3QUJA

Crystal structure of the phosphonate binding protein, phnd, from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
301
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
total genus 100
structure length 301
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qujA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA02
2P1SA 1Y3PA 4LQ2A 2DS9A 3OEMA 1Y9UA 2ZYOA 1MQIA 1H7CA 5CBSA 3E9XA 2KLFA 3VVEA 1B58A 1OMPA 2I0BA 4H5FA 3FXQA 4XKQA 3HO7A 2VP1A 1YCJA 5L8DA 4OETA 2A5TA 4O3CA 2QS4A 1LRZA 4IY6A 1GR2A 3MVXA 1OVTA 5AA3A 4EYYR 1R9LA 3KN3A 4DCXA 3U1OA 3MP6A 1MDQA 4QFKA 4TLLB 3SDFA 5H8SA 3OEKA 5F7VA 1P1NA 4POXA 1EZOA 1LLSA 1SVXB 2NUVA 3JZJA 2WKYA 3G3GA 3RLFE 1B32A 4ZEBA 2F6GA 4OESA 4JSDA 4NF6B 2F34A 1D3KA 1Q35A 1LGBC 3MVZA 4FEDA 5JTYB 1FCKA 2Q89A 2Z8FA 1ZIUA 5H8FB 1FQBA 2DP8A 2DE2A 5TU0A 5DYHA 2ESNA 3IOWA 5I57A 4ZZAA 1H45A 4Q30B 3TTMA 4YKPA 3CKDA 1FQDA 1MY1A 2ZNUA 1B40A 4IO2A 4QFNA 1GTKA 3B6TA 4H8IA 4ELRA 3IR1A 3SEWA 1POTA 4WEDA 1B3HA 3I3VA 1MS7A 1XS5A 1H44A 5DTBA 5FTIA 4FORA 1LFIA 3OELA 1Q1KA 5KDTB 4Z7EA 4GF8A 3E4RA 5I56A 1US4A 2XXIA 4GQOA 4G8HA 5H8QA 4YMAA 4FAJA 3MBPA 3SEUA 1ZKBA 1B5IA 4OVJA 5BUUA 1MY3A 5HM4B 1Y4TA 3GLBA 4R6KA 2O69A 4ZEKA 4LUBA 5AA4B 3I5OA 2IC6A 4OHNA 5HBCA 4EUOA 5DEXA 1UTBA 1PDAA 3N6UA 2M8CA 1P1WA 5IAIA 1MXWA 1S50A 3U94A 1LB8A 3TELA 1IJ5A 4HW8A 1BTJA 3FZVA 4FEBA 4ZZEA 2PT2A 2Q88A 4DIGA 4ESXA 1EZPA 4U4SA 3UN6A 2FYIA 1DPPA 4OXVA 5HPQA 2Y7IA 3MUQA 5J1DA 1Z7ME 2XXWA 1LAXA 2HQ0A 3U93A 3TEPA 4KFQA 1JETA 3V89B 3PMWA 3LUYA 3CFLA 1T0KA 4Q8RA 4U21A 3SETA 3FVOA 4YMBA 3O2AA 2O6AA 2DWAA 1UTHA 2REJA 2ZMBA 3B7DA 2DQVA 4FJPA 1CE2A 3CSGA 4DE8A 5I2KA 3USDA 3OO8A 4H5GA 5ISUA 3K2DA 4RYAA 2OZZA 4J2CA 3FJGA 5F1QA 2Q2AA 3PMVA 3VLWA 4MH5A 4X1DA 1LAGE 4ZEDA 1EU8A 4NF8A 3CVGA 3S2VA 5LOMA 4RPNA 3LSFB 2YJPA 3QUJA 2CA5A 1H43A 3K6WA 5AA2A 3A3UA 5AA1A 5ICQA 5H8NA 4Q0CA 4BDNA 3B6QA 4KQPA 1I69A 4M1VA 1NNKA 1QULA 4F3PA 1B46A 1Y3NA 4G8MA 1R1NA 4DCYA 3CFZA 3UP9A 4YU0A 2GH9A 4IO3A 4O3BA 3VE1B 3TTKA 1Y20A 4IY5A 5KZTA 1P1UA 1MXUA 1B4HA 3HCQA 1SI0A 2AYSA 3KJTA 1NH8A 3RN8A 3SERA 1F9BA 4RK9A 4ZECA 1B9JA 4R6YA 4AB6A 1DTGA 2CZLA 2G93A 3EHSA 1UIUA 2O1MA 3S9NC 3PUYE 2DWJA 3O29A 4EXKA 1GGGA 3DP8A 3EQ1A 3OO6A 2FNCA 5TPAA 2R71A 3IOUA 3MP8A 1USYE 1B0LA 2OBGA 1VFEA 3TDJA 2O84X 2HCAA 4LA9A 4OFLA 2NXOA 2ONSA 4FE8A 3PUWE 4HCWA 3KGCA 3H4ZA 4R73A 2G0UA 3LSLA 1DPEA 4KYEA 2H5YA 3RTFB 4LZ7A 2X9XA 3T9VA 3TQWA 3FJ7A 4G68C 4OENA 1MH4A 2AL5A 4ZE8A 5JEIA 4X1BA 3FVGA 1B52A 4X48A 5K2XA 3C32A 1URGA 1LFGA 3HHFA 1HSEA 3KG2A 1FTJA 4JB7A 2Z22A 3L6HA 2O1LA 2VD2A 2Q9TA 3Q29A 4BDRA 3W15C 3UORA 4NF4B 4F39A 4GFRA 2Y7KA 5H8HA 4XKNA 2O7IA 1R9QA 1XT8A 3OENA 4WEPA 1I6AA 3TYHA 4NEDA 3T22A 2W7YA 3TCHA 5CRYA 1ATGA 1QJMA 3PV0E 4KYDA 3H03A 4KYSA 4DDDA 3H6VA 2AL4A 3VLVA 1A99A 4RXLA 2V3UA 3MVYA 1EH3A 4DXUA 1AMFA 1VSOA 3KEIA 1BIYA 3CG1A 3O6IA 2DVCA 3VV5A 3Q28A 1M5EA 3PUXE 4BDLA 3Q26A 4ELOA 1NMUA 4QF9A 1MM7A 1B1HA 2QSXA 4QSEA 1MPDA 5FTHA 1ZJLA 3D4GA 1B51A 4QFLA 4YKKA 4NWDA 3CI8A 4KPTA 4EQ9A 4F19A 3FASA 1IXCA 3IL1B 1WODA 1BP5A 2H98A 3VVDA 1TFDA 1I6QA 4DLDA 4JBZA 1M5CA 1SYIA 4F18A 4DXCA 2F35A 4QFPA 1B1XA 3K01A 4THIA 4IO7A 4RNSA 2NWJA 3KFMA 1B5HA 3TFLA 4YKJA 4ZE9A 1IITA 3THIA 4PETA 4POWA 5I58A 3O97A 4XXUA 3FATA 3G3KA 1B7ZA 5ELVA 3G3JA 4F2QA 1IUDA 1MQDA 4WXJA 2C5JA 5H8HB 3IK6B 3P7IA 2ZNTA 2RINA 3FXDB 1ZMGA 3U8QA 1Z0PA 1FTKA 3RTWB 3M3LA 2MBGA 4FATA 2F36A 4GXAA 5JK4A 4R9GA 1MXZA 1I6BA 5CMKA 3IORA 1MXYA 3QAXA 4QFOA 1MY2A 3V5AA 3QSLA 3RQTA 1B3GA 4H6DA 3TQLA 1UIVA 1PB8A 2D3IA 1YPNA 1WDNA 4FIMA 3WAFA 2UVIA 4LONB 3U92A 1SW4A 1SYHA 5EHMA 3S9MC 2IA4A 1NNTA 3ECRA 3DP6A 3D4CA 3QYTA 3QK6A 1Y3QA 4ZEIA 1DOTA 4LATA 4F1UA 2H9BA 1TXFA 3EHTA 3ZS6A 1XC1A 4H8JA 1LAHE 3SEYA 3TCFA 4IGTA 4RPOA 2V3QA 5DVFA 1SD3A 4OEUA 1GVCA 3N6TA 3H7MA 1JVYA 3G3FA 1AH5A 1NKXA 2OWTA 3KZGA 4L17A 3I6VA 1B05A 1OLCA 2A5TB 3PPRA 4JSOA 1FTOA 4HS7A 3QIMA 1N3XA 2QS3A 3RNNA 2ANJA 4RK2A 3ILUB 3MPLA 2ZYNA 2HXWA 3H6WA 2NOOA 4NTLA 3C36A 4F3GA 3E3KA 3Q25A 5I58B 3ILTB 1URSA 2QS2A 2R9JA 3M3FA 1YAEA 3MZ9A 3PPOA 4EF1A 4R2BA 2PX1A 5L9MA 4GWOA 4C1UA 1FTMA 4YB5A 3PUZE 4JWOA 3OO7A 4G2ZA 4LQ5A 3EN3A 5CMMA 4ISUA 1WVJA 2KWHA 4F2OA 3L6GA 3PPNA 1N7XA 3IB0A 1M5DA 3N26A 1URDA 5I57B 3OMBA 2QPQA 1QKAA 4GL0A 5L9SA 5I2NA 1ZLQA 3FVKA 3MJNA 1CB6A 1AOVA 1A7LA 2Y84A 4OMBA 3HPIA 4PP0A 5A5XA 1BLFA 3MW0A 2I48A 1P1QA 2Y7PA 4FECA 1MQHA 3LSXA 2G29A 2Y7RA 4N13A 4IGRA 4KD5A 2B65A 3OSQA 4U2RA 1UQWA 1H3DA 1SBPA 1B3FA 1USYH 1QUIA 5I56B 1LCTA 3N5LA 2X9WA 5H8QB 3MC2A 3PU5A 1QKBA 3CR9A 3K02A 2I6EA 3HHGA 3L3PA 4GD5A 3BFTA 3TKDA 1MH3A 4IO6A 4YZZA 4GXSB 5K2YA 3ONMA 2ZNSA 5ICTA 3PGFA 1QW0A 1O64A 2RC8A 3QXMA 3VVFA 4HTGA 5DEXB 5CMCA 1UTBB 5TP9A 3KN7A 4TLMB 3R26A 1QUJA 2KWIB 1M5BA 3FUZA 3SEXA 3FXUA 3OSRA 1JW4A 3RT8A 1D4NA 3G3IA 4YB6A 3JYRA 3F11A 3DM0A 3IAZA 3ODBA 2QMXA 4YICA 3FJMA 4F29A 1PBPA 4H67A 3TAJA 2PMSA 4YAHX 1FQFA 2DE3A 3E13X 1IXIA 1FQEA 4E0WA 4ZDMA 3T9XB 3H6UA 3ZKLA 1JQFA 2GHAA 5KCJA 1IXHA 2OCUA 1J1NA 1MM6A 2QL3A 4G4PA 4YKIA 5FHOA 3K0VA 3K4UA 1PEBA 4GVOA 1MRPA 2H4IA 4O3AA 4ZEFA 1B5JA 5A5XB 5CBRA 5CC2A 1PBQA 2ALUA 3C35A 1QSDA 4P0IA 4U1OA 1UTHB 2XXPA 4KCDA 1NNPA 1LAFE 5I2KB 2XD3A 3O66A 3V83A 1SW2A 1N04A 2RCBA 4TQUQ 3VDFA 2F7BA 2F5XA 1A8FA 3C9HA 1IQ7A 4NF5A 2VOZA 4PFWA 3RT6B 3PUVE 4H0WA 5B70A 3LBSA 2Q8JA 4P0GA 1A55A 4NF8B 1H76A 2DOJA 1OLAA 1JW5A 3VLUA 1MPCA 2XXXA 2OLBA 4BDOA 1PB9A 4GRKA 5AA2B 4AQ4A 1TWYA 4EQ7A 3TTLA 1MG1A 5H8NB 1B0HA 4X9TA 1SDXA 4OZ9A 3SESA 4ZS9A 1JVXA 4QHQA 3OO9A 2K48A 2X9YA 2I58A 1HSJA 4N07A 2O68A 3IOTA 3RY3A 3MAMA 1LBCA 2RC7A 3PD9A 4MLVA 4TOZA 5BWJA 2QJEA 3PPPA 2F78A 2C5KT 1N0TA 2R6GE 1PC3A 2ZYMA 2DWIA 2ABHA 4F3BA 4DNDA 1JEVA 3IJXB 4UACA 2UXAA 3AXFA 4RJZA 3DELB 4F22A 2Y7WA 2DWHA 1DTZA 5TPAB 3HV1A 2V93A 4GOTA 2X7QA 5JTYA 3RPWA 1GV8A 3CSBA 2B3BA 2E0SA 2DVZA 3N94A 5H8FA 4L0RA 1O63A 3TUSA 1VFDA 5ITOA 3CG3A 3IX1A 3H06B 4U23A 4C1TA 2F7CA 2X26A 1Y1MA 3K6VA 4NE4A 3KOTA 5DT6A 2GRVA 4PFYA 1A40A 1LB9A 2Z23A 1MY0A 2ZXTA 3M3KA 3TODA 1EZ9A 2I3WA 4R9FA 2ONKE 4H65A 3JV9A 2VHAA 3HSTA 3CFXA 1OIBA 1JW1A 4QSCA 2THIA 3PPQA 3KBRA 4QSDA 1LSTA 1IEJA 2QMWA 5KDTA 4F3SA 1YTVA 1N7WA 4GLIA 1US5A 5I84A 2VD3A 3O6GA 1R6ZA 1VE4A 2AIXA 4OERA 2B3FA 3ZKKA 4B6XA 1PB7A 1D9VA 3K6UA 3W9VA 4HCYA 5AA4A 2NVUB 2V3TA 2H99A 3VXBA 2LAOA 3FVNA 2I4BA 2XX8A 4OEVA 2IC9A 4JXIA 4EQBA 4ND9A 4BLAA 1XOCA 3MPKA 1LBBA 4NWCA 1A8EA 2XXRA 4G68A 1XVXA 1QVSA 3BKIB 2P0SA 2I0CA 2XTLA 2PT1A 2OJTA 5B7DA 1JEUA 4OFOA 2REGA 2OK2A 2HZKA 3Q27A 3UIFA 4LP2B 3MVWA 2F7AA 3TCGA 4R72A 4YB7A 4U22A 3H6TA 4JWXA 3K6XA 5ITPA 4XIGQ 1NNFA 3RGYA 3MWBA 1A54A 4JWYA 4MF3A 5IKBA 3IO4A 5EYFA 3PMXA 3MZ1A 4MBPA 1B7UA 1N76A 4P11A 3C34A 3UA8A 4CQIA 3QUFA 3C31A 3TPAA 3CRBA 1Y1ZA 4LZ5A 3U72A 2HAUA 1ZTYA 4BDQA 4H1XA 1AL3A 2HFBA 2XXQA 2I4CA 1II5A 3EF7A 1OVBA 4G77A 3VFJA 1RYOA 5FHNA 3K1PA 2OWSA 2XX7A 1IXGA 3BFUA 4DXBA 3O9PA 1LVFA 4KCCA 4R6HA 3W9WA 2V84A 4PQJA 3MXZA 4KR5A 2XXTA 4MFIA 2PYYA 2H25A 2RKMA 1IZ1A 4ECFA 4PE5B 1OQHA 4R74A 2F97A 4ELPA 3SKPA 4RA1A 1ANFA 4WKMA 3OOAA 4G68B 2HZLA 1TFAA 1Y4CA 3FD3A 2UVHA 1B3LA 3A3CA 2HAVA 3B6WA 3CIJA 4LVQA 4QRZA 5L9OA 3GBBA 2GHBA 2XHDA 4I62A 4DZ1A 3DLNA 2C5IT 3MQ9A 2A5SA 5DVIA 2XXHA 1FW0A 1OQGA 1KWHA 3FXEB 4OYVA 3LR1A 3MZBA 3IOVA 1DMBA 1POY1 1QUKA 2BJJX 3KSXA 3WAEA 3G7WA 3T93B 1MY4A 2UVJA 2Z8EA 1M5FA 4F31B 5AA2D 3TKLB 3GBAA 3TMGA 4OQOA 3UGWA 2XXUA 1MQJA 5CI5A 5EHSA 1MXVA 1AIVA 1MQGA 2F6PA 4M4GA 1SI1A 1ZU0A 3FGSA 3KOSA 3R6UA 3IB1A 3C4MA 4G8NA 4KI0E 4U4XA 4Q5TA 4I1DA 1TT1A 5FHMA 3FV1A 2Z8DA 2UVGA 3KSJA 4C0RA 3FXRA 1N84A 1S9TA 1B2HA 2V25A 1FQCA 2X7PA 1L5TA 1O7TA 3MP1A 1LCFA 2DXRA 4N6PA 3EPEA 3TTRA 3TTNA 1NL5A 3TZAA 2YLNA 3K1NA 4U1ZA 1IIWA 2IEEA 5I2NB 3VXCA 1FTLA 1Z7NE 3GXAA 5CMBA 2F8DA 4FI5A 3SEVA 1MXXA 2RC9A 3H3GA 3IO6A 4I8CA 2XXYA 3KN8A 3OD7A 4ELQA 1P99A 4NF4A 1NFTA 5AE4A 1IJ6A 2O51A 1B7HA 4IO5A 3A09A 2UYEA 1XVYA 2I49A 4GIZA 3T9HB 1LFHA 4KHZE 2E1SA 4Z0IA 5M2VA 3T96B 2FA7A 2UYFA 2O7UA 4IO4A 4F1VA 1P1OA 1FQAA 5I59A 3BBRA 4XTCQ 5DVJA 3S4UA 1ZKEA 1NH7A 3IB2A 1S7YA 1N3WA 1ELJA 1VR5A 3GZGA 2HEUA 1MPBA 3C33A 3G3HA 3V8XB 1ZBMA 1BKAA 3DP4A 5TP9B 2DE4A 2P2AA 4E0XA 4UA8A 4AB5A 4PFUA 2QRYA 4ESWA 4RY1A 1SW1A 4MLQA 2RF1A 2D5WA 4XKRA 2ONRA 3OXNA 3O6HA 2CMOA 3CVRA 2QS1A 2ZYKA 4OWDA 3K1MA 1DSNA 2DYXA 2XXVA 1RKMA 4BDMA 3O28A 1B4ZA 3EHUA 4I9DA 4F1YA 4R75A 5KCJB 3LSWA 4PFTA 3FIRA 2YPNA 3FV2A 3S9EA 1SQYA 4EDPA 3HN0A 3T66A 3UK4A 2XX9A 2PBWA 1D9YA 4IB2A 4EXLA 3S9LC 4EF2A 3T9UA 4ONYA 4LZ8A 3IJOB 4NF6A 4OTEA 4GL8A 2Q2CA 4OFJA 2XD2A 2D21A 4R2FA 1XHYA 3K00A 2GFEA 5CM6A 4XKPA 4K3FA 3LC8A 2VGQA 2I3VA 3ZSFA 4JDFA 1HSLA 1SW5A 1RYXA 2PVUA 1JNFA 3PD8A 5I59B 3M8UA 1MDP1 4NF5B 2DSFA 3RUMA 1B3EA 3R7XA 4NMYA 1B6HA 2DXYA 3KJ7A 2RCAA
chains in the Genus database with same CATH superfamily
1W0AA 1HG2A 3UFEA 1LKXA 2P1SA 2E9XC 1Y3PA 4X62T 1G0HA 4PAIA 5LBMA 4TV8E 3PUSA 4LQ2A 4ILCA 3ZT6A 4LF9T 2DDKA 2DS9A 3OEMA 4YTNA 1Y9UA 2ZYOA 3VR9A 1MQIA 1H7CA 4IE6A 5CBSA 4H9OC 5EZYE 1XDPA 3BK9A 3N9NA 3E9XA 3FB2A 2KLFA 3VVEA 1MIYA 1B58A 1OMPA 2VKJA 2VKDA 2I0BA 2A72A 2DWKA 4H5FA 2VASA 1X9BA 2FBWA 2XASB 3FXQA 4XKQA 4X20E 3HO7A 5DQVA 2VP1A 1YCJA 5L8DA 1SE7A 3P8CD 4OETA 2A5TA 4O3CA 2N2NA 4A56A 2QS4A 1G73A 4HWHA 1LRZA 4IY6A 3FZFB 4KUMB 1GR2A 3KV6A 4EGWA 3MVXA 1OVTA 5AA3A 4EYYR 1R9LA 3KN3A 2CE7A 4WBNE 4TV9E 2JPFA 4DCXA 2J1DG 3U1OA 2WBBA 4DR4T 1ZOYA 3MP6A 2N9DA 1MDQA 4N6DA 4QFKA 2ZM2A 5JDQA 1WFDA 4TLLB 3SDFA 5H8SA 4KX6A 3OEKA 5F7VA 5FKYA 3KC0A 3CHGA 3ZN0B 1OWAA 2CRBA 1P1NA 1XI6A 3QNUA 1WR6A 4POXA 1FPJA 1EZOA 1LLSA 1SVXB 2NUVA 3JZJA 2WKYA 3G3GA 4OVSA 2LE8A 3RLFE 2KMFA 1B32A 2CWYA 4X1YE 4ZEBA 3G06A 3CX6B 2F6GA 2EHOA 2LSIA 3LG7A 4OESA 4JSDA 4NF6B 4JI6T 2F34A 1D3KA 2VPNA 1D0XA 3RPLA 3CQGB 5I3SA 3UU6A 3IEEA 1Q35A 2YDRA 1LGBC 3MVZA 4FEDA 5JTYB 1Y01A 2H89A 2RP4A 3PE0A 1LBVA 1FCKA 2QVAA 3C50A 2Q89A 1EYKA 4H46A 2Z8FA 1YD8G 1ZIUA 5H8FB 4U74A 3QC9A 1FQBA 4CXXA 4U72A 1BR4A 4ILBA 1UK5A 3KBZA 1IMCA 4P8BA 3A8YC 3AE1A 4CN6A 1SA0E 2DP8A 2DE2A 5TU0A 4MNCA 5DYHA 2ESNA 3IOWA 5I57A 3C4WA 4ZZAA 1H45A 3ZKRA 4Q30B 3TTMA 4YKPA 3CKDA 1FQDA 4I4TE 1MY1A 2ZNUA 1B40A 4UR9A 4IO2A 1OEDC 4ERRA 4QFNA 5C2TA 1GTKA 3B6TA 4H8IA 5J2TE 4NAPA 4ELRA 2X0YA 3IR1A 5JR9C 4MBQA 2LM9A 3ZMZB 5H6QB 2VKOA 3MK7C 5HEGA 3TLSA 1POTA 3SEWA 2WQYA 4GYSA 1B3HA 3I3VA 4WEDA 2J47A 4LMLA 3PV0F 1MS7A 1XS5A 2J4GA 2WDRA 2LHNA 5AQNB 4AQFC 1H44A 2XWKA 5DTBA 2W61A 5FTIA 3KFWX 5CFBA 3DP7A 4H9PC 4FORA 2FJBA 1SPIA 1LFIA 4N91A 3ESLA 4PFIA 3WAJA 1NV6A 5F24A 1WR0A 3HR0A 5BMVE 3OELA 1IMBA 2VQFT 2IDOB 1Q1KA 3N9LA 3BQKA 5KDTB 4Z7EA 2XQ8A 3KC1A 4GF8A 2Q9QC 3E4RA 5I56A 4DBQA 3AA0B 1US4A 5LGNB 2XXIA 4DR1T 2IUBA 4GQOA 3PUXF 4G8HA 4GBWA 5H8QA 4OYKA 4H63H 4YMAA 4FAJA 3MBPA 3CX8B 3SEUA 2W66A 5AQGB 1FPEA 4PE3A 3ZN1B 3R6NA 1ZKBA 1B5IA 2ACZA 5FYMA 4OVJA 5BUUA 4P1NA 1WLXA 3UFGA 1MY3A 5HM4B 1Y4TA 3GLBA 1D1BA 5HWXA 4R6KA 2O69A 2W2UA 3IFAA 4ZEKA 4LUBA 2YDQA 4F6RC 3ZMVB 2B1EA 5AA4B 3UUMA 3I5OA 1MIVA 2IC6A 2XM1A 3VHLA 4O7MA 1HX8A 4JI8T 3I1AA 4OHNA 5HBCA 5HXEA 5LHIB 2E9XA 4EUOA 4H9NC 4LFBT 3CQXC 2FVZA 2X66A 5DEXA 1UTBA 2CLYC 2CZKA 4U3CA 1PDAA 3N6UA 2M8CA 1P1WA 4ADZA 4N6KA 4HE0A 4C90A 5IAIA 1MXWA 4GWUA 1S50A 3U94A 1LB8A 1R8IA 5HYAA 3OJAA 4KP3C 3TELA 4HEAA 1IJ5A 4HW8A 2D0TA 1BTJA 3N2OA 3FZVA 4FEBA 4ZZEA 2PT2A 3CQCB 5AQVB 2Q88A 4DIGA 3SOLA 4WZXA 4ZEYA 4LMKA 5DQWA 4ESXA 1EZPA 2NW8A 4U4SA 4XBFB 2OWZA 2VL0A 3UN6A 2FYIA 1RDYA 2Q74A 1DPPA 4OXVA 2XQ9A 4TNWA 2AXDS 3N9OA 4B3TT 5HPQA 2Y7IA 3MUQA 5J1DA 4PF6A 1Z7ME 2XXWA 5FXZA 1LAXA 2V6XA 2HQ0A 4PFOA 3U93A 4UF0A 3TEPA 4MALA 3ZSTA 4HFCA 4KFQA 1JETA 3UU3A 3V89B 1LBXA 1J5ET 3AECA 2DLRA 3T8OA 4DMVA 2XQYA 1QGXA 2V1DB 3PMWA 3AE7A 3SFDA 3LUYA 2W62A 3CFLA 3FZLB 2V7KA 2KZ7B 1T0KA 3Q5XA 4Q8RA 2NTXA 4U21A 4HN9A 4BJMA 3SETA 3CMLA 3FVOA 4AS4A 3TLWA 4YMBA 3O2AA 2O6AA 3D0TA 4GK5E 2DWAA 1NV7A 3MYUA 3AA1B 1UTHA 2REJA 2ZMBA 2XQ4A 3B7DA 2DQVA 4FJPA 1CE2A 2LLYA 3CSGA 4DE8A 3TLUA 4QX8B 2VK9A 4BA9A 5LXTE 3USDA 5I2KA 2ES0A 4L5GA 3OO8A 4H5GA 5ISUA 3SS1A 3K2DA 4RYAA 2NW7A 2OZZA 1FIOA 4I43B 4J2CA 2Q9QD 4PAFA 2ODVA 4PF8A 2XY8B 4AKGA 4NUVA 2ZM0A 4NPPA 4NQ8A 3FJGA 2V5DA 2XAFB 4NXMT 5F1QA 2Q2AA 3PMVA 5CGMA 3VLWA 2Y48B 4P09A 4MH5A 1WRDA 4X1DA 4U31A 3IHRA 1LAGE 4HWFA 4GX4A 4PTKA 4ZEDA 1FBGA 2V8SV 4XZCA 1EU8A 3LBXA 4NF8A 5AQKB 3CVGA 3S2VA 1OEDA 4RPNA 5LOMA 4IDQA 3RYCE 3V5UA 3LDQB 3LSFB 3BQLA 2YJPA 3QUJA 2CEAA 2CA5A 1H43A 3K6WA 1INPA 4TN7B 2HHHT 4LFAT 1YKEB 5LBQB 3EAMA 5AA2A 3A3UA 5AA1A 2XQ5A 3C4ZA 5ICQA 5H8NA 4MNIA 4Q0CA 4BDNA 3B6QA 4NXNT 3JCFA 4KQPA 3L09A 1I69A 4M1VA 2VB6A 4B3ST 1BR0A 2D5UA 1NNKA 1QULA 4F3PA 4Z91A 3LSVA 1B46A 1NV1A 1GQEA 1Y3NA 4G8MA 1R1NA 4DCYA 4YT0A 3CFZA 4X1IE 3AEFA 3UP9A 3O1JA 3PJAA 3GN5A 3O9XA 4OANA 1G0IA 2PTFA 4YU0A 2QVRA 1XDOA 2GH9A 3I9YA 4DV1T 1KK7A 4IO3A 2MYSA 4O3BA 3VE1B 3TTKA 1Y20A 2YINA 4IY5A 5KZTA 1P1UA 4N78D 1MXUA 4NX1A 4PFPA 3JC6C 1B4HA 3HCQA 1VOMA 1SI0A 2AYSA 4IHJE 3KJTA 4KMCA 3Q5DA 2I59A 1NH8A 5HEUA 5HEJA 3RN8A 1HCIA 1OEDE 3X1DA 3SERA 1F9BA 2XPKA 3AE2A 2UXDT 2YN6A 3O1IA 3PUZF 4RK9A 3EI0A 4M1PA 4ZECA 4HWIB 1V9DA 3N9PA 2P3VA 1B9JA 4B3MT 4JV5T 4R6YA 4IR8A 4AB6A 2FJDA 1DTGA 3SFEA 2CZLA 2G93A 3EHSA 3ONXA 1UIUA 2LSGA 3RRCA 3RQWA 2O1MA 3S9NC 3PUYE 2HN2A 2QGSA 3K3QC 1T72A 2DWJA 5EK4A 4EXTA 5FVKA 4EZHA 3O29A 4EXKA 1MMGA 4QXCB 1GGGA 3DP8A 2NTYA 3EQ1A 3OO6A 2BZBA 2FNCA 5TPAA 2R71A 5HCMA 1FBPA 3IOUA 3MP8A 1USYE 1B0LA 3UU8A 2OBGA 4K0KT 3Q5EA 2BG9A 5L47A 1VFEA 3K1SA 5J2UE 5JRCB 3E0ZA 2O84X 4IT4A 3KVAA 3PUAA 4UELA 4YJ3E 2HCAA 3TDJA 3UUNA 1CHUA 4F8HA 4AXPA 2A2FX 2LHRA 4EIWA 1W0BA 4QXDA 4LA9A 3NRXA 4UIGA 4OFLA 2NXOA 3D1RA 2ONSA 3LBXB 4FE8A 1S94A 4TX5A 4IL9A 4JBWF 3PUWE 2WSSV 5FNVE 4HE8A 4B3RT 3E22E 4HCWA 3KGCA 5AQJB 3H4ZA 3AEDA 4R73A 2G0UA 3LSLA 5HXHA 1SUMB 2E2AA 2XAGB 2MTQA 3K8PC 1DPEA 4KYEA 3N2KE 3A7MA 2H5YA 4YXDA 3RTFB 5JH7E 3RIAA 3AA7B 4HFHA 4LZ7A 2X9XA 5I7IA 3T9VA 4JI3T 3TQWA 3F31A 3FJ7A 4G68C 3QB5K 4OENA 1MH4A 2AL5A 4ZE8A 3B50A 3AEBA 5AQMB 5JEIA 1NUYA 4X1BA 3FVGA 1B52A 4X48A 5K2XA 4HWDA 3C32A 3KV5A 5FVLA 1URGA 4AISA 1US7B 5IZZA 4ZHQE 1LFGA 5ADXL 4NF0A 3HHFA 4X1KE 2UUBT 1HSEA 2BG9E 3KG2A 3ZYKA 4MAGA 1FTJA 4KI0F 4JB7A 2Z22A 3L6HA 2O1LA 2VD2A 4KHPT 5ET6A 3ABVA 3ETUA 2Q9TA 3Q29A 4BDRA 2HPGA 3W15C 4HFEA 3UORA 4NF4B 2UXBT 4F39A 4GFRA 4E7SA 2Y7KA 5H8HA 4ISTA 4XKNA 2NW9A 3I9WA 4EZ4A 2O7IA 1BK4A 3QB5A 1R9QA 2CHOA 1XT8A 3OENA 4WEPA 2XSBA 4UVCB 1I6AA 5ABFB 1FJ9A 4O8SA 3TYHA 4NEDA 1XMOT 4ISSA 3T22A 2W7YA 4AIUA 1HNWT 3TCHA 5CRYA 2H7OA 3C4XA 1ATGA 1QJMA 3PV0E 1CUNA 4KYDA 1XNQT 1ZHCA 3H03A 4MIJA 1HTJF 1KEYA 4KYSA 2VKHA 5IZ1A 4DDDA 3H6VA 2AL4A 3VLVA 1A99A 4RXLA 2V3UA 3MJXA 3MVYA 1EH3A 4A97A 1FEWA 5C8YE 4DXUA 4LFCT 1AMFA 4HFDA 1VSOA 1FBEA 3KEIA 3AEEA 1BIYA 2M6IA 1Q9DA 3ZJ1A 3CG1A 2OA5A 3O6IA 3IBPA 2DVCA 2K24A 3VV5A 3Q28A 3CWZB 1M5EA 4Z90A 2WDVA 3PUXE 4HGAA 4BDLA 3Q26A 4ELOA 3MA9A 4JEHB 5CB4E 3KDSE 1NUZA 1NMUA 4QF9A 3FZKB 2Q8MA 4QH5A 3HI2A 1XMQT 2Y8DA 4WW0A 5AQQB 4DR2T 2LSYA 1HS7A 1B1HA 1MM7A 2QSXA 2WMNA 3RKOA 4QSEA 1MPDA 5FTHA 1ZJLA 4PJLA 3D4GA 1VRBA 3C51A 1B51A 2UU9T 3UQ4A 3EUHA 4QFLA 4PCDA 3J7Yq 4YKKA 4I0UA 4NWDA 2CBJA 3CI8A 4KPTA 4X64T 4EQ9A 1S35A 4F19A 5LTCA 2OX3A 3FASA 1IXCA 3IL1B 4HTEA 1WODA 1CNQA 4ZZBA 3B8BA 2MOZA 4LF5T 3U65A 4EYUA 3PUVF 5L4EA 1BP5A 2K3WA 4O2AE 2H98A 3VVDA 4DIDB 5KDMC 1I6QA 5HXSA 1TFDA 2XWVA 1G8XA 4HE1A 4DLDA 4JBZA 3RH3A 4MX6A 1M5CA 2WEFA 1B7TA 5AQLB 2FJAA 5KX5E 1IBLT 1AWBA 1SYIA 5J1GA 4DXCA 4F18A 2F35A 3ZLIA 4QFPA 4ZXLA 1B1XA 3K01A 4THIA 1FBDA 4IO7A 4RNSA 2NWJA 3KFMA 3RKGA 3AAAB 3HKDE 2IIUA 1B5HA 3TFLA 4YKJA 4ZE9A 3ROJA 1IITA 3THIA 2K9AA 4OVTA 3CX7B 4PETA 4Z8XA 2D2SA 2XSAA 4POWA 2H3RA 2YK0A 5I58A 3O97A 2IAKA 4XXUA 3FATA 3G3KA 1B7ZA 3AVRA 5ELVA 2KLQA 2YOEA 2FIXA 3G3JA 2VWAA 4O4JE 4F2QA 1IUDA 2LJLA 2PG8A 1MQDA 2C5JA 4WXJA 3IK6B 3KBUA 2PBIA 5H8HB 3P7IA 2V26A 2LSJA 4PFRA 2ZNTA 4JI5T 2RINA 3L39A 3FXDB 1ZMGA 3U8QA 1Z0PA 1FTKA 1NV5A 4UV9B 3RTWB 1I94T 3M3LA 2MBGA 4FATA 2F36A 2W4XA 4GXAA 4G63A 5JK4A 4R9GA 4IDZA 5AQIB 1MXZA 1I6BA 5CMKA 3IORA 1MXYA 3QAXA 1VCTA 4P0BA 5AQUB 4QFOA 1MY2A 4WBOA 3V5AA 5IWAT 3QSLA 3RQTA 1B3GA 4GOUA 4H6DA 3TQLA 4JI2T 1UIVA 3OYXA 1PB8A 1YKHB 3AXJB 5F8PA 2D3IA 1YPNA 1WDNA 4FIMA 4I3EA 3WAFA 4MNPA 2UVIA 4LONB 3U92A 4AS5A 1SW4A 1SYHA 5EHMA 3KVBA 4DR7T 3S9MC 4YY3T 2R6GF 2IA4A 1NNTA 1KA0A 3ECRA 3DP6A 3D4CA 2JRKA 3QYTA 5DW8A 3QK6A 2V7MA 2WBLA 1Y3QA 3NBXX 5AFUL 4ZEIA 2PFZA 1DOTA 5IUXA 4LATA 3ETVA 4F1UA 3BIGA 2H9BA 1TXFA 2LRLA 3EHTA 3ZS6A 3PU8A 4DV0T 4GX3A 1XC1A 1DCUA 1LAHE 4H8JA 2P3NA 2JMKA 3SEYA 4IGTA 3TCFA 4RPOA 2V3QA 5DVFA 1SD3A 4OEUA 1GVCA 5HEHA 3N6TA 2X51A 3H7MA 1JVYA 2A9UA 3EABA 3G3FA 1AH5A 1NKXA 2OWTA 2V4CA 3KZGA 4L17A 2CXFA 3RQUA 3I6VA 1B05A 1OLCA 5DABA 2A5TB 3PPRA 4JSOA 5FL0A 4PC9A 1FTOA 4HS7A 3QIMA 3VKGA 1N3XA 2DCFA 3U78A 3E78A 2Z6EA 4OYJA 2QS3A 3JADA 2N1GA 2ANJA 3RNNA 2BKOA 4RK2A 1LVKA 2NR4A 2LRKA 3ILUB 5LMNT 4LN5A 3MPLA 2ZYNA 2HXWA 3UT5E 5AQRB 2KNDA 4EEDA 3H6WA 2NOOA 4NTLA 2KR0A 3HL6A 3C36A 4F3GA 3E3KA 3Q25A 1KZ8A 1D0YA 2WYKA 2VVNA 4QX7B 2ZZWA 5I58B 3WI3A 2W0GA 1IMFA 3ILTB 2LSKA 1URSA 3P4SA 2QS2A 2R9JA 5AQOB 3M3FA 4OA4A 4OVRA 1YAEA 4QH4A 3MZ9A 2DI4A 3PPOA 2EHOB 4EF1A 4R2BA 2DHRA 2R8TA 2PFVA 5FXVA 2PX1A 5IZ3A 5L9MA 3RPLB 3MACA 4GWOA 1FJGT 3PTRB 1FTMA 4C1UA 1KFYA 2L9QA 3RI5A 4YB5A 3PUZE 4JWOA 4H9QC 3OO7A 2BS2A 4G2ZA 4LQ5A 1XZYA 3EN3A 5CMMA 5AQFB 4ISUA 2QYWA 1WVJA 2KWHA 3NRYA 4F2OA 3DTOA 5ABGA 3L6GA 3PPNA 5H6RB 4X04A 1N7XA 3B57A 1WYCA 3IB0A 2WZIA 4HFVA 5HWYA 1M5DA 3N26A 1URDA 5I57B 3OMBA 2QPQA 4HFBA 2WWUA 1QKAA 4GL0A 5L9SA 4N4UA 4JVIA 5T3JA 5I2NA 1ZLQA 3FVKA 3MJNA 2I6HA 2W67A 2XWIA 3AE9A 1CB6A 3QOFA 5I5PA 1AOVA 1A7LA 4ZS3A 5TAOA 2Y84A 5CA1E 4QHOA 4OMBA 1FPGA 3HPIA 4O8MA 4U2YA 5IHYA 4PP0A 5A5XA 1RDXA 3M3ZB 4MLKA 2X68A 4PAKA 5ET7A 1NUXA 1BLFA 2WX9A 4N8YA 3MW0A 2I48A 4V1Av 1P1QA 2Y7PA 4G61A 4LF4T 3PUQA 2E5LT 4FECA 1MQHA 3LSXA 1HR0T 2G29A 2Y7RA 1O3XA 4N13A 4IGRA 1ZEEA 5AQPB 4IREA 5CJ5A 4KD5A 2CXLA 3OYZA 2B65A 3ANWA 3OSQA 4U2RA 1H3DA 1SBPA 1UQWA 5LP6E 1QLBA 2V7JA 1B3FA 1USYH 1QUIA 5I56B 3U3IA 1LCTA 3N5LA 2X9WA 2WU2A 1SHZC 5EYHA 2CMRA 4O4LE 4COFA 3MC2A 3PU5A 5H8QB 5FY1A 3EVYA 1NV0A 1QKBA 3CR9A 3NWIA 3K02A 2I6EA 3HHGA 1DU2A 3L3PA 1KA1A 2WU5A 4A5XA 4ASKA 3NZQA 4GD5A 4ANJA 3BFTA 3TKDA 3LK42 4DV6T 1MH3A 1YZ0A 1IMEA 1NEKA 2RA1A 4IO6A 4GXSB 1MIWA 3A5XA 4YZZA 1LBWA 5K2YA 3ONMA 2KXPB 4EEBA 2ZNSA 5ICTA 1E1HB 5JDLA 4DV3T 1IMDA 1LEVA 3PGFA 5JR9A 3KV4A 4AKHA 5AQSB 4I55E 2E9XB 4CXWA 1QW0A 1O64A 2RC8A 3QXMA 3VVFA 1WCRA 4HTGA 2BJIA 2VT5A 5DEXB 2WY2A 4AQFA 5EK2A 2YKSA 2NP9A 1UTBB 5CMCA 2WB5A 5TP9A 4DO0A 1IBKT 3KN7A 4TLMB 3UUBA 3R26A 1QUJA 4ILUA 2J62A 2KWIB 4IE4A 1M5BA 3FUZA 3SEXA 1MNDA 3FXUA 3OSRA 1JW4A 3RT8A 1D4NA 3G3IA 2YDSA 4YB6A 3JYRA 3AE6A 2NWBA 5F3JA 3F11A 3DM0A 3IAZA 3ODBA 2QMXA 4QH1A 4XEQA 4U33A 4YJ2E 2Q9QA 4YICA 3FJMA 4F29A 5L3EB 1PBPA 4H67A 3SRZA 1YXIA 2PMSA 4YAHX 3TAJA 1FQFA 4IDPA 1I6ZA 2DE3A 3E13X 2DNXA 4X65T 1IXIA 1FQEA 4E0WA 3LJCA 3VRAA 4ZDMA 2WDQA 3F2EA 3T9XB 3H6UA 4ILAA 3ZKLA 1YXRA 3AE5A 1E2AA 1JQFA 1YW0A 4XAXB 4QBAA 2WCAA 5LHGB 2GHAA 5KCJA 3RYFE 4UF0B 4PW8A 4ZS2A 1IXHA 2OCUA 4H9RC 3RIUC 1J1NA 1FBFA 1MM6A 2QL3A 4G4PA 4YKIA 5FHOA 3K0VA 3K4UA 5LYJE 1PEBA 4GVOA 1MRPA 2H4IA 4O3AA 4ZEFA 1HNXT 2ACXA 4NG7A 1B5JA 5A5XB 5CBRA 1FMWA 2BDEA 1PBQA 5CC2A 2ALUA 5FP3A 3C35A 5JDNA 3EHZA 4DBRA 4TWDA 4UV8B 4GKKT 4ZOLE 3KBTA 1QSDA 4IGUA 4P0IA 1OXZA 4GYRA 4U1OA 2MKZA 1FRPA 1UTHB 2XXPA 4KCDA 1NNPA 1LAFE 1FBHA 5I2KB 2XD3A 3O66A 2D0UA 3V83A 1SW2A 1N04A 4H45A 4PK5A 5L3GB 2RCBA 4TQUQ 4O7IA 3VDFA 4CN4A 4PGPA 3T1BA 5ET5A 5JDMA 2F7BA 2F5XA 4P1LA 1A8FA 3C9HA 5IYZE 1IQ7A 3PTYA 4NF5A 2VOZA 5LOVE 4PFWA 3RT6B 3PUVE 4H0WA 4PAGA 3ZMSB 4OFZA 5B70A 5LJMA 3HFUA 3LBSA 4DI4B 2Q8JA 3UU5A 5LG4A 1A55A 3UQ7A 4N17A 4NF8B 3MKDA 4P0GA 1H76A 4P56A 5JDHA 4IIJE 1OEDB 2DOJA 2LKHA 1OLAA 3AE3A 1NENA 1JP4A 1JW5A 4I3YA 3VLUA 1MPCA 2XXXA 3AEAA 3FZMB 3AEGA 5JR9B 2B76A 2OLBA 4CXYA 3K3NA 4EV6A 4BDOA 1PB9A 4GRKA 5AA2B 4AQ4A 3ZMUB 5KXJA 1TWYA 2EHOC 4EQ7A 3TTLA 5ABHA 2C0SA 4H9SE 1MG1A 5H8NB 1B0HA 1XWMA 4X9TA 4PGNA 3CIRA 3N9QA 2QA7A 3RYHE 2FHYA 4I50E 4WYVA 2HPJA 3AE4A 4CI2B 2PJQA 1SDXA 4OZ9A 5ETWA 3SESA 4ZS9A 1JVXA 4QHQA 3NVOA 2XJ7A 2V7IA 1VCSA 3B5MA 2DWGA 4FJOA 1FPFA 3GN5B 4ZI3C 2H7VC 3LUZA 3OO9A 2K48A 2X9YA 3Q9DA 2I58A 1HSJA 2UUAT 2LEHA 4N07A 1UGOA 4ZI7E 2O68A 5HEOA 5JTGA 3IOTA 4BJNA 3CK6A 3RY3A 3MAMA 1LBCA 3LK3B 2RC7A 3PD9A 3ZJ2A 4MHFA 4MLVA 3JAFA 4TOZA 5LGUB 5IM2A 4DVDA 5BWJA 2QJEA 4AKIA 3FHNA 3PPPA 2F78A 2C5KT 2KSRA 1N0TA 2QVUA 2PCRA 2R6GE 1PC3A 2ZYMA 1U5PA 2DWIA 5JDFA 2ABHA 5EQ9A 4F3BA 3Q2MA 4DNDA 1YQ3A 4GWXA 1JEVA 3IJXB 4UACA 2UXAA 2SPCA 2CLYB 2GQ1A 3E08A 5LNKA 2YU2A 3BIHA 3AXFA 4RJZA 3DELB 2W00A 4F22A 5J16A 3T1HT 4LF8T 1KNZA 2Y7WA 3AE8A 2DWHA 1DTZA 5TPAB 3HV1A 4YSXA 3HKBE 2V93A 4GOTA 4UABA 2X7QA 5JTYA 3RPWA 4P3LA 4GKJT 3LFMA 4PFBA 3CSBA 1GV8A 2IMLA 2VVSA 2CEYA 2B3BA 2E0SA 2DVZA 3N94A 5H8FA 2Y5LA 4LMJA 4L0RA 2ODUA 2BG9B 4CI1B 1O63A 3TUSA 1VFDA 5LCYA 5ITOA 2WAUA 3E79A 5AQTB 3CG3A 3IX1A 3H06B 3RF1A 4U23A 1AJ3A 4C1TA 5FXXA 2F7CA 1Y1MA 2X26A 3K6VA 4NE4A 2HXRA 2MAWA 3KOTA 4MEVA 5DT6A 2GRVA 5A5LA 4U7IA 1HX1B 4IL4A 4CZZB 2OV9A 4PFYA 4QWNB 1A40A 5L2LA 4DV7T 1LB9A 2Z23A 2A3DA 2CBIA 1NI9A 1MY0A 4KHZF 2X9HA 2ZXTA 3FBLA 3M3KA 3TODA 1EZ9A 4KBMB 3RIUA 4AQGA 2I3WA 4R9FA 4GIWA 2ONKE 1FTAA 4YFSA 1WYBA 2JJ9A 4H65A 3JV9A 4N15A 2VHAA 3HSTA 3FXBA 3PUYF 5F5WA 4WNKA 3CFXA 1OIBA 1JW1A 2EHOD 2QFLA 2THIA 3PPQA 3FBZA 4QSCA 3SZPA 3KBRA 4PNIA 4QSDA 1LSTA 4X66T 2HH7A 1IEJA 1MMAA 4PDHA 2QMWA 1L0VA 4P9KA 5KDTA 1IAPA 4F3SA 1YTVA 1N7WA 4O2BE 3TLTA 4GLIA 1UURA 1US5A 4P0AA 2XQAA 5I84A 2VD3A 4ZI3D 1FPBA 3O6GA 5FL1A 1R6ZA 4P47A 1VE4A 2BVLA 4NIQA 2AIXA 4OERA 5LJNA 2B3FA 3ZKKA 2V5CA 4B6XA 2DL1A 1PB7A 1D9VA 4U7YA 3K6UA 3PUWF 4P1EA 3W9VA 2XAJB 3RYIE 5LGTB 1XNRT 1KNRA 2PFYA 4HCYA 3ONJA 3LV0A 4DUZT 5AA4A 4O94A 4PBQA 2NVUB 2V3TA 5LHHB 2H99A 3VXBA 2LAOA 2BKPA 2JQHA 3OBVE 5JREA 3FVNA 5L3DB 2I4BA 3WAKA 2XX8A 4OEVA 3V5SA 2IC9A 4JXIA 4EQBA 2UXXB 3RX6A 4ND9A 4BLAA 1XOCA 3MPKA 1LBBA 4NWCA 3N9MA 2VURA 1A8EA 2V6YA 2XXRA 3MZKB 4UVBB 3H3AA 4EAHA 4OX9T 2F3DA 4PJJA 4G68A 1XVXA 1QVSA 3BKIB 5FBPA 2P0SA 2I0CA 2XTLA 2CM0A 3ZMTB 2PT1A 2OJTA 4IE7A 5B7DA 1JEUA 4OFOA 2REGA 4LF6T 2OK2A 3IF8B 1E7PA 2HZKA 2IHR1 1JNZA 4ZI2D 3O1HA 3Q27A 3UIFA 4LP2B 3MVWA 2F7AA 3TCGA 3VR8A 5ESYA 1FJ6A 4NUUA 4R72A 4YB7A 4U22A 1BR1A 1BR2A 3H6TA 2KT9A 4JWXA 2LOPA 3K6XA 5EQ8A 1FSAA 5ITPA 4XIGQ 2QVVA 1NNFA 2Y5KA 3RGYA 1FPLA 2W63A 3MWBA 1U4QA 2CHNA 2E8IA 1VDWA 1A54A 4IDOA 3EDUA 1RDZA 4JWYA 4QXBB 4MF3A 2YEVC 4X5TA 5IKBA 2E9XD 1Z8UA 2XZEA 5FY7A 3IO4A 2ZLYA 3PMXA 3MZ1A 4MBPA 3H37A 1B7UA 1N76A 5EYFA 3A29A 4N81A 4P11A 3C34A 4OVQA 1NV4A 3ZYLA 3I0OA 2XQ7A 3UA8A 4CQIA 4GK0E 3QUFA 3C31A 3TPAA 3CRBA 1Y1ZA 4LZ5A 3U72A 2BS3A 2JMHA 2HAUA 3GMIA 1ZTYA 1EYIA 4BDQA 4H1XA 1AL3A 2HFBA 5LA6E 2XXQA 4K0UA 2I4CA 2XAHB 1II5A 5C3JA 5JVDE 3EF7A 1OVBA 2YU1A 4GX6A 2B4LA 2UXCT 4G77A 1NV2A 3VFJA 2Y6XA 1RYOA 5FHNA 3K1PA 4MJOA 2OWSA 2XX7A 1ZP0A 4MMPA 4NGUA 3KINB 4L9IA 4PK4A 3ZEFB 3HKEE 1IXGA 3BFUA 4DXBA 3O9PA 1LVFA 1IBMT 4KCCA 2L3LA 5HCJA 4R6HA 3W9WA 2MPKA 4JI7T 3P4WA 2V84A 4PQJA 4TNVA 4MHCA 3MXZA 4KR5A 2XXTA 4MFIA 4DV4T 4JYAT 2PYYA 2H25A 4DR6T 2RKMA 4MFRA 4OK0A 4OHFA 3P4QA 1EYJA 1IZ1A 4ECFA 2VQET 1DBZA 4PE5B 5LDZA 1D0ZA 1OQHA 4JVDA 4NN3A 4R74A 4UEMA 1M7KA 2F97A 4ELPA 3SKPA 4GWZA 2I0MA 3IFCA 4TZ4C 2HHMA 2KQZA 4RA1A 3PU3A 1ANFA 5HXCA 2XQ3A 2V6YB 2XHEB 2LKGA 3PURA 4WKMA 4JLEA 3OOAA 4G68B 4CI3B 1FPKA 3RC8A 2HZLA 4G2AA 1TFAA 1Y4CA 1NWMX 3FD3A 1W09A 2UVHA 1B3LA 3A3CA 3JAEA 3R84B 2HAVA 3Q5WA 3ZPOA 3B6WA 4JVCA 3CIJA 1K9YA 2BG9C 4LVQA 4QRZA 5L9OA 1D9QA 2ZZVA 2M67A 5EYGA 2WS3A 3GBBA 2GHBA 3AA6B 2X0LB 2XHDA 3EKIA 4I62A 4DZ1A 3RLFF 3OTOT 1D1AA 1UX5A 3VU7H 3DLNA 1M62A 3K3OA 2C5IT 3MQ9A 1ZV4X 2A5SA 5DVIA 3W15B 5LMUT 5E0OA 2XXHA 1MMDA 5LB7B 1FW0A 3ZC1A 1OQGA 1KWHA 3FXEB 4OYVA 3LR1A 4EOZB 3MZBA 3IOVA 4N8GA 1DMBA 1POY1 4YLHA 1QUKA 2BJJX 4GWWA 3KSXA 3T93B 3G7WA 3WAEA 1MY4A 2UVJA 4QKNA 4U2ZA 4Q25A 2Z8EA 3OVUA 1N33T 1M5FA 4F31B 5BR8T 2FBPA 3TKLB 5AA2D 3GBAA 5IGAA 3TMGA 4OQOA 5HXRA 1T7SA 3UGWA 3I0QA 3O4XE 1K9ZA 3ZT5A 2XXUA 4GBVA 2P9BA 4PJNA 4XFEA 5L4HA 1MQJA 5CI5A 3NKZA 4EB6E 5EHSA 1MXVA 1AIVA 1MQGA 2X0HA 2F6PA 4M4GA 3UTKA 1SI1A 3ZC0A 1MMNA 1ZU0A 1NAFA 2CCQA 4UVAB 3F57A 3FGSA 3KOSA 1UCUA 2VL8A 4YTPA 3R6UA 4PK6A 1X79A 1EZ3A 4YSYA 5JRCA 3IB1A 4DV2T 3C4MA 4G8NA 2XA5A 4KI0E 4X8RA 5L3FB 4U4XA 4Q5TA 4I1DA 1TT1A 4YHJA 2CZIA 3TLVA 5FHMA 4AKLA 2BBJA 4IE0A 3P50A 1LBZA 3FV1A 3PDYA 3ZCIA 2ZMAA 4O4IE 2UVGA 2Z8DA 5IZ3B 3KSJA 2WYPA 3FBPA 2WP9A 3UUXB 2NOXA 4C0RA 3FXRA 4ZZCA 2ZZXA 3DJBA 1N84A 1B2HA 1S9TA 2V25A 1FQCA 2WBDA 2X7PA 2XQ6A 2LOSA 1L5TA 2BVMA 4TWFA 2CEXA 1O7TA 2D9DA 3UULA 5DJQC 2FUPA 3RHWA 3MP1A 3RGLA 1LCFA 4E7ZA 4PBHA 2DXRA 4N6PA 3EPEA 3TTRA 2UUCT 3AAIA 3TTNA 3OPCA 4HFIA 1NL5A 1HG5A 4HXVA 4JI4T 2LT3A 3TZAA 2YLNA 3VKHA 4JI1T 2VPOA 3K1NA 2BS4A 4U1ZA 1IIWA 3GWHA 2CWOA 3RPUA 2IEEA 5I2NB 3VXCA 1FTLA 1Z7NE 3GXAA 1HNZT 2CZHA 5CMBA 1N34T 2XUEA 2F8DA 4FI5A 4IE5A 3PJAJ 3GYYA 1QUUA 1MXXA 2RC9A 3H3GA 3SEVA 4CN1A 5ABEA 3IO6A 4I8CA 3QMFA 2XXYA 4PDDA 3H3MA 3C64A 4BAYB 2JIWA 3KN8A 3OD7A 4IDNA 1FPIA 2L5VA 4ELQA 4H63V 1P99A 4NF4A 4OVPA 3P4RA 3ZT7A 4YSZA 1NFTA 5AE4A 1IJ6A 3BQIA 2O51A 1B7HA 3EDVA 2GK9A 3A09A 2WMOA 2UYEA 4IO5A 3NZPA 2AE9A 3AAEB 3J9X1 1XVYA 2X67A 2I49A 4GIZA 1J1JA 4HE2A 3T9HB 5EQ7A 1LFHA 5ABFA 1T8BA 1MNEA 1UUSA 2WZHA 3ANWB 4QXHB 5JDGA 4KHZE 1KNPA 2E1SA 4Z0IA 4DI3D 1D1CA 2CXDA 4DMWA 2JJKA 2K5BB 5M2VA 1N32T 3T96B 4HWCA 2FA7A 2UYFA 2O7UA 2L8KA 2KINB 3T0JA 4IO4A 1HFAA 3N2GE 4F1VA 3B13A 1P1OA 1FQAA 3GA8A 5AQHB 5I59A 1W9RA 3BBRA 4XTCQ 3RYDA 5DVJA 1NV3A 2ZM6T 3S4UA 1ZKEA 4XF5A 1T98A 2WM9A 4FBPA 4DR3T 4A98A 2F4VT 5GONE 4JEUB 1NH7A 3IB2A 1S7YA 1N3WA 1ELJA 2XWOA 3AB3B 1VR5A 2QRXA 2JQQA 3C98B 2FJEA 4YHHT 2HEUA 5L3CB 3GZGA 1MPBA 2E5VA 3MSTA 2OLTA 3C33A 3G3HA 1LBYA 3V8XB 3ZSSA 2WWVA 3ONLC 5HAXA 2HN1A 1ZBMA 1BKAA 2XXKA 1HF8A 2UXNB 3DP4A 5EQAA 5TP9B 2DE4A 2H88A 1N36T 3RIFA 3ISPA 4HKAA 2P2AA 4E0XA 4UA8A 3UU4A 3P4PA 4AB5A 4AI6A 4PFUA 2V7LA 2QRYA 3OKQA 4TWHA 4ESWA 2LM2A 4RY1A 1SW1A 3PUGA 4MLQA 2RF1A 2ZM8A 2D5WA 1KF6A 4XKRA 1FPDA 1YQ4A 2ONRA 5KMGP 3SWHA 3OXNA 3O6HA 2Q9QB 1DK4A 3ZCJA 2CPTA 2CMOA 2XM2A 3RC3A 1UX4A 3CVRA 2M6BA 2QS1A 5EK3A 5A1LA 2ZYKA 4OWDA 2B4MA 4JUYA 3K1MA 1J5WA 4I40A 4O4HE 2BBHA 5M4YA 1DSNA 2DYXA 4DR5T 3ZYMA 2XXVA 3HKCE 1RKMA 4BDMA 5CA0E 5JQGE 3O28A 1B4ZA 4KXPA 3EHUA 4I9DA 4F1YA 4R75A 5KCJB 3LSWA 4PFTA 3FIRA 4AQYT 2YPNA 3FV2A 5ET8A 4GWSA 3S9EA 5J0ZA 1SQYA 4EDPA 3HN0A 3T66A 4MCOA 3UK4A 3T1YT 2XX9A 4UXNB 2PBWA 1YYZA 1D9YA 3JC6D 4IB2A 4EXLA 3S9LC 4EF2A 2JQKA 3T9UA 4ONYA 4LZ8A 3IJOB 4AKRB 3VRBA 4DV5T 4NF6A 4OTEA 4DUYT 3NOHA 4GL8A 2Q2CA 4OFJA 4JI0T 2XD2A 3M65A 2D21A 4R2FA 5FXWA 5L3BB 4C91A 1XHYA 1IMAA 3K00A 2GFEA 5CM6A 4XKPA 4K3FA 3LC8A 2VGQA 4ZI2C 2I3VA 3ZSFA 1JNRA 1Y64B 4JDFA 1HSLA 4YTMA 1SW5A 1RYXA 4TUYE 1NUWA 3LK2B 2F3BA 2PVUA 4PJMA 2FIEA 3AVSA 1JNFA 3PD8A 4GWYA 5I59B 2IW5B 3M8UA 5LG3A 1MDP1 2HPLA 3KV9A 4NF5B 4LF7T 5FY0A 3HA4A 3RRWA 2DSFA 3L8RA 3FZHB 3RUMA 2BKNA 3AXJA 1B3EA 5FMNA 4NMYA 1FMVA 3R7XA 3CPZA 1B6HA 2DXYA 2XAQB 3IA3A 4NHBA 1FBCA 1IZNB 2RPAA 3KJ7A 2RCAA 2JQ9A
chains in the Genus database with same CATH topology
1HG2A 3UFEA 1LKXA 2P1SA 2E9XC 1Y3PA 5LBMA 4TV8E 3PUSA 4LQ2A 2DS9A 3OEMA 1Y9UA 2ZYOA 1MQIA 1H7CA 4IE6A 5CBSA 4H9OC 5EZYE 3BK9A 3N9NA 3E9XA 3FB2A 2KLFA 3VVEA 1MIYA 1OMPA 1B58A 2VKJA 2VKDA 2I0BA 2A72A 2DWKA 4H5FA 2VASA 2XASB 3FXQA 4XKQA 4X20E 3HO7A 5DQVA 2VP1A 1YCJA 5L8DA 3P8CD 4OETA 2A5TA 4O3CA 2N2NA 4A56A 2QS4A 1G73A 1LRZA 4IY6A 4KUMB 1GR2A 3KV6A 3MVXA 1OVTA 5AA3A 4EYYR 1R9LA 3KN3A 2CE7A 4WBNE 4TV9E 2JPFA 4DCXA 2J1DG 3U1OA 3MP6A 2N9DA 1MDQA 4QFKA 2ZM2A 5JDQA 4TLLB 3SDFA 5H8SA 3OEKA 5F7VA 3ZN0B 1OWAA 1P1NA 1WR6A 4POXA 1EZOA 1LLSA 1SVXB 2NUVA 3JZJA 2WKYA 3G3GA 2LE8A 3RLFE 2KMFA 1B32A 2CWYA 4X1YE 4ZEBA 3CX6B 2F6GA 2EHOA 2LSIA 3LG7A 4OESA 4JSDA 4NF6B 2F34A 1D3KA 1D0XA 3CQGB 3IEEA 1Q35A 1LGBC 3MVZA 4FEDA 5JTYB 2RP4A 3PE0A 1FCKA 3C50A 2Q89A 2Z8FA 1YD8G 1ZIUA 5H8FB 4U74A 3QC9A 1FQBA 4CXXA 4U72A 1BR4A 1SA0E 2DP8A 2DE2A 5TU0A 5DYHA 2ESNA 3IOWA 5I57A 3C4WA 4ZZAA 1H45A 4Q30B 3TTMA 4YKPA 3CKDA 1FQDA 4I4TE 1MY1A 2ZNUA 1B40A 4IO2A 4ERRA 4QFNA 1GTKA 3B6TA 4H8IA 5J2TE 4ELRA 3IR1A 5JR9C 4MBQA 2LM9A 3ZMZB 5H6QB 2VKOA 3MK7C 3SEWA 1POTA 4GYSA 1B3HA 3I3VA 4WEDA 1MS7A 1XS5A 1H44A 2LHNA 4AQFC 5DTBA 2W61A 5FTIA 3KFWX 3DP7A 4H9PC 4FORA 1LFIA 3ESLA 3WAJA 5BMVE 3HR0A 3OELA 1Q1KA 3N9LA 3BQKA 5KDTB 4Z7EA 4GF8A 2Q9QC 3E4RA 5I56A 4DBQA 3AA0B 1US4A 5LGNB 2XXIA 4GQOA 4G8HA 5H8QA 4OYKA 4H63H 4YMAA 4FAJA 3MBPA 3CX8B 3SEUA 3ZN1B 3R6NA 1ZKBA 1B5IA 5FYMA 4OVJA 5BUUA 1WLXA 1MY3A 5HM4B 1Y4TA 3GLBA 1D1BA 5HWXA 4R6KA 2O69A 4ZEKA 4LUBA 4F6RC 3ZMVB 2B1EA 5AA4B 3UUMA 3I5OA 1MIVA 2IC6A 3VHLA 1HX8A 3I1AA 4OHNA 5HBCA 5HXEA 5LHIB 2E9XA 4EUOA 4H9NC 3CQXC 2X66A 5DEXA 1UTBA 2CLYC 1PDAA 3N6UA 2M8CA 1P1WA 4ADZA 4C90A 5IAIA 1MXWA 1S50A 3U94A 1LB8A 5HYAA 3OJAA 4KP3C 3TELA 4HEAA 1IJ5A 4HW8A 2D0TA 1BTJA 3N2OA 3FZVA 4FEBA 4ZZEA 2PT2A 3CQCB 2Q88A 4DIGA 3SOLA 5DQWA 4ESXA 1EZPA 2NW8A 4U4SA 4XBFB 3UN6A 2FYIA 1DPPA 4OXVA 3N9OA 5HPQA 2Y7IA 3MUQA 5J1DA 1Z7ME 2XXWA 5FXZA 1LAXA 2HQ0A 4PFOA 3U93A 4UF0A 3TEPA 4MALA 4KFQA 1JETA 3V89B 2DLRA 3T8OA 4DMVA 2XQYA 3PMWA 2V1DB 3LUYA 2W62A 3CFLA 2V7KA 2KZ7B 1T0KA 3Q5XA 4Q8RA 2NTXA 4U21A 4HN9A 4BJMA 3SETA 3CMLA 3FVOA 4YMBA 3O2AA 2O6AA 3D0TA 4GK5E 2DWAA 3AA1B 1UTHA 2REJA 2ZMBA 3B7DA 2DQVA 4FJPA 1CE2A 3CSGA 4DE8A 4QX8B 2VK9A 4BA9A 5LXTE 3USDA 5I2KA 2ES0A 4L5GA 3OO8A 4H5GA 5ISUA 3SS1A 3K2DA 4RYAA 2NW7A 2OZZA 1FIOA 4I43B 4J2CA 2Q9QD 2ODVA 4AKGA 4NUVA 2ZM0A 3FJGA 2XAFB 5F1QA 2Q2AA 3PMVA 3VLWA 2Y48B 4P09A 4MH5A 1WRDA 4X1DA 3IHRA 1LAGE 4ZEDA 4XZCA 1EU8A 3LBXA 4NF8A 3CVGA 3S2VA 5LOMA 4RPNA 3RYCE 3V5UA 3LSFB 3BQLA 2YJPA 3QUJA 2CEAA 2CA5A 1H43A 3K6WA 4TN7B 1YKEB 5LBQB 5AA2A 3A3UA 5AA1A 3C4ZA 5ICQA 5H8NA 4Q0CA 4BDNA 3B6QA 4KQPA 1I69A 3L09A 4M1VA 2VB6A 1BR0A 2D5UA 1NNKA 1QULA 4F3PA 1B46A 1Y3NA 4G8MA 1R1NA 4DCYA 3CFZA 4X1IE 3UP9A 3O1JA 3GN5A 3O9XA 4YU0A 2GH9A 3I9YA 1KK7A 4IO3A 2MYSA 4O3BA 3VE1B 3TTKA 1Y20A 2YINA 4IY5A 5KZTA 1P1UA 1MXUA 4N78D 4PFPA 3JC6C 1B4HA 3HCQA 1VOMA 1SI0A 2AYSA 4IHJE 3KJTA 4KMCA 2I59A 1NH8A 3RN8A 1HCIA 3SERA 1F9BA 3O1IA 4RK9A 4M1PA 4ZECA 1V9DA 3N9PA 1B9JA 4R6YA 4AB6A 1DTGA 2CZLA 2G93A 3EHSA 3ONXA 1UIUA 2LSGA 3RRCA 2O1MA 3S9NC 3PUYE 2QGSA 3K3QC 2DWJA 5EK4A 4EXTA 4EZHA 3O29A 4EXKA 1MMGA 4QXCB 1GGGA 3DP8A 2NTYA 3EQ1A 3OO6A 2BZBA 2FNCA 5TPAA 2R71A 3IOUA 3MP8A 1USYE 1B0LA 2OBGA 1VFEA 5J2UE 5JRCB 3E0ZA 2O84X 4UELA 3KVAA 3PUAA 4YJ3E 2HCAA 3TDJA 3UUNA 4AXPA 2A2FX 2LHRA 4EIWA 4LA9A 3NRXA 4UIGA 4OFLA 2NXOA 2ONSA 3LBXB 4FE8A 1S94A 4TX5A 3PUWE 2WSSV 5FNVE 4HE8A 3E22E 4HCWA 3KGCA 3H4ZA 4R73A 2G0UA 3LSLA 5HXHA 2XAGB 2MTQA 3K8PC 1DPEA 4KYEA 3N2KE 2H5YA 3RTFB 5JH7E 3AA7B 4LZ7A 2X9XA 3T9VA 3TQWA 3F31A 3FJ7A 4G68C 4OENA 1MH4A 2AL5A 4ZE8A 5JEIA 4X1BA 3FVGA 1B52A 4X48A 5K2XA 3C32A 3KV5A 1URGA 1US7B 4ZHQE 1LFGA 5ADXL 3HHFA 4X1KE 1HSEA 3KG2A 3ZYKA 1FTJA 4JB7A 2Z22A 3L6HA 2O1LA 2VD2A 3ETUA 2Q9TA 3Q29A 4BDRA 3W15C 3UORA 4NF4B 4F39A 4GFRA 4E7SA 2Y7KA 5H8HA 4ISTA 4XKNA 2NW9A 3I9WA 4EZ4A 2O7IA 1R9QA 1XT8A 3OENA 4WEPA 4UVCB 1I6AA 4O8SA 3TYHA 4NEDA 4ISSA 3T22A 2W7YA 3TCHA 5CRYA 3C4XA 2H7OA 1ATGA 1QJMA 3PV0E 1CUNA 4KYDA 1ZHCA 3H03A 1HTJF 4KYSA 2VKHA 4DDDA 3H6VA 2AL4A 3VLVA 1A99A 4RXLA 2V3UA 3MJXA 3MVYA 1EH3A 1FEWA 5C8YE 4DXUA 1AMFA 1VSOA 3KEIA 1BIYA 3ZJ1A 3CG1A 2OA5A 3O6IA 3IBPA 2DVCA 2K24A 3VV5A 3Q28A 3CWZB 1M5EA 3PUXE 4HGAA 4BDLA 3Q26A 4ELOA 3MA9A 4JEHB 5CB4E 3KDSE 1NMUA 4QF9A 3HI2A 2Y8DA 4WW0A 2LSYA 1HS7A 1B1HA 1MM7A 2QSXA 2WMNA 3RKOA 4QSEA 1MPDA 5FTHA 1ZJLA 4PJLA 3D4GA 1VRBA 3C51A 1B51A 4QFLA 3EUHA 3J7Yq 4YKKA 4NWDA 3CI8A 4KPTA 4EQ9A 1S35A 4F19A 3FASA 1IXCA 3IL1B 4HTEA 1WODA 2MOZA 4EYUA 1BP5A 2H98A 3VVDA 4O2AE 1TFDA 5KDMC 1I6QA 5HXSA 4DLDA 1G8XA 4JBZA 3RH3A 1M5CA 1B7TA 1SYIA 5KX5E 4F18A 5J1GA 4DXCA 2F35A 3ZLIA 4QFPA 1B1XA 3K01A 4THIA 4IO7A 4RNSA 2NWJA 3KFMA 3AAAB 3HKDE 1B5HA 3TFLA 4YKJA 4ZE9A 1IITA 3THIA 2K9AA 4PETA 3CX7B 4Z8XA 2D2SA 4POWA 2H3RA 2YK0A 5I58A 3O97A 2IAKA 4XXUA 3FATA 3G3KA 1B7ZA 3AVRA 5ELVA 2KLQA 3G3JA 2VWAA 4O4JE 4F2QA 1IUDA 2LJLA 2PG8A 1MQDA 2C5JA 4WXJA 3IK6B 3KBUA 2PBIA 5H8HB 3P7IA 2V26A 2LSJA 2ZNTA 2RINA 3FXDB 1ZMGA 3U8QA 1Z0PA 1FTKA 4UV9B 3RTWB 3M3LA 2MBGA 4FATA 2F36A 4GXAA 4G63A 5JK4A 4R9GA 4IDZA 1MXZA 1I6BA 5CMKA 3IORA 1MXYA 3QAXA 4P0BA 4QFOA 1MY2A 4WBOA 3V5AA 3QSLA 3RQTA 1B3GA 4GOUA 4H6DA 3TQLA 1UIVA 3OYXA 1PB8A 1YKHB 5F8PA 2D3IA 1YPNA 1WDNA 4FIMA 3WAFA 2UVIA 4LONB 3U92A 1SW4A 1SYHA 5EHMA 3KVBA 3S9MC 2IA4A 1NNTA 3ECRA 3DP6A 3D4CA 2JRKA 3QYTA 3QK6A 2V7MA 2WBLA 1Y3QA 3NBXX 5AFUL 4ZEIA 1DOTA 4LATA 3ETVA 4F1UA 2H9BA 1TXFA 3EHTA 3ZS6A 3PU8A 1XC1A 4H8JA 1LAHE 3SEYA 2JMKA 3TCFA 4IGTA 4RPOA 2V3QA 5DVFA 1SD3A 4OEUA 1GVCA 3N6TA 2X51A 3H7MA 1JVYA 3G3FA 1AH5A 1NKXA 2OWTA 3KZGA 4L17A 2CXFA 3I6VA 1B05A 1OLCA 5DABA 2A5TB 3PPRA 4JSOA 1FTOA 4HS7A 3QIMA 3VKGA 1N3XA 2DCFA 3U78A 2Z6EA 4OYJA 2QS3A 2N1GA 2ANJA 3RNNA 4RK2A 1LVKA 3ILUB 3MPLA 2ZYNA 2HXWA 3UT5E 2KNDA 3H6WA 2NOOA 4NTLA 3HL6A 3C36A 4F3GA 3E3KA 3Q25A 1D0YA 4QX7B 5I58B 3WI3A 2W0GA 3ILTB 2LSKA 1URSA 2QS2A 2R9JA 3M3FA 1YAEA 3MZ9A 2DI4A 3PPOA 2EHOB 4EF1A 4R2BA 2DHRA 2PFVA 5FXVA 2PX1A 5L9MA 3MACA 4GWOA 3PTRB 1FTMA 4C1UA 2L9QA 4YB5A 3PUZE 4JWOA 4H9QC 3OO7A 4G2ZA 4LQ5A 3EN3A 5CMMA 4ISUA 1WVJA 2KWHA 3NRYA 4F2OA 3DTOA 3L6GA 3PPNA 5H6RB 1N7XA 3B57A 1WYCA 3IB0A 4HFVA 5HWYA 1M5DA 3N26A 1URDA 5I57B 3OMBA 2QPQA 1QKAA 2WWUA 4GL0A 5L9SA 5I2NA 1ZLQA 3FVKA 3MJNA 1CB6A 1AOVA 1A7LA 4ZS3A 5TAOA 2Y84A 5CA1E 4QHOA 4OMBA 3HPIA 5IHYA 4PP0A 5A5XA 4MLKA 2X68A 1BLFA 3MW0A 2I48A 4V1Av 1P1QA 2Y7PA 3PUQA 4FECA 1MQHA 3LSXA 2G29A 2Y7RA 1O3XA 4N13A 4IGRA 1ZEEA 4KD5A 2CXLA 3OYZA 2B65A 3ANWA 3OSQA 4U2RA 1UQWA 1H3DA 1SBPA 5LP6E 2V7JA 1B3FA 1USYH 1QUIA 5I56B 3U3IA 1LCTA 3N5LA 2X9WA 1SHZC 2CMRA 4O4LE 5H8QB 3MC2A 3PU5A 5FY1A 3EVYA 1QKBA 3CR9A 3K02A 2I6EA 3HHGA 3L3PA 4ASKA 3NZQA 4GD5A 4ANJA 3BFTA 3TKDA 3LK42 1MH3A 2RA1A 4IO6A 4GXSB 1MIWA 3A5XA 4YZZA 5K2YA 3ONMA 2KXPB 2ZNSA 5ICTA 1E1HB 5JDLA 3PGFA 5JR9A 3KV4A 4AKHA 4I55E 2E9XB 4CXWA 1QW0A 1O64A 2RC8A 3QXMA 3VVFA 4HTGA 5DEXB 4AQFA 5EK2A 5CMCA 2NP9A 1UTBB 5TP9A 4DO0A 3KN7A 4TLMB 3R26A 1QUJA 4ILUA 2KWIB 4IE4A 1M5BA 3FUZA 3SEXA 1MNDA 3FXUA 3OSRA 1JW4A 3RT8A 1D4NA 3G3IA 4YB6A 3JYRA 2NWBA 5F3JA 3F11A 3DM0A 3IAZA 3ODBA 2QMXA 4YJ2E 2Q9QA 4YICA 3FJMA 4F29A 5L3EB 1PBPA 4H67A 3SRZA 4YAHX 2PMSA 3TAJA 1FQFA 2DE3A 3E13X 2DNXA 1IXIA 1FQEA 4E0WA 3LJCA 4ZDMA 3F2EA 3T9XB 3H6UA 3ZKLA 1JQFA 1YW0A 4XAXB 5LHGB 2GHAA 5KCJA 3RYFE 4UF0B 4PW8A 4ZS2A 1IXHA 2OCUA 4H9RC 1J1NA 1MM6A 2QL3A 4G4PA 4YKIA 5FHOA 3K0VA 3K4UA 5LYJE 1PEBA 4GVOA 1MRPA 2H4IA 4O3AA 4ZEFA 2ACXA 1B5JA 5A5XB 5CBRA 1FMWA 2BDEA 1PBQA 5CC2A 2ALUA 5FP3A 3C35A 5JDNA 4DBRA 4UV8B 4ZOLE 3KBTA 1QSDA 4IGUA 4P0IA 1OXZA 4GYRA 4U1OA 1UTHB 2XXPA 4KCDA 1NNPA 1LAFE 5I2KB 2XD3A 3O66A 2D0UA 3V83A 1SW2A 1N04A 4PK5A 5L3GB 2RCBA 4TQUQ 3VDFA 5JDMA 2F7BA 2F5XA 1A8FA 3C9HA 5IYZE 1IQ7A 4NF5A 2VOZA 5LOVE 4PFWA 3RT6B 3PUVE 4H0WA 4PAGA 3ZMSB 4OFZA 5B70A 5LJMA 3LBSA 2Q8JA 5LG4A 4P0GA 1A55A 4NF8B 3MKDA 1H76A 5JDHA 4IIJE 2DOJA 1OLAA 1JW5A 3VLUA 1MPCA 2XXXA 5JR9B 2OLBA 4CXYA 3K3NA 4BDOA 1PB9A 4GRKA 5AA2B 4AQ4A 3ZMUB 1TWYA 2EHOC 4EQ7A 3TTLA 2C0SA 4H9SE 1MG1A 5H8NB 1B0HA 4X9TA 3N9QA 2QA7A 3RYHE 4I50E 4CI2B 2HPJA 1SDXA 4OZ9A 2PJQA 3SESA 5ETWA 4ZS9A 1JVXA 4QHQA 2V7IA 2DWGA 4FJOA 3GN5B 4ZI3C 2H7VC 3OO9A 2K48A 2X9YA 3Q9DA 2I58A 1HSJA 2LEHA 4N07A 4ZI7E 2O68A 3IOTA 4BJNA 3RY3A 3MAMA 1LBCA 3LK3B 2RC7A 3PD9A 3ZJ2A 4MLVA 4TOZA 5LGUB 4DVDA 5BWJA 2QJEA 4AKIA 3FHNA 3PPPA 2F78A 2C5KT 1N0TA 2R6GE 1PC3A 2ZYMA 1U5PA 2DWIA 5JDFA 2ABHA 4F3BA 3Q2MA 4DNDA 1JEVA 3IJXB 4UACA 2UXAA 2SPCA 2CLYB 3E08A 5LNKA 2YU2A 3AXFA 4RJZA 3DELB 2W00A 4F22A 1KNZA 2Y7WA 2DWHA 1DTZA 5TPAB 3HV1A 2V93A 3HKBE 4GOTA 2X7QA 5JTYA 3RPWA 3LFMA 1GV8A 3CSBA 2B3BA 2E0SA 2DVZA 3N94A 5H8FA 4L0RA 2ODUA 4CI1B 1O63A 3TUSA 1VFDA 5LCYA 5ITOA 2WAUA 3CG3A 3IX1A 3H06B 4U23A 1AJ3A 4C1TA 5FXXA 2F7CA 1Y1MA 2X26A 3K6VA 4NE4A 3KOTA 5DT6A 2GRVA 4CZZB 4PFYA 4QWNB 1A40A 5L2LA 1LB9A 2Z23A 2A3DA 1MY0A 2X9HA 2ZXTA 3FBLA 3M3KA 3TODA 1EZ9A 4KBMB 4AQGA 2I3WA 4R9FA 4GIWA 2ONKE 4YFSA 1WYBA 2JJ9A 4H65A 3JV9A 2VHAA 3HSTA 4WNKA 3CFXA 1OIBA 1JW1A 2EHOD 2THIA 3PPQA 4QSCA 3FBZA 3KBRA 4PNIA 4QSDA 1LSTA 2HH7A 1IEJA 1MMAA 2QMWA 5KDTA 1IAPA 4F3SA 1YTVA 1N7WA 4O2BE 4GLIA 1US5A 4P0AA 5I84A 2VD3A 4ZI3D 3O6GA 1R6ZA 1VE4A 2BVLA 2AIXA 4OERA 5LJNA 2B3FA 3ZKKA 4B6XA 1PB7A 1D9VA 3K6UA 3W9VA 2XAJB 3RYIE 5LGTB 4HCYA 5AA4A 2NVUB 2V3TA 5LHHB 2H99A 3VXBA 2LAOA 3OBVE 5JREA 3FVNA 5L3DB 2I4BA 3WAKA 2XX8A 4OEVA 3V5SA 2IC9A 4JXIA 4EQBA 2UXXB 3RX6A 4ND9A 4BLAA 1XOCA 3MPKA 1LBBA 4NWCA 3N9MA 1A8EA 2XXRA 3MZKB 4UVBB 3H3AA 4EAHA 4PJJA 4G68A 1XVXA 1QVSA 3BKIB 2P0SA 2I0CA 2XTLA 2CM0A 3ZMTB 2PT1A 2OJTA 4IE7A 5B7DA 1JEUA 4OFOA 2REGA 2OK2A 3IF8B 2HZKA 4ZI2D 3O1HA 3Q27A 3UIFA 4LP2B 3MVWA 2F7AA 3TCGA 4NUUA 4R72A 4YB7A 4U22A 1BR1A 1BR2A 3H6TA 2KT9A 4JWXA 2LOPA 3K6XA 5ITPA 4XIGQ 1NNFA 3RGYA 2W63A 3MWBA 1U4QA 2E8IA 1A54A 3EDUA 4JWYA 4QXBB 4MF3A 2YEVC 5IKBA 2E9XD 5FY7A 3IO4A 2ZLYA 3PMXA 3MZ1A 4MBPA 3H37A 1B7UA 1N76A 5EYFA 4P11A 3C34A 3ZYLA 3I0OA 3UA8A 4CQIA 4GK0E 3QUFA 3C31A 3TPAA 3CRBA 1Y1ZA 4LZ5A 3U72A 2JMHA 2HAUA 3GMIA 1ZTYA 4BDQA 4H1XA 1AL3A 2HFBA 5LA6E 2XXQA 4K0UA 2I4CA 2XAHB 1II5A 5JVDE 3EF7A 1OVBA 2YU1A 4G77A 3VFJA 2Y6XA 1RYOA 5FHNA 3K1PA 2OWSA 2XX7A 3KINB 4L9IA 4PK4A 3ZEFB 3HKEE 1IXGA 3BFUA 4DXBA 3O9PA 1LVFA 4KCCA 2L3LA 4R6HA 3W9WA 2V84A 4PQJA 4MHCA 3MXZA 4KR5A 2XXTA 4MFIA 2PYYA 2H25A 2RKMA 4MFRA 4OK0A 4OHFA 1IZ1A 4ECFA 4PE5B 1D0ZA 1OQHA 4R74A 4UEMA 2F97A 4ELPA 3SKPA 4TZ4C 4RA1A 3PU3A 1ANFA 5HXCA 2XHEB 3PURA 4WKMA 4JLEA 3OOAA 4G68B 4CI3B 3RC8A 2HZLA 4G2AA 1TFAA 1Y4CA 1NWMX 3FD3A 2UVHA 1B3LA 3A3CA 3R84B 2HAVA 3Q5WA 3ZPOA 3B6WA 3CIJA 4LVQA 4QRZA 5L9OA 2M67A 3GBBA 2GHBA 3AA6B 2X0LB 2XHDA 4I62A 4DZ1A 1D1AA 1UX5A 3VU7H 3DLNA 3K3OA 2C5IT 3MQ9A 1ZV4X 2A5SA 5DVIA 3W15B 5E0OA 2XXHA 1MMDA 1FW0A 3ZC1A 1OQGA 1KWHA 3FXEB 4OYVA 3LR1A 4EOZB 3MZBA 3IOVA 1DMBA 1POY1 4YLHA 1QUKA 2BJJX 3KSXA 3T93B 3G7WA 3WAEA 1MY4A 2UVJA 4QKNA 2Z8EA 1M5FA 4F31B 5AA2D 3TKLB 3GBAA 3TMGA 4OQOA 5HXRA 3UGWA 3I0QA 3O4XE 2XXUA 2P9BA 4PJNA 1MQJA 5CI5A 4EB6E 5EHSA 1MXVA 1AIVA 1MQGA 2F6PA 4M4GA 3UTKA 1SI1A 3ZC0A 1MMNA 1ZU0A 1NAFA 2CCQA 4UVAB 3F57A 3FGSA 3KOSA 1UCUA 2VL8A 3R6UA 4PK6A 1X79A 1EZ3A 5JRCA 3IB1A 3C4MA 4G8NA 4KI0E 5L3FB 4U4XA 4Q5TA 4I1DA 1TT1A 4YHJA 5FHMA 4AKLA 4IE0A 3FV1A 3PDYA 3ZCIA 2ZMAA 4O4IE 2UVGA 2Z8DA 3KSJA 3UUXB 2NOXA 4C0RA 3FXRA 3DJBA 1N84A 1B2HA 1S9TA 2V25A 1FQCA 2X7PA 2LOSA 1L5TA 2BVMA 1O7TA 3UULA 5DJQC 3MP1A 1LCFA 4E7ZA 2DXRA 4N6PA 3EPEA 3TTRA 3AAIA 3TTNA 1NL5A 1HG5A 2LT3A 3TZAA 2YLNA 3VKHA 3K1NA 4U1ZA 1IIWA 3GWHA 2CWOA 3RPUA 2IEEA 5I2NB 3VXCA 1FTLA 1Z7NE 3GXAA 5CMBA 2XUEA 2F8DA 4FI5A 4IE5A 3SEVA 1QUUA 1MXXA 2RC9A 3H3GA 3IO6A 4I8CA 2XXYA 3C64A 4BAYB 3KN8A 3OD7A 4ELQA 4H63V 1P99A 4NF4A 1NFTA 5AE4A 1IJ6A 3BQIA 2O51A 1B7HA 3EDVA 2GK9A 3A09A 2WMOA 2UYEA 4IO5A 3NZPA 3AAEB 3J9X1 1XVYA 2X67A 2I49A 4GIZA 3T9HB 1LFHA 1MNEA 3ANWB 5JDGA 4QXHB 4KHZE 2E1SA 4Z0IA 1D1CA 2CXDA 4DMWA 2K5BB 5M2VA 3T96B 2FA7A 2UYFA 2O7UA 2L8KA 2KINB 4IO4A 1HFAA 3N2GE 4F1VA 3B13A 1P1OA 1FQAA 3GA8A 5I59A 3BBRA 4XTCQ 5DVJA 3S4UA 1ZKEA 1T98A 2WM9A 5GONE 4JEUB 1NH7A 3IB2A 1S7YA 1N3WA 1ELJA 3AB3B 1VR5A 2JQQA 3C98B 3GZGA 2HEUA 5L3CB 1MPBA 3C33A 3G3HA 3V8XB 5HAXA 1ZBMA 1BKAA 3DP4A 1HF8A 2UXNB 5TP9B 2DE4A 4HKAA 2P2AA 4E0XA 4UA8A 4AB5A 4AI6A 4PFUA 2V7LA 2QRYA 3OKQA 4ESWA 4RY1A 1SW1A 3PUGA 4MLQA 2RF1A 2ZM8A 2D5WA 4XKRA 2ONRA 5KMGP 3SWHA 3OXNA 3O6HA 2Q9QB 3ZCJA 2CMOA 3RC3A 1UX4A 3CVRA 2QS1A 5EK3A 5A1LA 2ZYKA 4OWDA 4JUYA 3K1MA 4O4HE 5M4YA 1DSNA 2DYXA 3ZYMA 2XXVA 3HKCE 1RKMA 4BDMA 5CA0E 5JQGE 3O28A 1B4ZA 3EHUA 4I9DA 4F1YA 4R75A 5KCJB 3LSWA 4PFTA 3FIRA 2YPNA 3FV2A 3S9EA 1SQYA 4EDPA 3HN0A 3T66A 3UK4A 2XX9A 2PBWA 4UXNB 1D9YA 3JC6D 4IB2A 4EXLA 3S9LC 4EF2A 3T9UA 4ONYA 4LZ8A 3IJOB 4AKRB 4NF6A 4OTEA 4GL8A 2Q2CA 4OFJA 2XD2A 3M65A 2D21A 4R2FA 5FXWA 5L3BB 4C91A 1XHYA 3K00A 2GFEA 5CM6A 4XKPA 4K3FA 3LC8A 2VGQA 4ZI2C 2I3VA 3ZSFA 1Y64B 4JDFA 1HSLA 1SW5A 1RYXA 4TUYE 3LK2B 2PVUA 4PJMA 3AVSA 1JNFA 3PD8A 5I59B 2IW5B 3M8UA 1MDP1 2HPLA 3KV9A 4NF5B 5FY0A 3HA4A 3RRWA 2DSFA 3RUMA 1B3EA 5FMNA 4NMYA 1FMVA 3R7XA 3CPZA 1B6HA 2DXYA 2XAQB 1IZNB 3KJ7A 2RCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1S A;  1Y3P A;  4LQ2 A;  2DS9 A;  3OEM A;  1Y9U A;  2ZYO A;  1MQI A;  1H7C A;  5CBS A;  3E9X A;  2KLF A;  3VVE A;  1B58 A;  1OMP A;  2I0B A;  4H5F A;  3FXQ A;  4XKQ A;  3HO7 A;  2VP1 A;  1YCJ A;  5L8D A;  4OET A;  2A5T A;  4O3C A;  2QS4 A;  1LRZ A;  4IY6 A;  1GR2 A;  3MVX A;  1OVT A;  5AA3 A;  4EYY R;  1R9L A;  3KN3 A;  4DCX A;  3U1O A;  3MP6 A;  1MDQ A;  4QFK A;  4TLL B;  3SDF A;  5H8S A;  3OEK A;  5F7V A;  1P1N A;  4POX A;  1EZO A;  1LLS A;  1SVX B;  2NUV A;  3JZJ A;  2WKY A;  3G3G A;  3RLF E;  1B32 A;  4ZEB A;  2F6G A;  4OES A;  4JSD A;  4NF6 B;  2F34 A;  1D3K A;  1Q35 A;  1LGB C;  3MVZ A;  4FED A;  5JTY B;  1FCK A;  2Q89 A;  2Z8F A;  1ZIU A;  5H8F B;  1FQB A;  2DP8 A;  2DE2 A;  5TU0 A;  5DYH A;  2ESN A;  3IOW A;  5I57 A;  4ZZA A;  1H45 A;  4Q30 B;  3TTM A;  4YKP A;  3CKD A;  1FQD A;  1MY1 A;  2ZNU A;  1B40 A;  4IO2 A;  4QFN A;  1GTK A;  3B6T A;  4H8I A;  4ELR A;  3IR1 A;  3SEW A;  1POT A;  4WED A;  1B3H A;  3I3V A;  1MS7 A;  1XS5 A;  1H44 A;  5DTB A;  5FTI A;  4FOR A;  1LFI A;  3OEL A;  1Q1K A;  5KDT B;  4Z7E A;  4GF8 A;  3E4R A;  5I56 A;  1US4 A;  2XXI A;  4GQO A;  4G8H A;  5H8Q A;  4YMA A;  4FAJ A;  3MBP A;  3SEU A;  1ZKB A;  1B5I A;  4OVJ A;  5BUU A;  1MY3 A;  5HM4 B;  1Y4T A;  3GLB A;  4R6K A;  2O69 A;  4ZEK A;  4LUB A;  5AA4 B;  3I5O A;  2IC6 A;  4OHN A;  5HBC A;  4EUO A;  5DEX A;  1UTB A;  1PDA A;  3N6U A;  2M8C A;  1P1W A;  5IAI A;  1MXW A;  1S50 A;  3U94 A;  1LB8 A;  3TEL A;  1IJ5 A;  4HW8 A;  1BTJ A;  3FZV A;  4FEB A;  4ZZE A;  2PT2 A;  2Q88 A;  4DIG A;  4ESX A;  1EZP A;  4U4S A;  3UN6 A;  2FYI A;  1DPP A;  4OXV A;  5HPQ A;  2Y7I A;  3MUQ A;  5J1D A;  1Z7M E;  2XXW A;  1LAX A;  2HQ0 A;  3U93 A;  3TEP A;  4KFQ A;  1JET A;  3V89 B;  3PMW A;  3LUY A;  3CFL A;  1T0K A;  4Q8R A;  4U21 A;  3SET A;  3FVO A;  4YMB A;  3O2A A;  2O6A A;  2DWA A;  1UTH A;  2REJ A;  2ZMB A;  3B7D A;  2DQV A;  4FJP A;  1CE2 A;  3CSG A;  4DE8 A;  5I2K A;  3USD A;  3OO8 A;  4H5G A;  5ISU A;  3K2D A;  4RYA A;  2OZZ A;  4J2C A;  3FJG A;  5F1Q A;  2Q2A A;  3PMV A;  3VLW A;  4MH5 A;  4X1D A;  1LAG E;  4ZED A;  1EU8 A;  4NF8 A;  3CVG A;  3S2V A;  5LOM A;  4RPN A;  3LSF B;  2YJP A;  3QUJ A;  2CA5 A;  1H43 A;  3K6W A;  5AA2 A;  3A3U A;  5AA1 A;  5ICQ A;  5H8N A;  4Q0C A;  4BDN A;  3B6Q A;  4KQP A;  1I69 A;  4M1V A;  1NNK A;  1QUL A;  4F3P A;  1B46 A;  1Y3N A;  4G8M A;  1R1N A;  4DCY A;  3CFZ A;  3UP9 A;  4YU0 A;  2GH9 A;  4IO3 A;  4O3B A;  3VE1 B;  3TTK A;  1Y20 A;  4IY5 A;  5KZT A;  1P1U A;  1MXU A;  1B4H A;  3HCQ A;  1SI0 A;  2AYS A;  3KJT A;  1NH8 A;  3RN8 A;  3SER A;  1F9B A;  4RK9 A;  4ZEC A;  1B9J A;  4R6Y A;  4AB6 A;  1DTG A;  2CZL A;  2G93 A;  3EHS A;  1UIU A;  2O1M A;  3S9N C;  3PUY E;  2DWJ A;  3O29 A;  4EXK A;  1GGG A;  3DP8 A;  3EQ1 A;  3OO6 A;  2FNC A;  5TPA A;  2R71 A;  3IOU A;  3MP8 A;  1USY E;  1B0L A;  2OBG A;  1VFE A;  3TDJ A;  2O84 X;  2HCA A;  4LA9 A;  4OFL A;  2NXO A;  2ONS A;  4FE8 A;  3PUW E;  4HCW A;  3KGC A;  3H4Z A;  4R73 A;  2G0U A;  3LSL A;  1DPE A;  4KYE A;  2H5Y A;  3RTF B;  4LZ7 A;  2X9X A;  3T9V A;  3TQW A;  3FJ7 A;  4G68 C;  4OEN A;  1MH4 A;  2AL5 A;  4ZE8 A;  5JEI A;  4X1B A;  3FVG A;  1B52 A;  4X48 A;  5K2X A;  3C32 A;  1URG A;  1LFG A;  3HHF A;  1HSE A;  3KG2 A;  1FTJ A;  4JB7 A;  2Z22 A;  3L6H A;  2O1L A;  2VD2 A;  2Q9T A;  3Q29 A;  4BDR A;  3W15 C;  3UOR A;  4NF4 B;  4F39 A;  4GFR A;  2Y7K A;  5H8H A;  4XKN A;  2O7I A;  1R9Q A;  1XT8 A;  3OEN A;  4WEP A;  1I6A A;  3TYH A;  4NED A;  3T22 A;  2W7Y A;  3TCH A;  5CRY A;  1ATG A;  1QJM A;  3PV0 E;  4KYD A;  3H03 A;  4KYS A;  4DDD A;  3H6V A;  2AL4 A;  3VLV A;  1A99 A;  4RXL A;  2V3U A;  3MVY A;  1EH3 A;  4DXU A;  1AMF A;  1VSO A;  3KEI A;  1BIY A;  3CG1 A;  3O6I A;  2DVC A;  3VV5 A;  3Q28 A;  1M5E A;  3PUX E;  4BDL A;  3Q26 A;  4ELO A;  1NMU A;  4QF9 A;  1MM7 A;  1B1H A;  2QSX A;  4QSE A;  1MPD A;  5FTH A;  1ZJL A;  3D4G A;  1B51 A;  4QFL A;  4YKK A;  4NWD A;  3CI8 A;  4KPT A;  4EQ9 A;  4F19 A;  3FAS A;  1IXC A;  3IL1 B;  1WOD A;  1BP5 A;  2H98 A;  3VVD A;  1TFD A;  1I6Q A;  4DLD A;  4JBZ A;  1M5C A;  1SYI A;  4F18 A;  4DXC A;  2F35 A;  4QFP A;  1B1X A;  3K01 A;  4THI A;  4IO7 A;  4RNS A;  2NWJ A;  3KFM A;  1B5H A;  3TFL A;  4YKJ A;  4ZE9 A;  1IIT A;  3THI A;  4PET A;  4POW A;  5I58 A;  3O97 A;  4XXU A;  3FAT A;  3G3K A;  1B7Z A;  5ELV A;  3G3J A;  4F2Q A;  1IUD A;  1MQD A;  4WXJ A;  2C5J A;  5H8H B;  3IK6 B;  3P7I A;  2ZNT A;  2RIN A;  3FXD B;  1ZMG A;  3U8Q A;  1Z0P A;  1FTK A;  3RTW B;  3M3L A;  2MBG A;  4FAT A;  2F36 A;  4GXA A;  5JK4 A;  4R9G A;  1MXZ A;  1I6B A;  5CMK A;  3IOR A;  1MXY A;  3QAX A;  4QFO A;  1MY2 A;  3V5A A;  3QSL A;  3RQT A;  1B3G A;  4H6D A;  3TQL A;  1UIV A;  1PB8 A;  2D3I A;  1YPN A;  1WDN A;  4FIM A;  3WAF A;  2UVI A;  4LON B;  3U92 A;  1SW4 A;  1SYH A;  5EHM A;  3S9M C;  2IA4 A;  1NNT A;  3ECR A;  3DP6 A;  3D4C A;  3QYT A;  3QK6 A;  1Y3Q A;  4ZEI A;  1DOT A;  4LAT A;  4F1U A;  2H9B A;  1TXF A;  3EHT A;  3ZS6 A;  1XC1 A;  4H8J A;  1LAH E;  3SEY A;  3TCF A;  4IGT A;  4RPO A;  2V3Q A;  5DVF A;  1SD3 A;  4OEU A;  1GVC A;  3N6T A;  3H7M A;  1JVY A;  3G3F A;  1AH5 A;  1NKX A;  2OWT A;  3KZG A;  4L17 A;  3I6V A;  1B05 A;  1OLC A;  2A5T B;  3PPR A;  4JSO A;  1FTO A;  4HS7 A;  3QIM A;  1N3X A;  2QS3 A;  3RNN A;  2ANJ A;  4RK2 A;  3ILU B;  3MPL A;  2ZYN A;  2HXW A;  3H6W A;  2NOO A;  4NTL A;  3C36 A;  4F3G A;  3E3K A;  3Q25 A;  5I58 B;  3ILT B;  1URS A;  2QS2 A;  2R9J A;  3M3F A;  1YAE A;  3MZ9 A;  3PPO A;  4EF1 A;  4R2B A;  2PX1 A;  5L9M A;  4GWO A;  4C1U A;  1FTM A;  4YB5 A;  3PUZ E;  4JWO A;  3OO7 A;  4G2Z A;  4LQ5 A;  3EN3 A;  5CMM A;  4ISU A;  1WVJ A;  2KWH A;  4F2O A;  3L6G A;  3PPN A;  1N7X A;  3IB0 A;  1M5D A;  3N26 A;  1URD A;  5I57 B;  3OMB A;  2QPQ A;  1QKA A;  4GL0 A;  5L9S A;  5I2N A;  1ZLQ A;  3FVK A;  3MJN A;  1CB6 A;  1AOV A;  1A7L A;  2Y84 A;  4OMB A;  3HPI A;  4PP0 A;  5A5X A;  1BLF A;  3MW0 A;  2I48 A;  1P1Q A;  2Y7P A;  4FEC A;  1MQH A;  3LSX A;  2G29 A;  2Y7R A;  4N13 A;  4IGR A;  4KD5 A;  2B6