3QUJA

Crystal structure of the phosphonate binding protein, phnd, from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
301
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 100
structure length 301
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qujA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA02
3VLUA 1TFDA 2GHAA 3OENA 1A55A 4JBZA 3TODA 4XXUA 3CFZA 1QULA 4ZEFA 2B3FA 1Q35A 2QS3A 3G3IA 4I8CA 5I56A 1N0TA 2XXRA 4DNDA 1B0HA 3BBRA 4OERA 1UTBB 3RT6B 1LAHE 4IGTA 3MPLA 1DPEA 3FASA 2ABHA 5A5XB 1ZLQA 4H5GA 3K6UA 4K3FA 1DSNA 5BWJA 3Q29A 3ILTB 3TEPA 1B46A 2DVCA 1NL5A 1A40A 3FIRA 4P11A 2X9WA 4P0GA 3I5OA 4MF3A 4E0XA 3FJMA 1QW0A 1JVYA 1MH3A 4RJZA 1O63A 3TKDA 1EZPA 2GHBA 1IIWA 4MFIA 4Q5TA 3OO6A 3H7MA 4IO2A 5JEIA 3T22A 3OOAA 1JQFA 1LCTA 3ONMA 4DCXA 2NOOA 3H6WA 1FTLA 1MM7A 2O7IA 2Q2AA 1B0LA 3E4RA 4QFKA 1QJMA 3MP6A 1WDNA 1DMBA 1ZIUA 1B5HA 3FXQA 4GXAA 4F39A 3K6VA 4OHNA 2D5WA 3KOTA 1Y4CA 2O68A 4ZZAA 4XKNA 1GR2A 3IK6B 5I84A 1AL3A 4R75A 1P1NA 4TQUQ 2UVGA 5DVJA 5I2KB 1XOCA 3TQLA 3PUYE 3T9VA 4OEVA 3T9UA 1NNPA 1B5IA 2PBWA 4IY5A 3KZGA 2ONKE 1N7XA 3IO4A 3V83A 1TT1A 2DWHA 3FUZA 1URGA 2M8CA 4O3BA 2QL3A 1BLFA 4NF5B 2H9BA 2VP1A 2ONRA 3KN8A 4OXVA 3V89B 2HQ0A 2V3TA 4YKIA 3VVDA 5I57B 3VVEA 1MQHA 4F2QA 4RY1A 4H65A 2AL5A 1Y9UA 4OTEA 1MQJA 1URDA 4H8JA 3FVOA 1FTMA 3GLBA 3MWBA 1H7CA 4LQ2A 3MVWA 3IAZA 2ZYNA 2XXIA 1LLSA 3LSWA 1NNTA 2R71A 3C36A 2I0BA 3KJ7A 3MZBA 3DLNA 4GL8A 2DVZA 1B3HA 2HCAA 4U4XA 1M5EA 1XS5A 5CM6A 3ZKKA 3THIA 3E9XA 1MDQA 2B65A 2OBGA 3I6VA 1CE2A 4X9TA 4XTCQ 5FTIA 1USYE 1F9BA 3CIJA 4KYDA 1SDXA 4GD5A 1IJ5A 1M5CA 3MZ1A 3CSBA 5DEXB 4H67A 2AL4A 4ONYA 4JWXA 1Y3PA 2X9XA 5HBCA 3B6WA 4JDFA 3MXZA 1AMFA 3FGSA 2OWTA 3KFMA 3MVYA 3H6VA 2ZMBA 1QSDA 4F19A 5H8NB 4J2CA 1UTBA 1LAXA 2A5SA 5DTBA 2OK2A 3IB1A 2I4CA 4G77A 4MBPA 1Q1KA 2RCAA 5I2NB 4F29A 1MY4A 1HSEA 3FD3A 5A5XA 1MXUA 4NF6B 1XC1A 4EQ7A 1XVYA 1S9TA 1WVJA 1FTOA 1SW2A 1B9JA 2RINA 3M8UA 4YAHX 2UVHA 1MPBA 4YB7A 4FE8A 1R6ZA 4ZE9A 2QS4A 2X9YA 4YMAA 2XX9A 3W15C 2QPQA 5FHNA 2O6AA 3K01A 2VD3A 1LSTA 2XXUA 1B3FA 4N6PA 4GFRA 4U1OA 4KQPA 2PT2A 3TKLB 4OWDA 2F5XA 3Q28A 3PD9A 5I59A 4PFWA 3O2AA 3Q27A 4PFYA 2XXHA 3HN0A 3PUXE 3RLFE 5AA2B 3CSGA 5DYHA 1LAFE 5I2KA 3N6TA 5CBSA 3GXAA 2RC7A 2QSXA 4IO5A 1LGBC 4F18A 5H8HB 3KN3A 4NF5A 3PPPA 3IOVA 4IO6A 4L0RA 1N3XA 3IOWA 5JTYB 3U92A 1UIUA 2GRVA 2I58A 4RYAA 1CB6A 3O97A 2DWJA 5I57A 1AIVA 3S4UA 4RK2A 4MLVA 1A54A 1KWHA 3PMVA 2HFBA 3OSRA 3QYTA 2PVUA 3N5LA 1B40A 3OEMA 1UTHB 4DXUA 4R6YA 4JWYA 3IO6A 2QJEA 3CFLA 2XD3A 1N76A 1NNFA 2V93A 1Y20A 3PD8A 3K1PA 1H76A 2R9JA 4NF8B 1SVXB 3U8QA 3ZKLA 1IZ1A 1VR5A 4LVQA 5LOMA 1B4HA 4ELQA 1M5BA 4R9GA 5AA4B 4FATA 4QFPA 4GL0A 2KWIB 4WEDA 2VHAA 4RA1A 1USYH 2ZNTA 2C5IT 3C31A 1JW4A 2F6GA 2Y7KA 2V25A 3G3FA 4X1DA 3S9MC 1MH4A 3CI8A 3G7WA 1JW5A 2REJA 3PUWE 4YKPA 1R1NA 4GQOA 3SEVA 4IY6A 1ATGA 4QHQA 3MVZA 2Z8FA 2IA4A 4H0WA 2FYIA 5H8NA 4NE4A 5H8QB 2F7BA 3SERA 3UIFA 3H03A 4E0WA 4LA9A 1JEVA 4IB2A 5FTHA 5I2NA 3OMBA 3LC8A 2Q88A 4NF6A 3FV2A 2Y7PA 1NKXA 3Q26A 4HW8A 2X7PA 1NH8A 2WKYA 3M3LA 2GH9A 4KYSA 3C4MA 1JW1A 1MY1A 1ZU0A 1TXFA 1NH7A 4YB6A 2DXRA 3KEIA 3VLWA 1JVXA 3O6HA 3EPEA 3HHGA 1SI0A 1FQAA 4F3BA 4PFTA 3O29A 3H4ZA 3SEYA 3MVXA 4EQBA 1VFDA 4F1UA 4GOTA 4RPOA 1PEBA 4ZEKA 5EYFA 1R9LA 2C5JA 5TPAB 3PV0E 3HCQA 3R7XA 1SD3A 4HCYA 3KBRA 4QFLA 4G8NA 4POXA 1H45A 3S2VA 1QUIA 4U23A 3PU5A 4QRZA 4F31B 5AA2A 4EXKA 4B6XA 4OEUA 4QFNA 5DVIA 2HZKA 2UXAA 4IGRA 3IB0A 4ZDMA 2MBGA 1N04A 2Q9TA 3SEUA 1QUKA 5BUUA 1N3WA 2RKMA 2Y84A 1YAEA 1IXCA 3O6IA 2NVUB 1PB7A 4BDMA 3A09A 1SYIA 5H8HA 4UA8A 5L9OA 1MXZA 1PBPA 3IOTA 3I3VA 4QSDA 4Q30B 5JTYA 1LB8A 4QFOA 4YKJA 5KDTB 2Q2CA 5AA1A 3IOUA 4XKQA 1H43A 2G93A 3KOSA 1IXHA 4DDDA 1IQ7A 1GV8A 1VSOA 1MXVA 3G3GA 4OQOA 1B7HA 1MDP1 1DTZA 1A99A 3VDFA 4NWCA 3TFLA 3LSFB 2QS1A 3IORA 1UQWA 2AYSA 4R2BA 1PDAA 2I3WA 1UIVA 1US5A 5TU0A 1IEJA 4FAJA 5AA4A 5ICQA 3KG2A 3TCGA 1HSJA 1AOVA 4OMBA 4KD5A 3V8XB 5KCJB 1I6AA 1URSA 1MG1A 2XXWA 2VD2A 3TCHA 2V3QA 2H98A 3PPNA 4X48A 2HAVA 3F11A 3TTLA 4AB6A 1NNKA 2UYFA 5AA3A 1L5TA 4R6KA 4ZZEA 2FNCA 2F7CA 3TCFA 2DQVA 1XVXA 3ZS6A 2DE3A 1B51A 3T96B 1FQBA 1QUJA 2E0SA 1OVBA 2F97A 1DOTA 4TOZA 3EQ1A 5FHMA 2E1SA 3KSJA 2O1MA 5H8QA 2I49A 2P0SA 2XXTA 4OVJA 1EH3A 1LVFA 4DCYA 3UGWA 2G0UA 1LAGE 4RPNA 1RKMA 1A8EA 3PPQA 3P7IA 3O28A 3MP1A 4I62A 1GVCA 4O3CA 1A8FA 1TWYA 1POY1 2Q89A 4NWDA 2D21A 4ZECA 1Y3QA 1SQYA 2H99A 1LFGA 1D9VA 2HXWA 2KLFA 3CRBA 4QSCA 3C9HA 3VXBA 2G29A 4RXLA 4YZZA 3W9WA 2NWJA 4POWA 1M5DA 4EXLA 2DWAA 2DOJA 4HCWA 3SETA 2K48A 2H25A 5ELVA 3EHSA 5TPAA 1GGGA 4H8IA 3OEKA 3MPKA 4O3AA 4BDQA 4DIGA 4KYEA 3UN6A 2F36A 4U2RA 2GFEA 2HZLA 3H6TA 2QMWA 3TYHA 4YU0A 3A3CA 4F3SA 3U94A 1MPCA 2QMXA 3U1OA 1B32A 3TPAA 3UP9A 1R9QA 1PB9A 1IXIA 1H3DA 4DZ1A 1SW1A 1FQDA 3HSTA 3PGFA 4ZEDA 3MC2A 3FVKA 4H1XA 3R26A 2O69A 1US4A 1JETA 3MAMA 3RQTA 5KDTA 3TTRA 4ELPA 2F34A 4Z7EA 3O66A 3KGCA 1VE4A 2O7UA 2O84X 1MQIA 5ISUA 1LFIA 1B05A 3C34A 3PUVE 2RC8A 5CMMA 4Q0CA 4OETA 4AQ4A 1RYOA 1SW5A 3OXNA 3KN7A 3QXMA 4EQ9A 2FA7A 4P0IA 5CI5A 5IAIA 4BLAA 1GTKA 2CZLA 4BDOA 4H6DA 3FZVA 4GIZA 3FXRA 3RTWB 1A7LA 2ONSA 1LBBA 4OFLA 2IC6A 1ZKBA 5JK4A 4LUBA 5KCJA 2H5YA 2I4BA 2I0CA 5ICTA 2I6EA 3CKDA 1JNFA 2C5KT 4WKMA 3H06B 5ITOA 1J1NA 3UORA 4IO3A 1SW4A 1ZBMA 3S9EA 2OJTA 3TTNA 4F1VA 1OLCA 3LSLA 2F8DA 4JSOA 1POTA 4RNSA 4C1UA 4FORA 1LBCA 3GZGA 3TUSA 2UVIA 4NEDA 4YKKA 2PYYA 3K1MA 3KSXA 1JEUA 1RYXA 1Y1MA 4PE5B 3SESA 3DP4A 4I1DA 4TLLB 2YPNA 3IB2A 1ZJLA 4HS7A 1MY3A 3CVGA 5HPQA 2ESNA 2ANJA 3IJOB 5CMCA 5IKBA 2O1LA 5DEXA 4FEDA 5CC2A 1OMPA 3H6UA 1MRPA 2R6GE 2W7YA 3LR1A 1Y1ZA 4JXIA 1MY2A 4R74A 1I69A 3AXFA 3FV1A 4EYYR 4DLDA 3MP8A 1MXWA 1OLAA 4LONB 2UVJA 3EF7A 3JYRA 3K02A 5CMKA 3D4GA 3DM0A 3BKIB 3S9NC 3N26A 4U1ZA 4F22A 1XHYA 1OQHA 2Y7RA 3RPWA 5J1DA 4C0RA 1BTJA 3FATA 3QAXA 1OQGA 2OCUA 2DE2A 2LAOA 4EUOA 5K2YA 2REGA 3QUFA 3SEWA 1EZOA 1LCFA 3KJTA 1VFEA 4ELOA 4EF1A 4QF9A 2NUVA 5L8DA 3ILUB 3G3JA 3K1NA 3FXUA 4ECFA 1II5A 3TDJA 3S9LC 3C32A 3FJGA 3HPIA 2F78A 1O64A 4GVOA 4XKRA 1MS7A 1P99A 1QKAA 3SDFA 1FQEA 4LZ8A 4OFJA 4KI0E 1Z0PA 4G68B 1B5JA 2AIXA 4PQJA 4G68C 4FEBA 1LB9A 1OVTA 5EHMA 3DP6A 3TTMA 4LQ5A 3W9VA 2I48A 1S7YA 1IUDA 1PBQA 4OYVA 4X1BA 4EDPA 4ND9A 5H8FB 4XIGQ 3GBAA 4JWOA 2Z8DA 3VV5A 2IEEA 3G3KA 1ELJA 3HV1A 3K0VA 4ISUA 2HAUA 2XXXA 1IJ6A 1YTVA 4C1TA 3MBPA 1MPDA 3O6GA 2NXOA 5DT6A 2DP8A 2RC9A 3CVRA 2Z23A 1B58A 1TFAA 1P1QA 2YJPA 3A3UA 1AH5A 3OO7A 3CG3A 3B6TA 5CMBA 1FQCA 3D4CA 4FIMA 1B3GA 5CBRA 3K6XA 1D4NA 3B6QA 3K4UA 2V84A 3VVFA 3T9HB 2KWHA 2Q8JA 1SYHA 1SBPA 1D3KA 2VGQA 1FQFA 2ZYMA 4YICA 1N84A 5I59B 2X26A 3T93B 2XXPA 1UTHA 4IO7A 1MQGA 3QSLA 1Y4TA 4F3PA 4ESXA 4M1VA 4KFQA 4NF8A 3MUQA 3SKPA 1DPPA 3E3KA 3DP8A 4N13A 1P1UA 3RN8A 3MZ9A 3QUJA 5I58B 3MJNA 4FJPA 2HEUA 3G3HA 1Z7NE 4OZ9A 4EF2A 3VXCA 3JZJA 3TELA 3L3PA 4DXCA 4R72A 2XXYA 4PFUA 1P1OA 4KCDA 5L9SA 2O51A 5FHOA 1BP5A 4YMBA 4GF8A 4BDNA 3H3GA 4WEPA 4U22A 3C33A 4DE8A 1B7ZA 2F6PA 3PPOA 1OIBA 2BJJX 3M3FA 3OELA 1M5FA 3K6WA 3PUZE 1WODA 1I6BA 3USDA 3L6GA 2V3UA 4KCCA 3EN3A 2F7AA 1B1HA 2PMSA 4H5FA 4ZS9A 4ZE8A 1EZ9A 3QK6A 4FI5A 4LP2B 3EHTA 2ZNSA 4BDRA 2ZNUA 1IXGA 1Y3NA 4DXBA 2OZZA 2XX7A 4WXJA 4ESWA 4IO4A 2VOZA 3TAJA 3FVNA 4R2FA 1YCJA 2XD2A 1MM6A 3IL1B 4G68A 3IR1A 3HO7A 4G2ZA 1LFHA 1MQDA 2OWSA 1B2HA 2A5TB 5H8SA 3TMGA 1QKBA 2B3BA 1I6QA 1LRZA 4OFOA 2D3IA 1O7TA 1N7WA 5M2VA 3B7DA 1B7UA 5ITPA 2Z22A 2Y7WA 3FVGA 1IITA 3PPRA 5H8FA 1ANFA 4NF4B 1FTKA 1SI1A 2ALUA 1ZKEA 4XKPA 3OO9A 4NMYA 5TP9B 1B1XA 3L6HA 2QS2A 1B6HA 2DSFA 2UYEA 3UA8A 4GXSB 5F7VA 3E13X 3MQ9A 4CQIA 3OSQA 3DELB 3OD7A 5AE4A 4FECA 3RNNA 5I56B 2ZXTA 3CG1A 4G8HA 1EU8A 3RTFB 2P1SA 2Y7IA 4F1YA 2X7QA 4ZEIA 3TZAA 2DYXA 3TTKA 2XXVA 1B3EA 3IX1A 1BIYA 2XHDA 3FXDB 2QRYA 3LUYA 4G4PA 2I3VA 2ZYKA 3C35A 3VLVA 4KR5A 2Z8EA 5HM4B 4Z0IA 4KPTA 2P2AA 1P1WA 4I9DA 3U93A 3RT8A 2H4IA 3QIMA 2OLBA 3JV9A 3U72A 3ECRA 1FTJA 5I58A 1FW0A 2DWIA 4U4SA 3RUMA 1FCKA 3BFTA 3K2DA 4MH5A 3ZSFA 3K00A 4THIA 2DXYA 1XT8A 5F1QA 1PB8A 2IC9A 4LZ5A 4GRKA 4NTLA 1YPNA 5DVFA 4ELRA 1B4ZA 4JB7A 2DS9A 1ZTYA 3RGYA 1T0KA 5B7DA 4PP0A 4OESA 2F35A 3UK4A 5KZTA 1QVSA 3V5AA 2XX8A 3LBSA 4R9FA 3VE1B 3WAFA 4KHZE 4YB5A 2DE4A 4U21A 4M4GA 4GLIA 1NFTA 3T9XB 3N6UA 3GBBA 4G8MA 5L9MA 3CR9A 4PETA 4BDLA 4Q8RA 4GWOA 5K2XA 4QSEA 1D9YA 1S50A 5B70A 3PMXA 1B3LA 3TQWA 4AB5A 2RF1A 2ZYOA 1NMUA 3VFJA 4TLMB 4MLQA 1HSLA 5AA2D 1Z7ME 3MW0A 3BFUA 3FJ7A 4LATA 3PMWA 3FXEB 1B52A 1ZMGA 1MXYA 3Q25A 3RY3A 2PX1A 1DTGA 2THIA 1MY0A 2YLNA 5EHSA 1BKAA 4L17A 3T66A 4RK9A 3R6UA 4R6HA 2CMOA 2PT1A 2RCBA 3OO8A 2A5TA 4LZ7A 1H44A 5CRYA 2XTLA 3M3KA 3HHFA 3SEXA 4R73A 4JSDA 3EHUA 3IJXB 3CFXA 2XXQA 4F2OA 1MXXA 3ODBA 4UACA 4NF4A 3LSXA 4N07A 3N94A 3O9PA 4HTGA 4F3GA 5TP9A 3WAEA 4ZEBA 2CA5A 1PC3A 4OENA
chains in the Genus database with same CATH superfamily
3VLUA 1TFDA 2GHAA 3OENA 1A55A 1DCUA 3EDUA 4EIWA 2W67A 5LBQB 4JBZA 4IGUA 4P3LA 3TODA 3GYYA 4XXUA 3CFZA 4PGNA 1QULA 2CE7A 4ZEFA 2B3FA 1Q35A 2CPTA 2UXBT 2QS3A 3G3IA 4I8CA 5I56A 1N0TA 2XXRA 3IF8B 4DNDA 3FZHB 1B0HA 3BBRA 4OERA 3AE3A 1UTBB 4HFBA 3RT6B 1LAHE 4MNIA 4IGTA 3PUGA 3MPLA 1DPEA 4N6DA 3FASA 5EQ7A 2Z6EA 3AEFA 3E0ZA 3CK6A 2ES0A 2J62A 4YJ3E 3M3ZB 4TV8E 2ABHA 4GK5E 5A5XB 1HS7A 2A9UA 1N36T 1ZLQA 2HPGA 4H5GA 3K6UA 4K3FA 1DSNA 4IE0A 2XUEA 5BWJA 3RIUC 2WBDA 3Q29A 2WP9A 3ILTB 3TEPA 4ILUA 1B46A 2BS3A 1NL5A 2DVCA 2ZM8A 1NUZA 4YHJA 1A40A 3FIRA 4P11A 2X9WA 4P0GA 3I5OA 2X68A 4YTPA 1S94A 4MF3A 4E0XA 3FJMA 4TWFA 1QW0A 3A8YC 2ZM0A 4XBFB 1JVYA 5J1GA 1MH3A 4RJZA 1O63A 5HCJA 4I43B 3O4XE 3TKDA 4UF0A 1EZPA 2DNXA 2GHBA 2XQ6A 1IIWA 4MFIA 4Q5TA 1D0ZA 5ABGA 3MZKB 2KT9A 4GBVA 3OO6A 3H7MA 2CRBA 4IO2A 5JEIA 3T22A 4GX3A 2F3DA 5JDLA 5EYHA 5LMNT 4QX8B 3OOAA 2MYSA 4CI2B 2BKNA 1JQFA 3K1SA 4AKHA 1LCTA 2BG9E 4ANJA 3ONMA 4DCXA 2NOOA 4X64T 3H6WA 4WZXA 5DQVA 1FTLA 1MM7A 4PGPA 2Q74A 4X04A 4NUUA 2O7IA 5FL1A 2W0GA 3FBPA 5ET8A 4YSXA 2Q2AA 4NXMT 1B0LA 5L2LA 3E4RA 2M67A 4QFKA 2NWBA 1QJMA 3MP6A 1WDNA 2V5DA 5JQGE 3UU6A 4CI1B 5LHHB 4H9RC 1DMBA 4I40A 1ZIUA 1B5HA 3FXQA 4GXAA 2CLYB 2V6YA 4F39A 3N9NA 3QNUA 3FBZA 2RPAA 3K6VA 4OHNA 2D5WA 3MJXA 3KOTA 1Y4CA 2O68A 3N9LA 5JDNA 1KZ8A 2WEFA 4ZZAA 3LBXA 4XKNA 1GR2A 4LFAT 3IK6B 4P0AA 5I84A 1AL3A 4R75A 1P1NA 4WBNE 4TQUQ 2UVGA 5DVJA 2XY8B 5C3JA 2PFYA 5M4YA 5I2KB 1XOCA 3TQLA 5ABFB 3PUYE 3T9VA 4OEVA 2LLYA 1K9ZA 3T9UA 3KBUA 1LBXA 1NNPA 2XQ7A 4HFIA 1B5IA 4H63V 3RIFA 3NRYA 2FIXA 2PBWA 2B76A 4IY5A 1BR4A 3KZGA 2ONKE 5ETWA 1N7XA 3IO4A 3V83A 3HKEE 1TT1A 2DWHA 3FUZA 1URGA 1HNXT 4NXNT 2E9XB 2M8CA 4O3BA 2QL3A 2JJ9A 1BLFA 3U78A 4NF5B 2H9BA 2VP1A 2ONRA 3KN8A 4OXVA 3V89B 2HQ0A 2V3TA 4YKIA 3VVDA 3T0JA 5IUXA 5I57B 2FHYA 3ZMSB 3VVEA 1MQHA 4F2QA 4RY1A 5JR9C 4H65A 2PG8A 2VKJA 2AL5A 1Y9UA 4OTEA 1MQJA 4H9OC 2SPCA 1FPDA 2WZHA 3TLSA 1URDA 1G73A 4H8JA 3FVOA 4I50E 1FTMA 5LGTB 3GLBA 3GA8A 2BKPA 5LGNB 3MWBA 1H7CA 4LQ2A 1IMFA 2UXDT 3MVWA 4LF4T 3IAZA 3E08A 2ZYNA 2VURA 2XXIA 2H7OA 1LLSA 4O8MA 3TLWA 3LSWA 1NNTA 2R71A 3C36A 2I0BA 3KJ7A 3IEEA 3MZBA 1MIYA 4G61A 3DLNA 1YQ4A 4GL8A 2XAQB 2DVZA 2JPFA 1ZP0A 4AKGA 2GK9A 1B3HA 2K9AA 2VQFT 3ZEFB 4TV9E 4DR3T 4TN7B 2HCAA 4ADZA 4PFRA 2LEHA 5ET6A 3RYDA 2K5BB 4U4XA 1UUSA 1M5EA 5KX5E 4F6RC 1XS5A 4NUVA 3ZKKA 3THIA 1JNRA 3E9XA 5CM6A 3DTOA 1MDQA 2PBIA 2B65A 4IDZA 4U72A 2OBGA 2J1DG 4EYUA 2A72A 3I6VA 2VASA 1CE2A 2PTFA 2RA1A 2XM2A 4X9TA 4XTCQ 5E0OA 4XZCA 1D9QA 3EUHA 4P9KA 5FTIA 1USYE 1X79A 1F9BA 3CIJA 4KYDA 3LFMA 1SDXA 4GD5A 1IJ5A 3UUMA 1M5CA 2X67A 3EHZA 4ZS2A 3C51A 3MZ1A 4UXNB 3CSBA 5DEXB 4H67A 3AXJA 1VOMA 2AL4A 4DV7T 2XWOA 4ONYA 3RGLA 5AQUB 3E22E 3C4WA 4JWXA 2LM2A 1Y3PA 2X9XA 5HBCA 3B6WA 5FY1A 4X20E 2VPOA 4O4IE 4BJMA 4JDFA 3MXZA 3N2GE 1AMFA 5AQPB 5JDQA 4ZI7E 3FGSA 2E9XD 4NX1A 1I6ZA 2OWTA 3OBVE 3ZN1B 3KFMA 3MVYA 4MLKA 5CFBA 3H6VA 4AKLA 2LSYA 1NV7A 2WDQA 4EAHA 2ZMBA 1QSDA 4PJJA 4F19A 1D1AA 5H8NB 4DR2T 3WAJA 4J2CA 3ZLIA 4A56A 2H88A 1UTBA 5ESYA 1LAXA 2A5SA 5DTBA 2X51A 4HFVA 5T3JA 1J5WA 4ISTA 2OK2A 1MIVA 3IB1A 2I4CA 4G77A 4PE3A 4MBPA 1Q1KA 2RCAA 5I2NB 4F29A 1MY4A 3B5MA 1HSEA 3FD3A 4UELA 5A5XA 5JDGA 1MXUA 4NF6B 1XC1A 4EQ7A 4AXPA 1XVYA 3AE8A 1S9TA 3BIGA 5F5WA 3RIUA 3AEEA 4DR5T 1WVJA 5J0ZA 2GQ1A 1EYJA 1FTOA 1YKHB 1SW2A 1B9JA 3SRZA 2RINA 3M8UA 4YAHX 4N8YA 3CX8B 2NW9A 2XAFB 4MBQA 1MPBA 2UVHA 4YB7A 4FE8A 2FJEA 1R6ZA 4ZE9A 2IHR1 2KINB 2WY2A 4H45A 2QS4A 2P9BA 3K3NA 2X9YA 1NWMX 4YMAA 4TNWA 2XX9A 5HEJA 2F3BA 3W15C 4EZHA 3K3OA 2QPQA 2OX3A 2Q9QD 5FHNA 2QVRA 2O6AA 4AQFC 2JQQA 3K01A 2VD3A 3OYXA 1LSTA 2XXUA 4UEMA 1B3FA 4HWFA 4JVDA 2W62A 3PV0F 3VKGA 4N6PA 3EI0A 2XAGB 2Y8DA 4GFRA 4U1OA 3L09A 4KQPA 3J7Yq 3RQUA 5LG4A 2PT2A 4IL4A 3TKLB 4OWDA 2F5XA 1B7TA 4GYRA 3UU3A 5EYGA 3Q28A 2LOPA 3PD9A 2XWIA 5I59A 4PFWA 3O2AA 3Q27A 3VRBA 4PFYA 1XMQT 2DI4A 3PTYA 2XXHA 3HN0A 3PUXE 4CN1A 1E2AA 4QKNA 3RLFE 5AA2B 3QB5A 3CSGA 3N2OA 4ISSA 3ZT5A 5JDMA 4P1LA 4X66T 2FJAA 3OVUA 4GWYA 5DYHA 1LAFE 5I2KA 3N6TA 3O1JA 5CBSA 3GXAA 1HTJF 4N17A 1HCIA 2RC7A 2QSXA 4IO5A 1LGBC 4F18A 2I59A 2LT3A 5H8HB 5HXHA 1KNPA 5LXTE 2E9XA 3VHLA 4Z91A 5FNVE 3KN3A 5LYJE 4COFA 2WMNA 4NF5A 3PPPA 2CZKA 4DUYT 3IOVA 4IO6A 4L0RA 5GONE 1N3XA 3IOWA 5JTYB 3HL6A 2DWKA 4DR4T 1UIUA 3CX6B 3U92A 2GRVA 2I58A 4RYAA 2W2UA 1CB6A 3O97A 2UUCT 4MCOA 2DWJA 1ZEEA 3AE9A 5I57A 4O4JE 1AIVA 2D0TA 2CWYA 3WAKA 3S4UA 2UU9T 4RK2A 2RP4A 4MLVA 1A54A 4MX6A 5AQFB 2VL0A 5LHIB 3BIHA 1KWHA 3PMVA 2QFLA 2HFBA 2IAKA 3OSRA 3QYTA 2PVUA 1WR0A 3N5LA 2UXCT 1B40A 3SS1A 2PCRA 4HWHA 4IL9A 3OEMA 1UTHB 4DXUA 4JVIA 4R6YA 1FPEA 4DMWA 4JWYA 3IO6A 2QJEA 3CFLA 2XD3A 4LFCT 2V7LA 1N76A 1W0AA 1NNFA 1Y20A 2V93A 3PD8A 2VKHA 3K1PA 1H76A 4PBHA 4HE1A 2R9JA 4DVDA 4NF8B 1SVXB 3U8QA 3ZKLA 5AQQB 1IZ1A 1VR5A 4HE0A 4LVQA 1OEDC 4U33A 5LOMA 1B4HA 4ELQA 2LHNA 5H6RB 1M5BA 4R9GA 3RX6A 2OA5A 5AA4B 2QGSA 3CQGB 2M6IA 3AA0B 4QFPA 2Y48B 4FATA 2NW7A 2KWIB 4A97A 4GL0A 4WEDA 2VHAA 4RA1A 1USYH 2ZNTA 4QH4A 2JQHA 4OK0A 2C5IT 1CUNA 1Z8UA 3C31A 1JW4A 2F6GA 5FVLA 3FBLA 2V25A 2Y7KA 3G3FA 4JVCA 4X1DA 5F24A 4TZ4C 3S9MC 5CA0E 1MH4A 1O3XA 4QH5A 2CZIA 3CI8A 1HNWT 2BBJA 3G7WA 1JW5A 2REJA 3PUWE 4EXTA 4YKPA 1R1NA 5JREA 1VCSA 4LN5A 4GQOA 1NI9A 1FMVA 2D0UA 1ZHCA 4EEBA 4YT0A 1MMGA 5LHGB 5LNKA 3ESLA 4IREA 4MALA 3SEVA 4GWXA 4IY6A 1ATGA 2DWGA 1D1BA 2XASB 5DJQC 4QHQA 1I94T 3MVZA 2IUBA 3FZMB 2Z8FA 2FBWA 3ZYLA 2IA4A 4H0WA 2FYIA 2OV9A 3FZFB 5H8NA 2HHMA 2ZZVA 1RDZA 4Z90A 3GWHA 4NE4A 2WMOA 5H8QB 2F7BA 3SERA 2VPNA 1FPBA 3UIFA 5FL0A 1IZNB 1WR6A 3H03A 5LB7B 2P3NA 4LF8T 4E0WA 4LA9A 1JEVA 1FPKA 4IB2A 5FTHA 5I2NA 3OMBA 3LC8A 2MOZA 2Q88A 2K24A 3QMFA 4C90A 4NF6A 3VRAA 3FV2A 3D1RA 2Y7PA 4B3RT 2LOSA 1NKXA 4YY3T 4AS5A 2BVLA 4O2BE 3Q26A 2W66A 3HKDE 3ZYKA 4HW8A 2XAJB 2X7PA 1NH8A 1XI6A 2P3VA 2YOEA 2WKYA 3M3LA 2HPJA 2GH9A 4KYSA 3ZPOA 3C4MA 3KV9A 1JW1A 1MY1A 3LJCA 1IBMT 1ZU0A 2XAHB 1TXFA 2XWKA 3TLUA 1NH7A 4YB6A 4H9QC 4CXWA 4GIWA 2DXRA 3KEIA 1XMOT 3VLWA 4AQFA 2PFVA 1JVXA 3PU3A 3O6HA 4O2AE 3EPEA 3HHGA 2CBJA 3C64A 4KUMB 4L9IA 1SI0A 4JUYA 1VCTA 4O7MA 1FQAA 4F3BA 2CM0A 4PFTA 3O29A 4BAYB 3H4ZA 3SEYA 3MVXA 4EQBA 1XDOA 4NN3A 4IR8A 1VFDA 4F1UA 1KA0A 4GOTA 3IBPA 4RPOA 1PEBA 4ZZCA 4ZEKA 5J2TE 5EYFA 1R9LA 2C5JA 5TPAB 4ZI2D 1MNEA 1NAFA 3PV0E 3R6NA 2WBBA 1WYCA 2WDVA 3HCQA 3R7XA 1SD3A 4ZXLA 5J2UE 4HCYA 2LSGA 3KBRA 2A3DA 4QFLA 4G8NA 5EZYE 2CXFA 5H6QB 4POXA 4AQGA 1H45A 3S2VA 4YXDA 5ADXL 1QUIA 3AE6A 4U23A 2QA7A 4X62T 2FIEA 4QWNB 3PU5A 4QRZA 4F31B 5L47A 1LBZA 1IAPA 5AA2A 1LKXA 1XWMA 4EXKA 2E5VA 4CZZB 4B6XA 4OEUA 4QFNA 2LSIA 5DVIA 2HZKA 4KBMB 2UXAA 3IB0A 4IGRA 4ZDMA 3OKQA 2MBGA 4PK5A 1Q9DA 2FJBA 4G63A 5DQWA 4X1YE 1N04A 2Q9TA 3SEUA 2UXXB 1QUKA 5BUUA 3RKGA 1N3WA 5JVDE 4JI0T 2RKMA 2Y84A 1YAEA 3GMIA 5F3JA 3ZMUB 1E7PA 4B3MT 5LOVE 3BQKA 1IXCA 3O6IA 4AKIA 2NVUB 1PB7A 4BDMA 3A09A 1SYIA 5H8HA 2H7VC 1NENA 4UA8A 5L9OA 2VL8A 4PK6A 1MXZA 3UULA 1PBPA 3IOTA 1SE7A 4PAIA 4ZS3A 3I3VA 1IMCA 1YKEB 4QSDA 3PUXF 4CN6A 1W9RA 4GWSA 4Q30B 4DBRA 4LF9T 5JTYA 3RLFF 1J1JA 4U31A 1LB8A 2CLYC 4QFOA 4YKJA 1XZYA 5KDTB 2Q2CA 5AA1A 3IOUA 4XKQA 5AQRB 3ZSSA 4PFIA 1H43A 2G93A 3KOSA 4EB6E 1UX4A 3RYFE 1IXHA 4P47A 4DDDA 1IQ7A 5EK3A 1GV8A 2L8KA 1VSOA 3KDSE 2J47A 1MXVA 1EZ3A 3G3GA 4OQOA 5HAXA 3PJAJ 2BZBA 1B7HA 4WNKA 1VRBA 1FRPA 2K3WA 1MDP1 3UT5E 1A99A 4IE5A 1BR0A 1DTZA 3UUXB 5F8PA 2D9DA 2VWAA 3VDFA 1KNZA 4NWCA 3TFLA 1CHUA 2IMLA 2BJIA 3FZKB 4JI6T 3LSFB 2QS1A 3ZC0A 3IORA 1UQWA 1OEDA 2AYSA 4R2BA 2LHRA 1PDAA 3RRCA 2I3WA 3WI3A 1UIVA 1US5A 4MIJA 5TU0A 2X0YA 1IEJA 4FAJA 2E9XC 5AA4A 4WW0A 5ICQA 3KG2A 3NZPA 1FSAA 1LBYA 4OVTA 3TCGA 3PU8A 3NZQA 4PDDA 1D0XA 3VKHA 1HSJA 3ISPA 2E5LT 2BVMA 1AOVA 4OMBA 4KD5A 3V8XB 5KCJB 1I6AA 1URSA 1MG1A 4DV5T 5CB4E 2VD2A 2XXWA 3QC9A 3RHWA 4U7IA 3KBTA 3TCHA 2V3QA 5L4HA 4JI8T 2W61A 1W09A 2H98A 3SFEA 3PPNA 4X48A 1NV2A 2HAVA 2VKDA 3F11A 3UFEA 3TTLA 4TWDA 4AB6A 1NNKA 1NV5A 2UYFA 5AA3A 5AQLB 4XEQA 1L5TA 4R6KA 1LEVA 4ZZEA 2FNCA 2F7CA 2WCAA 3ZN0B 3TCFA 5HYAA 2BS2A 3U65A 1SA0E 2DQVA 1XVXA 3RYCE 3ZS6A 3P8CD 4IE4A 2BG9B 2DE3A 3KVAA 1B51A 3T96B 4AISA 1FQBA 1QUJA 2E0SA 1OVBA 3H3MA 4HN9A 4GKJT 1DU2A 2F97A 1DOTA 4TOZA 3EQ1A 3NBXX 3Q9DA 5FHMA 1M62A 4PJNA 3UU4A 2E1SA 2Q9QB 3KSJA 2Q9QC 3ZMVB 2O1MA 4H9SE 4N81A 2LRLA 5H8QA 1VDWA 3Q5EA 4PF6A 2I49A 3PUWF 2P0SA 2XXTA 4OVJA 4DR1T 1EH3A 2B4MA 1LVFA 4DCYA 2OWZA 1FEWA 4DR7T 3G06A 3RIAA 2G0UA 3UGWA 4HXVA 4U7YA 1LAGE 3X1DA 3RYIE 4GWZA 4PNIA 4RPNA 3JAFA 1RKMA 2R6GF 1A8EA 3UFGA 5AQIB 5AQOB 3P7IA 3PPQA 3RH3A 3O28A 2LSJA 3MP1A 3D0TA 4I62A 1GVCA 3RC3A 2WAUA 4O3CA 4U2YA 1A8FA 2NP9A 1TWYA 1POY1 2Q89A 4IT4A 3SOLA 4NWDA 3N9OA 2D21A 4ZECA 1WCRA 5LDZA 1Y3QA 1SQYA 2H99A 4H46A 1LFGA 3V5SA 5TAOA 1D9VA 2HXWA 2KLFA 3CRBA 4TUYE 2W00A 3RPLB 5L4EA 1U5PA 4QSCA 2IW5B 3C9HA 4MFRA 5AQGB 3RKOA 3VXBA 3A5XA 4E7SA 2G29A 4RXLA 4YZZA 2XQ5A 3W9WA 2E8IA 2ZMAA 2NW8A 4OHFA 2NWJA 4XAXB 4POWA 2FJDA 1M5DA 4EXLA 2M6BA 2DWAA 2DOJA 4GX6A 4P1NA 2YDRA 4HCWA 2KQZA 1SUMB 3SETA 2K48A 2H25A 4QXDA 3EHSA 5ELVA 4DV2T 1FBGA 2VK9A 5TPAA 1GGGA 2XQ4A 3ZKRA 4LMLA 3PTRB 1G0IA 4H8IA 4EV6A 1KF6A 5ABEA 3F31A 3OEKA 3ANWB 1RDXA 2DCFA 3R84B 3E79A 4HGAA 3MPKA 5IHYA 5BR8T 5L3EB 2JQKA 3PE0A 4O3AA 2MAWA 2XQ3A 4BDQA 4YFSA 4DIGA 3OPCA 4KYEA 3UN6A 3AEDA 2F36A 3ONXA 4U2RA 2GFEA 1IMEA 3CQCB 2HZLA 3H6TA 4QXHB 2QMWA 4N4UA 3TYHA 1X9BA 3I0OA 4YU0A 4HFEA 1M7KA 3HFUA 2B1EA 4LFBT 1FIOA 3A3CA 4F3SA 3U94A 1MPCA 2QMXA 3U1OA 4X1KE 1B32A 1HNZT 5EK2A 3T8OA 5L3GB 3TPAA 3UP9A 1R9QA 1PB9A 2N2NA 5C2TA 5IGAA 4ZZBA 3DJBA 1IXIA 1H3DA 4DZ1A 1SW1A 1FQDA 3SZPA 3MACA 3HR0A 2D5UA 1MNDA 3EVYA 3PDYA 3HSTA 4QHOA 3PGFA 4F8HA 4ZEDA 3MC2A 4NHBA 3FVKA 1FJGT 4H1XA 3R26A 1OEDE 2L9QA 2VQET 2ZZWA 3LG7A 1QGXA 2O69A 4ZHQE 1US4A 1JETA 2DL1A 2V5CA 3MAMA 4MEVA 3RQTA 4MHFA 5KDTA 4X8RA 3QB5K 3TTRA 4ELPA 1G8XA 3AEBA 2YN6A 2F34A 4Z7EA 3O66A 3KGCA 2YU1A 4DV0T 1VE4A 2O7UA 2O84X 1MQIA 5ISUA 1LFIA 1ZV4X 1B05A 3C34A 3Q2MA 3PUVE 4HFDA 1QLBA 1NUXA 4IE6A 2RC8A 2ZM2A 2DLRA 5J16A 5CMMA 1XNRT 4Q0CA 5ABFA 4OETA 5IWAT 4AQ4A 1RYOA 1SW5A 3LUZA 3OXNA 3KN7A 3MA9A 3IFAA 4V1Av 4LF5T 4IDPA 2WU5A 3QXMA 4EQ9A 1HG5A 2FA7A 4P0IA 2VT5A 2I0MA 4PTKA 5CI5A 1UURA 5IAIA 1HX1B 4BLAA 3P4QA 1GTKA 3ZJ2A 2CZLA 3AA1B 4BDOA 4H6DA 3FZVA 4EGWA 4GIZA 3FB2A 1Y01A 3FXRA 3RTWB 1A7LA 3JCFA 4QX7B 2ONSA 1LBBA 4DMVA 4ERRA 4OFLA 2IC6A 3ZCJA 4P8BA 5IZ3B 5L3BB 4GWUA 1ZKBA 5JK4A 4IHJE 5FXXA 1KEYA 5HWYA 4LUBA 5KCJA 2H5YA 2I4BA 2I0CA 5ICTA 2I6EA 1FPJA 3CKDA 1JNFA 2WYKA 4GX4A 4DV1T 2C5KT 3P4RA 4NPPA 4UABA 2R8TA 4WKMA 2MTQA 3H06B 5ITOA 1J1NA 2ZZXA 2N9DA 3UORA 4FJOA 4IO3A 1SW4A 1ZBMA 3H3AA 5AFUL 3S9EA 5DABA 5JDHA 3AAAB 2ODVA 2OJTA 3TTNA 3AE5A 1MMAA 4F1VA 1OLCA 2XA5A 3LSLA 3LBXB 3P50A 1KA1A 2F8DA 4OYKA 4JSOA 4HWDA 2NOXA 2BG9A 1POTA 5BMVE 4RNSA 4PBQA 4C1UA 4GYSA 4NIQA 1IBKT 2XPKA 1JP4A 4FORA 1LBCA 1OXZA 4HWIB 4ZI3D 3GZGA 3TUSA 2UVIA 1OWAA 5FMNA 5L3CB 4NEDA 2DHRA 4YKKA 2E2AA 2Q9QA 2PYYA 3BQIA 3AVSA 3K1MA 2LKHA 3KSXA 4PF8A 4I55E 2MPKA 5LJNA 3ABVA 2W4XA 4B3ST 1JEUA 1RYXA 1Y1MA 4PE5B 3GN5B 2AXDS 2WQYA 3SESA 2VB6A 3C98B 3DP4A 4HE8A 1FBFA 4I1DA 4TLLB 2YPNA 3IB2A 3O9XA 2CCQA 3CWZB 3OJAA 1ZJLA 4HS7A 4ZI2C 1FJ9A 3RYHE 1FBHA 3AAIA 1MY3A 3CVGA 4OANA 2ESNA 1HG2A 2HN2A 1EYIA 2ANJA 3IJOB 5CMCA 5HPQA 5IKBA 2O1LA 5DEXA 4FEDA 5CC2A 2XQ8A 1OMPA 3IA3A 3H6UA 5IZZA 1MRPA 5AQTB 2R6GE 2W7YA 3LR1A 1Y1ZA 4JXIA 1MY2A 4R74A 1I69A 3AXFA 5FY0A 5LA6E 3FV1A 3SFDA 4KX6A 4EYYR 4DLDA 4GBWA 3MP8A 3P4SA 4UV8B 1MXWA 1OLAA 4LONB 3PUZF 4A5XA 1J5ET 5FVKA 2UVJA 3EF7A 3JYRA 3K02A 5CMKA 3RPLA 3D4GA 4PAFA 4O4LE 3DM0A 3BKIB 3S9NC 3N26A 4OFZA 4UR9A 4U1ZA 3LK3B 3N9PA 2YEVC 5ABHA 4HFCA 4GWWA 4M1PA 4F22A 5CGMA 2LM9A 1XHYA 3HKBE 1OQHA 3ZMTB 1UCUA 2Y7RA 3FZLB 1U4QA 3EKIA 2WYPA 3RPWA 5J1DA 4C0RA 4X1IE 1BTJA 3FATA 1WRDA 4GK0E 3QAXA 3F57A 4B3TT 4JI1T 2ODUA 1OQGA 3AE2A 2OCUA 2Y5LA 5HXEA 2FVZA 4MNCA 2XSAA 2DE2A 3OTOT 4PAGA 2LAOA 4EUOA 3ANWA 2HXRA 5K2YA 1T7SA 4AIUA 1FTAA 2REGA 3QUFA 3SEWA 1EZOA 4K0UA 1LCFA 3KJTA 3I0QA 1VFEA 4JBWF 5AQMB 4GKKT 4ELOA 4EF1A 4O94A 3UQ4A 4QF9A 2NUVA 1UGOA 3Q5WA 4OVRA 5L8DA 3B50A 3ILUB 3G3JA 3K1NA 3FXUA 4ECFA 1UX5A 5LCYA 3RPUA 4UV9B 1II5A 4KP3C 4PFOA 3TDJA 4BJNA 1WYBA 3C32A 3S9LC 1T98A 3FJGA 3HPIA 4OA4A 2F78A 1O64A 4N6KA 2PJQA 4GVOA 4XKRA 1MS7A 2JIWA 1P99A 1QKAA 1XDPA 4DV3T 5EQ9A 3I1AA 1FQEA 3SDFA 3KVBA 4LZ8A 4OFJA 3K8PC 2FUPA 4IDNA 1Z0PA 4KI0E 2OLTA 4G68B 4JEUB 1B5JA 2AIXA 4PQJA 4G68C 4YTMA 4IDQA 1K9YA 4FEBA 1LB9A 1OVTA 3FXBA 4PFPA 4HEAA 3RI5A 1FPFA 3LK42 5EHMA 2LRKA 3DP6A 3TTMA 4LQ5A 3W9VA 2I48A 1S7YA 4YJ2E 1IUDA 1PBQA 4OYVA 2UUAT 1UK5A 2CBIA 4X1BA 2XSBA 3ETVA 3AEAA 2CEAA 4EDPA 4ND9A 3O1IA 4U3CA 2Y6XA 3T1YT 2V26A 1FJ6A 4XIGQ 5H8FB 4LF6T 3GBAA 4JWOA 2Z8DA 5LJMA 3VV5A 1YXRA 3HKCE 4EZ4A 4ILAA 2IEEA 4AI6A 3G3KA 1ELJA 1N33T 2NTYA 4OX9T 2I6HA 3HV1A 3K0VA 4ISUA 4AS4A 4YHHT 5KXJA 3VR8A 2HAUA 2XXXA 4LMJA 1IJ6A 1YTVA 4JI3T 4C1TA 3MBPA 4HWCA 2LKGA 5FXVA 1MPDA 3O6GA 4DO0A 4AQYT 2NXOA 5LP6E 3AE4A 4N91A 3UUNA 4Z8XA 5DT6A 3NRXA 2DP8A 3RC8A 4QBAA 3F2EA 4X5TA 2WS3A 3ZCIA 2RC9A 3CVRA 2KNDA 2W63A 3NOHA 3CPZA 2Z23A 3BQLA 4JLEA 1B58A 1TFAA 2LSKA 1P1QA 3CHGA 2YJPA 2NR4A 3A3UA 1AH5A 3K3QC 3LDQB 4GOUA 1FBPA 4QXCB 3OO7A 4DV6T 2N1GA 3CG3A 3LSVA 3B6TA 5CMBA 1FQCA 3D4CA 4FIMA 1B3GA 1D1CA 5IZ3A 4JI2T 4DUZT 5IM2A 3KINB 3OYZA 5CBRA 3K6XA 4DR6T 2XQAA 1D4NA 3B6QA 3PUVF 2JJKA 3K4UA 5FXZA 4L5GA 2V84A 3VVFA 3T9HB 2KWHA 2Q8JA 1SYHA 1SBPA 1D3KA 1FBCA 2VGQA 4OYJA 2HH7A 5FKYA 1FQFA 2ZYMA 4DI3D 3ROJA 4YICA 1N84A 4NAPA 2YKSA 5I59B 2X26A 3T93B 2BDEA 3ONLC 1UTHA 2XXPA 5IZ1A 4KHPT 4IO7A 1MQGA 2WB5A 2CHOA 3QSLA 1Y4TA 4F3PA 5LG3A 2EHOB 3JC6C 1IMAA 2EHOC 4ESXA 4M1VA 3E78A 4MAGA 3NVOA 3LV0A 4KFQA 4NF8A 3MUQA 1Y64B 3PUAA 3SKPA 1DPPA 5I7IA 5LTCA 1NUYA 4TWHA 2B4LA 3E3KA 4A98A 3DP8A 4N13A 1P1UA 3NWIA 3RN8A 3QUJA 3MZ9A 3Q5XA 5I58B 3MJNA 4JYAT 4FJPA 2HEUA 3G3HA 1Z7NE 1D0YA 4OZ9A 4EF2A 3CX7B 3VXCA 3TLTA 3JZJA 3ZT7A 3TELA 2YU2A 3L3PA 4DXCA 3MSTA 4R72A 3AB3B 2XXYA 3Q5DA 4P56A 2V7JA 3C4XA 4WYVA 4PFUA 2KSRA 3GN5A 3MK7C 4LF7T 3J9X1 1BK4A 2CEYA 4JI7T 1P1OA 4O7IA 4KCDA 5L9SA 2O51A 3ONJA 5FHOA 2QVUA 4H9NC 4ILBA 4YLHA 4PAKA 5JR9B 1BP5A 4KHZF 2D2SA 3ZYMA 1WLXA 4YMBA 2CWOA 3ZC1A 4ZEYA 2QVVA 5FXWA 4GF8A 4BDNA 1AJ3A 1BR1A 3H3GA 4WEPA 4U22A 2BG9C 1INPA 3C33A 5KDMC 3AE1A 4I3EA 1N32T 2CXLA 4I3YA 4DE8A 1B7ZA 2ACZA 5HEUA 2F6PA 4YSYA 3PPOA 2ZLYA 1OIBA 2MKZA 4DBQA 2BJJX 3B57A 4CI3B 3M3FA 3OELA 3ZMZB 3MKDA 2DDKA 1M5FA 3K6WA 3PUZE 1CNQA 3NKZA 5CJ5A 4YSZA 4PJLA 5HXRA 4C91A 2A2FX 4MNPA 1WODA 1I6BA 4I0UA 4PFBA 3USDA 3L6GA 2WU2A 1MIWA 2ZM6T 3EABA 3N9MA 2V3UA 4KCCA 3EN3A 3P4PA 2AE9A 2F7AA 2V7MA 1YW0A 2Y5KA 5L3DB 1B1HA 2Q8MA 3JC6D 4K0KT 2PMSA 4H5FA 2EHOD 4ZS9A 4ZE8A 4P09A 1EZ9A 1V9DA 3QK6A 5EK4A 3IFCA 4ASKA 2BS4A 4CN4A 2XHEB 5AQKB 2HN1A 4H9PC 4FI5A 4LP2B 4PC9A 5AQJB 4HE2A 3A7MA 1T72A 3EHTA 2ZNSA 4BDRA 2ZNUA 4YTNA 1IXGA 1Y3NA 4DXBA 3PURA 3ETUA 2OZZA 5HEOA 2XX7A 4WXJA 3HI2A 4PJMA 1FMWA 4IO4A 3I9YA 4NF0A 4ESWA 2HPLA 5LMUT 2VOZA 4HKAA 5HWXA 1XNQT 3TAJA 3FVNA 4ILCA 4R2FA 1KNRA 1YCJA 2XD2A 4JEHB 1MM6A 3IL1B 2V1DB 4G68A 5C8YE 5FP3A 3IR1A 1JNZA 3B13A 5AQSB 3HO7A 4G2ZA 1LFHA 1MQDA 2OWSA 1B2HA 2A5TB 4OVSA 5H8SA 5HXCA 2JMKA 3TMGA 4JI5T 1QKBA 2X0HA 2B3BA 5I3SA 4P0BA 1I6QA 3KC1A 5FBPA 1LRZA 1G0HA 4OFOA 3IHRA 1O7TA 2NTXA 2D3IA 3RF1A 1EYKA 1N7WA 3B7DA 1LBVA 1B7UA 5HXSA 5M2VA 5ITPA 2Z22A 1FPGA 1NV1A 2Y7WA 3FVGA 1IITA 1S35A 3RQWA 4U74A 3PPRA 1NV6A 5H8FA 2V7IA 4CXYA 1ANFA 1NV3A 4NF4B 3HA4A 1FTKA 2CXDA 4QXBB 2YDQA 5CA1E 2CEXA 1N34T 5AQHB 2VVNA 3ZJ1A 4KMCA 2XXKA 1SI1A 2ALUA 1ZKEA 3AAEB 4XKPA 1YQ3A 3OO9A 1MMNA 4MJOA 4CXXA 4NMYA 5TP9B 1B1XA 5JRCB 2X0LB 3L6HA 3ZSTA 4KI0F 2QS2A 2WWVA 1B6HA 1SPIA 2DSFA 2BBHA 5LGUB 1FBDA 4HFHA 3SWHA 2WBLA 4I4TE 1YYZA 2XQYA 2YK0A 2UYEA 2H3RA 3AECA 3UA8A 3I9WA 5KMGP 1HF8A 1LVKA 1NEKA 4GXSB 5F7VA 3E13X 3MQ9A 5ET7A 3AEGA 3W15B 4CQIA 3UQ7A 3EDVA 3OSQA 2XJ7A 3DELB 3OD7A 3KC0A 5AE4A 4FECA 3RNNA 5I56B 2V6XA 2QYWA 2ZXTA 3CQXC 4UVCB 3CG1A 2LJLA 1NV0A 4G8HA 1EU8A 2CZHA 1R8IA 3FHNA 4UVBB 3RTFB 2P1SA 3AVRA 4MHCA 4ZI3C 2Y7IA 4F1YA 2XM1A 5LBMA 2XQ9A 2X7QA 4ZEIA 5A5LA 3TZAA 5HEHA 2DYXA 2KXPB 2VKOA 2QVAA 3TTKA 2XXVA 4JI4T 1B3EA 3IX1A 4PK4A 1BIYA 2XHDA 1NV4A 4MMPA 3FXDB 4LMKA 3ZT6A 3N9QA 2QRYA 3LUYA 2XZEA 4G4PA 2I3VA 3CMLA 2ZYKA 2CHNA 3AE7A 4BA9A 3P4WA 3C35A 3N2KE 3VLVA 4KR5A 2Z8EA 2IIUA 3AA7B 2L3LA 4Z0IA 5HM4B 3CIRA 2EHOA 4KPTA 3L39A 1L0VA 1MMDA 5FY7A 2P2AA 2WDRA 4UF0B 2KMFA 1P1WA 2V7KA 4I9DA 2L5VA 3U93A 3RT8A 2H4IA 3JAEA 2IDOB 1T8BA 3QIMA 1W0BA 3C50A 3KBZA 1ZOYA 2OLBA 3JV9A 3U72A 5IYZE 3ECRA 5ET5A 2JQ9A 2JMHA 5JH7E 2HHHT 1FTJA 5I58A 1FW0A 2DWIA 4U4SA 3RUMA 4O8SA 1FCKA 3BFTA 3QOFA 4TNVA 2H89A 5HCMA 3K2DA 4MH5A 3ZSFA 3K00A 4THIA 2J4GA 2DXYA 3VR9A 1XT8A 4E7ZA 1PB8A 5F1QA 2IC9A 4UIGA 4LZ5A 4GRKA 4NTLA 1FBEA 2XWVA 4PW8A 5AQNB 1WFDA 1YPNA 5DVFA 1NUWA 1KFYA 4ELRA 1B4ZA 4JB7A 1AWBA 2LE8A 1RDYA 2V6YB 2DS9A 1ZTYA 3RGYA 3U3IA 4X65T 4JV5T 1T0KA 5JR9A 4KXPA 3T1HT 3AA6B 5B7DA 4PP0A 3MYUA 4OESA 5L3FB 2F35A 5JDFA 3UK4A 5KZTA 3RRWA 2C0SA 3PUYF 1QVSA 2XX8A 3V5AA 3BK9A 5A1LA 3H37A 3KV5A 4TX5A 3LBSA 4U2ZA 4DIDB 2WZIA 4R9FA 3VE1B 3WAFA 4KHZE 3KFWX 4YB5A 2DE4A 3JADA 3T1BA 4OVPA 4EEDA 5I5PA 1IMBA 4ZOLE 4U21A 1GQEA 4M4GA 4DI4B 4WBOA 4GLIA 1NFTA 3T9XB 2UXNB 3N6UA 3GBBA 3UTKA 4G8MA 4XF5A 5L9MA 3CR9A 1OEDB 4H63H 4G2AA 2BKOA 4PETA 5HEGA 4BDLA 4Q8RA 4N8GA 4GWOA 2WSSV 5K2XA 5AQVB 1LBWA 4AKRB 4QSEA 1D9YA 1S50A 2PFZA 5B70A 3C4ZA 3PMXA 4NGUA 1B3LA 2VVSA 4HTEA 2CMRA 3TQWA 2KZ7B 4O4HE 1YD8G 4AB5A 2RF1A 2ZYOA 1HFAA 1NMUA 3VFJA 3UUBA 2WX9A 3KV4A 4IDOA 4TLMB 2FBPA 4P1EA 2UUBT 1QUUA 4MLQA 2X66A 3B8BA 1US7B 1HSLA 5AA2D 2WM9A 4QH1A 1Z7ME 2X9HA 3BFUA 3FJ7A 3MW0A 4FBPA 4LATA 4NG7A 4PCDA 3M65A 4UVAB 3L8RA 3PMWA 3FXEB 1B52A 1YZ0A 1ZMGA 1DK4A 1HR0T 2YDSA 1MXYA 3Q25A 4NQ8A 3RY3A 2PX1A 4IIJE 1DTGA 1KK7A 2THIA 1SHZC 1FPLA 1HX8A 3PUQA 4PDHA 1MY0A 2YLNA 5EHSA 1BKAA 4N15A 4L17A 3T66A 4RK9A 3O1HA 5JTGA 1IBLT 3R6UA 2YINA 5DW8A 2KLQA 2ACXA 5EQ8A 1IMDA 4R6HA 2V8SV 1FPIA 1E1HB 3PJAA 2CMOA 2PT1A 1YXIA 2RCBA 3OO8A 5EQAA 2A5TA 4LZ7A 1H44A 4XFEA 4DV4T 5CRYA 2JRKA 3EAMA 2XTLA 5FYMA 3M3KA 3HHFA 3TLVA 3SEXA 4R73A 4JSDA 2WWUA 1BR2A 3EHUA 3VU7H 3IJXB 3CFXA 3V5UA 2XXQA 4F2OA 1MXXA 3ODBA 3A29A 3UU8A 2V4CA 4UACA 4OVQA 4NF4A 3LSXA 4EOZB 3LK2B 3N94A 4N07A 3O9PA 3PUSA 3UU5A 4IE7A 4HTGA 3KV6A 4F3GA 4Q25A 1DBZA 2QRXA 5TP9A 3WAEA 3DP7A 3AXJB 5JRCA 4ZEBA 2CA5A 2KR0A 1PC3A 2F4VT 4OENA 4N78D
chains in the Genus database with same CATH topology
3VLUA 1TFDA 2GHAA 3OENA 1A55A 3EDUA 4EIWA 5LBQB 4JBZA 4IGUA 3TODA 4XXUA 3CFZA 1QULA 2CE7A 4ZEFA 2B3FA 1Q35A 2QS3A 3G3IA 4I8CA 5I56A 1N0TA 2XXRA 3IF8B 4DNDA 1B0HA 3BBRA 4OERA 1UTBB 3RT6B 1LAHE 4IGTA 3PUGA 3MPLA 1DPEA 3FASA 2Z6EA 3E0ZA 2ES0A 4YJ3E 4TV8E 2ABHA 4GK5E 5A5XB 1HS7A 1ZLQA 4H5GA 3K6UA 4K3FA 1DSNA 4IE0A 2XUEA 5BWJA 3Q29A 3ILTB 3TEPA 4ILUA 1B46A 2DVCA 1NL5A 2ZM8A 4YHJA 1A40A 3FIRA 4P11A 2X9WA 4P0GA 3I5OA 2X68A 4MF3A 1S94A 4E0XA 3FJMA 1QW0A 2ZM0A 4XBFB 1JVYA 5J1GA 1MH3A 4RJZA 1O63A 4I43B 3O4XE 3TKDA 4UF0A 1EZPA 2DNXA 2GHBA 1IIWA 4MFIA 4Q5TA 1D0ZA 3MZKB 2KT9A 3OO6A 3H7MA 4IO2A 5JEIA 3T22A 5JDLA 4QX8B 3OOAA 2MYSA 4CI2B 1JQFA 4AKHA 1LCTA 4ANJA 3ONMA 4DCXA 2NOOA 3H6WA 5DQVA 1FTLA 1MM7A 4NUUA 2O7IA 2W0GA 2Q2AA 1B0LA 5L2LA 3E4RA 2M67A 4QFKA 2NWBA 1QJMA 3MP6A 1WDNA 5JQGE 4CI1B 5LHHB 4H9RC 1DMBA 1ZIUA 1B5HA 3FXQA 4GXAA 2CLYB 4F39A 3N9NA 3FBZA 3K6VA 4OHNA 2D5WA 3MJXA 3KOTA 1Y4CA 2O68A 3N9LA 5JDNA 4ZZAA 3LBXA 4XKNA 1GR2A 3IK6B 4P0AA 5I84A 1AL3A 4R75A 1P1NA 4WBNE 4TQUQ 2UVGA 5DVJA 5M4YA 5I2KB 1XOCA 3TQLA 3PUYE 3T9VA 4OEVA 3T9UA 3KBUA 1NNPA 1B5IA 4H63V 3NRYA 2PBWA 4IY5A 1BR4A 3KZGA 2ONKE 5ETWA 1N7XA 3IO4A 3V83A 3HKEE 1TT1A 2DWHA 3FUZA 1URGA 2E9XB 2M8CA 4O3BA 2QL3A 2JJ9A 1BLFA 3U78A 4NF5B 2H9BA 2VP1A 2ONRA 3KN8A 4OXVA 3V89B 2HQ0A 2V3TA 4YKIA 3VVDA 5I57B 3ZMSB 3VVEA 1MQHA 4F2QA 4RY1A 5JR9C 4H65A 2PG8A 2VKJA 2AL5A 1Y9UA 4OTEA 1MQJA 4H9OC 2SPCA 1URDA 1G73A 4H8JA 3FVOA 4I50E 1FTMA 5LGTB 3GLBA 3GA8A 5LGNB 3MWBA 1H7CA 4LQ2A 3MVWA 3IAZA 3E08A 2ZYNA 2XXIA 2H7OA 1LLSA 3LSWA 1NNTA 2R71A 3C36A 2I0BA 3KJ7A 3IEEA 3MZBA 1MIYA 3DLNA 4GL8A 2XAQB 2DVZA 2JPFA 4AKGA 2GK9A 1B3HA 2K9AA 3ZEFB 4TV9E 4TN7B 2HCAA 4ADZA 2LEHA 2K5BB 4U4XA 1M5EA 5KX5E 1XS5A 4F6RC 4NUVA 3ZKKA 3THIA 5CM6A 3E9XA 3DTOA 1MDQA 2PBIA 2B65A 4IDZA 4U72A 2OBGA 2J1DG 4EYUA 2A72A 3I6VA 2VASA 1CE2A 2RA1A 4X9TA 4XTCQ 5E0OA 4XZCA 3EUHA 5FTIA 1USYE 1X79A 1F9BA 3CIJA 4KYDA 3LFMA 1SDXA 4GD5A 1IJ5A 3UUMA 1M5CA 2X67A 4ZS2A 3C51A 3MZ1A 4UXNB 3CSBA 5DEXB 4H67A 1VOMA 2AL4A 4ONYA 3E22E 3C4WA 4JWXA 1Y3PA 2X9XA 5HBCA 3B6WA 5FY1A 4X20E 4O4IE 4BJMA 4JDFA 3MXZA 3N2GE 1AMFA 5JDQA 4ZI7E 3FGSA 2E9XD 2OWTA 3OBVE 3ZN1B 3KFMA 3MVYA 4MLKA 3H6VA 4AKLA 2LSYA 4EAHA 2ZMBA 1QSDA 4PJJA 4F19A 1D1AA 5H8NB 3WAJA 4J2CA 3ZLIA 4A56A 1UTBA 1LAXA 2A5SA 5DTBA 2X51A 4HFVA 4ISTA 2OK2A 1MIVA 3IB1A 2I4CA 4G77A 4MBPA 1Q1KA 2RCAA 5I2NB 4F29A 1MY4A 1HSEA 3FD3A 4UELA 5A5XA 5JDGA 1MXUA 4NF6B 1XC1A 4EQ7A 4AXPA 1XVYA 1S9TA 1WVJA 1FTOA 1YKHB 1SW2A 1B9JA 3SRZA 2RINA 3M8UA 4YAHX 3CX8B 2NW9A 2XAFB 4MBQA 1MPBA 2UVHA 4YB7A 4FE8A 1R6ZA 4ZE9A 2KINB 2QS4A 2P9BA 3K3NA 2X9YA 1NWMX 4YMAA 2XX9A 3W15C 4EZHA 3K3OA 2QPQA 2Q9QD 5FHNA 2O6AA 4AQFC 2JQQA 3K01A 2VD3A 3OYXA 1LSTA 2XXUA 4UEMA 1B3FA 2W62A 3VKGA 4N6PA 2XAGB 2Y8DA 4GFRA 4U1OA 3L09A 4KQPA 3J7Yq 2PT2A 5LG4A 3TKLB 4OWDA 2F5XA 1B7TA 4GYRA 3Q28A 2LOPA 3PD9A 5I59A 4PFWA 3O2AA 3Q27A 4PFYA 2DI4A 2XXHA 3HN0A 3PUXE 4QKNA 3RLFE 5AA2B 3CSGA 3N2OA 4ISSA 5JDMA 5DYHA 1LAFE 5I2KA 3N6TA 3O1JA 5CBSA 3GXAA 1HTJF 1HCIA 2RC7A 2QSXA 4IO5A 1LGBC 4F18A 2I59A 2LT3A 5H8HB 5HXHA 5LXTE 2E9XA 3VHLA 3KN3A 5FNVE 5LYJE 2WMNA 4NF5A 3PPPA 3IOVA 4IO6A 4L0RA 5GONE 1N3XA 3IOWA 5JTYB 3HL6A 2DWKA 3U92A 1UIUA 3CX6B 2GRVA 2I58A 4RYAA 1CB6A 3O97A 2DWJA 1ZEEA 5I57A 4O4JE 1AIVA 2D0TA 2CWYA 3WAKA 3S4UA 4RK2A 2RP4A 4MLVA 1A54A 5LHIB 1KWHA 3PMVA 2HFBA 2IAKA 3OSRA 3QYTA 2PVUA 3N5LA 1B40A 3SS1A 3OEMA 1UTHB 4DXUA 4R6YA 4DMWA 4JWYA 3IO6A 2QJEA 3CFLA 2XD3A 2V7LA 1N76A 1NNFA 2V93A 1Y20A 3PD8A 2VKHA 3K1PA 1H76A 2R9JA 4DVDA 4NF8B 1SVXB 3U8QA 3ZKLA 1IZ1A 1VR5A 4LVQA 5LOMA 1B4HA 4ELQA 2LHNA 5H6RB 1M5BA 4R9GA 3RX6A 2OA5A 5AA4B 2QGSA 3CQGB 4FATA 3AA0B 4QFPA 2Y48B 2NW7A 2KWIB 4GL0A 4WEDA 2VHAA 4RA1A 1USYH 2ZNTA 4OK0A 2C5IT 1CUNA 3C31A 1JW4A 2F6GA 2Y7KA 3FBLA 2V25A 3G3FA 4X1DA 4TZ4C 3S9MC 5CA0E 1MH4A 1O3XA 3CI8A 3G7WA 1JW5A 2REJA 3PUWE 4EXTA 4YKPA 1R1NA 5JREA 4GQOA 1FMVA 2D0UA 1ZHCA 1MMGA 5LHGB 5LNKA 3ESLA 4MALA 3SEVA 4IY6A 1ATGA 2DWGA 1D1BA 2XASB 5DJQC 4QHQA 3MVZA 2Z8FA 3ZYLA 2IA4A 4H0WA 2FYIA 5H8NA 4NE4A 3GWHA 2WMOA 5H8QB 2F7BA 3SERA 3UIFA 1IZNB 1WR6A 3H03A 4E0WA 4LA9A 1JEVA 4IB2A 5FTHA 5I2NA 3OMBA 3LC8A 2MOZA 2Q88A 2K24A 4C90A 4NF6A 3FV2A 2Y7PA 2LOSA 1NKXA 2BVLA 4O2BE 3Q26A 4HW8A 3HKDE 3ZYKA 2XAJB 2X7PA 1NH8A 2WKYA 3M3LA 2HPJA 2GH9A 4KYSA 3ZPOA 3C4MA 3KV9A 1JW1A 1MY1A 3LJCA 1ZU0A 2XAHB 1TXFA 1NH7A 4YB6A 4H9QC 4CXWA 4GIWA 2DXRA 3KEIA 3VLWA 4AQFA 2PFVA 1JVXA 3PU3A 3O6HA 4O2AE 3EPEA 3HHGA 3C64A 4KUMB 4L9IA 1SI0A 4JUYA 1FQAA 4F3BA 2CM0A 4PFTA 3O29A 4BAYB 3H4ZA 3SEYA 3MVXA 4EQBA 1VFDA 4F1UA 4GOTA 3IBPA 4RPOA 1PEBA 4ZEKA 5J2TE 5EYFA 1R9LA 2C5JA 5TPAB 4ZI2D 1MNEA 1NAFA 3PV0E 3R6NA 1WYCA 3HCQA 3R7XA 1SD3A 5J2UE 4HCYA 2LSGA 3KBRA 2A3DA 4QFLA 4G8NA 5EZYE 2CXFA 5H6QB 4POXA 4AQGA 1H45A 3S2VA 5ADXL 1QUIA 4U23A 2QA7A 3PU5A 4QWNB 4QRZA 4F31B 1IAPA 5AA2A 1LKXA 4EXKA 4CZZB 4B6XA 4OEUA 4QFNA 2LSIA 5DVIA 2HZKA 4KBMB 2UXAA 3IB0A 4IGRA 4ZDMA 3OKQA 2MBGA 4PK5A 4G63A 5DQWA 4X1YE 2Q9TA 1N04A 3SEUA 2UXXB 1QUKA 5BUUA 1N3WA 5JVDE 2RKMA 2Y84A 1YAEA 3GMIA 5F3JA 3ZMUB 5LOVE 3BQKA 1IXCA 3O6IA 4AKIA 2NVUB 1PB7A 4BDMA 3A09A 1SYIA 5H8HA 2H7VC 4UA8A 5L9OA 2VL8A 4PK6A 1MXZA 3UULA 1PBPA 3IOTA 4ZS3A 3I3VA 4QSDA 1YKEB 4Q30B 4DBRA 5JTYA 1LB8A 2CLYC 4QFOA 4YKJA 5KDTB 2Q2CA 5AA1A 3IOUA 4XKQA 1H43A 2G93A 3KOSA 4EB6E 1UX4A 3RYFE 1IXHA 4DDDA 1IQ7A 5EK3A 1GV8A 2L8KA 1VSOA 3KDSE 1MXVA 1EZ3A 3G3GA 4OQOA 5HAXA 2BZBA 1B7HA 4WNKA 1VRBA 1MDP1 3UT5E 1A99A 4IE5A 1BR0A 1DTZA 3UUXB 5F8PA 2VWAA 3VDFA 1KNZA 4NWCA 3TFLA 3LSFB 2QS1A 3ZC0A 3IORA 1UQWA 2AYSA 4R2BA 2LHRA 1PDAA 3RRCA 2I3WA 3WI3A 1UIVA 1US5A 5TU0A 1IEJA 4FAJA 2E9XC 5AA4A 4WW0A 5ICQA 3KG2A 3NZPA 3TCGA 3PU8A 3NZQA 1D0XA 3VKHA 1HSJA 2BVMA 1AOVA 4OMBA 4KD5A 3V8XB 5KCJB 1I6AA 1URSA 1MG1A 5CB4E 2VD2A 2XXWA 3QC9A 3KBTA 3TCHA 2V3QA 2W61A 2H98A 3PPNA 4X48A 2HAVA 2VKDA 3F11A 3UFEA 3TTLA 4AB6A 1NNKA 2UYFA 5AA3A 1L5TA 4R6KA 4ZZEA 2FNCA 2F7CA 3ZN0B 3TCFA 5HYAA 1SA0E 2DQVA 1XVXA 3RYCE 3ZS6A 3P8CD 4IE4A 2DE3A 3KVAA 1B51A 3T96B 1FQBA 1QUJA 2E0SA 1OVBA 4HN9A 2F97A 1DOTA 4TOZA 3EQ1A 3NBXX 3Q9DA 5FHMA 4PJNA 2E1SA 2Q9QB 3KSJA 2Q9QC 3ZMVB 2O1MA 4H9SE 5H8QA 2I49A 2P0SA 2XXTA 4OVJA 1EH3A 1LVFA 4DCYA 1FEWA 3UGWA 2G0UA 1LAGE 3RYIE 4PNIA 4RPNA 1RKMA 1A8EA 3PPQA 3P7IA 3RH3A 3O28A 2LSJA 3MP1A 3D0TA 4I62A 1GVCA 3RC3A 2WAUA 4O3CA 1A8FA 2NP9A 1TWYA 1POY1 2Q89A 3SOLA 4NWDA 3N9OA 2D21A 4ZECA 1Y3QA 1SQYA 2H99A 1LFGA 3V5SA 5TAOA 1D9VA 2HXWA 2KLFA 3CRBA 4TUYE 2W00A 1U5PA 4QSCA 2IW5B 3C9HA 4MFRA 3RKOA 3VXBA 3A5XA 4E7SA 2G29A 4RXLA 4YZZA 3W9WA 2E8IA 2ZMAA 2NW8A 4OHFA 2NWJA 4XAXB 4POWA 1M5DA 4EXLA 2DWAA 2DOJA 4HCWA 3SETA 2K48A 2H25A 5ELVA 3EHSA 5TPAA 2VK9A 1GGGA 3PTRB 4H8IA 3F31A 3OEKA 3ANWB 2DCFA 3R84B 4HGAA 3MPKA 5IHYA 5L3EB 3PE0A 4O3AA 4BDQA 4YFSA 4DIGA 4KYEA 3UN6A 2F36A 3ONXA 4U2RA 2GFEA 3CQCB 2HZLA 3H6TA 4QXHB 2QMWA 3TYHA 3I0OA 4YU0A 2B1EA 1FIOA 3A3CA 4F3SA 3U94A 1MPCA 2QMXA 3U1OA 4X1KE 1B32A 5EK2A 3T8OA 5L3GB 3TPAA 3UP9A 1R9QA 1PB9A 2N2NA 3DJBA 1IXIA 1H3DA 4DZ1A 1SW1A 1FQDA 3MACA 3HR0A 2D5UA 1MNDA 3EVYA 3PDYA 3HSTA 4QHOA 3PGFA 4ZEDA 3MC2A 3FVKA 4H1XA 3R26A 2L9QA 3LG7A 2O69A 4ZHQE 1US4A 1JETA 3MAMA 3RQTA 5KDTA 3TTRA 4ELPA 1G8XA 2F34A 4Z7EA 3O66A 3KGCA 2YU1A 1VE4A 2O7UA 2O84X 1MQIA 5ISUA 1LFIA 1ZV4X 1B05A 3C34A 3Q2MA 3PUVE 4IE6A 2RC8A 2ZM2A 2DLRA 5CMMA 4Q0CA 4OETA 4AQ4A 1RYOA 1SW5A 3OXNA 3KN7A 3MA9A 4V1Av 3QXMA 4EQ9A 1HG5A 2FA7A 4P0IA 5CI5A 5IAIA 4BLAA 1GTKA 3ZJ2A 2CZLA 3AA1B 4BDOA 4H6DA 3FZVA 4GIZA 3FB2A 3FXRA 3RTWB 1A7LA 2ONSA 4QX7B 1LBBA 4DMVA 4ERRA 4OFLA 2IC6A 3ZCJA 5L3BB 1ZKBA 5JK4A 4IHJE 5FXXA 5HWYA 4LUBA 5KCJA 2H5YA 2I4BA 2I0CA 5ICTA 2I6EA 3CKDA 1JNFA 2C5KT 4WKMA 2MTQA 3H06B 5ITOA 1J1NA 2N9DA 3UORA 4FJOA 4IO3A 1SW4A 1ZBMA 3H3AA 5AFUL 3S9EA 5DABA 5JDHA 3AAAB 2ODVA 2OJTA 3TTNA 1MMAA 4F1VA 1OLCA 3LSLA 3LBXB 2F8DA 4OYKA 4JSOA 2NOXA 1POTA 5BMVE 4RNSA 4C1UA 4GYSA 4FORA 1LBCA 1OXZA 4ZI3D 3GZGA 3TUSA 2UVIA 1OWAA 5FMNA 5L3CB 4NEDA 2DHRA 4YKKA 2Q9QA 2PYYA 3BQIA 3AVSA 3K1MA 3KSXA 4I55E 5LJNA 1JEUA 1RYXA 1Y1MA 4PE5B 3GN5B 3SESA 2VB6A 3C98B 3DP4A 4HE8A 4I1DA 4TLLB 2YPNA 3IB2A 3O9XA 2CCQA 3CWZB 3OJAA 1ZJLA 4HS7A 4ZI2C 3RYHE 1MY3A 3AAIA 3CVGA 5HPQA 2ESNA 1HG2A 2ANJA 3IJOB 5CMCA 5IKBA 2O1LA 5DEXA 4FEDA 5CC2A 1OMPA 3H6UA 1MRPA 2R6GE 2W7YA 3LR1A 1Y1ZA 4JXIA 1MY2A 4R74A 1I69A 3AXFA 5FY0A 5LA6E 3FV1A 4EYYR 4DLDA 3MP8A 4UV8B 1MXWA 1OLAA 4LONB 2UVJA 3EF7A 3JYRA 3K02A 5CMKA 3D4GA 4O4LE 3DM0A 3BKIB 3S9NC 3N26A 4OFZA 4U1ZA 3LK3B 3N9PA 2YEVC 4M1PA 4F22A 2LM9A 1XHYA 3HKBE 1OQHA 3ZMTB 1UCUA 2Y7RA 1U4QA 3RPWA 5J1DA 4C0RA 4X1IE 1BTJA 3FATA 1WRDA 4GK0E 3QAXA 3F57A 2ODUA 1OQGA 2OCUA 5HXEA 2DE2A 4PAGA 2LAOA 4EUOA 3ANWA 5K2YA 2REGA 3QUFA 3SEWA 1EZOA 4K0UA 1LCFA 3KJTA 3I0QA 1VFEA 4ELOA 4EF1A 4QF9A 2NUVA 3Q5WA 5L8DA 3ILUB 3G3JA 3K1NA 3FXUA 4ECFA 1UX5A 5LCYA 3RPUA 4UV9B 1II5A 4KP3C 4PFOA 3TDJA 4BJNA 1WYBA 3C32A 3S9LC 1T98A 3FJGA 3HPIA 2F78A 1O64A 2PJQA 4GVOA 4XKRA 1MS7A 1P99A 1QKAA 3I1AA 1FQEA 3SDFA 3KVBA 4LZ8A 4OFJA 3K8PC 4KI0E 1Z0PA 4G68B 4JEUB 1B5JA 2AIXA 4PQJA 4G68C 4FEBA 1LB9A 1OVTA 4PFPA 4HEAA 3LK42 5EHMA 3DP6A 3TTMA 4LQ5A 3W9VA 2I48A 1S7YA 4YJ2E 1IUDA 1PBQA 4OYVA 4X1BA 3ETVA 2CEAA 4EDPA 4ND9A 3O1IA 2Y6XA 2V26A 5H8FB 4XIGQ 3GBAA 4JWOA 2Z8DA 5LJMA 3VV5A 3HKCE 4EZ4A 2IEEA 4AI6A 3G3KA 1ELJA 2NTYA 3HV1A 3K0VA 4ISUA 2HAUA 2XXXA 1IJ6A 1YTVA 4C1TA 3MBPA 5FXVA 1MPDA 3O6GA 4DO0A 2NXOA 5LP6E 3UUNA 4Z8XA 5DT6A 3NRXA 2DP8A 3RC8A 3F2EA 3ZCIA 2RC9A 3CVRA 2KNDA 2W63A 3CPZA 2Z23A 3BQLA 4JLEA 1B58A 1TFAA 2LSKA 1P1QA 2YJPA 3A3UA 1AH5A 3K3QC 4GOUA 4QXCB 3OO7A 2N1GA 3CG3A 3B6TA 5CMBA 1FQCA 3D4CA 4FIMA 1B3GA 1D1CA 3KINB 3OYZA 5CBRA 3K6XA 1D4NA 3B6QA 3K4UA 5FXZA 4L5GA 2V84A 3VVFA 3T9HB 2KWHA 2Q8JA 1SYHA 1SBPA 1D3KA 2VGQA 4OYJA 2HH7A 1FQFA 2ZYMA 4YICA 1N84A 5I59B 2X26A 3T93B 2BDEA 2XXPA 1UTHA 4IO7A 1MQGA 3QSLA 1Y4TA 4F3PA 2EHOB 3JC6C 2EHOC 4ESXA 4M1VA 4KFQA 4NF8A 3MUQA 1Y64B 3PUAA 3SKPA 1DPPA 3E3KA 3DP8A 4N13A 1P1UA 3RN8A 3QUJA 3MZ9A 3Q5XA 5I58B 3MJNA 4FJPA 2HEUA 3G3HA 1Z7NE 1D0YA 4OZ9A 4EF2A 3CX7B 3VXCA 3JZJA 3TELA 2YU2A 3L3PA 4DXCA 4R72A 3AB3B 2XXYA 2V7JA 3C4XA 4PFUA 3GN5A 3MK7C 3J9X1 1P1OA 4KCDA 5L9SA 2O51A 5FHOA 4H9NC 4YLHA 5JR9B 1BP5A 2D2SA 3ZYMA 1WLXA 4YMBA 2CWOA 3ZC1A 5FXWA 4GF8A 4BDNA 1AJ3A 1BR1A 3H3GA 4WEPA 4U22A 3C33A 5KDMC 2CXLA 4DE8A 1B7ZA 2F6PA 3PPOA 2ZLYA 1OIBA 4DBQA 2BJJX 3B57A 4CI3B 3M3FA 3OELA 3ZMZB 3MKDA 1M5FA 3K6WA 3PUZE 4PJLA 5HXRA 4C91A 2A2FX 1WODA 1I6BA 3USDA 3L6GA 1MIWA 3N9MA 2V3UA 4KCCA 3EN3A 2F7AA 2V7MA 1YW0A 5L3DB 1B1HA 3JC6D 2PMSA 4H5FA 2EHOD 4ZS9A 4ZE8A 4P09A 1EZ9A 1V9DA 3QK6A 5EK4A 4ASKA 2XHEB 4H9PC 4FI5A 4LP2B 3EHTA 2ZNSA 4BDRA 2ZNUA 1IXGA 1Y3NA 4DXBA 3PURA 3ETUA 2OZZA 2XX7A 4WXJA 3HI2A 4PJMA 1FMWA 4IO4A 3I9YA 4ESWA 2HPLA 2VOZA 4HKAA 5HWXA 3TAJA 3FVNA 4R2FA 1YCJA 2XD2A 4JEHB 1MM6A 3IL1B 2V1DB 4G68A 5C8YE 5FP3A 3IR1A 3B13A 3HO7A 4G2ZA 1LFHA 1MQDA 2OWSA 1B2HA 2A5TB 5H8SA 5HXCA 2JMKA 3TMGA 1QKBA 2B3BA 4P0BA 1I6QA 1LRZA 4OFOA 3IHRA 1O7TA 2NTXA 2D3IA 1N7WA 5M2VA 3B7DA 1B7UA 5HXSA 5ITPA 2Z22A 2Y7WA 3FVGA 1IITA 1S35A 4U74A 3PPRA 5H8FA 2V7IA 4CXYA 1ANFA 4NF4B 3HA4A 1FTKA 2CXDA 4QXBB 5CA1E 3ZJ1A 4KMCA 1SI1A 2ALUA 1ZKEA 3AAEB 4XKPA 3OO9A 1MMNA 4CXXA 4NMYA 5TP9B 1B1XA 5JRCB 2X0LB 3L6HA 2QS2A 1B6HA 2DSFA 5LGUB 3SWHA 2WBLA 4I4TE 2XQYA 2YK0A 2UYEA 2H3RA 3UA8A 3I9WA 5KMGP 1HF8A 1LVKA 4GXSB 5F7VA 3E13X 3MQ9A 3W15B 4CQIA 3EDVA 3OSQA 3DELB 3OD7A 5AE4A 4FECA 3RNNA 5I56B 2ZXTA 3CQXC 4UVCB 3CG1A 2LJLA 4G8HA 1EU8A 3FHNA 4UVBB 3RTFB 2P1SA 3AVRA 4MHCA 4ZI3C 2Y7IA 4F1YA 2X7QA 5LBMA 4ZEIA 3TZAA 2DYXA 2KXPB 2VKOA 3TTKA 2XXVA 1B3EA 3IX1A 4PK4A 1BIYA 2XHDA 3FXDB 3N9QA 2QRYA 3LUYA 4G4PA 2I3VA 3CMLA 2ZYKA 4BA9A 3C35A 3N2KE 3VLVA 4KR5A 2Z8EA 3AA7B 2L3LA 4Z0IA 5HM4B 2EHOA 4KPTA 1MMDA 5FY7A 2P2AA 4UF0B 2KMFA 1P1WA 2V7KA 4I9DA 3U93A 3RT8A 2H4IA 3QIMA 3C50A 2OLBA 3JV9A 3U72A 5IYZE 3ECRA 2JMHA 5JH7E 1FTJA 5I58A 1FW0A 2DWIA 4U4SA 3RUMA 4O8SA 1FCKA 3BFTA 3K2DA 4MH5A 3ZSFA 3K00A 4THIA 2DXYA 1XT8A 4E7ZA 1PB8A 5F1QA 2IC9A 4UIGA 4LZ5A 4GRKA 4NTLA 4PW8A 1YPNA 5DVFA 4ELRA 1B4ZA 4JB7A 2LE8A 2DS9A 1ZTYA 3RGYA 3U3IA 1T0KA 5JR9A 3AA6B 5B7DA 4PP0A 4OESA 5L3FB 2F35A 5JDFA 3UK4A 5KZTA 3RRWA 2C0SA 1QVSA 3V5AA 2XX8A 3BK9A 5A1LA 3H37A 3KV5A 4TX5A 3LBSA 4R9FA 3VE1B 3WAFA 4KHZE 3KFWX 4YB5A 2DE4A 4ZOLE 4U21A 4M4GA 4WBOA 4GLIA 1NFTA 3T9XB 2UXNB 3N6UA 3GBBA 3UTKA 4G8MA 5L9MA 3CR9A 4H63H 4G2AA 4PETA 4BDLA 4Q8RA 4GWOA 2WSSV 5K2XA 4AKRB 4QSEA 1D9YA 1S50A 5B70A 3C4ZA 3PMXA 1B3LA 4HTEA 2CMRA 3TQWA 2KZ7B 4O4HE 1YD8G 4AB5A 2RF1A 2ZYOA 1HFAA 1NMUA 3VFJA 3KV4A 4TLMB 1QUUA 4MLQA 2X66A 1US7B 1HSLA 5AA2D 1Z7ME 2WM9A 2X9HA 3BFUA 3FJ7A 3MW0A 4LATA 3M65A 4UVAB 3PMWA 3FXEB 1B52A 1ZMGA 1MXYA 3Q25A 3RY3A 2PX1A 4IIJE 1DTGA 1KK7A 2THIA 1SHZC 1HX8A 3PUQA 1MY0A 2YLNA 5EHSA 1BKAA 4L17A 3T66A 4RK9A 3O1HA 3R6UA 2YINA 2KLQA 2ACXA 4R6HA 1E1HB 2CMOA 2PT1A 2RCBA 3OO8A 2A5TA 4LZ7A 1H44A 5CRYA 2JRKA 2XTLA 5FYMA 3M3KA 3HHFA 3SEXA 4R73A 4JSDA 2WWUA 1BR2A 3EHUA 3VU7H 3IJXB 3CFXA 3V5UA 2XXQA 4F2OA 1MXXA 3ODBA 4UACA 4NF4A 3LSXA 4EOZB 3LK2B 3N94A 4N07A 3O9PA 3PUSA 4IE7A 4HTGA 3KV6A 4F3GA 5TP9A 3WAEA 3DP7A 5JRCA 4ZEBA 2CA5A 1PC3A 4OENA 4N78D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLU A;  1TFD A;  2GHA A;  3OEN A;  1A55 A;  4JBZ A;  3TOD A;  4XXU A;  3CFZ A;  1QUL A;  4ZEF A;  2B3F A;  1Q35 A;  2QS3 A;  3G3I A;  4I8C A;  5I56 A;  1N0T A;  2XXR A;  4DND A;  1B0H A;  3BBR A;  4OER A;  1UTB B;  3RT6 B;  1LAH E;  4IGT A;  3MPL A;  1DPE A;  3FAS A;  2ABH A;  5A5X B;  1ZLQ A;  4H5G A;  3K6U A;  4K3F A;  1DSN A;  5BWJ A;  3Q29 A;  3ILT B;  3TEP A;  1B46 A;  2DVC A;  1NL5 A;  1A40 A;  3FIR A;  4P11 A;  2X9W A;  4P0G A;  3I5O A;  4MF3 A;  4E0X A;  3FJM A;  1QW0 A;  1JVY A;  1MH3 A;  4RJZ A;  1O63 A;  3TKD A;  1EZP A;  2GHB A;  1IIW A;  4MFI A;  4Q5T A;  3OO6 A;  3H7M A;  4IO2 A;  5JEI A;  3T22 A;  3OOA A;  1JQF A;  1LCT A;  3ONM A;  4DCX A;  2NOO A;  3H6W A;  1FTL A;  1MM7 A;  2O7I A;  2Q2A A;  1B0L A;  3E4R A;  4QFK A;  1QJM A;  3MP6 A;  1WDN A;  1DMB A;  1ZIU A;  1B5H A;  3FXQ A;  4GXA A;  4F39 A;  3K6V A;  4OHN A;  2D5W A;  3KOT A;  1Y4C A;  2O68 A;  4ZZA A;  4XKN A;  1GR2 A;  3IK6 B;  5I84 A;  1AL3 A;  4R75 A;  1P1N A;  4TQU Q;  2UVG A;  5DVJ A;  5I2K B;  1XOC A;  3TQL A;  3PUY E;  3T9V A;  4OEV A;  3T9U A;  1NNP A;  1B5I A;  2PBW A;  4IY5 A;  3KZG A;  2ONK E;  1N7X A;  3IO4 A;  3V83 A;  1TT1 A;  2DWH A;  3FUZ A;  1URG A;  2M8C A;  4O3B A;  2QL3 A;  1BLF A;  4NF5 B;  2H9B A;  2VP1 A;  2ONR A;  3KN8 A;  4OXV A;  3V89 B;  2HQ0 A;  2V3T A;  4YKI A;  3VVD A;  5I57 B;  3VVE A;  1MQH A;  4F2Q A;  4RY1 A;  4H65 A;  2AL5 A;  1Y9U A;  4OTE A;  1MQJ A;  1URD A;  4H8J A;  3FVO A;  1FTM A;  3GLB A;  3MWB A;  1H7C A;  4LQ2 A;  3MVW A;  3IAZ A;  2ZYN A;  2XXI A;  1LLS A;  3LSW A;  1NNT A;  2R71 A;  3C36 A;  2I0B A;  3KJ7 A;  3MZB A;  3DLN A;  4GL8 A;  2DVZ A;  1B3H A;  2HCA A;  4U4X A;  1M5E A;  1XS5 A;  5CM6 A;  3ZKK A;  3THI A;  3E9X A;  1MDQ A;  2B65 A;  2OBG A;  3I6V A;  1CE2 A;  4X9T A;  4XTC Q;  5FTI A;  1USY E;  1F9B A;  3CIJ A;  4KYD A;  1SDX A;  4GD5 A;  1IJ5 A;  1M5C A;  3MZ1 A;  3CSB A;  5DEX B;  4H67 A;  2AL4 A;  4ONY A;  4JWX A;  1Y3P A;  2X9X A;  5HBC A;  3B6W A;  4JDF A;  3MXZ A;  1AMF A;  3FGS A;  2OWT A;  3KFM A;  3MVY A;  3H6V A;  2ZMB A;  1QSD A;  4F19 A;  5H8N B;  4J2C A;  1UTB A;  1LAX A;  2A5S A;  5DTB A;  2OK2 A;  3IB1 A;  2I4C A;  4G77 A;  4MBP A;  1Q1K A;  2RCA A;  5I2N B;  4F29 A;  1MY4 A;  1HSE A;  3FD3 A;  5A5X A;  1MXU A;  4NF6 B;  1XC1 A;  4EQ7 A;  1XVY A;  1S9T A;  1WVJ A;  1FTO A;  1SW2 A;  1B9J A;  2RIN A;  3M8U A;  4YAH X;  2UVH A;  1MPB A;  4YB7 A;  4FE8 A;  1R6Z A;  4ZE9 A;  2QS4 A;  2X9Y A;  4YMA A;  2XX9 A;  3W15 C;  2QPQ A;  5FHN A;  2O6A A;  3K01 A;  2VD3 A;  1LST A;  2XXU A;  1B3F A;  4N6P A;  4GFR A;  4U1O A;  4KQP A;  2PT2 A;  3TKL B;  4OWD A;  2F5X A;  3Q28 A;  3PD9 A;  5I59 A;  4PFW A;  3O2A A;  3Q27 A;  4PFY A;  2XXH A;  3HN0 A;  3PUX E;  3RLF E;  5AA2 B;  3CSG A;  5DYH A;  1LAF E;  5I2K A;  3N6T A;  5CBS A;  3GXA A;  2RC7 A;  2QSX A;  4IO5 A;  1LGB C;  4F18 A;  5H8H B;  3KN3 A;  4NF5 A;  3PPP A;  3IOV A;  4IO6 A;  4L0R A;  1N3X A;  3IOW A;  5JTY B;  3U92 A;  1UIU A;  2GRV A;  2I58 A;  4RYA A;  1CB6 A;  3O97 A;  2DWJ A;  5I57 A;  1AIV A;  3S4U A;  4RK2 A;  4MLV A;  1A54 A;  1KWH A;  3PMV A;  2HFB A;  3OSR A;  3QYT A;  2PVU A;  3N5L A;  1B40 A;  3OEM A;  1UTH B;  4DXU A;  4R6Y A;  4JWY A;  3IO6 A;  2QJE A;  3CFL A;  2XD3 A;  1N76 A;  1NNF A;  2V93 A;  1Y20 A;  3PD8 A;  3K1P A;  1H76 A;  2R9J A;  4NF8 B;  1SVX B;  3U8Q A;  3ZKL A;  1IZ1 A;  1VR5 A;  4LVQ A;  5LOM A;  1B4H A;  4ELQ A;  1M5B A;  4R9G A;  5AA4 B;  4FAT A;  4QFP A;  4GL0 A;  2KWI B;  4WED A;  2VHA A;  4RA1 A;  1USY H;  2ZNT A;  2C5I T;  3C31 A;  1JW4 A;  2F6G A;  2Y7K A;  2V25 A;  3G3F A;  4X1D A;  3S9M C;  1MH4 A;  3CI8 A;  3G7W A;  1JW5 A;  2REJ A;  3PUW E;  4YKP A;  1R1N A;  4GQO A;  3SEV A;  4IY6 A;  1ATG A;  4QHQ A;  3MVZ A;  2Z8F A;  2IA4 A;  4H0W A;  2FYI A;  5H8N A;  4NE4 A;  5H8Q B;  2F7B A;  3SER A;  3UIF A;  3H03 A;  4E0W A;  4LA9 A;  1JEV A;  4IB2 A;  5FTH A;  5I2N A;  3OMB A;  3LC8 A;  2Q88 A;  4NF6 A;  3FV2 A;  2Y7P A;  1NKX A;  3Q26 A;  4HW8 A;  2X7P A;  1NH8 A;  2WKY A;  3M3L A;  2GH9 A;  4KYS A;  3C4M A;  1JW1 A;  1MY1 A;  1ZU0 A;  1TXF A;  1NH7 A;  4YB6 A;  2DXR A;  3KEI A;  3VLW A;  1JVX A;  3O6H A;  3EPE A;  3HHG A;  1SI0 A;  1FQA A;  4F3B A;  4PFT A;  3O29 A;  3H4Z A;  3SEY A;  3MVX A;  4EQB A;  1VFD A;  4F1U A;  4GOT A;  4RPO A;  1PEB A;  4ZEK A;  5EYF A;  1R9L A;  2C5J A;  5TPA B;  3PV0 E;  3HCQ A;  3R7X A;  1SD3 A;  4HCY A;  3KBR A;  4QFL A;  4G8N A;  4POX A;  1H45 A;  3S2V A;  1QUI A;  4U23 A;  3PU5 A;  4QRZ A;  4F31 B;  5AA2 A;  4EXK A;  4B6X A;  4OEU A;  4QFN A;  5DVI A;  2HZK A;  2UXA A;  4IGR A;  3IB0 A;  4ZDM A;  2MBG A;  1N04 A;  2Q9T A;  3SEU A;  1QUK A;  5BUU A;  1N3W A;  2RKM A;  2Y84 A;  1YAE A;  1IXC A;  3O6I A;  2NVU B;  1PB7 A;  4BDM A;  3A09 A;  1SYI A;  5H8H A;  4UA8 A;  5L9O A;  1MXZ A;  1PBP A;  3IOT A;  3I3V A;  4QSD A;  4Q30 B;  5JTY A;  1LB8 A;  4QFO A;  4YKJ A;  5KDT B;  2Q2C A;  5AA1 A;  3IOU A;  4XKQ A;  1H43 A;  2G93 A;  3KOS A;  1IXH A;  4DDD A;  1IQ7 A;  1GV8 A;  1VSO A;  1MXV A;  3G3G A;  4OQO A;  1B7H A;  1MDP 1;  1DTZ A;  1A99 A;  3VDF A;  4NWC A;  3TFL A;  3LSF B;  2QS1 A;  3IOR A;  1UQW A;  2AYS A;  4R2B A;  1PDA A;  2I3W A;  1UIV A;  1US5 A;  5TU0 A;  1IEJ A;  4FAJ A;  5AA4 A;  5ICQ A;  3KG2 A;  3TCG A;  1HSJ A;  1AOV A;  4OMB A;  4KD5 A;  3V8X B;  5KCJ B;  1I6A A;  1URS A;  1MG1 A;  2XXW A;  2VD2 A;  3TCH A;  2V3Q A;  2H98 A;  3PPN A;  4X48 A;  2HAV A;  3F11 A;  3TTL A;  4AB6 A;  1NNK A;  2UYF A;  5AA3 A;  1L5T A;  4R6K A;  4ZZE A;  2FNC A;  2F7C A;  3TCF A;  2DQV A;  1XVX A;  3ZS6 A;  2DE3 A;  1B51 A;  3T96 B;  1FQB A;  1QUJ A;  2E0S A;  1OVB A;  2F97 A;  1DOT A;  4TOZ A;  3EQ1 A;  5FHM A;  2E1S A;  3KSJ A;  2O1M A;  5H8Q A;  2I49 A;  2P0S A;  2XXT A;  4OVJ A;  1EH3 A;  1LVF A;  4DCY A;  3UGW A;  2G0U A;  1LAG E;  4RPN A;  1RKM A;  1A8E A;  3PPQ A;  3P7I A;  3O28 A;  3MP1 A;  4I62 A;  1GVC A;  4O3C A;  1A8F A;  1TWY A;  1POY 1;  2Q89 A;  4NWD A;  2D21 A;  4ZEC A;  1Y3Q A;  1SQY A;  2H99 A;  1LFG A;  1D9V A;  2HXW A;  2KLF A;  3CRB A;  4QS