5AQGB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqgB00
5AQTB 5AQUB 5AQOB 4HWIB 1UK5A 5AQPB 2D9DA 1I6ZA 5AQIB 1HX1B 5AQNB 5AQQB 4HWDA 3FZHB 5AQJB 5AQGB 5AQHB 4HWHA 3M3ZB 1UGOA 3LDQB 5AQVB 3A8YC 3FZLB 1M62A 5AQKB 5AQLB 5AQFB 1M7KA 5AQRB 5AQMB 4HWCA 3FZFB 4HWFA 3FZKB 5AQSB 3FZMB 1T7SA
chains in the Genus database with same CATH superfamily
3RC8A 4UV8B 4U2YA 2FJBA 2K24A 2WM9A 1N34T 2ES0A 2XM1A 3UUBA 3PJAJ 1Y01A 5J1GA 5IYZE 1UX5A 2D0TA 4I55E 3RRWA 4LFAT 4ZOLE 2CXLA 3QOFA 2A3DA 3N9MA 5LMUT 3ZT6A 4DV2T 2UUBT 3KVBA 3N9PA 5KX5E 4YT0A 3Q5EA 2V6YA 1WR0A 3UQ4A 2W61A 3SS1A 2YDSA 2C0SA 1OEDB 4MFRA 4CN1A 2FBWA 2CHOA 1YD8G 3AEBA 2WU5A 5LMNT 1R8IA 5FXXA 1KNRA 3ZYMA 2NW9A 1XMQT 4Z8XA 5LOVE 5FXZA 3HI2A 2FJEA 3ANWB 3V5SA 2ZMAA 4JI8T 5AQUB 2ODUA 4YSZA 5AQOB 4HWIB 1SE7A 2VASA 3AE1A 4DR3T 2WDQA 2I59A 2ZM6T 5JRCA 4JI7T 2Z6EA 4DV1T 4GIWA 2QGSA 4QX7B 4YLHA 2V7MA 2BBHA 4ZI2C 4B3ST 3UU6A 3LFMA 3SFDA 3P50A 3MK7C 5FL0A 2CWOA 4EYYR 2CEAA 4EZ4A 5CA0E 5L4EA 2W2UA 4KHPT 2LSIA 4A97A 3ZT7A 5ABGA 4EAHA 2VB6A 3HR0A 2Q9QB 2JRKA 5HCJA 3ZMTB 3SOLA 1D0XA 4IHJE 5F8PA 4DMVA 4HN9A 2NP9A 1MMGA 2VKOA 5DABA 2R6GF 3RYIE 2B1EA 2MTQA 2EHOD 2KINB 2BG9E 3GN5A 2ODVA 4F8HA 2UUAT 2E5VA 2HPJA 3JC6C 2YOEA 3HKCE 4X64T 4O4LE 3L3PA 5L3GB 4O8SA 3CMLA 2WU2A 4BAYB 3KV4A 3RC3A 1BR1A 3O4XE 4OK0A 4AQFA 3MACA 5LJNA 2BS2A 1FIOA 3AAIA 4H9OC 2LSKA 3H3MA 4YHJA 3JAEA 2BG9A 4ANJA 2IC9A 3ESLA 3LK2B 3NZPA 2XAHB 5HYAA 1HG2A 1MMDA 2H7OA 3MJXA 3TKLB 2K48A 3RIFA 4HWCA 3PUXF 3C98B 1W0BA 2WSSV 4DV4T 2CCQA 3QNUA 2SPCA 4H9NC 2DWGA 3E22E 3NRXA 1MMAA 2XM2A 3AEAA 4AKLA 2BBJA 2W66A 5JR9C 3ZLIA 4I4TE 4WBOA 5L3EB 3RIUA 4X20E 4A56A 5M4YA 2CM0A 4EXTA 5AQJB 5AQHB 3R84B 1BR2A 1ZOYA 2V1DB 2BKOA 4IE4A 2E9XD 1G8XA 4TV8E 4JBWF 2X0HA 1ZV4X 4I43B 3GMIA 3OYZA 3Q5DA 2WP9A 3SWHA 5BMVE 2WBLA 4QHOA 3EVYA 3PU3A 2MYSA 4PK4A 3ZYLA 4X1KE 2VK9A 1M62A 4Z91A 2KLQA 5JDHA 3DJBA 3ABVA 2XQ4A 4UVAB 3LBXA 2LLYA 2J1DG 3AEGA 1KFYA 2AXDS 2L3LA 2LKHA 2IDOB 3VHLA 4U72A 3I9WA 1HG5A 5FNVE 3IEEA 3B13A 4X1YE 5C3JA 5L4HA 5KMGP 2XTLA 2QA7A 4YFSA 1T98A 2LHNA 4PNIA 4EEDA 3ZMSB 2XQ5A 1MNDA 4QXCB 4U7IA 1WYCA 2ZM0A 2KNDA 2LKGA 1B7TA 5H6RB 5HEHA 4TWDA 3VRAA 4H9SE 3ZT5A 3O1IA 4GKKT 5HEJA 4KX6A 4HFVA 4UV9B 3FBLA 2LE8A 2KSRA 5LB7B 2OV9A 4LMJA 4HTEA 2E2AA 1I6ZA 4AI6A 2FJAA 3U78A 2C5JA 1MMNA 4DO0A 2C5IT 4PFPA 3PUZF 4O4IE 4HWFA 3FB2A 2XZEA 3AE4A 5HXSA 1EZ3A 2V8SV 3SRZA 1E1HB 1IZNB 3AE9A 3AEEA 5HXEA 4LMKA 1HNXT 5H6QB 5FL1A 5LA6E 4P09A 5L3FB 4ILUA 3OPCA 4AQGA 2LSJA 4UEMA 3RRCA 1X9BA 4DNDA 4KUMB 3CKDA 1IJ6A 4JYAT 3P4SA 3W15B 1GQEA 3QB5K 2P9BA 1S35A 2E8IA 5HAXA 5AQSB 3F2EA 3KINB 5DQVA 1YKEB 2ZM8A 4CN6A 4PJJA 3OVUA 4DBQA 2BS4A 4ISTA 2Q9QD 4BJNA 3H3AA 1AJ3A 3RHWA 4B3RT 4CI1B 4TZ4C 3ZC1A 2PFVA 3DTOA 4IIJE 4YSYA 5CGMA 4UVBB 5FMNA 3MKDA 3AXJA 2H89A 2CXDA 4TUYE 3PV0F 4AKIA 4LF6T 4JV5T 3CQGB 4HWHA 5IUXA 2W67A 4JI5T 3ONLC 4ILAA 1J1JA 1YQ4A 2XQ6A 5FYMA 4LFCT 2G0UA 3IHRA 3NVOA 4MLKA 1FMWA 4E7ZA 2L8KA 2CWYA 2M67A 1SUMB 4MBQA 4EV6A 3JADA 4OHFA 3C4ZA 2EHOA 2WZIA 2W0GA 4IDZA 2Y6XA 3UUXB 4TN7B 3UTKA 2HPLA 3K3NA 2UXDT 3UUMA 4IE5A 2XSAA 3QUJA 2XHEB 3RLFF 3EUHA 5DJQC 1ZKEA 3M3ZB 4JEHB 1XMOT 3F57A 3I9YA 4P0AA 3PURA 2HN1A 2H3RA 4A5XA 4DV5T 2KT9A 1CUNA 4OFZA 5AQQB 1Y64B 2BVLA 3GN5B 1W9RA 1D1BA 4GK5E 3P4QA 2IHR1 5FXWA 1ZEEA 3BQIA 3ZJ2A 4QX8B 4BJMA 4UVCB 5DQWA 3EABA 4C91A 3UU4A 5J2UE 3AAEB 4JLEA 4XAXB 2CRBA 2XQYA 1IBLT 3KVAA 4E7SA 2XAQB 4DR5T 1D1CA 4DR7T 2A2FX 4TNWA 5AQTB 2YKSA 4XZCA 1VCTA 3MZKB 1W0AA 4QH1A 4F6RC 2FJDA 2BG9B 2PTFA 4YJ2E 1QUUA 3EAMA 1MNEA 4HFDA 4CXYA 4IE7A 5AQMB 3ONJA 4GYRA 4BA9A 3AE5A 2M6BA 4O2BE 2E9XA 2UXCT 3H37A 2J62A 2JMKA 1D0YA 5JREA 3UT5E 4ISSA 2WMOA 2X9XA 3DP7A 5LGNB 4ZHQE 2C5KT 3KBTA 5AQNB 4B6XA 3UULA 4HE8A 2V7JA 5FY7A 3VU7H 4ZI2D 2VL8A 2YEVC 2VWAA 2XPKA 4UF0B 2WS3A 1MIYA 3RKGA 3FZMB 1VCSA 3IBPA 2LOPA 3QC9A 3PUVF 1HFAA 2DNXA 2KZ7B 4PJLA 2W4XA 2CBIA 2PG8A 3PDYA 5JH7E 2JQQA 1UUSA 3KFWX 3AE8A 2X0LB 3CWZB 1HTJF 5J0ZA 2IIUA 1W09A 4H9QC 3N2KE 3LDQB 1OEDA 5LXTE 4QXHB 4ZEYA 1T7SA 3JC6D 2W00A 3UUNA 4K0KT 3AEDA 3NRYA 2Y48B 1MIWA 3ANWA 4YJ3E 5L3DB 2NW8A 1M7KA 3AEFA 3AE2A 4NXMT 3ZMUB 1H7CA 4DIDB 2VVNA 1T72A 1UURA 5HEUA 2X67A 4DR2T 4NIQA 5KDMC 5L3CB 3RYFE 4G63A 4J2CA 4C90A 4DV6T 5TAOA 2LOSA 1J5ET 1VRBA 2VURA 3P4WA 1E2AA 1LVFA 4H63V 4QH5A 4IE6A 3FZHB 2VKHA 2FUPA 1OWAA 1S94A 3ZMVB 3J9X1 2XY8B 4B3TT 3T1HT 2UU9T 2K5BB 4OYKA 2NR4A 2I0MA 3UU8A 1WR6A 5LCYA 1HX1B 5J2TE 4AISA 2Q9QA 4HFIA 3IF8B 1OXZA 1ZHCA 3L39A 2CXFA 2NWBA 4PFOA 2XASB 3G06A 3C64A 3RGLA 4EZHA 4WBNE 2BVMA 3AE7A 1N36T 3CX7B 2WAUA 3E0ZA 2XAJB 5C8YE 5FVKA 4B3MT 4KI0F 4EEBA 3N2GE 2NOXA 2QVAA 2DCFA 3FZKB 5EZYE 3HKBE 4IDPA 1HS7A 2XAFB 4EOZB 4JI0T 4CZZB 2QRXA 3OJAA 3LK42 1L0VA 4X65T 3SFEA 3O1JA 4KHZF 2ACXA 2X9YA 2LSYA 4PJMA 3J7Yq 4H9PC 2KWHA 4EB6E 2VL0A 3C51A 1I94T 4HWDA 2WWUA 4HGAA 4IDQA 4QXBB 3RIAA 3UQ7A 2ZLYA 2IC6A 3RKOA 2IAKA 2M6IA 4PW8A 5HCMA 1XNRT 2BG9C 4JUYA 3ETUA 2WB5A 2MOZA 3Q2MA 4UELA 3BK9A 3A8YC 4TV9E 3PUGA 2V6XA 4ZI3C 5JDFA 3PUAA 3EDVA 2RP4A 3FHNA 3UFEA 5CB4E 4X1IE 3ZCIA 4YTPA 3VKHA 4QKNA 4I50E 4EYUA 4LF5T 3JCFA 2JJ9A 2H7VC 2JPFA 3RIUC 4QWNB 1BR0A 2XQ3A 3ZN1B 4AKRB 5A1LA 3KDSE 4JI3T 4COFA 4KBMB 2V7LA 2WWVA 4LF7T 2V6YB 5HXRA 3WAJA 2UXNB 4DR6T 3M65A 1MIVA 4IE0A 1XDOA 4ASKA 1DU2A 4V1Av 4IT4A 4O4JE 1U4QA 5LBQB 5ABEA 2NTYA 3CPZA 5IHYA 1X79A 3VRBA 2VQET 3PUSA 1G73A 3K3QC 3T1YT 1NENA 1D1AA 4CQIA 3AAAB 3ZC0A 3K3OA 2MBGA 2CLYC 3LK3B 2UUCT 4CI2B 3AECA 2LEHA 2KXPB 3ZKRA 2YINA 3N9QA 4ZXLA 3JAFA 2KWIB 2WQYA 4AKGA 2CMRA 3C50A 4ERRA 4PK6A 3ZSSA 4IL4A 5JRCB 4CXXA 2D5UA 4L9IA 2J47A 1US7B 4X62T 4DBRA 3I0OA 4WZXA 5LGUB 2HN2A 2K3WA 4FJOA 5AQPB 4DV3T 3Q9DA 1KK7A 5HWXA 4GOUA 2GK9A 3N9OA 4LF9T 3P4PA 4TNVA 3OTOT 2D2SA 4OX9T 3ZEFB 2X0YA 1JNRA 2X66A 1XNQT 2XJ7A 4HEAA 1XWMA 2BKPA 3CX6B 3HKEE 5F3JA 1WFDA 5FXVA 3X1DA 5ABFA 4GYSA 2IUBA 3KBUA 2F4VT 4CI3B 5ABHA 3WAKA 4U74A 3C4WA 2QYWA 5JDLA 2JIWA 4WNKA 4LF8T 4JI2T 3ZYKA 2WDRA 3QB5A 2K9AA 3UU3A 2IW5B 3FXDB 5HXCA 3EHZA 1IBMT 2RPAA 3HL6A 3BQKA 3PU8A 4DUZT 3N9LA 3OYXA 2KMFA 4DR1T 1YW0A 2VKDA 4PAGA 2JMHA 3RYCE 3VKGA 2HHHT 1JNZA 5ETWA 2V5CA 3TLSA 4UIGA 4H9RC 5KXJA 2N1GA 3AA0B 5JTGA 3I0QA 3S4UA 2XQAA 2X9HA 3PUQA 4ILBA 4N78D 3FZLB 3L8RA 1FMVA 3K1SA 4HFCA 4X66T 5JR9A 3TLUA 4YSXA 4DV0T 2LT3A 1LVKA 4GKJT 2OLTA 2LRKA 2L9QA 3O1HA 3I1AA 4EIWA 3P8CD 2YN6A 4UR9A 3OBVE 5EK3A 3IA3A 3RYHE 5AQLB 5AQFB 4XBFB 2LM9A 5AQRB 4PJNA 5FY1A 2WY2A 2Y8DA 5JDGA 4UXNB 3KV6A 2D9DA 4NUVA 5BR8T 4P0BA 2V26A 1UCUA 1U5PA 5LHHB 4AKHA 4HFEA 4YTMA 4OYJA 3WI3A 4MALA 4YTNA 3A5XA 2V7IA 1OEDE 3AB3B 3L09A 1IAPA 3TLTA 1YQ3A 3ZPOA 2EHOC 4HFHA 5EK2A 2YU1A 3B57A 2UXXB 5ADXL 2I6HA 4DMWA 2CBJA 5JVDE 3N2OA 2CLYB 3LBXB 2WDVA 4TX5A 4LMLA 1E7PA 3N5LA 2X9WA 2N9DA 2XAGB 5EK4A 3VR9A 5LHIB 3MXZA 4DV7T 5LHGB 2UXBT 1WRDA 2OA5A 3FZFB 3O9XA 3PTRB 3ZN0B 2DWKA 3NWIA 4L5GA 3NBXX 4K0UA 2LM2A 1YKHB 1NWMX 3HKDE 4ZZCA 3CQXC 5AFUL 4L0RA 4HFBA 1CHUA 4IL9A 4JI6T 5C2TA 3AE3A 3B5MA 3RQWA 5HEOA 2ACZA 2AE9A 4Z90A 3PUYF 3UU5A 4AXPA 2CA5A 1LKXA 3KV9A 4ZS2A 5LP6E 2WCAA 5F5WA 5AQGB 1IJ5A 5E0OA 4MHCA 2MPKA 2E5LT 2V5DA 4WYVA 4LFBT 4TWHA 4ILCA 3CK6A 4YXDA 5CJ5A 4DR4T 1QSDA 4DVDA 5AQIB 3QK6A 4PK5A 5L3BB 5FVLA 5AQVB 3ZJ1A 3ZSTA 2CHNA 4IDOA 4O4HE 2E9XC 5LG4A 4H63H 4CXWA 2XUEA 2JQKA 5L2LA 1FJGT 3ZMZB 5LYJE 3F31A 3BQLA 5HWYA 1KEYA 4TWFA 5AQKB 4UF0A 1NAFA 2CPTA 3PE0A 3AE6A 2NW7A 4M1PA 4QH4A 3K8PC 3AA6B 2V7KA 2VQFT 1FEWA 2YK0A 2N2NA 3Q5WA 4ZS3A 5GONE 2LRLA 1UK5A 3ONXA 3T8OA 3LJCA 3RH3A 1QLBA 4AQYT 1O3XA 1HNZT 2DI4A 4IDNA 1D0ZA 3VR8A 4DUYT 2LSGA 3CQCB 3TLWA 1T8BA 4YHHT 2DHRA 4JI1T 2YDRA 3GWHA 5FP3A 4I0UA 2CE7A 2ZM2A 2BS3A 3KV5A 3EDUA 3HA4A 3ZCJA 3AA7B 3AXJB 2WZHA 5HEGA 4WW0A 2RA1A 2W62A 1NEKA 1OEDC 2IMLA 1VOMA 4AQFC 4IREA 5JDMA 2PBIA 1WCRA 5JDNA 3LSVA 4ZI7E 3TLVA 2BKNA 2A9UA 1HR0T 3R6NA 1BR4A 4AIUA 3FBZA 1Z0PA 4P1NA 3RI5A 1UGOA 3NKZA 4U31A 3CVRA 4IGUA 2EHOB 4NUUA 1XDPA 5LBMA 2PJQA 3RPUA 5L47A 3P4RA 2HH7A 4LF4T 4CN4A 2BDEA 4A98A 1WYBA 3LG7A 3RX6A 4GK0E 3FXEB 4KP3C 1N32T 2H88A 5CFBA 3N9NA 2LHRA 2YDQA 4X5TA 2JQ9A 2DLRA 3U3IA 5IWAT 1UX4A 5JQGE 3CX8B 5FKYA 1N33T 4ZI3D 5ABFB 3AA1B 2MAWA 3MA9A 3RQUA 3GA8A 2LJLA 4NXNT 2XQ7A 2X51A 5LJMA 2W63A 3PJAA 2VKJA 2B76A 1V9DA 5LG3A 1HF8A 4FI5A 4U7YA 3RF1A 3V5UA 3C4XA 1IBKT 1KNPA 2Q9QC 3D0TA 2NTXA 3UFGA 4HKAA 1SA0E 2X68A 5JDQA 4G2AA 1KF6A 2DL1A 3ETVA 1Z8UA 1J5WA 2XQ8A 1LRZA 4JI4T 4ZZBA 2A72A 2YU2A 3OKQA 4U2ZA 2D0UA 2XSBA 4U33A 4EGWA 4KMCA 4O2AE 3EI0A 2XQ9A 5JR9B 5FY0A 2E9XB 1KNZA 1WLXA 5LGTB 1HX8A 4NPPA 2VVSA 4JEUB 1ZP0A 3A7MA 5CA1E 1HNWT 1SHZC 2J4GA 2JQHA 1YXRA 3AVSA 3AVRA 3NZQA 1HCIA 3CIRA 2WMNA 3PUWF 4U3CA 3E08A 2BZBA 1XZYA 5HXHA 5LNKA 4Q25A 3P7IA 4ADZA 4YY3T 3Q5XA
chains in the Genus database with same CATH topology
5AQTB 5AQUB 5AQOB 4HWIB 1UK5A 5AQPB 2D9DA 1I6ZA 5AQIB 1HX1B 5AQNB 5AQQB 4HWDA 3FZHB 5AQJB 5AQGB 5AQHB 4HWHA 3M3ZB 1UGOA 3LDQB 5AQVB 3A8YC 3FZLB 1M62A 5AQKB 5AQLB 5AQFB 1M7KA 5AQRB 5AQMB 4HWCA 3FZFB 4HWFA 3FZKB 5AQSB 3FZMB 1T7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQT B;  5AQU B;  5AQO B;  4HWI B;  1UK5 A;  5AQP B;  2D9D A;  1I6Z A;  5AQI B;  1HX1 B;  5AQN B;  5AQQ B;  4HWD A;  3FZH B;  5AQJ B;  5AQG B;  5AQH B;  4HWH A;  3M3Z B;  1UGO A;  3LDQ B;  5AQV B;  3A8Y C;  3FZL B;  1M62 A;  5AQK B;  5AQL B;  5AQF B;  1M7K A;  5AQR B;  5AQM B;  4HWC A;  3FZF B;  4HWF A;  3FZK B;  5AQS B;  3FZM B;  1T7S A; 
#chains in the Genus database with same CATH topology
 3RC8 A;  4UV8 B;  4U2Y A;  2FJB A;  2K24 A;  2WM9 A;  1N34 T;  2ES0 A;  2XM1 A;  3UUB A;  3PJA J;  1Y01 A;  5J1G A;  5IYZ E;  1UX5 A;  2D0T A;  4I55 E;  3RRW A;  4LFA T;  4ZOL E;  2CXL A;  3QOF A;  2A3D A;  3N9M A;  5LMU T;  3ZT6 A;  4DV2 T;  2UUB T;  3KVB A;  3N9P A;  5KX5 E;  4YT0 A;  3Q5E A;  2V6Y A;  1WR0 A;  3UQ4 A;  2W61 A;  3SS1 A;  2YDS A;  2C0S A;  1OED B;  4MFR A;  4CN1 A;  2FBW A;  2CHO A;  1YD8 G;  3AEB A;  2WU5 A;  5LMN T;  1R8I A;  5FXX A;  1KNR A;  3ZYM A;  2NW9 A;  1XMQ T;  4Z8X A;  5LOV E;  5FXZ A;  3HI2 A;  2FJE A;  3ANW B;  3V5S A;  2ZMA A;  4JI8 T;  5AQU B;  2ODU A;  4YSZ A;  5AQO B;  4HWI B;  1SE7 A;  2VAS A;  3AE1 A;  4DR3 T;  2WDQ A;  2I59 A;  2ZM6 T;  5JRC A;  4JI7 T;  2Z6E A;  4DV1 T;  4GIW A;  2QGS A;  4QX7 B;  4YLH A;  2V7M A;  2BBH A;  4ZI2 C;  4B3S T;  3UU6 A;  3LFM A;  3SFD A;  3P50 A;  3MK7 C;  5FL0 A;  2CWO A;  4EYY R;  2CEA A;  4EZ4 A;  5CA0 E;  5L4E A;  2W2U A;  4KHP T;  2LSI A;  4A97 A;  3ZT7 A;  5ABG A;  4EAH A;  2VB6 A;  3HR0 A;  2Q9Q B;  2JRK A;  5HCJ A;  3ZMT B;  3SOL A;  1D0X A;  4IHJ E;  5F8P A;  4DMV A;  4HN9 A;  2NP9 A;  1MMG A;  2VKO A;  5DAB A;  2R6G F;  3RYI E;  2B1E A;  2MTQ A;  2EHO D;  2KIN B;  2BG9 E;  3GN5 A;  2ODV A;  4F8H A;  2UUA T;  2E5V A;  2HPJ A;  3JC6 C;  2YOE A;  3HKC E;  4X64 T;  4O4L E;  3L3P A;  5L3G B;  4O8S A;  3CML A;  2WU2 A;  4BAY B;  3KV4 A;  3RC3 A;  1BR1 A;  3O4X E;  4OK0 A;  4AQF A;  3MAC A;  5LJN A;  2BS2 A;  1FIO A;  3AAI A;  4H9O C;  2LSK A;  3H3M A;  4YHJ A;  3JAE A;  2BG9 A;  4ANJ A;  2IC9 A;  3ESL A;  3LK2 B;  3NZP A;  2XAH B;  5HYA A;  1HG2 A;  1MMD A;  2H7O A;  3MJX A;  3TKL B;  2K48 A;  3RIF A;  4HWC A;  3PUX F;  3C98 B;  1W0B A;  2WSS V;  4DV4 T;  2CCQ A;  3QNU A;  2SPC A;  4H9N C;  2DWG A;  3E22 E;  3NRX A;  1MMA A;  2XM2 A;  3AEA A;  4AKL A;  2BBJ A;  2W66 A;  5JR9 C;  3ZLI A;  4I4T E;  4WBO A;  5L3E B;  3RIU A;  4X20 E;  4A56 A;  5M4Y A;  2CM0 A;  4EXT A;  5AQJ B;  5AQH B;  3R84 B;  1BR2 A;  1ZOY A;  2V1D B;  2BKO A;  4IE4 A;  2E9X D;  1G8X A;  4TV8 E;  4JBW F;  2X0H A;  1ZV4 X;  4I43 B;  3GMI A;  3OYZ A;  3Q5D A;  2WP9 A;  3SWH A;  5BMV E;  2WBL A;  4QHO A;  3EVY A;  3PU3 A;  2MYS A;  4PK4 A;  3ZYL A;  4X1K E;  2VK9 A;  1M62 A;  4Z91 A;  2KLQ A;  5JDH A;  3DJB A;  3ABV A;  2XQ4 A;  4UVA B;  3LBX A;  2LLY A;  2J1D G;  3AEG A;  1KFY A;  2AXD S;  2L3L A;  2LKH A;  2IDO B;  3VHL A;  4U72 A;  3I9W A;  1HG5 A;  5FNV E;  3IEE A;  3B13 A;  4X1Y E;  5C3J A;  5L4H A;  5KMG P;  2XTL A;  2QA7 A;  4YFS A;  1T98 A;  2LHN A;  4PNI A;  4EED A;  3ZMS B;  2XQ5 A;  1MND A;  4QXC B;  4U7I A;  1WYC A;  2ZM0 A;  2KND A;  2LKG A;  1B7T A;  5H6R B;  5HEH A;  4TWD A;  3VRA A;  4H9S E;  3ZT5 A;  3O1I A;  4GKK T;  5HEJ A;  4KX6 A;  4HFV A;  4UV9 B;  3FBL A;  2LE8 A;  2KSR A;  5LB7 B;  2OV9 A;  4LMJ A;  4HTE A;  2E2A A;  1I6Z A;  4AI6 A;  2FJA A;  3U78 A;  2C5J A;  1MMN A;  4DO0 A;  2C5I T;  4PFP A;  3PUZ F;  4O4I E;  4HWF A;  3FB2 A;  2XZE A;  3AE4 A;  5HXS A;  1EZ3 A;  2V8S V;  3SRZ A;  1E1H B;  1IZN B;  3AE9 A;  3AEE A;  5HXE A;  4LMK A;  1HNX T;  5H6Q B;  5FL1 A;  5LA6 E;  4P09 A;  5L3F B;  4ILU A;  3OPC A;  4AQG A;  2LSJ A;  4UEM A;  3RRC A;  1X9B A;  4DND A;  4KUM B;  3CKD A;  1IJ6 A;  4JYA T;  3P4S A;  3W15 B;  1GQE A;  3QB5 K;  2P9B A;  1S35 A;  2E8I A;  5HAX A;  5AQS B;  3F2E A;  3KIN B;  5DQV A;  1YKE B;  2ZM8 A;  4CN6 A;  4PJJ A;  3OVU A;  4DBQ A;  2BS4 A;  4IST A;  2Q9Q D;  4BJN A;  3H3A A;  1AJ3 A;  3RHW A;  4B3R T;  4CI1 B;  4TZ4 C;  3ZC1 A;  2PFV A;  3DTO A;  4IIJ E;  4YSY A;  5CGM A;  4UVB B;  5FMN A;  3MKD A;  3AXJ A;  2H89 A;  2CXD A;  4TUY E;  3PV0 F;  4AKI A;  4LF6 T;  4JV5 T;  3CQG B;  4HWH A;  5IUX A;  2W67 A;  4JI5 T;  3ONL C;  4ILA A;  1J1J A;  1YQ4 A;  2XQ6 A;  5FYM A;  4LFC T;  2G0U A;  3IHR A;  3NVO A;  4MLK A;  1FMW A;  4E7Z A;  2L8K A;  2CWY A;  2M67 A;  1SUM B;  4MBQ A;  4EV6 A;  3JAD A;  4OHF A;  3C4Z A;  2EHO A;  2WZI A;  2W0G A;  4IDZ A;  2Y6X A;  3UUX B;  4TN7 B;  3UTK A;  2HPL A;  3K3N A;  2UXD T;  3UUM A;  4IE5 A;  2XSA A;  3QUJ A;  2XHE B;  3RLF F;  3EUH A;  5DJQ C;  1ZKE A;  3M3Z B;  4JEH B;  1XMO T;  3F57 A;  3I9Y A;  4P0A A;  3PUR A;  2HN1 A;  2H3R A;  4A5X A;  4DV5 T;  2KT9 A;  1CUN A;  4OFZ A;  5AQQ B;  1Y64 B;  2BVL A;  3GN5 B;  1W9R A;  1D1B A;  4GK5 E;  3P4Q A;  2IHR 1;  5FXW A;  1ZEE A;  3BQI A;  3ZJ2 A;  4QX8 B;  4BJM A;  4UVC B;  5DQW A;  3EAB A;  4C91 A;  3UU4 A;  5J2U E;  3AAE B;  4JLE A;  4XAX B;  2CRB A;  2XQY A;  1IBL T;  3KVA A;  4E7S A;  2XAQ B;  4DR5 T;  1D1C A;  4DR7 T;  2A2F X;  4TNW A;  5AQT B;  2YKS A;  4XZC A;  1VCT A;  3MZK B;  1W0A A;  4QH1 A;  4F6R C;  2FJD A;  2BG9 B;  2PTF A;  4YJ2 E;  1QUU A;  3EAM A;  1MNE A;  4HFD A;  4CXY A;  4IE7 A;  5AQM B;  3ONJ A;  4GYR A;  4BA9 A;  3AE5 A;  2M6B A;  4O2B E;  2E9X A;  2UXC T;  3H37 A;  2J62 A;  2JMK A;  1D0Y A;  5JRE A;  3UT5 E;  4ISS A;  2WMO A;  2X9X A;  3DP7 A;  5LGN B;  4ZHQ E;  2C5K T;  3KBT A;  5AQN B;  4B6X A;  3UUL A;  4HE8 A;  2V7J A;  5FY7 A;  3VU7 H;  4ZI2 D;  2VL8 A;  2YEV C;  2VWA A;  2XPK A;  4UF0 B;  2WS3 A;  1MIY A;  3RKG A;  3FZM B;  1VCS A;  3IBP A;  2LOP A;  3QC9 A;  3PUV F;  1HFA A;  2DNX A;  2KZ7 B;  4PJL A;  2W4X A;  2CBI A;  2PG8 A;  3PDY A;  5JH7 E;  2JQQ A;  1UUS A;  3KFW X;  3AE8 A;  2X0L B;  3CWZ B;  1HTJ F;  5J0Z A;  2IIU A;  1W09 A;  4H9Q C;  3N2K E;  3LDQ B;  1OED A;  5LXT E;  4QXH B;  4ZEY A;  1T7S A;  3JC6 D;  2W00 A;  3UUN A;  4K0K T;  3AED A;  3NRY A;  2Y48 B;  1MIW A;  3ANW A;  4YJ3 E;  5L3D B;  2NW8 A;  1M7K A;  3AEF A;  3AE2 A;  4NXM T;  3ZMU B;  1H7C A;  4DID B;  2VVN A;  1T72 A;  1UUR A;  5HEU A;  2X67 A;  4DR2 T;  4NIQ A;  5KDM C;  5L3C B;  3RYF E;  4G63 A;  4J2C A;  4C90 A;  4DV6 T;  5TAO A;  2LOS A;  1J5E T;  1VRB A;  2VUR A;  3P4W A;  1E2A A;  1LVF A;  4H63 V;  4QH5 A;  4IE6 A;  3FZH B;  2VKH A;  2FUP A;  1OWA A;  1S94 A;  3ZMV B;  3J9X 1;  2XY8 B;  4B3T T;  3T1H T;  2UU9 T;  2K5B B;  4OYK A;  2NR4 A;  2I0M A;  3UU8 A;  1WR6 A;  5LCY A;  1HX1 B;  5J2T E;  4AIS A;  2Q9Q A;  4HFI A;  3IF8 B;  1OXZ A;  1ZHC A;  3L39 A;  2CXF A;  2NWB A;  4PFO A;  2XAS B;  3G06 A;  3C64 A;  3RGL A;  4EZH A;  4WBN E;  2BVM A;  3AE7 A;  1N36 T;  3CX7 B;  2WAU A;  3E0Z A;  2XAJ B;  5C8Y E;  5FVK A;  4B3M T;  4KI0 F;  4EEB A;  3N2G E;  2NOX A;  2QVA A;  2DCF A;  3FZK B;  5EZY E;  3HKB E;  4IDP A;  1HS7 A;  2XAF B;  4EOZ B;  4JI0 T;  4CZZ B;  2QRX A;  3OJA A;  3LK4 2;  1L0V A;  4X65 T;  3SFE A;  3O1J A;  4KHZ F;  2ACX A;  2X9Y A;  2LSY A;  4PJM A;  3J7Y q;  4H9P C;  2KWH A;  4EB6 E;  2VL0 A;  3C51 A;  1I94 T;  4HWD A;  2WWU A;  4HGA A;  4IDQ A;  4QXB B;  3RIA A;  3UQ7 A;  2ZLY A;  2IC6 A;  3RKO A;  2IAK A;  2M6I A;  4PW8 A;  5HCM A;  1XNR T;  2BG9 C;  4JUY A;  3ETU A;  2WB5 A;  2MOZ A;  3Q2M A;  4UEL A;  3BK9 A;  3A8Y C;  4TV9 E;  3PUG A;  2V6X A;  4ZI3 C;  5JDF A;  3PUA A;  3EDV A;  2RP4 A;  3FHN A;  3UFE A;  5CB4 E;  4X1I E;  3ZCI A;  4YTP A;  3VKH A;  4QKN A;  4I50 E;  4EYU A;  4LF5 T;  3JCF A;  2JJ9 A;  2H7V C;  2JPF A;  3RIU C;  4QWN B;  1BR0 A;  2XQ3 A;  3ZN1 B;  4AKR B;  5A1L A;  3KDS E;  4JI3 T;  4COF A;  4KBM B;  2V7L A;  2WWV A;  4LF7 T;  2V6Y B;  5HXR A;  3WAJ A;  2UXN B;  4DR6 T;  3M65 A;  1MIV A;  4IE0 A;  1XDO A;  4ASK A;  1DU2 A;  4V1A v;  4IT4 A;  4O4J E;  1U4Q A;  5LBQ B;  5ABE A;  2NTY A;  3CPZ A;  5IHY A;  1X79 A;  3VRB A;  2VQE T;  3PUS A;  1G73 A;  3K3Q C;  3T1Y T;  1NEN A;  1D1A A;  4CQI A;  3AAA B;  3ZC0 A;  3K3O A;  2MBG A;  2CLY C;  3LK3 B;  2UUC T;  4CI2 B;  3AEC A;  2LEH A;  2KXP B;  3ZKR A;  2YIN A;  3N9Q A;  4ZXL A;  3JAF A;  2KWI B;  2WQY A;  4AKG A;  2CMR A;  3C50 A;  4ERR A;  4PK6 A;  3ZSS A;  4IL4 A;  5JRC B;  4CXX A;  2D5U A;  4L9I A;  2J47 A;  1US7 B;  4X62 T;  4DBR A;  3I0O A;  4WZX A;  5LGU B;  2HN2 A;  2K3W A;  4FJO A;  5AQP B;  4DV3 T;  3Q9D A;  1KK7 A;  5HWX A;  4GOU A;  2GK9 A;  3N9O A;  4LF9 T;  3P4P A;  4TNV A;  3OTO T;  2D2S A;  4OX9 T;  3ZEF B;  2X0Y A;  1JNR A;  2X66 A;  1XNQ T;  2XJ7 A;  4HEA A;  1XWM A;  2BKP A;  3CX6 B;  3HKE E;  5F3J A;  1WFD A;  5FXV A;  3X1D A;  5ABF A;  4GYS A;  2IUB A;  3KBU A;  2F4V T;  4CI3 B;  5ABH A;  3WAK A;  4U74 A;  3C4W A;  2QYW A;  5JDL A;  2JIW A;  4WNK A;  4LF8 T;  4JI2 T;  3ZYK A;  2WDR A;  3QB5 A;  2K9A A;  3UU3 A;  2IW5 B;  3FXD B;  5HXC A;  3EHZ A;  1IBM T;  2RPA A;  3HL6 A;  3BQK A;  3PU8 A;  4DUZ T;  3N9L A;  3OYX A;  2KMF A;  4DR1 T;  1YW0 A;  2VKD A;  4PAG A;  2JMH A;  3RYC E;  3VKG A;  2HHH T;  1JNZ A;  5ETW A;  2V5C A;  3TLS A;  4UIG A;  4H9R C;  5KXJ A;  2N1G A;  3AA0 B;  5JTG A;  3I0Q A;  3S4U A;  2XQA A;  2X9H A;  3PUQ A;  4ILB A;  4N78 D;  3FZL B;  3L8R A;  1FMV A;  3K1S A;  4HFC A;  4X66 T;  5JR9 A;  3TLU A;  4YSX A;  4DV0 T;  2LT3 A;  1LVK A;  4GKJ T;  2OLT A;  2LRK A;  2L9Q A;  3O1H A;  3I1A A;  4EIW A;  3P8C D;  2YN6 A;  4UR9 A;  3OBV E;  5EK3 A;  3IA3 A;  3RYH E;  5AQL B;  5AQF B;  4XBF B;  2LM9 A;  5AQR B;  4PJN A;  5FY1 A;  2WY2 A;  2Y8D A;  5JDG A;  4UXN B;  3KV6 A;  2D9D A;  4NUV A;  5BR8 T;  4P0B A;  2V26 A;  1UCU A;  1U5P A;  5LHH B;  4AKH A;  4HFE A;  4YTM A;  4OYJ A;  3WI3 A;  4MAL A;  4YTN A;  3A5X A;  2V7I A;  1OED E;  3AB3 B;  3L09 A;  1IAP A;  3TLT A;  1YQ3 A;  3ZPO A;  2EHO C;  4HFH A;  5EK2 A;  2YU1 A;  3B57 A;  2UXX B;  5ADX L;  2I6H A;  4DMW A;  2CBJ A;  5JVD E;  3N2O A;  2CLY B;  3LBX B;  2WDV A;  4TX5 A;  4LML A;  1E7P A;  3N5L A;  2X9W A;  2N9D A;  2XAG B;  5EK4 A;  3VR9 A;  5LHI B;  3MXZ A;  4DV7 T;  5LHG B;  2UXB T;  1WRD A;  2OA5 A;  3FZF B;  3O9X A;  3PTR B;  3ZN0 B;  2DWK A;  3NWI A;  4L5G A;  3NBX X;  4K0U A;  2LM2 A;  1YKH B;  1NWM X;  3HKD E;  4ZZC A;  3CQX C;  5AFU L;  4L0R A;  4HFB A;  1CHU A;  4IL9 A;  4JI6 T;  5C2T A;  3AE3 A;  3B5M A;  3RQW A;  5HEO A;  2ACZ A;  2AE9 A;  4Z90 A;  3PUY F;  3UU5 A;  4AXP A;  2CA5 A;  1LKX A;  3KV9 A;  4ZS2 A;  5LP6 E;  2WCA A;  5F5W A;  5AQG B;  1IJ5 A;  5E0O A;  4MHC A;  2MPK A;  2E5L T;  2V5D A;  4WYV A;  4LFB T;  4TWH A;  4ILC A;  3CK6 A;  4YXD A;  5CJ5 A;  4DR4 T;  1QSD A;  4DVD A;  5AQI B;  3QK6 A;  4PK5 A;  5L3B B;  5FVL A;  5AQV B;  3ZJ1 A;  3ZST A;  2CHN A;  4IDO A;  4O4H E;  2E9X C;  5LG4 A;  4H63 H;  4CXW A;  2XUE A;  2JQK A;  5L2L A;  1FJG T;  3ZMZ B;  5LYJ E;  3F31 A;  3BQL A;  5HWY A;  1KEY A;  4TWF A;  5AQK B;  4UF0 A;  1NAF A;  2CPT A;  3PE0 A;  3AE6 A;  2NW7 A;  4M1P A;  4QH4 A;  3K8P C;  3AA6 B;  2V7K A;  2VQF T;  1FEW A;  2YK0 A;  2N2N A;  3Q5W A;  4ZS3 A;  5GON E;  2LRL A;  1UK5 A;  3ONX A;  3T8O A;  3LJC A;  3RH3 A;  1QLB A;  4AQY T;  1O3X A;  1HNZ T;  2DI4 A;  4IDN A;  1D0Z A;  3VR8 A;  4DUY T;  2LSG A;  3CQC B;  3TLW A;  1T8B A;  4YHH T;  2DHR A;  4JI1 T;  2YDR A;  3GWH A;  5FP3 A;  4I0U A;  2CE7 A;  2ZM2 A;  2BS3 A;  3KV5 A;  3EDU A;  3HA4 A;  3ZCJ A;  3AA7 B;  3AXJ B;  2WZH A;  5HEG A;  4WW0 A;  2RA1 A;  2W62 A;  1NEK A;  1OED C;  2IML A;  1VOM A;  4AQF C;  4IRE A;  5JDM A;  2PBI A;  1WCR A;  5JDN A;  3LSV A;  4ZI7 E;  3TLV A;  2BKN A;  2A9U A;  1HR0 T;  3R6N A;  1BR4 A;  4AIU A;  3FBZ A;  1Z0P A;  4P1N A;  3RI5 A;  1UGO A;  3NKZ A;  4U31 A;  3CVR A;  4IGU A;  2EHO B;  4NUU A;  1XDP A;  5LBM A;  2PJQ A;  3RPU A;  5L47 A;  3P4R A;  2HH7 A;  4LF4 T;  4CN4 A;  2BDE A;  4A98 A;  1WYB A;  3LG7 A;  3RX6 A;  4GK0 E;  3FXE B;  4KP3 C;  1N32 T;  2H88 A;  5CFB A;  3N9N A;  2LHR A;  2YDQ A;  4X5T A;  2JQ9 A;  2DLR A;  3U3I A;  5IWA T;  1UX4 A;  5JQG E;  3CX8 B;  5FKY A;  1N33 T;  4ZI3 D;  5ABF B;  3AA1 B;  2MAW A;  3MA9 A;  3RQU A;  3GA8 A;  2LJL A;  4NXN T;  2XQ7 A;  2X51 A;  5LJM A;  2W63 A;  3PJA A;  2VKJ A;  2B76 A;  1V9D A;  5LG3 A;  1HF8 A;  4FI5 A;  4U7Y A;  3RF1 A;  3V5U A;  3C4X A;  1IBK T;  1KNP A;  2Q9Q C;  3D0T A;  2NTX A;  3UFG A;  4HKA A;  1SA0 E;  2X68 A;  5JDQ A;  4G2A A;  1KF6 A;  2DL1 A;  3ETV A;  1Z8U A;  1J5W A;  2XQ8 A;  1LRZ A;  4JI4 T;  4ZZB A;  2A72 A;  2YU2 A;  3OKQ A;  4U2Z A;  2D0U A;  2XSB A;  4U33 A;  4EGW A;  4KMC A;  4O2A E;  3EI0 A;  2XQ9 A;  5JR9 B;  5FY0 A;  2E9X B;  1KNZ A;  1WLX A;  5LGT B;  1HX8 A;  4NPP A;  2VVS A;  4JEU B;  1ZP0 A;  3A7M A;  5CA1 E;  1HNW T;  1SHZ C;  2J4G A;  2JQH A;  1YXR A;  3AVS A;  3AVR A;  3NZQ A;  1HCI A;  3CIR A;  2WMN A;  3PUW F;  4U3C A;  3E08 A;  2BZB A;  1XZY A;  5HXH A;  5LNK A;  4Q25 A;  3P7I A;  4ADZ A;  4YY3 T;  3Q5X A; 
#chains in the Genus database with same CATH homology
 5AQT B;  5AQU B;  5AQO B;  4HWI B;  1UK5 A;  5AQP B;  2D9D A;  1I6Z A;  5AQI B;  1HX1 B;  5AQN B;  5AQQ B;  4HWD A;  3FZH B;  5AQJ B;  5AQG B;  5AQH B;  4HWH A;  3M3Z B;  1UGO A;  3LDQ B;  5AQV B;  3A8Y C;  3FZL B;  1M62 A;  5AQK B;  5AQL B;  5AQF B;  1M7K A;  5AQR B;  5AQM B;  4HWC A;  3FZF B;  4HWF A;  3FZK B;  5AQS B;  3FZM B;  1T7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...