5KMGP

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
128
structure length
128
Chain Sequence
GAAALKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1520 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5kmgP00
3NRXA 3NRYA 5KMGP
chains in the Genus database with same CATH superfamily
2MBGA 2RP4A 3I0QA 5M4YA 4YY3T 3R6NA 4AQGA 5J2TE 2JIWA 2BBJA 1D1AA 5L3BB 4X1IE 4Z90A 4AQFA 2YN6A 3N9QA 5AQUB 4M1PA 2W67A 4IL9A 3DTOA 2WP9A 4B3RT 2WZHA 3X1DA 3PUYF 2CBIA 1YW0A 3A7MA 4PNIA 3C4ZA 2UXCT 4CZZB 3AA0B 4X20E 4GOUA 4LF8T 2XM1A 5HXEA 2A3DA 5JDGA 2VL0A 4DIDB 2BS3A 3ONLC 1L0VA 4XAXB 3NRYA 3N9NA 1NEKA 5LG3A 3OVUA 3KFWX 2D9DA 2NW7A 5LP6E 2CPTA 3C98B 4TWHA 4XBFB 3FXDB 3C51A 3N9OA 3RRCA 3FBZA 3N9MA 3CX7B 4UVAB 3ZMSB 4HGAA 2A2FX 2CBJA 3IA3A 3JC6D 5HXHA 3PUXF 2EHOB 3MKDA 4PK6A 2E5LT 4JI4T 2M67A 2W62A 4EEBA 1FEWA 2H88A 4P1NA 5FXWA 1N32T 2P9BA 4MHCA 2D0UA 4U31A 2E5VA 4AIUA 3FXEB 4ZI2C 3G06A 3ZCIA 5LGUB 4AKGA 3P4QA 2UUBT 3PDYA 3J9X1 3FZLB 2YOEA 4JI3T 2UXBT 2YDSA 4HWIB 3RYCE 2VKDA 3JAEA 5HXSA 2MTQA 1YD8G 2WQYA 1U4QA 2V8SV 3AE8A 3E08A 5CA0E 2NOXA 2WDVA 4HFVA 4L0RA 3KV9A 3N9PA 4ERRA 3Q2MA 2XUEA 4QX8B 2XASB 4HE8A 1NWMX 4LMLA 5AQGB 5AQQB 2JJ9A 2C0SA 3QB5A 4HFIA 4WW0A 4IE7A 5ABEA 5HXCA 2C5IT 2CCQA 3HKCE 2JPFA 4ZZBA 2HH7A 2WS3A 4DV6T 2WU2A 3B57A 2CA5A 3O1HA 2XQ8A 4DNDA 2QA7A 4JEUB 4PW8A 2V5DA 3O4XE 3QB5K 1KK7A 2X0YA 3TKLB 2CXDA 4WZXA 2LSYA 1OEDA 2BG9E 3PUAA 3ZN1B 3V5UA 3RKOA 4UVCB 5DQVA 4H9RC 2QYWA 2JRKA 3HKDE 4PAGA 3ZC0A 3KV5A 4TX5A 5AQFB 3TLUA 5JRCA 3O9XA 2UUAT 3H3MA 4YXDA 2E9XC 2VK9A 2BVLA 3KV6A 3BQIA 2LSJA 2X9YA 4H9PC 4YTMA 2WB5A 5AQSB 3UTKA 3OBVE 2BG9C 4A98A 3ONJA 3ZT5A 4HTEA 3ZT7A 2NP9A 3EI0A 5IWAT 5C3JA 5HEJA 5LMUT 3MA9A 4Q25A 3U78A 5AQVB 3U3IA 2QGSA 1X79A 1D0ZA 5FXXA 2R6GF 3KINB 5HYAA 2BKNA 3D0TA 4X65T 4QXCB 3WAJA 2FUPA 3AE2A 5FYMA 2BZBA 4I0UA 2CLYC 2N1GA 3LK3B 4MBQA 4AI6A 3HA4A 3EABA 3BK9A 4TZ4C 2PG8A 4Z91A 2ZLYA 4DVDA 1YKEB 2DCFA 3VHLA 1MIVA 2JMKA 2V7JA 4DBRA 2YDQA 3EDVA 1ZOYA 2VQET 1N36T 3KDSE 2X0HA 3ZPOA 5EK4A 1BR2A 3DP7A 4X64T 5ADXL 3UFGA 1MMGA 1T8BA 4UF0B 3ETUA 3WAKA 4O8SA 1FIOA 1UK5A 4ZI3D 4U7IA 1HG5A 2YDRA 1R8IA 4NUUA 5CB4E 4DR5T 2I6HA 2LKGA 4LMJA 4UEMA 5FY7A 1HFAA 5FVLA 4UR9A 3QK6A 4BA9A 3HKEE 4U2ZA 1ZV4X 1XNRT 3BQKA 3T1YT 4AQFC 2JMHA 5JVDE 1N33T 2WMOA 2XPKA 1KFYA 2V7LA 4PK5A 2LT3A 4EEDA 1WLXA 3QNUA 2E9XB 2YK0A 2XQ6A 4OYJA 4HWDA 3LK42 4C90A 4DR3T 5LG4A 4GKKT 3A5XA 4IL4A 1HNZT 2FJAA 3HKBE 2DHRA 1D1BA 1XMOT 1FMWA 2VKOA 2XQ3A 3RLFF 2JQHA 3P4RA 4P0AA 4X1KE 4HFEA 4A97A 1SE7A 4H63H 2Q9QB 2BG9A 1KNPA 3ZEFB 2Z6EA 3ZLIA 5LMNT 1T98A 2MAWA 1MNEA 3KBUA 3AE4A 1UUSA 5IYZE 3JC6C 2LM2A 1KF6A 2C5KT 4KMCA 4DV0T 3GN5A 4IDPA 2C5JA 5EZYE 4PK4A 4PJJA 1MMNA 4I43B 2VL8A 4IE0A 5L3CB 4H9QC 5FL1A 1NAFA 4KUMB 3OJAA 2CE7A 3IF8B 2XAQB 5LYJE 2IAKA 4OYKA 5E0OA 4FI5A 4P0BA 4IIJE 4DR1T 4JI8T 5FXZA 2VKHA 4IDQA 3E22E 3RYIE 3VU7H 4EZHA 3OYXA 4LFAT 1DU2A 1HX1B 5JH7E 2LSGA 2XQ5A 3PURA 3RI5A 3PUVF 3P7IA 2A72A 1WYBA 4GIWA 1D1CA 3ESLA 3EDUA 5FVKA 5J0ZA 2YKSA 1XMQT 4DMVA 4TV8E 3RYFE 3OKQA 4X1YE 4ZI7E 3ZYLA 3RGLA 3AXJA 1MMDA 2J4GA 1FJGT 2DWKA 2ES0A 4DO0A 4ZEYA 5AQNB 3AAAB 3AEAA 4K0KT 2WBLA 2MYSA 5LHHB 5EK2A 4YSXA 2VQFT 2XTLA 4P09A 5JTGA 2OA5A 3RF1A 3HI2A 5KX5E 4EOZB 1WRDA 2L8KA 3ZCJA 4COFA 1E1HB 1OEDC 2WCAA 1ZHCA 2V7MA 4QH5A 4A5XA 3I0OA 2XQ9A 5A1LA 2WM9A 1XWMA 5LJMA 4BJMA 2K3WA 5KXJA 2V7KA 4BJNA 3MZKB 1W0BA 3VKHA 1HX8A 2AE9A 2BVMA 1WFDA 5JREA 1US7B 1S94A 3QUJA 1E7PA 2BS4A 3CK6A 2M6IA 2ZMAA 4O4HE 1OWAA 2V5CA 4DV5T 3ZSSA 2QRXA 2D2SA 3E0ZA 1ZP0A 3QOFA 5FY0A 2WDQA 1VOMA 3TLWA 2XAFB 4MALA 2CWYA 5GONE 3EAMA 5LHGB 5IUXA 3LBXA 3ZKRA 2CHOA 4UV8B 2XAJB 3AVSA 3ZMVB 1WR6A 2UU9T 5LCYA 4JLEA 4CN1A 4PJLA 2KWHA 2B76A 3FB2A 4H9NC 3OYZA 2NR4A 2QVAA 2IW5B 2L3LA 4L5GA 1NENA 4TNWA 2ACZA 5CA1E 3VR9A 2X66A 4UIGA 1LVKA 3SOLA 2JQ9A 3RIAA 5CJ5A 2UXDT 5LA6E 2EHOD 4ASKA 2KLQA 4TWDA 2LOPA 2VWAA 3AE1A 3JADA 2VKJA 4CN4A 3C4XA 3ZMZB 4AKHA 1WYCA 2LSKA 2Y8DA 3RX6A 3ZMTB 3O1IA 4JEHB 2DI4A 4HN9A 1IBKT 2CM0A 4ILAA 4ZI3C 2PFVA 1T7SA 4ZXLA 4DR6T 3OPCA 1T72A 3PUGA 4LF9T 4H63V 5JDMA 4EB6E 3AE6A 1OEDB 4QH4A 3RQUA 2XQ7A 2NW8A 4BAYB 2UUCT 2HN2A 3NZPA 5FXVA 3TLVA 4QKNA 2K9AA 1N34T 3ZN0B 5ABHA 4ZS2A 3CMLA 5JRCB 3F2EA 4IE5A 2CXLA 3M3ZB 1XNQT 3AEEA 4WNKA 3CKDA 3B13A 4DUYT 4AKRB 4JBWF 1FMVA 3JCFA 4DBQA 4EXTA 4IT4A 3UT5E 4YJ2E 2KSRA 4ZHQE 3Q5DA 3SFDA 1LRZA 3RIFA 1QUUA 2FBWA 2OV9A 4PJMA 4YHJA 2W61A 3UUXB 4EIWA 2BS2A 2N9DA 3PUZF 1S35A 4JI5T 1HNWT 4B6XA 4ZZCA 2KT9A 3P50A 3CIRA 2D5UA 5FP3A 4CI2B 3N2OA 5F8PA 4QWNB 4UXNB 3RKGA 1JNRA 3Q5WA 1Y01A 3AEDA 5L4HA 3PU3A 3RRWA 2H7OA 4QXBB 2VVNA 3AA7B 5H6QB 2V26A 4NIQA 3L3PA 4H9SE 2X9WA 4XZCA 3PUWF 2MPKA 4IHJE 4EYUA 2J47A 3ZSTA 3Q5XA 3RC3A 2BBHA 4U74A 4YTNA 4B3TT 5EK3A 2XHEB 2SPCA 2HPJA 4X66T 5F3JA 5J1GA 5ETWA 1H7CA 1E2AA 3ETVA 4YTPA 4OHFA 4EYYR 1CUNA 2DNXA 3UQ4A 5H6RB 3EUHA 4I50E 2VVSA 1M7KA 2YU1A 2B1EA 2XJ7A 2FJEA 4K0UA 4A56A 4HFHA 1J1JA 4KHZF 5JR9A 2CHNA 2W66A 4CXYA 4F6RC 4CN6A 1G8XA 1J5ET 3AE3A 3PU8A 5AFUL 2LHRA 1QSDA 5BMVE 3UU5A 1HS7A 2A9UA 2WWVA 4TUYE 4U2YA 2XQAA 2ZM0A 2FJBA 2ZM2A 3Q5EA 4GK0E 4LFCT 4OK0A 1QLBA 3OTOT 4B3ST 1KNRA 4AQYT 4ZS3A 5AQIB 2HHHT 4J2CA 2X51A 4DV3T 2BKOA 5L4EA 3VKGA 3AEFA 5IHYA 2YEVC 2BG9B 1X9BA 4U3CA 3P4SA 5AQOB 2XAHB 1UCUA 2UXNB 5LOVE 3VR8A 1JNZA 3A8YC 5HEHA 5AQRB 4HKAA 2CMRA 3RC8A 3GA8A 2NWBA 3GN5B 3ZYKA 3ANWA 5TAOA 4EZ4A 3KVAA 3DJBA 1W0AA 4YJ3E 4E7ZA 2CXFA 2WMNA 3S4UA 2LHNA 4DMWA 4HFBA 3PUQA 1IJ5A 4JYAT 1HG2A 5AQJB 2WAUA 2CLYB 3LG7A 3AA6B 1EZ3A 3MK7C 4TN7B 4LF5T 5HEUA 3FZKB 2J1DG 2Q9QA 2E2AA 4KI0F 3N2KE 5L3FB 3GWHA 2XSBA 3T8OA 3ZYMA 2LEHA 2V1DB 2Q9QD 3MXZA 5HWYA 1O3XA 2LLYA 2LOSA 1W09A 2FJDA 4X62T 5LJNA 3VRAA 3RQWA 1OXZA 2PJQA 3K3QC 3I9YA 1V9DA 2ZM6T 4JI6T 5ABFA 3RHWA 2BKPA 3AXJB 3R84B 5HXRA 4IGUA 2K24A 5AQMB 3AA1B 2X0LB 1HTJF 2VURA 2XAGB 2V6YA 3UUNA 4GK5E 2H89A 3SFEA 3CPZA 4O4LE 5JDNA 1MIWA 3EVYA 1YQ3A 1B7TA 3SWHA 5JDLA 4HWCA 2YINA 2RA1A 3LK2B 4NXMT 2IDOB 4U72A 3J7Yq 2XZEA 4ILBA 3L39A 2E8IA 5FL0A 3PV0F 2X9XA 5HWXA 4ANJA 4QXHB 3F31A 3SS1A 3IEEA 4I55E 1YQ4A 4JUYA 1D0XA 1ZKEA 4KX6A 4F8HA 5AQHB 1LKXA 4CXWA 1UURA 2LRLA 1VRBA 4HFDA 3CWZB 3PE0A 1UX4A 1CHUA 1SA0E 4L9IA 3NBXX 3MJXA 1YXRA 4KP3C 2D0TA 3ZJ2A 3RYHE 2I0MA 2UXXB 3Q9DA 2DLRA 2GK9A 3UU3A 3PTRB 4LF4T 5JDQA 3UULA 4YHHT 3FZHB 3LBXB 4HWHA 4G63A 3VRBA 4AKIA 4CQIA 3I1AA 3AE9A 4O2BE 2I59A 2X67A 2KINB 4JI7T 2BDEA 3ZMUB 2V7IA 3K3NA 2NTXA 4HFCA 2IUBA 5LHIB 2OLTA 3JAFA 1IJ6A 3KV4A 2W4XA 5L3EB 4EGWA 2WSSV 3UUBA 3RIUA 4DUZT 2X68A 1MIYA 1IBMT 4DV2T 3P4PA 3I9WA 3RH3A 2LE8A 4PJNA 5DJQC 4U33A 3N5LA 3C64A 1HF8A 1M62A 3AB3B 3AE7A 1BR0A 2EHOA 1I94T 3C4WA 5J2UE 4GYRA 2KMFA 2ACXA 4ISSA 4DV7T 4O4IE 2WWUA 1XDPA 2XQYA 3C50A 1D0YA 4LFBT 5FKYA 3LSVA 2CEAA 5CGMA 4UELA 2ODUA 2LSIA 2X9HA 3MACA 4NPPA 3M65A 5JR9C 4IE6A 2J62A 4GYSA 2XSAA 5HEOA 2LRKA 4O2AE 2K48A 4KBMB 4LF7T 5FY1A 3FBLA 1HR0T 2ZM8A 3PUSA 1AJ3A 2IMLA 3SRZA 4KHPT 2VB6A 4OFZA 3UFEA 4EV6A 2F4VT 1YKHB 5JQGE 2G0UA 2W0GA 2DWGA 4JI2T 5C2TA 2WU5A 5F5WA 3K3OA 5LGTB 2KXPB 4X5TA 3NKZA 2RPAA 4B3MT 2WY2A 3NRXA 5DQWA 2W00A 5HEGA 3NVOA 2YU2A 3KVBA 4QX7B 2NW9A 2H3RA 5JDHA 1BR1A 3L09A 3O1JA 3AAEB 2LKHA 5LBQB 4JV5T 2M6BA 4YSYA 3UQ7A 3ABVA 2HPLA 1MNDA 1ZEEA 3HL6A 3CX8B 3AECA 4I4TE 4PFOA 2LJLA 1WCRA 2H7VC 4AISA 2NTYA 3CVRA 4ISTA 3FZFB 5LB7B 4LF6T 4H9OC 3V5SA 1LVFA 2WZIA 2Q9QC 4G2AA 4WBOA 2KWIB 3PJAA 2IC9A 5HCMA 2VASA 4GKJT 2V6XA 5AQLB 4ILUA 4CI3B 2IHR1 4QHOA 3K8PC 4V1Av 5LNKA 4DR2T 4CXXA 3KBTA 4IREA 4JI1T 4PFPA 5AQPB 4ZI2D 3ONXA 4IDZA 4Z8XA 5JDFA 1HNXT 3ZT6A 1W9RA 2N2NA 3CQCB 3W15B 4AKLA 3AE5A 5JR9B 4YLHA 2Y48B 3BQLA 3LJCA 1MMAA 3CQGB 4N78D 4ADZA 4DR4T 3K1SA 4FJOA 1WR0A 5L3GB 2LM9A 3QC9A 2DL1A 4JI0T 4HWFA 5LXTE 1UX5A 1BR4A 1J5WA 1VCSA 4UV9B 4OX9T 3L8RA 2HN1A 4MFRA 5L3DB 3H37A 1UGOA 2L9QA 1IAPA 2CRBA 1XZYA 3ZC1A 2JQQA 2XY8B 5L47A 5CFBA 3WI3A 3T1HT 4UF0A 4MLKA 2WDRA 1IZNB 4DV4T 3TLTA 1HCIA 3UU8A 2KNDA 4YSZA 5KMGP 3ANWB 2Y6XA 4NUVA 4LMKA 1SUMB 3NZQA 1KEYA 2E9XA 5LBMA 2XM2A 3RPUA 4CI1B 2E9XD 3NWIA 1VCTA 4QH1A 4YFSA 4U7YA 5LGNB 4E7SA 1GQEA 5KDMC 3GMIA 2XQ4A 2PTFA 4TNVA 4ZOLE 4O4JE 2KZ7B 4DR7T 1I6ZA 4IDNA 2IIUA 1XDOA 1G73A 3LDQB 1U5PA 5AQKB 3RIUC 3UU6A 3FHNA 3H3AA 5FNVE 3AAIA 5ABFB 3P8CD 2W63A 3UUMA 4EAHA 2ODVA 3TLSA 4IE4A 2JQKA 5AQTB 3IHRA 3CQXC 5ABGA 2EHOC 3AVRA 4UVBB 3IBPA 3AEBA 3PJAJ 5BR8T 1Z0PA 2V6YB 2W2UA 4TV9E 3P4WA 3AEGA 3N2GE 3FZMB 3HR0A 3LFMA 2MOZA 4YT0A 5C8YE 4DV1T 5FMNA 4WYVA 2AXDS 5HCJA 4IDOA 3N9LA 1Y64B 2K5BB 1IBLT 2IC6A 4C91A 4TWFA 3F57A 5DABA 1SHZC 2CWOA 1Z8UA 4ILCA 5HAXA 3CX6B 1OEDE 1KNZA 4NXNT 3B5MA 4HEAA 4AXPA 4WBNE 3ZJ1A 2PBIA 3EHZA 3UU4A 5L2LA
chains in the Genus database with same CATH topology
3Q5WA 4ISSA 2MBGA 2RP4A 3PU3A 3I0QA 3RRWA 3HKBE 4O4IE 2DHRA 1D1BA 2WWUA 2XQYA 5M4YA 2H7OA 1FMWA 2VKOA 3C50A 4QXBB 1D0YA 3R6NA 4AQGA 3AA7B 5H6QB 2V26A 5J2TE 3L3PA 4H9SE 2CEAA 4P0AA 2X9WA 4XZCA 4X1KE 1D1AA 5L3BB 4IHJE 4UELA 4EYUA 4X1IE 4H63H 4AQFA 2ODUA 2Q9QB 3Q5XA 3N9QA 2LSIA 3RC3A 4M1PA 2X9HA 3ZEFB 3MACA 2Z6EA 3DTOA 3M65A 3ZLIA 5JR9C 1T98A 4IE6A 4U74A 1YW0A 1MNEA 3KBUA 5EK3A 4PNIA 3C4ZA 4GYSA 5IYZE 3JC6C 4O2AE 2C5KT 4CZZB 2XHEB 3AA0B 4KMCA 4X20E 4GOUA 2SPCA 3GN5A 2HPJA 2K48A 5F3JA 4KBMB 5J1GA 2C5JA 5ETWA 2A3DA 4PK4A 5EZYE 5HXEA 5JDGA 4PJJA 1MMNA 5FY1A 1H7CA 3ETVA 4I43B 4OHFA 3FBLA 4EYYR 2VL8A 1CUNA 4IE0A 5L3CB 2ZM8A 3PUSA 4H9QC 4XAXB 1AJ3A 2DNXA 1NAFA 3NRYA 5H6RB 3N9NA 4KUMB 3EUHA 4I50E 3SRZA 2YU1A 2VB6A 4OFZA 3UFEA 3OJAA 2CE7A 2B1EA 3KFWX 3IF8B 1YKHB 2XAQB 5JQGE 2NW7A 4K0UA 5LP6E 2IAKA 4OYKA 4A56A 5LYJE 5E0OA 3C98B 4FI5A 4P0BA 2G0UA 2W0GA 2DWGA 4IIJE 4XBFB 3FXDB 3C51A 5JR9A 5FXZA 3K3OA 5LGTB 2KXPB 2VKHA 3N9OA 3E22E 3RRCA 3RYIE 3FBZA 4CXYA 3VU7H 3N9MA 4F6RC 3NRXA 4EZHA 3CX7B 5DQWA 2W00A 4UVAB 3ZMSB 4HGAA 1G8XA 2A2FX 2YU2A 3JC6D 3KVBA 3OYXA 4QX7B 3PU8A 2NW9A 2H3RA 5AFUL 2LHRA 1QSDA 5BMVE 5HXHA 5JDHA 1HS7A 2EHOB 1BR1A 3MKDA 2LSGA 4TUYE 3L09A 3O1JA 5JH7E 3AAEB 4PK6A 3PURA 2M67A 2W62A 1FEWA 2ZM0A 5LBQB 2ZM2A 4GK0E 4OK0A 3P7IA 5FXWA 2A72A 2P9BA 1WYBA 4GIWA 4MHCA 2D0UA 2HPLA 1D1CA 3ESLA 1MNDA 3EDUA 4ZS3A 3FXEB 1ZEEA 4ZI2C 3HL6A 4DMVA 4TV8E 3CX8B 3RYFE 3OKQA 4X1YE 3ZCIA 5LGUB 4I4TE 4J2CA 4ZI7E 2X51A 3ZYLA 4PFOA 4AKGA 2LJLA 1MMDA 3PDYA 3J9X1 3VKGA 2H7VC 5IHYA 2NTYA 2YEVC 2DWKA 2ES0A 3CVRA 4ISTA 4DO0A 4H9OC 3AAAB 3RYCE 2VKDA 2XAHB 1UCUA 2WBLA 3V5SA 2UXNB 2MYSA 5HXSA 2MTQA 1LVFA 5LOVE 5LHHB 5EK2A 4HKAA 2CMRA 1YD8G 2Q9QC 4G2AA 4WBOA 3GA8A 2XTLA 3RC8A 2KWIB 1U4QA 4P09A 3E08A 5CA0E 2NOXA 2IC9A 2NWBA 3GN5B 4HFVA 4L0RA 3ZYKA 3ANWA 2OA5A 5TAOA 4EZ4A 3KV9A 3N9PA 4ERRA 3HI2A 5KX5E 2VASA 3KVAA 3DJBA 4YJ3E 4EOZB 4E7ZA 3Q2MA 2XUEA 1WRDA 2CXFA 2WMNA 4ILUA 3S4UA 4CI3B 2L8KA 3ZCJA 4QX8B 4QHOA 1E1HB 3K8PC 4V1Av 5LNKA 2XASB 4HE8A 1ZHCA 2V7MA 4CXXA 1NWMX 3KBTA 2LHNA 3I0OA 4DMWA 4PFPA 2JJ9A 2C0SA 3PUQA 1IJ5A 4WW0A 5A1LA 2WM9A 4ZI2D 4IE7A 1HG2A 5LJMA 3ONXA 4IDZA 4Z8XA 4BJMA 5JDFA 2WAUA 2CLYB 5HXCA 2C5IT 2V7KA 3LG7A 2CCQA 3HKCE 2N2NA 4BJNA 3MZKB 3CQCB 2JPFA 3AA6B 1EZ3A 3W15B 3VKHA 4AKLA 3MK7C 4TN7B 2HH7A 1HX8A 5JR9B 4YLHA 2BVMA 5JREA 1US7B 2J1DG 2Q9QA 1S94A 2Y48B 3B57A 3BQLA 3LJCA 1MMAA 3CQGB 3QUJA 4N78D 2CA5A 3O1HA 3N2KE 5L3FB 4DNDA 4ADZA 3GWHA 2QA7A 2ZMAA 3T8OA 3ZYMA 4JEUB 4O4HE 4PW8A 1OWAA 2LEHA 2V1DB 2Q9QD 3MXZA 4FJOA 5HWYA 1O3XA 3O4XE 2D2SA 5L3GB 3E0ZA 1KK7A 2LM9A 3QC9A 3TKLB 2LOSA 2CXDA 2LSYA 3PUAA 3ZN1B 5LXTE 5FY0A 3V5UA 3RKOA 5LJNA 1UX5A 4UVCB 1BR4A 5DQVA 4UV9B 1VOMA 4H9RC 1OXZA 2PJQA 2XAFB 3I9YA 3K3QC 4MALA 2JRKA 3HKDE 4PAGA 3ZC0A 2CWYA 3KV5A 1V9DA 5GONE 4MFRA 4TX5A 5LHGB 5L3DB 3H37A 3O9XA 5JRCA 3LBXA 3R84B 5HXRA 2L9QA 4IGUA 1IAPA 2E9XC 2VK9A 2BVLA 2K24A 4UV8B 3ZC1A 3KV6A 3BQIA 2JQQA 2LSJA 3WI3A 4UF0A 3AA1B 2XAJB 3AVSA 4MLKA 2X9YA 3ZMVB 1WR6A 2X0LB 1IZNB 4H9PC 5LCYA 1HTJF 4JLEA 3UTKA 2XAGB 3OBVE 4PJLA 2KWHA 3FB2A 3UUNA 4H9NC 3OYZA 1HCIA 2KNDA 2IW5B 2L3LA 4HTEA 4L5GA 4GK5E 5KMGP 3ANWB 3CPZA 4O4LE 5CA1E 2Y6XA 5JDNA 1MIWA 2NP9A 3EVYA 4NUVA 2X66A 4UIGA 1B7TA 3SWHA 1LVKA 3SOLA 5JDLA 2YINA 2RA1A 3LK2B 3MA9A 3NZQA 4U72A 5LA6E 3J7Yq 2EHOD 4ASKA 2KLQA 3U78A 2E8IA 2LOPA 2VWAA 2E9XA 2QGSA 2VKJA 3U3IA 3C4XA 2X9XA 1X79A 1D0ZA 5LBMA 3ZMZB 4ANJA 5HWXA 4AKHA 4QXHB 5FXXA 3F31A 1WYCA 3RPUA 3SS1A 4CI1B 3IEEA 3KINB 4I55E 4JUYA 2LSKA 2Y8DA 2E9XD 3RX6A 5HYAA 1D0XA 3ZMTB 3D0TA 4QXCB 1ZKEA 3O1IA 4JEHB 2DI4A 4HN9A 4YFSA 3WAJA 2CM0A 5FYMA 2BZBA 2CLYC 2N1GA 3LK3B 4ZI3C 5LGNB 4MBQA 4E7SA 2PFVA 1LKXA 4AI6A 4CXWA 5KDMC 3GMIA 1VRBA 3CWZB 3HA4A 3PE0A 3PUGA 1UX4A 4ZOLE 3BK9A 4O4JE 4TZ4C 4H63V 5JDMA 2KZ7B 4EB6E 1SA0E 4L9IA 2PG8A 1G73A 3NBXX 3MJXA 2ZLYA 4DVDA 1YKEB 2DCFA 4KP3C 1U5PA 2D0TA 2NW8A 4BAYB 3VHLA 3ZJ2A 3FHNA 3RYHE 1MIVA 3Q9DA 2JMKA 2UXXB 3NZPA 2V7JA 4DBRA 2DLRA 5FXVA 2GK9A 3H3AA 4QKNA 2K9AA 3EDVA 3PTRB 5JDQA 3UULA 5FNVE 3AAIA 3ZN0B 3P8CD 3KDSE 2W63A 3UUMA 4EAHA 2ODVA 4ZS2A 3CMLA 5JRCB 3ZPOA 3F2EA 3LBXB 5EK4A 1BR2A 3DP7A 4G63A 4IE4A 4IE5A 4AKIA 2CXLA 4CQIA 5ADXL 3IHRA 3I1AA 3CQXC 1MMGA 4O2BE 2I59A 2EHOC 2X67A 3AVRA 2KINB 3B13A 3CKDA 4UVBB 4WNKA 4UF0B 3IBPA 3ETUA 2BDEA 3WAKA 4AKRB 4O8SA 1FMVA 3ZMUB 2V7IA 3K3NA 4DBQA 1FIOA 1Z0PA 4EXTA 4ZI3D 4TV9E 2NTXA 3UT5E 4YJ2E 1HG5A 4ZHQE 3N2GE 4NUUA 5LHIB 5CB4E 3HR0A 3LFMA 2MOZA 4UEMA 5C8YE 5FY7A 1LRZA 1IJ6A 5FMNA 1HFAA 3KV4A 5L3EB 2WSSV 3QK6A 3N9LA 2X68A 1QUUA 4BA9A 1MIYA 3HKEE 4PJMA 1ZV4X 1Y64B 2K5BB 3BQKA 4YHJA 3I9WA 2W61A 3RH3A 3UUXB 4AQFC 2IC6A 2LE8A 4EIWA 2JMHA 4PJNA 5JVDE 4C91A 3F57A 5DABA 1SHZC 2N9DA 1S35A 5DJQC 2WMOA 4B6XA 2V7LA 3N5LA 4PK5A 2LT3A 2CWOA 3C64A 1WLXA 2KT9A 1HF8A 2E9XB 2YK0A 5HAXA 3AB3B 4OYJA 3CX6B 2D5UA 5FP3A 1BR0A 2EHOA 1KNZA 4CI2B 4AXPA 3LK42 3N2OA 4HEAA 4C90A 5F8PA 4WBNE 3C4WA 4QWNB 4UXNB 3ZJ1A 4GYRA 5J2UE 2PBIA 5LG4A 3A5XA 5L2LA 2KMFA 2ACXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRX A;  3NRY A;  5KMG P; 
#chains in the Genus database with same CATH topology
 2MBG A;  2RP4 A;  3I0Q A;  5M4Y A;  4YY3 T;  3R6N A;  4AQG A;  5J2T E;  2JIW A;  2BBJ A;  1D1A A;  5L3B B;  4X1I E;  4Z90 A;  4AQF A;  2YN6 A;  3N9Q A;  5AQU B;  4M1P A;  2W67 A;  4IL9 A;  3DTO A;  2WP9 A;  4B3R T;  2WZH A;  3X1D A;  3PUY F;  2CBI A;  1YW0 A;  3A7M A;  4PNI A;  3C4Z A;  2UXC T;  4CZZ B;  3AA0 B;  4X20 E;  4GOU A;  4LF8 T;  2XM1 A;  5HXE A;  2A3D A;  5JDG A;  2VL0 A;  4DID B;  2BS3 A;  3ONL C;  1L0V A;  4XAX B;  3NRY A;  3N9N A;  1NEK A;  5LG3 A;  3OVU A;  3KFW X;  2D9D A;  2NW7 A;  5LP6 E;  2CPT A;  3C98 B;  4TWH A;  4XBF B;  3FXD B;  3C51 A;  3N9O A;  3RRC A;  3FBZ A;  3N9M A;  3CX7 B;  4UVA B;  3ZMS B;  4HGA A;  2A2F X;  2CBJ A;  3IA3 A;  3JC6 D;  5HXH A;  3PUX F;  2EHO B;  3MKD A;  4PK6 A;  2E5L T;  4JI4 T;  2M67 A;  2W62 A;  4EEB A;  1FEW A;  2H88 A;  4P1N A;  5FXW A;  1N32 T;  2P9B A;  4MHC A;  2D0U A;  4U31 A;  2E5V A;  4AIU A;  3FXE B;  4ZI2 C;  3G06 A;  3ZCI A;  5LGU B;  4AKG A;  3P4Q A;  2UUB T;  3PDY A;  3J9X 1;  3FZL B;  2YOE A;  4JI3 T;  2UXB T;  2YDS A;  4HWI B;  3RYC E;  2VKD A;  3JAE A;  5HXS A;  2MTQ A;  1YD8 G;  2WQY A;  1U4Q A;  2V8S V;  3AE8 A;  3E08 A;  5CA0 E;  2NOX A;  2WDV A;  4HFV A;  4L0R A;  3KV9 A;  3N9P A;  4ERR A;  3Q2M A;  2XUE A;  4QX8 B;  2XAS B;  4HE8 A;  1NWM X;  4LML A;  5AQG B;  5AQQ B;  2JJ9 A;  2C0S A;  3QB5 A;  4HFI A;  4WW0 A;  4IE7 A;  5ABE A;  5HXC A;  2C5I T;  2CCQ A;  3HKC E;  2JPF A;  4ZZB A;  2HH7 A;  2WS3 A;  4DV6 T;  2WU2 A;  3B57 A;  2CA5 A;  3O1H A;  2XQ8 A;  4DND A;  2QA7 A;  4JEU B;  4PW8 A;  2V5D A;  3O4X E;  3QB5 K;  1KK7 A;  2X0Y A;  3TKL B;  2CXD A;  4WZX A;  2LSY A;  1OED A;  2BG9 E;  3PUA A;  3ZN1 B;  3V5U A;  3RKO A;  4UVC B;  5DQV A;  4H9R C;  2QYW A;  2JRK A;  3HKD E;  4PAG A;  3ZC0 A;  3KV5 A;  4TX5 A;  5AQF B;  3TLU A;  5JRC A;  3O9X A;  2UUA T;  3H3M A;  4YXD A;  2E9X C;  2VK9 A;  2BVL A;  3KV6 A;  3BQI A;  2LSJ A;  2X9Y A;  4H9P C;  4YTM A;  2WB5 A;  5AQS B;  3UTK A;  3OBV E;  2BG9 C;  4A98 A;  3ONJ A;  3ZT5 A;  4HTE A;  3ZT7 A;  2NP9 A;  3EI0 A;  5IWA T;  5C3J A;  5HEJ A;  5LMU T;  3MA9 A;  4Q25 A;  3U78 A;  5AQV B;  3U3I A;  2QGS A;  1X79 A;  1D0Z A;  5FXX A;  2R6G F;  3KIN B;  5HYA A;  2BKN A;  3D0T A;  4X65 T;  4QXC B;  3WAJ A;  2FUP A;  3AE2 A;  5FYM A;  2BZB A;  4I0U A;  2CLY C;  2N1G A;  3LK3 B;  4MBQ A;  4AI6 A;  3HA4 A;  3EAB A;  3BK9 A;  4TZ4 C;  2PG8 A;  4Z91 A;  2ZLY A;  4DVD A;  1YKE B;  2DCF A;  3VHL A;  1MIV A;  2JMK A;  2V7J A;  4DBR A;  2YDQ A;  3EDV A;  1ZOY A;  2VQE T;  1N36 T;  3KDS E;  2X0H A;  3ZPO A;  5EK4 A;  1BR2 A;  3DP7 A;  4X64 T;  5ADX L;  3UFG A;  1MMG A;  1T8B A;  4UF0 B;  3ETU A;  3WAK A;  4O8S A;  1FIO A;  1UK5 A;  4ZI3 D;  4U7I A;  1HG5 A;  2YDR A;  1R8I A;  4NUU A;  5CB4 E;  4DR5 T;  2I6H A;  2LKG A;  4LMJ A;  4UEM A;  5FY7 A;  1HFA A;  5FVL A;  4UR9 A;  3QK6 A;  4BA9 A;  3HKE E;  4U2Z A;  1ZV4 X;  1XNR T;  3BQK A;  3T1Y T;  4AQF C;  2JMH A;  5JVD E;  1N33 T;  2WMO A;  2XPK A;  1KFY A;  2V7L A;  4PK5 A;  2LT3 A;  4EED A;  1WLX A;  3QNU A;  2E9X B;  2YK0 A;  2XQ6 A;  4OYJ A;  4HWD A;  3LK4 2;  4C90 A;  4DR3 T;  5LG4 A;  4GKK T;  3A5X A;  4IL4 A;  1HNZ T;  2FJA A;  3HKB E;  2DHR A;  1D1B A;  1XMO T;  1FMW A;  2VKO A;  2XQ3 A;  3RLF F;  2JQH A;  3P4R A;  4P0A A;  4X1K E;  4HFE A;  4A97 A;  1SE7 A;  4H63 H;  2Q9Q B;  2BG9 A;  1KNP A;  3ZEF B;  2Z6E A;  3ZLI A;  5LMN T;  1T98 A;  2MAW A;  1MNE A;  3KBU A;  3AE4 A;  1UUS A;  5IYZ E;  3JC6 C;  2LM2 A;  1KF6 A;  2C5K T;  4KMC A;  4DV0 T;  3GN5 A;  4IDP A;  2C5J A;  5EZY E;  4PK4 A;  4PJJ A;  1MMN A;  4I43 B;  2VL8 A;  4IE0 A;  5L3C B;  4H9Q C;  5FL1 A;  1NAF A;  4KUM B;  3OJA A;  2CE7 A;  3IF8 B;  2XAQ B;  5LYJ E;  2IAK A;  4OYK A;  5E0O A;  4FI5 A;  4P0B A;  4IIJ E;  4DR1 T;  4JI8 T;  5FXZ A;  2VKH A;  4IDQ A;  3E22 E;  3RYI E;  3VU7 H;  4EZH A;  3OYX A;  4LFA T;  1DU2 A;  1HX1 B;  5JH7 E;  2LSG A;  2XQ5 A;  3PUR A;  3RI5 A;  3PUV F;  3P7I A;  2A72 A;  1WYB A;  4GIW A;  1D1C A;  3ESL A;  3EDU A;  5FVK A;  5J0Z A;  2YKS A;  1XMQ T;  4DMV A;  4TV8 E;  3RYF E;  3OKQ A;  4X1Y E;  4ZI7 E;  3ZYL A;  3RGL A;  3AXJ A;  1MMD A;  2J4G A;  1FJG T;  2DWK A;  2ES0 A;  4DO0 A;  4ZEY A;  5AQN B;  3AAA B;  3AEA A;  4K0K T;  2WBL A;  2MYS A;  5LHH B;  5EK2 A;  4YSX A;  2VQF T;  2XTL A;  4P09 A;  5JTG A;  2OA5 A;  3RF1 A;  3HI2 A;  5KX5 E;  4EOZ B;  1WRD A;  2L8K A;  3ZCJ A;  4COF A;  1E1H B;  1OED C;  2WCA A;  1ZHC A;  2V7M A;  4QH5 A;  4A5X A;  3I0O A;  2XQ9 A;  5A1L A;  2WM9 A;  1XWM A;  5LJM A;  4BJM A;  2K3W A;  5KXJ A;  2V7K A;  4BJN A;  3MZK B;  1W0B A;  3VKH A;  1HX8 A;  2AE9 A;  2BVM A;  1WFD A;  5JRE A;  1US7 B;  1S94 A;  3QUJ A;  1E7P A;  2BS4 A;  3CK6 A;  2M6I A;  2ZMA A;  4O4H E;  1OWA A;  2V5C A;  4DV5 T;  3ZSS A;  2QRX A;  2D2S A;  3E0Z A;  1ZP0 A;  3QOF A;  5FY0 A;  2WDQ A;  1VOM A;  3TLW A;  2XAF B;  4MAL A;  2CWY A;  5GON E;  3EAM A;  5LHG B;  5IUX A;  3LBX A;  3ZKR A;  2CHO A;  4UV8 B;  2XAJ B;  3AVS A;  3ZMV B;  1WR6 A;  2UU9 T;  5LCY A;  4JLE A;  4CN1 A;  4PJL A;  2KWH A;  2B76 A;  3FB2 A;  4H9N C;  3OYZ A;  2NR4 A;  2QVA A;  2IW5 B;  2L3L A;  4L5G A;  1NEN A;  4TNW A;  2ACZ A;  5CA1 E;  3VR9 A;  2X66 A;  4UIG A;  1LVK A;  3SOL A;  2JQ9 A;  3RIA A;  5CJ5 A;  2UXD T;  5LA6 E;  2EHO D;  4ASK A;  2KLQ A;  4TWD A;  2LOP A;  2VWA A;  3AE1 A;  3JAD A;  2VKJ A;  4CN4 A;  3C4X A;  3ZMZ B;  4AKH A;  1WYC A;  2LSK A;  2Y8D A;  3RX6 A;  3ZMT B;  3O1I A;  4JEH B;  2DI4 A;  4HN9 A;  1IBK T;  2CM0 A;  4ILA A;  4ZI3 C;  2PFV A;  1T7S A;  4ZXL A;  4DR6 T;  3OPC A;  1T72 A;  3PUG A;  4LF9 T;  4H63 V;  5JDM A;  4EB6 E;  3AE6 A;  1OED B;  4QH4 A;  3RQU A;  2XQ7 A;  2NW8 A;  4BAY B;  2UUC T;  2HN2 A;  3NZP A;  5FXV A;  3TLV A;  4QKN A;  2K9A A;  1N34 T;  3ZN0 B;  5ABH A;  4ZS2 A;  3CML A;  5JRC B;  3F2E A;  4IE5 A;  2CXL A;  3M3Z B;  1XNQ T;  3AEE A;  4WNK A;  3CKD A;  3B13 A;  4DUY T;  4AKR B;  4JBW F;  1FMV A;  3JCF A;  4DBQ A;  4EXT A;  4IT4 A;  3UT5 E;  4YJ2 E;  2KSR A;  4ZHQ E;  3Q5D A;  3SFD A;  1LRZ A;  3RIF A;  1QUU A;  2FBW A;  2OV9 A;  4PJM A;  4YHJ A;  2W61 A;  3UUX B;  4EIW A;  2BS2 A;  2N9D A;  3PUZ F;  1S35 A;  4JI5 T;  1HNW T;  4B6X A;  4ZZC A;  2KT9 A;  3P50 A;  3CIR A;  2D5U A;  5FP3 A;  4CI2 B;  3N2O A;  5F8P A;  4QWN B;  4UXN B;  3RKG A;  1JNR A;  3Q5W A;  1Y01 A;  3AED A;  5L4H A;  3PU3 A;  3RRW A;  2H7O A;  4QXB B;  2VVN A;  3AA7 B;  5H6Q B;  2V26 A;  4NIQ A;  3L3P A;  4H9S E;  2X9W A;  4XZC A;  3PUW F;  2MPK A;  4IHJ E;  4EYU A;  2J47 A;  3ZST A;  3Q5X A;  3RC3 A;  2BBH A;  4U74 A;  4YTN A;  4B3T T;  5EK3 A;  2XHE B;  2SPC A;  2HPJ A;  4X66 T;  5F3J A;  5J1G A;  5ETW A;  1H7C A;  1E2A A;  3ETV A;  4YTP A;  4OHF A;  4EYY R;  1CUN A;  2DNX A;  3UQ4 A;  5H6R B;  3EUH A;  4I50 E;  2VVS A;  1M7K A;  2YU1 A;  2B1E A;  2XJ7 A;  2FJE A;  4K0U A;  4A56 A;  4HFH A;  1J1J A;  4KHZ F;  5JR9 A;  2CHN A;  2W66 A;  4CXY A;  4F6R C;  4CN6 A;  1G8X A;  1J5E T;  3AE3 A;  3PU8 A;  5AFU L;  2LHR A;  1QSD A;  5BMV E;  3UU5 A;  1HS7 A;  2A9U A;  2WWV A;  4TUY E;  4U2Y A;  2XQA A;  2ZM0 A;  2FJB A;  2ZM2 A;  3Q5E A;  4GK0 E;  4LFC T;  4OK0 A;  1QLB A;  3OTO T;  4B3S T;  1KNR A;  4AQY T;  4ZS3 A;  5AQI B;  2HHH T;  4J2C A;  2X51 A;  4DV3 T;  2BKO A;  5L4E A;  3VKG A;  3AEF A;  5IHY A;  2YEV C;  2BG9 B;  1X9B A;  4U3C A;  3P4S A;  5AQO B;  2XAH B;  1UCU A;  2UXN B;  5LOV E;  3VR8 A;  1JNZ A;  3A8Y C;  5HEH A;  5AQR B;  4HKA A;  2CMR A;  3RC8 A;  3GA8 A;  2NWB A;  3GN5 B;  3ZYK A;  3ANW A;  5TAO A;  4EZ4 A;  3KVA A;  3DJB A;  1W0A A;  4YJ3 E;  4E7Z A;  2CXF A;  2WMN A;  3S4U A;  2LHN A;  4DMW A;  4HFB A;  3PUQ A;  1IJ5 A;  4JYA T;  1HG2 A;  5AQJ B;  2WAU A;  2CLY B;  3LG7 A;  3AA6 B;  1EZ3 A;  3MK7 C;  4TN7 B;  4LF5 T;  5HEU A;  3FZK B;  2J1D G;  2Q9Q A;  2E2A A;  4KI0 F;  3N2K E;  5L3F B;  3GWH A;  2XSB A;  3T8O A;  3ZYM A;  2LEH A;  2V1D B;  2Q9Q D;  3MXZ A;  5HWY A;  1O3X A;  2LLY A;  2LOS A;  1W09 A;  2FJD A;  4X62 T;  5LJN A;  3VRA A;  3RQW A;  1OXZ A;  2PJQ A;  3K3Q C;  3I9Y A;  1V9D A;  2ZM6 T;  4JI6 T;  5ABF A;  3RHW A;  2BKP A;  3AXJ B;  3R84 B;  5HXR A;  4IGU A;  2K24 A;  5AQM B;  3AA1 B;  2X0L B;  1HTJ F;  2VUR A;  2XAG B;  2V6Y A;  3UUN A;  4GK5 E;  2H89 A;  3SFE A;  3CPZ A;  4O4L E;  5JDN A;  1MIW A;  3EVY A;  1YQ3 A;  1B7T A;  3SWH A;  5JDL A;  4HWC A;  2YIN A;  2RA1 A;  3LK2 B;  4NXM T;  2IDO B;  4U72 A;  3J7Y q;  2XZE A;  4ILB A;  3L39 A;  2E8I A;  5FL0 A;  3PV0 F;  2X9X A;  5HWX A;  4ANJ A;  4QXH B;  3F31 A;  3SS1 A;  3IEE A;  4I55 E;  1YQ4 A;  4JUY A;  1D0X A;  1ZKE A;  4KX6 A;  4F8H A;  5AQH B;  1LKX A;  4CXW A;  1UUR A;  2LRL A;  1VRB A;  4HFD A;  3CWZ B;  3PE0 A;  1UX4 A;  1CHU A;  1SA0 E;  4L9I A;  3NBX X;  3MJX A;  1YXR A;  4KP3 C;  2D0T A;  3ZJ2 A;  3RYH E;  2I0M A;  2UXX B;  3Q9D A;  2DLR A;  2GK9 A;  3UU3 A;  3PTR B;  4LF4 T;  5JDQ A;  3UUL A;  4YHH T;  3FZH B;  3LBX B;  4HWH A;  4G63 A;  3VRB A;  4AKI A;  4CQI A;  3I1A A;  3AE9 A;  4O2B E;  2I59 A;  2X67 A;  2KIN B;  4JI7 T;  2BDE A;  3ZMU B;  2V7I A;  3K3N A;  2NTX A;  4HFC A;  2IUB A;  5LHI B;  2OLT A;  3JAF A;  1IJ6 A;  3KV4 A;  2W4X A;  5L3E B;  4EGW A;  2WSS V;  3UUB A;  3RIU A;  4DUZ T;  2X68 A;  1MIY A;  1IBM T;  4DV2 T;  3P4P A;  3I9W A;  3RH3 A;  2LE8 A;  4PJN A;  5DJQ C;  4U33 A;  3N5L A;  3C64 A;  1HF8 A;  1M62 A;  3AB3 B;  3AE7 A;  1BR0 A;  2EHO A;  1I94 T;  3C4W A;  5J2U E;  4GYR A;  2KMF A;  2ACX A;  4ISS A;  4DV7 T;  4O4I E;  2WWU A;  1XDP A;  2XQY A;  3C50 A;  1D0Y A;  4LFB T;  5FKY A;  3LSV A;  2CEA A;  5CGM A;  4UEL A;  2ODU A;  2LSI A;  2X9H A;  3MAC A;  4NPP A;  3M65 A;  5JR9 C;  4IE6 A;  2J62 A;  4GYS A;  2XSA A;  5HEO A;  2LRK A;  4O2A E;  2K48 A;  4KBM B;  4LF7 T;  5FY1 A;  3FBL A;  1HR0 T;  2ZM8 A;  3PUS A;  1AJ3 A;  2IML A;  3SRZ A;  4KHP T;  2VB6 A;  4OFZ A;  3UFE A;  4EV6 A;  2F4V T;  1YKH B;  5JQG E;  2G0U A;  2W0G A;  2DWG A;  4JI2 T;  5C2T A;  2WU5 A;  5F5W A;  3K3O A;  5LGT B;  2KXP B;  4X5T A;  3NKZ A;  2RPA A;  4B3M T;  2WY2 A;  3NRX A;  5DQW A;  2W00 A;  5HEG A;  3NVO A;  2YU2 A;  3KVB A;  4QX7 B;  2NW9 A;  2H3R A;  5JDH A;  1BR1 A;  3L09 A;  3O1J A;  3AAE B;  2LKH A;  5LBQ B;  4JV5 T;  2M6B A;  4YSY A;  3UQ7 A;  3ABV A;  2HPL A;  1MND A;  1ZEE A;  3HL6 A;  3CX8 B;  3AEC A;  4I4T E;  4PFO A;  2LJL A;  1WCR A;  2H7V C;  4AIS A;  2NTY A;  3CVR A;  4IST A;  3FZF B;  5LB7 B;  4LF6 T;  4H9O C;  3V5S A;  1LVF A;  2WZI A;  2Q9Q C;  4G2A A;  4WBO A;  2KWI B;  3PJA A;  2IC9 A;  5HCM A;  2VAS A;  4GKJ T;  2V6X A;  5AQL B;  4ILU A;  4CI3 B;  2IHR 1;  4QHO A;  3K8P C;  4V1A v;  5LNK A;  4DR2 T;  4CXX A;  3KBT A;  4IRE A;  4JI1 T;  4PFP A;  5AQP B;  4ZI2 D;  3ONX A;  4IDZ A;  4Z8X A;  5JDF A;  1HNX T;  3ZT6 A;  1W9R A;  2N2N A;  3CQC B;  3W15 B;  4AKL A;  3AE5 A;  5JR9 B;  4YLH A;  2Y48 B;  3BQL A;  3LJC A;  1MMA A;  3CQG B;  4N78 D;  4ADZ A;  4DR4 T;  3K1S A;  4FJO A;  1WR0 A;  5L3G B;  2LM9 A;  3QC9 A;  2DL1 A;  4JI0 T;  4HWF A;  5LXT E;  1UX5 A;  1BR4 A;  1J5W A;  1VCS A;  4UV9 B;  4OX9 T;  3L8R A;  2HN1 A;  4MFR A;  5L3D B;  3H37 A;  1UGO A;  2L9Q A;  1IAP A;  2CRB A;  1XZY A;  3ZC1 A;  2JQQ A;  2XY8 B;  5L47 A;  5CFB A;  3WI3 A;  3T1H T;  4UF0 A;  4MLK A;  2WDR A;  1IZN B;  4DV4 T;  3TLT A;  1HCI A;  3UU8 A;  2KND A;  4YSZ A;  5KMG P;  3ANW B;  2Y6X A;  4NUV A;  4LMK A;  1SUM B;  3NZQ A;  1KEY A;  2E9X A;  5LBM A;  2XM2 A;  3RPU A;  4CI1 B;  2E9X D;  3NWI A;  1VCT A;  4QH1 A;  4YFS A;  4U7Y A;  5LGN B;  4E7S A;  1GQE A;  5KDM C;  3GMI A;  2XQ4 A;  2PTF A;  4TNV A;  4ZOL E;  4O4J E;  2KZ7 B;  4DR7 T;  1I6Z A;  4IDN A;  2IIU A;  1XDO A;  1G73 A;  3LDQ B;  1U5P A;  5AQK B;  3RIU C;  3UU6 A;  3FHN A;  3H3A A;  5FNV E;  3AAI A;  5ABF B;  3P8C D;  2W63 A;  3UUM A;  4EAH A;  2ODV A;  3TLS A;  4IE4 A;  2JQK A;  5AQT B;  3IHR A;  3CQX C;  5ABG A;  2EHO C;  3AVR A;  4UVB B;  3IBP A;  3AEB A;  3PJA J;  5BR8 T;  1Z0P A;  2V6Y B;  2W2U A;  4TV9 E;  3P4W A;  3AEG A;  3N2G E;  3FZM B;  3HR0 A;  3LFM A;  2MOZ A;  4YT0 A;  5C8Y E;  4DV1 T;  5FMN A;  4WYV A;  2AXD S;  5HCJ A;  4IDO A;  3N9L A;  1Y64 B;  2K5B B;  1IBL T;  2IC6 A;  4C91 A;  4TWF A;  3F57 A;  5DAB A;  1SHZ C;  2CWO A;  1Z8U A;  4ILC A;  5HAX A;  3CX6 B;  1OED E;  1KNZ A;  4NXN T;  3B5M A;  4HEA A;  4AXP A;  4WBN E;  3ZJ1 A;  2PBI A;  3EHZ A;  3UU4 A;  5L2L A; 
#chains in the Genus database with same CATH homology
 3Q5W A;  4ISS A;  2MBG A;  2RP4 A;  3PU3 A;  3I0Q A;  3RRW A;  3HKB E;  4O4I E;  2DHR A;  1D1B A;  2WWU A;  2XQY A;  5M4Y A;  2H7O A;  1FMW A;  2VKO A;  3C50 A;  4QXB B;  1D0Y A;  3R6N A;  4AQG A;  3AA7 B;  5H6Q B;  2V26 A;  5J2T E;  3L3P A;  4H9S E;  2CEA A;  4P0A A;  2X9W A;  4XZC A;  4X1K E;  1D1A A;  5L3B B;  4IHJ E;  4UEL A;  4EYU A;  4X1I E;  4H63 H;  4AQF A;  2ODU A;  2Q9Q B;  3Q5X A;  3N9Q A;  2LSI A;  3RC3 A;  4M1P A;  2X9H A;  3ZEF B;  3MAC A;  2Z6E A;  3DTO A;  3M65 A;  3ZLI A;  5JR9 C;  1T98 A;  4IE6 A;  4U74 A;  1YW0 A;  1MNE A;  3KBU A;  5EK3 A;  4PNI A;  3C4Z A;  4GYS A;  5IYZ E;  3JC6 C;  4O2A E;  2C5K T;  4CZZ B;  2XHE B;  3AA0 B;  4KMC A;  4X20 E;  4GOU A;  2SPC A;  3GN5 A;  2HPJ A;  2K48 A;  5F3J A;  4KBM B;  5J1G A;  2C5J A;  5ETW A;  2A3D A;  4PK4 A;  5EZY E;  5HXE A;  5JDG A;  4PJJ A;  1MMN A;  5FY1 A;  1H7C A;  3ETV A;  4I43 B;  4OHF A;  3FBL A;  4EYY R;  2VL8 A;  1CUN A;  4IE0 A;  5L3C B;  2ZM8 A;  3PUS A;  4H9Q C;  4XAX B;  1AJ3 A;  2DNX A;  1NAF A;  3NRY A;  5H6R B;  3N9N A;  4KUM B;  3EUH A;  4I50 E;  3SRZ A;  2YU1 A;  2VB6 A;  4OFZ A;  3UFE A;  3OJA A;  2CE7 A;  2B1E A;  3KFW X;  3IF8 B;  1YKH B;  2XAQ B;  5JQG E;  2NW7 A;  4K0U A;  5LP6 E;  2IAK A;  4OYK A;  4A56 A;  5LYJ E;  5E0O A;  3C98 B;  4FI5 A;  4P0B A;  2G0U A;  2W0G A;  2DWG A;  4IIJ E;  4XBF B;  3FXD B;  3C51 A;  5JR9 A;  5FXZ A;  3K3O A;  5LGT B;  2KXP B;  2VKH A;  3N9O A;  3E22 E;  3RRC A;  3RYI E;  3FBZ A;  4CXY A;  3VU7 H;  3N9M A;  4F6R C;  3NRX A;  4EZH A;  3CX7 B;  5DQW A;  2W00 A;  4UVA B;  3ZMS B;  4HGA A;  1G8X A;  2A2F X;  2YU2 A;  3JC6 D;  3KVB A;  3OYX A;  4QX7 B;  3PU8 A;  2NW9 A;  2H3R A;  5AFU L;  2LHR A;  1QSD A;  5BMV E;  5HXH A;  5JDH A;  1HS7 A;  2EHO B;  1BR1 A;  3MKD A;  2LSG A;  4TUY E;  3L09 A;  3O1J A;  5JH7 E;  3AAE B;  4PK6 A;  3PUR A;  2M67 A;  2W62 A;  1FEW A;  2ZM0 A;  5LBQ B;  2ZM2 A;  4GK0 E;  4OK0 A;  3P7I A;  5FXW A;  2A72 A;  2P9B A;  1WYB A;  4GIW A;  4MHC A;  2D0U A;  2HPL A;  1D1C A;  3ESL A;  1MND A;  3EDU A;  4ZS3 A;  3FXE B;  1ZEE A;  4ZI2 C;  3HL6 A;  4DMV A;  4TV8 E;  3CX8 B;  3RYF E;  3OKQ A;  4X1Y E;  3ZCI A;  5LGU B;  4I4T E;  4J2C A;  4ZI7 E;  2X51 A;  3ZYL A;  4PFO A;  4AKG A;  2LJL A;  1MMD A;  3PDY A;  3J9X 1;  3VKG A;  2H7V C;  5IHY A;  2NTY A;  2YEV C;  2DWK A;  2ES0 A;  3CVR A;  4IST A;  4DO0 A;  4H9O C;  3AAA B;  3RYC E;  2VKD A;  2XAH B;  1UCU A;  2WBL A;  3V5S A;  2UXN B;  2MYS A;  5HXS A;  2MTQ A;  1LVF A;  5LOV E;  5LHH B;  5EK2 A;  4HKA A;  2CMR A;  1YD8 G;  2Q9Q C;  4G2A A;  4WBO A;  3GA8 A;  2XTL A;  3RC8 A;  2KWI B;  1U4Q A;  4P09 A;  3E08 A;  5CA0 E;  2NOX A;  2IC9 A;  2NWB A;  3GN5 B;  4HFV A;  4L0R A;  3ZYK A;  3ANW A;  2OA5 A;  5TAO A;  4EZ4 A;  3KV9 A;  3N9P A;  4ERR A;  3HI2 A;  5KX5 E;  2VAS A;  3KVA A;  3DJB A;  4YJ3 E;  4EOZ B;  4E7Z A;  3Q2M A;  2XUE A;  1WRD A;  2CXF A;  2WMN A;  4ILU A;  3S4U A;  4CI3 B;  2L8K A;  3ZCJ A;  4QX8 B;  4QHO A;  1E1H B;  3K8P C;  4V1A v;  5LNK A;  2XAS B;  4HE8 A;  1ZHC A;  2V7M A;  4CXX A;  1NWM X;  3KBT A;  2LHN A;  3I0O A;  4DMW A;  4PFP A;  2JJ9 A;  2C0S A;  3PUQ A;  1IJ5 A;  4WW0 A;  5A1L A;  2WM9 A;  4ZI2 D;  4IE7 A;  1HG2 A;  5LJM A;  3ONX A;  4IDZ A;  4Z8X A;  4BJM A;  5JDF A;  2WAU A;  2CLY B;  5HXC A;  2C5I T;  2V7K A;  3LG7 A;  2CCQ A;  3HKC E;  2N2N A;  4BJN A;  3MZK B;  3CQC B;  2JPF A;  3AA6 B;  1EZ3 A;  3W15 B;  3VKH A;  4AKL A;  3MK7 C;  4TN7 B;  2HH7 A;  1HX8 A;  5JR9 B;  4YLH A;  2BVM A;  5JRE A;  1US7 B;  2J1D G;  2Q9Q A;  1S94 A;  2Y48 B;  3B57 A;  3BQL A;  3LJC A;  1MMA A;  3CQG B;  3QUJ A;  4N78 D;  2CA5 A;  3O1H A;  3N2K E;  5L3F B;  4DND A;  4ADZ A;  3GWH A;  2QA7 A;  2ZMA A;  3T8O A;  3ZYM A;  4JEU B;  4O4H E;  4PW8 A;  1OWA A;  2LEH A;  2V1D B;  2Q9Q D;  3MXZ A;  4FJO A;  5HWY A;  1O3X A;  3O4X E;  2D2S A;  5L3G B;  3E0Z A;  1KK7 A;  2LM9 A;  3QC9 A;  3TKL B;  2LOS A;  2CXD A;  2LSY A;  3PUA A;  3ZN1 B;  5LXT E;  5FY0 A;  3V5U A;  3RKO A;  5LJN A;  1UX5 A;  4UVC B;  1BR4 A;  5DQV A;  4UV9 B;  1VOM A;  4H9R C;  1OXZ A;  2PJQ A;  2XAF B;  3I9Y A;  3K3Q C;  4MAL A;  2JRK A;  3HKD E;  4PAG A;  3ZC0 A;  2CWY A;  3KV5 A;  1V9D A;  5GON E;  4MFR A;  4TX5 A;  5LHG B;  5L3D B;  3H37 A;  3O9X A;  5JRC A;  3LBX A;  3R84 B;  5HXR A;  2L9Q A;  4IGU A;  1IAP A;  2E9X C;  2VK9 A;  2BVL A;  2K24 A;  4UV8 B;  3ZC1 A;  3KV6 A;  3BQI A;  2JQQ A;  2LSJ A;  3WI3 A;  4UF0 A;  3AA1 B;  2XAJ B;  3AVS A;  4MLK A;  2X9Y A;  3ZMV B;  1WR6 A;  2X0L B;  1IZN B;  4H9P C;  5LCY A;  1HTJ F;  4JLE A;  3UTK A;  2XAG B;  3OBV E;  4PJL A;  2KWH A;  3FB2 A;  3UUN A;  4H9N C;  3OYZ A;  1HCI A;  2KND A;  2IW5 B;  2L3L A;  4HTE A;  4L5G A;  4GK5 E;  5KMG P;  3ANW B;  3CPZ A;  4O4L E;  5CA1 E;  2Y6X A;  5JDN A;  1MIW A;  2NP9 A;  3EVY A;  4NUV A;  2X66 A;  4UIG A;  1B7T A;  3SWH A;  1LVK A;  3SOL A;  5JDL A;  2YIN A;  2RA1 A;  3LK2 B;  3MA9 A;  3NZQ A;  4U72 A;  5LA6 E;  3J7Y q;  2EHO D;  4ASK A;  2KLQ A;  3U78 A;  2E8I A;  2LOP A;  2VWA A;  2E9X A;  2QGS A;  2VKJ A;  3U3I A;  3C4X A;  2X9X A;  1X79 A;  1D0Z A;  5LBM A;  3ZMZ B;  4ANJ A;  5HWX A;  4AKH A;  4QXH B;  5FXX A;  3F31 A;  1WYC A;  3RPU A;  3SS1 A;  4CI1 B;  3IEE A;  3KIN B;  4I55 E;  4JUY A;  2LSK A;  2Y8D A;  2E9X D;  3RX6 A;  5HYA A;  1D0X A;  3ZMT B;  3D0T A;  4QXC B;  1ZKE A;  3O1I A;  4JEH B;  2DI4 A;  4HN9 A;  4YFS A;  3WAJ A;  2CM0 A;  5FYM A;  2BZB A;  2CLY C;  2N1G A;  3LK3 B;  4ZI3 C;  5LGN B;  4MBQ A;  4E7S A;  2PFV A;  1LKX A;  4AI6 A;  4CXW A;  5KDM C;  3GMI A;  1VRB A;  3CWZ B;  3HA4 A;  3PE0 A;  3PUG A;  1UX4 A;  4ZOL E;  3BK9 A;  4O4J E;  4TZ4 C;  4H63 V;  5JDM A;  2KZ7 B;  4EB6 E;  1SA0 E;  4L9I A;  2PG8 A;  1G73 A;  3NBX X;  3MJX A;  2ZLY A;  4DVD A;  1YKE B;  2DCF A;  4KP3 C;  1U5P A;  2D0T A;  2NW8 A;  4BAY B;  3VHL A;  3ZJ2 A;  3FHN A;  3RYH E;  1MIV A;  3Q9D A;  2JMK A;  2UXX B;  3NZP A;  2V7J A;  4DBR A;  2DLR A;  5FXV A;  2GK9 A;  3H3A A;  4QKN A;  2K9A A;  3EDV A;  3PTR B;  5JDQ A;  3UUL A;  5FNV E;  3AAI A;  3ZN0 B;  3P8C D;  3KDS E;  2W63 A;  3UUM A;  4EAH A;  2ODV A;  4ZS2 A;  3CML A;  5JRC B;  3ZPO A;  3F2E A;  3LBX B;  5EK4 A;  1BR2 A;  3DP7 A;  4G63 A;  4IE4 A;  4IE5 A;  4AKI A;  2CXL A;  4CQI A;  5ADX L;  3IHR A;  3I1A A;  3CQX C;  1MMG A;  4O2B E;  2I59 A;  2EHO C;  2X67 A;  3AVR A;  2KIN B;  3B13 A;  3CKD A;  4UVB B;  4WNK A;  4UF0 B;  3IBP A;  3ETU A;  2BDE A;  3WAK A;  4AKR B;  4O8S A;  1FMV A;  3ZMU B;  2V7I A;  3K3N A;  4DBQ A;  1FIO A;  1Z0P A;  4EXT A;  4ZI3 D;  4TV9 E;  2NTX A;  3UT5 E;  4YJ2 E;  1HG5 A;  4ZHQ E;  3N2G E;  4NUU A;  5LHI B;  5CB4 E;  3HR0 A;  3LFM A;  2MOZ A;  4UEM A;  5C8Y E;  5FY7 A;  1LRZ A;  1IJ6 A;  5FMN A;  1HFA A;  3KV4 A;  5L3E B;  2WSS V;  3QK6 A;  3N9L A;  2X68 A;  1QUU A;  4BA9 A;  1MIY A;  3HKE E;  4PJM A;  1ZV4 X;  1Y64 B;  2K5B B;  3BQK A;  4YHJ A;  3I9W A;  2W61 A;  3RH3 A;  3UUX B;  4AQF C;  2IC6 A;  2LE8 A;  4EIW A;  2JMH A;  4PJN A;  5JVD E;  4C91 A;  3F57 A;  5DAB A;  1SHZ C;  2N9D A;  1S35 A;  5DJQ C;  2WMO A;  4B6X A;  2V7L A;  3N5L A;  4PK5 A;  2LT3 A;  2CWO A;  3C64 A;  1WLX A;  2KT9 A;  1HF8 A;  2E9X B;  2YK0 A;  5HAX A;  3AB3 B;  4OYJ A;  3CX6 B;  2D5U A;  5FP3 A;  1BR0 A;  2EHO A;  1KNZ A;  4CI2 B;  4AXP A;  3LK4 2;  3N2O A;  4HEA A;  4C90 A;  5F8P A;  4WBN E;  3C4W A;  4QWN B;  4UXN B;  3ZJ1 A;  4GYR A;  5J2U E;  2PBI A;  5LG4 A;  3A5X A;  5L2L A;  2KMF A;  2ACX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...