5KDMC

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone / dna binding protein
total genus 58
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2016-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5kdmC00
4H9QC 4H9SE 4H9RC 5KDMC 4H9PC 4H9OC 4HGAA 4H9NC
chains in the Genus database with same CATH superfamily
3RI5A 1UUSA 4I4TE 3QK6A 5J2TE 4CI2B 3NKZA 4U3CA 1WLXA 2LSIA 2ZMAA 4YTPA 4A56A 3LBXA 2V7KA 1SUMB 5J1GA 5LYJE 1BR0A 3ZYMA 3K8PC 5FVLA 2ZM0A 3L3PA 3O1IA 4PJJA 4IT4A 4IDZA 2X9WA 3U78A 4A98A 5L3DB 1S94A 3RIFA 1MIYA 4YY3T 4YHHT 3RIUC 4XZCA 1KEYA 3JADA 2GK9A 3B13A 2WCAA 3SOLA 1YQ3A 3E0ZA 1V9DA 5LBMA 3H3AA 2YDRA 4YXDA 4K0KT 2LSGA 4B6XA 3HKCE 3QB5A 3JC6C 4I43B 4WBNE 2N2NA 4CXYA 2W67A 5AQFB 5HEOA 3AAAB 4E7SA 3ONJA 5IYZE 3RKGA 4ZEYA 3PUYF 2CWOA 5ADXL 4YTMA 3V5SA 4HWIB 2WMOA 3M65A 5IUXA 3N2GE 4EYYR 4EV6A 2IHR1 4YSXA 3OYZA 3ABVA 4IREA 4IE6A 4MFRA 2H7VC 3FZKB 3PUGA 1N36T 2SPCA 3AXJA 3U3IA 3ETVA 3RYHE 5JDGA 1IBMT 3P4SA 3PE0A 2XQYA 3L09A 4C90A 4PW8A 1KNRA 4O8SA 4HFVA 5DQVA 3TLVA 2ZM2A 5AQIB 5HXRA 5HCJA 4OK0A 4TNVA 4LMJA 1NWMX 5L3EB 4DV6T 4HEAA 2VURA 4X1IE 3ZMZB 3UUBA 3CK6A 4UEMA 5EK3A 2XAQB 2JMHA 4NPPA 3ZJ1A 2ZLYA 3N2OA 4ZI7E 5FY0A 3FZHB 3ZN0B 1HX1B 4IDOA 2HH7A 2CRBA 2CM0A 2VK9A 4H9NC 2K24A 4PFOA 4CXXA 2E9XA 5KXJA 1QUUA 4LMLA 2HHHT 3HA4A 4PK4A 3LK42 4IE7A 5LOVE 5AQMB 4UVAB 3IA3A 2CBJA 4DV7T 3P8CD 3UUXB 1OEDA 3ANWA 1LVFA 3KDSE 3I9YA 3BQLA 4QWNB 4MBQA 3PTRB 4XBFB 3FXEB 4TV9E 4QXCB 3JC6D 4EOZB 2VQET 3C64A 2Q9QA 1FJGT 2IC9A 4L9IA 2VWAA 1XDPA 4CN1A 3NVOA 5L4HA 5EK2A 3D0TA 1N33T 3RKOA 2KLQA 5AQKB 3ZCIA 5JREA 3Q5WA 5E0OA 1D0YA 3CVRA 3P4RA 5JH7E 3AECA 3TLWA 1MNDA 3VU7H 1XNQT 4OHFA 5EZYE 3WAKA 2BDEA 1UX4A 2KNDA 1XDOA 3OKQA 2YN6A 3AEFA 1UGOA 1IJ5A 3F57A 3AA7B 3NBXX 3HI2A 2D9DA 3EABA 5IHYA 5JDQA 2G0UA 3CX6B 2JPFA 5TAOA 4MLKA 2L8KA 5FY7A 4YT0A 4DR5T 4GYSA 4HE8A 1MMDA 5CA0E 3KINB 4ILBA 2MAWA 5JQGE 2LOSA 3ZYKA 2QYWA 3SWHA 4ILUA 3O4XE 2CLYC 4AXPA 3MACA 4H9RC 3PUSA 2WB5A 5LJNA 5LJMA 5LGUB 5M4YA 2BVMA 4AKGA 4JBWF 4YSYA 1R8IA 3ESLA 2RPAA 1ZV4X 3ONXA 1U4QA 3AB3B 3RYCE 2YU1A 2CE7A 2A2FX 4U72A 2XM2A 2V5CA 3LDQB 5DJQC 2JJ9A 4O4JE 4B3RT 4EEBA 4IIJE 3C4WA 4CZZB 3AE5A 5A1LA 1BR4A 4CI3B 2BBJA 5JR9A 3PJAJ 4DV0T 2A72A 3Q9DA 4WNKA 2XAJB 2PG8A 2X51A 4JI2T 3T1YT 2D2SA 4EIWA 4U7IA 2V1DB 1J5WA 1I6ZA 2V6XA 5FXZA 2CHNA 3L8RA 3A8YC 5AQVB 2D0TA 1QLBA 3SFDA 4AQFC 4P1NA 3UQ7A 3AA6B 4I55E 2XASB 4DO0A 4ZS2A 1MMGA 2VKDA 4DMVA 3ZMTB 5AQRB 2N1GA 1JNZA 1CUNA 2E8IA 4KI0F 5KMGP 4X66T 5C8YE 1XMOT 2M6IA 5L3FB 5HAXA 2YDQA 3GN5B 2CXFA 2LEHA 4XAXB 2V6YB 3IF8B 2LRKA 4O2BE 2LE8A 1U5PA 3CWZB 3EI0A 4WW0A 3PUXF 5ABGA 3P7IA 3PV0F 5HYAA 1IZNB 2HN2A 3UUMA 5LG3A 3N5LA 5LGNB 4UVBB 2WS3A 1XWMA 3RRCA 5LP6E 4DR6T 2XTLA 4ERRA 3UTKA 5IWAT 4AKIA 2MPKA 2H88A 1UCUA 3AA0B 3UFEA 3TKLB 3KV5A 2BG9A 2A3DA 2FJEA 2FJAA 4ZOLE 3CIRA 1I94T 4QXBB 1N32T 4BJMA 2BKOA 3ZYLA 4DV1T 2XUEA 4U2YA 2AE9A 2I6HA 4K0UA 4BJNA 5JDLA 5ETWA 2WWUA 3I0OA 2WQYA 1HNZT 5DABA 2AXDS 4DBQA 2ACXA 4JUYA 2UXCT 2E9XC 4LF4T 2HPJA 1HFAA 4EYUA 2IMLA 2XHEB 1GQEA 1KNPA 4AQYT 2VVSA 3W15B 3QB5K 4JI6T 4L5GA 1FMWA 4A97A 1CHUA 5CB4E 5LCYA 5LG4A 4OX9T 1KF6A 1MMAA 2DL1A 4EZ4A 4MALA 1X9BA 1IJ6A 3PJAA 3J7Yq 3RPUA 4BA9A 2NWBA 5JDHA 2W66A 3JAEA 3R6NA 4PJMA 3RIAA 5LMNT 3TLTA 3EVYA 2LSYA 4IE0A 1WR6A 2CBIA 2A9UA 3N9QA 1SA0E 2V5DA 5L3BB 3N9PA 4AISA 2BS2A 1LKXA 2LLYA 1DU2A 4LF8T 3IEEA 4PAGA 4KUMB 2XZEA 2ODUA 3K3OA 1ZHCA 1SHZC 4P0AA 2CLYB 3ETUA 2R6GF 5FVKA 1HG5A 4TX5A 4WZXA 3RQWA 1M62A 1YW0A 4ADZA 2KINB 2BG9E 4YHJA 1L0VA 4ISTA 3SRZA 2XQ6A 4CXWA 2DHRA 2IW5B 2D0UA 3F2EA 3J9X1 4QX8B 3TLUA 2XQ9A 3MZKB 3RHWA 2OV9A 2WZIA 4UF0B 4O4HE 3MA9A 3AE6A 2WM9A 3IHRA 4HKAA 1S35A 5DQWA 3RC8A 4OFZA 1YXRA 5FMNA 3RF1A 3EDVA 2XQ5A 3JCFA 5AQTB 2IC6A 5FNVE 2K3WA 4TV8E 4QX7B 3RYIE 4NUVA 5L3CB 3FZMB 2LHRA 4IDQA 2YDSA 3ZT5A 4O2AE 3AE3A 1MMNA 4GYRA 3O9XA 2BZBA 4IDPA 5HEHA 2X67A 3OBVE 2MTQA 4G63A 4PJLA 4HFIA 2E9XD 3I1AA 5LHGB 3VKHA 2J1DG 4JI0T 2UUAT 1FEWA 1XNRT 4IHJE 4PK5A 5LGTB 2NTYA 3CPZA 3P50A 2K48A 2VL0A 5BMVE 4AKHA 3C51A 2KSRA 4H63H 4O4LE 3MXZA 4M1PA 1WRDA 4GK5E 3FZLB 5FL0A 1KFYA 3P4PA 2XAFB 5CA1E 3HL6A 3RIUA 4YJ2E 3N9LA 1WR0A 1JNRA 4HWDA 2Q9QD 1KNZA 5AQQB 5LNKA 2QGSA 4H9PC 3HKBE 1US7B 4TWFA 3HKDE 3UULA 2C5IT 3ZC1A 1UK5A 2CEAA 3KBTA 5ABEA 3DJBA 2C0SA 2X66A 3HKEE 3BQIA 3LSVA 3PU8A 3KVAA 3T8OA 2C5KT 4O4IE 3UFGA 4ISSA 5JDMA 2UXNB 2D5UA 1G8XA 2W62A 4F6RC 4CI1B 4AI6A 1QSDA 5FXVA 3ZCJA 2V7IA 1W9RA 3FZFB 3SFEA 3QC9A 2OA5A 5LHHB 2UUBT 2N9DA 3ZLIA 3M3ZB 3N9MA 5AQOB 3AEEA 3HR0A 4QH5A 3RX6A 5L47A 4DV4T 5F3JA 2OLTA 4IE5A 3NRYA 4TN7B 4COFA 2UXXB 2E9XB 3QNUA 1WYCA 2PBIA 2LRLA 3KV9A 1FIOA 1IAPA 1HG2A 1ZP0A 4EXTA 4UIGA 4DNDA 3MK7C 3LG7A 2JQHA 2ZM8A 2BG9C 1G73A 3ANWB 1MIVA 1T72A 3ZMSB 1OWAA 2UXDT 2LSKA 4B3TT 2JRKA 3PURA 2Y8DA 2JQKA 4HN9A 1OEDE 5KDMC 2KWIB 5C3JA 5JRCA 2CCQA 2QA7A 2XSAA 4YSZA 1D0XA 5L2LA 3NRXA 1BR2A 3JAFA 3Q5XA 2IUBA 2F4VT 4YLHA 3RQUA 5AFUL 4NXNT 1VCTA 2EHOA 4ZZCA 1M7KA 4TUYE 3RRWA 4DUYT 4QH4A 5BR8T 1IBLT 4V1Av 3LJCA 5AQNB 2XPKA 4DV2T 4LFCT 3G06A 1T7SA 2X9YA 5ABHA 3UUNA 5CGMA 4Z91A 4PFPA 2X0HA 5LA6E 4HFDA 3TLSA 1ZKEA 1H7CA 2UXBT 4HWHA 1WCRA 3LK3B 4ZI3D 3DTOA 4HFBA 2JIWA 3CKDA 4U74A 1VRBA 5LBQB 2XQ4A 3OVUA 4L0RA 5F8PA 3AEDA 3DP7A 5FKYA 2CHOA 2I59A 5AQGB 4NIQA 2FJBA 4H63V 3KBUA 3AAIA 1XZYA 4HWCA 2E2AA 4DR2T 5AQLB 3ZMUB 5LMUT 5FXXA 1HR0T 2LKHA 2X0YA 2PFVA 3P4WA 5FYMA 4IGUA 3GA8A 1FMVA 1UURA 5HEJA 2I0MA 5FP3A 3RLFF 1UX5A 4DV3T 4LF7T 2YKSA 2L9QA 3Q2MA 4H9OC 5LB7B 4GK0E 1Z8UA 2HN1A 4U7YA 5J2UE 4UVCB 3CQCB 4I0UA 4EGWA 3RGLA 4TWHA 3EDUA 2J4GA 1HX8A 2FBWA 1J5ET 2WSSV 1D0ZA 3L39A 5ABFB 3S4UA 4JEUB 2W61A 2YINA 4U2ZA 3KV6A 4ZXLA 3UQ4A 3GMIA 3A7MA 5JDFA 2H3RA 2NOXA 3AE1A 2LOPA 3PDYA 3V5UA 2VL8A 2KZ7B 5HEGA 3QUJA 2XJ7A 1NEKA 5FL1A 1D1AA 4TWDA 3C98B 3VHLA 3NZQA 4ANJA 5AQSB 4X1YE 5F5WA 5HCMA 3AE9A 2M67A 4UF0A 4ZZBA 4PNIA 1YD8G 3OJAA 5AQHB 3ZSSA 2P9BA 2BS4A 1YKEB 3CQXC 3GWHA 4P0BA 1XMQT 2WZHA 1B7TA 3B5MA 1OEDC 4YJ3E 4ZI2D 4UXNB 4LFAT 4B3MT 4TZ4C 4DUZT 5AQJB 2W2UA 5L3GB 4AKRB 4HTEA 2Q9QC 4DBRA 3B57A 2W4XA 3P4QA 2Z6EA 1HF8A 2DNXA 4GOUA 2E5VA 2XQ7A 3I9WA 4IL9A 2V7LA 3AE4A 3FHNA 1BR1A 3MKDA 2RA1A 5JTGA 4B3ST 2DWKA 4CN4A 4KP3C 2PJQA 4UV9B 3WI3A 4AQFA 2B76A 2BG9B 4LF9T 3AE7A 2H7OA 2H89A 4DR7T 2WDQA 4F8HA 2UU9T 2W0GA 2LM2A 4WYVA 5AQUB 5LXTE 4HFHA 1ZOYA 3N9NA 2LKGA 3AVRA 1IBKT 3C4XA 2X0LB 4Q25A 3SS1A 5CFBA 4JYAT 1Y01A 2VB6A 3UU4A 5HXHA 4JV5T 1MNEA 5HXEA 5J0ZA 2LSJA 4KHZF 3LBXB 3ZT7A 4IDNA 3FBLA 2VVNA 4DMWA 2W63A 3CQGB 2IIUA 4X1KE 3RYFE 1HTJF 3NZPA 3ZEFB 3CX8B 3H37A 1E1HB 2PTFA 4G2AA 3AE8A 4GIWA 4Z90A 3AEAA 2NW9A 1T8BA 2BKPA 2XM1A 3KFWX 2WU5A 2VKHA 3I0QA 2XQ8A 2YEVC 3F31A 2BBHA 1Z0PA 4DR1T 3CX7B 1LRZA 4JI5T 2WAUA 4ILCA 1SE7A 3VRBA 1AJ3A 2MBGA 3RC3A 3ZMVB 2J62A 4X64T 1N34T 1HNWT 4J2CA 5HEUA 5H6QB 2KXPB 2XAHB 4GKKT 4DIDB 3UU6A 2VKJA 5JDNA 5HXSA 2EHOC 4LF6T 4DR3T 3C50A 1OXZA 1WFDA 2WU2A 5JR9C 1W09A 4CN6A 2DI4A 1O3XA 1VOMA 3KVBA 2X9XA 4DR4T 2K9AA 4NUUA 1LVKA 4QH1A 2DLRA 4FI5A 4X20E 5FY1A 3WAJA 2KWHA 3AXJB 5KX5E 2LM9A 2ES0A 5CJ5A 3C4ZA 3X1DA 2XY8B 1D1CA 2UUCT 2YOEA 2CXLA 4HWFA 2JQQA 2V26A 5HWXA 2ZM6T 2WY2A 2X68A 2Y48B 4LF5T 4EZHA 3K3NA 3AVSA 3EHZA 4MHCA 3UU5A 4ZI3C 4JI7T 1T98A 2IAKA 2MYSA 3VR8A 2CMRA 2YU2A 3OTOT 3PUQA 4AIUA 2JMKA 1NAFA 3O1JA 3E22E 1HCIA 3EUHA 2YK0A 4UR9A 3N2KE 2CXDA 2V8SV 2NR4A 4N78D 5JVDE 3ZN1B 4JI1T 3O1HA 4OYJA 2WMNA 2VQFT 2XQAA 4ASKA 3T1HT 2NP9A 3PUVF 1W0BA 2NTXA 4ILAA 4TNWA 4X65T 3VRAA 2M6BA 3H3MA 4KMCA 4YFSA 3K3QC 4PJNA 3PUZF 2ACZA 4JLEA 2J47A 2LJLA 1OEDB 2WWVA 3UT5E 1YQ4A 3OPCA 4ZHQE 2B1EA 4OYKA 4EAHA 5AQPB 2Y6XA 3PU3A 3AA1B 3KV4A 1YKHB 4BAYB 1MIWA 4IE4A 2CPTA 4Z8XA 2Q9QB 2RP4A 4CQIA 2W00A 2BS3A 3R84B 4E7ZA 3IBPA 2K5BB 2VKOA 2ODVA 2WBLA 3UU8A 1E2AA 1WYBA 3GN5A 4X5TA 3AEGA 2V6YA 2EHOD 5C2TA 4QXHB 4HFEA 3OYXA 3BQKA 3CMLA 4QHOA 4P09A 4U31A 5HWYA 4I50E 5HXCA 4C91A 3ZKRA 4AQGA 3AAEB 3Q5EA 3E08A 4ZS3A 4DV5T 3ZT6A 4YTNA 4KBMB 4EB6E 3QOFA 2XAGB 4HGAA 2WDVA 3VR9A 4EEDA 4ZI2C 3BK9A 2VASA 2KMFA 2WDRA 1EZ3A 4JEHB 5ABFA 2KT9A 1X79A 1VCSA 4WBOA 2WP9A 2L3LA 4H9QC 2CWYA 3ZJ2A 3VKGA 2V7MA 1E7PA 2CA5A 5FXWA 3MJXA 4DVDA 3ZC0A 2FJDA 4KX6A 1HS7A 2QRXA 3LFMA 2XSBA 3ONLC 4JI8T 3EAMA 3FB2A 4FJOA 5LHIB 4NXMT 3Q5DA 2MOZA 1D1BA 3PUAA 2HPLA 2JQ9A 3AEBA 4IL4A 1W0AA 5EK4A 2BKNA 4JI4T 2IDOB 2E5LT 1ZEEA 4LFBT 2FUPA 3UU3A 5JRCB 2XQ3A 4A5XA 4UELA 4JI3T 2V7JA 4H9SE 4QKNA 3A5XA 2NW8A 3PUWF 1J1JA 1NENA 5GONE 5H6RB 4X62T 4PK6A 3AE2A 1KK7A 2EHOB 2X9HA 1Y64B 3FBZA 4GKJT 2DWGA 3LK2B 4HFCA 3ZPOA 3NWIA 2C5JA 5JR9B 3N9OA 4KHPT 1HNXT 4U33A 2LHNA 2DCFA 3RH3A 3FXDB 2BVLA 2QVAA 2LT3A 3ZSTA 3K1SA 5L4EA 4UV8B 4AKLA 2NW7A 4LMKA
chains in the Genus database with same CATH topology
2D5UA 3H37A 3Q9DA 4WNKA 1E1HB 1G8XA 2W62A 4G2AA 4F6RC 4CI1B 4AI6A 1QSDA 4I4TE 3QK6A 2XAJB 5FXVA 5J2TE 4GIWA 3ZCJA 4CI2B 2V7IA 2PG8A 1WLXA 2LSIA 2X51A 2ZMAA 2NW9A 3QC9A 2OA5A 4A56A 5LHHB 3KFWX 3LBXA 2D2SA 2V7KA 4EIWA 2V1DB 2N9DA 2VKHA 3ZLIA 5JDMA 3I0QA 5J1GA 5LYJE 1BR0A 3ZYMA 3N9MA 5FXZA 3K8PC 2YEVC 2ZM0A 3L3PA 3O1IA 4PJJA 3F31A 2D0TA 3HR0A 1HTJF 3RX6A 4IDZA 2X9WA 3U78A 5L3DB 5F3JA 1S94A 4AQFC 4IE5A 1Z0PA 3NRYA 1MIYA 3AA6B 4TN7B 4I55E 2XASB 2UXXB 4XZCA 3CX7B 1LRZA 4DO0A 4ZS2A 2WAUA 2E9XB 1MMGA 1AJ3A 2VKDA 2MBGA 4DMVA 1WYCA 2GK9A 3B13A 2PBIA 3RC3A 3ZMTB 3KV9A 3ZMVB 1FIOA 1IAPA 2N1GA 3SOLA 1HG2A 3E0ZA 4J2CA 4UIGA 4EXTA 1V9DA 5H6QB 5LBMA 2KXPB 1CUNA 2E8IA 4DNDA 3MK7C 2XAHB 5KMGP 3LG7A 3H3AA 5C8YE 2ZM8A 2LSGA 2VKJA 5JDNA 5HXSA 1G73A 4B6XA 3ANWB 3HKCE 1MIVA 5L3FB 3JC6C 2EHOC 4I43B 4WBNE 3ZMSB 2N2NA 1OWAA 5HAXA 3C50A 1OXZA 2LSKA 4CXYA 2JRKA 3AAAB 3GN5B 4E7SA 3PURA 5JR9C 2DI4A 1O3XA 1VOMA 2CXFA 2LEHA 2Y8DA 3KVBA 2X9XA 4XAXB 5IYZE 3IF8B 2K9AA 4HN9A 4NUUA 2CWOA 2LE8A 1U5PA 1LVKA 3CWZB 4O2BE 5ADXL 5KDMC 3V5SA 2DLRA 4FI5A 2KWIB 4WW0A 3CX8B 4X20E 5FY1A 3WAJA 5JRCA 2WMOA 3M65A 3P7IA 2KWHA 5HYAA 2CCQA 1IZNB 3UUMA 3N5LA 5KX5E 3N2GE 5LGNB 2LM9A 2ES0A 4EYYR 3C4ZA 2QA7A 4UVBB 3RRCA 5LP6E 3OYZA 1D0XA 2XTLA 5L2LA 4ERRA 4IE6A 3NRXA 1D1CA 3UTKA 1BR2A 4AKIA 4MFRA 2H7VC 3Q5XA 1UCUA 2CXLA 3AA0B 3UFEA 3TKLB 3KV5A 2A3DA 2JQQA 2V26A 4YLHA 5AFUL 5HWXA 2EHOA 2X68A 2Y48B 4ZOLE 3PUGA 4EZHA 4TUYE 3K3NA 3AVSA 2SPCA 3RRWA 3U3IA 4MHCA 3ETVA 4QXBB 4V1Av 4ZI3C 3LJCA 1T98A 2IAKA 2MYSA 3RYHE 5JDGA 2CMRA 4BJMA 2YU2A 3PUQA 3ZYLA 3PE0A 2XQYA 3L09A 4C90A 2JMKA 1NAFA 2X9YA 2XUEA 4PW8A 3O1JA 3E22E 1HCIA 4K0UA 4BJNA 3UUNA 3EUHA 2YK0A 4O8SA 4HFVA 5DQVA 4PFPA 5JDLA 3N2KE 5ETWA 2WWUA 2ZM2A 3I0OA 2CXDA 5LA6E 4N78D 5JVDE 3ZN1B 5DABA 4DBQA 5HXRA 1ZKEA 2ACXA 4JUYA 2E9XC 3O1HA 4OYJA 2WMNA 4OK0A 2HPJA 1H7CA 1HFAA 4EYUA 1NWMX 2XHEB 3LK3B 4ASKA 5L3EB 2NP9A 4HEAA 4X1IE 3ZMZB 4ZI3D 3DTOA 4UEMA 3CKDA 4U74A 1VRBA 5EK3A 5LBQB 3W15B 2XAQB 2NTXA 2JMHA 3ZJ1A 2ZLYA 3N2OA 4L0RA 4ZI7E 5F8PA 3DP7A 5FY0A 4L5GA 1FMWA 2I59A 5CB4E 4KMCA 4H63V 4YFSA 3ZN0B 3K3QC 4PJNA 5LCYA 5LG4A 3KBUA 1MMAA 3AAIA 4EZ4A 4MALA 4JLEA 4ADZA 2HH7A 1IJ6A 2CM0A 3J7Yq 2VK9A 3RPUA 4BA9A 4H9NC 2LJLA 3UT5E 2K24A 2NWBA 4PFOA 4CXXA 2E9XA 4ZHQE 5JDHA 2B1EA 3ZMUB 1QUUA 4OYKA 5FXXA 3R6NA 4EAHA 3HA4A 2Y6XA 4PK4A 4PJMA 2PFVA 3PU3A 3AA1B 3KV4A 1YKHB 3EVYA 5FYMA 3LK42 2LSYA 3GA8A 4IGUA 1WR6A 1FMVA 4IE7A 4IE0A 4BAYB 1MIWA 4IE4A 4Z8XA 5FP3A 5LOVE 1UX5A 4UVAB 2L9QA 2Q9QB 2RP4A 3Q2MA 4CQIA 2W00A 3R84B 4H9OC 4E7ZA 4GK0E 3N9QA 1SA0E 3P8CD 3N9PA 3ANWA 3IBPA 3UUXB 5L3BB 1LKXA 1LVFA 2K5BB 2VKOA 3IEEA 2ODVA 2WBLA 4PAGA 3KDSE 3I9YA 3BQLA 4QWNB 1WYBA 4MBQA 3PTRB 4KUMB 4XBFB 3GN5A 3FXEB 5J2UE 2ODUA 3K3OA 4UVCB 1ZHCA 3CQCB 4QXCB 4TV9E 1SHZC 3JC6D 2EHOD 2CLYB 4EOZB 4P0AA 3ETUA 4QXHB 1HG5A 3EDUA 3OYXA 3C64A 4TX5A 1HX8A 2Q9QA 1YW0A 2WSSV 1D0ZA 3BQKA 2IC9A 3CMLA 4L9IA 4P09A 2VWAA 2KINB 4QHOA 5HWYA 4YHJA 4ISTA 3S4UA 4JEUB 4I50E 3SRZA 5HXCA 4CXWA 2W61A 4C91A 2DHRA 2YINA 4AQGA 3KV6A 3AAEB 2IW5B 2D0UA 3E08A 5EK2A 4ZS3A 3F2EA 3J9X1 3D0TA 3GMIA 4QX8B 5JDFA 2H3RA 3RKOA 2NOXA 3MZKB 4KBMB 4EB6E 2XAGB 4HGAA 2LOPA 4UF0B 2KLQA 3PDYA 4O4HE 3ZCIA 3V5UA 2VL8A 3BK9A 4ZI2C 5JREA 2VASA 2KMFA 3Q5WA 3MA9A 2KZ7B 5E0OA 1EZ3A 1D0YA 3QUJA 4JEHB 3CVRA 2KT9A 2WM9A 3IHRA 4HKAA 1X79A 1S35A 1D1AA 5JH7E 4WBOA 2L3LA 1MNDA 3C98B 3VU7H 5DQWA 3NZQA 4OFZA 4OHFA 4H9QC 5EZYE 3VHLA 4ANJA 3RC8A 5FMNA 2CWYA 3ZJ2A 3VKGA 2V7MA 2CA5A 3EDVA 4X1YE 5FXWA 3MJXA 2IC6A 3WAKA 4DVDA 5FNVE 3ZC0A 4TV8E 2BDEA 1UX4A 4QX7B 2KNDA 1HS7A 2M67A 4UF0A 3LFMA 3OKQA 3RYIE 4NUVA 4PNIA 1YD8G 3OJAA 2LHRA 5L3CB 2P9BA 3CQXC 1YKEB 3GWHA 4O2AE 4P0BA 1IJ5A 3FB2A 4FJOA 5LHIB 3F57A 1MMNA 1B7TA 3AA7B 3NBXX 4GYRA 3HI2A 3O9XA 4YJ3E 4ZI2D 2BZBA 2MOZA 1D1BA 3PUAA 4UXNB 2HPLA 5IHYA 5JDQA 2G0UA 3CX6B 2JPFA 5TAOA 4MLKA 2X67A 3OBVE 2L8KA 5FY7A 4GYSA 2MTQA 4G63A 4TZ4C 4PJLA 4HE8A 5L3GB 2E9XD 3I1AA 5LHGB 3VKHA 5EK4A 4AKRB 2J1DG 4HTEA 2Q9QC 1FEWA 4IHJE 4DBRA 1ZEEA 3B57A 4PK5A 1MMDA 5LGTB 5CA0E 2NTYA 3CPZA 2Z6EA 3KINB 1HF8A 2DNXA 4GOUA 5JQGE 2K48A 2LOSA 3I9WA 5JRCB 2V7LA 3ZYKA 5BMVE 4AKHA 4UELA 2V7JA 3C51A 3FHNA 1BR1A 4H9SE 3MKDA 4QKNA 2RA1A 3SWHA 4ILUA 4H63H 3A5XA 4O4LE 3MXZA 2NW8A 4M1PA 1WRDA 4GK5E 3O4XE 2CLYC 4AXPA 3MACA 2XAFB 5CA1E 2DWKA 4KP3C 2PJQA 4H9RC 3PUSA 5GONE 4UV9B 3WI3A 4AQFA 5LJNA 5LJMA 5H6RB 3HL6A 4YJ2E 5LGUB 5M4YA 2BVMA 3N9LA 4PK6A 4AKGA 2H7OA 1KK7A 2Q9QD 3ESLA 2EHOB 2X9HA 1KNZA 5LNKA 2W0GA 1Y64B 3FBZA 2QGSA 2DWGA 3LK2B 4H9PC 1ZV4X 3HKBE 3ZPOA 3ONXA 1US7B 2C5JA 5JR9B 3HKDE 3UULA 1U4QA 2C5IT 3AB3B 3RYCE 3ZC1A 3N9OA 2YU1A 2CEAA 5LXTE 3KBTA 3DJBA 2CE7A 2A2FX 4U72A 3N9NA 2C0SA 3AVRA 2X66A 2X0LB 3C4XA 3SS1A 2LHNA 5DJQC 2JJ9A 3BQIA 2DCFA 3HKEE 4O4JE 3PU8A 3RH3A 2VB6A 3KVAA 3T8OA 3FXDB 2BVLA 5HXHA 1MNEA 2LT3A 5HXEA 2C5KT 4IIJE 2LSJA 3C4WA 4CZZB 3LBXB 3FBLA 5A1LA 1BR4A 4DMWA 2W63A 3CQGB 4CI3B 4O4IE 4UV8B 4X1KE 4AKLA 5JR9A 3RYFE 4ISSA 2NW7A 2UXNB 3NZPA 3ZEFB 2A72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9Q C;  4H9S E;  4H9R C;  5KDM C;  4H9P C;  4H9O C;  4HGA A;  4H9N C; 
#chains in the Genus database with same CATH topology
 3RI5 A;  1UUS A;  4I4T E;  3QK6 A;  5J2T E;  4CI2 B;  3NKZ A;  4U3C A;  1WLX A;  2LSI A;  2ZMA A;  4YTP A;  4A56 A;  3LBX A;  2V7K A;  1SUM B;  5J1G A;  5LYJ E;  1BR0 A;  3ZYM A;  3K8P C;  5FVL A;  2ZM0 A;  3L3P A;  3O1I A;  4PJJ A;  4IT4 A;  4IDZ A;  2X9W A;  3U78 A;  4A98 A;  5L3D B;  1S94 A;  3RIF A;  1MIY A;  4YY3 T;  4YHH T;  3RIU C;  4XZC A;  1KEY A;  3JAD A;  2GK9 A;  3B13 A;  2WCA A;  3SOL A;  1YQ3 A;  3E0Z A;  1V9D A;  5LBM A;  3H3A A;  2YDR A;  4YXD A;  4K0K T;  2LSG A;  4B6X A;  3HKC E;  3QB5 A;  3JC6 C;  4I43 B;  4WBN E;  2N2N A;  4CXY A;  2W67 A;  5AQF B;  5HEO A;  3AAA B;  4E7S A;  3ONJ A;  5IYZ E;  3RKG A;  4ZEY A;  3PUY F;  2CWO A;  5ADX L;  4YTM A;  3V5S A;  4HWI B;  2WMO A;  3M65 A;  5IUX A;  3N2G E;  4EYY R;  4EV6 A;  2IHR 1;  4YSX A;  3OYZ A;  3ABV A;  4IRE A;  4IE6 A;  4MFR A;  2H7V C;  3FZK B;  3PUG A;  1N36 T;  2SPC A;  3AXJ A;  3U3I A;  3ETV A;  3RYH E;  5JDG A;  1IBM T;  3P4S A;  3PE0 A;  2XQY A;  3L09 A;  4C90 A;  4PW8 A;  1KNR A;  4O8S A;  4HFV A;  5DQV A;  3TLV A;  2ZM2 A;  5AQI B;  5HXR A;  5HCJ A;  4OK0 A;  4TNV A;  4LMJ A;  1NWM X;  5L3E B;  4DV6 T;  4HEA A;  2VUR A;  4X1I E;  3ZMZ B;  3UUB A;  3CK6 A;  4UEM A;  5EK3 A;  2XAQ B;  2JMH A;  4NPP A;  3ZJ1 A;  2ZLY A;  3N2O A;  4ZI7 E;  5FY0 A;  3FZH B;  3ZN0 B;  1HX1 B;  4IDO A;  2HH7 A;  2CRB A;  2CM0 A;  2VK9 A;  4H9N C;  2K24 A;  4PFO A;  4CXX A;  2E9X A;  5KXJ A;  1QUU A;  4LML A;  2HHH T;  3HA4 A;  4PK4 A;  3LK4 2;  4IE7 A;  5LOV E;  5AQM B;  4UVA B;  3IA3 A;  2CBJ A;  4DV7 T;  3P8C D;  3UUX B;  1OED A;  3ANW A;  1LVF A;  3KDS E;  3I9Y A;  3BQL A;  4QWN B;  4MBQ A;  3PTR B;  4XBF B;  3FXE B;  4TV9 E;  4QXC B;  3JC6 D;  4EOZ B;  2VQE T;  3C64 A;  2Q9Q A;  1FJG T;  2IC9 A;  4L9I A;  2VWA A;  1XDP A;  4CN1 A;  3NVO A;  5L4H A;  5EK2 A;  3D0T A;  1N33 T;  3RKO A;  2KLQ A;  5AQK B;  3ZCI A;  5JRE A;  3Q5W A;  5E0O A;  1D0Y A;  3CVR A;  3P4R A;  5JH7 E;  3AEC A;  3TLW A;  1MND A;  3VU7 H;  1XNQ T;  4OHF A;  5EZY E;  3WAK A;  2BDE A;  1UX4 A;  2KND A;  1XDO A;  3OKQ A;  2YN6 A;  3AEF A;  1UGO A;  1IJ5 A;  3F57 A;  3AA7 B;  3NBX X;  3HI2 A;  2D9D A;  3EAB A;  5IHY A;  5JDQ A;  2G0U A;  3CX6 B;  2JPF A;  5TAO A;  4MLK A;  2L8K A;  5FY7 A;  4YT0 A;  4DR5 T;  4GYS A;  4HE8 A;  1MMD A;  5CA0 E;  3KIN B;  4ILB A;  2MAW A;  5JQG E;  2LOS A;  3ZYK A;  2QYW A;  3SWH A;  4ILU A;  3O4X E;  2CLY C;  4AXP A;  3MAC A;  4H9R C;  3PUS A;  2WB5 A;  5LJN A;  5LJM A;  5LGU B;  5M4Y A;  2BVM A;  4AKG A;  4JBW F;  4YSY A;  1R8I A;  3ESL A;  2RPA A;  1ZV4 X;  3ONX A;  1U4Q A;  3AB3 B;  3RYC E;  2YU1 A;  2CE7 A;  2A2F X;  4U72 A;  2XM2 A;  2V5C A;  3LDQ B;  5DJQ C;  2JJ9 A;  4O4J E;  4B3R T;  4EEB A;  4IIJ E;  3C4W A;  4CZZ B;  3AE5 A;  5A1L A;  1BR4 A;  4CI3 B;  2BBJ A;  5JR9 A;  3PJA J;  4DV0 T;  2A72 A;  3Q9D A;  4WNK A;  2XAJ B;  2PG8 A;  2X51 A;  4JI2 T;  3T1Y T;  2D2S A;  4EIW A;  4U7I A;  2V1D B;  1J5W A;  1I6Z A;  2V6X A;  5FXZ A;  2CHN A;  3L8R A;  3A8Y C;  5AQV B;  2D0T A;  1QLB A;  3SFD A;  4AQF C;  4P1N A;  3UQ7 A;  3AA6 B;  4I55 E;  2XAS B;  4DO0 A;  4ZS2 A;  1MMG A;  2VKD A;  4DMV A;  3ZMT B;  5AQR B;  2N1G A;  1JNZ A;  1CUN A;  2E8I A;  4KI0 F;  5KMG P;  4X66 T;  5C8Y E;  1XMO T;  2M6I A;  5L3F B;  5HAX A;  2YDQ A;  3GN5 B;  2CXF A;  2LEH A;  4XAX B;  2V6Y B;  3IF8 B;  2LRK A;  4O2B E;  2LE8 A;  1U5P A;  3CWZ B;  3EI0 A;  4WW0 A;  3PUX F;  5ABG A;  3P7I A;  3PV0 F;  5HYA A;  1IZN B;  2HN2 A;  3UUM A;  5LG3 A;  3N5L A;  5LGN B;  4UVB B;  2WS3 A;  1XWM A;  3RRC A;  5LP6 E;  4DR6 T;  2XTL A;  4ERR A;  3UTK A;  5IWA T;  4AKI A;  2MPK A;  2H88 A;  1UCU A;  3AA0 B;  3UFE A;  3TKL B;  3KV5 A;  2BG9 A;  2A3D A;  2FJE A;  2FJA A;  4ZOL E;  3CIR A;  1I94 T;  4QXB B;  1N32 T;  4BJM A;  2BKO A;  3ZYL A;  4DV1 T;  2XUE A;  4U2Y A;  2AE9 A;  2I6H A;  4K0U A;  4BJN A;  5JDL A;  5ETW A;  2WWU A;  3I0O A;  2WQY A;  1HNZ T;  5DAB A;  2AXD S;  4DBQ A;  2ACX A;  4JUY A;  2UXC T;  2E9X C;  4LF4 T;  2HPJ A;  1HFA A;  4EYU A;  2IML A;  2XHE B;  1GQE A;  1KNP A;  4AQY T;  2VVS A;  3W15 B;  3QB5 K;  4JI6 T;  4L5G A;  1FMW A;  4A97 A;  1CHU A;  5CB4 E;  5LCY A;  5LG4 A;  4OX9 T;  1KF6 A;  1MMA A;  2DL1 A;  4EZ4 A;  4MAL A;  1X9B A;  1IJ6 A;  3PJA A;  3J7Y q;  3RPU A;  4BA9 A;  2NWB A;  5JDH A;  2W66 A;  3JAE A;  3R6N A;  4PJM A;  3RIA A;  5LMN T;  3TLT A;  3EVY A;  2LSY A;  4IE0 A;  1WR6 A;  2CBI A;  2A9U A;  3N9Q A;  1SA0 E;  2V5D A;  5L3B B;  3N9P A;  4AIS A;  2BS2 A;  1LKX A;  2LLY A;  1DU2 A;  4LF8 T;  3IEE A;  4PAG A;  4KUM B;  2XZE A;  2ODU A;  3K3O A;  1ZHC A;  1SHZ C;  4P0A A;  2CLY B;  3ETU A;  2R6G F;  5FVK A;  1HG5 A;  4TX5 A;  4WZX A;  3RQW A;  1M62 A;  1YW0 A;  4ADZ A;  2KIN B;  2BG9 E;  4YHJ A;  1L0V A;  4IST A;  3SRZ A;  2XQ6 A;  4CXW A;  2DHR A;  2IW5 B;  2D0U A;  3F2E A;  3J9X 1;  4QX8 B;  3TLU A;  2XQ9 A;  3MZK B;  3RHW A;  2OV9 A;  2WZI A;  4UF0 B;  4O4H E;  3MA9 A;  3AE6 A;  2WM9 A;  3IHR A;  4HKA A;  1S35 A;  5DQW A;  3RC8 A;  4OFZ A;  1YXR A;  5FMN A;  3RF1 A;  3EDV A;  2XQ5 A;  3JCF A;  5AQT B;  2IC6 A;  5FNV E;  2K3W A;  4TV8 E;  4QX7 B;  3RYI E;  4NUV A;  5L3C B;  3FZM B;  2LHR A;  4IDQ A;  2YDS A;  3ZT5 A;  4O2A E;  3AE3 A;  1MMN A;  4GYR A;  3O9X A;  2BZB A;  4IDP A;  5HEH A;  2X67 A;  3OBV E;  2MTQ A;  4G63 A;  4PJL A;  4HFI A;  2E9X D;  3I1A A;  5LHG B;  3VKH A;  2J1D G;  4JI0 T;  2UUA T;  1FEW A;  1XNR T;  4IHJ E;  4PK5 A;  5LGT B;  2NTY A;  3CPZ A;  3P50 A;  2K48 A;  2VL0 A;  5BMV E;  4AKH A;  3C51 A;  2KSR A;  4H63 H;  4O4L E;  3MXZ A;  4M1P A;  1WRD A;  4GK5 E;  3FZL B;  5FL0 A;  1KFY A;  3P4P A;  2XAF B;  5CA1 E;  3HL6 A;  3RIU A;  4YJ2 E;  3N9L A;  1WR0 A;  1JNR A;  4HWD A;  2Q9Q D;  1KNZ A;  5AQQ B;  5LNK A;  2QGS A;  4H9P C;  3HKB E;  1US7 B;  4TWF A;  3HKD E;  3UUL A;  2C5I T;  3ZC1 A;  1UK5 A;  2CEA A;  3KBT A;  5ABE A;  3DJB A;  2C0S A;  2X66 A;  3HKE E;  3BQI A;  3LSV A;  3PU8 A;  3KVA A;  3T8O A;  2C5K T;  4O4I E;  3UFG A;  4ISS A;  5JDM A;  2UXN B;  2D5U A;  1G8X A;  2W62 A;  4F6R C;  4CI1 B;  4AI6 A;  1QSD A;  5FXV A;  3ZCJ A;  2V7I A;  1W9R A;  3FZF B;  3SFE A;  3QC9 A;  2OA5 A;  5LHH B;  2UUB T;  2N9D A;  3ZLI A;  3M3Z B;  3N9M A;  5AQO B;  3AEE A;  3HR0 A;  4QH5 A;  3RX6 A;  5L47 A;  4DV4 T;  5F3J A;  2OLT A;  4IE5 A;  3NRY A;  4TN7 B;  4COF A;  2UXX B;  2E9X B;  3QNU A;  1WYC A;  2PBI A;  2LRL A;  3KV9 A;  1FIO A;  1IAP A;  1HG2 A;  1ZP0 A;  4EXT A;  4UIG A;  4DND A;  3MK7 C;  3LG7 A;  2JQH A;  2ZM8 A;  2BG9 C;  1G73 A;  3ANW B;  1MIV A;  1T72 A;  3ZMS B;  1OWA A;  2UXD T;  2LSK A;  4B3T T;  2JRK A;  3PUR A;  2Y8D A;  2JQK A;  4HN9 A;  1OED E;  5KDM C;  2KWI B;  5C3J A;  5JRC A;  2CCQ A;  2QA7 A;  2XSA A;  4YSZ A;  1D0X A;  5L2L A;  3NRX A;  1BR2 A;  3JAF A;  3Q5X A;  2IUB A;  2F4V T;  4YLH A;  3RQU A;  5AFU L;  4NXN T;  1VCT A;  2EHO A;  4ZZC A;  1M7K A;  4TUY E;  3RRW A;  4DUY T;  4QH4 A;  5BR8 T;  1IBL T;  4V1A v;  3LJC A;  5AQN B;  2XPK A;  4DV2 T;  4LFC T;  3G06 A;  1T7S A;  2X9Y A;  5ABH A;  3UUN A;  5CGM A;  4Z91 A;  4PFP A;  2X0H A;  5LA6 E;  4HFD A;  3TLS A;  1ZKE A;  1H7C A;  2UXB T;  4HWH A;  1WCR A;  3LK3 B;  4ZI3 D;  3DTO A;  4HFB A;  2JIW A;  3CKD A;  4U74 A;  1VRB A;  5LBQ B;  2XQ4 A;  3OVU A;  4L0R A;  5F8P A;  3AED A;  3DP7 A;  5FKY A;  2CHO A;  2I59 A;  5AQG B;  4NIQ A;  2FJB A;  4H63 V;  3KBU A;  3AAI A;  1XZY A;  4HWC A;  2E2A A;  4DR2 T;  5AQL B;  3ZMU B;  5LMU T;  5FXX A;  1HR0 T;  2LKH A;  2X0Y A;  2PFV A;  3P4W A;  5FYM A;  4IGU A;  3GA8 A;  1FMV A;  1UUR A;  5HEJ A;  2I0M A;  5FP3 A;  3RLF F;  1UX5 A;  4DV3 T;  4LF7 T;  2YKS A;  2L9Q A;  3Q2M A;  4H9O C;  5LB7 B;  4GK0 E;  1Z8U A;  2HN1 A;  4U7Y A;  5J2U E;  4UVC B;  3CQC B;  4I0U A;  4EGW A;  3RGL A;  4TWH A;  3EDU A;  2J4G A;  1HX8 A;  2FBW A;  1J5E T;  2WSS V;  1D0Z A;  3L39 A;  5ABF B;  3S4U A;  4JEU B;  2W61 A;  2YIN A;  4U2Z A;  3KV6 A;  4ZXL A;  3UQ4 A;  3GMI A;  3A7M A;  5JDF A;  2H3R A;  2NOX A;  3AE1 A;  2LOP A;  3PDY A;  3V5U A;  2VL8 A;  2KZ7 B;  5HEG A;  3QUJ A;  2XJ7 A;  1NEK A;  5FL1 A;  1D1A A;  4TWD A;  3C98 B;  3VHL A;  3NZQ A;  4ANJ A;  5AQS B;  4X1Y E;  5F5W A;  5HCM A;  3AE9 A;  2M67 A;  4UF0 A;  4ZZB A;  4PNI A;  1YD8 G;  3OJA A;  5AQH B;  3ZSS A;  2P9B A;  2BS4 A;  1YKE B;  3CQX C;  3GWH A;  4P0B A;  1XMQ T;  2WZH A;  1B7T A;  3B5M A;  1OED C;  4YJ3 E;  4ZI2 D;  4UXN B;  4LFA T;  4B3M T;  4TZ4 C;  4DUZ T;  5AQJ B;  2W2U A;  5L3G B;  4AKR B;  4HTE A;  2Q9Q C;  4DBR A;  3B57 A;  2W4X A;  3P4Q A;  2Z6E A;  1HF8 A;  2DNX A;  4GOU A;  2E5V A;  2XQ7 A;  3I9W A;  4IL9 A;  2V7L A;  3AE4 A;  3FHN A;  1BR1 A;  3MKD A;  2RA1 A;  5JTG A;  4B3S T;  2DWK A;  4CN4 A;  4KP3 C;  2PJQ A;  4UV9 B;  3WI3 A;  4AQF A;  2B76 A;  2BG9 B;  4LF9 T;  3AE7 A;  2H7O A;  2H89 A;  4DR7 T;  2WDQ A;  4F8H A;  2UU9 T;  2W0G A;  2LM2 A;  4WYV A;  5AQU B;  5LXT E;  4HFH A;  1ZOY A;  3N9N A;  2LKG A;  3AVR A;  1IBK T;  3C4X A;  2X0L B;  4Q25 A;  3SS1 A;  5CFB A;  4JYA T;  1Y01 A;  2VB6 A;  3UU4 A;  5HXH A;  4JV5 T;  1MNE A;  5HXE A;  5J0Z A;  2LSJ A;  4KHZ F;  3LBX B;  3ZT7 A;  4IDN A;  3FBL A;  2VVN A;  4DMW A;  2W63 A;  3CQG B;  2IIU A;  4X1K E;  3RYF E;  1HTJ F;  3NZP A;  3ZEF B;  3CX8 B;  3H37 A;  1E1H B;  2PTF A;  4G2A A;  3AE8 A;  4GIW A;  4Z90 A;  3AEA A;  2NW9 A;  1T8B A;  2BKP A;  2XM1 A;  3KFW X;  2WU5 A;  2VKH A;  3I0Q A;  2XQ8 A;  2YEV C;  3F31 A;  2BBH A;  1Z0P A;  4DR1 T;  3CX7 B;  1LRZ A;  4JI5 T;  2WAU A;  4ILC A;  1SE7 A;  3VRB A;  1AJ3 A;  2MBG A;  3RC3 A;  3ZMV B;  2J62 A;  4X64 T;  1N34 T;  1HNW T;  4J2C A;  5HEU A;  5H6Q B;  2KXP B;  2XAH B;  4GKK T;  4DID B;  3UU6 A;  2VKJ A;  5JDN A;  5HXS A;  2EHO C;  4LF6 T;  4DR3 T;  3C50 A;  1OXZ A;  1WFD A;  2WU2 A;  5JR9 C;  1W09 A;  4CN6 A;  2DI4 A;  1O3X A;  1VOM A;  3KVB A;  2X9X A;  4DR4 T;  2K9A A;  4NUU A;  1LVK A;  4QH1 A;  2DLR A;  4FI5 A;  4X20 E;  5FY1 A;  3WAJ A;  2KWH A;  3AXJ B;  5KX5 E;  2LM9 A;  2ES0 A;  5CJ5 A;  3C4Z A;  3X1D A;  2XY8 B;  1D1C A;  2UUC T;  2YOE A;  2CXL A;  4HWF A;  2JQQ A;  2V26 A;  5HWX A;  2ZM6 T;  2WY2 A;  2X68 A;  2Y48 B;  4LF5 T;  4EZH A;  3K3N A;  3AVS A;  3EHZ A;  4MHC A;  3UU5 A;  4ZI3 C;  4JI7 T;  1T98 A;  2IAK A;  2MYS A;  3VR8 A;  2CMR A;  2YU2 A;  3OTO T;  3PUQ A;  4AIU A;  2JMK A;  1NAF A;  3O1J A;  3E22 E;  1HCI A;  3EUH A;  2YK0 A;  4UR9 A;  3N2K E;  2CXD A;  2V8S V;  2NR4 A;  4N78 D;  5JVD E;  3ZN1 B;  4JI1 T;  3O1H A;  4OYJ A;  2WMN A;  2VQF T;  2XQA A;  4ASK A;  3T1H T;  2NP9 A;  3PUV F;  1W0B A;  2NTX A;  4ILA A;  4TNW A;  4X65 T;  3VRA A;  2M6B A;  3H3M A;  4KMC A;  4YFS A;  3K3Q C;  4PJN A;  3PUZ F;  2ACZ A;  4JLE A;  2J47 A;  2LJL A;  1OED B;  2WWV A;  3UT5 E;  1YQ4 A;  3OPC A;  4ZHQ E;  2B1E A;  4OYK A;  4EAH A;  5AQP B;  2Y6X A;  3PU3 A;  3AA1 B;  3KV4 A;  1YKH B;  4BAY B;  1MIW A;  4IE4 A;  2CPT A;  4Z8X A;  2Q9Q B;  2RP4 A;  4CQI A;  2W00 A;  2BS3 A;  3R84 B;  4E7Z A;  3IBP A;  2K5B B;  2VKO A;  2ODV A;  2WBL A;  3UU8 A;  1E2A A;  1WYB A;  3GN5 A;  4X5T A;  3AEG A;  2V6Y A;  2EHO D;  5C2T A;  4QXH B;  4HFE A;  3OYX A;  3BQK A;  3CML A;  4QHO A;  4P09 A;  4U31 A;  5HWY A;  4I50 E;  5HXC A;  4C91 A;  3ZKR A;  4AQG A;  3AAE B;  3Q5E A;  3E08 A;  4ZS3 A;  4DV5 T;  3ZT6 A;  4YTN A;  4KBM B;  4EB6 E;  3QOF A;  2XAG B;  4HGA A;  2WDV A;  3VR9 A;  4EED A;  4ZI2 C;  3BK9 A;  2VAS A;  2KMF A;  2WDR A;  1EZ3 A;  4JEH B;  5ABF A;  2KT9 A;  1X79 A;  1VCS A;  4WBO A;  2WP9 A;  2L3L A;  4H9Q C;  2CWY A;  3ZJ2 A;  3VKG A;  2V7M A;  1E7P A;  2CA5 A;  5FXW A;  3MJX A;  4DVD A;  3ZC0 A;  2FJD A;  4KX6 A;  1HS7 A;  2QRX A;  3LFM A;  2XSB A;  3ONL C;  4JI8 T;  3EAM A;  3FB2 A;  4FJO A;  5LHI B;  4NXM T;  3Q5D A;  2MOZ A;  1D1B A;  3PUA A;  2HPL A;  2JQ9 A;  3AEB A;  4IL4 A;  1W0A A;  5EK4 A;  2BKN A;  4JI4 T;  2IDO B;  2E5L T;  1ZEE A;  4LFB T;  2FUP A;  3UU3 A;  5JRC B;  2XQ3 A;  4A5X A;  4UEL A;  4JI3 T;  2V7J A;  4H9S E;  4QKN A;  3A5X A;  2NW8 A;  3PUW F;  1J1J A;  1NEN A;  5GON E;  5H6R B;  4X62 T;  4PK6 A;  3AE2 A;  1KK7 A;  2EHO B;  2X9H A;  1Y64 B;  3FBZ A;  4GKJ T;  2DWG A;  3LK2 B;  4HFC A;  3ZPO A;  3NWI A;  2C5J A;  5JR9 B;  3N9O A;  4KHP T;  1HNX T;  4U33 A;  2LHN A;  2DCF A;  3RH3 A;  3FXD B;  2BVL A;  2QVA A;  2LT3 A;  3ZST A;  3K1S A;  5L4E A;  4UV8 B;  4AKL A;  2NW7 A;  4LMK A; 
#chains in the Genus database with same CATH homology
 2D5U A;  3H37 A;  3Q9D A;  4WNK A;  1E1H B;  1G8X A;  2W62 A;  4G2A A;  4F6R C;  4CI1 B;  4AI6 A;  1QSD A;  4I4T E;  3QK6 A;  2XAJ B;  5FXV A;  5J2T E;  4GIW A;  3ZCJ A;  4CI2 B;  2V7I A;  2PG8 A;  1WLX A;  2LSI A;  2X51 A;  2ZMA A;  2NW9 A;  3QC9 A;  2OA5 A;  4A56 A;  5LHH B;  3KFW X;  3LBX A;  2D2S A;  2V7K A;  4EIW A;  2V1D B;  2N9D A;  2VKH A;  3ZLI A;  5JDM A;  3I0Q A;  5J1G A;  5LYJ E;  1BR0 A;  3ZYM A;  3N9M A;  5FXZ A;  3K8P C;  2YEV C;  2ZM0 A;  3L3P A;  3O1I A;  4PJJ A;  3F31 A;  2D0T A;  3HR0 A;  1HTJ F;  3RX6 A;  4IDZ A;  2X9W A;  3U78 A;  5L3D B;  5F3J A;  1S94 A;  4AQF C;  4IE5 A;  1Z0P A;  3NRY A;  1MIY A;  3AA6 B;  4TN7 B;  4I55 E;  2XAS B;  2UXX B;  4XZC A;  3CX7 B;  1LRZ A;  4DO0 A;  4ZS2 A;  2WAU A;  2E9X B;  1MMG A;  1AJ3 A;  2VKD A;  2MBG A;  4DMV A;  1WYC A;  2GK9 A;  3B13 A;  2PBI A;  3RC3 A;  3ZMT B;  3KV9 A;  3ZMV B;  1FIO A;  1IAP A;  2N1G A;  3SOL A;  1HG2 A;  3E0Z A;  4J2C A;  4UIG A;  4EXT A;  1V9D A;  5H6Q B;  5LBM A;  2KXP B;  1CUN A;  2E8I A;  4DND A;  3MK7 C;  2XAH B;  5KMG P;  3LG7 A;  3H3A A;  5C8Y E;  2ZM8 A;  2LSG A;  2VKJ A;  5JDN A;  5HXS A;  1G73 A;  4B6X A;  3ANW B;  3HKC E;  1MIV A;  5L3F B;  3JC6 C;  2EHO C;  4I43 B;  4WBN E;  3ZMS B;  2N2N A;  1OWA A;  5HAX A;  3C50 A;  1OXZ A;  2LSK A;  4CXY A;  2JRK A;  3AAA B;  3GN5 B;  4E7S A;  3PUR A;  5JR9 C;  2DI4 A;  1O3X A;  1VOM A;  2CXF A;  2LEH A;  2Y8D A;  3KVB A;  2X9X A;  4XAX B;  5IYZ E;  3IF8 B;  2K9A A;  4HN9 A;  4NUU A;  2CWO A;  2LE8 A;  1U5P A;  1LVK A;  3CWZ B;  4O2B E;  5ADX L;  5KDM C;  3V5S A;  2DLR A;  4FI5 A;  2KWI B;  4WW0 A;  3CX8 B;  4X20 E;  5FY1 A;  3WAJ A;  5JRC A;  2WMO A;  3M65 A;  3P7I A;  2KWH A;  5HYA A;  2CCQ A;  1IZN B;  3UUM A;  3N5L A;  5KX5 E;  3N2G E;  5LGN B;  2LM9 A;  2ES0 A;  4EYY R;  3C4Z A;  2QA7 A;  4UVB B;  3RRC A;  5LP6 E;  3OYZ A;  1D0X A;  2XTL A;  5L2L A;  4ERR A;  4IE6 A;  3NRX A;  1D1C A;  3UTK A;  1BR2 A;  4AKI A;  4MFR A;  2H7V C;  3Q5X A;  1UCU A;  2CXL A;  3AA0 B;  3UFE A;  3TKL B;  3KV5 A;  2A3D A;  2JQQ A;  2V26 A;  4YLH A;  5AFU L;  5HWX A;  2EHO A;  2X68 A;  2Y48 B;  4ZOL E;  3PUG A;  4EZH A;  4TUY E;  3K3N A;  3AVS A;  2SPC A;  3RRW A;  3U3I A;  4MHC A;  3ETV A;  4QXB B;  4V1A v;  4ZI3 C;  3LJC A;  1T98 A;  2IAK A;  2MYS A;  3RYH E;  5JDG A;  2CMR A;  4BJM A;  2YU2 A;  3PUQ A;  3ZYL A;  3PE0 A;  2XQY A;  3L09 A;  4C90 A;  2JMK A;  1NAF A;  2X9Y A;  2XUE A;  4PW8 A;  3O1J A;  3E22 E;  1HCI A;  4K0U A;  4BJN A;  3UUN A;  3EUH A;  2YK0 A;  4O8S A;  4HFV A;  5DQV A;  4PFP A;  5JDL A;  3N2K E;  5ETW A;  2WWU A;  2ZM2 A;  3I0O A;  2CXD A;  5LA6 E;  4N78 D;  5JVD E;  3ZN1 B;  5DAB A;  4DBQ A;  5HXR A;  1ZKE A;  2ACX A;  4JUY A;  2E9X C;  3O1H A;  4OYJ A;  2WMN A;  4OK0 A;  2HPJ A;  1H7C A;  1HFA A;  4EYU A;  1NWM X;  2XHE B;  3LK3 B;  4ASK A;  5L3E B;  2NP9 A;  4HEA A;  4X1I E;  3ZMZ B;  4ZI3 D;  3DTO A;  4UEM A;  3CKD A;  4U74 A;  1VRB A;  5EK3 A;  5LBQ B;  3W15 B;  2XAQ B;  2NTX A;  2JMH A;  3ZJ1 A;  2ZLY A;  3N2O A;  4L0R A;  4ZI7 E;  5F8P A;  3DP7 A;  5FY0 A;  4L5G A;  1FMW A;  2I59 A;  5CB4 E;  4KMC A;  4H63 V;  4YFS A;  3ZN0 B;  3K3Q C;  4PJN A;  5LCY A;  5LG4 A;  3KBU A;  1MMA A;  3AAI A;  4EZ4 A;  4MAL A;  4JLE A;  4ADZ A;  2HH7 A;  1IJ6 A;  2CM0 A;  3J7Y q;  2VK9 A;  3RPU A;  4BA9 A;  4H9N C;  2LJL A;  3UT5 E;  2K24 A;  2NWB A;  4PFO A;  4CXX A;  2E9X A;  4ZHQ E;  5JDH A;  2B1E A;  3ZMU B;  1QUU A;  4OYK A;  5FXX A;  3R6N A;  4EAH A;  3HA4 A;  2Y6X A;  4PK4 A;  4PJM A;  2PFV A;  3PU3 A;  3AA1 B;  3KV4 A;  1YKH B;  3EVY A;  5FYM A;  3LK4 2;  2LSY A;  3GA8 A;  4IGU A;  1WR6 A;  1FMV A;  4IE7 A;  4IE0 A;  4BAY B;  1MIW A;  4IE4 A;  4Z8X A;  5FP3 A;  5LOV E;  1UX5 A;  4UVA B;  2L9Q A;  2Q9Q B;  2RP4 A;  3Q2M A;  4CQI A;  2W00 A;  3R84 B;  4H9O C;  4E7Z A;  4GK0 E;  3N9Q A;  1SA0 E;  3P8C D;  3N9P A;  3ANW A;  3IBP A;  3UUX B;  5L3B B;  1LKX A;  1LVF A;  2K5B B;  2VKO A;  3IEE A;  2ODV A;  2WBL A;  4PAG A;  3KDS E;  3I9Y A;  3BQL A;  4QWN B;  1WYB A;  4MBQ A;  3PTR B;  4KUM B;  4XBF B;  3GN5 A;  3FXE B;  5J2U E;  2ODU A;  3K3O A;  4UVC B;  1ZHC A;  3CQC B;  4QXC B;  4TV9 E;  1SHZ C;  3JC6 D;  2EHO D;  2CLY B;  4EOZ B;  4P0A A;  3ETU A;  4QXH B;  1HG5 A;  3EDU A;  3OYX A;  3C64 A;  4TX5 A;  1HX8 A;  2Q9Q A;  1YW0 A;  2WSS V;  1D0Z A;  3BQK A;  2IC9 A;  3CML A;  4L9I A;  4P09 A;  2VWA A;  2KIN B;  4QHO A;  5HWY A;  4YHJ A;  4IST A;  3S4U A;  4JEU B;  4I50 E;  3SRZ A;  5HXC A;  4CXW A;  2W61 A;  4C91 A;  2DHR A;  2YIN A;  4AQG A;  3KV6 A;  3AAE B;  2IW5 B;  2D0U A;  3E08 A;  5EK2 A;  4ZS3 A;  3F2E A;  3J9X 1;  3D0T A;  3GMI A;  4QX8 B;  5JDF A;  2H3R A;  3RKO A;  2NOX A;  3MZK B;  4KBM B;  4EB6 E;  2XAG B;  4HGA A;  2LOP A;  4UF0 B;  2KLQ A;  3PDY A;  4O4H E;  3ZCI A;  3V5U A;  2VL8 A;  3BK9 A;  4ZI2 C;  5JRE A;  2VAS A;  2KMF A;  3Q5W A;  3MA9 A;  2KZ7 B;  5E0O A;  1EZ3 A;  1D0Y A;  3QUJ A;  4JEH B;  3CVR A;  2KT9 A;  2WM9 A;  3IHR A;  4HKA A;  1X79 A;  1S35 A;  1D1A A;  5JH7 E;  4WBO A;  2L3L A;  1MND A;  3C98 B;  3VU7 H;  5DQW A;  3NZQ A;  4OFZ A;  4OHF A;  4H9Q C;  5EZY E;  3VHL A;  4ANJ A;  3RC8 A;  5FMN A;  2CWY A;  3ZJ2 A;  3VKG A;  2V7M A;  2CA5 A;  3EDV A;  4X1Y E;  5FXW A;  3MJX A;  2IC6 A;  3WAK A;  4DVD A;  5FNV E;  3ZC0 A;  4TV8 E;  2BDE A;  1UX4 A;  4QX7 B;  2KND A;  1HS7 A;  2M67 A;  4UF0 A;  3LFM A;  3OKQ A;  3RYI E;  4NUV A;  4PNI A;  1YD8 G;  3OJA A;  2LHR A;  5L3C B;  2P9B A;  3CQX C;  1YKE B;  3GWH A;  4O2A E;  4P0B A;  1IJ5 A;  3FB2 A;  4FJO A;  5LHI B;  3F57 A;  1MMN A;  1B7T A;  3AA7 B;  3NBX X;  4GYR A;  3HI2 A;  3O9X A;  4YJ3 E;  4ZI2 D;  2BZB A;  2MOZ A;  1D1B A;  3PUA A;  4UXN B;  2HPL A;  5IHY A;  5JDQ A;  2G0U A;  3CX6 B;  2JPF A;  5TAO A;  4MLK A;  2X67 A;  3OBV E;  2L8K A;  5FY7 A;  4GYS A;  2MTQ A;  4G63 A;  4TZ4 C;  4PJL A;  4HE8 A;  5L3G B;  2E9X D;  3I1A A;  5LHG B;  3VKH A;  5EK4 A;  4AKR B;  2J1D G;  4HTE A;  2Q9Q C;  1FEW A;  4IHJ E;  4DBR A;  1ZEE A;  3B57 A;  4PK5 A;  1MMD A;  5LGT B;  5CA0 E;  2NTY A;  3CPZ A;  2Z6E A;  3KIN B;  1HF8 A;  2DNX A;  4GOU A;  5JQG E;  2K48 A;  2LOS A;  3I9W A;  5JRC B;  2V7L A;  3ZYK A;  5BMV E;  4AKH A;  4UEL A;  2V7J A;  3C51 A;  3FHN A;  1BR1 A;  4H9S E;  3MKD A;  4QKN A;  2RA1 A;  3SWH A;  4ILU A;  4H63 H;  3A5X A;  4O4L E;  3MXZ A;  2NW8 A;  4M1P A;  1WRD A;  4GK5 E;  3O4X E;  2CLY C;  4AXP A;  3MAC A;  2XAF B;  5CA1 E;  2DWK A;  4KP3 C;  2PJQ A;  4H9R C;  3PUS A;  5GON E;  4UV9 B;  3WI3 A;  4AQF A;  5LJN A;  5LJM A;  5H6R B;  3HL6 A;  4YJ2 E;  5LGU B;  5M4Y A;  2BVM A;  3N9L A;  4PK6 A;  4AKG A;  2H7O A;  1KK7 A;  2Q9Q D;  3ESL A;  2EHO B;  2X9H A;  1KNZ A;  5LNK A;  2W0G A;  1Y64 B;  3FBZ A;  2QGS A;  2DWG A;  3LK2 B;  4H9P C;  1ZV4 X;  3HKB E;  3ZPO A;  3ONX A;  1US7 B;  2C5J A;  5JR9 B;  3HKD E;  3UUL A;  1U4Q A;  2C5I T;  3AB3 B;  3RYC E;  3ZC1 A;  3N9O A;  2YU1 A;  2CEA A;  5LXT E;  3KBT A;  3DJB A;  2CE7 A;  2A2F X;  4U72 A;  3N9N A;  2C0S A;  3AVR A;  2X66 A;  2X0L B;  3C4X A;  3SS1 A;  2LHN A;  5DJQ C;  2JJ9 A;  3BQI A;  2DCF A;  3HKE E;  4O4J E;  3PU8 A;  3RH3 A;  2VB6 A;  3KVA A;  3T8O A;  3FXD B;  2BVL A;  5HXH A;  1MNE A;  2LT3 A;  5HXE A;  2C5K T;  4IIJ E;  2LSJ A;  3C4W A;  4CZZ B;  3LBX B;  3FBL A;  5A1L A;  1BR4 A;  4DMW A;  2W63 A;  3CQG B;  4CI3 B;  4O4I E;  4UV8 B;  4X1K E;  4AKL A;  5JR9 A;  3RYF E;  4ISS A;  2NW7 A;  2UXN B;  3NZP A;  3ZEF B;  2A72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...