5AQGB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 113
sequence length 113
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqgB00
5AQUB 5AQFB 5AQNB 1UGOA 5AQGB 1UK5A 1HX1B 3M3ZB 4HWHA 5AQSB 5AQVB 5AQQB 5AQHB 3FZKB 4HWCA 5AQTB 5AQJB 1T7SA 3FZLB 3FZMB 4HWIB 5AQPB 5AQRB 5AQLB 3LDQB 3FZHB 3FZFB 1M62A 1I6ZA 5AQMB 5AQOB 1M7KA 4HWDA 3A8YC 4HWFA 5AQKB 2D9DA 5AQIB
chains in the Genus database with same CATH superfamily
2WCAA 4QX8B 3PURA 4EB6E 3RI5A 2KLQA 3SFEA 3ONLC 4HWIB 5EK2A 3PU8A 2WAUA 5HCJA 4EEDA 3A8YC 5JR9B 4CXWA 3M3ZB 2X51A 4TWDA 4ZI7E 4A5XA 2K5BB 2K9AA 4XAXB 2IDOB 3AEEA 5FNVE 3S4UA 1IAPA 3HA4A 2PFVA 4PAGA 4JI5T 1S35A 3P4QA 4Z91A 4P0AA 4IE6A 2NR4A 1IBMT 3TLSA 1XDOA 3EVYA 3QK6A 4TX5A 3H37A 2LLYA 3J7Yq 3HR0A 3RIAA 3AE6A 5LMNT 2ZMAA 3EDUA 1HS7A 2NW8A 2YDRA 2XTLA 1IZNB 2UUBT 2IIUA 3UULA 1BR4A 4GIWA 5FXZA 4V1Av 4HWDA 4DR2T 3N9MA 3AE7A 1NEKA 3FXEB 5BMVE 4PJJA 3N2KE 3C51A 2LM9A 3NKZA 3UU4A 3FHNA 2G0UA 2BZBA 4ILUA 4UF0A 2A3DA 2V7LA 3K3QC 1HG2A 1UGOA 5KX5E 4ZI2C 4ZI3D 2YU2A 5KDMC 2LKGA 2VKJA 3K8PC 3UFEA 4HFHA 2XUEA 5LYJE 2VKOA 1B7TA 4LF8T 5LJMA 2CBJA 2VWAA 3CQGB 1WYCA 4LMKA 3AE4A 2OA5A 4I50E 5FXWA 1ZEEA 1D0YA 2W4XA 3RYCE 1Z0PA 4X1YE 3HKEE 4JV5T 1D1AA 3L39A 4O4IE 2DLRA 4PK6A 2BBHA 5AQMB 4PFOA 5AFUL 3CKDA 4PJLA 1MNDA 1MIYA 3AEDA 1GQEA 2KSRA 4UVBB 5LHIB 5F8PA 3ZT6A 1YQ4A 5BR8T 4M1PA 4FI5A 2B76A 5DJQC 5M4YA 4ILBA 4PNIA 5L3DB 2YU1A 3AECA 2V6YB 3M65A 3TLTA 2BKNA 5LGTB 2XAGB 2E8IA 2X9WA 2R6GF 3SFDA 3OYXA 5ETWA 4UF0B 2XQ4A 1ZKEA 1XMQT 2JQKA 2WQYA 2C5IT 1J5WA 4L5GA 2JQ9A 2E5VA 5J0ZA 3LK3B 3I9YA 5KMGP 3JADA 4G2AA 2HHHT 2XJ7A 3ZEFB 4DR7T 3N9LA 3PJAA 2CBIA 2L9QA 3AE2A 1CHUA 4QXHB 3FXDB 4FJOA 2XQ6A 5FP3A 5FVKA 5FY1A 1J1JA 4DVDA 2JJ9A 2BG9B 3N5LA 3AXJA 2XQ3A 4YHJA 5JDMA 4CZZB 3SRZA 1US7B 1BR0A 1HX1B 2ZM6T 4LFAT 3FBLA 2BBJA 4HWHA 1U5PA 3T1HT 4CN6A 4YXDA 3AEGA 4LFBT 5JR9C 3ZC1A 3OVUA 2V7JA 4GKKT 2J62A 4JI7T 4AISA 3VRBA 4KBMB 1XMOT 4X20E 3QB5A 4I55E 4YY3T 5FXVA 4EEBA 2VASA 2X68A 1IJ5A 4H9RC 3RYFE 4CXYA 2V8SV 5JDGA 2VQET 3TKLB 3LK42 1E7PA 3AB3B 1YXRA 3MK7C 2FUPA 2XQAA 1D1CA 2WMOA 4LFCT 4B3ST 3AVSA 1NENA 4ZEYA 4PW8A 3OYZA 3LSVA 3KDSE 4QHOA 3UU3A 5JQGE 5CGMA 4CI3B 1ZP0A 3KV9A 2HN2A 1FJGT 2RPAA 1WLXA 4U33A 1N33T 4ISSA 3PUQA 4ISTA 3AXJB 2YEVC 2MTQA 4EIWA 2KMFA 3ZJ1A 2RP4A 3ONXA 4PK5A 1Y01A 4LMLA 4ZI3C 2LEHA 3UU6A 4IDZA 3UUMA 2CXFA 3RX6A 1EZ3A 1XNQT 4PJMA 5JDNA 4X62T 4WW0A 2UUAT 3Q2MA 2W63A 2QRXA 1UK5A 5JREA 4DR5T 2OV9A 4GOUA 5ABHA 2ZM2A 5HEJA 2AE9A 5H6RB 2M6IA 3K3OA 4KP3C 4C91A 5LNKA 1I6ZA 2CXLA 3HL6A 3W15B 2W2UA 1MMDA 1AJ3A 3J9X1 4H9OC 4UR9A 2H7OA 3H3AA 4O4JE 1XZYA 5LGUB 2J1DG 2CA5A 3V5UA 3AEFA 5L3BB 2PBIA 2IMLA 4AKHA 2CLYC 4F6RC 2J47A 4IDQA 2W67A 4AKLA 5AQVB 3ZMVB 2B1EA 5JR9A 2HN1A 3ZCIA 5AQLB 2NW9A 3E22E 3ZYLA 1IBKT 3I0OA 3OBVE 2VQFT 4U72A 3RIUA 1L0VA 5AQKB 1JNZA 5L4EA 3DTOA 4DR4T 1YD8G 3U3IA 2ACXA 4X64T 4U2ZA 3C98B 2X0HA 3B13A 3AAIA 4P1NA 3LDQB 4XZCA 3AE9A 3KBUA 1HTJF 1HX8A 3P7IA 4YJ3E 5HYAA 3AE1A 3CQCB 3H3MA 2LSKA 5L3GB 4CN1A 5C8YE 4TWHA 5JDLA 2BVMA 2L8KA 3F31A 3SS1A 4KI0F 5L4HA 2P9BA 2IC9A 1MMAA 2XQYA 2N9DA 3NVOA 2UXNB 3CPZA 2BG9C 2XASB 5JTGA 5LHGB 4Q25A 4GK0E 5LCYA 2CMRA 4JI2T 3CX6B 2I6HA 5JVDE 2A9UA 5JDFA 5E0OA 2MOZA 2LKHA 4IDPA 1HF8A 2WDRA 3OJAA 4DV2T 4IDOA 2WU2A 4QXCB 2PJQA 2X67A 3UUXB 3O9XA 3AA1B 4EZHA 4CXXA 2D9DA 5LG3A 4H9PC 2LSYA 3ESLA 5H6QB 2Y6XA 4TNVA 4PJNA 3I1AA 1MMNA 4LF6T 4B3MT 5HEUA 2IW5B 1Z8UA 3PU3A 1HFAA 3Q9DA 2WB5A 2ACZA 1VCSA 2CHNA 4UXNB 2LSIA 4LF7T 5ABGA 2F4VT 4HGAA 3R6NA 4DV1T 4DV6T 4K0KT 4TZ4C 2CXDA 4P09A 4EV6A 4IHJE 1LRZA 5F5WA 2V6YA 3RC8A 2KXPB 2DL1A 2D0TA 1FIOA 3HI2A 2MBGA 2C5KT 3KVAA 4JUYA 2MAWA 3BK9A 1N32T 4YSXA 5GONE 5CB4E 2XQ7A 2WDVA 2I0MA 3SWHA 5J2UE 4WBOA 5AQJB 4GYSA 4EYUA 3ZYKA 2WDQA 1D0ZA 5L47A 1H7CA 2A72A 1QUUA 5J2TE 5IYZE 4MBQA 1IBLT 4HTEA 4U2YA 4NUVA 1VCTA 5HXSA 4IL9A 2XM2A 3KV4A 4AIUA 1XDPA 3KFWX 2WWVA 4KHZF 4HFVA 2BG9A 5LG4A 3RPUA 3FBZA 2JQQA 4HEAA 4I4TE 5AQGB 2JRKA 1HR0T 2FBWA 4MFRA 4HFDA 2CLYB 2Q9QA 3VRAA 3AAAB 4DV3T 3QC9A 5J1GA 1WR6A 3RKOA 2N1GA 2Z6EA 3P8CD 1SUMB 1SA0E 3FZKB 3FZMB 3UQ7A 1O3XA 2ODUA 3C64A 1VOMA 2WM9A 3FB2A 5DQVA 4E7SA 1MIVA 1IJ6A 5ABEA 2RA1A 3ETUA 1KK7A 3ABVA 4YT0A 3PE0A 4JI1T 4QH4A 2X9YA 4OYKA 5LA6E 3AA0B 4ANJA 2PG8A 2XAQB 1U4QA 5JH7E 3RYHE 3C4XA 1UX5A 2C0SA 3ZSSA 3DP7A 2FJAA 3MACA 4YSZA 2W00A 2JQHA 2K3WA 1WR0A 4KX6A 4I0UA 1HNXT 1X79A 2IC6A 4BJNA 3G06A 1UCUA 2X0YA 3PV0F 3AE5A 2YKSA 4DBRA 5HWXA 2HPJA 2Q9QB 4TWFA 4CI1B 2LM2A 1NWMX 2IHR1 3OTOT 2Q9QD 3P4SA 5CA1E 3A7MA 3CX7B 4UV9B 3JCFA 3RQWA 1R8IA 2YOEA 3RIUC 3FZLB 1WCRA 2LRKA 3ONJA 2CPTA 2ZLYA 1T72A 3LJCA 4A97A 4OHFA 3EABA 4YLHA 1S94A 2MPKA 4ZHQE 1W0AA 4ILCA 5HEOA 1MMGA 5AQQB 3ZC0A 3HKBE 4ILAA 1G73A 1T98A 4U31A 3TLWA 3DJBA 1N34T 5DABA 3Q5WA 3UFGA 5FXXA 4DR3T 2LJLA 3P4RA 2DNXA 4O8SA 4NXNT 1WYBA 1YKEB 4DUZT 4IL4A 3ZT7A 1KNZA 4IE7A 2DI4A 4B3RT 2ZM0A 2CWOA 2LT3A 4F8HA 1T8BA 2BG9E 2N2NA 3O1HA 3AAEB 4YJ2E 2WY2A 4YTNA 2NW7A 4E7ZA 2ODVA 4KUMB 3ANWB 4DV5T 2IAKA 4DIDB 2LE8A 3E08A 1KNPA 1KNRA 4PFPA 2XQ5A 5L3FB 2VK9A 4WYVA 4YTPA 4DUYT 3CIRA 2XM1A 2SPCA 5FL1A 1OWAA 2V7MA 3FZHB 4AXPA 1XWMA 3O4XE 2JMKA 3U78A 2YN6A 2YINA 4HFBA 3HKDE 4AQFA 3ETVA 4JI0T 3IHRA 5KXJA 4NIQA 3B5MA 4HFEA 1MNEA 4DBQA 2CCQA 2CHOA 2BVLA 4X1KE 2VURA 4WNKA 4EZ4A 4MHCA 2V5DA 2W0GA 2AXDS 4QH1A 3WAJA 2XAFB 2XAHB 3N2OA 3PTRB 1LKXA 3MA9A 4OX9T 3F2EA 4J2CA 3GN5B 4CN4A 3VHLA 5EK4A 3IEEA 3RC3A 2C5JA 3E0ZA 3VU7H 2V7KA 4ZXLA 5FYMA 1J5ET 4TN7B 3KV6A 3K1SA 4TNWA 4Z90A 4JEUB 2ES0A 4U74A 5LMUT 5EK3A 4O4LE 4DO0A 2EHOA 3O1IA 5ADXL 4P0BA 4U3CA 4HE8A 2M67A 2W62A 4B3TT 3EDVA 3QUJA 3TLVA 4BJMA 5A1LA 4XBFB 5HWYA 4EGWA 4ZS2A 3JC6D 4QWNB 3RYIE 3PUXF 1ZV4X 1CUNA 5EZYE 4QKNA 1WFDA 5TAOA 2X9HA 3ZMSB 4ADZA 5CA0E 1QSDA 4A98A 3BQLA 3AA6B 1N36T 4EAHA 3LBXA 4IE5A 2DCFA 5HXHA 3RRWA 5AQFB 3JAFA 5L2LA 3RKGA 2XSBA 5FY0A 4TV9E 3NRYA 2NTYA 4IT4A 4OFZA 4H63H 3CWZB 5AQPB 1E1HB 2KINB 3A5XA 3NWIA 2Q9QC 3TLUA 3RQUA 3ZN1B 5ABFB 1KEYA 2YK0A 4JLEA 1W0BA 3PUWF 3T8OA 4TV8E 2EHOB 3RHWA 2UXBT 5JRCA 4AKGA 2YDSA 2XPKA 2VB6A 3RF1A 2CE7A 2I59A 2EHOD 5AQUB 2JPFA 2D0UA 2D5UA 5AQSB 3UT5E 2KWIB 4HN9A 1OEDA 4H9NC 4EOZB 4PK4A 2KT9A 3UTKA 4UELA 5AQNB 5C3JA 2NTXA 1HG5A 2QYWA 3ZPOA 2XAJB 2A2FX 5LBQB 3GMIA 3LBXB 4N78D 2BS2A 2QGSA 3UU5A 1E2AA 4ZZBA 2DWGA 3L3PA 4JI6T 3L8RA 2VVNA 5AQIB 2ZM8A 2K24A 2L3LA 4UIGA 1YW0A 1BR2A 4KMCA 3O1JA 1X9BA 4DV7T 1UUSA 4AQYT 4HKAA 4Z8XA 1HNWT 1LVFA 4AKIA 2NP9A 2W61A 3X1DA 2QVAA 4IE0A 1ZHCA 4L0RA 1FMWA 5L3EB 2NOXA 3VR8A 4IE4A 3PJAJ 5L3CB 5FY7A 2E9XA 5JRCB 4CQIA 4H63V 3P4PA 4QXBB 4BAYB 4IIJE 1M7KA 4JYAT 1BR1A 2X66A 4HWFA 4O4HE 5DQWA 1OEDB 4DMVA 3Q5XA 3EHZA 4DR1T 4DV4T 2BKOA 1HCIA 3ZKRA 4KHPT 3KINB 2UU9T 5IUXA 3BQKA 4OK0A 2LSJA 3EI0A 2CM0A 4LF4T 5IHYA 2W66A 2K48A 5HCMA 1JNRA 3CQXC 3B57A 3RIFA 2BS4A 4AI6A 5LOVE 2X0LB 4GK5E 4WBNE 2XHEB 2LSGA 2V7IA 3K3NA 2KZ7B 4I43B 4YTMA 5CJ5A 1LVKA 1KFYA 1W09A 5LJNA 4ERRA 5FKYA 5JDQA 3EUHA 3JC6C 3ZLIA 4AQFC 4JEHB 3V5SA 2HH7A 2E9XB 4ZS3A 3AVRA 3I9WA 2KWHA 3QOFA 1DU2A 3RLFF 1FEWA 2WSSV 2E9XD 1D0XA 3MZKB 4AKRB 1OEDE 3CMLA 3ZN0B 1V9DA 2Y8DA 5HXEA 1XNRT 3MXZA 5AQRB 4HFCA 3UUNA 2WMNA 3R84B 3N9OA 2WBLA 4G63A 3N2GE 4AQGA 2E5LT 3ANWA 3GWHA 2LOSA 2CWYA 3CVRA 2VKHA 1ZOYA 4IREA 4QH5A 3RH3A 4O2AE 4X65T 3LG7A 1UX4A 1KF6A 3BQIA 3KBTA 4ZOLE 4C90A 3UUBA 2EHOC 3IBPA 2WU5A 4UEMA 3AEBA 2WS3A 3F57A 5AQHB 5AQTB 2VL8A 3MJXA 1W9RA 3CX8B 1M62A 2VKDA 1QLBA 2UUCT 2VVSA 4H9SE 3RGLA 1I94T 5HEGA 3LK2B 2WWUA 4O2BE 3GA8A 3UU8A 3QNUA 3GN5A 4LF5T 1OXZA 3ZT5A 2UXCT 1Y64B 5IWAT 2KNDA 5LP6E 5AQOB 2FJDA 4DV0T 2OLTA 3AEAA 3KV5A 2H89A 4ZZCA 3EAMA 2BKPA 4K0UA 3OKQA 1YKHB 3N9NA 2YDQA 4OYJA 5F3JA 1T7SA 4X66T 3C4WA 2V6XA 2JMHA 1VRBA 2WP9A 2H88A 3JAEA 3N9QA 3QB5K 1NAFA 2BDEA 4IDNA 2V5CA 4MLKA 3ZMZB 5JDHA 2DHRA 3RRCA 2E2AA 3L09A 1WRDA 4LMJA 3PUAA 4ASKA 4JI8T 3NZPA 2FJBA 3PUZF 4HWCA 5HXRA 3N9PA 4DNDA 4NUUA 5CFBA 1SE7A 2BS3A 2Y48B 1OEDC 2J4GA 3AA7B 3P50A 3VKHA 4EYYR 4A56A 5LHHB 4ZI2D 3VKGA 5FMNA 2LHNA 4UVAB 2LHRA 2PTFA 3WAKA 3ZYMA 5C2TA 1HNZT 3SOLA 2IUBA 3PUVF 2XQ9A 3FZFB 4YHHT 2XSAA 5HXCA 3ZMTB 2CRBA 3IA3A 2M6BA 3P4WA 3T1YT 2JIWA 3Q5DA 4JI3T 4DR6T 5LBMA 4BA9A 4GKJT 3HKCE 1MIWA 4X5TA 5HAXA 1FMVA 4JBWF 5ABFA 4WZXA 3MKDA 4YFSA 4X1IE 4COFA 4CI2B 4QX7B 1YQ3A 3C50A 5LXTE 3LFMA 3KVBA 2UXDT 3ZSTA 3AE3A 3AE8A 2LRLA 3PUGA 4UV8B 4DMWA 2NWBA 2WZHA 2WZIA 2XZEA 4UVCB 2LOPA 5HEHA 1D1BA 4JI4T 3C4ZA 5LGNB 4TUYE 4GYRA 3OPCA 4NPPA 2FJEA 2E9XC 2V26A 3UQ4A 2V1DB 4EXTA 4NXMT 3IF8B 3PUSA 2VL0A 3PUYF 3D0TA 2H3RA 2HPLA 4IGUA 4YSYA 3VR9A 2QA7A 3NZQA 5LB7B 4LF9T 4L9IA 5FL0A 4U7YA 2D2SA 1SHZC 3NBXX 2X9XA 3ZCJA 3WI3A 5FVLA 2XQ8A 4H9QC 3CK6A 4U7IA 2H7VC 4MALA 2MYSA 2UXXB 3Q5EA 3ZJ2A 2XY8B 2DWKA 2GK9A 3PDYA 2CEAA 1UURA 4HFIA 3I0QA 3ZMUB 4B6XA 3NRXA 1G8XA
chains in the Genus database with same CATH topology
5AQUB 5AQFB 5AQNB 1UGOA 5AQGB 1UK5A 1HX1B 3M3ZB 4HWHA 5AQSB 5AQVB 5AQQB 5AQHB 3FZKB 4HWCA 5AQTB 5AQJB 1T7SA 3FZLB 3FZMB 4HWIB 5AQPB 5AQRB 5AQLB 3LDQB 3FZHB 3FZFB 1M62A 1I6ZA 5AQMB 5AQOB 1M7KA 4HWDA 3A8YC 4HWFA 5AQKB 2D9DA 5AQIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQU B;  5AQF B;  5AQN B;  1UGO A;  5AQG B;  1UK5 A;  1HX1 B;  3M3Z B;  4HWH A;  5AQS B;  5AQV B;  5AQQ B;  5AQH B;  3FZK B;  4HWC A;  5AQT B;  5AQJ B;  1T7S A;  3FZL B;  3FZM B;  4HWI B;  5AQP B;  5AQR B;  5AQL B;  3LDQ B;  3FZH B;  3FZF B;  1M62 A;  1I6Z A;  5AQM B;  5AQO B;  1M7K A;  4HWD A;  3A8Y C;  4HWF A;  5AQK B;  2D9D A;  5AQI B; 
#chains in the Genus database with same CATH topology
 2WCA A;  4QX8 B;  3PUR A;  4EB6 E;  3RI5 A;  2KLQ A;  3SFE A;  3ONL C;  4HWI B;  5EK2 A;  3PU8 A;  2WAU A;  5HCJ A;  4EED A;  3A8Y C;  5JR9 B;  4CXW A;  3M3Z B;  2X51 A;  4TWD A;  4ZI7 E;  4A5X A;  2K5B B;  2K9A A;  4XAX B;  2IDO B;  3AEE A;  5FNV E;  3S4U A;  1IAP A;  3HA4 A;  2PFV A;  4PAG A;  4JI5 T;  1S35 A;  3P4Q A;  4Z91 A;  4P0A A;  4IE6 A;  2NR4 A;  1IBM T;  3TLS A;  1XDO A;  3EVY A;  3QK6 A;  4TX5 A;  3H37 A;  2LLY A;  3J7Y q;  3HR0 A;  3RIA A;  3AE6 A;  5LMN T;  2ZMA A;  3EDU A;  1HS7 A;  2NW8 A;  2YDR A;  2XTL A;  1IZN B;  2UUB T;  2IIU A;  3UUL A;  1BR4 A;  4GIW A;  5FXZ A;  4V1A v;  4HWD A;  4DR2 T;  3N9M A;  3AE7 A;  1NEK A;  3FXE B;  5BMV E;  4PJJ A;  3N2K E;  3C51 A;  2LM9 A;  3NKZ A;  3UU4 A;  3FHN A;  2G0U A;  2BZB A;  4ILU A;  4UF0 A;  2A3D A;  2V7L A;  3K3Q C;  1HG2 A;  1UGO A;  5KX5 E;  4ZI2 C;  4ZI3 D;  2YU2 A;  5KDM C;  2LKG A;  2VKJ A;  3K8P C;  3UFE A;  4HFH A;  2XUE A;  5LYJ E;  2VKO A;  1B7T A;  4LF8 T;  5LJM A;  2CBJ A;  2VWA A;  3CQG B;  1WYC A;  4LMK A;  3AE4 A;  2OA5 A;  4I50 E;  5FXW A;  1ZEE A;  1D0Y A;  2W4X A;  3RYC E;  1Z0P A;  4X1Y E;  3HKE E;  4JV5 T;  1D1A A;  3L39 A;  4O4I E;  2DLR A;  4PK6 A;  2BBH A;  5AQM B;  4PFO A;  5AFU L;  3CKD A;  4PJL A;  1MND A;  1MIY A;  3AED A;  1GQE A;  2KSR A;  4UVB B;  5LHI B;  5F8P A;  3ZT6 A;  1YQ4 A;  5BR8 T;  4M1P A;  4FI5 A;  2B76 A;  5DJQ C;  5M4Y A;  4ILB A;  4PNI A;  5L3D B;  2YU1 A;  3AEC A;  2V6Y B;  3M65 A;  3TLT A;  2BKN A;  5LGT B;  2XAG B;  2E8I A;  2X9W A;  2R6G F;  3SFD A;  3OYX A;  5ETW A;  4UF0 B;  2XQ4 A;  1ZKE A;  1XMQ T;  2JQK A;  2WQY A;  2C5I T;  1J5W A;  4L5G A;  2JQ9 A;  2E5V A;  5J0Z A;  3LK3 B;  3I9Y A;  5KMG P;  3JAD A;  4G2A A;  2HHH T;  2XJ7 A;  3ZEF B;  4DR7 T;  3N9L A;  3PJA A;  2CBI A;  2L9Q A;  3AE2 A;  1CHU A;  4QXH B;  3FXD B;  4FJO A;  2XQ6 A;  5FP3 A;  5FVK A;  5FY1 A;  1J1J A;  4DVD A;  2JJ9 A;  2BG9 B;  3N5L A;  3AXJ A;  2XQ3 A;  4YHJ A;  5JDM A;  4CZZ B;  3SRZ A;  1US7 B;  1BR0 A;  1HX1 B;  2ZM6 T;  4LFA T;  3FBL A;  2BBJ A;  4HWH A;  1U5P A;  3T1H T;  4CN6 A;  4YXD A;  3AEG A;  4LFB T;  5JR9 C;  3ZC1 A;  3OVU A;  2V7J A;  4GKK T;  2J62 A;  4JI7 T;  4AIS A;  3VRB A;  4KBM B;  1XMO T;  4X20 E;  3QB5 A;  4I55 E;  4YY3 T;  5FXV A;  4EEB A;  2VAS A;  2X68 A;  1IJ5 A;  4H9R C;  3RYF E;  4CXY A;  2V8S V;  5JDG A;  2VQE T;  3TKL B;  3LK4 2;  1E7P A;  3AB3 B;  1YXR A;  3MK7 C;  2FUP A;  2XQA A;  1D1C A;  2WMO A;  4LFC T;  4B3S T;  3AVS A;  1NEN A;  4ZEY A;  4PW8 A;  3OYZ A;  3LSV A;  3KDS E;  4QHO A;  3UU3 A;  5JQG E;  5CGM A;  4CI3 B;  1ZP0 A;  3KV9 A;  2HN2 A;  1FJG T;  2RPA A;  1WLX A;  4U33 A;  1N33 T;  4ISS A;  3PUQ A;  4IST A;  3AXJ B;  2YEV C;  2MTQ A;  4EIW A;  2KMF A;  3ZJ1 A;  2RP4 A;  3ONX A;  4PK5 A;  1Y01 A;  4LML A;  4ZI3 C;  2LEH A;  3UU6 A;  4IDZ A;  3UUM A;  2CXF A;  3RX6 A;  1EZ3 A;  1XNQ T;  4PJM A;  5JDN A;  4X62 T;  4WW0 A;  2UUA T;  3Q2M A;  2W63 A;  2QRX A;  1UK5 A;  5JRE A;  4DR5 T;  2OV9 A;  4GOU A;  5ABH A;  2ZM2 A;  5HEJ A;  2AE9 A;  5H6R B;  2M6I A;  3K3O A;  4KP3 C;  4C91 A;  5LNK A;  1I6Z A;  2CXL A;  3HL6 A;  3W15 B;  2W2U A;  1MMD A;  1AJ3 A;  3J9X 1;  4H9O C;  4UR9 A;  2H7O A;  3H3A A;  4O4J E;  1XZY A;  5LGU B;  2J1D G;  2CA5 A;  3V5U A;  3AEF A;  5L3B B;  2PBI A;  2IML A;  4AKH A;  2CLY C;  4F6R C;  2J47 A;  4IDQ A;  2W67 A;  4AKL A;  5AQV B;  3ZMV B;  2B1E A;  5JR9 A;  2HN1 A;  3ZCI A;  5AQL B;  2NW9 A;  3E22 E;  3ZYL A;  1IBK T;  3I0O A;  3OBV E;  2VQF T;  4U72 A;  3RIU A;  1L0V A;  5AQK B;  1JNZ A;  5L4E A;  3DTO A;  4DR4 T;  1YD8 G;  3U3I A;  2ACX A;  4X64 T;  4U2Z A;  3C98 B;  2X0H A;  3B13 A;  3AAI A;  4P1N A;  3LDQ B;  4XZC A;  3AE9 A;  3KBU A;  1HTJ F;  1HX8 A;  3P7I A;  4YJ3 E;  5HYA A;  3AE1 A;  3CQC B;  3H3M A;  2LSK A;  5L3G B;  4CN1 A;  5C8Y E;  4TWH A;  5JDL A;  2BVM A;  2L8K A;  3F31 A;  3SS1 A;  4KI0 F;  5L4H A;  2P9B A;  2IC9 A;  1MMA A;  2XQY A;  2N9D A;  3NVO A;  2UXN B;  3CPZ A;  2BG9 C;  2XAS B;  5JTG A;  5LHG B;  4Q25 A;  4GK0 E;  5LCY A;  2CMR A;  4JI2 T;  3CX6 B;  2I6H A;  5JVD E;  2A9U A;  5JDF A;  5E0O A;  2MOZ A;  2LKH A;  4IDP A;  1HF8 A;  2WDR A;  3OJA A;  4DV2 T;  4IDO A;  2WU2 A;  4QXC B;  2PJQ A;  2X67 A;  3UUX B;  3O9X A;  3AA1 B;  4EZH A;  4CXX A;  2D9D A;  5LG3 A;  4H9P C;  2LSY A;  3ESL A;  5H6Q B;  2Y6X A;  4TNV A;  4PJN A;  3I1A A;  1MMN A;  4LF6 T;  4B3M T;  5HEU A;  2IW5 B;  1Z8U A;  3PU3 A;  1HFA A;  3Q9D A;  2WB5 A;  2ACZ A;  1VCS A;  2CHN A;  4UXN B;  2LSI A;  4LF7 T;  5ABG A;  2F4V T;  4HGA A;  3R6N A;  4DV1 T;  4DV6 T;  4K0K T;  4TZ4 C;  2CXD A;  4P09 A;  4EV6 A;  4IHJ E;  1LRZ A;  5F5W A;  2V6Y A;  3RC8 A;  2KXP B;  2DL1 A;  2D0T A;  1FIO A;  3HI2 A;  2MBG A;  2C5K T;  3KVA A;  4JUY A;  2MAW A;  3BK9 A;  1N32 T;  4YSX A;  5GON E;  5CB4 E;  2XQ7 A;  2WDV A;  2I0M A;  3SWH A;  5J2U E;  4WBO A;  5AQJ B;  4GYS A;  4EYU A;  3ZYK A;  2WDQ A;  1D0Z A;  5L47 A;  1H7C A;  2A72 A;  1QUU A;  5J2T E;  5IYZ E;  4MBQ A;  1IBL T;  4HTE A;  4U2Y A;  4NUV A;  1VCT A;  5HXS A;  4IL9 A;  2XM2 A;  3KV4 A;  4AIU A;  1XDP A;  3KFW X;  2WWV A;  4KHZ F;  4HFV A;  2BG9 A;  5LG4 A;  3RPU A;  3FBZ A;  2JQQ A;  4HEA A;  4I4T E;  5AQG B;  2JRK A;  1HR0 T;  2FBW A;  4MFR A;  4HFD A;  2CLY B;  2Q9Q A;  3VRA A;  3AAA B;  4DV3 T;  3QC9 A;  5J1G A;  1WR6 A;  3RKO A;  2N1G A;  2Z6E A;  3P8C D;  1SUM B;  1SA0 E;  3FZK B;  3FZM B;  3UQ7 A;  1O3X A;  2ODU A;  3C64 A;  1VOM A;  2WM9 A;  3FB2 A;  5DQV A;  4E7S A;  1MIV A;  1IJ6 A;  5ABE A;  2RA1 A;  3ETU A;  1KK7 A;  3ABV A;  4YT0 A;  3PE0 A;  4JI1 T;  4QH4 A;  2X9Y A;  4OYK A;  5LA6 E;  3AA0 B;  4ANJ A;  2PG8 A;  2XAQ B;  1U4Q A;  5JH7 E;  3RYH E;  3C4X A;  1UX5 A;  2C0S A;  3ZSS A;  3DP7 A;  2FJA A;  3MAC A;  4YSZ A;  2W00 A;  2JQH A;  2K3W A;  1WR0 A;  4KX6 A;  4I0U A;  1HNX T;  1X79 A;  2IC6 A;  4BJN A;  3G06 A;  1UCU A;  2X0Y A;  3PV0 F;  3AE5 A;  2YKS A;  4DBR A;  5HWX A;  2HPJ A;  2Q9Q B;  4TWF A;  4CI1 B;  2LM2 A;  1NWM X;  2IHR 1;  3OTO T;  2Q9Q D;  3P4S A;  5CA1 E;  3A7M A;  3CX7 B;  4UV9 B;  3JCF A;  3RQW A;  1R8I A;  2YOE A;  3RIU C;  3FZL B;  1WCR A;  2LRK A;  3ONJ A;  2CPT A;  2ZLY A;  1T72 A;  3LJC A;  4A97 A;  4OHF A;  3EAB A;  4YLH A;  1S94 A;  2MPK A;  4ZHQ E;  1W0A A;  4ILC A;  5HEO A;  1MMG A;  5AQQ B;  3ZC0 A;  3HKB E;  4ILA A;  1G73 A;  1T98 A;  4U31 A;  3TLW A;  3DJB A;  1N34 T;  5DAB A;  3Q5W A;  3UFG A;  5FXX A;  4DR3 T;  2LJL A;  3P4R A;  2DNX A;  4O8S A;  4NXN T;  1WYB A;  1YKE B;  4DUZ T;  4IL4 A;  3ZT7 A;  1KNZ A;  4IE7 A;  2DI4 A;  4B3R T;  2ZM0 A;  2CWO A;  2LT3 A;  4F8H A;  1T8B A;  2BG9 E;  2N2N A;  3O1H A;  3AAE B;  4YJ2 E;  2WY2 A;  4YTN A;  2NW7 A;  4E7Z A;  2ODV A;  4KUM B;  3ANW B;  4DV5 T;  2IAK A;  4DID B;  2LE8 A;  3E08 A;  1KNP A;  1KNR A;  4PFP A;  2XQ5 A;  5L3F B;  2VK9 A;  4WYV A;  4YTP A;  4DUY T;  3CIR A;  2XM1 A;  2SPC A;  5FL1 A;  1OWA A;  2V7M A;  3FZH B;  4AXP A;  1XWM A;  3O4X E;  2JMK A;  3U78 A;  2YN6 A;  2YIN A;  4HFB A;  3HKD E;  4AQF A;  3ETV A;  4JI0 T;  3IHR A;  5KXJ A;  4NIQ A;  3B5M A;  4HFE A;  1MNE A;  4DBQ A;  2CCQ A;  2CHO A;  2BVL A;  4X1K E;  2VUR A;  4WNK A;  4EZ4 A;  4MHC A;  2V5D A;  2W0G A;  2AXD S;  4QH1 A;  3WAJ A;  2XAF B;  2XAH B;  3N2O A;  3PTR B;  1LKX A;  3MA9 A;  4OX9 T;  3F2E A;  4J2C A;  3GN5 B;  4CN4 A;  3VHL A;  5EK4 A;  3IEE A;  3RC3 A;  2C5J A;  3E0Z A;  3VU7 H;  2V7K A;  4ZXL A;  5FYM A;  1J5E T;  4TN7 B;  3KV6 A;  3K1S A;  4TNW A;  4Z90 A;  4JEU B;  2ES0 A;  4U74 A;  5LMU T;  5EK3 A;  4O4L E;  4DO0 A;  2EHO A;  3O1I A;  5ADX L;  4P0B A;  4U3C A;  4HE8 A;  2M67 A;  2W62 A;  4B3T T;  3EDV A;  3QUJ A;  3TLV A;  4BJM A;  5A1L A;  4XBF B;  5HWY A;  4EGW A;  4ZS2 A;  3JC6 D;  4QWN B;  3RYI E;  3PUX F;  1ZV4 X;  1CUN A;  5EZY E;  4QKN A;  1WFD A;  5TAO A;  2X9H A;  3ZMS B;  4ADZ A;  5CA0 E;  1QSD A;  4A98 A;  3BQL A;  3AA6 B;  1N36 T;  4EAH A;  3LBX A;  4IE5 A;  2DCF A;  5HXH A;  3RRW A;  5AQF B;  3JAF A;  5L2L A;  3RKG A;  2XSB A;  5FY0 A;  4TV9 E;  3NRY A;  2NTY A;  4IT4 A;  4OFZ A;  4H63 H;  3CWZ B;  5AQP B;  1E1H B;  2KIN B;  3A5X A;  3NWI A;  2Q9Q C;  3TLU A;  3RQU A;  3ZN1 B;  5ABF B;  1KEY A;  2YK0 A;  4JLE A;  1W0B A;  3PUW F;  3T8O A;  4TV8 E;  2EHO B;  3RHW A;  2UXB T;  5JRC A;  4AKG A;  2YDS A;  2XPK A;  2VB6 A;  3RF1 A;  2CE7 A;  2I59 A;  2EHO D;  5AQU B;  2JPF A;  2D0U A;  2D5U A;  5AQS B;  3UT5 E;  2KWI B;  4HN9 A;  1OED A;  4H9N C;  4EOZ B;  4PK4 A;  2KT9 A;  3UTK A;  4UEL A;  5AQN B;  5C3J A;  2NTX A;  1HG5 A;  2QYW A;  3ZPO A;  2XAJ B;  2A2F X;  5LBQ B;  3GMI A;  3LBX B;  4N78 D;  2BS2 A;  2QGS A;  3UU5 A;  1E2A A;  4ZZB A;  2DWG A;  3L3P A;  4JI6 T;  3L8R A;  2VVN A;  5AQI B;  2ZM8 A;  2K24 A;  2L3L A;  4UIG A;  1YW0 A;  1BR2 A;  4KMC A;  3O1J A;  1X9B A;  4DV7 T;  1UUS A;  4AQY T;  4HKA A;  4Z8X A;  1HNW T;  1LVF A;  4AKI A;  2NP9 A;  2W61 A;  3X1D A;  2QVA A;  4IE0 A;  1ZHC A;  4L0R A;  1FMW A;  5L3E B;  2NOX A;  3VR8 A;  4IE4 A;  3PJA J;  5L3C B;  5FY7 A;  2E9X A;  5JRC B;  4CQI A;  4H63 V;  3P4P A;  4QXB B;  4BAY B;  4IIJ E;  1M7K A;  4JYA T;  1BR1 A;  2X66 A;  4HWF A;  4O4H E;  5DQW A;  1OED B;  4DMV A;  3Q5X A;  3EHZ A;  4DR1 T;  4DV4 T;  2BKO A;  1HCI A;  3ZKR A;  4KHP T;  3KIN B;  2UU9 T;  5IUX A;  3BQK A;  4OK0 A;  2LSJ A;  3EI0 A;  2CM0 A;  4LF4 T;  5IHY A;  2W66 A;  2K48 A;  5HCM A;  1JNR A;  3CQX C;  3B57 A;  3RIF A;  2BS4 A;  4AI6 A;  5LOV E;  2X0L B;  4GK5 E;  4WBN E;  2XHE B;  2LSG A;  2V7I A;  3K3N A;  2KZ7 B;  4I43 B;  4YTM A;  5CJ5 A;  1LVK A;  1KFY A;  1W09 A;  5LJN A;  4ERR A;  5FKY A;  5JDQ A;  3EUH A;  3JC6 C;  3ZLI A;  4AQF C;  4JEH B;  3V5S A;  2HH7 A;  2E9X B;  4ZS3 A;  3AVR A;  3I9W A;  2KWH A;  3QOF A;  1DU2 A;  3RLF F;  1FEW A;  2WSS V;  2E9X D;  1D0X A;  3MZK B;  4AKR B;  1OED E;  3CML A;  3ZN0 B;  1V9D A;  2Y8D A;  5HXE A;  1XNR T;  3MXZ A;  5AQR B;  4HFC A;  3UUN A;  2WMN A;  3R84 B;  3N9O A;  2WBL A;  4G63 A;  3N2G E;  4AQG A;  2E5L T;  3ANW A;  3GWH A;  2LOS A;  2CWY A;  3CVR A;  2VKH A;  1ZOY A;  4IRE A;  4QH5 A;  3RH3 A;  4O2A E;  4X65 T;  3LG7 A;  1UX4 A;  1KF6 A;  3BQI A;  3KBT A;  4ZOL E;  4C90 A;  3UUB A;  2EHO C;  3IBP A;  2WU5 A;  4UEM A;  3AEB A;  2WS3 A;  3F57 A;  5AQH B;  5AQT B;  2VL8 A;  3MJX A;  1W9R A;  3CX8 B;  1M62 A;  2VKD A;  1QLB A;  2UUC T;  2VVS A;  4H9S E;  3RGL A;  1I94 T;  5HEG A;  3LK2 B;  2WWU A;  4O2B E;  3GA8 A;  3UU8 A;  3QNU A;  3GN5 A;  4LF5 T;  1OXZ A;  3ZT5 A;  2UXC T;  1Y64 B;  5IWA T;  2KND A;  5LP6 E;  5AQO B;  2FJD A;  4DV0 T;  2OLT A;  3AEA A;  3KV5 A;  2H89 A;  4ZZC A;  3EAM A;  2BKP A;  4K0U A;  3OKQ A;  1YKH B;  3N9N A;  2YDQ A;  4OYJ A;  5F3J A;  1T7S A;  4X66 T;  3C4W A;  2V6X A;  2JMH A;  1VRB A;  2WP9 A;  2H88 A;  3JAE A;  3N9Q A;  3QB5 K;  1NAF A;  2BDE A;  4IDN A;  2V5C A;  4MLK A;  3ZMZ B;  5JDH A;  2DHR A;  3RRC A;  2E2A A;  3L09 A;  1WRD A;  4LMJ A;  3PUA A;  4ASK A;  4JI8 T;  3NZP A;  2FJB A;  3PUZ F;  4HWC A;  5HXR A;  3N9P A;  4DND A;  4NUU A;  5CFB A;  1SE7 A;  2BS3 A;  2Y48 B;  1OED C;  2J4G A;  3AA7 B;  3P50 A;  3VKH A;  4EYY R;  4A56 A;  5LHH B;  4ZI2 D;  3VKG A;  5FMN A;  2LHN A;  4UVA B;  2LHR A;  2PTF A;  3WAK A;  3ZYM A;  5C2T A;  1HNZ T;  3SOL A;  2IUB A;  3PUV F;  2XQ9 A;  3FZF B;  4YHH T;  2XSA A;  5HXC A;  3ZMT B;  2CRB A;  3IA3 A;  2M6B A;  3P4W A;  3T1Y T;  2JIW A;  3Q5D A;  4JI3 T;  4DR6 T;  5LBM A;  4BA9 A;  4GKJ T;  3HKC E;  1MIW A;  4X5T A;  5HAX A;  1FMV A;  4JBW F;  5ABF A;  4WZX A;  3MKD A;  4YFS A;  4X1I E;  4COF A;  4CI2 B;  4QX7 B;  1YQ3 A;  3C50 A;  5LXT E;  3LFM A;  3KVB A;  2UXD T;  3ZST A;  3AE3 A;  3AE8 A;  2LRL A;  3PUG A;  4UV8 B;  4DMW A;  2NWB A;  2WZH A;  2WZI A;  2XZE A;  4UVC B;  2LOP A;  5HEH A;  1D1B A;  4JI4 T;  3C4Z A;  5LGN B;  4TUY E;  4GYR A;  3OPC A;  4NPP A;  2FJE A;  2E9X C;  2V26 A;  3UQ4 A;  2V1D B;  4EXT A;  4NXM T;  3IF8 B;  3PUS A;  2VL0 A;  3PUY F;  3D0T A;  2H3R A;  2HPL A;  4IGU A;  4YSY A;  3VR9 A;  2QA7 A;  3NZQ A;  5LB7 B;  4LF9 T;  4L9I A;  5FL0 A;  4U7Y A;  2D2S A;  1SHZ C;  3NBX X;  2X9X A;  3ZCJ A;  3WI3 A;  5FVL A;  2XQ8 A;  4H9Q C;  3CK6 A;  4U7I A;  2H7V C;  4MAL A;  2MYS A;  2UXX B;  3Q5E A;  3ZJ2 A;  2XY8 B;  2DWK A;  2GK9 A;  3PDY A;  2CEA A;  1UUR A;  4HFI A;  3I0Q A;  3ZMU B;  4B6X A;  3NRX A;  1G8X A; 
#chains in the Genus database with same CATH homology
 5AQU B;  5AQF B;  5AQN B;  1UGO A;  5AQG B;  1UK5 A;  1HX1 B;  3M3Z B;  4HWH A;  5AQS B;  5AQV B;  5AQQ B;  5AQH B;  3FZK B;  4HWC A;  5AQT B;  5AQJ B;  1T7S A;  3FZL B;  3FZM B;  4HWI B;  5AQP B;  5AQR B;  5AQL B;  3LDQ B;  3FZH B;  3FZF B;  1M62 A;  1I6Z A;  5AQM B;  5AQO B;  1M7K A;  4HWD A;  3A8Y C;  4HWF A;  5AQK B;  2D9D A;  5AQI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...