5AQGB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 44
structure length 113
sequence length 113
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqgB00
5AQJB 5AQIB 3FZMB 1UK5A 5AQTB 1I6ZA 5AQVB 5AQSB 5AQFB 5AQPB 5AQKB 5AQNB 5AQLB 5AQQB 5AQUB 1HX1B 1T7SA 2D9DA 1UGOA 5AQOB 3FZKB 4HWHA 3LDQB 1M62A 4HWDA 3M3ZB 5AQRB 3FZHB 3A8YC 3FZLB 1M7KA 4HWFA 3FZFB 5AQMB 5AQGB 4HWCA 4HWIB 5AQHB
chains in the Genus database with same CATH superfamily
5LBMA 2LRLA 4JI8T 1U4QA 4EXTA 2YDRA 4HFHA 4UVAB 1IZNB 2VKDA 3PURA 1L0VA 4LFBT 1E2AA 4EZ4A 4JI1T 1O3XA 2VKOA 1UCUA 4IDQA 2BS3A 3NBXX 4JBWF 2RP4A 2E9XB 2MTQA 5AQKB 4AQFC 4C90A 3OYZA 2H88A 3ZMTB 2Z6EA 4HKAA 4YTNA 4DR2T 2UUBT 3PU8A 2WZHA 4J2CA 3LSVA 4BA9A 3ANWB 2SPCA 5JDLA 3UFGA 4FI5A 2HPJA 2LOPA 1VOMA 3GA8A 1MNEA 5AQOB 3P4PA 3RPUA 4H9RC 5HEOA 1IBMT 5FY7A 5ABGA 2VKHA 5TAOA 2X9YA 3NKZA 5L2LA 3A8YC 3P8CD 4KHZF 4LMJA 3C51A 5BR8T 2XTLA 5AQMB 2D0UA 4LF8T 3FHNA 2PG8A 2YEVC 5LNKA 4B3RT 1E1HB 2W62A 3P4WA 4LF4T 3ABVA 3RRCA 1XNQT 5HWYA 4ILCA 1VRBA 1N36T 2FJDA 2CHNA 3UUMA 3EDUA 3P4RA 1X79A 5ADXL 4O4IE 2N1GA 2PTFA 5AQSB 4EGWA 2CWYA 4IE6A 5CA1E 2UU9T 4LF5T 1MIWA 1OXZA 2R6GF 1UUSA 5AQQB 4YLHA 1QUUA 5JR9C 4JI3T 2M6BA 3KVBA 1WLXA 4JEUB 5JH7E 3TLVA 2W4XA 2FJEA 4G2AA 2HHHT 3GN5B 2NW9A 3K3OA 3AE2A 3N5LA 3MJXA 2CA5A 4QXCB 4WNKA 3UQ4A 1LKXA 1D1BA 2VL8A 4ZXLA 4M1PA 4UVCB 3AE8A 3UU3A 4QH5A 4N78D 2LT3A 3UU8A 2VQFT 2BG9B 1OEDB 1Z0PA 1HX1B 4U33A 1H7CA 4DV2T 3WAKA 4YHHT 4X1YE 4B3MT 3CX6B 3KV4A 2KMFA 3QB5K 3DTOA 1MMNA 5AQTB 3N2GE 5JDMA 2WDVA 4IT4A 4OK0A 1KNPA 2VL0A 4QWNB 2RA1A 3SFDA 2VASA 2QGSA 3AB3B 4TZ4C 4ZI3C 3T1HT 2G0UA 2JMHA 3AE5A 2N9DA 4ILAA 4EEBA 4H63H 2BBJA 2V26A 2KWHA 1IBKT 1EZ3A 1B7TA 1HF8A 5IHYA 5FY1A 4AISA 2WBLA 3PUWF 2LSKA 4HGAA 4UF0B 4QKNA 2OV9A 3EUHA 5ABFB 2CXFA 1GQEA 2X0HA 1VCSA 3B13A 2EHOD 3IEEA 3TLUA 2BKPA 2DWGA 3BK9A 4JLEA 3ZCIA 3ZSTA 4IE5A 3ZEFB 3H3AA 4NIQA 4JEHB 5A1LA 1FMWA 2W67A 4NUUA 4UVBB 1ZV4X 2JQKA 2WWUA 5LHHB 3BQKA 2Q9QB 5HAXA 1D1AA 4X20E 3KDSE 3K3QC 3PUSA 1HG5A 4ISSA 3UU4A 3RYHE 3ZC0A 4XAXB 5AQFB 3N9OA 3QK6A 4O8SA 5LHIB 1YD8G 2EHOB 1WFDA 2YKSA 2IIUA 2E9XC 3E08A 3N9PA 1S35A 3L09A 3PUGA 4U7YA 3CX7B 3RF1A 3CK6A 2K3WA 3AE1A 3N9NA 5AQUB 2IAKA 5LYJE 4UEMA 1SHZC 3MXZA 3Q5DA 2K5BB 4ZZCA 2KZ7B 1XDPA 5IYZE 1UGOA 3OPCA 4QHOA 5DQVA 3RHWA 4DMVA 4YSXA 4CN1A 2XQ3A 3UU5A 4LFAT 2BDEA 2Y48B 5AQRB 2V1DB 3LK42 3RGLA 4X64T 4L0RA 1KNZA 4H9PC 3HR0A 3UUXB 2X67A 3RH3A 2V5DA 5JDQA 2KT9A 2ES0A 4PJLA 4HWIB 2V6YB 3PJAA 4DVDA 1KF6A 5AQJB 1YQ4A 4EZHA 4O4JE 1YW0A 3K8PC 5L3GB 4QX8B 5LA6E 5AQVB 2LSGA 4NPPA 2XZEA 5AFUL 3IA3A 4DUYT 2CBJA 4DV1T 3ONLC 1NENA 1J5ET 1J5WA 3I9YA 4KP3C 5AQPB 2BKOA 2CRBA 2V7KA 2X9HA 4KI0F 4BJNA 3NZQA 3O4XE 5J0ZA 1SA0E 1FJGT 4FJOA 3PJAJ 4YTMA 4CN6A 4GKJT 2M67A 3RI5A 4QXHB 4HEAA 3ZMVB 3ZMSB 4ISTA 2W63A 2C5JA 3LDQB 4DV6T 3P4SA 5LG4A 3LFMA 3AEDA 3CWZB 4UIGA 2IUBA 4H9QC 5KXJA 1HNWT 2VVSA 4COFA 3SWHA 2BG9C 1FIOA 2XAHB 3I0OA 1N33T 3OVUA 3JADA 3MA9A 4IE0A 4DR4T 4AKRB 1XDOA 3AEGA 3AA1B 4EYUA 2V6XA 5KMGP 4X5TA 1JNRA 5L3CB 4DBRA 3T1YT 2X9XA 3P4QA 2XSAA 3SOLA 4PJJA 2BKNA 5LMNT 5FVKA 2CMRA 3AEBA 2BS4A 2VVNA 1NAFA 2A2FX 5J1GA 2C5IT 3CX8B 3U78A 2XM2A 2X9WA 3LBXB 1T8BA 3WAJA 4XZCA 5JQGE 2DHRA 3AAAB 1XWMA 1U5PA 3E0ZA 3VU7H 3ZLIA 1I94T 4DR6T 2WMNA 4Q25A 5FXVA 4YSZA 2UXBT 2YOEA 4HWDA 5CFBA 5LG3A 2D5UA 5LMUT 3QB5A 1MIVA 3ZC1A 4DR1T 2BS2A 3JCFA 3VRBA 5JRCA 2ACXA 4AQGA 2L8KA 4HN9A 3AXJB 1MMGA 3AVSA 4HTEA 4IE7A 3RIUA 4ZI3D 4OX9T 3ZMUB 4E7SA 1I6ZA 5HXEA 3ANWA 3I1AA 2XPKA 2ODVA 3UTKA 4YSYA 3FB2A 2VK9A 2XQ4A 4ZS3A 1KK7A 3KBTA 3L8RA 4B6XA 5CA0E 5L3EB 4NXNT 3VR9A 2W61A 5FMNA 5L3FB 4AKIA 5AQLB 4JUYA 3VR8A 2LE8A 3IF8B 1NEKA 2JMKA 3AEAA 2LLYA 4IHJE 5ETWA 1MMAA 3ZN1B 2KWIB 2UUCT 2DWKA 4IE4A 4B3TT 5H6RB 4X66T 2XHEB 4MHCA 4UF0A 4L9IA 3OJAA 2WM9A 5HYAA 5HWXA 2DI4A 2DLRA 3UFEA 2LM2A 1XNRT 2NR4A 2GK9A 1AJ3A 5L3DB 2VURA 3FZHB 3M65A 2MYSA 4WBOA 2E5VA 1BR1A 1YKEB 3LBXA 3DP7A 2HN1A 4HWFA 3HA4A 2X51A 2YN6A 2H7VC 2VQET 1QLBA 4PJMA 4A98A 2PJQA 5L47A 5LCYA 3HI2A 2E5LT 2VKJA 2LSJA 2W00A 3ZYMA 3GMIA 3PUQA 4NUVA 3ZJ2A 5IUXA 5L4HA 4C91A 3WI3A 4JYAT 3PTRB 3Q5XA 3J9X1 5JDNA 3CIRA 1WCRA 2XQAA 2V5CA 2CLYC 2CE7A 3IBPA 1HNXT 3L3PA 3AE3A 4YJ2E 3F2EA 3GN5A 4U31A 3AE9A 5JDFA 3PU3A 4DV5T 4HWHA 4H63V 4PK4A 5HCMA 2IC9A 2LKGA 3OKQA 5HXCA 3RX6A 2FBWA 3LJCA 4HFCA 4AQYT 1OEDC 4OHFA 3FZFB 3I0QA 4CZZB 2JJ9A 5AQGB 4HWCA 3RC8A 4O4LE 4QX7B 2C0SA 5KX5E 1XZYA 5LGTB 2XAFB 2ZM2A 1UK5A 1BR4A 3UUNA 2UUAT 4DBQA 2X0YA 4I50E 2NW8A 2MBGA 3AAEB 4P1NA 1ZHCA 4JI6T 2ODUA 4HFDA 3EAMA 5JR9B 4A56A 4ILBA 3FXDB 4UELA 4ADZA 5FXZA 3ZSSA 3ZT7A 5LB7B 4IGUA 2JQ9A 2BBHA 4PJNA 1MNDA 2BZBA 2Q9QA 3FXEB 3C4XA 2LJLA 3R6NA 2WDRA 1HFAA 5HEJA 3J7Yq 2J1DG 4P0BA 2JPFA 2J62A 4ZEYA 1V9DA 3OYXA 2E9XA 4CN4A 2EHOA 5F8PA 4X65T 4DV7T 5FL0A 2DL1A 4KUMB 3AA7B 1ZEEA 4YXDA 4DUZT 2WQYA 2X68A 2A3DA 2V7LA 2AE9A 2XM1A 4EIWA 5IWAT 4P0AA 3PUZF 4CI2B 2OA5A 1W0AA 4F8HA 2WY2A 1ZOYA 3AE4A 3C50A 3ZKRA 3UQ7A 3Q9DA 3C4ZA 3JC6D 4H9NC 2K48A 4HFEA 5L3BB 5LXTE 2L9QA 1OWAA 2UXXB 4YTPA 1G73A 4TWHA 1IBLT 2E2AA 3RRWA 2B76A 3NRXA 1YKHB 1N34T 2Y6XA 5F3JA 4DR3T 2XUEA 2IDOB 2BVLA 3SS1A 2IC6A 1BR2A 5FKYA 3AXJA 2XQ6A 1FEWA 3CMLA 4YT0A 2QRXA 2K9AA 2CCQA 3AEFA 3CPZA 2XQYA 3EDVA 4K0UA 4PFOA 3EABA 4CI3B 3MACA 2ZM8A 1HNZT 5EK4A 2MOZA 2WU5A 1Y64B 3RLFF 4LF6T 4TNWA 2E9XD 3D0TA 3KV6A 5ABEA 4MBQA 4YJ3E 3R84B 4DMWA 2WB5A 3ETUA 3RYIE 1M7KA 2JQHA 3B5MA 2LSYA 4TWFA 3ESLA 5FY0A 5HXRA 3V5UA 3ZPOA 4YHJA 5J2TE 4LFCT 2WMOA 5AQIB 1D0YA 2JQQA 4HFVA 3AAIA 4TV8E 2WAUA 1KNRA 2NW7A 1OEDE 4TWDA 4UXNB 4O2AE 3RIFA 3HKDE 2YDSA 2F4VT 4OYKA 4O4HE 4DO0A 2NP9A 2X0LB 3QOFA 2JRKA 4ILUA 4AKHA 2BG9A 4ZI2D 4UR9A 2H3RA 3G06A 3FBLA 3IHRA 2OLTA 3JAFA 1HCIA 2J4GA 3PUAA 3Q5WA 4NXMT 4H9OC 2UXDT 4PNIA 1DU2A 4X1IE 4EB6E 3AA6B 5DABA 3W15B 1US7B 3A7MA 5CB4E 4WYVA 4A97A 3VKGA 4DV4T 3O9XA 3RYFE 5L4EA 3M3ZB 2P9BA 2CEAA 2LRKA 3CQXC 3NVOA 1FMVA 2XSBA 4LMLA 5BMVE 2KXPB 4U2YA 5C8YE 3U3IA 5JRCB 3ZT5A 3ZCJA 2MPKA 2YU2A 4JI7T 4B3ST 5HEGA 2X66A 4I4TE 1WYCA 2HN2A 2V8SV 2CLYB 1KEYA 1KFYA 2CHOA 4MALA 4OFZA 3ZYLA 4F6RC 4HE8A 4XBFB 1IJ5A 4LMKA 3UU6A 3ZT6A 2CM0A 4CXXA 5JTGA 1YQ3A 5JREA 4U3CA 3KINB 4AI6A 4KX6A 3K3NA 4KMCA 4AIUA 5C2TA 4LF7T 2XAJB 4IDZA 4WZXA 1SUMB 3TLWA 3V5SA 4GK0E 3ZMZB 4A5XA 2YK0A 2YINA 5F5WA 4KHPT 4Z91A 3CQGB 2Q9QC 4IREA 5JDGA 4DV0T 4L5GA 1WYBA 3LG7A 3SRZA 3UULA 4G63A 3AECA 1M62A 4QXBB 2B1EA 2D0TA 3P7IA 1CUNA 2A9UA 2V7IA 2UXNB 5LHGB 4LF9T 3AE7A 1X9BA 4GK5E 5E0OA 4I0UA 2K24A 3DJBA 5HEHA 3ZJ1A 1N32T 4X62T 1LVFA 2VB6A 2ZMAA 3PE0A 4H9SE 4I55E 2H7OA 4YFSA 2IW5B 4AXPA 3MKDA 2XQ9A 5FL1A 3RIAA 3K1SA 2M6IA 5LGNB 1MMDA 2XAQB 5GONE 1MIYA 4CI1B 4IL9A 5FYMA 5HCJA 5LGUB 5LP6E 2KNDA 3NWIA 3H3MA 4E7ZA 3L39A 1CHUA 3QC9A 3N9MA 4U7IA 3NRYA 2C5KT 3PDYA 4MLKA 4WBNE 5J2UE 2WU2A 3C4WA 3KVAA 3ONXA 3PUVF 4IDNA 4V1Av 5DQWA 2WWVA 3H37A 3AEEA 3S4UA 4QH4A 3KBUA 2KINB 1WR0A 3EHZA 3FZKB 3P50A 3RIUC 3TLSA 1LVKA 5CJ5A 1SE7A 3FBZA 3PUYF 2V7MA 2Q9QD 4UV8B 2NTXA 2BVMA 5FNVE 2KLQA 5FP3A 5LJMA 4DR5T 2LHNA 4HFIA 4U74A 5HXSA 1Y01A 5M4YA 4PK6A 2ACZA 3ZYKA 3TLTA 5CGMA 4HFBA 2CXDA 2PFVA 2LKHA 5JDHA 4TN7B 1ZKEA 3PUXF 5EK3A 2CXLA 2IHR1 1IJ6A 4TNVA 4TX5A 5LBQB 3N2OA 3PV0F 3UT5E 1T98A 1HX8A 3RYCE 4CQIA 1UX4A 4EV6A 4AQFA 1HG2A 3OTOT 2PBIA 2AXDS 2VWAA 2XJ7A 4UV9B 2MAWA 1D0XA 4EEDA 3RKGA 3JAEA 3RC3A 5EZYE 4ASKA 3N9QA 2WDQA 4Z8XA 5FXWA 1W0BA 2CBIA 3HKEE 3KV9A 4Z90A 5HEUA 4PAGA 4JI4T 1HS7A 4ZZBA 4O2BE 3F31A 2QA7A 2QYWA 4ZHQE 3RQUA 4DNDA 2E8IA 2I6HA 3VKHA 1G8XA 2XQ5A 3QUJA 1LRZA 2CWOA 3MZKB 4GIWA 3X1DA 2NTYA 3FZLB 4DIDB 4U72A 4GOUA 1UX5A 2I59A 3AA0B 4P09A 4X1KE 4JI0T 4JI2T 3O1IA 4PFPA 1Z8UA 3CKDA 4ZS2A 4ZI2C 4K0KT 4AKGA 3ZN0B 2LSIA 2YU1A 4ZOLE 2LEHA 2LOSA 3C98B 3O1JA 1BR0A 1QSDA 2XQ8A 3T8OA 3VHLA 1HR0T 3MK7C 3Q2MA 4CXYA 4DR7T 2WSSV 1XMQT 4I43B 3BQLA 2HPLA 2EHOC 3AVRA 3VRAA 5JR9A 3AE6A 3N2KE 2WP9A 4GYRA 4PK5A 4GYSA 4WW0A 5C3JA 3ONJA 4IL4A 2ZM6T 2I0MA 2W2UA 2V6YA 2WS3A 3BQIA 2FJAA 1T7SA 1W09A 4TV9E 3UUBA 3RQWA 2RPAA 5KDMC 5JVDE 4QH1A 2BG9E 4EOZB 2LM9A 2D2SA 1D1CA 2WCAA 1T72A 1R8IA 3RKOA 3GWHA 3TKLB 3A5XA 4JV5T 2HH7A 2JIWA 2W0GA 3ETVA 5EK2A 4EYYR 4ANJA 1IAPA 1J1JA 1NWMX 3HKCE 3Q5EA 2WZIA 3LK2B 2W66A 3NZPA 5AQHB 3SFEA 3FZMB 4AKLA 3HKBE 4IIJE 1D0ZA 2H89A 2Y8DA 2XQ7A 4PW8A 1XMOT 1W9RA 1WR6A 3EVYA 2DNXA 3JC6C 2ZLYA 2FJBA 2L3LA 2NWBA 4IDPA 4U2ZA 2KSRA 4JI5T 2XY8B 3EI0A 5ABFA 2QVAA 4YY3T 3HL6A 3CVRA 3F57A 4DV3T 2FUPA 1VCTA 2N2NA 2XASB 3CQCB 2CPTA 3KFWX 3LK3B 3I9WA 3OBVE 4TUYE 5DJQC 5AQNB 2A72A 5H6QB 5LJNA 2XAGB 2YDQA 1WRDA 5ABHA 2UXCT 2D9DA 2NOXA 4OYJA 4CXWA 5LOVE 5HXHA 1S94A 2LHRA 3KV5A 1HTJF 4BJMA 1UURA 1JNZA 2J47A 1YXRA 1ZP0A 2DCFA 3QNUA 2IMLA 3B57A 4EAHA 4ZI7E 2ZM0A 4IDOA 2V7JA 4KBMB 3E22E 5FVLA 1E7PA 5FXXA 4BAYB 3O1HA 4MFRA 3N9LA 1OEDA 4ERRA 3C64A 4GKKT
chains in the Genus database with same CATH topology
5AQJB 5AQIB 3FZMB 1UK5A 5AQTB 1I6ZA 5AQVB 5AQSB 5AQFB 5AQPB 5AQKB 5AQNB 5AQLB 5AQQB 5AQUB 1HX1B 1T7SA 2D9DA 1UGOA 5AQOB 3FZKB 4HWHA 3LDQB 1M62A 4HWDA 3M3ZB 5AQRB 3FZHB 3A8YC 3FZLB 1M7KA 4HWFA 3FZFB 5AQMB 5AQGB 4HWCA 4HWIB 5AQHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ B;  5AQI B;  3FZM B;  1UK5 A;  5AQT B;  1I6Z A;  5AQV B;  5AQS B;  5AQF B;  5AQP B;  5AQK B;  5AQN B;  5AQL B;  5AQQ B;  5AQU B;  1HX1 B;  1T7S A;  2D9D A;  1UGO A;  5AQO B;  3FZK B;  4HWH A;  3LDQ B;  1M62 A;  4HWD A;  3M3Z B;  5AQR B;  3FZH B;  3A8Y C;  3FZL B;  1M7K A;  4HWF A;  3FZF B;  5AQM B;  5AQG B;  4HWC A;  4HWI B;  5AQH B; 
#chains in the Genus database with same CATH topology
 5LBM A;  2LRL A;  4JI8 T;  1U4Q A;  4EXT A;  2YDR A;  4HFH A;  4UVA B;  1IZN B;  2VKD A;  3PUR A;  1L0V A;  4LFB T;  1E2A A;  4EZ4 A;  4JI1 T;  1O3X A;  2VKO A;  1UCU A;  4IDQ A;  2BS3 A;  3NBX X;  4JBW F;  2RP4 A;  2E9X B;  2MTQ A;  5AQK B;  4AQF C;  4C90 A;  3OYZ A;  2H88 A;  3ZMT B;  2Z6E A;  4HKA A;  4YTN A;  4DR2 T;  2UUB T;  3PU8 A;  2WZH A;  4J2C A;  3LSV A;  4BA9 A;  3ANW B;  2SPC A;  5JDL A;  3UFG A;  4FI5 A;  2HPJ A;  2LOP A;  1VOM A;  3GA8 A;  1MNE A;  5AQO B;  3P4P A;  3RPU A;  4H9R C;  5HEO A;  1IBM T;  5FY7 A;  5ABG A;  2VKH A;  5TAO A;  2X9Y A;  3NKZ A;  5L2L A;  3A8Y C;  3P8C D;  4KHZ F;  4LMJ A;  3C51 A;  5BR8 T;  2XTL A;  5AQM B;  2D0U A;  4LF8 T;  3FHN A;  2PG8 A;  2YEV C;  5LNK A;  4B3R T;  1E1H B;  2W62 A;  3P4W A;  4LF4 T;  3ABV A;  3RRC A;  1XNQ T;  5HWY A;  4ILC A;  1VRB A;  1N36 T;  2FJD A;  2CHN A;  3UUM A;  3EDU A;  3P4R A;  1X79 A;  5ADX L;  4O4I E;  2N1G A;  2PTF A;  5AQS B;  4EGW A;  2CWY A;  4IE6 A;  5CA1 E;  2UU9 T;  4LF5 T;  1MIW A;  1OXZ A;  2R6G F;  1UUS A;  5AQQ B;  4YLH A;  1QUU A;  5JR9 C;  4JI3 T;  2M6B A;  3KVB A;  1WLX A;  4JEU B;  5JH7 E;  3TLV A;  2W4X A;  2FJE A;  4G2A A;  2HHH T;  3GN5 B;  2NW9 A;  3K3O A;  3AE2 A;  3N5L A;  3MJX A;  2CA5 A;  4QXC B;  4WNK A;  3UQ4 A;  1LKX A;  1D1B A;  2VL8 A;  4ZXL A;  4M1P A;  4UVC B;  3AE8 A;  3UU3 A;  4QH5 A;  4N78 D;  2LT3 A;  3UU8 A;  2VQF T;  2BG9 B;  1OED B;  1Z0P A;  1HX1 B;  4U33 A;  1H7C A;  4DV2 T;  3WAK A;  4YHH T;  4X1Y E;  4B3M T;  3CX6 B;  3KV4 A;  2KMF A;  3QB5 K;  3DTO A;  1MMN A;  5AQT B;  3N2G E;  5JDM A;  2WDV A;  4IT4 A;  4OK0 A;  1KNP A;  2VL0 A;  4QWN B;  2RA1 A;  3SFD A;  2VAS A;  2QGS A;  3AB3 B;  4TZ4 C;  4ZI3 C;  3T1H T;  2G0U A;  2JMH A;  3AE5 A;  2N9D A;  4ILA A;  4EEB A;  4H63 H;  2BBJ A;  2V26 A;  2KWH A;  1IBK T;  1EZ3 A;  1B7T A;  1HF8 A;  5IHY A;  5FY1 A;  4AIS A;  2WBL A;  3PUW F;  2LSK A;  4HGA A;  4UF0 B;  4QKN A;  2OV9 A;  3EUH A;  5ABF B;  2CXF A;  1GQE A;  2X0H A;  1VCS A;  3B13 A;  2EHO D;  3IEE A;  3TLU A;  2BKP A;  2DWG A;  3BK9 A;  4JLE A;  3ZCI A;  3ZST A;  4IE5 A;  3ZEF B;  3H3A A;  4NIQ A;  4JEH B;  5A1L A;  1FMW A;  2W67 A;  4NUU A;  4UVB B;  1ZV4 X;  2JQK A;  2WWU A;  5LHH B;  3BQK A;  2Q9Q B;  5HAX A;  1D1A A;  4X20 E;  3KDS E;  3K3Q C;  3PUS A;  1HG5 A;  4ISS A;  3UU4 A;  3RYH E;  3ZC0 A;  4XAX B;  5AQF B;  3N9O A;  3QK6 A;  4O8S A;  5LHI B;  1YD8 G;  2EHO B;  1WFD A;  2YKS A;  2IIU A;  2E9X C;  3E08 A;  3N9P A;  1S35 A;  3L09 A;  3PUG A;  4U7Y A;  3CX7 B;  3RF1 A;  3CK6 A;  2K3W A;  3AE1 A;  3N9N A;  5AQU B;  2IAK A;  5LYJ E;  4UEM A;  1SHZ C;  3MXZ A;  3Q5D A;  2K5B B;  4ZZC A;  2KZ7 B;  1XDP A;  5IYZ E;  1UGO A;  3OPC A;  4QHO A;  5DQV A;  3RHW A;  4DMV A;  4YSX A;  4CN1 A;  2XQ3 A;  3UU5 A;  4LFA T;  2BDE A;  2Y48 B;  5AQR B;  2V1D B;  3LK4 2;  3RGL A;  4X64 T;  4L0R A;  1KNZ A;  4H9P C;  3HR0 A;  3UUX B;  2X67 A;  3RH3 A;  2V5D A;  5JDQ A;  2KT9 A;  2ES0 A;  4PJL A;  4HWI B;  2V6Y B;  3PJA A;  4DVD A;  1KF6 A;  5AQJ B;  1YQ4 A;  4EZH A;  4O4J E;  1YW0 A;  3K8P C;  5L3G B;  4QX8 B;  5LA6 E;  5AQV B;  2LSG A;  4NPP A;  2XZE A;  5AFU L;  3IA3 A;  4DUY T;  2CBJ A;  4DV1 T;  3ONL C;  1NEN A;  1J5E T;  1J5W A;  3I9Y A;  4KP3 C;  5AQP B;  2BKO A;  2CRB A;  2V7K A;  2X9H A;  4KI0 F;  4BJN A;  3NZQ A;  3O4X E;  5J0Z A;  1SA0 E;  1FJG T;  4FJO A;  3PJA J;  4YTM A;  4CN6 A;  4GKJ T;  2M67 A;  3RI5 A;  4QXH B;  4HEA A;  3ZMV B;  3ZMS B;  4IST A;  2W63 A;  2C5J A;  3LDQ B;  4DV6 T;  3P4S A;  5LG4 A;  3LFM A;  3AED A;  3CWZ B;  4UIG A;  2IUB A;  4H9Q C;  5KXJ A;  1HNW T;  2VVS A;  4COF A;  3SWH A;  2BG9 C;  1FIO A;  2XAH B;  3I0O A;  1N33 T;  3OVU A;  3JAD A;  3MA9 A;  4IE0 A;  4DR4 T;  4AKR B;  1XDO A;  3AEG A;  3AA1 B;  4EYU A;  2V6X A;  5KMG P;  4X5T A;  1JNR A;  5L3C B;  4DBR A;  3T1Y T;  2X9X A;  3P4Q A;  2XSA A;  3SOL A;  4PJJ A;  2BKN A;  5LMN T;  5FVK A;  2CMR A;  3AEB A;  2BS4 A;  2VVN A;  1NAF A;  2A2F X;  5J1G A;  2C5I T;  3CX8 B;  3U78 A;  2XM2 A;  2X9W A;  3LBX B;  1T8B A;  3WAJ A;  4XZC A;  5JQG E;  2DHR A;  3AAA B;  1XWM A;  1U5P A;  3E0Z A;  3VU7 H;  3ZLI A;  1I94 T;  4DR6 T;  2WMN A;  4Q25 A;  5FXV A;  4YSZ A;  2UXB T;  2YOE A;  4HWD A;  5CFB A;  5LG3 A;  2D5U A;  5LMU T;  3QB5 A;  1MIV A;  3ZC1 A;  4DR1 T;  2BS2 A;  3JCF A;  3VRB A;  5JRC A;  2ACX A;  4AQG A;  2L8K A;  4HN9 A;  3AXJ B;  1MMG A;  3AVS A;  4HTE A;  4IE7 A;  3RIU A;  4ZI3 D;  4OX9 T;  3ZMU B;  4E7S A;  1I6Z A;  5HXE A;  3ANW A;  3I1A A;  2XPK A;  2ODV A;  3UTK A;  4YSY A;  3FB2 A;  2VK9 A;  2XQ4 A;  4ZS3 A;  1KK7 A;  3KBT A;  3L8R A;  4B6X A;  5CA0 E;  5L3E B;  4NXN T;  3VR9 A;  2W61 A;  5FMN A;  5L3F B;  4AKI A;  5AQL B;  4JUY A;  3VR8 A;  2LE8 A;  3IF8 B;  1NEK A;  2JMK A;  3AEA A;  2LLY A;  4IHJ E;  5ETW A;  1MMA A;  3ZN1 B;  2KWI B;  2UUC T;  2DWK A;  4IE4 A;  4B3T T;  5H6R B;  4X66 T;  2XHE B;  4MHC A;  4UF0 A;  4L9I A;  3OJA A;  2WM9 A;  5HYA A;  5HWX A;  2DI4 A;  2DLR A;  3UFE A;  2LM2 A;  1XNR T;  2NR4 A;  2GK9 A;  1AJ3 A;  5L3D B;  2VUR A;  3FZH B;  3M65 A;  2MYS A;  4WBO A;  2E5V A;  1BR1 A;  1YKE B;  3LBX A;  3DP7 A;  2HN1 A;  4HWF A;  3HA4 A;  2X51 A;  2YN6 A;  2H7V C;  2VQE T;  1QLB A;  4PJM A;  4A98 A;  2PJQ A;  5L47 A;  5LCY A;  3HI2 A;  2E5L T;  2VKJ A;  2LSJ A;  2W00 A;  3ZYM A;  3GMI A;  3PUQ A;  4NUV A;  3ZJ2 A;  5IUX A;  5L4H A;  4C91 A;  3WI3 A;  4JYA T;  3PTR B;  3Q5X A;  3J9X 1;  5JDN A;  3CIR A;  1WCR A;  2XQA A;  2V5C A;  2CLY C;  2CE7 A;  3IBP A;  1HNX T;  3L3P A;  3AE3 A;  4YJ2 E;  3F2E A;  3GN5 A;  4U31 A;  3AE9 A;  5JDF A;  3PU3 A;  4DV5 T;  4HWH A;  4H63 V;  4PK4 A;  5HCM A;  2IC9 A;  2LKG A;  3OKQ A;  5HXC A;  3RX6 A;  2FBW A;  3LJC A;  4HFC A;  4AQY T;  1OED C;  4OHF A;  3FZF B;  3I0Q A;  4CZZ B;  2JJ9 A;  5AQG B;  4HWC A;  3RC8 A;  4O4L E;  4QX7 B;  2C0S A;  5KX5 E;  1XZY A;  5LGT B;  2XAF B;  2ZM2 A;  1UK5 A;  1BR4 A;  3UUN A;  2UUA T;  4DBQ A;  2X0Y A;  4I50 E;  2NW8 A;  2MBG A;  3AAE B;  4P1N A;  1ZHC A;  4JI6 T;  2ODU A;  4HFD A;  3EAM A;  5JR9 B;  4A56 A;  4ILB A;  3FXD B;  4UEL A;  4ADZ A;  5FXZ A;  3ZSS A;  3ZT7 A;  5LB7 B;  4IGU A;  2JQ9 A;  2BBH A;  4PJN A;  1MND A;  2BZB A;  2Q9Q A;  3FXE B;  3C4X A;  2LJL A;  3R6N A;  2WDR A;  1HFA A;  5HEJ A;  3J7Y q;  2J1D G;  4P0B A;  2JPF A;  2J62 A;  4ZEY A;  1V9D A;  3OYX A;  2E9X A;  4CN4 A;  2EHO A;  5F8P A;  4X65 T;  4DV7 T;  5FL0 A;  2DL1 A;  4KUM B;  3AA7 B;  1ZEE A;  4YXD A;  4DUZ T;  2WQY A;  2X68 A;  2A3D A;  2V7L A;  2AE9 A;  2XM1 A;  4EIW A;  5IWA T;  4P0A A;  3PUZ F;  4CI2 B;  2OA5 A;  1W0A A;  4F8H A;  2WY2 A;  1ZOY A;  3AE4 A;  3C50 A;  3ZKR A;  3UQ7 A;  3Q9D A;  3C4Z A;  3JC6 D;  4H9N C;  2K48 A;  4HFE A;  5L3B B;  5LXT E;  2L9Q A;  1OWA A;  2UXX B;  4YTP A;  1G73 A;  4TWH A;  1IBL T;  2E2A A;  3RRW A;  2B76 A;  3NRX A;  1YKH B;  1N34 T;  2Y6X A;  5F3J A;  4DR3 T;  2XUE A;  2IDO B;  2BVL A;  3SS1 A;  2IC6 A;  1BR2 A;  5FKY A;  3AXJ A;  2XQ6 A;  1FEW A;  3CML A;  4YT0 A;  2QRX A;  2K9A A;  2CCQ A;  3AEF A;  3CPZ A;  2XQY A;  3EDV A;  4K0U A;  4PFO A;  3EAB A;  4CI3 B;  3MAC A;  2ZM8 A;  1HNZ T;  5EK4 A;  2MOZ A;  2WU5 A;  1Y64 B;  3RLF F;  4LF6 T;  4TNW A;  2E9X D;  3D0T A;  3KV6 A;  5ABE A;  4MBQ A;  4YJ3 E;  3R84 B;  4DMW A;  2WB5 A;  3ETU A;  3RYI E;  1M7K A;  2JQH A;  3B5M A;  2LSY A;  4TWF A;  3ESL A;  5FY0 A;  5HXR A;  3V5U A;  3ZPO A;  4YHJ A;  5J2T E;  4LFC T;  2WMO A;  5AQI B;  1D0Y A;  2JQQ A;  4HFV A;  3AAI A;  4TV8 E;  2WAU A;  1KNR A;  2NW7 A;  1OED E;  4TWD A;  4UXN B;  4O2A E;  3RIF A;  3HKD E;  2YDS A;  2F4V T;  4OYK A;  4O4H E;  4DO0 A;  2NP9 A;  2X0L B;  3QOF A;  2JRK A;  4ILU A;  4AKH A;  2BG9 A;  4ZI2 D;  4UR9 A;  2H3R A;  3G06 A;  3FBL A;  3IHR A;  2OLT A;  3JAF A;  1HCI A;  2J4G A;  3PUA A;  3Q5W A;  4NXM T;  4H9O C;  2UXD T;  4PNI A;  1DU2 A;  4X1I E;  4EB6 E;  3AA6 B;  5DAB A;  3W15 B;  1US7 B;  3A7M A;  5CB4 E;  4WYV A;  4A97 A;  3VKG A;  4DV4 T;  3O9X A;  3RYF E;  5L4E A;  3M3Z B;  2P9B A;  2CEA A;  2LRK A;  3CQX C;  3NVO A;  1FMV A;  2XSB A;  4LML A;  5BMV E;  2KXP B;  4U2Y A;  5C8Y E;  3U3I A;  5JRC B;  3ZT5 A;  3ZCJ A;  2MPK A;  2YU2 A;  4JI7 T;  4B3S T;  5HEG A;  2X66 A;  4I4T E;  1WYC A;  2HN2 A;  2V8S V;  2CLY B;  1KEY A;  1KFY A;  2CHO A;  4MAL A;  4OFZ A;  3ZYL A;  4F6R C;  4HE8 A;  4XBF B;  1IJ5 A;  4LMK A;  3UU6 A;  3ZT6 A;  2CM0 A;  4CXX A;  5JTG A;  1YQ3 A;  5JRE A;  4U3C A;  3KIN B;  4AI6 A;  4KX6 A;  3K3N A;  4KMC A;  4AIU A;  5C2T A;  4LF7 T;  2XAJ B;  4IDZ A;  4WZX A;  1SUM B;  3TLW A;  3V5S A;  4GK0 E;  3ZMZ B;  4A5X A;  2YK0 A;  2YIN A;  5F5W A;  4KHP T;  4Z91 A;  3CQG B;  2Q9Q C;  4IRE A;  5JDG A;  4DV0 T;  4L5G A;  1WYB A;  3LG7 A;  3SRZ A;  3UUL A;  4G63 A;  3AEC A;  1M62 A;  4QXB B;  2B1E A;  2D0T A;  3P7I A;  1CUN A;  2A9U A;  2V7I A;  2UXN B;  5LHG B;  4LF9 T;  3AE7 A;  1X9B A;  4GK5 E;  5E0O A;  4I0U A;  2K24 A;  3DJB A;  5HEH A;  3ZJ1 A;  1N32 T;  4X62 T;  1LVF A;  2VB6 A;  2ZMA A;  3PE0 A;  4H9S E;  4I55 E;  2H7O A;  4YFS A;  2IW5 B;  4AXP A;  3MKD A;  2XQ9 A;  5FL1 A;  3RIA A;  3K1S A;  2M6I A;  5LGN B;  1MMD A;  2XAQ B;  5GON E;  1MIY A;  4CI1 B;  4IL9 A;  5FYM A;  5HCJ A;  5LGU B;  5LP6 E;  2KND A;  3NWI A;  3H3M A;  4E7Z A;  3L39 A;  1CHU A;  3QC9 A;  3N9M A;  4U7I A;  3NRY A;  2C5K T;  3PDY A;  4MLK A;  4WBN E;  5J2U E;  2WU2 A;  3C4W A;  3KVA A;  3ONX A;  3PUV F;  4IDN A;  4V1A v;  5DQW A;  2WWV A;  3H37 A;  3AEE A;  3S4U A;  4QH4 A;  3KBU A;  2KIN B;  1WR0 A;  3EHZ A;  3FZK B;  3P50 A;  3RIU C;  3TLS A;  1LVK A;  5CJ5 A;  1SE7 A;  3FBZ A;  3PUY F;  2V7M A;  2Q9Q D;  4UV8 B;  2NTX A;  2BVM A;  5FNV E;  2KLQ A;  5FP3 A;  5LJM A;  4DR5 T;  2LHN A;  4HFI A;  4U74 A;  5HXS A;  1Y01 A;  5M4Y A;  4PK6 A;  2ACZ A;  3ZYK A;  3TLT A;  5CGM A;  4HFB A;  2CXD A;  2PFV A;  2LKH A;  5JDH A;  4TN7 B;  1ZKE A;  3PUX F;  5EK3 A;  2CXL A;  2IHR 1;  1IJ6 A;  4TNV A;  4TX5 A;  5LBQ B;  3N2O A;  3PV0 F;  3UT5 E;  1T98 A;  1HX8 A;  3RYC E;  4CQI A;  1UX4 A;  4EV6 A;  4AQF A;  1HG2 A;  3OTO T;  2PBI A;  2AXD S;  2VWA A;  2XJ7 A;  4UV9 B;  2MAW A;  1D0X A;  4EED A;  3RKG A;  3JAE A;  3RC3 A;  5EZY E;  4ASK A;  3N9Q A;  2WDQ A;  4Z8X A;  5FXW A;  1W0B A;  2CBI A;  3HKE E;  3KV9 A;  4Z90 A;  5HEU A;  4PAG A;  4JI4 T;  1HS7 A;  4ZZB A;  4O2B E;  3F31 A;  2QA7 A;  2QYW A;  4ZHQ E;  3RQU A;  4DND A;  2E8I A;  2I6H A;  3VKH A;  1G8X A;  2XQ5 A;  3QUJ A;  1LRZ A;  2CWO A;  3MZK B;  4GIW A;  3X1D A;  2NTY A;  3FZL B;  4DID B;  4U72 A;  4GOU A;  1UX5 A;  2I59 A;  3AA0 B;  4P09 A;  4X1K E;  4JI0 T;  4JI2 T;  3O1I A;  4PFP A;  1Z8U A;  3CKD A;  4ZS2 A;  4ZI2 C;  4K0K T;  4AKG A;  3ZN0 B;  2LSI A;  2YU1 A;  4ZOL E;  2LEH A;  2LOS A;  3C98 B;  3O1J A;  1BR0 A;  1QSD A;  2XQ8 A;  3T8O A;  3VHL A;  1HR0 T;  3MK7 C;  3Q2M A;  4CXY A;  4DR7 T;  2WSS V;  1XMQ T;  4I43 B;  3BQL A;  2HPL A;  2EHO C;  3AVR A;  3VRA A;  5JR9 A;  3AE6 A;  3N2K E;  2WP9 A;  4GYR A;  4PK5 A;  4GYS A;  4WW0 A;  5C3J A;  3ONJ A;  4IL4 A;  2ZM6 T;  2I0M A;  2W2U A;  2V6Y A;  2WS3 A;  3BQI A;  2FJA A;  1T7S A;  1W09 A;  4TV9 E;  3UUB A;  3RQW A;  2RPA A;  5KDM C;  5JVD E;  4QH1 A;  2BG9 E;  4EOZ B;  2LM9 A;  2D2S A;  1D1C A;  2WCA A;  1T72 A;  1R8I A;  3RKO A;  3GWH A;  3TKL B;  3A5X A;  4JV5 T;  2HH7 A;  2JIW A;  2W0G A;  3ETV A;  5EK2 A;  4EYY R;  4ANJ A;  1IAP A;  1J1J A;  1NWM X;  3HKC E;  3Q5E A;  2WZI A;  3LK2 B;  2W66 A;  3NZP A;  5AQH B;  3SFE A;  3FZM B;  4AKL A;  3HKB E;  4IIJ E;  1D0Z A;  2H89 A;  2Y8D A;  2XQ7 A;  4PW8 A;  1XMO T;  1W9R A;  1WR6 A;  3EVY A;  2DNX A;  3JC6 C;  2ZLY A;  2FJB A;  2L3L A;  2NWB A;  4IDP A;  4U2Z A;  2KSR A;  4JI5 T;  2XY8 B;  3EI0 A;  5ABF A;  2QVA A;  4YY3 T;  3HL6 A;  3CVR A;  3F57 A;  4DV3 T;  2FUP A;  1VCT A;  2N2N A;  2XAS B;  3CQC B;  2CPT A;  3KFW X;  3LK3 B;  3I9W A;  3OBV E;  4TUY E;  5DJQ C;  5AQN B;  2A72 A;  5H6Q B;  5LJN A;  2XAG B;  2YDQ A;  1WRD A;  5ABH A;  2UXC T;  2D9D A;  2NOX A;  4OYJ A;  4CXW A;  5LOV E;  5HXH A;  1S94 A;  2LHR A;  3KV5 A;  1HTJ F;  4BJM A;  1UUR A;  1JNZ A;  2J47 A;  1YXR A;  1ZP0 A;  2DCF A;  3QNU A;  2IML A;  3B57 A;  4EAH A;  4ZI7 E;  2ZM0 A;  4IDO A;  2V7J A;  4KBM B;  3E22 E;  5FVL A;  1E7P A;  5FXX A;  4BAY B;  3O1H A;  4MFR A;  3N9L A;  1OED A;  4ERR A;  3C64 A;  4GKK T; 
#chains in the Genus database with same CATH homology
 5AQJ B;  5AQI B;  3FZM B;  1UK5 A;  5AQT B;  1I6Z A;  5AQV B;  5AQS B;  5AQF B;  5AQP B;  5AQK B;  5AQN B;  5AQL B;  5AQQ B;  5AQU B;  1HX1 B;  1T7S A;  2D9D A;  1UGO A;  5AQO B;  3FZK B;  4HWH A;  3LDQ B;  1M62 A;  4HWD A;  3M3Z B;  5AQR B;  3FZH B;  3A8Y C;  3FZL B;  1M7K A;  4HWF A;  3FZF B;  5AQM B;  5AQG B;  4HWC A;  4HWI B;  5AQH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...