3ZJ2A

Structure of nab2p tandem zinc finger 34
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
GSVQTGIVLCKFGALCSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIKEVKPISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NUCLEAR POLYADENYLATED RNA-BINDING PROTEIN NAB2
publication title Two Singular Types of Ccch Tandem Zinc Finger in Nab2P Contribute to Polyadenosine RNA Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zj2A00
2LHNA 3ZJ2A 5L2LA 3ZJ1A
chains in the Genus database with same CATH superfamily
4HFBA 3FZKB 3MA9A 3PUAA 2X68A 1KEYA 2HH7A 3RIUA 3N2KE 2EHOD 4IDZA 3WI3A 4JEHB 5IYZE 4XAXB 3E08A 4YTNA 4QX8B 5HCMA 4Z8XA 3QK6A 2UXDT 1SHZC 2XPKA 4H63V 5DQVA 2Q9QC 4HFDA 4ZS2A 3UFEA 5FY1A 2W2UA 3VR8A 2OLTA 3GN5A 1T98A 1GQEA 3PUXF 3P4QA 4GKKT 2H3RA 2G0UA 3HA4A 4A56A 4YHHT 2CWOA 2D0TA 5ADXL 4DV4T 3RF1A 2IC6A 2Y48B 4DV0T 5ABGA 3UFGA 3K3QC 2CXLA 2WSSV 2WCAA 2C5JA 3RRWA 5AQOB 3E22E 4QH1A 4EYYR 2WDRA 4DR7T 2PTFA 1KNPA 2VURA 5LYJE 2CE7A 3V5SA 5FY7A 2LSIA 2WM9A 4QXCB 1VCTA 3AE4A 2X67A 3AVRA 1B7TA 2NOXA 4JI2T 4TX5A 4MALA 2X9XA 4TZ4C 3HR0A 3H37A 2MYSA 4CI1B 2LEHA 2VK9A 4YTPA 4DV2T 2ES0A 4PK6A 3NRYA 3L39A 3SFEA 3MZKB 1E1HB 5JQGE 4HFVA 4U2YA 3K8PC 3R84B 3UTKA 2VKJA 3P4RA 5KDMC 4B3MT 4IE5A 3MACA 3KVAA 3I0OA 3PUYF 4PAGA 2D5UA 3B57A 4TNVA 1BR2A 3AEBA 5FMNA 5CFBA 2N1GA 5FXVA 2XAJB 2DL1A 2WMOA 3NWIA 5LGUB 4G63A 4HFCA 3UULA 2CPTA 4A97A 3P50A 2OA5A 2V6YB 3Q9DA 3ZJ1A 2C5KT 3VHLA 2X9WA 3ZMUB 3UUXB 2ODVA 2MAWA 3AEGA 1OEDA 3CQGB 4F6RC 3UUMA 4B3RT 4EAHA 1DU2A 4HFHA 2XQAA 3ESLA 3N9NA 2H88A 5IWAT 4H9PC 4JLEA 4BAYB 3IBPA 4Z90A 4ILUA 2YU1A 3ANWA 4ZS3A 4BJNA 5AQLB 2WDVA 3PU3A 3RPUA 3LG7A 2UUCT 2YU2A 4X1YE 5L2LA 2K9AA 4JI7T 4IL4A 3CK6A 2M67A 2OV9A 3HKCE 4IDOA 4KP3C 2A9UA 1LVKA 2CBIA 3EABA 5FXZA 2WWUA 2VKHA 2IW5B 3ZT5A 4EYUA 2ZM0A 3KVBA 3CX7B 1ZEEA 2JQQA 4IL9A 4U74A 4IIJE 1IBKT 4TNWA 2JQ9A 4KI0F 4HWIB 2LLYA 1T72A 3GA8A 4KUMB 3SOLA 3RYFE 2FBWA 1Z0PA 2YDRA 1WR0A 4HKAA 4X65T 2BKNA 1HG2A 1KF6A 3N9LA 3FBZA 4PJNA 4EGWA 3LK2B 1LKXA 4KBMB 4LF9T 1W0BA 3KV6A 3ZSTA 5JR9B 4ZXLA 4ZZBA 2QGSA 3V5UA 3HKBE 5AQFB 2XSBA 3HL6A 4WBOA 1HS7A 5AQNB 1Y01A 1IJ5A 5HCJA 1NWMX 4TWFA 4IE7A 2ZM8A 5EK3A 1U5PA 3OYZA 5AQJB 3HKDE 4L9IA 2IHR1 2JJ9A 4LFBT 2K3WA 4P0BA 5LG3A 3UQ7A 3U3IA 1SE7A 4ILAA 5LXTE 2WU5A 2XUEA 3C50A 2KWIB 3CX8B 4H9RC 4AQYT 1YKHB 4DV3T 2V7LA 3O1HA 2BS3A 3ZCJA 3ZYMA 4FJOA 4XBFB 1JNZA 1IBLT 3CQXC 1HTJF 1WRDA 5AQIB 4HTEA 4EIWA 2KSRA 2DCFA 1ZHCA 3ZN1B 4CN1A 2MTQA 5ABHA 2UUBT 2XAQB 4X66T 2BDEA 3LK42 5AQKB 1J5ET 4X1KE 4LMKA 4ZZCA 4EZHA 2V7IA 1W9RA 2B1EA 2Z6EA 3N9PA 4F8HA 4ZI2D 2NTYA 3B13A 4DBQA 4YSXA 2IDOB 2F4VT 3NZPA 5LP6E 3AE6A 4CN4A 2BVLA 4CXXA 4Q25A 5IHYA 3ZMZB 2BG9B 3PV0F 2DI4A 4ISTA 4IREA 2LRKA 4H9QC 4JEUB 1IAPA 3JC6C 2IUBA 3N2OA 1ZV4X 2HN2A 1HNXT 2CWYA 4UF0B 3OPCA 4JI3T 4CI2B 5L3GB 3AA6B 1QSDA 4H9SE 2XQ6A 1NAFA 2UXCT 2YOEA 2VKDA 5IUXA 2VQET 4H63H 3C51A 5HEGA 2CLYB 1KNZA 4J2CA 5AQGB 3FZHB 5JDGA 5J2UE 1KFYA 4YLHA 5HXHA 4AI6A 1SA0E 3Q5XA 4DV5T 3TLVA 3ZC0A 3NZQA 2Q9QB 4X1IE 5HYAA 5CA0E 2WZIA 2DLRA 4YHJA 4LMLA 4IDQA 3O9XA 4QH5A 1XNRT 3RX6A 2V26A 2KZ7B 2E9XD 1MMAA 3T8OA 4LFCT 5L3CB 2XQ9A 4DV7T 5FL1A 2ACXA 3AEEA 5FVLA 5L3FB 4EZ4A 4YY3T 5CB4E 1S35A 3AECA 2MPKA 4ZOLE 4ADZA 5L3DB 3O1JA 3LJCA 2D2SA 4ERRA 3AEFA 3HKEE 3AE5A 3N9QA 2LM2A 5L3EB 2YDSA 3ZN0B 1I6ZA 3P8CD 3ZMSB 4AKHA 3RRCA 4JI1T 2MOZA 4I50E 5C2TA 1ZOYA 2J47A 5JDFA 2SPCA 4ZI3D 2W4XA 2H7VC 4AQFA 3AA1B 3AVSA 5DABA 2YK0A 2BZBA 3IHRA 4XZCA 2WQYA 1SUMB 3W15B 4U7YA 5JH7E 2E9XA 4TWHA 4HWFA 2JQKA 2A2FX 3ZPOA 2NTXA 2BKOA 1X9BA 2BBHA 3KFWX 3SRZA 2XM2A 3RC8A 4P0AA 1OWAA 3CKDA 4EXTA 4B3ST 3LSVA 2VL0A 2XQ8A 3OTOT 4OK0A 5LHHB 4OFZA 3KV9A 2E5VA 4PFPA 2EHOA 4UVBB 4X20E 1H7CA 3C4XA 3P4WA 4ILCA 4WW0A 3AE9A 3ZLIA 5ABFB 2LSGA 5AQUB 4HE8A 2Q9QD 3FB2A 5F8PA 4K0KT 3PUGA 5AQHB 1MNEA 3ZJ2A 3D0TA 5JRCB 5HWYA 5L4EA 2RP4A 3QB5K 5CA1E 3ZSSA 4CQIA 4PJJA 5LHIB 3K3OA 2V7KA 3A7MA 2E8IA 4ZEYA 1D1AA 3FXDB 4KMCA 4CI3B 3RH3A 4IDPA 2M6BA 4DVDA 3BQKA 1FEWA 3KINB 3ZYLA 4GOUA 5JDLA 3Q5WA 4PJLA 4MFRA 3OVUA 4UF0A 4TV9E 3RYIE 5LMNT 2QRXA 4QHOA 1N36T 4DIDB 4DR2T 2JQHA 2K5BB 3AXJB 3DTOA 2X0YA 3GMIA 3ZMTB 1HG5A 5FXXA 1CUNA 3I0QA 3RLFF 1WLXA 3Q5EA 5M4YA 3K1SA 4H9OC 2Q9QA 4NIQA 1D0YA 5JDQA 3FZLB 2FJAA 4HWHA 4AKGA 4LFAT 5LGNB 2W63A 1G8XA 3EDUA 2WS3A 1UGOA 4GKJT 4FI5A 2CEAA 1FMVA 1X79A 3P4PA 2KT9A 4DR3T 1XNQT 2A72A 4U2ZA 2DNXA 4NUVA 1XMQT 4E7ZA 4X5TA 2IAKA 3X1DA 4DR1T 1W0AA 2Y8DA 2N9DA 2D0UA 2D9DA 2PBIA 2QYWA 3F57A 2V7MA 1YW0A 2CMRA 4YJ2E 1HCIA 3LBXB 4N78D 1M62A 2MBGA 3ONLC 5HXEA 1G73A 4WYVA 4IDNA 1XWMA 5HXCA 2CA5A 5J2TE 5LGTB 1FJGT 4HFEA 5LMUT 4Z91A 2BKPA 5LHGB 1VCSA 5CGMA 3CIRA 4HN9A 3FZFB 4I43B 3B5MA 4P09A 3BK9A 5L4HA 3PJAA 4MHCA 2W00A 4UVAB 4U3CA 5L3BB 3IF8B 5A1LA 4PNIA 2JMHA 2Y6XA 1VRBA 5HAXA 3AAIA 5JTGA 2FJEA 5HWXA 2WY2A 1JNRA 2CM0A 1T8BA 2W66A 4DV1T 3J9X1 2XQYA 3KV5A 4NPPA 2WB5A 2FJDA 4LF6T 4IE0A 4DBRA 2AE9A 2J1DG 2JPFA 4DNDA 3ZKRA 2X9HA 4CN6A 1XZYA 4QH4A 3T1YT 1BR1A 2VQFT 3QUJA 3TLTA 2WAUA 2V5DA 2WDQA 1QLBA 3TLUA 3EDVA 3N5LA 2XAFB 5E0OA 4PK5A 1L0VA 4DV6T 5JREA 2UU9T 3BQIA 2LHNA 3VU7H 1WCRA 2KWHA 4UV8B 2NP9A 3AE3A 3UU4A 2NR4A 4YXDA 5ABFA 2I0MA 2KLQA 1WYBA 2PFVA 4ZI7E 2C0SA 4B3TT 1VOMA 2VKOA 4AIUA 4UEMA 3RIUC 1YQ4A 2LKGA 2NW8A 3QOFA 2UUAT 5JRCA 2BG9E 1D1CA 3WAJA 3ONJA 2YEVC 1YQ3A 2XAHB 4UV9B 3VKHA 3MKDA 2V6YA 2VASA 4AQFC 2IIUA 3LFMA 5HEUA 5J1GA 1US7B 3FHNA 4EEBA 2XQ4A 3C4ZA 5FXWA 3GWHA 4CXYA 3ZT7A 3QNUA 4G2AA 2JMKA 1NEKA 2NWBA 2E9XC 3SFDA 4OX9T 5FVKA 5BMVE 2VWAA 1E2AA 4QX7B 4EEDA 4JI6T 3K3NA 2X9YA 3PU8A 5KX5E 1O3XA 2W0GA 4U7IA 4U31A 3CVRA 2CXDA 3AXJA 3BQLA 2WZHA 4YSYA 3MK7C 3CMLA 4C91A 2V7JA 4AKLA 3RQUA 1M7KA 1MIYA 2KMFA 3N9MA 2IMLA 3JAEA 2WP9A 4M1PA 2EHOC 1UX5A 3PJAJ 2XHEB 5FL0A 2NW9A 1MNDA 3DP7A 4A5XA 3Q5DA 4KHPT 3M65A 4WZXA 3I1AA 3IEEA 3L09A 3TLWA 1E7PA 3NBXX 1HNWT 5EZYE 4BJMA 4AKRB 3H3MA 3HI2A 4GK0E 2CBJA 1V9DA 3VR9A 4DO0A 2ZM2A 2ODUA 5EK2A 1MMGA 4CXWA 4NUUA 3I9WA 1ZKEA 3EHZA 2LSKA 3J7Yq 3O1IA 5GONE 3EAMA 3LDQB 4DMWA 3SS1A 3JC6D 1HX8A 3CPZA 1OEDC 2HHHT 4UELA 5JR9A 5LBMA 2W61A 4HWCA 2K24A 4QXHB 3NKZA 3N9OA 3L3PA 3RYCE 1D0XA 3UT5E 4YFSA 2FUPA 2WBLA 1QUUA 4AISA 4U33A 1N33T 1UK5A 2CLYC 2PJQA 2FJBA 1XDOA 3I9YA 2X0HA 4KX6A 1N32T 1AJ3A 5FKYA 5KMGP 2XZEA 4JUYA 2ZM6T 4JV5T 2LSJA 5H6QB 4B6XA 5EK4A 3SWHA 4O2BE 3RKGA 1MIWA 1Y64B 5AFUL 3L8RA 3U78A 2C5IT 2LKHA 2AXDS 2XQ7A 3ZMVB 3ZC1A 2L9QA 5H6RB 5LJNA 4IE4A 2UXNB 5HEOA 4K0UA 4JI5T 3AAEB 2K48A 4JBWF 4PK4A 2QA7A 3F31A 2NW7A 2HPLA 4O4JE 3UUBA 3UU8A 5LB7B 2I59A 3EVYA 5JDNA 3OKQA 3ZEFB 1N34T 3JCFA 1EZ3A 3UU3A 3OYXA 1WYCA 4EV6A 3NVOA 3FBLA 3WAKA 2R6GF 3EUHA 3VRBA 3M3ZB 4BA9A 2M6IA 3TKLB 1Z8UA 3CQCB 4AXPA 2JIWA 3OBVE 1XMOT 2XJ7A 3ETVA 1MMDA 3RIAA 3PDYA 1UURA 3NRXA 2WU2A 2BG9A 2X66A 4WNKA 1MMNA 1J5WA 4OYKA 2E5LT 5JDHA 4V1Av 1W09A 3UU6A 2HN1A 3JADA 3ONXA 3C4WA 1S94A 1UCUA 3RQWA 5FNVE 1T7SA 5LBQB 4GYSA 4O4IE 5C8YE 1WFDA 3RIFA 3RYHE 3AB3B 2YKSA 5HXRA 2YINA 3VRAA 3F2EA 4UIGA 4H9NC 4CZZB 1HR0T 2BVMA 1U4QA 1LRZA 5HEJA 4HEAA 2X0LB 3FZMB 1HNZT 2JRKA 4TV8E 3PUZF 5FY0A 4I0UA 5DQWA 2BS2A 3JAFA 4DMVA 5TAOA 1KNRA 4ISSA 5AQPB 2DHRA 4HGAA 5AQVB 3UUNA 2B76A 2RA1A 3LK3B 3ETUA 3T1HT 4TUYE 3ZCIA 1BR0A 2GK9A 4QXBB 1YD8G 5LJMA 2RPAA 2H7OA 2PG8A 5AQMB 4LF5T 3AA7B 2W67A 4E7SA 2CRBA 3AE7A 3CX6B 2J4GA 4O2AE 1KK7A 2LRLA 5FYMA 1D1BA 2CCQA 2E2AA 4X62T 3RC3A 4I4TE 5AQTB 2LE8A 2LOSA 2J62A 2ACZA 4ASKA 2BBJA 4EOZB 2V8SV 4YT0A 3KBUA 1R8IA 3PE0A 3RHWA 4YJ3E 3P7IA 4O8SA 4O4LE 4JYAT 4IT4A 5HXSA 4JI4T 3OJAA 3Q2MA 4X64T 4LF4T 1IJ6A 4ZI2C 4C90A 3GN5B 4YSZA 5LG4A 4MLKA 3C98B 2DWGA 2XM1A 1YKEB 3AEDA 3EI0A 2X51A 2VL8A 1D0ZA 2VB6A 3S4UA 4IE6A 2KINB 1UUSA 2V5CA 4I55E 4NXMT 2E9XB 4DUYT 4P1NA 4EB6E 3ZYKA 3C64A 4HFIA 2YN6A 2LT3A 2CHOA 2V6XA 3KBTA 5FP3A 3AE8A 1IBMT 2YDQA 4L0RA 3H3AA 2H89A 2L3LA 2VVNA 4ANJA 4DR5T 1I94T 5JR9C 1IZNB 1YXRA 2XSAA 5J0ZA 3VKGA 3QB5A 5LOVE 2I6HA 2A3DA 2KXPB 2QVAA 2XAGB 4OYJA 3UQ4A 2WMNA 5JVDE 3UU5A 2EHOB 4AQGA 1CHUA 4PFOA 3PUQA 3ZT6A 4OHFA 1WR6A 4PJMA 5LA6E 2XY8B 4ILBA 4QWNB 2P9BA 3A8YC 1FIOA 1LVFA 3P4SA 1HX1B 4QKNA 4KHZF 2UXXB 4A98A 4UXNB 1OEDE 4ZHQE 3MXZA 1XDPA 5BR8T 3QC9A 4AKIA 2XASB 2LSYA 3A5XA 3G06A 3KDSE 3AE1A 2LJLA 4COFA 4UR9A 2L8KA 5AQRB 4GYRA 3IA3A 2CHNA 4DR4T 3N2GE 5F3JA 4HWDA 2N2NA 4DUZT 2DWKA 4GK5E 3RI5A 5ETWA 2LOPA 1BR4A 3PUVF 4MBQA 3MJXA 2UXBT 2WWVA 4TN7B 2XTLA 2VVSA 1UX4A 4LF7T 4LF8T 1OEDB 2XQ3A 5LNKA 1FMWA 4O4HE 4JI0T 4JI8T 2LHRA 4PW8A 4UVCB 4NXNT 3DJBA 3R6NA 3AEAA 5C3JA 5JDMA 1NENA 3CWZB 3ANWB 5KXJA 2IC9A 4U72A 3RGLA 1MIVA 5F5WA 2W62A 3PUSA 3FXEB 4ZI3C 5AQSB 2CXFA 5HEHA 4YTMA 3O4XE 1J1JA 4GIWA 5ABEA 4LMJA 3AA0B 3TLSA 3ABVA 3AE2A 3PUWF 3KV4A 3PTRB 2BS4A 5CJ5A 3LBXA 3RKOA 4WBNE 2XQ5A 3PURA 2HPJA 3AAAB 5LCYA 2BG9C 1HF8A 2V1DB 4TWDA 4DR6T 2ZLYA 5DJQC 5L47A 4L5GA 2KNDA 1HFAA 4IGUA 4IHJE 1OXZA 2LM9A 1ZP0A 3E0ZA 5AQQB 2ZMAA
chains in the Genus database with same CATH topology
2CA5A 3OBVE 5J2TE 3B13A 5LGTB 3ETVA 5LHGB 4DBQA 1MMDA 3PDYA 3NRXA 3MA9A 3PUAA 3NZPA 2X68A 5LP6E 4HN9A 4I43B 2HH7A 2X66A 4WNKA 4P09A 3BK9A 1MMNA 3N2KE 2BVLA 4OYKA 2EHOD 4IDZA 4MHCA 3WI3A 2W00A 4UVAB 4JEHB 5IYZE 5JDHA 4CXXA 4V1Av 4XAXB 3E08A 5L3BB 3IF8B 5A1LA 4QX8B 4PNIA 5IHYA 3ZMZB 2JMHA 2Y6XA 4Z8XA 3QK6A 1VRBA 5HAXA 3AAIA 5HWXA 1SHZC 3ONXA 2CM0A 3C4WA 2DI4A 4H63V 5DQVA 4ISTA 1S94A 3J9X1 2Q9QC 4ZS2A 3UFEA 5FY1A 2XQYA 1UCUA 3GN5A 3KV5A 1T98A 4H9QC 4JEUB 5FNVE 1IAPA 3JC6C 3N2OA 1ZV4X 2H3RA 2G0UA 5LBQB 2CWYA 4UF0B 4GYSA 3HA4A 4O4IE 4A56A 4CI2B 2CWOA 4IE0A 5L3GB 3AA6B 2D0TA 4DBRA 5C8YE 5ADXL 2J1DG 2IC6A 2Y48B 2JPFA 4DNDA 3RYHE 1QSDA 4H9SE 1NAFA 3AB3B 5HXRA 2X9HA 3K3QC 2VKDA 2CXLA 2WSSV 2YINA 4H63H 3C51A 1KNZA 2CLYB 4J2CA 1BR1A 5JDGA 5J2UE 4YLHA 3F2EA 4UIGA 5HXHA 4AI6A 4H9NC 3QUJA 4CZZB 2C5JA 3RRWA 2WAUA 1SA0E 2BVMA 3E22E 3Q5XA 1U4QA 4EYYR 1LRZA 4HEAA 2X0LB 3EDVA 3N5LA 2XAFB 5E0OA 4PK5A 3ZC0A 2JRKA 5JREA 3NZQA 4TV8E 3BQIA 2Q9QB 5FY0A 4X1IE 5HYAA 5CA0E 2LHNA 5LYJE 2CE7A 3V5SA 2DLRA 5FY7A 2LSIA 2WM9A 4QXCB 4YHJA 5DQWA 3VU7H 3O9XA 2KWHA 2X67A 3AVRA 1B7TA 2NOXA 4UV8B 3RX6A 2NP9A 4DMVA 4TX5A 2V26A 2KZ7B 4MALA 2X9XA 4TZ4C 2E9XD 3HR0A 4ISSA 3H37A 1MMAA 2MYSA 5TAOA 3T8OA 5L3CB 4CI1B 2DHRA 2LEHA 2VK9A 4HGAA 3UUNA 2RA1A 2ACXA 3ETUA 3LK3B 2KLQA 1WYBA 2PFVA 4ZI7E 2C0SA 2ES0A 4TUYE 4PK6A 1VOMA 3NRYA 2VKOA 3MZKB 4UEMA 1E1HB 3ZCIA 4HFVA 5JQGE 1BR0A 2GK9A 3K8PC 5L3FB 3R84B 3UTKA 4EZ4A 2VKJA 1YD8G 4QXBB 2NW8A 5LJMA 5KDMC 5JRCA 5CB4E 4IE5A 2H7OA 1D1CA 2PG8A 3MACA 1S35A 3KVAA 3I0OA 4PAGA 3WAJA 2YEVC 4ZOLE 4ADZA 2D5UA 2XAHB 3AA7B 4UV9B 3B57A 1BR2A 5L3DB 3VKHA 3MKDA 5FMNA 2VASA 4AQFC 3O1JA 3LJCA 2D2SA 4E7SA 4ERRA 3LFMA 2N1GA 3CX6B 5J1GA 5FXVA 2XAJB 1US7B 3HKEE 3FHNA 3C4ZA 4O2AE 1KK7A 2WMOA 3N9QA 5LGUB 4G63A 5FXWA 5L3EB 5FYMA 3UULA 1D1BA 2CCQA 3ZN0B 3RC3A 3GWHA 4I4TE 4CXYA 2OA5A 2LE8A 2LOSA 3P8CD 3ZMSB 4AKHA 3RRCA 2MOZA 4G2AA 4I50E 2JMKA 4ASKA 5JDFA 2NWBA 2E9XC 4EOZB 3Q9DA 2SPCA 4ZI3D 3ZJ1A 2C5KT 3VHLA 5BMVE 2X9WA 3ZMUB 3UUXB 2VWAA 2ODVA 3KBUA 2H7VC 3PE0A 4QX7B 4AQFA 4YJ3E 3P7IA 3AA1B 3CQGB 3K3NA 4O8SA 2X9YA 4F6RC 4O4LE 3PU8A 3UUMA 3AVSA 1O3XA 5DABA 5HXSA 5KX5E 2W0GA 3OJAA 2YK0A 3Q2MA 2BZBA 4EAHA 3CVRA 2CXDA 3IHRA 4XZCA 3BQLA 1IJ6A 3ESLA 4ZI2C 4C90A 3N9NA 3GN5B 3MK7C 3CMLA 3W15B 4C91A 2V7JA 4AKLA 5LG4A 4H9PC 4JLEA 5JH7E 4BAYB 2E9XA 1MIYA 3IBPA 2KMFA 4ILUA 4MLKA 3C98B 3ANWA 2YU1A 2DWGA 3N9MA 4ZS3A 1YKEB 2A2FX 4BJNA 3PU3A 3ZPOA 3RPUA 3LG7A 2X51A 2VL8A 2YU2A 1D0ZA 2VB6A 2NTXA 3S4UA 4IE6A 2KINB 4X1YE 5L2LA 2K9AA 4M1PA 4I55E 2E9XB 2EHOC 1UX5A 3KFWX 2M67A 2XHEB 3HKCE 4EB6E 3ZYKA 3C64A 2NW9A 3SRZA 4KP3C 1MNDA 2LT3A 3RC8A 3DP7A 4P0AA 1OWAA 3CKDA 4EXTA 1LVKA 3KBTA 5FP3A 3M65A 5FXZA 3I1AA 2WWUA 3IEEA 2VKHA 2IW5B 4L0RA 3H3AA 3L09A 4EYUA 2ZM0A 4OK0A 2L3LA 5LHHB 4ANJA 3NBXX 3KVBA 3CX7B 1ZEEA 4OFZA 1IZNB 3KV9A 5EZYE 2JQQA 5JR9C 4BJMA 4U74A 4AKRB 3VKGA 4PFPA 4IIJE 2EHOA 4UVBB 5LOVE 3HI2A 4GK0E 4X20E 1V9DA 4DO0A 2ZM2A 1H7CA 2A3DA 2KXPB 2ODUA 2XAGB 3C4XA 5EK2A 4OYJA 1MMGA 4WW0A 2WMNA 4CXWA 5JVDE 3GA8A 4NUUA 3ZLIA 3I9WA 1ZKEA 2LSGA 4KUMB 3SOLA 3RYFE 4HE8A 2LSKA 2Q9QD 3J7Yq 2EHOB 4AQGA 4PFOA 3O1IA 3FB2A 3PUQA 1Z0PA 5GONE 5F8PA 3PUGA 4DMWA 3SS1A 3JC6D 1MNEA 1HX8A 3CPZA 4OHFA 1WR6A 3D0TA 3ZJ2A 4HKAA 4UELA 5JR9A 4PJMA 5JRCB 5LBMA 5HWYA 2W61A 5LA6E 1HG2A 3N9LA 4QWNB 2P9BA 3FBZA 1FIOA 1LVFA 4PJNA 2K24A 4QKNA 3LK2B 2RP4A 2UXXB 1LKXA 4UXNB 4KBMB 5CA1E 4ZHQE 3MXZA 4CQIA 4PJJA 4QXHB 5LHIB 4AKIA 3QC9A 2XASB 2LSYA 3A5XA 3KDSE 3K3OA 3KV6A 5JR9B 3N9OA 2V7KA 2LJLA 3L3PA 3RYCE 1D0XA 3UT5E 4YFSA 2E8IA 2QGSA 2L8KA 1D1AA 3V5UA 2WBLA 3FXDB 1QUUA 4GYRA 4KMCA 4CI3B 3HKBE 3RH3A 2CLYC 3N2GE 5F3JA 2PJQA 2N2NA 2DWKA 4GK5E 4DVDA 3BQKA 1FEWA 5ETWA 3HL6A 2LOPA 1BR4A 3KINB 4WBOA 1HS7A 3ZYLA 3I9YA 4MBQA 4GOUA 3MJXA 5JDLA 3Q5WA 4PJLA 4MFRA 1IJ5A 1AJ3A 4TN7B 4UF0A 1NWMX 2XTLA 4IE7A 1UX4A 5KMGP 2ZM8A 5EK3A 4JUYA 5LNKA 1FMWA 1U5PA 4O4HE 3OYZA 2LSJA 4TV9E 5H6QB 3RYIE 3HKDE 4L9IA 4B6XA 2LHRA 4QHOA 5EK4A 4PW8A 2K5BB 2JJ9A 3SWHA 4UVCB 3DTOA 3GMIA 3ZMTB 1HG5A 3DJBA 5FXXA 3R6NA 1CUNA 3I0QA 4O2BE 5JDMA 4P0BA 1WLXA 1MIWA 1Y64B 5AFUL 3CWZB 3ANWB 3U3IA 3U78A 5LXTE 2C5IT 2IC9A 4U72A 5M4YA 2XUEA 1MIVA 3ZMVB 3C50A 2KWIB 3CX8B 4H9OC 2W62A 2Q9QA 3FXEB 3PUSA 2L9QA 4ZI3C 3ZC1A 5H6RB 1D0YA 5JDQA 5LJNA 4H9RC 2CXFA 4AKGA 4IE4A 3O4XE 5LGNB 2UXNB 1G8XA 1YKHB 2W63A 3EDUA 4GIWA 4K0UA 3AAEB 2K48A 3AA0B 2V7LA 4FI5A 3O1HA 2QA7A 4PK4A 3F31A 2NW7A 2HPLA 4O4JE 2CEAA 1FMVA 1X79A 3ZCJA 3ZYMA 2I59A 4FJOA 4XBFB 3EVYA 5JDNA 3KV4A 3OKQA 2KT9A 3CQXC 1HTJF 3ZEFB 1WRDA 2A72A 3PTRB 4HTEA 4EIWA 2DNXA 1EZ3A 4NUVA 2DCFA 1ZHCA 3OYXA 1WYCA 3ZN1B 3LBXA 3RKOA 4WBNE 4E7ZA 3PURA 2HPJA 3AAAB 3FBLA 2IAKA 5LCYA 1HF8A 2MTQA 2V1DB 3WAKA 2Y8DA 2XAQB 2N9DA 2BDEA 3LK42 2D0UA 2ZLYA 2PBIA 4X1KE 5DJQC 3F57A 3EUHA 4EZHA 2V7IA 2V7MA 4L5GA 1YW0A 2CMRA 4YJ2E 2B1EA 1HCIA 2Z6EA 3LBXB 4N78D 2KNDA 1HFAA 3N9PA 4IGUA 4IHJE 2MBGA 4BA9A 1OXZA 5HXEA 2LM9A 1G73A 3TKLB 4ZI2D 2NTYA 3E0ZA 2ZMAA 3CQCB 4AXPA 5HXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHN A;  3ZJ2 A;  5L2L A;  3ZJ1 A; 
#chains in the Genus database with same CATH topology
 4HFB A;  3FZK B;  3MA9 A;  3PUA A;  2X68 A;  1KEY A;  2HH7 A;  3RIU A;  3N2K E;  2EHO D;  4IDZ A;  3WI3 A;  4JEH B;  5IYZ E;  4XAX B;  3E08 A;  4YTN A;  4QX8 B;  5HCM A;  4Z8X A;  3QK6 A;  2UXD T;  1SHZ C;  2XPK A;  4H63 V;  5DQV A;  2Q9Q C;  4HFD A;  4ZS2 A;  3UFE A;  5FY1 A;  2W2U A;  3VR8 A;  2OLT A;  3GN5 A;  1T98 A;  1GQE A;  3PUX F;  3P4Q A;  4GKK T;  2H3R A;  2G0U A;  3HA4 A;  4A56 A;  4YHH T;  2CWO A;  2D0T A;  5ADX L;  4DV4 T;  3RF1 A;  2IC6 A;  2Y48 B;  4DV0 T;  5ABG A;  3UFG A;  3K3Q C;  2CXL A;  2WSS V;  2WCA A;  2C5J A;  3RRW A;  5AQO B;  3E22 E;  4QH1 A;  4EYY R;  2WDR A;  4DR7 T;  2PTF A;  1KNP A;  2VUR A;  5LYJ E;  2CE7 A;  3V5S A;  5FY7 A;  2LSI A;  2WM9 A;  4QXC B;  1VCT A;  3AE4 A;  2X67 A;  3AVR A;  1B7T A;  2NOX A;  4JI2 T;  4TX5 A;  4MAL A;  2X9X A;  4TZ4 C;  3HR0 A;  3H37 A;  2MYS A;  4CI1 B;  2LEH A;  2VK9 A;  4YTP A;  4DV2 T;  2ES0 A;  4PK6 A;  3NRY A;  3L39 A;  3SFE A;  3MZK B;  1E1H B;  5JQG E;  4HFV A;  4U2Y A;  3K8P C;  3R84 B;  3UTK A;  2VKJ A;  3P4R A;  5KDM C;  4B3M T;  4IE5 A;  3MAC A;  3KVA A;  3I0O A;  3PUY F;  4PAG A;  2D5U A;  3B57 A;  4TNV A;  1BR2 A;  3AEB A;  5FMN A;  5CFB A;  2N1G A;  5FXV A;  2XAJ B;  2DL1 A;  2WMO A;  3NWI A;  5LGU B;  4G63 A;  4HFC A;  3UUL A;  2CPT A;  4A97 A;  3P50 A;  2OA5 A;  2V6Y B;  3Q9D A;  3ZJ1 A;  2C5K T;  3VHL A;  2X9W A;  3ZMU B;  3UUX B;  2ODV A;  2MAW A;  3AEG A;  1OED A;  3CQG B;  4F6R C;  3UUM A;  4B3R T;  4EAH A;  1DU2 A;  4HFH A;  2XQA A;  3ESL A;  3N9N A;  2H88 A;  5IWA T;  4H9P C;  4JLE A;  4BAY B;  3IBP A;  4Z90 A;  4ILU A;  2YU1 A;  3ANW A;  4ZS3 A;  4BJN A;  5AQL B;  2WDV A;  3PU3 A;  3RPU A;  3LG7 A;  2UUC T;  2YU2 A;  4X1Y E;  5L2L A;  2K9A A;  4JI7 T;  4IL4 A;  3CK6 A;  2M67 A;  2OV9 A;  3HKC E;  4IDO A;  4KP3 C;  2A9U A;  1LVK A;  2CBI A;  3EAB A;  5FXZ A;  2WWU A;  2VKH A;  2IW5 B;  3ZT5 A;  4EYU A;  2ZM0 A;  3KVB A;  3CX7 B;  1ZEE A;  2JQQ A;  4IL9 A;  4U74 A;  4IIJ E;  1IBK T;  4TNW A;  2JQ9 A;  4KI0 F;  4HWI B;  2LLY A;  1T72 A;  3GA8 A;  4KUM B;  3SOL A;  3RYF E;  2FBW A;  1Z0P A;  2YDR A;  1WR0 A;  4HKA A;  4X65 T;  2BKN A;  1HG2 A;  1KF6 A;  3N9L A;  3FBZ A;  4PJN A;  4EGW A;  3LK2 B;  1LKX A;  4KBM B;  4LF9 T;  1W0B A;  3KV6 A;  3ZST A;  5JR9 B;  4ZXL A;  4ZZB A;  2QGS A;  3V5U A;  3HKB E;  5AQF B;  2XSB A;  3HL6 A;  4WBO A;  1HS7 A;  5AQN B;  1Y01 A;  1IJ5 A;  5HCJ A;  1NWM X;  4TWF A;  4IE7 A;  2ZM8 A;  5EK3 A;  1U5P A;  3OYZ A;  5AQJ B;  3HKD E;  4L9I A;  2IHR 1;  2JJ9 A;  4LFB T;  2K3W A;  4P0B A;  5LG3 A;  3UQ7 A;  3U3I A;  1SE7 A;  4ILA A;  5LXT E;  2WU5 A;  2XUE A;  3C50 A;  2KWI B;  3CX8 B;  4H9R C;  4AQY T;  1YKH B;  4DV3 T;  2V7L A;  3O1H A;  2BS3 A;  3ZCJ A;  3ZYM A;  4FJO A;  4XBF B;  1JNZ A;  1IBL T;  3CQX C;  1HTJ F;  1WRD A;  5AQI B;  4HTE A;  4EIW A;  2KSR A;  2DCF A;  1ZHC A;  3ZN1 B;  4CN1 A;  2MTQ A;  5ABH A;  2UUB T;  2XAQ B;  4X66 T;  2BDE A;  3LK4 2;  5AQK B;  1J5E T;  4X1K E;  4LMK A;  4ZZC A;  4EZH A;  2V7I A;  1W9R A;  2B1E A;  2Z6E A;  3N9P A;  4F8H A;  4ZI2 D;  2NTY A;  3B13 A;  4DBQ A;  4YSX A;  2IDO B;  2F4V T;  3NZP A;  5LP6 E;  3AE6 A;  4CN4 A;  2BVL A;  4CXX A;  4Q25 A;  5IHY A;  3ZMZ B;  2BG9 B;  3PV0 F;  2DI4 A;  4IST A;  4IRE A;  2LRK A;  4H9Q C;  4JEU B;  1IAP A;  3JC6 C;  2IUB A;  3N2O A;  1ZV4 X;  2HN2 A;  1HNX T;  2CWY A;  4UF0 B;  3OPC A;  4JI3 T;  4CI2 B;  5L3G B;  3AA6 B;  1QSD A;  4H9S E;  2XQ6 A;  1NAF A;  2UXC T;  2YOE A;  2VKD A;  5IUX A;  2VQE T;  4H63 H;  3C51 A;  5HEG A;  2CLY B;  1KNZ A;  4J2C A;  5AQG B;  3FZH B;  5JDG A;  5J2U E;  1KFY A;  4YLH A;  5HXH A;  4AI6 A;  1SA0 E;  3Q5X A;  4DV5 T;  3TLV A;  3ZC0 A;  3NZQ A;  2Q9Q B;  4X1I E;  5HYA A;  5CA0 E;  2WZI A;  2DLR A;  4YHJ A;  4LML A;  4IDQ A;  3O9X A;  4QH5 A;  1XNR T;  3RX6 A;  2V26 A;  2KZ7 B;  2E9X D;  1MMA A;  3T8O A;  4LFC T;  5L3C B;  2XQ9 A;  4DV7 T;  5FL1 A;  2ACX A;  3AEE A;  5FVL A;  5L3F B;  4EZ4 A;  4YY3 T;  5CB4 E;  1S35 A;  3AEC A;  2MPK A;  4ZOL E;  4ADZ A;  5L3D B;  3O1J A;  3LJC A;  2D2S A;  4ERR A;  3AEF A;  3HKE E;  3AE5 A;  3N9Q A;  2LM2 A;  5L3E B;  2YDS A;  3ZN0 B;  1I6Z A;  3P8C D;  3ZMS B;  4AKH A;  3RRC A;  4JI1 T;  2MOZ A;  4I50 E;  5C2T A;  1ZOY A;  2J47 A;  5JDF A;  2SPC A;  4ZI3 D;  2W4X A;  2H7V C;  4AQF A;  3AA1 B;  3AVS A;  5DAB A;  2YK0 A;  2BZB A;  3IHR A;  4XZC A;  2WQY A;  1SUM B;  3W15 B;  4U7Y A;  5JH7 E;  2E9X A;  4TWH A;  4HWF A;  2JQK A;  2A2F X;  3ZPO A;  2NTX A;  2BKO A;  1X9B A;  2BBH A;  3KFW X;  3SRZ A;  2XM2 A;  3RC8 A;  4P0A A;  1OWA A;  3CKD A;  4EXT A;  4B3S T;  3LSV A;  2VL0 A;  2XQ8 A;  3OTO T;  4OK0 A;  5LHH B;  4OFZ A;  3KV9 A;  2E5V A;  4PFP A;  2EHO A;  4UVB B;  4X20 E;  1H7C A;  3C4X A;  3P4W A;  4ILC A;  4WW0 A;  3AE9 A;  3ZLI A;  5ABF B;  2LSG A;  5AQU B;  4HE8 A;  2Q9Q D;  3FB2 A;  5F8P A;  4K0K T;  3PUG A;  5AQH B;  1MNE A;  3ZJ2 A;  3D0T A;  5JRC B;  5HWY A;  5L4E A;  2RP4 A;  3QB5 K;  5CA1 E;  3ZSS A;  4CQI A;  4PJJ A;  5LHI B;  3K3O A;  2V7K A;  3A7M A;  2E8I A;  4ZEY A;  1D1A A;  3FXD B;  4KMC A;  4CI3 B;  3RH3 A;  4IDP A;  2M6B A;  4DVD A;  3BQK A;  1FEW A;  3KIN B;  3ZYL A;  4GOU A;  5JDL A;  3Q5W A;  4PJL A;  4MFR A;  3OVU A;  4UF0 A;  4TV9 E;  3RYI E;  5LMN T;  2QRX A;  4QHO A;  1N36 T;  4DID B;  4DR2 T;  2JQH A;  2K5B B;  3AXJ B;  3DTO A;  2X0Y A;  3GMI A;  3ZMT B;  1HG5 A;  5FXX A;  1CUN A;  3I0Q A;  3RLF F;  1WLX A;  3Q5E A;  5M4Y A;  3K1S A;  4H9O C;  2Q9Q A;  4NIQ A;  1D0Y A;  5JDQ A;  3FZL B;  2FJA A;  4HWH A;  4AKG A;  4LFA T;  5LGN B;  2W63 A;  1G8X A;  3EDU A;  2WS3 A;  1UGO A;  4GKJ T;  4FI5 A;  2CEA A;  1FMV A;  1X79 A;  3P4P A;  2KT9 A;  4DR3 T;  1XNQ T;  2A72 A;  4U2Z A;  2DNX A;  4NUV A;  1XMQ T;  4E7Z A;  4X5T A;  2IAK A;  3X1D A;  4DR1 T;  1W0A A;  2Y8D A;  2N9D A;  2D0U A;  2D9D A;  2PBI A;  2QYW A;  3F57 A;  2V7M A;  1YW0 A;  2CMR A;  4YJ2 E;  1HCI A;  3LBX B;  4N78 D;  1M62 A;  2MBG A;  3ONL C;  5HXE A;  1G73 A;  4WYV A;  4IDN A;  1XWM A;  5HXC A;  2CA5 A;  5J2T E;  5LGT B;  1FJG T;  4HFE A;  5LMU T;  4Z91 A;  2BKP A;  5LHG B;  1VCS A;  5CGM A;  3CIR A;  4HN9 A;  3FZF B;  4I43 B;  3B5M A;  4P09 A;  3BK9 A;  5L4H A;  3PJA A;  4MHC A;  2W00 A;  4UVA B;  4U3C A;  5L3B B;  3IF8 B;  5A1L A;  4PNI A;  2JMH A;  2Y6X A;  1VRB A;  5HAX A;  3AAI A;  5JTG A;  2FJE A;  5HWX A;  2WY2 A;  1JNR A;  2CM0 A;  1T8B A;  2W66 A;  4DV1 T;  3J9X 1;  2XQY A;  3KV5 A;  4NPP A;  2WB5 A;  2FJD A;  4LF6 T;  4IE0 A;  4DBR A;  2AE9 A;  2J1D G;  2JPF A;  4DND A;  3ZKR A;  2X9H A;  4CN6 A;  1XZY A;  4QH4 A;  3T1Y T;  1BR1 A;  2VQF T;  3QUJ A;  3TLT A;  2WAU A;  2V5D A;  2WDQ A;  1QLB A;  3TLU A;  3EDV A;  3N5L A;  2XAF B;  5E0O A;  4PK5 A;  1L0V A;  4DV6 T;  5JRE A;  2UU9 T;  3BQI A;  2LHN A;  3VU7 H;  1WCR A;  2KWH A;  4UV8 B;  2NP9 A;  3AE3 A;  3UU4 A;  2NR4 A;  4YXD A;  5ABF A;  2I0M A;  2KLQ A;  1WYB A;  2PFV A;  4ZI7 E;  2C0S A;  4B3T T;  1VOM A;  2VKO A;  4AIU A;  4UEM A;  3RIU C;  1YQ4 A;  2LKG A;  2NW8 A;  3QOF A;  2UUA T;  5JRC A;  2BG9 E;  1D1C A;  3WAJ A;  3ONJ A;  2YEV C;  1YQ3 A;  2XAH B;  4UV9 B;  3VKH A;  3MKD A;  2V6Y A;  2VAS A;  4AQF C;  2IIU A;  3LFM A;  5HEU A;  5J1G A;  1US7 B;  3FHN A;  4EEB A;  2XQ4 A;  3C4Z A;  5FXW A;  3GWH A;  4CXY A;  3ZT7 A;  3QNU A;  4G2A A;  2JMK A;  1NEK A;  2NWB A;  2E9X C;  3SFD A;  4OX9 T;  5FVK A;  5BMV E;  2VWA A;  1E2A A;  4QX7 B;  4EED A;  4JI6 T;  3K3N A;  2X9Y A;  3PU8 A;  5KX5 E;  1O3X A;  2W0G A;  4U7I A;  4U31 A;  3CVR A;  2CXD A;  3AXJ A;  3BQL A;  2WZH A;  4YSY A;  3MK7 C;  3CML A;  4C91 A;  2V7J A;  4AKL A;  3RQU A;  1M7K A;  1MIY A;  2KMF A;  3N9M A;  2IML A;  3JAE A;  2WP9 A;  4M1P A;  2EHO C;  1UX5 A;  3PJA J;  2XHE B;  5FL0 A;  2NW9 A;  1MND A;  3DP7 A;  4A5X A;  3Q5D A;  4KHP T;  3M65 A;  4WZX A;  3I1A A;  3IEE A;  3L09 A;  3TLW A;  1E7P A;  3NBX X;  1HNW T;  5EZY E;  4BJM A;  4AKR B;  3H3M A;  3HI2 A;  4GK0 E;  2CBJ A;  1V9D A;  3VR9 A;  4DO0 A;  2ZM2 A;  2ODU A;  5EK2 A;  1MMG A;  4CXW A;  4NUU A;  3I9W A;  1ZKE A;  3EHZ A;  2LSK A;  3J7Y q;  3O1I A;  5GON E;  3EAM A;  3LDQ B;  4DMW A;  3SS1 A;  3JC6 D;  1HX8 A;  3CPZ A;  1OED C;  2HHH T;  4UEL A;  5JR9 A;  5LBM A;  2W61 A;  4HWC A;  2K24 A;  4QXH B;  3NKZ A;  3N9O A;  3L3P A;  3RYC E;  1D0X A;  3UT5 E;  4YFS A;  2FUP A;  2WBL A;  1QUU A;  4AIS A;  4U33 A;  1N33 T;  1UK5 A;  2CLY C;  2PJQ A;  2FJB A;  1XDO A;  3I9Y A;  2X0H A;  4KX6 A;  1N32 T;  1AJ3 A;  5FKY A;  5KMG P;  2XZE A;  4JUY A;  2ZM6 T;  4JV5 T;  2LSJ A;  5H6Q B;  4B6X A;  5EK4 A;  3SWH A;  4O2B E;  3RKG A;  1MIW A;  1Y64 B;  5AFU L;  3L8R A;  3U78 A;  2C5I T;  2LKH A;  2AXD S;  2XQ7 A;  3ZMV B;  3ZC1 A;  2L9Q A;  5H6R B;  5LJN A;  4IE4 A;  2UXN B;  5HEO A;  4K0U A;  4JI5 T;  3AAE B;  2K48 A;  4JBW F;  4PK4 A;  2QA7 A;  3F31 A;  2NW7 A;  2HPL A;  4O4J E;  3UUB A;  3UU8 A;  5LB7 B;  2I59 A;  3EVY A;  5JDN A;  3OKQ A;  3ZEF B;  1N34 T;  3JCF A;  1EZ3 A;  3UU3 A;  3OYX A;  1WYC A;  4EV6 A;  3NVO A;  3FBL A;  3WAK A;  2R6G F;  3EUH A;  3VRB A;  3M3Z B;  4BA9 A;  2M6I A;  3TKL B;  1Z8U A;  3CQC B;  4AXP A;  2JIW A;  3OBV E;  1XMO T;  2XJ7 A;  3ETV A;  1MMD A;  3RIA A;  3PDY A;  1UUR A;  3NRX A;  2WU2 A;  2BG9 A;  2X66 A;  4WNK A;  1MMN A;  1J5W A;  4OYK A;  2E5L T;  5JDH A;  4V1A v;  1W09 A;  3UU6 A;  2HN1 A;  3JAD A;  3ONX A;  3C4W A;  1S94 A;  1UCU A;  3RQW A;  5FNV E;  1T7S A;  5LBQ B;  4GYS A;  4O4I E;  5C8Y E;  1WFD A;  3RIF A;  3RYH E;  3AB3 B;  2YKS A;  5HXR A;  2YIN A;  3VRA A;  3F2E A;  4UIG A;  4H9N C;  4CZZ B;  1HR0 T;  2BVM A;  1U4Q A;  1LRZ A;  5HEJ A;  4HEA A;  2X0L B;  3FZM B;  1HNZ T;  2JRK A;  4TV8 E;  3PUZ F;  5FY0 A;  4I0U A;  5DQW A;  2BS2 A;  3JAF A;  4DMV A;  5TAO A;  1KNR A;  4ISS A;  5AQP B;  2DHR A;  4HGA A;  5AQV B;  3UUN A;  2B76 A;  2RA1 A;  3LK3 B;  3ETU A;  3T1H T;  4TUY E;  3ZCI A;  1BR0 A;  2GK9 A;  4QXB B;  1YD8 G;  5LJM A;  2RPA A;  2H7O A;  2PG8 A;  5AQM B;  4LF5 T;  3AA7 B;  2W67 A;  4E7S A;  2CRB A;  3AE7 A;  3CX6 B;  2J4G A;  4O2A E;  1KK7 A;  2LRL A;  5FYM A;  1D1B A;  2CCQ A;  2E2A A;  4X62 T;  3RC3 A;  4I4T E;  5AQT B;  2LE8 A;  2LOS A;  2J62 A;  2ACZ A;  4ASK A;  2BBJ A;  4EOZ B;  2V8S V;  4YT0 A;  3KBU A;  1R8I A;  3PE0 A;  3RHW A;  4YJ3 E;  3P7I A;  4O8S A;  4O4L E;  4JYA T;  4IT4 A;  5HXS A;  4JI4 T;  3OJA A;  3Q2M A;  4X64 T;  4LF4 T;  1IJ6 A;  4ZI2 C;  4C90 A;  3GN5 B;  4YSZ A;  5LG4 A;  4MLK A;  3C98 B;  2DWG A;  2XM1 A;  1YKE B;  3AED A;  3EI0 A;  2X51 A;  2VL8 A;  1D0Z A;  2VB6 A;  3S4U A;  4IE6 A;  2KIN B;  1UUS A;  2V5C A;  4I55 E;  4NXM T;  2E9X B;  4DUY T;  4P1N A;  4EB6 E;  3ZYK A;  3C64 A;  4HFI A;  2YN6 A;  2LT3 A;  2CHO A;  2V6X A;  3KBT A;  5FP3 A;  3AE8 A;  1IBM T;  2YDQ A;  4L0R A;  3H3A A;  2H89 A;  2L3L A;  2VVN A;  4ANJ A;  4DR5 T;  1I94 T;  5JR9 C;  1IZN B;  1YXR A;  2XSA A;  5J0Z A;  3VKG A;  3QB5 A;  5LOV E;  2I6H A;  2A3D A;  2KXP B;  2QVA A;  2XAG B;  4OYJ A;  3UQ4 A;  2WMN A;  5JVD E;  3UU5 A;  2EHO B;  4AQG A;  1CHU A;  4PFO A;  3PUQ A;  3ZT6 A;  4OHF A;  1WR6 A;  4PJM A;  5LA6 E;  2XY8 B;  4ILB A;  4QWN B;  2P9B A;  3A8Y C;  1FIO A;  1LVF A;  3P4S A;  1HX1 B;  4QKN A;  4KHZ F;  2UXX B;  4A98 A;  4UXN B;  1OED E;  4ZHQ E;  3MXZ A;  1XDP A;  5BR8 T;  3QC9 A;  4AKI A;  2XAS B;  2LSY A;  3A5X A;  3G06 A;  3KDS E;  3AE1 A;  2LJL A;  4COF A;  4UR9 A;  2L8K A;  5AQR B;  4GYR A;  3IA3 A;  2CHN A;  4DR4 T;  3N2G E;  5F3J A;  4HWD A;  2N2N A;  4DUZ T;  2DWK A;  4GK5 E;  3RI5 A;  5ETW A;  2LOP A;  1BR4 A;  3PUV F;  4MBQ A;  3MJX A;  2UXB T;  2WWV A;  4TN7 B;  2XTL A;  2VVS A;  1UX4 A;  4LF7 T;  4LF8 T;  1OED B;  2XQ3 A;  5LNK A;  1FMW A;  4O4H E;  4JI0 T;  4JI8 T;  2LHR A;  4PW8 A;  4UVC B;  4NXN T;  3DJB A;  3R6N A;  3AEA A;  5C3J A;  5JDM A;  1NEN A;  3CWZ B;  3ANW B;  5KXJ A;  2IC9 A;  4U72 A;  3RGL A;  1MIV A;  5F5W A;  2W62 A;  3PUS A;  3FXE B;  4ZI3 C;  5AQS B;  2CXF A;  5HEH A;  4YTM A;  3O4X E;  1J1J A;  4GIW A;  5ABE A;  4LMJ A;  3AA0 B;  3TLS A;  3ABV A;  3AE2 A;  3PUW F;  3KV4 A;  3PTR B;  2BS4 A;  5CJ5 A;  3LBX A;  3RKO A;  4WBN E;  2XQ5 A;  3PUR A;  2HPJ A;  3AAA B;  5LCY A;  2BG9 C;  1HF8 A;  2V1D B;  4TWD A;  4DR6 T;  2ZLY A;  5DJQ C;  5L47 A;  4L5G A;  2KND A;  1HFA A;  4IGU A;  4IHJ E;  1OXZ A;  2LM9 A;  1ZP0 A;  3E0Z A;  5AQQ B;  2ZMA A; 
#chains in the Genus database with same CATH homology
 2CA5 A;  3OBV E;  5J2T E;  3B13 A;  5LGT B;  3ETV A;  5LHG B;  4DBQ A;  1MMD A;  3PDY A;  3NRX A;  3MA9 A;  3PUA A;  3NZP A;  2X68 A;  5LP6 E;  4HN9 A;  4I43 B;  2HH7 A;  2X66 A;  4WNK A;  4P09 A;  3BK9 A;  1MMN A;  3N2K E;  2BVL A;  4OYK A;  2EHO D;  4IDZ A;  4MHC A;  3WI3 A;  2W00 A;  4UVA B;  4JEH B;  5IYZ E;  5JDH A;  4CXX A;  4V1A v;  4XAX B;  3E08 A;  5L3B B;  3IF8 B;  5A1L A;  4QX8 B;  4PNI A;  5IHY A;  3ZMZ B;  2JMH A;  2Y6X A;  4Z8X A;  3QK6 A;  1VRB A;  5HAX A;  3AAI A;  5HWX A;  1SHZ C;  3ONX A;  2CM0 A;  3C4W A;  2DI4 A;  4H63 V;  5DQV A;  4IST A;  1S94 A;  3J9X 1;  2Q9Q C;  4ZS2 A;  3UFE A;  5FY1 A;  2XQY A;  1UCU A;  3GN5 A;  3KV5 A;  1T98 A;  4H9Q C;  4JEU B;  5FNV E;  1IAP A;  3JC6 C;  3N2O A;  1ZV4 X;  2H3R A;  2G0U A;  5LBQ B;  2CWY A;  4UF0 B;  4GYS A;  3HA4 A;  4O4I E;  4A56 A;  4CI2 B;  2CWO A;  4IE0 A;  5L3G B;  3AA6 B;  2D0T A;  4DBR A;  5C8Y E;  5ADX L;  2J1D G;  2IC6 A;  2Y48 B;  2JPF A;  4DND A;  3RYH E;  1QSD A;  4H9S E;  1NAF A;  3AB3 B;  5HXR A;  2X9H A;  3K3Q C;  2VKD A;  2CXL A;  2WSS V;  2YIN A;  4H63 H;  3C51 A;  1KNZ A;  2CLY B;  4J2C A;  1BR1 A;  5JDG A;  5J2U E;  4YLH A;  3F2E A;  4UIG A;  5HXH A;  4AI6 A;  4H9N C;  3QUJ A;  4CZZ B;  2C5J A;  3RRW A;  2WAU A;  1SA0 E;  2BVM A;  3E22 E;  3Q5X A;  1U4Q A;  4EYY R;  1LRZ A;  4HEA A;  2X0L B;  3EDV A;  3N5L A;  2XAF B;  5E0O A;  4PK5 A;  3ZC0 A;  2JRK A;  5JRE A;  3NZQ A;  4TV8 E;  3BQI A;  2Q9Q B;  5FY0 A;  4X1I E;  5HYA A;  5CA0 E;  2LHN A;  5LYJ E;  2CE7 A;  3V5S A;  2DLR A;  5FY7 A;  2LSI A;  2WM9 A;  4QXC B;  4YHJ A;  5DQW A;  3VU7 H;  3O9X A;  2KWH A;  2X67 A;  3AVR A;  1B7T A;  2NOX A;  4UV8 B;  3RX6 A;  2NP9 A;  4DMV A;  4TX5 A;  2V26 A;  2KZ7 B;  4MAL A;  2X9X A;  4TZ4 C;  2E9X D;  3HR0 A;  4ISS A;  3H37 A;  1MMA A;  2MYS A;  5TAO A;  3T8O A;  5L3C B;  4CI1 B;  2DHR A;  2LEH A;  2VK9 A;  4HGA A;  3UUN A;  2RA1 A;  2ACX A;  3ETU A;  3LK3 B;  2KLQ A;  1WYB A;  2PFV A;  4ZI7 E;  2C0S A;  2ES0 A;  4TUY E;  4PK6 A;  1VOM A;  3NRY A;  2VKO A;  3MZK B;  4UEM A;  1E1H B;  3ZCI A;  4HFV A;  5JQG E;  1BR0 A;  2GK9 A;  3K8P C;  5L3F B;  3R84 B;  3UTK A;  4EZ4 A;  2VKJ A;  1YD8 G;  4QXB B;  2NW8 A;  5LJM A;  5KDM C;  5JRC A;  5CB4 E;  4IE5 A;  2H7O A;  1D1C A;  2PG8 A;  3MAC A;  1S35 A;  3KVA A;  3I0O A;  4PAG A;  3WAJ A;  2YEV C;  4ZOL E;  4ADZ A;  2D5U A;  2XAH B;  3AA7 B;  4UV9 B;  3B57 A;  1BR2 A;  5L3D B;  3VKH A;  3MKD A;  5FMN A;  2VAS A;  4AQF C;  3O1J A;  3LJC A;  2D2S A;  4E7S A;  4ERR A;  3LFM A;  2N1G A;  3CX6 B;  5J1G A;  5FXV A;  2XAJ B;  1US7 B;  3HKE E;  3FHN A;  3C4Z A;  4O2A E;  1KK7 A;  2WMO A;  3N9Q A;  5LGU B;  4G63 A;  5FXW A;  5L3E B;  5FYM A;  3UUL A;  1D1B A;  2CCQ A;  3ZN0 B;  3RC3 A;  3GWH A;  4I4T E;  4CXY A;  2OA5 A;  2LE8 A;  2LOS A;  3P8C D;  3ZMS B;  4AKH A;  3RRC A;  2MOZ A;  4G2A A;  4I50 E;  2JMK A;  4ASK A;  5JDF A;  2NWB A;  2E9X C;  4EOZ B;  3Q9D A;  2SPC A;  4ZI3 D;  3ZJ1 A;  2C5K T;  3VHL A;  5BMV E;  2X9W A;  3ZMU B;  3UUX B;  2VWA A;  2ODV A;  3KBU A;  2H7V C;  3PE0 A;  4QX7 B;  4AQF A;  4YJ3 E;  3P7I A;  3AA1 B;  3CQG B;  3K3N A;  4O8S A;  2X9Y A;  4F6R C;  4O4L E;  3PU8 A;  3UUM A;  3AVS A;  1O3X A;  5DAB A;  5HXS A;  5KX5 E;  2W0G A;  3OJA A;  2YK0 A;  3Q2M A;  2BZB A;  4EAH A;  3CVR A;  2CXD A;  3IHR A;  4XZC A;  3BQL A;  1IJ6 A;  3ESL A;  4ZI2 C;  4C90 A;  3N9N A;  3GN5 B;  3MK7 C;  3CML A;  3W15 B;  4C91 A;  2V7J A;  4AKL A;  5LG4 A;  4H9P C;  4JLE A;  5JH7 E;  4BAY B;  2E9X A;  1MIY A;  3IBP A;  2KMF A;  4ILU A;  4MLK A;  3C98 B;  3ANW A;  2YU1 A;  2DWG A;  3N9M A;  4ZS3 A;  1YKE B;  2A2F X;  4BJN A;  3PU3 A;  3ZPO A;  3RPU A;  3LG7 A;  2X51 A;  2VL8 A;  2YU2 A;  1D0Z A;  2VB6 A;  2NTX A;  3S4U A;  4IE6 A;  2KIN B;  4X1Y E;  5L2L A;  2K9A A;  4M1P A;  4I55 E;  2E9X B;  2EHO C;  1UX5 A;  3KFW X;  2M67 A;  2XHE B;  3HKC E;  4EB6 E;  3ZYK A;  3C64 A;  2NW9 A;  3SRZ A;  4KP3 C;  1MND A;  2LT3 A;  3RC8 A;  3DP7 A;  4P0A A;  1OWA A;  3CKD A;  4EXT A;  1LVK A;  3KBT A;  5FP3 A;  3M65 A;  5FXZ A;  3I1A A;  2WWU A;  3IEE A;  2VKH A;  2IW5 B;  4L0R A;  3H3A A;  3L09 A;  4EYU A;  2ZM0 A;  4OK0 A;  2L3L A;  5LHH B;  4ANJ A;  3NBX X;  3KVB A;  3CX7 B;  1ZEE A;  4OFZ A;  1IZN B;  3KV9 A;  5EZY E;  2JQQ A;  5JR9 C;  4BJM A;  4U74 A;  4AKR B;  3VKG A;  4PFP A;  4IIJ E;  2EHO A;  4UVB B;  5LOV E;  3HI2 A;  4GK0 E;  4X20 E;  1V9D A;  4DO0 A;  2ZM2 A;  1H7C A;  2A3D A;  2KXP B;  2ODU A;  2XAG B;  3C4X A;  5EK2 A;  4OYJ A;  1MMG A;  4WW0 A;  2WMN A;  4CXW A;  5JVD E;  3GA8 A;  4NUU A;  3ZLI A;  3I9W A;  1ZKE A;  2LSG A;  4KUM B;  3SOL A;  3RYF E;  4HE8 A;  2LSK A;  2Q9Q D;  3J7Y q;  2EHO B;  4AQG A;  4PFO A;  3O1I A;  3FB2 A;  3PUQ A;  1Z0P A;  5GON E;  5F8P A;  3PUG A;  4DMW A;  3SS1 A;  3JC6 D;  1MNE A;  1HX8 A;  3CPZ A;  4OHF A;  1WR6 A;  3D0T A;  3ZJ2 A;  4HKA A;  4UEL A;  5JR9 A;  4PJM A;  5JRC B;  5LBM A;  5HWY A;  2W61 A;  5LA6 E;  1HG2 A;  3N9L A;  4QWN B;  2P9B A;  3FBZ A;  1FIO A;  1LVF A;  4PJN A;  2K24 A;  4QKN A;  3LK2 B;  2RP4 A;  2UXX B;  1LKX A;  4UXN B;  4KBM B;  5CA1 E;  4ZHQ E;  3MXZ A;  4CQI A;  4PJJ A;  4QXH B;  5LHI B;  4AKI A;  3QC9 A;  2XAS B;  2LSY A;  3A5X A;  3KDS E;  3K3O A;  3KV6 A;  5JR9 B;  3N9O A;  2V7K A;  2LJL A;  3L3P A;  3RYC E;  1D0X A;  3UT5 E;  4YFS A;  2E8I A;  2QGS A;  2L8K A;  1D1A A;  3V5U A;  2WBL A;  3FXD B;  1QUU A;  4GYR A;  4KMC A;  4CI3 B;  3HKB E;  3RH3 A;  2CLY C;  3N2G E;  5F3J A;  2PJQ A;  2N2N A;  2DWK A;  4GK5 E;  4DVD A;  3BQK A;  1FEW A;  5ETW A;  3HL6 A;  2LOP A;  1BR4 A;  3KIN B;  4WBO A;  1HS7 A;  3ZYL A;  3I9Y A;  4MBQ A;  4GOU A;  3MJX A;  5JDL A;  3Q5W A;  4PJL A;  4MFR A;  1IJ5 A;  1AJ3 A;  4TN7 B;  4UF0 A;  1NWM X;  2XTL A;  4IE7 A;  1UX4 A;  5KMG P;  2ZM8 A;  5EK3 A;  4JUY A;  5LNK A;  1FMW A;  1U5P A;  4O4H E;  3OYZ A;  2LSJ A;  4TV9 E;  5H6Q B;  3RYI E;  3HKD E;  4L9I A;  4B6X A;  2LHR A;  4QHO A;  5EK4 A;  4PW8 A;  2K5B B;  2JJ9 A;  3SWH A;  4UVC B;  3DTO A;  3GMI A;  3ZMT B;  1HG5 A;  3DJB A;  5FXX A;  3R6N A;  1CUN A;  3I0Q A;  4O2B E;  5JDM A;  4P0B A;  1WLX A;  1MIW A;  1Y64 B;  5AFU L;  3CWZ B;  3ANW B;  3U3I A;  3U78 A;  5LXT E;  2C5I T;  2IC9 A;  4U72 A;  5M4Y A;  2XUE A;  1MIV A;  3ZMV B;  3C50 A;  2KWI B;  3CX8 B;  4H9O C;  2W62 A;  2Q9Q A;  3FXE B;  3PUS A;  2L9Q A;  4ZI3 C;  3ZC1 A;  5H6R B;  1D0Y A;  5JDQ A;  5LJN A;  4H9R C;  2CXF A;  4AKG A;  4IE4 A;  3O4X E;  5LGN B;  2UXN B;  1G8X A;  1YKH B;  2W63 A;  3EDU A;  4GIW A;  4K0U A;  3AAE B;  2K48 A;  3AA0 B;  2V7L A;  4FI5 A;  3O1H A;  2QA7 A;  4PK4 A;  3F31 A;  2NW7 A;  2HPL A;  4O4J E;  2CEA A;  1FMV A;  1X79 A;  3ZCJ A;  3ZYM A;  2I59 A;  4FJO A;  4XBF B;  3EVY A;  5JDN A;  3KV4 A;  3OKQ A;  2KT9 A;  3CQX C;  1HTJ F;  3ZEF B;  1WRD A;  2A72 A;  3PTR B;  4HTE A;  4EIW A;  2DNX A;  1EZ3 A;  4NUV A;  2DCF A;  1ZHC A;  3OYX A;  1WYC A;  3ZN1 B;  3LBX A;  3RKO A;  4WBN E;  4E7Z A;  3PUR A;  2HPJ A;  3AAA B;  3FBL A;  2IAK A;  5LCY A;  1HF8 A;  2MTQ A;  2V1D B;  3WAK A;  2Y8D A;  2XAQ B;  2N9D A;  2BDE A;  3LK4 2;  2D0U A;  2ZLY A;  2PBI A;  4X1K E;  5DJQ C;  3F57 A;  3EUH A;  4EZH A;  2V7I A;  2V7M A;  4L5G A;  1YW0 A;  2CMR A;  4YJ2 E;  2B1E A;  1HCI A;  2Z6E A;  3LBX B;  4N78 D;  2KND A;  1HFA A;  3N9P A;  4IGU A;  4IHJ E;  2MBG A;  4BA9 A;  1OXZ A;  5HXE A;  2LM9 A;  1G73 A;  3TKL B;  4ZI2 D;  2NTY A;  3E0Z A;  2ZMA A;  3CQC B;  4AXP A;  5HXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...