  3RPU A;  3H3A A;  2YK0 A;  4P0A A;  4EZH A;  3PU3 A;  2MTQ A;  3QK6 A;  3VKG A;  5C3J A;  2ACX A;  2ODU A;  4JLE A;  4HWD A;  1HS7 A;  4KI0 F;  4QH5 A;  2CA5 A;  3MKD A;  4IL9 A;  2X0L B;  2VB6 A;  2XAG B;  2VKD A;  5JR9 B;  5JDQ A;  3UUL A;  2HH7 A;  5LP6 E;  4JYA T;  2JQQ A;  3LDQ B;  1H7C A;  3T1H T;  2HPL A;  4TWF A;  3O4X E;  4AQG A;  2XQY A;  2WZH A;  1KFY A;  2CXL A;  5L4E A;  2LSG A;  2LLY A;  1SA0 E;  1MIW A;  1MND A;  1ZKE A;  2KIN B;  3AB3 B;  3CQX C;  2X9H A;  2MPK A;  3SRZ A;  1W0B A;  2XQ7 A;  2NOX A;  2I6H A;  3ZT6 A;  5A1L A;  1W0A A;  5CA0 E;  4LFA T;  3C50 A;  4O2A E;  5E0O A;  4LFC T;  3VRA A;  4G2A A;  3K1S A;  3RI5 A;  2IUB A;  1D0Z A;  2E8I A;  1LVF A;  2R6G F;  4B3T T;  3AA6 B;  2XY8 B;  4LF5 T;  3AEE A;  2XAJ B;  2NW7 A;  2CHO A;  2J62 A;  4DR4 T;  3A7M A;  2LT3 A;  3IHR A;  4DV4 T;  1Z8U A;  5AQR B;  4ADZ A;  4GKK T;  3OYZ A;  4O2B E;  5HCJ A;  1KNR A;  3CPZ A;  5FXV A;  4YJ2 E;  3GN5 B;  2YU2 A;  4PJM A;  2WU2 A;  4YHJ A;  3AE2 A;  3RLF F;  4EAH A;  4HWC A;  4H9R C;  1HTJ F;  2CRB A;  3P4S A;  2OLT A;  3J7Y q;  1E2A A;  2PFV A;  3N9L A;  2X51 A;  1E7P A;  1BR4 A;  2DL1 A;  5FXZ A;  2NW9 A;  4JV5 T;  4DR5 T;  4Z90 A;  3KV9 A;  4YT0 A;  3BK9 A;  3ZC1 A;  5F3J A;  3R6N A;  1CHU A;  5CFB A;  3ZMU B;  1R8I A;  2JIW A;  2C5J A;  4I0U A;  3CX6 B;  4HTE A;  2WB5 A;  3SS1 A;  5ABE A;  3LFM A;  2CE7 A;  3ZMS B;  3ZCI A;  1D0Y A;  1WR6 A;  5L2L A;  4JI0 T;  1OWA A;  2IIU A;  4ILU A;  3KBU A;  5HWX A;  3P4W A;  3H37 A;  4TV9 E;  4MAL A;  1QUU A;  2XZE A;  3OPC A;  4QXB B;  4X5T A;  4GKJ T;  2ZM6 T;  1YW0 A;  3ONJ A;  1QSD A;  4ERR A;  2C5I T;  1BR1 A;  4U2Y A;  5JDL A;  3AED A;  5JDM A;  3RIA A;  2IC6 A;  1N33 T;  5C2T A;  4DBQ A;  1FEW A;  4A98 A;  1UK5 A;  3UU8 A;  5LXT E;  1ZEE A;  5BR8 T;  3I0O A;  4LF8 T;  4IE7 A;  3J9X 1;  3RIU C;  1NWM X;  5F5W A;  3LK3 B;  2A72 A;  2KLQ A;  4IE5 A;  1W9R A;  4H63 H;  4QH1 A;  4YJ3 E;  4KHP T;  4AIS A;  1O3X A;  2WY2 A;  2WM9 A;  3UUM A;  2KZ7 B;  5LGT B;  4DR7 T;  1UCU A;  3I9W A;  2DHR A;  4PAG A;  2QYW A;  2LM9 A;  2V7L A;  4UF0 A;  5FNV E;  2WMO A;  2NP9 A;  3VKH A;  2L3L A;  2MAW A;  2XAS B;  2XQ5 A;  5KDM C;  5LBQ B;  3PU8 A;  3S4U A;  3LK2 B;  4ZI7 E;  2RA1 A;  4DND A;  5IYZ E;  3VHL A;  4UXN B;  2UXN B;  3SFE A;  3V5S A;  5CB4 E;  4CXY A;  2VKO A;  1SUM B;  5AQV B;  3B57 A;  2YIN A;  2XJ7 A;  4OX9 T;  1NAF A;  4U7I A;  1UX5 A;  1MNE A;  1Z0P A;  2CEA A;  4AKG A;  4O4L E;  4X1K E;  5H6R B;  3F31 A;  3EDU A;  2XAH B;  2LJL A;  3O1J A;  4A97 A;  4X64 T;  1B7T A;  1WRD A;  5JRC A;  2X66 A;  2VVN A;  2BVM A;  3Q5E A;  3P4P A;  4AKL A;  2V7I A;  4WBO A;  5JDG A;  2JQ9 A;  3AE1 A;  1HX1 B;  3LK4 2;  4PJL A;  4U2Z A;  4DMV A;  5LGN B;  2IDO B;  1KNZ A;  4LF6 T;  4EOZ B;  4DMW A;  4OYK A;  3LSV A;  1HNW T;  3OVU A;  3N2O A;  3ZMT B;  1YQ3 A;  2ZMA A;  4DUY T;  1MMN A;  3GWH A;  3O1H A;  2LSK A;  2IW5 B;  3ZLI A;  4C91 A;  3I0Q A;  3RIU A;  5AFU L;  2IHR 1;  2G0U A;  3F57 A;  5FXW A;  1MMD A;  4DV7 T;  1KEY A;  1M7K A;  2P9B A;  3NVO A;  1HX8 A;  4YSY A;  2K3W A;  4A56 A;  4WW0 A;  5HEG A;  2DCF A;  5AQM B;  5LHG B;  2MYS A;  1S94 A;  2V7J A;  5L3D B;  4IE4 A;  4UVB B;  4KX6 A;  2UXB T;  3AA0 B;  3FZH B;  5L3E B;  3RGL A;  1I6Z A;  1NEN A;  4HFE A;  3VRB A;  2B76 A;  1L0V A;  2V7K A;  3N2K E;  4LF9 T;  3F2E A;  1VRB A;  3MXZ A;  3ZSS A;  2CCQ A;  5AQF B;  2W63 A;  4TN7 B;  2XAF B;  2H88 A;  2H3R A;  2BZB A;  1XWM A; 
#chains in the Genus database with same CATH homology
 5CA0 E;  2VAS A;  4UF0 B;  4Z8X A;  3U3I A;  3C50 A;  4O2A E;  5E0O A;  5ADX L;  2MBG A;  5JH7 E;  4HKA A;  4G2A A;  3UUN A;  5LHI B;  4UV8 B;  3CKD A;  4TZ4 C;  2E9X D;  2K24 A;  1YKH B;  2D5U A;  2CWO A;  2UXX B;  3EVY A;  3OJA A;  3N9O A;  5LYJ E;  2LEH A;  1D0Z A;  2E8I A;  5CA1 E;  1LVF A;  3IF8 B;  3M65 A;  3AA6 B;  2ZLY A;  2W00 A;  3KV5 A;  2QGS A;  2XAJ B;  2NW7 A;  4WBN E;  2PBI A;  3ESL A;  3K3N A;  5JDH A;  3ZYM A;  4X20 E;  2CWY A;  3C51 A;  2LT3 A;  3CML A;  4PFO A;  3IHR A;  5FP3 A;  1IJ5 A;  2L9Q A;  5FXX A;  1LRZ A;  4ADZ A;  2PG8 A;  4DVD A;  1VOM A;  3OBV E;  3TKL B;  3OYZ A;  4IGU A;  5HWY A;  3AA1 B;  4YLH A;  4HFV A;  4O2B E;  3CQC B;  3CPZ A;  4AXP A;  5FXV A;  4YJ2 E;  3HL6 A;  4U72 A;  4O4H E;  3GN5 B;  2YU2 A;  4CQI A;  2X9W A;  4KBM B;  5EZY E;  1MIV A;  4PJM A;  1FMW A;  1D1A A;  5F8P A;  2CXD A;  5LJN A;  5FMN A;  3BQI A;  4YHJ A;  1IAP A;  4EAH A;  3ETU A;  4H9R C;  1HTJ F;  3ZN1 B;  3C4X A;  4MFR A;  2EHO B;  5EK2 A;  1HG5 A;  2DNX A;  2KWI B;  2C0S A;  1LVK A;  4AI6 A;  2LSY A;  3ANW B;  2CMR A;  5JRC B;  3J7Y q;  4JEH B;  2E9X B;  3FXE B;  4H63 V;  5BMV E;  4E7S A;  2A3D A;  2PFV A;  3N9L A;  2X51 A;  4CI3 B;  4ISS A;  1BR4 A;  2NW9 A;  3LBX A;  5FXZ A;  1SHZ C;  3RX6 A;  5HXH A;  2K9A A;  3RYH E;  1U5P A;  3KV9 A;  3BK9 A;  3ZC1 A;  5F3J A;  2WWU A;  4ZI2 D;  3R6N A;  5KX5 E;  3ZMU B;  3RYC E;  1CUN A;  3PUS A;  3O1I A;  2C5J A;  2DI4 A;  4AKR B;  2NTY A;  3CX6 B;  3I1A A;  1LKX A;  1MMG A;  4J2C A;  4QHO A;  4HTE A;  3MAC A;  4TV8 E;  4IHJ E;  5LA6 E;  3SS1 A;  4HGA A;  2KT9 A;  4QX8 B;  1WYB A;  4O4J E;  2VK9 A;  3LFM A;  3EDV A;  2CE7 A;  2N2N A;  2ZM0 A;  3HKC E;  3QC9 A;  3HKE E;  3ZMS B;  3RRW A;  1G8X A;  4EXT A;  4BJM A;  5LOV E;  1HG2 A;  2IC9 A;  3ZCI A;  1D0Y A;  1WR6 A;  2NW8 A;  3N9M A;  4AQF C;  5L3G B;  5L2L A;  1OWA A;  4ILU A;  3QUJ A;  3KBU A;  4H9S E;  2N9D A;  3FBZ A;  4EIW A;  3WAJ A;  1BR0 A;  3N9P A;  3CWZ B;  5HWX A;  1D0X A;  2QA7 A;  2V26 A;  3H37 A;  2DLR A;  4TV9 E;  1T98 A;  2M67 A;  4HEA A;  4DO0 A;  3NRY A;  4MAL A;  1D1B A;  5HAX A;  4P0B A;  1QUU A;  2LSI A;  4KUM B;  3WAK A;  4TUY E;  3E08 A;  2XHE B;  2XAQ B;  4QXB B;  3ZN0 B;  3N9N A;  2EHO D;  4M1P A;  2EHO C;  4CZZ B;  4BA9 A;  3T8O A;  2VKJ A;  4I50 E;  4I4T E;  5L3C B;  1YW0 A;  5JDN A;  5EK3 A;  1QSD A;  3W15 B;  4ERR A;  2C5I T;  2E9X C;  1BR1 A;  3CX7 B;  5DJQ C;  4EYY R;  3ONX A;  4OYJ A;  3KBT A;  3KVB A;  5JDL A;  3ZJ2 A;  3P8C D;  2LOP A;  5LCY A;  5FY0 A;  4U74 A;  4GK5 E;  4I55 E;  2VKH A;  5HXE A;  5JDM A;  2ZM8 A;  2IC6 A;  3FHN A;  2NWB A;  3KV4 A;  1YD8 G;  1YKE B;  3LG7 A;  4DBQ A;  4C90 A;  3MJX A;  1FEW A;  3C4W A;  3N2G E;  2ODV A;  2LE8 A;  3GMI A;  3PUG A;  4B6X A;  3NZQ A;  1G73 A;  3DTO A;  3JC6 D;  4ZI3 C;  2D0T A;  2W61 A;  3L3P A;  4ZI3 D;  5LXT E;  1ZEE A;  3K8P C;  3P7I A;  3I0O A;  2H7O A;  4PFP A;  5JR9 A;  4NUV A;  4ZHQ E;  4IE7 A;  5IHY A;  3J9X 1;  3AAE B;  3D0T A;  2HPJ A;  3E22 E;  5DAB A;  4EYU A;  4NUU A;  3RC8 A;  2BDE A;  1NWM X;  3IEE A;  4GYR A;  3NBX X;  3HA4 A;  4FJO A;  3IBP A;  3LK3 B;  2A72 A;  2KLQ A;  4QXC B;  4IE5 A;  2B1E A;  4H63 H;  4E7Z A;  3FB2 A;  4ANJ A;  2SPC A;  1HCI A;  3DJB A;  3Q5W A;  4TX5 A;  4YJ3 E;  2LOS A;  4H9P C;  4JEU B;  2LSJ A;  4MBQ A;  4L9I A;  2CLY C;  3Q9D A;  4ZOL E;  3L09 A;  3ZJ1 A;  2W62 A;  1O3X A;  3N5L A;  5JDF A;  4UVC B;  4O4I E;  2XUE A;  4P09 A;  4JUY A;  5LG4 A;  5GON E;  1WYC A;  2RP4 A;  2WM9 A;  3MZK B;  4MHC A;  1D1C A;  1S35 A;  2KZ7 B;  3UUM A;  5LGT B;  2W0G A;  3Q5X A;  5HXR A;  3E0Z A;  1HFA A;  1E1H B;  1UCU A;  3I9W A;  4HE8 A;  2DHR A;  4ZI2 C;  2XTL A;  4QWN B;  2KWH A;  3RRC A;  2Z6E A;  3C64 A;  3SWH A;  4PAG A;  2VWA A;  3RKO A;  1MMA A;  4N78 D;  5L3B B;  3GA8 A;  4IE6 A;  4PW8 A;  3HKB E;  1US7 B;  3HR0 A;  2V7M A;  2LM9 A;  2V7L A;  2JJ9 A;  3CQG B;  2N1G A;  4UF0 A;  3B13 A;  5JRE A;  2KMF A;  4H9Q C;  5FNV E;  3UFE A;  4XBF B;  2JMK A;  2WMO A;  2WBL A;  3ZCJ A;  2KND A;  2NP9 A;  4IST A;  3EUH A;  2L3L A;  3ZYK A;  4CI1 B;  3VKH A;  3ZMV B;  2C5K T;  3UUX B;  2CM0 A;  3PDY A;  2XAS B;  5KDM C;  3I9Y A;  5JVD E;  5LBQ B;  5KMG P;  4MLK A;  3PU8 A;  5ETW A;  3PE0 A;  3S4U A;  3HKD E;  3LK2 B;  1FIO A;  2MOZ A;  4K0U A;  3WI3 A;  3KFW X;  1U4Q A;  3FBL A;  4V1A v;  5FYM A;  2Q9Q A;  4ZI7 E;  4H9O C;  4L0R A;  3K3O A;  2RA1 A;  4DND A;  5IYZ E;  3VHL A;  4UV9 B;  5HXS A;  2CLY B;  4UXN B;  2UXN B;  2X68 A;  2YU1 A;  4BAY B;  4PK5 A;  4AQF A;  3V5S A;  5CB4 E;  4CXY A;  3AAA B;  2VKO A;  5J1G A;  3MK7 C;  2WMN A;  3LBX B;  5DQV A;  4EB6 E;  4CXX A;  4OFZ A;  3B57 A;  4QX7 B;  2YIN A;  1IJ6 A;  5J2U E;  1NAF A;  1UX5 A;  4O8S A;  3GN5 A;  1MNE A;  1Z0P A;  5L3F B;  2CEA A;  3PUA A;  4AKG A;  3KDS E;  4O4L E;  1IZN B;  3V5U A;  4X1K E;  1OXZ A;  3HI2 A;  5H6R B;  2X9X A;  3RC3 A;  5J2T E;  3F31 A;  4AKH A;  2KXP B;  3EDU A;  2XAH B;  2LJL A;  3C98 B;  2EHO A;  2H7V C;  4F6R C;  3O1J A;  2J1D G;  3ETV A;  4PJN A;  4L5G A;  5LBM A;  3CX8 B;  4PNI A;  1B7T A;  3ANW A;  3PUQ A;  5EK4 A;  1WRD A;  3PUR A;  3MA9 A;  5JRC A;  2X66 A;  3Q2M A;  4HN9 A;  2E9X A;  4OK0 A;  2BVM A;  4QKN A;  4YFS A;  2V1D B;  4AKL A;  2PJQ A;  2V7I A;  4WBO A;  3JC6 C;  3PTR B;  5JDG A;  3LK4 2;  4QXH B;  4PJL A;  4PK4 A;  2JRK A;  4DMV A;  2Q9Q B;  5LGN B;  3ZEF B;  5JR9 C;  3O9X A;  5FY1 A;  2LHN A;  1KNZ A;  4ASK A;  4EOZ B;  3BQK A;  4DMW A;  4OYK A;  3ZMZ B;  4ZS3 A;  4GK0 E;  1AJ3 A;  2BVL A;  3LJC A;  4PJJ A;  3RYF E;  4BJN A;  3RH3 A;  3ZYL A;  4OHF A;  1HF8 A;  3N2O A;  3ZMT B;  2CXF A;  2ZMA A;  3VU7 H;  1MMN A;  3GWH A;  3A5X A;  2OA5 A;  3O1H A;  2X9Y A;  2LSK A;  5LJM A;  2IW5 B;  3ZLI A;  4C91 A;  2LHR A;  3I0Q A;  3RYI E;  3CVR A;  2JMH A;  2YEV C;  5C8Y E;  5JQG E;  5AFU L;  3C4Z A;  3AAI A;  3BQL A;  3FXD B;  2G0U A;  4CXW A;  3RPU A;  3H3A A;  2YK0 A;  4XZC A;  4P0A A;  3F57 A;  4GYS A;  1EZ3 A;  3NRX A;  4X1I E;  4GOU A;  2K48 A;  2ZM2 A;  5FXW A;  4CI2 B;  4EZH A;  3PU3 A;  2MTQ A;  1MMD A;  1FMV A;  3OYX A;  2JPF A;  3QK6 A;  4IDZ A;  3VKG A;  4I43 B;  3R84 B;  1V9D A;  4EZ4 A;  2I59 A;  2P9B A;  1HX8 A;  5DQW A;  4A56 A;  4WW0 A;  3OKQ A;  2ACX A;  3AVR A;  2ODU A;  4IE0 A;  2DCF A;  5H6Q B;  3UTK A;  2A2F X;  4WNK A;  4JLE A;  3UT5 E;  5LHG B;  1HS7 A;  1ZHC A;  3N9Q A;  2WAU A;  3AA7 B;  3SOL A;  1X79 A;  3AVS A;  2MYS A;  2CA5 A;  1S94 A;  2V7J A;  3MKD A;  2X0L B;  5L3D B;  2VB6 A;  2XAG B;  2L8K A;  2VKD A;  3KIN B;  4KP3 C;  5HXC A;  4IE4 A;  5JR9 B;  4UVB B;  3NZP A;  1WLX A;  5JDQ A;  3UUL A;  2K5B B;  2HH7 A;  3U78 A;  4XAX B;  5LP6 E;  3AA0 B;  3KVA A;  5LGU B;  5LHH B;  2Y48 B;  2JQQ A;  5L3E B;  4H9N C;  2VL8 A;  4PK6 A;  1H7C A;  2HPL A;  4GIW A;  4FI5 A;  3KV6 A;  1ZV4 X;  2GK9 A;  2Q9Q D;  2Q9Q C;  3O4X E;  4AKI A;  4KMC A;  2XQY A;  4AQG A;  5HYA A;  2Y6X A;  1MIY A;  2D2S A;  2ES0 A;  2DWG A;  4IIJ E;  2CXL A;  4X1Y E;  2LSG A;  2V7K A;  4UEM A;  4UIG A;  5TAO A;  1SA0 E;  4G63 A;  4DBR A;  3N2K E;  1MIW A;  1MND A;  2DWK A;  2D0U A;  5FY7 A;  1ZKE A;  2KIN B;  3AB3 B;  1Y64 B;  3F2E A;  4ZS2 A;  1VRB A;  3MXZ A;  3CQX C;  1BR2 A;  2X9H A;  1KK7 A;  2CCQ A;  2WSS V;  3SRZ A;  2W63 A;  4UEL A;  2NOX A;  3K3Q C;  4TN7 B;  2Y8D A;  5M4Y A;  2IAK A;  2XAF B;  2X67 A;  5A1L A;  3DP7 A;  2NTX A;  3ZC0 A;  2H3R A;  1UX4 A;  3ZPO A;  2BZB A;  4UVA B;  5LNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...