5KMGP

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
128
structure length
128
Chain Sequence
GAAALKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 57
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1520 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5kmgP00
3NRYA 5KMGP 3NRXA
chains in the Genus database with same CATH superfamily
1WFDA 4O4LE 2NP9A 2KZ7B 4EOZB 1I6ZA 4V1Av 5KDMC 2CE7A 5KMGP 2H3RA 3NRYA 4ILAA 2MTQA 4MALA 4ZXLA 4P0BA 4JI5T 5JRCA 3ABVA 3RRCA 5AQSB 5LGUB 1OWAA 1X9BA 2OLTA 3RIUC 5EK4A 3VHLA 2LM2A 5JDMA 3WAJA 1S94A 2CPTA 3NZQA 2MYSA 3PU8A 5AQQB 4AQYT 3E22E 4BJNA 4QHOA 2WDRA 5CGMA 4UEMA 4KUMB 2AXDS 1YQ3A 4X1IE 2A72A 4MLKA 4EV6A 5LMUT 5AQMB 3RRWA 3MJXA 1ZP0A 2ZM2A 2LEHA 4LFAT 3EAMA 4WNKA 4DBQA 5AQFB 4NXNT 4PFPA 3PUZF 4EZ4A 2PBIA 3LG7A 2WS3A 2UUCT 3JCFA 2BS3A 3ANWB 3HR0A 3AEDA 4AQFA 3PV0F 4LFCT 5IHYA 3TLVA 4A97A 2YEVC 4YXDA 4HE8A 1W09A 3VU7H 2UUAT 4LF4T 2BBJA 4KX6A 1LRZA 3VRAA 1MIYA 3PU3A 3IF8B 1D1AA 4ISTA 4U7IA 4AIUA 5HXHA 3QOFA 5AQLB 4MHCA 3RGLA 3HA4A 3KVAA 5KX5E 1IAPA 1YKEB 3KV5A 1MMGA 4HFBA 4JEUB 4K0UA 2BG9B 5HEGA 3P4WA 2B76A 5AQNB 5AQGB 4QKNA 2CMRA 1GQEA 4I43B 4QH4A 3RIAA 2RA1A 4H63V 4U33A 2BDEA 4YTMA 3AEBA 1KFYA 2ACZA 3A8YC 3ZMTB 3VKHA 2FUPA 3I9YA 4GYSA 4UV9B 1WR0A 3EDUA 3Q5EA 4QH5A 1KK7A 1JNZA 2QRXA 4OX9T 2QGSA 2YU1A 1US7B 3WI3A 4PK4A 1QLBA 2X67A 2L3LA 5JDHA 2PJQA 1WLXA 4E7SA 1KNRA 4I50E 3EVYA 4GOUA 4Z8XA 4LMJA 3RYCE 4B6XA 2CA5A 3AE6A 4EEBA 4HWCA 3RYIE 4HFEA 4H63H 3C64A 3ONLC 3UFEA 4B3RT 2FJEA 3N2KE 2XTLA 2V5CA 1ZKEA 3VRBA 2IC6A 1LKXA 3LDQB 4E7ZA 2CXLA 2DL1A 2EHOD 3FBZA 1L0VA 3OYZA 5FXVA 2UXBT 3A5XA 2BZBA 2M6IA 3T1HT 5CA1E 1J5WA 3PUYF 5L3BB 3CX7B 2NR4A 3ANWA 4KHPT 2LE8A 2W63A 4C90A 4HFHA 4O4JE 3UTKA 3VKGA 4QXHB 1M62A 2J4GA 3E0ZA 1XMOT 4UR9A 2LSJA 1OEDB 1ZEEA 3GN5B 3ZT7A 3AE8A 3RKGA 5AQOB 3W15B 1W9RA 3PDYA 2RPAA 2NW7A 3FBLA 5AQTB 1UUSA 4X66T 1V9DA 1HG5A 1YD8G 4JI7T 3O9XA 2UXCT 3B5MA 2Y8DA 2VURA 4BJMA 2W67A 2YN6A 4YSYA 5J1GA 3BQLA 2V26A 2N9DA 4PW8A 4EGWA 5L3FB 4HGAA 1KNZA 4DUYT 4P09A 2WBLA 4LF7T 1T72A 4AKHA 2KXPB 3ZT5A 3ZMUB 2WZIA 4X20E 2XASB 3OBVE 3CX6B 3U78A 4F8HA 2DWGA 3UU3A 5JRCB 4TV8E 3CKDA 3TKLB 1QUUA 4DV0T 2KT9A 2BVLA 2H7VC 2XQ6A 2W4XA 5ABHA 2DHRA 4AKGA 3PJAA 3RC8A 2CXDA 3AEEA 1KEYA 4YLHA 5LBQB 4HWFA 2V6YA 3KVBA 4PJLA 2J47A 4TWFA 1FEWA 4IIJE 3AVSA 4ZS2A 5LHIB 2IC9A 2Z6EA 3RH3A 4ZZCA 1S35A 3VR9A 4YT0A 2YDQA 2W62A 3EI0A 3GA8A 4TNWA 5LA6E 5HEHA 5ABFB 1OXZA 2JMHA 2Q9QA 4U2YA 1BR4A 3OYXA 2ZM6T 1CUNA 2CM0A 2WDQA 2XY8B 5LOVE 4HFIA 4HFVA 3D0TA 5HWXA 1D1CA 1U4QA 2XHEB 5JDFA 4EZHA 4ZI2D 5EK2A 5LYJE 2X51A 4DMVA 3O1IA 2DLRA 1WYBA 2IAKA 5AQHB 4DNDA 2VQET 2V7IA 3H37A 4XAXB 5L2LA 1OEDA 1VCSA 2BS2A 2FJDA 2W00A 3UUBA 3N5LA 4PAGA 5L4EA 4PJJA 2CWYA 2X66A 3QK6A 5HWYA 2XM1A 3Q2MA 3P7IA 4CI1B 4X62T 3CIRA 3ETVA 4O8SA 4DV7T 2DNXA 1ZV4X 2QVAA 2CRBA 4FI5A 4P1NA 5J0ZA 3N9MA 4IDZA 3RKOA 2HPJA 3N9OA 2BVMA 4DO0A 2HPLA 3R6NA 2DI4A 2C0SA 4NUVA 4LF6T 2E9XB 2K24A 2D0UA 2BKNA 2V5DA 4IREA 4A5XA 1T98A 1J1JA 2J62A 3DTOA 1Y01A 4PJMA 5DABA 1VRBA 3OVUA 5JR9B 3RQUA 4CN1A 4DR4T 5LJNA 1IBKT 3AE9A 2D9DA 4IE4A 3FHNA 4GK0E 4IE5A 1UURA 2LKHA 4YHJA 4YTNA 4ZI2C 1HR0T 2KWIB 4KBMB 4B3MT 4JI3T 3C4WA 3B13A 5CA0E 4GKJT 1BR1A 1T7SA 1MNEA 2ODUA 4H9PC 3FXEB 4L5GA 4H9QC 3UU8A 2Y48B 5HXSA 2XZEA 3L39A 2CXFA 3HI2A 2XAFB 3JADA 3O1JA 3ZJ1A 2XQ7A 3TLSA 4NPPA 2Y6XA 3QC9A 4QXCB 4IDQA 2WWUA 2WB5A 5ETWA 4AKIA 2BG9A 4EYUA 5H6QB 5C3JA 4M1PA 2F4VT 2I59A 2WSSV 2LT3A 5HEUA 2BBHA 2JQQA 2VKHA 3AAAB 2P9BA 3QUJA 5JR9A 2NW9A 4HFDA 3L8RA 3N9NA 4KMCA 3G06A 3AAEB 1VOMA 3TLWA 1ZHCA 2LRLA 4HWHA 4IDPA 3N9PA 3FZFB 2BKOA 2WAUA 3I0QA 3Q5XA 5JDNA 3E08A 4O4IE 4AKLA 5LXTE 1HNXT 2ODVA 2XM2A 5ABEA 2FJBA 3P4QA 2CEAA 2XQ4A 1E7PA 4IE0A 4UVCB 5LG4A 5FL0A 2EHOC 2IW5B 4XBFB 3K3QC 1HG2A 4U31A 5LGTB 1MMDA 2Q9QD 4ILCA 1JNRA 1SUMB 1D0XA 2NTXA 3LK3B 3L3PA 3UU5A 2JIWA 2B1EA 3K3OA 3UUMA 2V7LA 5LCYA 2A3DA 5FY1A 3KV6A 3H3MA 3HKEE 4HEAA 5HAXA 2KWHA 3SRZA 3ZMZB 2H7OA 4AISA 4QX7B 2A2FX 3ZYMA 2L8KA 3ZEFB 2GK9A 2LM9A 5FVKA 3UT5E 2XSBA 4EEDA 4JV5T 1UCUA 2WU2A 4JUYA 4YJ2E 2WMOA 4IHJE 2ZMAA 3JAFA 3LK2B 3OPCA 4PNIA 5ABFA 5JDQA 5LHHB 1EZ3A 2H88A 4B3ST 3VR8A 1Z8UA 2E8IA 3PUVF 4AQGA 4G2AA 1BR2A 5CB4E 3C4XA 1XDPA 4DBRA 2QA7A 4CXYA 4U3CA 3QNUA 2CLYC 3MXZA 2XQ8A 2YKSA 3LK42 4XZCA 2E9XA 3SWHA 3UUNA 3ZPOA 3HKDE 3PUAA 4TZ4C 4UVBB 1XMQT 2FBWA 2X68A 3Q9DA 2C5JA 3CX8B 4JBWF 2MBGA 2D0TA 3CQXC 5C8YE 4AXPA 2E5VA 2VWAA 2YOEA 1IJ6A 2XAGB 4UV8B 3ZJ2A 5JDGA 4LF5T 1E1HB 1X79A 3NRXA 1B7TA 5IYZE 3NWIA 3AXJB 3QB5K 2I0MA 1XDOA 1G8XA 2WZHA 1LVFA 2XJ7A 3CPZA 3NVOA 3PUGA 4LMKA 1SE7A 4YFSA 5J2TE 2UXXB 2IDOB 3C98B 4ASKA 3PUQA 1E2AA 3FXDB 5L3EB 4NIQA 4O2BE 1WRDA 2DWKA 5TAOA 4KP3C 3ZMVB 4CN4A 2RP4A 2V7MA 2PFVA 4GKKT 4ILBA 4HWDA 4LF8T 5FYMA 4ILUA 4HTEA 5FXXA 2WCAA 3O4XE 1WR6A 3Q5DA 4B3TT 1AJ3A 1NENA 1IJ5A 3OJAA 4X1KE 3RYHE 1J5ET 4P0AA 2L9QA 2KLQA 3FZMB 4OK0A 2KSRA 2BG9C 3FZHB 2CLYB 5M4YA 5F8PA 1XNQT 4DR3T 1D0ZA 4NUUA 3ZC1A 5JR9C 2X0HA 5L3DB 1Z0PA 3F31A 3UQ7A 5CJ5A 4DUZT 1IBLT 3C4ZA 3PUXF 4DV3T 1HNZT 3FZKB 4I0UA 3MZKB 4QH1A 4HN9A 3NKZA 1WYCA 5AQRB 1YW0A 3RLFF 4IE7A 3DP7A 1SA0E 3LFMA 3ESLA 4BA9A 5CFBA 1NAFA 2CBJA 2XPKA 2JPFA 2XAJB 1XZYA 5EZYE 2VVNA 4H9OC 1T8BA 4EIWA 2IMLA 2YU2A 2FJAA 2VKOA 5HXEA 3CQCB 3F2EA 1KF6A 5AQPB 1IBMT 2NW8A 3ZT6A 2E2AA 4U74A 4JI6T 4DR1T 3AE7A 3IA3A 2XAHB 4KHZF 4Z90A 5FL1A 3RIUA 4DR6T 3DJBA 2Q9QB 1N36T 3RF1A 3AAIA 3KFWX 3KINB 1DU2A 3AE4A 2V1DB 4G63A 4HFCA 4DV6T 4AI6A 1XWMA 3HL6A 1FIOA 4EB6E 4YSXA 5HCJA 3GMIA 2JQHA 2M6BA 3UUXB 3B57A 3ZKRA 1SHZC 4YTPA 2V6XA 2UUBT 3N2GE 5HEOA 1Y64B 5C2TA 4ADZA 4H9NC 5JTGA 3MACA 2JMKA 2VVSA 4U2ZA 5LJMA 3PURA 4CQIA 4IL9A 4QWNB 4WBNE 1HFAA 5LB7B 1U5PA 4GK5E 4TUYE 5FKYA 3UU4A 2JJ9A 4CXWA 3TLTA 1W0BA 2I6HA 2V7JA 5DJQC 5DQWA 2VK9A 3CWZB 1UX5A 4ZOLE 4LF9T 1G73A 1HX1B 4FJOA 4ZZBA 2WY2A 4EYYR 2E5LT 4LFBT 2PG8A 2YINA 3KBUA 1BR0A 2LOSA 1ZOYA 3A7MA 3AEFA 5BMVE 2J1DG 3KV4A 4X64T 5ABGA 3EABA 3RI5A 2HHHT 3EUHA 2NWBA 3R84B 2ACXA 4GYRA 3MA9A 4JLEA 4MFRA 5HXCA 5LHGB 5HYAA 2VB6A 2LSKA 2X9HA 3NZPA 3ONJA 3P4RA 2IUBA 2C5IT 4O4HE 2V6YB 3AE2A 3ZLIA 4X5TA 2X9WA 4TWDA 1UGOA 3ZSSA 4F6RC 2ZM8A 2KNDA 4A56A 3NBXX 2BS4A 4A98A 3PUSA 3N9LA 4YSZA 4DR7T 3PUWF 2WP9A 1OEDE 4AQFC 3T1YT 3C50A 2V8SV 2LRKA 4WBOA 1UK5A 2KINB 2WQYA 3ONXA 3P50A 2LKGA 5LBMA 3V5SA 2EHOB 2LSYA 5FXWA 1N33T 1HX8A 2QYWA 2OV9A 5AFUL 4GIWA 4UXNB 3T8OA 2MPKA 4CZZB 3KBTA 3LBXB 3ZYKA 3OTOT 1HNWT 2XQ3A 1YXRA 3K3NA 5EK3A 2LHRA 2W66A 3CQGB 4PK6A 3AVRA 4COFA 4DVDA 3LJCA 3K1SA 4TNVA 4ZS3A 4IT4A 1HCIA 5FY7A 4CI2B 2NTYA 4U7YA 1MMNA 2CCQA 3AXJA 1QSDA 4MBQA 2HH7A 3AA7B 4OYJA 4DMWA 3ZN1B 3RQWA 2YDRA 4CN6A 4ERRA 5AQKB 1MIVA 1I94T 1D1BA 5A1LA 2HN1A 1NEKA 2M67A 2OA5A 3LBXA 4UELA 5FXZA 2WWVA 2H89A 4HKAA 4DV4T 3HKBE 4PJNA 1KNPA 2A9UA 4LMLA 3UULA 5F5WA 5IUXA 4YJ3E 2XQ9A 5JDLA 3TLUA 3ZMSB 4DIDB 3BK9A 2KMFA 3I1AA 2ZLYA 3SFEA 4DR2T 4CXXA 2ZM0A 3J7Yq 4CI3B 2UU9T 2XSAA 3FZLB 2CHOA 4OFZA 2JQKA 3BQIA 3CK6A 3EDVA 5AQVB 3AEGA 2HN2A 3MKDA 3Q5WA 3UU6A 2X0LB 1YQ4A 3I0OA 2LLYA 5AQJB 3AE1A 3WAKA 5LG3A 4ZI3C 1YKHB 3BQKA 3GWHA 4QXBB 2VKJA 3UQ4A 4IGUA 4IDNA 1N34T 2LJLA 4ZEYA 2X0YA 1LVKA 2LSGA 5FMNA 2IHR1 2VL0A 3J9X1 3RYFE 4ZI3D 2W2UA 3AE3A 3SFDA 4L0RA 1HF8A 1R8IA 5ADXL 4UF0B 1FMWA 5JQGE 2WU5A 1HTJF 5L4HA 4C91A 2W0GA 3GN5A 4K0KT 3KV9A 4X65T 3CVRA 3AE5A 4H9RC 2YK0A 4YHHT 2XAQB 4DV5T 2VASA 3F57A 3IBPA 2SPCA 4JYAT 4AKRB 2NOXA 3C51A 4O2AE 2XQAA 3FB2A 2VQFT 3ETUA 4TN7B 4WYVA 1N32T 2BKPA 2BG9E 2LHNA 3QB5A 5HXRA 1IZNB 2WDVA 3ZYLA 4IE6A 1UX4A 2PTFA 2R6GF 5JH7E 2LSIA 2IIUA 3JC6D 2D2SA 1CHUA 5LNKA 3KDSE 1FJGT 4I55E 4DV1T 4EAHA 3PTRB 5HCMA 4JI2T 4JI4T 2V7KA 1O3XA 3ZC0A 2E9XC 3UFGA 2XQ5A 2W61A 1OEDC 4OYKA 3SOLA 4UIGA 4KI0F 4U72A 4DV2T 3N9QA 3JC6C 3P4SA 3AEAA 5JVDE 2UXNB 5L3GB 2XUEA 3HKCE 4ISSA 2LOPA 3H3AA 4X1YE 4NXMT 3AA6B 4JI8T 5LP6E 4IDOA 2MOZA 3RX6A 4TV9E 5E0OA 4JI1T 4HWIB 2CBIA 3LSVA 4Z91A 1D0YA 2JRKA 5AQUB 3P4PA 4ANJA 1H7CA 2UXDT 4IL4A 2Q9QC 3ZCIA 4I4TE 4QX8B 4BAYB 3M3ZB 2N2NA 4J2CA 5LMNT 3RC3A 2G0UA 4L9IA 3L09A 2K5BB 4UVAB 3JAEA 5FVLA 5F3JA 4Q25A 4ZHQE 1HS7A 2K48A 2CHNA 5LGNB 2JQ9A 3CMLA 3RIFA 2N1GA 2ES0A 3AB3B 5IWAT 4PK5A 3AA1B 4TWHA 1WCRA 4TX5A 5DQVA 3ZN0B 4JEHB 4PFOA 3V5UA 3OKQA 5JREA 5BR8T 3AA0B 1XNRT 2WM9A 3RPUA 1MIWA 2YDSA 1MNDA 3EHZA 3IHRA 5FP3A 5J2UE 5KXJA 2D5UA 1FMVA 2X9XA 1W0AA 3PJAJ 5GONE 5H6RB 2E9XD 2VKDA 3P8CD 2K3WA 3X1DA 3AECA 2DCFA 3IEEA 3M65A 3ZCJA 4ZI7E 5HEJA 3SS1A 4DR5T 2X9YA 1NWMX 3PE0A 2C5KT 3I9WA 4UF0A 4WW0A 5FY0A 4H9SE 3N2OA 3ZSTA 4EXTA 3K8PC 1M7KA 5AQIB 3U3IA 3MK7C 2WMNA 2CWOA 5FNVE 2AE9A 4N78D 1MMAA 2XQYA 4OHFA 4YY3T 3S4UA 2VL8A 3O1HA 2EHOA 2K9AA 4WZXA 2MAWA 4JI0T 5L3CB 5L47A 3RHWA 1VCTA
chains in the Genus database with same CATH topology
4O4LE 2NP9A 2KZ7B 4EOZB 4V1Av 5KDMC 2CE7A 5KMGP 2H3RA 3NRYA 2MTQA 4MALA 5JRCA 4P0BA 3RRCA 5LGUB 1OWAA 5EK4A 3VHLA 5JDMA 1S94A 3NZQA 2MYSA 3PU8A 3E22E 4BJNA 4QHOA 4UEMA 4KUMB 4X1IE 2A72A 4MLKA 3RRWA 3MJXA 2ZM2A 2LEHA 4DBQA 4WNKA 4PFPA 4EZ4A 2PBIA 3LG7A 3HR0A 3ANWB 4AQFA 5IHYA 2YEVC 4HE8A 3VU7H 1LRZA 1MIYA 3PU3A 3IF8B 1D1AA 4ISTA 5HXHA 4MHCA 3HA4A 3KVAA 5KX5E 1IAPA 1YKEB 3KV5A 1MMGA 4JEUB 4K0UA 4QKNA 2CMRA 4I43B 2RA1A 4H63V 2BDEA 3ZMTB 4GYSA 3I9YA 4UV9B 3EDUA 1KK7A 2QGSA 2YU1A 1US7B 3WI3A 4PK4A 2X67A 2L3LA 5JDHA 2PJQA 1WLXA 4I50E 3EVYA 4GOUA 4Z8XA 3RYCE 4B6XA 2CA5A 3RYIE 4H63H 3C64A 3UFEA 3N2KE 2XTLA 1ZKEA 2IC6A 1LKXA 4E7ZA 2CXLA 2EHOD 3FBZA 3OYZA 5FXVA 3A5XA 2BZBA 5CA1E 5L3BB 3CX7B 3ANWA 2LE8A 2W63A 4C90A 4O4JE 3UTKA 3VKGA 4QXHB 3E0ZA 2LSJA 1ZEEA 3GN5B 3W15B 3PDYA 2NW7A 3FBLA 1V9DA 1HG5A 1YD8G 3O9XA 4BJMA 2Y8DA 5J1GA 3BQLA 2V26A 2N9DA 4PW8A 5L3FB 4HGAA 1KNZA 4P09A 2WBLA 4AKHA 2KXPB 3ZMUB 4X20E 2XASB 3OBVE 3CX6B 3U78A 5JRCB 2DWGA 4TV8E 3CKDA 3TKLB 1QUUA 2KT9A 2BVLA 2H7VC 2DHRA 2CXDA 4YLHA 5LBQB 3KVBA 4PJLA 1FEWA 4IIJE 3AVSA 4ZS2A 5LHIB 2IC9A 2Z6EA 3RH3A 1S35A 5LA6E 2W62A 3GA8A 1OXZA 2JMHA 2Q9QA 1BR4A 3OYXA 1CUNA 2CM0A 5HWXA 3RC8A 5LOVE 4HFVA 3D0TA 5LYJE 1D1CA 1U4QA 2XHEB 5JDFA 4EZHA 4ZI2D 5EK2A 2X51A 4DMVA 3O1IA 2DLRA 1WYBA 2IAKA 4DNDA 2V7IA 3H37A 4XAXB 5L2LA 2W00A 3N5LA 4PAGA 4PJJA 2CWYA 2X66A 3QK6A 5HWYA 3Q2MA 3P7IA 4CI1B 4O8SA 3ETVA 2DNXA 1ZV4X 4FI5A 3N9MA 4IDZA 3RKOA 2HPJA 3N9OA 2BVMA 4DO0A 2HPLA 3R6NA 2DI4A 2C0SA 4NUVA 3VKHA 2E9XB 2K24A 2D0UA 1T98A 3DTOA 4PJMA 5DABA 1VRBA 5JR9B 5LJNA 4IE4A 3FHNA 4GK0E 4IE5A 4YHJA 4ZI2C 4AKGA 2KWIB 4KBMB 3C4WA 3B13A 5CA0E 1BR1A 1MNEA 2ODUA 4H9PC 3FXEB 4L5GA 4H9QC 2Y48B 5HXSA 2CXFA 3HI2A 2XAFB 3O1JA 3ZJ1A 2Y6XA 3QC9A 4QXCB 2WWUA 5ETWA 4AKIA 4EYUA 5H6QB 4M1PA 2I59A 2WSSV 2LT3A 2JQQA 2VKHA 3AAAB 3WAJA 2P9BA 3QUJA 5JR9A 2NW9A 3N9NA 4KMCA 3AAEB 1VOMA 1ZHCA 3N9PA 2WAUA 3I0QA 3Q5XA 5JDNA 3E08A 4O4IE 4AKLA 5LXTE 2ODVA 2CEAA 4IE0A 4UVCB 5LG4A 2EHOC 2IW5B 4XBFB 3K3QC 1HG2A 5LGTB 1MMDA 2Q9QD 1D0XA 2NTXA 3LK3B 3L3PA 3UUMA 2B1EA 3K3OA 2V7LA 5LCYA 2A3DA 5FY1A 3KV6A 3HKEE 4HEAA 3SRZA 5HAXA 2KWHA 3ZMZB 2H7OA 4QX7B 2A2FX 3ZYMA 2L8KA 3ZEFB 2GK9A 2LM9A 3UT5E 1UCUA 4JUYA 4YJ2E 2WMOA 4IHJE 2ZMAA 3LK2B 4PNIA 5LHHB 5JDQA 1EZ3A 2E8IA 4AQGA 4G2AA 1BR2A 5CB4E 3C4XA 4DBRA 2QA7A 4CXYA 2CLYC 3MXZA 3UUNA 3LK42 4XZCA 2E9XA 3SWHA 3ZPOA 3HKDE 3PUAA 4TZ4C 4UVBB 2X68A 3Q9DA 2C5JA 3CX8B 2MBGA 2D0TA 3CQXC 5C8YE 4AXPA 2VWAA 1IJ6A 2XAGB 4UV8B 3ZJ2A 5JDGA 1E1HB 1X79A 3NRXA 1B7TA 5IYZE 1G8XA 3PUGA 1LVFA 4YFSA 3CPZA 5J2TE 2UXXB 3C98B 4ASKA 3PUQA 3FXDB 5L3EB 4O2BE 1WRDA 2DWKA 5TAOA 4KP3C 3ZMVB 2RP4A 2V7MA 2PFVA 5FYMA 4ILUA 4HTEA 5FXXA 3O4XE 1WR6A 1AJ3A 1IJ5A 3OJAA 4X1KE 3RYHE 4P0AA 2L9QA 2KLQA 4OK0A 2CLYB 5M4YA 5F8PA 1D0ZA 4NUUA 3ZC1A 5JR9C 5L3DB 1Z0PA 3F31A 3C4ZA 3MZKB 4HN9A 1WYCA 1YW0A 4IE7A 3DP7A 1SA0E 3LFMA 3ESLA 4BA9A 1NAFA 2JPFA 2XAJB 5EZYE 4H9OC 4EIWA 2YU2A 2VKOA 5HXEA 3CQCB 3F2EA 2NW8A 4U74A 2XAHB 3DJBA 2Q9QB 3AAIA 3KFWX 3KINB 2V1DB 4G63A 4AI6A 3HL6A 1FIOA 4EB6E 3GMIA 3UUXB 3B57A 1SHZC 3N2GE 1Y64B 4ADZA 4H9NC 3MACA 2JMKA 5LJMA 3PURA 4CQIA 4QWNB 4WBNE 1HFAA 1U5PA 4GK5E 4TUYE 4CXWA 2JJ9A 2V7JA 5DJQC 5DQWA 2VK9A 3CWZB 1UX5A 4ZOLE 1G73A 4FJOA 1BR0A 4EYYR 2PG8A 2YINA 3KBUA 2LOSA 5BMVE 2J1DG 3KV4A 3EUHA 2NWBA 3R84B 2ACXA 4GYRA 3MA9A 4JLEA 4MFRA 5HXCA 5HYAA 2VB6A 2LSKA 2X9HA 3NZPA 4O4HE 2C5IT 3ZLIA 2X9WA 4F6RC 2ZM8A 2KNDA 4A56A 3NBXX 3PUSA 3N9LA 4AQFC 3C50A 4WBOA 2KINB 3ONXA 5LBMA 3V5SA 2EHOB 2LSYA 5FXWA 1HX8A 5AFUL 4GIWA 4UXNB 3T8OA 4CZZB 3KBTA 3LBXB 3ZYKA 3K3NA 5EK3A 4DVDA 2LHRA 4PK6A 3CQGB 3AVRA 3LJCA 4ZS3A 5FY7A 1HCIA 4CI2B 2NTYA 1MMNA 2CCQA 4MBQA 1QSDA 3AA7B 2HH7A 4OYJA 4DMWA 3ZN1B 4ERRA 1MIVA 1D1BA 5A1LA 2M67A 2OA5A 3LBXA 4UELA 5FXZA 4HKAA 3HKBE 4PJNA 3UULA 4YJ3E 5JDLA 3ZMSB 3BK9A 2KMFA 3I1AA 2ZLYA 4CXXA 2ZM0A 3J7Yq 4CI3B 4OFZA 3EDVA 3BQIA 3MKDA 3Q5WA 2X0LB 3I0OA 3WAKA 4ZI3C 1YKHB 3BQKA 3GWHA 4QXBB 2VKJA 4IGUA 2LJLA 1LVKA 2LSGA 5FMNA 3J9X1 3RYFE 4ZI3D 5ADXL 4L0RA 1HF8A 5JQGE 4UF0B 1FMWA 1HTJF 4C91A 2W0GA 3GN5A 3KV9A 3CVRA 4H9RC 2YK0A 2XAQB 2VASA 3F57A 3IBPA 2SPCA 4AKRB 2NOXA 3C51A 4O2AE 3FB2A 3ETUA 4TN7B 2LHNA 4E7SA 5HXRA 1IZNB 3ZYLA 5JH7E 4IE6A 1UX4A 2LSIA 3JC6D 2D2SA 5LNKA 3KDSE 4I55E 4EAHA 3PTRB 3ZC0A 2V7KA 1O3XA 2E9XC 2W61A 4OYKA 3SOLA 4UIGA 4U72A 3N9QA 3JC6C 5JVDE 2UXNB 5L3GB 2XUEA 3HKCE 4ISSA 2LOPA 3H3AA 4X1YE 3AA6B 5LP6E 2MOZA 3RX6A 4TV9E 5E0OA 1D0YA 2JRKA 4ANJA 1H7CA 2Q9QC 3ZCIA 4I4TE 4QX8B 4BAYB 2N2NA 4J2CA 3RC3A 2G0UA 4L9IA 3L09A 2K5BB 4UVAB 5F3JA 4ZHQE 1HS7A 2K48A 5LGNB 3CMLA 2N1GA 2ES0A 3AB3B 4PK5A 3AA1B 4TX5A 5DQVA 3ZN0B 4JEHB 4PFOA 3V5UA 3OKQA 5JREA 3AA0B 2WM9A 3RPUA 1MIWA 1MNDA 5FP3A 3IHRA 5J2UE 2D5UA 1FMVA 2X9XA 5GONE 5H6RB 2E9XD 2VKDA 3P8CD 4ZI7E 3M65A 2DCFA 3IEEA 3ZCJA 3SS1A 2X9YA 1NWMX 3PE0A 2C5KT 3I9WA 4UF0A 4WW0A 5FY0A 4H9SE 3N2OA 4EXTA 3K8PC 3U3IA 3MK7C 2WMNA 2CWOA 5FNVE 4N78D 2XQYA 1MMAA 4OHFA 3S4UA 2VL8A 3O1HA 2EHOA 2K9AA 5L3CB 5LHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRY A;  5KMG P;  3NRX A; 
#chains in the Genus database with same CATH topology
 1WFD A;  4O4L E;  2NP9 A;  2KZ7 B;  4EOZ B;  1I6Z A;  4V1A v;  5KDM C;  2CE7 A;  5KMG P;  2H3R A;  3NRY A;  4ILA A;  2MTQ A;  4MAL A;  4ZXL A;  4P0B A;  4JI5 T;  5JRC A;  3ABV A;  3RRC A;  5AQS B;  5LGU B;  1OWA A;  1X9B A;  2OLT A;  3RIU C;  5EK4 A;  3VHL A;  2LM2 A;  5JDM A;  3WAJ A;  1S94 A;  2CPT A;  3NZQ A;  2MYS A;  3PU8 A;  5AQQ B;  4AQY T;  3E22 E;  4BJN A;  4QHO A;  2WDR A;  5CGM A;  4UEM A;  4KUM B;  2AXD S;  1YQ3 A;  4X1I E;  2A72 A;  4MLK A;  4EV6 A;  5LMU T;  5AQM B;  3RRW A;  3MJX A;  1ZP0 A;  2ZM2 A;  2LEH A;  4LFA T;  3EAM A;  4WNK A;  4DBQ A;  5AQF B;  4NXN T;  4PFP A;  3PUZ F;  4EZ4 A;  2PBI A;  3LG7 A;  2WS3 A;  2UUC T;  3JCF A;  2BS3 A;  3ANW B;  3HR0 A;  3AED A;  4AQF A;  3PV0 F;  4LFC T;  5IHY A;  3TLV A;  4A97 A;  2YEV C;  4YXD A;  4HE8 A;  1W09 A;  3VU7 H;  2UUA T;  4LF4 T;  2BBJ A;  4KX6 A;  1LRZ A;  3VRA A;  1MIY A;  3PU3 A;  3IF8 B;  1D1A A;  4IST A;  4U7I A;  4AIU A;  5HXH A;  3QOF A;  5AQL B;  4MHC A;  3RGL A;  3HA4 A;  3KVA A;  5KX5 E;  1IAP A;  1YKE B;  3KV5 A;  1MMG A;  4HFB A;  4JEU B;  4K0U A;  2BG9 B;  5HEG A;  3P4W A;  2B76 A;  5AQN B;  5AQG B;  4QKN A;  2CMR A;  1GQE A;  4I43 B;  4QH4 A;  3RIA A;  2RA1 A;  4H63 V;  4U33 A;  2BDE A;  4YTM A;  3AEB A;  1KFY A;  2ACZ A;  3A8Y C;  3ZMT B;  3VKH A;  2FUP A;  3I9Y A;  4GYS A;  4UV9 B;  1WR0 A;  3EDU A;  3Q5E A;  4QH5 A;  1KK7 A;  1JNZ A;  2QRX A;  4OX9 T;  2QGS A;  2YU1 A;  1US7 B;  3WI3 A;  4PK4 A;  1QLB A;  2X67 A;  2L3L A;  5JDH A;  2PJQ A;  1WLX A;  4E7S A;  1KNR A;  4I50 E;  3EVY A;  4GOU A;  4Z8X A;  4LMJ A;  3RYC E;  4B6X A;  2CA5 A;  3AE6 A;  4EEB A;  4HWC A;  3RYI E;  4HFE A;  4H63 H;  3C64 A;  3ONL C;  3UFE A;  4B3R T;  2FJE A;  3N2K E;  2XTL A;  2V5C A;  1ZKE A;  3VRB A;  2IC6 A;  1LKX A;  3LDQ B;  4E7Z A;  2CXL A;  2DL1 A;  2EHO D;  3FBZ A;  1L0V A;  3OYZ A;  5FXV A;  2UXB T;  3A5X A;  2BZB A;  2M6I A;  3T1H T;  5CA1 E;  1J5W A;  3PUY F;  5L3B B;  3CX7 B;  2NR4 A;  3ANW A;  4KHP T;  2LE8 A;  2W63 A;  4C90 A;  4HFH A;  4O4J E;  3UTK A;  3VKG A;  4QXH B;  1M62 A;  2J4G A;  3E0Z A;  1XMO T;  4UR9 A;  2LSJ A;  1OED B;  1ZEE A;  3GN5 B;  3ZT7 A;  3AE8 A;  3RKG A;  5AQO B;  3W15 B;  1W9R A;  3PDY A;  2RPA A;  2NW7 A;  3FBL A;  5AQT B;  1UUS A;  4X66 T;  1V9D A;  1HG5 A;  1YD8 G;  4JI7 T;  3O9X A;  2UXC T;  3B5M A;  2Y8D A;  2VUR A;  4BJM A;  2W67 A;  2YN6 A;  4YSY A;  5J1G A;  3BQL A;  2V26 A;  2N9D A;  4PW8 A;  4EGW A;  5L3F B;  4HGA A;  1KNZ A;  4DUY T;  4P09 A;  2WBL A;  4LF7 T;  1T72 A;  4AKH A;  2KXP B;  3ZT5 A;  3ZMU B;  2WZI A;  4X20 E;  2XAS B;  3OBV E;  3CX6 B;  3U78 A;  4F8H A;  2DWG A;  3UU3 A;  5JRC B;  4TV8 E;  3CKD A;  3TKL B;  1QUU A;  4DV0 T;  2KT9 A;  2BVL A;  2H7V C;  2XQ6 A;  2W4X A;  5ABH A;  2DHR A;  4AKG A;  3PJA A;  3RC8 A;  2CXD A;  3AEE A;  1KEY A;  4YLH A;  5LBQ B;  4HWF A;  2V6Y A;  3KVB A;  4PJL A;  2J47 A;  4TWF A;  1FEW A;  4IIJ E;  3AVS A;  4ZS2 A;  5LHI B;  2IC9 A;  2Z6E A;  3RH3 A;  4ZZC A;  1S35 A;  3VR9 A;  4YT0 A;  2YDQ A;  2W62 A;  3EI0 A;  3GA8 A;  4TNW A;  5LA6 E;  5HEH A;  5ABF B;  1OXZ A;  2JMH A;  2Q9Q A;  4U2Y A;  1BR4 A;  3OYX A;  2ZM6 T;  1CUN A;  2CM0 A;  2WDQ A;  2XY8 B;  5LOV E;  4HFI A;  4HFV A;  3D0T A;  5HWX A;  1D1C A;  1U4Q A;  2XHE B;  5JDF A;  4EZH A;  4ZI2 D;  5EK2 A;  5LYJ E;  2X51 A;  4DMV A;  3O1I A;  2DLR A;  1WYB A;  2IAK A;  5AQH B;  4DND A;  2VQE T;  2V7I A;  3H37 A;  4XAX B;  5L2L A;  1OED A;  1VCS A;  2BS2 A;  2FJD A;  2W00 A;  3UUB A;  3N5L A;  4PAG A;  5L4E A;  4PJJ A;  2CWY A;  2X66 A;  3QK6 A;  5HWY A;  2XM1 A;  3Q2M A;  3P7I A;  4CI1 B;  4X62 T;  3CIR A;  3ETV A;  4O8S A;  4DV7 T;  2DNX A;  1ZV4 X;  2QVA A;  2CRB A;  4FI5 A;  4P1N A;  5J0Z A;  3N9M A;  4IDZ A;  3RKO A;  2HPJ A;  3N9O A;  2BVM A;  4DO0 A;  2HPL A;  3R6N A;  2DI4 A;  2C0S A;  4NUV A;  4LF6 T;  2E9X B;  2K24 A;  2D0U A;  2BKN A;  2V5D A;  4IRE A;  4A5X A;  1T98 A;  1J1J A;  2J62 A;  3DTO A;  1Y01 A;  4PJM A;  5DAB A;  1VRB A;  3OVU A;  5JR9 B;  3RQU A;  4CN1 A;  4DR4 T;  5LJN A;  1IBK T;  3AE9 A;  2D9D A;  4IE4 A;  3FHN A;  4GK0 E;  4IE5 A;  1UUR A;  2LKH A;  4YHJ A;  4YTN A;  4ZI2 C;  1HR0 T;  2KWI B;  4KBM B;  4B3M T;  4JI3 T;  3C4W A;  3B13 A;  5CA0 E;  4GKJ T;  1BR1 A;  1T7S A;  1MNE A;  2ODU A;  4H9P C;  3FXE B;  4L5G A;  4H9Q C;  3UU8 A;  2Y48 B;  5HXS A;  2XZE A;  3L39 A;  2CXF A;  3HI2 A;  2XAF B;  3JAD A;  3O1J A;  3ZJ1 A;  2XQ7 A;  3TLS A;  4NPP A;  2Y6X A;  3QC9 A;  4QXC B;  4IDQ A;  2WWU A;  2WB5 A;  5ETW A;  4AKI A;  2BG9 A;  4EYU A;  5H6Q B;  5C3J A;  4M1P A;  2F4V T;  2I59 A;  2WSS V;  2LT3 A;  5HEU A;  2BBH A;  2JQQ A;  2VKH A;  3AAA B;  2P9B A;  3QUJ A;  5JR9 A;  2NW9 A;  4HFD A;  3L8R A;  3N9N A;  4KMC A;  3G06 A;  3AAE B;  1VOM A;  3TLW A;  1ZHC A;  2LRL A;  4HWH A;  4IDP A;  3N9P A;  3FZF B;  2BKO A;  2WAU A;  3I0Q A;  3Q5X A;  5JDN A;  3E08 A;  4O4I E;  4AKL A;  5LXT E;  1HNX T;  2ODV A;  2XM2 A;  5ABE A;  2FJB A;  3P4Q A;  2CEA A;  2XQ4 A;  1E7P A;  4IE0 A;  4UVC B;  5LG4 A;  5FL0 A;  2EHO C;  2IW5 B;  4XBF B;  3K3Q C;  1HG2 A;  4U31 A;  5LGT B;  1MMD A;  2Q9Q D;  4ILC A;  1JNR A;  1SUM B;  1D0X A;  2NTX A;  3LK3 B;  3L3P A;  3UU5 A;  2JIW A;  2B1E A;  3K3O A;  3UUM A;  2V7L A;  5LCY A;  2A3D A;  5FY1 A;  3KV6 A;  3H3M A;  3HKE E;  4HEA A;  5HAX A;  2KWH A;  3SRZ A;  3ZMZ B;  2H7O A;  4AIS A;  4QX7 B;  2A2F X;  3ZYM A;  2L8K A;  3ZEF B;  2GK9 A;  2LM9 A;  5FVK A;  3UT5 E;  2XSB A;  4EED A;  4JV5 T;  1UCU A;  2WU2 A;  4JUY A;  4YJ2 E;  2WMO A;  4IHJ E;  2ZMA A;  3JAF A;  3LK2 B;  3OPC A;  4PNI A;  5ABF A;  5JDQ A;  5LHH B;  1EZ3 A;  2H88 A;  4B3S T;  3VR8 A;  1Z8U A;  2E8I A;  3PUV F;  4AQG A;  4G2A A;  1BR2 A;  5CB4 E;  3C4X A;  1XDP A;  4DBR A;  2QA7 A;  4CXY A;  4U3C A;  3QNU A;  2CLY C;  3MXZ A;  2XQ8 A;  2YKS A;  3LK4 2;  4XZC A;  2E9X A;  3SWH A;  3UUN A;  3ZPO A;  3HKD E;  3PUA A;  4TZ4 C;  4UVB B;  1XMQ T;  2FBW A;  2X68 A;  3Q9D A;  2C5J A;  3CX8 B;  4JBW F;  2MBG A;  2D0T A;  3CQX C;  5C8Y E;  4AXP A;  2E5V A;  2VWA A;  2YOE A;  1IJ6 A;  2XAG B;  4UV8 B;  3ZJ2 A;  5JDG A;  4LF5 T;  1E1H B;  1X79 A;  3NRX A;  1B7T A;  5IYZ E;  3NWI A;  3AXJ B;  3QB5 K;  2I0M A;  1XDO A;  1G8X A;  2WZH A;  1LVF A;  2XJ7 A;  3CPZ A;  3NVO A;  3PUG A;  4LMK A;  1SE7 A;  4YFS A;  5J2T E;  2UXX B;  2IDO B;  3C98 B;  4ASK A;  3PUQ A;  1E2A A;  3FXD B;  5L3E B;  4NIQ A;  4O2B E;  1WRD A;  2DWK A;  5TAO A;  4KP3 C;  3ZMV B;  4CN4 A;  2RP4 A;  2V7M A;  2PFV A;  4GKK T;  4ILB A;  4HWD A;  4LF8 T;  5FYM A;  4ILU A;  4HTE A;  5FXX A;  2WCA A;  3O4X E;  1WR6 A;  3Q5D A;  4B3T T;  1AJ3 A;  1NEN A;  1IJ5 A;  3OJA A;  4X1K E;  3RYH E;  1J5E T;  4P0A A;  2L9Q A;  2KLQ A;  3FZM B;  4OK0 A;  2KSR A;  2BG9 C;  3FZH B;  2CLY B;  5M4Y A;  5F8P A;  1XNQ T;  4DR3 T;  1D0Z A;  4NUU A;  3ZC1 A;  5JR9 C;  2X0H A;  5L3D B;  1Z0P A;  3F31 A;  3UQ7 A;  5CJ5 A;  4DUZ T;  1IBL T;  3C4Z A;  3PUX F;  4DV3 T;  1HNZ T;  3FZK B;  4I0U A;  3MZK B;  4QH1 A;  4HN9 A;  3NKZ A;  1WYC A;  5AQR B;  1YW0 A;  3RLF F;  4IE7 A;  3DP7 A;  1SA0 E;  3LFM A;  3ESL A;  4BA9 A;  5CFB A;  1NAF A;  2CBJ A;  2XPK A;  2JPF A;  2XAJ B;  1XZY A;  5EZY E;  2VVN A;  4H9O C;  1T8B A;  4EIW A;  2IML A;  2YU2 A;  2FJA A;  2VKO A;  5HXE A;  3CQC B;  3F2E A;  1KF6 A;  5AQP B;  1IBM T;  2NW8 A;  3ZT6 A;  2E2A A;  4U74 A;  4JI6 T;  4DR1 T;  3AE7 A;  3IA3 A;  2XAH B;  4KHZ F;  4Z90 A;  5FL1 A;  3RIU A;  4DR6 T;  3DJB A;  2Q9Q B;  1N36 T;  3RF1 A;  3AAI A;  3KFW X;  3KIN B;  1DU2 A;  3AE4 A;  2V1D B;  4G63 A;  4HFC A;  4DV6 T;  4AI6 A;  1XWM A;  3HL6 A;  1FIO A;  4EB6 E;  4YSX A;  5HCJ A;  3GMI A;  2JQH A;  2M6B A;  3UUX B;  3B57 A;  3ZKR A;  1SHZ C;  4YTP A;  2V6X A;  2UUB T;  3N2G E;  5HEO A;  1Y64 B;  5C2T A;  4ADZ A;  4H9N C;  5JTG A;  3MAC A;  2JMK A;  2VVS A;  4U2Z A;  5LJM A;  3PUR A;  4CQI A;  4IL9 A;  4QWN B;  4WBN E;  1HFA A;  5LB7 B;  1U5P A;  4GK5 E;  4TUY E;  5FKY A;  3UU4 A;  2JJ9 A;  4CXW A;  3TLT A;  1W0B A;  2I6H A;  2V7J A;  5DJQ C;  5DQW A;  2VK9 A;  3CWZ B;  1UX5 A;  4ZOL E;  4LF9 T;  1G73 A;  1HX1 B;  4FJO A;  4ZZB A;  2WY2 A;  4EYY R;  2E5L T;  4LFB T;  2PG8 A;  2YIN A;  3KBU A;  1BR0 A;  2LOS A;  1ZOY A;  3A7M A;  3AEF A;  5BMV E;  2J1D G;  3KV4 A;  4X64 T;  5ABG A;  3EAB A;  3RI5 A;  2HHH T;  3EUH A;  2NWB A;  3R84 B;  2ACX A;  4GYR A;  3MA9 A;  4JLE A;  4MFR A;  5HXC A;  5LHG B;  5HYA A;  2VB6 A;  2LSK A;  2X9H A;  3NZP A;  3ONJ A;  3P4R A;  2IUB A;  2C5I T;  4O4H E;  2V6Y B;  3AE2 A;  3ZLI A;  4X5T A;  2X9W A;  4TWD A;  1UGO A;  3ZSS A;  4F6R C;  2ZM8 A;  2KND A;  4A56 A;  3NBX X;  2BS4 A;  4A98 A;  3PUS A;  3N9L A;  4YSZ A;  4DR7 T;  3PUW F;  2WP9 A;  1OED E;  4AQF C;  3T1Y T;  3C50 A;  2V8S V;  2LRK A;  4WBO A;  1UK5 A;  2KIN B;  2WQY A;  3ONX A;  3P50 A;  2LKG A;  5LBM A;  3V5S A;  2EHO B;  2LSY A;  5FXW A;  1N33 T;  1HX8 A;  2QYW A;  2OV9 A;  5AFU L;  4GIW A;  4UXN B;  3T8O A;  2MPK A;  4CZZ B;  3KBT A;  3LBX B;  3ZYK A;  3OTO T;  1HNW T;  2XQ3 A;  1YXR A;  3K3N A;  5EK3 A;  2LHR A;  2W66 A;  3CQG B;  4PK6 A;  3AVR A;  4COF A;  4DVD A;  3LJC A;  3K1S A;  4TNV A;  4ZS3 A;  4IT4 A;  1HCI A;  5FY7 A;  4CI2 B;  2NTY A;  4U7Y A;  1MMN A;  2CCQ A;  3AXJ A;  1QSD A;  4MBQ A;  2HH7 A;  3AA7 B;  4OYJ A;  4DMW A;  3ZN1 B;  3RQW A;  2YDR A;  4CN6 A;  4ERR A;  5AQK B;  1MIV A;  1I94 T;  1D1B A;  5A1L A;  2HN1 A;  1NEK A;  2M67 A;  2OA5 A;  3LBX A;  4UEL A;  5FXZ A;  2WWV A;  2H89 A;  4HKA A;  4DV4 T;  3HKB E;  4PJN A;  1KNP A;  2A9U A;  4LML A;  3UUL A;  5F5W A;  5IUX A;  4YJ3 E;  2XQ9 A;  5JDL A;  3TLU A;  3ZMS B;  4DID B;  3BK9 A;  2KMF A;  3I1A A;  2ZLY A;  3SFE A;  4DR2 T;  4CXX A;  2ZM0 A;  3J7Y q;  4CI3 B;  2UU9 T;  2XSA A;  3FZL B;  2CHO A;  4OFZ A;  2JQK A;  3BQI A;  3CK6 A;  3EDV A;  5AQV B;  3AEG A;  2HN2 A;  3MKD A;  3Q5W A;  3UU6 A;  2X0L B;  1YQ4 A;  3I0O A;  2LLY A;  5AQJ B;  3AE1 A;  3WAK A;  5LG3 A;  4ZI3 C;  1YKH B;  3BQK A;  3GWH A;  4QXB B;  2VKJ A;  3UQ4 A;  4IGU A;  4IDN A;  1N34 T;  2LJL A;  4ZEY A;  2X0Y A;  1LVK A;  2LSG A;  5FMN A;  2IHR 1;  2VL0 A;  3J9X 1;  3RYF E;  4ZI3 D;  2W2U A;  3AE3 A;  3SFD A;  4L0R A;  1HF8 A;  1R8I A;  5ADX L;  4UF0 B;  1FMW A;  5JQG E;  2WU5 A;  1HTJ F;  5L4H A;  4C91 A;  2W0G A;  3GN5 A;  4K0K T;  3KV9 A;  4X65 T;  3CVR A;  3AE5 A;  4H9R C;  2YK0 A;  4YHH T;  2XAQ B;  4DV5 T;  2VAS A;  3F57 A;  3IBP A;  2SPC A;  4JYA T;  4AKR B;  2NOX A;  3C51 A;  4O2A E;  2XQA A;  3FB2 A;  2VQF T;  3ETU A;  4TN7 B;  4WYV A;  1N32 T;  2BKP A;  2BG9 E;  2LHN A;  3QB5 A;  5HXR A;  1IZN B;  2WDV A;  3ZYL A;  4IE6 A;  1UX4 A;  2PTF A;  2R6G F;  5JH7 E;  2LSI A;  2IIU A;  3JC6 D;  2D2S A;  1CHU A;  5LNK A;  3KDS E;  1FJG T;  4I55 E;  4DV1 T;  4EAH A;  3PTR B;  5HCM A;  4JI2 T;  4JI4 T;  2V7K A;  1O3X A;  3ZC0 A;  2E9X C;  3UFG A;  2XQ5 A;  2W61 A;  1OED C;  4OYK A;  3SOL A;  4UIG A;  4KI0 F;  4U72 A;  4DV2 T;  3N9Q A;  3JC6 C;  3P4S A;  3AEA A;  5JVD E;  2UXN B;  5L3G B;  2XUE A;  3HKC E;  4ISS A;  2LOP A;  3H3A A;  4X1Y E;  4NXM T;  3AA6 B;  4JI8 T;  5LP6 E;  4IDO A;  2MOZ A;  3RX6 A;  4TV9 E;  5E0O A;  4JI1 T;  4HWI B;  2CBI A;  3LSV A;  4Z91 A;  1D0Y A;  2JRK A;  5AQU B;  3P4P A;  4ANJ A;  1H7C A;  2UXD T;  4IL4 A;  2Q9Q C;  3ZCI A;  4I4T E;  4QX8 B;  4BAY B;  3M3Z B;  2N2N A;  4J2C A;  5LMN T;  3RC3 A;  2G0U A;  4L9I A;  3L09 A;  2K5B B;  4UVA B;  3JAE A;  5FVL A;  5F3J A;  4Q25 A;  4ZHQ E;  1HS7 A;  2K48 A;  2CHN A;  5LGN B;  2JQ9 A;  3CML A;  3RIF A;  2N1G A;  2ES0 A;  3AB3 B;  5IWA T;  4PK5 A;  3AA1 B;  4TWH A;  1WCR A;  4TX5 A;  5DQV A;  3ZN0 B;  4JEH B;  4PFO A;  3V5U A;  3OKQ A;  5JRE A;  5BR8 T;  3AA0 B;  1XNR T;  2WM9 A;  3RPU A;  1MIW A;  2YDS A;  1MND A;  3EHZ A;  3IHR A;  5FP3 A;  5J2U E;  5KXJ A;  2D5U A;  1FMV A;  2X9X A;  1W0A A;  3PJA J;  5GON E;  5H6R B;  2E9X D;  2VKD A;  3P8C D;  2K3W A;  3X1D A;  3AEC A;  2DCF A;  3IEE A;  3M65 A;  3ZCJ A;  4ZI7 E;  5HEJ A;  3SS1 A;  4DR5 T;  2X9Y A;  1NWM X;  3PE0 A;  2C5K T;  3I9W A;  4UF0 A;  4WW0 A;  5FY0 A;  4H9S E;  3N2O A;  3ZST A;  4EXT A;  3K8P C;  1M7K A;  5AQI B;  3U3I A;  3MK7 C;  2WMN A;  2CWO A;  5FNV E;  2AE9 A;  4N78 D;  1MMA A;  2XQY A;  4OHF A;  4YY3 T;  3S4U A;  2VL8 A;  3O1H A;  2EHO A;  2K9A A;  4WZX A;  2MAW A;  4JI0 T;  5L3C B;  5L47 A;  3RHW A;  1VCT A; 
#chains in the Genus database with same CATH homology
 4O4L E;  2NP9 A;  2KZ7 B;  4EOZ B;  4V1A v;  5KDM C;  2CE7 A;  5KMG P;  2H3R A;  3NRY A;  2MTQ A;  4MAL A;  5JRC A;  4P0B A;  3RRC A;  5LGU B;  1OWA A;  5EK4 A;  3VHL A;  5JDM A;  1S94 A;  3NZQ A;  2MYS A;  3PU8 A;  3E22 E;  4BJN A;  4QHO A;  4UEM A;  4KUM B;  4X1I E;  2A72 A;  4MLK A;  3RRW A;  3MJX A;  2ZM2 A;  2LEH A;  4DBQ A;  4WNK A;  4PFP A;  4EZ4 A;  2PBI A;  3LG7 A;  3HR0 A;  3ANW B;  4AQF A;  5IHY A;  2YEV C;  4HE8 A;  3VU7 H;  1LRZ A;  1MIY A;  3PU3 A;  3IF8 B;  1D1A A;  4IST A;  5HXH A;  4MHC A;  3HA4 A;  3KVA A;  5KX5 E;  1IAP A;  1YKE B;  3KV5 A;  1MMG A;  4JEU B;  4K0U A;  4QKN A;  2CMR A;  4I43 B;  2RA1 A;  4H63 V;  2BDE A;  3ZMT B;  4GYS A;  3I9Y A;  4UV9 B;  3EDU A;  1KK7 A;  2QGS A;  2YU1 A;  1US7 B;  3WI3 A;  4PK4 A;  2X67 A;  2L3L A;  5JDH A;  2PJQ A;  1WLX A;  4I50 E;  3EVY A;  4GOU A;  4Z8X A;  3RYC E;  4B6X A;  2CA5 A;  3RYI E;  4H63 H;  3C64 A;  3UFE A;  3N2K E;  2XTL A;  1ZKE A;  2IC6 A;  1LKX A;  4E7Z A;  2CXL A;  2EHO D;  3FBZ A;  3OYZ A;  5FXV A;  3A5X A;  2BZB A;  5CA1 E;  5L3B B;  3CX7 B;  3ANW A;  2LE8 A;  2W63 A;  4C90 A;  4O4J E;  3UTK A;  3VKG A;  4QXH B;  3E0Z A;  2LSJ A;  1ZEE A;  3GN5 B;  3W15 B;  3PDY A;  2NW7 A;  3FBL A;  1V9D A;  1HG5 A;  1YD8 G;  3O9X A;  4BJM A;  2Y8D A;  5J1G A;  3BQL A;  2V26 A;  2N9D A;  4PW8 A;  5L3F B;  4HGA A;  1KNZ A;  4P09 A;  2WBL A;  4AKH A;  2KXP B;  3ZMU B;  4X20 E;  2XAS B;  3OBV E;  3CX6 B;  3U78 A;  5JRC B;  2DWG A;  4TV8 E;  3CKD A;  3TKL B;  1QUU A;  2KT9 A;  2BVL A;  2H7V C;  2DHR A;  2CXD A;  4YLH A;  5LBQ B;  3KVB A;  4PJL A;  1FEW A;  4IIJ E;  3AVS A;  4ZS2 A;  5LHI B;  2IC9 A;  2Z6E A;  3RH3 A;  1S35 A;  5LA6 E;  2W62 A;  3GA8 A;  1OXZ A;  2JMH A;  2Q9Q A;  1BR4 A;  3OYX A;  1CUN A;  2CM0 A;  5HWX A;  3RC8 A;  5LOV E;  4HFV A;  3D0T A;  5LYJ E;  1D1C A;  1U4Q A;  2XHE B;  5JDF A;  4EZH A;  4ZI2 D;  5EK2 A;  2X51 A;  4DMV A;  3O1I A;  2DLR A;  1WYB A;  2IAK A;  4DND A;  2V7I A;  3H37 A;  4XAX B;  5L2L A;  2W00 A;  3N5L A;  4PAG A;  4PJJ A;  2CWY A;  2X66 A;  3QK6 A;  5HWY A;  3Q2M A;  3P7I A;  4CI1 B;  4O8S A;  3ETV A;  2DNX A;  1ZV4 X;  4FI5 A;  3N9M A;  4IDZ A;  3RKO A;  2HPJ A;  3N9O A;  2BVM A;  4DO0 A;  2HPL A;  3R6N A;  2DI4 A;  2C0S A;  4NUV A;  3VKH A;  2E9X B;  2K24 A;  2D0U A;  1T98 A;  3DTO A;  4PJM A;  5DAB A;  1VRB A;  5JR9 B;  5LJN A;  4IE4 A;  3FHN A;  4GK0 E;  4IE5 A;  4YHJ A;  4ZI2 C;  4AKG A;  2KWI B;  4KBM B;  3C4W A;  3B13 A;  5CA0 E;  1BR1 A;  1MNE A;  2ODU A;  4H9P C;  3FXE B;  4L5G A;  4H9Q C;  2Y48 B;  5HXS A;  2CXF A;  3HI2 A;  2XAF B;  3O1J A;  3ZJ1 A;  2Y6X A;  3QC9 A;  4QXC B;  2WWU A;  5ETW A;  4AKI A;  4EYU A;  5H6Q B;  4M1P A;  2I59 A;  2WSS V;  2LT3 A;  2JQQ A;  2VKH A;  3AAA B;  3WAJ A;  2P9B A;  3QUJ A;  5JR9 A;  2NW9 A;  3N9N A;  4KMC A;  3AAE B;  1VOM A;  1ZHC A;  3N9P A;  2WAU A;  3I0Q A;  3Q5X A;  5JDN A;  3E08 A;  4O4I E;  4AKL A;  5LXT E;  2ODV A;  2CEA A;  4IE0 A;  4UVC B;  5LG4 A;  2EHO C;  2IW5 B;  4XBF B;  3K3Q C;  1HG2 A;  5LGT B;  1MMD A;  2Q9Q D;  1D0X A;  2NTX A;  3LK3 B;  3L3P A;  3UUM A;  2B1E A;  3K3O A;  2V7L A;  5LCY A;  2A3D A;  5FY1 A;  3KV6 A;  3HKE E;  4HEA A;  3SRZ A;  5HAX A;  2KWH A;  3ZMZ B;  2H7O A;  4QX7 B;  2A2F X;  3ZYM A;  2L8K A;  3ZEF B;  2GK9 A;  2LM9 A;  3UT5 E;  1UCU A;  4JUY A;  4YJ2 E;  2WMO A;  4IHJ E;  2ZMA A;  3LK2 B;  4PNI A;  5LHH B;  5JDQ A;  1EZ3 A;  2E8I A;  4AQG A;  4G2A A;  1BR2 A;  5CB4 E;  3C4X A;  4DBR A;  2QA7 A;  4CXY A;  2CLY C;  3MXZ A;  3UUN A;  3LK4 2;  4XZC A;  2E9X A;  3SWH A;  3ZPO A;  3HKD E;  3PUA A;  4TZ4 C;  4UVB B;  2X68 A;  3Q9D A;  2C5J A;  3CX8 B;  2MBG A;  2D0T A;  3CQX C;  5C8Y E;  4AXP A;  2VWA A;  1IJ6 A;  2XAG B;  4UV8 B;  3ZJ2 A;  5JDG A;  1E1H B;  1X79 A;  3NRX A;  1B7T A;  5IYZ E;  1G8X A;  3PUG A;  1LVF A;  4YFS A;  3CPZ A;  5J2T E;  2UXX B;  3C98 B;  4ASK A;  3PUQ A;  3FXD B;  5L3E B;  4O2B E;  1WRD A;  2DWK A;  5TAO A;  4KP3 C;  3ZMV B;  2RP4 A;  2V7M A;  2PFV A;  5FYM A;  4ILU A;  4HTE A;  5FXX A;  3O4X E;  1WR6 A;  1AJ3 A;  1IJ5 A;  3OJA A;  4X1K E;  3RYH E;  4P0A A;  2L9Q A;  2KLQ A;  4OK0 A;  2CLY B;  5M4Y A;  5F8P A;  1D0Z A;  4NUU A;  3ZC1 A;  5JR9 C;  5L3D B;  1Z0P A;  3F31 A;  3C4Z A;  3MZK B;  4HN9 A;  1WYC A;  1YW0 A;  4IE7 A;  3DP7 A;  1SA0 E;  3LFM A;  3ESL A;  4BA9 A;  1NAF A;  2JPF A;  2XAJ B;  5EZY E;  4H9O C;  4EIW A;  2YU2 A;  2VKO A;  5HXE A;  3CQC B;  3F2E A;  2NW8 A;  4U74 A;  2XAH B;  3DJB A;  2Q9Q B;  3AAI A;  3KFW X;  3KIN B;  2V1D B;  4G63 A;  4AI6 A;  3HL6 A;  1FIO A;  4EB6 E;  3GMI A;  3UUX B;  3B57 A;  1SHZ C;  3N2G E;  1Y64 B;  4ADZ A;  4H9N C;  3MAC A;  2JMK A;  5LJM A;  3PUR A;  4CQI A;  4QWN B;  4WBN E;  1HFA A;  1U5P A;  4GK5 E;  4TUY E;  4CXW A;  2JJ9 A;  2V7J A;  5DJQ C;  5DQW A;  2VK9 A;  3CWZ B;  1UX5 A;  4ZOL E;  1G73 A;  4FJO A;  1BR0 A;  4EYY R;  2PG8 A;  2YIN A;  3KBU A;  2LOS A;  5BMV E;  2J1D G;  3KV4 A;  3EUH A;  2NWB A;  3R84 B;  2ACX A;  4GYR A;  3MA9 A;  4JLE A;  4MFR A;  5HXC A;  5HYA A;  2VB6 A;  2LSK A;  2X9H A;  3NZP A;  4O4H E;  2C5I T;  3ZLI A;  2X9W A;  4F6R C;  2ZM8 A;  2KND A;  4A56 A;  3NBX X;  3PUS A;  3N9L A;  4AQF C;  3C50 A;  4WBO A;  2KIN B;  3ONX A;  5LBM A;  3V5S A;  2EHO B;  2LSY A;  5FXW A;  1HX8 A;  5AFU L;  4GIW A;  4UXN B;  3T8O A;  4CZZ B;  3KBT A;  3LBX B;  3ZYK A;  3K3N A;  5EK3 A;  4DVD A;  2LHR A;  4PK6 A;  3CQG B;  3AVR A;  3LJC A;  4ZS3 A;  5FY7 A;  1HCI A;  4CI2 B;  2NTY A;  1MMN A;  2CCQ A;  4MBQ A;  1QSD A;  3AA7 B;  2HH7 A;  4OYJ A;  4DMW A;  3ZN1 B;  4ERR A;  1MIV A;  1D1B A;  5A1L A;  2M67 A;  2OA5 A;  3LBX A;  4UEL A;  5FXZ A;  4HKA A;  3HKB E;  4PJN A;  3UUL A;  4YJ3 E;  5JDL A;  3ZMS B;  3BK9 A;  2KMF A;  3I1A A;  2ZLY A;  4CXX A;  2ZM0 A;  3J7Y q;  4CI3 B;  4OFZ A;  3EDV A;  3BQI A;  3MKD A;  3Q5W A;  2X0L B;  3I0O A;  3WAK A;  4ZI3 C;  1YKH B;  3BQK A;  3GWH A;  4QXB B;  2VKJ A;  4IGU A;  2LJL A;  1LVK A;  2LSG A;  5FMN A;  3J9X 1;  3RYF E;  4ZI3 D;  5ADX L;  4L0R A;  1HF8 A;  5JQG E;  4UF0 B;  1FMW A;  1HTJ F;  4C91 A;  2W0G A;  3GN5 A;  3KV9 A;  3CVR A;  4H9R C;  2YK0 A;  2XAQ B;  2VAS A;  3F57 A;  3IBP A;  2SPC A;  4AKR B;  2NOX A;  3C51 A;  4O2A E;  3FB2 A;  3ETU A;  4TN7 B;  2LHN A;  4E7S A;  5HXR A;  1IZN B;  3ZYL A;  5JH7 E;  4IE6 A;  1UX4 A;  2LSI A;  3JC6 D;  2D2S A;  5LNK A;  3KDS E;  4I55 E;  4EAH A;  3PTR B;  3ZC0 A;  2V7K A;  1O3X A;  2E9X C;  2W61 A;  4OYK A;  3SOL A;  4UIG A;  4U72 A;  3N9Q A;  3JC6 C;  5JVD E;  2UXN B;  5L3G B;  2XUE A;  3HKC E;  4ISS A;  2LOP A;  3H3A A;  4X1Y E;  3AA6 B;  5LP6 E;  2MOZ A;  3RX6 A;  4TV9 E;  5E0O A;  1D0Y A;  2JRK A;  4ANJ A;  1H7C A;  2Q9Q C;  3ZCI A;  4I4T E;  4QX8 B;  4BAY B;  2N2N A;  4J2C A;  3RC3 A;  2G0U A;  4L9I A;  3L09 A;  2K5B B;  4UVA B;  5F3J A;  4ZHQ E;  1HS7 A;  2K48 A;  5LGN B;  3CML A;  2N1G A;  2ES0 A;  3AB3 B;  4PK5 A;  3AA1 B;  4TX5 A;  5DQV A;  3ZN0 B;  4JEH B;  4PFO A;  3V5U A;  3OKQ A;  5JRE A;  3AA0 B;  2WM9 A;  3RPU A;  1MIW A;  1MND A;  5FP3 A;  3IHR A;  5J2U E;  2D5U A;  1FMV A;  2X9X A;  5GON E;  5H6R B;  2E9X D;  2VKD A;  3P8C D;  4ZI7 E;  3M65 A;  2DCF A;  3IEE A;  3ZCJ A;  3SS1 A;  2X9Y A;  1NWM X;  3PE0 A;  2C5K T;  3I9W A;  4UF0 A;  4WW0 A;  5FY0 A;  4H9S E;  3N2O A;  4EXT A;  3K8P C;  3U3I A;  3MK7 C;  2WMN A;  2CWO A;  5FNV E;  4N78 D;  2XQY A;  1MMA A;  4OHF A;  3S4U A;  2VL8 A;  3O1H A;  2EHO A;  2K9A A;  5L3C B;  5LHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...