3QUJA

Crystal structure of the phosphonate binding protein, phnd, from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
301
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKLAKTTAIQAQLDDLDRLNNALSAMSSVSKAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli uti89
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 100
structure length 301
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3qujA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qujA02
3HV1A 2E1SA 3OO8A 4E0XA 3U94A 3FV2A 3I3VA 3Q29A 4JXIA 1QJMA 4R6HA 4MLQA 1VSOA 2IA4A 5FTIA 3VV5A 3OENA 3LUYA 2DVZA 1H44A 1HSEA 2RC7A 1B1XA 4I9DA 4P11A 3ECRA 2I48A 5DVJA 2C5IT 1A40A 3GLBA 3KJ7A 3C35A 3CVGA 1IXGA 3I5OA 1EZ9A 2YPNA 4G2ZA 1JQFA 3R6UA 2UVHA 4I1DA 3TKDA 3PPQA 1CB6A 3SEXA 3ZKKA 2XX8A 1B58A 1MRPA 5JTYB 4EUOA 3TKLB 3EN3A 1B5JA 3PU5A 4IO3A 4PETA 2PBWA 3E13X 4E0WA 4EQBA 4OEUA 2I0BA 1NFTA 4EQ7A 1MQIA 2DE4A 5KZTA 1QKBA 1Y3NA 3IJXB 1NMUA 3KN3A 3O28A 3ILTB 4IO6A 2RF1A 4MH5A 4PFUA 5H8HA 2OZZA 4R72A 5B7DA 4FEBA 2F78A 3IOUA 2KWHA 4IO2A 3T66A 1EZPA 1JVXA 4X9TA 1B5IA 4R9GA 4F39A 5L9OA 1GVCA 3MZBA 4G8MA 2DWHA 1VFEA 1AOVA 3OXNA 3S2VA 2NOOA 3RTWB 1JETA 3O9PA 4U21A 4YB5A 1O64A 3LSLA 1Y4TA 2X9XA 3RQTA 1LAFE 3TMGA 1S7YA 2H98A 3A3CA 3PUVE 4GLIA 4WKMA 3IOTA 3T9VA 1B4ZA 1URSA 3N5LA 3OEKA 4TOZA 4R2FA 1WODA 1Y1ZA 2OWSA 1BLFA 4BLAA 1J1NA 1SI1A 5IKBA 2ZYKA 1MG1A 5AA3A 1P1NA 1MY4A 4GIZA 1N7WA 1Y9UA 2X9YA 3SDFA 4ZE9A 4P0GA 1B46A 1UIUA 1OLAA 1UTBA 4FATA 5CBSA 3RUMA 2MBGA 1B7UA 1VR5A 2GH9A 3TQLA 3A3UA 4XIGQ 4X1DA 2DWAA 3H6VA 2UVGA 1Z0PA 4F22A 3HCQA 4X1BA 3TUSA 3PMVA 4C1TA 5H8QB 3FVKA 3FVOA 1LFGA 4NF5A 3TTKA 1MXYA 4O3BA 2GHBA 2OBGA 4YKKA 5I84A 3K6XA 3E3KA 3IR1A 4IO7A 3JYRA 4U1ZA 4HW8A 1N3WA 3SEYA 3GZGA 4N13A 5DTBA 4QRZA 1IJ6A 1Y20A 3QAXA 5CBRA 4OMBA 2PMSA 3VE1B 1H76A 1SDXA 1BTJA 2OLBA 2XXIA 5I59B 2KLFA 5DT6A 1N76A 4GL8A 2DE3A 3K00A 3BKIB 4JWXA 4EYYR 4O3CA 3FD3A 2AL4A 3H06B 3OMBA 3C32A 3C9HA 3CFLA 4WEDA 1A54A 4FAJA 3K1MA 3E9XA 4F3GA 4Q30B 5I2NB 4OWDA 3EHTA 5L9MA 3DELB 4ELRA 3Q28A 2NVUB 1FQFA 4XKNA 5TP9B 3USDA 4ELOA 1AIVA 2RKMA 4FE8A 5BWJA 5FTHA 5LOMA 4QFNA 4DXBA 5I58A 1M5CA 1MQJA 1Y3PA 4LUBA 4KD5A 3TPAA 1JEUA 4DXUA 2NUVA 3D4GA 5AA2B 1B0HA 2M8CA 4OVJA 1P1WA 3OD7A 3PUXE 4U4SA 5H8SA 5I58B 1JW4A 4R6YA 3CKDA 3Q26A 2P2AA 1IIWA 1SVXB 5JTYA 2O69A 2GRVA 3T22A 4YMBA 1FQAA 2Q89A 3H6TA 3M3KA 3CR9A 4QFPA 4GXAA 2ONKE 3KSXA 1MXVA 2F97A 1AMFA 2UVJA 1B1HA 3K01A 1ELJA 2HQ0A 4LQ5A 3SERA 1OIBA 3CG3A 1QW0A 1SQYA 1ZLQA 3AXFA 3B6WA 3L6HA 2HFBA 3KSJA 4NWCA 1AH5A 4FI5A 2W7YA 4RPNA 3SEWA 3IORA 3V89B 5ISUA 2G0UA 1TFDA 1IXCA 3RT8A 4DXCA 4Z7EA 1Z7NE 2OCUA 2Q8JA 2B65A 1LAGE 4LP2B 5HM4B 4RK2A 1B0LA 1D9VA 4QFOA 5AA2A 2Q88A 1CE2A 3QXMA 4FORA 2PT2A 3VVDA 2DS9A 2UXAA 4QFKA 3GBAA 4M4GA 2K48A 4YZZA 3PUYE 1OQHA 2G29A 2F6GA 3K0VA 4ONYA 5M2VA 1JNFA 2XXHA 1JVYA 3MUQA 3TODA 5AE4A 4QSEA 2A5TA 3LSXA 4OFJA 1DTZA 4U1OA 1IUDA 2O6AA 5I56B 3KG2A 1A8FA 5TU0A 4N6PA 4ELPA 1KWHA 4FJPA 1PBPA 2V3TA 4LZ8A 3U93A 3UP9A 5A5XB 1LVFA 2H5YA 5B70A 1N04A 3DP8A 2CMOA 3CVRA 1PB8A 2E0SA 3IJOB 4QF9A 1IEJA 3G7WA 2CZLA 1TWYA 5DEXB 1B3FA 1S9TA 2Y84A 2Q2AA 3BFTA 3C36A 1NH7A 3KN8A 4IO5A 3TYHA 3RTFB 4XXUA 4ECFA 3VVEA 3OELA 2AYSA 3UA8A 1MDP1 4LONB 1MQGA 3C34A 1P1UA 3QYTA 3CSGA 4NF5B 3LSFB 2O51A 4IY5A 1PC3A 1D9YA 4NE4A 2QRYA 3C33A 4PFYA 4LA9A 1LAXA 3SETA 2P1SA 1B05A 3H6UA 1MXXA 4BDQA 3MPLA 2F7CA 3MVWA 2NXOA 1YTVA 4RK9A 5K2XA 5H8FA 5AA1A 3EHSA 3IO4A 3V5AA 3JZJA 1OQGA 1YCJA 4OZ9A 4KHZE 1MY1A 3K1PA 5KCJA 4LVQA 1AL3A 1SI0A 4YKPA 4AQ4A 4F3BA 2X7PA 4H1XA 1M5FA 3H03A 3S4UA 1Q1KA 1SW5A 2FA7A 4THIA 2D3IA 4ZEFA 2F35A 2X26A 1XVYA 1NNPA 2DOJA 3B6TA 4OXVA 5EHSA 4BDOA 1OLCA 4GWOA 2IC6A 3THIA 3C31A 3OOAA 3CFXA 2D21A 3TTNA 2FYIA 4F3SA 4ISUA 5JK4A 3G3JA 3G3FA 4ND9A 1HSLA 1R9LA 3MWBA 3T96B 2O1MA 3N6UA 2F36A 4OFOA 2YLNA 2AIXA 1B3EA 4MF3A 5KCJB 3MXZA 4GRKA 1LRZA 4Z0IA 1BIYA 3DP6A 1DPEA 5H8FB 4CQIA 4IGTA 4KQPA 1LCTA 5H8HB 1DPPA 1EH3A 3UGWA 4G8HA 1QUJA 2NWJA 1LCFA 4BDLA 1B7ZA 3V83A 1XS5A 1RYXA 3U72A 4QSDA 3FJGA 1SYIA 4KI0E 3G3KA 3M3FA 2Y7KA 1N3XA 2B3BA 5KDTB 2DYXA 3VLWA 2ZYNA 1B5HA 1QULA 3FVGA 4YB6A 4F2QA 5AA4A 1EU8A 1MXUA 1URDA 2YJPA 3W9WA 2V25A 4XTCQ 2I58A 1R6ZA 2QJEA 4ZEKA 2QL3A 4GF8A 1SW2A 2HZLA 4PFTA 1SYHA 3RPWA 2F5XA 4TLLB 3OO7A 1USYE 3QUJA 3MJNA 4HTGA 3MPKA 4ZZAA 1MDQA 1URGA 2VD3A 1US4A 3DP4A 1LFHA 3VXCA 2XX9A 3MVYA 2G93A 2DWJA 4NEDA 4YAHX 5DVIA 3LC8A 3T9UA 2Z8FA 3VFJA 4F29A 4F18A 2DXRA 4XKRA 2RC9A 4KR5A 1NNFA 4Q5TA 1A99A 4MFIA 4NF4B 3SESA 3W9VA 3KOTA 4M1VA 3IB0A 4EF2A 1MPDA 4ZEDA 2UYFA 1ZMGA 3O6IA 3N94A 1LFIA 4OERA 4MLVA 1QKAA 5I59A 4KYEA 5L8DA 5CMKA 1FTKA 1ZIUA 2Z23A 3U1OA 4BDRA 3FUZA 1MM7A 3HN0A 3MVXA 2QS1A 2HAUA 4G4PA 3WAEA 4H67A 3UN6A 4YMAA 2AL5A 4PFWA 3O6GA 3TELA 5BUUA 1F9BA 3O66A 5H8NB 3MP1A 1DTGA 1RKMA 1ATGA 2XXQA 3IX1A 4KYDA 4P0IA 1PEBA 4H8IA 4PP0A 2REGA 3PGFA 3IOVA 3MAMA 2DP8A 4NF6B 1JW1A 3H3GA 4UACA 4LQ2A 4R73A 3TCHA 3TTMA 3RLFE 2C5JA 4NF8B 3FXDB 3F11A 2R9JA 3S9EA 3EHUA 2A5SA 3HPIA 5K2YA 4ZECA 1VE4A 4R75A 3CIJA 1ZJLA 3IL1B 1EZOA 1HSJA 2I4BA 3S9NC 3OEMA 4H8JA 4BDMA 2B3FA 4X48A 2OK2A 2V93A 1N7XA 3CG1A 1POY1 1ZKBA 1I69A 2QPQA 2V3QA 4GD5A 4KCCA 1MQHA 5I2KB 3FJ7A 3UORA 4ZZEA 3VLUA 1MQDA 1N0TA 4OESA 3T93B 2XXUA 1BP5A 2A5TB 4KYSA 3OO9A 2CA5A 4DNDA 4GOTA 3B7DA 5I2NA 3TZAA 1WVJA 2ZNTA 1H45A 2ESNA 1Q35A 2Z22A 3PUWE 4WXJA 3QIMA 5TP9A 3SEVA 2OJTA 1PB9A 3JV9A 2QS4A 2BJJX 3PD9A 4L17A 2GHAA 2XTLA 4OQOA 1R1NA 2R6GE 3DLNA 1IZ1A 3CI8A 3PPPA 1DSNA 1QUKA 1ZU0A 3Q25A 1LB8A 2Q2CA 2RINA 1PDAA 2I3WA 5CMMA 5CMBA 4TLMB 1GTKA 4MBPA 3TAJA 1UQWA 3M3LA 2Y7PA 1XHYA 5FHOA 3IOWA 4YB7A 2LAOA 4F2OA 5ICTA 1NNKA 1NNTA 1XT8A 1D4NA 2QS2A 2WKYA 2DWIA 2ANJA 5H8NA 4F1VA 1B4HA 1GR2A 2XXPA 2XXXA 4IB2A 3PUZE 1B51A 1R9QA 2PVUA 4RNSA 3G3HA 5FHMA 2DSFA 4DDDA 1B52A 3MP8A 1MXZA 2OWTA 2HXWA 3O29A 4OYVA 3FVNA 3FIRA 3QSLA 5L9SA 2UVIA 1IXHA 1US5A 1Y1MA 4L0RA 3H6WA 4OFLA 4YICA 4ESWA 2O7UA 3OSQA 3C4MA 1MPBA 3FASA 3K6UA 2Y7RA 3H4ZA 2I4CA 1YAEA 2Z8DA 1B9JA 2F7AA 3QUFA 4I8CA 1FTMA 4K3FA 2QS3A 4KFQA 4WEPA 3RY3A 1NH8A 2XXWA 3KZGA 4EQ9A 3FXEB 2X9WA 3IB1A 1M5EA 4LZ7A 4U2RA 5HPQA 1TT1A 2ZNSA 2Z8EA 1OVBA 4RXLA 4OENA 3K6VA 1IITA 1SD3A 4R9FA 5TPAB 3QK6A 3K2DA 2XXTA 4YKJA 5HBCA 4ZEBA 3T9HB 1LAHE 3Q27A 3T9XB 4RY1A 3G3GA 4DE8A 4EDPA 4IO4A 4JSDA 1SBPA 1DMBA 4JBZA 3RGYA 3W15C 4ESXA 1Y3QA 1B7HA 1OVTA 2O68A 2H25A 3G3IA 1FTOA 3I6VA 1MH3A 4DLDA 4JWOA 4NF6A 4H5GA 1LLSA 3MP6A 1O63A 3PMWA 4H65A 4JB7A 5F1QA 5ELVA 3P7IA 3K1NA 3FGSA 3ODBA 2RCAA 3TFLA 3TQWA 4YU0A 4ZE8A 1IQ7A 5H8QA 3CSBA 4GL0A 5A5XA 2H99A 2PYYA 1NL5A 2QMWA 4QFLA 4BDNA 4DCXA 1LSTA 4RYAA 3R26A 4RPOA 3TTLA 2VGQA 3LBSA 2O7IA 4F31B 3SEUA 5I57A 4FIMA 4EXLA 4R2BA 4XKQA 5CMCA 1GV8A 1T0KA 4U4XA 4GFRA 1A55A 2KWIB 1FTLA 5IAIA 3MW0A 2VP1A 4R74A 5I57B 1DOTA 1H43A 2VOZA 4ZS9A 2DVCA 3VVFA 4HCWA 4NWDA 1XVXA 1LBBA 2ZYMA 3MZ1A 3M8UA 2REJA 2ZYOA 1QSDA 3DM0A 1FQCA 3PPNA 1M5DA 1JEVA 4OTEA 2I6EA 4JDFA 5JEIA 4U23A 3ZSFA 4QSCA 3U8QA 1FW0A 3PV0E 5ITPA 3ONMA 1ZTYA 1FQDA 3FV1A 3L3PA 2ONSA 3ILUB 4POXA 3WAFA 1MS7A 1H7CA 1OMPA 3KFMA 3ZKLA 4YKIA 5I56A 1B40A 2F34A 4Q0CA 1B6HA 1MY2A 4G77A 1TFAA 3U92A 2V84A 4H0WA 4AB5A 4G68B 4ZDMA 3O6HA 2RC8A 2DQVA 4FEDA 5J1DA 3SKPA 2Q9TA 1XOCA 2HCAA 2QMXA 3H7MA 4QHQA 4F1YA 3HHFA 3CRBA 4U22A 1UTBB 4LZ5A 2ABHA 3MC2A 3MQ9A 3IO6A 1Z7ME 5EHMA 3TCGA 5CM6A 2Y7WA 1IJ5A 2D5WA 3FXUA 1MM6A 2O1LA 2XHDA 2IC9A 4OHNA 1MXWA 4KPTA 4HS7A 4PQJA 4F19A 4Q8RA 4DIGA 4OETA 1B3HA 1VFDA 4LATA 2F8DA 1I6QA 1UTHA 2C5KT 3MBPA 1SW1A 4PE5B 3TCFA 4AB6A 4G68C 5EYFA 4ELQA 2RCBA 3FZVA 1QUIA 4RA1A 2R71A 2XXVA 3RT6B 3A09A 3S9LC 2FNCA 4NMYA 5DEXA 1SW4A 2GFEA 1FCKA 2ZMBA 2PX1A 2XD3A 4DCYA 4HCYA 1B3LA 2X7QA 4XKPA 5TPAA 4C1UA 1B32A 1LBCA 1MY0A 1N84A 2P0SA 4GVOA 2F6PA 1UIVA 1MY3A 3BBRA 3E4RA 3KJTA 4ZEIA 3VDFA 1P99A 3KEIA 2XD2A 5DYHA 1NKXA 1POTA 1S50A 3RN8A 4F3PA 3PPRA 1MH4A 1USYH 3D4CA 1I6BA 3FXQA 3LR1A 4N07A 2O84X 4DZ1A 1WDNA 3FXRA 3HO7A 1RYOA 2VHAA 1FQEA 1FTJA 2XX7A 2V3UA 3MVZA 3RNNA 1IXIA 3TEPA 2ZXTA 4F1UA 1O7TA 4NTLA 1D3KA 1H3DA 5I2KA 4EXKA 2H4IA 3KGCA 1XC1A 3LSWA 5DVFA 1P1OA 4EF1A 3S9MC 3VLVA 1JW5A 3K4UA 3IK6B 3O97A 5F7VA 1PBQA 1UTHB 3UIFA 2VD2A 3IAZA 1GGGA 3R7XA 3OO6A 5FHNA 2Y7IA 5CRYA 1MPCA 1A8EA 1FQBA 3MZ9A 4O3AA 2I0CA 4RJZA 3V8XB 4NF8A 1A7LA 2HZKA 2HEUA 2XXRA 4H5FA 5CI5A 4KCDA 3UK4A 1P1QA 3OSRA 2I3VA 1I6AA 2PT1A 1LGBC 3K6WA 3EQ1A 2QSXA 4UA8A 5CC2A 2DXYA 3B6QA 3BFUA 3KOSA 3KN7A 2F7BA 1L5TA 5AA4B 1QVSA 4I62A 3EF7A 4G68A 2ONRA 3PMXA 4FECA 1ANFA 3L6GA 4G8NA 5AA2D 5KDTA 4JSOA 1II5A 1YPNA 4J2CA 3PD8A 1LB9A 4IY6A 4TQUQ 3GXAA 2H9BA 3HSTA 4H6DA 3TTRA 2THIA 3ZS6A 3TDJA 3HHGA 1B2HA 1B3GA 2ALUA 4GXSB 2ZNUA 3KBRA 3K02A 3GBBA 4IGRA 4OEVA 3VXBA 1Y4CA 1PB7A 2DE2A 3EPEA 3N6TA 4R6KA 3FJMA 2UYEA 3PPOA 1BKAA 1TXFA 2HAVA 5ITOA 5ICQA 4POWA 1M5BA 1ZBMA 3N26A 4GQOA 3CFZA 4NF4A 4B6XA 3IB2A 2I49A 2IEEA 4C0RA 3O2AA 1ZKEA 3FATA 2XXYA 4JWYA
chains in the Genus database with same CATH superfamily
3HKCE 2WU2A 3FV2A 3Q29A 4JXIA 4R6HA 2CZIA 1MNEA 3OENA 5T3JA 1UCUA 4HFEA 3KC1A 1H44A 4I9DA 1B1XA 2SPCA 4X66T 1A40A 3GLBA 3KJ7A 3ANWA 5FMNA 1IXGA 4DV4T 2YPNA 2XUEA 5JVDE 3HFUA 2KINB 3PPQA 3SEXA 1KF6A 4YJ3E 4EUOA 3TKLB 1T72A 2Z6EA 1FBEA 4AKIA 1K9ZA 1NFTA 2CM0A 2DNXA 3O28A 4MH5A 4IO6A 2NTYA 3KN3A 3LJCA 4B3ST 3T66A 2FIEA 1B5IA 4F39A 5L9OA 4A98A 2LSGA 1WLXA 2NOOA 3RTWB 1O64A 4P0BA 2E8IA 4PFRA 3PUVE 3A3CA 5HXHA 1B4ZA 1URSA 1OEDB 3CWZB 3N5LA 3OEKA 2WMNA 5J2TE 1WODA 2CZKA 3IA3A 3JAEA 3OVUA 1SI1A 3V5UA 5AA3A 4GIZA 3SDFA 4ISTA 1OLAA 3KV4A 3RUMA 1YKEB 4X1DA 1ZV4X 3H6VA 2Q9QA 4KHZF 4X1BA 4HFIA 2NW8A 2WBBA 4O3BA 4E7ZA 5L4HA 3BIHA 3K6XA 4HE2A 4N13A 2PJQA 2I59A 4O2BE 3RYCE 4OMBA 2PMSA 5AQVB 4PAIA 2KLFA 5DT6A 3RPWA 2W67A 3EDUA 3BKIB 4O3CA 3OMBA 2AL4A 2W63A 4WEDA 3CFLA 2J1DG 4ZOLE 5I2NB 3VR8A 4WBNE 4CZZB 4CN6A 4AQYT 5TP9B 2JQQA 1AIVA 3N2KE 3N2OA 2RKMA 5LOMA 5HAXA 5FTHA 2NWBA 4H9SE 1MQJA 4OVPA 5LG3A 3T1BA 3ZYLA 2NUVA 2W62A 5AA2B 1B0HA 4OVJA 1P1WA 3KFWX 3OD7A 5AQHB 1JW4A 3Q26A 5KXJA 3N9PA 1IIWA 2XWIA 4GWXA 2GRVA 4YMBA 2Q89A 2MYSA 4O94A 3CR9A 2UU9T 1MXVA 2F97A 3OPCA 2LSIA 3K01A 3UU6A 2OV9A 1FPGA 3U93A 5FXXA 2A72A 3ZEFB 3AXFA 3B6WA 2HFBA 4ZHQE 3A5XA 5ISUA 1IXCA 1WYCA 1BK4A 2X68A 4LP2B 2QA7A 4RK2A 4NAPA 1B0LA 2YK0A 4U2ZA 3K1SA 3HKBE 4ONYA 5M2VA 5IWAT 3MUQA 4LF8T 2A3DA 2XQ7A 5HEJA 4QSEA 3ESLA 1IUDA 2XSAA 2ZLYA 1S35A 1NV6A 5HWYA 3UP9A 4LZ8A 2X67A 5HXCA 1LVFA 2H5YA 4O7MA 2V5CA 4QF9A 3IJOB 1X9BA 2E9XC 4ZEYA 1PB8A 2E0SA 3G7WA 2XSBA 2FBWA 5HXRA 1B3FA 3TYHA 2Q2AA 4U7IA 3KN8A 1B7TA 3ABVA 1IMFA 3VVEA 4DBQA 2AYSA 2LHNA 3QYTA 4YTPA 4IY5A 3T1HT 2QRYA 3C33A 4PFYA 5EQ8A 3SETA 2P1SA 4P3LA 4DR6T 3VHLA 3MPLA 2NXOA 4NGUA 5AA1A 3IO4A 3VR9A 1MY1A 4U72A 5FBPA 4AQ4A 4YKPA 4OFZA 4B3MT 2CHNA 2D3IA 2XWOA 1XVYA 4PDDA 4GWOA 3N9OA 3AE5A 5LB7B 2HXRA 2VWAA 1UURA 2D21A 3BQIA 4N17A 1HSLA 2ZZXA 3SRZA 3RLFF 3PV0F 2YLNA 4MJOA 4MF3A 3RIAA 1LRZA 2ZZVA 1MIYA 3D0TA 1BIYA 3DP6A 1Y01A 1FPJA 1NENA 1NUYA 2QVRA 2KSRA 2NWJA 3HKEE 1HS7A 2A2FX 4NX1A 5JTGA 5CGMA 2ZYNA 3FVGA 1QULA 4C90A 4YB6A 4KP3C 1NI9A 4DI4B 4GKKT 2V25A 1R6ZA 2QL3A 1SW2A 3ANWB 2HZLA 4PFTA 1UUSA 2UXCT 4HTGA 4ZZAA 1LFHA 3VXCA 3ZMTB 2G93A 3Q5DA 3MJXA 1N34T 2Z8FA 4F29A 5DQWA 3P4RA 5DABA 3PJAJ 4LMKA 1NNFA 3CHGA 3GWHA 4PJJA 4AISA 3KOTA 4X20E 1ZMGA 4JI3T 4OERA 5I59A 4EB6E 4U74A 5AQOB 2UUCT 2QS1A 1M7KA 4YMAA 5BUUA 3O66A 3FBZA 3MP1A 5H8QB 3RRWA 4H8IA 2REGA 2X0YA 3GN5B 2DP8A 1JW1A 4R73A 3TCHA 3TTMA 3W15B 2C5JA 3AXJB 4NF8B 5BMVE 2R9JA 4OVQA 2A5SA 3HPIA 4BA9A 5K2YA 3RQWA 2UUAT 1HSJA 2I4BA 2WEFA 4DV0T 3CG1A 4GD5A 1I69A 4P8BA 5I2KB 3UORA 3FJ7A 4ZZEA 4JV5T 2L9QA 5LDZA 4OESA 2XAGB 1OEDC 2XXUA 3UUXB 2D0TA 2CA5A 3Q5WA 3NBXX 3FXBA 2ZNTA 1H45A 3B57A 3F31A 1MIWA 1Q35A 3ZPOA 2Z22A 3SEVA 1D9QA 3SFEA 3UU3A 2GHAA 3EKIA 2X66A 5JDLA 2RINA 4YFSA 1GTKA 4TLMB 3TAJA 5FL1A 4CXXA 3RHWA 2QS2A 2NW7A 2LT3A 3ONJA 4X1KE 2XXPA 2CPTA 2XXXA 4IB2A 1B51A 2DSFA 1B52A 2Q9QD 3O29A 3FVNA 2V6XA 4NXNT 1MPBA 2FUPA 5HYAA 3FASA 2Y7RA 3H4ZA 2I4CA 1YAEA 4K3FA 2F7AA 4E7SA 5LYJE 2XQ3A 2XXWA 4U3CA 4B3RT 2PCRA 4EQ9A 2X9WA 3IBPA 1M5EA 3IB1A 3OJAA 1TT1A 2ZNSA 1MMGA 3E22E 1VCTA 5TPAB 2JQHA 1YW0A 2C0SA 1LAHE 4JSDA 2CBJA 1SBPA 1DMBA 3RGYA 3AAAB 5L4EA 1Y3QA 4DLDA 5JDQA 4H65A 4PGPA 3Q5XA 3FGSA 4H9OC 4AKRB 3RYIE 2KXPB 2PG8A 3TFLA 3TQWA 2HPLA 2YINA 3K3NA 4BDNA 3LK3B 1WCRA 2VGQA 4ANJA 3SEUA 4EXLA 4R2BA 4EZ4A 1KFYA 2BS4A 5EQAA 5FL0A 5JREA 5IYZE 4GFRA 2ZM6T 4IT4A 5JDGA 4F8HA 3AVSA 2DVCA 2VOZA 5L3CB 4QX7B 3N9NA 2BZBA 2ZYOA 1QSDA 1LVKA 1FQCA 4PC9A 5FVKA 4OTEA 2XA5A 4TX5A 3RF1A 2LJLA 1BR2A 3PV0E 3ONMA 3R6NA 1FQDA 3L3PA 3ILUB 4O4IE 1OMPA 3KFMA 3ZKLA 4ILAA 3CQGB 3FZLB 3C64A 4G77A 4N8GA 2MKZA 4QWNB 2FJDA 4ZDMA 3O6HA 3O1HA 1FSAA 2JRKA 4IR8A 2Q9TA 5LCYA 1NV4A 4JVDA 4QHQA 1UTBB 3MQ9A 2QVUA 3KBTA 1IJ5A 4YAHX 4PK6A 4IIJE 1MM6A 1D0ZA 5LJMA 4OHNA 4HS7A 5LBQB 3TLSA 1T7SA 3MK7C 4LATA 2C5KT 4ELQA 2LHRA 4HE1A 2EHOA 2RCBA 1QUIA 3RT6B 2CHOA 1SHZC 3A09A 5DEXA 2GFEA 2XAQB 2KNDA 5C8YE 2LM2A 1B3LA 2XM2A 5LOVE 3BIGA 4TWFA 5TPAA 1B32A 2WB5A 4AI6A 2JIWA 2F6PA 3KJTA 3VDFA 3RN8A 4MALA 1NKXA 5JDNA 2V7LA 4LN5A 1USYH 3FXQA 2O84X 3HO7A 5IZ3B 3RNNA 2XX7A 1VOMA 3U3IA 2ZXTA 3TEPA 4F1UA 1US7B 4EXKA 2H4IA 3VLVA 3O97A 5F7VA 1QUUA 1UTHB 3AA6B 2VD2A 1GGGA 3E79A 3OTOT 1FQBA 1MPCA 4O3AA 2V4CA 4HWCA 1WR0A 2HZKA 2XXRA 5CI5A 5JDHA 4PAKA 1K9YA 2I3VA 1I6AA 3OSRA 1LGBC 3K6WA 3EQ1A 2QSXA 1KNPA 1MMAA 2MTQA 3B6QA 3BFUA 5A1LA 4H9PC 4FECA 1FPFA 1YPNA 4J2CA 1BR4A 4HTEA 2H9BA 3TTRA 3ZS6A 2FJAA 3TDJA 2ALUA 2WDVA 3VXBA 4OEVA 3GBBA 4ILUA 4LF6T 1Y4CA 3N6TA 2VVSA 4R6KA 4MHCA 3ZMSB 1TXFA 2H3RA 4POWA 3CFZA 3AAIA 4YSZA 4NF4A 4C0RA 3AE1A 2VKDA 4JWYA 4E0XA 4LF9T 3VV5A 1QJMA 4MLQA 3EDVA 3FHNA 4PK4A 3TLTA 5FP3A 2GK9A 2WYKA 3CQCB 1XMOT 1HSEA 3ECRA 3CK6A 2C5IT 5AQSB 2V6YA 4QXDA 5JR9A 4G2ZA 1JQFA 5KMGP 5LHHB 3ZKKA 5DQVA 5JTYB 1G0HA 1B5JA 3PU5A 2CCQA 4PETA 3E13X 1HNWT 4OEUA 4NF0A 3I0OA 4EQ7A 1QKBA 3IJXB 1NMUA 4PFUA 1XDPA 2RF1A 5H8HA 2OZZA 4FBPA 1JVXA 4X9TA 4R9GA 3ZC0A 4XZCA 3OXNA 1JETA 2RP4A 4U21A 4EV6A 2ZZWA 4DV1T 1S7YA 4WKMA 4GLIA 5JQGE 3AA1B 5I5PA 1W0BA 2WSSV 3FZFB 4TNVA 5AQKB 3IOTA 3T9VA 2DI4A 4TOZA 4R2FA 2OWSA 4PW8A 1BLFA 4JUYA 4JYAT 1J1NA 2ZYKA 2L3LA 1P1NA 4ZE9A 4P0GA 3NZPA 1UIUA 2DWKA 5CBSA 1NV3A 1VR5A 1FJ9A 2DWAA 1KZ8A 1E1HB 4C91A 2GQ1A 1LBWA 4KHPT 1MXYA 2CZHA 2GHBA 3ZMZB 1YQ3A 3CPZA 4GBWA 4DI3D 3FBPA 3JYRA 1HG5A 4U1ZA 1M62A 2IW5B 1N3WA 5DTBA 1G0IA 2BS2A 4IE4A 4HFCA 5LHGB 4MIJA 4HE8A 4H63H 1Y20A 5CBRA 5F24A 5J1GA 1H76A 2OLBA 1BTJA 1HCIA 5A5XA 4JWXA 4IE7A 1DK4A 3FD3A 3H06B 3ZCJA 3RKOA 1YXIA 2UXDT 3NVOA 2CEXA 4F3GA 3CQXC 5FXWA 4Q30B 3E78A 5BR8T 5DW8A 5L9MA 3DELB 4ELRA 4ELOA 3N9QA 4FE8A 2ODUA 3PTYA 4DXBA 4ZXLA 4IHJE 1E2AA 3TPAA 4U7YA 1NAFA 3CX6B 3IFAA 4U4SA 5H8SA 4QXCB 5ADXL 3CKDA 2OX3A 4IREA 1G73A 1SVXB 5IM2A 5JTYA 2NP9A 3TUSA 1FQAA 3ZC1A 3ROJA 3N2GE 1YYZA 1ELJA 2HQ0A 2XY8B 3ZSTA 1JNRA 2W7YA 3KVAA 4RPNA 3SEWA 1TFDA 3RT8A 4DXCA 3C98B 4PFPA 1Z7NE 4ZS2A 2B65A 1LAGE 5HM4B 5AA2A 4X62T 1FPEA 5AQTB 2Q88A 2XWVA 3QXMA 4FORA 4HWFA 3GBAA 4WW0A 4HKAA 4YZZA 3PUYE 1OQHA 2G29A 2F6GA 5I59B 4GX3A 1JVYA 4TUYE 4OFJA 1KNRA 4HFDA 3SS1A 3G06A 5LNKA 5TU0A 4G63A 1KWHA 4FJPA 5LGNB 3CVRA 4QHOA 4DR2T 1IEJA 4AS5A 1TWYA 2KR0A 3NRXA 5DEXB 1S9TA 3RTFB 4ECFA 3NWIA 4LONB 1CHUA 3TLUA 3CSGA 4NF5B 2O51A 4P56A 1JP4A 1PC3A 1O3XA 4PK5A 1HFAA 2N9DA 3PDYA 1EYIA 1MXXA 4PTKA 2YKSA 1YTVA 4XEQA 4UV9B 5IZ3A 4N81A 5KCJA 3JZJA 4NN3A 3RIUC 3K1PA 2X7PA 2CEAA 3H03A 3DJBA 1Q1KA 4MNIA 4THIA 2P9BA 3VU7H 2F35A 2DOJA 4OXVA 4DV2T 1U4QA 3MSTA 3AE9A 4H9RC 4WYVA 1SPIA 2XAFB 4I55E 2YU2A 2XQ4A 4F3SA 2FYIA 3SFDA 4ISUA 5JK4A 2WM9A 2V26A 4ND9A 1R9LA 2HN1A 4TWDA 3N6UA 1HX1B 3R84B 3A7MA 2AIXA 1B3EA 2VPNA 2JJ9A 4PFOA 2NW9A 4PF6A 3U65A 3QC9A 4DIDB 1ZHCA 4IGTA 1LCTA 5H8HB 1DPPA 3T8OA 1EH3A 3V83A 1SA0E 1XS5A 2CBIA 4AQGA 2Q74A 1KNZA 3G3KA 3M3FA 2B3BA 5KDTB 4I0UA 3VLWA 4NG7A 2LE8A 4F2QA 4MBQA 1EU8A 1URDA 2QJEA 1FBCA 4Q25A 5EYGA 2CWYA 1RDZA 1URGA 3HR0A 5LP6E 2XX9A 4NEDA 3VFJA 2DXRA 5LG4A 2KQZA 4XKRA 2VL0A 1HNXT 1A99A 4NF4B 1IBMT 3SESA 3LFMA 4M1VA 3IB0A 4EF2A 3O6IA 3N94A 2XAJB 5CMKA 5J16A 4BAYB 1FTKA 1LBYA 1ZIUA 2Z23A 3FUZA 2LRLA 3QOFA 3WAEA 4G4PA 2HAUA 4OANA 2H7VC 4H67A 3TELA 4LFBT 4HGAA 1F9BA 2JMHA 2VK9A 5H8NB 4P0IA 2XXQA 1RKMA 1ATGA 1W9RA 4PP0A 4U1OA 1FPKA 1SE7A 4NF6B 3H3GA 2J47A 1IAPA 2K24A 4IDNA 4PE3A 3S9EA 3ZMVB 4DV3T 3CIJA 1ZJLA 3LUZA 4NHBA 3OEMA 5C2TA 4H8JA 2Y5KA 3M3ZB 3PUGA 2ZMAA 2H89A 1FRPA 1N7XA 2OK2A 3VKHA 3OYZA 2V3QA 3HA4A 3VKGA 4GWZA 2DWGA 2YDSA 4EIWA 4DR3T 4AKGA 3RPLA 3TLVA 2E9XA 1BP5A 3OO9A 5I2NA 1AWBA 3B50A 3ZLIA 2CWOA 4WXJA 1PB9A 2BJJX 4UXNB 2XTLA 4NIQA 1R1NA 2R6GE 1IZ1A 5JRCB 3PPPA 2BKNA 1QUKA 3Q25A 1LB8A 2XXKA 2DLRA 4AQFC 3C4WA 5LBMA 4MBPA 3M3LA 3PUAA 3O1JA 4JEUB 4WBOA 1OEDE 2J4GA 1NNKA 4XF5A 2VVNA 4F1VA 1B4HA 1GR2A 4N6DA 2PVUA 4TN7B 5HEUA 2OWTA 3MP8A 2HXWA 3QSLA 4QKNA 4L0RA 4ESWA 2O7UA 3ZT5A 2VT5A 3OSQA 4PFBA 1XZYA 3PJAA 4KFQA 5ETWA 1WYBA 4DBRA 2UUBT 1FTMA 2QS3A 2X51A 2FJEA 5HPQA 1OVBA 1IITA 1IBKT 4YKJA 3T9HB 4DE8A 4OYJA 4UVBB 4A5XA 4JBZA 4ESXA 3K3QC 3QB5A 5EZYE 1OVTA 3G3IA 3I6VA 1MH3A 3MP6A 1O63A 2XQYA 3CX7B 4DV6T 2KZ7B 1IQ7A 3QB5K 4QFLA 4DCXA 4HXVA 1LSTA 4RYAA 2E9XD 3TTLA 3LBSA 2O7IA 4PAFA 1GV8A 5HCJA 3MW0A 3HL6A 2VP1A 1H43A 1IMAA 2CMRA 2CXFA 1LBBA 2FVZA 2REJA 4GK5E 4V1Av 4JI1T 4ZS3A 3LV0A 3LDQB 4U31A 2F3BA 5JEIA 3ZSFA 5JH7E 2N1GA 4JI5T 1NV1A 3WAKA 3FV1A 2ONSA 4POXA 3WAFA 1E7PA 4UR9A 3AVRA 4YTMA 4ILBA 1HX8A 4UVCB 1B6HA 1DU2A 3RI5A 4AB5A 4NUUA 3RC3A 2DQVA 4QBAA 2HCAA 2QMXA 1I94T 4EOZB 3HHFA 4DR1T 4CI2B 3MC2A 3IO6A 5EK4A 4MNPA 2Y7WA 4AS4A 2D5WA 2XHDA 1MXWA 2FHYA 4IGUA 1B3HA 1VFDA 1NV0A 3GA8A 5EYFA 4MAGA 5A5LA 3CMLA 5EK3A 1XNRT 2XXVA 1FBHA 1N33T 4P1LA 5FYMA 3D1RA 2I6HA 4ZI3C 1FCKA 1N36T 4K0KT 2PX1A 3EI0A 2X7QA 4JVIA 1MY0A 2P0SA 4GVOA 3ETUA 1UIVA 3BQLA 1FEWA 2CRBA 4F3PA 1POTA 3GMIA 3LR1A 3ZCIA 1I6BA 4DZ1A 4BJNA 1WDNA 1RYOA 1FQEA 3MVZA 3RPUA 2IHR1 1D3KA 4MMPA 1H3DA 1XC1A 5DVFA 3S9MC 1PBQA 3B8BA 3IAZA 3O9XA 5FHNA 5LMNT 4RJZA 2Q8MA 2P3VA 4H9NC 1JNZA 5HEGA 4IE0A 3UK4A 1YZ0A 4UA8A 4HN9A 4U2YA 1QVSA 3K8PC 2WZIA 3PMXA 1CNQA 1II5A 3PD8A 1G8XA 3PE0A 4X1YE 2J62A 2K5BB 5F8PA 2VL8A 1B2HA 2FJBA 2ZNUA 3K02A 1QGXA 1PB7A 3FJMA 5ICQA 3RH3A 1ZBMA 2EHOB 2IEEA 4P09A 3O2AA 3LG7A 1ZKEA 2XXYA 1QLBA 2CLYB 3HV1A 3OO8A 3U94A 5FTIA 3BK9A 3LUYA 2I0MA 3H37A 2PBIA 2ZM8A 4DR4T 2WZHA 3HKDE 4M1PA 3Q9DA 4I43B 5M4YA 2M6BA 2ZM2A 4DUZT 3I5OA 1EZ9A 2Y5LA 3R6UA 2UVHA 4I1DA 4ILCA 4HFHA 3TKDA 1CB6A 1B58A 4IO3A 4E0WA 2PBWA 3CX8B 3RYHE 4JVCA 5KZTA 2VASA 4R72A 3RC8A 4FEBA 1EZPA 5LGTB 1GVCA 1WFDA 4O4JE 1VFEA 2DWHA 5IGAA 4PJLA 4YB5A 4FJOA 4XBFB 3RQTA 1LAFE 3RRCA 2H98A 2BBHA 2E2AA 3C4ZA 4TNWA 2VKOA 2H7OA 1XMQT 3SOLA 3AE6A 5HXSA 3GYYA 1MY4A 4HWDA 2WWUA 3JC6D 4DV5T 2KMFA 4N78D 2GH9A 3TQLA 4I40A 4XIGQ 2UVGA 1Z0PA 3DP7A 3HCQA 4F22A 2LKGA 4TV9E 4C1TA 3TTKA 3FVOA 1LFGA 4NF5A 2NOXA 1RDXA 4X1IE 3J9X1 3L09A 4WZXA 1Z8UA 2V6YB 3E3KA 3IR1A 4IO7A 3FB2A 4UELA 3UU5A 1FJ6A 3GZGA 3RYFE 1IJ6A 3AEEA 3VE1B 3T0JA 4O8SA 1N76A 5H6QB 2DE3A 1S94A 3K00A 1FPBA 1UGOA 4H46A 3C9HA 4XFEA 2XHEB 3EVYA 4OWDA 3EHTA 3QMFA 4G2AA 1YKHB 2NVUB 4XKNA 2M6IA 4BJMA 5HEHA 4QFNA 2WAUA 4PJNA 1Y3PA 4KD5A 4DXUA 3AE4A 1KA1A 3D4GA 2KT9A 2M8CA 2PFYA 1W0AA 4R6YA 4WNKA 3O4XE 2P2AA 5HWXA 1FMWA 3T22A 3ISPA 2XASB 4QH5A 1NV7A 3WI3A 1AMFA 2UVJA 4LQ5A 2VKHA 3SERA 1OIBA 5EYHA 1QW0A 1N32T 1SQYA 1ZLQA 5CB4E 4ZI2C 3KSJA 4FI5A 3I0QA 4AKHA 2G0UA 4MNCA 4KMCA 3AE3A 2HN2A 3PU3A 1CE2A 5FKYA 3VVDA 2PT2A 2DS9A 5JRCA 4JI6T 5CA0E 2K48A 2RPAA 2DHRA 3K0VA 5AE4A 5I56B 3LSXA 1MNDA 2W0GA 3UT5E 3KG2A 1A8FA 4X65T 5F3JA 4ELPA 1NWMX 1PBPA 1WRDA 2V3TA 5A5XB 5B70A 1HF8A 3KV6A 3X1DA 3KBZA 3DP8A 2CMOA 4IL4A 3B5MA 5LJNA 2RA1A 4QH4A 1J5ET 2BJIA 2Y84A 4QX8B 1D1AA 3LSVA 3P4PA 4IO5A 4K0UA 4XXUA 3GN5A 2CE7A 2E5VA 1MQGA 1YXRA 1D9YA 4NE4A 2VB6A 2WDQA 2K9AA 4JBWF 3A29A 1NUZA 5K2XA 3V5SA 1FJGT 1GQEA 3V5AA 4OZ9A 2E9XB 4KHZE 4LVQA 1AL3A 1SI0A 2Q9QB 4HE0A 1MMNA 2FA7A 3ONLC 4ZEFA 3B6TA 5DJQC 5EHSA 2IC6A 3C31A 4JLEA 2V7JA 1LBVA 4HEAA 3MWBA 3LBXA 2O1MA 2F36A 4OFOA 2MAWA 3TLWA 5KCJB 1DPEA 2DDKA 5H8FB 2WCAA 1QUJA 1B7ZA 2OA5A 2UXBT 2XAHB 1SYIA 1T8BA 4PFIA 2Y7KA 2BBJA 2DYXA 4B3TT 5AA4A 3VRBA 3MACA 2XQAA 2HHMA 4XTCQ 2I58A 4ZEKA 3F2EA 4GF8A 2LOPA 1SYHA 3PUVF 3QUJA 1USYE 3MKDA 3MPKA 1MDQA 2VD3A 1US4A 2DWJA 3LC8A 1RDYA 4MX6A 3ZYKA 2YDQA 3ETVA 3ZJ2A 4MFIA 3EHZA 4ZEDA 4JEHB 2W2UA 4KX6A 2B76A 2XQ9A 4MLVA 2IDOB 3U1OA 4BDRA 2AXDS 3MVXA 2WQYA 4GYRA 3ZN1B 1ZEEA 2AL5A 4PFWA 3Q5EA 4JI0T 3O1IA 4LMLA 1DTGA 4KYDA 3B13A 3EABA 5ABHA 4UF0B 3IOVA 4OVRA 3P4SA 4IE6A 4LQ2A 3RX6A 1MMDA 2BVLA 2IMLA 3FBLA 4O8MA 3ZMUB 2ES0A 3EHUA 3Q2MA 2B4LA 3ZYMA 1VE4A 4XAXB 4PNIA 4YY3T 2EHOD 2BKPA 3S9NC 4BDMA 4X48A 4O4HE 3N9LA 2V93A 4KCCA 5AFUL 2QPQA 2E5LT 2BG9A 4GX4A 1MQDA 3U78A 1N0TA 4DVDA 4IDPA 4NPPA 4OYKA 2M67A 4EGWA 4DNDA 4GOTA 3B7DA 1BR1A 3TZAA 5FY7A 3SWHA 5TP9A 5CJ5A 2WBLA 3JV9A 3PD9A 4L17A 1IMEA 2L8KA 2IAKA 3DLNA 1DSNA 2Q2CA 1PDAA 2L5VA 5EQ7A 2Y6XA 5AQQB 1XHYA 3IOWA 4G61A 3A8YC 1FPLA 2JJKA 3PU8A 4DUYT 1NNTA 2X0HA 4U33A 3UU4A 1R9QA 2W66A 4GKJT 5ET5A 4DDDA 1YQ4A 5ABGA 1MXZA 4OYVA 3FIRA 3LK42 2UVIA 4YICA 1Y1MA 4HWIB 2XQ8A 4IDQA 4YTNA 3C4MA 3KC0A 3RYDA 1NV2A 3QUFA 1EZOA 2EHOC 4CN4A 2LKHA 4GOUA 3ZN0B 1L0VA 2XQ5A 4LZ7A 2Z8EA 4RXLA 5IZZA 4IDZA 2YDRA 1YD8G 4YJ2E 3K2DA 2XXTA 4EAHA 4GK0E 3Q27A 3T9XB 4RY1A 3G3GA 4EDPA 5LHIB 4IO4A 3ZKRA 3PURA 3W15C 4PAGA 4JWOA 4NF6A 4H5GA 3QNUA 1LLSA 3PMWA 4JB7A 5F1QA 5ELVA 2W00A 3K1NA 3ODBA 2RCAA 3CSBA 2H99A 2PYYA 5E0OA 5AQIB 5I3SA 3R26A 4F31B 3JAFA 5I57A 4TZ4C 4FIMA 4ZZCA 5CMCA 5JR9B 5L3FB 4U4XA 5IAIA 2VQET 1DOTA 4ZS9A 4CI1B 3UTKA 4X5TA 4HCWA 4NWDA 3MZ1A 3M8UA 3PUQA 1OEDA 4GWWA 1M5DA 4YSYA 4YHJA 2OWZA 2YOEA 2I6EA 4HFVA 4U23A 3U8QA 2KLQA 2JMKA 1MS7A 4Z91A 4KUMB 1B40A 2F34A 4Q0CA 5I56A 1D1CA 4IL9A 2V84A 2XJ7A 4H0WA 3CIRA 3ZT7A 4G68B 2RC8A 4FEDA 5FXZA 3SKPA 5CM6A 2ABHA 4OVTA 4AQFA 3FXUA 2O1LA 3WAJA 2IC9A 3AE8A 5GONE 4KPTA 3PUSA 4OETA 1I6QA 1UTHA 3H3AA 4UEMA 1SW1A 3TCFA 2FIXA 4EEBA 3FZVA 4RA1A 5LTCA 4GWUA 4DO0A 3K3OA 2FNCA 3S9LC 3EAMA 1IMDA 4NMYA 3AEDA 2ZMBA 1NUXA 3UQ7A 1HR0T 4HCYA 1Y64B 4XKPA 1N84A 2ZM0A 3P4QA 3IEEA 1MY3A 3FZKB 5DYHA 1S50A 4PBHA 1MH4A 3D4CA 4FAJA 3FXRA 2X9HA 2VHAA 2D0UA 2V8SV 3VRAA 4OHFA 1IXIA 1FIOA 1O7TA 4NTLA 2WWVA 2ACZA 1KK7A 3KVBA 4EF1A 2QVVA 3IK6B 3UIFA 3R7XA 1BR0A 4LF7T 4Q8RA 1A8EA 4UIGA 2I0CA 1VCSA 5L3GB 4H5FA 2BDEA 2WDRA 2Y8DA 3KOSA 1L5TA 5AA4B 4I62A 3EF7A 4G68A 2V7MA 1ANFA 4G8NA 5AA2D 5LA6E 5KX5E 2LEHA 3OYXA 4JSOA 2HPGA 5TAOA 4TQUQ 3HSTA 2YEVC 3HHGA 5J2UE 4GXSB 4IGRA 2NTXA 3EPEA 3AEFA 2UYEA 2VQFT 2HAVA 4GQOA 2WY2A 3N26A 4B6XA 2I49A 4JI4T 4PGNA 3FATA 4LMJA 2E1SA 3NKZA 3I3VA 4O4LE 1VSOA 2IA4A 1UX5A 4N91A 2DVZA 4CN1A 2RC7A 4P11A 5DVJA 2I48A 2WYPA 2CXDA 3C35A 5I7IA 3CVGA 4N15A 2XX8A 1MRPA 3EN3A 4UF0A 1D0XA 4EQBA 2I0BA 1MQIA 1XWMA 2DE4A 3M65A 5ESYA 1Y3NA 2JQ9A 1VRBA 5C3JA 3ILTB 4X04A 5B7DA 2F78A 3IOUA 2KWHA 1FBPA 4IO2A 2ACXA 1HG2A 4NXMT 3MZBA 4TV8E 4G8MA 1AOVA 4DMWA 3S2VA 2F4VT 2PFVA 3O9PA 3C50A 3LSLA 1ZOYA 5AQMB 5CFBA 2X9XA 1LBXA 1Y4TA 2B1EA 3TMGA 1D0YA 3UFEA 1LEVA 3UUBA 1Y1ZA 4BLAA 5IKBA 2NR4A 1IMBA 1HTJF 2W61A 1MG1A 4MFRA 1N7WA 1Y9UA 2X9YA 4YLHA 1B46A 1UTBA 4FATA 3AA0B 2MBGA 1HNZT 1B7UA 3A3UA 2JPFA 4OA4A 2Y48B 2XPKA 3PMVA 3FVKA 4GWYA 2OBGA 4YKKA 5I84A 1U5PA 3FZHB 5IZ1A 4L5GA 4HW8A 4L9IA 3SEYA 4QRZA 3RQUA 5KDMC 3QAXA 1EYJA 2CEYA 3OKQA 2XXIA 1SDXA 1WR6A 1KA0A 4GL8A 4EYYR 3LBXB 3RIUA 4EXTA 3C32A 1EYKA 4HWHA 3AEBA 1A54A 5ET7A 3JC6C 3E9XA 3K1MA 3KINB 3Q28A 4GIWA 1FQFA 3USDA 3KBUA 1NEKA 5BWJA 4DR5T 2QYWA 2MOZA 5FXVA 1XNQT 1M5CA 5I58A 4LUBA 4MEVA 3FZMB 4OVSA 1JEUA 2VPOA 3PUXE 4Z90A 5FY1A 3UFGA 3HI2A 2O69A 3H6TA 3M3KA 4QFPA 1KEYA 4GXAA 2ONKE 3KSXA 1B1HA 4LF5T 3CG3A 2WMOA 4X64T 3L6HA 4AIUA 4NWCA 1AH5A 3V89B 1X79A 3IORA 1UX4A 4YHHT 2OCUA 2Q8JA 2WS3A 4ZI3D 2XM1A 4KXPA 1D9VA 4GWSA 4QFOA 5LGUB 2UXAA 4QFKA 2R8TA 4M4GA 3PUYF 2XQ6A 3T9UA 3PUXF 3TODA 5EQ9A 1JNFA 2D5UA 3P8CD 2XXHA 4UABA 2A5TA 1DTZA 2O6AA 2CLYC 2IIUA 5IHYA 4ASKA 4N6PA 3UUMA 5AQUB 5FVLA 5ET6A 1N04A 2IUBA 2CZLA 3C36A 3BFTA 1NH7A 2HPJA 4F6RC 4GX6A 3OELA 3UA8A 1MDP1 3C34A 1P1UA 3LSFB 1D1BA 4A56A 4O7IA 3PUZF 1LAXA 4LA9A 1B05A 3H6UA 4BDQA 5H8FA 2F7CA 3MVWA 4RK9A 2VURA 1LKXA 3EHSA 4IDOA 1OQGA 1LBZA 1YCJA 4A97A 2LSKA 4F3BA 1I6ZA 1M5FA 4H63V 4H1XA 3S4UA 3P50A 3PTRB 1SW5A 5FY0A 3C51A 1NNPA 2X26A 2ODVA 4BDOA 2BKOA 5ABFA 1OLCA 3THIA 3OOAA 3CFXA 3TTNA 2X0LB 3G3JA 3UQ4A 3G3FA 2OLTA 2W4XA 3KV9A 5ABFB 3T96B 2JQKA 3OBVE 4PCDA 3I9YA 3MXZA 4QXHB 2V7KA 2HHHT 4GRKA 4Z0IA 2N2NA 2QRXA 4ZI7E 4CQIA 4KBMB 4KQPA 4KI0F 2LM9A 2QGSA 2QFLA 1OWAA 4NQ8A 5JR9C 4G8HA 3UGWA 1LCFA 4BDLA 3L39A 1RYXA 3U72A 4QSDA 3FJGA 4KI0E 2AE9A 1N3XA 5L2LA 1B5HA 1CUNA 4OX9T 1MXUA 4MLKA 2YJPA 3W9WA 5EK2A 4MCOA 5L3BB 4X8RA 5AQRB 4PJMA 3RGLA 4P0AA 5L3EB 5L47A 2F5XA 3OO7A 2D2SA 3MJNA 4TLLB 3DP4A 2LLYA 1NV5A 3MVYA 1FPDA 3SZPA 5DVIA 4I3EA 4F18A 4P47A 2BG9C 2RC9A 5JDFA 4KR5A 1VDWA 4Q5TA 5AQFB 3W9VA 3AA7B 1MPDA 2UYFA 2PTFA 4QXBB 4DV7T 1LFIA 1FMVA 1QKAA 4KYEA 5L8DA 2K3WA 4DMVA 2WP9A 5H6RB 4EZHA 4LFCT 1Q9DA 1MM7A 3HN0A 4PBQA 3UN6A 3O6GA 1FBFA 1FPIA 4F19A 3IX1A 3UU8A 2BG9E 2YN6A 1PEBA 3PGFA 2LSYA 2HH7A 2Q9QC 2V7IA 3UULA 3MAMA 3P4WA 4UACA 2CXLA 3E08A 3RLFE 1OXZA 2A9UA 3FXDB 5AQLB 3RKGA 1EZ3A 3F11A 4ERRA 4ZECA 2H88A 4R75A 3IL1B 1FTAA 2B3FA 3NZQA 3DTOA 2XZEA 3ZJ1A 4AXPA 1POY1 1ZKBA 1MQHA 4AKLA 3JCFA 5AQPB 3VLUA 3RPLB 5AQNB 3T93B 5L3DB 4LFAT 2A5TB 4KYSA 3H3MA 4N4UA 1WVJA 4YXDA 2ESNA 3PUWE 3AEAA 3QIMA 2OJTA 2V1DB 2QS4A 4JI2T 2BVMA 2F3DA 4OQOA 3PUWF 1IMCA 1ZU0A 2BG9B 2I3WA 5CMMA 5CMBA 1J1JA 5AQJB 2UXXB 1UQWA 2Y7PA 1ZP0A 4YB7A 5FHOA 3RIFA 3ZSSA 2LAOA 4F2OA 5ICTA 1XT8A 1D4NA 2WKYA 2UXNB 4H9QC 2ANJA 2DWIA 1DBZA 5H8NA 1FBGA 3PUZE 4I3YA 4RNSA 5FHMA 3G3HA 1AJ3A 5AQGB 4ADZA 3AEGA 3MA9A 2WU5A 5L9SA 1IXHA 1DCUA 1US5A 3H6WA 4OFLA 4P1NA 4EEDA 3K6UA 5CA1E 4ZI2D 2Z8DA 1B9JA 4WEPA 1V9DA 5HCMA 4I8CA 3RY3A 2FBPA 4Z8XA 1NH8A 3KZGA 3FXEB 3AE2A 4U2RA 3C4XA 4OENA 4I50E 3K6VA 4R9FA 1SD3A 3I1AA 2LSJA 3BQKA 5ET8A 2LRKA 3QK6A 5HBCA 2WBDA 4ZEBA 1IZNB 2BS3A 2LOSA 1B7HA 3KV5A 2O68A 2H25A 1FTOA 3F57A 1UK5A 2PFZA 3P7IA 4UVAB 4CXWA 3AE7A 4YU0A 1MIVA 5H8QA 4ZE8A 3T1YT 4GL0A 1NL5A 2QMWA 2B4MA 4PDHA 4RPOA 4P1EA 2QVAA 4COFA 3UUNA 4XKQA 1T0KA 1A55A 2KWIB 3E0ZA 5FNVE 1FTLA 5I57B 4R74A 4CI3B 1W09A 3VVFA 1XVXA 2ZYMA 3DM0A 2V5DA 4EYUA 4TWHA 3PPNA 4GYSA 3AAEB 3L8RA 5F5WA 1JEVA 2D9DA 3LK2B 4JDFA 4QSCA 3AB3B 1XDOA 1FW0A 5ITPA 1ZTYA 3MZKB 4UV8B 1H7CA 4IE5A 4YKIA 3I9WA 2VKJA 4YSXA 1MY2A 1TFAA 3U92A 4MHFA 3AECA 2XWKA 1J5WA 5J1DA 3KDSE 4GBVA 1XOCA 5HEOA 3H7MA 4F1YA 4I4TE 3CRBA 4YT0A 4U22A 4LZ5A 3TCGA 1Z7ME 4QH1A 5IUXA 5EHMA 4LF4T 4N8YA 4PQJA 2R6GF 4CXYA 4DIGA 2F8DA 3MBPA 4PE5B 3N9MA 4AB6A 4G68C 2R71A 3IF8B 1SW4A 4HFBA 4OK0A 2XD3A 4DCYA 4C1UA 1INPA 4ISSA 1LBCA 5J0ZA 3BBRA 3E4RA 4P9KA 5HXEA 4ZEIA 1P99A 3KEIA 1T98A 4O2AE 2XD2A 3PPRA 5I58B 4N07A 2P3NA 1FTJA 2V3UA 2YU1A 4JI8T 1SUMB 1IBLT 1FBDA 5I2KA 4PF8A 3KGCA 3LSWA 5ABEA 1P1OA 2MPKA 1JW5A 3K4UA 4NUVA 4N6KA 3NRYA 3OO6A 4DR7T 2Y7IA 5CRYA 4Z7EA 3MZ9A 3V8XB 3AXJA 4NF8A 1A7LA 2HEUA 4KCDA 5LXTE 1P1QA 2WX9A 2PT1A 1NUWA 5CC2A 3MYUA 2DXYA 1XI6A 3KN7A 2F7BA 3J7Yq 1R8IA 5LMUT 2ONRA 3IHRA 3L6GA 5KDTA 3IFCA 4JI7T 1LB9A 3ONXA 4IY6A 3GXAA 3ZT6A 4H6DA 2THIA 1B3GA 2DL1A 3KBRA 2DE2A 3PPOA 1BKAA 5ITOA 4H45A 2DCFA 1M5BA 3JADA 3NOHA 3IB2A 4ZZBA 5JDMA 3CI8A 3EUHA
chains in the Genus database with same CATH topology
3HKCE 3FV2A 3Q29A 4JXIA 4R6HA 1MNEA 3OENA 1UCUA 1H44A 4I9DA 1B1XA 2SPCA 1A40A 3GLBA 3KJ7A 3ANWA 5FMNA 1IXGA 2YPNA 2XUEA 5JVDE 2KINB 3PPQA 3SEXA 4YJ3E 4EUOA 3TKLB 2Z6EA 4AKIA 1NFTA 2CM0A 2DNXA 3O28A 4MH5A 4IO6A 2NTYA 3KN3A 3LJCA 3T66A 1B5IA 4F39A 5L9OA 2LSGA 1WLXA 2NOOA 3RTWB 1O64A 4P0BA 2E8IA 3PUVE 3A3CA 5HXHA 1B4ZA 1URSA 3CWZB 3N5LA 3OEKA 2WMNA 5J2TE 1WODA 1SI1A 3V5UA 5AA3A 4GIZA 3SDFA 4ISTA 1OLAA 3KV4A 3RUMA 1YKEB 4X1DA 1ZV4X 3H6VA 2Q9QA 4X1BA 2NW8A 4O3BA 4E7ZA 3K6XA 4N13A 2PJQA 2I59A 4O2BE 3RYCE 4OMBA 2PMSA 2KLFA 5DT6A 3RPWA 3EDUA 4O3CA 3BKIB 3OMBA 2AL4A 2W63A 4WEDA 3CFLA 2J1DG 4ZOLE 5I2NB 4WBNE 4CZZB 5TP9B 2JQQA 1AIVA 3N2KE 3N2OA 2RKMA 5LOMA 5HAXA 5FTHA 2NWBA 4H9SE 1MQJA 3ZYLA 2NUVA 2W62A 5AA2B 1B0HA 4OVJA 1P1WA 3KFWX 3OD7A 1JW4A 3Q26A 3N9PA 1IIWA 2GRVA 4YMBA 2Q89A 2MYSA 3CR9A 1MXVA 2F97A 2LSIA 3K01A 3U93A 5FXXA 2A72A 3ZEFB 3AXFA 3B6WA 2HFBA 4ZHQE 3A5XA 5ISUA 1IXCA 1WYCA 2X68A 4LP2B 2QA7A 4RK2A 1B0LA 2YK0A 3HKBE 4ONYA 5M2VA 3MUQA 2A3DA 4QSEA 3ESLA 1IUDA 2ZLYA 1S35A 5HWYA 3UP9A 4LZ8A 2X67A 5HXCA 1LVFA 2H5YA 4QF9A 3IJOB 2E9XC 2E0SA 1PB8A 3G7WA 5HXRA 1B3FA 3TYHA 2Q2AA 3KN8A 1B7TA 3VVEA 4DBQA 2AYSA 2LHNA 3QYTA 4IY5A 2QRYA 3C33A 4PFYA 3SETA 2P1SA 3VHLA 3MPLA 2NXOA 5AA1A 3IO4A 1MY1A 4U72A 4AQ4A 4YKPA 4OFZA 2D3IA 1XVYA 4GWOA 3N9OA 2VWAA 2D21A 3BQIA 1HSLA 3SRZA 2YLNA 4MF3A 1LRZA 1MIYA 3D0TA 1BIYA 3DP6A 2NWJA 3HKEE 1HS7A 2A2FX 2ZYNA 3FVGA 1QULA 4C90A 4YB6A 4KP3C 2V25A 1R6ZA 2QL3A 1SW2A 3ANWB 2HZLA 4PFTA 4HTGA 4ZZAA 1LFHA 3VXCA 3ZMTB 2G93A 3MJXA 2Z8FA 4F29A 5DQWA 5DABA 1NNFA 3GWHA 4PJJA 3KOTA 4X20E 1ZMGA 4OERA 5I59A 4EB6E 4U74A 2QS1A 4YMAA 5BUUA 3O66A 3FBZA 3MP1A 5H8QB 3RRWA 4H8IA 2REGA 3GN5B 2DP8A 1JW1A 4R73A 3TCHA 3TTMA 3W15B 2C5JA 4NF8B 5BMVE 2R9JA 2A5SA 3HPIA 4BA9A 5K2YA 1HSJA 2I4BA 3CG1A 4GD5A 1I69A 5I2KB 3UORA 3FJ7A 4ZZEA 2L9QA 4OESA 2XAGB 2XXUA 3UUXB 2D0TA 2CA5A 3Q5WA 3NBXX 2ZNTA 1H45A 3B57A 3F31A 1MIWA 1Q35A 3ZPOA 2Z22A 3SEVA 2GHAA 2X66A 5JDLA 2RINA 4YFSA 1GTKA 4TLMB 3TAJA 4CXXA 2QS2A 2NW7A 2LT3A 4X1KE 2XXPA 2XXXA 4IB2A 1B51A 2DSFA 1B52A 2Q9QD 3O29A 3FVNA 1MPBA 5HYAA 3FASA 2Y7RA 3H4ZA 2I4CA 1YAEA 4K3FA 2F7AA 4E7SA 5LYJE 2XXWA 4EQ9A 2X9WA 3IBPA 1M5EA 3IB1A 3OJAA 1TT1A 2ZNSA 1MMGA 3E22E 5TPAB 1YW0A 2C0SA 1LAHE 4JSDA 1SBPA 1DMBA 3RGYA 3AAAB 1Y3QA 4DLDA 5JDQA 4H65A 3Q5XA 3FGSA 4H9OC 4AKRB 3RYIE 2KXPB 2PG8A 3TFLA 3TQWA 2HPLA 2YINA 3K3NA 4BDNA 3LK3B 2VGQA 4ANJA 3SEUA 4EXLA 4R2BA 4EZ4A 4GFRA 5JREA 5IYZE 5JDGA 2VOZA 3AVSA 2DVCA 5L3CB 4QX7B 3N9NA 2BZBA 2ZYOA 1QSDA 1LVKA 1FQCA 4OTEA 4TX5A 2LJLA 1BR2A 3PV0E 3ONMA 3R6NA 1FQDA 3L3PA 3ILUB 4O4IE 1OMPA 3KFMA 3ZKLA 3CQGB 3C64A 4G77A 4QWNB 4ZDMA 3O6HA 3O1HA 2JRKA 2Q9TA 5LCYA 4QHQA 1UTBB 3MQ9A 3KBTA 1IJ5A 4YAHX 4PK6A 4IIJE 1MM6A 1D0ZA 5LJMA 4OHNA 4HS7A 5LBQB 3MK7C 4LATA 2C5KT 4ELQA 2LHRA 2EHOA 2RCBA 1QUIA 3RT6B 1SHZC 3A09A 5DEXA 2GFEA 2XAQB 2KNDA 5C8YE 1B3LA 5LOVE 5TPAA 1B32A 4AI6A 2F6PA 3KJTA 3VDFA 3RN8A 4MALA 1NKXA 5JDNA 2V7LA 1USYH 3FXQA 2O84X 3HO7A 3RNNA 2XX7A 1VOMA 3U3IA 2ZXTA 3TEPA 4F1UA 1US7B 4EXKA 2H4IA 3VLVA 3O97A 5F7VA 1QUUA 1UTHB 3AA6B 2VD2A 1GGGA 1MPCA 1FQBA 4O3AA 2HZKA 2XXRA 5CI5A 5JDHA 3OSRA 2I3VA 1I6AA 1LGBC 3K6WA 3EQ1A 2QSXA 1MMAA 2MTQA 3B6QA 3BFUA 5A1LA 4H9PC 4FECA 1YPNA 4J2CA 1BR4A 4HTEA 2H9BA 3TTRA 3ZS6A 3TDJA 2ALUA 3VXBA 4OEVA 3GBBA 4ILUA 1Y4CA 3N6TA 4R6KA 4MHCA 3ZMSB 1TXFA 2H3RA 4POWA 3CFZA 3AAIA 4NF4A 4C0RA 2VKDA 4JWYA 4E0XA 3VV5A 1QJMA 4MLQA 3EDVA 3FHNA 4PK4A 5FP3A 2GK9A 3CQCB 1HSEA 3ECRA 2C5IT 5JR9A 4G2ZA 1JQFA 5KMGP 5LHHB 3ZKKA 5DQVA 5JTYB 1B5JA 3PU5A 2CCQA 4PETA 3E13X 4OEUA 3I0OA 4EQ7A 1QKBA 3IJXB 1NMUA 4PFUA 2RF1A 5H8HA 2OZZA 1JVXA 4X9TA 4R9GA 3ZC0A 4XZCA 3OXNA 1JETA 2RP4A 4U21A 1S7YA 4WKMA 4GLIA 5JQGE 3AA1B 2WSSV 3IOTA 3T9VA 2DI4A 4TOZA 4R2FA 2OWSA 4PW8A 1BLFA 4JUYA 1J1NA 2ZYKA 2L3LA 1P1NA 4ZE9A 4P0GA 3NZPA 1UIUA 2DWKA 5CBSA 1VR5A 2DWAA 1E1HB 4C91A 1MXYA 2GHBA 3ZMZB 3CPZA 3JYRA 1HG5A 4U1ZA 2IW5B 1N3WA 5DTBA 4IE4A 5LHGB 4HE8A 4H63H 1Y20A 5CBRA 5J1GA 1H76A 2OLBA 1BTJA 1HCIA 5A5XA 4JWXA 4IE7A 3FD3A 3H06B 3ZCJA 3RKOA 4F3GA 3CQXC 5FXWA 4Q30B 5L9MA 3DELB 4ELRA 4ELOA 3N9QA 4FE8A 2ODUA 4DXBA 4IHJE 3TPAA 1NAFA 3CX6B 5H8SA 4U4SA 4QXCB 5ADXL 3CKDA 1G73A 1SVXB 5JTYA 3TUSA 2NP9A 1FQAA 3ZC1A 3N2GE 1ELJA 2HQ0A 2W7YA 3KVAA 4RPNA 3SEWA 1TFDA 3RT8A 4DXCA 3C98B 4PFPA 1Z7NE 4ZS2A 2B65A 1LAGE 5HM4B 5AA2A 2Q88A 3QXMA 4FORA 3GBAA 4WW0A 4HKAA 4YZZA 3PUYE 1OQHA 2G29A 2F6GA 5I59B 1JVYA 4TUYE 4OFJA 3SS1A 5LNKA 5TU0A 4G63A 1KWHA 4FJPA 5LGNB 3CVRA 4QHOA 1IEJA 1TWYA 5DEXB 3NRXA 1S9TA 3RTFB 4ECFA 4LONB 3CSGA 4NF5B 2O51A 1PC3A 1O3XA 4PK5A 1HFAA 2N9DA 3PDYA 1MXXA 1YTVA 4UV9B 5KCJA 3JZJA 3K1PA 2X7PA 2CEAA 3H03A 3DJBA 1Q1KA 4THIA 2P9BA 3VU7H 2F35A 2DOJA 4OXVA 1U4QA 4H9RC 2XAFB 4I55E 2YU2A 4F3SA 2FYIA 4ISUA 5JK4A 2WM9A 2V26A 4ND9A 1R9LA 3N6UA 3R84B 2AIXA 1B3EA 2JJ9A 4PFOA 2NW9A 3QC9A 1ZHCA 4IGTA 1LCTA 5H8HB 1DPPA 3T8OA 1EH3A 3V83A 1SA0E 1XS5A 4AQGA 1KNZA 3G3KA 3M3FA 2B3BA 5KDTB 3VLWA 2LE8A 4F2QA 4MBQA 1EU8A 1URDA 2QJEA 2CWYA 1URGA 3HR0A 5LP6E 2XX9A 4NEDA 3VFJA 2DXRA 5LG4A 4XKRA 1A99A 4NF4B 3SESA 3LFMA 4M1VA 3IB0A 4EF2A 3O6IA 3N94A 2XAJB 5CMKA 4BAYB 1FTKA 1ZIUA 2Z23A 3FUZA 3WAEA 4G4PA 2HAUA 2H7VC 4H67A 3TELA 4HGAA 1F9BA 2JMHA 2VK9A 5H8NB 4P0IA 2XXQA 1RKMA 1ATGA 4PP0A 4U1OA 4NF6B 3H3GA 1IAPA 2K24A 3S9EA 3ZMVB 3CIJA 1ZJLA 3OEMA 4H8JA 2OK2A 3PUGA 2ZMAA 1N7XA 3VKHA 3OYZA 2V3QA 3HA4A 3VKGA 2DWGA 4EIWA 4AKGA 2E9XA 1BP5A 3OO9A 5I2NA 3ZLIA 2CWOA 4WXJA 1PB9A 2BJJX 4UXNB 2XTLA 1R1NA 2R6GE 1IZ1A 5JRCB 3PPPA 1QUKA 3Q25A 1LB8A 2DLRA 4AQFC 3C4WA 5LBMA 4MBPA 3M3LA 3PUAA 3O1JA 4JEUB 4WBOA 1NNKA 4F1VA 1B4HA 1GR2A 2PVUA 4TN7B 3MP8A 2OWTA 2HXWA 3QSLA 4QKNA 4L0RA 4ESWA 2O7UA 3OSQA 4KFQA 5ETWA 1WYBA 4DBRA 1FTMA 2QS3A 2X51A 5HPQA 1OVBA 1IITA 4YKJA 3T9HB 4DE8A 4OYJA 4UVBB 4JBZA 4ESXA 3K3QC 5EZYE 1OVTA 3G3IA 3I6VA 1MH3A 3MP6A 1O63A 2XQYA 3CX7B 2KZ7B 1IQ7A 4QFLA 4DCXA 1LSTA 4RYAA 2E9XD 3TTLA 3LBSA 2O7IA 1GV8A 3MW0A 3HL6A 2VP1A 1H43A 2CMRA 2CXFA 1LBBA 2REJA 4GK5E 4V1Av 4ZS3A 5JEIA 3ZSFA 5JH7E 2N1GA 3WAKA 3FV1A 2ONSA 4POXA 3WAFA 3AVRA 1B6HA 1HX8A 4UVCB 4AB5A 4NUUA 3RC3A 2DQVA 2HCAA 2QMXA 4EOZB 3HHFA 4CI2B 3MC2A 3IO6A 5EK4A 2Y7WA 2D5WA 2XHDA 1MXWA 4IGUA 1B3HA 1VFDA 3GA8A 5EYFA 3CMLA 5EK3A 2XXVA 5FYMA 4ZI3C 1FCKA 2PX1A 2X7QA 1MY0A 2P0SA 4GVOA 3ETUA 1UIVA 3BQLA 1FEWA 4F3PA 1POTA 3GMIA 3LR1A 3ZCIA 1I6BA 4DZ1A 4BJNA 1WDNA 1RYOA 1FQEA 3MVZA 3RPUA 1D3KA 1H3DA 1XC1A 5DVFA 3S9MC 1PBQA 3IAZA 3O9XA 5FHNA 4RJZA 4H9NC 4IE0A 3UK4A 4UA8A 4HN9A 1QVSA 3K8PC 3PMXA 1II5A 3PD8A 1G8XA 3PE0A 4X1YE 2K5BB 5F8PA 2VL8A 1B2HA 2ZNUA 3K02A 1PB7A 3FJMA 5ICQA 3RH3A 1ZBMA 2EHOB 2IEEA 4P09A 3O2AA 3LG7A 1ZKEA 2XXYA 2CLYB 3HV1A 3OO8A 3U94A 5FTIA 3BK9A 3LUYA 3H37A 2PBIA 2ZM8A 3HKDE 4M1PA 3Q9DA 4I43B 5M4YA 2ZM2A 3I5OA 1EZ9A 3R6UA 2UVHA 4I1DA 3TKDA 1CB6A 1B58A 4IO3A 4E0WA 2PBWA 3CX8B 3RYHE 5KZTA 2VASA 4R72A 3RC8A 4FEBA 1EZPA 5LGTB 1GVCA 4O4JE 1VFEA 2DWHA 4PJLA 4YB5A 4FJOA 4XBFB 3RQTA 1LAFE 3RRCA 2H98A 3C4ZA 2VKOA 2H7OA 3SOLA 5HXSA 1MY4A 2WWUA 3JC6D 2KMFA 4N78D 2GH9A 3TQLA 4XIGQ 2UVGA 1Z0PA 3DP7A 3HCQA 4F22A 4TV9E 4C1TA 3TTKA 3FVOA 1LFGA 4NF5A 2NOXA 4X1IE 3J9X1 3L09A 3E3KA 3IR1A 4IO7A 3FB2A 4UELA 3GZGA 3RYFE 1IJ6A 3VE1B 4O8SA 1N76A 5H6QB 2DE3A 1S94A 3K00A 3C9HA 2XHEB 3EVYA 4OWDA 3EHTA 4G2AA 1YKHB 2NVUB 4XKNA 4BJMA 4QFNA 2WAUA 4PJNA 1Y3PA 4KD5A 4DXUA 3D4GA 2KT9A 2M8CA 4R6YA 4WNKA 3O4XE 2P2AA 5HWXA 1FMWA 3T22A 2XASB 3WI3A 1AMFA 2UVJA 4LQ5A 2VKHA 3SERA 1OIBA 1QW0A 1SQYA 1ZLQA 5CB4E 4ZI2C 3KSJA 4FI5A 3I0QA 4AKHA 2G0UA 4KMCA 3PU3A 1CE2A 3VVDA 2PT2A 2DS9A 5JRCA 5CA0E 2K48A 2DHRA 3K0VA 5AE4A 5I56B 3LSXA 1MNDA 2W0GA 3UT5E 3KG2A 1A8FA 5F3JA 4ELPA 1NWMX 1PBPA 1WRDA 2V3TA 5A5XB 5B70A 1HF8A 3KV6A 3DP8A 2CMOA 5LJNA 2RA1A 2Y84A 4QX8B 1D1AA 4IO5A 4K0UA 4XXUA 3GN5A 2CE7A 1MQGA 1D9YA 4NE4A 2VB6A 2K9AA 5K2XA 3V5SA 3V5AA 4OZ9A 2E9XB 4KHZE 4LVQA 1AL3A 1SI0A 2Q9QB 1MMNA 2FA7A 4ZEFA 3B6TA 5DJQC 5EHSA 2IC6A 3C31A 4JLEA 2V7JA 4HEAA 3MWBA 3LBXA 2O1MA 2F36A 4OFOA 5KCJB 1DPEA 5H8FB 1QUJA 1B7ZA 2OA5A 2XAHB 1SYIA 2Y7KA 2DYXA 5AA4A 3MACA 4XTCQ 4ZEKA 2I58A 3F2EA 4GF8A 2LOPA 1SYHA 3QUJA 1USYE 3MKDA 3MPKA 1MDQA 2VD3A 1US4A 2DWJA 3LC8A 3ZYKA 3ETVA 3ZJ2A 4MFIA 4ZEDA 4JEHB 4MLVA 3U1OA 4BDRA 3MVXA 4GYRA 3ZN1B 1ZEEA 2AL5A 4PFWA 3O1IA 1DTGA 4KYDA 3B13A 4UF0B 3IOVA 4IE6A 4LQ2A 1MMDA 2BVLA 3RX6A 3FBLA 3ZMUB 2ES0A 3EHUA 3Q2MA 3ZYMA 1VE4A 4XAXB 4PNIA 2EHOD 3S9NC 4BDMA 4X48A 4O4HE 3N9LA 2V93A 4KCCA 5AFUL 2QPQA 1MQDA 3U78A 1N0TA 4DVDA 4OYKA 2M67A 4DNDA 4GOTA 3B7DA 1BR1A 3TZAA 5FY7A 3SWHA 5TP9A 2WBLA 3JV9A 3PD9A 4L17A 2L8KA 2IAKA 3DLNA 1DSNA 2Q2CA 1PDAA 2Y6XA 1XHYA 3IOWA 3PU8A 1NNTA 1R9QA 4DDDA 1MXZA 4OYVA 3FIRA 3LK42 2UVIA 4YICA 1Y1MA 3C4MA 3QUFA 1EZOA 2EHOC 4GOUA 3ZN0B 4LZ7A 2Z8EA 4RXLA 4IDZA 1YD8G 4YJ2E 3K2DA 2XXTA 4EAHA 4GK0E 3Q27A 3T9XB 4RY1A 3G3GA 4EDPA 5LHIB 4IO4A 3PURA 3W15C 4PAGA 4JWOA 4NF6A 4H5GA 1LLSA 5F1QA 3PMWA 4JB7A 5ELVA 2W00A 3K1NA 3ODBA 2RCAA 3CSBA 2H99A 2PYYA 5E0OA 4F31B 3R26A 5I57A 4TZ4C 4FIMA 5CMCA 5JR9B 5L3FB 4U4XA 5IAIA 1DOTA 4ZS9A 4CI1B 3UTKA 4HCWA 4NWDA 3MZ1A 3M8UA 3PUQA 1M5DA 4YHJA 2I6EA 4HFVA 4U23A 3U8QA 2KLQA 2JMKA 1MS7A 4KUMB 1B40A 2F34A 4Q0CA 5I56A 1D1CA 2V84A 4H0WA 4G68B 2RC8A 4FEDA 5FXZA 3SKPA 5CM6A 2ABHA 4AQFA 3FXUA 2O1LA 2IC9A 3WAJA 4KPTA 5GONE 3PUSA 4OETA 1I6QA 1UTHA 3H3AA 4UEMA 1SW1A 3TCFA 3FZVA 4RA1A 4DO0A 3S9LC 2FNCA 4NMYA 2ZMBA 4HCYA 1Y64B 4XKPA 1N84A 2ZM0A 3IEEA 1MY3A 5DYHA 1S50A 1MH4A 3D4CA 4FAJA 3FXRA 2X9HA 2VHAA 2D0UA 4OHFA 1IXIA 1FIOA 1O7TA 4NTLA 1KK7A 3KVBA 4EF1A 3IK6B 3UIFA 3R7XA 1BR0A 4Q8RA 1A8EA 4UIGA 2I0CA 5L3GB 4H5FA 2BDEA 2Y8DA 3KOSA 1L5TA 5AA4B 4I62A 3EF7A 4G68A 2V7MA 1ANFA 4G8NA 5AA2D 5LA6E 5KX5E 2LEHA 3OYXA 4JSOA 5TAOA 4TQUQ 3HSTA 2YEVC 3HHGA 5J2UE 4GXSB 4IGRA 2NTXA 3EPEA 2UYEA 2HAVA 4GQOA 3N26A 4B6XA 2I49A 3FATA 2E1SA 3I3VA 4O4LE 1VSOA 2IA4A 1UX5A 2DVZA 4P11A 2RC7A 5DVJA 2I48A 2CXDA 3C35A 3CVGA 2XX8A 1MRPA 3EN3A 4UF0A 1D0XA 4EQBA 2I0BA 1MQIA 2DE4A 3M65A 1Y3NA 1VRBA 3ILTB 5B7DA 2F78A 3IOUA 2KWHA 4IO2A 2ACXA 1HG2A 3MZBA 4TV8E 4G8MA 1AOVA 4DMWA 3S2VA 2PFVA 3O9PA 3C50A 3LSLA 1Y4TA 2X9XA 2B1EA 3TMGA 1D0YA 3UFEA 1Y1ZA 4BLAA 5IKBA 1HTJF 2W61A 1MG1A 4MFRA 1N7WA 1Y9UA 2X9YA 4YLHA 1B46A 1UTBA 4FATA 3AA0B 2MBGA 1B7UA 3A3UA 2JPFA 2Y48B 3PMVA 3FVKA 2OBGA 4YKKA 5I84A 1U5PA 4L5GA 4HW8A 4L9IA 3SEYA 4QRZA 5KDMC 3QAXA 3OKQA 2XXIA 1SDXA 1WR6A 4GL8A 4EYYR 3LBXB 4EXTA 3C32A 1A54A 3JC6C 3E9XA 3K1MA 3KINB 3Q28A 4GIWA 1FQFA 3USDA 3KBUA 5BWJA 2MOZA 5FXVA 5I58A 1M5CA 4LUBA 1JEUA 3PUXE 5FY1A 3HI2A 2O69A 3H6TA 3M3KA 4QFPA 4GXAA 2ONKE 3KSXA 1B1HA 3CG3A 2WMOA 3L6HA 4NWCA 1AH5A 3V89B 1X79A 3IORA 1UX4A 2OCUA 2Q8JA 4ZI3D 1D9VA 4QFOA 5LGUB 2UXAA 4QFKA 4M4GA 3T9UA 3TODA 1JNFA 2D5UA 3P8CD 2XXHA 2A5TA 1DTZA 2O6AA 2CLYC 5IHYA 4ASKA 4N6PA 3UUMA 1N04A 2CZLA 3C36A 3BFTA 1NH7A 2HPJA 4F6RC 3OELA 3UA8A 1MDP1 3C34A 1P1UA 3LSFB 1D1BA 4A56A 4LA9A 1LAXA 1B05A 3H6UA 4BDQA 5H8FA 2F7CA 3MVWA 4RK9A 1LKXA 3EHSA 1OQGA 1YCJA 2LSKA 4F3BA 4H1XA 1M5FA 4H63V 3S4UA 1SW5A 3PTRB 5FY0A 3C51A 1NNPA 2X26A 2ODVA 4BDOA 1OLCA 3THIA 3OOAA 3CFXA 3TTNA 2X0LB 3G3JA 3G3FA 3KV9A 3T96B 3OBVE 3I9YA 3MXZA 4QXHB 2V7KA 4GRKA 4Z0IA 2N2NA 4ZI7E 4CQIA 4KBMB 4KQPA 2LM9A 2QGSA 1OWAA 3UGWA 5JR9C 4G8HA 1LCFA 4BDLA 1RYXA 3U72A 4QSDA 3FJGA 4KI0E 1N3XA 5L2LA 1B5HA 1CUNA 1MXUA 4MLKA 2YJPA 3W9WA 5EK2A 5L3BB 4PJMA 4P0AA 5L3EB 2F5XA 4TLLB 3OO7A 2D2SA 3MJNA 3DP4A 3MVYA 5DVIA 4F18A 2RC9A 5JDFA 4KR5A 4Q5TA 3W9VA 3AA7B 3EUHA 1MPDA 2UYFA 4QXBB 1LFIA 1FMVA 1QKAA 4KYEA 5L8DA 4DMVA 5H6RB 4EZHA 1MM7A 3HN0A 3UN6A 3O6GA 4F19A 3IX1A 1PEBA 3PGFA 2LSYA 2HH7A 2Q9QC 2V7IA 3UULA 3MAMA 4UACA 2CXLA 3E08A 3RLFE 1OXZA 3F11A 3FXDB 1EZ3A 4ERRA 4ZECA 4R75A 3IL1B 2B3FA 3NZQA 3DTOA 3ZJ1A 4AXPA 1ZKBA 1POY1 1MQHA 4AKLA 3VLUA 3T93B 5L3DB 2A5TB 4KYSA 1WVJA 2ESNA 3PUWE 3QIMA 2OJTA 2V1DB 2QS4A 2BVMA 4OQOA 1ZU0A 2I3WA 5CMMA 5CMBA 2UXXB 1UQWA 2Y7PA 5FHOA 4YB7A 2LAOA 4F2OA 5ICTA 1XT8A 1D4NA 2WKYA 2UXNB 4H9QC 2ANJA 2DWIA 5H8NA 3PUZE 4RNSA 5FHMA 3G3HA 1AJ3A 4ADZA 3MA9A 5L9SA 1IXHA 1US5A 3H6WA 4OFLA 3K6UA 5CA1E 4ZI2D 2Z8DA 1B9JA 4WEPA 1V9DA 4I8CA 3RY3A 4Z8XA 1NH8A 3KZGA 3FXEB 4U2RA 3C4XA 4OENA 4I50E 3K6VA 4R9FA 1SD3A 3I1AA 2LSJA 3BQKA 3QK6A 5HBCA 4ZEBA 1IZNB 2LOSA 1B7HA 3KV5A 2O68A 2H25A 1FTOA 3F57A 3P7IA 4UVAB 4CXWA 4YU0A 1MIVA 5H8QA 4ZE8A 4GL0A 1NL5A 2QMWA 4RPOA 3UUNA 4XKQA 1T0KA 1A55A 2KWIB 3E0ZA 5FNVE 1FTLA 5I57B 4R74A 4CI3B 3VVFA 1XVXA 2ZYMA 3DM0A 4EYUA 3PPNA 4GYSA 3AAEB 1JEVA 3LK2B 4JDFA 4QSCA 3AB3B 1FW0A 5ITPA 1ZTYA 3MZKB 4UV8B 1H7CA 4IE5A 4YKIA 3I9WA 2VKJA 1MY2A 1TFAA 3U92A 5J1DA 3KDSE 1XOCA 3H7MA 4F1YA 4I4TE 3CRBA 4U22A 4LZ5A 3TCGA 1Z7ME 5EHMA 4PQJA 4CXYA 4DIGA 2F8DA 3MBPA 4PE5B 3N9MA 4AB6A 4G68C 2R71A 3IF8B 1SW4A 4OK0A 2XD3A 4DCYA 4C1UA 4ISSA 1LBCA 3BBRA 3E4RA 4ZEIA 5HXEA 1P99A 3KEIA 1T98A 4O2AE 2XD2A 3PPRA 5I58B 4N07A 1FTJA 2V3UA 2YU1A 5I2KA 3KGCA 3LSWA 1P1OA 1JW5A 3K4UA 4NUVA 3NRYA 3OO6A 2Y7IA 5CRYA 4Z7EA 3MZ9A 3V8XB 4NF8A 1A7LA 2HEUA 4KCDA 5LXTE 1P1QA 2PT1A 5CC2A 2DXYA 3KN7A 2F7BA 3J7Yq 2ONRA 3IHRA 3L6GA 5KDTA 1LB9A 3ONXA 4IY6A 3GXAA 4H6DA 2THIA 1B3GA 3KBRA 2DE2A 3PPOA 1BKAA 5ITOA 2DCFA 1M5BA 3IB2A 5JDMA 3CI8A 3K3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HV1 A;  2E1S A;  3OO8 A;  4E0X A;  3U94 A;  3FV2 A;  3I3V A;  3Q29 A;  4JXI A;  1QJM A;  4R6H A;  4MLQ A;  1VSO A;  2IA4 A;  5FTI A;  3VV5 A;  3OEN A;  3LUY A;  2DVZ A;  1H44 A;  1HSE A;  2RC7 A;  1B1X A;  4I9D A;  4P11 A;  3ECR A;  2I48 A;  5DVJ A;  2C5I T;  1A40 A;  3GLB A;  3KJ7 A;  3C35 A;  3CVG A;  1IXG A;  3I5O A;  1EZ9 A;  2YPN A;  4G2Z A;  1JQF A;  3R6U A;  2UVH A;  4I1D A;  3TKD A;  3PPQ A;  1CB6 A;  3SEX A;  3ZKK A;  2XX8 A;  1B58 A;  1MRP A;  5JTY B;  4EUO A;  3TKL B;  3EN3 A;  1B5J A;  3PU5 A;  4IO3 A;  4PET A;  2PBW A;  3E13 X;  4E0W A;  4EQB A;  4OEU A;  2I0B A;  1NFT A;  4EQ7 A;  1MQI A;  2DE4 A;  5KZT A;  1QKB A;  1Y3N A;  3IJX B;  1NMU A;  3KN3 A;  3O28 A;  3ILT B;  4IO6 A;  2RF1 A;  4MH5 A;  4PFU A;  5H8H A;  2OZZ A;  4R72 A;  5B7D A;  4FEB A;  2F78 A;  3IOU A;  2KWH A;  4IO2 A;  3T66 A;  1EZP A;  1JVX A;  4X9T A;  1B5I A;  4R9G A;  4F39 A;  5L9O A;  1GVC A;  3MZB A;  4G8M A;  2DWH A;  1VFE A;  1AOV A;  3OXN A;  3S2V A;  2NOO A;  3RTW B;  1JET A;  3O9P A;  4U21 A;  4YB5 A;  1O64 A;  3LSL A;  1Y4T A;  2X9X A;  3RQT A;  1LAF E;  3TMG A;  1S7Y A;  2H98 A;  3A3C A;  3PUV E;  4GLI A;  4WKM A;  3IOT A;  3T9V A;  1B4Z A;  1URS A;  3N5L A;  3OEK A;  4TOZ A;  4R2F A;  1WOD A;  1Y1Z A;  2OWS A;  1BLF A;  4BLA A;  1J1N A;  1SI1 A;  5IKB A;  2ZYK A;  1MG1 A;  5AA3 A;  1P1N A;  1MY4 A;  4GIZ A;  1N7W A;  1Y9U A;  2X9Y A;  3SDF A;  4ZE9 A;  4P0G A;  1B46 A;  1UIU A;  1OLA A;  1UTB A;  4FAT A;  5CBS A;  3RUM A;  2MBG A;  1B7U A;  1VR5 A;  2GH9 A;  3TQL A;  3A3U A;  4XIG Q;  4X1D A;  2DWA A;  3H6V A;  2UVG A;  1Z0P A;  4F22 A;  3HCQ A;  4X1B A;  3TUS A;  3PMV A;  4C1T A;  5H8Q B;  3FVK A;  3FVO A;  1LFG A;  4NF5 A;  3TTK A;  1MXY A;  4O3B A;  2GHB A;  2OBG A;  4YKK A;  5I84 A;  3K6X A;  3E3K A;  3IR1 A;  4IO7 A;  3JYR A;  4U1Z A;  4HW8 A;  1N3W A;  3SEY A;  3GZG A;  4N13 A;  5DTB A;  4QRZ A;  1IJ6 A;  1Y20 A;  3QAX A;  5CBR A;  4OMB A;  2PMS A;  3VE1 B;  1H76 A;  1SDX A;  1BTJ A;  2OLB A;  2XXI A;  5I59 B;  2KLF A;  5DT6 A;  1N76 A;  4GL8 A;  2DE3 A;  3K00 A;  3BKI B;  4JWX A;  4EYY R;  4O3C A;  3FD3 A;  2AL4 A;  3H06 B;  3OMB A;  3C32 A;  3C9H A;  3CFL A;  4WED A;  1A54 A;  4FAJ A;  3K1M A;  3E9X A;  4F3G A;  4Q30 B;  5I2N B;  4OWD A;  3EHT A;  5L9M A;  3DEL B;  4ELR A;  3Q28 A;  2NVU B;  1FQF A;  4XKN A;  5TP9 B;  3USD A;  4ELO A;  1AIV A;  2RKM A;  4FE8 A;  5BWJ A;  5FTH A;  5LOM A;  4QFN A;  4DXB A;  5I58 A;  1M5C A;  1MQJ A;  1Y3P A;  4LUB A;  4KD5 A;  3TPA A;  1JEU A;  4DXU A;  2NUV A;  3D4G A;  5AA2 B;  1B0H A;  2M8C A;  4OVJ A;  1P1W A;  3OD7 A;  3PUX E;  4U4S A;  5H8S A;  5I58 B;  1JW4 A;  4R6Y A;  3CKD A;  3Q26 A;  2P2A A;  1IIW A;  1SVX B;  5JTY A;  2O69 A;  2GRV A;  3T22 A;  4YMB A;  1FQA A;  2Q89 A;  3H6T A;  3M3K A;  3CR9 A;  4QFP A;  4GXA A;  2ONK E;  3KSX A;  1MXV A;  2F97 A;  1AMF A;  2UVJ A;  1B1H A;  3K01 A;  1ELJ A;  2HQ0 A;  4LQ5 A;  3SER A;  1OIB A;  3CG3 A;  1QW0 A;  1SQY A;  1ZLQ A;  3AXF A;  3B6W A;  3L6H A;  2HFB A;  3KSJ A;  4NWC A;  1AH5 A;  4FI5 A;  2W7Y A;  4RPN A;  3SEW A;  3IOR A;  3V89 B;  5ISU A;  2G0U A;  1TFD A;  1IXC A;  3RT8 A;  4DXC A;  4Z7E A;  1Z7N E;  2OCU A;  2Q8J A;  2B65 A;  1LAG E;  4LP2 B;  5HM4 B;  4RK2 A;  1B0L A;  1D9V A;  4QFO A;  5AA2 A;  2Q88 A;  1CE2 A;  3QXM A;  4FOR A;  2PT2 A;  3VVD A;  2DS9 A;  2UXA A;  4QFK A;  3GBA A;  4M4G A;  2K48 A;  4YZZ A;  3PUY E;  1OQH A;  2G29 A;  2F6G A;  3K0V A;  4ONY A;  5M2V A;  1JNF A;  2XXH A;  1JVY A;  3MUQ A;  3TOD A;  5AE4 A;  4QSE A;  2A5T A;  3LSX A;  4OFJ A;  1DTZ A;  4U1O A;  1IUD A;  2O6A A;  5I56 B;  3KG2 A;  1A8F A;  5TU0 A;  4N6P A;  4ELP A;  1KWH A;  4FJP A;  1PBP A;  2V3T A;  4LZ8 A;  3U93 A;  3UP9 A;  5A5X B;  1LVF A;  2H5Y A;  5B70 A;  1N04 A;  3DP8 A;  2CMO A;  3CVR A;  1PB8 A;  2E0S A;  3IJO B;  4QF9 A;  1IEJ A;  3G7W A;  2CZL A;  1TWY A;  5DEX B;  1B3F A;  1S9T A;  2Y84 A;  2Q2A A;  3BFT A;  3C36 A;  1NH7 A;  3KN8 A;  4IO5 A;  3TYH A;  3RTF B;  4XXU A;  4ECF A;  3VVE A;  3OEL A;  2AYS A;  3UA8 A;  1MDP 1;  4LON B;  1MQG A;  3C34 A;  1P1U A;  3QYT A;  3CSG A;  4NF5 B;  3LSF B;  2O51 A;  4IY5 A;  1PC3 A;  1D9Y A;  4NE4 A;  2QRY A;  3C33 A;  4PFY A;  4LA9 A;  1LAX A;  3SET A;  2P1S A;  1B05 A;  3H6U A;  1MXX A;  4BDQ A;  3MPL A;  2F7C A;  3MVW A;  2NXO A;  1YTV A;  4RK9 A;  5K2X A;  5H8F A;  5AA1 A;  3EHS A;  3IO4 A;  3V5A A;  3JZJ A;  1OQG A;  1YCJ A;  4OZ9 A;  4KHZ E;  1MY1 A;  3K1P A;  5KCJ A;  4LVQ A;  1AL3 A;  1SI0 A;  4YKP A;  4AQ4 A;  4F3B A;  2X7P A;  4H1X A;  1M5F A;  3H03 A;  3S4U A;  1Q1K A;  1SW5 A;  2FA7 A;  4THI A;  2D3I A;  4ZEF A;  2F35 A;  2X26 A;  1XVY A;  1NNP A;  2DOJ A;  3B6T A;  4OXV A;  5EHS A;  4BDO A;  1OLC A;  4GWO A;  2IC6 A;  3THI A;  3C31 A;  3OOA A;  3CFX A;  2D21 A;  3TTN A;  2FYI A;  4F3S A;  4ISU A;  5JK4 A;  3G3J A;  3G3F A;  4ND9 A;  1HSL A;  1R9L A;  3MWB A;  3T96 B;  2O1M A;  3N6U A;  2F36 A;  4OFO A;  2YLN A;  2AIX A;  1B3E A;  4MF3 A;  5KCJ B;  3MXZ A;  4GRK A;  1LRZ A;  4Z0I A;  1BIY A;  3DP6 A;  1DPE A;  5H8F B;  4CQI A;  4IGT A;  4KQP A;  1LCT A;  5H8H B;  1DPP A;  1EH3 A;  3UGW A;  4G8H A;  1QUJ A;  2NWJ A;  1LCF A;  4BDL A;  1B7Z A;  3V83 A;  1XS5 A;  1RYX A;  3U72 A;  4QSD A;  3FJG A;  1SYI A;  4KI0 E;  3G3K A;  3M3F A;  2Y7K A;  1N3X A;  2B3B A;  5KDT B;  2DYX A;  3VLW A;  2ZYN A;  1B5H A;  1QUL A;  3FVG A;  4YB6 A;  4F2Q A;  5AA4 A;  1EU8 A;  1MXU A;  1URD A;  2YJP A;  3W9W A;  2V25 A;  4XTC Q;  2I58 A;  1R6Z A;  2QJE A;  4ZEK A;  2QL3 A;  4GF8 A;  1SW2 A;  2HZL A;  4PFT A;  1SYH A;  3RPW A;  2F5X A;  4TLL B;  3OO7 A;  1USY E;  3QUJ A;  3MJN A;  4HTG A;  3MPK A;  4ZZA A;  1MDQ A;  1URG A;  2VD3 A;  1US4 A;  3DP4 A;  1LFH A;  3VXC A;  2XX9 A;  3MVY A;  2G93 A;  2DWJ A;  4NED A;  4YAH X;  5DVI A;  3LC8 A;  3T9U A;  2Z8F A;  3VFJ A;  4F29 A;  4F18 A;  2DXR A;  4XKR A;  2RC9 A;  4KR5 A;  1NNF A;  4Q5T A;  1A99 A;  4MFI A;  4NF4 B;  3SES A;  3W9V A;  3KOT A;  4M1V A;  3IB0 A;  4EF2 A;  1MPD A;  4ZED A;  2UYF A;  1ZMG A;  3O6I A;  3N94 A;  1LFI A;  4OER A;  4MLV A;  1QKA A;  5I59 A;  4KYE A