5KDMC

Crystal structure of ebv tegument protein bnrf1 in complex with histone chaperone daxx and histones h3.3-h4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
205
Chain Sequence
b'RGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structural basis underlying viral hijacking of a histone chaperone complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone / dna binding protein
total genus 58
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2016-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2170 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5kdmC00
4H9OC 4H9RC 4H9QC 4H9SE 4HGAA 4H9NC 4H9PC 5KDMC
chains in the Genus database with same CATH superfamily
3LJCA 5IHYA 2D9DA 3KV9A 5ABGA 2WWUA 4DO0A 1EZ3A 3AE4A 5LHHB 3RX6A 2WZIA 4A56A 4PK4A 1D1BA 1YW0A 3NZQA 5L4EA 2ZM0A 4IT4A 3ZJ1A 4F8HA 3G06A 4YSZA 3ZMZB 3BK9A 3ZYMA 3TLUA 1E1HB 5LHIB 1KF6A 3FBLA 4DVDA 1KEYA 4COFA 5HWXA 4G63A 2CA5A 5DABA 3UU8A 3ZCJA 3ZC1A 2BBHA 3HA4A 4HWDA 5EK2A 4YJ3E 4L9IA 3VR8A 3GWHA 5JDMA 5FXXA 2OV9A 4LFAT 2ACZA 3AXJB 2CEAA 5JVDE 2FUPA 4H9NC 5LCYA 2X9YA 3CQCB 1O3XA 2Q9QB 4DR5T 3I9YA 4O4JE 4LF7T 2X66A 4XZCA 3ZMUB 2Y6XA 2WSSV 3PU8A 2CHNA 4HWCA 2ZMAA 3N9OA 1IBLT 3A7MA 2WQYA 4YT0A 4AI6A 4EOZB 4JI8T 4HEAA 5JRCA 4DV0T 2PTFA 5FY0A 2ODUA 2H89A 1MIVA 5LOVE 5F5WA 1MMDA 5HXSA 4NXMT 5L2LA 3N5LA 4WNKA 4YHHT 5HXHA 2LHRA 2VVSA 2HN1A 4IE6A 1ZEEA 4I0UA 3QC9A 5ABFB 3P4RA 4ANJA 4IIJE 3AE6A 3TLVA 4X64T 2W67A 3ZMVB 2H88A 2V7IA 2BG9C 2DWKA 5FXWA 4DUZT 3RLFF 4C91A 1WYBA 2VKJA 5HYAA 3J9X1 2D5UA 2BG9A 2VKOA 2UUCT 4PW8A 3PUAA 2V7KA 5AQNB 1T72A 2V1DB 3EUHA 4KHZF 4DR3T 3CVRA 3N9QA 5HAXA 4U7YA 2G0UA 3LG7A 4IE7A 4DR6T 2EHOC 3RC3A 3IF8B 1N36T 1J1JA 1FMVA 2X68A 5LMUT 2NWBA 1X79A 2EHOA 5L3BB 2I0MA 3HKBE 5HXRA 5JDNA 4Z8XA 2LJLA 3RPUA 3QNUA 2D0UA 4NIQA 5EZYE 4H63V 4ZI2C 3AA0B 4IE4A 4JI6T 2SPCA 4QH4A 1KFYA 4HFBA 3N2GE 4QHOA 2X0HA 4AKLA 1LVFA 4IL9A 2K48A 3ZKRA 4HWFA 2N9DA 2LM9A 3ANWA 4HWHA 4OYKA 2A2FX 5FP3A 4EEDA 3PUYF 1SHZC 3F2EA 4G2AA 3GN5A 4AQFC 2QA7A 4ZS3A 1HX8A 3AEAA 5FY7A 4IHJE 2KSRA 4HFDA 4DUYT 1AJ3A 4DNDA 4AQFA 2CPTA 3OTOT 3P4PA 2CWOA 1XMQT 4K0KT 3AE2A 3N9MA 4DR4T 2AE9A 1IJ6A 2E9XC 1N33T 5AQMB 1WR0A 4I50E 5EK4A 3EDVA 2VASA 2M67A 4NUUA 1Y64B 2FJEA 2XSAA 3FHNA 2GK9A 4EYUA 5AQGB 2F4VT 3AA7B 2V5CA 4IGUA 3Q5WA 2XHEB 1W0BA 1US7B 3AVSA 3T1HT 5HWYA 3ETUA 2BKOA 5A1LA 5FNVE 1VCTA 5JH7E 4LF4T 2HHHT 5LB7B 4UF0A 4AQYT 2LM2A 4QH1A 4CN1A 3I0OA 1J5ET 4AIUA 1MMGA 1OEDC 4NUVA 2CXLA 2YK0A 4H9PC 4JI4T 2V8SV 1OWAA 3GA8A 4IE0A 5LHGB 5IYZE 2XZEA 2BZBA 4H63H 4PK5A 4LF8T 2J62A 5FXZA 1CUNA 1HX1B 4JI7T 3CQGB 4JLEA 4V1Av 4N78D 4JI5T 4YSXA 3PUWF 2UXDT 2LKHA 1XMOT 1UCUA 4O2AE 2UXXB 4KHPT 3PUSA 4WBNE 2YDQA 3CKDA 4E7ZA 5KDMC 5LP6E 2L8KA 3B5MA 2XQYA 3UULA 4JI1T 5LGUB 4QXBB 3NBXX 2V26A 4HE8A 3RF1A 4JV5T 4GKJT 2H7OA 3BQIA 5LJNA 5JDQA 3AEGA 3KBUA 3I9WA 2CM0A 4EZ4A 3GMIA 4ISTA 1U5PA 3TLSA 3KINB 2Q9QD 2JRKA 5JDGA 5LGNB 3DTOA 5CA1E 1N32T 1HS7A 5AQHB 3UFGA 3RI5A 1YKEB 4U72A 4H9QC 4MLKA 4H9OC 1VOMA 3L8RA 4DV2T 2W2UA 3I1AA 2W00A 1ZOYA 4BJMA 3AE9A 1WFDA 5LNKA 2WDRA 3AE8A 3LK2B 1BR2A 4MBQA 5AQJB 3M3ZB 3AVRA 2I6HA 4GK5E 4DR7T 3P8CD 1XZYA 3DP7A 3L09A 4X1YE 5CJ5A 4O2BE 3MXZA 5L47A 1BR1A 3SOLA 5ADXL 1FMWA 1J5WA 3KV5A 3MZKB 1ZV4X 4YSYA 3O1IA 2WDQA 3V5SA 2K3WA 5JTGA 2LSGA 4L0RA 3LFMA 1XNQT 3ZYLA 2A72A 4ILUA 1L0VA 4ILBA 4CN6A 3CK6A 3PE0A 4TUYE 4X62T 3TLTA 3JADA 2J4GA 2CBJA 4QH5A 5AFUL 5LXTE 5HXEA 2OLTA 5FYMA 4AKHA 1M7KA 3MJXA 2LSJA 2LRKA 3KFWX 4IDPA 3P4SA 3HKCE 5DQWA 4P0AA 4NPPA 4TN7B 5FVLA 3PDYA 5FY1A 4DMVA 4TNVA 1WYCA 3H37A 4TZ4C 5GONE 3V5UA 4PJJA 4OFZA 2D0TA 1FJGT 2M6BA 3C64A 3O9XA 2FJBA 4ZI3D 3C51A 2XQ9A 5L3CB 3DJBA 4BAYB 4IDNA 4OYJA 2HH7A 1HG2A 3CX8B 2XQ5A 3RIFA 3K3QC 3AAAB 4LF5T 5AQOB 4ZI7E 3UTKA 3OJAA 2XQ3A 1MMAA 2NW8A 5J1GA 5DJQC 2V5DA 4UR9A 3PURA 4A5XA 1BR0A 2NW7A 2UXNB 1HNZT 2X9XA 4EEBA 1T8BA 2KWHA 4ERRA 3OYXA 3RC8A 2XAFB 5ETWA 2XUEA 3FXEB 1CHUA 1WR6A 1XNRT 1FEWA 3S4UA 3JC6C 4PJNA 3PJAJ 5IUXA 2LOPA 5C8YE 1Z0PA 2X0YA 3ZSTA 1UURA 2CLYC 1WRDA 2C5KT 3RIAA 4Z91A 4PJMA 5AQSB 2NW9A 2YDRA 3KBTA 1LRZA 1UX4A 4E7SA 2X51A 2YKSA 3K8PC 2XM2A 2XTLA 2IAKA 4JI0T 2WU2A 4DR2T 2JIWA 2KMFA 4AKIA 1R8IA 4TX5A 2PG8A 2WM9A 3OBVE 5KXJA 3Q5EA 4CXYA 3J7Yq 5AQLB 4U31A 3RRCA 4C90A 3EVYA 4HFHA 2WY2A 1LKXA 3P4WA 4U74A 2V7LA 4O4LE 5HXCA 5AQTB 3X1DA 2HN2A 3QOFA 4X65T 5HCMA 4JI2T 2CRBA 3MKDA 5IWAT 4QX7B 3P50A 4ISSA 3JAFA 4B3TT 1VRBA 1GQEA 3ZT6A 2WB5A 4KBMB 4J2CA 2V6YB 2CMRA 2VK9A 5HCJA 3CX7B 3PV0F 2WCAA 5AQRB 4LMLA 4H9RC 4ZOLE 1HNWT 2IIUA 3P4QA 3ETVA 2XY8B 1IJ5A 4DV5T 4Q25A 1NENA 3RRWA 3Q5XA 3Q9DA 4PFOA 4AXPA 1HNXT 2Q9QC 4UVCB 2UUAT 2KT9A 3AXJA 3RKOA 2XAHB 2C5IT 2WBLA 4CI2B 2NTYA 3VKHA 2RP4A 2Q9QA 3VKGA 2FBWA 3IBPA 4DV7T 5AQVB 4HFCA 4X66T 4TWDA 1B7TA 4WW0A 3ZT5A 1H7CA 2VB6A 2IMLA 5JDFA 5H6QB 4EYYR 2QVAA 3LK3B 4L5GA 1QSDA 1MNEA 2QYWA 3UFEA 2LKGA 1WLXA 3HKEE 2K5BB 3B57A 2R6GF 4IE5A 3TKLB 2IW5B 2YOEA 2JMKA 4AKRB 2X0LB 4AKGA 3OVUA 3N2KE 3CPZA 2WP9A 3UT5E 3CQXC 5BMVE 2UU9T 1E2AA 5LMNT 4BJNA 2N2NA 3UUMA 2MAWA 4HFEA 2WAUA 5ABFA 5JR9B 2VWAA 3Q2MA 1D0ZA 3PUQA 4UV8B 2WZHA 4CI1B 3L3PA 3ZC0A 4I43B 2KINB 3QB5A 1Z8UA 4IDQA 3QUJA 4CQIA 2IUBA 1MIYA 1NEKA 3H3AA 2C5JA 5AQKB 2CBIA 1W0AA 3UQ4A 4O8SA 2VL8A 4NXNT 5DQVA 4EIWA 3UU5A 2VL0A 5LA6E 1E7PA 4EB6E 3SFDA 4X1KE 4OX9T 1IAPA 4KUMB 2LSKA 2CE7A 5CB4E 4O4IE 2NTXA 4YFSA 3KVAA 1HG5A 4UVAB 4I55E 1D0YA 2VKDA 1SUMB 3ESLA 4GOUA 2FJDA 3ZEFB 4DIDB 4XAXB 1SA0E 5LBMA 3N2OA 1BR4A 4DV3T 1JNRA 2WMNA 2LHNA 4LMJA 3QK6A 4X5TA 4ZI3C 3PUZF 4YJ2E 5L3FB 3AECA 4EV6A 1T98A 4QXHB 3ZSSA 2FJAA 2UXBT 4U3CA 1NWMX 3K3NA 5AQFB 2X9HA 4DV1T 3UUXB 2MOZA 3HKDE 2JQHA 3PUGA 2BKPA 2LLYA 5CA0E 3K3OA 5HEHA 2CWYA 3AB3B 5F8PA 3NVOA 2J47A 3IHRA 3VRBA 2WWVA 2DCFA 3ZJ2A 2AXDS 2PBIA 2XSBA 4LFBT 4H9SE 1KNPA 1UX5A 2E9XD 4DBRA 4YY3T 2UXCT 3KVBA 3O1HA 4IREA 4UXNB 2LOSA 5CGMA 1G73A 4PNIA 3WAJA 2KLQA 3CIRA 4GIWA 5H6RB 2YU1A 5J2UE 4MHCA 1LVKA 4YHJA 3RQUA 2RA1A 3A8YC 2VKHA 4IDOA 1IZNB 4YTMA 1V9DA 5LYJE 2DWGA 3T8OA 4OHFA 3RIUC 5JDLA 3ZPOA 4KI0F 4JEUB 1HF8A 4Z90A 3RYFE 4AISA 4U2ZA 3RIUA 3B13A 2BG9B 1HR0T 2BKNA 1S35A 4FJOA 4ZHQE 3OKQA 4UV9B 1XDOA 4LFCT 3O4XE 2X9WA 2XM1A 4ZEYA 2M6IA 3I0QA 3VR9A 5JREA 2XQAA 2YEVC 4PJLA 2W4XA 3EI0A 4WYVA 2A9UA 4ZS2A 3MA9A 1T7SA 2EHOB 2D2SA 4ZZCA 1HCIA 5HEOA 2YN6A 1HTJF 3EDUA 3NKZA 5J2TE 3CMLA 3IEEA 1QLBA 4B3ST 3KDSE 2VQET 4YXDA 4HFIA 4PFPA 2E5LT 3L39A 2NR4A 3A5XA 3UU3A 3NZPA 2ZM6T 4DV4T 3LK42 3ANWB 2WS3A 3C4XA 3C50A 4HGAA 1OXZA 2ZLYA 4FI5A 2MYSA 4BA9A 2JQQA 3ZLIA 4ZXLA 3IA3A 2A3DA 3ZMSB 3RHWA 3GN5B 2Y48B 2MTQA 3C4WA 3HI2A 2ES0A 2BS2A 2QGSA 5LBQB 2J1DG 4EGWA 4IL4A 3H3MA 3VU7H 2XAJB 1MIWA 4JUYA 4HKAA 4TV9E 3PU3A 3ONJA 4U33A 5LG4A 3W15B 2JMHA 3FZMB 3N9PA 2VURA 1N34T 2ACXA 3AE1A 2YDSA 3UUNA 3AE5A 5FL0A 1NAFA 4PAGA 3WI3A 3LDQB 2E9XB 3FXDB 3PUVF 3SRZA 3HL6A 1D1AA 3ONXA 4CXXA 4QX8B 5TAOA 2KZ7B 2HPLA 3UU4A 1UK5A 2XAQB 1SE7A 3AEFA 1MNDA 3AA1B 2KWIB 1W09A 1ZP0A 2W62A 2LT3A 1W9RA 2BG9E 4CN4A 4UEMA 2W61A 4UF0B 3LSVA 3JAEA 3ZMTB 2CHOA 1YD8G 3NRYA 2IC6A 5HEGA 4GYSA 3N9NA 2K9AA 4K0UA 1HFAA 4JI3T 2NP9A 4A98A 4HN9A 5AQQB 2YU2A 4P09A 3AAEB 3FB2A 2BVLA 1OEDB 3ONLC 3UQ7A 2LEHA 2DI4A 5JDHA 4TNWA 5KMGP 1FIOA 4LF9T 3RH3A 3AEEA 1DU2A 3U78A 2W0GA 3C4ZA 4OK0A 2JJ9A 2ZM8A 4KMCA 4F6RC 2E2AA 3JCFA 1UGOA 2H7VC 4HFVA 2V6XA 5ABHA 3U3IA 5CFBA 3AEBA 3MACA 3UU6A 2LRLA 3F57A 3RYHE 5AQIB 4GKKT 2JQKA 2L9QA 3SS1A 5L3GB 5LGTB 4X20E 2MPKA 5L4HA 2W66A 5ABEA 2CXFA 4JYAT 3FZKB 2B76A 2LSIA 2CCQA 3FZHB 2JPFA 3AE3A 2PJQA 4UELA 4CZZB 1UUSA 4YTNA 3AAIA 4JEHB 2NOXA 2W63A 3ZT7A 2BBJA 1G8XA 3NWIA 5FKYA 2IHR1 2E8IA 3RQWA 2WU5A 1ZKEA 2WDVA 1I6ZA 3EABA 1JNZA 3E22E 1M62A 5LG3A 3BQKA 4TV8E 2BS4A 2RPAA 4EAHA 1KK7A 5J0ZA 3VHLA 3SWHA 3ZYKA 4X1IE 5L3DB 3ABVA 5C3JA 2DNXA 1YXRA 5FMNA 2MBGA 1MMNA 2E9XA 4DBQA 2BDEA 1YQ4A 2JQ9A 3MK7C 3JC6D 4GK0E 3E0ZA 3AEDA 4CXWA 3AE7A 1OEDE 2C0SA 2PFVA 5BR8T 3E08A 4HTEA 1XDPA 2DL1A 3LBXB 2I59A 4ZZBA 3P7IA 1ZHCA 4PK6A 4KX6A 2LE8A 2XQ4A 3SFEA 3FZFB 2N1GA 3PUXF 3VRAA 2LSYA 1VCSA 2XQ8A 2X67A 3PTRB 3UUBA 3T1YT 1I94T 3RYIE 1WCRA 1OEDA 5AQPB 4ILCA 4A97A 2EHOD 4ASKA 2KXPB 4EZHA 1YQ3A 5FL1A 3EHZA 4LF6T 2XASB 3N9LA 3RGLA 3F31A 4DR1T 2P9BA 1Y01A 5AQUB 5HEUA 3AA6B 3NRXA 5M4YA 1IBMT 3PJAA 2Z6EA 4QXCB 2V7JA 4JBWF 2KNDA 4U2YA 4P1NA 5KX5E 4ZI2D 5C2TA 5F3JA 2IC9A 4IDZA 3KV4A 4XBFB 4UVBB 4KP3C 3RYCE 4LMKA 4YLHA 2XJ7A 3Q5DA 3CX6B 2OA5A 4ILAA 3BQLA 2HPJA 2VQFT 2V6YA 4B3RT 2BS3A 3M65A 2B1EA 4P0BA 2XAGB 2XQ6A 4AQGA 2CXDA 4B3MT 4EXTA 3QB5K 1D0XA 3OYZA 3WAKA 4HWIB 2ODVA 4UIGA 4WBOA 1KNRA 4DMWA 3FBZA 3EAMA 2DLRA 3KV6A 4QWNB 3TLWA 2YINA 2H3RA 2IDOB 1KNZA 2DHRA 4TWHA 3HR0A 5L3EB 1XWMA 4U7IA 4QKNA 3R84B 1U4QA 1D1CA 3ZCIA 5LJMA 2L3LA 2ZM2A 4M1PA 5JRCB 3R6NA 5FXVA 1S94A 4CI3B 4B6XA 3ZN0B 3OPCA 4O4HE 1X9BA 2QRXA 4TWFA 5JQGE 1QUUA 3C98B 4GYRA 4YTPA 2XQ7A 5HEJA 1IBKT 1YKHB 3ZN1B 3FZLB 4DV6T 5E0OA 3CWZB 2V7MA 2VVNA 2K24A 4MALA 3RKGA 3D0TA 2CLYB 5EK3A 2WMOA 5JR9C 2UUBT 2XPKA 5FVKA 3O1JA 4WZXA 4MFRA 5JR9A 3LBXA 4I4TE 2Y8DA 2BVMA 2E5VA 3K1SA 4ADZA
chains in the Genus database with same CATH topology
2L8KA 2W62A 2XQYA 3LJCA 5IHYA 2NTYA 3UULA 2LT3A 5LGUB 3KV9A 4QXBB 3VKHA 2RP4A 4UEMA 2Q9QA 2W61A 3NBXX 2WWUA 2V26A 4HE8A 4DO0A 2H7OA 4UF0B 3VKGA 3ZMTB 1EZ3A 3BQIA 1YD8G 3IBPA 3NRYA 2IC6A 5LJNA 5LHHB 4GYSA 3N9NA 5JDQA 2K9AA 4K0UA 3KBUA 1B7TA 1HFAA 3I9WA 3RX6A 2NP9A 4HN9A 4WW0A 2CM0A 4A56A 1H7CA 4EZ4A 2VB6A 4PK4A 5JDFA 5H6QB 1D1BA 2YU2A 1YW0A 4P09A 3GMIA 3NZQA 4ISTA 2ZM0A 3AAEB 1U5PA 3FB2A 3ZJ1A 2BVLA 3KINB 4EYYR 2Q9QD 3LK3B 2JRKA 2LEHA 4L5GA 1QSDA 3ZMZB 1MNEA 2DI4A 5JDHA 3BK9A 3UFEA 5KMGP 5JDGA 1WLXA 3ZYMA 3HKEE 2K5BB 1E1HB 5LHIB 5LGNB 3B57A 1FIOA 3DTOA 4IE5A 3FBLA 4DVDA 5CA1E 1HS7A 3TKLB 2IW5B 5HWXA 3RH3A 4G63A 2CA5A 2JMKA 4AKRB 2X0LB 4AKGA 1YKEB 3U78A 2W0GA 5DABA 3C4ZA 4OK0A 4U72A 4H9QC 3ZCJA 3ZC1A 2JJ9A 2ZM8A 4MLKA 4KMCA 3N2KE 4F6RC 3CPZA 4H9OC 3CQXC 3UT5E 1VOMA 5BMVE 2H7VC 3HA4A 4HFVA 4BJNA 2N2NA 3UUMA 3I1AA 2WAUA 5JR9B 2W00A 2VWAA 5EK2A 4YJ3E 4L9IA 3Q2MA 1D0ZA 3GWHA 5JDMA 3PUQA 3U3IA 4BJMA 5FXXA 4UV8B 4CI1B 2CEAA 3L3PA 5JVDE 3ZC0A 3MACA 4I43B 4H9NC 2KINB 5LCYA 5LNKA 3F57A 2X9YA 3LK2B 3QUJA 4CQIA 3CQCB 1BR2A 3RYHE 4MBQA 1MIYA 1O3XA 2Q9QB 3AVRA 3H3AA 4GK5E 3I9YA 3P8CD 2L9QA 3SS1A 2C5JA 4O4JE 5L3GB 2X66A 3DP7A 3L09A 4X1YE 5LGTB 4X20E 4XZCA 3ZMUB 4O8SA 4O2BE 2VL8A 3MXZA 2Y6XA 2WSSV 3PU8A 2CXFA 5DQVA 4EIWA 2LSIA 2CCQA 2ZMAA 5LA6E 3N9OA 4EB6E 2JPFA 1BR1A 3SOLA 4X1KE 5ADXL 1FMWA 3KV5A 1IAPA 3MZKB 1ZV4X 4KUMB 4AI6A 2PJQA 4UELA 4CZZB 4EOZB 2LSKA 2CE7A 4HEAA 3O1IA 5JRCA 5CB4E 4O4IE 2NTXA 3AAIA 3V5SA 4YFSA 5FY0A 2ODUA 2LSGA 3KVAA 4JEHB 1HG5A 1MIVA 2NOXA 4UVAB 2W63A 4L0RA 3LFMA 3ZYLA 4I55E 2A72A 1G8XA 4ILUA 1D0YA 5LOVE 2VKDA 3ESLA 4GOUA 1MMDA 3ZEFB 5HXSA 5L2LA 2E8IA 3N5LA 4XAXB 1SA0E 5LBMA 4WNKA 3PE0A 4TUYE 5HXHA 2LHRA 1ZKEA 3N2OA 1BR4A 4IE6A 1ZEEA 2WMNA 2LHNA 3QC9A 3QK6A 5AFUL 4ANJA 5LXTE 3E22E 4IIJE 3BQKA 4TV8E 4ZI3C 4YJ2E 3ZMVB 5HXEA 5L3FB 2V7IA 4EAHA 1T98A 1KK7A 5FYMA 4AKHA 3VHLA 3MJXA 2LSJA 4QXHB 2DWKA 3KFWX 3SWHA 5FXWA 3ZYKA 3HKCE 4X1IE 5L3DB 5DQWA 4C91A 1WYBA 4P0AA 2DNXA 2VKJA 1NWMX 5FMNA 3K3NA 5HYAA 3J9X1 2D5UA 4TN7B 2MBGA 1MMNA 3PDYA 2E9XA 2VKOA 5FY1A 4DMVA 4DBQA 2X9HA 2BDEA 1WYCA 2MOZA 3HKDE 3MK7C 2V7KA 3PUAA 4PW8A 3UUXB 3H37A 3JC6D 3PUGA 2V1DB 4GK0E 3E0ZA 3EUHA 5CA0E 3CVRA 4TZ4C 3K3OA 3N9QA 5GONE 5HAXA 4CXWA 3V5UA 2CWYA 4PJJA 2G0UA 3AB3B 4OFZA 5F8PA 2C0SA 2PFVA 3IHRA 2D0TA 3LG7A 2DCFA 4IE7A 3ZJ2A 2PBIA 2EHOC 3RC3A 3C64A 3IF8B 3O9XA 3E08A 4HTEA 4H9SE 4ZI3D 1FMVA 1UX5A 3LBXB 2I59A 3C51A 2E9XD 2X68A 4DBRA 5L3CB 3KVBA 2NWBA 3P7IA 3O1HA 1ZHCA 3DJBA 1X79A 4UXNB 2EHOA 2LOSA 4PK6A 5L3BB 4BAYB 2LE8A 1G73A 4PNIA 3HKBE 2N1GA 5HXRA 4OYJA 5JDNA 2HH7A 4Z8XA 1HG2A 2LJLA 3CX8B 2LSYA 2X67A 3RPUA 3WAJA 2KLQA 3PTRB 2D0UA 3K3QC 4GIWA 5H6RB 5EZYE 4H63V 2YU1A 4ZI2C 3AAAB 3AA0B 4IE4A 5J2UE 2SPCA 4ZI7E 3UTKA 4MHCA 1LVKA 3OJAA 4YHJA 3RYIE 4QHOA 3N2GE 2RA1A 4AKLA 1MMAA 2VKHA 2NW8A 1LVFA 5J1GA 5DJQC 2EHOD 1IZNB 3PURA 1V9DA 4ASKA 1BR0A 2KXPB 5LYJE 2DWGA 2NW7A 2K48A 3T8OA 4EZHA 2N9DA 2UXNB 4OHFA 5JDLA 2LM9A 3ANWA 4OYKA 3ZPOA 2X9XA 2XASB 3N9LA 3F31A 2P9BA 2A2FX 2KWHA 4ERRA 4JEUB 1HF8A 3AA6B 3OYXA 5FP3A 3RYFE 3RC8A 3NRXA 5M4YA 3B13A 2XAFB 5ETWA 2XUEA 3FXEB 2Z6EA 4QXCB 2V7JA 1S35A 1SHZC 2KNDA 4FJOA 4ZHQE 1WR6A 3F2EA 3OKQA 4UV9B 1FEWA 4G2AA 5KX5E 3O4XE 4ZI2D 3GN5A 4AQFC 2X9WA 3S4UA 5F3JA 2QA7A 3JC6C 4PJNA 2IC9A 4IDZA 4ZS3A 1HX8A 2LOPA 3KV4A 5C8YE 4XBFB 3I0QA 4UVBB 4KP3C 3RYCE 5FY7A 4IHJE 5JREA 4YLHA 3CX6B 2YEVC 2OA5A 3BQLA 4PJLA 2HPJA 1Z0PA 1AJ3A 4DNDA 4AQFA 2CLYC 1WRDA 2C5KT 2CWOA 3N9MA 3M65A 4ZS2A 4PJMA 3MA9A 2NW9A 1IJ6A 2EHOB 2E9XC 2B1EA 2D2SA 1HCIA 3KBTA 4P0BA 1LRZA 2XAGB 1UX4A 1HTJF 4E7SA 2X51A 3EDUA 4I50E 3K8PC 4AQGA 2XTLA 2IAKA 5J2TE 5EK4A 2CXDA 3CMLA 4EXTA 3EDVA 1D0XA 2KMFA 3OYZA 4AKIA 3IEEA 4TX5A 2VASA 3WAKA 3KDSE 2M67A 4NUUA 1Y64B 2ODVA 4UIGA 4WBOA 4DMWA 3FHNA 4PFPA 3FBZA 2GK9A 2PG8A 4EYUA 2WM9A 3A5XA 3OBVE 3NZPA 2DLRA 3KV6A 4QWNB 4CXYA 3J7Yq 3AA7B 4IGUA 3Q5WA 2YINA 2XHEB 2H3RA 3RRCA 4C90A 1KNZA 2DHRA 1US7B 3EVYA 3AVSA 3LK42 3HR0A 1LKXA 5HWYA 3ETUA 5L3EB 5A1LA 3ANWB 4QKNA 2V7LA 4O4LE 4U74A 3R84B 1U4QA 5FNVE 3C4XA 5HXCA 1D1CA 3C50A 3ZCIA 5JH7E 5LJMA 2L3LA 4HGAA 2ZM2A 4UF0A 4M1PA 5JRCB 1OXZA 3R6NA 2ZLYA 4FI5A 2MYSA 4BA9A 3MKDA 2JQQA 3ZLIA 5FXVA 3I0OA 1S94A 4QX7B 1MMGA 2A3DA 4CI3B 4B6XA 4ISSA 3ZMSB 3GN5B 2Y48B 4NUVA 1VRBA 3ZN0B 2CXLA 2YK0A 4H9PC 4O4HE 2MTQA 3C4WA 3HI2A 2ES0A 1OWAA 3GA8A 4IE0A 2QGSA 5LBQB 5LHGB 4KBMB 5IYZE 2J1DG 2BZBA 5JQGE 4H63H 1QUUA 4J2CA 3C98B 3VU7H 4PK5A 4GYRA 2XAJB 1MIWA 4JUYA 2CMRA 4HKAA 2VK9A 1YKHB 4TV9E 3PU3A 5FXZA 1CUNA 3ZN1B 5KDMC 5E0OA 3CX7B 5LG4A 3CWZB 3W15B 2V7MA 4MALA 2K24A 2JMHA 3CQGB 3D0TA 4JLEA 2CLYB 3N9PA 4V1Av 4N78D 4H9RC 2ACXA 5EK3A 4ZOLE 2WMOA 3UUNA 5JR9C 1NAFA 4PAGA 3WI3A 2E9XB 3ETVA 3FXDB 1IJ5A 1UCUA 4O2AE 3SRZA 3HL6A 1D1AA 3ONXA 3O1JA 3RRWA 2UXXB 3Q5XA 4CXXA 4QX8B 3Q9DA 5TAOA 2KZ7B 4MFRA 4PFOA 2HPLA 5JR9A 3PUSA 2XAQB 3LBXA 4I4TE 4WBNE 2Y8DA 4AXPA 2Q9QC 3CKDA 4UVCB 1MNDA 2KT9A 3RKOA 2BVMA 2XAHB 2C5IT 4E7ZA 3AA1B 2KWIB 2WBLA 4CI2B 4ADZA 5LP6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O C;  4H9R C;  4H9Q C;  4H9S E;  4HGA A;  4H9N C;  4H9P C;  5KDM C; 
#chains in the Genus database with same CATH topology
 3LJC A;  5IHY A;  2D9D A;  3KV9 A;  5ABG A;  2WWU A;  4DO0 A;  1EZ3 A;  3AE4 A;  5LHH B;  3RX6 A;  2WZI A;  4A56 A;  4PK4 A;  1D1B A;  1YW0 A;  3NZQ A;  5L4E A;  2ZM0 A;  4IT4 A;  3ZJ1 A;  4F8H A;  3G06 A;  4YSZ A;  3ZMZ B;  3BK9 A;  3ZYM A;  3TLU A;  1E1H B;  5LHI B;  1KF6 A;  3FBL A;  4DVD A;  1KEY A;  4COF A;  5HWX A;  4G63 A;  2CA5 A;  5DAB A;  3UU8 A;  3ZCJ A;  3ZC1 A;  2BBH A;  3HA4 A;  4HWD A;  5EK2 A;  4YJ3 E;  4L9I A;  3VR8 A;  3GWH A;  5JDM A;  5FXX A;  2OV9 A;  4LFA T;  2ACZ A;  3AXJ B;  2CEA A;  5JVD E;  2FUP A;  4H9N C;  5LCY A;  2X9Y A;  3CQC B;  1O3X A;  2Q9Q B;  4DR5 T;  3I9Y A;  4O4J E;  4LF7 T;  2X66 A;  4XZC A;  3ZMU B;  2Y6X A;  2WSS V;  3PU8 A;  2CHN A;  4HWC A;  2ZMA A;  3N9O A;  1IBL T;  3A7M A;  2WQY A;  4YT0 A;  4AI6 A;  4EOZ B;  4JI8 T;  4HEA A;  5JRC A;  4DV0 T;  2PTF A;  5FY0 A;  2ODU A;  2H89 A;  1MIV A;  5LOV E;  5F5W A;  1MMD A;  5HXS A;  4NXM T;  5L2L A;  3N5L A;  4WNK A;  4YHH T;  5HXH A;  2LHR A;  2VVS A;  2HN1 A;  4IE6 A;  1ZEE A;  4I0U A;  3QC9 A;  5ABF B;  3P4R A;  4ANJ A;  4IIJ E;  3AE6 A;  3TLV A;  4X64 T;  2W67 A;  3ZMV B;  2H88 A;  2V7I A;  2BG9 C;  2DWK A;  5FXW A;  4DUZ T;  3RLF F;  4C91 A;  1WYB A;  2VKJ A;  5HYA A;  3J9X 1;  2D5U A;  2BG9 A;  2VKO A;  2UUC T;  4PW8 A;  3PUA A;  2V7K A;  5AQN B;  1T72 A;  2V1D B;  3EUH A;  4KHZ F;  4DR3 T;  3CVR A;  3N9Q A;  5HAX A;  4U7Y A;  2G0U A;  3LG7 A;  4IE7 A;  4DR6 T;  2EHO C;  3RC3 A;  3IF8 B;  1N36 T;  1J1J A;  1FMV A;  2X68 A;  5LMU T;  2NWB A;  1X79 A;  2EHO A;  5L3B B;  2I0M A;  3HKB E;  5HXR A;  5JDN A;  4Z8X A;  2LJL A;  3RPU A;  3QNU A;  2D0U A;  4NIQ A;  5EZY E;  4H63 V;  4ZI2 C;  3AA0 B;  4IE4 A;  4JI6 T;  2SPC A;  4QH4 A;  1KFY A;  4HFB A;  3N2G E;  4QHO A;  2X0H A;  4AKL A;  1LVF A;  4IL9 A;  2K48 A;  3ZKR A;  4HWF A;  2N9D A;  2LM9 A;  3ANW A;  4HWH A;  4OYK A;  2A2F X;  5FP3 A;  4EED A;  3PUY F;  1SHZ C;  3F2E A;  4G2A A;  3GN5 A;  4AQF C;  2QA7 A;  4ZS3 A;  1HX8 A;  3AEA A;  5FY7 A;  4IHJ E;  2KSR A;  4HFD A;  4DUY T;  1AJ3 A;  4DND A;  4AQF A;  2CPT A;  3OTO T;  3P4P A;  2CWO A;  1XMQ T;  4K0K T;  3AE2 A;  3N9M A;  4DR4 T;  2AE9 A;  1IJ6 A;  2E9X C;  1N33 T;  5AQM B;  1WR0 A;  4I50 E;  5EK4 A;  3EDV A;  2VAS A;  2M67 A;  4NUU A;  1Y64 B;  2FJE A;  2XSA A;  3FHN A;  2GK9 A;  4EYU A;  5AQG B;  2F4V T;  3AA7 B;  2V5C A;  4IGU A;  3Q5W A;  2XHE B;  1W0B A;  1US7 B;  3AVS A;  3T1H T;  5HWY A;  3ETU A;  2BKO A;  5A1L A;  5FNV E;  1VCT A;  5JH7 E;  4LF4 T;  2HHH T;  5LB7 B;  4UF0 A;  4AQY T;  2LM2 A;  4QH1 A;  4CN1 A;  3I0O A;  1J5E T;  4AIU A;  1MMG A;  1OED C;  4NUV A;  2CXL A;  2YK0 A;  4H9P C;  4JI4 T;  2V8S V;  1OWA A;  3GA8 A;  4IE0 A;  5LHG B;  5IYZ E;  2XZE A;  2BZB A;  4H63 H;  4PK5 A;  4LF8 T;  2J62 A;  5FXZ A;  1CUN A;  1HX1 B;  4JI7 T;  3CQG B;  4JLE A;  4V1A v;  4N78 D;  4JI5 T;  4YSX A;  3PUW F;  2UXD T;  2LKH A;  1XMO T;  1UCU A;  4O2A E;  2UXX B;  4KHP T;  3PUS A;  4WBN E;  2YDQ A;  3CKD A;  4E7Z A;  5KDM C;  5LP6 E;  2L8K A;  3B5M A;  2XQY A;  3UUL A;  4JI1 T;  5LGU B;  4QXB B;  3NBX X;  2V26 A;  4HE8 A;  3RF1 A;  4JV5 T;  4GKJ T;  2H7O A;  3BQI A;  5LJN A;  5JDQ A;  3AEG A;  3KBU A;  3I9W A;  2CM0 A;  4EZ4 A;  3GMI A;  4IST A;  1U5P A;  3TLS A;  3KIN B;  2Q9Q D;  2JRK A;  5JDG A;  5LGN B;  3DTO A;  5CA1 E;  1N32 T;  1HS7 A;  5AQH B;  3UFG A;  3RI5 A;  1YKE B;  4U72 A;  4H9Q C;  4MLK A;  4H9O C;  1VOM A;  3L8R A;  4DV2 T;  2W2U A;  3I1A A;  2W00 A;  1ZOY A;  4BJM A;  3AE9 A;  1WFD A;  5LNK A;  2WDR A;  3AE8 A;  3LK2 B;  1BR2 A;  4MBQ A;  5AQJ B;  3M3Z B;  3AVR A;  2I6H A;  4GK5 E;  4DR7 T;  3P8C D;  1XZY A;  3DP7 A;  3L09 A;  4X1Y E;  5CJ5 A;  4O2B E;  3MXZ A;  5L47 A;  1BR1 A;  3SOL A;  5ADX L;  1FMW A;  1J5W A;  3KV5 A;  3MZK B;  1ZV4 X;  4YSY A;  3O1I A;  2WDQ A;  3V5S A;  2K3W A;  5JTG A;  2LSG A;  4L0R A;  3LFM A;  1XNQ T;  3ZYL A;  2A72 A;  4ILU A;  1L0V A;  4ILB A;  4CN6 A;  3CK6 A;  3PE0 A;  4TUY E;  4X62 T;  3TLT A;  3JAD A;  2J4G A;  2CBJ A;  4QH5 A;  5AFU L;  5LXT E;  5HXE A;  2OLT A;  5FYM A;  4AKH A;  1M7K A;  3MJX A;  2LSJ A;  2LRK A;  3KFW X;  4IDP A;  3P4S A;  3HKC E;  5DQW A;  4P0A A;  4NPP A;  4TN7 B;  5FVL A;  3PDY A;  5FY1 A;  4DMV A;  4TNV A;  1WYC A;  3H37 A;  4TZ4 C;  5GON E;  3V5U A;  4PJJ A;  4OFZ A;  2D0T A;  1FJG T;  2M6B A;  3C64 A;  3O9X A;  2FJB A;  4ZI3 D;  3C51 A;  2XQ9 A;  5L3C B;  3DJB A;  4BAY B;  4IDN A;  4OYJ A;  2HH7 A;  1HG2 A;  3CX8 B;  2XQ5 A;  3RIF A;  3K3Q C;  3AAA B;  4LF5 T;  5AQO B;  4ZI7 E;  3UTK A;  3OJA A;  2XQ3 A;  1MMA A;  2NW8 A;  5J1G A;  5DJQ C;  2V5D A;  4UR9 A;  3PUR A;  4A5X A;  1BR0 A;  2NW7 A;  2UXN B;  1HNZ T;  2X9X A;  4EEB A;  1T8B A;  2KWH A;  4ERR A;  3OYX A;  3RC8 A;  2XAF B;  5ETW A;  2XUE A;  3FXE B;  1CHU A;  1WR6 A;  1XNR T;  1FEW A;  3S4U A;  3JC6 C;  4PJN A;  3PJA J;  5IUX A;  2LOP A;  5C8Y E;  1Z0P A;  2X0Y A;  3ZST A;  1UUR A;  2CLY C;  1WRD A;  2C5K T;  3RIA A;  4Z91 A;  4PJM A;  5AQS B;  2NW9 A;  2YDR A;  3KBT A;  1LRZ A;  1UX4 A;  4E7S A;  2X51 A;  2YKS A;  3K8P C;  2XM2 A;  2XTL A;  2IAK A;  4JI0 T;  2WU2 A;  4DR2 T;  2JIW A;  2KMF A;  4AKI A;  1R8I A;  4TX5 A;  2PG8 A;  2WM9 A;  3OBV E;  5KXJ A;  3Q5E A;  4CXY A;  3J7Y q;  5AQL B;  4U31 A;  3RRC A;  4C90 A;  3EVY A;  4HFH A;  2WY2 A;  1LKX A;  3P4W A;  4U74 A;  2V7L A;  4O4L E;  5HXC A;  5AQT B;  3X1D A;  2HN2 A;  3QOF A;  4X65 T;  5HCM A;  4JI2 T;  2CRB A;  3MKD A;  5IWA T;  4QX7 B;  3P50 A;  4ISS A;  3JAF A;  4B3T T;  1VRB A;  1GQE A;  3ZT6 A;  2WB5 A;  4KBM B;  4J2C A;  2V6Y B;  2CMR A;  2VK9 A;  5HCJ A;  3CX7 B;  3PV0 F;  2WCA A;  5AQR B;  4LML A;  4H9R C;  4ZOL E;  1HNW T;  2IIU A;  3P4Q A;  3ETV A;  2XY8 B;  1IJ5 A;  4DV5 T;  4Q25 A;  1NEN A;  3RRW A;  3Q5X A;  3Q9D A;  4PFO A;  4AXP A;  1HNX T;  2Q9Q C;  4UVC B;  2UUA T;  2KT9 A;  3AXJ A;  3RKO A;  2XAH B;  2C5I T;  2WBL A;  4CI2 B;  2NTY A;  3VKH A;  2RP4 A;  2Q9Q A;  3VKG A;  2FBW A;  3IBP A;  4DV7 T;  5AQV B;  4HFC A;  4X66 T;  4TWD A;  1B7T A;  4WW0 A;  3ZT5 A;  1H7C A;  2VB6 A;  2IML A;  5JDF A;  5H6Q B;  4EYY R;  2QVA A;  3LK3 B;  4L5G A;  1QSD A;  1MNE A;  2QYW A;  3UFE A;  2LKG A;  1WLX A;  3HKE E;  2K5B B;  3B57 A;  2R6G F;  4IE5 A;  3TKL B;  2IW5 B;  2YOE A;  2JMK A;  4AKR B;  2X0L B;  4AKG A;  3OVU A;  3N2K E;  3CPZ A;  2WP9 A;  3UT5 E;  3CQX C;  5BMV E;  2UU9 T;  1E2A A;  5LMN T;  4BJN A;  2N2N A;  3UUM A;  2MAW A;  4HFE A;  2WAU A;  5ABF A;  5JR9 B;  2VWA A;  3Q2M A;  1D0Z A;  3PUQ A;  4UV8 B;  2WZH A;  4CI1 B;  3L3P A;  3ZC0 A;  4I43 B;  2KIN B;  3QB5 A;  1Z8U A;  4IDQ A;  3QUJ A;  4CQI A;  2IUB A;  1MIY A;  1NEK A;  3H3A A;  2C5J A;  5AQK B;  2CBI A;  1W0A A;  3UQ4 A;  4O8S A;  2VL8 A;  4NXN T;  5DQV A;  4EIW A;  3UU5 A;  2VL0 A;  5LA6 E;  1E7P A;  4EB6 E;  3SFD A;  4X1K E;  4OX9 T;  1IAP A;  4KUM B;  2LSK A;  2CE7 A;  5CB4 E;  4O4I E;  2NTX A;  4YFS A;  3KVA A;  1HG5 A;  4UVA B;  4I55 E;  1D0Y A;  2VKD A;  1SUM B;  3ESL A;  4GOU A;  2FJD A;  3ZEF B;  4DID B;  4XAX B;  1SA0 E;  5LBM A;  3N2O A;  1BR4 A;  4DV3 T;  1JNR A;  2WMN A;  2LHN A;  4LMJ A;  3QK6 A;  4X5T A;  4ZI3 C;  3PUZ F;  4YJ2 E;  5L3F B;  3AEC A;  4EV6 A;  1T98 A;  4QXH B;  3ZSS A;  2FJA A;  2UXB T;  4U3C A;  1NWM X;  3K3N A;  5AQF B;  2X9H A;  4DV1 T;  3UUX B;  2MOZ A;  3HKD E;  2JQH A;  3PUG A;  2BKP A;  2LLY A;  5CA0 E;  3K3O A;  5HEH A;  2CWY A;  3AB3 B;  5F8P A;  3NVO A;  2J47 A;  3IHR A;  3VRB A;  2WWV A;  2DCF A;  3ZJ2 A;  2AXD S;  2PBI A;  2XSB A;  4LFB T;  4H9S E;  1KNP A;  1UX5 A;  2E9X D;  4DBR A;  4YY3 T;  2UXC T;  3KVB A;  3O1H A;  4IRE A;  4UXN B;  2LOS A;  5CGM A;  1G73 A;  4PNI A;  3WAJ A;  2KLQ A;  3CIR A;  4GIW A;  5H6R B;  2YU1 A;  5J2U E;  4MHC A;  1LVK A;  4YHJ A;  3RQU A;  2RA1 A;  3A8Y C;  2VKH A;  4IDO A;  1IZN B;  4YTM A;  1V9D A;  5LYJ E;  2DWG A;  3T8O A;  4OHF A;  3RIU C;  5JDL A;  3ZPO A;  4KI0 F;  4JEU B;  1HF8 A;  4Z90 A;  3RYF E;  4AIS A;  4U2Z A;  3RIU A;  3B13 A;  2BG9 B;  1HR0 T;  2BKN A;  1S35 A;  4FJO A;  4ZHQ E;  3OKQ A;  4UV9 B;  1XDO A;  4LFC T;  3O4X E;  2X9W A;  2XM1 A;  4ZEY A;  2M6I A;  3I0Q A;  3VR9 A;  5JRE A;  2XQA A;  2YEV C;  4PJL A;  2W4X A;  3EI0 A;  4WYV A;  2A9U A;  4ZS2 A;  3MA9 A;  1T7S A;  2EHO B;  2D2S A;  4ZZC A;  1HCI A;  5HEO A;  2YN6 A;  1HTJ F;  3EDU A;  3NKZ A;  5J2T E;  3CML A;  3IEE A;  1QLB A;  4B3S T;  3KDS E;  2VQE T;  4YXD A;  4HFI A;  4PFP A;  2E5L T;  3L39 A;  2NR4 A;  3A5X A;  3UU3 A;  3NZP A;  2ZM6 T;  4DV4 T;  3LK4 2;  3ANW B;  2WS3 A;  3C4X A;  3C50 A;  4HGA A;  1OXZ A;  2ZLY A;  4FI5 A;  2MYS A;  4BA9 A;  2JQQ A;  3ZLI A;  4ZXL A;  3IA3 A;  2A3D A;  3ZMS B;  3RHW A;  3GN5 B;  2Y48 B;  2MTQ A;  3C4W A;  3HI2 A;  2ES0 A;  2BS2 A;  2QGS A;  5LBQ B;  2J1D G;  4EGW A;  4IL4 A;  3H3M A;  3VU7 H;  2XAJ B;  1MIW A;  4JUY A;  4HKA A;  4TV9 E;  3PU3 A;  3ONJ A;  4U33 A;  5LG4 A;  3W15 B;  2JMH A;  3FZM B;  3N9P A;  2VUR A;  1N34 T;  2ACX A;  3AE1 A;  2YDS A;  3UUN A;  3AE5 A;  5FL0 A;  1NAF A;  4PAG A;  3WI3 A;  3LDQ B;  2E9X B;  3FXD B;  3PUV F;  3SRZ A;  3HL6 A;  1D1A A;  3ONX A;  4CXX A;  4QX8 B;  5TAO A;  2KZ7 B;  2HPL A;  3UU4 A;  1UK5 A;  2XAQ B;  1SE7 A;  3AEF A;  1MND A;  3AA1 B;  2KWI B;  1W09 A;  1ZP0 A;  2W62 A;  2LT3 A;  1W9R A;  2BG9 E;  4CN4 A;  4UEM A;  2W61 A;  4UF0 B;  3LSV A;  3JAE A;  3ZMT B;  2CHO A;  1YD8 G;  3NRY A;  2IC6 A;  5HEG A;  4GYS A;  3N9N A;  2K9A A;  4K0U A;  1HFA A;  4JI3 T;  2NP9 A;  4A98 A;  4HN9 A;  5AQQ B;  2YU2 A;  4P09 A;  3AAE B;  3FB2 A;  2BVL A;  1OED B;  3ONL C;  3UQ7 A;  2LEH A;  2DI4 A;  5JDH A;  4TNW A;  5KMG P;  1FIO A;  4LF9 T;  3RH3 A;  3AEE A;  1DU2 A;  3U78 A;  2W0G A;  3C4Z A;  4OK0 A;  2JJ9 A;  2ZM8 A;  4KMC A;  4F6R C;  2E2A A;  3JCF A;  1UGO A;  2H7V C;  4HFV A;  2V6X A;  5ABH A;  3U3I A;  5CFB A;  3AEB A;  3MAC A;  3UU6 A;  2LRL A;  3F57 A;  3RYH E;  5AQI B;  4GKK T;  2JQK A;  2L9Q A;  3SS1 A;  5L3G B;  5LGT B;  4X20 E;  2MPK A;  5L4H A;  2W66 A;  5ABE A;  2CXF A;  4JYA T;  3FZK B;  2B76 A;  2LSI A;  2CCQ A;  3FZH B;  2JPF A;  3AE3 A;  2PJQ A;  4UEL A;  4CZZ B;  1UUS A;  4YTN A;  3AAI A;  4JEH B;  2NOX A;  2W63 A;  3ZT7 A;  2BBJ A;  1G8X A;  3NWI A;  5FKY A;  2IHR 1;  2E8I A;  3RQW A;  2WU5 A;  1ZKE A;  2WDV A;  1I6Z A;  3EAB A;  1JNZ A;  3E22 E;  1M62 A;  5LG3 A;  3BQK A;  4TV8 E;  2BS4 A;  2RPA A;  4EAH A;  1KK7 A;  5J0Z A;  3VHL A;  3SWH A;  3ZYK A;  4X1I E;  5L3D B;  3ABV A;  5C3J A;  2DNX A;  1YXR A;  5FMN A;  2MBG A;  1MMN A;  2E9X A;  4DBQ A;  2BDE A;  1YQ4 A;  2JQ9 A;  3MK7 C;  3JC6 D;  4GK0 E;  3E0Z A;  3AED A;  4CXW A;  3AE7 A;  1OED E;  2C0S A;  2PFV A;  5BR8 T;  3E08 A;  4HTE A;  1XDP A;  2DL1 A;  3LBX B;  2I59 A;  4ZZB A;  3P7I A;  1ZHC A;  4PK6 A;  4KX6 A;  2LE8 A;  2XQ4 A;  3SFE A;  3FZF B;  2N1G A;  3PUX F;  3VRA A;  2LSY A;  1VCS A;  2XQ8 A;  2X67 A;  3PTR B;  3UUB A;  3T1Y T;  1I94 T;  3RYI E;  1WCR A;  1OED A;  5AQP B;  4ILC A;  4A97 A;  2EHO D;  4ASK A;  2KXP B;  4EZH A;  1YQ3 A;  5FL1 A;  3EHZ A;  4LF6 T;  2XAS B;  3N9L A;  3RGL A;  3F31 A;  4DR1 T;  2P9B A;  1Y01 A;  5AQU B;  5HEU A;  3AA6 B;  3NRX A;  5M4Y A;  1IBM T;  3PJA A;  2Z6E A;  4QXC B;  2V7J A;  4JBW F;  2KND A;  4U2Y A;  4P1N A;  5KX5 E;  4ZI2 D;  5C2T A;  5F3J A;  2IC9 A;  4IDZ A;  3KV4 A;  4XBF B;  4UVB B;  4KP3 C;  3RYC E;  4LMK A;  4YLH A;  2XJ7 A;  3Q5D A;  3CX6 B;  2OA5 A;  4ILA A;  3BQL A;  2HPJ A;  2VQF T;  2V6Y A;  4B3R T;  2BS3 A;  3M65 A;  2B1E A;  4P0B A;  2XAG B;  2XQ6 A;  4AQG A;  2CXD A;  4B3M T;  4EXT A;  3QB5 K;  1D0X A;  3OYZ A;  3WAK A;  4HWI B;  2ODV A;  4UIG A;  4WBO A;  1KNR A;  4DMW A;  3FBZ A;  3EAM A;  2DLR A;  3KV6 A;  4QWN B;  3TLW A;  2YIN A;  2H3R A;  2IDO B;  1KNZ A;  2DHR A;  4TWH A;  3HR0 A;  5L3E B;  1XWM A;  4U7I A;  4QKN A;  3R84 B;  1U4Q A;  1D1C A;  3ZCI A;  5LJM A;  2L3L A;  2ZM2 A;  4M1P A;  5JRC B;  3R6N A;  5FXV A;  1S94 A;  4CI3 B;  4B6X A;  3ZN0 B;  3OPC A;  4O4H E;  1X9B A;  2QRX A;  4TWF A;  5JQG E;  1QUU A;  3C98 B;  4GYR A;  4YTP A;  2XQ7 A;  5HEJ A;  1IBK T;  1YKH B;  3ZN1 B;  3FZL B;  4DV6 T;  5E0O A;  3CWZ B;  2V7M A;  2VVN A;  2K24 A;  4MAL A;  3RKG A;  3D0T A;  2CLY B;  5EK3 A;  2WMO A;  5JR9 C;  2UUB T;  2XPK A;  5FVK A;  3O1J A;  4WZX A;  4MFR A;  5JR9 A;  3LBX A;  4I4T E;  2Y8D A;  2BVM A;  2E5V A;  3K1S A;  4ADZ A; 
#chains in the Genus database with same CATH homology
 2L8K A;  2W62 A;  2XQY A;  3LJC A;  5IHY A;  2NTY A;  3UUL A;  2LT3 A;  5LGU B;  3KV9 A;  4QXB B;  3VKH A;  2RP4 A;  4UEM A;  2Q9Q A;  2W61 A;  3NBX X;  2WWU A;  2V26 A;  4HE8 A;  4DO0 A;  2H7O A;  4UF0 B;  3VKG A;  3ZMT B;  1EZ3 A;  3BQI A;  1YD8 G;  3IBP A;  3NRY A;  2IC6 A;  5LJN A;  5LHH B;  4GYS A;  3N9N A;  5JDQ A;  2K9A A;  4K0U A;  3KBU A;  1B7T A;  1HFA A;  3I9W A;  3RX6 A;  2NP9 A;  4HN9 A;  4WW0 A;  2CM0 A;  4A56 A;  1H7C A;  4EZ4 A;  2VB6 A;  4PK4 A;  5JDF A;  5H6Q B;  1D1B A;  2YU2 A;  1YW0 A;  4P09 A;  3GMI A;  3NZQ A;  4IST A;  2ZM0 A;  3AAE B;  1U5P A;  3FB2 A;  3ZJ1 A;  2BVL A;  3KIN B;  4EYY R;  2Q9Q D;  3LK3 B;  2JRK A;  2LEH A;  4L5G A;  1QSD A;  3ZMZ B;  1MNE A;  2DI4 A;  5JDH A;  3BK9 A;  3UFE A;  5KMG P;  5JDG A;  1WLX A;  3ZYM A;  3HKE E;  2K5B B;  1E1H B;  5LHI B;  5LGN B;  3B57 A;  1FIO A;  3DTO A;  4IE5 A;  3FBL A;  4DVD A;  5CA1 E;  1HS7 A;  3TKL B;  2IW5 B;  5HWX A;  3RH3 A;  4G63 A;  2CA5 A;  2JMK A;  4AKR B;  2X0L B;  4AKG A;  1YKE B;  3U78 A;  2W0G A;  5DAB A;  3C4Z A;  4OK0 A;  4U72 A;  4H9Q C;  3ZCJ A;  3ZC1 A;  2JJ9 A;  2ZM8 A;  4MLK A;  4KMC A;  3N2K E;  4F6R C;  3CPZ A;  4H9O C;  3CQX C;  3UT5 E;  1VOM A;  5BMV E;  2H7V C;  3HA4 A;  4HFV A;  4BJN A;  2N2N A;  3UUM A;  3I1A A;  2WAU A;  5JR9 B;  2W00 A;  2VWA A;  5EK2 A;  4YJ3 E;  4L9I A;  3Q2M A;  1D0Z A;  3GWH A;  5JDM A;  3PUQ A;  3U3I A;  4BJM A;  5FXX A;  4UV8 B;  4CI1 B;  2CEA A;  3L3P A;  5JVD E;  3ZC0 A;  3MAC A;  4I43 B;  4H9N C;  2KIN B;  5LCY A;  5LNK A;  3F57 A;  2X9Y A;  3LK2 B;  3QUJ A;  4CQI A;  3CQC B;  1BR2 A;  3RYH E;  4MBQ A;  1MIY A;  1O3X A;  2Q9Q B;  3AVR A;  3H3A A;  4GK5 E;  3I9Y A;  3P8C D;  2L9Q A;  3SS1 A;  2C5J A;  4O4J E;  5L3G B;  2X66 A;  3DP7 A;  3L09 A;  4X1Y E;  5LGT B;  4X20 E;  4XZC A;  3ZMU B;  4O8S A;  4O2B E;  2VL8 A;  3MXZ A;  2Y6X A;  2WSS V;  3PU8 A;  2CXF A;  5DQV A;  4EIW A;  2LSI A;  2CCQ A;  2ZMA A;  5LA6 E;  3N9O A;  4EB6 E;  2JPF A;  1BR1 A;  3SOL A;  4X1K E;  5ADX L;  1FMW A;  3KV5 A;  1IAP A;  3MZK B;  1ZV4 X;  4KUM B;  4AI6 A;  2PJQ A;  4UEL A;  4CZZ B;  4EOZ B;  2LSK A;  2CE7 A;  4HEA A;  3O1I A;  5JRC A;  5CB4 E;  4O4I E;  2NTX A;  3AAI A;  3V5S A;  4YFS A;  5FY0 A;  2ODU A;  2LSG A;  3KVA A;  4JEH B;  1HG5 A;  1MIV A;  2NOX A;  4UVA B;  2W63 A;  4L0R A;  3LFM A;  3ZYL A;  4I55 E;  2A72 A;  1G8X A;  4ILU A;  1D0Y A;  5LOV E;  2VKD A;  3ESL A;  4GOU A;  1MMD A;  3ZEF B;  5HXS A;  5L2L A;  2E8I A;  3N5L A;  4XAX B;  1SA0 E;  5LBM A;  4WNK A;  3PE0 A;  4TUY E;  5HXH A;  2LHR A;  1ZKE A;  3N2O A;  1BR4 A;  4IE6 A;  1ZEE A;  2WMN A;  2LHN A;  3QC9 A;  3QK6 A;  5AFU L;  4ANJ A;  5LXT E;  3E22 E;  4IIJ E;  3BQK A;  4TV8 E;  4ZI3 C;  4YJ2 E;  3ZMV B;  5HXE A;  5L3F B;  2V7I A;  4EAH A;  1T98 A;  1KK7 A;  5FYM A;  4AKH A;  3VHL A;  3MJX A;  2LSJ A;  4QXH B;  2DWK A;  3KFW X;  3SWH A;  5FXW A;  3ZYK A;  3HKC E;  4X1I E;  5L3D B;  5DQW A;  4C91 A;  1WYB A;  4P0A A;  2DNX A;  2VKJ A;  1NWM X;  5FMN A;  3K3N A;  5HYA A;  3J9X 1;  2D5U A;  4TN7 B;  2MBG A;  1MMN A;  3PDY A;  2E9X A;  2VKO A;  5FY1 A;  4DMV A;  4DBQ A;  2X9H A;  2BDE A;  1WYC A;  2MOZ A;  3HKD E;  3MK7 C;  2V7K A;  3PUA A;  4PW8 A;  3UUX B;  3H37 A;  3JC6 D;  3PUG A;  2V1D B;  4GK0 E;  3E0Z A;  3EUH A;  5CA0 E;  3CVR A;  4TZ4 C;  3K3O A;  3N9Q A;  5GON E;  5HAX A;  4CXW A;  3V5U A;  2CWY A;  4PJJ A;  2G0U A;  3AB3 B;  4OFZ A;  5F8P A;  2C0S A;  2PFV A;  3IHR A;  2D0T A;  3LG7 A;  2DCF A;  4IE7 A;  3ZJ2 A;  2PBI A;  2EHO C;  3RC3 A;  3C64 A;  3IF8 B;  3O9X A;  3E08 A;  4HTE A;  4H9S E;  4ZI3 D;  1FMV A;  1UX5 A;  3LBX B;  2I59 A;  3C51 A;  2E9X D;  2X68 A;  4DBR A;  5L3C B;  3KVB A;  2NWB A;  3P7I A;  3O1H A;  1ZHC A;  3DJB A;  1X79 A;  4UXN B;  2EHO A;  2LOS A;  4PK6 A;  5L3B B;  4BAY B;  2LE8 A;  1G73 A;  4PNI A;  3HKB E;  2N1G A;  5HXR A;  4OYJ A;  5JDN A;  2HH7 A;  4Z8X A;  1HG2 A;  2LJL A;  3CX8 B;  2LSY A;  2X67 A;  3RPU A;  3WAJ A;  2KLQ A;  3PTR B;  2D0U A;  3K3Q C;  4GIW A;  5H6R B;  5EZY E;  4H63 V;  2YU1 A;  4ZI2 C;  3AAA B;  3AA0 B;  4IE4 A;  5J2U E;  2SPC A;  4ZI7 E;  3UTK A;  4MHC A;  1LVK A;  3OJA A;  4YHJ A;  3RYI E;  4QHO A;  3N2G E;  2RA1 A;  4AKL A;  1MMA A;  2VKH A;  2NW8 A;  1LVF A;  5J1G A;  5DJQ C;  2EHO D;  1IZN B;  3PUR A;  1V9D A;  4ASK A;  1BR0 A;  2KXP B;  5LYJ E;  2DWG A;  2NW7 A;  2K48 A;  3T8O A;  4EZH A;  2N9D A;  2UXN B;  4OHF A;  5JDL A;  2LM9 A;  3ANW A;  4OYK A;  3ZPO A;  2X9X A;  2XAS B;  3N9L A;  3F31 A;  2P9B A;  2A2F X;  2KWH A;  4ERR A;  4JEU B;  1HF8 A;  3AA6 B;  3OYX A;  5FP3 A;  3RYF E;  3RC8 A;  3NRX A;  5M4Y A;  3B13 A;  2XAF B;  5ETW A;  2XUE A;  3FXE B;  2Z6E A;  4QXC B;  2V7J A;  1S35 A;  1SHZ C;  2KND A;  4FJO A;  4ZHQ E;  1WR6 A;  3F2E A;  3OKQ A;  4UV9 B;  1FEW A;  4G2A A;  5KX5 E;  3O4X E;  4ZI2 D;  3GN5 A;  4AQF C;  2X9W A;  3S4U A;  5F3J A;  2QA7 A;  3JC6 C;  4PJN A;  2IC9 A;  4IDZ A;  4ZS3 A;  1HX8 A;  2LOP A;  3KV4 A;  5C8Y E;  4XBF B;  3I0Q A;  4UVB B;  4KP3 C;  3RYC E;  5FY7 A;  4IHJ E;  5JRE A;  4YLH A;  3CX6 B;  2YEV C;  2OA5 A;  3BQL A;  4PJL A;  2HPJ A;  1Z0P A;  1AJ3 A;  4DND A;  4AQF A;  2CLY C;  1WRD A;  2C5K T;  2CWO A;  3N9M A;  3M65 A;  4ZS2 A;  4PJM A;  3MA9 A;  2NW9 A;  1IJ6 A;  2EHO B;  2E9X C;  2B1E A;  2D2S A;  1HCI A;  3KBT A;  4P0B A;  1LRZ A;  2XAG B;  1UX4 A;  1HTJ F;  4E7S A;  2X51 A;  3EDU A;  4I50 E;  3K8P C;  4AQG A;  2XTL A;  2IAK A;  5J2T E;  5EK4 A;  2CXD A;  3CML A;  4EXT A;  3EDV A;  1D0X A;  2KMF A;  3OYZ A;  4AKI A;  3IEE A;  4TX5 A;  2VAS A;  3WAK A;  3KDS E;  2M67 A;  4NUU A;  1Y64 B;  2ODV A;  4UIG A;  4WBO A;  4DMW A;  3FHN A;  4PFP A;  3FBZ A;  2GK9 A;  2PG8 A;  4EYU A;  2WM9 A;  3A5X A;  3OBV E;  3NZP A;  2DLR A;  3KV6 A;  4QWN B;  4CXY A;  3J7Y q;  3AA7 B;  4IGU A;  3Q5W A;  2YIN A;  2XHE B;  2H3R A;  3RRC A;  4C90 A;  1KNZ A;  2DHR A;  1US7 B;  3EVY A;  3AVS A;  3LK4 2;  3HR0 A;  1LKX A;  5HWY A;  3ETU A;  5L3E B;  5A1L A;  3ANW B;  4QKN A;  2V7L A;  4O4L E;  4U74 A;  3R84 B;  1U4Q A;  5FNV E;  3C4X A;  5HXC A;  1D1C A;  3C50 A;  3ZCI A;  5JH7 E;  5LJM A;  2L3L A;  4HGA A;  2ZM2 A;  4UF0 A;  4M1P A;  5JRC B;  1OXZ A;  3R6N A;  2ZLY A;  4FI5 A;  2MYS A;  4BA9 A;  3MKD A;  2JQQ A;  3ZLI A;  5FXV A;  3I0O A;  1S94 A;  4QX7 B;  1MMG A;  2A3D A;  4CI3 B;  4B6X A;  4ISS A;  3ZMS B;  3GN5 B;  2Y48 B;  4NUV A;  1VRB A;  3ZN0 B;  2CXL A;  2YK0 A;  4H9P C;  4O4H E;  2MTQ A;  3C4W A;  3HI2 A;  2ES0 A;  1OWA A;  3GA8 A;  4IE0 A;  2QGS A;  5LBQ B;  5LHG B;  4KBM B;  5IYZ E;  2J1D G;  2BZB A;  5JQG E;  4H63 H;  1QUU A;  4J2C A;  3C98 B;  3VU7 H;  4PK5 A;  4GYR A;  2XAJ B;  1MIW A;  4JUY A;  2CMR A;  4HKA A;  2VK9 A;  1YKH B;  4TV9 E;  3PU3 A;  5FXZ A;  1CUN A;  3ZN1 B;  5KDM C;  5E0O A;  3CX7 B;  5LG4 A;  3CWZ B;  3W15 B;  2V7M A;  4MAL A;  2K24 A;  2JMH A;  3CQG B;  3D0T A;  4JLE A;  2CLY B;  3N9P A;  4V1A v;  4N78 D;  4H9R C;  2ACX A;  5EK3 A;  4ZOL E;  2WMO A;  3UUN A;  5JR9 C;  1NAF A;  4PAG A;  3WI3 A;  2E9X B;  3ETV A;  3FXD B;  1IJ5 A;  1UCU A;  4O2A E;  3SRZ A;  3HL6 A;  1D1A A;  3ONX A;  3O1J A;  3RRW A;  2UXX B;  3Q5X A;  4CXX A;  4QX8 B;  3Q9D A;  5TAO A;  2KZ7 B;  4MFR A;  4PFO A;  2HPL A;  5JR9 A;  3PUS A;  2XAQ B;  3LBX A;  4I4T E;  4WBN E;  2Y8D A;  4AXP A;  2Q9Q C;  3CKD A;  4UVC B;  1MND A;  2KT9 A;  3RKO A;  2BVM A;  2XAH B;  2C5I T;  4E7Z A;  3AA1 B;  2KWI B;  2WBL A;  4CI2 B;  4ADZ A;  5LP6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...