3QUJA

Crystal structure of the phosphonate binding protein, phnd, from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
301
Chain Sequence
b'KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
total genus 100
structure length 301
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qujA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA02
2A5TA 4E0WA 2DQVA 1Y9UA 3QUJA 4BDNA 2ZYKA 3OSQA 4IO3A 2ABHA 2XXPA 4QFOA 2H5YA 5DEXA 5EYFA 4HW8A 3UP9A 3HPIA 5J1DA 5H8SA 4IY5A 2Q2AA 2VP1A 1MXYA 1YTVA 1VFEA 4NF4B 5EHSA 3U92A 2REGA 4OXVA 3CVRA 3ILTB 4G68A 3K02A 3O2AA 3IX1A 2UVGA 2QL3A 4H5FA 1P1QA 1AOVA 2A5SA 4BDOA 3BKIB 3RQTA 4F31B 5KCJB 3IAZA 2F7CA 3KOTA 4BDMA 3KOSA 5DTBA 1XVYA 1DTZA 1N04A 1PB7A 5AA3A 5CRYA 2QRYA 1FTKA 3TUSA 1M5CA 3MPKA 4ELPA 4LATA 4B6XA 2NXOA 3OEKA 3FVGA 3H6WA 1BKAA 4R6YA 3O29A 5I2NB 5FTHA 2R9JA 4ZEFA 3MAMA 2QS2A 2ZYNA 1H44A 3VLVA 3VVEA 1PB9A 2DS9A 3VVDA 3RLFE 4X1DA 4JBZA 3B7DA 3C34A 3IOUA 4OWDA 3EN3A 3MZ1A 1WDNA 2XXXA 3GZGA 3DELB 1I6AA 4G2ZA 4OEVA 3VDFA 1JQFA 3S4UA 2IA4A 1I69A 3GBAA 3T9HB 3OO6A 4JWXA 2XXVA 4O3CA 1EZ9A 3PPPA 5CMCA 4L17A 5FHMA 3S2VA 3OMBA 1B3HA 2UYEA 3MPLA 4NWCA 4L0RA 2P0SA 4NF8B 1Y1ZA 5CI5A 2P1SA 3C4MA 4EQBA 2KLFA 4F2OA 4KYDA 1B1XA 2Q9TA 3FD3A 4QFLA 2I48A 3OO7A 5H8QB 2DVZA 4R73A 2H99A 5HBCA 4YKIA 4AB6A 1IJ6A 3QIMA 4U22A 3G3IA 5I56B 1XC1A 3EF7A 3USDA 2LAOA 2THIA 3TELA 4JSDA 4CQIA 2GH9A 3KJ7A 3ECRA 3TTLA 5H8HA 2V93A 3BBRA 3FJMA 4ZEDA 1N0TA 1SVXB 5JK4A 5JTYA 4WKMA 4ELQA 5IKBA 3Q29A 2CA5A 1SYIA 3RT8A 4PFTA 4FAJA 3M3FA 1L5TA 4ZE8A 2C5IT 2DYXA 2F8DA 4GFRA 3MVWA 4R6KA 4XTCQ 5DT6A 3OXNA 1LSTA 4KHZE 5ISUA 4PFUA 1LB9A 1ZMGA 4NF5A 3ONMA 3FGSA 3CG1A 4FECA 2O51A 3TTRA 1ZTYA 3C35A 2YLNA 4KD5A 3KJTA 3PUXE 2F6PA 3K1NA 4Z0IA 3MP6A 3MQ9A 4R75A 5CM6A 2PT2A 4BDQA 1JW1A 1LAXA 5ELVA 5I84A 4JSOA 2PVUA 3PD9A 4RNSA 2DOJA 4HCYA 3DP6A 3L3PA 1Z0PA 4PETA 2DE4A 5DVIA 3ODBA 3RN8A 1PDAA 3T9UA 4G8MA 2D3IA 4LP2B 4OQOA 3SEUA 2P2AA 1O63A 4NF6B 2O1LA 2XTLA 4MLQA 3S9LC 3I5OA 1UTBA 4N6PA 4DXBA 5DYHA 5AA2B 3T96B 3LBSA 5I2KA 3O28A 1O64A 1QKAA 5H8NA 3RY3A 1B7ZA 3CSBA 3PUZE 4FORA 3PMWA 4POWA 3LC8A 4OYVA 2GFEA 1WODA 2UVHA 2HFBA 3THIA 3TCHA 1FW0A 3PPOA 4TQUQ 2Z8FA 1FQDA 2HEUA 2Z8DA 1FQCA 5BUUA 2Q8JA 1PBQA 4ISUA 2HZLA 4GXSB 2Z8EA 1NKXA 2OJTA 3IO6A 4OFOA 1JEUA 2R71A 4H65A 3OOAA 1NNKA 4GF8A 2F78A 5I59B 1Y3NA 3V83A 2XXTA 3K2DA 3DLNA 1USYE 3VE1B 2RF1A 1II5A 2X7PA 4GVOA 1A7LA 1AH5A 1KWHA 1D9YA 1GTKA 1LCFA 1NH7A 3TQLA 4FIMA 1NFTA 2DWHA 2VGQA 4QFNA 1YAEA 4G77A 1UQWA 3IB0A 1QVSA 4N13A 1XVXA 1AIVA 2QS1A 4U23A 3U93A 2B3BA 2RKMA 2I0BA 5ITOA 3H3GA 3CR9A 3CSGA 1SW1A 2BJJX 3TKLB 1FQAA 1QJMA 1T0KA 4H8IA 3SERA 4YKJA 4GLIA 4RYAA 3CI8A 3PUVE 1URGA 1SW4A 2DWIA 3PMXA 4TLMB 2ZYMA 4HTGA 1ELJA 5TU0A 2YPNA 1B9JA 2DWAA 4IO4A 4FEBA 3TAJA 3Q25A 3SEVA 2K48A 2CMOA 3HV1A 3H03A 3EPEA 2GRVA 4C1TA 1FQBA 1BLFA 1JEVA 5KDTB 2UVIA 4R9GA 4IGRA 1B05A 4GD5A 3N5LA 5TP9B 3TFLA 5AA4A 3TZAA 2F36A 2F6GA 3L6HA 1Y3PA 4NEDA 2QSXA 2RC9A 3ZKLA 1S9TA 1ZKBA 2OLBA 1LAGE 2ZMBA 3CRBA 3LSLA 5CMKA 2H25A 4LZ8A 1LFIA 1MY1A 1XS5A 4DCYA 2NVUB 1MM7A 3KFMA 1B58A 4GQOA 3VV5A 3G3HA 4OTEA 3TPAA 3DP4A 5TPAB 1TT1A 3MP1A 5JEIA 5I57B 1PBPA 1LBCA 4FE8A 1LCTA 4C1UA 2I0CA 1A55A 3HSTA 1D3KA 4ZZEA 4TOZA 3RTFB 2M8CA 1AL3A 4P0IA 3O9PA 4LONB 1POY1 3O6IA 3PPRA 3LSXA 2X9YA 3MWBA 3G3GA 4IB2A 2ONSA 5H8FA 2PYYA 2NUVA 3B6QA 4ZEBA 2D21A 4KI0E 1TFDA 1URDA 1A54A 1H7CA 1SW5A 5DEXB 3UIFA 1H45A 1N3XA 1D9VA 4OESA 3FV1A 3IJOB 3OENA 1US5A 2HQ0A 5DVFA 1QUJA 2MBGA 4QRZA 1UTHA 2DXYA 5FHOA 3T9XB 4M1VA 3RUMA 4KYSA 3U8QA 2XX7A 2HCAA 3FVNA 3S9NC 1IUDA 3W15C 2V3TA 4RK2A 2QS3A 1HSLA 3G7WA 2XX9A 1ZKEA 3LSFB 3FVKA 1IXGA 4POXA 2RC8A 2IC9A 2X7QA 5I2NA 3V89B 4MFIA 4GL8A 2B3FA 4OETA 1B0HA 4H1XA 5ICTA 1ANFA 3PGFA 3TQWA 4ESXA 1MXUA 3HHGA 4MLVA 3KN8A 4NWDA 1N3WA 4KPTA 3MVZA 1LBBA 1J1NA 4OERA 4AQ4A 2ZYOA 1OQGA 1NMUA 1MDP1 4ZECA 1USYH 3M3LA 5KZTA 3BFUA 4RA1A 3HHFA 1FCKA 4WXJA 1N7WA 3MJNA 4JB7A 4G4PA 4OZ9A 2OBGA 1A8FA 1JVYA 3FXQA 1QSDA 3CFZA 3KG2A 4GL0A 3FZVA 4BDRA 2Z23A 2V3QA 5H8QA 4M4GA 1SYHA 1Y20A 2W7YA 4I8CA 2NOOA 1SQYA 4U2RA 4EYYR 3C31A 4XKPA 4ECFA 3E4RA 1IJ5A 4DIGA 3ILUB 1B40A 1IZ1A 1DOTA 3GBBA 3FXDB 5M2VA 3T93B 1OQHA 3VXBA 4DLDA 2OWSA 1B5IA 2ONKE 3ZSFA 1B0LA 1JVXA 4ELRA 4OHNA 3LUYA 1QKBA 3IOVA 1R6ZA 4F18A 4F29A 3H06B 1B51A 4AB5A 2OZZA 2XD2A 2F34A 1SDXA 1DTGA 5A5XA 5H8HB 1BP5A 2XHDA 4R2BA 2X9WA 4E0XA 4NE4A 5JTYB 4U1ZA 2ZNTA 1QUIA 3ZKKA 2DVCA 3TTKA 4QF9A 3K6UA 1MY2A 4XKNA 3RPWA 4OFLA 3EHTA 2H98A 4OENA 4LUBA 1SI0A 4O3BA 5L9SA 4FI5A 4EQ9A 1P1OA 3QK6A 1PB8A 3Q26A 1TFAA 4YKPA 1VSOA 4ZE9A 3SEYA 3HCQA 3F11A 1ZIUA 4NF5B 4UA8A 4QSDA 2I4CA 1JW4A 2X26A 2F7AA 4F3SA 1YCJA 5HM4B 4LQ2A 1UIUA 2DWJA 4O3AA 2XXQA 3O6HA 4GRKA 2O68A 1Y4TA 1ZLQA 2ONRA 1N76A 3HN0A 3CFLA 3WAFA 4RPNA 3IR1A 4QHQA 2VD2A 1OIBA 1MQDA 3G3KA 1LB8A 3A3CA 1CE2A 3CKDA 4WEPA 1B2HA 3FV2A 4ND9A 2FNCA 3RNNA 2F35A 3MVYA 4F22A 4H0WA 3I3VA 2FA7A 1FQFA 4GXAA 2Y7IA 4XKRA 2E1SA 1B46A 5I58B 4I9DA 3D4GA 4XKQA 1B32A 4ZEKA 1UTBB 5IAIA 1O7TA 3KN3A 2GHBA 4LVQA 4DXCA 2F97A 4MBPA 3WAEA 4F2QA 1B4ZA 2O7IA 5H8NB 1B4HA 3E3KA 2PX1A 3MZBA 5F1QA 1MXXA 4RPOA 4P0GA 4H5GA 3PV0E 2CZLA 2WKYA 4DE8A 3U1OA 2QJEA 3U94A 1B52A 4BDLA 3EHUA 1EZOA 4JXIA 3CIJA 3EHSA 2PT1A 2ZNUA 3N6TA 4WEDA 3JZJA 4XXUA 2V84A 1H76A 4HS7A 2AYSA 3SKPA 1I6BA 2G93A 1EH3A 4KYEA 1MXVA 4R2FA 2I3VA 2VHAA 4X1BA 1JW5A 1M5FA 1GVCA 4X48A 3K01A 1MH3A 1NNTA 3IO4A 4U4SA 3TTNA 4EUOA 3OO8A 5K2YA 4DZ1A 3V5AA 1Y3QA 3PU5A 1Q1KA 4EXLA 1FTJA 1ZBMA 4EDPA 2F7BA 2O7UA 3TODA 2ANJA 3W9VA 4DNDA 2DE2A 2XXUA 1BIYA 5TP9A 1MH4A 4KQPA 4TLLB 1VE4A 2KWIB 4YB6A 3A09A 5CBRA 3KN7A 4PP0A 3UN6A 2I6EA 2DSFA 1MM6A 2Q2CA 2IC6A 1GR2A 1P1UA 2XXYA 3EQ1A 4DCXA 5L9MA 3K6VA 4YAHX 4QFKA 3W9WA 3B6WA 2QMWA 4YMAA 3FVOA 3QXMA 2YJPA 2X9XA 4Q0CA 2OK2A 3RGYA 3V8XB 4I1DA 5TPAA 3VXCA 5AA4B 1DSNA 1N7XA 3MBPA 4N07A 1YPNA 4C0RA 3MUQA 3TDJA 4J2CA 1A40A 3KZGA 1MQJA 4PQJA 3C9HA 4YU0A 3SESA 5CBSA 2VD3A 2Y7PA 1MG1A 3KBRA 4F19A 4YKKA 1P1WA 4Q8RA 3DP8A 4YZZA 3PPNA 2QPQA 4K3FA 1B7UA 1HSEA 1ZJLA 4NF4A 4UACA 3TKDA 1XT8A 2A5TB 3TTMA 3UA8A 2HZKA 3FATA 4GOTA 4YICA 1FTLA 3MVXA 3BFTA 5ITPA 2G0UA 4PFYA 4ZS9A 1OMPA 4KR5A 5HPQA 1B3GA 1JNFA 2XX8A 2FYIA 1S7YA 4JWYA 1VR5A 4H8JA 3PMVA 5KCJA 3N26A 3UK4A 1DMBA 2H9BA 1IXIA 1P1NA 3PPQA 4IO5A 4THIA 3C32A 1PEBA 3JV9A 1POTA 5H8FB 2GHAA 1XHYA 2Y7KA 1IEJA 3KSXA 2XXRA 3T66A 2DE3A 4G68B 1DPEA 3C36A 2O1MA 4KFQA 2QS4A 5L8DA 1H43A 1M5BA 3B6TA 1LAHE 4XIGQ 1UTHB 3FUZA 3HO7A 1B5JA 1MPBA 5CC2A 1MY4A 1DPPA 4JDFA 4EF1A 3TCGA 2OWTA 2IEEA 2O84X 1NL5A 5FTIA 2Q89A 3CFXA 3MP8A 3FXUA 3GXAA 4QSEA 2ZXTA 2RCAA 3TCFA 1MDQA 4ESWA 4KCDA 3K4UA 2G29A 3IB1A 3ZS6A 2UYFA 2E0SA 5FHNA 4F39A 1ZU0A 1R1NA 3LSWA 4OVJA 1A99A 1B3LA 3H6UA 3M8UA 2O69A 4NF8A 1QW0A 3N94A 5AE4A 3IL1B 1FTMA 1AMFA 3R7XA 3H7MA 4PFWA 3S9MC 4YB7A 3O97A 2I58A 1N84A 4Q5TA 2O6AA 2UXAA 3FXRA 5I56A 5K2XA 1IITA 4ZEIA 3I6VA 3T22A 1MQHA 4G8HA 3D4CA 1US4A 3TEPA 4KCCA 1FTOA 3SETA 3A3UA 1RYOA 2I4BA 4LQ5A 3FIRA 5L9OA 1F9BA 1SW2A 4LZ5A 2PMSA 1H3DA 2XXWA 2AL5A 2AL4A 2AIXA 4IO2A 3QUFA 4R72A 1MXZA 3E13X 2RINA 4YB5A 3SEWA 2UVJA 2RC7A 4U4XA 3OELA 1UIVA 3KSJA 3QSLA 2XXHA 2RCBA 4U1OA 5EHMA 1GGGA 4OEUA 4MF3A 1XOCA 4IY6A 4PE5B 1OLCA 3FJGA 2Y7RA 2ZNSA 4ZZAA 1A8EA 1MPDA 3O6GA 3JYRA 1MS7A 3IJXB 3UGWA 2ESNA 4X9TA 1NNPA 3IORA 1MY3A 4ELOA 4NMYA 3OD7A 3Q28A 1IQ7A 5A5XB 5F7VA 1IIWA 3KGCA 2I49A 3FASA 3VLWA 3LR1A 4IGTA 3MZ9A 4EXKA 1LVFA 4HCWA 1LFHA 2HAUA 3MXZA 3PUWE 4ZDMA 1LGBC 4NF6A 4EQ7A 1TXFA 4JWOA 2VOZA 4NTLA 3RT6B 5B7DA 5CMMA 4F1VA 3K1PA 3RTWB 2D5WA 1Y4CA 5AA2A 3FXEB 2PBWA 4F3GA 3M3KA 1B1HA 4OMBA 2QMXA 4LA9A 4RJZA 2Q88A 1Z7NE 3OO9A 3K6WA 4I62A 3H4ZA 1SD3A 5I58A 4GIZA 4F1UA 1RYXA 4IO6A 3K00A 3R6UA 3CVGA 3N6UA 1NH8A 3H6TA 1MRPA 1ATGA 2NWJA 3CG3A 5ICQA 1S50A 3MW0A 1Z7ME 2C5KT 1Q35A 1MY0A 3KEIA 1I6QA 1MQGA 1LFGA 4G68C 1MQIA 1IXHA 3VVFA 3P7IA 4U21A 2F5XA 5I2KB 4F3PA 4RY1A 3VLUA 5I59A 1WVJA 1VFDA 2H4IA 4R74A 1IXCA 2I3WA 3PUYE 5AA2D 2DXRA 1P99A 3DM0A 1SBPA 1BTJA 4P11A 4F1YA 4FATA 4Z7EA 5AA1A 3IB2A 3Q27A 3IOWA 1PC3A 3T9VA 1LRZA 3IK6B 1NNFA 1JETA 2XD3A 2V25A 2HAVA 1D4NA 3QYTA 4G8NA 4R9FA 1SI1A 3AXFA 2OCUA 3S9EA 4EF2A 4YMBA 3L6GA 2ALUA 3H6VA 3SEXA 3VFJA 3TYHA 3K1MA 2V3UA 3PD8A 4IO7A 1EU8A 4H67A 1OVTA 4QSCA 2B65A 2HXWA 1URSA 3IOTA 3TMGA 1RKMA 4LZ7A 4Q30B 4F3BA 1M5DA 4QFPA 3C33A 4OFJA 5KDTA 5B70A 1OVBA 4DXUA 5BWJA 3G3FA 1CB6A 3U72A 4ONYA 1R9LA 5DVJA 4R6HA 1QULA 1GV8A 4RK9A 1B5HA 3K6XA 4GWOA 3SDFA 2KWHA 3MC2A 1HSJA 1MXWA 2DP8A 5LOMA 3G3JA 3GLBA 3E9XA 1M5EA 2Z22A 3OEMA 4MH5A 2XXIA 4RXLA 1B3EA 1MPCA 4BLAA 1QUKA 1LLSA 3R26A 1TWYA 2R6GE 2Y84A 2Y7WA 1EZPA 5I57A 4FJPA 2REJA 3FJ7A 1FQEA 3O66A 1B6HA 3K0VA 2C5JA 4H6DA 3QAXA 1R9QA 1B3FA 1B7HA 1LAFE 5CMBA 4FEDA 1OLAA 3UORA 3OSRA 4DDDA 1Y1MA
chains in the Genus database with same CATH superfamily
2A5TA 1FBEA 2OV9A 3EHZA 4E0WA 4UELA 1XZYA 2DQVA 2M67A 5HWXA 3O4XE 1Y9UA 3QUJA 4BDNA 2A9UA 2ZYKA 3OSQA 4IO3A 2ABHA 3AAIA 1FPIA 3OYZA 2XXPA 1QGXA 5C3JA 4QFOA 2H5YA 3M65A 2D2SA 3OYXA 4GBVA 2CEXA 5DEXA 5EYFA 3OTOT 3CX6B 4HW8A 3QOFA 2HN1A 3UP9A 3N2KE 3HPIA 1FTAA 5J1DA 5LDZA 3ESLA 4ASKA 5H8SA 4IY5A 1B7TA 2Q2AA 3JCFA 2VP1A 4I55E 5LG4A 1MXYA 1YTVA 1IMCA 4UXNB 4NXMT 1VFEA 5LXTE 4E7ZA 4NF4B 5EHSA 1FPGA 1WRDA 4OVTA 1HX1B 1S94A 3U92A 3HFUA 3J7Yq 2REGA 4HFVA 2BS3A 4OXVA 3P4SA 3CVRA 2KSRA 3ILTB 5ET5A 4G68A 4KXPA 4CN6A 2WEFA 3K02A 3O2AA 4QH1A 4MNPA 2W63A 3IX1A 2UVGA 2QL3A 4H5FA 4CN1A 2Q9QC 3PUSA 4IL9A 1P1QA 1AOVA 1T72A 2A5SA 1R8IA 1IMAA 4BDOA 3BKIB 3N9QA 5E0OA 3RQTA 4F31B 5LCYA 5KCJB 3IA3A 4X20E 3IAZA 2ODUA 2F7CA 3KOTA 2QVAA 4Z8XA 4BDMA 3RPUA 4GX4A 2LOSA 4IE0A 3KOSA 5DTBA 1XVYA 4IIJE 1NV7A 2VKHA 1DTZA 4QH4A 3I0OA 3ETVA 1N04A 5HEJA 1PB7A 5AA3A 5CRYA 2QRYA 3ZMZB 1FTKA 3TUSA 5LBQB 3UU3A 1M5CA 4UF0A 5EK2A 3MPKA 3WAKA 1Q9DA 4ELPA 2PBIA 4LATA 4A56A 1BR0A 4B6XA 2NXOA 3AE4A 3OEKA 3FVGA 3H6WA 1BKAA 3QC9A 5AQVB 1FBHA 4R6YA 3E0ZA 4OANA 3O29A 3ZMVB 1KZ8A 5I2NB 3HKCE 3AECA 3CIRA 5FTHA 2R9JA 3FHNA 3EDUA 3F2EA 3PTYA 4YTNA 4ZEFA 4PK5A 1FSAA 3BQIA 2BG9E 4LF7T 2LKHA 3MAMA 1FMWA 2EHOA 2JQHA 3I1AA 1H44A 2QS2A 2ZYNA 3VLVA 3VVEA 1PB9A 2DS9A 3VVDA 3RLFE 4X1DA 4AQFC 4JBZA 3PTRB 2CBIA 3B7DA 3IBPA 3C34A 3IOUA 5IZ3B 3MZKB 5LTCA 3RIFA 1G73A 2W61A 2V5CA 4OWDA 2YDQA 4DIDB 3EN3A 3MZ1A 1XDPA 4MLKA 1UX5A 4G63A 4F8HA 1WDNA 4GWYA 4IE5A 2XXXA 3GZGA 4E7SA 3DELB 3HA4A 4H46A 1I6AA 3H3MA 1NV1A 4G2ZA 3F57A 2PG8A 2CRBA 4OEVA 3VDFA 1JQFA 3S4UA 1ZP0A 2YEVC 5HEGA 2IA4A 5HCMA 1XNQT 1I69A 4EIWA 3GBAA 3T9HB 4O4JE 2NWBA 3LK2B 3OO6A 4JWXA 4DVDA 4EEBA 4ZS2A 2XXVA 4O3CA 1EZ9A 3PPPA 5CMCA 1D0YA 4CI2B 4PFPA 2WZIA 4L17A 2WAUA 5FHMA 3S2VA 2V4CA 3OMBA 1B3HA 2UYEA 3MPLA 4NWCA 4L0RA 4JI0T 2P0SA 4NF8B 3R84B 1Y1ZA 2WS3A 1EYJA 2XUEA 5CI5A 3Q2MA 2JQ9A 2P1SA 3C4MA 4EQBA 2KLFA 4F2OA 4C90A 4KYDA 1B1XA 4I0UA 2Q9TA 2L5VA 3FD3A 4QFLA 1KA0A 5EQAA 4X1KE 4U72A 2B4LA 2I48A 3OO7A 5H8QB 5JREA 2DVZA 3D0TA 4R73A 2H99A 2EHOD 5HBCA 4FBPA 4YKIA 4AB6A 1IJ6A 2BVLA 3T8OA 4DR2T 3QIMA 1YD8G 1AWBA 4U22A 3N9MA 3CQCB 2N9DA 1J5ET 3G3IA 5I56B 1XC1A 3EF7A 4ZZCA 3KBZA 3USDA 2LAOA 5FY7A 2THIA 3TELA 4LF5T 4JSDA 1QLBA 4G2AA 4CQIA 1INPA 2GH9A 3KJ7A 3ZC1A 3ECRA 2XWVA 3TTLA 2WDQA 2NP9A 1W09A 5H8HA 4EV6A 2V93A 4DV5T 1D1CA 3BBRA 3MSTA 4O94A 2WBLA 3FJMA 4ZEDA 1N0TA 1SVXB 5JK4A 5LG3A 5JTYA 4WKMA 4ELQA 5IKBA 3Q29A 2CA5A 1YYZA 4XZCA 3B13A 2BG9C 4N91A 1SYIA 3FBZA 3RT8A 5AQNB 4OVPA 4PFTA 3RQUA 4WZXA 4N8GA 3MYUA 4FAJA 4HFIA 1M62A 4H9QC 3M3FA 1L5TA 2LHRA 4ZE8A 2C5IT 2DYXA 2F8DA 5CA0E 4GFRA 2BKOA 1LBWA 3MVWA 4R6KA 4XTCQ 4UV8B 5DT6A 4XF5A 5DABA 4LFCT 4OVQA 1K9ZA 3OXNA 2D0TA 4P9KA 2IHR1 1UK5A 5AQGB 1LBXA 2V7KA 2VL0A 1LSTA 4KHZE 5ISUA 5AQLB 4PFUA 1LB9A 1NV5A 2CBJA 2RP4A 4NAPA 1ZMGA 2VPNA 3ZYKA 4IE6A 3FZLB 4NF5A 3ONMA 3RI5A 4K0KT 3FGSA 1FPFA 4YHHT 3CG1A 4FECA 2J1DG 4YTMA 2XM2A 3ZC0A 2O51A 2XQ4A 3TTRA 4MNCA 1ZTYA 1MNDA 2X0HA 4HWCA 2QVVA 3C35A 2AE9A 3N9LA 2MTQA 2YLNA 5FYMA 4KD5A 3KJTA 3PUXE 4ANJA 3ZCIA 2F6PA 2YU2A 2Q74A 3K1NA 4Z0IA 3MP6A 3MQ9A 4O8MA 3UUMA 4DI4B 4KP3C 2CLYB 4UVCB 5F24A 4R75A 5CM6A 3F31A 2PT2A 2LRKA 4BDQA 1JW1A 2WQYA 1LAXA 5ELVA 5I84A 1KNZA 4JSOA 2PVUA 2V7LA 3KC0A 3PD9A 4RNSA 3P4WA 3UQ4A 4KBMB 2DOJA 1XWMA 4HCYA 3O1HA 3MKDA 3DP6A 5AQSB 3L3PA 2KXPB 4MBQA 4PK4A 4HWFA 4DV7T 1Z0PA 5ETWA 2WM9A 4PETA 2QYWA 1FMVA 2DE4A 5DVIA 1MIVA 3ODBA 1PDAA 3RN8A 2WDVA 3CPZA 4TN7B 5FY0A 4HE1A 5BMVE 3ANWB 3T9UA 4GWXA 3FZKB 4G8MA 2D3IA 4LP2B 4OQOA 3SEUA 2P2AA 1O63A 4NF6B 2IMLA 2O1LA 2XTLA 4MNIA 2XAHB 4MLQA 2XWOA 3S9LC 3I5OA 1UTBA 4N6PA 1CNQA 3CK6A 5AQIB 1QUUA 4DXBA 5ABFA 5AQPB 4ISSA 5DYHA 5AA2B 3T96B 2XWIA 3LBSA 2M6BA 2ZZWA 4ZI2D 5I2KA 3O28A 4ISTA 1HTJF 1O64A 1QKAA 5H8NA 4P1EA 3VR8A 4WBNE 3RY3A 1B7ZA 3CSBA 3PUZE 3OBVE 5LP6E 4I3EA 4FORA 3PMWA 1KF6A 4POWA 4DMWA 3LC8A 1D0ZA 4N8YA 4OYVA 3AEEA 5CA1E 4DR4T 2GFEA 4PBHA 1WODA 2UVHA 2HFBA 4GX3A 4WBOA 3THIA 2N2NA 3DJBA 4P1LA 3TCHA 1FW0A 3PPOA 2KLQA 2LSGA 2W66A 4TQUQ 2Z8FA 1G8XA 5LB7B 1FQDA 4NG7A 2HEUA 2Z8DA 1FQCA 2WDRA 3IHRA 5BUUA 2QVRA 2PCRA 2CPTA 2Q8JA 4DR1T 1W0BA 3FZHB 3RC3A 4O4HE 2VVSA 1PBQA 1NV6A 5JDLA 4ISUA 2HZLA 4GXSB 3LBXA 4AQFA 2JMHA 2Z8EA 1NKXA 2A3DA 2NTYA 2ZLYA 1LVKA 2OJTA 3E22E 3IO6A 4OFOA 1JEUA 3RPLA 2R71A 4H65A 1NUWA 4H9SE 2MOZA 2X9HA 3KVAA 3OOAA 1NNKA 4GF8A 1IMDA 2F78A 2UXDT 5LBMA 5AFUL 5I59B 1Y3NA 4ZI3D 3TAJA 4P56A 2XXTA 3K2DA 3V83A 4IDZA 3DLNA 1USYE 3UULA 3VE1B 4IREA 4NUVA 5DQVA 2JJKA 2RF1A 4MJOA 1II5A 2X7PA 2E9XC 4GVOA 1A7LA 1AH5A 2VQET 1D9YA 1GTKA 1KWHA 1LCFA 1NH7A 3FZFB 3A5XA 3TQLA 3P8CD 4JVIA 4FIMA 1NFTA 2DWHA 4A97A 2VGQA 4QX8B 3ISPA 2Y5LA 5L3BB 3PUWF 4QFNA 4QXHB 1YAEA 1VCSA 4G77A 1E7PA 1T7SA 3BK9A 4U2YA 1UQWA 4U74A 3IB0A 1QVSA 4N13A 1XVXA 3I0QA 1AIVA 2QS1A 4U23A 3KV5A 3U93A 2B3BA 1HFAA 2RKMA 2I0BA 5ITOA 3H3GA 3C4XA 3CR9A 5J0ZA 3ZJ2A 3CSGA 1SW1A 1V9DA 2FJAA 2XPKA 3AE7A 2BJJX 4HKAA 3RYFE 3EABA 3TKLB 4JI6T 1FQAA 1QJMA 2ZM2A 1T0KA 4H8IA 3O1IA 3SERA 1ZHCA 4YKJA 1LBYA 5I5PA 4GLIA 3OPCA 3CI8A 2HN2A 2BZBA 4RYAA 4O4LE 2LLYA 2VL8A 4UVBB 2ODVA 3PUVE 1URGA 1SW4A 2DWIA 3PMXA 4TLMB 2ZYMA 4HTGA 5J1GA 1ELJA 5TU0A 1MMDA 3U3IA 5KMGP 2NW8A 2YPNA 4MALA 3HKEE 1B9JA 2DWAA 4C91A 4IO4A 3ZEFB 4FEBA 3HKBE 2HHHT 4HE2A 4IL4A 2LSIA 2XQYA 3Q25A 3SEVA 2K48A 2R8TA 5EQ7A 2J62A 4JBWF 2CMOA 4UV9B 3L09A 3HV1A 2BG9A 1KNPA 3H3AA 3H03A 3EPEA 3VU7H 5LHHB 4IT4A 2GRVA 5AQMB 4C1TA 3AE8A 1Z8UA 1FQBA 4LMJA 1BLFA 2KINB 1J5WA 1JEVA 1G0IA 1OWAA 5KDTB 2FJBA 2UVIA 4R9GA 2NR4A 4O8SA 4PF6A 4IGRA 2MKZA 1B05A 3ZT6A 4GD5A 1OEDB 3SRZA 3N5LA 5EYGA 5TP9B 3UU8A 3TFLA 5AA4A 2WZHA 3TZAA 1HR0T 2F36A 2F6GA 2L3LA 2CWOA 3L6HA 1Y3PA 2XXKA 3PUYF 4IR8A 3NRYA 4NEDA 3E78A 2QSXA 4EZ4A 4PC9A 2RC9A 3ZKLA 1S9TA 1ZKBA 4PGPA 3K3OA 2IDOB 2OLBA 1LAGE 2ZMBA 3N9PA 3CRBA 3LSLA 5CMKA 2H25A 3ZSSA 4LZ8A 5HXSA 3GN5B 4QWNB 1LFIA 1MY1A 1IBLT 1XS5A 4DCYA 4Q25A 2CZKA 4AI6A 2NVUB 1LBZA 1MM7A 2XY8B 3KFMA 4TWFA 5ET7A 1B58A 2VT5A 2LJLA 1DU2A 4GQOA 2V6YB 3UTKA 3VV5A 3G3HA 5LHIB 2WBDA 4OTEA 3TPAA 3DP4A 2FHYA 2HH7A 3AA6B 5TPAB 2OA5A 1TT1A 5AQOB 3LUZA 3MP1A 3KV6A 5BR8T 1YW0A 2PFYA 5JEIA 2Q8MA 4PK6A 5I57B 1PBPA 1LBCA 4H63H 4FE8A 1E1HB 1IBKT 1LCTA 4C1UA 4PTKA 3KBTA 2I0CA 2MPKA 5FY1A 4YXDA 1A55A 4ZS3A 3HSTA 5AQUB 1D3KA 2WWVA 4AXPA 4JVCA 1UGOA 5FKYA 2ZZVA 4TOZA 4ZZEA 3RTFB 2WY2A 2D9DA 2QFLA 2M8CA 3V5SA 1AL3A 3GMIA 4P0IA 3O9PA 4LONB 4UR9A 1POY1 3LV0A 3O6IA 3PPRA 3LSXA 2X9YA 1UUSA 4AKGA 3G3GA 1N32T 3MWBA 4PCDA 4NXNT 4IB2A 1WYBA 1FPJA 2ONSA 5H8FA 5JDMA 1LEVA 2PYYA 3C98B 2NUVA 3B6QA 4GWZA 4ZEBA 4UEMA 2D21A 4H9NC 2GQ1A 4KI0E 4HN9A 4X5TA 2UXBT 1TFDA 1URDA 4WNKA 1A54A 1H7CA 1SW5A 5DEXB 2CWYA 2CXDA 3UIFA 2XQAA 2V6XA 3QMFA 1H45A 1N3XA 1D9VA 4OESA 3FV1A 3O1JA 3IJOB 2CZHA 1Y64B 2ZM0A 3OENA 1US5A 2HHMA 4O2BE 1K9YA 1QUJA 1X9BA 2XZEA 3M3ZB 2HQ0A 2IAKA 5DVFA 2MBGA 5AQJB 4QRZA 4AKHA 1UTHA 2LHNA 4ZZBA 2DXYA 4H9PC 1NV2A 5FHOA 2K24A 4DR7T 3T9XB 3NRXA 2F4VT 4M1VA 3FXBA 3JC6C 3RUMA 4KYSA 2X66A 2X0YA 4XBFB 3NOHA 2XAGB 3U8QA 4Z91A 2KNDA 2XX7A 2HCAA 4KX6A 3FVNA 3S9NC 1YZ0A 1IUDA 4TZ4C 2YN6A 3ZT7A 2QS3A 1HSLA 2V3TA 3G7WA 2XX9A 4RK2A 3W15C 4A5XA 1ZKEA 3VKHA 1T98A 3HI2A 2R6GF 4ZI7E 3LSFB 1FPDA 3FVKA 4PAIA 4YY3T 1IXGA 3RRWA 4POXA 2RC8A 2VKJA 1YQ4A 4NX1A 2VKOA 4YFSA 5DJQC 2IC9A 4JI4T 2X7QA 2V5DA 2E9XA 5I2NA 2F3BA 3V89B 4MFIA 3LJCA 4ZOLE 4GL8A 2B3FA 3Q5XA 5KX5E 1N34T 1B0HA 4H1XA 4OETA 5ICTA 4H9RC 1ANFA 3PGFA 4DBRA 3TQWA 4ESXA 1MXUA 3HHGA 4MLVA 3KN8A 1FRPA 2VVNA 4PDDA 4NWDA 3J9X1 2BBJA 2NW7A 1N3WA 2CM0A 5HEOA 2FVZA 4AQYT 3RYDA 4UF0B 5FL0A 3E79A 2Y5KA 4KPTA 3MVZA 1LBBA 1J1NA 3AA1B 4M1PA 4FJOA 2WP9A 1I6ZA 4OERA 4AQ4A 2ZYOA 4QBAA 1OQGA 1NMUA 1MDP1 4ZECA 3RX6A 2BKNA 5L4EA 1USYH 3M3LA 5KZTA 3BFUA 4RA1A 3HHFA 3C50A 1FCKA 4PFRA 4K0UA 2CHOA 4WXJA 5FP3A 4TNWA 5FBPA 1N7WA 2UU9T 1MIYA 3MJNA 4JB7A 3TLVA 4G4PA 4OZ9A 2YK0A 3FB2A 2OBGA 1A8FA 1ZOYA 2EHOB 1JVYA 1WCRA 3FXQA 3KDSE 1QSDA 3AE9A 3CFZA 4HE0A 3EI0A 3KG2A 4GL0A 3VKGA 1EZ3A 4YLHA 2CZIA 3FZVA 3T1YT 4CXYA 2E9XD 2XQ6A 4BDRA 2Z23A 2V3QA 1NENA 3TLSA 5H8QA 1UURA 5LGTB 4M4GA 2FJEA 1SYHA 1Y20A 5ABEA 4NN3A 2W7YA 1WR6A 3AA7B 4I8CA 2NOOA 1SQYA 4UIGA 4U2RA 3VRBA 4EYYR 2IIUA 3C31A 4B3ST 4U2ZA 4XKPA 3E4RA 4ECFA 3JAEA 1IJ5A 4HFCA 3Q5DA 2LE8A 4DIGA 3ILUB 2Z6EA 2WMOA 2XQ9A 3AAAB 3NZPA 3UFEA 1B40A 4PW8A 1IZ1A 1DOTA 4AKRB 3UUXB 2DNXA 4HTEA 5T3JA 3GBBA 3SOLA 5AQFB 2BS2A 3CWZB 3FXDB 3B50A 4TX5A 5M2VA 1OQHA 3T93B 3VXBA 5HXRA 5HXCA 2JQQA 3UU4A 4DLDA 2OWSA 3HL6A 1B5IA 2ONKE 3SS1A 1SUMB 2CEAA 3ZSFA 2CEYA 2W62A 1B0LA 1GQEA 3LDQB 2X68A 1EYKA 3RYIE 1JVXA 1BR1A 3MK7C 4ELRA 4OHNA 3LUYA 5IWAT 1QKBA 3IOVA 1R6ZA 4F18A 1X79A 4F29A 1MMNA 1KFYA 3H06B 4N81A 1B51A 4MEVA 4AB5A 2FBPA 2FIXA 4L9IA 2OZZA 2XD2A 2F34A 4I4TE 1SDXA 1DTGA 2XQ8A 4B3RT 4OYKA 4O4IE 2BDEA 5A5XA 4GOUA 1FBDA 3LK3B 3RGLA 5H8HB 1BP5A 4BA9A 2XQ5A 2XHDA 4R2BA 2X9WA 4E0XA 4GK5E 4NE4A 5JTYB 4U1ZA 2ZNTA 1QUIA 4MCOA 3ZKKA 2DVCA 3RLFF 3TTKA 5L4HA 5JR9C 3K6UA 1MY2A 4QF9A 4XKNA 5EQ8A 3EDVA 3CHGA 3RPWA 4OFLA 1IMBA 4DR6T 3EHTA 2H98A 4DV1T 1VOMA 4OENA 3MA9A 4I50E 5EK4A 4LUBA 1SI0A 4O3BA 3CQGB 5L9SA 1XDOA 3ZPOA 3CX8B 4FI5A 4EQ9A 2XAQB 1P1OA 3QK6A 1PB8A 4IDPA 4EYUA 1SA0E 1TFAA 3Q26A 4YKPA 1VDWA 1VSOA 4ZE9A 3P4PA 2UUAT 4HWDA 3SEYA 3HCQA 4L5GA 2WB5A 3F11A 5CJ5A 1ZIUA 2Q9QA 4NF5B 4UA8A 4QSDA 3EAMA 2LOPA 2I4CA 1JW4A 3ZN1B 2K3WA 4NPPA 2X26A 2RA1A 2CMRA 4P0BA 5LOVE 2F7AA 4F3SA 3PUQA 4DV0T 5L3FB 3PUGA 4U3CA 2W0GA 1YCJA 5HM4B 4BAYB 2XSAA 2B76A 4LQ2A 1UIUA 2DWJA 4O3AA 4X1IE 5JDHA 2XXQA 2DHRA 3O6HA 4GRKA 5F5WA 1BR2A 2O68A 1Y4TA 1ZLQA 2ONRA 1N76A 3HN0A 3CFLA 4A98A 3T1BA 2RPAA 3WAFA 4RPNA 1RDXA 3IR1A 4AS5A 3AE6A 5IYZE 4QHQA 3I9YA 2VD2A 4U7YA 5JTGA 1OIBA 5LNKA 1MQDA 3G3KA 1LB8A 3A3CA 1CE2A 4NGUA 3CKDA 4JI8T 4WEPA 1B2HA 4EAHA 3FV2A 4KUMB 4ND9A 1MNEA 4HWHA 1E2AA 1NV3A 2AXDS 1NV0A 2FNCA 5CB4E 3RNNA 2K5BB 2F35A 5HYAA 1FJ9A 3MVYA 4F22A 4H0WA 3I3VA 2FA7A 1FQFA 4GXAA 3ZKRA 4TUYE 4DUYT 2Y7IA 4XKRA 2E1SA 1B46A 1HCIA 3Q5EA 5I58B 5J2UE 5F8PA 2OX3A 4DUZT 4I9DA 3D4GA 4N17A 1MMAA 4XKQA 1B32A 4ZEKA 2VKDA 4B3MT 1UTBB 5IAIA 4JI5T 1O7TA 3KN3A 2Q9QD 2GHBA 4LVQA 4YJ3E 4PF8A 4DXCA 3AAEB 1FBCA 2X67A 2F97A 5A1LA 4MBPA 3ONLC 3WAEA 4F2QA 5M4YA 3CX7B 1B4ZA 1FBFA 2O7IA 5H8NB 1B4HA 3E3KA 2DL1A 3A29A 4GWSA 2PX1A 4PBQA 3MZBA 5F1QA 4KHZF 1MXXA 4RPOA 4P0GA 2QRXA 3PV0E 4H5GA 2CZLA 2BJIA 2WKYA 4JYAT 4DE8A 1G0HA 2LM9A 4JV5T 5A5LA 3U1OA 2QJEA 4V1Av 4PJLA 2M6IA 1B52A 3U94A 4BDLA 3EHUA 1D1BA 5JRCA 1EZOA 5AQKB 4JXIA 5IUXA 2OWZA 3CIJA 3AA0B 4O7MA 1WLXA 2WYPA 3EHSA 3KV9A 4PFBA 3ZMTB 3PUXF 2PT1A 2ZNUA 3N6TA 4WEDA 1HX8A 3JZJA 4XXUA 1HNXT 3LBXB 2KMFA 2V84A 1H76A 4U7IA 4HS7A 2AYSA 3SKPA 4PJJA 1I6BA 5FXZA 2G93A 4X64T 5AQHB 1I94T 1EH3A 3RPLB 4KYEA 1MXVA 4R2FA 3ZMUB 2I3VA 3RYHE 2VHAA 2WSSV 4X1BA 5I7IA 4JLEA 1JW5A 1M5FA 3T0JA 1GVCA 4X48A 1NUYA 3K01A 1MH3A 2H3RA 1NNTA 3IO4A 3C4ZA 5EK3A 4CXXA 4U4SA 3MJXA 1NV4A 2XJ7A 2LSJA 2WMNA 3TTNA 4EUOA 5HAXA 4OHFA 3OO8A 2EHOC 4PAKA 4JI3T 4DBQA 5K2YA 2PTFA 4DZ1A 4HWIB 4N4UA 2VURA 2A2FX 2DLRA 4BJNA 5L47A 1NI9A 5LA6E 3V5AA 2UUCT 1HG2A 4HFDA 1Y3QA 3PU5A 2BKPA 3U65A 2KQZA 1Q1KA 3ZMSB 3VHLA 4EXLA 3PURA 1FTJA 1ZBMA 4PAGA 4EDPA 2F7BA 2I6HA 2XHEB 5HEUA 3UT5E 2O7UA 1J1JA 3TODA 5EYHA 5FVKA 4DV2T 4GK0E 2ANJA 3W9VA 4DNDA 2DE2A 2XXUA 3ZYMA 1BIYA 5TP9A 5FXWA 1MH4A 3PUZF 4KQPA 4TLLB 2V8SV 1VE4A 5HXEA 1HNWT 2WWUA 2KWIB 4IHJE 4YB6A 5IHYA 3A09A 5IM2A 4DV6T 4ERRA 5CBRA 3KN7A 4PP0A 1XMQT 1XNRT 2SPCA 3UUBA 3VRAA 3UN6A 1IZNB 2I6EA 2DSFA 1HNZT 1MM6A 2Q2CA 2IC6A 1GR2A 4F6RC 1P1UA 2XXYA 4P1NA 3EQ1A 4DCXA 5L9MA 3K6VA 4QKNA 5IZ1A 2WX9A 1FPEA 3IFAA 3EVYA 4YAHX 3AE5A 4QFKA 2VASA 3W9WA 2V7IA 3SWHA 2C0SA 3B6WA 5C2TA 5L3GB 3C64A 1N33T 1FBGA 5LJNA 2BG9B 2QMWA 5JR9A 4YMAA 4I43B 3FVOA 2E5VA 4PNIA 4X62T 3QXMA 1M7KA 2YJPA 2X9XA 2VWAA 4Q0CA 3A7MA 2OK2A 3RGYA 2CE7A 5JDQA 3V8XB 1N36T 3UFGA 4I1DA 5TPAA 4GYSA 3KV4A 3VXCA 5AA4B 4CXWA 4OX9T 4OVRA 1DSNA 1N7XA 3AEGA 3MBPA 4N07A 4CZZB 1NEKA 3ZJ1A 4HFEA 1YXIA 1HG5A 1YPNA 4C0RA 3HKDE 3SFDA 3MUQA 3TDJA 4J2CA 1A40A 2ACZA 3PJAJ 3TLWA 5L3CB 3ONXA 3AXJB 1NUZA 3KZGA 5ABGA 2HPJA 1MQJA 4PQJA 3C9HA 4YU0A 3SESA 5CBSA 4X8RA 2L9QA 4GWUA 1RDZA 2VD3A 2Y7PA 4N6DA 1MG1A 3KBRA 4GWWA 4YKKA 1OXZA 1P1WA 4HXVA 2HXRA 4F19A 4P47A 4Q8RA 3DP8A 4YZZA 3PPNA 3RHWA 4DR5T 1ZEEA 2QPQA 3EUHA 4K3FA 1B7UA 1HSEA 1ZJLA 4NF4A 4UACA 2MYSA 3TKDA 1L0VA 1W9RA 3ZYLA 1XT8A 2A5TB 3TTMA 3UA8A 3BQKA 3PE0A 2HZKA 3FATA 4GOTA 2CLYC 2CXLA 4YICA 1FTLA 3MVXA 3BFTA 5ITPA 2G0UA 4ILBA 4PFYA 4ZS9A 4NHBA 2VK9A 3PUVF 1OMPA 3T1HT 4KR5A 3UUNA 1US7B 1B3GA 2P3NA 3NZQA 5HPQA 4TWDA 3WAJA 1JNFA 4JUYA 3TLUA 4DMVA 4EXTA 2NW9A 2XX8A 2FYIA 4ZI2C 5KXJA 2J47A 2DCFA 1S7YA 4JWYA 4PDHA 1VR5A 4H8JA 3PMVA 5KCJA 2H7OA 3N26A 3UK4A 1DMBA 2H9BA 2E5LT 1IXIA 1P1NA 2W00A 3PPQA 3PJAA 4IO5A 5JVDE 2XAFB 4THIA 3IFCA 1U5PA 3C32A 1PEBA 3RKGA 1SPIA 2V26A 2YOEA 2I0MA 3JV9A 1POTA 3H37A 2LM2A 2WCAA 5H8FB 1O3XA 2GHAA 1XHYA 1DK4A 2Y7KA 3AEFA 1BK4A 1EYIA 2H7VC 1IEJA 3KSXA 2V1DB 3OJAA 2XXRA 4MHFA 4YSZA 3T66A 3AVRA 2DE3A 4G68B 2DWGA 5FVLA 2WU2A 1DPEA 2JPFA 4GBWA 3OKQA 2O1MA 3C36A 4KFQA 4AS4A 2QS4A 5L8DA 1H43A 1M5BA 3B6TA 1LAHE 4XIGQ 1UTHB 3FUZA 3FZMB 3Q5WA 4ZI3C 3HO7A 2Y6XA 4AISA 1B5JA 1MPBA 5CC2A 4DR3T 1MY4A 1DPPA 4JDFA 4EF1A 4X65T 2YDRA 3TCGA 3AEDA 2OWTA 1JNZA 2IEEA 2O84X 4IGUA 2XA5A 1NL5A 5FTIA 5I3SA 2Q89A 4NQ8A 3JADA 2PFVA 2J4GA 1VCTA 3C51A 4EEDA 3CFXA 3MP8A 3FXUA 1SE7A 4B3TT 4JVDA 3CMLA 1OEDE 4DI3D 5IZ3A 3GXAA 4QSEA 1D1AA 4UVAB 2ZXTA 1IAPA 4N6KA 2RCAA 3TCFA 1MDQA 3SZPA 4LFBT 1S35A 4ESWA 4KCDA 2GK9A 1IMFA 3K4UA 3R6NA 2E9XB 3KBUA 2G29A 2FIEA 5HXHA 3IB1A 3ZS6A 3B8BA 2UYFA 3LSVA 2E0SA 5FHNA 3FBLA 4LN5A 4F39A 1ZU0A 4NUUA 5ET6A 1R1NA 3LSWA 4OVJA 1A99A 1B3LA 3H6UA 5LMNT 3RQWA 3M8UA 2O69A 1U4QA 4NF8A 1BR4A 3EKIA 4OYJA 1QW0A 3N94A 4QXDA 5AE4A 3IL1B 4WYVA 5TAOA 4DO0A 1FTMA 1AMFA 2JQKA 3R7XA 4KI0F 3JAFA 3P4QA 3H7MA 4PFWA 3S9MC 3RYCE 3ZN0B 4JI7T 4YB7A 3CQXC 5KDMC 3PUAA 5AQRB 4KHPT 3O97A 2I58A 4ILUA 3L39A 1N84A 2NTXA 4ILAA 4YSYA 4Q5TA 2O6AA 3RKOA 4HEAA 3K3NA 1T8BA 3KINB 2UXAA 3FXRA 5JQGE 3OVUA 4X04A 2FBWA 5HEHA 5I56A 5FNVE 5K2XA 4N78D 3ETUA 3RIUC 1IITA 5LJMA 4ZEIA 3I6VA 2UXXB 3DP7A 4P0AA 3T22A 3HR0A 1MQHA 4GX6A 2CHNA 4G8HA 3D4CA 5LGNB 1US4A 3TEPA 2QVUA 4KCCA 1FTOA 3SETA 3A3UA 1VRBA 3DTOA 4MX6A 4DV4T 1UX4A 1RYOA 2IUBA 5JDFA 2I4BA 4LQ5A 2KR0A 3LG7A 3AB3B 3FIRA 5L9OA 3BQLA 5EZYE 1F9BA 1SW2A 4H9OC 5AQTB 1DCUA 4LZ5A 1HS7A 2PMSA 2LKGA 1H3DA 2WYKA 2XXWA 5FMNA 2AL5A 2AL4A 2VQFT 4LF9T 2AIXA 5L3DB 4IO2A 3BIHA 3QUFA 4R72A 1MXZA 1OEDC 3E13X 2YKSA 2W4XA 4O7IA 2RINA 4YB5A 3SEWA 3ZT5A 2UVJA 1IBMT 2RC7A 4U4XA 3OELA 4MAGA 1UIVA 3KSJA 3QSLA 2XXHA 4NIQA 2K9AA 4LF8T 3V5UA 4BJMA 2RCBA 2UXNB 4MMPA 4GYRA 2KT9A 4U1OA 4U33A 5EHMA 1GGGA 2ZMAA 4OEUA 2XAJB 4MF3A 3UU6A 1XOCA 3E08A 4IY6A 4CI3B 1FJGT 4PE5B 1OLCA 3FJGA 2Y7RA 4HE8A 2ZNSA 4ZZAA 1FBPA 2CXFA 1A8EA 1MPDA 4OVSA 4P09A 3O6GA 3JYRA 1MS7A 4QHOA 3IJXB 3UGWA 2MAWA 2ESNA 4X9TA 5H6RB 3ZLIA 1NNPA 3IORA 2A72A 4AQGA 2ES0A 4HGAA 1MY3A 4ELOA 4H63V 4NMYA 3A8YC 4X1YE 2XQ3A 3OD7A 3ROJA 3Q28A 2UUBT 3PU8A 1WYCA 1IQ7A 2H89A 5A5XB 4ADZA 5F7VA 4CN4A 1IIWA 5DQWA 3KGCA 2I49A 1RDYA 1ZV4X 4ILCA 2QA7A 2D0UA 3QB5A 3IF8B 4LMKA 3FASA 3VLWA 2LRLA 4NF0A 3QB5K 3LR1A 4EZHA 4IGTA 3NWIA 3MZ9A 1FPBA 1MMGA 1LVFA 4HCWA 3ANWA 4QH5A 4EXKA 1LFHA 2HAUA 3MXZA 2I59A 4I3YA 3RRCA 3GYYA 3PUWE 5CFBA 4ZDMA 1LGBC 3AE1A 5L3EB 4NF6A 4EQ7A 5GONE 1TXFA 4JWOA 2VOZA 2UXCT 4NTLA 2E8IA 3RT6B 5B7DA 3ONJA 5CMMA 4QX7B 4F1VA 3K1PA 3RTWB 2D5WA 1Y4CA 4YSXA 2PFZA 3VR9A 5AA2A 3FXEB 2PBWA 4LFAT 2JRKA 4F3GA 3M3KA 1KNRA 2D5UA 1B1HA 1YKEB 4OMBA 4IE7A 2QMXA 4PE3A 4LA9A 4RJZA 2Q9QB 2YDSA 2Q88A 2ZM8A 1Z7NE 3OO9A 4TV9E 3K6WA 4I62A 1FPLA 3K3QC 3H4ZA 3GWHA 1W0AA 1SD3A 3ZSTA 5I58A 4GIZA 4F1UA 3KFWX 4O2AE 3N9NA 4MFRA 1RYXA 2W2UA 4IO6A 3K00A 3R6UA 3CVGA 3N6UA 2IW5B 1NH8A 3H6TA 1MRPA 1ATGA 4PAFA 4YT0A 3SFEA 4XFEA 2NWJA 2WU5A 3CG3A 1NWMX 4EGWA 5ICQA 1S50A 4GIWA 3C4WA 4IDOA 3MW0A 4JEHB 1Z7ME 4AIUA 3K8PC 4IE4A 2VPOA 2C5KT 4XEQA 1Q35A 3W15B 1CHUA 1FPKA 3UQ7A 5AQQB 1WFDA 1MY0A 3KEIA 1I6QA 1MQGA 4PJNA 1LFGA 4G68C 4YTPA 5ABFB 1MQIA 1IXHA 3VVFA 1WR0A 3P7IA 3I9WA 3B5MA 1D9QA 4U21A 2F5XA 5HCJA 1CUNA 5I2KB 4F3PA 4RY1A 1NAFA 1AJ3A 3VLUA 5I59A 1YXRA 5ABHA 5LYJE 2X0LB 1WVJA 3ABVA 1HF8A 1VFDA 2H4IA 4R74A 2FUPA 4ZHQE 1IXCA 2I3WA 3JC6D 3PUYE 3N2OA 5H6QB 5AA2D 2DI4A 4JI2T 2H88A 2DXRA 1P99A 3DM0A 4TWHA 1SBPA 1BTJA 3D1RA 2QGSA 2B4MA 1FIOA 4P11A 2XQ7A 1IMEA 4GKKT 2V7JA 4F1YA 3AEBA 2F3DA 2B1EA 1YKHB 5JDNA 4PJMA 1SHZC 4OA4A 4FATA 4XAXB 2ACXA 1MIWA 4Z7EA 1JNRA 2XWKA 3X1DA 5AA1A 5ADXL 5FXVA 3WI3A 3IB2A 3Q27A 3MACA 1Y01A 3IOWA 1PC3A 4CI1B 3T9VA 2X51A 1LRZA 3IK6B 4EOZB 5IZZA 3RC8A 1NNFA 1JETA 2XD3A 2LSKA 2V25A 2HAVA 1D4NA 4DV3T 3QYTA 4ZXLA 4G8NA 4R9FA 1SI1A 3AXFA 2OCUA 3S9EA 4EF2A 4YMBA 3L6GA 2ALUA 4H45A 2Y8DA 1XI6A 3H6VA 3SEXA 5JRCB 2LEHA 2DWKA 3VFJA 1LKXA 3TYHA 4WW0A 4LMLA 3K1MA 2ZZXA 3LFMA 4JEUB 4LF4T 5FL1A 1UCUA 3RIUA 4P8BA 2V3UA 3PD8A 5ET8A 5J16A 2LT3A 4LF6T 4IO7A 1EU8A 3KVBA 4ZEYA 4H67A 1OVTA 4PFIA 4N15A 4QSCA 2L8KA 5J2TE 2B65A 5JDGA 5F3JA 2KZ7B 2HXWA 3K1SA 3NVOA 1URSA 3IOTA 3TMGA 5IGAA 3TLTA 5C8YE 1RKMA 2NOXA 4LZ7A 4Q30B 4YHJA 4F3BA 2P3VA 3PU3A 3AEAA 2XM1A 3P50A 1M5DA 4QFPA 2BVMA 4COFA 3C33A 2XASB 4OFJA 4AKIA 5KDTA 4KMCA 1FJ6A 5B70A 1OVBA 3N9OA 1D0XA 4DXUA 3LK42 2ZM6T 1OEDA 2HPGA 2W67A 3G3FA 1CB6A 2BBHA 3RIAA 5BWJA 4OFZA 3O9XA 2N1GA 3ZCJA 5JH7E 4AKLA 3U72A 2HPLA 1LBVA 4ONYA 2P9BA 1R9LA 5L2LA 3BIGA 4P3LA 5LGUB 5DVJA 4R6HA 3AE2A 3L8RA 5FXXA 5DW8A 2JMKA 4MIJA 5HWYA 2WBBA 2DDKA 2JJ9A 4OK0A 1QULA 3AVSA 3PDYA 1XMOT 1GV8A 5LHGB 4Z90A 2BS4A 2JIWA 4RK9A 3GN5A 1B5HA 4X66T 3K6XA 4GWOA 3RH3A 1FEWA 3SDFA 2KWHA 4TNVA 2YINA 3MC2A 1JP4A 1HSJA 1MXWA 1KEYA 2DP8A 5LOMA 3G3JA 3GLBA 2V6YA 3E9XA 3P4RA 3PV0F 1M5EA 2Z22A 3OEMA 4MH5A 5ESYA 4I40A 2XXIA 3KC1A 3N2GE 4MHCA 4RXLA 2PJQA 4TV8E 3G06A 1B3EA 2YU1A 3NBXX 4IDNA 1KA1A 1MPCA 2VB6A 1QUKA 4BLAA 1LLSA 2FJDA 3R26A 1TWYA 4YJ2E 4IDQA 2R6GE 2Y84A 4EB6E 5CGMA 2Y7WA 4JI1T 4G61A 3RF1A 2XSBA 1EZPA 3Q9DA 4GKJT 5I57A 4FJPA 5EQ9A 3AE3A 3AXJA 2REJA 3FJ7A 4HFHA 3GA8A 1FQEA 1KK7A 3O66A 1B6HA 3K0VA 2C5JA 1DBZA 4HFBA 4H6DA 3NKZA 3IEEA 4U31A 3QAXA 1R9QA 1B3FA 2V7MA 1B7HA 4PFOA 2CCQA 3U78A 4UABA 1LAFE 2Y48B 3UU5A 5JR9B 3QNUA 3FBPA 5CMBA 5LMUT 1YQ3A 4QXBB 4FEDA 1OLAA 3B57A 1NUXA 2LSYA 4PGNA 3UORA 2OLTA 4QXCB 3OSRA 4DDDA 2E2AA 1Y1MA
chains in the Genus database with same CATH topology
2A5TA 4E0WA 4UELA 2DQVA 2M67A 5HWXA 3O4XE 1Y9UA 3QUJA 4BDNA 2ZYKA 3OSQA 4IO3A 2ABHA 3AAIA 3OYZA 2XXPA 4QFOA 2H5YA 3M65A 2D2SA 3OYXA 5DEXA 5EYFA 3CX6B 4HW8A 3UP9A 3N2KE 3HPIA 5J1DA 3ESLA 4ASKA 5H8SA 4IY5A 1B7TA 2Q2AA 2VP1A 4I55E 5LG4A 1MXYA 1YTVA 4UXNB 1VFEA 5LXTE 4E7ZA 4NF4B 5EHSA 1WRDA 1S94A 3U92A 3J7Yq 2REGA 4HFVA 4OXVA 3CVRA 3ILTB 4G68A 3K02A 3O2AA 2W63A 3IX1A 2UVGA 2QL3A 4H5FA 2Q9QC 3PUSA 1P1QA 1AOVA 2A5SA 4BDOA 3BKIB 3N9QA 5E0OA 3RQTA 4F31B 5LCYA 5KCJB 4X20E 3IAZA 2ODUA 2F7CA 3KOTA 4Z8XA 4BDMA 3RPUA 2LOSA 4IE0A 3KOSA 5DTBA 1XVYA 4IIJE 2VKHA 1DTZA 3I0OA 3ETVA 1N04A 1PB7A 5AA3A 5CRYA 2QRYA 3ZMZB 1FTKA 3TUSA 5LBQB 1M5CA 4UF0A 5EK2A 3MPKA 3WAKA 4ELPA 2PBIA 4LATA 4A56A 1BR0A 4B6XA 2NXOA 3OEKA 3FVGA 3H6WA 1BKAA 3QC9A 4R6YA 3E0ZA 3O29A 3ZMVB 5I2NB 3HKCE 5FTHA 2R9JA 3FHNA 3EDUA 3F2EA 4ZEFA 4PK5A 3BQIA 3MAMA 1FMWA 2EHOA 2QS2A 3I1AA 1H44A 2ZYNA 3VLVA 3VVEA 1PB9A 2DS9A 3VVDA 3RLFE 4X1DA 4AQFC 4JBZA 3PTRB 3B7DA 3IBPA 3C34A 3IOUA 3MZKB 1G73A 2W61A 4OWDA 3EN3A 3MZ1A 4MLKA 1WDNA 1UX5A 4G63A 4IE5A 2XXXA 3GZGA 4E7SA 3DELB 3HA4A 1I6AA 4G2ZA 3F57A 2PG8A 4OEVA 3VDFA 1JQFA 3S4UA 2YEVC 2IA4A 1I69A 4EIWA 3GBAA 3T9HB 4O4JE 2NWBA 3LK2B 3OO6A 4JWXA 4DVDA 4ZS2A 2XXVA 4O3CA 1EZ9A 3PPPA 5CMCA 1D0YA 4CI2B 4PFPA 4L17A 5FHMA 2WAUA 3S2VA 3OMBA 1B3HA 2UYEA 3MPLA 4NWCA 4L0RA 2P0SA 4NF8B 3R84B 1Y1ZA 2XUEA 5CI5A 3Q2MA 2P1SA 3C4MA 4EQBA 2KLFA 4F2OA 4C90A 4KYDA 1B1XA 2Q9TA 3FD3A 4QFLA 4X1KE 4U72A 2I48A 3OO7A 5H8QB 5JREA 2DVZA 3D0TA 4R73A 2H99A 2EHOD 5HBCA 4YKIA 4AB6A 1IJ6A 2BVLA 3T8OA 3QIMA 1YD8G 4U22A 3N9MA 3CQCB 2N9DA 3G3IA 5I56B 1XC1A 3EF7A 3USDA 2LAOA 5FY7A 2THIA 3TELA 4JSDA 4G2AA 4CQIA 2GH9A 3KJ7A 3ZC1A 3ECRA 3TTLA 2NP9A 5H8HA 2V93A 1D1CA 3BBRA 2WBLA 3FJMA 4ZEDA 1N0TA 1SVXB 5JK4A 5JTYA 4WKMA 4ELQA 5IKBA 3Q29A 2CA5A 4XZCA 3B13A 1SYIA 3FBZA 3RT8A 4PFTA 4FAJA 4H9QC 3M3FA 1L5TA 2LHRA 4ZE8A 2C5IT 2DYXA 2F8DA 5CA0E 4GFRA 3MVWA 4R6KA 4XTCQ 4UV8B 5DT6A 5DABA 3OXNA 2D0TA 2V7KA 1LSTA 4KHZE 5ISUA 4PFUA 1LB9A 2RP4A 1ZMGA 3ZYKA 4IE6A 4NF5A 3ONMA 3FGSA 3CG1A 4FECA 2J1DG 3ZC0A 2O51A 3TTRA 1ZTYA 1MNDA 3C35A 3N9LA 2MTQA 2YLNA 5FYMA 4KD5A 3KJTA 3PUXE 4ANJA 3ZCIA 2F6PA 2YU2A 3K1NA 4Z0IA 3MP6A 3MQ9A 3UUMA 4KP3C 2CLYB 4UVCB 4R75A 5CM6A 3F31A 2PT2A 4BDQA 1JW1A 1LAXA 5ELVA 5I84A 1KNZA 4JSOA 2PVUA 2V7LA 3PD9A 4RNSA 2DOJA 4KBMB 4HCYA 3O1HA 3MKDA 3DP6A 3L3PA 2KXPB 4MBQA 4PK4A 1Z0PA 5ETWA 2WM9A 4PETA 1FMVA 2DE4A 5DVIA 1MIVA 3ODBA 1PDAA 3RN8A 3CPZA 4TN7B 5FY0A 5BMVE 3ANWB 3T9UA 4G8MA 2D3IA 4LP2B 4OQOA 3SEUA 2P2AA 1O63A 4NF6B 2O1LA 2XTLA 2XAHB 4MLQA 3S9LC 3I5OA 1UTBA 4N6PA 1QUUA 4DXBA 4ISSA 5DYHA 5AA2B 3T96B 3LBSA 4ZI2D 5I2KA 3O28A 4ISTA 1HTJF 1O64A 1QKAA 5H8NA 4WBNE 3RY3A 1B7ZA 3CSBA 3PUZE 3OBVE 5LP6E 4FORA 3PMWA 4POWA 4DMWA 3LC8A 1D0ZA 4OYVA 5CA1E 2GFEA 1WODA 2UVHA 2HFBA 4WBOA 3THIA 2N2NA 3DJBA 3TCHA 1FW0A 3PPOA 2KLQA 2LSGA 4TQUQ 2Z8FA 1G8XA 1FQDA 2HEUA 2Z8DA 1FQCA 3IHRA 5BUUA 2Q8JA 3RC3A 4O4HE 1PBQA 5JDLA 4ISUA 2HZLA 4GXSB 3LBXA 4AQFA 2JMHA 2Z8EA 1NKXA 2A3DA 2NTYA 2ZLYA 1LVKA 2OJTA 3E22E 3IO6A 4OFOA 1JEUA 2R71A 4H65A 4H9SE 2MOZA 2X9HA 3KVAA 3OOAA 1NNKA 4GF8A 2F78A 5LBMA 5AFUL 5I59B 1Y3NA 4ZI3D 3V83A 2XXTA 3K2DA 4IDZA 3DLNA 1USYE 3UULA 3VE1B 4NUVA 5DQVA 2RF1A 1II5A 2X7PA 2E9XC 4GVOA 1A7LA 1AH5A 1KWHA 1D9YA 1GTKA 1LCFA 1NH7A 3A5XA 3TQLA 3P8CD 4FIMA 1NFTA 2DWHA 2VGQA 4QX8B 5L3BB 4QFNA 4QXHB 1YAEA 4G77A 3BK9A 1UQWA 4U74A 3IB0A 1QVSA 4N13A 1XVXA 3I0QA 1AIVA 2QS1A 4U23A 3KV5A 3U93A 2B3BA 1HFAA 2RKMA 2I0BA 5ITOA 3H3GA 3C4XA 3CR9A 3ZJ2A 3CSGA 1SW1A 1V9DA 2BJJX 4HKAA 3RYFE 3TKLB 1FQAA 1QJMA 2ZM2A 1T0KA 4H8IA 3O1IA 3SERA 1ZHCA 4YKJA 4GLIA 4RYAA 3CI8A 2BZBA 4O4LE 2VL8A 4UVBB 2ODVA 3PUVE 1URGA 1SW4A 2DWIA 3PMXA 4TLMB 2ZYMA 4HTGA 5J1GA 1ELJA 5TU0A 1MMDA 3U3IA 5KMGP 2NW8A 2YPNA 4MALA 3HKEE 1B9JA 2DWAA 4C91A 4IO4A 3ZEFB 4FEBA 3HKBE 3TAJA 2LSIA 2XQYA 3Q25A 3SEVA 2K48A 2CMOA 4UV9B 3L09A 3HV1A 3H3AA 3H03A 3EPEA 3VU7H 5LHHB 2GRVA 4C1TA 1FQBA 1BLFA 2KINB 1JEVA 1OWAA 5KDTB 2UVIA 4R9GA 4O8SA 4IGRA 1B05A 4GD5A 3SRZA 3N5LA 5TP9B 3TFLA 5AA4A 3TZAA 2F36A 2F6GA 2L3LA 2CWOA 3L6HA 1Y3PA 4NEDA 3NRYA 2QSXA 4EZ4A 2RC9A 3ZKLA 1S9TA 1ZKBA 3K3OA 2OLBA 1LAGE 2ZMBA 3N9PA 3CRBA 3LSLA 5CMKA 2H25A 4LZ8A 5HXSA 3GN5B 4QWNB 1LFIA 1MY1A 1XS5A 4DCYA 4AI6A 2NVUB 1MM7A 3KFMA 1B58A 2LJLA 4GQOA 3UTKA 3VV5A 3G3HA 5LHIB 4OTEA 3TPAA 3DP4A 2HH7A 3AA6B 5TPAB 2OA5A 1TT1A 3MP1A 3KV6A 1YW0A 5JEIA 4PK6A 5I57B 1PBPA 1LBCA 4H63H 4FE8A 1E1HB 1LCTA 4C1UA 3KBTA 2I0CA 5FY1A 1A55A 4ZS3A 3HSTA 1D3KA 4AXPA 4ZZEA 4TOZA 3RTFB 2M8CA 3V5SA 1AL3A 3GMIA 4P0IA 3O9PA 4LONB 1POY1 3O6IA 3PPRA 3LSXA 2X9YA 3MWBA 4AKGA 3G3GA 4IB2A 1WYBA 2ONSA 5H8FA 5JDMA 2PYYA 3C98B 2NUVA 3B6QA 4ZEBA 4UEMA 2D21A 4H9NC 4KI0E 4HN9A 1TFDA 1URDA 4WNKA 1A54A 1H7CA 1SW5A 5DEXB 2CWYA 2CXDA 3UIFA 1H45A 1N3XA 1D9VA 4OESA 3FV1A 3O1JA 3IJOB 1Y64B 2ZM0A 3OENA 1US5A 4O2BE 2HQ0A 1QUJA 5DVFA 2IAKA 2MBGA 4QRZA 4AKHA 1UTHA 2LHNA 2DXYA 4H9PC 5FHOA 2K24A 3T9XB 3NRXA 4M1VA 3JC6C 3RUMA 4KYSA 2X66A 4XBFB 3U8QA 2XAGB 2KNDA 2XX7A 2HCAA 3FVNA 3S9NC 1IUDA 4TZ4C 2V3TA 4RK2A 2QS3A 1HSLA 3G7WA 3W15C 2XX9A 1ZKEA 3VKHA 1T98A 3HI2A 4ZI7E 3LSFB 3FVKA 1IXGA 3RRWA 4POXA 2RC8A 2VKJA 2VKOA 4YFSA 5DJQC 2IC9A 2X7QA 2E9XA 5I2NA 3V89B 4MFIA 3LJCA 4ZOLE 4GL8A 2B3FA 3Q5XA 5KX5E 4OETA 1B0HA 4H1XA 5ICTA 4H9RC 1ANFA 3PGFA 4DBRA 3TQWA 4ESXA 1MXUA 3HHGA 4MLVA 3KN8A 4NWDA 3J9X1 1N3WA 2NW7A 2CM0A 4UF0B 4KPTA 3MVZA 1LBBA 1J1NA 3AA1B 4M1PA 4FJOA 4OERA 4AQ4A 2ZYOA 1OQGA 1NMUA 1MDP1 4ZECA 3RX6A 1USYH 3M3LA 5KZTA 3BFUA 4RA1A 3HHFA 3C50A 1FCKA 4K0UA 4WXJA 5FP3A 1N7WA 1MIYA 3MJNA 4JB7A 4G4PA 4OZ9A 2YK0A 3FB2A 2OBGA 1A8FA 2EHOB 1JVYA 3FXQA 3KDSE 1QSDA 3CFZA 3KG2A 4GL0A 3VKGA 1EZ3A 4YLHA 3FZVA 4CXYA 2E9XD 4BDRA 2Z23A 2V3QA 5H8QA 5LGTB 4M4GA 1SYHA 1Y20A 2W7YA 1WR6A 3AA7B 4I8CA 2NOOA 1SQYA 4UIGA 4U2RA 4EYYR 3C31A 4XKPA 4ECFA 3E4RA 1IJ5A 2LE8A 4DIGA 3ILUB 2Z6EA 2WMOA 3AAAB 3NZPA 3UFEA 1B40A 4PW8A 1IZ1A 1DOTA 4AKRB 3UUXB 2DNXA 4HTEA 3GBBA 3SOLA 3CWZB 3FXDB 5M2VA 4TX5A 3T93B 1OQHA 3VXBA 5HXRA 5HXCA 2JQQA 4DLDA 2OWSA 3HL6A 1B5IA 2ONKE 3SS1A 2CEAA 3ZSFA 2W62A 1B0LA 2X68A 3RYIE 1JVXA 1BR1A 3MK7C 4ELRA 4OHNA 3LUYA 1QKBA 3IOVA 1R6ZA 4F18A 1X79A 4F29A 1MMNA 3H06B 1B51A 4AB5A 4L9IA 2OZZA 2XD2A 2F34A 4I4TE 1SDXA 1DTGA 4OYKA 4O4IE 2BDEA 5A5XA 4GOUA 3LK3B 5H8HB 1BP5A 4BA9A 2XHDA 4R2BA 2X9WA 4E0XA 4GK5E 4NE4A 5JTYB 4U1ZA 2ZNTA 1QUIA 3ZKKA 2DVCA 3TTKA 5JR9C 3K6UA 1MY2A 4QF9A 4XKNA 3EDVA 3RPWA 4OFLA 3EHTA 2H98A 1VOMA 4OENA 3MA9A 4I50E 5EK4A 4LUBA 1SI0A 4O3BA 3CQGB 5L9SA 3ZPOA 3CX8B 4FI5A 4EQ9A 2XAQB 1P1OA 3QK6A 1PB8A 4EYUA 1SA0E 1TFAA 3Q26A 4YKPA 1VSOA 4ZE9A 3SEYA 3HCQA 4L5GA 3F11A 1ZIUA 2Q9QA 4NF5B 4UA8A 4QSDA 2LOPA 2I4CA 1JW4A 3ZN1B 2X26A 2RA1A 2CMRA 4P0BA 5LOVE 2F7AA 4F3SA 3PUQA 5L3FB 3PUGA 2W0GA 1YCJA 5HM4B 4BAYB 4LQ2A 1UIUA 2DWJA 4O3AA 4X1IE 5JDHA 2XXQA 2DHRA 3O6HA 4GRKA 1BR2A 2O68A 1Y4TA 1ZLQA 2ONRA 1N76A 3HN0A 3CFLA 3WAFA 4RPNA 3IR1A 5IYZE 4QHQA 3I9YA 2VD2A 1OIBA 5LNKA 1MQDA 3G3KA 1LB8A 3A3CA 1CE2A 3CKDA 4WEPA 1B2HA 4EAHA 3FV2A 4KUMB 4ND9A 1MNEA 2FNCA 5CB4E 3RNNA 2K5BB 2F35A 5HYAA 3MVYA 4F22A 4H0WA 3I3VA 2FA7A 1FQFA 4GXAA 4TUYE 2Y7IA 4XKRA 2E1SA 1B46A 1HCIA 5I58B 5J2UE 5F8PA 4I9DA 3D4GA 1MMAA 4XKQA 1B32A 4ZEKA 2VKDA 1UTBB 5IAIA 1O7TA 3KN3A 2Q9QD 2GHBA 4LVQA 4YJ3E 4DXCA 3AAEB 2F97A 2X67A 4MBPA 5A1LA 3WAEA 4F2QA 5M4YA 3CX7B 1B4ZA 2O7IA 5H8NB 1B4HA 3E3KA 2PX1A 3MZBA 5F1QA 1MXXA 4RPOA 4P0GA 4H5GA 3PV0E 2CZLA 2WKYA 4DE8A 2LM9A 3U1OA 2QJEA 4V1Av 4PJLA 1B52A 3U94A 4BDLA 3EHUA 1D1BA 5JRCA 1EZOA 4JXIA 3CIJA 3AA0B 1WLXA 3EHSA 3KV9A 3ZMTB 2PT1A 2ZNUA 3N6TA 4WEDA 1HX8A 3JZJA 4XXUA 3LBXB 2KMFA 2V84A 1H76A 4HS7A 2AYSA 3SKPA 4PJJA 1I6BA 5FXZA 2G93A 1EH3A 4KYEA 1MXVA 4R2FA 3ZMUB 2I3VA 3RYHE 2VHAA 2WSSV 4X1BA 4JLEA 1JW5A 1M5FA 1GVCA 4X48A 3K01A 1MH3A 2H3RA 1NNTA 3IO4A 3C4ZA 5EK3A 4CXXA 4U4SA 3MJXA 2LSJA 2WMNA 3TTNA 4EUOA 5HAXA 4OHFA 3OO8A 2EHOC 4DBQA 5K2YA 4DZ1A 2A2FX 2DLRA 4BJNA 5LA6E 3V5AA 1HG2A 1Y3QA 3PU5A 1Q1KA 3ZMSB 3VHLA 4EXLA 3PURA 1FTJA 1ZBMA 4PAGA 4EDPA 2F7BA 2XHEB 3UT5E 2O7UA 3TODA 4GK0E 2ANJA 3W9VA 4DNDA 2DE2A 2XXUA 3ZYMA 1BIYA 5TP9A 5FXWA 1MH4A 4KQPA 4TLLB 1VE4A 5HXEA 2WWUA 2KWIB 4IHJE 4YB6A 5IHYA 3A09A 5CBRA 4ERRA 3KN7A 4PP0A 2SPCA 3UN6A 1IZNB 2I6EA 2DSFA 1MM6A 2Q2CA 2IC6A 1GR2A 4F6RC 1P1UA 2XXYA 3EQ1A 4DCXA 5L9MA 3K6VA 4QKNA 3EVYA 4YAHX 4QFKA 3W9WA 2VASA 2V7IA 3SWHA 2C0SA 3B6WA 5L3GB 3C64A 5LJNA 2QMWA 5JR9A 4YMAA 4I43B 3FVOA 4PNIA 3QXMA 2YJPA 2X9XA 2VWAA 4Q0CA 2OK2A 3RGYA 2CE7A 5JDQA 3V8XB 4I1DA 5TPAA 4GYSA 3KV4A 3VXCA 5AA4B 4CXWA 1DSNA 1N7XA 3MBPA 4N07A 4CZZB 3ZJ1A 1HG5A 1YPNA 4C0RA 3HKDE 3MUQA 3TDJA 4J2CA 1A40A 5L3CB 3ONXA 3KZGA 1MQJA 2HPJA 4PQJA 3C9HA 4YU0A 3SESA 5CBSA 2L9QA 2VD3A 2Y7PA 1MG1A 3KBRA 4YKKA 4F19A 1OXZA 1P1WA 4Q8RA 3DP8A 4YZZA 3PPNA 1ZEEA 2QPQA 3EUHA 4K3FA 1B7UA 1HSEA 1ZJLA 4NF4A 4UACA 2MYSA 3TKDA 3ZYLA 1XT8A 2A5TB 3TTMA 3UA8A 3BQKA 3PE0A 2HZKA 3FATA 4GOTA 2CLYC 2CXLA 4YICA 1FTLA 3MVXA 3BFTA 5ITPA 2G0UA 4PFYA 4ZS9A 2VK9A 1OMPA 4KR5A 3UUNA 1US7B 1B3GA 5HPQA 3NZQA 3WAJA 1JNFA 4JUYA 4DMVA 4EXTA 2NW9A 2XX8A 2FYIA 4ZI2C 2DCFA 1S7YA 4JWYA 1VR5A 4H8JA 3PMVA 5KCJA 2H7OA 3N26A 3UK4A 1DMBA 2H9BA 1IXIA 1P1NA 2W00A 3PPQA 4IO5A 5JVDE 2XAFB 4THIA 1U5PA 3C32A 1PEBA 2V26A 3JV9A 1POTA 3H37A 5H8FB 1O3XA 2GHAA 1XHYA 2Y7KA 1IEJA 2H7VC 3KSXA 2V1DB 3OJAA 2XXRA 3T66A 3AVRA 2DE3A 4G68B 2DWGA 1DPEA 2JPFA 3OKQA 2O1MA 3C36A 4KFQA 2QS4A 5L8DA 1H43A 1M5BA 3B6TA 1LAHE 4XIGQ 1UTHB 3FUZA 3Q5WA 4ZI3C 3HO7A 2Y6XA 1B5JA 1MPBA 5CC2A 1MY4A 1DPPA 4JDFA 4EF1A 3TCGA 2OWTA 2IEEA 2O84X 4IGUA 1NL5A 5FTIA 2Q89A 2PFVA 3C51A 3CFXA 3MP8A 3FXUA 3CMLA 3GXAA 4QSEA 1D1AA 4UVAB 2ZXTA 1IAPA 2RCAA 3TCFA 1MDQA 1S35A 4ESWA 4KCDA 2GK9A 3K4UA 3R6NA 2E9XB 3KBUA 2G29A 5HXHA 3IB1A 3ZS6A 2UYFA 2E0SA 5FHNA 3FBLA 4F39A 1ZU0A 4NUUA 1R1NA 3LSWA 4OVJA 1A99A 1B3LA 3H6UA 3M8UA 2O69A 1U4QA 4NF8A 1BR4A 4OYJA 1QW0A 3N94A 5AE4A 3IL1B 5TAOA 4DO0A 1FTMA 1AMFA 3R7XA 3H7MA 4PFWA 3S9MC 3RYCE 3ZN0B 4YB7A 3CQXC 5KDMC 3PUAA 3O97A 2I58A 4ILUA 1N84A 2NTXA 4Q5TA 2O6AA 3RKOA 4HEAA 3K3NA 2UXAA 3KINB 3FXRA 5JQGE 5I56A 5FNVE 5K2XA 4N78D 3ETUA 1IITA 5LJMA 4ZEIA 3I6VA 2UXXB 3DP7A 4P0AA 3T22A 3HR0A 1MQHA 4G8HA 3D4CA 5LGNB 1US4A 3TEPA 4KCCA 1FTOA 3SETA 3A3UA 1VRBA 3DTOA 1UX4A 1RYOA 5JDFA 2I4BA 4LQ5A 3LG7A 3AB3B 3FIRA 5L9OA 3BQLA 5EZYE 1F9BA 1SW2A 4H9OC 4LZ5A 1HS7A 2PMSA 1H3DA 2XXWA 5FMNA 2AL5A 2AL4A 2AIXA 5L3DB 4IO2A 3QUFA 4R72A 1MXZA 3E13X 2RINA 4YB5A 3SEWA 2UVJA 2RC7A 4U4XA 3OELA 1UIVA 3KSJA 3QSLA 2XXHA 2K9AA 3V5UA 4BJMA 2RCBA 2UXNB 4GYRA 2KT9A 4U1OA 5EHMA 1GGGA 2ZMAA 4OEUA 2XAJB 4MF3A 1XOCA 3E08A 4IY6A 4CI3B 4PE5B 1OLCA 3FJGA 2Y7RA 4HE8A 2ZNSA 4ZZAA 2CXFA 1A8EA 1MPDA 4P09A 3O6GA 3JYRA 1MS7A 4QHOA 3IJXB 3UGWA 2ESNA 4X9TA 5H6RB 3ZLIA 1NNPA 3IORA 2A72A 4AQGA 2ES0A 4HGAA 1MY3A 4ELOA 4H63V 4NMYA 4X1YE 3OD7A 3Q28A 3PU8A 1WYCA 1IQ7A 5A5XB 4ADZA 5F7VA 1IIWA 5DQWA 3KGCA 2I49A 1ZV4X 2QA7A 2D0UA 3IF8B 3FASA 3VLWA 3LR1A 4EZHA 4IGTA 3MZ9A 4EXKA 1MMGA 1LVFA 4HCWA 3ANWA 1LFHA 2HAUA 3MXZA 2I59A 3RRCA 3PUWE 4ZDMA 1LGBC 4NF6A 5L3EB 4EQ7A 5GONE 1TXFA 4JWOA 2VOZA 4NTLA 2E8IA 3RT6B 5B7DA 5CMMA 4QX7B 4F1VA 3K1PA 3RTWB 2D5WA 1Y4CA 5AA2A 3FXEB 2PBWA 2JRKA 4F3GA 3M3KA 2D5UA 1B1HA 1YKEB 4OMBA 4IE7A 2QMXA 4LA9A 4RJZA 2Q9QB 2Q88A 2ZM8A 1Z7NE 3OO9A 4TV9E 3K6WA 4I62A 3K3QC 3H4ZA 3GWHA 1SD3A 5I58A 4GIZA 4F1UA 3KFWX 4O2AE 3N9NA 4MFRA 1RYXA 4IO6A 3K00A 3R6UA 3CVGA 3N6UA 2IW5B 1NH8A 3H6TA 1MRPA 1ATGA 2NWJA 3CG3A 1NWMX 5ICQA 1S50A 4GIWA 3C4WA 3MW0A 4JEHB 1Z7ME 3K8PC 4IE4A 2C5KT 1Q35A 3W15B 1MY0A 3KEIA 1I6QA 1MQGA 4PJNA 1LFGA 4G68C 1MQIA 1IXHA 3VVFA 3P7IA 3I9WA 4U21A 2F5XA 1CUNA 5I2KB 4F3PA 4RY1A 1NAFA 1AJ3A 3VLUA 5I59A 5LYJE 2X0LB 1WVJA 1HF8A 1VFDA 2H4IA 4R74A 4ZHQE 1IXCA 2I3WA 3JC6D 3PUYE 3N2OA 5H6QB 5AA2D 2DI4A 2DXRA 1P99A 3DM0A 1SBPA 1BTJA 2QGSA 1FIOA 4P11A 2V7JA 4F1YA 2B1EA 1YKHB 5JDNA 4PJMA 1SHZC 4FATA 4XAXB 2ACXA 1MIWA 4Z7EA 5AA1A 5ADXL 5FXVA 3WI3A 3IB2A 3Q27A 3MACA 3IOWA 1PC3A 4CI1B 3T9VA 2X51A 1LRZA 3IK6B 4EOZB 3RC8A 1NNFA 1JETA 2XD3A 2LSKA 2V25A 2HAVA 1D4NA 3QYTA 4G8NA 4R9FA 1SI1A 3AXFA 2OCUA 3S9EA 4EF2A 4YMBA 3L6GA 2ALUA 2Y8DA 3H6VA 3SEXA 5JRCB 2LEHA 2DWKA 3VFJA 1LKXA 3TYHA 4WW0A 3K1MA 3LFMA 4JEUB 1UCUA 2V3UA 3PD8A 2LT3A 4IO7A 1EU8A 3KVBA 4H67A 1OVTA 4QSCA 2L8KA 5J2TE 2B65A 5JDGA 5F3JA 2KZ7B 2HXWA 1URSA 3IOTA 3TMGA 5C8YE 1RKMA 2NOXA 4LZ7A 4Q30B 4YHJA 4F3BA 3PU3A 1M5DA 4QFPA 2BVMA 3C33A 2XASB 4OFJA 4AKIA 5KDTA 4KMCA 5B70A 1OVBA 3N9OA 1D0XA 4DXUA 3LK42 3G3FA 5BWJA 1CB6A 4OFZA 4AKLA 2N1GA 3ZCJA 5JH7E 3O9XA 3U72A 2HPLA 4ONYA 2P9BA 1R9LA 5L2LA 5LGUB 5DVJA 4R6HA 5FXXA 2JMKA 5HWYA 2JJ9A 4OK0A 1QULA 3AVSA 3PDYA 1GV8A 5LHGB 4RK9A 3GN5A 1B5HA 3K6XA 4GWOA 3RH3A 1FEWA 3SDFA 2KWHA 2YINA 3MC2A 1HSJA 1MXWA 2DP8A 5LOMA 3G3JA 3GLBA 3E9XA 1M5EA 2Z22A 3OEMA 4MH5A 2XXIA 4RXLA 3N2GE 4MHCA 2PJQA 4TV8E 1B3EA 2YU1A 3NBXX 1MPCA 1QUKA 4BLAA 2VB6A 1LLSA 3R26A 1TWYA 4YJ2E 2R6GE 2Y84A 4EB6E 2Y7WA 1EZPA 3Q9DA 5I57A 4FJPA 2REJA 3FJ7A 1FQEA 3GA8A 1KK7A 3O66A 1B6HA 3K0VA 2C5JA 4H6DA 3IEEA 3QAXA 1R9QA 1B3FA 2V7MA 1B7HA 4PFOA 2CCQA 3U78A 1LAFE 2Y48B 5JR9B 5CMBA 4QXBB 4FEDA 1OLAA 3B57A 2LSYA 3UORA 4QXCB 3OSRA 4DDDA 1Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5T A;  4E0W A;  2DQV A;  1Y9U A;  3QUJ A;  4BDN A;  2ZYK A;  3OSQ A;  4IO3 A;  2ABH A;  2XXP A;  4QFO A;  2H5Y A;  5DEX A;  5EYF A;  4HW8 A;  3UP9 A;  3HPI A;  5J1D A;  5H8S A;  4IY5 A;  2Q2A A;  2VP1 A;  1MXY A;  1YTV A;  1VFE A;  4NF4 B;  5EHS A;  3U92 A;  2REG A;  4OXV A;  3CVR A;  3ILT B;  4G68 A;  3K02 A;  3O2A A;  3IX1 A;  2UVG A;  2QL3 A;  4H5F A;  1P1Q A;  1AOV A;  2A5S A;  4BDO A;  3BKI B;  3RQT A;  4F31 B;  5KCJ B;  3IAZ A;  2F7C A;  3KOT A;  4BDM A;  3KOS A;  5DTB A;  1XVY A;  1DTZ A;  1N04 A;  1PB7 A;  5AA3 A;  5CRY A;  2QRY A;  1FTK A;  3TUS A;  1M5C A;  3MPK A;  4ELP A;  4LAT A;  4B6X A;  2NXO A;  3OEK A;  3FVG A;  3H6W A;  1BKA A;  4R6Y A;  3O29 A;  5I2N B;  5FTH A;  2R9J A;  4ZEF A;  3MAM A;  2QS2 A;  2ZYN A;  1H44 A;  3VLV A;  3VVE A;  1PB9 A;  2DS9 A;  3VVD A;  3RLF E;  4X1D A;  4JBZ A;  3B7D A;  3C34 A;  3IOU A;  4OWD A;  3EN3 A;  3MZ1 A;  1WDN A;  2XXX A;  3GZG A;  3DEL B;  1I6A A;  4G2Z A;  4OEV A;  3VDF A;  1JQF A;  3S4U A;  2IA4 A;  1I69 A;  3GBA A;  3T9H B;  3OO6 A;  4JWX A;  2XXV A;  4O3C A;  1EZ9 A;  3PPP A;  5CMC A;  4L17 A;  5FHM A;  3S2V A;  3OMB A;  1B3H A;  2UYE A;  3MPL A;  4NWC A;  4L0R A;  2P0S A;  4NF8 B;  1Y1Z A;  5CI5 A;  2P1S A;  3C4M A;  4EQB A;  2KLF A;  4F2O A;  4KYD A;  1B1X A;  2Q9T A;  3FD3 A;  4QFL A;  2I48 A;  3OO7 A;  5H8Q B;  2DVZ A;  4R73 A;  2H99 A;  5HBC A;  4YKI A;  4AB6 A;  1IJ6 A;  3QIM A;  4U22 A;  3G3I A;  5I56 B;  1XC1 A;  3EF7 A;  3USD A;  2LAO A;  2THI A;  3TEL A;  4JSD A;  4CQI A;  2GH9 A;  3KJ7 A;  3ECR A;  3TTL A;  5H8H A;  2V93 A;  3BBR A;  3FJM A;  4ZED A;  1N0T A;  1SVX B;  5JK4 A;  5JTY A;  4WKM A;  4ELQ A;  5IKB A;  3Q29 A;  2CA5 A;  1SYI A;  3RT8 A;  4PFT A;  4FAJ A;  3M3F A;  1L5T A;  4ZE8 A;  2C5I T;  2DYX A;  2F8D A;  4GFR A;  3MVW A;  4R6K A;  4XTC Q;  5DT6 A;  3OXN A;  1LST A;  4KHZ E;  5ISU A;  4PFU A;  1LB9 A;  1ZMG A;  4NF5 A;  3ONM A;  3FGS A;  3CG1 A;  4FEC A;  2O51 A;  3TTR A;  1ZTY A;  3C35 A;  2YLN A;  4KD5 A;  3KJT A;  3PUX E;  2F6P A;  3K1N A;  4Z0I A;  3MP6 A;  3MQ9 A;  4R75 A;  5CM6 A;  2PT2 A;  4BDQ A;  1JW1 A;  1LAX A;  5ELV A;  5I84 A;  4JSO A;  2PVU A;  3PD9 A;  4RNS A;  2DOJ A;  4HCY A;  3DP6 A;  3L3P A;  1Z0P A;  4PET A;  2DE4 A;  5DVI A;  3ODB A;  3RN8 A;  1PDA A;  3T9U A;  4G8M A;  2D3I A;  4LP2 B;  4OQO A;  3SEU A;  2P2A A;  1O63 A;  4NF6 B;  2O1L A;  2XTL A;  4MLQ A;  3S9L C;  3I5O A;  1UTB A;  4N6P A;  4DXB A;  5DYH A;  5AA2 B;  3T96 B;  3LBS A;  5I2K A;  3O28 A;  1O64 A;  1QKA A;  5H8N A;  3RY3 A;  1B7Z A;  3CSB A;  3PUZ E;  4FOR A;  3PMW A;  4POW A;  3LC8 A;  4OYV A;  2GFE A;  1WOD A;  2UVH A;  2HFB A;  3THI A;  3TCH A;  1FW0 A;  3PPO A;  4TQU Q;  2Z8F A;  1FQD A;  2HEU A;  2Z8D A;  1FQC A;  5BUU A;  2Q8J A;  1PBQ A;  4ISU A;  2HZL A;  4GXS B;  2Z8E A;  1NKX A;  2OJT A;  3IO6 A;  4OFO A;  1JEU A;  2R71 A;  4H65 A;  3OOA A;  1NNK A;  4GF8 A;  2F78 A;  5I59 B;  1Y3N A;  3V83 A;  2XXT A;  3K2D A;  3DLN A;  1USY E;  3VE1 B;  2RF1 A;  1II5 A;  2X7P A;  4GVO A;  1A7L A;  1AH5 A;  1KWH A;  1D9Y A;  1GTK A;  1LCF A;  1NH7 A;  3TQL A;  4FIM A;  1NFT A;  2DWH A;  2VGQ A;  4QFN A;  1YAE A;  4G77 A;  1UQW A;  3IB0 A;  1QVS A;  4N13 A;  1XVX A;  1AIV A;  2QS1 A;  4U23 A;  3U93 A;  2B3B A;  2RKM A;  2I0B A;  5ITO A;  3H3G A;  3CR9 A;  3CSG A;  1SW1 A;  2BJJ X;  3TKL B;  1FQA A;  1QJM A;  1T0K A;  4H8I A;  3SER A;  4YKJ A;  4GLI A;  4RYA A;  3CI8 A;  3PUV E;  1URG A;  1SW4 A;  2DWI A;  3PMX A;  4TLM B;  2ZYM A;  4HTG A;  1ELJ A;  5TU0 A;  2YPN A;  1B9J A;  2DWA A;  4IO4 A;  4FEB A;  3TAJ A;  3Q25 A;  3SEV A;  2K48 A;  2CMO A;  3HV1 A;  3H03 A;  3EPE A;  2GRV A;  4C1T A;  1FQB A;  1BLF A;  1JEV A;  5KDT B;  2UVI A;  4R9G A;  4IGR A;  1B05 A;  4GD5 A;  3N5L A;  5TP9 B;  3TFL A;  5AA4 A;  3TZA A;  2F36 A;  2F6G A;  3L6H A;  1Y3P A;  4NED A;  2QSX A;  2RC9 A;  3ZKL A;  1S9T A;  1ZKB A;  2OLB A;  1LAG E;  2ZMB A;  3CRB A;  3LSL A;  5CMK A;  2H25 A;  4LZ8 A;  1LFI A;  1MY1 A;  1XS5 A;  4DCY A;  2NVU B;  1MM7 A;  3KFM A;  1B58 A;  4GQO A;  3VV5 A;  3G3H A;  4OTE A;  3TPA A;  3DP4 A;  5TPA B;  1TT1 A;  3MP1 A;  5JEI A;  5I57 B;  1PBP A;  1LBC A;  4FE8 A;  1LCT A;  4C1U A;  2I0C A;  1A55 A;  3HST A;  1D3K A;  4ZZE A;  4TOZ A;  3RTF B;  2M8C A;  1AL3 A;  4P0I A;  3O9P A;  4LON B;  1POY 1;  3O6I A;  3PPR A;  3LSX A;  2X9Y A;  3MWB A;  3G3G A;  4IB2 A;  2ONS A;  5H8F A;  2PYY A;  2NUV A;  3B6Q A;  4ZEB A;  2D21 A;  4KI0 E;  1TFD A;  1URD A;  1A54 A;  1H7C A;  1SW5 A;  5DEX B;  3UIF A;  1H45 A;  1N3X A;  1D9V A;  4OES A;  3FV1 A;  3IJO B;  3OEN A;  1US5 A;  2HQ0 A;  5DVF A;  1QUJ A;  2MBG A;  4QRZ A;  1UTH A;  2DXY A;  5FHO A;  3T9X B;  4M1V A;  3RUM A;  4KYS A;  3U8Q A;  2XX7 A;  2HCA A;  3FVN A;  3S9N C;  1IUD A;  3W15 C;  2V3T A;  4RK2 A;  2QS3 A;  1HSL A;  3G7W A;  2XX9 A;  1ZKE A;  3LSF B;  3FVK A;  1IXG A;  4POX A;  2RC8 A;  2IC9 A;  2X7Q A;  5I2N A;  3V89 B;  4MFI A;  4GL8 A;  2B3F A;  4OET A;  1B0H A;  4H1X A;  5ICT A;  1ANF A;  3PGF A;  3TQW A;  4ESX A;  1MXU A;  3HHG A;  4MLV A;  3KN8 A;  4NWD A;  1N3W A;  4KPT A;  3MVZ A;  1LBB A;  1J1N A;  4OER A;  4AQ4 A;  2ZYO A;  1OQG A;  1NMU A;  1MDP 1;  4ZEC A;  1USY H;  3M3L A;  5KZT A;  3BFU A;  4RA1 A;  3HHF A;  1FCK A;  4WXJ A;  1N7W A;  3MJN A;  4JB7 A;  4G4P A;  4OZ9 A;  2OBG A;  1A8F A;  1JVY A;  3FXQ A;  1QSD A;  3CFZ A;  3KG2 A;  4GL0 A;  3FZV A;  4BDR A;  2Z23 A;  2V3Q A;  5H8Q A;  4M4G A;  1SYH A;  1Y20 A;  2W7Y A;  4I8C A;  2NOO A;  1SQY A;  4U2R A;  4EYY R;  3C31 A;  4XKP A;  4ECF A;  3E4R A;  1IJ5 A;  4DIG A;  3ILU B;  1B40 A;  1IZ1 A;  1DOT A;  3GBB A;  3FXD B;  5M2V A;  3T93 B;  1OQH A;  3VXB A;  4DLD A;  2OWS A;  1B5I A;  2ONK E;  3ZSF A;  1B0L A;  1JVX A;  4ELR A;  4OHN A;  3LUY A;  1QKB A;  3IOV A;  1R6Z A;  4F18 A;  4F29 A;  3H06 B;  1B51 A;  4AB5 A;  2OZZ A;  2XD2 A;  2F34 A;  1SDX A;  1DTG A;  5A5X A;  5H8H B;  1BP5 A;  2XHD A;  4R2B A;  2X9W A;  4E0X A;  4NE4 A;  5JTY B;  4U1Z A;  2ZNT A;  1QUI A;  3ZKK A;  2DVC A;  3TTK A;  4QF9 A;  3K6U A;  1MY2 A;  4