3QUJA

Crystal structure of the phosphonate binding protein, phnd, from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
301
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 100
structure length 301
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qujA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA02
1Z0PA 4RK2A 2O69A 3T66A 2HEUA 1IJ6A 2OWTA 1FTKA 1URDA 3N26A 4Q0CA 3P7IA 3G7WA 4NF8A 2P2AA 1B3EA 2Z8EA 4IY5A 4KCDA 3MP8A 2DE3A 5AA4A 4G8NA 1Y4TA 3C31A 1OLCA 2PT1A 1QSDA 4ESWA 4EUOA 1YPNA 3H3GA 2HXWA 1LSTA 4TLLB 2OBGA 4XXUA 3S2VA 1XVXA 4U2RA 5DEXB 2XXWA 1LVFA 2AL4A 3SDFA 2ZMBA 1N7WA 1BKAA 1M5BA 2UYFA 3RTFB 1JVXA 3R7XA 3ZSFA 1PBQA 2ZNSA 4ND9A 3MPKA 4FORA 5H8HA 2VD2A 4XTCQ 5KZTA 3PMVA 1ATGA 5DYHA 5A5XA 4OWDA 3THIA 4RY1A 2UYEA 3R26A 4N6PA 3T9VA 4I1DA 3QAXA 1B58A 4GQOA 2XXYA 4JWYA 2RINA 2YPNA 1JEVA 5CI5A 2V25A 1LBBA 1XVYA 4MLVA 3SEWA 3CVRA 1ZKEA 3O97A 3U72A 1FCKA 4H67A 3V89B 3EQ1A 2DE2A 1MM6A 4WKMA 1ZIUA 1Z7ME 3K2DA 2PMSA 4F1UA 4DDDA 1MH4A 2OJTA 3O28A 5FTIA 1NKXA 1DMBA 5FTHA 1B2HA 3R6UA 4LQ5A 4ZECA 2DWJA 3VVFA 3T9XB 3ECRA 4JWOA 4EQBA 3CVGA 1N76A 3IB0A 2HZKA 3S9MC 4F3SA 2XXUA 5FHOA 1H7CA 3KN3A 2V3QA 1A40A 2QJEA 3FJGA 1XOCA 2RC8A 2OK2A 5CBSA 3LSLA 2K48A 4PFUA 5TP9A 2I4BA 3PMWA 2XXQA 3CR9A 3HN0A 1I69A 3PD8A 5FHMA 2D3IA 1NNFA 4NE4A 3SKPA 2P0SA 1EZ9A 1B51A 1D9YA 4YKJA 3IB2A 2DS9A 4X48A 5M2VA 3CG1A 4HCWA 3FXRA 1UQWA 1NNPA 1FQEA 4QFPA 3PPNA 1MDP1 4FAJA 3H03A 2Y7RA 1D9VA 4GXAA 4GRKA 3T96B 2F97A 3G3GA 4RPOA 1UTBB 3CSBA 5CMBA 4G68C 4X1DA 4E0XA 3ILUB 4BDQA 4NF5B 3FVKA 5CMCA 1LAFE 2F34A 2XXIA 1H44A 3W15C 1EZPA 5HBCA 5IAIA 5H8QB 4R75A 2QMWA 3B6QA 2QS2A 4OXVA 3FXQA 4I9DA 1OIBA 2NOOA 3KJTA 1DTZA 2XX8A 3ILTB 3RUMA 1M5FA 3DELB 4LQ2A 1FQDA 3E4RA 3BBRA 3Q25A 4TLMB 4O3AA 3QUJA 3VDFA 3IORA 1RYXA 3LSFB 1ZTYA 1Y9UA 5KCJA 3K1PA 2QPQA 5EYFA 3S9EA 1MXYA 3FIRA 2IC6A 1TXFA 2XXXA 2RC7A 3KFMA 4K3FA 1URSA 1TWYA 2I4CA 3TTLA 1BTJA 4NF8B 2VGQA 4RXLA 1OLAA 3JV9A 2VP1A 3K1MA 4U22A 1R6ZA 2PT2A 1Y3PA 1MPDA 4M1VA 3MVWA 4YAHX 3HPIA 1ZBMA 1IJ5A 2Z22A 5AA4B 3IR1A 2QS1A 1MPBA 5TU0A 4JBZA 1MM7A 2RCBA 1LBCA 2AL5A 4GIZA 3QXMA 4QFKA 3VXCA 3TUSA 1PB9A 2A5TA 4WEPA 4R73A 4IGTA 2HZLA 2O1MA 3KN8A 1LAHE 4AB5A 2ZYKA 1P1QA 4H6DA 2ABHA 5F7VA 4NEDA 5H8HB 1GTKA 2QMXA 4BDLA 1AIVA 2HFBA 1Y1MA 4YKKA 5A5XB 4Q30B 1ANFA 1SYIA 3CRBA 4JB7A 5DTBA 5HPQA 1ELJA 4ZEKA 4O3BA 2OZZA 1ZJLA 2HAVA 4RK9A 5K2XA 1MQHA 4JSOA 2XXHA 3FXUA 3T93B 3K6VA 1VR5A 2I58A 4EXKA 4YMBA 1D4NA 1RKMA 1B3FA 1QW0A 3RGYA 2V3UA 4E0WA 1MQIA 3H6WA 1A8EA 1NL5A 3FUZA 5JK4A 3GBBA 3FV2A 1P1NA 3FD3A 3TZAA 4F3PA 3T9HB 1S7YA 2H4IA 1OVTA 1N0TA 5ICTA 4U1ZA 3PPOA 5F1QA 2Q88A 3TCGA 4DCXA 1BLFA 1XHYA 3FVGA 4R6KA 2X7PA 3HV1A 4GOTA 1AH5A 3K01A 2ONSA 3U92A 4DIGA 2WKYA 4UACA 1LAXA 2XX9A 1NH8A 4G2ZA 3RLFE 4I8CA 5TP9B 1B5HA 2F35A 2Q89A 3OO7A 1OQHA 5H8NA 1T0KA 3VXBA 2HAUA 3PMXA 3MZ9A 4GFRA 2O51A 4UA8A 1SVXB 3CKDA 1B5IA 3QIMA 3FXEB 2Q2AA 4GL0A 2GFEA 2O6AA 3PD9A 3MJNA 5I58A 4ESXA 1FTMA 1IZ1A 4HW8A 1IXGA 1ZKBA 1CE2A 2XXPA 4YB5A 4BDOA 3OO6A 4JXIA 4NF4A 3RY3A 2W7YA 1O7TA 1N84A 1D3KA 2HQ0A 2REJA 4NWCA 4F19A 2ZNTA 5B70A 1P1UA 4HCYA 2F7AA 2F6PA 2UVHA 4ZDMA 2O68A 4KPTA 3KBRA 3MZBA 5KCJB 4L17A 4GXSB 3M8UA 1H45A 2DSFA 2NVUB 4IO3A 1JEUA 4XKPA 5EHSA 1VFEA 2QRYA 3MQ9A 1IQ7A 2DWHA 4C1UA 1J1NA 1A54A 1LFIA 4F1VA 2O7UA 3IX1A 1NNTA 2KLFA 3I3VA 1HSJA 3AXFA 1JW4A 5I2KA 4IY6A 3I5OA 5EHMA 1JQFA 2V93A 1GVCA 1YTVA 3M3LA 2DWIA 2X9XA 3Q26A 2NUVA 3C36A 2A5TB 2D5WA 3B6WA 2E0SA 3CSGA 2DWAA 1FQAA 3TODA 1LGBC 1SI0A 4U4SA 4GF8A 5DT6A 3SEXA 1MQGA 3MWBA 1SW4A 2V3TA 3TTMA 3TELA 4OVJA 3KG2A 5AA2A 3Q28A 2CMOA 3JYRA 2C5JA 4AQ4A 4YZZA 1B3HA 3HO7A 4OFOA 2H9BA 1JETA 2CA5A 4Z7EA 5AA3A 4O3CA 3C4MA 4YMAA 2VOZA 1B7HA 3IO4A 2LAOA 2DXRA 3K02A 3RPWA 2E1SA 3DP6A 3UA8A 1IUDA 1TFAA 1QUJA 2B65A 3FASA 3KOTA 4RPNA 4R9GA 3IOWA 4MFIA 1EZOA 4ISUA 4U4XA 4C1TA 1LAGE 2XX7A 1HSEA 3CFLA 3TKLB 4DLDA 3O6GA 1BP5A 1IXHA 1MXVA 4WEDA 4EF2A 2ESNA 4BLAA 2I3WA 3DLNA 3TPAA 4ELRA 4ZEFA 3QYTA 4L0RA 5TPAA 1II5A 3H4ZA 3G3KA 2IC9A 2RKMA 4NTLA 2Y7WA 1H3DA 2G29A 1SYHA 1JVYA 3VE1B 2R9JA 5DVJA 4F39A 3IAZA 1OQGA 3QSLA 4LZ7A 1FTJA 4LVQA 4PFTA 1GV8A 3C34A 3TFLA 1IXIA 3JZJA 1QJMA 1SI1A 1B7ZA 4FIMA 4MF3A 5CC2A 1US5A 3A3UA 1ZMGA 2ALUA 3OEMA 5H8NB 1S50A 3DM0A 1IEJA 3U1OA 4H0WA 4OEVA 1NFTA 1N7XA 2OCUA 3FGSA 1SDXA 3VFJA 3C32A 5I58B 1UTHA 3N94A 4ZS9A 1FQBA 3FJ7A 4RJZA 1B7UA 3TKDA 2Q8JA 2ANJA 3CFZA 3S9NC 1UIUA 3RT8A 3VVDA 4RNSA 4H8IA 4RYAA 4KR5A 4NF4B 2VHAA 4DNDA 2I49A 4ELQA 5CRYA 5J1DA 4EQ9A 4KD5A 1PC3A 3EF7A 1IXCA 4IO6A 4OTEA 2F6GA 4G4PA 3HHGA 1O64A 1M5DA 1PBPA 2XD2A 2NXOA 1LFHA 1MDQA 1VE4A 3O66A 5L9SA 1MXZA 4POXA 3VLUA 2MBGA 2X9WA 3UN6A 3FVNA 2P1SA 3SEVA 1DTGA 3VLVA 1VSOA 2GRVA 2I3VA 2F7CA 3PPRA 2QSXA 3GXAA 4G68A 3RQTA 4ZZAA 1QUKA 1MXWA 4KYEA 1QULA 1FQFA 2FNCA 1R9QA 2X9YA 1B1XA 1DOTA 4GLIA 3ODBA 2DYXA 3C35A 3RNNA 4DCYA 1B3LA 3A09A 2GHAA 3EHUA 1A99A 5I2KB 5ISUA 4F2QA 2DP8A 4QF9A 1GR2A 1MY0A 3G3FA 3KSXA 4OERA 4OEUA 4OYVA 4LZ8A 4YB6A 2C5KT 3KN7A 1B52A 4R6HA 4OENA 4XIGQ 4F3BA 1I6AA 2V84A 5ITOA 1SQYA 3H6VA 3BKIB 4IO4A 2DQVA 3G3JA 5AA2B 2Q2CA 5ICQA 3IL1B 4FEDA 3S4UA 2IA4A 2B3FA 2DVCA 2DXYA 3OSRA 1DPEA 3EHTA 4IO2A 1ZU0A 1YCJA 2R71A 4H5GA 4OFLA 4XKRA 3MBPA 1B4HA 4GVOA 2ONKE 1QKAA 3H6UA 1B6HA 4KYDA 4YKIA 1WVJA 3H7MA 1B05A 4PE5B 3OSQA 1N3XA 3C33A 4FJPA 3D4CA 1USYH 4DXBA 3O9PA 1FTLA 2X26A 3A3CA 2ZYOA 4LONB 1MG1A 2XXRA 3EN3A 1MY1A 3RT6B 4TOZA 4U1OA 4F3GA 4R72A 1DSNA 3K00A 3S9LC 5I2NA 3K6WA 1US4A 5HM4B 3LSXA 1UIVA 2I48A 5I56A 1XS5A 3UK4A 3PU5A 3TTKA 5TPAB 2GHBA 3VVEA 4LUBA 3EPEA 1YAEA 4P0IA 2Y7IA 3K1NA 2C5IT 1F9BA 2RC9A 1LFGA 4DXCA 1HSLA 4C0RA 5IKBA 3PUZE 3FXDB 4J2CA 1MY2A 3MW0A 3IK6B 2I0BA 1R1NA 1Y20A 3FVOA 2DVZA 1LCTA 1B32A 2A5SA 3OD7A 3K6XA 3KSJA 3PUYE 3BFTA 4YICA 5CM6A 3OMBA 4ZE8A 3E9XA 2XTLA 1QUIA 1S9TA 4I62A 1PDAA 4NF6A 1Y3QA 2O84X 1MY4A 4OFJA 3HHFA 2OWSA 5JTYA 1UTHB 3WAFA 3MVZA 3RTWB 1MQJA 1USYE 1I6QA 4R9FA 1O63A 3PGFA 4QSDA 5JEIA 4IGRA 2YJPA 3W9WA 1B4ZA 4JWXA 4FECA 4IO5A 3IOTA 5I57A 1JNFA 3IOUA 3MAMA 4N07A 3USDA 4KQPA 1OVBA 4QSCA 2F8DA 2H5YA 4LZ5A 1RYOA 3KZGA 2UVJA 2QS4A 4KHZE 1PB7A 4FEBA 1B5JA 5AA1A 2Z8FA 2Y84A 4NMYA 3SEYA 2X7QA 4KI0E 2PX1A 4G8HA 1IIWA 2XXVA 3UGWA 3BFUA 2R6GE 1OMPA 4DZ1A 3TAJA 1A55A 4G68B 2QS3A 3TYHA 3WAEA 4MH5A 4P11A 3Q27A 1NMUA 4QRZA 4BDNA 1WDNA 3W9VA 2UVGA 3SERA 3IJXB 2VD3A 4KCCA 4P0GA 2XHDA 3QUFA 3MZ1A 1B40A 1LRZA 3SETA 3EHSA 4ELOA 2Z8DA 2ZYNA 2ZYMA 3L6GA 4JDFA 1QKBA 2F5XA 5H8FA 4Z0IA 3TCHA 2G93A 1MRPA 1ZLQA 1P1WA 3O6IA 1FQCA 2H99A 3B7DA 1VFDA 4F18A 4TQUQ 1A8FA 1WODA 4R2FA 4LATA 4ELPA 2UXAA 4QSEA 3U8QA 1I6BA 1NH7A 4BDMA 1PEBA 2D21A 4EF1A 3O29A 4IO7A 3CIJA 2IEEA 3M3KA 1P1OA 3DP4A 4DXUA 5CMKA 4FI5A 2FYIA 1Q35A 4QFOA 3UORA 3U93A 2F78A 3T22A 3OO9A 3CI8A 1B1HA 5FHNA 3M3FA 3K4UA 4OESA 1AOVA 1MXUA 3LC8A 3OENA 4ZZEA 3T9UA 4PP0A 2F36A 1URGA 1MS7A 1Z7NE 2PVUA 4R6YA 2PBWA 2Q9TA 2OLBA 1XT8A 4QHQA 3FV1A 3E3KA 2FA7A 4G77A 3N5LA 1EU8A 1NNKA 5I2NB 1KWHA 1LLSA 2I6EA 5I56B 4ZEBA 2YLNA 1IITA 3LUYA 1POY1 2UVIA 4ECFA 1N04A 5I59A 3D4GA 4H65A 4LP2B 3CG3A 3IOVA 1MH3A 1H43A 2DOJA 5KDTA 2B3BA 3H06B 4KYSA 5CBRA 4DE8A 3TEPA 5BUUA 5I84A 4THIA 3TCFA 1Y1ZA 1R9LA 2NWJA 3MC2A 2HCAA 3V83A 1M5EA 4NF6B 5K2YA 4WXJA 1PB8A 1JW5A 4QFNA 4GWOA 3OOAA 3OXNA 1LB8A 3DP8A 4F2OA 5AA2D 1XC1A 3ONMA 3PPPA 3TMGA 1LB9A 3SESA 3F11A 4EQ7A 3L6HA 3U94A 5JTYB 4R2BA 5DEXA 3PUXE 1B0HA 4EXLA 4YB7A 1FTOA 4RA1A 3C9HA 1N3WA 3K0VA 3VLWA 2O1LA 3QK6A 3B6TA 3MXZA 4ONYA 1B9JA 5I57B 4FATA 1A7LA 3GLBA 4POWA 3OELA 2THIA 1AMFA 3PUVE 2ZNUA 2RF1A 3G3HA 2KWIB 3ZKLA 2H25A 2XXTA 2PYYA 4H8JA 2AIXA 1CB6A 3MP1A 4CQIA 2ZXTA 4HS7A 3ZS6A 3TTNA 1B46A 3PPQA 4H1XA 3RN8A 3MVYA 1POTA 4EDPA 4F22A 4YKPA 2REGA 3UP9A 4MLQA 4MBPA 1FW0A 3TTRA 2G0UA 2H98A 1Q1KA 3I6VA 4F1YA 1BIYA 5L9MA 3FJMA 3VV5A 1JW1A 3MPLA 1AL3A 1B3GA 4X1BA 2Z23A 4Q5TA 2F7BA 1DPPA 2I0CA 1Y3NA 4ZE9A 4ZEDA 4FE8A 4OZ9A 1LCFA 1SBPA 3IO6A 3UIFA 4X9TA 4U21A 4N13A 3H6TA 4KFQA 3V5AA 4OHNA 1H76A 2BJJX 4F31B 4BDRA 5LOMA 3SEUA 3TQWA 4IB2A 4QFLA 3OEKA 3KOSA 4F29A 5H8FB 1QVSA 4PFWA 3HSTA 1GGGA 3G3IA 4Q8RA 3L3PA 1P99A 5BWJA 1TT1A 3K6UA 3MVXA 4XKNA 3IB1A 3V8XB 2GH9A 1MXXA 4G8MA 2DE4A 4EYYR 4R74A 4H5FA 3ZKKA 5CMMA 1MQDA 5DVFA 5L9OA 2AYSA 3IJOB 2RCAA 2Y7PA 3O6HA 4PETA 3O2AA 4GL8A 5AE4A 4OETA 3MP6A 4LA9A 2O7IA 4AB6A 4XKQA 1EH3A 1SW5A 1UTBA 3PUWE 4OQOA 3LR1A 1SW2A 1SD3A 4U23A 3PV0E 3TQLA 4NF5A 5DVIA 3KJ7A 3Q29A 2M8CA 3FATA 3GZGA 1B0LA 3HCQA 2XD3A 3MUQA 3OO8A 3GBAA 4PFYA 3E13X 3FZVA 4OMBA 3N6UA 5B7DA 1TFDA 5H8QA 4B6XA 2QL3A 3TDJA 2KWHA 3LSWA 5H8SA 5ITPA 1L5TA 4ZEIA 4M4GA 4PQJA 4GD5A 1MY3A 3LBSA 1MPCA 2ONRA 5I59B 3KEIA 3N6TA 1SW1A 3CFXA 5L8DA 4HTGA 2CZLA 4YU0A 1Y4CA 2Y7KA 4NWDA 4JSDA 5KDTB 3KGCA 1M5CA 5ELVA
chains in the Genus database with same CATH superfamily
3VU7H 1Z0PA 2YINA 2UUAT 4RK2A 2O69A 4DMWA 2IIUA 4MALA 3KBTA 3T66A 2HEUA 1IJ6A 2OWTA 4DV5T 3NBXX 1FTKA 2X67A 2NW7A 2XJ7A 1IMEA 3PU8A 1URDA 3N26A 5HXCA 4Q0CA 1XNRT 2DWKA 3P7IA 4YSXA 3G7WA 4NF8A 2P2AA 2ZM8A 1B3EA 2Z8EA 4IY5A 4IDPA 4KCDA 3MP8A 3UUBA 4GOUA 2DE3A 1W09A 5AA4A 3T1HT 3EVYA 1Y4TA 3C31A 2X51A 2WU5A 5JDMA 1OLCA 2FIXA 4G8NA 2PT1A 2J1DG 1QSDA 1KA0A 4ESWA 4EUOA 4HFBA 1YPNA 3H3GA 2NOXA 2HXWA 5C3JA 1LSTA 3RIUA 3UTKA 5KX5E 2XQAA 4TLLB 1FBEA 4N8GA 2OBGA 3ESLA 4XXUA 3S2VA 1XVXA 2WP9A 4AQYT 5JR9A 4ZS2A 4U2RA 5DEXB 2XXWA 1LVFA 2AL4A 3SDFA 3AXJA 4HWFA 2ZMBA 4L5GA 1N7WA 1BKAA 2JMHA 1M5BA 3EHZA 2UYFA 2V7LA 3AEEA 3RTFB 1JVXA 3R7XA 3ZSFA 1PBQA 4K0UA 2ZNSA 4ND9A 3MPKA 1T98A 3H3MA 4FORA 5H8HA 2VD2A 4DV0T 5HEOA 4XTCQ 5KZTA 3PMVA 4IE5A 2VKDA 1ATGA 5DYHA 3CHGA 2HHHT 2FHYA 5A5XA 4OWDA 3THIA 4RY1A 2UYEA 3RKGA 3R26A 4O4JE 5AQHB 4N6PA 1G0IA 4NX1A 3ROJA 4DI3D 4IE0A 3T9VA 4DVDA 4I1DA 5LP6E 3W15B 3GYYA 5FL0A 1EZ3A 5AQQB 4O7IA 4UV8B 3AAEB 3QAXA 2XSAA 3KV4A 3AEFA 4U2YA 1YD8G 5ABEA 1B58A 3RYDA 3ZYLA 1MMNA 3CX8B 5IHYA 4GQOA 3AA6B 2XXYA 3AE7A 4HFHA 5LOVE 4JWYA 2RINA 4N91A 2YPNA 1BR2A 1JEVA 2W00A 2BS2A 5CI5A 2V25A 1LBBA 5EK2A 4QWNB 5JH7E 3CMLA 4JI3T 1XVYA 2LSIA 4MLVA 2X0YA 3SEWA 2AXDS 3CVRA 1ZKEA 2E9XB 3ZEFB 5JTGA 3O97A 3U72A 4IT4A 4UIGA 1HS7A 1FCKA 2N2NA 5A1LA 4H67A 3V89B 3EQ1A 1YKHB 2DE2A 4GX6A 1MM6A 2N9DA 4QX8B 4HXVA 4WKMA 1ZIUA 1Z7ME 3K2DA 2PMSA 2PBIA 1IMDA 1HX1B 5HWYA 4DDDA 1MH4A 4F1UA 2YU1A 3P4WA 4YT0A 2OJTA 3O1IA 3O28A 5FTIA 1NKXA 4DR4T 1DMBA 5FTHA 3CQGB 1B2HA 2LKHA 3R6UA 4LQ5A 4ZECA 2DWJA 3VVFA 2D0TA 3T9XB 3ECRA 4JWOA 3N2OA 4EQBA 3CVGA 1N76A 2KLQA 3IB0A 3DTOA 4OK0A 2HZKA 4L9IA 3S9MC 4X1KE 3FZFB 4F3SA 2IUBA 3P4RA 2XXUA 3PUXF 5FHOA 2V26A 1H7CA 3KN3A 3WAKA 2ZLYA 2V3QA 2Q9QB 4X04A 1A40A 5LB7B 2QJEA 2OLTA 1XOCA 3FJGA 3KBZA 4X62T 2RC8A 2B76A 4AKGA 2OK2A 5CBSA 1HX8A 3C64A 3LSLA 2K48A 5AQPB 1OEDE 4PFUA 5AQGB 1DBZA 5L4HA 4FBPA 3AE9A 4NXMT 3RIFA 5AQRB 2VASA 5TP9A 5L47A 2I4BA 3O1JA 3PMWA 4CI3B 2XXQA 3CR9A 2NWBA 2L9QA 2N1GA 4GWWA 2WEFA 1E2AA 3HN0A 3N9QA 1I69A 1XMQT 3PD8A 5FHMA 3V5UA 2D3IA 4KHPT 5FP3A 1NNFA 4NE4A 3SKPA 5H6RB 4N6DA 2P0SA 1EZ9A 2OA5A 1B51A 1D9YA 4YKJA 3IB2A 4JI7T 1D0XA 2DS9A 2WYPA 4X48A 2CLYB 1XDOA 5M2VA 1SPIA 2BVMA 2J4GA 2VPNA 3CG1A 4AI6A 4HCWA 3FXRA 1UQWA 1NNPA 1FQEA 4QFPA 4CZZB 5AQFB 4JI2T 3PPNA 5CFBA 1MDP1 4FAJA 3H03A 2Y7RA 1D9VA 2V5CA 4GXAA 3BIGA 4GRKA 2KNDA 3T96B 2F97A 4ISSA 3G3GA 4RPOA 2KQZA 1FPLA 5LNKA 4PK6A 2FBPA 4ZEYA 1UTBB 5HEGA 3CSBA 5CMBA 4G68C 4X1DA 1CHUA 4E0XA 4GWYA 4B3TT 3ILUB 3ZSSA 5CB4E 4BDQA 4NF5B 4ZZCA 3J9X1 3TLVA 1KFYA 4MHCA 4BJMA 4I40A 3FVKA 4H63H 5CMCA 1LAFE 2F34A 2XXIA 2YN6A 4I3EA 1H44A 1FPBA 3CX7B 4O8SA 1SUMB 3W15C 2XQ3A 2WWUA 1EZPA 5HBCA 5IAIA 4XF5A 5H8QB 3SOLA 2RP4A 2QMWA 4R75A 3B6QA 3C51A 2QS2A 4OXVA 1CNQA 3FXQA 4I9DA 4DR6T 1OIBA 2NOOA 4GX4A 1CUNA 3AE4A 4YTNA 4ASKA 1DTZA 3KJTA 4YTMA 2XX8A 3ILTB 3PUGA 3RUMA 1NUYA 1M5FA 5FL1A 3Q5XA 3DELB 4XZCA 4LQ2A 3GMIA 1FQDA 3E4RA 3AEGA 2E9XC 3BBRA 3Q25A 4TLMB 4O3AA 3QUJA 2Y5KA 2FBWA 1KA1A 3VDFA 3IORA 1FBPA 1RYXA 5J2UE 3LSFB 1ZTYA 4LMJA 1Y9UA 5KCJA 2CXFA 4QH5A 2H7VC 2QRXA 3K1PA 2QPQA 2CRBA 5EYFA 3B50A 2YU2A 5LMNT 4HFCA 3S9EA 1MXYA 2FIEA 5DQVA 3FIRA 2UU9T 1SA0E 2IC6A 3RHWA 3LJCA 1TXFA 3MYUA 4OVQA 4PAIA 5EK4A 2RC7A 2XXXA 3KFMA 2L8KA 4PFOA 4K3FA 1URSA 1TWYA 4KUMB 3J7Yq 2I4CA 3TTLA 3BK9A 1BTJA 4NF8B 2VGQA 4RXLA 1OLAA 3JV9A 2VP1A 3K1MA 4JI4T 4UXNB 4U22A 5I3SA 1R6ZA 2PT2A 2Q9QC 1Y3PA 1MPDA 4M1VA 3KFWX 3MVWA 4YAHX 3JADA 1WLXA 3IF8B 3HPIA 1LBVA 1ZBMA 1IJ5A 2Z22A 5AA4B 4AQFC 3KVAA 3IR1A 3QOFA 3RLFF 3BIHA 2QS1A 1MPBA 2V7JA 2PTFA 1GQEA 3PV0F 4U2ZA 3MSTA 2DWGA 5TU0A 4JBZA 1MM7A 5ESYA 4GIWA 2RCBA 1LBCA 2AL5A 4GIZA 3QXMA 4QFKA 3VXCA 3TUSA 5HXSA 1PB9A 2A5TA 4WEPA 1IMCA 3PDYA 2SPCA 5JR9B 4R73A 4IGTA 2HZLA 2XA5A 1BR0A 2CEXA 2O1MA 3P4PA 3KN8A 2LRKA 3AXJB 5F5WA 4GWZA 5ET7A 3JAEA 1LAHE 4DR1T 5ETWA 4AB5A 3BQIA 5KXJA 4V1Av 2HHMA 2EHOC 4P9KA 2ZYKA 4B3MT 2CXLA 3FZHB 1P1QA 2ABHA 5L3FB 4H6DA 5F7VA 4NEDA 1JNZA 3E0ZA 2XHEB 1GTKA 5H8HB 3ZKRA 2QMXA 3HI2A 1MIVA 4BDLA 1AIVA 1G8XA 2HFBA 4XAXB 1Y1MA 4YKKA 5A5XB 3UT5E 4Q30B 1ANFA 5AQLB 1SYIA 3CRBA 4JB7A 2H7OA 5DTBA 3ZCIA 4N8YA 1ZP0A 2WYKA 5GONE 5HPQA 1MNDA 4NIQA 1ELJA 1NV0A 4ZEKA 4ILCA 3C4ZA 4O3BA 2OZZA 1ZJLA 2HAVA 1T72A 4RK9A 3HKBE 3M65A 5K2XA 3HFUA 1MQHA 3JCFA 4JSOA 2XXHA 2BG9E 3FXUA 3T93B 3PJAJ 4TUYE 2Q74A 4JI0T 3N9PA 1EYJA 1FMWA 1Z8UA 3K6VA 4O94A 1VR5A 2M67A 5EQAA 1T8BA 1UK5A 3PTYA 4NHBA 3RYIE 1ZHCA 2I58A 4EXKA 4YMBA 1D4NA 4BAYB 3C4XA 1RKMA 2NTXA 1NWMX 1B3FA 1QW0A 3RGYA 2V3UA 4BA9A 4E0WA 4P1LA 1MQIA 2KZ7B 3H6WA 1A8EA 1NL5A 3FUZA 2FJBA 5JK4A 3GBBA 2BS3A 1NUZA 3FV2A 1P1NA 3FD3A 5JVDE 3TZAA 4I55E 4F3PA 3T9HB 1S7YA 1FEWA 2LRLA 2H4IA 2W63A 2D9DA 1OVTA 1YZ0A 3AAAB 4HFVA 2K5BB 5FY0A 5LHIB 2UXXB 3ZMTB 4UVBB 2KXPB 2D5UA 1K9ZA 1N0TA 4JI8T 5ICTA 3U65A 4U1ZA 4JI1T 3PPOA 5F1QA 1XNQT 2Q88A 4IDZA 2XZEA 2D0UA 3WAJA 3TCGA 4DCXA 1BLFA 3VKGA 4JVCA 1HF8A 4C91A 1XHYA 4AQGA 3FVGA 4R6KA 2X7PA 3AE5A 3HV1A 3SFEA 4GOTA 3QC9A 2LSJA 4HFDA 4OANA 1AH5A 3K01A 2ONSA 3U92A 5CJ5A 2XWVA 4OA4A 4DIGA 2WKYA 2LOSA 5L4EA 4FJOA 2WX9A 4P3LA 4UACA 3Q2MA 2CEAA 1LAXA 2CZKA 2XX9A 4PBHA 1NH8A 2WZHA 4G2ZA 3RLFE 4I8CA 3AVRA 1FPFA 3ZPOA 5TP9B 3PUSA 2NW9A 2LHRA 1B5HA 2F35A 2Q89A 3OO7A 1OQHA 5H8NA 3FBZA 1T0KA 3VXBA 2UUCT 2HAUA 3PMXA 3JC6C 2P3NA 3MZ9A 4GFRA 5FKYA 3HKCE 4O7MA 4O8MA 2BG9A 3SRZA 2H88A 2O51A 2XASB 2YDSA 5AQKB 4UA8A 2VKHA 3KV6A 3CKDA 1SVXB 1B5IA 4DV7T 1WRDA 3QIMA 4PDHA 3FXEB 2Q2AA 3RGLA 2GFEA 4GL0A 3ZN1B 2O6AA 3PD9A 4GYSA 3MJNA 4QXDA 1IBKT 2MAWA 4PGNA 5I58A 5JDFA 3QMFA 3MA9A 4ESXA 2QVRA 1FTMA 4GWXA 1IZ1A 2PFZA 4HW8A 4DV3T 2F3DA 1IXGA 2R8TA 1ZKBA 1CE2A 2XXPA 4YB5A 1W9RA 1FMVA 4BDOA 3CX6B 2AE9A 3OO6A 4DV1T 4JXIA 3CPZA 4OFZA 3V5SA 1HG5A 4IE6A 4NF4A 3LK2B 3RPUA 4MNCA 3NVOA 3RY3A 3C4WA 2W7YA 2IW5B 1O7TA 1N84A 5LG3A 2V6YA 3CQCB 2E9XD 1E7PA 1D3KA 1D1AA 3AE3A 2HQ0A 3P8CD 4XEQA 2REJA 4NWCA 4NPPA 4F19A 2ZNTA 1UCUA 5B70A 1P1UA 3VHLA 4HCYA 1E1HB 1FBDA 2F7AA 2F6PA 2UVHA 5AQJB 4O4HE 4ZDMA 4PAKA 3E78A 2O68A 4KP3C 3FBPA 4KPTA 5HXEA 3KBRA 2KMFA 3MZBA 3D0TA 4JVIA 2X68A 5LJNA 5AQNB 5KCJB 4L17A 1NV5A 4LMLA 4GXSB 5IGAA 4N4UA 3M8UA 1H45A 2DSFA 2NVUB 4YJ3E 4H9PC 2Q9QD 4IO3A 1JEUA 4XKPA 5EHSA 3FZMB 1VFEA 2QRYA 3O4XE 3KVBA 3MQ9A 1IQ7A 3E22E 3FB2A 5HEJA 2DWHA 4C1UA 4AKLA 2QVVA 3AEAA 4JBWF 1J1NA 3P4QA 4IDNA 1A54A 2JQHA 1LFIA 2LSGA 4F1VA 4X66T 2O7UA 3QNUA 4ZI3D 3T0JA 3IX1A 1NNTA 2KLFA 3ANWA 5JDGA 4PF6A 3I3VA 1SE7A 1HSJA 3AXFA 5F24A 5LYJE 1JW4A 2YEVC 5I2KA 2LEHA 4IY6A 4YFSA 4H9OC 3I5OA 1B7TA 2Q8MA 4QBAA 5EHMA 4EZ4A 4WBNE 1JQFA 2V93A 4Z90A 1GVCA 1YTVA 2CMRA 2B4LA 5L3BB 4GK5E 4H63V 1XMOT 3ONXA 3M3LA 4OYKA 2DWIA 2NP9A 4IE7A 2X9XA 4CN4A 3N9NA 2EHOD 2XY8B 3Q26A 2NUVA 1D9QA 3C36A 2A5TB 3OYXA 2D5WA 4PFPA 3B6WA 2E0SA 3CSGA 4TZ4C 2DWAA 2HPLA 1FQAA 3TODA 1FRPA 2PFVA 2XQ4A 4AKHA 2FJEA 3K1SA 1LGBC 1SI0A 4U4SA 4GF8A 5DT6A 3SEXA 4ZI7E 1MQGA 1SW4A 2V3TA 3MWBA 3TTMA 2MPKA 3TELA 3D1RA 4OVJA 1WR0A 3T8OA 3KG2A 4GWSA 4PK4A 5AA2A 3Q28A 2X0LB 5ET6A 3N2KE 4DBQA 5LHGB 2CMOA 1NEKA 3JYRA 2C5JA 1X79A 4HE1A 4AQ4A 4YZZA 2WS3A 1B3HA 3HO7A 4OFOA 2H9BA 1UURA 2LLYA 1JETA 2CA5A 2W2UA 4Z7EA 4QX7B 2JJ9A 4LF5T 5AA3A 1Y01A 4O3CA 5L3DB 5IZZA 2WMOA 3C4MA 4YMAA 2VOZA 1B7HA 4N78D 3IO4A 2LAOA 2DXRA 5JDQA 4ZZBA 3K02A 3RPWA 2E1SA 5FY7A 3F31A 3DP6A 4PDDA 3UA8A 1IUDA 1TFAA 1QUJA 2B65A 3EDUA 3FASA 3KOTA 4RPNA 3RRCA 1OWAA 5L3EB 3KV9A 4R9GA 1IMAA 3IOWA 4MFIA 1EZOA 4ISUA 5J16A 2IMLA 4DR2T 4U4XA 3E79A 3KC1A 4LF9T 1LAGE 4C1TA 2XX7A 5HXRA 1HSEA 3CFLA 3HR0A 3ONLC 4GWUA 1NV4A 3TKLB 4DLDA 3OTOT 2KT9A 3O6GA 4N15A 1WYBA 1BP5A 1IXHA 3UULA 1MXVA 4WEDA 4HKAA 1NUWA 4EF2A 4YSZA 2ESNA 3ZT6A 2LJLA 4BLAA 2I3WA 3DLNA 3TPAA 4HGAA 1LBXA 5ADXL 4ELRA 4IE4A 2V6XA 4ZEFA 5DW8A 1VCSA 4ANJA 4WZXA 3QYTA 4L0RA 5JREA 1QGXA 2XQ6A 5TPAA 4CXYA 1II5A 3RRWA 2WDVA 3C98B 3H4ZA 3G3KA 1U5PA 2IC9A 3SFDA 2RA1A 2RKMA 2WBLA 4NTLA 2Y7WA 1H3DA 2G29A 4AS4A 5FXVA 1SYHA 4DUYT 4N17A 2CBJA 1JVYA 2XQ5A 4MHFA 3VE1B 3LK3B 1J1JA 2R9JA 2BKOA 5DVJA 4F39A 2I6HA 4NUVA 4X65T 2FUPA 1OQGA 3IAZA 3QSLA 4LZ7A 4IR8A 4AS5A 3JC6D 1SHZC 1FTJA 2F3BA 4LVQA 4PC9A 4PFTA 3B5MA 1GV8A 3C34A 3TFLA 3DP7A 1IXIA 3JZJA 1QJMA 3ETUA 1SI1A 1B7ZA 4NF0A 4LN5A 4FIMA 4MF3A 5J2TE 4C90A 5CC2A 1US5A 4AISA 3A3UA 3B8BA 2E5VA 4N81A 1UX4A 1ZMGA 2B1EA 2ALUA 1FIOA 3OEMA 5H8NB 2DNXA 3RYCE 1S50A 1IBMT 1NV1A 3FXBA 2CE7A 3X1DA 2BG9B 3DM0A 1IEJA 3U1OA 3AECA 4H0WA 4OEVA 1NFTA 1N7XA 2OCUA 2CPTA 3FGSA 1SDXA 2F4VT 4NN3A 1HTJF 5AQSB 3VFJA 3L09A 1YQ3A 4UEMA 2BZBA 2VQET 3C32A 5JQGE 1OEDA 3U78A 5I58B 2LKGA 5LGUB 1UTHA 2ZZWA 2J62A 3N94A 1WYCA 4G63A 3G06A 4CN1A 1L0VA 4ZS9A 1FQBA 3FJ7A 4EZHA 4QHOA 3NRYA 4RJZA 4MJOA 4IREA 1AJ3A 1B7UA 3TKDA 2Q8JA 2CEYA 5AQVB 2ANJA 3CFZA 3S9NC 3PUAA 1UIUA 3RT8A 3VVDA 4DIDB 5HXHA 4RNSA 4H8IA 2LSYA 4H9RC 3AVSA 4RYAA 4OX9T 4KR5A 3T1BA 3HKEE 1T7SA 3VR8A 4NF4B 2VHAA 3RF1A 4DNDA 2I49A 4ELQA 2XWOA 5CRYA 2BKPA 2FJAA 1NV7A 5J1DA 4EQ9A 2XXKA 4KD5A 2V6YB 1PC3A 4OVSA 3EF7A 1XDPA 4IL4A 1IXCA 5AQIB 5FXWA 4IO6A 2XM2A 1K9YA 4OTEA 2F6GA 5L2LA 4G4PA 4P56A 3HHGA 1HNZT 1O64A 3TLTA 1M5DA 1PBPA 3UQ7A 1IBLT 2XD2A 4Q25A 3UU6A 4PJLA 4NAPA 4EIWA 1UX5A 2LSKA 4DV6T 2NXOA 4HFEA 1LFHA 1U4QA 1MDQA 1VE4A 3PJAA 3O66A 4GBWA 3UUNA 4ILAA 1N32T 3UFGA 5L9SA 2VKOA 2V7KA 1MXZA 4POXA 3VLUA 1FPDA 2MBGA 2X9WA 3UN6A 3FVNA 3IBPA 2P1SA 3SEVA 1DTGA 4NXNT 3VLVA 1VSOA 2GRVA 4PCDA 2I3VA 2F7CA 3PPRA 4TWFA 2V5DA 1NUXA 4BJNA 2QSXA 3GXAA 2KINB 4GYRA 4EOZB 4LFBT 4G68A 3ZSTA 3RQTA 2BBJA 4WNKA 4ZZAA 1QUKA 3MZKB 4TX5A 1MXWA 1IAPA 4KYEA 5AFUL 2CM0A 2K9AA 3P4SA 1QULA 3H3AA 4MNPA 2QVAA 1WR6A 2XPKA 1FQFA 2MTQA 2FNCA 4P47A 3SS1A 4YHJA 1R9QA 5M4YA 2A2FX 2X9YA 1B1XA 1DOTA 4GLIA 3ODBA 2DYXA 4JEHB 5AQMB 3L8RA 3C35A 3RNNA 4DCYA 2CLYC 4H46A 4DV2T 4LF8T 1B3LA 3A09A 1D1CA 4HWHA 4MIJA 1R8IA 3PUZF 2JJKA 2WDQA 3ANWB 3EAMA 4COFA 2GHAA 2PJQA 1J5ET 4U74A 1V9DA 3EHUA 1A99A 5HAXA 5I2KB 5ISUA 4EV6A 2QVUA 4PFRA 4F2QA 4E7ZA 2DP8A 4QF9A 4PBQA 1GR2A 1MY0A 3G3FA 3ZMVB 3KSXA 4OERA 2X0HA 5FYMA 2HH7A 2WMNA 3ONJA 3PUYF 5ET8A 3ZN0B 4OEUA 2JRKA 5AQOB 4OYVA 2D2SA 4ZOLE 4LZ8A 2JQQA 4YB6A 2C5KT 3KN7A 1B52A 4R6HA 4OENA 4XIGQ 4F3BA 5ABHA 1I6AA 5CA1E 2V84A 5ITOA 1SQYA 2XAQB 3N9MA 1FBHA 3AEDA 3LG7A 1NENA 2LOPA 4ZI2C 3H6VA 2ZM0A 3JAFA 2ODVA 3RC8A 5JDHA 4YSYA 3BKIB 5EQ7A 4JVDA 2JPFA 4IO4A 2DQVA 5C8YE 2ZMAA 1LKXA 3G3JA 5AA2B 4H9QC 5LDZA 2Q2CA 1FBFA 5ICQA 2QYWA 1INPA 3IL1B 4FEDA 2V8SV 4PTKA 3NZPA 4P1NA 1KNPA 3S4UA 4A98A 5I7IA 2IAKA 2IA4A 1ZEEA 2B3FA 2DVCA 5EQ8A 2DXYA 3LBXA 4IGUA 1NV6A 4UABA 3OSRA 1DPEA 3EHTA 4IO2A 1ZU0A 4I50E 4P09A 4B3ST 1YCJA 2R71A 4H5GA 4OFLA 4XKRA 4MCOA 3MBPA 1B4HA 2VB6A 3IEEA 3PE0A 1QUUA 4DUZT 4GVOA 2CWOA 3TLWA 1QKAA 2ONKE 3H6UA 2CBIA 4LMKA 1B6HA 4KYDA 3OJAA 5AQUB 1M62A 1MMAA 4YKIA 4PFIA 1D0ZA 4PJNA 3F2EA 1WVJA 3H7MA 1B05A 1VDWA 3ZC1A 4PAGA 4PE5B 3OSQA 2YKSA 1I6ZA 1N3XA 4CI1B 1RDYA 3C33A 4FJPA 3D4CA 1USYH 4DXBA 2BVLA 3O9PA 1FTLA 1OXZA 4PJMA 2X26A 3A3CA 2ZYOA 1HFAA 4UV9B 4LONB 1MIYA 1MG1A 2UXNB 4P0BA 2A72A 2PG8A 4TV9E 2XXRA 3EN3A 4YJ2E 1MY1A 3RT6B 3A7MA 2OX3A 5LJMA 4TOZA 4KHZF 4U1OA 1RDZA 2YDRA 1M7KA 2EHOA 5H6QB 4F3GA 4UELA 5LBMA 4R72A 4O4IE 1DSNA 4XBFB 3K00A 4TWDA 4KI0F 2Y6XA 3S9LC 2B4MA 5I2NA 3K6WA 1US4A 2VQFT 2NR4A 4G61A 1JP4A 5HM4B 3LSXA 3GWHA 5FY1A 1UIVA 1FJGT 2I48A 5I56A 2QFLA 1N33T 1XS5A 3UK4A 3PU5A 2R6GF 3T1YT 4K0KT 2GHBA 5TPAB 3TTKA 4HE2A 2KR0A 3VVEA 4EEDA 1FJ9A 5CGMA 3RIUC 4LUBA 1QLBA 4OVRA 3EPEA 2JQKA 2I59A 4A56A 5IZ3A 1YAEA 4P0IA 2Y7IA 3K1NA 3HL6A 2C5IT 1F9BA 1YQ4A 2V4CA 3LSVA 5JR9C 2RC9A 3P50A 4ADZA 1LFGA 4DXCA 2L3LA 4CXXA 2Y8DA 2A3DA 4TNVA 1HSLA 4C0RA 2XM1A 1MIWA 5IKBA 2VVNA 4KMCA 2J47A 3PUZE 3NOHA 3VR9A 3FXDB 4J2CA 3ZJ1A 2YK0A 3LDQB 2XAJB 4DMVA 1MY2A 3MW0A 3GN5A 2BS4A 5HEUA 5FVKA 2I0BA 3IK6B 1R1NA 1WCRA 1S35A 1Y20A 5L3GB 2DVZA 2ODUA 1YXIA 2QGSA 3FVOA 1LCTA 1B32A 2A5SA 2FVZA 3OD7A 3K6XA 3KSJA 2HN1A 3PUYE 3BFTA 2WBBA 4YICA 3IHRA 5CM6A 3ZC0A 3OMBA 4ZE8A 4KX6A 3E9XA 4DBRA 2XTLA 1QUIA 5JDNA 1S9TA 1HNWT 4UR9A 1VCTA 4IIJE 3UU4A 1PDAA 4I62A 4NF6A 3PURA 4H9NC 1NV3A 2VKJA 2CHOA 1Y3QA 1YW0A 1Y64B 2O84X 3ZMUB 2W67A 1MY4A 1HCIA 1DCUA 4OFJA 3AA0B 3RI5A 1ZOYA 2XWKA 4JI6T 2LE8A 3UU3A 3KC0A 5IZ1A 1HG2A 2C0SA 4DR5T 3HHFA 4HWCA 2PFYA 2OWSA 1OEDB 4JV5T 2RPAA 5JTYA 3EI0A 1UTHB 1LBYA 5FBPA 4U33A 3WAFA 3R6NA 3N9OA 3MVZA 3RTWB 4DR3T 1MQJA 1USYE 2I0MA 1I6QA 2NW8A 1NAFA 2VVSA 4R9FA 3I0OA 4DV4T 1O63A 2M6IA 3VRAA 3PGFA 5BR8T 1G73A 4QSDA 5JEIA 4IGRA 2YJPA 3W9WA 1B4ZA 2KSRA 3B13A 4EXTA 3MACA 3N2GE 4JWXA 1ZV4X 4FECA 1YKEB 5J0ZA 4IO5A 3IOTA 5I57A 3K3OA 1JNFA 3IOUA 3OYZA 2DLRA 4X8RA 3MAMA 3RIAA 3IFAA 4N07A 4QH4A 2E5LT 2CZHA 3K3QC 3USDA 4X1YE 4KQPA 3VKHA 2BKNA 1BK4A 1OVBA 4QSCA 2YOEA 4PE3A 2F8DA 5BMVE 5JDLA 3RQWA 2H5YA 4LZ5A 3BQKA 4QXCB 3AB3B 3OVUA 3UUMA 3F57A 3LK42 4UF0A 3ZCJA 1RYOA 3KZGA 5ABFA 2UVJA 2GK9A 2XSBA 4WYVA 4X5TA 4I0UA 2QS4A 4KHZE 2VPOA 1PB7A 4JYAT 4FEBA 1B5JA 4JLEA 5AA1A 4TV8E 5FVLA 4IDOA 2Z8FA 3RX6A 2Y84A 4NMYA 3SEYA 2X7QA 4LFAT 3I1AA 4KI0E 2PX1A 4G8HA 4MFRA 1IIWA 2XXVA 1FPKA 4A5XA 3BFUA 3UGWA 4LF6T 2R6GE 1OMPA 4DZ1A 3TAJA 1A55A 4G68B 2QS3A 4A97A 3TYHA 3WAEA 4MH5A 4P11A 3Q27A 2XQ9A 3IA3A 1NMUA 3UU5A 3RC3A 2ZZVA 2ZM6T 4PGPA 4QRZA 2UXCT 4BDNA 4ZHQE 1KF6A 1WDNA 3A8YC 3W9VA 2UVGA 5E0OA 3SERA 1W0BA 4M1PA 2E2AA 3ZMSB 3K8PC 4F8HA 2P3VA 4E7SA 3IJXB 4WW0A 5LG4A 5FXZA 2CWYA 2VD3A 5HCMA 5HYAA 2V7MA 4KCCA 4P0GA 1US7B 5DJQC 4U3CA 2XHDA 2XQYA 2HXRA 3QUFA 3MZ1A 2M6BA 5KDMC 4EAHA 2WSSV 3OBVE 4MLKA 5F3JA 2CZIA 4PK5A 1D0YA 2Y48B 3OPCA 1B40A 1LRZA 3SETA 3EHSA 4ELOA 2W61A 5DQWA 1KNZA 4ZI2D 2Z8DA 2ZYNA 2PCRA 3RPLA 3AEBA 5ABGA 2ZYMA 3TLSA 4LFCT 1FPJA 3L6GA 4JDFA 1QKBA 5DABA 2F5XA 5H8FA 4Z0IA 2L5VA 3TCHA 5HCJA 5CA0E 2G93A 1MRPA 1ZLQA 5LXTE 4AXPA 1P1WA 4EYUA 3O6IA 1FQCA 4EGWA 2H99A 2V7IA 2IHR1 3B7DA 1VFDA 4F18A 4U72A 4TWHA 2BJIA 2Z6EA 4TQUQ 1A8FA 4F6RC 5JRCA 1WODA 4JI5T 1XZYA 4MX6A 2XWIA 4R2FA 4LATA 4ELPA 2UXAA 4QSEA 3U8QA 3Q5WA 1LBWA 2ZZXA 1I6BA 3HKDE 1NH7A 1OEDC 1PEBA 4BDMA 3LBXB 4AIUA 2D21A 1BR4A 4EF1A 4NUUA 3O29A 4IO7A 4XFEA 1YYZA 3CIJA 2JMKA 1WFDA 2VL0A 2IEEA 4GKJT 3ABVA 3M3KA 1P1OA 3DP4A 4DXUA 5CMKA 4FI5A 3I9YA 2P9BA 2FYIA 1Q35A 4QFOA 3UORA 4LF4T 3U93A 3NKZA 2F78A 3T22A 1HNXT 3OO9A 2VWAA 4GX3A 4I43B 3A29A 4KXPA 2Y5LA 3CI8A 2MKZA 3PUVF 3UU8A 5HEHA 1B1HA 5FHNA 4DI4B 3M3FA 5ET5A 3K4UA 1EYIA 1KNRA 4OESA 1AOVA 1MXUA 3LC8A 3OENA 4ZZEA 3T9UA 4PP0A 2GQ1A 2ES0A 2XUEA 2F36A 1URGA 3VRBA 2W62A 3NZQA 4PAFA 2HPJA 1MS7A 4EEBA 1Z7NE 2PVUA 2EHOB 2JIWA 4R6YA 2PBWA 2Q9TA 2OLBA 1NV2A 1XT8A 4QHQA 3FV1A 3E3KA 2FA7A 4G77A 3N5LA 1EU8A 2WWVA 1NNKA 5I2NB 3H37A 5EK3A 1KWHA 1LLSA 3L39A 2I6EA 5I56B 2UXDT 1X9BA 4ZEBA 2YLNA 4CN6A 1IITA 1POY1 1RDXA 3LUYA 2UVIA 4O4LE 4ECFA 4KBMB 1N04A 4HWDA 5I59A 3D4GA 3I0QA 4H65A 3UFEA 3OKQA 4LP2B 5IZ3B 4PF8A 3CG3A 3IOVA 3K3NA 1MH3A 1H43A 4OHFA 2DOJA 4ZS3A 4QXHB 4Z91A 5IWAT 4ILUA 1DU2A 5KDTA 2B3BA 5KMGP 1BR1A 3H06B 4X20E 4H45A 4KYSA 3I9WA 5CBRA 2CCQA 4ERRA 3GN5B 3AAIA 4DE8A 4TNWA 3TEPA 4GBVA 2VL8A 4QH1A 2WB5A 4G2AA 3CQXC 5BUUA 5I84A 2DHRA 4THIA 3NRXA 3TCFA 2ACZA 1I94T 1Y1ZA 4HE0A 2UUBT 3CIRA 3ZYMA 1IMBA 1D1BA 1R9LA 2NWJA 5LCYA 4MNIA 1FBGA 3MC2A 2X66A 1IZNB 2HCAA 3V83A 1IMFA 3RQUA 1M5EA 4NF6B 5K2YA 4WXJA 1PB8A 1JW5A 4QFNA 4GWOA 4PJJA 3OOAA 3OXNA 1LB8A 3DP8A 4F2OA 5LGNB 5AA2D 1MNEA 1XC1A 3ONMA 3AA7B 2WAUA 3RKOA 3PPPA 3Q5EA 4JUYA 3FHNA 2ZM2A 4O2AE 2VK9A 2DL1A 3TMGA 3LFMA 1MMDA 1LB9A 3SESA 1N34T 3F11A 3KDSE 4EQ7A 4MBQA 3L6HA 3U94A 5JTYB 5LA6E 3QB5A 5IYZE 4YLHA 4R2BA 2OV9A 3AA1B 3CWZB 5DEXA 2VURA 3PUXE 3GA8A 4QKNA 3U3IA 5C2TA 3PTRB 2LHNA 1B0HA 4MEVA 4EXLA 4YB7A 1FTOA 4RA1A 4OVTA 3C9HA 3TLUA 1N3WA 3K0VA 3VLWA 2BDEA 3O9XA 2O1LA 3QK6A 3PUQA 3B6TA 2XQ8A 4H9SE 3MXZA 2XAGB 3E08A 4ONYA 1B9JA 1AWBA 5I57B 4I4TE 4FATA 1KZ8A 1A7LA 3GLBA 4POWA 4EB6E 3PUWF 3EABA 2HN2A 1EYKA 5A5LA 3OELA 2THIA 4JEUB 1AMFA 3WI3A 4I3YA 4P0AA 1FJ6A 1VOMA 2ZNUA 3PUVE 2H3RA 2RF1A 4ISTA 4ZI3C 3AE2A 5EZYE 3G3HA 2KWIB 3ZKLA 2H25A 5HWXA 1LEVA 2K3WA 2PYYA 2VT5A 2XXTA 3ETVA 2AIXA 4H8JA 4UF0B 3IFCA 1MMGA 1CB6A 3MP1A 5ABFB 4CQIA 2ZXTA 4HS7A 4HE8A 3ZYKA 3ZS6A 3TTNA 1B46A 4MAGA 3PPQA 3AE6A 5J1GA 4H1XA 5AQTB 3CK6A 4U7YA 2LT3A 2NTYA 3RN8A 2WBDA 1J5WA 3AE1A 3B57A 2WDRA 3ISPA 5I5PA 3MVYA 4NG7A 5EYHA 2LM2A 1POTA 4EDPA 5LTCA 4F22A 4YKPA 3RH3A 2E9XA 2REGA 3FZKB 4HN9A 3UP9A 2WM9A 5FXXA 4MLQA 4MBPA 1FW0A 5T3JA 3TTRA 2G0UA 4B3RT 1LVKA 2H98A 4DR7T 5LHHB 2JQ9A 1Q1KA 3I6VA 3EUHA 1FBCA 4F1YA 3ZMZB 2XAHB 1BIYA 5L9MA 2CHNA 1XWMA 2BG9C 4U7IA 1JW1A 3FJMA 1UGOA 3ZT5A 3VV5A 4AKRB 3MPLA 4QXBB 5TAOA 1AL3A 1B3GA 1FSAA 2Z23A 4N6KA 4X1BA 5IM2A 4Q5TA 4YHHT 4NQ8A 2UXBT 2W4XA 2F7BA 1DPPA 2I0CA 2IDOB 2DCFA 1Y3NA 4ZE9A 4ZEDA 5IUXA 4FE8A 4Z8XA 5F8PA 2XAFB 1LCFA 1SBPA 4OZ9A 3IO6A 3ZJ2A 4MMPA 3UIFA 4X9TA 4U21A 4IDQA 4N13A 4CI2B 3H6TA 1NI9A 4KFQA 4OVPA 1JNRA 3FZLB 3Q5DA 4YY3T 3V5AA 2HPGA 5LBQB 2Q9QA 4OHNA 1H76A 2BJJX 2E8IA 4F31B 3RPLB 1FPGA 4BDRA 5LOMA 3SEUA 3TQWA 4IB2A 4QFLA 3OEKA 3M3ZB 1VRBA 1FPIA 4HTEA 4AQFA 3UUXB 3KOSA 1XI6A 5H8FB 4F29A 4YXDA 1QVSA 4PFWA 3HSTA 4IHJE 1YXRA 1GGGA 3G3IA 4U31A 4Q8RA 3L3PA 5FMNA 1P99A 5BWJA 2ACXA 3C50A 4TN7B 1TT1A 3A5XA 1G0HA 3K6UA 4OYJA 3MVXA 2WZIA 3LUZA 2XQ7A 2OWZA 4XKNA 3IB1A 4GK0E 3R84B 3V8XB 4WBOA 2GH9A 2DDKA 5JRCB 4AKIA 3Q9DA 5FNVE 3EDVA 3QB5K 5L3CB 1MXXA 4G8MA 2DE4A 3SZPA 4EYYR 4PNIA 3ZT7A 3KV5A 4R74A 4H5FA 3ZKKA 5CMMA 1MQDA 1UUSA 5DVFA 3BQLA 2MOZA 5L9OA 2A9UA 2AYSA 3IJOB 1LBZA 2RCAA 4IL9A 2W0GA 2WY2A 2Y7PA 3O6HA 3KINB 2V1DB 4ZXLA 3N9LA 4PETA 3RYFE 3O2AA 4GL8A 1Q9DA 3LV0A 5AE4A 4OETA 2YDQA 4ILBA 4PW8A 3MP6A 2MYSA 3EKIA 2O7IA 4LA9A 4X1IE 2H89A 4AB6A 2DI4A 3UQ4A 4NGUA 1EH3A 4XKQA 1SW5A 1O3XA 2K24A 3FBLA 1UTBA 3PUWE 4OQOA 3LR1A 1SW2A 4UVCB 2X9HA 2W66A 1FPEA 1SD3A 4U23A 4O2BE 3PV0E 3TQLA 2BBHA 4YTPA 3KJ7A 4NF5A 5DVIA 4LF7T 3Q29A 2M8CA 3FATA 3MKDA 3GZGA 1B0LA 3HCQA 2XD3A 3MJXA 1N36T 3MUQA 3OO8A 4X64T 1KK7A 3GBAA 4PFYA 3E13X 3FZVA 4OMBA 4UVAB 3N6UA 3HA4A 5EQ9A 1TFDA 5B7DA 1FTAA 3ZLIA 5H8QA 4B6XA 3MK7C 2QL3A 4HWIB 3PU3A 1HR0T 3TDJA 2KWHA 2WU2A 2CXDA 3RYHE 3DJBA 4DO0A 3LSWA 5H8SA 5ITPA 4P8BA 1L5TA 2FJDA 4ZEIA 4M4GA 1W0AA 4HFIA 4PQJA 4GD5A 1MY3A 3KBUA 3LBSA 1MPCA 5EYGA 4PFBA 1S94A 1DK4A 2ONRA 5I59B 3KEIA 3N6TA 3NWIA 1SW1A 4HEAA 3SWHA 3CFXA 4GKKT 2WCAA 5L8DA 3AE8A 4HTGA 2CZLA 3O1HA 2LM9A 4YU0A 4P1EA 1Y4CA 2Y7KA 4NWDA 4JSDA 5KDTB 5LGTB 5LMUT 3KGCA 4CXWA 1M5CA 5ELVA 2WQYA 2QA7A 1KEYA
chains in the Genus database with same CATH topology
3VU7H 1Z0PA 2YINA 4RK2A 2O69A 4DMWA 4MALA 3KBTA 3T66A 2HEUA 1IJ6A 2OWTA 3NBXX 1FTKA 2X67A 2NW7A 3PU8A 1URDA 3N26A 5HXCA 4Q0CA 2DWKA 3P7IA 3G7WA 4NF8A 2P2AA 2ZM8A 1B3EA 2Z8EA 4IY5A 4KCDA 3MP8A 4GOUA 2DE3A 5AA4A 3EVYA 1Y4TA 3C31A 2X51A 5JDMA 4G8NA 1OLCA 2PT1A 2J1DG 1QSDA 4ESWA 4EUOA 1YPNA 3H3GA 2NOXA 2HXWA 1LSTA 3UTKA 5KX5E 4TLLB 2OBGA 3ESLA 4XXUA 3S2VA 1XVXA 5JR9A 4ZS2A 4U2RA 5DEXB 2XXWA 1LVFA 2AL4A 3SDFA 2ZMBA 4L5GA 1N7WA 1BKAA 2JMHA 1M5BA 2UYFA 2V7LA 3RTFB 1JVXA 3R7XA 3ZSFA 1PBQA 4K0UA 2ZNSA 4ND9A 3MPKA 1T98A 4FORA 5H8HA 2VD2A 4XTCQ 5KZTA 3PMVA 4IE5A 2VKDA 1ATGA 5DYHA 5A5XA 4OWDA 3THIA 4RY1A 2UYEA 3R26A 4O4JE 4N6PA 4IE0A 3T9VA 4DVDA 4I1DA 5LP6E 3W15B 1EZ3A 4UV8B 3AAEB 3QAXA 3KV4A 1YD8G 1B58A 3ZYLA 1MMNA 3CX8B 5IHYA 4GQOA 3AA6B 2XXYA 5LOVE 4JWYA 2RINA 2YPNA 1BR2A 1JEVA 2W00A 5CI5A 2V25A 1LBBA 5EK2A 4QWNB 5JH7E 3CMLA 1XVYA 2LSIA 4MLVA 3SEWA 3CVRA 1ZKEA 2E9XB 3ZEFB 3O97A 3U72A 4UIGA 1HS7A 1FCKA 2N2NA 5A1LA 4H67A 3V89B 3EQ1A 1YKHB 2DE2A 1MM6A 2N9DA 4QX8B 4WKMA 1ZIUA 1Z7ME 3K2DA 2PMSA 2PBIA 5HWYA 4DDDA 1MH4A 4F1UA 2YU1A 2OJTA 3O1IA 3O28A 5FTIA 1NKXA 1DMBA 5FTHA 3CQGB 1B2HA 3R6UA 4LQ5A 4ZECA 2DWJA 3VVFA 2D0TA 3T9XB 3ECRA 4JWOA 3N2OA 4EQBA 3CVGA 1N76A 2KLQA 3IB0A 3DTOA 2HZKA 4OK0A 4L9IA 3S9MC 4X1KE 4F3SA 2XXUA 5FHOA 2V26A 1H7CA 3KN3A 3WAKA 2ZLYA 2V3QA 2Q9QB 1A40A 2QJEA 3FJGA 1XOCA 2RC8A 4AKGA 2OK2A 5CBSA 1HX8A 3C64A 3LSLA 2K48A 4PFUA 2VASA 5TP9A 2I4BA 3O1JA 3PMWA 4CI3B 2XXQA 3CR9A 2NWBA 2L9QA 2N1GA 3HN0A 3N9QA 1I69A 3PD8A 5FHMA 3V5UA 2D3IA 5FP3A 1NNFA 4NE4A 3SKPA 5H6RB 2P0SA 1EZ9A 2OA5A 1B51A 1D9YA 4YKJA 3IB2A 1D0XA 2DS9A 4X48A 2CLYB 5M2VA 2BVMA 3CG1A 4AI6A 4HCWA 3FXRA 1UQWA 1NNPA 1FQEA 4QFPA 4CZZB 3PPNA 1MDP1 4FAJA 3H03A 2Y7RA 1D9VA 4GXAA 4GRKA 2KNDA 3T96B 2F97A 4ISSA 3G3GA 4RPOA 5LNKA 4PK6A 1UTBB 3CSBA 5CMBA 4G68C 4X1DA 4E0XA 3ILUB 5CB4E 4BDQA 4NF5B 3J9X1 4MHCA 4BJMA 3FVKA 4H63H 5CMCA 1LAFE 2F34A 2XXIA 1H44A 3CX7B 4O8SA 3W15C 2WWUA 1EZPA 5HBCA 5IAIA 5H8QB 3SOLA 2RP4A 2QMWA 4R75A 3B6QA 3C51A 2QS2A 4OXVA 3FXQA 4I9DA 1OIBA 2NOOA 1CUNA 3KJTA 1DTZA 4ASKA 2XX8A 3ILTB 3PUGA 3RUMA 1M5FA 3Q5XA 3DELB 4XZCA 4LQ2A 3GMIA 1FQDA 3E4RA 2E9XC 3BBRA 3Q25A 4TLMB 4O3AA 3QUJA 3VDFA 3IORA 1RYXA 5J2UE 3LSFB 1ZTYA 1Y9UA 5KCJA 2CXFA 2H7VC 3K1PA 2QPQA 5EYFA 2YU2A 3S9EA 1MXYA 5DQVA 3FIRA 1SA0E 2IC6A 3LJCA 1TXFA 5EK4A 2RC7A 2XXXA 3KFMA 2L8KA 4PFOA 4K3FA 1URSA 1TWYA 4KUMB 3J7Yq 2I4CA 3TTLA 3BK9A 1BTJA 4NF8B 2VGQA 4RXLA 1OLAA 3JV9A 2VP1A 3K1MA 4U22A 4UXNB 1R6ZA 2PT2A 2Q9QC 1Y3PA 1MPDA 4M1VA 3KFWX 3MVWA 4YAHX 1WLXA 3IF8B 3HPIA 1ZBMA 1IJ5A 2Z22A 5AA4B 4AQFC 3KVAA 3IR1A 2QS1A 1MPBA 2V7JA 2DWGA 5TU0A 4JBZA 1MM7A 4GIWA 2RCBA 1LBCA 2AL5A 4GIZA 3QXMA 4QFKA 3VXCA 3TUSA 5HXSA 1PB9A 2A5TA 4WEPA 3PDYA 2SPCA 5JR9B 4R73A 4IGTA 2HZLA 1BR0A 2O1MA 3KN8A 1LAHE 5ETWA 4AB5A 3BQIA 4V1Av 2EHOC 2ZYKA 2CXLA 1P1QA 4H6DA 2ABHA 5L3FB 5F7VA 4NEDA 5H8HB 3E0ZA 2XHEB 1GTKA 2QMXA 3HI2A 1MIVA 4BDLA 1AIVA 1G8XA 2HFBA 4XAXB 1Y1MA 4YKKA 5A5XB 3UT5E 4Q30B 1ANFA 1SYIA 3CRBA 4JB7A 2H7OA 5DTBA 3ZCIA 5GONE 5HPQA 1MNDA 1ELJA 4ZEKA 4O3BA 3C4ZA 2OZZA 1ZJLA 2HAVA 4RK9A 3HKBE 3M65A 5K2XA 1MQHA 4JSOA 2XXHA 3FXUA 3T93B 4TUYE 3N9PA 1FMWA 3K6VA 1VR5A 2M67A 3RYIE 1ZHCA 2I58A 4EXKA 4YMBA 1D4NA 4BAYB 3C4XA 1RKMA 2NTXA 1NWMX 1B3FA 1QW0A 3RGYA 2V3UA 4BA9A 4E0WA 1MQIA 2KZ7B 3H6WA 1A8EA 1NL5A 3FUZA 5JK4A 3GBBA 3FV2A 1P1NA 3FD3A 5JVDE 3TZAA 4I55E 4F3PA 3T9HB 1S7YA 1FEWA 2H4IA 2W63A 1OVTA 3AAAB 4HFVA 2K5BB 5FY0A 5LHIB 2UXXB 3ZMTB 4UVBB 2KXPB 2D5UA 1N0TA 5ICTA 4U1ZA 3PPOA 5F1QA 2Q88A 4IDZA 2D0UA 3WAJA 3TCGA 4DCXA 1BLFA 3VKGA 1HF8A 4C91A 1XHYA 4AQGA 3FVGA 4R6KA 2X7PA 3HV1A 4GOTA 3QC9A 2LSJA 1AH5A 3K01A 2ONSA 3U92A 4DIGA 2WKYA 2LOSA 4FJOA 4UACA 3Q2MA 2CEAA 1LAXA 2XX9A 1NH8A 4G2ZA 3RLFE 4I8CA 3AVRA 3ZPOA 5TP9B 3PUSA 2NW9A 2LHRA 1B5HA 2F35A 2Q89A 3OO7A 1OQHA 5H8NA 3FBZA 1T0KA 3VXBA 2HAUA 3PMXA 3JC6C 3MZ9A 4GFRA 3HKCE 2O51A 3SRZA 2XASB 4UA8A 2VKHA 3KV6A 3CKDA 1SVXB 1B5IA 1WRDA 3QIMA 3FXEB 2Q2AA 4GL0A 2GFEA 3ZN1B 2O6AA 3PD9A 4GYSA 3MJNA 5I58A 5JDFA 3MA9A 4ESXA 1FTMA 1IZ1A 4HW8A 1IXGA 1ZKBA 1CE2A 2XXPA 4YB5A 4BDOA 1FMVA 3CX6B 3OO6A 4JXIA 3CPZA 4OFZA 3V5SA 1HG5A 4IE6A 4NF4A 3LK2B 3RPUA 3RY3A 3C4WA 2W7YA 2IW5B 1O7TA 1N84A 3CQCB 2E9XD 1D3KA 1D1AA 2HQ0A 3P8CD 2REJA 4NWCA 4F19A 2ZNTA 1UCUA 5B70A 1P1UA 3VHLA 4HCYA 1E1HB 2F7AA 2F6PA 2UVHA 4O4HE 4ZDMA 2O68A 4KP3C 4KPTA 5HXEA 3KBRA 2KMFA 3MZBA 3D0TA 2X68A 5LJNA 5KCJB 4L17A 4GXSB 3M8UA 1H45A 2DSFA 2NVUB 4YJ3E 4H9PC 2Q9QD 4IO3A 1JEUA 4XKPA 5EHSA 1VFEA 2QRYA 3O4XE 3KVBA 3MQ9A 1IQ7A 3E22E 3FB2A 2DWHA 4C1UA 4AKLA 1J1NA 1A54A 1LFIA 2LSGA 4F1VA 2O7UA 4ZI3D 3IX1A 1NNTA 2KLFA 3ANWA 5JDGA 3I3VA 1HSJA 3AXFA 5LYJE 1JW4A 2YEVC 5I2KA 2LEHA 4IY6A 4YFSA 4H9OC 3I5OA 1B7TA 5EHMA 4EZ4A 4WBNE 1JQFA 2V93A 1GVCA 1YTVA 2CMRA 5L3BB 4GK5E 4H63V 3ONXA 3M3LA 4OYKA 2DWIA 2NP9A 4IE7A 2X9XA 3N9NA 2EHOD 3Q26A 2NUVA 3C36A 2A5TB 3OYXA 2D5WA 4PFPA 3B6WA 2E0SA 3CSGA 4TZ4C 2DWAA 2HPLA 1FQAA 3TODA 2PFVA 4AKHA 1LGBC 1SI0A 4U4SA 4GF8A 5DT6A 3SEXA 4ZI7E 1MQGA 1SW4A 2V3TA 3MWBA 3TTMA 3TELA 4OVJA 3T8OA 3KG2A 4PK4A 5AA2A 3Q28A 2X0LB 3N2KE 4DBQA 5LHGB 2CMOA 3JYRA 2C5JA 1X79A 4AQ4A 4YZZA 1B3HA 3HO7A 4OFOA 2H9BA 1JETA 2CA5A 4Z7EA 4QX7B 2JJ9A 5AA3A 4O3CA 5L3DB 2WMOA 3C4MA 4YMAA 2VOZA 1B7HA 4N78D 3IO4A 2LAOA 2DXRA 5JDQA 3K02A 3RPWA 2E1SA 5FY7A 3F31A 3DP6A 3UA8A 1IUDA 1TFAA 1QUJA 2B65A 3EDUA 3FASA 3KOTA 4RPNA 3RRCA 1OWAA 5L3EB 3KV9A 4R9GA 3IOWA 4MFIA 1EZOA 4ISUA 4U4XA 4C1TA 1LAGE 2XX7A 5HXRA 1HSEA 3CFLA 3HR0A 3TKLB 4DLDA 2KT9A 3O6GA 1WYBA 1BP5A 1IXHA 3UULA 1MXVA 4WEDA 4HKAA 4EF2A 2ESNA 2LJLA 4BLAA 2I3WA 3DLNA 3TPAA 4HGAA 5ADXL 4ELRA 4IE4A 4ZEFA 4ANJA 3QYTA 4L0RA 5JREA 5TPAA 4CXYA 1II5A 3RRWA 3C98B 3H4ZA 3G3KA 1U5PA 2IC9A 2RA1A 2RKMA 2WBLA 4NTLA 2Y7WA 1H3DA 2G29A 5FXVA 1SYHA 1JVYA 3VE1B 3LK3B 2R9JA 5DVJA 4F39A 4NUVA 3IAZA 1OQGA 3QSLA 4LZ7A 3JC6D 1SHZC 1FTJA 4LVQA 4PFTA 1GV8A 3C34A 3TFLA 3DP7A 1IXIA 3JZJA 1QJMA 3ETUA 1SI1A 1B7ZA 4FIMA 4MF3A 5J2TE 4C90A 5CC2A 1US5A 3A3UA 1UX4A 1ZMGA 2B1EA 2ALUA 1FIOA 3OEMA 5H8NB 2DNXA 3RYCE 1S50A 2CE7A 3DM0A 1IEJA 3U1OA 4H0WA 4OEVA 1NFTA 1N7XA 2OCUA 3FGSA 1SDXA 1HTJF 3VFJA 3L09A 4UEMA 2BZBA 3C32A 5JQGE 3U78A 5I58B 5LGUB 1UTHA 3N94A 1WYCA 4G63A 4ZS9A 1FQBA 3FJ7A 4EZHA 4QHOA 3NRYA 4RJZA 1B7UA 3TKDA 2Q8JA 2ANJA 3CFZA 3S9NC 3PUAA 1UIUA 3RT8A 3VVDA 5HXHA 4RNSA 4H8IA 2LSYA 4H9RC 3AVSA 4RYAA 4KR5A 3HKEE 4NF4B 2VHAA 4DNDA 2I49A 4ELQA 5CRYA 5J1DA 4EQ9A 4KD5A 1PC3A 3EF7A 1IXCA 5FXWA 4IO6A 4OTEA 2F6GA 5L2LA 4G4PA 3HHGA 1O64A 1M5DA 1PBPA 2XD2A 4PJLA 4EIWA 1UX5A 2LSKA 2NXOA 1LFHA 1U4QA 1MDQA 1VE4A 3O66A 3UUNA 5L9SA 2VKOA 2V7KA 1MXZA 4POXA 3VLUA 2MBGA 2X9WA 3UN6A 3FVNA 3IBPA 2P1SA 3SEVA 1DTGA 3VLVA 1VSOA 2GRVA 2I3VA 2F7CA 3PPRA 4BJNA 2QSXA 3GXAA 2KINB 4GYRA 4EOZB 4G68A 3RQTA 4WNKA 4ZZAA 1QUKA 3MZKB 4TX5A 1MXWA 1IAPA 4KYEA 5AFUL 2CM0A 2K9AA 1QULA 3H3AA 1WR6A 1FQFA 2MTQA 2FNCA 3SS1A 4YHJA 1R9QA 5M4YA 2A2FX 2X9YA 1B1XA 1DOTA 4GLIA 3ODBA 2DYXA 4JEHB 3C35A 3RNNA 4DCYA 2CLYC 1B3LA 3A09A 1D1CA 3ANWB 2GHAA 2PJQA 4U74A 1V9DA 3EHUA 1A99A 5HAXA 5I2KB 5ISUA 4F2QA 4E7ZA 2DP8A 4QF9A 1GR2A 1MY0A 3G3FA 3ZMVB 3KSXA 4OERA 5FYMA 2HH7A 2WMNA 3ZN0B 4OEUA 2JRKA 4OYVA 2D2SA 4ZOLE 4LZ8A 2JQQA 4YB6A 2C5KT 3KN7A 1B52A 4R6HA 4OENA 4XIGQ 4F3BA 1I6AA 5CA1E 2V84A 5ITOA 1SQYA 2XAQB 3N9MA 3LG7A 3H6VA 2LOPA 4ZI2C 2ZM0A 2ODVA 3RC8A 5JDHA 3BKIB 2JPFA 4IO4A 2DQVA 5C8YE 2ZMAA 1LKXA 3G3JA 5AA2B 4H9QC 2Q2CA 5ICQA 3IL1B 4FEDA 3NZPA 3S4UA 2IAKA 2IA4A 1ZEEA 2B3FA 2DVCA 2DXYA 3LBXA 4IGUA 3OSRA 1DPEA 3EHTA 4IO2A 1ZU0A 4I50E 4P09A 1YCJA 2R71A 4H5GA 4OFLA 4XKRA 3MBPA 1B4HA 2VB6A 3IEEA 3PE0A 1QUUA 4GVOA 2CWOA 1QKAA 2ONKE 3H6UA 1B6HA 4KYDA 3OJAA 1MMAA 4YKIA 1D0ZA 4PJNA 3F2EA 1WVJA 3H7MA 1B05A 3ZC1A 4PAGA 4PE5B 3OSQA 1N3XA 4CI1B 3C33A 4FJPA 3D4CA 1USYH 4DXBA 2BVLA 3O9PA 1FTLA 1OXZA 4PJMA 2X26A 3A3CA 2ZYOA 1HFAA 4UV9B 4LONB 1MIYA 1MG1A 2UXNB 4P0BA 2A72A 2PG8A 4TV9E 2XXRA 3EN3A 4YJ2E 1MY1A 3RT6B 5LJMA 4TOZA 4U1OA 2EHOA 5H6QB 4F3GA 4UELA 5LBMA 4R72A 4O4IE 1DSNA 4XBFB 3K00A 2Y6XA 3S9LC 5I2NA 3K6WA 1US4A 5HM4B 3LSXA 3GWHA 5FY1A 1UIVA 2I48A 5I56A 1XS5A 3UK4A 3PU5A 3TTKA 5TPAB 2GHBA 3VVEA 4LUBA 3EPEA 2I59A 4A56A 1YAEA 4P0IA 2Y7IA 3K1NA 3HL6A 2C5IT 1F9BA 5JR9C 2RC9A 4ADZA 1LFGA 4DXCA 2L3LA 4CXXA 2Y8DA 2A3DA 1HSLA 4C0RA 1MIWA 5IKBA 4KMCA 3PUZE 3FXDB 4J2CA 3ZJ1A 2YK0A 2XAJB 4DMVA 1MY2A 3MW0A 3GN5A 3IK6B 2I0BA 1R1NA 1S35A 1Y20A 5L3GB 2DVZA 2ODUA 3FVOA 2QGSA 1LCTA 1B32A 2A5SA 3OD7A 3K6XA 3KSJA 3PUYE 3BFTA 4YICA 3IHRA 5CM6A 3ZC0A 3OMBA 4ZE8A 3E9XA 4DBRA 2XTLA 1QUIA 5JDNA 1S9TA 4IIJE 4I62A 1PDAA 4NF6A 3PURA 4H9NC 2VKJA 1Y3QA 1YW0A 1Y64B 2O84X 3ZMUB 1MY4A 1HCIA 4OFJA 3AA0B 2LE8A 1HG2A 2C0SA 3HHFA 2OWSA 5JTYA 1UTHB 3WAFA 3R6NA 3N9OA 3MVZA 3RTWB 1MQJA 1USYE 1I6QA 2NW8A 1NAFA 4R9FA 3I0OA 1O63A 3PGFA 1G73A 4QSDA 5JEIA 4IGRA 2YJPA 3W9WA 1B4ZA 3B13A 4EXTA 3MACA 3N2GE 4JWXA 1ZV4X 4FECA 1YKEB 4IO5A 3IOTA 5I57A 3K3OA 1JNFA 3IOUA 3OYZA 2DLRA 3MAMA 4N07A 3USDA 3K3QC 4X1YE 4KQPA 3VKHA 1OVBA 4QSCA 2F8DA 5BMVE 5JDLA 2H5YA 4LZ5A 3BQKA 4QXCB 3AB3B 3UUMA 3F57A 3LK42 4UF0A 3ZCJA 1RYOA 3KZGA 2UVJA 2GK9A 2QS4A 4KHZE 1PB7A 4FEBA 1B5JA 4JLEA 5AA1A 4TV8E 2Z8FA 3RX6A 2Y84A 4NMYA 3SEYA 2X7QA 3I1AA 4KI0E 2PX1A 4G8HA 4MFRA 1IIWA 2XXVA 3UGWA 3BFUA 2R6GE 1OMPA 4DZ1A 3TAJA 1A55A 4G68B 2QS3A 3TYHA 3WAEA 4MH5A 4P11A 3Q27A 1NMUA 3RC3A 4QRZA 4BDNA 4ZHQE 1WDNA 3W9VA 2UVGA 5E0OA 3SERA 4M1PA 3IJXB 3ZMSB 3K8PC 4E7SA 4WW0A 5LG4A 5FXZA 2CWYA 2VD3A 5HYAA 4KCCA 2V7MA 4P0GA 1US7B 5DJQC 2XHDA 2XQYA 3QUFA 3MZ1A 4EAHA 2WSSV 5KDMC 3OBVE 4MLKA 5F3JA 4PK5A 1D0YA 2Y48B 1B40A 1LRZA 3SETA 3EHSA 4ELOA 2W61A 5DQWA 1KNZA 4ZI2D 2Z8DA 2ZYNA 2ZYMA 3L6GA 4JDFA 1QKBA 5DABA 2F5XA 5H8FA 4Z0IA 3TCHA 5CA0E 2G93A 1MRPA 1ZLQA 5LXTE 4AXPA 1P1WA 4EYUA 3O6IA 1FQCA 2H99A 2V7IA 3B7DA 1VFDA 4F18A 4U72A 2Z6EA 4TQUQ 1A8FA 4F6RC 5JRCA 1WODA 4R2FA 4LATA 4ELPA 2UXAA 4QSEA 3U8QA 3Q5WA 1I6BA 3HKDE 1NH7A 1PEBA 4BDMA 3LBXB 2D21A 1BR4A 4EF1A 4NUUA 3O29A 4IO7A 3CIJA 2JMKA 2IEEA 3M3KA 1P1OA 3DP4A 4DXUA 5CMKA 4FI5A 3I9YA 2P9BA 2FYIA 1Q35A 4QFOA 3UORA 3U93A 2F78A 3T22A 3OO9A 2VWAA 4I43B 3CI8A 1B1HA 5FHNA 3M3FA 3K4UA 4OESA 1AOVA 1MXUA 3LC8A 3OENA 4ZZEA 3T9UA 4PP0A 2ES0A 2XUEA 2F36A 1URGA 2W62A 3NZQA 2HPJA 1MS7A 1Z7NE 2PVUA 2EHOB 4R6YA 2PBWA 2Q9TA 2OLBA 1XT8A 4QHQA 3FV1A 3E3KA 2FA7A 4G77A 3N5LA 1EU8A 1NNKA 5I2NB 3H37A 5EK3A 1KWHA 1LLSA 2I6EA 5I56B 4ZEBA 2YLNA 1IITA 3LUYA 1POY1 2UVIA 4O4LE 4ECFA 4KBMB 1N04A 5I59A 3D4GA 3I0QA 4H65A 3UFEA 3OKQA 4LP2B 3CG3A 3IOVA 3K3NA 1MH3A 1H43A 4OHFA 2DOJA 4ZS3A 4QXHB 4ILUA 5KDTA 2B3BA 5KMGP 1BR1A 3H06B 4X20E 4KYSA 3I9WA 5CBRA 2CCQA 4ERRA 3GN5B 3AAIA 4DE8A 3TEPA 2VL8A 4G2AA 3CQXC 5BUUA 5I84A 2DHRA 4THIA 3NRXA 3TCFA 1Y1ZA 3ZYMA 1D1BA 1R9LA 2NWJA 5LCYA 3MC2A 2X66A 1IZNB 2HCAA 3V83A 1M5EA 4NF6B 5K2YA 4WXJA 1PB8A 1JW5A 4QFNA 4GWOA 4PJJA 3OOAA 3OXNA 1LB8A 3DP8A 4F2OA 5LGNB 5AA2D 1MNEA 1XC1A 3ONMA 3AA7B 2WAUA 3RKOA 3PPPA 4JUYA 3FHNA 2ZM2A 4O2AE 2VK9A 3TMGA 3LFMA 1MMDA 1LB9A 3SESA 3F11A 3KDSE 4EQ7A 4MBQA 3L6HA 3U94A 5JTYB 5LA6E 5IYZE 4YLHA 4R2BA 3AA1B 3CWZB 5DEXA 3PUXE 3GA8A 4QKNA 3U3IA 3PTRB 2LHNA 1B0HA 4EXLA 4YB7A 1FTOA 4RA1A 3C9HA 1N3WA 3K0VA 3VLWA 2BDEA 3O9XA 2O1LA 3QK6A 3PUQA 3B6TA 4H9SE 3MXZA 2XAGB 3E08A 4ONYA 1B9JA 5I57B 4I4TE 4FATA 1A7LA 3GLBA 4POWA 4EB6E 3OELA 2THIA 4JEUB 1AMFA 3WI3A 4P0AA 2ZNUA 1VOMA 3PUVE 2H3RA 2RF1A 4ISTA 4ZI3C 5EZYE 3G3HA 2KWIB 3ZKLA 2H25A 5HWXA 2PYYA 2XXTA 4H8JA 3ETVA 2AIXA 4UF0B 1MMGA 1CB6A 3MP1A 4CQIA 2ZXTA 4HS7A 4HE8A 3ZYKA 3ZS6A 3TTNA 1B46A 3PPQA 5J1GA 4H1XA 2LT3A 2NTYA 3RN8A 3B57A 3MVYA 1POTA 4EDPA 4F22A 4YKPA 3RH3A 2E9XA 2REGA 4HN9A 3UP9A 2WM9A 5FXXA 4MLQA 4MBPA 1FW0A 3TTRA 2G0UA 1LVKA 2H98A 5LHHB 1Q1KA 3I6VA 3EUHA 4F1YA 3ZMZB 2XAHB 1BIYA 5L9MA 3FJMA 3VV5A 1JW1A 4AKRB 3MPLA 4QXBB 5TAOA 1AL3A 1B3GA 4X1BA 2Z23A 4Q5TA 2F7BA 1DPPA 2I0CA 2DCFA 1Y3NA 4ZE9A 4ZEDA 4FE8A 4Z8XA 5F8PA 2XAFB 1LCFA 1SBPA 4OZ9A 3IO6A 3ZJ2A 3UIFA 4X9TA 4U21A 4N13A 4CI2B 3H6TA 4KFQA 3V5AA 5LBQB 2Q9QA 4OHNA 1H76A 2BJJX 2E8IA 4F31B 4BDRA 5LOMA 3SEUA 3TQWA 4IB2A 4QFLA 3OEKA 1VRBA 4HTEA 4AQFA 3UUXB 3KOSA 4F29A 5H8FB 1QVSA 4PFWA 3HSTA 4IHJE 1GGGA 3G3IA 4Q8RA 3L3PA 5FMNA 1P99A 5BWJA 2ACXA 3C50A 4TN7B 1TT1A 3A5XA 3K6UA 4OYJA 3MVXA 4XKNA 3IB1A 4GK0E 3R84B 3V8XB 4WBOA 2GH9A 5JRCB 4AKIA 3Q9DA 5FNVE 3EDVA 1MXXA 5L3CB 4G8MA 2DE4A 4EYYR 4PNIA 3KV5A 4R74A 4H5FA 3ZKKA 5CMMA 1MQDA 5DVFA 3BQLA 2MOZA 5L9OA 2AYSA 3IJOB 2RCAA 2W0GA 2Y7PA 3O6HA 3KINB 2V1DB 3N9LA 4PETA 3RYFE 3O2AA 4GL8A 5AE4A 4OETA 4PW8A 3MP6A 2MYSA 4LA9A 2O7IA 4X1IE 4AB6A 2DI4A 4XKQA 1EH3A 1SW5A 1O3XA 2K24A 3FBLA 1UTBA 3PUWE 4OQOA 3LR1A 1SW2A 4UVCB 2X9HA 1SD3A 4U23A 4O2BE 3PV0E 3TQLA 4NF5A 5DVIA 3KJ7A 3Q29A 2M8CA 3FATA 3MKDA 3GZGA 1B0LA 3HCQA 2XD3A 3MJXA 3MUQA 3OO8A 1KK7A 3GBAA 4PFYA 3E13X 3FZVA 4OMBA 4UVAB 3N6UA 3HA4A 5B7DA 1TFDA 3ZLIA 5H8QA 4B6XA 3MK7C 2QL3A 3PU3A 3TDJA 2KWHA 2CXDA 3RYHE 3DJBA 4DO0A 3LSWA 5H8SA 5ITPA 1L5TA 4ZEIA 4M4GA 4PQJA 4GD5A 1MY3A 3KBUA 3LBSA 1MPCA 1S94A 2ONRA 5I59B 3KEIA 3N6TA 1SW1A 4HEAA 3SWHA 3CFXA 5L8DA 4HTGA 2CZLA 3O1HA 2LM9A 4YU0A 1Y4CA 2Y7KA 4NWDA 4JSDA 5KDTB 5LGTB 3KGCA 4CXWA 1M5CA 5ELVA 1AJ3A 2QA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0P A;  4RK2 A;  2O69 A;  3T66 A;  2HEU A;  1IJ6 A;  2OWT A;  1FTK A;  1URD A;  3N26 A;  4Q0C A;  3P7I A;  3G7W A;  4NF8 A;  2P2A A;  1B3E A;  2Z8E A;  4IY5 A;  4KCD A;  3MP8 A;  2DE3 A;  5AA4 A;  4G8N A;  1Y4T A;  3C31 A;  1OLC A;  2PT1 A;  1QSD A;  4ESW A;  4EUO A;  1YPN A;  3H3G A;  2HXW A;  1LST A;  4TLL B;  2OBG A;  4XXU A;  3S2V A;  1XVX A;  4U2R A;  5DEX B;  2XXW A;  1LVF A;  2AL4 A;  3SDF A;  2ZMB A;  1N7W A;  1BKA A;  1M5B A;  2UYF A;  3RTF B;  1JVX A;  3R7X A;  3ZSF A;  1PBQ A;  2ZNS A;  4ND9 A;  3MPK A;  4FOR A;  5H8H A;  2VD2 A;  4XTC Q;  5KZT A;  3PMV A;  1ATG A;  5DYH A;  5A5X A;  4OWD A;  3THI A;  4RY1 A;  2UYE A;  3R26 A;  4N6P A;  3T9V A;  4I1D A;  3QAX A;  1B58 A;  4GQO A;  2XXY A;  4JWY A;  2RIN A;  2YPN A;  1JEV A;  5CI5 A;  2V25 A;  1LBB A;  1XVY A;  4MLV A;  3SEW A;  3CVR A;  1ZKE A;  3O97 A;  3U72 A;  1FCK A;  4H67 A;  3V89 B;  3EQ1 A;  2DE2 A;  1MM6 A;  4WKM A;  1ZIU A;  1Z7M E;  3K2D A;  2PMS A;  4F1U A;  4DDD A;  1MH4 A;  2OJT A;  3O28 A;  5FTI A;  1NKX A;  1DMB A;  5FTH A;  1B2H A;  3R6U A;  4LQ5 A;  4ZEC A;  2DWJ A;  3VVF A;  3T9X B;  3ECR A;  4JWO A;  4EQB A;  3CVG A;  1N76 A;  3IB0 A;  2HZK A;  3S9M C;  4F3S A;  2XXU A;  5FHO A;  1H7C A;  3KN3 A;  2V3Q A;  1A40 A;  2QJE A;  3FJG A;  1XOC A;  2RC8 A;  2OK2 A;  5CBS A;  3LSL A;  2K48 A;  4PFU A;  5TP9 A;  2I4B A;  3PMW A;  2XXQ A;  3CR9 A;  3HN0 A;  1I69 A;  3PD8 A;  5FHM A;  2D3I A;  1NNF A;  4NE4 A;  3SKP A;  2P0S A;  1EZ9 A;  1B51 A;  1D9Y A;  4YKJ A;  3IB2 A;  2DS9 A;  4X48 A;  5M2V A;  3CG1 A;  4HCW A;  3FXR A;  1UQW A;  1NNP A;  1FQE A;  4QFP A;  3PPN A;  1MDP 1;  4FAJ A;  3H03 A;  2Y7R A;  1D9V A;  4GXA A;  4GRK A;  3T96 B;  2F97 A;  3G3G A;  4RPO A;  1UTB B;  3CSB A;  5CMB A;  4G68 C;  4X1D A;  4E0X A;  3ILU B;  4BDQ A;  4NF5 B;  3FVK A;  5CMC A;  1LAF E;  2F34 A;  2XXI A;  1H44 A;  3W15 C;  1EZP A;  5HBC A;  5IAI A;  5H8Q B;  4R75 A;  2QMW A;  3B6Q A;  2QS2 A;  4OXV A;  3FXQ A;  4I9D A;  1OIB A;  2NOO A;  3KJT A;  1DTZ A;  2XX8 A;  3ILT B;  3RUM A;  1M5F A;  3DEL B;  4LQ2 A;  1FQD A;  3E4R A;  3BBR A;  3Q25 A;  4TLM B;  4O3A A;  3QUJ A;  3VDF A;  3IOR A;  1RYX A;  3LSF B;  1ZTY A;  1Y9U A;  5KCJ A;  3K1P A;  2QPQ A;  5EYF A;  3S9E A;  1MXY A;  3FIR A;  2IC6 A;  1TXF A;  2XXX A;  2RC7 A;  3KFM A;  4K3F A;  1URS A;  1TWY A;  2I4C A;  3TTL A;  1BTJ A;  4NF8 B;  2VGQ A;  4RXL A;  1OLA A;  3JV9 A;  2VP1 A;  3K1M A;  4U22 A;  1R6Z A;  2PT2 A;  1Y3P A;  1MPD A;  4M1V A;  3MVW A;  4YAH X;  3HPI A;  1ZBM A;  1IJ5 A;  2Z22 A;  5AA4 B;  3IR1 A;  2QS1 A;  1MPB A;  5TU0 A;  4JBZ A;  1MM7 A;  2RCB A;  1LBC A;  2AL5 A;  4GIZ A;  3QXM A;  4QFK A;  3VXC A;  3TUS A;  1PB9 A;  2A5T A;  4WEP A;  4R73 A;  4IGT A;  2HZL A;  2O1M A;  3KN8 A;  1LAH E;  4AB5 A;  2ZYK A;  1P1Q A;  4H6D A;  2ABH A;  5F7V A;  4NED A;  5H8H B;  1GTK A;  2QMX A;  4BDL A;  1AIV A;  2HFB A;  1Y1M A;  4YKK A;  5A5X B;  4Q30 B;  1ANF A;  1SYI A;  3CRB A;  4JB7 A;  5DTB A;  5HPQ A;  1ELJ A;  4ZEK A;  4O3B A;  2OZZ A;  1ZJL A;  2HAV A;  4RK9 A;  5K2X A;  1MQH A;  4JSO A;  2XXH A;  3FXU A;  3T93 B;  3K6V A;  1VR5 A;  2I58 A;  4EXK A;  4YMB A;  1D4N A;  1RKM A;  1B3F A;  1QW0 A;  3RGY A;  2V3U A;  4E0W A;  1MQI A;  3H6W A;  1A8E A;  1NL5 A;  3FUZ A;  5JK4 A;  3GBB A;  3FV2 A;  1P1N A;  3FD3 A;  3TZA A;  4F3P A;  3T9H B;  1S7Y A;  2H4I A;  1OVT A;  1N0T A;  5ICT A;  4U1Z A;  3PPO A;  5F1Q A;  2Q88 A;  3TCG A;  4DCX A;  1BLF A;  1XHY A;  3FVG A;  4R6K A;  2X7P A;  3HV1 A;  4GOT A;  1AH5 A;  3K01 A;  2ONS A;  3U92 A;  4DIG A;  2WKY A;  4UAC A;  1LAX A;  2XX9 A;  1NH8 A;  4G2Z A;  3RLF E;  4I8C A;  5TP9 B;  1B5H A;  2F35 A;  2Q89 A;  3OO7 A;  1OQH A;  5H8N A;  1T0K A;  3VXB A;  2HAU A;  3PMX A;  3MZ9 A;  4GFR A;  2O51 A;  4UA8 A;  1SVX B;  3CKD A;  1B5I A;  3QIM A;  3FXE B;  2Q2A A;  4GL0 A;  2GFE A;  2O6A A;  3PD9 A;  3MJN A;  5I58 A;  4ESX A;  1FTM A;  1IZ1 A;  4HW8 A;  1IXG A;  1ZKB A;  1CE2 A;  2XXP A;  4YB5 A;  4BDO A;  3OO6 A;  4JXI A;  4NF4 A;  3RY3 A;  2W7Y A;  1O7T A;  1N84 A;  1D3K A;  2HQ0 A;  2REJ A;  4NWC A;  4F19 A;  2ZNT A;  5B70 A;  1P1U A;  4HCY A;  2F7A A;  2F6P A;  2UVH A;  4ZDM A;  2O68 A;  4KPT A;  3KBR A;  3MZB A;  5KCJ B;  4L17 A;  4GXS B;  3M8U A;  1H45 A;  2DSF A;  2NVU B;  4IO3 A;  1JEU A;  4XKP A;  5EHS A;  1VFE A;  2QRY A;  3MQ9 A;  1IQ7 A;  2DWH A;  4C1U A;  1J1N A;  1A54 A;  1LFI A;  4F1V A;  2O7U A;  3IX1 A;  1NNT A;  2KLF A;  3I3V A;  1HSJ A;  3AXF A;  1JW4 A;  5I2K A;  4IY6 A;  3I5O A;  5EHM A;  1JQF A;  2V93 A;  1GVC A;  1YTV A;  3M3L A;  2DWI A;  2X9X A;  3Q26 A;  2NUV A;  3C36 A;  2A5T B;  2D5W A;  3B6W A;  2E0S A;  3CSG A;  2DWA A;  1FQA A;  3TOD A;  1LGB C;  1SI0 A;  4U4S A;  4GF8 A;  5DT6 A;  3SEX A;  1MQG A;  3MWB A;  1SW4 A;  2V3T A;  3TTM A;  3TEL A;  4OVJ A;  3KG2 A;  5AA2 A;  3Q28 A;  2CMO A;  3JYR A;  2C5J A;  4AQ4 A;  4YZZ A;  1B3H A;  3HO7 A;  4OFO A;  2H9B A;  1JET A;  2CA5 A;  4Z7E A;  5AA3 A;  4O3C A;  3C4M A;  4YMA A;  2VOZ A;  1B7H A;  3IO4 A;  2LAO A;  2DXR A;  3K02 A;  3RPW A;  2E1S A;  3DP6 A;  3UA8 A;  1IUD A;  1TFA A;  1QUJ A;  2B65 A;  3FAS A;  3KOT A;  4RPN A;  4R9G A;  3IOW A;  4MFI A;  1EZO A;  4ISU A;  4U4X A;  4C1T A;  1LAG E;  2XX7 A;  1HSE A;  3CFL A;  3TKL B;  4DLD A;  3O6G A;  1BP5 A;  1IXH A;  1MXV A;  4WED A;  4EF2 A;  2ESN A;  4BLA A;  2I3W A;  3DLN A;  3TPA A;  4ELR A;  4ZEF A;  3QYT A;  4L0R A;  5TPA A;  1II5 A;  3H4Z A;  3G3K A;  2IC9 A;  2RKM A;  4NTL A;  2Y7W A;  1H3D A;  2G29 A;  1SYH A;  1JVY A;  3VE1 B;  2R9J A;  5DVJ A;  4F39 A;  3IAZ A;  1OQG A;  3QSL A;  4LZ7 A;  1FTJ A;  4LVQ A;  4PFT A;  1GV8 A;  3C34 A;  3TFL A;  1IXI A;  3JZJ A;  1QJM A;  1SI1 A;  1B7Z A;  4FIM A;  4MF3 A;  5CC2 A;  1US5 A;  3A3U A;  1ZMG A;  2ALU A;  3OEM A;  5H8N B;  1S50 A;  3DM0 A;  1IEJ A;  3U1O A;  4H0W A;  4OEV A;  1NFT A;  1N7X A;  2OCU A;  3FGS A;  1SDX A;  3VFJ A;  3C32 A;  5I58 B;  1UTH A;  3N94 A;  4ZS9 A;  1FQB A;  3FJ7 A;  4RJZ A;  1B7U A;  3TKD A;  2Q8J A;  2ANJ A;  3CFZ A;  3S9N C;  1UIU A;  3RT8 A;  3VVD A;  4RN