3QUJA

Crystal structure of the phosphonate binding protein, phnd, from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
301
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 100
structure length 301
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qujA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA02
4JB7A 3GXAA 4DCYA 3GLBA 3VLWA 2XX8A 1B32A 2ALUA 2QPQA 4UA8A 1US5A 3KSJA 4GL8A 4IO7A 1TFDA 3TQWA 1F9BA 4Q5TA 5JEIA 2XD2A 2QS3A 5CMMA 2IC9A 3U1OA 3JV9A 1MQJA 3LSLA 3PV0E 1FTLA 2F78A 1US4A 2D3IA 2UYFA 5I57A 1PB9A 3LR1A 2Y7PA 1HSJA 3FV1A 3ODBA 3QYTA 3PMXA 5DTBA 3FVKA 4OMBA 1FCKA 4FI5A 3AXFA 1LB9A 1TT1A 5H8HB 3CSGA 3KN7A 1H43A 1JW5A 3TZAA 3TTRA 1M5BA 4ESWA 1N3WA 2DXRA 4JWXA 4ZEIA 4NF8B 5IAIA 2Z8DA 1OQGA 1OVTA 2DVZA 4PFYA 2XXPA 4OENA 2ONSA 1L5TA 1P99A 1EZPA 1B3HA 3WAEA 4I1DA 3CFLA 1AOVA 4WKMA 4I62A 4OEVA 3IOTA 4IY5A 1I6BA 4LVQA 3A3CA 1DMBA 1OLAA 4G8NA 4GD5A 5TU0A 3FJ7A 3TYHA 2XXYA 1MQIA 3BFUA 2F34A 3MJNA 3O6IA 4H5FA 4I8CA 5HBCA 2I3VA 3B6QA 4F3PA 4ZE9A 5A5XA 1O7TA 3IL1B 3IOUA 3K1NA 3OENA 4RPNA 2V3TA 3G7WA 4M4GA 1LB8A 2F36A 1Z7NE 2XXRA 4IGTA 1AH5A 3IORA 4R6KA 2G0UA 4F29A 1NL5A 2ONKE 1AMFA 5AA4B 2F7BA 1IXHA 2QMXA 3LBSA 3LC8A 3MP8A 3O6GA 4FIMA 4ELPA 1MY4A 2DVCA 2HAUA 3H6TA 3OMBA 3UK4A 3RNNA 3MXZA 2HZKA 2VD2A 4GFRA 4RPOA 2ZYKA 3FXDB 4ND9A 4R75A 4R72A 4H65A 1MQHA 3CIJA 4MLQA 4Z7EA 3T9UA 2HQ0A 2QRYA 2OBGA 3Q25A 3RT6B 3M3LA 4AB6A 5I2KB 1YCJA 3TEPA 1DTZA 5EHMA 3PPPA 1LAHE 3LUYA 3OOAA 2I58A 4YICA 1ZLQA 2G93A 2OJTA 4PQJA 5BWJA 5K2YA 1MS7A 4RXLA 2ZYOA 2UXAA 3PGFA 3EHSA 5FHNA 4U2RA 4NF6B 3B6TA 5TP9B 3SESA 2RC9A 3ZS6A 2H9BA 3L6GA 3FVOA 3RPWA 4F18A 3ZKLA 1LSTA 3S9EA 5AA2D 3N26A 4P0IA 1LCTA 3RTWB 3H6WA 3GBAA 3DP4A 4HCWA 1B3FA 3C36A 3A09A 4JDFA 3SETA 4EDPA 2V84A 3U8QA 4PP0A 4F19A 5HM4B 4H8JA 4EQ9A 2YLNA 1YAEA 3VE1B 4FE8A 2XXUA 5I58A 1VSOA 1Y20A 1D9YA 2UVJA 3B6WA 3N94A 4G68C 1N0TA 3G3JA 3MC2A 4U1OA 5L8DA 4DXBA 4QFLA 4BDLA 1I6QA 3T9HB 2Y7KA 1ZBMA 1MY1A 1B4ZA 3DP6A 4H1XA 1FQDA 1FTOA 2HCAA 3CSBA 4OVJA 4YB6A 5ELVA 4HS7A 4YB7A 2RC8A 4GXAA 4OHNA 2D21A 1B2HA 3VVFA 4B6XA 2WKYA 1MRPA 1B5HA 1FQEA 1FQCA 1SBPA 2X7PA 4L17A 4KYEA 4NF5A 4X1BA 5CI5A 4EUOA 1MQDA 2H4IA 2GFEA 3DLNA 3PPOA 1ZTYA 3H7MA 1B0HA 3GZGA 4GLIA 1PB8A 4R6HA 2ABHA 4J2CA 3CFXA 4QFOA 4WEDA 4IB2A 3V89B 2F6GA 3KFMA 4KYDA 4F2QA 2GH9A 4U23A 1RYOA 2DWHA 3SKPA 3EHUA 4DNDA 2XXWA 2XXQA 1IJ5A 1R1NA 3QIMA 1VE4A 1VFDA 2QS2A 3HSTA 3IR1A 4LQ5A 4WEPA 5F1QA 1USYH 4H5GA 4IY6A 4X48A 3TAJA 3E3KA 1B3LA 2HZLA 4XKPA 1JVYA 4GVOA 3N5LA 4WXJA 2GHAA 2AL5A 3RGYA 2E1SA 1NNTA 1PB7A 1IXGA 1QKBA 1XOCA 2V3UA 3PUXE 3Q28A 3MAMA 4OFOA 1PC3A 5FHOA 3T9XB 4ZEDA 4GQOA 1BLFA 1H45A 4KHZE 1SW5A 3IB2A 2R9JA 3USDA 4XXUA 1Y9UA 3PUVE 3G3HA 3CKDA 2GRVA 3N6UA 4Q0CA 3FGSA 5EYFA 4FAJA 3A3UA 3CVGA 4ZZAA 3V5AA 2I0CA 3KJTA 4OWDA 2Q88A 3IO4A 1MPCA 1RKMA 4KPTA 5JTYB 1SYHA 2DWJA 3VXBA 5KCJA 1Y4TA 1IJ6A 1FQBA 2D5WA 3QSLA 5J1DA 3PD9A 1PDAA 4BDOA 1A8EA 1QUJA 4DXCA 2I4BA 4F2OA 4ZEBA 5KCJB 2RF1A 1QJMA 3VXCA 1IIWA 1POY1 5H8FA 3S9MC 3V8XB 2HEUA 4CQIA 2ANJA 4GF8A 3CG1A 2KWHA 1DOTA 4YMAA 2O7IA 4NE4A 1PEBA 1OMPA 3BKIB 3PUYE 2F97A 3CG3A 2DOJA 3MVWA 4ELOA 2O1LA 1B46A 3ECRA 1QUKA 2OCUA 2F5XA 2P0SA 1LVFA 1UTBA 2QSXA 3LSXA 2Y7RA 4YKKA 2A5TB 1DTGA 1N3XA 3HCQA 4U22A 1EZ9A 2Y7WA 4YAHX 4ZS9A 4ZEKA 2I48A 1FQAA 3CRBA 4YZZA 4F22A 1Y1ZA 3K6WA 5FHMA 3T9VA 4FORA 1FW0A 1B3EA 4P0GA 3OEKA 4YU0A 2CA5A 2HFBA 4LATA 3UORA 4JSDA 3O28A 3ZSFA 1Y1MA 4ECFA 5A5XB 4JWOA 1A8FA 4EF2A 1B5IA 2F6PA 4OERA 2PT2A 3KJ7A 1DPPA 1OIBA 5AE4A 2A5SA 2Q2AA 1B6HA 3QUFA 5ITOA 2I4CA 4JSOA 3THIA 5F7VA 2XHDA 4RJZA 4Q30B 3VDFA 2DS9A 1MXVA 1UTHA 3MP1A 4KD5A 1H44A 2NOOA 3SDFA 1JW4A 2Y84A 5CMCA 3RLFE 4OYVA 4QFKA 3SEYA 4R9GA 4RYAA 2OZZA 3B7DA 4NF8A 3FXEB 1B4HA 3EF7A 1MDQA 1S7YA 3PPRA 1CB6A 4RY1A 5H8SA 4I9DA 5AA1A 1MG1A 4P11A 2IC6A 4NF5B 3VVDA 3MZ1A 2YJPA 2REJA 2FA7A 1MQGA 2OLBA 3KSXA 5CM6A 5IKBA 4N07A 4NMYA 2RKMA 2I6EA 2H99A 1A99A 1H7CA 3UIFA 2XTLA 3D4GA 5CRYA 4YKPA 2B3FA 5KZTA 1TFAA 4GRKA 5ICQA 4QF9A 4BLAA 5CMBA 3SERA 5I2KA 4QSCA 4IO4A 1CE2A 1MH3A 1N76A 1SW4A 1NH8A 1MY0A 3UP9A 2C5IT 1IZ1A 1BIYA 4OESA 2F35A 3FV2A 3U92A 4RA1A 1MPBA 2CZLA 2QJEA 3H06B 3EN3A 3FJGA 4IO3A 3PU5A 4PFTA 3MVYA 4FEDA 3FJMA 4G4PA 3U72A 4XTCQ 3RTFB 5JTYA 3KOTA 1AL3A 5CMKA 4OZ9A 4QHQA 1M5FA 1WODA 2O7UA 3I5OA 2I49A 3MWBA 4U21A 3TTLA 1B1HA 2Z22A 4IO5A 1LFIA 2PX1A 3KG2A 4MLVA 4JXIA 4X1DA 4DCXA 4QSEA 1IXIA 2F8DA 4N13A 4TLMB 1LBBA 2IEEA 5I59A 1UQWA 3MP6A 5AA2A 1B1XA 4XKNA 4OEUA 3FVNA 4U1ZA 2ZNUA 1H76A 3KZGA 3MUQA 5ICTA 4FECA 5DYHA 1A40A 3EHTA 4IO2A 3RY3A 1EZOA 1A54A 1I69A 1POTA 3G3FA 4H8IA 4FJPA 1QUIA 4LUBA 2ZNSA 5BUUA 5I58B 5L9SA 3V83A 1B9JA 1GGGA 2F7CA 1B7UA 1LRZA 4G77A 1QVSA 4YKIA 1P1NA 4C0RA 1B5JA 4R6YA 2W7YA 3G3KA 5FTIA 2O6AA 4BDRA 4E0WA 5AA3A 1P1WA 3TUSA 1N7WA 4ELRA 2VOZA 4ZZEA 5AA4A 2DWAA 1NNKA 1SW2A 3O97A 1QW0A 1N7XA 3E13X 1IEJA 1Z7ME 2AYSA 1QSDA 1BP5A 4GIZA 3IB1A 3IO6A 4ONYA 4DIGA 2R71A 4C1UA 4HW8A 1ZJLA 3Q27A 4THIA 2KWIB 4Q8RA 5K2XA 1Q1KA 4XKRA 1UTHB 1OVBA 1GVCA 3KOSA 5H8FB 4JWYA 3T96B 1NNPA 2FYIA 1ATGA 1MH4A 2RCAA 2X7QA 4TOZA 3MZ9A 5I2NA 4E0XA 4DZ1A 3SEXA 3FD3A 3K02A 3P7IA 3T93B 3K6XA 1FTKA 1URSA 2B3BA 3K1MA 2XD3A 3CR9A 3OO8A 3O9PA 3FASA 2OWTA 4KI0E 3K4UA 4POWA 4NEDA 1NNFA 2UYEA 5H8NB 4OETA 2NWJA 4HTGA 3U93A 3H3GA 2A5TA 3MQ9A 4H0WA 3DELB 4F3BA 5DT6A 4H6DA 2AL4A 2V3QA 3PMWA 2XXIA 1JQFA 1Q35A 3Q26A 1BTJA 1GV8A 1JVXA 5I59B 2X9XA 1B7HA 3IOVA 4ZE8A 2XXVA 1O63A 4OQOA 2X9WA 1SQYA 3S4UA 2IA4A 2PT1A 3PPNA 1XT8A 2O51A 2DP8A 2H5YA 2ONRA 3MPKA 1IITA 1B3GA 1PBQA 1HSEA 1VR5A 3HPIA 3JZJA 3MVXA 1NMUA 3O29A 3C9HA 1DSNA 1JEUA 3KGCA 3L6HA 3FXQA 4QRZA 5DVJA 3TTKA 2Y7IA 4OFJA 5TP9A 4ELQA 2QS1A 3W9WA 2UVIA 4KCDA 2ZXTA 1PBPA 2BJJX 3IJXB 3MBPA 1DPEA 1MXZA 3C31A 2F7AA 1EH3A 1FQFA 2HXWA 5ITPA 3TELA 1MY2A 3TMGA 1GTKA 4ESXA 3M8UA 4QFPA 3TODA 1URDA 4F31B 3TKDA 5DEXB 5CBRA 1UTBB 1S9TA 2ZMBA 5DVFA 3RN8A 2QS4A 3E4RA 3LSFB 1II5A 4YB5A 5L9OA 3FZVA 1HSLA 2DE3A 2PMSA 2X26A 3H03A 3O2AA 3R6UA 2P2AA 4GOTA 3L3PA 3UA8A 4EQBA 2RC7A 3TCGA 1USYE 4PFUA 5H8QA 4F1UA 3HO7A 1NFTA 3KN8A 3VFJA 2O69A 1QKAA 3PPQA 5CC2A 2H25A 4G68B 5ISUA 3VVEA 5I2NB 1IUDA 3H4ZA 3MPLA 3SEVA 1JW1A 1XC1A 2VP1A 5H8HA 1LFGA 1ANFA 2FNCA 2NXOA 2Q9TA 3IOWA 2DSFA 1M5DA 3TTMA 3MW0A 2RCBA 1B05A 3C32A 3GBBA 5FTHA 3IB0A 4KR5A 1SW1A 4R74A 3TQLA 1MPDA 4R2FA 3RQTA 4Z0IA 4F1VA 1LCFA 2I0BA 3N6TA 2MBGA 2AIXA 3DP8A 3QAXA 3EPEA 1JEVA 1VFEA 3FATA 1M5EA 1R9LA 1SYIA 1YPNA 3HV1A 1S50A 1A7LA 3HHFA 3KEIA 4NF4B 1NH7A 3OELA 2E0SA 3IK6B 3H6UA 3OXNA 3WAFA 4POXA 1LAGE 4YKJA 5I56A 3IJOB 1BKAA 4LONB 4MH5A 5H8QB 5TPAA 4AQ4A 3K6VA 5I84A 1LAXA 4XIGQ 1Z0PA 3OSQA 2DWIA 4NWCA 4TLLB 4X9TA 2ZYNA 1WDNA 2XX9A 5DVIA 1P1UA 5M2VA 1XVYA 1H3DA 1LLSA 3JYRA 3K00A 2DQVA 3TKLB 1KWHA 1SVXB 3TCHA 3HHGA 4O3BA 1FTJA 4YMBA 1MXYA 1D4NA 2PYYA 4H67A 3DM0A 4ISUA 4R9FA 3ZKKA 5B7DA 5I57B 3OO9A 4NF6A 4LZ5A 4DE8A 4L0RA 3R7XA 2V25A 1O64A 4KYSA 3FIRA 4AB5A 1JETA 4NTLA 5CBSA 2DE4A 5JK4A 4MF3A 3IAZA 2X9YA 4K3FA 4QSDA 3K01A 2K48A 2Z8FA 4IGRA 3OO6A 2NUVA 4LZ7A 3TCFA 3VLVA 5LOMA 1LFHA 3TFLA 4N6PA 2C5JA 3E9XA 1TWYA 4R2BA 4U4SA 5TPAB 4KFQA 3RT8A 4G8HA 4BDQA 3G3IA 1NKXA 3O66A 4KQPA 4EXKA 1ZIUA 3TPAA 2THIA 4KCCA 1IXCA 2OWSA 3PUWE 3S9NC 3KBRA 4F39A 4EYYR 1MY3A 1QULA 1XS5A 5H8NA 1B52A 5HPQA 4PETA 2Q8JA 1SDXA 3HN0A 3FXUA 4DDDA 2XXTA 3QK6A 3MZBA 1ZU0A 4OTEA 3ILTB 4MBPA 2NVUB 3BFTA 1IQ7A 1ELJA 1OQHA 4UACA 3TDJA 4C1TA 2UVGA 3CI8A 4LP2B 3R26A 4QFNA 3S9LC 3C33A 4U4XA 1ZMGA 1R9QA 2VHAA 4FEBA 1TXFA 2CMOA 1OLCA 2DXYA 4OXVA 4R73A 4BDNA 4F1YA 1SI0A 2OK2A 1Y3NA 1SD3A 1MM6A 1R6ZA 2HAVA 2P1SA 3BBRA 3M3FA 4GXSB 4PE5B 1LBCA 4EQ7A 1XHYA 2I3WA 3CFZA 1J1NA 2KLFA 3I3VA 3OD7A 5L9MA 3Q29A 4LQ2A 3S2VA 1M5CA 3SEWA 1YTVA 4PFWA 1LAFE 2G29A 4G8MA 3RUMA 2XXXA 3MVZA 4NF4A 1UIVA 4OFLA 1EU8A 2UVHA 1URGA 4MFIA 3ILUB 1B58A 3W15C 5B70A 3K1PA 2DE2A 3C35A 1P1OA 1P1QA 2REGA 1N84A 2GHBA 3OEMA 3PMVA 3CVRA 3QUJA 4TQUQ 2Z8EA 2VGQA 3IX1A 2ZYMA 4O3AA 4M1VA 1ZKEA 1WVJA 4GWOA 1D9VA 4HCYA 1Y3PA 1LGBC 2PBWA 3SEUA 3UN6A 4EF1A 3PD8A 2Q2CA 2ZNTA 1A55A 3K0VA 4ZEFA 1B40A 4DXUA 3G3GA 4LZ8A 2R6GE 4GL0A 1MDP1 5EHSA 5KDTA 5DEXA 2Z23A 2H98A 3TTNA 3KN3A 3U94A 1MM7A 1D3KA 3EQ1A 2O84X 3D4CA 3VLUA 3ONMA 2QMWA 3LSWA 4LA9A 3W9VA 4ZECA 1Y4CA 4G2ZA 4BDMA 1MXUA 3QXMA 4RNSA 2C5KT 2XX7A 4G68A 3K2DA 1XVXA 3FUZA 4ZDMA 1FTMA 2XXHA 3FVGA 4F3GA 1N04A 1ZKBA 2ESNA 2VD3A 4XKQA 2QL3A 3M3KA 2O68A 3F11A 2M8CA 3H6VA 3PUZE 1SI1A 2LAOA 1GR2A 4IO6A 4RK2A 3I6VA 1B0LA 4FATA 1AIVA 1B7ZA 4O3CA 1UIUA 3OO7A 3K6UA 3VV5A 3C4MA 4F3SA 1T0KA 4EXLA 3T66A 2DYXA 1B51A 3C34A 3UGWA 2B65A 5KDTB 2RINA 3O6HA 3FXRA 2V93A 2O1MA 1JNFA 2YPNA 3OSRA 4RK9A 5AA2B 1MXWA 2PVUA 4NWDA 3T22A 4JBZA 1MXXA 1RYXA 1Y3QA 2Q89A 4DLDA 5I56B 1I6AA
chains in the Genus database with same CATH superfamily
2VPNA 3GXAA 4JB7A 4DCYA 2RA1A 3BQLA 3N9MA 4UA8A 4PAIA 4YJ2E 5L3EB 3KSJA 3EKIA 1LKXA 2XA5A 5A5LA 3CQXC 5CMMA 2HHMA 3UFGA 5J2UE 1FTLA 2UYFA 1PB9A 3NRXA 2CZIA 3LR1A 4PK5A 5JDMA 1FCKA 3TZAA 4U3CA 3TTRA 4ESWA 5IZ3A 3AEGA 1SE7A 3QMFA 4ZEIA 5IAIA 1QLBA 1OQGA 4WBOA 1OVTA 4N6DA 4PFYA 2ONSA 2BVLA 1P99A 1FTAA 3WAEA 4AKRB 3CFLA 4WKMA 4I62A 4OEVA 5FMNA 2W66A 1DMBA 4GD5A 5TU0A 2JIWA 3FJ7A 1MQIA 3VHLA 2F34A 4I8CA 3PTRB 5HBCA 4ZE9A 3B6QA 1O7TA 3K1NA 4EEBA 4N91A 2F4VT 2JPFA 4M4GA 2IHR1 1LB8A 4JVCA 1Z7NE 4IGTA 4R6KA 3IORA 4MFRA 1NL5A 1AMFA 2F7BA 2QMXA 3O6GA 3MP8A 4HWDA 5L4EA 5A1LA 3RNNA 5IZZA 4JI7T 4GFRA 2ZYKA 1HX8A 3LFMA 2N2NA 3RKGA 4R75A 1MNEA 3ZEFB 4H65A 3GYYA 4PAGA 2WBBA 2BG9B 5JDQA 4F29A 2Y48B 3ZT6A 1HNWT 1ZLQA 2OJTA 3PUXF 1FBCA 1MS7A 4RXLA 2UXAA 2YK0A 1IMAA 5JDGA 2JJ9A 2CBJA 3L6GA 3RPWA 3UT5E 3VRAA 3ZKLA 2CBIA 3S9EA 1ZV4X 3VKGA 4P0IA 1INPA 3SOLA 4B3MT 2GK9A 1B3FA 4HCWA 4JDFA 4JVIA 2V84A 3E78A 2X9HA 4CXXA 1J5ET 5HM4B 4PTKA 3PU3A 2FIEA 3UU5A 3IBPA 2UVJA 3L09A 4QH1A 2LSGA 2XM1A 3G3JA 3DJBA 4A56A 5JDLA 2FBPA 2OV9A 3HR0A 2Y7KA 1B4ZA 4YB6A 2FUPA 1MIVA 4QHOA 4H1XA 2B76A 4HS7A 4OHNA 3RI5A 1D1CA 3VVFA 4QH4A 2WKYA 1B5HA 2WYPA 4KYEA 1MMAA 2BVMA 3M65A 5AQRB 4EUOA 3NZQA 3ZC0A 3FBPA 4DMWA 4R6HA 2ABHA 4KUMB 5LHGB 3V89B 2JMKA 4UV8B 4U23A 2DWHA 2VL0A 3PV0F 2XXWA 3QB5A 2XXQA 3UU6A 3QIMA 5F1QA 4WEPA 5AQGB 4OHFA 1DU2A 4H5GA 3E3KA 1G0IA 2WBLA 4WXJA 2ZM6T 4YHJA 2GHAA 3RGYA 2E1SA 1PB7A 3PUXE 5FHOA 3PUYF 5EYGA 3UUMA 1PC3A 3IEEA 3T9XB 1IMEA 4GQOA 3RYDA 4UXNB 3NKZA 4U2ZA 2VASA 4XXUA 5EYFA 4ZZAA 4DV3T 3KJTA 4DR3T 2Q88A 1I94T 1IAPA 1SYHA 4V1Av 3QSLA 2E2AA 1W0BA 3K8PC 5J1DA 4BDOA 4GWWA 4HFDA 5LDZA 1QUJA 3A29A 4ZEBA 1XNQT 2LE8A 2RF1A 1POY1 1GQEA 5H8FA 4IREA 5LCYA 5JR9B 4NE4A 1PEBA 2XAHB 2UXDT 4AI6A 1NWMX 2QVRA 3MVWA 2O1LA 2Y8DA 5EK3A 3ECRA 2OCUA 2KLQA 1LEVA 4UELA 3HCQA 4ZS9A 4ZEKA 4F22A 4PF6A 3WI3A 3LBXB 3T9VA 1FW0A 1B3EA 3UORA 2CA5A 3OPCA 3ZN0B 4EF2A 1EYKA 3CWZB 1WR6A 4WZXA 1CNQA 2A5SA 2Q2AA 4DUZT 1UCUA 4H9NC 3THIA 1FPKA 1JNRA 3VDFA 3T1BA 4PK6A 3LUZA 1IMFA 4HFEA 1OEDB 1EZ3A 3SEYA 3UU3A 4NF8A 2BG9E 1B4HA 3EF7A 2OWZA 3UUBA 1CB6A 2LOSA 1MG1A 2W62A 2H89A 3MZ1A 2YJPA 2FA7A 4DV2T 4N07A 2DNXA 3AXJA 2H99A 2RKMA 5CRYA 4YKPA 5J16A 4QF9A 4HE8A 5HWYA 4QSCA 2B4LA 1NH8A 1MY0A 1IZ1A 3FV2A 3UU8A 3IFAA 1CHUA 2CZLA 4P8BA 1IMCA 4PFTA 3I0OA 4P09A 3U72A 1AL3A 5CMKA 4QHQA 1M5FA 1WODA 2N9DA 2NWBA 3KG2A 4PDHA 1IXIA 3N2KE 4CN1A 4Z91A 2X0HA 4IHJE 3MP6A 5AA2A 4X66T 3ONXA 2R6GF 2ZNUA 1H76A 4U1ZA 5ICTA 1DCUA 1NUZA 5DYHA 1A40A 4O4LE 3RY3A 4MNIA 2PCRA 3G3FA 4FJPA 4HFCA 5I58B 2BS4A 1LBZA 3AE2A 2VKHA 1GGGA 2F7CA 2VKOA 4N81A 1B7UA 1FPEA 4YKIA 3AEFA 1P1NA 4E0WA 4GWSA 3C50A 2VOZA 2WCAA 5AA4A 1IEJA 4GX3A 4GIZA 4DI4B 4YY3T 1ZJLA 4THIA 1YKHB 2WP9A 2D2SA 1GVCA 1FPIA 3KOSA 2V6YB 3WAKA 1NNPA 2UXNB 4EOZB 1NV6A 2BG9A 2BZBA 4A98A 3LK2B 2CLYB 3K6XA 1FTKA 3RRWA 1URSA 3BIGA 2XD3A 1NNFA 2UYEA 4N4UA 4GX6A 1UURA 4HTGA 4WYVA 5DABA 2A5TA 3MQ9A 3DELB 4OVPA 2AL4A 1HR0T 1Q35A 3PE0A 4GWZA 5HYAA 2X9XA 4ZE8A 2XXVA 3ONJA 1BR2A 4MEVA 2FJAA 2H5YA 1PBQA 4PFBA 1NMUA 3L6HA 3AA6B 5BMVE 3ABVA 4NX1A 4ZI3D 4YHHT 3C4WA 2HXRA 2XWKA 5CFBA 4QFPA 4HWCA 3TKDA 5CBRA 1UTBB 3NBXX 3LSFB 5L9OA 3RYIE 2DE3A 2X26A 4LMJA 3O2AA 3UA8A 4JLEA 3TCGA 2K24A 4NAPA 4F1UA 3HO7A 3KN8A 1FIOA 2HPGA 3VFJA 2VB6A 2H25A 3EDVA 5ISUA 5AQNB 4Z90A 4IDQA 1KFYA 3DP7A 1JW1A 2VP1A 1DBZA 2XY8B 5CB4E 2DSFA 4MAGA 3GBBA 5FTHA 2E9XA 4DO0A 2E9XC 4R2FA 5HXHA 4QXDA 2XQ7A 1RDZA 4NF4B 3WAFA 3OELA 1SUMB 3IK6B 3H6UA 3OXNA 4OVRA 4POXA 4MH5A 5TPAA 5FY1A 1LAXA 5AQVB 4TLLB 4X9TA 5M2VA 3D0TA 3FZMB 1FEWA 4HFHA 3CK6A 3SFDA 5ETWA 3P4QA 2V7IA 1KWHA 2DQVA 2Q8MA 3HHGA 4O3BA 1FTJA 3NRYA 2PYYA 3ZKKA 5I57B 2HHHT 1T8BA 3GA8A 5LGTB 2LM9A 4JYAT 1FPFA 4DBQA 4KYSA 5CBSA 3KINB 4NTLA 3KBUA 4K3FA 2X9YA 4LZ7A 1TWYA 3V5SA 3RT8A 4G8HA 1YKEB 2THIA 3C4XA 2V5DA 1MY3A 4IR8A 1B52A 5LP6E 4CI3B 1SDXA 4DDDA 3FXUA 1US7B 1NUYA 1ZU0A 4OTEA 4TWFA 2Q9QD 4PF8A 3SZPA 3TDJA 1HCIA 2UVGA 3CI8A 4QFNA 3R26A 3C33A 4I50E 4QXCB 2VHAA 4FEBA 4BDNA 4R73A 2BBHA 4PE5B 3BBRA 5LBMA 2Q9QB 1XHYA 2I3WA 5L9MA 3S2VA 4LQ2A 1M5CA 2PFYA 4HWFA 4PFOA 2XXXA 1S94A 4GYRA 4AXPA 2UUAT 4MFIA 2QVAA 3TLUA 2REGA 2SPCA 1N84A 3PMVA 3CVRA 3QUJA 2VGQA 4M1VA 1LGBC 2R8TA 1M7KA 1O3XA 3G3GA 1FSAA 5EHSA 3AA1B 1RDYA 5DEXA 2YDSA 5AFUL 3TTNA 4GKKT 1K9ZA 1WYCA 1MM7A 4O7MA 2O84X 3VLUA 4IE0A 3ONMA 2QMWA 3LSWA 4IDOA 4LA9A 3AAEB 3R6NA 3PTYA 4RNSA 2V6XA 4X1IE 1XVXA 3FUZA 1OWAA 3ZMZB 3EHZA 4F3GA 1N04A 4DUYT 5HEUA 4XKQA 4CI2B 1WLXA 3H6VA 4IO6A 2LAOA 4RK2A 1KA0A 2PBIA 2FJDA 1B7ZA 2E9XB 3K6UA 3VV5A 3C4MA 1T0KA 4JI3T 3T66A 1Z8UA 2DYXA 4X1KE 2RINA 4QX7B 3P8CD 1U4QA 5LTCA 2YPNA 5AQPB 1MXWA 3AE4A 5AQFB 1SPIA 2CMRA 4JBZA 5AA2B 3U65A 4DLDA 2BS2A 4OFZA 3T1HT 3PUGA 2XX8A 2ZZVA 1US5A 1FRPA 5JEIA 2HPLA 2WB5A 2QS3A 3ZT7A 2PJQA 5BR8T 5EQ7A 3PV0E 1US4A 2D3IA 5EQ8A 3IFCA 1E2AA 5DTBA 4PGPA 4NPPA 5FP3A 4FI5A 1LB9A 3MKDA 3O1IA 5FBPA 5AQIB 5LB7B 4QH5A 4NF8B 2NOXA 5FKYA 2DVZA 4G61A 4OENA 4KMCA 3H3AA 4O4JE 2EHOD 3BQKA 4G8NA 1YD8G 4ERRA 2QVUA 2XXYA 4CN6A 5C2TA 4H5FA 3O6IA 4OK0A 2XAFB 3KV5A 3IL1B 2UXCT 1MIYA 2V3TA 3G7WA 1AH5A 5AQMB 3LBSA 2H88A 3J9X1 3H6TA 3OMBA 4ILAA 5EK4A 3MXZA 2HZKA 3LV0A 4ND9A 2A9UA 1WCRA 1OEDE 5HEHA 1MQHA 4XAXB 4MLQA 2K9AA 4XEQA 3T9UA 4Z7EA 1XI6A 2QRYA 2OBGA 3M3LA 3L39A 4UF0B 1DTZA 5EHMA 3PPPA 2I58A 2G93A 4PQJA 5BWJA 5L47A 4O4IE 1HNXT 3PGFA 4XF5A 3AEAA 5KX5E 4NF6B 3B6TA 2RC9A 2H9BA 5JR9A 3FVOA 2JQ9A 1LSTA 2VQFT 3BQIA 1NV1A 5AA2D 1LCTA 2NP9A 4GBWA 3CX7B 5LJMA 4JI0T 3DP4A 2YDRA 3SETA 2IAKA 2CZKA 4PP0A 3LBXA 3VE1B 5I58A 4ZHQE 1Y20A 1D9YA 3B6WA 5HXSA 4ZEDA 4CN4A 5HEJA 3N2GE 3LSVA 1I6QA 4LF6T 1ZBMA 3DP6A 2HCAA 2WDVA 4YB7A 5ELVA 5L4HA 2XAJB 1FQEA 1Y01A 1SBPA 3E08A 5CI5A 1MQDA 4PJMA 2GFEA 3PPOA 3H7MA 1B0HA 4GLIA 4BJNA 3CFXA 3ZMSB 4EYUA 4KYDA 4F2QA 2F3BA 2V5CA 1RYOA 5ESYA 4DNDA 4GWYA 1IJ5A 4LF4T 3HSTA 4U7IA 1W0AA 3IR1A 3UULA 3JC6C 2MTQA 4NIQA 2UU9T 2DDKA 2WU2A 2DL1A 3NOHA 5GONE 3FZKB 2PFZA 1XDOA 1FBEA 2V3UA 3AEDA 1XOCA 2FIXA 1D1AA 5LMUT 5JR9C 1N36T 1BLFA 3ZCJA 1QGXA 2R9JA 3FGSA 4FAJA 5FXWA 3A3UA 3ANWB 3KVAA 3CVGA 2P3NA 3EAMA 2QYWA 4O94A 1MPCA 4I3YA 2CXDA 1Y4TA 2JQHA 5KCJA 1IJ6A 1AWBA 3UUXB 2XWOA 1A8EA 4DXCA 4F2OA 1QJMA 3K3QC 4GF8A 1LBVA 3CG1A 5L3BB 2YDQA 4QXHB 1OMPA 3BKIB 3PUYE 2F97A 3EDUA 1BR0A 1UK5A 4ELOA 1UUSA 1KK7A 1NV4A 2P0SA 1UTBA 2QSXA 2L5VA 4YKKA 1HG5A 4IDNA 4U22A 1G73A 2I48A 4YZZA 3K6WA 5FHMA 3OEKA 4JSDA 3O28A 4MJOA 4ECFA 3Q9DA 1MNDA 5JRCA 4AISA 3RQWA 1B6HA 3AECA 2XHDA 4RJZA 3TLVA 2NW8A 4MCOA 4MLKA 4KD5A 2NOOA 1JW4A 2CWYA 4OYVA 2IMLA 3H3MA 1X79A 1FBFA 3B7DA 4PCDA 3HKEE 5ABFB 5EQAA 1KNPA 3E22E 3T1YT 4B3TT 1MDQA 4JEUB 1S7YA 4PFRA 2XHEB 1MMNA 5LJNA 3PUSA 3PPRA 4RY1A 5AA1A 4E7SA 2KQZA 3O1HA 3MACA 2OLBA 5CM6A 3KC1A 5L3CB 1A99A 1H7CA 1YW0A 4DR1T 2XTLA 1TFAA 2ODVA 4MNPA 3KDSE 4DVDA 5CMBA 2XASB 3CPZA 4IO4A 1SA0E 4ADZA 2C5IT 4RA1A 1MPBA 3HKBE 2ZM8A 3MVYA 3FJMA 4XTCQ 3RTFB 4OZ9A 1WR0A 3MWBA 3HFUA 2I49A 1B1HA 2RPAA 1NV0A 1LFIA 4H9QC 2PX1A 4JXIA 4LMKA 2F8DA 3KV4A 4TLMB 3CQGB 1LBBA 5HCJA 4XKNA 4OEUA 3RLFF 3WAJA 3MUQA 3OYZA 5L3DB 3KZGA 3NVOA 3EHTA 5IM2A 1A54A 1EYJA 5L9SA 3V83A 3UUNA 2IIUA 2FJBA 4N8GA 1QVSA 2M6BA 3RQUA 4R6YA 2W7YA 3G3KA 4BDRA 2O6AA 3TUSA 4ELRA 3AE3A 4GK0E 4LF8T 2DWAA 3ZT5A 1NNKA 1SW2A 3O97A 3RH3A 5JRCB 1N7XA 1QSDA 4UEMA 3IO6A 2VPOA 4HEAA 3B8BA 4G2AA 4Q8RA 4PAFA 1V9DA 1UTHB 4GBVA 5H8FB 1ZP0A 4JWYA 3T96B 1MH4A 1D0YA 5AQUB 4TOZA 4UF0A 5I2NA 1I6ZA 4E0XA 4TN7B 3KV6A 4PE3A 4N78D 2YOEA 2K5BB 1IMBA 3CR9A 3FASA 4COFA 3K4UA 5LGNB 4NEDA 4ZI7E 4HE1A 2Q9QC 3RIAA 3OYXA 4H0WA 2LRKA 1HS7A 1GV8A 1JQFA 1BTJA 5L2LA 3CQCB 3HL6A 2QVVA 2A3DA 2GQ1A 2X9WA 2O51A 2DP8A 2W61A 2ONRA 4G4PA 3JZJA 3MVXA 3VLWA 5B70A 1JEUA 1ZEEA 4P56A 3TTKA 3FXQA 4QRZA 4ELQA 5BUUA 4OFJA 3ZYKA 4KCDA 2XAQB 4O2BE 2ZXTA 5EQ9A 3PUZF 1DPEA 2KT9A 1MXZA 4I3EA 3C31A 5DW8A 1FQFA 2HXWA 1MY2A 3I0QA 2ZM2A 5J1GA 3M8UA 3TODA 1D9QA 2XUEA 1LBXA 2OX3A 2Q9QA 2V26A 2QS4A 1IMDA 3E4RA 4YB5A 3TYHA 2PMSA 4GOTA 2P2AA 3I9YA 3L3PA 2RC7A 1USYE 3H37A 2XQ6A 1VRBA 3ZCIA 3PPQA 2XJ7A 4G68B 1IUDA 3CMLA 4NUVA 2VKJA 3MPLA 2LSKA 5ABFA 1BR4A 3TTMA 3MW0A 1W09A 4NUUA 4R74A 4Z0IA 4EB6E 5FXZA 5KDMC 1LCFA 2I0BA 5I3SA 3DP8A 3QAXA 4AKLA 1SHZC 2CXFA 5C3JA 1M5EA 1SYIA 1IBLT 4TWDA 5HXCA 2E0SA 2IW5B 4YKJA 5I56A 1NUXA 3IJOB 1BKAA 2WWVA 5I84A 5HEGA 2M67A 1Z0PA 2D0TA 3OSQA 5IUXA 2DWIA 2XAGB 2WX9A 1P1UA 2VT5A 4U74A 1LLSA 3K00A 2MOZA 1SVXB 5CA0E 3TCHA 3LJCA 4EV6A 1MXYA 1D4NA 3FZHB 4H63H 3PJAA 4U72A 4R9FA 3OO9A 3V5UA 4LFCT 3OKQA 4LZ5A 4MHCA 4DE8A 2V25A 4AB5A 1JETA 2CCQA 2XWVA 2DE4A 4MF3A 3IAZA 1YQ4A 2ZZWA 4KHPT 3K01A 4P1LA 2Z8FA 4QSDA 2NUVA 3AE5A 2F3DA 4B3RT 2C5JA 3E9XA 5TPAB 1KF6A 4BDQA 1JP4A 4EXKA 3G3IA 4ILBA 3ZYLA 3LK42 4F39A 1QULA 1YXRA 2H7VC 3OTOT 3HN0A 4IE4A 4F6RC 3AVRA 3NZPA 3ILTB 4O4HE 4MBPA 1FPGA 3S9LC 4L9IA 1ZMGA 4NN3A 4OXVA 2CMOA 1SI0A 1OXZA 2AXDS 4AIUA 2OK2A 1R6ZA 2HAVA 3M3FA 4HFIA 3ZMVB 2WBDA 1LBCA 1J1NA 5HAXA 5JDNA 1YTVA 1HF8A 1LAFE 4G8MA 4E7ZA 3ILUB 2LKHA 3C35A 4GKJT 1P1QA 3OEMA 1UX5A 1NI9A 2QA7A 3CX6B 2I0MA 5HCMA 3IX1A 3RYFE 5J0ZA 2ZYMA 1WVJA 3UN6A 3EUHA 4JBWF 2LSYA 3HA4A 4BA9A 2Q2CA 2ZNTA 3BIHA 4F8HA 2XQ5A 1D1BA 4GL0A 2Z23A 3W15B 5EK2A 4X8RA 5I7IA 4ANJA 1D3KA 4JI2T 3EQ1A 3D4CA 4A5XA 3W9VA 3PUAA 1Y4CA 3ZSTA 1RDXA 4BDMA 2LKGA 2C5KT 3ZKRA 2XX7A 3K2DA 1FTMA 2XXHA 3FVGA 1ZKBA 3GMIA 2ESNA 2VD3A 2ZZXA 5CJ5A 3F57A 3UQ4A 2O68A 3PUZE 5H8NB 3C51A 1HTJF 2W67A 5FL0A 1AIVA 1MMDA 1UIUA 5LYJE 4JI4T 2D0UA 1N33T 5IHYA 4HFBA 2VKDA 4TV9E 3J7Yq 3OSRA 4HFVA 4ZZBA 4GWXA 1RYXA 1Y3QA 3ZJ1A 3QOFA 5AQLB 1I6AA 4AQYT 4H45A 2ZLYA 2XQ9A 4IO7A 4KP3C 4HWIB 4Q5TA 4KI0F 2XD2A 3JV9A 4YJ3E 3KBZA 4EIWA 5I57A 2Y7PA 1HSJA 3JC6D 3FV1A 3ODBA 3PMXA 3QYTA 2L3LA 2XQYA 3B50A 3FVKA 4OMBA 3AXFA 1H43A 1JW5A 1FJGT 5ET8A 3FHNA 1M5BA 5L3GB 3ZMUB 1N3WA 3MA9A 2DXRA 3MZKB 1L5TA 4JI1T 1B3HA 4PBQA 1AOVA 3SWHA 3IOTA 4LVQA 3C4ZA 4CI1B 3A3CA 4DIDB 3BFUA 4X1YE 4YTMA 3AEEA 2I3VA 4F3PA 3OENA 3IOUA 2UUBT 1OEDC 3NWIA 2G0UA 4ZI2D 2ONKE 1IXHA 3O4XE 2E5LT 4NXNT 5F5WA 1MY4A 2HAUA 4MALA 4AKIA 3VU7H 4WW0A 3K1SA 2VVSA 4R72A 4IDPA 3CIJA 2HQ0A 3T8OA 3TEPA 4P47A 2ACZA 5HWXA 1LAHE 3LUYA 4YICA 2XQ8A 5K2YA 3JADA 3A5XA 3EHSA 4U2RA 5TP9B 3SESA 5DQWA 4P9KA 4F18A 3ANWA 4O8SA 1FJ9A 5HXRA 3RTWB 3H6WA 2H7OA 2FHYA 3GBAA 1J1JA 3A09A 1R8IA 3HKCE 3N2OA 3U8QA 2P9BA 4H8JA 4EQ9A 2X0LB 4K0KT 2YLNA 1N34T 4FE8A 4TZ4C 4G68C 3U78A 4XFEA 1N0TA 3MC2A 4U1OA 5L8DA 4DXBA 2PTFA 2CEYA 4OVJA 1FTOA 1KNZA 3CSBA 1VCSA 4HWHA 3FBLA 4GXAA 5ABEA 2D21A 4O2AE 4L17A 1MRPA 4NF5A 3G06A 1FQCA 3OVUA 4OVTA 4UR9A 3RX6A 2H4IA 1IBKT 3GZGA 4J2CA 1QUUA 4WEDA 4IB2A 2NR4A 3KVBA 3SKPA 3EHUA 3RIFA 1LVKA 4LF5T 1VE4A 1VFDA 2QS2A 4LQ5A 4UVBB 3IHRA 5J2TE 3TAJA 4NF0A 2HZLA 2J47A 1K9YA 5AQQB 3IA3A 3TPAA 4HTEA 2EHOB 1QKBA 4OFOA 3Q28A 2V8SV 1NV3A 1H45A 4KHZE 1SW5A 3QC9A 1Y9UA 2GRVA 3N6UA 1YQ3A 4IL9A 3V5AA 4U31A 1FBHA 2I0CA 3VXBA 5JTYB 1RKMA 3SS1A 1NENA 5ET6A 3PUQA 4AQFA 2D5WA 3JCFA 3PUVF 5KCJB 4EAHA 3T0JA 4HE0A 4I40A 3RPUA 4CQIA 2ANJA 2ZMAA 3ETVA 4ZI3C 2O7IA 5C8YE 5AQJB 3BK9A 1IZNB 4P3LA 2MKZA 1LVFA 3LSXA 1DTGA 2CHNA 1N3XA 4DV7T 1EZ9A 4YAHX 1FQAA 4N6KA 3TCFA 4FORA 1UX4A 2X66A 2HFBA 3OBVE 1Y1MA 3N9OA 4QWNB 1A8FA 2E5VA 2F6PA 3RRCA 5FNVE 2PT2A 1DPPA 1OIBA 5AE4A 1D0ZA 2LLYA 3QB5K 3Q2MA 4JSOA 5ITOA 5F7VA 4Q30B 4PK4A 1UTHA 1XDPA 3MP1A 1H44A 3SDFA 5LHHB 3GN5A 5IZ3B 4KBMB 1FMWA 5H8SA 4I9DA 4P11A 4NF5B 3VVDA 4N8YA 2REJA 1Q9DA 5IKBA 2CRBA 4NMYA 2I6EA 3D4GA 2EHOA 4DV0T 2V7LA 4PDDA 4I43B 3ETUA 3RC3A 4BLAA 3SERA 2DCFA 4FJOA 4EGWA 1SW4A 3UP9A 4OESA 1BIYA 3H06B 3FJGA 3Q5DA 5LG4A 1E1HB 3AE7A 3VKHA 4FEDA 5JTYA 3KOTA 1T98A 4M1PA 2O7UA 3TTLA 3I5OA 4U21A 2WS3A 4IO5A 2LHNA 3AAIA 4C90A 4YSZA 4MLVA 4X1DA 2HN2A 4LMLA 4N13A 3GWHA 2WM9A 1IBMT 2D9DA 2NW7A 1B1XA 5IGAA 4FECA 4YTNA 1EZOA 1FBPA 1QUIA 2LHRA 1B9JA 3UU4A 4G77A 3D1RA 1AJ3A 1B5JA 5F24A 1P1WA 2WDRA 1N7WA 4ZZEA 3E0ZA 4O7IA 1QW0A 4U7YA 1MIWA 4AKGA 2AYSA 5T3JA 1BP5A 1KZ8A 4DIGA 4C1UA 4HW8A 3FXBA 4XKRA 3UTKA 4U2YA 2FYIA 4I0UA 3SRZA 2RCAA 4OVSA 3MZ9A 3R84B 4DZ1A 3FD3A 3N9PA 3ZN1B 1FPLA 3T93B 2I59A 4KHZF 2L9QA 2B3BA 3K1MA 4KI0E 3O9PA 2OWTA 4JVDA 4UVAB 3PJAJ 2OA5A 2V7MA 3H3GA 5DT6A 4YT0A 2V3QA 4GK5E 1XMOT 2J1DG 2XXIA 3PMWA 3Q26A 4MHFA 1JVXA 4DR2T 1O63A 4OQOA 1SQYA 3S4UA 2PT1A 4IE5A 1XT8A 3N9QA 3MPKA 3EI0A 1HSEA 5DVJA 3C9HA 3E79A 3AE9A 3CHGA 5TP9A 2Z6EA 4MIJA 3W9WA 4UIGA 3IJXB 4DMVA 5ET7A 3I9WA 4PJJA 5ITPA 4X62T 4MMPA 2RP4A 1URDA 4X64T 3RN8A 1II5A 2YU2A 1HSLA 3H03A 3R6UA 1MMGA 2DI4A 3QNUA 4YFSA 5CC2A 5KMGP 1QKAA 3TLSA 3VVEA 4H63V 2BG9C 1LFGA 2FNCA 1M5DA 2RCBA 1B05A 2C0SA 3C32A 3IB0A 3TQLA 4N15A 3RQTA 4F1VA 3N6TA 2MBGA 4DBRA 4I55E 1JEVA 4HGAA 1YPNA 2LT3A 4O3AA 1S50A 4ZEYA 1KNRA 1A7LA 3HHFA 2CHOA 4L5GA 1N32T 3FBZA 4K0UA 1FJ6A 1FPJA 2Q74A 2JQKA 4GOUA 2B4MA 4XIGQ 2QGSA 4NWCA 2ZYNA 1WDNA 2XX9A 4LF9T 3JAEA 4OX9T 1XVYA 2W63A 2AE9A 4DI3D 4P1NA 2Y5KA 4CXYA 2BJIA 5JH7E 1NV7A 2VWAA 1YZ0A 4H67A 3IF8B 3R7XA 1S35A 1O64A 4OA4A 5DQVA 2WEFA 5JK4A 1XNRT 4KXPA 2K48A 3OO6A 2E8IA 4ISSA 2XSBA 3TFLA 2N1GA 4R2BA 4U4SA 4YXDA 2FVZA 2WAUA 3A7MA 1NKXA 1NV2A 1ZIUA 3O66A 2VL8A 4KCCA 1IXCA 2OWSA 4EYYR 5H8NA 2NTYA 4PETA 2Q8JA 2XM2A 1YXIA 2MYSA 2VURA 5CA1E 1KEYA 2OLTA 3BFTA 3F31A 5B7DA 1T7SA 1WFDA 4QX8B 3VRBA 2BBJA 3AEBA 1TXFA 1OLCA 2DXYA 4WNKA 4F1YA 1SD3A 1MM6A 1B7TA 4UV9B 3VR8A 3CFZA 3MSTA 3RHWA 2KLFA 3I3VA 4H9OC 4OYJA 4PGNA 5LGUB 4NG7A 3W15C 4YSXA 2UVHA 1URGA 1B58A 2MPKA 4P0BA 3K1PA 5ABHA 3MYUA 2XZEA 2GHBA 1FBGA 4TQUQ 2V7JA 2KZ7B 4IL4A 3EVYA 5I5PA 4EQ7A 1ZKEA 4HCYA 1Y3PA 2H3RA 4XBFB 1A55A 4ZEFA 1ZHCA 1B40A 2R6GE 1MDP1 5KDTA 2H98A 3K3OA 3Q5EA 4NHBA 4PC9A 4JV5T 2WSSV 4YTPA 3LK3B 5L3FB 2CEXA 5AQHB 3AAAB 1J5WA 4ZDMA 4G68A 4IE7A 3ZJ2A 2UXBT 2V7KA 3M3KA 4OERA 4FATA 1G8XA 1OEDA 1SI1A 2LRLA 2BS3A 3OO7A 4F3SA 4EXLA 2KR0A 1B51A 3C34A 2WMOA 5KDTB 4PAKA 2V93A 3ZPOA 2BDEA 4PJLA 1JNFA 4ILUA 4A97A 1MXXA 2Q89A 5I56B 2XXKA 4GIWA 2CE7A 3GLBA 1B32A 2ALUA 2FBWA 2QPQA 4GL8A 1TFDA 3TQWA 1F9BA 4Z8XA 3U1OA 2IC9A 5F3JA 3P4RA 1MQJA 3LSLA 4HE2A 2F78A 3ROJA 3MK7C 2DLRA 1T72A 2WWUA 3ZMTB 5H8HB 1TT1A 3CSGA 3KN7A 5JQGE 3HKDE 4JWXA 4IGUA 4IDZA 1HNZT 1LBWA 2Z8DA 3LDQB 4LN5A 3ZSSA 2XXPA 3ISPA 4I1DA 3AA7B 4AQFC 3PURA 4IY5A 3UFEA 1I6BA 4ZS3A 2WMNA 1OLAA 5FXXA 3MJNA 5A5XA 4TNWA 2NW9A 2CLYC 3C98B 1Y64B 2Y6XA 4RPNA 2F36A 2XXRA 4EZHA 2J62A 4PBHA 5AA4B 5FL1A 2WYKA 3LC8A 4FIMA 4ELPA 4UVCB 2DVCA 4TX5A 2WQYA 4WBNE 2LSIA 3UK4A 2V4CA 5HXEA 4IT4A 4H46A 2W0GA 2VD2A 4AS4A 4RPOA 4QKNA 3FXDB 3RKOA 4QBAA 2W00A 3RT6B 2JMHA 3Q25A 4AB6A 5I2KB 1YCJA 2KMFA 3OOAA 4YLHA 5JREA 5TAOA 2YU1A 2ZYOA 5FHNA 3ZLIA 3ZS6A 3P4SA 3N26A 2WZHA 3C36A 4EDPA 1YYZA 1BK4A 4F19A 3AXJB 1YAEA 3RF1A 2XXUA 1VSOA 3JAFA 1WYBA 5ABGA 2WU5A 3KFWX 3N94A 4GX4A 2PFVA 4QFLA 3T9HB 4BDLA 2M6IA 4AQ4A 1MY1A 2VK9A 1FQDA 2BKPA 2RC8A 4PFIA 5LOVE 2XPKA 1B2HA 2P3VA 4B6XA 5I2NB 2X7PA 4X1BA 4AKHA 1VOMA 4BJMA 3DLNA 3CIRA 3RIUC 1ZTYA 1PB8A 4QFOA 2B1EA 5FY0A 4JEHB 2X51A 5IWAT 2F6GA 3KFMA 2GH9A 2HPJA 5LNKA 1VDWA 2ODUA 1R1NA 2CWOA 5LBQB 3N9NA 1USYH 4IY6A 4X48A 4X5TA 1G0HA 1B3LA 4XKPA 5FVLA 5FY7A 1JVYA 4GVOA 4O8MA 3N5LA 2AL5A 3L8RA 2WY2A 1NNTA 1IXGA 3GN5B 4PFPA 3MAMA 4LF7T 2WDQA 3B57A 2XWIA 3IB2A 1NAFA 4CZZB 3USDA 2CEAA 5FVKA 4JI5T 3FZFB 4MX6A 3PUVE 4Q0CA 3G3HA 3CKDA 5LG3A 3VR9A 4OWDA 3IO4A 3FZLB 4KPTA 2DWJA 1HFAA 5FXVA 1FQBA 4H9SE 3PD9A 2KNDA 2X68A 1PDAA 3RPLA 2D5UA 2I4BA 2UXXB 3VXCA 5AQOB 2V6YA 1IIWA 3S9MC 3V8XB 2DWKA 1HG2A 3AVSA 2HEUA 4P1EA 3B13A 2KWHA 1DOTA 4YMAA 4TV8E 2J4GA 4JUYA 3CG3A 5H6QB 4EEDA 2DOJA 4ZZCA 4NQ8A 1B46A 5EYHA 1UGOA 1W9RA 1QUKA 2F5XA 2Y7RA 2A5TB 5LXTE 4H9PC 2Y7WA 3CRBA 4LFAT 1Y1ZA 4JI6T 1FPDA 4P0GA 4QXBB 5JDFA 1FBDA 4YU0A 4LATA 3ZSFA 5A5XB 2CPTA 4JWOA 1B5IA 4BAYB 3KJ7A 2EHOC 1CUNA 3QUFA 5LMNT 1EYIA 2I4CA 3I1AA 2DS9A 3MJXA 4NXMT 3TLTA 1MXVA 3RGLA 3TLWA 3AE6A 2LM2A 2Y84A 5CMCA 4QFKA 3P4WA 3RLFE 4R9GA 2CM0A 4RYAA 2OZZA 3P50A 3N9LA 4GWUA 3FXEB 2IC6A 5AQTB 5E0OA 1L0VA 2Y5LA 1MQGA 3KSXA 2XQ4A 2LSJA 3UIFA 3SFEA 1NUWA 4XZCA 2KXPB 1XWMA 2WZIA 4ZOLE 2B3FA 5KZTA 4GRKA 4AS5A 5ICQA 3PUWF 5I2KA 3CX8B 3ZYMA 1CE2A 1MH3A 1N76A 3EABA 1WRDA 3RC8A 2F35A 3U92A 2QJEA 3EN3A 4IO3A 3PU5A 2QFLA 4HKAA 1NV5A 2Z22A 4N17A 4DCXA 5AQSB 4QSEA 4ZS2A 4OANA 2QRXA 2IEEA 5I59A 1UQWA 3B5MA 2IDOB 4I4TE 4ISTA 4EZ4A 1FPBA 3FVNA 2LEHA 1KA1A 4IO2A 1I69A 1POTA 4LUBA 4H8IA 2ZNSA 3KBTA 2ZM0A 1LRZA 3FB2A 3ZC1A 4C0RA 5F8PA 5FTIA 4C91A 5AA3A 4DV6T 4EXTA 1D0XA 3E13X 1Z7ME 2ACXA 2CXLA 3IB1A 2R71A 3Q27A 2KWIB 5K2XA 1Q1KA 5FYMA 5CGMA 1OVBA 3O1JA 4IE6A 4CXWA 1ATGA 4X65T 5JDHA 2X7QA 3SEXA 3K02A 3P7IA 3KV9A 4X04A 2W4XA 4TWHA 2L8KA 4FBPA 3C64A 3OO8A 2VVNA 3RYCE 4POWA 4KX6A 2XQ3A 4OETA 3Q5WA 2NWJA 3U93A 4MBQA 4F3BA 4H6DA 1U5PA 5EZYE 3AE8A 2A72A 5I59B 1B7HA 3IOVA 1LBYA 3O9XA 2IA4A 3PPNA 2YN6A 5DJQC 1IITA 1B3GA 3HPIA 1VR5A 3O29A 4ONYA 1EZPA 1DSNA 3KGCA 2X0YA 4DR4T 2Y7IA 2QS1A 2UVIA 2DHRA 1PBPA 2BJJX 3MBPA 2PG8A 3ESLA 2F7AA 1EH3A 3TELA 3TMGA 4MNCA 1GTKA 4ESXA 4F31B 5DEXB 3PDYA 3OJAA 1S9TA 2ZMBA 1ZOYA 5DVFA 5HEOA 4TUYE 3FZVA 4EQBA 4U33A 4PFUA 5H8QA 1NFTA 2O69A 2JQQA 2LOPA 4X20E 3M3ZB 3H4ZA 3SEVA 1XC1A 1JNZA 4YSYA 5H8HA 1VCTA 4DV1T 2UUCT 1ANFA 2NXOA 2BKOA 2Q9TA 3IOWA 3HI2A 3UQ7A 4KR5A 1SW1A 1HX1B 1MPDA 2AIXA 3EPEA 1VFEA 3FATA 1R9LA 3KC0A 3HV1A 4P0AA 2ES0A 3KEIA 1NH7A 1LAGE 2CZHA 5H8QB 4LONB 2KINB 2MAWA 3K6VA 3F2EA 5H6RB 5DVIA 1H3DA 4DR7T 3JYRA 2HH7A 3TKLB 4YMBA 3DTOA 4JI8T 3DM0A 4ISUA 3U3IA 4ZI2C 4NF6A 4UABA 4TNVA 1NEKA 4L0RA 3ONLC 4PW8A 2YKSA 3FIRA 2KSRA 3VLVA 4IGRA 5LOMA 5ADXL 4HXVA 4AQGA 3LG7A 1LFHA 4N6PA 3Q5XA 4KFQA 4KQPA 4Q25A 1M62A 3S9NC 3PUWE 3KBRA 4DV5T 5HPQA 1XS5A 3A8YC 3AE1A 4B3ST 2JJKA 4IIJE 4ASKA 3QK6A 5M4YA 2XXTA 3MZBA 2NVUB 2XSAA 4ILCA 1IQ7A 1ELJA 1OQHA 4NGUA 2YINA 4UACA 4C1TA 3RYHE 4LP2B 5LHIB 1XMQT 2BKNA 4U4XA 1R9QA 2LJLA 2XQAA 2JRKA 3AA0B 1Y3NA 2P1SA 4GXSB 2VQET 4H9RC 1BR1A 3SEWA 3OD7A 3Q29A 4OYKA 4DV4T 4PFWA 2X67A 2G29A 3RUMA 2V1DB 3MVZA 4NF4A 4OVQA 5LA6E 1UIVA 4OFLA 1EU8A 2HN1A 5IYZE 2DE2A 3K3NA 1P1OA 2Z8EA 4ZXLA 4DR6T 4GWOA 1D9VA 3SEUA 1DK4A 2PBWA 4EF1A 3PD8A 3K0VA 2W2UA 5AQKB 4DXUA 1E7PA 4LZ8A 4PNIA 5JVDE 3KN3A 2FJEA 3U94A 2NTXA 2IUBA 5KXJA 4DR5T 4LFBT 4G63A 2A2FX 4ZECA 3AB3B 3X1DA 4G2ZA 1MXUA 3QXMA 2DWGA 2E9XD 1FMVA 2I6HA 4GYSA 2QL3A 1X9BA 2M8CA 3F11A 3P4PA 1GR2A 3I6VA 1B0LA 5JTGA 4PJNA 1XZYA 4O3CA 2YEVC 4HN9A 3UGWA 2K3WA 3O6HA 3FXRA 3RIUA 3PU8A 2O1MA 5ET5A 3RPLB 4RK9A 2PVUA 4NWDA 3T22A 2B65A 5IZ1A
chains in the Genus database with same CATH topology
4JB7A 3GXAA 4DCYA 2RA1A 3BQLA 3N9MA 4UA8A 4YJ2E 5L3EB 3KSJA 1LKXA 3CQXC 5CMMA 1FTLA 5J2UE 2UYFA 1PB9A 3NRXA 3LR1A 4PK5A 5JDMA 1FCKA 3TZAA 3TTRA 4ESWA 4ZEIA 5IAIA 1OQGA 1OVTA 4WBOA 4PFYA 2ONSA 2BVLA 1P99A 3WAEA 4AKRB 3CFLA 4WKMA 4I62A 4OEVA 5FMNA 1DMBA 4GD5A 5TU0A 3FJ7A 1MQIA 3VHLA 2F34A 4I8CA 3PTRB 5HBCA 4ZE9A 3B6QA 1O7TA 3K1NA 2JPFA 4M4GA 1LB8A 1Z7NE 4IGTA 4R6KA 3IORA 4MFRA 1NL5A 1AMFA 2F7BA 2QMXA 3O6GA 3MP8A 5A1LA 3RNNA 4GFRA 2ZYKA 1HX8A 3LFMA 2N2NA 4R75A 1MNEA 3ZEFB 4H65A 4PAGA 5JDQA 4F29A 2Y48B 1ZLQA 2OJTA 1MS7A 4RXLA 2UXAA 2YK0A 5JDGA 2JJ9A 3L6GA 3RPWA 3UT5E 3ZKLA 3S9EA 1ZV4X 3VKGA 4P0IA 3SOLA 2GK9A 1B3FA 4HCWA 4JDFA 2V84A 2X9HA 4CXXA 5HM4B 3PU3A 3IBPA 2UVJA 3L09A 2LSGA 3G3JA 3DJBA 4A56A 5JDLA 3HR0A 2Y7KA 1B4ZA 4YB6A 4QHOA 1MIVA 4H1XA 4HS7A 4OHNA 1D1CA 3VVFA 2WKYA 1B5HA 4KYEA 1MMAA 2BVMA 3M65A 4EUOA 3NZQA 3ZC0A 4DMWA 4R6HA 2ABHA 4KUMB 5LHGB 3V89B 2JMKA 4UV8B 4U23A 2DWHA 2XXWA 2XXQA 3QIMA 5F1QA 4WEPA 4OHFA 4H5GA 3E3KA 2WBLA 4WXJA 2GHAA 4YHJA 3RGYA 2E1SA 1PB7A 3PUXE 5FHOA 3UUMA 1PC3A 3IEEA 3T9XB 4GQOA 4UXNB 2VASA 4XXUA 5EYFA 4ZZAA 3KJTA 2Q88A 1IAPA 1SYHA 4V1Av 3QSLA 3K8PC 5J1DA 4BDOA 1QUJA 4ZEBA 2RF1A 2LE8A 1POY1 5H8FA 5LCYA 5JR9B 4NE4A 1PEBA 2XAHB 4AI6A 1NWMX 3MVWA 2O1LA 2Y8DA 5EK3A 3ECRA 2OCUA 2KLQA 4UELA 3HCQA 4ZS9A 4ZEKA 4F22A 3WI3A 3LBXB 3T9VA 1FW0A 1B3EA 3UORA 2CA5A 3ZN0B 4EF2A 3CWZB 1WR6A 2A5SA 2Q2AA 1UCUA 4H9NC 3THIA 3VDFA 4PK6A 1EZ3A 3SEYA 4NF8A 1B4HA 3EF7A 1CB6A 2LOSA 1MG1A 2W62A 3MZ1A 2YJPA 2FA7A 4N07A 2DNXA 2RKMA 2H99A 5CRYA 4YKPA 4QF9A 4HE8A 5HWYA 4QSCA 1NH8A 1MY0A 1IZ1A 3FV2A 2CZLA 4PFTA 3I0OA 4P09A 3U72A 1AL3A 5CMKA 4QHQA 1M5FA 1WODA 2N9DA 2NWBA 3KG2A 1IXIA 3N2KE 4IHJE 3MP6A 5AA2A 3ONXA 4U1ZA 2ZNUA 1H76A 5ICTA 5DYHA 1A40A 4O4LE 3RY3A 3G3FA 4FJPA 5I58B 2VKHA 1GGGA 2F7CA 2VKOA 1B7UA 4YKIA 1P1NA 4E0WA 3C50A 2VOZA 5AA4A 1IEJA 4GIZA 1ZJLA 4THIA 1YKHB 2D2SA 1GVCA 3KOSA 3WAKA 1NNPA 2UXNB 4EOZB 2BZBA 3LK2B 2CLYB 3K6XA 1FTKA 3RRWA 1URSA 2XD3A 1NNFA 2UYEA 4HTGA 5DABA 2A5TA 3MQ9A 3DELB 2AL4A 1Q35A 3PE0A 5HYAA 2X9XA 4ZE8A 2XXVA 1BR2A 2H5YA 1PBQA 1NMUA 3L6HA 3AA6B 5BMVE 4ZI3D 3C4WA 4QFPA 3TKDA 5CBRA 1UTBB 3NBXX 3LSFB 5L9OA 3RYIE 2DE3A 2X26A 3O2AA 3UA8A 4JLEA 3TCGA 2K24A 4F1UA 3HO7A 3KN8A 1FIOA 3VFJA 2VB6A 2H25A 3EDVA 5ISUA 3DP7A 1JW1A 2VP1A 5CB4E 2DSFA 3GBBA 5FTHA 2E9XA 4DO0A 2E9XC 4R2FA 5HXHA 4NF4B 3WAFA 3OELA 3IK6B 3H6UA 3OXNA 4POXA 4MH5A 5TPAA 5FY1A 1LAXA 4TLLB 4X9TA 5M2VA 3D0TA 1FEWA 5ETWA 2V7IA 1KWHA 2DQVA 3HHGA 4O3BA 1FTJA 3NRYA 2PYYA 3ZKKA 5I57B 3GA8A 2LM9A 5LGTB 4DBQA 4KYSA 5CBSA 3KINB 4NTLA 3KBUA 4K3FA 2X9YA 4LZ7A 1TWYA 3V5SA 3RT8A 4G8HA 1YKEB 2THIA 3C4XA 1MY3A 1B52A 5LP6E 4CI3B 1SDXA 4DDDA 3FXUA 1US7B 1ZU0A 4OTEA 2Q9QD 3TDJA 1HCIA 2UVGA 3CI8A 4QFNA 3R26A 3C33A 4I50E 4QXCB 2VHAA 4FEBA 4BDNA 4R73A 4PE5B 3BBRA 5LBMA 2Q9QB 1XHYA 2I3WA 5L9MA 3S2VA 4LQ2A 1M5CA 4PFOA 2XXXA 1S94A 4GYRA 4AXPA 4MFIA 2REGA 2SPCA 1N84A 3PMVA 3CVRA 3QUJA 2VGQA 4M1VA 1LGBC 1O3XA 3G3GA 5EHSA 3AA1B 5DEXA 5AFUL 3TTNA 1WYCA 1MM7A 2O84X 3VLUA 4IE0A 3ONMA 2QMWA 3LSWA 4LA9A 3AAEB 3R6NA 4RNSA 4X1IE 1XVXA 3FUZA 1OWAA 3ZMZB 4F3GA 1N04A 4XKQA 4CI2B 1WLXA 3H6VA 4IO6A 2LAOA 4RK2A 2PBIA 1B7ZA 2E9XB 3K6UA 3VV5A 3C4MA 1T0KA 3T66A 2DYXA 4X1KE 2RINA 4QX7B 3P8CD 1U4QA 2YPNA 5AA2B 1MXWA 2CMRA 4JBZA 4DLDA 4OFZA 3PUGA 2XX8A 1US5A 5JEIA 2HPLA 2QS3A 2PJQA 3PV0E 1US4A 2D3IA 5DTBA 5FP3A 4FI5A 1LB9A 3MKDA 3O1IA 4NF8B 2NOXA 2DVZA 4OENA 4KMCA 3H3AA 4O4JE 2EHOD 3BQKA 4G8NA 1YD8G 4ERRA 2XXYA 4H5FA 3O6IA 4OK0A 2XAFB 3KV5A 3IL1B 1MIYA 2V3TA 3G7WA 1AH5A 3LBSA 3J9X1 3H6TA 3OMBA 5EK4A 3MXZA 2HZKA 4ND9A 1MQHA 4XAXB 4MLQA 2K9AA 3T9UA 4Z7EA 2QRYA 2OBGA 3M3LA 4UF0B 1DTZA 5EHMA 3PPPA 2I58A 2G93A 4PQJA 5BWJA 4O4IE 3PGFA 5KX5E 4NF6B 3B6TA 2RC9A 2H9BA 5JR9A 3FVOA 1LSTA 3BQIA 5AA2D 1LCTA 2NP9A 3CX7B 5LJMA 3DP4A 3SETA 2IAKA 4PP0A 3LBXA 3VE1B 5I58A 4ZHQE 1Y20A 1D9YA 3B6WA 5HXSA 4ZEDA 3N2GE 1I6QA 1ZBMA 3DP6A 2HCAA 5ELVA 4YB7A 2XAJB 1FQEA 1SBPA 3E08A 5CI5A 1MQDA 4PJMA 2GFEA 3PPOA 3H7MA 1B0HA 4GLIA 4BJNA 3CFXA 3ZMSB 4EYUA 4KYDA 4F2QA 1RYOA 4DNDA 1IJ5A 3HSTA 3IR1A 3UULA 3JC6C 2MTQA 5GONE 2V3UA 1XOCA 1D1AA 5JR9C 1BLFA 3ZCJA 2R9JA 3FGSA 4FAJA 5FXWA 3A3UA 3ANWB 3KVAA 3CVGA 1MPCA 2CXDA 1Y4TA 5KCJA 1IJ6A 3UUXB 1A8EA 4DXCA 4F2OA 1QJMA 3K3QC 4GF8A 3CG1A 5L3BB 4QXHB 1OMPA 3BKIB 3PUYE 2F97A 3EDUA 1BR0A 4ELOA 1KK7A 2P0SA 1UTBA 2QSXA 4YKKA 1HG5A 4U22A 1G73A 2I48A 4YZZA 3K6WA 5FHMA 3OEKA 4JSDA 3O28A 4ECFA 3Q9DA 1MNDA 5JRCA 1B6HA 2XHDA 4RJZA 2NW8A 4MLKA 4KD5A 2NOOA 1JW4A 2CWYA 4OYVA 3B7DA 1X79A 3HKEE 3E22E 1MDQA 4JEUB 1S7YA 2XHEB 1MMNA 5LJNA 3PUSA 3PPRA 4RY1A 5AA1A 4E7SA 3O1HA 3MACA 2OLBA 5CM6A 5L3CB 1A99A 1H7CA 1YW0A 2XTLA 1TFAA 2ODVA 3KDSE 4DVDA 5CMBA 2XASB 3CPZA 4IO4A 1SA0E 4ADZA 2C5IT 4RA1A 1MPBA 3HKBE 2ZM8A 3MVYA 3FJMA 4XTCQ 3RTFB 4OZ9A 3MWBA 2I49A 1B1HA 1LFIA 4H9QC 2PX1A 4JXIA 2F8DA 3KV4A 4TLMB 3CQGB 1LBBA 4XKNA 4OEUA 3WAJA 3MUQA 3OYZA 5L3DB 3KZGA 3EHTA 1A54A 5L9SA 3V83A 3UUNA 1QVSA 4R6YA 2W7YA 3G3KA 4BDRA 2O6AA 3TUSA 4ELRA 4GK0E 2DWAA 1NNKA 1SW2A 3O97A 3RH3A 5JRCB 1N7XA 1QSDA 4UEMA 3IO6A 4HEAA 4G2AA 4Q8RA 1V9DA 1UTHB 5H8FB 4JWYA 3T96B 1MH4A 1D0YA 4TOZA 4UF0A 5I2NA 4E0XA 4TN7B 3KV6A 4N78D 3CR9A 2K5BB 3FASA 3K4UA 5LGNB 4NEDA 4ZI7E 2Q9QC 3OYXA 4H0WA 1HS7A 1GV8A 1JQFA 1BTJA 5L2LA 3CQCB 3HL6A 2A3DA 2X9WA 2O51A 2DP8A 2W61A 2ONRA 4G4PA 3JZJA 3MVXA 3VLWA 5B70A 1JEUA 1ZEEA 5BUUA 3TTKA 3FXQA 4QRZA 4ELQA 4OFJA 3ZYKA 4KCDA 2XAQB 4O2BE 2ZXTA 1DPEA 2KT9A 1MXZA 3C31A 1FQFA 2HXWA 1MY2A 3I0QA 2ZM2A 5J1GA 3M8UA 3TODA 2XUEA 2Q9QA 2V26A 2QS4A 3E4RA 4YB5A 3TYHA 2PMSA 4GOTA 2P2AA 3I9YA 3L3PA 2RC7A 1USYE 3H37A 1VRBA 3ZCIA 3PPQA 4G68B 1IUDA 3CMLA 4NUVA 2VKJA 3MPLA 2LSKA 1BR4A 3TTMA 3MW0A 4R74A 4NUUA 4Z0IA 4EB6E 5FXZA 5KDMC 1LCFA 2I0BA 3DP8A 3QAXA 4AKLA 1SHZC 2CXFA 1M5EA 1SYIA 5HXCA 2E0SA 2IW5B 4YKJA 5I56A 3IJOB 1BKAA 5I84A 2M67A 1Z0PA 2D0TA 3OSQA 2DWIA 2XAGB 1P1UA 4U74A 1LLSA 3K00A 2MOZA 1SVXB 5CA0E 3TCHA 3LJCA 1MXYA 1D4NA 4H63H 4U72A 4R9FA 3OO9A 3V5UA 4LZ5A 3OKQA 4MHCA 4DE8A 2V25A 4AB5A 1JETA 2CCQA 2DE4A 4MF3A 3IAZA 4QSDA 3K01A 2Z8FA 2NUVA 2C5JA 3E9XA 5TPAB 4BDQA 4EXKA 3G3IA 3ZYLA 3LK42 4F39A 1QULA 2H7VC 3HN0A 4IE4A 4F6RC 3AVRA 3NZPA 3ILTB 4O4HE 4MBPA 3S9LC 4L9IA 1ZMGA 4OXVA 2CMOA 1SI0A 2OK2A 1OXZA 1R6ZA 2HAVA 3M3FA 3ZMVB 1LBCA 1J1NA 5HAXA 5JDNA 1YTVA 1HF8A 1LAFE 4G8MA 4E7ZA 3ILUB 3C35A 1P1QA 3OEMA 1UX5A 2QA7A 3CX6B 3IX1A 3RYFE 2ZYMA 1WVJA 3UN6A 3EUHA 2LSYA 3HA4A 4BA9A 2Q2CA 2ZNTA 1D1BA 4GL0A 2Z23A 3W15B 5EK2A 4ANJA 1D3KA 3EQ1A 3D4CA 3W9VA 3PUAA 1Y4CA 4BDMA 2C5KT 2XX7A 3K2DA 1FTMA 2XXHA 3FVGA 1ZKBA 3GMIA 2ESNA 2VD3A 5H8NB 3F57A 2O68A 3PUZE 3C51A 1HTJF 1AIVA 1MMDA 1UIUA 5LYJE 2D0UA 5IHYA 2VKDA 4TV9E 3J7Yq 3OSRA 4HFVA 1RYXA 1Y3QA 3ZJ1A 1I6AA 2ZLYA 4IO7A 4KP3C 4Q5TA 2XD2A 3JV9A 4YJ3E 4EIWA 5I57A 2Y7PA 1HSJA 3JC6D 3FV1A 3ODBA 3PMXA 3QYTA 2L3LA 2XQYA 3FVKA 4OMBA 3AXFA 1H43A 1JW5A 3FHNA 1M5BA 5L3GB 3ZMUB 1N3WA 3MA9A 2DXRA 3MZKB 1L5TA 1B3HA 1AOVA 3SWHA 3IOTA 4LVQA 3C4ZA 4CI1B 3A3CA 3BFUA 4X1YE 2I3VA 4F3PA 3OENA 3IOUA 2G0UA 4ZI2D 2ONKE 1IXHA 3O4XE 1MY4A 2HAUA 4MALA 4AKIA 3VU7H 4WW0A 4R72A 3CIJA 2HQ0A 3T8OA 3TEPA 5HWXA 1LAHE 3LUYA 4YICA 5K2YA 3A5XA 3EHSA 4U2RA 5TP9B 3SESA 5DQWA 4F18A 3ANWA 4O8SA 5HXRA 3RTWB 3H6WA 2H7OA 3GBAA 3A09A 3HKCE 3N2OA 3U8QA 2P9BA 4H8JA 4EQ9A 2X0LB 2YLNA 4FE8A 4TZ4C 4G68C 3U78A 1N0TA 3MC2A 4U1OA 5L8DA 4DXBA 4OVJA 1FTOA 1KNZA 3CSBA 3FBLA 4GXAA 2D21A 4O2AE 4L17A 1MRPA 4NF5A 1FQCA 3RX6A 2H4IA 3GZGA 4J2CA 1QUUA 4WEDA 4IB2A 3KVBA 3SKPA 3EHUA 1LVKA 1VE4A 1VFDA 2QS2A 4LQ5A 4UVBB 3IHRA 5J2TE 3TAJA 2HZLA 3TPAA 4HTEA 2EHOB 1QKBA 4OFOA 3Q28A 1H45A 4KHZE 1SW5A 3QC9A 1Y9UA 2GRVA 3N6UA 3V5AA 2I0CA 3VXBA 5JTYB 1RKMA 3SS1A 3PUQA 4AQFA 2D5WA 5KCJB 4EAHA 3RPUA 4CQIA 2ANJA 2ZMAA 3ETVA 4ZI3C 2O7IA 5C8YE 3BK9A 1IZNB 1LVFA 3LSXA 1DTGA 1N3XA 1EZ9A 4YAHX 1FQAA 3TCFA 4FORA 1UX4A 2X66A 2HFBA 3OBVE 1Y1MA 3N9OA 4QWNB 1A8FA 2F6PA 3RRCA 5FNVE 2PT2A 1DPPA 1OIBA 5AE4A 1D0ZA 5ITOA 3Q2MA 4JSOA 5F7VA 4Q30B 4PK4A 1UTHA 3MP1A 1H44A 3SDFA 5LHHB 3GN5A 4KBMB 1FMWA 5H8SA 4I9DA 4P11A 4NF5B 3VVDA 2REJA 5IKBA 4NMYA 2I6EA 3D4GA 2EHOA 2V7LA 4I43B 3ETUA 3RC3A 4BLAA 3SERA 2DCFA 4FJOA 1SW4A 3UP9A 4OESA 1BIYA 3H06B 3FJGA 5LG4A 4FEDA 1E1HB 5JTYA 3VKHA 3KOTA 1T98A 4M1PA 2O7UA 3TTLA 3I5OA 4U21A 4IO5A 2LHNA 3AAIA 4C90A 4MLVA 4X1DA 4N13A 3GWHA 2WM9A 2NW7A 1B1XA 4FECA 1EZOA 1QUIA 2LHRA 1B9JA 4G77A 1AJ3A 1B5JA 1P1WA 1N7WA 4ZZEA 3E0ZA 1QW0A 1MIWA 4AKGA 2AYSA 1BP5A 4DIGA 4C1UA 4HW8A 4XKRA 3UTKA 2FYIA 2RCAA 3SRZA 3MZ9A 3R84B 4DZ1A 3FD3A 3N9PA 3ZN1B 3T93B 2I59A 2L9QA 2B3BA 3K1MA 4KI0E 3O9PA 2OWTA 4UVAB 2OA5A 2V7MA 3H3GA 5DT6A 2V3QA 4GK5E 2XXIA 2J1DG 3PMWA 3Q26A 1JVXA 1O63A 4OQOA 1SQYA 3S4UA 2PT1A 4IE5A 1XT8A 3N9QA 3MPKA 1HSEA 5DVJA 3C9HA 5TP9A 2Z6EA 3W9WA 4UIGA 3IJXB 4DMVA 3I9WA 4PJJA 5ITPA 2RP4A 1URDA 3RN8A 1II5A 2YU2A 1HSLA 3H03A 3R6UA 1MMGA 2DI4A 4YFSA 5CC2A 5KMGP 1QKAA 3VVEA 4H63V 1LFGA 2FNCA 1M5DA 2RCBA 1B05A 2C0SA 3C32A 3IB0A 3TQLA 3RQTA 4F1VA 3N6TA 2MBGA 4DBRA 4I55E 1JEVA 4HGAA 1YPNA 2LT3A 4O3AA 1S50A 1A7LA 3HHFA 4L5GA 3FBZA 4K0UA 4GOUA 4XIGQ 2QGSA 4NWCA 2ZYNA 1WDNA 2XX9A 1XVYA 2W63A 4CXYA 5JH7E 2VWAA 4H67A 3IF8B 3R7XA 1S35A 1O64A 5DQVA 5JK4A 2K48A 3OO6A 2E8IA 4ISSA 3TFLA 2N1GA 4R2BA 4U4SA 3O66A 2WAUA 1NKXA 1ZIUA 2VL8A 4KCCA 1IXCA 2OWSA 4EYYR 5H8NA 2NTYA 4PETA 2Q8JA 2MYSA 5CA1E 3BFTA 3F31A 5B7DA 4QX8B 1TXFA 2DXYA 1OLCA 4WNKA 4F1YA 1SD3A 1MM6A 1B7TA 4UV9B 3CFZA 2KLFA 3I3VA 4H9OC 4OYJA 5LGUB 3W15C 2UVHA 1URGA 1B58A 4P0BA 3K1PA 2GHBA 4TQUQ 2V7JA 2KZ7B 3EVYA 4EQ7A 1ZKEA 4HCYA 1Y3PA 2H3RA 4XBFB 1A55A 4ZEFA 1ZHCA 1B40A 2R6GE 1MDP1 5KDTA 2H98A 3K3OA 2WSSV 3LK3B 5L3FB 3AAAB 4ZDMA 4G68A 4IE7A 3ZJ2A 2V7KA 3M3KA 4OERA 4FATA 1G8XA 1SI1A 3OO7A 4F3SA 4EXLA 1B51A 3C34A 2WMOA 5KDTB 2V93A 3ZPOA 2BDEA 4PJLA 1JNFA 4ILUA 1MXXA 2Q89A 5I56B 4GIWA 2CE7A 3GLBA 1B32A 2ALUA 2QPQA 4GL8A 1TFDA 3TQWA 1F9BA 4Z8XA 3U1OA 2IC9A 5F3JA 1MQJA 3LSLA 2F78A 3MK7C 2DLRA 2WWUA 3ZMTB 5H8HB 1TT1A 3CSGA 3KN7A 5JQGE 3HKDE 4JWXA 4IGUA 4IDZA 2Z8DA 2XXPA 4I1DA 3AA7B 4AQFC 3PURA 4IY5A 3UFEA 1I6BA 4ZS3A 2WMNA 1OLAA 5FXXA 3MJNA 5A5XA 2NW9A 2CLYC 3C98B 1Y64B 2Y6XA 4RPNA 2F36A 2XXRA 4EZHA 5AA4B 3LC8A 4FIMA 4ELPA 4UVCB 2DVCA 4TX5A 4WBNE 2LSIA 3UK4A 5HXEA 2W0GA 2VD2A 4RPOA 4QKNA 3FXDB 3RKOA 2W00A 3RT6B 2JMHA 3Q25A 4AB6A 5I2KB 1YCJA 2KMFA 3OOAA 4YLHA 5JREA 5TAOA 2YU1A 2ZYOA 5FHNA 3ZLIA 3ZS6A 3N26A 3C36A 4EDPA 4F19A 1YAEA 2XXUA 1VSOA 1WYBA 3KFWX 3N94A 2PFVA 4QFLA 3T9HB 4BDLA 4AQ4A 1MY1A 2VK9A 1FQDA 2RC8A 5LOVE 1B2HA 4B6XA 5I2NB 2X7PA 4X1BA 4AKHA 1VOMA 4BJMA 3DLNA 1ZTYA 1PB8A 4QFOA 2B1EA 5FY0A 4JEHB 2X51A 2F6GA 3KFMA 2GH9A 2HPJA 5LNKA 2ODUA 1R1NA 2CWOA 5LBQB 3N9NA 1USYH 4IY6A 4X48A 1B3LA 4XKPA 5FY7A 1JVYA 4GVOA 3N5LA 2AL5A 1NNTA 1IXGA 3GN5B 4PFPA 3MAMA 3B57A 3IB2A 1NAFA 4CZZB 3USDA 2CEAA 3PUVE 4Q0CA 3G3HA 3CKDA 4OWDA 3IO4A 4KPTA 2DWJA 1HFAA 5FXVA 1FQBA 4H9SE 3PD9A 2KNDA 2X68A 1PDAA 2D5UA 2I4BA 2UXXB 3VXCA 1IIWA 3S9MC 3V8XB 2DWKA 1HG2A 3AVSA 2HEUA 3B13A 2KWHA 1DOTA 4YMAA 4TV8E 4JUYA 3CG3A 5H6QB 2DOJA 1B46A 1QUKA 2F5XA 2Y7RA 2A5TB 5LXTE 4H9PC 2Y7WA 3CRBA 1Y1ZA 4P0GA 4QXBB 5JDFA 4YU0A 4LATA 3ZSFA 5A5XB 4JWOA 1B5IA 4BAYB 3KJ7A 2EHOC 1CUNA 3QUFA 2I4CA 3I1AA 2DS9A 3MJXA 1MXVA 2Y84A 5CMCA 3RLFE 4QFKA 4R9GA 2CM0A 4RYAA 2OZZA 3N9LA 3FXEB 2IC6A 5E0OA 1MQGA 3KSXA 2LSJA 3UIFA 4XZCA 2KXPB 4ZOLE 2B3FA 5KZTA 4GRKA 5ICQA 5I2KA 3CX8B 3ZYMA 1CE2A 1MH3A 1N76A 1WRDA 3RC8A 2F35A 3U92A 2QJEA 3EN3A 4IO3A 3PU5A 4HKAA 2Z22A 4DCXA 4QSEA 4ZS2A 2IEEA 5I59A 1UQWA 4EZ4A 4I4TE 4ISTA 3FVNA 2LEHA 4IO2A 1I69A 1POTA 4LUBA 4H8IA 2ZNSA 3KBTA 2ZM0A 1LRZA 3FB2A 3ZC1A 4C0RA 5F8PA 5FTIA 4C91A 5AA3A 4EXTA 1D0XA 3E13X 1Z7ME 2ACXA 2CXLA 3IB1A 2R71A 3Q27A 2KWIB 5K2XA 1Q1KA 5FYMA 1OVBA 3O1JA 4IE6A 4CXWA 1ATGA 5JDHA 2X7QA 3SEXA 3K02A 3P7IA 3KV9A 2L8KA 3C64A 3OO8A 3RYCE 4POWA 4OETA 3Q5WA 2NWJA 3U93A 4MBQA 4F3BA 4H6DA 1U5PA 5EZYE 2A72A 5I59B 1B7HA 3IOVA 3O9XA 2IA4A 3PPNA 5DJQC 1IITA 1B3GA 3HPIA 1VR5A 3O29A 4ONYA 1EZPA 1DSNA 3KGCA 2Y7IA 2QS1A 2UVIA 2DHRA 1PBPA 2BJJX 3MBPA 2PG8A 3ESLA 2F7AA 1EH3A 3TELA 3TMGA 1GTKA 4ESXA 4F31B 5DEXB 3PDYA 3OJAA 1S9TA 2ZMBA 5DVFA 4TUYE 3FZVA 4EQBA 4PFUA 5H8QA 1NFTA 2O69A 2JQQA 2LOPA 4X20E 3H4ZA 3SEVA 1XC1A 5H8HA 1ANFA 2NXOA 2Q9TA 3IOWA 3HI2A 4KR5A 1SW1A 1MPDA 2AIXA 3EPEA 1VFEA 3FATA 1R9LA 3HV1A 4P0AA 2ES0A 3KEIA 1NH7A 1LAGE 5H8QB 4LONB 2KINB 3K6VA 3F2EA 5H6RB 5DVIA 1H3DA 3JYRA 2HH7A 3TKLB 4YMBA 3DTOA 3DM0A 4ISUA 3U3IA 4ZI2C 4NF6A 4L0RA 4PW8A 3FIRA 3VLVA 4IGRA 5LOMA 5ADXL 4AQGA 3LG7A 1LFHA 4N6PA 3Q5XA 4KFQA 4KQPA 3S9NC 3PUWE 3KBRA 5HPQA 1XS5A 4IIJE 4ASKA 3QK6A 5M4YA 2XXTA 3MZBA 2NVUB 1IQ7A 1ELJA 1OQHA 4UACA 2YINA 4C1TA 3RYHE 4LP2B 5LHIB 4U4XA 1R9QA 2LJLA 2JRKA 3AA0B 1Y3NA 2P1SA 4GXSB 4H9RC 1BR1A 3SEWA 3OD7A 3Q29A 4OYKA 4PFWA 2X67A 2G29A 3RUMA 2V1DB 3MVZA 4NF4A 5LA6E 1UIVA 4OFLA 1EU8A 5IYZE 2DE2A 3K3NA 1P1OA 2Z8EA 4GWOA 1D9VA 3SEUA 2PBWA 4EF1A 3PD8A 3K0VA 4DXUA 4LZ8A 4PNIA 5JVDE 3KN3A 3U94A 2NTXA 4G63A 2A2FX 4ZECA 3AB3B 4G2ZA 1MXUA 3QXMA 2DWGA 2E9XD 1FMVA 4GYSA 2QL3A 3F11A 2M8CA 1GR2A 3I6VA 1B0LA 4PJNA 4O3CA 2YEVC 4HN9A 3UGWA 3O6HA 3FXRA 3PU8A 2O1MA 4RK9A 2PVUA 4NWDA 3T22A 2B65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JB7 A;  3GXA A;  4DCY A;  3GLB A;  3VLW A;  2XX8 A;  1B32 A;  2ALU A;  2QPQ A;  4UA8 A;  1US5 A;  3KSJ A;  4GL8 A;  4IO7 A;  1TFD A;  3TQW A;  1F9B A;  4Q5T A;  5JEI A;  2XD2 A;  2QS3 A;  5CMM A;  2IC9 A;  3U1O A;  3JV9 A;  1MQJ A;  3LSL A;  3PV0 E;  1FTL A;  2F78 A;  1US4 A;  2D3I A;  2UYF A;  5I57 A;  1PB9 A;  3LR1 A;  2Y7P A;  1HSJ A;  3FV1 A;  3ODB A;  3QYT A;  3PMX A;  5DTB A;  3FVK A;  4OMB A;  1FCK A;  4FI5 A;  3AXF A;  1LB9 A;  1TT1 A;  5H8H B;  3CSG A;  3KN7 A;  1H43 A;  1JW5 A;  3TZA A;  3TTR A;  1M5B A;  4ESW A;  1N3W A;  2DXR A;  4JWX A;  4ZEI A;  4NF8 B;  5IAI A;  2Z8D A;  1OQG A;  1OVT A;  2DVZ A;  4PFY A;  2XXP A;  4OEN A;  2ONS A;  1L5T A;  1P99 A;  1EZP A;  1B3H A;  3WAE A;  4I1D A;  3CFL A;  1AOV A;  4WKM A;  4I62 A;  4OEV A;  3IOT A;  4IY5 A;  1I6B A;  4LVQ A;  3A3C A;  1DMB A;  1OLA A;  4G8N A;  4GD5 A;  5TU0 A;  3FJ7 A;  3TYH A;  2XXY A;  1MQI A;  3BFU A;  2F34 A;  3MJN A;  3O6I A;  4H5F A;  4I8C A;  5HBC A;  2I3V A;  3B6Q A;  4F3P A;  4ZE9 A;  5A5X A;  1O7T A;  3IL1 B;  3IOU A;  3K1N A;  3OEN A;  4RPN A;  2V3T A;  3G7W A;  4M4G A;  1LB8 A;  2F36 A;  1Z7N E;  2XXR A;  4IGT A;  1AH5 A;  3IOR A;  4R6K A;  2G0U A;  4F29 A;  1NL5 A;  2ONK E;  1AMF A;  5AA4 B;  2F7B A;  1IXH A;  2QMX A;  3LBS A;  3LC8 A;  3MP8 A;  3O6G A;  4FIM A;  4ELP A;  1MY4 A;  2DVC A;  2HAU A;  3H6T A;  3OMB A;  3UK4 A;  3RNN A;  3MXZ A;  2HZK A;  2VD2 A;  4GFR A;  4RPO A;  2ZYK A;  3FXD B;  4ND9 A;  4R75 A;  4R72 A;  4H65 A;  1MQH A;  3CIJ A;  4MLQ A;  4Z7E A;  3T9U A;  2HQ0 A;  2QRY A;  2OBG A;  3Q25 A;  3RT6 B;  3M3L A;  4AB6 A;  5I2K B;  1YCJ A;  3TEP A;  1DTZ A;  5EHM A;  3PPP A;  1LAH E;  3LUY A;  3OOA A;  2I58 A;  4YIC A;  1ZLQ A;  2G93 A;  2OJT A;  4PQJ A;  5BWJ A;  5K2Y A;  1MS7 A;  4RXL A;  2ZYO A;  2UXA A;  3PGF A;  3EHS A;  5FHN A;  4U2R A;  4NF6 B;  3B6T A;  5TP9 B;  3SES A;  2RC9 A;  3ZS6 A;  2H9B A;  3L6G A;  3FVO A;  3RPW A;  4F18 A;  3ZKL A;  1LST A;  3S9E A;  5AA2 D;  3N26 A;  4P0I A;  1LCT A;  3RTW B;  3H6W A;  3GBA A;  3DP4 A;  4HCW A;  1B3F A;  3C36 A;  3A09 A;  4JDF A;  3SET A;  4EDP A;  2V84 A;  3U8Q A;  4PP0 A;  4F19 A;  5HM4 B;  4H8J A;  4EQ9 A;  2YLN A;  1YAE A;  3VE1 B;  4FE8 A;  2XXU A;  5I58 A;  1VSO A;  1Y20 A;  1D9Y A;  2UVJ A;  3B6W A;  3N94 A;  4G68 C;  1N0T A;  3G3J A;  3MC2 A;  4U1O A;  5L8D A;  4DXB A;  4QFL A;  4BDL A;  1I6Q A;  3T9H B;  2Y7K A;  1ZBM A;  1MY1 A;  1B4Z A;  3DP6 A;  4H1X A;  1FQD A;  1FTO A;  2HCA A;  3CSB A;  4OVJ A;  4YB6 A;  5ELV A;  4HS7 A;  4YB7 A;  2RC8 A;  4GXA A;  4OHN A;  2D21 A;  1B2H A;  3VVF A;  4B6X A;  2WKY A;  1MRP A;  1B5H A;  1FQE A;  1FQC A;  1SBP A;  2X7P A;  4L17 A;  4KYE A;  4NF5 A;  4X1B A;  5CI5 A;  4EUO A;  1MQD A;  2H4I A;  2GFE A;  3DLN A;  3PPO A;  1ZTY A;  3H7M A;  1B0H A;  3GZG A;  4GLI A;  1PB8 A;  4R6H A;  2ABH A;  4J2C A;  3CFX A;  4QFO A;  4WED A;  4IB2 A;  3V89 B;  2F6G A;  3KFM A;  4KYD A;  4F2Q A;  2GH9 A;  4U23 A;  1RYO A;  2DWH A;  3SKP A;  3EHU A;  4DND A;  2XXW A;  2XXQ A;  1IJ5 A;  1R1N A;  3QIM A;  1VE4 A;  1VFD A;  2QS2 A;  3HST A;  3IR1 A;  4LQ5 A;  4WEP A;  5F1Q A;  1USY H;  4H5G A;  4IY6 A;  4X48 A;  3TAJ A;  3E3K A;  1B3L A;  2HZL A;  4XKP A;  1JVY A;  4GVO A;  3N5L A;  4WXJ A;  2GHA A;  2AL5 A;  3RGY A;  2E1S A;  1NNT A;  1PB7 A;  1IXG A;  1QKB A;  1XOC A;  2V3U A;  3PUX E;  3Q28 A;  3MAM A;  4OFO A;  1PC3 A;  5FHO A;  3T9X B;  4ZED A;  4GQO A;  1BLF A;  1H45 A;  4KHZ E;  1SW5 A;  3IB2 A;  2R9J A;  3USD A;  4XXU A;  1Y9U A;  3PUV E;  3G3H A;  3CKD A;  2GRV A;  3N6U A;  4Q0C A;  3FGS A;  5EYF A;  4FAJ A;  3A3U A;  3CVG A;  4ZZA A;  3V5A A;  2I0C A;  3KJT A;  4OWD A;  2Q88 A;  3IO4 A;  1MPC A;  1RKM A;  4KPT A;  5JTY B;  1SYH A;  2DWJ A;  3VXB A;  5KCJ A;  1Y4T A;  1IJ6 A;  1FQB A;  2D5W A;  3QSL A;  5J1D A;  3PD9 A;  1PDA A;  4BDO A;  1A8E A;  1QUJ A;  4DXC A;  2I4B A;  4F2O A;  4ZEB A;  5KCJ B;  2RF1 A;  1QJM A;  3VXC A;  1IIW A;  1POY 1;  5H8F A;  3S9M C;  3V8X B;  2HEU A;  4CQI A;  2ANJ A;  4GF8 A;  3CG1 A;  2KWH A;  1DOT A;  4YMA A;  2O7I A;  4NE4 A;  1PEB A;  1OMP A;  3BKI B;  3PUY E;  2F97 A;  3CG3 A;  2DOJ A;  3MVW A;  4ELO A;  2O1L A;  1B46 A;  3ECR A;  1QUK A;  2OCU A;  2F5X A;  2P0S A;  1LVF A;  1UTB A;  2QSX A;  3LSX A;  2Y7R A;  4YKK A;  2A5T B;  1DTG A;  1N3X A;  3HCQ A;  4U22 A;  1EZ9 A;  2Y7W A;  4YAH X;  4ZS9 A;  4ZEK A;  2I48 A;  1FQA A;  3CRB A;  4YZZ A;  4F22 A;  1Y1Z A;  3K6W A;  5FHM A;  3T9V A;  4FOR A;  1FW0 A;  1B3E A;  4P0G A;  3OEK A;  4YU0 A;  2CA5 A;  2HFB A;  4LAT A;  3UOR A;  4JSD A;  3O28 A;  3ZSF A;  1Y1M A;  4ECF A;  5A5X B;  4JWO A;  1A8F A;  4EF2 A;  1B5I A;  2F6P A;  4OER A;  2PT2 A;  3KJ7 A;  1DPP A;  1OIB A;  5AE4 A;  2A5S A;  2Q2A A;  1B6H A;  3QUF A;  5ITO A;  2I4C A;  4JSO A;  3THI A;  5F7V A;  2XHD A;  4RJZ A;  4Q30 B;  3VDF A;  2DS9 A;  1MXV A;  1UTH A;  3MP1 A;  4KD5 A;  1H44 A;  2NOO A;  3SDF A;  1JW4 A;  2Y84 A;  5CMC A;  3RLF E;  4OYV A;  4QFK A;  3SEY A;  4R9G A;  4RYA A;  2OZZ A;  3B7D A;  4NF8 A;  3FXE B;  1B4H A;  3EF7 A;  1MDQ A;  1S7Y A;  3PPR A;  1CB6 A;  4RY1 A;  5H8S A;  4I9D A;  5AA1 A;  1MG1 A;  4P11 A;  2IC6 A;  4NF5 B;  3VVD A;  3MZ1 A;  2YJP A;  2REJ A;  2FA7 A;  1MQG A;  2OLB A;  3KSX A;  5CM6 A;  5IKB A;  4N07 A;  4NMY A;  2RKM A;  2I6E A;  2H99 A;  1A99 A;  1H7C A;  3UIF A;  2XTL A;  3D4G A;  5CRY A;  4YKP A;  2B3F A;  5KZT A;  1TFA A;  4GRK A;  5ICQ A;  4QF9 A;  4BLA A;  5CMB A;  3SER A;  5I2K A;  4QSC A;  4IO4 A;  1CE2 A;  1MH3 A;  1N76 A;  1SW4 A;  1NH8 A;  1MY0 A;  3UP9 A;  2C5I T;  1IZ1 A;  1BIY A;  4OES A;  2F35 A;  3FV2 A;  3U92 A;  4RA1 A;  1MPB A;  2CZL A;  2QJE A;  3H06 B;  3EN3 A;  3FJG A;  4IO3 A;  3PU5 A;  4PFT A;  3MVY A;  4FED A;  3FJM A;  4G4P A;  3U72 A;  4XTC Q;  3RTF B;  5JTY A;  3KOT A;  1AL3 A;  5CMK A;  4OZ9 A;  4QHQ A;  1M5F A;  1WOD A;  2O7U A;  3I5O A;  2I49 A;  3MWB A;  4U21 A;  3TTL A;  1B1H A;  2Z22 A;  4IO5 A;  1LFI A;  2PX1 A;  3KG2 A;  4MLV A;  4JXI A;  4X1D A;  4DCX A;  4QSE A;  1IXI A;  2F8D A;  4N13 A;  4TLM B;  1LBB A;  2IEE A;  5I59 A;  1UQW A;  3MP6 A