5AQGB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
b'GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqgB00
5AQJB 5AQNB 1M7KA 3M3ZB 5AQQB 1T7SA 5AQVB 5AQPB 4HWCA 4HWFA 3FZLB 3A8YC 5AQGB 5AQOB 1UGOA 5AQKB 5AQRB 5AQSB 3FZHB 5AQUB 1HX1B 4HWIB 1I6ZA 1UK5A 4HWHA 3FZMB 2D9DA 5AQFB 3FZKB 5AQLB 5AQTB 3FZFB 5AQHB 5AQMB 4HWDA 5AQIB 1M62A 3LDQB
chains in the Genus database with same CATH superfamily
1HFAA 2JQQA 2CXDA 3VR8A 1KK7A 4YFSA 3UU6A 5HXRA 1US7B 3JAEA 1FEWA 2C5KT 2X0HA 3UU5A 5HCJA 3IEEA 3KV5A 3CVRA 4HFEA 2V7LA 3BQKA 4L9IA 3PE0A 2EHOC 3ZPOA 2A2FX 2Y48B 3C64A 2VB6A 3L3PA 3AA6B 3LJCA 4X1IE 2IUBA 5H6RB 5FL0A 3KFWX 4AXPA 5C3JA 3P4RA 3UFEA 4E7ZA 1XNQT 3HR0A 3PJAJ 3NZPA 2I59A 2LJLA 3OYXA 5J2TE 2BS4A 5LGNB 5J1GA 3MACA 5FNVE 4X64T 3F2EA 3P8CD 1UUSA 2WB5A 3RGLA 2Q9QA 5JDMA 1LKXA 2V7KA 3ZT6A 3DJBA 4JI0T 2DL1A 2XZEA 3O1IA 2LSKA 1MMGA 3T8OA 2XQ6A 1HG5A 5TAOA 4IT4A 2C5IT 2LSIA 2VURA 2CBIA 3L39A 2X9YA 1NAFA 1S94A 5IYZE 4B3TT 4CZZB 3AE6A 3Q5WA 4ZZBA 4A56A 3C50A 4KBMB 3CWZB 2WDVA 3L8RA 2ES0A 4ADZA 2RP4A 4NXMT 3EDVA 3OKQA 2E2AA 2XJ7A 5JTGA 4X20E 2V8SV 1YQ4A 5AQNB 3M3ZB 4EYUA 1W0BA 2X9HA 3U3IA 3ONLC 2KXPB 4U2YA 4DUYT 5LHIB 2FJEA 2LSJA 2X0YA 1B7TA 2W00A 5HXSA 1WYCA 4PJMA 3E22E 4LF6T 3RYFE 4K0KT 5HEUA 2XAGB 4YY3T 3P50A 2E5VA 5LJMA 4Z8XA 5L2LA 4A5XA 3SRZA 3MXZA 3LFMA 1D1CA 5JDFA 4EEBA 4JI4T 2J62A 4AQFC 4GOUA 1JNRA 1QUUA 5KDMC 3OPCA 3ZMSB 3ZMZB 2DNXA 1WRDA 3AE9A 4MALA 3RKGA 1DU2A 3I9WA 3HKDE 5JH7E 5CJ5A 4COFA 2ZM2A 5FKYA 2IW5B 4Z91A 5L3EB 1LVKA 2OA5A 2V5DA 1LRZA 4MFRA 4IDOA 5HEGA 2UXDT 2E9XA 4ZXLA 3FXEB 4CN1A 4P0AA 3AAAB 3EI0A 4ILBA 4UR9A 2CWYA 3FZKB 1X9BA 2LM2A 2L9QA 3NRYA 5EK2A 4K0UA 5GONE 2BVLA 4XZCA 2LSYA 4UF0B 2KLQA 2VVNA 5L4EA 4IHJE 2UUCT 1T72A 5JRCB 3SFEA 2BBHA 3TLUA 2ZLYA 3ETVA 2KWHA 3I1AA 3UQ7A 3ZYLA 2AXDS 3EVYA 3ZMTB 3PUGA 4JYAT 1OWAA 3IF8B 3MA9A 1YD8G 1BR1A 1YQ3A 3GWHA 2HN2A 2UUAT 3L09A 4EZHA 3N9OA 2XPKA 1OEDC 4YHJA 4KI0F 3RYCE 1MMAA 2BBJA 2LOSA 4IE5A 3B57A 4AQYT 3RC8A 1D0YA 2X66A 4EB6E 2V6YB 3AECA 2LE8A 3WI3A 1MIVA 2DLRA 5AFUL 3EUHA 4YXDA 3ZMVB 3NZQA 4X65T 3UFGA 2WQYA 4CXWA 2DWKA 3X1DA 5HYAA 4DR5T 3PUYF 1D1BA 1U4QA 3OVUA 4IDQA 1VRBA 4L0RA 3UUMA 5AQGB 5AQOB 1SUMB 4YJ3E 4GKKT 3AEAA 2XQ3A 2KZ7B 4BJNA 5HXCA 2CRBA 2XHEB 1IBLT 5AQJB 5DQVA 4B6XA 3ZN0B 2XQ7A 2BZBA 1HX1B 2PFVA 3PJAA 4EOZB 1SA0E 3PV0F 2WS3A 5DJQC 3Q2MA 1J5ET 1BR0A 2OV9A 5AQIB 4H63V 3PUAA 5KMGP 2YDQA 1L0VA 4CQIA 4LFBT 2VKJA 3MJXA 3HA4A 2UUBT 3ZJ2A 1AJ3A 1D0XA 4EZ4A 1XMQT 4QXBB 5CA0E 3AEDA 4O4JE 4DV3T 2XQAA 2Z6EA 3JADA 2PJQA 4G2AA 1KFYA 2LSGA 4DMVA 2QGSA 2QA7A 5LOVE 3EAMA 4HWIB 5E0OA 1Z0PA 5L47A 3U78A 3AEBA 4NPPA 4AISA 2LKGA 2Q9QB 4LMJA 1KNRA 2QRXA 3QB5K 3ESLA 1HTJF 3A8YC 3AXJA 1ZHCA 1ZP0A 4QXCB 3TLVA 2J1DG 3N2KE 1S35A 2JMHA 4O8SA 2CWOA 2LT3A 3MZKB 4ISSA 4JEHB 2YN6A 4OX9T 2X9XA 1KNZA 3EHZA 4DBQA 5LGUB 3AA7B 4ZS3A 4HFCA 2ZM6T 1N32T 5FYMA 4JI2T 3M65A 3QNUA 2L8KA 2E8IA 3SWHA 4F6RC 2LM9A 5JR9B 1KNPA 4UV8B 3CQXC 1HCIA 4I0UA 2NTYA 5JDGA 3KV9A 2I0MA 2V5CA 5LMUT 3HI2A 4NUUA 3E0ZA 3ZLIA 2DWGA 2YDSA 3LDQB 4UEMA 4DBRA 4EEDA 3T1HT 2CHOA 4X66T 3AEFA 3VRAA 3I0QA 5FY0A 2DI4A 2AE9A 3AE2A 3PUZF 1NWMX 2G0UA 4ERRA 5KXJA 3P4PA 4DV1T 4J2CA 3CX6B 3HKEE 3RIUA 3RC3A 4PK6A 2KWIB 2WDRA 3CQCB 4U74A 4QH1A 3LK42 2KNDA 3HL6A 5M4YA 2XM2A 2D9DA 2V7JA 3ONXA 4TWDA 3NKZA 4LF9T 4PJNA 4H9SE 2LRKA 4H9NC 3ZN1B 3H3MA 5AQVB 2CXLA 4FI5A 4MBQA 4FJOA 4IREA 5CB4E 2N2NA 2WMNA 2XQ8A 5IUXA 3N9MA 3O1HA 3DTOA 3RYHE 2WM9A 3ONJA 5H6QB 4WW0A 4KX6A 4PAGA 2CPTA 3PU8A 2D2SA 4YSZA 2E9XB 4F8HA 4QXHB 1BR4A 4ZHQE 3N9PA 2WP9A 4IE0A 2IDOB 4PFPA 4IIJE 3KDSE 4UXNB 3PUWF 2KINB 5LG4A 5JDQA 4DR4T 4XBFB 3OBVE 3CX7B 5J0ZA 1IBKT 3OTOT 3AB3B 4HWFA 4JI7T 2W2UA 2VKDA 3ZT5A 2F4VT 1N33T 4UELA 3UU8A 4QH5A 4DV7T 4PK5A 2JQKA 4CXYA 3ZEFB 2VKHA 2BDEA 3ABVA 2CMRA 5JR9A 5LJNA 4WNKA 3K1SA 3BQIA 5F3JA 4OYKA 4U7YA 2A72A 3O4XE 2WAUA 3Q9DA 4HFIA 4CN4A 5L4HA 3VU7H 1HS7A 3IA3A 3J7Yq 3QC9A 4JI5T 2W62A 1HR0T 4TNVA 4LFAT 4HFDA 4IDPA 3AE4A 2M67A 3KV6A 3B13A 3NWIA 2UXCT 4U31A 3UQ4A 3Q5EA 2JPFA 2WU2A 4H9OC 4GK5E 4LMKA 4OFZA 3OYZA 2Y8DA 3ZJ1A 4U7IA 4NXNT 4ZS2A 3AVSA 4KHPT 3VKHA 5FVKA 2YEVC 5FVLA 4EXTA 4U33A 3T1YT 4NUVA 4ZI7E 4O2AE 4G63A 4BJMA 1IJ5A 2HHHT 4EV6A 5AQFB 3I9YA 3CMLA 3QUJA 3IBPA 1OXZA 2Y6XA 2DHRA 5ABFA 4LFCT 3RRCA 2WWUA 2JRKA 1IZNB 2NOXA 2YU1A 4B3RT 5HEHA 3N9NA 4TX5A 3SS1A 1M62A 2MPKA 1VCSA 2IMLA 4O4IE 4PFOA 2LHRA 3NBXX 3UUNA 3O1JA 1UCUA 5AQSB 2J47A 2Q9QD 4JI8T 3VHLA 4DMWA 3P7IA 3K3OA 5L3DB 3N5LA 3RHWA 2XSAA 3RIFA 1T98A 3UU3A 1U5PA 2QYWA 4DV2T 4IE4A 1MMNA 4TUYE 2JJ9A 4HFBA 3H3AA 2JMKA 4YTNA 3FZFB 4JI6T 4V1Av 3RRWA 3SFDA 2K5BB 3K8PC 4UIGA 4DV6T 4M1PA 2WWVA 3AXJB 2XAFB 1W09A 4DR7T 5FXVA 3EDUA 1XNRT 2Q9QC 4YTPA 3RPUA 5ABGA 2ACZA 2LLYA 2EHOA 4C90A 4LF7T 1V9DA 2CA5A 2GK9A 2D0TA 4PJLA 2D0UA 3FZMB 3OJAA 5AQHB 2IAKA 2V7MA 2XASB 4H9QC 2KSRA 2RPAA 3NVOA 2W0GA 1J1JA 4PK4A 3GA8A 2K24A 3ZMUB 3ZT7A 1W0AA 2V7IA 2NTXA 3R84B 1MIWA 5LB7B 1NEKA 4QX8B 2WSSV 4QWNB 1HX8A 1O3XA 1W9RA 2CBJA 2W61A 2BVMA 1HF8A 2CLYB 4YLHA 1XWMA 3C4WA 3UUXB 2FUPA 2VL0A 4QKNA 5HCMA 2DCFA 4B3MT 4YSXA 3TLTA 5L3FB 1JNZA 2K48A 3ZYKA 1YKEB 2D5UA 2BKNA 3LSVA 2HPLA 4IDNA 5JQGE 5HXEA 4HN9A 4HFVA 3AA1B 2E9XD 1SHZC 2LEHA 2PBIA 4LF8T 4HKAA 3TLWA 3QB5A 2IC9A 1T8BA 5FXXA 3H37A 1H7CA 4CI1B 2KT9A 2H89A 3FZHB 1QSDA 4HWHA 5LG3A 5ETWA 3SOLA 2HPJA 3AVRA 1XDOA 1MNDA 2E5LT 2X0LB 2ZM8A 2SPCA 2WZHA 4JEUB 4P1NA 2NW7A 5CA1E 3K3QC 3PURA 3GN5A 4ZOLE 5DABA 5L3CB 2W4XA 3GMIA 4AKHA 2YDRA 2NW9A 3BQLA 3C51A 2L3LA 3B5MA 5FL1A 2E9XC 1Y01A 3UU4A 4OK0A 2IIUA 2NWBA 3ZC0A 4TZ4C 4TWFA 3HKBE 4EAHA 4JUYA 3Q5DA 2FJAA 4KHZF 3UT5E 4AQFA 5JREA 3JAFA 1KF6A 3HKCE 2P9BA 2BS2A 2HH7A 4KMCA 4N78D 4IL4A 2XAJB 1YKHB 4AIUA 2JIWA 1IBMT 3NRXA 4WBNE 2IHR1 1G8XA 3Q5XA 4AI6A 4TN7B 3C4XA 1D1AA 2XM1A 4TNWA 4U3CA 2YOEA 2BKOA 5AQRB 5IWAT 4GYRA 1WR6A 2MTQA 1WLXA 2PTFA 4PJJA 2N1GA 1MNEA 2LKHA 3CK6A 3ZYMA 3ETUA 1IJ6A 3G06A 4QH4A 2B1EA 3ZCJA 4QX7B 4MLKA 2CM0A 3LK3B 1J5WA 5LP6E 2MOZA 2M6BA 4Z90A 5FMNA 3AEGA 4KUMB 5LBQB 2YINA 1I94T 4DUZT 3D0TA 4YJ2E 4WBOA 2A3DA 4JI1T 1QLBA 5BMVE 4LF4T 3RI5A 2W66A 3F57A 2IC6A 2X68A 3RF1A 1X79A 2YK0A 3QK6A 4HGAA 2M6IA 2JQHA 2XTLA 4YHHT 1MMDA 4DVDA 2XAHB 4ILUA 3AAIA 3PUQA 4BA9A 4CI2B 5ABFB 4I4TE 4IGUA 3LBXB 2XUEA 3S4UA 2R6GF 1WFDA 2XAQB 1VCTA 4NIQA 1OEDA 3CX8B 3ZSTA 2W67A 4HE8A 2BG9B 1HG2A 4CXXA 3RIAA 3V5UA 4I50E 4IDZA 2X67A 3QOFA 3AEEA 3ZC1A 1FMWA 4X5TA 1UX5A 5ABHA 4ZI2D 4UVCB 4MHCA 4H9PC 2VQET 1HNXT 3TLSA 3N9LA 2VWAA 5ADXL 4IE6A 2UXBT 1WR0A 1UK5A 4C91A 2C5JA 5FXZA 2CHNA 1HNWT 4XAXB 3FXDB 1N36T 4PNIA 3P4WA 4JV5T 4IE7A 4DV4T 2ZMAA 2H88A 2WY2A 3JCFA 2XQ4A 3R6NA 3ANWB 4ZI3D 2ODVA 2QVAA 3V5SA 2K3WA 3UUBA 2UU9T 1MIYA 2A9UA 5HEJA 5LXTE 3AE5A 2HN1A 2VKOA 2V6XA 3UULA 4JBWF 4ZI2C 5HXHA 5HAXA 3LK2B 3UTKA 5HWYA 5JVDE 3J9X1 2V26A 2X9WA 4EIWA 3PUSA 5A1LA 5LNKA 4AKGA 2EHOB 4O2BE 1ZEEA 2ODUA 2X51A 3K3NA 1XDPA 1BR2A 4AKIA 2NP9A 1I6ZA 5LGTB 3RH3A 3IHRA 5KX5E 4HTEA 5EK4A 3KV4A 3ZCIA 2LRLA 4ASKA 4ISTA 3WAJA 1ZKEA 3VKGA 3VRBA 3TKLB 4ZI3C 1N34T 1T7SA 2OLTA 4GK0E 2UXNB 4LMLA 4TV8E 2PG8A 2C0SA 1CUNA 2VL8A 5HWXA 2FBWA 2CEAA 2WZIA 1WCRA 4PW8A 5AQMB 3ZKRA 2WCAA 2CE7A 3LBXA 4DR1T 2UXXB 4WZXA 2WDQA 3RX6A 3KBTA 2BG9A 5AQUB 1FJGT 5C8YE 5C2TA 4LF5T 4E7SA 4DNDA 2YU2A 3CPZA 2CCQA 4TV9E 4DV0T 2CLYC 3MKDA 5LCYA 1HNZT 2VVSA 2XY8B 3FB2A 3P4SA 3DP7A 5FXWA 4DR3T 4JLEA 3VR9A 3E08A 2H7OA 1WYBA 2MBGA 4CI3B 3FBLA 3N2GE 3AA0B 3RIUC 4DR2T 5JDNA 2VQFT 4HEAA 2VK9A 5HEOA 2XQ5A 4X1KE 4UVAB 5AQLB 3PTRB 2YKSA 3ANWA 2XSBA 4GKJT 4ILCA 3RQWA 4U72A 5BR8T 3JC6D 1OEDE 4H9RC 5JDHA 2BKPA 3F31A 4I55E 4YT0A 4KP3C 4AQGA 2WBLA 3GN5B 3AE1A 4I43B 3CKDA 3N9QA 2J4GA 4JI3T 3PDYA 1D0ZA 3FBZA 2WMOA 4ILAA 4Q25A 4U2ZA 2LOPA 3W15B 3A5XA 2NR4A 3A7MA 5JDLA 5AQPB 3LG7A 4UV9B 1UGOA 4A97A 4A98A 4X62T 1UX4A 1XZYA 1LVFA 4OHFA 3KVBA 4IL9A 1SE7A 4ANJA 4DO0A 1E7PA 1YXRA 3PUXF 2XQ9A 5LMNT 5LHHB 5FY7A 4B3ST 2BS3A 5CGMA 4YSYA 5F8PA 1FIOA 3JC6C 2XQYA 4P09A 2N9DA 4DIDB 4ZEYA 2JQ9A 2FJBA 3C4ZA 5EZYE 5JR9C 2W63A 4GYSA 1E2AA 3PU3A 4AKLA 5LA6E 4O4HE 5DQWA 1G73A 2H7VC 5FP3A 3KVAA 3I0OA 4WYVA 2WU5A 4OYJA 5ABEA 1UURA 3MK7C 1IAPA 5IHYA 5LBMA 4DV5T 1KEYA 3AE8A 4UVBB 5L3GB 2NW8A 2H3RA 3C98B 5AQTB 2RA1A 3AE7A 3N2OA 2CXFA 1FMVA 4UF0A 2MAWA 5LHGB 2B76A 3FZLB 4EGWA 2ZM0A 4TWHA 5FY1A 2LHNA 3PUVF 5JRCA 3P4QA 2MYSA 2I6HA 5EK3A 4CN6A 2V1DB 3FHNA 2K9AA 1Z8UA 4P0BA 4QHOA 2FJDA 1NENA 1ZOYA 2KMFA 2VASA 2BG9E 1OEDB 5F5WA 3BK9A 5LYJE 3EABA 5L3BB 1Y64B 4HFHA 3O9XA 1VOMA 3WAKA 2BG9C 4YTMA 1XMOT 4EYYR 4DR6T 3KINB 4GIWA 3RQUA 3RYIE 4ZZCA 3ZSSA 1R8IA 4H63H 2V6YA 3CQGB 3CIRA 1M7KA 4BAYB 5AQQB 4HWCA 5CFBA 3AAEB 3RKOA 1GQEA 1YW0A 5AQKB 2EHOD 1EZ3A 2ACXA 1E1HB 4L5GA 4AKRB 1ZV4X 3AE3A 4HWDA 3RLFF 1CHUA 3KBUA 5J2UE 4O4LE 4X1YE
chains in the Genus database with same CATH topology
5AQJB 5AQNB 1M7KA 3M3ZB 5AQQB 1T7SA 5AQVB 5AQPB 4HWCA 4HWFA 3FZLB 3A8YC 5AQGB 5AQOB 1UGOA 5AQKB 5AQRB 5AQSB 3FZHB 5AQUB 1HX1B 4HWIB 1I6ZA 1UK5A 4HWHA 3FZMB 2D9DA 5AQFB 3FZKB 5AQLB 5AQTB 3FZFB 5AQHB 5AQMB 4HWDA 5AQIB 1M62A 3LDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ B;  5AQN B;  1M7K A;  3M3Z B;  5AQQ B;  1T7S A;  5AQV B;  5AQP B;  4HWC A;  4HWF A;  3FZL B;  3A8Y C;  5AQG B;  5AQO B;  1UGO A;  5AQK B;  5AQR B;  5AQS B;  3FZH B;  5AQU B;  1HX1 B;  4HWI B;  1I6Z A;  1UK5 A;  4HWH A;  3FZM B;  2D9D A;  5AQF B;  3FZK B;  5AQL B;  5AQT B;  3FZF B;  5AQH B;  5AQM B;  4HWD A;  5AQI B;  1M62 A;  3LDQ B; 
#chains in the Genus database with same CATH topology
 1HFA A;  2JQQ A;  2CXD A;  3VR8 A;  1KK7 A;  4YFS A;  3UU6 A;  5HXR A;  1US7 B;  3JAE A;  1FEW A;  2C5K T;  2X0H A;  3UU5 A;  5HCJ A;  3IEE A;  3KV5 A;  3CVR A;  4HFE A;  2V7L A;  3BQK A;  4L9I A;  3PE0 A;  2EHO C;  3ZPO A;  2A2F X;  2Y48 B;  3C64 A;  2VB6 A;  3L3P A;  3AA6 B;  3LJC A;  4X1I E;  2IUB A;  5H6R B;  5FL0 A;  3KFW X;  4AXP A;  5C3J A;  3P4R A;  3UFE A;  4E7Z A;  1XNQ T;  3HR0 A;  3PJA J;  3NZP A;  2I59 A;  2LJL A;  3OYX A;  5J2T E;  2BS4 A;  5LGN B;  5J1G A;  3MAC A;  5FNV E;  4X64 T;  3F2E A;  3P8C D;  1UUS A;  2WB5 A;  3RGL A;  2Q9Q A;  5JDM A;  1LKX A;  2V7K A;  3ZT6 A;  3DJB A;  4JI0 T;  2DL1 A;  2XZE A;  3O1I A;  2LSK A;  1MMG A;  3T8O A;  2XQ6 A;  1HG5 A;  5TAO A;  4IT4 A;  2C5I T;  2LSI A;  2VUR A;  2CBI A;  3L39 A;  2X9Y A;  1NAF A;  1S94 A;  5IYZ E;  4B3T T;  4CZZ B;  3AE6 A;  3Q5W A;  4ZZB A;  4A56 A;  3C50 A;  4KBM B;  3CWZ B;  2WDV A;  3L8R A;  2ES0 A;  4ADZ A;  2RP4 A;  4NXM T;  3EDV A;  3OKQ A;  2E2A A;  2XJ7 A;  5JTG A;  4X20 E;  2V8S V;  1YQ4 A;  5AQN B;  3M3Z B;  4EYU A;  1W0B A;  2X9H A;  3U3I A;  3ONL C;  2KXP B;  4U2Y A;  4DUY T;  5LHI B;  2FJE A;  2LSJ A;  2X0Y A;  1B7T A;  2W00 A;  5HXS A;  1WYC A;  4PJM A;  3E22 E;  4LF6 T;  3RYF E;  4K0K T;  5HEU A;  2XAG B;  4YY3 T;  3P50 A;  2E5V A;  5LJM A;  4Z8X A;  5L2L A;  4A5X A;  3SRZ A;  3MXZ A;  3LFM A;  1D1C A;  5JDF A;  4EEB A;  4JI4 T;  2J62 A;  4AQF C;  4GOU A;  1JNR A;  1QUU A;  5KDM C;  3OPC A;  3ZMS B;  3ZMZ B;  2DNX A;  1WRD A;  3AE9 A;  4MAL A;  3RKG A;  1DU2 A;  3I9W A;  3HKD E;  5JH7 E;  5CJ5 A;  4COF A;  2ZM2 A;  5FKY A;  2IW5 B;  4Z91 A;  5L3E B;  1LVK A;  2OA5 A;  2V5D A;  1LRZ A;  4MFR A;  4IDO A;  5HEG A;  2UXD T;  2E9X A;  4ZXL A;  3FXE B;  4CN1 A;  4P0A A;  3AAA B;  3EI0 A;  4ILB A;  4UR9 A;  2CWY A;  3FZK B;  1X9B A;  2LM2 A;  2L9Q A;  3NRY A;  5EK2 A;  4K0U A;  5GON E;  2BVL A;  4XZC A;  2LSY A;  4UF0 B;  2KLQ A;  2VVN A;  5L4E A;  4IHJ E;  2UUC T;  1T72 A;  5JRC B;  3SFE A;  2BBH A;  3TLU A;  2ZLY A;  3ETV A;  2KWH A;  3I1A A;  3UQ7 A;  3ZYL A;  2AXD S;  3EVY A;  3ZMT B;  3PUG A;  4JYA T;  1OWA A;  3IF8 B;  3MA9 A;  1YD8 G;  1BR1 A;  1YQ3 A;  3GWH A;  2HN2 A;  2UUA T;  3L09 A;  4EZH A;  3N9O A;  2XPK A;  1OED C;  4YHJ A;  4KI0 F;  3RYC E;  1MMA A;  2BBJ A;  2LOS A;  4IE5 A;  3B57 A;  4AQY T;  3RC8 A;  1D0Y A;  2X66 A;  4EB6 E;  2V6Y B;  3AEC A;  2LE8 A;  3WI3 A;  1MIV A;  2DLR A;  5AFU L;  3EUH A;  4YXD A;  3ZMV B;  3NZQ A;  4X65 T;  3UFG A;  2WQY A;  4CXW A;  2DWK A;  3X1D A;  5HYA A;  4DR5 T;  3PUY F;  1D1B A;  1U4Q A;  3OVU A;  4IDQ A;  1VRB A;  4L0R A;  3UUM A;  5AQG B;  5AQO B;  1SUM B;  4YJ3 E;  4GKK T;  3AEA A;  2XQ3 A;  2KZ7 B;  4BJN A;  5HXC A;  2CRB A;  2XHE B;  1IBL T;  5AQJ B;  5DQV A;  4B6X A;  3ZN0 B;  2XQ7 A;  2BZB A;  1HX1 B;  2PFV A;  3PJA A;  4EOZ B;  1SA0 E;  3PV0 F;  2WS3 A;  5DJQ C;  3Q2M A;  1J5E T;  1BR0 A;  2OV9 A;  5AQI B;  4H63 V;  3PUA A;  5KMG P;  2YDQ A;  1L0V A;  4CQI A;  4LFB T;  2VKJ A;  3MJX A;  3HA4 A;  2UUB T;  3ZJ2 A;  1AJ3 A;  1D0X A;  4EZ4 A;  1XMQ T;  4QXB B;  5CA0 E;  3AED A;  4O4J E;  4DV3 T;  2XQA A;  2Z6E A;  3JAD A;  2PJQ A;  4G2A A;  1KFY A;  2LSG A;  4DMV A;  2QGS A;  2QA7 A;  5LOV E;  3EAM A;  4HWI B;  5E0O A;  1Z0P A;  5L47 A;  3U78 A;  3AEB A;  4NPP A;  4AIS A;  2LKG A;  2Q9Q B;  4LMJ A;  1KNR A;  2QRX A;  3QB5 K;  3ESL A;  1HTJ F;  3A8Y C;  3AXJ A;  1ZHC A;  1ZP0 A;  4QXC B;  3TLV A;  2J1D G;  3N2K E;  1S35 A;  2JMH A;  4O8S A;  2CWO A;  2LT3 A;  3MZK B;  4ISS A;  4JEH B;  2YN6 A;  4OX9 T;  2X9X A;  1KNZ A;  3EHZ A;  4DBQ A;  5LGU B;  3AA7 B;  4ZS3 A;  4HFC A;  2ZM6 T;  1N32 T;  5FYM A;  4JI2 T;  3M65 A;  3QNU A;  2L8K A;  2E8I A;  3SWH A;  4F6R C;  2LM9 A;  5JR9 B;  1KNP A;  4UV8 B;  3CQX C;  1HCI A;  4I0U A;  2NTY A;  5JDG A;  3KV9 A;  2I0M A;  2V5C A;  5LMU T;  3HI2 A;  4NUU A;  3E0Z A;  3ZLI A;  2DWG A;  2YDS A;  3LDQ B;  4UEM A;  4DBR A;  4EED A;  3T1H T;  2CHO A;  4X66 T;  3AEF A;  3VRA A;  3I0Q A;  5FY0 A;  2DI4 A;  2AE9 A;  3AE2 A;  3PUZ F;  1NWM X;  2G0U A;  4ERR A;  5KXJ A;  3P4P A;  4DV1 T;  4J2C A;  3CX6 B;  3HKE E;  3RIU A;  3RC3 A;  4PK6 A;  2KWI B;  2WDR A;  3CQC B;  4U74 A;  4QH1 A;  3LK4 2;  2KND A;  3HL6 A;  5M4Y A;  2XM2 A;  2D9D A;  2V7J A;  3ONX A;  4TWD A;  3NKZ A;  4LF9 T;  4PJN A;  4H9S E;  2LRK A;  4H9N C;  3ZN1 B;  3H3M A;  5AQV B;  2CXL A;  4FI5 A;  4MBQ A;  4FJO A;  4IRE A;  5CB4 E;  2N2N A;  2WMN A;  2XQ8 A;  5IUX A;  3N9M A;  3O1H A;  3DTO A;  3RYH E;  2WM9 A;  3ONJ A;  5H6Q B;  4WW0 A;  4KX6 A;  4PAG A;  2CPT A;  3PU8 A;  2D2S A;  4YSZ A;  2E9X B;  4F8H A;  4QXH B;  1BR4 A;  4ZHQ E;  3N9P A;  2WP9 A;  4IE0 A;  2IDO B;  4PFP A;  4IIJ E;  3KDS E;  4UXN B;  3PUW F;  2KIN B;  5LG4 A;  5JDQ A;  4DR4 T;  4XBF B;  3OBV E;  3CX7 B;  5J0Z A;  1IBK T;  3OTO T;  3AB3 B;  4HWF A;  4JI7 T;  2W2U A;  2VKD A;  3ZT5 A;  2F4V T;  1N33 T;  4UEL A;  3UU8 A;  4QH5 A;  4DV7 T;  4PK5 A;  2JQK A;  4CXY A;  3ZEF B;  2VKH A;  2BDE A;  3ABV A;  2CMR A;  5JR9 A;  5LJN A;  4WNK A;  3K1S A;  3BQI A;  5F3J A;  4OYK A;  4U7Y A;  2A72 A;  3O4X E;  2WAU A;  3Q9D A;  4HFI A;  4CN4 A;  5L4H A;  3VU7 H;  1HS7 A;  3IA3 A;  3J7Y q;  3QC9 A;  4JI5 T;  2W62 A;  1HR0 T;  4TNV A;  4LFA T;  4HFD A;  4IDP A;  3AE4 A;  2M67 A;  3KV6 A;  3B13 A;  3NWI A;  2UXC T;  4U31 A;  3UQ4 A;  3Q5E A;  2JPF A;  2WU2 A;  4H9O C;  4GK5 E;  4LMK A;  4OFZ A;  3OYZ A;  2Y8D A;  3ZJ1 A;  4U7I A;  4NXN T;  4ZS2 A;  3AVS A;  4KHP T;  3VKH A;  5FVK A;  2YEV C;  5FVL A;  4EXT A;  4U33 A;  3T1Y T;  4NUV A;  4ZI7 E;  4O2A E;  4G63 A;  4BJM A;  1IJ5 A;  2HHH T;  4EV6 A;  5AQF B;  3I9Y A;  3CML A;  3QUJ A;  3IBP A;  1OXZ A;  2Y6X A;  2DHR A;  5ABF A;  4LFC T;  3RRC A;  2WWU A;  2JRK A;  1IZN B;  2NOX A;  2YU1 A;  4B3R T;  5HEH A;  3N9N A;  4TX5 A;  3SS1 A;  1M62 A;  2MPK A;  1VCS A;  2IML A;  4O4I E;  4PFO A;  2LHR A;  3NBX X;  3UUN A;  3O1J A;  1UCU A;  5AQS B;  2J47 A;  2Q9Q D;  4JI8 T;  3VHL A;  4DMW A;  3P7I A;  3K3O A;  5L3D B;  3N5L A;  3RHW A;  2XSA A;  3RIF A;  1T98 A;  3UU3 A;  1U5P A;  2QYW A;  4DV2 T;  4IE4 A;  1MMN A;  4TUY E;  2JJ9 A;  4HFB A;  3H3A A;  2JMK A;  4YTN A;  3FZF B;  4JI6 T;  4V1A v;  3RRW A;  3SFD A;  2K5B B;  3K8P C;  4UIG A;  4DV6 T;  4M1P A;  2WWV A;  3AXJ B;  2XAF B;  1W09 A;  4DR7 T;  5FXV A;  3EDU A;  1XNR T;  2Q9Q C;  4YTP A;  3RPU A;  5ABG A;  2ACZ A;  2LLY A;  2EHO A;  4C90 A;  4LF7 T;  1V9D A;  2CA5 A;  2GK9 A;  2D0T A;  4PJL A;  2D0U A;  3FZM B;  3OJA A;  5AQH B;  2IAK A;  2V7M A;  2XAS B;  4H9Q C;  2KSR A;  2RPA A;  3NVO A;  2W0G A;  1J1J A;  4PK4 A;  3GA8 A;  2K24 A;  3ZMU B;  3ZT7 A;  1W0A A;  2V7I A;  2NTX A;  3R84 B;  1MIW A;  5LB7 B;  1NEK A;  4QX8 B;  2WSS V;  4QWN B;  1HX8 A;  1O3X A;  1W9R A;  2CBJ A;  2W61 A;  2BVM A;  1HF8 A;  2CLY B;  4YLH A;  1XWM A;  3C4W A;  3UUX B;  2FUP A;  2VL0 A;  4QKN A;  5HCM A;  2DCF A;  4B3M T;  4YSX A;  3TLT A;  5L3F B;  1JNZ A;  2K48 A;  3ZYK A;  1YKE B;  2D5U A;  2BKN A;  3LSV A;  2HPL A;  4IDN A;  5JQG E;  5HXE A;  4HN9 A;  4HFV A;  3AA1 B;  2E9X D;  1SHZ C;  2LEH A;  2PBI A;  4LF8 T;  4HKA A;  3TLW A;  3QB5 A;  2IC9 A;  1T8B A;  5FXX A;  3H37 A;  1H7C A;  4CI1 B;  2KT9 A;  2H89 A;  3FZH B;  1QSD A;  4HWH A;  5LG3 A;  5ETW A;  3SOL A;  2HPJ A;  3AVR A;  1XDO A;  1MND A;  2E5L T;  2X0L B;  2ZM8 A;  2SPC A;  2WZH A;  4JEU B;  4P1N A;  2NW7 A;  5CA1 E;  3K3Q C;  3PUR A;  3GN5 A;  4ZOL E;  5DAB A;  5L3C B;  2W4X A;  3GMI A;  4AKH A;  2YDR A;  2NW9 A;  3BQL A;  3C51 A;  2L3L A;  3B5M A;  5FL1 A;  2E9X C;  1Y01 A;  3UU4 A;  4OK0 A;  2IIU A;  2NWB A;  3ZC0 A;  4TZ4 C;  4TWF A;  3HKB E;  4EAH A;  4JUY A;  3Q5D A;  2FJA A;  4KHZ F;  3UT5 E;  4AQF A;  5JRE A;  3JAF A;  1KF6 A;  3HKC E;  2P9B A;  2BS2 A;  2HH7 A;  4KMC A;  4N78 D;  4IL4 A;  2XAJ B;  1YKH B;  4AIU A;  2JIW A;  1IBM T;  3NRX A;  4WBN E;  2IHR 1;  1G8X A;  3Q5X A;  4AI6 A;  4TN7 B;  3C4X A;  1D1A A;  2XM1 A;  4TNW A;  4U3C A;  2YOE A;  2BKO A;  5AQR B;  5IWA T;  4GYR A;  1WR6 A;  2MTQ A;  1WLX A;  2PTF A;  4PJJ A;  2N1G A;  1MNE A;  2LKH A;  3CK6 A;  3ZYM A;  3ETU A;  1IJ6 A;  3G06 A;  4QH4 A;  2B1E A;  3ZCJ A;  4QX7 B;  4MLK A;  2CM0 A;  3LK3 B;  1J5W A;  5LP6 E;  2MOZ A;  2M6B A;  4Z90 A;  5FMN A;  3AEG A;  4KUM B;  5LBQ B;  2YIN A;  1I94 T;  4DUZ T;  3D0T A;  4YJ2 E;  4WBO A;  2A3D A;  4JI1 T;  1QLB A;  5BMV E;  4LF4 T;  3RI5 A;  2W66 A;  3F57 A;  2IC6 A;  2X68 A;  3RF1 A;  1X79 A;  2YK0 A;  3QK6 A;  4HGA A;  2M6I A;  2JQH A;  2XTL A;  4YHH T;  1MMD A;  4DVD A;  2XAH B;  4ILU A;  3AAI A;  3PUQ A;  4BA9 A;  4CI2 B;  5ABF B;  4I4T E;  4IGU A;  3LBX B;  2XUE A;  3S4U A;  2R6G F;  1WFD A;  2XAQ B;  1VCT A;  4NIQ A;  1OED A;  3CX8 B;  3ZST A;  2W67 A;  4HE8 A;  2BG9 B;  1HG2 A;  4CXX A;  3RIA A;  3V5U A;  4I50 E;  4IDZ A;  2X67 A;  3QOF A;  3AEE A;  3ZC1 A;  1FMW A;  4X5T A;  1UX5 A;  5ABH A;  4ZI2 D;  4UVC B;  4MHC A;  4H9P C;  2VQE T;  1HNX T;  3TLS A;  3N9L A;  2VWA A;  5ADX L;  4IE6 A;  2UXB T;  1WR0 A;  1UK5 A;  4C91 A;  2C5J A;  5FXZ A;  2CHN A;  1HNW T;  4XAX B;  3FXD B;  1N36 T;  4PNI A;  3P4W A;  4JV5 T;  4IE7 A;  4DV4 T;  2ZMA A;  2H88 A;  2WY2 A;  3JCF A;  2XQ4 A;  3R6N A;  3ANW B;  4ZI3 D;  2ODV A;  2QVA A;  3V5S A;  2K3W A;  3UUB A;  2UU9 T;  1MIY A;  2A9U A;  5HEJ A;  5LXT E;  3AE5 A;  2HN1 A;  2VKO A;  2V6X A;  3UUL A;  4JBW F;  4ZI2 C;  5HXH A;  5HAX A;  3LK2 B;  3UTK A;  5HWY A;  5JVD E;  3J9X 1;  2V26 A;  2X9W A;  4EIW A;  3PUS A;  5A1L A;  5LNK A;  4AKG A;  2EHO B;  4O2B E;  1ZEE A;  2ODU A;  2X51 A;  3K3N A;  1XDP A;  1BR2 A;  4AKI A;  2NP9 A;  1I6Z A;  5LGT B;  3RH3 A;  3IHR A;  5KX5 E;  4HTE A;  5EK4 A;  3KV4 A;  3ZCI A;  2LRL A;  4ASK A;  4IST A;  3WAJ A;  1ZKE A;  3VKG A;  3VRB A;  3TKL B;  4ZI3 C;  1N34 T;  1T7S A;  2OLT A;  4GK0 E;  2UXN B;  4LML A;  4TV8 E;  2PG8 A;  2C0S A;  1CUN A;  2VL8 A;  5HWX A;  2FBW A;  2CEA A;  2WZI A;  1WCR A;  4PW8 A;  5AQM B;  3ZKR A;  2WCA A;  2CE7 A;  3LBX A;  4DR1 T;  2UXX B;  4WZX A;  2WDQ A;  3RX6 A;  3KBT A;  2BG9 A;  5AQU B;  1FJG T;  5C8Y E;  5C2T A;  4LF5 T;  4E7S A;  4DND A;  2YU2 A;  3CPZ A;  2CCQ A;  4TV9 E;  4DV0 T;  2CLY C;  3MKD A;  5LCY A;  1HNZ T;  2VVS A;  2XY8 B;  3FB2 A;  3P4S A;  3DP7 A;  5FXW A;  4DR3 T;  4JLE A;  3VR9 A;  3E08 A;  2H7O A;  1WYB A;  2MBG A;  4CI3 B;  3FBL A;  3N2G E;  3AA0 B;  3RIU C;  4DR2 T;  5JDN A;  2VQF T;  4HEA A;  2VK9 A;  5HEO A;  2XQ5 A;  4X1K E;  4UVA B;  5AQL B;  3PTR B;  2YKS A;  3ANW A;  2XSB A;  4GKJ T;  4ILC A;  3RQW A;  4U72 A;  5BR8 T;  3JC6 D;  1OED E;  4H9R C;  5JDH A;  2BKP A;  3F31 A;  4I55 E;  4YT0 A;  4KP3 C;  4AQG A;  2WBL A;  3GN5 B;  3AE1 A;  4I43 B;  3CKD A;  3N9Q A;  2J4G A;  4JI3 T;  3PDY A;  1D0Z A;  3FBZ A;  2WMO A;  4ILA A;  4Q25 A;  4U2Z A;  2LOP A;  3W15 B;  3A5X A;  2NR4 A;  3A7M A;  5JDL A;  5AQP B;  3LG7 A;  4UV9 B;  1UGO A;  4A97 A;  4A98 A;  4X62 T;  1UX4 A;  1XZY A;  1LVF A;  4OHF A;  3KVB A;  4IL9 A;  1SE7 A;  4ANJ A;  4DO0 A;  1E7P A;  1YXR A;  3PUX F;  2XQ9 A;  5LMN T;  5LHH B;  5FY7 A;  4B3S T;  2BS3 A;  5CGM A;  4YSY A;  5F8P A;  1FIO A;  3JC6 C;  2XQY A;  4P09 A;  2N9D A;  4DID B;  4ZEY A;  2JQ9 A;  2FJB A;  3C4Z A;  5EZY E;  5JR9 C;  2W63 A;  4GYS A;  1E2A A;  3PU3 A;  4AKL A;  5LA6 E;  4O4H E;  5DQW A;  1G73 A;  2H7V C;  5FP3 A;  3KVA A;  3I0O A;  4WYV A;  2WU5 A;  4OYJ A;  5ABE A;  1UUR A;  3MK7 C;  1IAP A;  5IHY A;  5LBM A;  4DV5 T;  1KEY A;  3AE8 A;  4UVB B;  5L3G B;  2NW8 A;  2H3R A;  3C98 B;  5AQT B;  2RA1 A;  3AE7 A;  3N2O A;  2CXF A;  1FMV A;  4UF0 A;  2MAW A;  5LHG B;  2B76 A;  3FZL B;  4EGW A;  2ZM0 A;  4TWH A;  5FY1 A;  2LHN A;  3PUV F;  5JRC A;  3P4Q A;  2MYS A;  2I6H A;  5EK3 A;  4CN6 A;  2V1D B;  3FHN A;  2K9A A;  1Z8U A;  4P0B A;  4QHO A;  2FJD A;  1NEN A;  1ZOY A;  2KMF A;  2VAS A;  2BG9 E;  1OED B;  5F5W A;  3BK9 A;  5LYJ E;  3EAB A;  5L3B B;  1Y64 B;  4HFH A;  3O9X A;  1VOM A;  3WAK A;  2BG9 C;  4YTM A;  1XMO T;  4EYY R;  4DR6 T;  3KIN B;  4GIW A;  3RQU A;  3RYI E;  4ZZC A;  3ZSS A;  1R8I A;  4H63 H;  2V6Y A;  3CQG B;  3CIR A;  1M7K A;  4BAY B;  5AQQ B;  4HWC A;  5CFB A;  3AAE B;  3RKO A;  1GQE A;  1YW0 A;  5AQK B;  2EHO D;  1EZ3 A;  2ACX A;  1E1H B;  4L5G A;  4AKR B;  1ZV4 X;  3AE3 A;  4HWD A;  3RLF F;  1CHU A;  3KBU A;  5J2U E;  4O4L E;  4X1Y E; 
#chains in the Genus database with same CATH homology
 5AQJ B;  5AQN B;  1M7K A;  3M3Z B;  5AQQ B;  1T7S A;  5AQV B;  5AQP B;  4HWC A;  4HWF A;  3FZL B;  3A8Y C;  5AQG B;  5AQO B;  1UGO A;  5AQK B;  5AQR B;  5AQS B;  3FZH B;  5AQU B;  1HX1 B;  4HWI B;  1I6Z A;  1UK5 A;  4HWH A;  3FZM B;  2D9D A;  5AQF B;  3FZK B;  5AQL B;  5AQT B;  3FZF B;  5AQH B;  5AQM B;  4HWD A;  5AQI B;  1M62 A;  3LDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...