5KDMC

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
205
Chain Sequence
RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone / dna binding protein
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2016-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5kdmC00
4H9SE 4H9RC 4H9PC 5KDMC 4H9OC 4HGAA 4H9NC 4H9QC
chains in the Genus database with same CATH superfamily
4TV9E 2VB6A 2VVSA 2KINB 3ZMUB 4WZXA 4AKRB 2KLQA 3FB2A 4AKLA 4P0AA 3RX6A 3BQLA 3N5LA 2BKPA 4JI8T 2ES0A 2XJ7A 3CX6B 2VQET 4HFVA 5IHYA 2D0UA 3N2OA 3RYFE 2YK0A 5J0ZA 3GN5A 2P9BA 3PUWF 4PNIA 2W67A 5BMVE 1E7PA 2UUAT 2IDOB 4I0UA 2XAGB 3K3QC 4NXNT 2MOZA 4GKJT 1W0AA 3RRCA 4ZI7E 4JLEA 4HWFA 5LA6E 5C8YE 3DTOA 3MKDA 2CWOA 1N34T 4QH4A 2CPTA 2V5DA 4EAHA 4C91A 5JRCB 2XAHB 4UIGA 1FMVA 5AFUL 3AEFA 3P4RA 4KHZF 4DV0T 2FJDA 2SPCA 3ZT6A 5F3JA 4HKAA 2EHOB 3RI5A 3RC3A 4HGAA 4AI6A 1HTJF 2FJBA 2X66A 4X1KE 3M3ZB 3LBXA 5CB4E 3C98B 3PU8A 3U78A 4PW8A 3AE6A 2DL1A 2LM2A 4H9PC 3T1YT 2CM0A 2LJLA 3B5MA 4IGUA 3RQWA 5IYZE 3OYXA 1J5WA 2NOXA 2XAJB 3PUSA 5FY7A 3UFEA 4YT0A 2DCFA 4JEUB 3O4XE 5KDMC 4PJLA 4X66T 1AJ3A 4X65T 1R8IA 4ILAA 3RIUA 4PK5A 2VKDA 5GONE 2Y48B 4DV1T 4EEDA 2IC6A 5AQUB 4YLHA 2UUBT 5EK4A 3PUXF 4LF4T 1MNEA 3NKZA 3EI0A 3FZFB 1HX1B 2KXPB 3PUVF 4UVAB 2WZHA 4GKKT 4TZ4C 4KP3C 2LSYA 3M65A 2J47A 2H89A 1X9BA 5JRCA 4IREA 1XMOT 2F4VT 3QC9A 4F8HA 5LGTB 1KF6A 5ETWA 2BVLA 4EZHA 3W15B 2ZMAA 4YTPA 4IDOA 5ABHA 4IE7A 3MZKB 2C5KT 2MYSA 4IHJE 2LHRA 5CJ5A 2UXXB 4ANJA 3F57A 3I0OA 3GA8A 3HKCE 3SRZA 3K3OA 3AAAB 3P4SA 1LVFA 4DUYT 2I6HA 1SHZC 4P0BA 2XPKA 1T72A 2E9XB 2DHRA 2ACXA 3CQGB 1XZYA 1WCRA 2WM9A 5LHHB 2LKHA 2BS2A 4PJMA 2X0HA 4A56A 3AA7B 2WSSV 3FZHB 4OYKA 2V26A 1U4QA 2RA1A 2D9DA 3NVOA 1WRDA 4HTEA 4PJJA 4PK4A 1MMDA 1V9DA 1L0VA 3L39A 4JUYA 2N1GA 3ZKRA 4K0UA 3KVBA 2VL0A 3PUQA 4UEMA 3H37A 4DV2T 1CHUA 3PTRB 3PUAA 1MIYA 5LOVE 2YDSA 1WR0A 1Z8UA 5EK3A 4ISSA 4JBWF 2VK9A 4HFBA 1KNRA 4X1IE 5FXWA 5BR8T 4U7YA 2BG9C 3S4UA 4LF6T 4H63H 3EHZA 5ADXL 2LSIA 4JI3T 2VURA 2QRXA 3NZPA 4DR7T 2WU2A 4O4HE 1W09A 4NUVA 2LSKA 2VQFT 4BAYB 3ZN0B 5KMGP 3CQXC 2XQ6A 1X79A 4GOUA 1YKEB 3TLSA 5LG4A 4BJNA 1KFYA 4IL4A 5E0OA 4O4IE 3RPUA 2CMRA 2LRLA 4JI5T 2W62A 5ABEA 3QB5K 2W66A 4IDQA 3LSVA 3Q2MA 3ZT5A 3TLVA 4O2AE 4KMCA 5AQFB 4EEBA 2YU2A 5LJNA 3AE2A 5AQJB 2HHHT 3ETVA 3OPCA 3PE0A 2M6IA 3ZN1B 4EV6A 3BQIA 2VASA 1D0YA 3NRXA 2EHOD 4JI7T 4TV8E 2LT3A 1D0XA 3J7Yq 3AAIA 2H3RA 4IDZA 2ODVA 5JREA 4U3CA 5HCJA 4HWCA 2XQ3A 4F6RC 3FXDB 4J2CA 4O2BE 4ZI3D 4QH5A 2LEHA 2WDRA 4H9OC 2JQQA 5LGNB 3QB5A 3SWHA 4AKGA 3LDQB 2V6YA 2FBWA 3AE4A 2VKHA 2QVAA 3UQ7A 2EHOC 3NZQA 2RPAA 4DR6T 2CBJA 1M62A 4TNVA 2DWGA 4DR2T 4JI6T 4ZI3C 2FUPA 2KNDA 4QXHB 4EYYR 1NENA 3F2EA 4ASKA 2LKGA 5F8PA 3E08A 4LFBT 3UU5A 4HWDA 3ZYMA 3CX7B 5AQOB 3JAFA 1XNRT 1YKHB 4OHFA 2W63A 1LRZA 3RKOA 3VR8A 2X9XA 2Q9QD 2ODUA 4PFPA 3UQ4A 3QNUA 2LOSA 1UUSA 3MA9A 3RYCE 3FZMB 3T1HT 3PUZF 2XM1A 2BKOA 2XTLA 3N2KE 4LMLA 5LMNT 1UX5A 3BK9A 3HKDE 4QXCB 3KV4A 4X5TA 4DR5T 4PFOA 2IAKA 5H6RB 3CPZA 2N2NA 3P8CD 3OJAA 3OVUA 1M7KA 5M4YA 4CN6A 3C51A 2DNXA 2H88A 4IT4A 4OX9T 3Q5DA 2WS3A 4YFSA 2WDVA 1E1HB 4A98A 1MMNA 4YTNA 2E9XD 2WU5A 2XQ7A 1E2AA 3HKBE 2PFVA 3I1AA 4U74A 4E7ZA 1NAFA 1UX4A 4DBRA 4DNDA 3IHRA 2CLYC 5HEGA 1Y01A 2BVMA 5L3EB 3ESLA 2CRBA 2W0GA 3UUBA 3ZMTB 1YQ4A 2BG9A 2E9XC 2AE9A 5FY1A 3L3PA 4ERRA 2J62A 5KX5E 1IBKT 1Y64B 3UUNA 3ZEFB 1EZ3A 4WW0A 4ZXLA 3N2GE 2MPKA 3I9WA 4U2ZA 3IBPA 2VKOA 1J1JA 3J9X1 3ETUA 3AE7A 4U2YA 1XNQT 4OYJA 1HNWT 5AQLB 3EABA 1BR4A 4IE5A 3ANWB 1YXRA 3UU3A 4AIUA 3B57A 3KV9A 4UVBB 4B3TT 4ZZCA 5EZYE 2V5CA 2I59A 3EDVA 4GIWA 3LFMA 4OFZA 1JNZA 2FJEA 2C5JA 3MJXA 4CN4A 4KUMB 2K3WA 2N9DA 4WNKA 3KINB 4H63V 1HG2A 4CXWA 3BQKA 3AE5A 3A8YC 4KHPT 5HWYA 2IC9A 3OYZA 1VOMA 1LVKA 1US7B 5AQVB 4E7SA 2BS3A 1DU2A 4TWFA 5FKYA 3PV0F 1S94A 2JMHA 1GQEA 4MLKA 3EDUA 3TKLB 3JAEA 5HXHA 1FMWA 5FY0A 5DJQC 5HEJA 3JC6D 4L9IA 5ABFB 2Q9QB 4P09A 5IWAT 2G0UA 5HAXA 4EZ4A 5JDFA 1IJ5A 4YJ3E 3UFGA 4U33A 2XSBA 2A72A 3EAMA 3VHLA 3SS1A 2YN6A 4QH1A 1HG5A 4X1YE 5IUXA 3RF1A 2NP9A 1ZOYA 3JC6C 4ZEYA 5JTGA 2EHOA 1KK7A 1Z0PA 3AXJB 3RQUA 4CQIA 4TN7B 1FJGT 2UXBT 5JDHA 2XSAA 1U5PA 4QX8B 2XQAA 4GYRA 2X67A 3ANWA 2CEAA 3H3AA 4JV5T 2XUEA 1SUMB 3CX8B 2WP9A 4MFRA 5L3CB 2XASB 3A7MA 3VRAA 2PBIA 4C90A 3ZC0A 2K48A 4TWHA 1OEDB 2LSGA 4HWIB 2CLYB 4HFIA 2OLTA 2L9QA 2CBIA 2BG9E 2JQ9A 2NW7A 2QYWA 4DIDB 2UXCT 2V7IA 5L3DB 1FEWA 4BA9A 3OBVE 5DQWA 1ZHCA 2CHNA 2QA7A 3ZC1A 2W2UA 3RGLA 3LK2B 2OA5A 5C2TA 4GYSA 3NBXX 1NEKA 2XY8B 3U3IA 5LP6E 2CXDA 2X51A 1XDOA 1IZNB 2Q9QA 3CKDA 5TAOA 3ONLC 2W61A 2E5VA 2YU1A 3Q9DA 5ABGA 3KBUA 1MMGA 2WDQA 1LKXA 3GWHA 1QLBA 3C50A 4COFA 3FXEB 1WFDA 4O4JE 5FNVE 2L3LA 2A9UA 2KWHA 3AXJA 5JQGE 4DV5T 4G2AA 5AQSB 3ZCJA 3C64A 5FXXA 1W0BA 2JMKA 2NR4A 3UTKA 4X62T 5L3GB 2YDQA 5LHIB 2FJAA 2V7JA 3HR0A 4V1Av 2XQ5A 1OEDA 5JDQA 1BR2A 2V7KA 3K3NA 2DWKA 1MMAA 2MTQA 4XAXB 2LSJA 2E9XA 3LK42 1MIWA 5JDGA 4AQGA 4JI4T 2IW5B 3R6NA 4AXPA 2IIUA 1S35A 4CZZB 3NRYA 5H6QB 5HEHA 4MBQA 5CFBA 2X9YA 4X20E 2CHOA 4B3MT 1HR0T 5J2UE 2B76A 3V5UA 4PAGA 2D2SA 4CI1B 3UU8A 3RYIE 5HYAA 2WBLA 4IL9A 3CK6A 5FYMA 3UUMA 3WI3A 2KWIB 4DV6T 1N32T 1UGOA 3AA0B 2UXNB 5JR9B 1VRBA 1XDPA 4ZS2A 2CXLA 4TUYE 2K24A 1T7SA 4YJ2E 4LF7T 3GMIA 3RH3A 4YHHT 3IEEA 4P1NA 2VVNA 3VU7H 2XAFB 4XBFB 1BR0A 3ZYLA 1HX8A 3FZKB 4CI3B 4JI0T 3N9MA 3AB3B 1N33T 4ZOLE 3KV6A 3TLTA 1VCTA 3UULA 3K1SA 5JVDE 3Q5XA 1OXZA 4JYAT 2BS4A 3AAEB 4B3RT 1OWAA 3ABVA 2NWBA 5L4HA 4PK6A 1KNZA 4DV3T 2X0LB 4HFHA 4UVCB 3QOFA 2WAUA 1XMQT 2LE8A 1G73A 4QHOA 3L8RA 3P7IA 2W00A 2BZBA 4LF9T 3PJAJ 2W4XA 5LHGB 3CVRA 4JI2T 1OEDE 1ZEEA 2XQ4A 4PJNA 5LMUT 3AE1A 4ZI2D 4B3ST 2WCAA 3RYHE 2JIWA 4WBOA 5AQGB 2Q9QC 1MIVA 2E2AA 4DO0A 1YW0A 4UF0B 3FHNA 4IE4A 2PTFA 3LBXB 2QGSA 2ZM2A 2YDRA 2UU9T 2OV9A 3Q5WA 1JNRA 4ZI2C 3C4WA 5AQKB 2XM2A 4DMVA 3N9PA 4NIQA 5LYJE 4DR1T 3CWZB 1BR1A 3AE3A 1D1BA 3HKEE 3AE8A 1J5ET 3FBZA 2XZEA 2WB5A 3ZT7A 1D0ZA 5LCYA 5AQNB 5HCMA 3AA1B 3LG7A 3KDSE 3C4ZA 2Z6EA 2KZ7B 3SOLA 1I94T 4JI1T 3N9NA 4A97A 3VKHA 4ILUA 1OEDC 2DI4A 1IJ6A 4IE0A 4IIJE 3G06A 2C5IT 4ILBA 3H3MA 3K8PC 4MALA 2VKJA 4O8SA 5EK2A 3HI2A 2YEVC 2XHEB 1YQ3A 2XAQB 3PURA 2UXDT 2WWVA 4EGWA 5DABA 1UCUA 3N9LA 4UV8B 4LMKA 4ZZBA 3ZMZB 3O1HA 1SE7A 3ZLIA 5FXZA 2LLYA 3AEGA 5L3FB 4DV4T 2IUBA 3R84B 2LM9A 2NW8A 2R6GF 2MAWA 2YOEA 3PU3A 4L5GA 3E0ZA 2GK9A 4YSZA 5AQPB 2NW9A 1ZKEA 4EIWA 3JCFA 4MHCA 4UF0A 3SFDA 2BBHA 4HFEA 2KMFA 3ZJ2A 3T8OA 2B1EA 2ZLYA 2NTYA 3ONXA 5AQTB 4G63A 5JH7E 1G8XA 2D5UA 1QUUA 2J1DG 4HN9A 4Z90A 4TWDA 4CXXA 3IA3A 3MK7C 4YY3T 3RIAA 3AEEA 5L4EA 4H9QC 3FBLA 1O3XA 1MNDA 2Y8DA 3UT5E 3PJAA 3P4WA 3LJCA 4IDPA 2Y6XA 4BJMA 2LRKA 1HS7A 3ZPOA 3P4QA 3CMLA 2NTXA 4LF5T 4AQFC 3ZMSB 3ZCIA 3N9OA 2MBGA 3SFEA 4K0KT 2E8IA 3UU6A 4U31A 1HNXT 3MACA 3KV5A 2YKSA 2BBJA 4NUUA 4QX7B 5JDMA 2BDEA 5AQMB 4DMWA 4I50E 2LOPA 3EVYA 1HF8A 4KX6A 4HFCA 2X9WA 3D0TA 1IAPA 4LFAT 3NWIA 3O1JA 5LJMA 5LB7B 4DUZT 5HWXA 4QKNA 5A1LA 2HH7A 1B7TA 3B13A 2WQYA 3O9XA 2VL8A 5AQQB 1H7CA 5CA0E 5HEUA 5FL1A 4I4TE 1CUNA 3A5XA 4CI2B 1ZP0A 5HXSA 4ZS3A 3C4XA 2ZM6T 3TLUA 5FL0A 5L47A 2V7LA 5JR9C 5J1GA 2A2FX 1SA0E 3HA4A 2D0TA 4DVDA 3AE9A 1T98A 2A3DA 4FI5A 4QWNB 3VR9A 2C0SA 4WYVA 2E5LT 3RIFA 2JQKA 3UU4A 3RLFF 4U7IA 2WZIA 3ZMVB 5HEOA 4EB6E 2V7MA 4UR9A 5ABFA 4Q25A 4M1PA 5LNKA 2JPFA 2H7OA 3MXZA 2ZM0A 4HE8A 2I0MA 5LBMA 3KVAA 4DR3T 5CA1E 5KXJA 3OKQA 3I9YA 3UUXB 1FIOA 3RHWA 3RKGA 2K5BB 2HPLA 1IBLT 4IE6A 2DLRA 2HN2A 3KFWX 3LK3B 4H9RC 4TNWA 4GK5E 2KT9A 1ZV4X 4TX5A 4DR4T 2HPJA 2ACZA 5LGUB 3JADA 3HL6A 3P50A 5AQHB 4JEHB 3FZLB 2PG8A 2HN1A 5LG3A 1WLXA 4QXBB 4I43B 1UURA 4LMJA 2BKNA 1KEYA 2PJQA 2J4GA 4UELA 2V6YB 2IHR1 2X0YA 5AQRB 1T8BA 2IMLA 4O4LE 4ADZA 3AECA 4XZCA 2XQ8A 4H9NC 3WAKA 1I6ZA 3ONJA 5J2TE 3RC8A 2UUCT 3CIRA 3DJBA 3AEDA 3PDYA 1N36T 4U72A 3PUYF 1NWMX 4FJOA 3IF8B 3X1DA 1HFAA 3Q5EA 2XQYA 3QUJA 4AKIA 2WMNA 1UK5A 1QSDA 1WYBA 2L8KA 3AVRA 1D1AA 4YTMA 1W9RA 2K9AA 2CXFA 2WY2A 3VRBA 2H7VC 5LXTE 1VCSA 3RIUC 5CGMA 4LF8T 5HXCA 4EOZB 1KNPA 3KBTA 2JQHA 4L0RA 1HCIA 5LBQB 5HXEA 4ISTA 4UV9B 2JRKA 5C3JA 4UXNB 3DP7A 3O1IA 5FMNA 4ILCA 4B6XA 1WYCA 3AA6B 4YXDA 3F31A 2X68A 4IDNA 2RP4A 5L2LA 1XWMA 4AQFA 3AEBA 2CA5A 3VKGA 5FVKA 5FVLA 2X9HA 3RRWA 3ZSSA 1WR6A 5JDLA 3L09A 1HNZT 2AXDS 3AVSA 3CQCB 4GK0E 5JDNA 4YSYA 3GN5B 2M67A 3PUGA 3ZSTA 2VWAA 2V6XA 2M6BA 1D1CA 3OTOT 4CXYA 3N9QA 5FXVA 2XQ9A 2V1DB 2ZM8A 4ZHQE 3E22E 3P4PA 4AQYT 4I55E 4WBNE 4YSXA 2WMOA 4HWHA 4CN1A 5HXRA 4EXTA 4KBMB 2BG9B 4Z91A 4EYUA 3QK6A 5F5WA 2LHNA 3ZYKA 2CWYA 4OK0A 1IBMT 3TLWA 2CCQA 4KI0F 3I0QA 4X64T 3ZJ1A 2JJ9A 5JR9A 5L3BB 4AKHA 5FP3A 4Z8XA 3WAJA 2YINA 4LFCT 2WWUA 5DQVA 4DBQA 4NPPA 5AQIB 4AISA 4H9SE 3V5SA 1YD8G 3EUHA 2V8SV 4N78D 4HFDA 4NXMT 4A5XA 2KSRA 3AEAA 2CE7A 4YHJA 4DV7T 4HEAA
chains in the Genus database with same CATH topology
4TV9E 2VB6A 4BJMA 2EHOD 1HS7A 4TV8E 2LT3A 3ZPOA 2W61A 1D0XA 3CMLA 3J7Yq 3AAIA 2KINB 3ZMUB 2H3RA 2NTXA 2YU1A 3Q9DA 4IDZA 2ODVA 4AKRB 5JREA 2KLQA 3KBUA 1MMGA 3FB2A 4AKLA 4AQFC 3ZMSB 4P0AA 4F6RC 3RX6A 3ZCIA 1LKXA 3GWHA 3FXDB 3BQLA 3N5LA 3N9OA 4J2CA 4O2BE 2ES0A 4ZI3D 3C50A 2LEHA 3FXEB 4H9OC 2MBGA 3CX6B 2JQQA 4HFVA 4O4JE 5IHYA 2D0UA 2E8IA 5LGNB 3SWHA 5FNVE 2L3LA 3N2OA 3RYFE 4AKGA 2YK0A 3MACA 3KV5A 3GN5A 2P9BA 2KWHA 4NUUA 4QX7B 4PNIA 5JDMA 2BDEA 5JQGE 2VKHA 5BMVE 4G2AA 4DMWA 2EHOC 3NZQA 4I50E 3ZCJA 2LOPA 2XAGB 3C64A 5FXXA 2JMKA 3K3QC 3EVYA 3UTKA 2DWGA 1HF8A 2MOZA 2X9WA 3D0TA 1IAPA 4ZI3C 3RRCA 5L3GB 4ZI7E 3O1JA 4JLEA 2KNDA 4QXHB 5LHIB 5LJMA 4EYYR 5LA6E 5HWXA 4QKNA 3F2EA 4ASKA 5C8YE 5A1LA 2HH7A 1B7TA 2V7JA 5F8PA 3DTOA 3E08A 3MKDA 2CWOA 3B13A 3HR0A 4V1Av 3O9XA 2VL8A 5JDQA 1H7CA 3ZYMA 4EAHA 5CA0E 3CX7B 1BR2A 2V7KA 4I4TE 3K3NA 4C91A 5JRCB 2XAHB 4UIGA 2DWKA 1MMAA 2MTQA 1FMVA 4XAXB 5AFUL 2LSJA 2E9XA 1CUNA 3A5XA 3LK42 1YKHB 4OHFA 4CI2B 2SPCA 1MIWA 5JDGA 5F3JA 4HKAA 4AQGA 2EHOB 4ZS3A 5HXSA 3C4XA 2W63A 3RC3A 4HGAA 4AI6A 2V7LA 1LRZA 2IW5B 1HTJF 3RKOA 3R6NA 5JR9C 2X9XA 2Q9QD 2X66A 4AXPA 4X1KE 2A2FX 5J1GA 1S35A 2ODUA 4CZZB 3LBXA 5CB4E 3NRYA 3C98B 1SA0E 4PFPA 5H6QB 2LOSA 3MA9A 3RYCE 4MBQA 2X9YA 3PU8A 4X20E 3HA4A 4PW8A 3U78A 5J2UE 2XTLA 2D0TA 3V5UA 4H9PC 4DVDA 3N2KE 2CM0A 2LJLA 4PAGA 1T98A 4IGUA 2A3DA 2D2SA 4FI5A 4CI1B 4QWNB 3RYIE 5HYAA 2C0SA 5IYZE 2WBLA 3OYXA 1UX5A 2NOXA 2XAJB 3BK9A 3HKDE 3PUSA 5FY7A 5FYMA 3UFEA 3UUMA 3ZMVB 3WI3A 4QXCB 2KWIB 4EB6E 2V7MA 3KV4A 4M1PA 5LNKA 2JPFA 2DCFA 3AA0B 2H7OA 2UXNB 4PFOA 3MXZA 2IAKA 5JR9B 2ZM0A 4HE8A 1VRBA 5H6RB 4ZS2A 3KVAA 5LBMA 4JEUB 2CXLA 3CPZA 2N2NA 3O4XE 5CA1E 5KDMC 4TUYE 2K24A 4PJLA 3P8CD 4YJ2E 3OKQA 1AJ3A 3GMIA 3I9YA 1FIOA 3UUXB 3OJAA 2K5BB 5M4YA 3C51A 4PK5A 2VKDA 5GONE 2DNXA 2Y48B 3RH3A 2HPLA 2IC6A 3IEEA 4IE6A 2DLRA 4YLHA 3KFWX 3LK3B 3VU7H 2XAFB 5EK4A 4XBFB 4YFSA 4H9RC 1MNEA 1BR0A 1E1HB 4GK5E 2KT9A 2KXPB 4UVAB 1MMNA 1ZV4X 2E9XD 4TX5A 3ZYLA 1HX8A 2HPJA 3HKBE 2PFVA 4TZ4C 4CI3B 4KP3C 3I1AA 3N9MA 3AB3B 2LSYA 3M65A 4U74A 4ZOLE 5LGUB 4E7ZA 3HL6A 1NAFA 3KV6A 1UX4A 4JEHB 4DNDA 3UULA 4DBRA 3IHRA 5JRCA 2PG8A 2CLYC 1WLXA 4QXBB 4I43B 3QC9A 5JVDE 3Q5XA 1OXZA 2BVMA 5L3EB 5LGTB 3ESLA 5ETWA 3AAEB 2BVLA 2W0GA 1OWAA 3ZMTB 2E9XC 2PJQA 4UELA 2NWBA 4EZHA 5FY1A 3L3PA 4PK6A 4ERRA 1KNZA 3W15B 5KX5E 1Y64B 2X0LB 3UUNA 3ZEFB 4O4LE 4ADZA 1EZ3A 2ZMAA 4UVCB 4WW0A 4XZCA 4H9NC 3WAKA 3N2GE 5J2TE 3I9WA 3IBPA 2VKOA 2WAUA 3RC8A 4IE7A 2LE8A 1G73A 3J9X1 3ETUA 3MZKB 2C5KT 2MYSA 3DJBA 4QHOA 4IHJE 2LHRA 3PDYA 2UXXB 4U72A 4ANJA 1NWMX 4FJOA 3IF8B 3P7IA 2W00A 2BZBA 4OYJA 3F57A 3I0OA 1BR4A 3GA8A 3ANWB 4IE5A 3HKCE 3K3OA 3B57A 1HFAA 3AAAB 2XQYA 3KV9A 3QUJA 3SRZA 4UVBB 1LVFA 4AKIA 5EZYE 5LHGB 3CVRA 2WMNA 2I59A 3EDVA 4GIWA 1ZEEA 3LFMA 4PJNA 4OFZA 1SHZC 4P0BA 4ZI2D 2C5JA 1QSDA 3MJXA 2E9XB 4KUMB 2DHRA 1WYBA 2N9DA 3RYHE 4WNKA 2L8KA 2ACXA 4WBOA 3CQGB 2Q9QC 3KINB 2WM9A 4H63V 3AVRA 5LHHB 1MIVA 1D1AA 4DO0A 1YW0A 1HG2A 4CXWA 3BQKA 4UF0B 4PJMA 3FHNA 4A56A 5HWYA 2IC9A 3AA7B 2K9AA 2WSSV 2CXFA 4IE4A 4OYKA 3OYZA 2V26A 1VOMA 3LBXB 2H7VC 1LVKA 2QGSA 2ZM2A 1U4QA 1US7B 2RA1A 5LXTE 3Q5WA 1WRDA 4E7SA 4ZI2C 3C4WA 5HXCA 4EOZB 4HTEA 4PJJA 4PK4A 4DMVA 3KBTA 1MMDA 1V9DA 3N9PA 4L0RA 1S94A 2JMHA 1HCIA 4MLKA 5LBQB 3EDUA 4JUYA 5LYJE 5HXEA 2N1GA 3CWZB 4ISTA 1BR1A 3TKLB 4UV9B 5HXHA 1D1BA 4K0UA 1FMWA 2JRKA 3KVBA 3PUQA 3HKEE 5FY0A 4UEMA 4UXNB 5DJQC 3H37A 3DP7A 3O1IA 5FMNA 3FBZA 3JC6D 4B6XA 1WYCA 3AA6B 4L9IA 3F31A 2X68A 2Q9QB 4P09A 3PTRB 3PUAA 2RP4A 2G0UA 1D0ZA 1MIYA 5LCYA 5L2LA 4AQFA 3AA1B 5LOVE 3LG7A 2CA5A 3KDSE 5HAXA 4EZ4A 3C4ZA 5JDFA 1IJ5A 3VKGA 2Z6EA 2KZ7B 3SOLA 5EK3A 4ISSA 4YJ3E 2X9HA 3N9NA 3RRWA 2VK9A 3VKHA 1WR6A 4ILUA 5JDLA 2A72A 3L09A 4X1IE 5FXWA 3AVSA 3VHLA 3S4UA 2DI4A 3SS1A 1IJ6A 4H63H 1HG5A 4IE0A 4IIJE 5ADXL 3CQCB 4X1YE 2LSIA 4GK0E 2C5IT 2NP9A 3JC6C 5JDNA 3K8PC 4MALA 2VKJA 2EHOA 3GN5B 1KK7A 4O8SA 1Z0PA 5EK2A 3HI2A 2M67A 2YEVC 3NZPA 2XHEB 3PUGA 2XAQB 3PURA 4CQIA 2VWAA 4TN7B 4O4HE 5DABA 4NUVA 2LSKA 5JDHA 1UCUA 1U5PA 1D1CA 3N9LA 4QX8B 4UV8B 4BAYB 3ZN0B 4GYRA 5KMGP 2X67A 3ANWA 2CEAA 3O1HA 3H3AA 3ZMZB 3CQXC 2XUEA 3CX8B 3ZLIA 5FXZA 4CXYA 5L3FB 3N9QA 5FXVA 2V1DB 1X79A 4MFRA 5L3CB 3R84B 4GOUA 2LM9A 2NW8A 2XASB 2ZM8A 4ZHQE 2PBIA 3E22E 4C90A 1YKEB 3ZC0A 2K48A 3PU3A 4I55E 4L5GA 4WBNE 2WMOA 3E0ZA 5HXRA 2LSGA 4EXTA 4KBMB 5LG4A 4BJNA 2CLYB 4EYUA 3QK6A 2GK9A 5E0OA 2L9QA 4O4IE 2NW9A 3RPUA 1ZKEA 2LHNA 3ZYKA 2CMRA 4EIWA 2CWYA 4MHCA 2NW7A 4UF0A 4OK0A 2CCQA 3I0QA 2W62A 2V7IA 5L3DB 1FEWA 4BA9A 2KMFA 3ZJ2A 3T8OA 2B1EA 3ZJ1A 2JJ9A 5JR9A 5L3BB 3Q2MA 2ZLYA 4AKHA 2NTYA 3ONXA 3OBVE 5FP3A 4G63A 4Z8XA 5JH7E 5DQWA 1ZHCA 1G8XA 2D5UA 2QA7A 4O2AE 3ZC1A 3WAJA 4KMCA 1QUUA 2YINA 3LK2B 2WWUA 2J1DG 4HN9A 2OA5A 2YU2A 5DQVA 4DBQA 4GYSA 4CXXA 5LJNA 3MK7C 4H9SE 3NBXX 3ETVA 3V5SA 1YD8G 3EUHA 4N78D 3PE0A 3U3IA 3ZN1B 4H9QC 3FBLA 1O3XA 3BQIA 1MNDA 2Y8DA 2CXDA 3UT5E 5LP6E 2CE7A 2X51A 2VASA 3LJCA 4YHJA 1D0YA 1IZNB 2Q9QA 3NRXA 3CKDA 2Y6XA 4HEAA 5TAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9S E;  4H9R C;  4H9P C;  5KDM C;  4H9O C;  4HGA A;  4H9N C;  4H9Q C; 
#chains in the Genus database with same CATH topology
 4TV9 E;  2VB6 A;  2VVS A;  2KIN B;  3ZMU B;  4WZX A;  4AKR B;  2KLQ A;  3FB2 A;  4AKL A;  4P0A A;  3RX6 A;  3BQL A;  3N5L A;  2BKP A;  4JI8 T;  2ES0 A;  2XJ7 A;  3CX6 B;  2VQE T;  4HFV A;  5IHY A;  2D0U A;  3N2O A;  3RYF E;  2YK0 A;  5J0Z A;  3GN5 A;  2P9B A;  3PUW F;  4PNI A;  2W67 A;  5BMV E;  1E7P A;  2UUA T;  2IDO B;  4I0U A;  2XAG B;  3K3Q C;  4NXN T;  2MOZ A;  4GKJ T;  1W0A A;  3RRC A;  4ZI7 E;  4JLE A;  4HWF A;  5LA6 E;  5C8Y E;  3DTO A;  3MKD A;  2CWO A;  1N34 T;  4QH4 A;  2CPT A;  2V5D A;  4EAH A;  4C91 A;  5JRC B;  2XAH B;  4UIG A;  1FMV A;  5AFU L;  3AEF A;  3P4R A;  4KHZ F;  4DV0 T;  2FJD A;  2SPC A;  3ZT6 A;  5F3J A;  4HKA A;  2EHO B;  3RI5 A;  3RC3 A;  4HGA A;  4AI6 A;  1HTJ F;  2FJB A;  2X66 A;  4X1K E;  3M3Z B;  3LBX A;  5CB4 E;  3C98 B;  3PU8 A;  3U78 A;  4PW8 A;  3AE6 A;  2DL1 A;  2LM2 A;  4H9P C;  3T1Y T;  2CM0 A;  2LJL A;  3B5M A;  4IGU A;  3RQW A;  5IYZ E;  3OYX A;  1J5W A;  2NOX A;  2XAJ B;  3PUS A;  5FY7 A;  3UFE A;  4YT0 A;  2DCF A;  4JEU B;  3O4X E;  5KDM C;  4PJL A;  4X66 T;  1AJ3 A;  4X65 T;  1R8I A;  4ILA A;  3RIU A;  4PK5 A;  2VKD A;  5GON E;  2Y48 B;  4DV1 T;  4EED A;  2IC6 A;  5AQU B;  4YLH A;  2UUB T;  5EK4 A;  3PUX F;  4LF4 T;  1MNE A;  3NKZ A;  3EI0 A;  3FZF B;  1HX1 B;  2KXP B;  3PUV F;  4UVA B;  2WZH A;  4GKK T;  4TZ4 C;  4KP3 C;  2LSY A;  3M65 A;  2J47 A;  2H89 A;  1X9B A;  5JRC A;  4IRE A;  1XMO T;  2F4V T;  3QC9 A;  4F8H A;  5LGT B;  1KF6 A;  5ETW A;  2BVL A;  4EZH A;  3W15 B;  2ZMA A;  4YTP A;  4IDO A;  5ABH A;  4IE7 A;  3MZK B;  2C5K T;  2MYS A;  4IHJ E;  2LHR A;  5CJ5 A;  2UXX B;  4ANJ A;  3F57 A;  3I0O A;  3GA8 A;  3HKC E;  3SRZ A;  3K3O A;  3AAA B;  3P4S A;  1LVF A;  4DUY T;  2I6H A;  1SHZ C;  4P0B A;  2XPK A;  1T72 A;  2E9X B;  2DHR A;  2ACX A;  3CQG B;  1XZY A;  1WCR A;  2WM9 A;  5LHH B;  2LKH A;  2BS2 A;  4PJM A;  2X0H A;  4A56 A;  3AA7 B;  2WSS V;  3FZH B;  4OYK A;  2V26 A;  1U4Q A;  2RA1 A;  2D9D A;  3NVO A;  1WRD A;  4HTE A;  4PJJ A;  4PK4 A;  1MMD A;  1V9D A;  1L0V A;  3L39 A;  4JUY A;  2N1G A;  3ZKR A;  4K0U A;  3KVB A;  2VL0 A;  3PUQ A;  4UEM A;  3H37 A;  4DV2 T;  1CHU A;  3PTR B;  3PUA A;  1MIY A;  5LOV E;  2YDS A;  1WR0 A;  1Z8U A;  5EK3 A;  4ISS A;  4JBW F;  2VK9 A;  4HFB A;  1KNR A;  4X1I E;  5FXW A;  5BR8 T;  4U7Y A;  2BG9 C;  3S4U A;  4LF6 T;  4H63 H;  3EHZ A;  5ADX L;  2LSI A;  4JI3 T;  2VUR A;  2QRX A;  3NZP A;  4DR7 T;  2WU2 A;  4O4H E;  1W09 A;  4NUV A;  2LSK A;  2VQF T;  4BAY B;  3ZN0 B;  5KMG P;  3CQX C;  2XQ6 A;  1X79 A;  4GOU A;  1YKE B;  3TLS A;  5LG4 A;  4BJN A;  1KFY A;  4IL4 A;  5E0O A;  4O4I E;  3RPU A;  2CMR A;  2LRL A;  4JI5 T;  2W62 A;  5ABE A;  3QB5 K;  2W66 A;  4IDQ A;  3LSV A;  3Q2M A;  3ZT5 A;  3TLV A;  4O2A E;  4KMC A;  5AQF B;  4EEB A;  2YU2 A;  5LJN A;  3AE2 A;  5AQJ B;  2HHH T;  3ETV A;  3OPC A;  3PE0 A;  2M6I A;  3ZN1 B;  4EV6 A;  3BQI A;  2VAS A;  1D0Y A;  3NRX A;  2EHO D;  4JI7 T;  4TV8 E;  2LT3 A;  1D0X A;  3J7Y q;  3AAI A;  2H3R A;  4IDZ A;  2ODV A;  5JRE A;  4U3C A;  5HCJ A;  4HWC A;  2XQ3 A;  4F6R C;  3FXD B;  4J2C A;  4O2B E;  4ZI3 D;  4QH5 A;  2LEH A;  2WDR A;  4H9O C;  2JQQ A;  5LGN B;  3QB5 A;  3SWH A;  4AKG A;  3LDQ B;  2V6Y A;  2FBW A;  3AE4 A;  2VKH A;  2QVA A;  3UQ7 A;  2EHO C;  3NZQ A;  2RPA A;  4DR6 T;  2CBJ A;  1M62 A;  4TNV A;  2DWG A;  4DR2 T;  4JI6 T;  4ZI3 C;  2FUP A;  2KND A;  4QXH B;  4EYY R;  1NEN A;  3F2E A;  4ASK A;  2LKG A;  5F8P A;  3E08 A;  4LFB T;  3UU5 A;  4HWD A;  3ZYM A;  3CX7 B;  5AQO B;  3JAF A;  1XNR T;  1YKH B;  4OHF A;  2W63 A;  1LRZ A;  3RKO A;  3VR8 A;  2X9X A;  2Q9Q D;  2ODU A;  4PFP A;  3UQ4 A;  3QNU A;  2LOS A;  1UUS A;  3MA9 A;  3RYC E;  3FZM B;  3T1H T;  3PUZ F;  2XM1 A;  2BKO A;  2XTL A;  3N2K E;  4LML A;  5LMN T;  1UX5 A;  3BK9 A;  3HKD E;  4QXC B;  3KV4 A;  4X5T A;  4DR5 T;  4PFO A;  2IAK A;  5H6R B;  3CPZ A;  2N2N A;  3P8C D;  3OJA A;  3OVU A;  1M7K A;  5M4Y A;  4CN6 A;  3C51 A;  2DNX A;  2H88 A;  4IT4 A;  4OX9 T;  3Q5D A;  2WS3 A;  4YFS A;  2WDV A;  1E1H B;  4A98 A;  1MMN A;  4YTN A;  2E9X D;  2WU5 A;  2XQ7 A;  1E2A A;  3HKB E;  2PFV A;  3I1A A;  4U74 A;  4E7Z A;  1NAF A;  1UX4 A;  4DBR A;  4DND A;  3IHR A;  2CLY C;  5HEG A;  1Y01 A;  2BVM A;  5L3E B;  3ESL A;  2CRB A;  2W0G A;  3UUB A;  3ZMT B;  1YQ4 A;  2BG9 A;  2E9X C;  2AE9 A;  5FY1 A;  3L3P A;  4ERR A;  2J62 A;  5KX5 E;  1IBK T;  1Y64 B;  3UUN A;  3ZEF B;  1EZ3 A;  4WW0 A;  4ZXL A;  3N2G E;  2MPK A;  3I9W A;  4U2Z A;  3IBP A;  2VKO A;  1J1J A;  3J9X 1;  3ETU A;  3AE7 A;  4U2Y A;  1XNQ T;  4OYJ A;  1HNW T;  5AQL B;  3EAB A;  1BR4 A;  4IE5 A;  3ANW B;  1YXR A;  3UU3 A;  4AIU A;  3B57 A;  3KV9 A;  4UVB B;  4B3T T;  4ZZC A;  5EZY E;  2V5C A;  2I59 A;  3EDV A;  4GIW A;  3LFM A;  4OFZ A;  1JNZ A;  2FJE A;  2C5J A;  3MJX A;  4CN4 A;  4KUM B;  2K3W A;  2N9D A;  4WNK A;  3KIN B;  4H63 V;  1HG2 A;  4CXW A;  3BQK A;  3AE5 A;  3A8Y C;  4KHP T;  5HWY A;  2IC9 A;  3OYZ A;  1VOM A;  1LVK A;  1US7 B;  5AQV B;  4E7S A;  2BS3 A;  1DU2 A;  4TWF A;  5FKY A;  3PV0 F;  1S94 A;  2JMH A;  1GQE A;  4MLK A;  3EDU A;  3TKL B;  3JAE A;  5HXH A;  1FMW A;  5FY0 A;  5DJQ C;  5HEJ A;  3JC6 D;  4L9I A;  5ABF B;  2Q9Q B;  4P09 A;  5IWA T;  2G0U A;  5HAX A;  4EZ4 A;  5JDF A;  1IJ5 A;  4YJ3 E;  3UFG A;  4U33 A;  2XSB A;  2A72 A;  3EAM A;  3VHL A;  3SS1 A;  2YN6 A;  4QH1 A;  1HG5 A;  4X1Y E;  5IUX A;  3RF1 A;  2NP9 A;  1ZOY A;  3JC6 C;  4ZEY A;  5JTG A;  2EHO A;  1KK7 A;  1Z0P A;  3AXJ B;  3RQU A;  4CQI A;  4TN7 B;  1FJG T;  2UXB T;  5JDH A;  2XSA A;  1U5P A;  4QX8 B;  2XQA A;  4GYR A;  2X67 A;  3ANW A;  2CEA A;  3H3A A;  4JV5 T;  2XUE A;  1SUM B;  3CX8 B;  2WP9 A;  4MFR A;  5L3C B;  2XAS B;  3A7M A;  3VRA A;  2PBI A;  4C90 A;  3ZC0 A;  2K48 A;  4TWH A;  1OED B;  2LSG A;  4HWI B;  2CLY B;  4HFI A;  2OLT A;  2L9Q A;  2CBI A;  2BG9 E;  2JQ9 A;  2NW7 A;  2QYW A;  4DID B;  2UXC T;  2V7I A;  5L3D B;  1FEW A;  4BA9 A;  3OBV E;  5DQW A;  1ZHC A;  2CHN A;  2QA7 A;  3ZC1 A;  2W2U A;  3RGL A;  3LK2 B;  2OA5 A;  5C2T A;  4GYS A;  3NBX X;  1NEK A;  2XY8 B;  3U3I A;  5LP6 E;  2CXD A;  2X51 A;  1XDO A;  1IZN B;  2Q9Q A;  3CKD A;  5TAO A;  3ONL C;  2W61 A;  2E5V A;  2YU1 A;  3Q9D A;  5ABG A;  3KBU A;  1MMG A;  2WDQ A;  1LKX A;  3GWH A;  1QLB A;  3C50 A;  4COF A;  3FXE B;  1WFD A;  4O4J E;  5FNV E;  2L3L A;  2A9U A;  2KWH A;  3AXJ A;  5JQG E;  4DV5 T;  4G2A A;  5AQS B;  3ZCJ A;  3C64 A;  5FXX A;  1W0B A;  2JMK A;  2NR4 A;  3UTK A;  4X62 T;  5L3G B;  2YDQ A;  5LHI B;  2FJA A;  2V7J A;  3HR0 A;  4V1A v;  2XQ5 A;  1OED A;  5JDQ A;  1BR2 A;  2V7K A;  3K3N A;  2DWK A;  1MMA A;  2MTQ A;  4XAX B;  2LSJ A;  2E9X A;  3LK4 2;  1MIW A;  5JDG A;  4AQG A;  4JI4 T;  2IW5 B;  3R6N A;  4AXP A;  2IIU A;  1S35 A;  4CZZ B;  3NRY A;  5H6Q B;  5HEH A;  4MBQ A;  5CFB A;  2X9Y A;  4X20 E;  2CHO A;  4B3M T;  1HR0 T;  5J2U E;  2B76 A;  3V5U A;  4PAG A;  2D2S A;  4CI1 B;  3UU8 A;  3RYI E;  5HYA A;  2WBL A;  4IL9 A;  3CK6 A;  5FYM A;  3UUM A;  3WI3 A;  2KWI B;  4DV6 T;  1N32 T;  1UGO A;  3AA0 B;  2UXN B;  5JR9 B;  1VRB A;  1XDP A;  4ZS2 A;  2CXL A;  4TUY E;  2K24 A;  1T7S A;  4YJ2 E;  4LF7 T;  3GMI A;  3RH3 A;  4YHH T;  3IEE A;  4P1N A;  2VVN A;  3VU7 H;  2XAF B;  4XBF B;  1BR0 A;  3ZYL A;  1HX8 A;  3FZK B;  4CI3 B;  4JI0 T;  3N9M A;  3AB3 B;  1N33 T;  4ZOL E;  3KV6 A;  3TLT A;  1VCT A;  3UUL A;  3K1S A;  5JVD E;  3Q5X A;  1OXZ A;  4JYA T;  2BS4 A;  3AAE B;  4B3R T;  1OWA A;  3ABV A;  2NWB A;  5L4H A;  4PK6 A;  1KNZ A;  4DV3 T;  2X0L B;  4HFH A;  4UVC B;  3QOF A;  2WAU A;  1XMQ T;  2LE8 A;  1G73 A;  4QHO A;  3L8R A;  3P7I A;  2W00 A;  2BZB A;  4LF9 T;  3PJA J;  2W4X A;  5LHG B;  3CVR A;  4JI2 T;  1OED E;  1ZEE A;  2XQ4 A;  4PJN A;  5LMU T;  3AE1 A;  4ZI2 D;  4B3S T;  2WCA A;  3RYH E;  2JIW A;  4WBO A;  5AQG B;  2Q9Q C;  1MIV A;  2E2A A;  4DO0 A;  1YW0 A;  4UF0 B;  3FHN A;  4IE4 A;  2PTF A;  3LBX B;  2QGS A;  2ZM2 A;  2YDR A;  2UU9 T;  2OV9 A;  3Q5W A;  1JNR A;  4ZI2 C;  3C4W A;  5AQK B;  2XM2 A;  4DMV A;  3N9P A;  4NIQ A;  5LYJ E;  4DR1 T;  3CWZ B;  1BR1 A;  3AE3 A;  1D1B A;  3HKE E;  3AE8 A;  1J5E T;  3FBZ A;  2XZE A;  2WB5 A;  3ZT7 A;  1D0Z A;  5LCY A;  5AQN B;  5HCM A;  3AA1 B;  3LG7 A;  3KDS E;  3C4Z A;  2Z6E A;  2KZ7 B;  3SOL A;  1I94 T;  4JI1 T;  3N9N A;  4A97 A;  3VKH A;  4ILU A;  1OED C;  2DI4 A;  1IJ6 A;  4IE0 A;  4IIJ E;  3G06 A;  2C5I T;  4ILB A;  3H3M A;  3K8P C;  4MAL A;  2VKJ A;  4O8S A;  5EK2 A;  3HI2 A;  2YEV C;  2XHE B;  1YQ3 A;  2XAQ B;  3PUR A;  2UXD T;  2WWV A;  4EGW A;  5DAB A;  1UCU A;  3N9L A;  4UV8 B;  4LMK A;  4ZZB A;  3ZMZ B;  3O1H A;  1SE7 A;  3ZLI A;  5FXZ A;  2LLY A;  3AEG A;  5L3F B;  4DV4 T;  2IUB A;  3R84 B;  2LM9 A;  2NW8 A;  2R6G F;  2MAW A;  2YOE A;  3PU3 A;  4L5G A;  3E0Z A;  2GK9 A;  4YSZ A;  5AQP B;  2NW9 A;  1ZKE A;  4EIW A;  3JCF A;  4MHC A;  4UF0 A;  3SFD A;  2BBH A;  4HFE A;  2KMF A;  3ZJ2 A;  3T8O A;  2B1E A;  2ZLY A;  2NTY A;  3ONX A;  5AQT B;  4G63 A;  5JH7 E;  1G8X A;  2D5U A;  1QUU A;  2J1D G;  4HN9 A;  4Z90 A;  4TWD A;  4CXX A;  3IA3 A;  3MK7 C;  4YY3 T;  3RIA A;  3AEE A;  5L4E A;  4H9Q C;  3FBL A;  1O3X A;  1MND A;  2Y8D A;  3UT5 E;  3PJA A;  3P4W A;  3LJC A;  4IDP A;  2Y6X A;  4BJM A;  2LRK A;  1HS7 A;  3ZPO A;  3P4Q A;  3CML A;  2NTX A;  4LF5 T;  4AQF C;  3ZMS B;  3ZCI A;  3N9O A;  2MBG A;  3SFE A;  4K0K T;  2E8I A;  3UU6 A;  4U31 A;  1HNX T;  3MAC A;  3KV5 A;  2YKS A;  2BBJ A;  4NUU A;  4QX7 B;  5JDM A;  2BDE A;  5AQM B;  4DMW A;  4I50 E;  2LOP A;  3EVY A;  1HF8 A;  4KX6 A;  4HFC A;  2X9W A;  3D0T A;  1IAP A;  4LFA T;  3NWI A;  3O1J A;  5LJM A;  5LB7 B;  4DUZ T;  5HWX A;  4QKN A;  5A1L A;  2HH7 A;  1B7T A;  3B13 A;  2WQY A;  3O9X A;  2VL8 A;  5AQQ B;  1H7C A;  5CA0 E;  5HEU A;  5FL1 A;  4I4T E;  1CUN A;  3A5X A;  4CI2 B;  1ZP0 A;  5HXS A;  4ZS3 A;  3C4X A;  2ZM6 T;  3TLU A;  5FL0 A;  5L47 A;  2V7L A;  5JR9 C;  5J1G A;  2A2F X;  1SA0 E;  3HA4 A;  2D0T A;  4DVD A;  3AE9 A;  1T98 A;  2A3D A;  4FI5 A;  4QWN B;  3VR9 A;  2C0S A;  4WYV A;  2E5L T;  3RIF A;  2JQK A;  3UU4 A;  3RLF F;  4U7I A;  2WZI A;  3ZMV B;  5HEO A;  4EB6 E;  2V7M A;  4UR9 A;  5ABF A;  4Q25 A;  4M1P A;  5LNK A;  2JPF A;  2H7O A;  3MXZ A;  2ZM0 A;  4HE8 A;  2I0M A;  5LBM A;  3KVA A;  4DR3 T;  5CA1 E;  5KXJ A;  3OKQ A;  3I9Y A;  3UUX B;  1FIO A;  3RHW A;  3RKG A;  2K5B B;  2HPL A;  1IBL T;  4IE6 A;  2DLR A;  2HN2 A;  3KFW X;  3LK3 B;  4H9R C;  4TNW A;  4GK5 E;  2KT9 A;  1ZV4 X;  4TX5 A;  4DR4 T;  2HPJ A;  2ACZ A;  5LGU B;  3JAD A;  3HL6 A;  3P50 A;  5AQH B;  4JEH B;  3FZL B;  2PG8 A;  2HN1 A;  5LG3 A;  1WLX A;  4QXB B;  4I43 B;  1UUR A;  4LMJ A;  2BKN A;  1KEY A;  2PJQ A;  2J4G A;  4UEL A;  2V6Y B;  2IHR 1;  2X0Y A;  5AQR B;  1T8B A;  2IML A;  4O4L E;  4ADZ A;  3AEC A;  4XZC A;  2XQ8 A;  4H9N C;  3WAK A;  1I6Z A;  3ONJ A;  5J2T E;  3RC8 A;  2UUC T;  3CIR A;  3DJB A;  3AED A;  3PDY A;  1N36 T;  4U72 A;  3PUY F;  1NWM X;  4FJO A;  3IF8 B;  3X1D A;  1HFA A;  3Q5E A;  2XQY A;  3QUJ A;  4AKI A;  2WMN A;  1UK5 A;  1QSD A;  1WYB A;  2L8K A;  3AVR A;  1D1A A;  4YTM A;  1W9R A;  2K9A A;  2CXF A;  2WY2 A;  3VRB A;  2H7V C;  5LXT E;  1VCS A;  3RIU C;  5CGM A;  4LF8 T;  5HXC A;  4EOZ B;  1KNP A;  3KBT A;  2JQH A;  4L0R A;  1HCI A;  5LBQ B;  5HXE A;  4IST A;  4UV9 B;  2JRK A;  5C3J A;  4UXN B;  3DP7 A;  3O1I A;  5FMN A;  4ILC A;  4B6X A;  1WYC A;  3AA6 B;  4YXD A;  3F31 A;  2X68 A;  4IDN A;  2RP4 A;  5L2L A;  1XWM A;  4AQF A;  3AEB A;  2CA5 A;  3VKG A;  5FVK A;  5FVL A;  2X9H A;  3RRW A;  3ZSS A;  1WR6 A;  5JDL A;  3L09 A;  1HNZ T;  2AXD S;  3AVS A;  3CQC B;  4GK0 E;  5JDN A;  4YSY A;  3GN5 B;  2M67 A;  3PUG A;  3ZST A;  2VWA A;  2V6X A;  2M6B A;  1D1C A;  3OTO T;  4CXY A;  3N9Q A;  5FXV A;  2XQ9 A;  2V1D B;  2ZM8 A;  4ZHQ E;  3E22 E;  3P4P A;  4AQY T;  4I55 E;  4WBN E;  4YSX A;  2WMO A;  4HWH A;  4CN1 A;  5HXR A;  4EXT A;  4KBM B;  2BG9 B;  4Z91 A;  4EYU A;  3QK6 A;  5F5W A;  2LHN A;  3ZYK A;  2CWY A;  4OK0 A;  1IBM T;  3TLW A;  2CCQ A;  4KI0 F;  3I0Q A;  4X64 T;  3ZJ1 A;  2JJ9 A;  5JR9 A;  5L3B B;  4AKH A;  5FP3 A;  4Z8X A;  3WAJ A;  2YIN A;  4LFC T;  2WWU A;  5DQV A;  4DBQ A;  4NPP A;  5AQI B;  4AIS A;  4H9S E;  3V5S A;  1YD8 G;  3EUH A;  2V8S V;  4N78 D;  4HFD A;  4NXM T;  4A5X A;  2KSR A;  3AEA A;  2CE7 A;  4YHJ A;  4DV7 T;  4HEA A; 
#chains in the Genus database with same CATH homology
 4TV9 E;  2VB6 A;  4BJM A;  2EHO D;  1HS7 A;  4TV8 E;  2LT3 A;  3ZPO A;  2W61 A;  1D0X A;  3CML A;  3J7Y q;  3AAI A;  2KIN B;  3ZMU B;  2H3R A;  2NTX A;  2YU1 A;  3Q9D A;  4IDZ A;  2ODV A;  4AKR B;  5JRE A;  2KLQ A;  3KBU A;  1MMG A;  3FB2 A;  4AKL A;  4AQF C;  3ZMS B;  4P0A A;  4F6R C;  3RX6 A;  3ZCI A;  1LKX A;  3GWH A;  3FXD B;  3BQL A;  3N5L A;  3N9O A;  4J2C A;  4O2B E;  2ES0 A;  4ZI3 D;  3C50 A;  2LEH A;  3FXE B;  4H9O C;  2MBG A;  3CX6 B;  2JQQ A;  4HFV A;  4O4J E;  5IHY A;  2D0U A;  2E8I A;  5LGN B;  3SWH A;  5FNV E;  2L3L A;  3N2O A;  3RYF E;  4AKG A;  2YK0 A;  3MAC A;  3KV5 A;  3GN5 A;  2P9B A;  2KWH A;  4NUU A;  4QX7 B;  4PNI A;  5JDM A;  2BDE A;  5JQG E;  2VKH A;  5BMV E;  4G2A A;  4DMW A;  2EHO C;  3NZQ A;  4I50 E;  3ZCJ A;  2LOP A;  2XAG B;  3C64 A;  5FXX A;  2JMK A;  3K3Q C;  3EVY A;  3UTK A;  2DWG A;  1HF8 A;  2MOZ A;  2X9W A;  3D0T A;  1IAP A;  4ZI3 C;  3RRC A;  5L3G B;  4ZI7 E;  3O1J A;  4JLE A;  2KND A;  4QXH B;  5LHI B;  5LJM A;  4EYY R;  5LA6 E;  5HWX A;  4QKN A;  3F2E A;  4ASK A;  5C8Y E;  5A1L A;  2HH7 A;  1B7T A;  2V7J A;  5F8P A;  3DTO A;  3E08 A;  3MKD A;  2CWO A;  3B13 A;  3HR0 A;  4V1A v;  3O9X A;  2VL8 A;  5JDQ A;  1H7C A;  3ZYM A;  4EAH A;  5CA0 E;  3CX7 B;  1BR2 A;  2V7K A;  4I4T E;  3K3N A;  4C91 A;  5JRC B;  2XAH B;  4UIG A;  2DWK A;  1MMA A;  2MTQ A;  1FMV A;  4XAX B;  5AFU L;  2LSJ A;  2E9X A;  1CUN A;  3A5X A;  3LK4 2;  1YKH B;  4OHF A;  4CI2 B;  2SPC A;  1MIW A;  5JDG A;  5F3J A;  4HKA A;  4AQG A;  2EHO B;  4ZS3 A;  5HXS A;  3C4X A;  2W63 A;  3RC3 A;  4HGA A;  4AI6 A;  2V7L A;  1LRZ A;  2IW5 B;  1HTJ F;  3RKO A;  3R6N A;  5JR9 C;  2X9X A;  2Q9Q D;  2X66 A;  4AXP A;  4X1K E;  2A2F X;  5J1G A;  1S35 A;  2ODU A;  4CZZ B;  3LBX A;  5CB4 E;  3NRY A;  3C98 B;  1SA0 E;  4PFP A;  5H6Q B;  2LOS A;  3MA9 A;  3RYC E;  4MBQ A;  2X9Y A;  3PU8 A;  4X20 E;  3HA4 A;  4PW8 A;  3U78 A;  5J2U E;  2XTL A;  2D0T A;  3V5U A;  4H9P C;  4DVD A;  3N2K E;  2CM0 A;  2LJL A;  4PAG A;  1T98 A;  4IGU A;  2A3D A;  2D2S A;  4FI5 A;  4CI1 B;  4QWN B;  3RYI E;  5HYA A;  2C0S A;  5IYZ E;  2WBL A;  3OYX A;  1UX5 A;  2NOX A;  2XAJ B;  3BK9 A;  3HKD E;  3PUS A;  5FY7 A;  5FYM A;  3UFE A;  3UUM A;  3ZMV B;  3WI3 A;  4QXC B;  2KWI B;  4EB6 E;  2V7M A;  3KV4 A;  4M1P A;  5LNK A;  2JPF A;  2DCF A;  3AA0 B;  2H7O A;  2UXN B;  4PFO A;  3MXZ A;  2IAK A;  5JR9 B;  2ZM0 A;  4HE8 A;  1VRB A;  5H6R B;  4ZS2 A;  3KVA A;  5LBM A;  4JEU B;  2CXL A;  3CPZ A;  2N2N A;  3O4X E;  5CA1 E;  5KDM C;  4TUY E;  2K24 A;  4PJL A;  3P8C D;  4YJ2 E;  3OKQ A;  1AJ3 A;  3GMI A;  3I9Y A;  1FIO A;  3UUX B;  3OJA A;  2K5B B;  5M4Y A;  3C51 A;  4PK5 A;  2VKD A;  5GON E;  2DNX A;  2Y48 B;  3RH3 A;  2HPL A;  2IC6 A;  3IEE A;  4IE6 A;  2DLR A;  4YLH A;  3KFW X;  3LK3 B;  3VU7 H;  2XAF B;  5EK4 A;  4XBF B;  4YFS A;  4H9R C;  1MNE A;  1BR0 A;  1E1H B;  4GK5 E;  2KT9 A;  2KXP B;  4UVA B;  1MMN A;  1ZV4 X;  2E9X D;  4TX5 A;  3ZYL A;  1HX8 A;  2HPJ A;  3HKB E;  2PFV A;  4TZ4 C;  4CI3 B;  4KP3 C;  3I1A A;  3N9M A;  3AB3 B;  2LSY A;  3M65 A;  4U74 A;  4ZOL E;  5LGU B;  4E7Z A;  3HL6 A;  1NAF A;  3KV6 A;  1UX4 A;  4JEH B;  4DND A;  3UUL A;  4DBR A;  3IHR A;  5JRC A;  2PG8 A;  2CLY C;  1WLX A;  4QXB B;  4I43 B;  3QC9 A;  5JVD E;  3Q5X A;  1OXZ A;  2BVM A;  5L3E B;  5LGT B;  3ESL A;  5ETW A;  3AAE B;  2BVL A;  2W0G A;  1OWA A;  3ZMT B;  2E9X C;  2PJQ A;  4UEL A;  2NWB A;  4EZH A;  5FY1 A;  3L3P A;  4PK6 A;  4ERR A;  1KNZ A;  3W15 B;  5KX5 E;  1Y64 B;  2X0L B;  3UUN A;  3ZEF B;  4O4L E;  4ADZ A;  1EZ3 A;  2ZMA A;  4UVC B;  4WW0 A;  4XZC A;  4H9N C;  3WAK A;  3N2G E;  5J2T E;  3I9W A;  3IBP A;  2VKO A;  2WAU A;  3RC8 A;  4IE7 A;  2LE8 A;  1G73 A;  3J9X 1;  3ETU A;  3MZK B;  2C5K T;  2MYS A;  3DJB A;  4QHO A;  4IHJ E;  2LHR A;  3PDY A;  2UXX B;  4U72 A;  4ANJ A;  1NWM X;  4FJO A;  3IF8 B;  3P7I A;  2W00 A;  2BZB A;  4OYJ A;  3F57 A;  3I0O A;  1BR4 A;  3GA8 A;  3ANW B;  4IE5 A;  3HKC E;  3K3O A;  3B57 A;  1HFA A;  3AAA B;  2XQY A;  3KV9 A;  3QUJ A;  3SRZ A;  4UVB B;  1LVF A;  4AKI A;  5EZY E;  5LHG B;  3CVR A;  2WMN A;  2I59 A;  3EDV A;  4GIW A;  1ZEE A;  3LFM A;  4PJN A;  4OFZ A;  1SHZ C;  4P0B A;  4ZI2 D;  2C5J A;  1QSD A;  3MJX A;  2E9X B;  4KUM B;  2DHR A;  1WYB A;  2N9D A;  3RYH E;  4WNK A;  2L8K A;  2ACX A;  4WBO A;  3CQG B;  2Q9Q C;  3KIN B;  2WM9 A;  4H63 V;  3AVR A;  5LHH B;  1MIV A;  1D1A A;  4DO0 A;  1YW0 A;  1HG2 A;  4CXW A;  3BQK A;  4UF0 B;  4PJM A;  3FHN A;  4A56 A;  5HWY A;  2IC9 A;  3AA7 B;  2K9A A;  2WSS V;  2CXF A;  4IE4 A;  4OYK A;  3OYZ A;  2V26 A;  1VOM A;  3LBX B;  2H7V C;  1LVK A;  2QGS A;  2ZM2 A;  1U4Q A;  1US7 B;  2RA1 A;  5LXT E;  3Q5W A;  1WRD A;  4E7S A;  4ZI2 C;  3C4W A;  5HXC A;  4EOZ B;  4HTE A;  4PJJ A;  4PK4 A;  4DMV A;  3KBT A;  1MMD A;  1V9D A;  3N9P A;  4L0R A;  1S94 A;  2JMH A;  1HCI A;  4MLK A;  5LBQ B;  3EDU A;  4JUY A;  5LYJ E;  5HXE A;  2N1G A;  3CWZ B;  4IST A;  1BR1 A;  3TKL B;  4UV9 B;  5HXH A;  1D1B A;  4K0U A;  1FMW A;  2JRK A;  3KVB A;  3PUQ A;  3HKE E;  5FY0 A;  4UEM A;  4UXN B;  5DJQ C;  3H37 A;  3DP7 A;  3O1I A;  5FMN A;  3FBZ A;  3JC6 D;  4B6X A;  1WYC A;  3AA6 B;  4L9I A;  3F31 A;  2X68 A;  2Q9Q B;  4P09 A;  3PTR B;  3PUA A;  2RP4 A;  2G0U A;  1D0Z A;  1MIY A;  5LCY A;  5L2L A;  4AQF A;  3AA1 B;  5LOV E;  3LG7 A;  2CA5 A;  3KDS E;  5HAX A;  4EZ4 A;  3C4Z A;  5JDF A;  1IJ5 A;  3VKG A;  2Z6E A;  2KZ7 B;  3SOL A;  5EK3 A;  4ISS A;  4YJ3 E;  2X9H A;  3N9N A;  3RRW A;  2VK9 A;  3VKH A;  1WR6 A;  4ILU A;  5JDL A;  2A72 A;  3L09 A;  4X1I E;  5FXW A;  3AVS A;  3VHL A;  3S4U A;  2DI4 A;  3SS1 A;  1IJ6 A;  4H63 H;  1HG5 A;  4IE0 A;  4IIJ E;  5ADX L;  3CQC B;  4X1Y E;  2LSI A;  4GK0 E;  2C5I T;  2NP9 A;  3JC6 C;  5JDN A;  3K8P C;  4MAL A;  2VKJ A;  2EHO A;  3GN5 B;  1KK7 A;  4O8S A;  1Z0P A;  5EK2 A;  3HI2 A;  2M67 A;  2YEV C;  3NZP A;  2XHE B;  3PUG A;  2XAQ B;  3PUR A;  4CQI A;  2VWA A;  4TN7 B;  4O4H E;  5DAB A;  4NUV A;  2LSK A;  5JDH A;  1UCU A;  1U5P A;  1D1C A;  3N9L A;  4QX8 B;  4UV8 B;  4BAY B;  3ZN0 B;  4GYR A;  5KMG P;  2X67 A;  3ANW A;  2CEA A;  3O1H A;  3H3A A;  3ZMZ B;  3CQX C;  2XUE A;  3CX8 B;  3ZLI A;  5FXZ A;  4CXY A;  5L3F B;  3N9Q A;  5FXV A;  2V1D B;  1X79 A;  4MFR A;  5L3C B;  3R84 B;  4GOU A;  2LM9 A;  2NW8 A;  2XAS B;  2ZM8 A;  4ZHQ E;  2PBI A;  3E22 E;  4C90 A;  1YKE B;  3ZC0 A;  2K48 A;  3PU3 A;  4I55 E;  4L5G A;  4WBN E;  2WMO A;  3E0Z A;  5HXR A;  2LSG A;  4EXT A;  4KBM B;  5LG4 A;  4BJN A;  2CLY B;  4EYU A;  3QK6 A;  2GK9 A;  5E0O A;  2L9Q A;  4O4I E;  2NW9 A;  3RPU A;  1ZKE A;  2LHN A;  3ZYK A;  2CMR A;  4EIW A;  2CWY A;  4MHC A;  2NW7 A;  4UF0 A;  4OK0 A;  2CCQ A;  3I0Q A;  2W62 A;  2V7I A;  5L3D B;  1FEW A;  4BA9 A;  2KMF A;  3ZJ2 A;  3T8O A;  2B1E A;  3ZJ1 A;  2JJ9 A;  5JR9 A;  5L3B B;  3Q2M A;  2ZLY A;  4AKH A;  2NTY A;  3ONX A;  3OBV E;  5FP3 A;  4G63 A;  4Z8X A;  5JH7 E;  5DQW A;  1ZHC A;  1G8X A;  2D5U A;  2QA7 A;  4O2A E;  3ZC1 A;  3WAJ A;  4KMC A;  1QUU A;  2YIN A;  3LK2 B;  2WWU A;  2J1D G;  4HN9 A;  2OA5 A;  2YU2 A;  5DQV A;  4DBQ A;  4GYS A;  4CXX A;  5LJN A;  3MK7 C;  4H9S E;  3NBX X;  3ETV A;  3V5S A;  1YD8 G;  3EUH A;  4N78 D;  3PE0 A;  3U3I A;  3ZN1 B;  4H9Q C;  3FBL A;  1O3X A;  3BQI A;  1MND A;  2Y8D A;  2CXD A;  3UT5 E;  5LP6 E;  2CE7 A;  2X51 A;  2VAS A;  3LJC A;  4YHJ A;  1D0Y A;  1IZN B;  2Q9Q A;  3NRX A;  3CKD A;  2Y6X A;  4HEA A;  5TAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...