5AQGB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
b'GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqgB00
4HWCA 1UK5A 5AQNB 5AQKB 5AQJB 5AQVB 3FZKB 5AQOB 5AQGB 5AQRB 5AQHB 5AQIB 5AQFB 2D9DA 3FZHB 1T7SA 4HWIB 5AQLB 3FZFB 1M62A 5AQPB 5AQTB 3A8YC 1HX1B 1UGOA 4HWHA 4HWDA 1M7KA 3M3ZB 5AQSB 3FZMB 4HWFA 5AQQB 5AQMB 5AQUB 3FZLB 1I6ZA 3LDQB
chains in the Genus database with same CATH superfamily
2HPLA 2NW7A 5C2TA 3RC8A 5CJ5A 4JLEA 4IE0A 2R6GF 4UF0B 4KX6A 4ILCA 3NWIA 4AIUA 4IGUA 3ZMVB 1MIWA 4O4HE 2UXCT 2JQ9A 4OK0A 4BJMA 2NP9A 4YHJA 2OV9A 1YQ4A 4AQGA 2BBJA 2P9BA 5LXTE 4I4TE 1J1JA 3RPUA 5LMNT 4OX9T 2SPCA 2KLQA 1MMGA 2PBIA 5FXVA 3N9MA 3NRYA 3AEGA 5BR8T 4N78D 2WZIA 4NXMT 4YSYA 1LVFA 1JNRA 2D0UA 3P50A 3B57A 3LG7A 1KF6A 1MNDA 5J2UE 2WM9A 4TNWA 2Y6XA 4A97A 5LNKA 4HKAA 3RYIE 5HYAA 4MHCA 2L8KA 3ZMTB 2WMOA 4HTEA 3FZLB 2KMFA 5L4HA 2XQ5A 3Q5DA 5LMUT 4ZI3D 1HG2A 3ZT5A 3JC6D 4X62T 1FEWA 3P7IA 5FVKA 1US7B 3MKDA 5J2TE 1ZOYA 3RX6A 3ZC1A 3O4XE 1VOMA 2BVLA 2QA7A 5CA0E 3BQIA 5AQMB 3AA7B 1G73A 4CZZB 3FB2A 4IDPA 3PU3A 1WCRA 4YXDA 2IIUA 4WNKA 2IHR1 1R8IA 2LE8A 3VHLA 4ASKA 4JI3T 2XUEA 2LSYA 4H9SE 4U2ZA 2VKJA 1UURA 3PDYA 2WS3A 3N2GE 1ZP0A 4QH1A 2VQFT 3ZYMA 2WCAA 3ZJ2A 3UU4A 2LJLA 1W0AA 4NXNT 1HNXT 2XTLA 3X1DA 1WRDA 5AQTB 3ETVA 3D0TA 4LMKA 5L3DB 3LBXA 4ILAA 3AA1B 2EHOD 3ZSSA 5AQPB 5FXXA 4YTNA 2JJ9A 1YW0A 4YT0A 4CXWA 5LG3A 3AEDA 3AAEB 2M6IA 5JREA 3F57A 4LF5T 2WBLA 3VU7H 5J1GA 4TWFA 1IJ5A 1HFAA 3UULA 2V7IA 2DCFA 3AEBA 4H9RC 3K3OA 2I59A 3SOLA 2XQ4A 4LFAT 4EXTA 3ONLC 5AQSB 5AFUL 3A5XA 3CX7B 2ZM8A 1D1AA 4ZI3C 1V9DA 3JC6C 5C8YE 2OA5A 4M1PA 4DO0A 4IREA 1X79A 3IHRA 1YKEB 2CBIA 3EVYA 4TV9E 5LHGB 4K0KT 3R84B 2K24A 2ES0A 3PURA 2V6YB 2WZHA 3ANWA 1KEYA 4IL9A 4YSXA 3Q5XA 4NUVA 4NPPA 2FJDA 3B13A 2CWYA 4JI1T 3AE2A 4UVCB 4LF8T 4ZI2D 3NRXA 2WSSV 3C4WA 2XAJB 3UU3A 5LGTB 4DV1T 1Y01A 3QB5K 2KNDA 2K9AA 3SRZA 1I94T 4A56A 3ZYKA 3R6NA 2MTQA 4TWDA 5AQVB 2WMNA 2UUAT 4ZZCA 4O8SA 3VKGA 4PK5A 1UGOA 1HS7A 2DLRA 5ETWA 2WWUA 2JRKA 4DV5T 5DQVA 4C91A 3RI5A 4PJJA 3CQGB 1D1BA 3P4SA 3ZMUB 4TWHA 1DU2A 3DTOA 1XNQT 3PUYF 3NBXX 2IMLA 2JPFA 2I6HA 4DMVA 4KMCA 4IE5A 4JI5T 4HFHA 4DR7T 4E7ZA 4DBRA 1XZYA 4PNIA 4CI3B 2V5DA 2CXFA 4IL4A 3V5SA 3KVBA 2MPKA 2V8SV 5JDHA 4HWDA 2E9XA 3EDUA 4H63V 3JCFA 4MBQA 2NW9A 1CUNA 2GK9A 4BA9A 5F5WA 4F8HA 3UUXB 1W0BA 2PG8A 3I9WA 4O2AE 2CXDA 4X1IE 5KDMC 4DV3T 1OEDC 2WQYA 4X65T 2CE7A 4UIGA 4X1YE 2BG9E 5EK3A 1W9RA 2VWAA 2H88A 4EV6A 2W2UA 4I43B 4JI2T 2LEHA 2CRBA 2K5BB 2CBJA 3OBVE 3E08A 5JR9A 3RH3A 3C98B 3PE0A 2YEVC 4YLHA 3N9LA 2VQET 3RIAA 4F6RC 3RIFA 1YXRA 2Q9QC 1IJ6A 3GN5A 2Q9QB 3ZT6A 3GA8A 4HWHA 3TLSA 3I0OA 1WLXA 1L0VA 3IBPA 3T8OA 5DQWA 2YINA 5JRCB 2X67A 3ZC0A 5ABGA 4X5TA 1SHZC 2KSRA 4B3ST 5LOVE 3LFMA 4GKJT 5L3BB 1MNEA 3UU6A 4AKIA 5LYJE 3FZMB 1IZNB 3K1SA 3QK6A 5HCMA 4QXHB 2IC9A 1G8XA 3L8RA 4HE8A 2VK9A 2ACZA 4GK0E 4CQIA 3LK42 4P1NA 3KINB 2V7MA 3GMIA 2FJAA 1XWMA 4AKLA 3EHZA 1T8BA 2UU9T 5AQJB 5L47A 2ZMAA 2NTYA 4MFRA 2NOXA 1WFDA 3K3QC 2BKNA 4CXXA 2VVNA 3N2KE 5HAXA 4QH5A 3ZYLA 1HF8A 1MMNA 3OYZA 2AXDS 4PFPA 3C4ZA 2CM0A 4EYUA 3AE7A 4O2BE 3ZCIA 3CVRA 3FHNA 2UUCT 2LOPA 4UEMA 2VKHA 2CCQA 3CWZB 3N9QA 1HR0T 4O4JE 4TN7B 5AQUB 3UT5E 2LSJA 4JV5T 4LMJA 2X0LB 1Y64B 3CKDA 3E0ZA 3RHWA 1ZHCA 2E5VA 3AB3B 4DR6T 1UX5A 5IUXA 2V7JA 2CA5A 1BR0A 1D1CA 4HFCA 1OXZA 3EUHA 2V1DB 4QHOA 3KV9A 2H89A 3CMLA 4B3RT 4AI6A 2NR4A 3K8PC 3WAKA 4JUYA 1O3XA 4HWCA 1UK5A 4EIWA 3OVUA 3CX6B 1UUSA 4TX5A 3PU8A 3ZEFB 4U3CA 1OEDE 5HEGA 1YD8G 3MK7C 4HFVA 3Q9DA 4HFIA 1T72A 2IDOB 4H9NC 4YJ3E 2Z6EA 4ISTA 4EB6E 4GK5E 4LMLA 3C50A 4WBNE 4HEAA 5FMNA 5JH7E 1ZEEA 4UF0A 2XAHB 2YN6A 5LGUB 4TUYE 3C4XA 1Z8UA 4E7SA 1KFYA 4YFSA 5AQGB 3FBZA 2JQHA 1QSDA 3AE8A 1BR4A 4QKNA 4EEDA 2UXDT 5LP6E 2DWGA 1NENA 1LVKA 5LA6E 3H3MA 3EDVA 5LJNA 1BR2A 4K0UA 2DNXA 2X9WA 2FUPA 4IDZA 2HHHT 3Q2MA 3RKGA 2H7VC 5KX5E 3PUVF 4L9IA 4KHZF 4DV2T 4YSZA 4Z90A 5ABEA 4DV4T 4I50E 4AKHA 3DJBA 5HXRA 2X9XA 5JDLA 5JQGE 3PUAA 4ZHQE 2I0MA 1NAFA 2CEAA 4ADZA 1S94A 2N9DA 3P8CD 1XMOT 4CXYA 2VL8A 4U31A 4OFZA 1H7CA 2CWOA 4QWNB 2LM2A 5CGMA 1NWMX 5C3JA 2L3LA 4Z8XA 3MXZA 3PUZF 4AXPA 5HEJA 4WZXA 2XQYA 2E9XD 3ONXA 1X9BA 2VKOA 4U7IA 2PTFA 2XAGB 5FXWA 5AQOB 2LM9A 4YY3T 3OTOT 2WB5A 1U4QA 2CHNA 2CPTA 3EI0A 4U72A 5JDGA 2BG9C 2X9YA 1Z0PA 4FI5A 1YQ3A 2BG9B 4EZ4A 3RLFF 3NVOA 3A7MA 3BQKA 4LFCT 2KWHA 5AQKB 5FL1A 3ZT7A 1WR0A 5CFBA 2J62A 4ILUA 4AQYT 1N36T 4PW8A 5FKYA 4NIQA 3AE1A 3AE9A 3G06A 2HH7A 4IHJE 2WDVA 5L2LA 3KV5A 4MLKA 2UXBT 1UX4A 2X0YA 4BJNA 5LG4A 4UV8B 3AE5A 3HKEE 4PK6A 4NUUA 5AQRB 2V7KA 3JADA 5F3JA 2A9UA 3H37A 2ODVA 4IE7A 4WYVA 2KZ7B 3ZSTA 3E22E 3IF8B 4HN9A 3VR9A 2EHOC 3RRWA 2YU1A 3UU8A 4GIWA 2EHOB 3UUBA 5HEUA 2QRXA 3DP7A 2H3RA 2IUBA 3RIUC 4L0RA 4QX7B 2KINB 2C5JA 3AAIA 3P4WA 4O4LE 2BBHA 3F31A 2V26A 1B7TA 3ZJ1A 5FNVE 3O1JA 2J4GA 3A8YC 2XQ3A 2V6YA 1E7PA 4YTMA 2XASB 2YKSA 4LF4T 2BS4A 3RC3A 3JAFA 3P4QA 4HWFA 2XM1A 2Y8DA 2FJEA 3AAAB 2G0UA 3QC9A 4GOUA 2OLTA 3AE6A 3SWHA 2QVAA 2MOZA 5LBQB 4O4IE 3I9YA 4V1Av 3L39A 4CI1B 4PAGA 3ABVA 4B3MT 3B5MA 3I0QA 2CMRA 5E0OA 5ADXL 1KNZA 5DABA 1W09A 2ZM2A 1D0ZA 2A2FX 2HN1A 2HN2A 5GONE 4JI7T 2F4VT 4AQFC 2LRKA 4EOZB 5A1LA 3IEEA 3OPCA 1J5WA 3P4RA 4ZI2C 4PFOA 3P4PA 1OEDB 3KFWX 4UR9A 4EGWA 4TNVA 3KVAA 2YK0A 1IBKT 3HI2A 4ZI7E 2IAKA 4UXNB 3T1HT 3U78A 1JNZA 4A98A 2LLYA 2FJBA 3AA6B 2WU5A 5AQNB 4G2AA 5JDMA 3LSVA 4JEHB 2W62A 3UU5A 4HWIB 2WDRA 3AE4A 3RF1A 3RKOA 3AEFA 3QOFA 2X9HA 4JI8T 3O9XA 4AKGA 3LDQB 2W0GA 3OKQA 2JMKA 3UUMA 4JI4T 5IYZE 3GWHA 4PJLA 4IIJE 3BQLA 4JEUB 3J9X1 3RYCE 4Q25A 5KXJA 4ISSA 2XQAA 3OYXA 3N2OA 1XDPA 3T1YT 3SS1A 2WY2A 3UQ7A 3ONJA 2D5UA 2BKPA 2JIWA 1OEDA 2XQ9A 2KWIB 3U3IA 3TLWA 4L5GA 1XNRT 4DV0T 4LFBT 5IWAT 2W66A 3CQCB 1KNPA 4AISA 5CA1E 2H7OA 2A3DA 3ZN1B 4GYSA 2C5IT 2JQKA 3SFDA 4PK4A 3KBTA 3FZFB 4DV6T 2XHEB 2XZEA 1AJ3A 3O1IA 1HG5A 2JMHA 3ZKRA 2Q9QA 2V6XA 4QXBB 1XDOA 2UUBT 5JDNA 1IBLT 3FZKB 1N32T 1T98A 1WYCA 4LF6T 5JRCA 3QUJA 3AEAA 2WP9A 2VASA 4DR1T 4EEBA 4J2CA 3RGLA 4JI0T 4UELA 1ZV4X 4X66T 3VKHA 2J47A 4CN1A 2C0SA 5JVDE 3UTKA 5JTGA 1YKHB 1HCIA 3ZMSB 4ZS2A 4I0UA 4U7YA 4P09A 1VRBA 1FIOA 2B76A 2LKHA 4ZS3A 1KK7A 1FMVA 3PUSA 3N9NA 2XJ7A 3N9PA 4ZZBA 2D9DA 5EK4A 4CI2B 2W00A 5DJQC 1VCTA 2YU2A 5HEHA 2XM2A 5FVLA 5L3GB 5M4YA 5L3EB 2A72A 2W4XA 4H63H 3Q5EA 4DUZT 3HKBE 3N9OA 3WAJA 2Y48B 4DVDA 2M67A 1E2AA 2VB6A 3W15B 2WDQA 2LHRA 2BZBA 3CIRA 3JAEA 1I6ZA 4LF9T 4COFA 4OYJA 4ANJA 3LK2B 4EYYR 4FJOA 3LBXB 2N1GA 2K3WA 3FXDB 5HXSA 5LCYA 3SFEA 4HGAA 4JBWF 2VVSA 4ZXLA 4TZ4C 2QYWA 3S4UA 4P0AA 3HKDE 3AEEA 3HA4A 3L3PA 2XSAA 1QUUA 2UXNB 4KUMB 3KDSE 2CXLA 4YHHT 2XY8B 5HXCA 3N5LA 2D2SA 3VRAA 3J7Yq 2BVMA 2CHOA 3AE3A 5EZYE 4UVAB 4YJ2E 2LKGA 2X0HA 3I1AA 1D0XA 1SUMB 4ZOLE 5H6RB 3HKCE 4OYKA 4B6XA 5J0ZA 3IA3A 2FBWA 4X20E 1UCUA 2DI4A 4AKRB 4H9PC 3FBLA 1U5PA 4YTPA 3ETUA 1N34T 3RQWA 1WYBA 1CHUA 4IDNA 4DNDA 3ANWB 3CK6A 2YOEA 4UVBB 2V5CA 3LJCA 1QLBA 4ILBA 3CPZA 2L9QA 3NKZA 3PTRB 2ZLYA 4U74A 1MIVA 3PUQA 5JDQA 1HX1B 4QH4A 4I55E 1HX8A 1IAPA 2B1EA 5IHYA 4LF7T 4XZCA 4IT4A 2XQ8A 3ZPOA 2X68A 3H3AA 4IE6A 1WR6A 4DR3T 4EAHA 2MBGA 1D0YA 3UFGA 4A5XA 4HFDA 1VCSA 3F2EA 2ZM0A 2V7LA 3EAMA 2KT9A 5LHHB 5LBMA 2XSBA 3RYFE 2PJQA 3WI3A 3AVSA 1T7SA 3MACA 2XPKA 1BR1A 3C51A 2VKDA 5FY0A 3VR8A 4GYRA 1GQEA 2QGSA 4IE4A 4P0BA 2MYSA 1SA0E 2DHRA 2WAUA 5KMGP 3UQ4A 4DMWA 5L4EA 3MJXA 5HCJA 4C90A 2VL0A 4H9OC 5CB4E 1FJGT 5LJMA 3AXJB 4H9QC 2BG9A 3TLUA 3ZMZB 1MIYA 5F8PA 2JQQA 5AQFB 3PJAJ 4ZEYA 4DR4T 1ZKEA 2E9XC 5HXEA 2E9XB 4X1KE 3VRBA 5H6QB 5HWYA 4JYAT 1LKXA 3MA9A 5JDFA 2J1DG 2RPAA 1HTJF 2X51A 5FY1A 5AQLB 2NW8A 2PFVA 2RA1A 4QX8B 3O1HA 2Q9QD 2W61A 2K48A 2D0TA 2LHNA 3QB5A 3UUNA 4QXCB 5FL0A 2LRLA 3TLTA 2BS3A 5LHIB 4DV7T 2YDQA 4OHFA 4IDOA 2IC6A 3CX8B 2LT3A 2VURA 5JR9C 3C64A 4HFEA 5JR9B 5FY7A 3V5UA 5ABFB 5AQQB 5TAOA 2AE9A 3AXJA 2LOSA 4B3TT 3KV4A 2XAFB 3FZHB 2N2NA 3GN5B 4WW0A 2EHOA 2XQ7A 4UV9B 1NEKA 3NZPA 4EZHA 2KXPB 1S35A 2E2AA 2E5LT 4TV8E 2NWBA 2LSGA 3OJAA 5FXZA 4PJNA 1HNWT 4Z91A 5LB7B 2ACXA 2HPJA 3TLVA 3RIUA 4G63A 4PJMA 3RYHE 3HL6A 4DIDB 3LK3B 3TKLB 3K3NA 4HFBA 4ERRA 5L3CB 2BDEA 2ODUA 1XMQT 2X66A 3PUXF 3PUWF 4KHPT 2CLYC 2ZM6T 1MMAA 4KP3C 2MAWA 3RQUA 2CLYB 1IBMT 5FP3A 4XAXB 5ABFA 5BMVE 4KI0F 2YDSA 4IDQA 1N33T 4X64T 4BAYB 2WU2A 1M62A 3ZCJA 1EZ3A 3NZQA 1E1HB 5ABHA 2W67A 4DR5T 2XQ6A 5L3FB 2BKOA 3KV6A 3QNUA 5FYMA 2LSKA 2C5KT 2M6BA 5LGNB 4AQFA 4WBOA 5HEOA 2DL1A 1OWAA 5AQIB 2E8IA 3PV0F 4U2YA 3EABA 4U33A 4GKKT 1MMDA 3MZKB 5EK2A 3HR0A 4MALA 3Q5WA 3M3ZB 1HNZT 1J5ET 2BS2A 1FMWA 4DR2T 3ESLA 3CQXC 2XAQB 5HWXA 4CN4A 1SE7A 3ZN0B 2NTXA 3UFEA 1LRZA 4KBMB 2YDRA 3RRCA 3FXEB 3ZLIA 4DBQA 1KNRA 2IW5B 3AECA 3L09A 2DWKA 3AA0B 4DUYT 4JI6T 2W63A 4CN6A 5HXHA 2RP4A 2UXXB 5AQHB 3M65A 3BK9A 3PJAA 4XBFB 3KBUA 3PUGA 1M7KA 2LSIA 3AVRA 2WWVA
chains in the Genus database with same CATH topology
4HWCA 1UK5A 5AQNB 5AQKB 5AQJB 5AQVB 3FZKB 5AQOB 5AQGB 5AQRB 5AQHB 5AQIB 5AQFB 2D9DA 3FZHB 1T7SA 4HWIB 5AQLB 3FZFB 1M62A 5AQPB 5AQTB 3A8YC 1HX1B 1UGOA 4HWHA 4HWDA 1M7KA 3M3ZB 5AQSB 3FZMB 4HWFA 5AQQB 5AQMB 5AQUB 3FZLB 1I6ZA 3LDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWC A;  1UK5 A;  5AQN B;  5AQK B;  5AQJ B;  5AQV B;  3FZK B;  5AQO B;  5AQG B;  5AQR B;  5AQH B;  5AQI B;  5AQF B;  2D9D A;  3FZH B;  1T7S A;  4HWI B;  5AQL B;  3FZF B;  1M62 A;  5AQP B;  5AQT B;  3A8Y C;  1HX1 B;  1UGO A;  4HWH A;  4HWD A;  1M7K A;  3M3Z B;  5AQS B;  3FZM B;  4HWF A;  5AQQ B;  5AQM B;  5AQU B;  3FZL B;  1I6Z A;  3LDQ B; 
#chains in the Genus database with same CATH topology
 2HPL A;  2NW7 A;  5C2T A;  3RC8 A;  5CJ5 A;  4JLE A;  4IE0 A;  2R6G F;  4UF0 B;  4KX6 A;  4ILC A;  3NWI A;  4AIU A;  4IGU A;  3ZMV B;  1MIW A;  4O4H E;  2UXC T;  2JQ9 A;  4OK0 A;  4BJM A;  2NP9 A;  4YHJ A;  2OV9 A;  1YQ4 A;  4AQG A;  2BBJ A;  2P9B A;  5LXT E;  4I4T E;  1J1J A;  3RPU A;  5LMN T;  4OX9 T;  2SPC A;  2KLQ A;  1MMG A;  2PBI A;  5FXV A;  3N9M A;  3NRY A;  3AEG A;  5BR8 T;  4N78 D;  2WZI A;  4NXM T;  4YSY A;  1LVF A;  1JNR A;  2D0U A;  3P50 A;  3B57 A;  3LG7 A;  1KF6 A;  1MND A;  5J2U E;  2WM9 A;  4TNW A;  2Y6X A;  4A97 A;  5LNK A;  4HKA A;  3RYI E;  5HYA A;  4MHC A;  2L8K A;  3ZMT B;  2WMO A;  4HTE A;  3FZL B;  2KMF A;  5L4H A;  2XQ5 A;  3Q5D A;  5LMU T;  4ZI3 D;  1HG2 A;  3ZT5 A;  3JC6 D;  4X62 T;  1FEW A;  3P7I A;  5FVK A;  1US7 B;  3MKD A;  5J2T E;  1ZOY A;  3RX6 A;  3ZC1 A;  3O4X E;  1VOM A;  2BVL A;  2QA7 A;  5CA0 E;  3BQI A;  5AQM B;  3AA7 B;  1G73 A;  4CZZ B;  3FB2 A;  4IDP A;  3PU3 A;  1WCR A;  4YXD A;  2IIU A;  4WNK A;  2IHR 1;  1R8I A;  2LE8 A;  3VHL A;  4ASK A;  4JI3 T;  2XUE A;  2LSY A;  4H9S E;  4U2Z A;  2VKJ A;  1UUR A;  3PDY A;  2WS3 A;  3N2G E;  1ZP0 A;  4QH1 A;  2VQF T;  3ZYM A;  2WCA A;  3ZJ2 A;  3UU4 A;  2LJL A;  1W0A A;  4NXN T;  1HNX T;  2XTL A;  3X1D A;  1WRD A;  5AQT B;  3ETV A;  3D0T A;  4LMK A;  5L3D B;  3LBX A;  4ILA A;  3AA1 B;  2EHO D;  3ZSS A;  5AQP B;  5FXX A;  4YTN A;  2JJ9 A;  1YW0 A;  4YT0 A;  4CXW A;  5LG3 A;  3AED A;  3AAE B;  2M6I A;  5JRE A;  3F57 A;  4LF5 T;  2WBL A;  3VU7 H;  5J1G A;  4TWF A;  1IJ5 A;  1HFA A;  3UUL A;  2V7I A;  2DCF A;  3AEB A;  4H9R C;  3K3O A;  2I59 A;  3SOL A;  2XQ4 A;  4LFA T;  4EXT A;  3ONL C;  5AQS B;  5AFU L;  3A5X A;  3CX7 B;  2ZM8 A;  1D1A A;  4ZI3 C;  1V9D A;  3JC6 C;  5C8Y E;  2OA5 A;  4M1P A;  4DO0 A;  4IRE A;  1X79 A;  3IHR A;  1YKE B;  2CBI A;  3EVY A;  4TV9 E;  5LHG B;  4K0K T;  3R84 B;  2K24 A;  2ES0 A;  3PUR A;  2V6Y B;  2WZH A;  3ANW A;  1KEY A;  4IL9 A;  4YSX A;  3Q5X A;  4NUV A;  4NPP A;  2FJD A;  3B13 A;  2CWY A;  4JI1 T;  3AE2 A;  4UVC B;  4LF8 T;  4ZI2 D;  3NRX A;  2WSS V;  3C4W A;  2XAJ B;  3UU3 A;  5LGT B;  4DV1 T;  1Y01 A;  3QB5 K;  2KND A;  2K9A A;  3SRZ A;  1I94 T;  4A56 A;  3ZYK A;  3R6N A;  2MTQ A;  4TWD A;  5AQV B;  2WMN A;  2UUA T;  4ZZC A;  4O8S A;  3VKG A;  4PK5 A;  1UGO A;  1HS7 A;  2DLR A;  5ETW A;  2WWU A;  2JRK A;  4DV5 T;  5DQV A;  4C91 A;  3RI5 A;  4PJJ A;  3CQG B;  1D1B A;  3P4S A;  3ZMU B;  4TWH A;  1DU2 A;  3DTO A;  1XNQ T;  3PUY F;  3NBX X;  2IML A;  2JPF A;  2I6H A;  4DMV A;  4KMC A;  4IE5 A;  4JI5 T;  4HFH A;  4DR7 T;  4E7Z A;  4DBR A;  1XZY A;  4PNI A;  4CI3 B;  2V5D A;  2CXF A;  4IL4 A;  3V5S A;  3KVB A;  2MPK A;  2V8S V;  5JDH A;  4HWD A;  2E9X A;  3EDU A;  4H63 V;  3JCF A;  4MBQ A;  2NW9 A;  1CUN A;  2GK9 A;  4BA9 A;  5F5W A;  4F8H A;  3UUX B;  1W0B A;  2PG8 A;  3I9W A;  4O2A E;  2CXD A;  4X1I E;  5KDM C;  4DV3 T;  1OED C;  2WQY A;  4X65 T;  2CE7 A;  4UIG A;  4X1Y E;  2BG9 E;  5EK3 A;  1W9R A;  2VWA A;  2H88 A;  4EV6 A;  2W2U A;  4I43 B;  4JI2 T;  2LEH A;  2CRB A;  2K5B B;  2CBJ A;  3OBV E;  3E08 A;  5JR9 A;  3RH3 A;  3C98 B;  3PE0 A;  2YEV C;  4YLH A;  3N9L A;  2VQE T;  3RIA A;  4F6R C;  3RIF A;  1YXR A;  2Q9Q C;  1IJ6 A;  3GN5 A;  2Q9Q B;  3ZT6 A;  3GA8 A;  4HWH A;  3TLS A;  3I0O A;  1WLX A;  1L0V A;  3IBP A;  3T8O A;  5DQW A;  2YIN A;  5JRC B;  2X67 A;  3ZC0 A;  5ABG A;  4X5T A;  1SHZ C;  2KSR A;  4B3S T;  5LOV E;  3LFM A;  4GKJ T;  5L3B B;  1MNE A;  3UU6 A;  4AKI A;  5LYJ E;  3FZM B;  1IZN B;  3K1S A;  3QK6 A;  5HCM A;  4QXH B;  2IC9 A;  1G8X A;  3L8R A;  4HE8 A;  2VK9 A;  2ACZ A;  4GK0 E;  4CQI A;  3LK4 2;  4P1N A;  3KIN B;  2V7M A;  3GMI A;  2FJA A;  1XWM A;  4AKL A;  3EHZ A;  1T8B A;  2UU9 T;  5AQJ B;  5L47 A;  2ZMA A;  2NTY A;  4MFR A;  2NOX A;  1WFD A;  3K3Q C;  2BKN A;  4CXX A;  2VVN A;  3N2K E;  5HAX A;  4QH5 A;  3ZYL A;  1HF8 A;  1MMN A;  3OYZ A;  2AXD S;  4PFP A;  3C4Z A;  2CM0 A;  4EYU A;  3AE7 A;  4O2B E;  3ZCI A;  3CVR A;  3FHN A;  2UUC T;  2LOP A;  4UEM A;  2VKH A;  2CCQ A;  3CWZ B;  3N9Q A;  1HR0 T;  4O4J E;  4TN7 B;  5AQU B;  3UT5 E;  2LSJ A;  4JV5 T;  4LMJ A;  2X0L B;  1Y64 B;  3CKD A;  3E0Z A;  3RHW A;  1ZHC A;  2E5V A;  3AB3 B;  4DR6 T;  1UX5 A;  5IUX A;  2V7J A;  2CA5 A;  1BR0 A;  1D1C A;  4HFC A;  1OXZ A;  3EUH A;  2V1D B;  4QHO A;  3KV9 A;  2H89 A;  3CML A;  4B3R T;  4AI6 A;  2NR4 A;  3K8P C;  3WAK A;  4JUY A;  1O3X A;  4HWC A;  1UK5 A;  4EIW A;  3OVU A;  3CX6 B;  1UUS A;  4TX5 A;  3PU8 A;  3ZEF B;  4U3C A;  1OED E;  5HEG A;  1YD8 G;  3MK7 C;  4HFV A;  3Q9D A;  4HFI A;  1T72 A;  2IDO B;  4H9N C;  4YJ3 E;  2Z6E A;  4IST A;  4EB6 E;  4GK5 E;  4LML A;  3C50 A;  4WBN E;  4HEA A;  5FMN A;  5JH7 E;  1ZEE A;  4UF0 A;  2XAH B;  2YN6 A;  5LGU B;  4TUY E;  3C4X A;  1Z8U A;  4E7S A;  1KFY A;  4YFS A;  5AQG B;  3FBZ A;  2JQH A;  1QSD A;  3AE8 A;  1BR4 A;  4QKN A;  4EED A;  2UXD T;  5LP6 E;  2DWG A;  1NEN A;  1LVK A;  5LA6 E;  3H3M A;  3EDV A;  5LJN A;  1BR2 A;  4K0U A;  2DNX A;  2X9W A;  2FUP A;  4IDZ A;  2HHH T;  3Q2M A;  3RKG A;  2H7V C;  5KX5 E;  3PUV F;  4L9I A;  4KHZ F;  4DV2 T;  4YSZ A;  4Z90 A;  5ABE A;  4DV4 T;  4I50 E;  4AKH A;  3DJB A;  5HXR A;  2X9X A;  5JDL A;  5JQG E;  3PUA A;  4ZHQ E;  2I0M A;  1NAF A;  2CEA A;  4ADZ A;  1S94 A;  2N9D A;  3P8C D;  1XMO T;  4CXY A;  2VL8 A;  4U31 A;  4OFZ A;  1H7C A;  2CWO A;  4QWN B;  2LM2 A;  5CGM A;  1NWM X;  5C3J A;  2L3L A;  4Z8X A;  3MXZ A;  3PUZ F;  4AXP A;  5HEJ A;  4WZX A;  2XQY A;  2E9X D;  3ONX A;  1X9B A;  2VKO A;  4U7I A;  2PTF A;  2XAG B;  5FXW A;  5AQO B;  2LM9 A;  4YY3 T;  3OTO T;  2WB5 A;  1U4Q A;  2CHN A;  2CPT A;  3EI0 A;  4U72 A;  5JDG A;  2BG9 C;  2X9Y A;  1Z0P A;  4FI5 A;  1YQ3 A;  2BG9 B;  4EZ4 A;  3RLF F;  3NVO A;  3A7M A;  3BQK A;  4LFC T;  2KWH A;  5AQK B;  5FL1 A;  3ZT7 A;  1WR0 A;  5CFB A;  2J62 A;  4ILU A;  4AQY T;  1N36 T;  4PW8 A;  5FKY A;  4NIQ A;  3AE1 A;  3AE9 A;  3G06 A;  2HH7 A;  4IHJ E;  2WDV A;  5L2L A;  3KV5 A;  4MLK A;  2UXB T;  1UX4 A;  2X0Y A;  4BJN A;  5LG4 A;  4UV8 B;  3AE5 A;  3HKE E;  4PK6 A;  4NUU A;  5AQR B;  2V7K A;  3JAD A;  5F3J A;  2A9U A;  3H37 A;  2ODV A;  4IE7 A;  4WYV A;  2KZ7 B;  3ZST A;  3E22 E;  3IF8 B;  4HN9 A;  3VR9 A;  2EHO C;  3RRW A;  2YU1 A;  3UU8 A;  4GIW A;  2EHO B;  3UUB A;  5HEU A;  2QRX A;  3DP7 A;  2H3R A;  2IUB A;  3RIU C;  4L0R A;  4QX7 B;  2KIN B;  2C5J A;  3AAI A;  3P4W A;  4O4L E;  2BBH A;  3F31 A;  2V26 A;  1B7T A;  3ZJ1 A;  5FNV E;  3O1J A;  2J4G A;  3A8Y C;  2XQ3 A;  2V6Y A;  1E7P A;  4YTM A;  2XAS B;  2YKS A;  4LF4 T;  2BS4 A;  3RC3 A;  3JAF A;  3P4Q A;  4HWF A;  2XM1 A;  2Y8D A;  2FJE A;  3AAA B;  2G0U A;  3QC9 A;  4GOU A;  2OLT A;  3AE6 A;  3SWH A;  2QVA A;  2MOZ A;  5LBQ B;  4O4I E;  3I9Y A;  4V1A v;  3L39 A;  4CI1 B;  4PAG A;  3ABV A;  4B3M T;  3B5M A;  3I0Q A;  2CMR A;  5E0O A;  5ADX L;  1KNZ A;  5DAB A;  1W09 A;  2ZM2 A;  1D0Z A;  2A2F X;  2HN1 A;  2HN2 A;  5GON E;  4JI7 T;  2F4V T;  4AQF C;  2LRK A;  4EOZ B;  5A1L A;  3IEE A;  3OPC A;  1J5W A;  3P4R A;  4ZI2 C;  4PFO A;  3P4P A;  1OED B;  3KFW X;  4UR9 A;  4EGW A;  4TNV A;  3KVA A;  2YK0 A;  1IBK T;  3HI2 A;  4ZI7 E;  2IAK A;  4UXN B;  3T1H T;  3U78 A;  1JNZ A;  4A98 A;  2LLY A;  2FJB A;  3AA6 B;  2WU5 A;  5AQN B;  4G2A A;  5JDM A;  3LSV A;  4JEH B;  2W62 A;  3UU5 A;  4HWI B;  2WDR A;  3AE4 A;  3RF1 A;  3RKO A;  3AEF A;  3QOF A;  2X9H A;  4JI8 T;  3O9X A;  4AKG A;  3LDQ B;  2W0G A;  3OKQ A;  2JMK A;  3UUM A;  4JI4 T;  5IYZ E;  3GWH A;  4PJL A;  4IIJ E;  3BQL A;  4JEU B;  3J9X 1;  3RYC E;  4Q25 A;  5KXJ A;  4ISS A;  2XQA A;  3OYX A;  3N2O A;  1XDP A;  3T1Y T;  3SS1 A;  2WY2 A;  3UQ7 A;  3ONJ A;  2D5U A;  2BKP A;  2JIW A;  1OED A;  2XQ9 A;  2KWI B;  3U3I A;  3TLW A;  4L5G A;  1XNR T;  4DV0 T;  4LFB T;  5IWA T;  2W66 A;  3CQC B;  1KNP A;  4AIS A;  5CA1 E;  2H7O A;  2A3D A;  3ZN1 B;  4GYS A;  2C5I T;  2JQK A;  3SFD A;  4PK4 A;  3KBT A;  3FZF B;  4DV6 T;  2XHE B;  2XZE A;  1AJ3 A;  3O1I A;  1HG5 A;  2JMH A;  3ZKR A;  2Q9Q A;  2V6X A;  4QXB B;  1XDO A;  2UUB T;  5JDN A;  1IBL T;  3FZK B;  1N32 T;  1T98 A;  1WYC A;  4LF6 T;  5JRC A;  3QUJ A;  3AEA A;  2WP9 A;  2VAS A;  4DR1 T;  4EEB A;  4J2C A;  3RGL A;  4JI0 T;  4UEL A;  1ZV4 X;  4X66 T;  3VKH A;  2J47 A;  4CN1 A;  2C0S A;  5JVD E;  3UTK A;  5JTG A;  1YKH B;  1HCI A;  3ZMS B;  4ZS2 A;  4I0U A;  4U7Y A;  4P09 A;  1VRB A;  1FIO A;  2B76 A;  2LKH A;  4ZS3 A;  1KK7 A;  1FMV A;  3PUS A;  3N9N A;  2XJ7 A;  3N9P A;  4ZZB A;  2D9D A;  5EK4 A;  4CI2 B;  2W00 A;  5DJQ C;  1VCT A;  2YU2 A;  5HEH A;  2XM2 A;  5FVL A;  5L3G B;  5M4Y A;  5L3E B;  2A72 A;  2W4X A;  4H63 H;  3Q5E A;  4DUZ T;  3HKB E;  3N9O A;  3WAJ A;  2Y48 B;  4DVD A;  2M67 A;  1E2A A;  2VB6 A;  3W15 B;  2WDQ A;  2LHR A;  2BZB A;  3CIR A;  3JAE A;  1I6Z A;  4LF9 T;  4COF A;  4OYJ A;  4ANJ A;  3LK2 B;  4EYY R;  4FJO A;  3LBX B;  2N1G A;  2K3W A;  3FXD B;  5HXS A;  5LCY A;  3SFE A;  4HGA A;  4JBW F;  2VVS A;  4ZXL A;  4TZ4 C;  2QYW A;  3S4U A;  4P0A A;  3HKD E;  3AEE A;  3HA4 A;  3L3P A;  2XSA A;  1QUU A;  2UXN B;  4KUM B;  3KDS E;  2CXL A;  4YHH T;  2XY8 B;  5HXC A;  3N5L A;  2D2S A;  3VRA A;  3J7Y q;  2BVM A;  2CHO A;  3AE3 A;  5EZY E;  4UVA B;  4YJ2 E;  2LKG A;  2X0H A;  3I1A A;  1D0X A;  1SUM B;  4ZOL E;  5H6R B;  3HKC E;  4OYK A;  4B6X A;  5J0Z A;  3IA3 A;  2FBW A;  4X20 E;  1UCU A;  2DI4 A;  4AKR B;  4H9P C;  3FBL A;  1U5P A;  4YTP A;  3ETU A;  1N34 T;  3RQW A;  1WYB A;  1CHU A;  4IDN A;  4DND A;  3ANW B;  3CK6 A;  2YOE A;  4UVB B;  2V5C A;  3LJC A;  1QLB A;  4ILB A;  3CPZ A;  2L9Q A;  3NKZ A;  3PTR B;  2ZLY A;  4U74 A;  1MIV A;  3PUQ A;  5JDQ A;  1HX1 B;  4QH4 A;  4I55 E;  1HX8 A;  1IAP A;  2B1E A;  5IHY A;  4LF7 T;  4XZC A;  4IT4 A;  2XQ8 A;  3ZPO A;  2X68 A;  3H3A A;  4IE6 A;  1WR6 A;  4DR3 T;  4EAH A;  2MBG A;  1D0Y A;  3UFG A;  4A5X A;  4HFD A;  1VCS A;  3F2E A;  2ZM0 A;  2V7L A;  3EAM A;  2KT9 A;  5LHH B;  5LBM A;  2XSB A;  3RYF E;  2PJQ A;  3WI3 A;  3AVS A;  1T7S A;  3MAC A;  2XPK A;  1BR1 A;  3C51 A;  2VKD A;  5FY0 A;  3VR8 A;  4GYR A;  1GQE A;  2QGS A;  4IE4 A;  4P0B A;  2MYS A;  1SA0 E;  2DHR A;  2WAU A;  5KMG P;  3UQ4 A;  4DMW A;  5L4E A;  3MJX A;  5HCJ A;  4C90 A;  2VL0 A;  4H9O C;  5CB4 E;  1FJG T;  5LJM A;  3AXJ B;  4H9Q C;  2BG9 A;  3TLU A;  3ZMZ B;  1MIY A;  5F8P A;  2JQQ A;  5AQF B;  3PJA J;  4ZEY A;  4DR4 T;  1ZKE A;  2E9X C;  5HXE A;  2E9X B;  4X1K E;  3VRB A;  5H6Q B;  5HWY A;  4JYA T;  1LKX A;  3MA9 A;  5JDF A;  2J1D G;  2RPA A;  1HTJ F;  2X51 A;  5FY1 A;  5AQL B;  2NW8 A;  2PFV A;  2RA1 A;  4QX8 B;  3O1H A;  2Q9Q D;  2W61 A;  2K48 A;  2D0T A;  2LHN A;  3QB5 A;  3UUN A;  4QXC B;  5FL0 A;  2LRL A;  3TLT A;  2BS3 A;  5LHI B;  4DV7 T;  2YDQ A;  4OHF A;  4IDO A;  2IC6 A;  3CX8 B;  2LT3 A;  2VUR A;  5JR9 C;  3C64 A;  4HFE A;  5JR9 B;  5FY7 A;  3V5U A;  5ABF B;  5AQQ B;  5TAO A;  2AE9 A;  3AXJ A;  2LOS A;  4B3T T;  3KV4 A;  2XAF B;  3FZH B;  2N2N A;  3GN5 B;  4WW0 A;  2EHO A;  2XQ7 A;  4UV9 B;  1NEK A;  3NZP A;  4EZH A;  2KXP B;  1S35 A;  2E2A A;  2E5L T;  4TV8 E;  2NWB A;  2LSG A;  3OJA A;  5FXZ A;  4PJN A;  1HNW T;  4Z91 A;  5LB7 B;  2ACX A;  2HPJ A;  3TLV A;  3RIU A;  4G63 A;  4PJM A;  3RYH E;  3HL6 A;  4DID B;  3LK3 B;  3TKL B;  3K3N A;  4HFB A;  4ERR A;  5L3C B;  2BDE A;  2ODU A;  1XMQ T;  2X66 A;  3PUX F;  3PUW F;  4KHP T;  2CLY C;  2ZM6 T;  1MMA A;  4KP3 C;  2MAW A;  3RQU A;  2CLY B;  1IBM T;  5FP3 A;  4XAX B;  5ABF A;  5BMV E;  4KI0 F;  2YDS A;  4IDQ A;  1N33 T;  4X64 T;  4BAY B;  2WU2 A;  1M62 A;  3ZCJ A;  1EZ3 A;  3NZQ A;  1E1H B;  5ABH A;  2W67 A;  4DR5 T;  2XQ6 A;  5L3F B;  2BKO A;  3KV6 A;  3QNU A;  5FYM A;  2LSK A;  2C5K T;  2M6B A;  5LGN B;  4AQF A;  4WBO A;  5HEO A;  2DL1 A;  1OWA A;  5AQI B;  2E8I A;  3PV0 F;  4U2Y A;  3EAB A;  4U33 A;  4GKK T;  1MMD A;  3MZK B;  5EK2 A;  3HR0 A;  4MAL A;  3Q5W A;  3M3Z B;  1HNZ T;  1J5E T;  2BS2 A;  1FMW A;  4DR2 T;  3ESL A;  3CQX C;  2XAQ B;  5HWX A;  4CN4 A;  1SE7 A;  3ZN0 B;  2NTX A;  3UFE A;  1LRZ A;  4KBM B;  2YDR A;  3RRC A;  3FXE B;  3ZLI A;  4DBQ A;  1KNR A;  2IW5 B;  3AEC A;  3L09 A;  2DWK A;  3AA0 B;  4DUY T;  4JI6 T;  2W63 A;  4CN6 A;  5HXH A;  2RP4 A;  2UXX B;  5AQH B;  3M65 A;  3BK9 A;  3PJA A;  4XBF B;  3KBU A;  3PUG A;  1M7K A;  2LSI A;  3AVR A;  2WWV A; 
#chains in the Genus database with same CATH homology
 4HWC A;  1UK5 A;  5AQN B;  5AQK B;  5AQJ B;  5AQV B;  3FZK B;  5AQO B;  5AQG B;  5AQR B;  5AQH B;  5AQI B;  5AQF B;  2D9D A;  3FZH B;  1T7S A;  4HWI B;  5AQL B;  3FZF B;  1M62 A;  5AQP B;  5AQT B;  3A8Y C;  1HX1 B;  1UGO A;  4HWH A;  4HWD A;  1M7K A;  3M3Z B;  5AQS B;  3FZM B;  4HWF A;  5AQQ B;  5AQM B;  5AQU B;  3FZL B;  1I6Z A;  3LDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...