5KMGP

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
128
structure length
128
Chain Sequence
GAAALKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 57
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1520 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5kmgP00
5KMGP 3NRYA 3NRXA
chains in the Genus database with same CATH superfamily
2YOEA 3LFMA 4MLKA 2NTXA 4DUYT 2NW8A 4A56A 2XY8B 1HNZT 3CQCB 1SA0E 1YKEB 2MYSA 4F8HA 4KI0F 4E7ZA 4NPPA 4HEAA 1SHZC 5DQWA 3FXEB 3IF8B 5FVKA 4H9SE 3MK7C 4DMVA 3N9OA 3W15B 2E8IA 5L3CB 3A8YC 2KZ7B 2XQ7A 5JDFA 3VKGA 2HPLA 3AB3B 2KT9A 5FXWA 5JDNA 3G06A 4UF0B 3KV4A 4JI6T 1MMDA 3AA1B 2LRLA 1YQ3A 3MKDA 3OYXA 2CHOA 4CXWA 1YD8G 4HWFA 2DI4A 1ZV4X 5CFBA 2UUCT 2LSKA 2DLRA 2K5BB 3T8OA 4B3ST 2A2FX 3BQIA 1FEWA 3SFDA 1UCUA 3JADA 3HR0A 4QH4A 4AKHA 4ILBA 3R84B 5JVDE 1WR0A 2DNXA 4MFRA 3EUHA 4O2AE 3X1DA 3CMLA 4B6XA 1EZ3A 3ZJ1A 3K1SA 3NRYA 4JV5T 4YTPA 3UTKA 1E1HB 5KMGP 4JLEA 1KK7A 1O3XA 4ASKA 5C8YE 5JDHA 4H9OC 1IZNB 1FIOA 4P1NA 3V5SA 4P0BA 2IDOB 2BBJA 2QRXA 2LHNA 5AQLB 3RX6A 4BA9A 4A97A 5HEHA 5HEGA 3M3ZB 4XZCA 5AQMB 5L3GB 3FZMB 4XAXB 3VR9A 1J1JA 2JJ9A 5JQGE 4ZZBA 4A5XA 1L0VA 2H3RA 3AE4A 2VASA 2WU5A 3I0QA 4IL4A 4UVBB 1BR4A 5LHIB 4DR4T 3LJCA 2XQ9A 4BJNA 2W67A 2XQ6A 3AECA 3C51A 2V8SV 3KV9A 2B76A 2HHHT 2W2UA 4IDOA 4TZ4C 1NWMX 3ZC1A 5LGNB 3MZKB 2W00A 4WNKA 4V1Av 4EGWA 1IBLT 2X67A 4I55E 4DBRA 2E2AA 3QUJA 5FP3A 2SPCA 1MIVA 1ZP0A 3UQ7A 2D5UA 2D0UA 2R6GF 1UX4A 2YKSA 3QNUA 2CE7A 5FY1A 2XQYA 3UUXB 2ODUA 4C91A 2RA1A 1S94A 3GN5B 3ZMUB 3WAJA 3IA3A 1LVFA 5AQNB 4GOUA 4GKKT 3E22E 5LG3A 3EDUA 1OWAA 2XQ3A 1QLBA 2MTQA 3I9WA 3GA8A 3RF1A 5IUXA 4YT0A 2XQ4A 3MXZA 1VOMA 5AQTB 4F6RC 4AQFA 2H7OA 5JTGA 2MBGA 4YSXA 4U72A 3P8CD 4TUYE 5LXTE 3QK6A 1ZEEA 4UIGA 4LFCT 5CGMA 3KV6A 3RC8A 2IAKA 4N78D 3ZSTA 2WSSV 4DV0T 4QXCB 2DCFA 3ZCJA 3T1YT 2IIUA 4DBQA 4HTEA 1UX5A 2W63A 3SS1A 3OBVE 2CEAA 2JIWA 2BDEA 4HWCA 5AQOB 5HWYA 2VVNA 1KNRA 2JQQA 3ZC0A 1SE7A 1U5PA 2JRKA 4ZI3D 3RYHE 3UFEA 1J5ET 1HG2A 4K0UA 5LB7B 1JNRA 2AXDS 2XAQB 3F2EA 3KVBA 3PUQA 4IDPA 1FJGT 2WZHA 3AVSA 3PUVF 4HKAA 4JEUB 3BQKA 5FXXA 4MALA 3N9MA 5CA1E 3RYCE 4AKIA 2CLYC 4UV8B 1T7SA 5FYMA 3ZCIA 5A1LA 5M4YA 2K48A 4DV1T 4UVAB 3C50A 2UXCT 3JCFA 2XM2A 5EK3A 2M67A 3VKHA 3ZYMA 4EV6A 2QYWA 1G8XA 3AE6A 1G73A 4HWHA 4X5TA 4EB6E 2WDQA 4DR3T 4LFAT 2EHOC 4ILUA 2UUBT 3LDQB 2DWKA 5L3BB 3PU3A 1HX1B 3ZMZB 1YKHB 3AEDA 4QH5A 4JI3T 2A9UA 1ZKEA 3PUAA 2PBIA 3OKQA 3I0OA 2XASB 3ZT6A 2CBIA 2UXDT 2I0MA 4DO0A 3RIFA 2EHOA 2EHOD 1HCIA 2WZIA 3O9XA 2CXLA 2PFVA 1UGOA 2LE8A 3PE0A 4IDNA 4B3TT 4DV4T 1MMGA 2L8KA 5HCJA 3OTOT 1V9DA 3ZMSB 3RHWA 1S35A 4DUZT 1W9RA 3NWIA 5JDLA 3UU4A 5BR8T 4NIQA 3FZHB 4TN7B 4NUVA 4QHOA 4Z8XA 4YY3T 3ANWB 2K9AA 3KVAA 3PUXF 4PK4A 1WYCA 4IL9A 4EYUA 3PV0F 4DR5T 2BBHA 4HWDA 4M1PA 4YTMA 4YSZA 4GIWA 1XMOT 1WLXA 2VL8A 2WM9A 1LKXA 4L0RA 4QXBB 5HYAA 3C4ZA 2ACZA 3LSVA 4Z90A 2VKHA 2WMOA 3RKGA 4DNDA 2IMLA 3UULA 2FJAA 3Q9DA 3K3NA 3ZN1B 3TLTA 3AEAA 3A5XA 3ANWA 2X9WA 4P09A 4E7SA 3AAAB 3PUYF 3FXDB 1KNPA 3P4WA 3SOLA 2HN1A 2YU1A 1KEYA 3L09A 4X66T 2XM1A 5LYJE 4AQFC 2VKOA 4Z91A 4EXTA 4JI8T 1N32T 1ZHCA 3HKDE 5LOVE 1N33T 3I1AA 1HS7A 4LF6T 1WCRA 4XBFB 3N5LA 3CK6A 3CX6B 3N9LA 4EZ4A 1XNRT 4YHHT 5LA6E 4UV9B 3TKLB 4JI5T 3HKCE 4QWNB 4WW0A 4OHFA 1VCTA 1WRDA 3QB5A 2RP4A 2I6HA 4ZXLA 1XMQT 4HFCA 3UUBA 1XNQT 5IWAT 3AE9A 1D1CA 2V7LA 4HGAA 1WFDA 3RGLA 3J9X1 3RIUA 4U3CA 1N34T 5F8PA 2E5VA 2VURA 2W61A 2XZEA 3TLUA 3HI2A 4PFOA 2VK9A 2WB5A 3F31A 2BG9C 2YU2A 2FBWA 4I4TE 2LSIA 3ONLC 5J0ZA 3AE5A 2DL1A 2FJBA 3CQGB 2K3WA 4H9NC 4HN9A 4ISTA 3AEGA 4TWHA 5LGTB 2MPKA 3N9NA 5L3DB 2CXDA 5LMNT 2C5IT 5L3FB 3MA9A 1D0YA 2Q9QA 2CM0A 2XJ7A 2YN6A 3TLWA 4COFA 5ABFB 4DR2T 4KHPT 4A98A 2LLYA 2HPJA 2V7KA 4X65T 2UXBT 2XAFB 4LMJA 2Y6XA 3PDYA 2ES0A 4I0UA 3RYFE 3UU5A 4JI2T 2M6BA 2VWAA 3AEEA 2CCQA 2X9XA 4IE5A 4PJNA 4HFEA 4AKRB 3IBPA 1OEDB 1D1BA 2JQ9A 4J2CA 2KXPB 4O4IE 5CJ5A 1GQEA 4LF9T 4BJMA 2V5DA 1J5WA 2QVAA 1US7B 3K8PC 3CIRA 4TV8E 5ABFA 2BG9B 1QUUA 1R8IA 2A72A 2XQAA 2UU9T 1OEDE 1HTJF 3NRXA 3KV5A 4JUYA 5LNKA 2P9BA 3LBXA 2NW7A 1XWMA 4LF4T 2KMFA 2L3LA 3JAEA 4B3MT 4U31A 5HEJA 3Q5DA 2IC6A 5HEOA 1CHUA 5CB4E 4CI2B 4CZZB 4EEDA 4OX9T 4QX7B 5HXSA 3AA0B 3KFWX 3TLSA 4CI1B 3UQ4A 4U74A 3ZMTB 3FBLA 2LT3A 3PTRB 2M6IA 4DR7T 4ISSA 1M7KA 4TV9E 4OYKA 1Z0PA 4AIUA 2LSJA 2NTYA 2WWVA 4HWIB 3J7Yq 3FHNA 3E08A 3ABVA 3MACA 1W0AA 4QX8B 1JNZA 2E5LT 2WAUA 4IGUA 3R6NA 4U2ZA 3EABA 2LJLA 2NOXA 3P4RA 5AQIB 1I94T 3L39A 3U3IA 5TAOA 2OA5A 4PAGA 3HL6A 3IEEA 3QB5K 4HFDA 2X0LB 3ONJA 5CA0E 4CXYA 2KINB 5AQUB 5KXJA 3LBXB 5LHGB 2XHEB 3O1IA 2J1DG 3FZLB 5FVLA 3QC9A 2UUAT 3Q5WA 2V7MA 2QA7A 3AAEB 1LRZA 2RPAA 4HE8A 2XAHB 4ADZA 5JDQA 2X9HA 2NP9A 3N9PA 3AA7B 3K3QC 4UR9A 3VRAA 1NENA 4UF0A 3DP7A 1YW0A 4YLHA 1IAPA 3FB2A 2XQ8A 3MJXA 1D0ZA 1MNDA 2LM9A 2X0YA 3UU6A 4CI3B 1UK5A 2NWBA 1Y01A 1WR6A 2CA5A 2PG8A 4YXDA 1MIWA 2WQYA 4IT4A 2CRBA 3UT5E 3PJAJ 4UEMA 2X66A 4HFHA 3RQWA 2NW9A 1BR0A 4ILAA 5LMUT 3RIUC 5HEUA 4H63V 4ERRA 4WBNE 3WI3A 4CQIA 2LKGA 3CX7B 2YDQA 3U78A 3LK3B 4EEBA 3O4XE 3RQUA 4O4LE 5F3JA 3CX8B 2LM2A 2V6YB 2XPKA 2Q9QB 2PTFA 2XAGB 2A3DA 4JBWF 4H63H 3EI0A 2E9XD 4KBMB 1I6ZA 4H9PC 4AISA 1NEKA 2ACXA 3KBUA 3EVYA 3N2OA 2KNDA 3P4QA 4U2YA 2FJDA 4IE4A 4TNVA 1IBKT 4MBQA 4KX6A 3A7MA 4DV6T 2VKDA 5FY7A 2JQKA 3BK9A 3KDSE 4HFIA 4JEHB 2CWYA 4O2BE 3AEBA 5HXRA 5LCYA 1W0BA 2V6YA 2I59A 4OYJA 5AQQB 2N1GA 3NZPA 4DV5T 2K24A 3JC6D 4YHJA 1HR0T 4IHJE 5HAXA 5LBMA 3CKDA 4I50E 5AQKB 3ONXA 3AE3A 5EK2A 3RKOA 1VCSA 4KUMB 3FZKB 3RI5A 2C0SA 3VU7H 2Z6EA 2WDRA 1IJ5A 4KHZF 2N9DA 2X68A 5L4EA 4JYAT 4QH1A 2X0HA 3UU8A 3ZSSA 5GONE 2BZBA 2HN2A 3OPCA 1OEDA 3ZYLA 4TWFA 1KF6A 1XDPA 1NAFA 3D0TA 2YEVC 3CPZA 3IHRA 3L3PA 3VHLA 1Z8UA 2JMKA 2JQHA 2MOZA 3GMIA 4X1KE 5ETWA 4L5GA 4DV2T 2X9YA 1XDOA 2CWOA 5LHHB 3RLFF 3O1JA 1AJ3A 3QOFA 3NVOA 2KSRA 1KNZA 1DU2A 4G63A 2H7VC 3HA4A 4PNIA 3C4WA 1MMAA 4ZS2A 2BS3A 3FBZA 3HKBE 1HFAA 2V1DB 3S4UA 2HH7A 2WU2A 2CPTA 5FMNA 4G2AA 2E9XB 2V7IA 3ZJ2A 1MMNA 3GWHA 2BG9E 4EIWA 4DR1T 2BVMA 3RH3A 2YDSA 2W62A 3P50A 3AE7A 4PFPA 3UU3A 4ANJA 2LRKA 5JDMA 4AKGA 1MIYA 2FJEA 4FI5A 3P4SA 5E0OA 1N36T 2Y8DA 2WMNA 2BKNA 2LSYA 3AXJB 3HKEE 3ZEFB 4H9RC 1HF8A 4CN6A 5C2TA 5L3EB 2D9DA 4IDZA 5JREA 3N9QA 5EZYE 2Y48B 2DHRA 3GN5A 5HXHA 2JMHA 3PUSA 3PUGA 2DWGA 4WBOA 5JRCA 2WCAA 4GKJT 2J4GA 4LF5T 1Y64B 3Q5EA 4H9QC 3FZFB 5ABHA 2C5JA 3KINB 3UUMA 4I43B 2LSGA 3BQLA 4MHCA 5AQVB 5FXZA 5J1GA 2XUEA 4EYYR 4EOZB 2ODVA 2N2NA 3ZKRA 2LOPA 2MAWA 2CXFA 2VL0A 3F57A 1MNEA 1FMVA 3ETUA 3OYZA 4UXNB 5JRCB 1BR2A 4ZI2C 3P7IA 1T8BA 5F5WA 3DJBA 2H88A 4QXHB 1T72A 3B13A 5DABA 1UUSA 2LEHA 2V6XA 3AE2A 4IE6A 3VR8A 5JDGA 5LBQB 3AAIA 3JAFA 3N2KE 5AFUL 5LGUB 2C5KT 3Q2MA 4YJ3E 2UXNB 2YDRA 3SFEA 4WZXA 5HCMA 3PURA 5H6RB 1VRBA 2GK9A 2ZM2A 4LF7T 5JH7E 3PU8A 4LMLA 4YFSA 2BS4A 5FNVE 5FL1A 2D0TA 4P0AA 3ZPOA 2J62A 4O8SA 2YINA 5L4HA 3WAKA 4QKNA 2LHRA 4K0KT 4GYRA 2KWIB 1W09A 5FL0A 4PW8A 4JI0T 4JI7T 4TX5A 3NKZA 4Q25A 5JR9C 5LJNA 1T98A 3AVRA 3ZMVB 3O1HA 4GYSA 2BG9A 2JPFA 5HXCA 2IC9A 2X51A 2YK0A 3H37A 3OJAA 2WBLA 5L47A 5LP6E 4NXNT 2F4VT 1BR1A 1ZOYA 4OK0A 3RYIE 5C3JA 4AI6A 4AXPA 2W4XA 2J47A 3AE8A 4DMWA 5ADXL 1HNWT 2BKOA 2EHOB 2Q9QC 1H7CA 2LOSA 2WDVA 2XTLA 2ZM8A 5AQPB 5JR9A 5J2UE 4ILCA 1X9BA 2UXXB 4UELA 3RRWA 4U33A 4AQYT 3ESLA 4CXXA 5KX5E 2CBJA 3KBTA 3VRBA 2WS3A 3UUNA 1D0XA 3M65A 4ZHQE 2OV9A 5J2TE 1FMWA 2WP9A 3DTOA 5IYZE 1YQ4A 3RC3A 2VQET 1D1AA 3PJAA 3PUZF 4O4JE 1HX8A 4TWDA 4WYVA 3H3MA 4EZHA 2VQFT 3CVRA 4LMKA 3L8RA 5AQJB 4DVDA 2PJQA 3K3OA 4AKLA 5JR9B 2BKPA 3AA6B 4HFBA 1E2AA 5AQHB 3SWHA 3ZT7A 4CN4A 2B1EA 4ZOLE 3C98B 4ZEYA 4GK5E 3AE1A 3UFGA 2G0UA 2V7JA 3B57A 4IDQA 2LKHA 4B3RT 3AXJA 4LFBT 3LK2B 5EK4A 2XAJB 3I9YA 2V26A 3ZN0B 4L9IA 4KMCA 4X20E 1HG5A 2QGSA 4IE7A 4IE0A 2E9XC 1LVKA 1UURA 2NR4A 2ZMAA 3NZQA 3TLVA 3SRZA 1M62A 1QSDA 2CHNA 2L9QA 2ZLYA 4FJOA 4ZZCA 2VKJA 1KFYA 3H3AA 4IREA 3CWZB 4X62T 2VVSA 3P4PA 1E7PA 3CQXC 3T1HT 5FXVA 1HNXT 4TNWA 1IJ6A 3ZLIA 4YTNA 2V5CA 4UVCB 5ABGA 2E9XA 3RRCA 4C90A 3EDVA 3PUWF 5AQGB 4PK5A 5IHYA 3AEFA 4LF8T 1XZYA 3EAMA 5FKYA 1WYBA 3ZYKA 2VB6A 4DIDB 1OXZA 3JC6C 2XSAA 2KWHA 4KP3C 5AQFB 2W66A 2XQ5A 2ZM6T 4DR6T 4DV3T 1U4QA 2W0GA 4ZI2D 4ZS3A 4HFVA 2H89A 4U7YA 3RPUA 5LJMA 4JI1T 3E0ZA 4NUUA 3EHZA 4PJLA 5KDMC 1B7TA 3N2GE 3C64A 5AQRB 4AQGA 5DJQC 2Q9QD 3B5MA 3V5UA 4NXMT 4IIJE 1YXRA 2FUPA 5DQVA 4EAHA 5AQSB 2CMRA 4X64T 1IBMT 2WY2A 2CLYB 2IHR1 2IUBA 4YJ2E 2ZM0A 3OVUA 4OFZA 5LG4A 4U7IA 2BS2A 4PK6A 4CN1A 1CUNA 2KLQA 4X1IE 3C4XA 4ZI3C 5HWXA 4DV7T 5HXEA 1SUMB 2BVLA 2WWUA 4PJMA 5L2LA 5FY0A 3Q5XA 4GK0E 3ZT5A 5BMVE 2OLTA 4PJJA 2XSBA 5ABEA 2D2SA 2IW5B 4YSYA 5H6QB 1OEDC 3ETVA 3LG7A 3RIAA 4BAYB 4X1YE 1X79A 2AE9A 4O4HE 3LK42 4ZI7E 3NBXX 4JI4T
chains in the Genus database with same CATH topology
3LFMA 4MLKA 2NTXA 2NW8A 4A56A 3CQCB 1SA0E 1YKEB 2MYSA 5DQWA 4HEAA 1SHZC 4DMVA 3FXEB 3IF8B 4H9SE 3MK7C 3N9OA 3W15B 2E8IA 5L3CB 2KZ7B 5JDFA 3VKGA 2HPLA 3AB3B 2KT9A 5FXWA 5JDNA 4UF0B 3KV4A 1MMDA 3AA1B 3MKDA 3OYXA 4CXWA 1YD8G 2DI4A 1ZV4X 2LSKA 2DLRA 2K5BB 3T8OA 2A2FX 3BQIA 1FEWA 1UCUA 3HR0A 4AKHA 3R84B 5JVDE 4MFRA 2DNXA 4O2AE 3EUHA 3CMLA 4B6XA 1EZ3A 3ZJ1A 3NRYA 3UTKA 1E1HB 5KMGP 4JLEA 1KK7A 1O3XA 4ASKA 5C8YE 5JDHA 4H9OC 1IZNB 1FIOA 3V5SA 4P0BA 2LHNA 4BA9A 3RX6A 4XZCA 5L3GB 4XAXB 2JJ9A 5JQGE 2H3RA 2VASA 3I0QA 4UVBB 1BR4A 5LHIB 3LJCA 4BJNA 3C51A 3KV9A 4TZ4C 1NWMX 3ZC1A 5LGNB 3MZKB 2W00A 4WNKA 4V1Av 2X67A 4I55E 4DBRA 3QUJA 5FP3A 2SPCA 1MIVA 2D5UA 2D0UA 1UX4A 2CE7A 5FY1A 2XQYA 3UUXB 2ODUA 4C91A 2RA1A 1S94A 3GN5B 3ZMUB 3WAJA 1LVFA 4GOUA 3E22E 3EDUA 1OWAA 2MTQA 3I9WA 3GA8A 3MXZA 1VOMA 4F6RC 4AQFA 2H7OA 2MBGA 4U72A 3P8CD 4TUYE 5LXTE 3QK6A 1ZEEA 4UIGA 3KV6A 3RC8A 2IAKA 4N78D 2WSSV 4QXCB 2DCFA 3ZCJA 4DBQA 4HTEA 1UX5A 2W63A 3SS1A 3OBVE 2CEAA 5HWYA 2BDEA 2JQQA 3ZC0A 1U5PA 2JRKA 4ZI3D 3RYHE 3UFEA 1HG2A 4K0UA 2XAQB 3F2EA 3KVBA 3PUQA 3AVSA 4HKAA 4JEUB 5FXXA 3BQKA 5CA1E 4MALA 3N9MA 4AKIA 3RYCE 2CLYC 4UV8B 5FYMA 3ZCIA 5A1LA 5M4YA 2K48A 4UVAB 3C50A 5EK3A 2M67A 3VKHA 3ZYMA 1G8XA 1G73A 4EB6E 2EHOC 4ILUA 2DWKA 5L3BB 3PU3A 3ZMZB 1YKHB 1ZKEA 3PUAA 2PBIA 3OKQA 3I0OA 2XASB 4DO0A 2EHOA 2EHOD 1HCIA 3O9XA 2CXLA 2PFVA 2LE8A 3PE0A 1MMGA 2L8KA 1V9DA 3ZMSB 1S35A 5JDLA 4TN7B 4Z8XA 4NUVA 4QHOA 3ANWB 2K9AA 3KVAA 4PK4A 1WYCA 4EYUA 4M1PA 4GIWA 1WLXA 2VL8A 2WM9A 1LKXA 4L0RA 4QXBB 5HYAA 3C4ZA 2VKHA 2WMOA 4DNDA 3UULA 3Q9DA 3K3NA 3ZN1B 3A5XA 3ANWA 2X9WA 4P09A 4E7SA 3AAAB 3FXDB 3SOLA 2YU1A 3L09A 5LYJE 4AQFC 2VKOA 4EXTA 1ZHCA 3HKDE 5LOVE 1HS7A 3I1AA 4XBFB 3N5LA 3CX6B 3N9LA 4EZ4A 5LA6E 4UV9B 3TKLB 3HKCE 4QWNB 4WW0A 4OHFA 1WRDA 2RP4A 1D1CA 2V7LA 4HGAA 3J9X1 5F8PA 2W61A 3HI2A 4PFOA 3F31A 2VK9A 4I4TE 2YU2A 2LSIA 3CQGB 4H9NC 4HN9A 4ISTA 5LGTB 3N9NA 5L3DB 2CXDA 2C5IT 5L3FB 3MA9A 1D0YA 2Q9QA 2CM0A 2V7KA 2HPJA 2XAFB 2Y6XA 3PDYA 2ES0A 3RYFE 2VWAA 4IE5A 2CCQA 2X9XA 4PJNA 4AKRB 3IBPA 1D1BA 4J2CA 4O4IE 2KXPB 4BJMA 1US7B 3K8PC 4TV8E 1QUUA 2A72A 1HTJF 3NRXA 3KV5A 4JUYA 5LNKA 2P9BA 3LBXA 2NW7A 2KMFA 2L3LA 2IC6A 4CI2B 5CB4E 4CZZB 4QX7B 5HXSA 3AA0B 3KFWX 4CI1B 4U74A 3ZMTB 3FBLA 2LT3A 3PTRB 4ISSA 4TV9E 4OYKA 1Z0PA 2LSJA 2NTYA 3J7Yq 3FHNA 3E08A 3MACA 4QX8B 2WAUA 4IGUA 3R6NA 2LJLA 2NOXA 3U3IA 5TAOA 2OA5A 4PAGA 3HL6A 3IEEA 2X0LB 5CA0E 4CXYA 2KINB 5LHGB 3LBXB 2XHEB 3O1IA 2J1DG 3QC9A 3Q5WA 2V7MA 2QA7A 3AAEB 1LRZA 4HE8A 2XAHB 4ADZA 5JDQA 2X9HA 2NP9A 3N9PA 3AA7B 3K3QC 4UF0A 4E7ZA 3DP7A 1YW0A 4YLHA 1IAPA 3FB2A 3MJXA 4CI3B 1D0ZA 1MNDA 2LM9A 2NWBA 2PG8A 1WR6A 2CA5A 1MIWA 3UT5E 4UEMA 2X66A 2NW9A 1BR0A 4H63V 4ERRA 4WBNE 3WI3A 4CQIA 3CX7B 3U78A 3LK3B 3O4XE 4O4LE 5F3JA 3CX8B 2Q9QB 2XAGB 2A3DA 4H63H 4KBMB 2E9XD 4H9PC 3KBUA 2ACXA 3N2OA 3EVYA 2KNDA 4IE4A 4MBQA 2VKDA 5FY7A 3BK9A 4JEHB 3KDSE 5HXRA 4O2BE 2CWYA 5LCYA 2I59A 4OYJA 2N1GA 3NZPA 2K24A 3JC6D 4YHJA 4IHJE 5HAXA 5LBMA 3CKDA 4I50E 3ONXA 5EK2A 3RKOA 4KUMB 2C0SA 3VU7H 2Z6EA 1IJ5A 2N9DA 2X68A 5GONE 2BZBA 3ZYLA 1NAFA 3D0TA 2YEVC 3CPZA 3IHRA 3L3PA 3VHLA 2JMKA 2MOZA 3GMIA 4X1KE 5ETWA 4L5GA 2X9YA 2CWOA 1AJ3A 5LHHB 3O1JA 1KNZA 4G63A 2H7VC 3HA4A 4PNIA 3C4WA 1MMAA 4ZS2A 3FBZA 3HKBE 1HFAA 2V1DB 3S4UA 2HH7A 5FMNA 3ZJ2A 4G2AA 2E9XB 2V7IA 1MMNA 3GWHA 4EIWA 2BVMA 3RH3A 4PFPA 2W62A 4ANJA 5JDMA 4AKGA 1MIYA 4FI5A 5E0OA 2Y8DA 2WMNA 2LSYA 3HKEE 3ZEFB 4H9RC 1HF8A 5L3EB 4IDZA 5JREA 3N9QA 5EZYE 2Y48B 2DHRA 3GN5A 5HXHA 2JMHA 3PUSA 3PUGA 2DWGA 4WBOA 5JRCA 1Y64B 4H9QC 2C5JA 3KINB 3UUMA 4I43B 2LSGA 3BQLA 4MHCA 5FXZA 5J1GA 2XUEA 4EYYR 4EOZB 2ODVA 2N2NA 2LOPA 3F57A 2CXFA 1MNEA 1FMVA 3ETUA 3OYZA 4UXNB 5JRCB 1BR2A 4ZI2C 3P7IA 3DJBA 4QXHB 3B13A 5DABA 2LEHA 4IE6A 5JDGA 5LBQB 3AAIA 5LGUB 3N2KE 2C5KT 3Q2MA 4YJ3E 2UXNB 3PURA 5H6RB 1VRBA 2GK9A 2ZM2A 5JH7E 3PU8A 4YFSA 5FNVE 2D0TA 4P0AA 3ZPOA 4O8SA 2YINA 3WAKA 4QKNA 2LHRA 4GYRA 2KWIB 4PW8A 4TX5A 5LJNA 5JR9C 1T98A 3AVRA 3ZMVB 3O1HA 4GYSA 5HXCA 2JPFA 2IC9A 2X51A 2YK0A 3H37A 3OJAA 2WBLA 5LP6E 1BR1A 4OK0A 3RYIE 4AI6A 4AXPA 4DMWA 5ADXL 2EHOB 2Q9QC 1H7CA 2LOSA 5JR9A 2XTLA 2ZM8A 5J2UE 4UELA 2UXXB 3RRWA 3ESLA 4CXXA 5KX5E 3KBTA 3UUNA 4ZHQE 1D0XA 3M65A 5J2TE 1FMWA 3DTOA 5IYZE 3RC3A 1D1AA 4O4JE 1HX8A 4EZHA 3CVRA 4DVDA 2PJQA 3K3OA 4AKLA 5JR9B 3AA6B 3SWHA 2B1EA 4ZOLE 3C98B 4GK5E 2G0UA 2V7JA 3B57A 3LK2B 5EK4A 2XAJB 3I9YA 2V26A 3ZN0B 4L9IA 4KMCA 4X20E 1HG5A 2QGSA 4IE7A 4IE0A 2E9XC 1LVKA 2ZMAA 3NZQA 3SRZA 1QSDA 2L9QA 2ZLYA 4FJOA 2VKJA 3H3AA 3CWZB 3CQXC 5FXVA 1IJ6A 3ZLIA 4UVCB 2E9XA 3RRCA 4C90A 3EDVA 4PK5A 5IHYA 3ZYKA 5AFUL 1WYBA 2VB6A 1OXZA 3JC6C 4KP3C 2KWHA 1U4QA 2W0GA 4ZI2D 4ZS3A 4HFVA 3RPUA 5LJMA 3E0ZA 4NUUA 4PJLA 5KDMC 1B7TA 3N2GE 3C64A 4AQGA 5DJQC 2Q9QD 3V5UA 4IIJE 5DQVA 4EAHA 2CMRA 2CLYB 4YJ2E 2ZM0A 5LG4A 4OFZA 4PK6A 1CUNA 2KLQA 4X1IE 3C4XA 4ZI3C 5HWXA 5HXEA 2BVLA 2WWUA 4PJMA 5L2LA 5FY0A 3Q5XA 4GK0E 5BMVE 4PJJA 2D2SA 2IW5B 5H6QB 4BAYB 3ETVA 3LG7A 4ZI7E 4X1YE 1X79A 4O4HE 3LK42 3NBXX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KMG P;  3NRY A;  3NRX A; 
#chains in the Genus database with same CATH topology
 2YOE A;  3LFM A;  4MLK A;  2NTX A;  4DUY T;  2NW8 A;  4A56 A;  2XY8 B;  1HNZ T;  3CQC B;  1SA0 E;  1YKE B;  2MYS A;  4F8H A;  4KI0 F;  4E7Z A;  4NPP A;  4HEA A;  1SHZ C;  5DQW A;  3FXE B;  3IF8 B;  5FVK A;  4H9S E;  3MK7 C;  4DMV A;  3N9O A;  3W15 B;  2E8I A;  5L3C B;  3A8Y C;  2KZ7 B;  2XQ7 A;  5JDF A;  3VKG A;  2HPL A;  3AB3 B;  2KT9 A;  5FXW A;  5JDN A;  3G06 A;  4UF0 B;  3KV4 A;  4JI6 T;  1MMD A;  3AA1 B;  2LRL A;  1YQ3 A;  3MKD A;  3OYX A;  2CHO A;  4CXW A;  1YD8 G;  4HWF A;  2DI4 A;  1ZV4 X;  5CFB A;  2UUC T;  2LSK A;  2DLR A;  2K5B B;  3T8O A;  4B3S T;  2A2F X;  3BQI A;  1FEW A;  3SFD A;  1UCU A;  3JAD A;  3HR0 A;  4QH4 A;  4AKH A;  4ILB A;  3R84 B;  5JVD E;  1WR0 A;  2DNX A;  4MFR A;  3EUH A;  4O2A E;  3X1D A;  3CML A;  4B6X A;  1EZ3 A;  3ZJ1 A;  3K1S A;  3NRY A;  4JV5 T;  4YTP A;  3UTK A;  1E1H B;  5KMG P;  4JLE A;  1KK7 A;  1O3X A;  4ASK A;  5C8Y E;  5JDH A;  4H9O C;  1IZN B;  1FIO A;  4P1N A;  3V5S A;  4P0B A;  2IDO B;  2BBJ A;  2QRX A;  2LHN A;  5AQL B;  3RX6 A;  4BA9 A;  4A97 A;  5HEH A;  5HEG A;  3M3Z B;  4XZC A;  5AQM B;  5L3G B;  3FZM B;  4XAX B;  3VR9 A;  1J1J A;  2JJ9 A;  5JQG E;  4ZZB A;  4A5X A;  1L0V A;  2H3R A;  3AE4 A;  2VAS A;  2WU5 A;  3I0Q A;  4IL4 A;  4UVB B;  1BR4 A;  5LHI B;  4DR4 T;  3LJC A;  2XQ9 A;  4BJN A;  2W67 A;  2XQ6 A;  3AEC A;  3C51 A;  2V8S V;  3KV9 A;  2B76 A;  2HHH T;  2W2U A;  4IDO A;  4TZ4 C;  1NWM X;  3ZC1 A;  5LGN B;  3MZK B;  2W00 A;  4WNK A;  4V1A v;  4EGW A;  1IBL T;  2X67 A;  4I55 E;  4DBR A;  2E2A A;  3QUJ A;  5FP3 A;  2SPC A;  1MIV A;  1ZP0 A;  3UQ7 A;  2D5U A;  2D0U A;  2R6G F;  1UX4 A;  2YKS A;  3QNU A;  2CE7 A;  5FY1 A;  2XQY A;  3UUX B;  2ODU A;  4C91 A;  2RA1 A;  1S94 A;  3GN5 B;  3ZMU B;  3WAJ A;  3IA3 A;  1LVF A;  5AQN B;  4GOU A;  4GKK T;  3E22 E;  5LG3 A;  3EDU A;  1OWA A;  2XQ3 A;  1QLB A;  2MTQ A;  3I9W A;  3GA8 A;  3RF1 A;  5IUX A;  4YT0 A;  2XQ4 A;  3MXZ A;  1VOM A;  5AQT B;  4F6R C;  4AQF A;  2H7O A;  5JTG A;  2MBG A;  4YSX A;  4U72 A;  3P8C D;  4TUY E;  5LXT E;  3QK6 A;  1ZEE A;  4UIG A;  4LFC T;  5CGM A;  3KV6 A;  3RC8 A;  2IAK A;  4N78 D;  3ZST A;  2WSS V;  4DV0 T;  4QXC B;  2DCF A;  3ZCJ A;  3T1Y T;  2IIU A;  4DBQ A;  4HTE A;  1UX5 A;  2W63 A;  3SS1 A;  3OBV E;  2CEA A;  2JIW A;  2BDE A;  4HWC A;  5AQO B;  5HWY A;  2VVN A;  1KNR A;  2JQQ A;  3ZC0 A;  1SE7 A;  1U5P A;  2JRK A;  4ZI3 D;  3RYH E;  3UFE A;  1J5E T;  1HG2 A;  4K0U A;  5LB7 B;  1JNR A;  2AXD S;  2XAQ B;  3F2E A;  3KVB A;  3PUQ A;  4IDP A;  1FJG T;  2WZH A;  3AVS A;  3PUV F;  4HKA A;  4JEU B;  3BQK A;  5FXX A;  4MAL A;  3N9M A;  5CA1 E;  3RYC E;  4AKI A;  2CLY C;  4UV8 B;  1T7S A;  5FYM A;  3ZCI A;  5A1L A;  5M4Y A;  2K48 A;  4DV1 T;  4UVA B;  3C50 A;  2UXC T;  3JCF A;  2XM2 A;  5EK3 A;  2M67 A;  3VKH A;  3ZYM A;  4EV6 A;  2QYW A;  1G8X A;  3AE6 A;  1G73 A;  4HWH A;  4X5T A;  4EB6 E;  2WDQ A;  4DR3 T;  4LFA T;  2EHO C;  4ILU A;  2UUB T;  3LDQ B;  2DWK A;  5L3B B;  3PU3 A;  1HX1 B;  3ZMZ B;  1YKH B;  3AED A;  4QH5 A;  4JI3 T;  2A9U A;  1ZKE A;  3PUA A;  2PBI A;  3OKQ A;  3I0O A;  2XAS B;  3ZT6 A;  2CBI A;  2UXD T;  2I0M A;  4DO0 A;  3RIF A;  2EHO A;  2EHO D;  1HCI A;  2WZI A;  3O9X A;  2CXL A;  2PFV A;  1UGO A;  2LE8 A;  3PE0 A;  4IDN A;  4B3T T;  4DV4 T;  1MMG A;  2L8K A;  5HCJ A;  3OTO T;  1V9D A;  3ZMS B;  3RHW A;  1S35 A;  4DUZ T;  1W9R A;  3NWI A;  5JDL A;  3UU4 A;  5BR8 T;  4NIQ A;  3FZH B;  4TN7 B;  4NUV A;  4QHO A;  4Z8X A;  4YY3 T;  3ANW B;  2K9A A;  3KVA A;  3PUX F;  4PK4 A;  1WYC A;  4IL9 A;  4EYU A;  3PV0 F;  4DR5 T;  2BBH A;  4HWD A;  4M1P A;  4YTM A;  4YSZ A;  4GIW A;  1XMO T;  1WLX A;  2VL8 A;  2WM9 A;  1LKX A;  4L0R A;  4QXB B;  5HYA A;  3C4Z A;  2ACZ A;  3LSV A;  4Z90 A;  2VKH A;  2WMO A;  3RKG A;  4DND A;  2IML A;  3UUL A;  2FJA A;  3Q9D A;  3K3N A;  3ZN1 B;  3TLT A;  3AEA A;  3A5X A;  3ANW A;  2X9W A;  4P09 A;  4E7S A;  3AAA B;  3PUY F;  3FXD B;  1KNP A;  3P4W A;  3SOL A;  2HN1 A;  2YU1 A;  1KEY A;  3L09 A;  4X66 T;  2XM1 A;  5LYJ E;  4AQF C;  2VKO A;  4Z91 A;  4EXT A;  4JI8 T;  1N32 T;  1ZHC A;  3HKD E;  5LOV E;  1N33 T;  3I1A A;  1HS7 A;  4LF6 T;  1WCR A;  4XBF B;  3N5L A;  3CK6 A;  3CX6 B;  3N9L A;  4EZ4 A;  1XNR T;  4YHH T;  5LA6 E;  4UV9 B;  3TKL B;  4JI5 T;  3HKC E;  4QWN B;  4WW0 A;  4OHF A;  1VCT A;  1WRD A;  3QB5 A;  2RP4 A;  2I6H A;  4ZXL A;  1XMQ T;  4HFC A;  3UUB A;  1XNQ T;  5IWA T;  3AE9 A;  1D1C A;  2V7L A;  4HGA A;  1WFD A;  3RGL A;  3J9X 1;  3RIU A;  4U3C A;  1N34 T;  5F8P A;  2E5V A;  2VUR A;  2W61 A;  2XZE A;  3TLU A;  3HI2 A;  4PFO A;  2VK9 A;  2WB5 A;  3F31 A;  2BG9 C;  2YU2 A;  2FBW A;  4I4T E;  2LSI A;  3ONL C;  5J0Z A;  3AE5 A;  2DL1 A;  2FJB A;  3CQG B;  2K3W A;  4H9N C;  4HN9 A;  4IST A;  3AEG A;  4TWH A;  5LGT B;  2MPK A;  3N9N A;  5L3D B;  2CXD A;  5LMN T;  2C5I T;  5L3F B;  3MA9 A;  1D0Y A;  2Q9Q A;  2CM0 A;  2XJ7 A;  2YN6 A;  3TLW A;  4COF A;  5ABF B;  4DR2 T;  4KHP T;  4A98 A;  2LLY A;  2HPJ A;  2V7K A;  4X65 T;  2UXB T;  2XAF B;  4LMJ A;  2Y6X A;  3PDY A;  2ES0 A;  4I0U A;  3RYF E;  3UU5 A;  4JI2 T;  2M6B A;  2VWA A;  3AEE A;  2CCQ A;  2X9X A;  4IE5 A;  4PJN A;  4HFE A;  4AKR B;  3IBP A;  1OED B;  1D1B A;  2JQ9 A;  4J2C A;  2KXP B;  4O4I E;  5CJ5 A;  1GQE A;  4LF9 T;  4BJM A;  2V5D A;  1J5W A;  2QVA A;  1US7 B;  3K8P C;  3CIR A;  4TV8 E;  5ABF A;  2BG9 B;  1QUU A;  1R8I A;  2A72 A;  2XQA A;  2UU9 T;  1OED E;  1HTJ F;  3NRX A;  3KV5 A;  4JUY A;  5LNK A;  2P9B A;  3LBX A;  2NW7 A;  1XWM A;  4LF4 T;  2KMF A;  2L3L A;  3JAE A;  4B3M T;  4U31 A;  5HEJ A;  3Q5D A;  2IC6 A;  5HEO A;  1CHU A;  5CB4 E;  4CI2 B;  4CZZ B;  4EED A;  4OX9 T;  4QX7 B;  5HXS A;  3AA0 B;  3KFW X;  3TLS A;  4CI1 B;  3UQ4 A;  4U74 A;  3ZMT B;  3FBL A;  2LT3 A;  3PTR B;  2M6I A;  4DR7 T;  4ISS A;  1M7K A;  4TV9 E;  4OYK A;  1Z0P A;  4AIU A;  2LSJ A;  2NTY A;  2WWV A;  4HWI B;  3J7Y q;  3FHN A;  3E08 A;  3ABV A;  3MAC A;  1W0A A;  4QX8 B;  1JNZ A;  2E5L T;  2WAU A;  4IGU A;  3R6N A;  4U2Z A;  3EAB A;  2LJL A;  2NOX A;  3P4R A;  5AQI B;  1I94 T;  3L39 A;  3U3I A;  5TAO A;  2OA5 A;  4PAG A;  3HL6 A;  3IEE A;  3QB5 K;  4HFD A;  2X0L B;  3ONJ A;  5CA0 E;  4CXY A;  2KIN B;  5AQU B;  5KXJ A;  3LBX B;  5LHG B;  2XHE B;  3O1I A;  2J1D G;  3FZL B;  5FVL A;  3QC9 A;  2UUA T;  3Q5W A;  2V7M A;  2QA7 A;  3AAE B;  1LRZ A;  2RPA A;  4HE8 A;  2XAH B;  4ADZ A;  5JDQ A;  2X9H A;  2NP9 A;  3N9P A;  3AA7 B;  3K3Q C;  4UR9 A;  3VRA A;  1NEN A;  4UF0 A;  3DP7 A;  1YW0 A;  4YLH A;  1IAP A;  3FB2 A;  2XQ8 A;  3MJX A;  1D0Z A;  1MND A;  2LM9 A;  2X0Y A;  3UU6 A;  4CI3 B;  1UK5 A;  2NWB A;  1Y01 A;  1WR6 A;  2CA5 A;  2PG8 A;  4YXD A;  1MIW A;  2WQY A;  4IT4 A;  2CRB A;  3UT5 E;  3PJA J;  4UEM A;  2X66 A;  4HFH A;  3RQW A;  2NW9 A;  1BR0 A;  4ILA A;  5LMU T;  3RIU C;  5HEU A;  4H63 V;  4ERR A;  4WBN E;  3WI3 A;  4CQI A;  2LKG A;  3CX7 B;  2YDQ A;  3U78 A;  3LK3 B;  4EEB A;  3O4X E;  3RQU A;  4O4L E;  5F3J A;  3CX8 B;  2LM2 A;  2V6Y B;  2XPK A;  2Q9Q B;  2PTF A;  2XAG B;  2A3D A;  4JBW F;  4H63 H;  3EI0 A;  2E9X D;  4KBM B;  1I6Z A;  4H9P C;  4AIS A;  1NEK A;  2ACX A;  3KBU A;  3EVY A;  3N2O A;  2KND A;  3P4Q A;  4U2Y A;  2FJD A;  4IE4 A;  4TNV A;  1IBK T;  4MBQ A;  4KX6 A;  3A7M A;  4DV6 T;  2VKD A;  5FY7 A;  2JQK A;  3BK9 A;  3KDS E;  4HFI A;  4JEH B;  2CWY A;  4O2B E;  3AEB A;  5HXR A;  5LCY A;  1W0B A;  2V6Y A;  2I59 A;  4OYJ A;  5AQQ B;  2N1G A;  3NZP A;  4DV5 T;  2K24 A;  3JC6 D;  4YHJ A;  1HR0 T;  4IHJ E;  5HAX A;  5LBM A;  3CKD A;  4I50 E;  5AQK B;  3ONX A;  3AE3 A;  5EK2 A;  3RKO A;  1VCS A;  4KUM B;  3FZK B;  3RI5 A;  2C0S A;  3VU7 H;  2Z6E A;  2WDR A;  1IJ5 A;  4KHZ F;  2N9D A;  2X68 A;  5L4E A;  4JYA T;  4QH1 A;  2X0H A;  3UU8 A;  3ZSS A;  5GON E;  2BZB A;  2HN2 A;  3OPC A;  1OED A;  3ZYL A;  4TWF A;  1KF6 A;  1XDP A;  1NAF A;  3D0T A;  2YEV C;  3CPZ A;  3IHR A;  3L3P A;  3VHL A;  1Z8U A;  2JMK A;  2JQH A;  2MOZ A;  3GMI A;  4X1K E;  5ETW A;  4L5G A;  4DV2 T;  2X9Y A;  1XDO A;  2CWO A;  5LHH B;  3RLF F;  3O1J A;  1AJ3 A;  3QOF A;  3NVO A;  2KSR A;  1KNZ A;  1DU2 A;  4G63 A;  2H7V C;  3HA4 A;  4PNI A;  3C4W A;  1MMA A;  4ZS2 A;  2BS3 A;  3FBZ A;  3HKB E;  1HFA A;  2V1D B;  3S4U A;  2HH7 A;  2WU2 A;  2CPT A;  5FMN A;  4G2A A;  2E9X B;  2V7I A;  3ZJ2 A;  1MMN A;  3GWH A;  2BG9 E;  4EIW A;  4DR1 T;  2BVM A;  3RH3 A;  2YDS A;  2W62 A;  3P50 A;  3AE7 A;  4PFP A;  3UU3 A;  4ANJ A;  2LRK A;  5JDM A;  4AKG A;  1MIY A;  2FJE A;  4FI5 A;  3P4S A;  5E0O A;  1N36 T;  2Y8D A;  2WMN A;  2BKN A;  2LSY A;  3AXJ B;  3HKE E;  3ZEF B;  4H9R C;  1HF8 A;  4CN6 A;  5C2T A;  5L3E B;  2D9D A;  4IDZ A;  5JRE A;  3N9Q A;  5EZY E;  2Y48 B;  2DHR A;  3GN5 A;  5HXH A;  2JMH A;  3PUS A;  3PUG A;  2DWG A;  4WBO A;  5JRC A;  2WCA A;  4GKJ T;  2J4G A;  4LF5 T;  1Y64 B;  3Q5E A;  4H9Q C;  3FZF B;  5ABH A;  2C5J A;  3KIN B;  3UUM A;  4I43 B;  2LSG A;  3BQL A;  4MHC A;  5AQV B;  5FXZ A;  5J1G A;  2XUE A;  4EYY R;  4EOZ B;  2ODV A;  2N2N A;  3ZKR A;  2LOP A;  2MAW A;  2CXF A;  2VL0 A;  3F57 A;  1MNE A;  1FMV A;  3ETU A;  3OYZ A;  4UXN B;  5JRC B;  1BR2 A;  4ZI2 C;  3P7I A;  1T8B A;  5F5W A;  3DJB A;  2H88 A;  4QXH B;  1T72 A;  3B13 A;  5DAB A;  1UUS A;  2LEH A;  2V6X A;  3AE2 A;  4IE6 A;  3VR8 A;  5JDG A;  5LBQ B;  3AAI A;  3JAF A;  3N2K E;  5AFU L;  5LGU B;  2C5K T;  3Q2M A;  4YJ3 E;  2UXN B;  2YDR A;  3SFE A;  4WZX A;  5HCM A;  3PUR A;  5H6R B;  1VRB A;  2GK9 A;  2ZM2 A;  4LF7 T;  5JH7 E;  3PU8 A;  4LML A;  4YFS A;  2BS4 A;  5FNV E;  5FL1 A;  2D0T A;  4P0A A;  3ZPO A;  2J62 A;  4O8S A;  2YIN A;  5L4H A;  3WAK A;  4QKN A;  2LHR A;  4K0K T;  4GYR A;  2KWI B;  1W09 A;  5FL0 A;  4PW8 A;  4JI0 T;  4JI7 T;  4TX5 A;  3NKZ A;  4Q25 A;  5JR9 C;  5LJN A;  1T98 A;  3AVR A;  3ZMV B;  3O1H A;  4GYS A;  2BG9 A;  2JPF A;  5HXC A;  2IC9 A;  2X51 A;  2YK0 A;  3H37 A;  3OJA A;  2WBL A;  5L47 A;  5LP6 E;  4NXN T;  2F4V T;  1BR1 A;  1ZOY A;  4OK0 A;  3RYI E;  5C3J A;  4AI6 A;  4AXP A;  2W4X A;  2J47 A;  3AE8 A;  4DMW A;  5ADX L;  1HNW T;  2BKO A;  2EHO B;  2Q9Q C;  1H7C A;  2LOS A;  2WDV A;  2XTL A;  2ZM8 A;  5AQP B;  5JR9 A;  5J2U E;  4ILC A;  1X9B A;  2UXX B;  4UEL A;  3RRW A;  4U33 A;  4AQY T;  3ESL A;  4CXX A;  5KX5 E;  2CBJ A;  3KBT A;  3VRB A;  2WS3 A;  3UUN A;  1D0X A;  3M65 A;  4ZHQ E;  2OV9 A;  5J2T E;  1FMW A;  2WP9 A;  3DTO A;  5IYZ E;  1YQ4 A;  3RC3 A;  2VQE T;  1D1A A;  3PJA A;  3PUZ F;  4O4J E;  1HX8 A;  4TWD A;  4WYV A;  3H3M A;  4EZH A;  2VQF T;  3CVR A;  4LMK A;  3L8R A;  5AQJ B;  4DVD A;  2PJQ A;  3K3O A;  4AKL A;  5JR9 B;  2BKP A;  3AA6 B;  4HFB A;  1E2A A;  5AQH B;  3SWH A;  3ZT7 A;  4CN4 A;  2B1E A;  4ZOL E;  3C98 B;  4ZEY A;  4GK5 E;  3AE1 A;  3UFG A;  2G0U A;  2V7J A;  3B57 A;  4IDQ A;  2LKH A;  4B3R T;  3AXJ A;  4LFB T;  3LK2 B;  5EK4 A;  2XAJ B;  3I9Y A;  2V26 A;  3ZN0 B;  4L9I A;  4KMC A;  4X20 E;  1HG5 A;  2QGS A;  4IE7 A;  4IE0 A;  2E9X C;  1LVK A;  1UUR A;  2NR4 A;  2ZMA A;  3NZQ A;  3TLV A;  3SRZ A;  1M62 A;  1QSD A;  2CHN A;  2L9Q A;  2ZLY A;  4FJO A;  4ZZC A;  2VKJ A;  1KFY A;  3H3A A;  4IRE A;  3CWZ B;  4X62 T;  2VVS A;  3P4P A;  1E7P A;  3CQX C;  3T1H T;  5FXV A;  1HNX T;  4TNW A;  1IJ6 A;  3ZLI A;  4YTN A;  2V5C A;  4UVC B;  5ABG A;  2E9X A;  3RRC A;  4C90 A;  3EDV A;  3PUW F;  5AQG B;  4PK5 A;  5IHY A;  3AEF A;  4LF8 T;  1XZY A;  3EAM A;  5FKY A;  1WYB A;  3ZYK A;  2VB6 A;  4DID B;  1OXZ A;  3JC6 C;  2XSA A;  2KWH A;  4KP3 C;  5AQF B;  2W66 A;  2XQ5 A;  2ZM6 T;  4DR6 T;  4DV3 T;  1U4Q A;  2W0G A;  4ZI2 D;  4ZS3 A;  4HFV A;  2H89 A;  4U7Y A;  3RPU A;  5LJM A;  4JI1 T;  3E0Z A;  4NUU A;  3EHZ A;  4PJL A;  5KDM C;  1B7T A;  3N2G E;  3C64 A;  5AQR B;  4AQG A;  5DJQ C;  2Q9Q D;  3B5M A;  3V5U A;  4NXM T;  4IIJ E;  1YXR A;  2FUP A;  5DQV A;  4EAH A;  5AQS B;  2CMR A;  4X64 T;  1IBM T;  2WY2 A;  2CLY B;  2IHR 1;  2IUB A;  4YJ2 E;  2ZM0 A;  3OVU A;  4OFZ A;  5LG4 A;  4U7I A;  2BS2 A;  4PK6 A;  4CN1 A;  1CUN A;  2KLQ A;  4X1I E;  3C4X A;  4ZI3 C;  5HWX A;  4DV7 T;  5HXE A;  1SUM B;  2BVL A;  2WWU A;  4PJM A;  5L2L A;  5FY0 A;  3Q5X A;  4GK0 E;  3ZT5 A;  5BMV E;  2OLT A;  4PJJ A;  2XSB A;  5ABE A;  2D2S A;  2IW5 B;  4YSY A;  5H6Q B;  1OED C;  3ETV A;  3LG7 A;  3RIA A;  4BAY B;  4X1Y E;  1X79 A;  2AE9 A;  4O4H E;  3LK4 2;  4ZI7 E;  3NBX X;  4JI4 T; 
#chains in the Genus database with same CATH homology
 3LFM A;  4MLK A;  2NTX A;  2NW8 A;  4A56 A;  3CQC B;  1SA0 E;  1YKE B;  2MYS A;  5DQW A;  4HEA A;  1SHZ C;  4DMV A;  3FXE B;  3IF8 B;  4H9S E;  3MK7 C;  3N9O A;  3W15 B;  2E8I A;  5L3C B;  2KZ7 B;  5JDF A;  3VKG A;  2HPL A;  3AB3 B;  2KT9 A;  5FXW A;  5JDN A;  4UF0 B;  3KV4 A;  1MMD A;  3AA1 B;  3MKD A;  3OYX A;  4CXW A;  1YD8 G;  2DI4 A;  1ZV4 X;  2LSK A;  2DLR A;  2K5B B;  3T8O A;  2A2F X;  3BQI A;  1FEW A;  1UCU A;  3HR0 A;  4AKH A;  3R84 B;  5JVD E;  4MFR A;  2DNX A;  4O2A E;  3EUH A;  3CML A;  4B6X A;  1EZ3 A;  3ZJ1 A;  3NRY A;  3UTK A;  1E1H B;  5KMG P;  4JLE A;  1KK7 A;  1O3X A;  4ASK A;  5C8Y E;  5JDH A;  4H9O C;  1IZN B;  1FIO A;  3V5S A;  4P0B A;  2LHN A;  4BA9 A;  3RX6 A;  4XZC A;  5L3G B;  4XAX B;  2JJ9 A;  5JQG E;  2H3R A;  2VAS A;  3I0Q A;  4UVB B;  1BR4 A;  5LHI B;  3LJC A;  4BJN A;  3C51 A;  3KV9 A;  4TZ4 C;  1NWM X;  3ZC1 A;  5LGN B;  3MZK B;  2W00 A;  4WNK A;  4V1A v;  2X67 A;  4I55 E;  4DBR A;  3QUJ A;  5FP3 A;  2SPC A;  1MIV A;  2D5U A;  2D0U A;  1UX4 A;  2CE7 A;  5FY1 A;  2XQY A;  3UUX B;  2ODU A;  4C91 A;  2RA1 A;  1S94 A;  3GN5 B;  3ZMU B;  3WAJ A;  1LVF A;  4GOU A;  3E22 E;  3EDU A;  1OWA A;  2MTQ A;  3I9W A;  3GA8 A;  3MXZ A;  1VOM A;  4F6R C;  4AQF A;  2H7O A;  2MBG A;  4U72 A;  3P8C D;  4TUY E;  5LXT E;  3QK6 A;  1ZEE A;  4UIG A;  3KV6 A;  3RC8 A;  2IAK A;  4N78 D;  2WSS V;  4QXC B;  2DCF A;  3ZCJ A;  4DBQ A;  4HTE A;  1UX5 A;  2W63 A;  3SS1 A;  3OBV E;  2CEA A;  5HWY A;  2BDE A;  2JQQ A;  3ZC0 A;  1U5P A;  2JRK A;  4ZI3 D;  3RYH E;  3UFE A;  1HG2 A;  4K0U A;  2XAQ B;  3F2E A;  3KVB A;  3PUQ A;  3AVS A;  4HKA A;  4JEU B;  5FXX A;  3BQK A;  5CA1 E;  4MAL A;  3N9M A;  4AKI A;  3RYC E;  2CLY C;  4UV8 B;  5FYM A;  3ZCI A;  5A1L A;  5M4Y A;  2K48 A;  4UVA B;  3C50 A;  5EK3 A;  2M67 A;  3VKH A;  3ZYM A;  1G8X A;  1G73 A;  4EB6 E;  2EHO C;  4ILU A;  2DWK A;  5L3B B;  3PU3 A;  3ZMZ B;  1YKH B;  1ZKE A;  3PUA A;  2PBI A;  3OKQ A;  3I0O A;  2XAS B;  4DO0 A;  2EHO A;  2EHO D;  1HCI A;  3O9X A;  2CXL A;  2PFV A;  2LE8 A;  3PE0 A;  1MMG A;  2L8K A;  1V9D A;  3ZMS B;  1S35 A;  5JDL A;  4TN7 B;  4Z8X A;  4NUV A;  4QHO A;  3ANW B;  2K9A A;  3KVA A;  4PK4 A;  1WYC A;  4EYU A;  4M1P A;  4GIW A;  1WLX A;  2VL8 A;  2WM9 A;  1LKX A;  4L0R A;  4QXB B;  5HYA A;  3C4Z A;  2VKH A;  2WMO A;  4DND A;  3UUL A;  3Q9D A;  3K3N A;  3ZN1 B;  3A5X A;  3ANW A;  2X9W A;  4P09 A;  4E7S A;  3AAA B;  3FXD B;  3SOL A;  2YU1 A;  3L09 A;  5LYJ E;  4AQF C;  2VKO A;  4EXT A;  1ZHC A;  3HKD E;  5LOV E;  1HS7 A;  3I1A A;  4XBF B;  3N5L A;  3CX6 B;  3N9L A;  4EZ4 A;  5LA6 E;  4UV9 B;  3TKL B;  3HKC E;  4QWN B;  4WW0 A;  4OHF A;  1WRD A;  2RP4 A;  1D1C A;  2V7L A;  4HGA A;  3J9X 1;  5F8P A;  2W61 A;  3HI2 A;  4PFO A;  3F31 A;  2VK9 A;  4I4T E;  2YU2 A;  2LSI A;  3CQG B;  4H9N C;  4HN9 A;  4IST A;  5LGT B;  3N9N A;  5L3D B;  2CXD A;  2C5I T;  5L3F B;  3MA9 A;  1D0Y A;  2Q9Q A;  2CM0 A;  2V7K A;  2HPJ A;  2XAF B;  2Y6X A;  3PDY A;  2ES0 A;  3RYF E;  2VWA A;  4IE5 A;  2CCQ A;  2X9X A;  4PJN A;  4AKR B;  3IBP A;  1D1B A;  4J2C A;  4O4I E;  2KXP B;  4BJM A;  1US7 B;  3K8P C;  4TV8 E;  1QUU A;  2A72 A;  1HTJ F;  3NRX A;  3KV5 A;  4JUY A;  5LNK A;  2P9B A;  3LBX A;  2NW7 A;  2KMF A;  2L3L A;  2IC6 A;  4CI2 B;  5CB4 E;  4CZZ B;  4QX7 B;  5HXS A;  3AA0 B;  3KFW X;  4CI1 B;  4U74 A;  3ZMT B;  3FBL A;  2LT3 A;  3PTR B;  4ISS A;  4TV9 E;  4OYK A;  1Z0P A;  2LSJ A;  2NTY A;  3J7Y q;  3FHN A;  3E08 A;  3MAC A;  4QX8 B;  2WAU A;  4IGU A;  3R6N A;  2LJL A;  2NOX A;  3U3I A;  5TAO A;  2OA5 A;  4PAG A;  3HL6 A;  3IEE A;  2X0L B;  5CA0 E;  4CXY A;  2KIN B;  5LHG B;  3LBX B;  2XHE B;  3O1I A;  2J1D G;  3QC9 A;  3Q5W A;  2V7M A;  2QA7 A;  3AAE B;  1LRZ A;  4HE8 A;  2XAH B;  4ADZ A;  5JDQ A;  2X9H A;  2NP9 A;  3N9P A;  3AA7 B;  3K3Q C;  4UF0 A;  4E7Z A;  3DP7 A;  1YW0 A;  4YLH A;  1IAP A;  3FB2 A;  3MJX A;  4CI3 B;  1D0Z A;  1MND A;  2LM9 A;  2NWB A;  2PG8 A;  1WR6 A;  2CA5 A;  1MIW A;  3UT5 E;  4UEM A;  2X66 A;  2NW9 A;  1BR0 A;  4H63 V;  4ERR A;  4WBN E;  3WI3 A;  4CQI A;  3CX7 B;  3U78 A;  3LK3 B;  3O4X E;  4O4L E;  5F3J A;  3CX8 B;  2Q9Q B;  2XAG B;  2A3D A;  4H63 H;  4KBM B;  2E9X D;  4H9P C;  3KBU A;  2ACX A;  3N2O A;  3EVY A;  2KND A;  4IE4 A;  4MBQ A;  2VKD A;  5FY7 A;  3BK9 A;  4JEH B;  3KDS E;  5HXR A;  4O2B E;  2CWY A;  5LCY A;  2I59 A;  4OYJ A;  2N1G A;  3NZP A;  2K24 A;  3JC6 D;  4YHJ A;  4IHJ E;  5HAX A;  5LBM A;  3CKD A;  4I50 E;  3ONX A;  5EK2 A;  3RKO A;  4KUM B;  2C0S A;  3VU7 H;  2Z6E A;  1IJ5 A;  2N9D A;  2X68 A;  5GON E;  2BZB A;  3ZYL A;  1NAF A;  3D0T A;  2YEV C;  3CPZ A;  3IHR A;  3L3P A;  3VHL A;  2JMK A;  2MOZ A;  3GMI A;  4X1K E;  5ETW A;  4L5G A;  2X9Y A;  2CWO A;  1AJ3 A;  5LHH B;  3O1J A;  1KNZ A;  4G63 A;  2H7V C;  3HA4 A;  4PNI A;  3C4W A;  1MMA A;  4ZS2 A;  3FBZ A;  3HKB E;  1HFA A;  2V1D B;  3S4U A;  2HH7 A;  5FMN A;  3ZJ2 A;  4G2A A;  2E9X B;  2V7I A;  1MMN A;  3GWH A;  4EIW A;  2BVM A;  3RH3 A;  4PFP A;  2W62 A;  4ANJ A;  5JDM A;  4AKG A;  1MIY A;  4FI5 A;  5E0O A;  2Y8D A;  2WMN A;  2LSY A;  3HKE E;  3ZEF B;  4H9R C;  1HF8 A;  5L3E B;  4IDZ A;  5JRE A;  3N9Q A;  5EZY E;  2Y48 B;  2DHR A;  3GN5 A;  5HXH A;  2JMH A;  3PUS A;  3PUG A;  2DWG A;  4WBO A;  5JRC A;  1Y64 B;  4H9Q C;  2C5J A;  3KIN B;  3UUM A;  4I43 B;  2LSG A;  3BQL A;  4MHC A;  5FXZ A;  5J1G A;  2XUE A;  4EYY R;  4EOZ B;  2ODV A;  2N2N A;  2LOP A;  3F57 A;  2CXF A;  1MNE A;  1FMV A;  3ETU A;  3OYZ A;  4UXN B;  5JRC B;  1BR2 A;  4ZI2 C;  3P7I A;  3DJB A;  4QXH B;  3B13 A;  5DAB A;  2LEH A;  4IE6 A;  5JDG A;  5LBQ B;  3AAI A;  5LGU B;  3N2K E;  2C5K T;  3Q2M A;  4YJ3 E;  2UXN B;  3PUR A;  5H6R B;  1VRB A;  2GK9 A;  2ZM2 A;  5JH7 E;  3PU8 A;  4YFS A;  5FNV E;  2D0T A;  4P0A A;  3ZPO A;  4O8S A;  2YIN A;  3WAK A;  4QKN A;  2LHR A;  4GYR A;  2KWI B;  4PW8 A;  4TX5 A;  5LJN A;  5JR9 C;  1T98 A;  3AVR A;  3ZMV B;  3O1H A;  4GYS A;  5HXC A;  2JPF A;  2IC9 A;  2X51 A;  2YK0 A;  3H37 A;  3OJA A;  2WBL A;  5LP6 E;  1BR1 A;  4OK0 A;  3RYI E;  4AI6 A;  4AXP A;  4DMW A;  5ADX L;  2EHO B;  2Q9Q C;  1H7C A;  2LOS A;  5JR9 A;  2XTL A;  2ZM8 A;  5J2U E;  4UEL A;  2UXX B;  3RRW A;  3ESL A;  4CXX A;  5KX5 E;  3KBT A;  3UUN A;  4ZHQ E;  1D0X A;  3M65 A;  5J2T E;  1FMW A;  3DTO A;  5IYZ E;  3RC3 A;  1D1A A;  4O4J E;  1HX8 A;  4EZH A;  3CVR A;  4DVD A;  2PJQ A;  3K3O A;  4AKL A;  5JR9 B;  3AA6 B;  3SWH A;  2B1E A;  4ZOL E;  3C98 B;  4GK5 E;  2G0U A;  2V7J A;  3B57 A;  3LK2 B;  5EK4 A;  2XAJ B;  3I9Y A;  2V26 A;  3ZN0 B;  4L9I A;  4KMC A;  4X20 E;  1HG5 A;  2QGS A;  4IE7 A;  4IE0 A;  2E9X C;  1LVK A;  2ZMA A;  3NZQ A;  3SRZ A;  1QSD A;  2L9Q A;  2ZLY A;  4FJO A;  2VKJ A;  3H3A A;  3CWZ B;  3CQX C;  5FXV A;  1IJ6 A;  3ZLI A;  4UVC B;  2E9X A;  3RRC A;  4C90 A;  3EDV A;  4PK5 A;  5IHY A;  3ZYK A;  5AFU L;  1WYB A;  2VB6 A;  1OXZ A;  3JC6 C;  4KP3 C;  2KWH A;  1U4Q A;  2W0G A;  4ZI2 D;  4ZS3 A;  4HFV A;  3RPU A;  5LJM A;  3E0Z A;  4NUU A;  4PJL A;  5KDM C;  1B7T A;  3N2G E;  3C64 A;  4AQG A;  5DJQ C;  2Q9Q D;  3V5U A;  4IIJ E;  5DQV A;  4EAH A;  2CMR A;  2CLY B;  4YJ2 E;  2ZM0 A;  5LG4 A;  4OFZ A;  4PK6 A;  1CUN A;  2KLQ A;  4X1I E;  3C4X A;  4ZI3 C;  5HWX A;  5HXE A;  2BVL A;  2WWU A;  4PJM A;  5L2L A;  5FY0 A;  3Q5X A;  4GK0 E;  5BMV E;  4PJJ A;  2D2S A;  2IW5 B;  5H6Q B;  4BAY B;  3ETV A;  3LG7 A;  4ZI7 E;  4X1Y E;  1X79 A;  4O4H E;  3LK4 2;  3NBX X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...