5AQGB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqgB00
3FZLB 3FZMB 5AQFB 4HWDA 4HWIB 5AQRB 5AQQB 4HWFA 5AQKB 3FZFB 5AQMB 1M62A 1M7KA 4HWHA 5AQPB 1HX1B 3FZKB 5AQTB 3LDQB 5AQGB 1UK5A 5AQHB 5AQVB 5AQJB 5AQOB 5AQNB 5AQUB 5AQIB 5AQLB 1T7SA 4HWCA 2D9DA 3A8YC 1UGOA 3FZHB 5AQSB 3M3ZB 1I6ZA
chains in the Genus database with same CATH superfamily
3QOFA 2X67A 2X9XA 1XZYA 1KK7A 3DJBA 2DI4A 4EIWA 5FVLA 3NRYA 1Z0PA 1XWMA 4A98A 1N34T 5AQLB 2BG9E 4CI2B 2XAHB 5EK2A 2NW8A 1I6ZA 2XQ4A 4WZXA 3NVOA 4FJOA 3CPZA 4V1Av 2QRXA 5L3DB 3C50A 2JQ9A 4GOUA 4ZI7E 2CHNA 5JR9A 3BQIA 5LXTE 4UVAB 2YU1A 2VASA 4KHPT 2KNDA 3CX8B 1D1BA 2XAGB 3O4XE 2UUBT 1YKHB 4L5GA 2FJEA 1HX8A 3ZYMA 5CJ5A 2D0UA 3LDQB 5LHHB 2PFVA 2NTYA 3QK6A 3FB2A 3OTOT 4HGAA 3UUNA 4WBNE 3O9XA 4JYAT 5AQFB 2V6YB 3HKBE 5DJQC 5JDMA 2UUCT 2AE9A 4IIJE 2B76A 5JREA 4HTEA 3M65A 1HCIA 4L9IA 1KF6A 4B6XA 5AQVB 2DHRA 5JQGE 1MNDA 4LF4T 1IBKT 2RA1A 3LBXA 1U5PA 2BKOA 3PUQA 5HEHA 3TKLB 2AXDS 2IW5B 3AXJB 4P0AA 2JMHA 4EOZB 3F2EA 1KFYA 4DR4T 3DP7A 3P7IA 3AE3A 2H7OA 2WQYA 3FZLB 1H7CA 4LMKA 4KHZF 4PW8A 4ILCA 2WDRA 2E9XD 1AJ3A 5HEJA 3ZKRA 4ILBA 5C8YE 3AB3B 2PBIA 2Y48B 4TNWA 2IUBA 3KDSE 4YXDA 2K48A 3UU6A 5AQQB 2C5KT 2BG9C 4YLHA 4H9NC 3SRZA 4NPPA 5L3EB 1MMAA 3UT5E 1Z8UA 3K1SA 1X79A 2XQ7A 4DV5T 4QX8B 4JI5T 4O8SA 1D0ZA 5HCMA 2Q9QB 4QXCB 2P9BA 5LG4A 2N2NA 3QNUA 3KV6A 3PV0F 3N9MA 4LMLA 3B5MA 3SFEA 2BBHA 4IE0A 1XMQT 4IREA 2IC9A 2D5UA 2W66A 4YT0A 4O2AE 4NXMT 5JTGA 4HFVA 3ANWA 5JDLA 5AQUB 2Q9QA 1UURA 2VQFT 4DNDA 4BJNA 4EXTA 4NUVA 3AE1A 4QH4A 2Y6XA 4UR9A 2XY8B 3CX7B 1IBLT 2UUAT 3Q5DA 3R84B 2E8IA 3CQCB 5IWAT 2CRBA 2V5CA 5L4EA 4WNKA 2JPFA 3PUYF 3RYFE 3NZQA 4H9QC 5AQKB 3NBXX 3ZMUB 2A3DA 4PK5A 2NOXA 3OYZA 2LSJA 5IYZE 1HFAA 4YHJA 5LCYA 4LF6T 2A9UA 3EVYA 2X9WA 2DL1A 2L9QA 1IAPA 3TLTA 4XZCA 4OK0A 4IDOA 4B3ST 4KI0F 5C2TA 1ZV4X 3FZMB 2MYSA 1E1HB 1UCUA 4CXWA 3AA6B 3AE6A 2ZM6T 1V9DA 4O4JE 4QWNB 4ILUA 4ERRA 2B1EA 2M6IA 1XDPA 3C51A 2LOPA 3H37A 1UK5A 1MMNA 3AAEB 3TLSA 1NENA 1MIWA 2J4GA 2JRKA 3HI2A 4JEUB 1SA0E 4I43B 3FBLA 2J1DG 4U2ZA 2H88A 3UU5A 3A5XA 1OEDA 2OV9A 3ZT6A 4X62T 3FXDB 3O1IA 1EZ3A 4MALA 2F4VT 4DV2T 2XAJB 4X1IE 3SOLA 2W61A 4YTNA 2I6HA 5F5WA 2CXDA 3JC6C 5KDMC 2EHOD 2KSRA 2WU5A 2VVNA 4JEHB 2IMLA 5FXWA 3UTKA 2W4XA 3RRWA 4EEDA 3AA7B 1WLXA 2LKHA 4DV4T 4AKGA 3ZSSA 2LLYA 2SPCA 1VCTA 4IL4A 2ODVA 3I0QA 2D9DA 4JI3T 5EK3A 1B7TA 4UV8B 4P0BA 5ADXL 4EB6E 2XPKA 1FEWA 1FMWA 2YOEA 2CXFA 4X65T 2BS3A 3HL6A 3L8RA 4IHJE 3UQ4A 4JI2T 2OA5A 5L3CB 3N2GE 4ANJA 4ZI3D 2YEVC 2C0SA 4IE5A 2WDVA 2VKDA 2LRLA 2E9XA 1SUMB 1HNWT 2W63A 3RHWA 3PUSA 2L8KA 3MK7C 4UEMA 2LT3A 3N9QA 3AEAA 1JNRA 2XTLA 2FJBA 3OJAA 4JI4T 2E2AA 5LOVE 3GN5B 4H9RC 4OYKA 3N9PA 4YTMA 1CUNA 1T8BA 3X1DA 2UXDT 2XQ9A 4LF5T 2NW9A 2LEHA 3L39A 5CA1E 3VHLA 1T72A 3ZJ1A 4UELA 5TAOA 3AEEA 2CLYB 3HA4A 3ZLIA 3AAIA 1HF8A 1S94A 3EAMA 4OHFA 4ZZCA 4ZI2C 4YJ3E 4NIQA 4UVBB 2VL8A 1J5ET 2QA7A 2WBLA 2RP4A 2MPKA 4XBFB 4TN7B 1UUSA 5M4YA 2BS4A 2XUEA 1OEDE 2E5LT 3EHZA 5LJNA 2WDQA 5JR9B 2XAFB 1SHZC 4PJMA 3ZMZB 2HH7A 3ETVA 3G06A 5CFBA 2V7LA 5FL1A 4EYUA 3KVAA 3CIRA 1FIOA 3P4SA 1LVKA 2XQYA 4HWIB 4MHCA 1E2AA 4AQFA 4DR6T 4KP3C 4MBQA 5FNVE 5F3JA 1WR6A 3ZT7A 3Q5XA 2LSYA 2HN1A 4OFZA 3AEFA 2CEAA 1J1JA 3GA8A 4AISA 1XNQT 2YDSA 2LJLA 2K9AA 3QC9A 3RLFF 2LSIA 3LBXB 4HWHA 1YXRA 3FZKB 3RYCE 3UU3A 5LBQB 3GWHA 2BVLA 2K3WA 4E7SA 2IAKA 3V5SA 3IEEA 4HFBA 4U2YA 4B3MT 1NWMX 3EUHA 5E0OA 1MIVA 4Z91A 3C64A 3D0TA 1M7KA 4UIGA 2V7JA 2Z6EA 5ABGA 1YKEB 1ZEEA 4AKRB 1W9RA 5EK4A 2E5VA 2HHHT 3E08A 2XZEA 4GKJT 2JMKA 3VRAA 1CHUA 2KINB 2PJQA 3PDYA 4IDZA 3RF1A 1HR0T 2LM9A 4QH5A 3U78A 4AIUA 3ZEFB 3H3AA 4TV8E 4PAGA 3BK9A 3HKEE 2UXCT 4O4IE 1LVFA 1QUUA 3P8CD 5H6RB 1JNZA 2WAUA 3OBVE 3RC8A 4ZXLA 5AQPB 4JI7T 3K3NA 3CMLA 4IDNA 5L47A 2IIUA 2VK9A 2XSBA 3Q2MA 2EHOA 1QLBA 2N1GA 4PK4A 3HKDE 1G73A 1UGOA 4PFOA 3SFDA 3J7Yq 2C5JA 1HG5A 2H89A 2JIWA 3LK2B 4KUMB 4IDPA 3RI5A 5AQHB 4LF8T 2CHOA 4GK0E 2M6BA 1KEYA 4P1NA 4LF9T 3ANWB 3W15B 1R8IA 3PUXF 3RH3A 4HN9A 4HWFA 3ZYKA 5ABEA 3RIUC 4U3CA 4LFAT 2LSGA 4AQYT 1LRZA 3I1AA 2KZ7B 4H9PC 2V5DA 4DV7T 2KWIB 3ZJ2A 5ABFA 2XASB 3UUXB 5H6QB 5JH7E 3AVRA 4ISSA 4X1YE 5HXHA 3MA9A 3T8OA 5CGMA 2X9YA 2V7MA 2WWVA 2D2SA 1KNPA 2JQQA 5DQVA 2CWOA 2QGSA 3KV9A 2XQ6A 4IT4A 3I0OA 4PFPA 3K3QC 1BR0A 1G8XA 3VRBA 1IZNB 5L3FB 3AA0B 5FY7A 2WMNA 1UX4A 1IJ5A 3WAJA 2VQET 3ZN1B 2DLRA 4DBRA 5FMNA 5A1LA 3EI0A 3RRCA 3AECA 4DO0A 4U33A 4KBMB 2VURA 3VKGA 2WM9A 5JDNA 4UV9B 1YW0A 2WY2A 5HYAA 3FHNA 1MIYA 4E7ZA 1MNEA 3JC6D 3PUVF 4HFIA 4X5TA 2KLQA 3AE5A 2IDOB 1FJGT 1O3XA 1HX1B 3NKZA 5LA6E 3NWIA 3U3IA 2J47A 4IDQA 4CQIA 4HE8A 4F6RC 2YDRA 3AAAB 1OEDB 4Z8XA 2LHNA 2XQ8A 3ZN0B 4JV5T 2LHRA 4JI0T 4EAHA 5FXVA 1BR4A 2MBGA 3AE8A 5LB7B 4ZS2A 4ZS3A 1T98A 3WI3A 3H3MA 2ACZA 4MFRA 4CN1A 4COFA 3CX6B 2JQKA 4PJJA 3RYHE 2XQ5A 2W67A 5LGTB 2IC6A 3GMIA 5LMUT 4U74A 4CI3B 2V7IA 2FJAA 4DR7T 4N78D 1IJ6A 1QSDA 3L09A 2PTFA 4U7IA 2ES0A 3JAEA 5LP6E 2NP9A 3O1HA 4J2CA 2A72A 2CLYC 3N2KE 1HNZT 3PJAA 3AEBA 3MJXA 2DWKA 2BBJA 4TUYE 2XM2A 5IUXA 5AQSB 5HWYA 4GK5E 1US7B 3SWHA 3Q5WA 5JR9C 5AQOB 2WMOA 4YHHT 2QVAA 2VVSA 2IHR1 1U4QA 4KMCA 2BG9A 2V8SV 1WRDA 2ZM2A 4EYYR 2H3RA 4NXNT 4BA9A 3PU3A 1T7SA 3VR9A 1XMOT 5AFUL 1BR1A 3C98B 2G0UA 5JDFA 2E9XB 4TV9E 2WU2A 4YY3T 3AEDA 4ZZBA 1MMGA 4ZI2D 5LMNT 3E0ZA 4DV1T 3ZSTA 4X20E 5LJMA 3ESLA 3RIFA 4U72A 4U31A 4HWDA 3N9NA 3JADA 3ZC0A 2XM1A 4IE4A 5LGNB 3KINB 2ACXA 2LKGA 4TX5A 4DMVA 3ZC1A 2ZMAA 2OLTA 4HWCA 4JI8T 3CWZB 4A97A 4ZEYA 4NUUA 4BAYB 2XQ3A 3F31A 4EZHA 3IF8B 3WAKA 3KV5A 3E22E 3I9WA 3AEGA 3P4WA 2X0YA 4TWFA 4CN6A 4O4HE 5F8PA 5AQJB 3QUJA 1VCSA 5HEOA 4EV6A 2BDEA 2GK9A 2YK0A 3P4RA 2J62A 2JJ9A 3J9X1 4LMJA 4AKIA 1W0BA 2D0TA 2UXBT 3CQXC 3PTRB 4L0RA 3FZHB 4ISTA 3PJAJ 4DV6T 3KFWX 1Y01A 2DCFA 1X9BA 3BQLA 4EGWA 4HKAA 2N9DA 2C5IT 1WCRA 2WP9A 2LOSA 1D0YA 4TWHA 5LBMA 5LYJE 2DWGA 2NTXA 2MAWA 4CXXA 5J2UE 4K0KT 3R6NA 2KWHA 2BVMA 5DQWA 2CCQA 3C4XA 4GIWA 3S4UA 5FVKA 2Q9QC 4QXHB 2X66A 2W62A 4YSXA 3SS1A 3V5UA 3QB5A 1WFDA 1N32T 3ZMSB 1I94T 2NR4A 4UF0A 3ZPOA 1M62A 4JBWF 2I59A 3N9LA 2FUPA 4DUYT 4JUYA 3RKGA 4TNVA 4HFDA 5JDQA 4DV3T 2CBJA 3L3PA 4G2AA 4A5XA 3K8PC 2WCAA 2LM2A 2L3LA 2YU2A 4IL9A 5AQMB 5FYMA 5BR8T 1YQ4A 3C4WA 1XDOA 3EABA 2VKHA 3N9OA 4IGUA 3ZYLA 4QH1A 2ZM8A 2WB5A 1Y64B 3AE2A 1N36T 4WW0A 3RGLA 4P09A 2XHEB 3AA1B 1HG2A 3EDUA 2BS2A 2MTQA 2XJ7A 1MMDA 1NEKA 1NAFA 5HXSA 4ASKA 2W00A 2V6XA 3KBTA 3KVBA 1E7PA 2EHOB 4X1KE 5HWXA 2WSSV 2JQHA 4QKNA 5HXCA 3AE7A 3Q9DA 4ILAA 3TLVA 1VRBA 5FKYA 3B57A 3LFMA 1YD8G 2K5BB 2LSKA 3OVUA 4A56A 1YQ3A 3M3ZB 4I50E 4IE6A 4BJMA 1J5WA 4DBQA 3NRXA 3PUWF 3IHRA 1ZOYA 2V7KA 1OEDC 5LNKA 1KNRA 1ZKEA 3HKCE 4PNIA 5BMVE 3BQKA 3LJCA 4YSYA 2UU9T 2V6YA 3ONXA 5DABA 2MOZA 4DV0T 3OYXA 5FY0A 3VU7H 3AE9A 5ABFB 1WR0A 3RYIE 2X9HA 2XSAA 3RC3A 5JDHA 3JAFA 5HXEA 3AVSA 4KX6A 4CXYA 5L4HA 2R6GF 3OPCA 5L3GB 4JI6T 5LG3A 3MXZA 4OX9T 3AXJA 5JVDE 2X0HA 4DUZT 1D1AA 4AKHA 1UX5A 2HN2A 3FXEB 1D0XA 4UXNB 2CWYA 3PU8A 4H63V 2WS3A 2RPAA 4LFBT 2DNXA 1OXZA 3LK3B 2CPTA 3LSVA 4GKKT 3VR8A 5L2LA 2XQAA 3P4PA 2CMRA 3TLUA 2VL0A 3PE0A 4TWDA 2ZLYA 2V26A 4FI5A 2H7VC 5ETWA 2KMFA 3N2OA 4DR2T 5HXRA 4PJNA 2X68A 3PURA 3T1YT 1HTJF 2CA5A 3LK42 2E9XC 3RX6A 3P50A 2W0GA 4TZ4C 2BKPA 3EDVA 4PJLA 4LFCT 4OYJA 4QXBB 4I55E 2X51A 1SE7A 3PUAA 5ABHA 3JCFA 2YN6A 5LHIB 3MZKB 3QB5K 4UVCB 2PG8A 3RQUA 4GYRA 3ETUA 4HFCA 5KMGP 4DR5T 2LRKA 1LKXA 2A2FX 5CB4E 4HEAA 4O4LE 3FBZA 3UFEA 3UFGA 3UQ7A 1IBMT 4YSZA 1D1CA 4AI6A 2W2UA 3O1JA 4YFSA 4ADZA 1XNRT 3IA3A 4IE7A 1DU2A 5CA0E 4CN4A 2VWAA 3UULA 1HS7A 5AQGB 2QYWA 4C91A 2KXPB 4LF7T 2WZIA 4B3RT 2M67A 5LHGB 4M1PA 2KT9A 4H9OC 4JLEA 4I0UA 3UUMA 5J2TE 2BG9B 1HNXT 4DR3T 4EEBA 5GONE 3NZPA 4F8HA 2CBIA 4AQFC 5KX5E 3ONJA 5KXJA 2X0LB 3T1HT 2VKJA 5AQIB 4HFEA 2ZM0A 3RPUA 3TLWA 4O2BE 2BZBA 3PUGA 4C90A 2WZHA 3F57A 3A7MA 1L0VA 3OKQA 1ZP0A 3ZMTB 3LG7A 1GQEA 3A8YC 5JDGA 1N33T 3ZCJA 4B3TT 3PUZF 4G63A 3N5LA 2HPJA 4H9SE 3K3OA 4CI1B 3RIUA 5J0ZA 2BKNA 3HR0A 4DIDB 3DTOA 4Q25A 4QX7B 4U7YA 2K24A 4AQGA 4X64T 3MKDA 4AXPA 2YDQA 4HFHA 3I9YA 4I4TE 1KNZA 2LE8A 3ONLC 2ODUA 4DVDA 4YJ2E 4YTPA 2I0MA 5FP3A 5FXZA 4WBOA 3ZCIA 5LGUB 3CKDA 2WWUA 4XAXB 3KBUA 5HCJA 4ZOLE 2NWBA 1S35A 2UXNB 3UU8A 2YINA 5AQRB 5HAXA 4ZHQE 4WYVA 4JI1T 2Q9QD 2HPLA 3KV4A 4GYSA 2XAQB 5AQTB 1FMVA 3VKHA 4Z90A 2VKOA 2EHOC 4AKLA 1WYCA 3ABVA 3C4ZA 2Y8DA 4DMWA 3CQGB 2CXLA 1BR2A 4H63H 2VB6A 3B13A 4CZZB 3AE4A 5JRCB 3FZFB 5C3JA 5L3BB 3Q5EA 2UXXB 4MLKA 2NW7A 3UU4A 4PK6A 1ZHCA 4X66T 4DR1T 5J1GA 5EZYE 5FL0A 2YKSA 5HEUA 3CVRA 3MACA 2FBWA 1OWAA 2FJDA 5FXXA 3ZT5A 5HEGA 4EZ4A 3RKOA 4UF0B 5FY1A 3UUBA 5AQNB 5IHYA 2CM0A 3ZMVB 1VOMA 4QHOA 5JRCA 3RQWA 3IBPA 1W0AA 4ZI3C 4K0UA 3RIAA 3P4QA 3GN5A 1W09A 3CK6A 2V1DB 2CE7A 1WYBA
chains in the Genus database with same CATH topology
3FZLB 3FZMB 5AQFB 4HWDA 4HWIB 5AQRB 5AQQB 4HWFA 5AQKB 3FZFB 5AQMB 1M62A 1M7KA 4HWHA 5AQPB 1HX1B 3FZKB 5AQTB 3LDQB 5AQGB 1UK5A 5AQHB 5AQVB 5AQJB 5AQOB 5AQNB 5AQUB 5AQIB 5AQLB 1T7SA 4HWCA 2D9DA 3A8YC 1UGOA 3FZHB 5AQSB 3M3ZB 1I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZL B;  3FZM B;  5AQF B;  4HWD A;  4HWI B;  5AQR B;  5AQQ B;  4HWF A;  5AQK B;  3FZF B;  5AQM B;  1M62 A;  1M7K A;  4HWH A;  5AQP B;  1HX1 B;  3FZK B;  5AQT B;  3LDQ B;  5AQG B;  1UK5 A;  5AQH B;  5AQV B;  5AQJ B;  5AQO B;  5AQN B;  5AQU B;  5AQI B;  5AQL B;  1T7S A;  4HWC A;  2D9D A;  3A8Y C;  1UGO A;  3FZH B;  5AQS B;  3M3Z B;  1I6Z A; 
#chains in the Genus database with same CATH topology
 3QOF A;  2X67 A;  2X9X A;  1XZY A;  1KK7 A;  3DJB A;  2DI4 A;  4EIW A;  5FVL A;  3NRY A;  1Z0P A;  1XWM A;  4A98 A;  1N34 T;  5AQL B;  2BG9 E;  4CI2 B;  2XAH B;  5EK2 A;  2NW8 A;  1I6Z A;  2XQ4 A;  4WZX A;  3NVO A;  4FJO A;  3CPZ A;  4V1A v;  2QRX A;  5L3D B;  3C50 A;  2JQ9 A;  4GOU A;  4ZI7 E;  2CHN A;  5JR9 A;  3BQI A;  5LXT E;  4UVA B;  2YU1 A;  2VAS A;  4KHP T;  2KND A;  3CX8 B;  1D1B A;  2XAG B;  3O4X E;  2UUB T;  1YKH B;  4L5G A;  2FJE A;  1HX8 A;  3ZYM A;  5CJ5 A;  2D0U A;  3LDQ B;  5LHH B;  2PFV A;  2NTY A;  3QK6 A;  3FB2 A;  3OTO T;  4HGA A;  3UUN A;  4WBN E;  3O9X A;  4JYA T;  5AQF B;  2V6Y B;  3HKB E;  5DJQ C;  5JDM A;  2UUC T;  2AE9 A;  4IIJ E;  2B76 A;  5JRE A;  4HTE A;  3M65 A;  1HCI A;  4L9I A;  1KF6 A;  4B6X A;  5AQV B;  2DHR A;  5JQG E;  1MND A;  4LF4 T;  1IBK T;  2RA1 A;  3LBX A;  1U5P A;  2BKO A;  3PUQ A;  5HEH A;  3TKL B;  2AXD S;  2IW5 B;  3AXJ B;  4P0A A;  2JMH A;  4EOZ B;  3F2E A;  1KFY A;  4DR4 T;  3DP7 A;  3P7I A;  3AE3 A;  2H7O A;  2WQY A;  3FZL B;  1H7C A;  4LMK A;  4KHZ F;  4PW8 A;  4ILC A;  2WDR A;  2E9X D;  1AJ3 A;  5HEJ A;  3ZKR A;  4ILB A;  5C8Y E;  3AB3 B;  2PBI A;  2Y48 B;  4TNW A;  2IUB A;  3KDS E;  4YXD A;  2K48 A;  3UU6 A;  5AQQ B;  2C5K T;  2BG9 C;  4YLH A;  4H9N C;  3SRZ A;  4NPP A;  5L3E B;  1MMA A;  3UT5 E;  1Z8U A;  3K1S A;  1X79 A;  2XQ7 A;  4DV5 T;  4QX8 B;  4JI5 T;  4O8S A;  1D0Z A;  5HCM A;  2Q9Q B;  4QXC B;  2P9B A;  5LG4 A;  2N2N A;  3QNU A;  3KV6 A;  3PV0 F;  3N9M A;  4LML A;  3B5M A;  3SFE A;  2BBH A;  4IE0 A;  1XMQ T;  4IRE A;  2IC9 A;  2D5U A;  2W66 A;  4YT0 A;  4O2A E;  4NXM T;  5JTG A;  4HFV A;  3ANW A;  5JDL A;  5AQU B;  2Q9Q A;  1UUR A;  2VQF T;  4DND A;  4BJN A;  4EXT A;  4NUV A;  3AE1 A;  4QH4 A;  2Y6X A;  4UR9 A;  2XY8 B;  3CX7 B;  1IBL T;  2UUA T;  3Q5D A;  3R84 B;  2E8I A;  3CQC B;  5IWA T;  2CRB A;  2V5C A;  5L4E A;  4WNK A;  2JPF A;  3PUY F;  3RYF E;  3NZQ A;  4H9Q C;  5AQK B;  3NBX X;  3ZMU B;  2A3D A;  4PK5 A;  2NOX A;  3OYZ A;  2LSJ A;  5IYZ E;  1HFA A;  4YHJ A;  5LCY A;  4LF6 T;  2A9U A;  3EVY A;  2X9W A;  2DL1 A;  2L9Q A;  1IAP A;  3TLT A;  4XZC A;  4OK0 A;  4IDO A;  4B3S T;  4KI0 F;  5C2T A;  1ZV4 X;  3FZM B;  2MYS A;  1E1H B;  1UCU A;  4CXW A;  3AA6 B;  3AE6 A;  2ZM6 T;  1V9D A;  4O4J E;  4QWN B;  4ILU A;  4ERR A;  2B1E A;  2M6I A;  1XDP A;  3C51 A;  2LOP A;  3H37 A;  1UK5 A;  1MMN A;  3AAE B;  3TLS A;  1NEN A;  1MIW A;  2J4G A;  2JRK A;  3HI2 A;  4JEU B;  1SA0 E;  4I43 B;  3FBL A;  2J1D G;  4U2Z A;  2H88 A;  3UU5 A;  3A5X A;  1OED A;  2OV9 A;  3ZT6 A;  4X62 T;  3FXD B;  3O1I A;  1EZ3 A;  4MAL A;  2F4V T;  4DV2 T;  2XAJ B;  4X1I E;  3SOL A;  2W61 A;  4YTN A;  2I6H A;  5F5W A;  2CXD A;  3JC6 C;  5KDM C;  2EHO D;  2KSR A;  2WU5 A;  2VVN A;  4JEH B;  2IML A;  5FXW A;  3UTK A;  2W4X A;  3RRW A;  4EED A;  3AA7 B;  1WLX A;  2LKH A;  4DV4 T;  4AKG A;  3ZSS A;  2LLY A;  2SPC A;  1VCT A;  4IL4 A;  2ODV A;  3I0Q A;  2D9D A;  4JI3 T;  5EK3 A;  1B7T A;  4UV8 B;  4P0B A;  5ADX L;  4EB6 E;  2XPK A;  1FEW A;  1FMW A;  2YOE A;  2CXF A;  4X65 T;  2BS3 A;  3HL6 A;  3L8R A;  4IHJ E;  3UQ4 A;  4JI2 T;  2OA5 A;  5L3C B;  3N2G E;  4ANJ A;  4ZI3 D;  2YEV C;  2C0S A;  4IE5 A;  2WDV A;  2VKD A;  2LRL A;  2E9X A;  1SUM B;  1HNW T;  2W63 A;  3RHW A;  3PUS A;  2L8K A;  3MK7 C;  4UEM A;  2LT3 A;  3N9Q A;  3AEA A;  1JNR A;  2XTL A;  2FJB A;  3OJA A;  4JI4 T;  2E2A A;  5LOV E;  3GN5 B;  4H9R C;  4OYK A;  3N9P A;  4YTM A;  1CUN A;  1T8B A;  3X1D A;  2UXD T;  2XQ9 A;  4LF5 T;  2NW9 A;  2LEH A;  3L39 A;  5CA1 E;  3VHL A;  1T72 A;  3ZJ1 A;  4UEL A;  5TAO A;  3AEE A;  2CLY B;  3HA4 A;  3ZLI A;  3AAI A;  1HF8 A;  1S94 A;  3EAM A;  4OHF A;  4ZZC A;  4ZI2 C;  4YJ3 E;  4NIQ A;  4UVB B;  2VL8 A;  1J5E T;  2QA7 A;  2WBL A;  2RP4 A;  2MPK A;  4XBF B;  4TN7 B;  1UUS A;  5M4Y A;  2BS4 A;  2XUE A;  1OED E;  2E5L T;  3EHZ A;  5LJN A;  2WDQ A;  5JR9 B;  2XAF B;  1SHZ C;  4PJM A;  3ZMZ B;  2HH7 A;  3ETV A;  3G06 A;  5CFB A;  2V7L A;  5FL1 A;  4EYU A;  3KVA A;  3CIR A;  1FIO A;  3P4S A;  1LVK A;  2XQY A;  4HWI B;  4MHC A;  1E2A A;  4AQF A;  4DR6 T;  4KP3 C;  4MBQ A;  5FNV E;  5F3J A;  1WR6 A;  3ZT7 A;  3Q5X A;  2LSY A;  2HN1 A;  4OFZ A;  3AEF A;  2CEA A;  1J1J A;  3GA8 A;  4AIS A;  1XNQ T;  2YDS A;  2LJL A;  2K9A A;  3QC9 A;  3RLF F;  2LSI A;  3LBX B;  4HWH A;  1YXR A;  3FZK B;  3RYC E;  3UU3 A;  5LBQ B;  3GWH A;  2BVL A;  2K3W A;  4E7S A;  2IAK A;  3V5S A;  3IEE A;  4HFB A;  4U2Y A;  4B3M T;  1NWM X;  3EUH A;  5E0O A;  1MIV A;  4Z91 A;  3C64 A;  3D0T A;  1M7K A;  4UIG A;  2V7J A;  2Z6E A;  5ABG A;  1YKE B;  1ZEE A;  4AKR B;  1W9R A;  5EK4 A;  2E5V A;  2HHH T;  3E08 A;  2XZE A;  4GKJ T;  2JMK A;  3VRA A;  1CHU A;  2KIN B;  2PJQ A;  3PDY A;  4IDZ A;  3RF1 A;  1HR0 T;  2LM9 A;  4QH5 A;  3U78 A;  4AIU A;  3ZEF B;  3H3A A;  4TV8 E;  4PAG A;  3BK9 A;  3HKE E;  2UXC T;  4O4I E;  1LVF A;  1QUU A;  3P8C D;  5H6R B;  1JNZ A;  2WAU A;  3OBV E;  3RC8 A;  4ZXL A;  5AQP B;  4JI7 T;  3K3N A;  3CML A;  4IDN A;  5L47 A;  2IIU A;  2VK9 A;  2XSB A;  3Q2M A;  2EHO A;  1QLB A;  2N1G A;  4PK4 A;  3HKD E;  1G73 A;  1UGO A;  4PFO A;  3SFD A;  3J7Y q;  2C5J A;  1HG5 A;  2H89 A;  2JIW A;  3LK2 B;  4KUM B;  4IDP A;  3RI5 A;  5AQH B;  4LF8 T;  2CHO A;  4GK0 E;  2M6B A;  1KEY A;  4P1N A;  4LF9 T;  3ANW B;  3W15 B;  1R8I A;  3PUX F;  3RH3 A;  4HN9 A;  4HWF A;  3ZYK A;  5ABE A;  3RIU C;  4U3C A;  4LFA T;  2LSG A;  4AQY T;  1LRZ A;  3I1A A;  2KZ7 B;  4H9P C;  2V5D A;  4DV7 T;  2KWI B;  3ZJ2 A;  5ABF A;  2XAS B;  3UUX B;  5H6Q B;  5JH7 E;  3AVR A;  4ISS A;  4X1Y E;  5HXH A;  3MA9 A;  3T8O A;  5CGM A;  2X9Y A;  2V7M A;  2WWV A;  2D2S A;  1KNP A;  2JQQ A;  5DQV A;  2CWO A;  2QGS A;  3KV9 A;  2XQ6 A;  4IT4 A;  3I0O A;  4PFP A;  3K3Q C;  1BR0 A;  1G8X A;  3VRB A;  1IZN B;  5L3F B;  3AA0 B;  5FY7 A;  2WMN A;  1UX4 A;  1IJ5 A;  3WAJ A;  2VQE T;  3ZN1 B;  2DLR A;  4DBR A;  5FMN A;  5A1L A;  3EI0 A;  3RRC A;  3AEC A;  4DO0 A;  4U33 A;  4KBM B;  2VUR A;  3VKG A;  2WM9 A;  5JDN A;  4UV9 B;  1YW0 A;  2WY2 A;  5HYA A;  3FHN A;  1MIY A;  4E7Z A;  1MNE A;  3JC6 D;  3PUV F;  4HFI A;  4X5T A;  2KLQ A;  3AE5 A;  2IDO B;  1FJG T;  1O3X A;  1HX1 B;  3NKZ A;  5LA6 E;  3NWI A;  3U3I A;  2J47 A;  4IDQ A;  4CQI A;  4HE8 A;  4F6R C;  2YDR A;  3AAA B;  1OED B;  4Z8X A;  2LHN A;  2XQ8 A;  3ZN0 B;  4JV5 T;  2LHR A;  4JI0 T;  4EAH A;  5FXV A;  1BR4 A;  2MBG A;  3AE8 A;  5LB7 B;  4ZS2 A;  4ZS3 A;  1T98 A;  3WI3 A;  3H3M A;  2ACZ A;  4MFR A;  4CN1 A;  4COF A;  3CX6 B;  2JQK A;  4PJJ A;  3RYH E;  2XQ5 A;  2W67 A;  5LGT B;  2IC6 A;  3GMI A;  5LMU T;  4U74 A;  4CI3 B;  2V7I A;  2FJA A;  4DR7 T;  4N78 D;  1IJ6 A;  1QSD A;  3L09 A;  2PTF A;  4U7I A;  2ES0 A;  3JAE A;  5LP6 E;  2NP9 A;  3O1H A;  4J2C A;  2A72 A;  2CLY C;  3N2K E;  1HNZ T;  3PJA A;  3AEB A;  3MJX A;  2DWK A;  2BBJ A;  4TUY E;  2XM2 A;  5IUX A;  5AQS B;  5HWY A;  4GK5 E;  1US7 B;  3SWH A;  3Q5W A;  5JR9 C;  5AQO B;  2WMO A;  4YHH T;  2QVA A;  2VVS A;  2IHR 1;  1U4Q A;  4KMC A;  2BG9 A;  2V8S V;  1WRD A;  2ZM2 A;  4EYY R;  2H3R A;  4NXN T;  4BA9 A;  3PU3 A;  1T7S A;  3VR9 A;  1XMO T;  5AFU L;  1BR1 A;  3C98 B;  2G0U A;  5JDF A;  2E9X B;  4TV9 E;  2WU2 A;  4YY3 T;  3AED A;  4ZZB A;  1MMG A;  4ZI2 D;  5LMN T;  3E0Z A;  4DV1 T;  3ZST A;  4X20 E;  5LJM A;  3ESL A;  3RIF A;  4U72 A;  4U31 A;  4HWD A;  3N9N A;  3JAD A;  3ZC0 A;  2XM1 A;  4IE4 A;  5LGN B;  3KIN B;  2ACX A;  2LKG A;  4TX5 A;  4DMV A;  3ZC1 A;  2ZMA A;  2OLT A;  4HWC A;  4JI8 T;  3CWZ B;  4A97 A;  4ZEY A;  4NUU A;  4BAY B;  2XQ3 A;  3F31 A;  4EZH A;  3IF8 B;  3WAK A;  3KV5 A;  3E22 E;  3I9W A;  3AEG A;  3P4W A;  2X0Y A;  4TWF A;  4CN6 A;  4O4H E;  5F8P A;  5AQJ B;  3QUJ A;  1VCS A;  5HEO A;  4EV6 A;  2BDE A;  2GK9 A;  2YK0 A;  3P4R A;  2J62 A;  2JJ9 A;  3J9X 1;  4LMJ A;  4AKI A;  1W0B A;  2D0T A;  2UXB T;  3CQX C;  3PTR B;  4L0R A;  3FZH B;  4IST A;  3PJA J;  4DV6 T;  3KFW X;  1Y01 A;  2DCF A;  1X9B A;  3BQL A;  4EGW A;  4HKA A;  2N9D A;  2C5I T;  1WCR A;  2WP9 A;  2LOS A;  1D0Y A;  4TWH A;  5LBM A;  5LYJ E;  2DWG A;  2NTX A;  2MAW A;  4CXX A;  5J2U E;  4K0K T;  3R6N A;  2KWH A;  2BVM A;  5DQW A;  2CCQ A;  3C4X A;  4GIW A;  3S4U A;  5FVK A;  2Q9Q C;  4QXH B;  2X66 A;  2W62 A;  4YSX A;  3SS1 A;  3V5U A;  3QB5 A;  1WFD A;  1N32 T;  3ZMS B;  1I94 T;  2NR4 A;  4UF0 A;  3ZPO A;  1M62 A;  4JBW F;  2I59 A;  3N9L A;  2FUP A;  4DUY T;  4JUY A;  3RKG A;  4TNV A;  4HFD A;  5JDQ A;  4DV3 T;  2CBJ A;  3L3P A;  4G2A A;  4A5X A;  3K8P C;  2WCA A;  2LM2 A;  2L3L A;  2YU2 A;  4IL9 A;  5AQM B;  5FYM A;  5BR8 T;  1YQ4 A;  3C4W A;  1XDO A;  3EAB A;  2VKH A;  3N9O A;  4IGU A;  3ZYL A;  4QH1 A;  2ZM8 A;  2WB5 A;  1Y64 B;  3AE2 A;  1N36 T;  4WW0 A;  3RGL A;  4P09 A;  2XHE B;  3AA1 B;  1HG2 A;  3EDU A;  2BS2 A;  2MTQ A;  2XJ7 A;  1MMD A;  1NEK A;  1NAF A;  5HXS A;  4ASK A;  2W00 A;  2V6X A;  3KBT A;  3KVB A;  1E7P A;  2EHO B;  4X1K E;  5HWX A;  2WSS V;  2JQH A;  4QKN A;  5HXC A;  3AE7 A;  3Q9D A;  4ILA A;  3TLV A;  1VRB A;  5FKY A;  3B57 A;  3LFM A;  1YD8 G;  2K5B B;  2LSK A;  3OVU A;  4A56 A;  1YQ3 A;  3M3Z B;  4I50 E;  4IE6 A;  4BJM A;  1J5W A;  4DBQ A;  3NRX A;  3PUW F;  3IHR A;  1ZOY A;  2V7K A;  1OED C;  5LNK A;  1KNR A;  1ZKE A;  3HKC E;  4PNI A;  5BMV E;  3BQK A;  3LJC A;  4YSY A;  2UU9 T;  2V6Y A;  3ONX A;  5DAB A;  2MOZ A;  4DV0 T;  3OYX A;  5FY0 A;  3VU7 H;  3AE9 A;  5ABF B;  1WR0 A;  3RYI E;  2X9H A;  2XSA A;  3RC3 A;  5JDH A;  3JAF A;  5HXE A;  3AVS A;  4KX6 A;  4CXY A;  5L4H A;  2R6G F;  3OPC A;  5L3G B;  4JI6 T;  5LG3 A;  3MXZ A;  4OX9 T;  3AXJ A;  5JVD E;  2X0H A;  4DUZ T;  1D1A A;  4AKH A;  1UX5 A;  2HN2 A;  3FXE B;  1D0X A;  4UXN B;  2CWY A;  3PU8 A;  4H63 V;  2WS3 A;  2RPA A;  4LFB T;  2DNX A;  1OXZ A;  3LK3 B;  2CPT A;  3LSV A;  4GKK T;  3VR8 A;  5L2L A;  2XQA A;  3P4P A;  2CMR A;  3TLU A;  2VL0 A;  3PE0 A;  4TWD A;  2ZLY A;  2V26 A;  4FI5 A;  2H7V C;  5ETW A;  2KMF A;  3N2O A;  4DR2 T;  5HXR A;  4PJN A;  2X68 A;  3PUR A;  3T1Y T;  1HTJ F;  2CA5 A;  3LK4 2;  2E9X C;  3RX6 A;  3P50 A;  2W0G A;  4TZ4 C;  2BKP A;  3EDV A;  4PJL A;  4LFC T;  4OYJ A;  4QXB B;  4I55 E;  2X51 A;  1SE7 A;  3PUA A;  5ABH A;  3JCF A;  2YN6 A;  5LHI B;  3MZK B;  3QB5 K;  4UVC B;  2PG8 A;  3RQU A;  4GYR A;  3ETU A;  4HFC A;  5KMG P;  4DR5 T;  2LRK A;  1LKX A;  2A2F X;  5CB4 E;  4HEA A;  4O4L E;  3FBZ A;  3UFE A;  3UFG A;  3UQ7 A;  1IBM T;  4YSZ A;  1D1C A;  4AI6 A;  2W2U A;  3O1J A;  4YFS A;  4ADZ A;  1XNR T;  3IA3 A;  4IE7 A;  1DU2 A;  5CA0 E;  4CN4 A;  2VWA A;  3UUL A;  1HS7 A;  5AQG B;  2QYW A;  4C91 A;  2KXP B;  4LF7 T;  2WZI A;  4B3R T;  2M67 A;  5LHG B;  4M1P A;  2KT9 A;  4H9O C;  4JLE A;  4I0U A;  3UUM A;  5J2T E;  2BG9 B;  1HNX T;  4DR3 T;  4EEB A;  5GON E;  3NZP A;  4F8H A;  2CBI A;  4AQF C;  5KX5 E;  3ONJ A;  5KXJ A;  2X0L B;  3T1H T;  2VKJ A;  5AQI B;  4HFE A;  2ZM0 A;  3RPU A;  3TLW A;  4O2B E;  2BZB A;  3PUG A;  4C90 A;  2WZH A;  3F57 A;  3A7M A;  1L0V A;  3OKQ A;  1ZP0 A;  3ZMT B;  3LG7 A;  1GQE A;  3A8Y C;  5JDG A;  1N33 T;  3ZCJ A;  4B3T T;  3PUZ F;  4G63 A;  3N5L A;  2HPJ A;  4H9S E;  3K3O A;  4CI1 B;  3RIU A;  5J0Z A;  2BKN A;  3HR0 A;  4DID B;  3DTO A;  4Q25 A;  4QX7 B;  4U7Y A;  2K24 A;  4AQG A;  4X64 T;  3MKD A;  4AXP A;  2YDQ A;  4HFH A;  3I9Y A;  4I4T E;  1KNZ A;  2LE8 A;  3ONL C;  2ODU A;  4DVD A;  4YJ2 E;  4YTP A;  2I0M A;  5FP3 A;  5FXZ A;  4WBO A;  3ZCI A;  5LGU B;  3CKD A;  2WWU A;  4XAX B;  3KBU A;  5HCJ A;  4ZOL E;  2NWB A;  1S35 A;  2UXN B;  3UU8 A;  2YIN A;  5AQR B;  5HAX A;  4ZHQ E;  4WYV A;  4JI1 T;  2Q9Q D;  2HPL A;  3KV4 A;  4GYS A;  2XAQ B;  5AQT B;  1FMV A;  3VKH A;  4Z90 A;  2VKO A;  2EHO C;  4AKL A;  1WYC A;  3ABV A;  3C4Z A;  2Y8D A;  4DMW A;  3CQG B;  2CXL A;  1BR2 A;  4H63 H;  2VB6 A;  3B13 A;  4CZZ B;  3AE4 A;  5JRC B;  3FZF B;  5C3J A;  5L3B B;  3Q5E A;  2UXX B;  4MLK A;  2NW7 A;  3UU4 A;  4PK6 A;  1ZHC A;  4X66 T;  4DR1 T;  5J1G A;  5EZY E;  5FL0 A;  2YKS A;  5HEU A;  3CVR A;  3MAC A;  2FBW A;  1OWA A;  2FJD A;  5FXX A;  3ZT5 A;  5HEG A;  4EZ4 A;  3RKO A;  4UF0 B;  5FY1 A;  3UUB A;  5AQN B;  5IHY A;  2CM0 A;  3ZMV B;  1VOM A;  4QHO A;  5JRC A;  3RQW A;  3IBP A;  1W0A A;  4ZI3 C;  4K0U A;  3RIA A;  3P4Q A;  3GN5 A;  1W09 A;  3CK6 A;  2V1D B;  2CE7 A;  1WYB A; 
#chains in the Genus database with same CATH homology
 3FZL B;  3FZM B;  5AQF B;  4HWD A;  4HWI B;  5AQR B;  5AQQ B;  4HWF A;  5AQK B;  3FZF B;  5AQM B;  1M62 A;  1M7K A;  4HWH A;  5AQP B;  1HX1 B;  3FZK B;  5AQT B;  3LDQ B;  5AQG B;  1UK5 A;  5AQH B;  5AQV B;  5AQJ B;  5AQO B;  5AQN B;  5AQU B;  5AQI B;  5AQL B;  1T7S A;  4HWC A;  2D9D A;  3A8Y C;  1UGO A;  3FZH B;  5AQS B;  3M3Z B;  1I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...