4JLEA

Structure of the p. falciparum pfi1780w phist domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
149
structure length
149
Chain Sequence
b'YTAEEINEMINSSNEFINRNDMNIIFSYVHESEREKFKKVEENIFKFIQSIVETYKIPDEYKMRKFKFAHFEMQGYALKQEKFLLEYAFLSLNGKLCERKKFKEVLEYVKREWIEFRKSMFDVWKEKLASEFREHGEMLNQKRKLKQHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHIST
publication title A Plasmodium falciparum PHIST protein binds the virulence factor PfEMP1 and comigrates to knobs on the host cell surface.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Protein binding
total genus 60
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09687 PRESAN Plasmodium RESA N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jleA00
4JLEA
chains in the Genus database with same CATH superfamily
1HNZT 4X20E 2L8KA 1UX5A 4IE5A 5LYJE 4UVBB 3JADA 4M1PA 2UXDT 2CHNA 2J62A 3TLWA 1VCSA 1IAPA 3UUBA 5DJQC 5IYZE 3P4WA 1KF6A 4YJ2E 4B3TT 3EI0A 5HXHA 5LJMA 3AEBA 2HPLA 1XNQT 3AXJA 1UX4A 1IBLT 4GK5E 4NXNT 4CI1B 1MIWA 4QX8B 1YQ3A 2V5DA 4YSZA 3HKCE 4UV9B 1NAFA 4X62T 5JRCA 4U74A 2LKGA 4DR5T 1YKHB 2YK0A 1Z0PA 1H7CA 4BA9A 4H9RC 2CHOA 1SUMB 1HX1B 2D0UA 1UUSA 5JR9C 2P9BA 3SFDA 3OVUA 5GONE 4EYUA 4EGWA 3I0OA 4UR9A 1U4QA 2AE9A 2QGSA 2MTQA 4JI1T 2FJDA 2X51A 3QUJA 5KDMC 3UUXB 3AE7A 3LBXB 2UXNB 2IW5B 2J4GA 3RPUA 2XUEA 4HFHA 2BVMA 3O1JA 5HWXA 5J2TE 2V6YB 2FUPA 4UEMA 3VRBA 4DUZT 2BKNA 1YXRA 2QVAA 3P4SA 4YHHT 3HR0A 3K1SA 4IE7A 4IIJE 3EABA 4JUYA 3AE5A 3RIUC 1BR1A 3AE3A 5JR9B 3OTOT 3ZSTA 1L0VA 4TUYE 3N2KE 5FXWA 4MLKA 1HNWT 1J1JA 3N9QA 3FBZA 3RKGA 3RGLA 2NW7A 1VCTA 5AQQB 3FZHB 5FXZA 2IMLA 2JQ9A 3IEEA 5L2LA 3K8PC 2W4XA 4OX9T 2CWOA 2D5UA 4JI4T 3Q9DA 4DV4T 5A1LA 3CX8B 2BKPA 3AB3B 4BJNA 3PE0A 5AQNB 3N9MA 2LSJA 2YEVC 4DR4T 3FXDB 4PAGA 2K3WA 2EHOC 1E2AA 5DQVA 1XDPA 4IDZA 2V7IA 4LFBT 2XAGB 2BBJA 4HGAA 4EIWA 5L3GB 2CPTA 5FVKA 4NIQA 3JC6C 2M67A 5HXCA 4ADZA 2FBWA 2LT3A 2YDSA 3CX6B 2XZEA 4LF8T 4X1YE 2BVLA 2G0UA 4AKIA 3PURA 1N33T 2VKDA 3WAJA 2ZM2A 1LVKA 4PK6A 1HCIA 2CXDA 5AQSB 4LF9T 4HFEA 3L09A 2XSAA 3P7IA 4YTMA 3VRAA 2PG8A 2SPCA 5LHIB 2JRKA 4IE4A 3UTKA 4G2AA 4PJJA 5JDHA 3O1HA 2KMFA 3FB2A 1NWMX 2Q9QC 3N2GE 2C5KT 1GQEA 1XWMA 1OXZA 2EHOB 3UU8A 4ZXLA 1D0ZA 3LBXA 3FZLB 5L3CB 3WAKA 2V6XA 2E5VA 3AAEB 4N78D 1WRDA 4H9QC 5BMVE 2V6YA 2DWGA 3L8RA 2W61A 4A5XA 5AQOB 2M6BA 3AEAA 5LGNB 4KUMB 2CMRA 3EUHA 1MIYA 5JR9A 1JNRA 2IUBA 4WW0A 4Z90A 3SFEA 3HA4A 5KXJA 2LSGA 2DHRA 3UUNA 4AIUA 3EHZA 2FJAA 2X67A 2VB6A 3LG7A 3U3IA 2UUAT 1IZNB 4ZI3C 2J47A 2Q9QB 2XASB 4TNWA 3QNUA 4PK5A 2WS3A 3RIFA 4ILUA 2IIUA 3RC8A 4DIDB 5F3JA 2XM1A 2N2NA 2XAHB 4OHFA 4TN7B 5EK4A 3I1AA 5ABHA 4JI6T 4GYRA 2CBJA 3PTRB 4ZZBA 3TKLB 4KHZF 5CA0E 1FMVA 4AKHA 5AFUL 3I0QA 5L4EA 2E9XD 3IHRA 2XAFB 4LMJA 2V5CA 3PUGA 2UXCT 3L3PA 3CWZB 3PUSA 3BK9A 4A56A 1SE7A 2WDRA 4UIGA 1XZYA 3F31A 2LM9A 4ZI2D 3AEDA 5EK3A 3IBPA 3UFGA 3O9XA 3ZKRA 1MIVA 2YN6A 3KBTA 4TWFA 3ZMUB 3RC3A 4PFPA 3VKGA 3B57A 4U3CA 3X1DA 4CXWA 5HEGA 5C2TA 3P8CD 3GN5B 3P4RA 4CI3B 1E1HB 1FMWA 4AI6A 2XTLA 5IUXA 3GMIA 2LRLA 1VRBA 2Y48B 4C90A 4K0KT 2F4VT 2MOZA 4JEHB 2YDQA 3HL6A 4DMWA 3AEEA 4O4IE 3BQLA 5J1GA 4G63A 4PNIA 1U5PA 5CB4E 3HKEE 4QXHB 2XQ6A 1T98A 5FY7A 4PFOA 2PBIA 3EAMA 4F8HA 3PUVF 2LSYA 2JQHA 4O4JE 3P4PA 3KV4A 2LSKA 3LK3B 4GKJT 2I59A 4L0RA 2Y6XA 2UUCT 4AQYT 4QH5A 3ETUA 5FY0A 3UU6A 3UU4A 2HN1A 3E22E 4GYSA 5AQLB 4CI2B 2Q9QA 4H63H 3E08A 4P09A 5EK2A 4DV5T 2KWIB 3N9OA 3R84B 5ABEA 4WBOA 4CN6A 3CKDA 1MNDA 3ZSSA 4IL4A 1NEKA 4HWIB 4HE8A 4PK4A 2FJBA 4GKKT 2M6IA 2BS3A 3M65A 4HTEA 2CE7A 3RIAA 2DL1A 3PJAJ 5FY1A 4EAHA 4GOUA 5ETWA 5JTGA 4DBRA 1R8IA 2NP9A 2FJEA 1WFDA 1T72A 2ZM0A 4IT4A 3N5LA 2K48A 3G06A 4YFSA 1EZ3A 4P1NA 3T1YT 2YKSA 4ASKA 3C51A 5HCJA 2CXLA 1HF8A 1HR0T 2VWAA 3I9YA 2ZM8A 2LEHA 4DR7T 2DI4A 2DLRA 2WU2A 5L3DB 1VOMA 5LBQB 4ZS2A 4CXYA 1T7SA 2X66A 4K0UA 2BKOA 4EZ4A 4U31A 4I55E 3GN5A 4KX6A 2ODUA 5JDLA 3UUMA 2ZM6T 3I9WA 2PFVA 2WDQA 2NW9A 5JQGE 2NR4A 5FL0A 5FMNA 3Q2MA 4YSYA 4DO0A 1CHUA 4MBQA 1MMNA 5TAOA 1N34T 3AE2A 1IJ5A 5LMUT 2XQYA 1KEYA 3PJAA 3LJCA 2I0MA 4YTPA 5JREA 4CN1A 3ZT7A 4A98A 4FI5A 3ZYMA 3EVYA 2CEAA 2LOPA 4TZ4C 2VQET 3H3MA 2MYSA 2CLYC 2ZLYA 2HN2A 5LBMA 3ZEFB 2UU9T 1WR0A 3AA7B 4JLEA 1KNRA 2X9XA 2ACZA 4E7SA 3ZJ2A 4LMLA 4WZXA 5FXXA 4KP3C 3VR9A 2KLQA 4H9NC 5LP6E 2AXDS 3OYXA 5JDMA 4Z91A 2WDVA 4LMKA 4YHJA 2JIWA 2NWBA 2DCFA 4WBNE 4JI2T 2H7OA 4HKAA 2XQ5A 5HXSA 3LK42 3P50A 4DUYT 4IDPA 2CCQA 2W0GA 5FXVA 1W09A 2VVNA 2QRXA 3PDYA 2VKOA 1OEDE 2H3RA 3AVRA 1D1CA 3ZN0B 2CLYB 4P0BA 3RYFE 2A2FX 1HX8A 3ZT5A 2V7JA 4HFIA 1HNXT 4EOZB 1E7PA 2WQYA 5CFBA 2CM0A 1Y01A 2WM9A 5LGUB 3MJXA 2IAKA 4IHJE 2IDOB 4KBMB 5LG3A 3CK6A 3NRXA 5ABFB 3PUAA 1US7B 2LM2A 3RKOA 5HEJA 2V8SV 2YDRA 4ISTA 4I50E 3IF8B 3QOFA 2WU5A 1IJ6A 3VU7H 4DV2T 4KI0F 2VKHA 3SOLA 5AQUB 3SWHA 4QX7B 2H89A 2KINB 2N9DA 2XM2A 2BS4A 3TLVA 2WP9A 3IA3A 4EEDA 1IBMT 1LRZA 1B7TA 2X0HA 4QXBB 1ZEEA 3N2OA 2VKJA 3MKDA 2KSRA 1JNZA 1Y64B 1J5ET 2VL0A 4O2AE 1N36T 2VL8A 2MBGA 2QA7A 4UXNB 5LOVE 2NOXA 4U33A 3JC6D 1OEDC 3ZMZB 2LOSA 2H7VC 2XHEB 5DQWA 4EB6E 4U7YA 3KINB 4B6XA 2XPKA 2NW8A 3ZLIA 4DV1T 1YW0A 3MXZA 1I94T 4IDOA 4H63V 1D0YA 3ONJA 2DNXA 3NRYA 1D1AA 4EZHA 3AE1A 2E8IA 1S35A 4CZZB 4L9IA 4TX5A 2VK9A 5ADXL 2Q9QD 2IC6A 1KNPA 4PJNA 5CA1E 2E9XC 4YJ3E 2V7KA 4EYYR 4O4LE 4U72A 4JI3T 2VQFT 3UULA 5AQTB 4XZCA 2YU1A 4H9OC 3B5MA 2R6GF 2YINA 2WCAA 3BQIA 1QSDA 2UXXB 4O4HE 2K24A 2HPJA 2KNDA 4AKRB 3M3ZB 5FKYA 3H3AA 3UT5E 3ZC0A 3TLUA 2X9YA 1OEDB 2RPAA 3OBVE 4X1KE 3VKHA 3NBXX 4QKNA 3UFEA 4Z8XA 3N9LA 2BDEA 4TV8E 5ABFA 3TLSA 2NTYA 3VR8A 3EDUA 3RIUA 2CA5A 3AA0B 4UVCB 5AQJB 1MMDA 3VHLA 4UELA 3FZFB 1XMQT 3GA8A 4ZI3D 2A9UA 5AQIB 4DV0T 2E9XB 4ANJA 4GK0E 4YTNA 4LF4T 4WNKA 4V1Av 4LFAT 4UF0B 5LGTB 5FNVE 4QH1A 3ZPOA 2BG9C 4IE6A 3A5XA 4ZS3A 1W0AA 3AVSA 5AQMB 3J9X1 2A3DA 3S4UA 4HWCA 4DV7T 2LHRA 2XQAA 3O1IA 2EHOA 4HFVA 2I6HA 2WMNA 1HTJF 3Q5DA 4JI8T 1MMAA 4ILBA 1XMOT 4DR1T 3R6NA 3QK6A 4EXTA 2KT9A 4X64T 5LCYA 2LSIA 3RX6A 2C0SA 4BJMA 2MAWA 4B3ST 3ZT6A 3C64A 1WCRA 2V7MA 2X9WA 3FZKB 3W15B 5AQHB 4C91A 1FEWA 1ZKEA 2ACXA 1ZP0A 4TV9E 2WWUA 3Q5XA 2D2SA 3DTOA 2BG9B 3KVAA 4IDNA 4I4TE 3F2EA 3FXEB 3ESLA 5F5WA 3ZJ1A 3TLTA 3FBLA 1WYBA 3AE6A 2ES0A 5KMGP 3C50A 2VURA 2JQQA 1OEDA 1MNEA 4XAXB 5AQGB 3C98B 3RYHE 3RI5A 4HEAA 1BR4A 1S94A 2KZ7B 3K3OA 2WB5A 4YSXA 2H88A 2PJQA 3A7MA 1UCUA 3MZKB 3CQCB 4O2BE 3ZC1A 3GWHA 3V5SA 1N32T 2JQKA 3MACA 1WYCA 4HWHA 1QUUA 3AAAB 1OWAA 4E7ZA 4JYAT 2B1EA 3EDVA 3K3QC 2LRKA 2E9XA 1J5WA 5C8YE 4JI7T 3CX7B 4UVAB 4UF0A 1ZV4X 5J2UE 5AQPB 3N9PA 1T8BA 3AEFA 3PUQA 2V1DB 2JPFA 2W63A 1FJGT 2ZMAA 2J1DG 2D9DA 3RQWA 5H6RB 3CMLA 2XAJB 2XQ9A 1KFYA 2BS2A 4OYJA 1XDOA 2W2UA 3PU3A 4ILAA 2WZIA 1YQ4A 3RYIE 2VVSA 2XY8B 3ZYKA 4DVDA 4KMCA 4NPPA 3NZQA 3Q5EA 5HXEA 2K5BB 3P4QA 5KX5E 4DR6T 1ZHCA 1X9BA 5HEHA 3RQUA 4U7IA 5JH7E 4IE0A 5AQKB 4MFRA 1UGOA 4U2YA 2BZBA 2X68A 1W9RA 3FZMB 2BG9A 2A72A 4X65T 3CQXC 4QWNB 4EEBA 1M62A 2XQ3A 5LB7B 3QB5A 2X0LB 1HS7A 2WAUA 4X5TA 1LKXA 3NKZA 3ZMSB 3OPCA 4QXCB 4AXPA 2W62A 4MHCA 3PV0F 3KV5A 3JAFA 5AQRB 5LG4A 5HYAA 3MA9A 3WI3A 2LKHA 2DWKA 2V7LA 1O3XA 4ZEYA 4Q25A 5FYMA 1DU2A 3CPZA 4NUVA 3D0TA 5F8PA 4CQIA 1Z8UA 2UUBT 4DNDA 4ZZCA 3PUXF 4I0UA 3NVOA 2GK9A 1M7KA 4MALA 2XQ4A 5L3EB 2XQ7A 4DR3T 4ZI7E 1CUNA 2W00A 1G8XA 3ETVA 5CJ5A 3UU5A 3ZN1B 3PU8A 4JI5T 1G73A 4AQFC 4P0AA 5AQVB 5LHHB 5H6QB 3RRCA 5HEUA 3KV6A 4J2CA 4CXXA 4HWDA 5LMNT 4X66T 4NXMT 1D1BA 3MK7C 3DP7A 4B3RT 3ZMVB 2JMKA 4PJLA 5LHGB 3QB5K 2XAQB 4TWDA 3KV9A 5HCMA 1HG2A 1X79A 5FVLA 3CQGB 2OA5A 3V5UA 5AQFB 4QH4A 1XNRT 3ZYLA 2L9QA 2MPKA 2QYWA 5IHYA 2IC9A 2Z6EA 4DV3T 2XJ7A 3PUWF 5JDFA 2X9HA 4NUUA 1WLXA 3PUYF 3ANWB 5EZYE 2UXBT 4FJOA 3KBUA 3LDQB 3JAEA 2EHOD 3C4XA 4IGUA 3RRWA 4H9SE 4IDQA 2WSSV 5IWAT 3HI2A 4TWHA 5HAXA 4I43B 3NWIA 1I6ZA 3DJBA 2K9AA 3BQKA 4WYVA 1WR6A 1UURA 4LF6T 3N9NA 4HN9A 1W0BA 4BAYB 1HG5A 2RP4A 3ABVA 4O8SA 2E5LT 2E2AA 5HXRA 3T8OA 2CBIA 2D0TA 2W66A 4IREA 2BG9E 1BR0A 1D0XA 3A8YC 4DV6T 5J0ZA 4OK0A 4KHPT 4YT0A 3ZCIA 4L5GA 3LK2B 4OFZA 4U2ZA 5FL1A 3CVRA 4AISA 1IBKT 3J7Yq 3AE8A 3HKDE 3RYCE 4JV5T 3OYZA 3F57A 4UV8B 3AA1B 4ZHQE 3C4ZA 3SS1A 4DBQA 5LXTE 5LJNA 4IL9A 4ZI2C 2HH7A 5ABGA 2OV9A 3RH3A 5JDQA 2LJLA 3L39A 5JVDE 2JMHA 4LFCT 5CGMA 4ZOLE 5E0OA 3KFWX 3RLFF 1UK5A 2ODVA 2WBLA 5C3JA 2LLYA 3ZCJA 4TNVA 4H9PC 4JEUB 2RA1A 2YU2A 5FP3A 3E0ZA 3AEGA 2PTFA 4OYKA 4YLHA 5L3BB 3FHNA 2WZHA 2LE8A 4HFCA 3UQ4A 1YD8G 2CWYA 5M4YA 2BBHA 3KVBA 3Q5WA 4CN4A 4HFDA 2CRBA 3LFMA 4JI0T 1BR2A 3PUZF 3AECA 1V9DA 3ANWA 2CXFA 4PW8A 2VASA 2B76A 4YY3T 3SRZA 5JDNA 4AQFA 4JBWF 5LNKA 4X1IE 3K3NA 2HHHT 3AXJB 2Y8DA 4ILCA 2XQ8A 3C4WA 4ISSA 3RHWA 4PJMA 4A97A 5BR8T 3H37A 2X0YA 3U78A 1MMGA 2WMOA 2XSBA 3ONLC 5JRCB 3HKBE 5DABA 4B3MT 3OJAA 1AJ3A 1ZOYA 2IHR1 4YXDA 2V26A 1FIOA 2NTXA 1KK7A 4LF7T 3CIRA 1LVFA 4AKGA 1HFAA 5JDGA 4HFBA 2OLTA 4AQGA 1NENA 3O4XE 4F6RC 2JJ9A 2WWVA 4DR2T 1KNZA 1SA0E 3RF1A 3ZMTB 2KXPB 5L47A 2YOEA 3JCFA 3T1HT 4DMVA 2N1GA 4EV6A 5HEOA 5L3FB 2C5IT 2L3LA 4GIWA 5LA6E 4HWFA 4XBFB 2WY2A 1QLBA 3KDSE 3UU3A 2KWHA 4QHOA 4AKLA 3OKQA 3AAIA 3AE9A 3AA6B 5L4HA 4ERRA 5HWYA 3QC9A 1YKEB 3AE4A 4LF5T 2C5JA 3UQ7A 4COFA 2W67A 3LSVA 3B13A 2LHNA 3ONXA 1SHZC 3NZPA
chains in the Genus database with same CATH topology
2V7LA 3KBTA 1O3XA 3JC6D 4X20E 2L8KA 3ZMUB 1UX5A 3RC3A 3ZMZB 4IE5A 2LOSA 5FYMA 2H7VC 5LYJE 4UVBB 4PFPA 2XHEB 3CPZA 4NUVA 4M1PA 3D0TA 5DQWA 3B57A 5F8PA 4CQIA 4EB6E 3VKGA 4DNDA 3KINB 4B6XA 4CXWA 1IAPA 2NW8A 3P8CD 5DJQC 2GK9A 3ZLIA 1YW0A 3GN5B 5IYZE 3MXZA 4CI3B 4MALA 1E1HB 4YJ2E 1FMWA 4H63V 4AI6A 1D0YA 2XTLA 5HXHA 5LJMA 3GMIA 1VRBA 2Y48B 2DNXA 3NRYA 1D1AA 4C90A 2HPLA 4EZHA 2MOZA 4JEHB 5L3EB 2E8IA 1S35A 4CZZB 4ZI7E 1CUNA 1UX4A 2W00A 4L9IA 1G8XA 4TX5A 2VK9A 3ETVA 3HL6A 4GK5E 4DMWA 5ADXL 3ZN1B 3PU8A 4CI1B 4O4IE 2Q9QD 3BQLA 5J1GA 4G63A 1MIWA 1G73A 2IC6A 4PNIA 4QX8B 4AQFC 1U5PA 4PJNA 5CA1E 4P0AA 5CB4E 2E9XC 5LHHB 4YJ3E 2V7KA 3HKEE 4EYYR 4QXHB 5H6QB 5FY7A 1T98A 4O4LE 4U72A 4PFOA 2PBIA 3HKCE 3KV6A 4J2CA 4UV9B 3RRCA 1NAFA 3UULA 4XZCA 2LSYA 2YU1A 4CXXA 4O4JE 4H9OC 5JRCA 4U74A 3KV4A 2YINA 2LSKA 3LK3B 1YKHB 2YK0A 1Z0PA 3BQIA 1H7CA 1QSDA 1D1BA 4BA9A 2UXXB 4O4HE 2K24A 2HPJA 2KNDA 4AKRB 2I59A 3MK7C 3DP7A 3ZMVB 4H9RC 3H3AA 2JMKA 2Y6XA 4L0RA 4PJLA 3UT5E 5LHGB 3ZC0A 2X9YA 3ETUA 2D0UA 2XAQB 3OBVE 5FY0A 3KV9A 5JR9C 2P9BA 1HG2A 1X79A 4X1KE 3CQGB 3E22E 3VKHA 3NBXX 2OA5A 4QKNA 3UFEA 3V5UA 4GYSA 4Z8XA 4CI2B 2Q9QA 3N9LA 4H63H 2BDEA 3E08A 4TV8E 3ZYLA 2L9QA 4P09A 5EK2A 5IHYA 2KWIB 5GONE 4EYUA 2IC9A 3N9OA 3R84B 2Z6EA 2NTYA 3I0OA 1U4QA 4WBOA 3EDUA 5JDFA 3CKDA 1MNDA 2X9HA 4NUUA 1WLXA 2CA5A 2QGSA 4HE8A 3ANWB 5EZYE 4PK4A 3AA0B 2MTQA 4FJOA 3KBUA 2X51A 4UVCB 3QUJA 5KDMC 1MMDA 3VHLA 3M65A 4HTEA 3UUXB 4UELA 2EHOD 2CE7A 3C4XA 3LBXB 4IGUA 3RRWA 3GA8A 4H9SE 4ZI3D 2UXNB 2IW5B 5FY1A 4EAHA 3RPUA 4GOUA 2WSSV 2XUEA 5ETWA 4DBRA 2NP9A 2BVMA 3HI2A 2E9XB 3O1JA 5HWXA 5HAXA 5J2TE 4ANJA 4I43B 2ZM0A 4GK0E 3N5LA 3DJBA 4UEMA 4WNKA 4V1Av 2K48A 2K9AA 3BQKA 4UF0B 4YFSA 5LGTB 1EZ3A 1WR6A 5FNVE 3ZPOA 3N9NA 4IE6A 4HN9A 4ASKA 3A5XA 3HR0A 4ZS3A 3C51A 4IE7A 4IIJE 3AVSA 2CXLA 3J9X1 2A3DA 4JUYA 3S4UA 4BAYB 1HG5A 1BR1A 2LHRA 5JR9B 1HF8A 2RP4A 3O1IA 2VWAA 2EHOA 3I9YA 2ZM8A 2LEHA 4O8SA 4TUYE 3N2KE 2DI4A 4HFVA 4MLKA 5FXWA 3N9QA 5HXRA 3T8OA 2DLRA 2WMNA 1HTJF 3FBZA 5L3DB 2D0TA 1VOMA 2NW7A 1MMAA 5LBQB 1BR0A 4ZS2A 4CXYA 5FXZA 3R6NA 3QK6A 4EXTA 2KT9A 1D0XA 3IEEA 5LCYA 5L2LA 3K8PC 2X66A 4OK0A 2CWOA 4K0UA 2D5UA 4EZ4A 2LSIA 3ZCIA 3RX6A 2C0SA 4L5GA 3LK2B 4OFZA 4BJMA 4I55E 3GN5A 2ODUA 5JDLA 3UUMA 3CVRA 3I9WA 3Q9DA 2PFVA 3C64A 2NW9A 2V7MA 2X9WA 5A1LA 3CX8B 3J7Yq 3AB3B 3W15B 4BJNA 3PE0A 5JQGE 3HKDE 3RYCE 4C91A 3N9MA 2LSJA 2YEVC 3OYZA 5FMNA 3F57A 3Q2MA 1FEWA 1ZKEA 2ACXA 3FXDB 3AA1B 4PAGA 4UV8B 4ZHQE 4TV9E 2WWUA 3C4ZA 3SS1A 4DBQA 4DO0A 5LXTE 2EHOC 4MBQA 1MMNA 5LJNA 5TAOA 4ZI2C 2HH7A 3Q5XA 5DQVA 1IJ5A 4IDZA 2D2SA 3DTOA 2V7IA 3RH3A 5JDQA 2XQYA 3KVAA 4I4TE 2LJLA 2XAGB 3F2EA 4HGAA 3FXEB 5JVDE 2JMHA 3ESLA 4ZOLE 4EIWA 5L3GB 5E0OA 3LJCA 5JREA 3JC6C 2M67A 3KFWX 5HXCA 4ADZA 4FI5A 3ZJ1A 3ZYMA 2LT3A 2ODVA 2WBLA 3EVYA 3CX6B 3FBLA 4X1YE 2CEAA 2BVLA 1WYBA 2LOPA 2G0UA 4AKIA 3PURA 3ZCJA 4TZ4C 4H9PC 4JEUB 2ES0A 2VKDA 5KMGP 2RA1A 2ZM2A 3C50A 2JQQA 3WAJA 1LVKA 2YU2A 5FP3A 4PK6A 1HCIA 2CXDA 3E0ZA 1MNEA 2MYSA 2CLYC 4XAXB 3C98B 4OYKA 3L09A 3RYHE 2ZLYA 4YLHA 3P7IA 4HEAA 5LBMA 1BR4A 5L3BB 2PG8A 2SPCA 3ZEFB 2JRKA 4IE4A 5LHIB 3FHNA 3UTKA 2LE8A 1S94A 2KZ7B 3K3OA 1YD8G 2CWYA 4G2AA 4PJJA 5M4YA 5JDHA 3O1HA 3KVBA 3Q5WA 3AA7B 4JLEA 2KMFA 3FB2A 2X9XA 1NWMX 2PJQA 1UCUA 3LFMA 3MZKB 3ZJ2A 4E7SA 2Q9QC 3N2GE 1BR2A 3CQCB 1V9DA 4O2BE 5FXXA 2C5KT 3ZC1A 3ANWA 3GWHA 3V5SA 3MACA 4KP3C 1WYCA 1QUUA 1OXZA 3AAAB 2KLQA 1OWAA 4H9NC 5LP6E 2CXFA 2EHOB 3OYXA 4PW8A 2VASA 5JDMA 1D0ZA 4E7ZA 2B1EA 3LBXA 5L3CB 3WAKA 3EDVA 3K3QC 3SRZA 5JDNA 4YHJA 4AQFA 5LNKA 2NWBA 4X1IE 3AAEB 3K3NA 2E9XA 4N78D 2Y8DA 1WRDA 2DCFA 3C4WA 4H9QC 4ISSA 5BMVE 5C8YE 4PJMA 4WBNE 2DWGA 3CX7B 4UVAB 2H7OA 3H37A 4UF0A 2W61A 1ZV4X 4HKAA 3U78A 5J2UE 5HXSA 1MMGA 3LK42 2WMOA 3N9PA 5LGNB 2CCQA 2W0GA 5FXVA 3PUQA 2V1DB 2JPFA 2W63A 2ZMAA 2VKOA 3PDYA 2CMRA 4KUMB 3EUHA 2J1DG 1MIYA 3HKBE 5DABA 2H3RA 5JRCB 3OJAA 3AVRA 5JR9A 5H6RB 1D1CA 3CMLA 3ZN0B 2CLYB 2XAJB 4P0BA 4WW0A 1AJ3A 3RYFE 4OYJA 3PU3A 2A2FX 3HA4A 1HX8A 2LSGA 3RYIE 2V26A 2V7JA 2DHRA 1FIOA 3UUNA 2NTXA 1KK7A 4EOZB 1LVFA 4AKGA 2X67A 1HFAA 2VB6A 2CM0A 3ZYKA 5JDGA 3LG7A 3U3IA 1IZNB 4DVDA 2WM9A 5LGUB 3MJXA 4ZI3C 4AQGA 3O4XE 4F6RC 4KMCA 2Q9QB 2JJ9A 2XASB 3NZQA 2IAKA 4IHJE 5HXEA 2K5BB 4KBMB 3NRXA 4PK5A 3PUAA 5KX5E 1KNZA 1SA0E 4ILUA 1ZHCA 1US7B 3RC8A 3ZMTB 3RKOA 5F3JA 2KXPB 5JH7E 2N2NA 2XAHB 4OHFA 4IE0A 4TN7B 4MFRA 4ISTA 4I50E 3IF8B 5EK4A 1IJ6A 3VU7H 4DMVA 2BZBA 2N1GA 2VKHA 5L3FB 2X68A 3I1AA 3SOLA 2C5IT 2L3LA 3PTRB 4GIWA 4GYRA 4QX7B 5LA6E 3SWHA 3TKLB 5CA0E 1FMVA 4XBFB 4AKHA 2KINB 2N9DA 5AFUL 3KDSE 2A72A 3I0QA 2KWHA 2E9XD 4QHOA 4AKLA 3CQXC 3IHRA 4QWNB 3OKQA 2XAFB 3AAIA 3AA6B 1LRZA 3PUGA 1B7TA 4ERRA 3L3PA 5HWYA 2X0LB 3CWZB 3PUSA 4QXBB 1HS7A 1ZEEA 2WAUA 3N2OA 3QC9A 1LKXA 3BK9A 4A56A 1YKEB 2VKJA 3MKDA 4UIGA 3ZMSB 2C5JA 3F31A 2LM9A 4ZI2D 4QXCB 4AXPA 5EK3A 2W62A 4MHCA 3IBPA 3KV5A 1Y64B 3O9XA 4O2AE 3B13A 2LHNA 2VL8A 3ONXA 2MBGA 2QA7A 1MIVA 4UXNB 5HYAA 5LG4A 1SHZC 3MA9A 3NZPA 3WI3A 2DWKA 5LOVE 2NOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLE A; 
#chains in the Genus database with same CATH topology
 1HNZ T;  4X20 E;  2L8K A;  1UX5 A;  4IE5 A;  5LYJ E;  4UVB B;  3JAD A;  4M1P A;  2UXD T;  2CHN A;  2J62 A;  3TLW A;  1VCS A;  1IAP A;  3UUB A;  5DJQ C;  5IYZ E;  3P4W A;  1KF6 A;  4YJ2 E;  4B3T T;  3EI0 A;  5HXH A;  5LJM A;  3AEB A;  2HPL A;  1XNQ T;  3AXJ A;  1UX4 A;  1IBL T;  4GK5 E;  4NXN T;  4CI1 B;  1MIW A;  4QX8 B;  1YQ3 A;  2V5D A;  4YSZ A;  3HKC E;  4UV9 B;  1NAF A;  4X62 T;  5JRC A;  4U74 A;  2LKG A;  4DR5 T;  1YKH B;  2YK0 A;  1Z0P A;  1H7C A;  4BA9 A;  4H9R C;  2CHO A;  1SUM B;  1HX1 B;  2D0U A;  1UUS A;  5JR9 C;  2P9B A;  3SFD A;  3OVU A;  5GON E;  4EYU A;  4EGW A;  3I0O A;  4UR9 A;  1U4Q A;  2AE9 A;  2QGS A;  2MTQ A;  4JI1 T;  2FJD A;  2X51 A;  3QUJ A;  5KDM C;  3UUX B;  3AE7 A;  3LBX B;  2UXN B;  2IW5 B;  2J4G A;  3RPU A;  2XUE A;  4HFH A;  2BVM A;  3O1J A;  5HWX A;  5J2T E;  2V6Y B;  2FUP A;  4UEM A;  3VRB A;  4DUZ T;  2BKN A;  1YXR A;  2QVA A;  3P4S A;  4YHH T;  3HR0 A;  3K1S A;  4IE7 A;  4IIJ E;  3EAB A;  4JUY A;  3AE5 A;  3RIU C;  1BR1 A;  3AE3 A;  5JR9 B;  3OTO T;  3ZST A;  1L0V A;  4TUY E;  3N2K E;  5FXW A;  4MLK A;  1HNW T;  1J1J A;  3N9Q A;  3FBZ A;  3RKG A;  3RGL A;  2NW7 A;  1VCT A;  5AQQ B;  3FZH B;  5FXZ A;  2IML A;  2JQ9 A;  3IEE A;  5L2L A;  3K8P C;  2W4X A;  4OX9 T;  2CWO A;  2D5U A;  4JI4 T;  3Q9D A;  4DV4 T;  5A1L A;  3CX8 B;  2BKP A;  3AB3 B;  4BJN A;  3PE0 A;  5AQN B;  3N9M A;  2LSJ A;  2YEV C;  4DR4 T;  3FXD B;  4PAG A;  2K3W A;  2EHO C;  1E2A A;  5DQV A;  1XDP A;  4IDZ A;  2V7I A;  4LFB T;  2XAG B;  2BBJ A;  4HGA A;  4EIW A;  5L3G B;  2CPT A;  5FVK A;  4NIQ A;  3JC6 C;  2M67 A;  5HXC A;  4ADZ A;  2FBW A;  2LT3 A;  2YDS A;  3CX6 B;  2XZE A;  4LF8 T;  4X1Y E;  2BVL A;  2G0U A;  4AKI A;  3PUR A;  1N33 T;  2VKD A;  3WAJ A;  2ZM2 A;  1LVK A;  4PK6 A;  1HCI A;  2CXD A;  5AQS B;  4LF9 T;  4HFE A;  3L09 A;  2XSA A;  3P7I A;  4YTM A;  3VRA A;  2PG8 A;  2SPC A;  5LHI B;  2JRK A;  4IE4 A;  3UTK A;  4G2A A;  4PJJ A;  5JDH A;  3O1H A;  2KMF A;  3FB2 A;  1NWM X;  2Q9Q C;  3N2G E;  2C5K T;  1GQE A;  1XWM A;  1OXZ A;  2EHO B;  3UU8 A;  4ZXL A;  1D0Z A;  3LBX A;  3FZL B;  5L3C B;  3WAK A;  2V6X A;  2E5V A;  3AAE B;  4N78 D;  1WRD A;  4H9Q C;  5BMV E;  2V6Y A;  2DWG A;  3L8R A;  2W61 A;  4A5X A;  5AQO B;  2M6B A;  3AEA A;  5LGN B;  4KUM B;  2CMR A;  3EUH A;  1MIY A;  5JR9 A;  1JNR A;  2IUB A;  4WW0 A;  4Z90 A;  3SFE A;  3HA4 A;  5KXJ A;  2LSG A;  2DHR A;  3UUN A;  4AIU A;  3EHZ A;  2FJA A;  2X67 A;  2VB6 A;  3LG7 A;  3U3I A;  2UUA T;  1IZN B;  4ZI3 C;  2J47 A;  2Q9Q B;  2XAS B;  4TNW A;  3QNU A;  4PK5 A;  2WS3 A;  3RIF A;  4ILU A;  2IIU A;  3RC8 A;  4DID B;  5F3J A;  2XM1 A;  2N2N A;  2XAH B;  4OHF A;  4TN7 B;  5EK4 A;  3I1A A;  5ABH A;  4JI6 T;  4GYR A;  2CBJ A;  3PTR B;  4ZZB A;  3TKL B;  4KHZ F;  5CA0 E;  1FMV A;  4AKH A;  5AFU L;  3I0Q A;  5L4E A;  2E9X D;  3IHR A;  2XAF B;  4LMJ A;  2V5C A;  3PUG A;  2UXC T;  3L3P A;  3CWZ B;  3PUS A;  3BK9 A;  4A56 A;  1SE7 A;  2WDR A;  4UIG A;  1XZY A;  3F31 A;  2LM9 A;  4ZI2 D;  3AED A;  5EK3 A;  3IBP A;  3UFG A;  3O9X A;  3ZKR A;  1MIV A;  2YN6 A;  3KBT A;  4TWF A;  3ZMU B;  3RC3 A;  4PFP A;  3VKG A;  3B57 A;  4U3C A;  3X1D A;  4CXW A;  5HEG A;  5C2T A;  3P8C D;  3GN5 B;  3P4R A;  4CI3 B;  1E1H B;  1FMW A;  4AI6 A;  2XTL A;  5IUX A;  3GMI A;  2LRL A;  1VRB A;  2Y48 B;  4C90 A;  4K0K T;  2F4V T;  2MOZ A;  4JEH B;  2YDQ A;  3HL6 A;  4DMW A;  3AEE A;  4O4I E;  3BQL A;  5J1G A;  4G63 A;  4PNI A;  1U5P A;  5CB4 E;  3HKE E;  4QXH B;  2XQ6 A;  1T98 A;  5FY7 A;  4PFO A;  2PBI A;  3EAM A;  4F8H A;  3PUV F;  2LSY A;  2JQH A;  4O4J E;  3P4P A;  3KV4 A;  2LSK A;  3LK3 B;  4GKJ T;  2I59 A;  4L0R A;  2Y6X A;  2UUC T;  4AQY T;  4QH5 A;  3ETU A;  5FY0 A;  3UU6 A;  3UU4 A;  2HN1 A;  3E22 E;  4GYS A;  5AQL B;  4CI2 B;  2Q9Q A;  4H63 H;  3E08 A;  4P09 A;  5EK2 A;  4DV5 T;  2KWI B;  3N9O A;  3R84 B;  5ABE A;  4WBO A;  4CN6 A;  3CKD A;  1MND A;  3ZSS A;  4IL4 A;  1NEK A;  4HWI B;  4HE8 A;  4PK4 A;  2FJB A;  4GKK T;  2M6I A;  2BS3 A;  3M65 A;  4HTE A;  2CE7 A;  3RIA A;  2DL1 A;  3PJA J;  5FY1 A;  4EAH A;  4GOU A;  5ETW A;  5JTG A;  4DBR A;  1R8I A;  2NP9 A;  2FJE A;  1WFD A;  1T72 A;  2ZM0 A;  4IT4 A;  3N5L A;  2K48 A;  3G06 A;  4YFS A;  1EZ3 A;  4P1N A;  3T1Y T;  2YKS A;  4ASK A;  3C51 A;  5HCJ A;  2CXL A;  1HF8 A;  1HR0 T;  2VWA A;  3I9Y A;  2ZM8 A;  2LEH A;  4DR7 T;  2DI4 A;  2DLR A;  2WU2 A;  5L3D B;  1VOM A;  5LBQ B;  4ZS2 A;  4CXY A;  1T7S A;  2X66 A;  4K0U A;  2BKO A;  4EZ4 A;  4U31 A;  4I55 E;  3GN5 A;  4KX6 A;  2ODU A;  5JDL A;  3UUM A;  2ZM6 T;  3I9W A;  2PFV A;  2WDQ A;  2NW9 A;  5JQG E;  2NR4 A;  5FL0 A;  5FMN A;  3Q2M A;  4YSY A;  4DO0 A;  1CHU A;  4MBQ A;  1MMN A;  5TAO A;  1N34 T;  3AE2 A;  1IJ5 A;  5LMU T;  2XQY A;  1KEY A;  3PJA A;  3LJC A;  2I0M A;  4YTP A;  5JRE A;  4CN1 A;  3ZT7 A;  4A98 A;  4FI5 A;  3ZYM A;  3EVY A;  2CEA A;  2LOP A;  4TZ4 C;  2VQE T;  3H3M A;  2MYS A;  2CLY C;  2ZLY A;  2HN2 A;  5LBM A;  3ZEF B;  2UU9 T;  1WR0 A;  3AA7 B;  4JLE A;  1KNR A;  2X9X A;  2ACZ A;  4E7S A;  3ZJ2 A;  4LML A;  4WZX A;  5FXX A;  4KP3 C;  3VR9 A;  2KLQ A;  4H9N C;  5LP6 E;  2AXD S;  3OYX A;  5JDM A;  4Z91 A;  2WDV A;  4LMK A;  4YHJ A;  2JIW A;  2NWB A;  2DCF A;  4WBN E;  4JI2 T;  2H7O A;  4HKA A;  2XQ5 A;  5HXS A;  3LK4 2;  3P50 A;  4DUY T;  4IDP A;  2CCQ A;  2W0G A;  5FXV A;  1W09 A;  2VVN A;  2QRX A;  3PDY A;  2VKO A;  1OED E;  2H3R A;  3AVR A;  1D1C A;  3ZN0 B;  2CLY B;  4P0B A;  3RYF E;  2A2F X;  1HX8 A;  3ZT5 A;  2V7J A;  4HFI A;  1HNX T;  4EOZ B;  1E7P A;  2WQY A;  5CFB A;  2CM0 A;  1Y01 A;  2WM9 A;  5LGU B;  3MJX A;  2IAK A;  4IHJ E;  2IDO B;  4KBM B;  5LG3 A;  3CK6 A;  3NRX A;  5ABF B;  3PUA A;  1US7 B;  2LM2 A;  3RKO A;  5HEJ A;  2V8S V;  2YDR A;  4IST A;  4I50 E;  3IF8 B;  3QOF A;  2WU5 A;  1IJ6 A;  3VU7 H;  4DV2 T;  4KI0 F;  2VKH A;  3SOL A;  5AQU B;  3SWH A;  4QX7 B;  2H89 A;  2KIN B;  2N9D A;  2XM2 A;  2BS4 A;  3TLV A;  2WP9 A;  3IA3 A;  4EED A;  1IBM T;  1LRZ A;  1B7T A;  2X0H A;  4QXB B;  1ZEE A;  3N2O A;  2VKJ A;  3MKD A;  2KSR A;  1JNZ A;  1Y64 B;  1J5E T;  2VL0 A;  4O2A E;  1N36 T;  2VL8 A;  2MBG A;  2QA7 A;  4UXN B;  5LOV E;  2NOX A;  4U33 A;  3JC6 D;  1OED C;  3ZMZ B;  2LOS A;  2H7V C;  2XHE B;  5DQW A;  4EB6 E;  4U7Y A;  3KIN B;  4B6X A;  2XPK A;  2NW8 A;  3ZLI A;  4DV1 T;  1YW0 A;  3MXZ A;  1I94 T;  4IDO A;  4H63 V;  1D0Y A;  3ONJ A;  2DNX A;  3NRY A;  1D1A A;  4EZH A;  3AE1 A;  2E8I A;  1S35 A;  4CZZ B;  4L9I A;  4TX5 A;  2VK9 A;  5ADX L;  2Q9Q D;  2IC6 A;  1KNP A;  4PJN A;  5CA1 E;  2E9X C;  4YJ3 E;  2V7K A;  4EYY R;  4O4L E;  4U72 A;  4JI3 T;  2VQF T;  3UUL A;  5AQT B;  4XZC A;  2YU1 A;  4H9O C;  3B5M A;  2R6G F;  2YIN A;  2WCA A;  3BQI A;  1QSD A;  2UXX B;  4O4H E;  2K24 A;  2HPJ A;  2KND A;  4AKR B;  3M3Z B;  5FKY A;  3H3A A;  3UT5 E;  3ZC0 A;  3TLU A;  2X9Y A;  1OED B;  2RPA A;  3OBV E;  4X1K E;  3VKH A;  3NBX X;  4QKN A;  3UFE A;  4Z8X A;  3N9L A;  2BDE A;  4TV8 E;  5ABF A;  3TLS A;  2NTY A;  3VR8 A;  3EDU A;  3RIU A;  2CA5 A;  3AA0 B;  4UVC B;  5AQJ B;  1MMD A;  3VHL A;  4UEL A;  3FZF B;  1XMQ T;  3GA8 A;  4ZI3 D;  2A9U A;  5AQI B;  4DV0 T;  2E9X B;  4ANJ A;  4GK0 E;  4YTN A;  4LF4 T;  4WNK A;  4V1A v;  4LFA T;  4UF0 B;  5LGT B;  5FNV E;  4QH1 A;  3ZPO A;  2BG9 C;  4IE6 A;  3A5X A;  4ZS3 A;  1W0A A;  3AVS A;  5AQM B;  3J9X 1;  2A3D A;  3S4U A;  4HWC A;  4DV7 T;  2LHR A;  2XQA A;  3O1I A;  2EHO A;  4HFV A;  2I6H A;  2WMN A;  1HTJ F;  3Q5D A;  4JI8 T;  1MMA A;  4ILB A;  1XMO T;  4DR1 T;  3R6N A;  3QK6 A;  4EXT A;  2KT9 A;  4X64 T;  5LCY A;  2LSI A;  3RX6 A;  2C0S A;  4BJM A;  2MAW A;  4B3S T;  3ZT6 A;  3C64 A;  1WCR A;  2V7M A;  2X9W A;  3FZK B;  3W15 B;  5AQH B;  4C91 A;  1FEW A;  1ZKE A;  2ACX A;  1ZP0 A;  4TV9 E;  2WWU A;  3Q5X A;  2D2S A;  3DTO A;  2BG9 B;  3KVA A;  4IDN A;  4I4T E;  3F2E A;  3FXE B;  3ESL A;  5F5W A;  3ZJ1 A;  3TLT A;  3FBL A;  1WYB A;  3AE6 A;  2ES0 A;  5KMG P;  3C50 A;  2VUR A;  2JQQ A;  1OED A;  1MNE A;  4XAX B;  5AQG B;  3C98 B;  3RYH E;  3RI5 A;  4HEA A;  1BR4 A;  1S94 A;  2KZ7 B;  3K3O A;  2WB5 A;  4YSX A;  2H88 A;  2PJQ A;  3A7M A;  1UCU A;  3MZK B;  3CQC B;  4O2B E;  3ZC1 A;  3GWH A;  3V5S A;  1N32 T;  2JQK A;  3MAC A;  1WYC A;  4HWH A;  1QUU A;  3AAA B;  1OWA A;  4E7Z A;  4JYA T;  2B1E A;  3EDV A;  3K3Q C;  2LRK A;  2E9X A;  1J5W A;  5C8Y E;  4JI7 T;  3CX7 B;  4UVA B;  4UF0 A;  1ZV4 X;  5J2U E;  5AQP B;  3N9P A;  1T8B A;  3AEF A;  3PUQ A;  2V1D B;  2JPF A;  2W63 A;  1FJG T;  2ZMA A;  2J1D G;  2D9D A;  3RQW A;  5H6R B;  3CML A;  2XAJ B;  2XQ9 A;  1KFY A;  2BS2 A;  4OYJ A;  1XDO A;  2W2U A;  3PU3 A;  4ILA A;  2WZI A;  1YQ4 A;  3RYI E;  2VVS A;  2XY8 B;  3ZYK A;  4DVD A;  4KMC A;  4NPP A;  3NZQ A;  3Q5E A;  5HXE A;  2K5B B;  3P4Q A;  5KX5 E;  4DR6 T;  1ZHC A;  1X9B A;  5HEH A;  3RQU A;  4U7I A;  5JH7 E;  4IE0 A;  5AQK B;  4MFR A;  1UGO A;  4U2Y A;  2BZB A;  2X68 A;  1W9R A;  3FZM B;  2BG9 A;  2A72 A;  4X65 T;  3CQX C;  4QWN B;  4EEB A;  1M62 A;  2XQ3 A;  5LB7 B;  3QB5 A;  2X0L B;  1HS7 A;  2WAU A;  4X5T A;  1LKX A;  3NKZ A;  3ZMS B;  3OPC A;  4QXC B;  4AXP A;  2W62 A;  4MHC A;  3PV0 F;  3KV5 A;  3JAF A;  5AQR B;  5LG4 A;  5HYA A;  3MA9 A;  3WI3 A;  2LKH A;  2DWK A;  2V7L A;  1O3X A;  4ZEY A;  4Q25 A;  5FYM A;  1DU2 A;  3CPZ A;  4NUV A;  3D0T A;  5F8P A;  4CQI A;  1Z8U A;  2UUB T;  4DND A;  4ZZC A;  3PUX F;  4I0U A;  3NVO A;  2GK9 A;  1M7K A;  4MAL A;  2XQ4 A;  5L3E B;  2XQ7 A;  4DR3 T;  4ZI7 E;  1CUN A;  2W00 A;  1G8X A;  3ETV A;  5CJ5 A;  3UU5 A;  3ZN1 B;  3PU8 A;  4JI5 T;  1G73 A;  4AQF C;  4P0A A;  5AQV B;  5LHH B;  5H6Q B;  3RRC A;  5HEU A;  3KV6 A;  4J2C A;  4CXX A;  4HWD A;  5LMN T;  4X66 T;  4NXM T;  1D1B A;  3MK7 C;  3DP7 A;  4B3R T;  3ZMV B;  2JMK A;  4PJL A;  5LHG B;  3QB5 K;  2XAQ B;  4TWD A;  3KV9 A;  5HCM A;  1HG2 A;  1X79 A;  5FVL A;  3CQG B;  2OA5 A;  3V5U A;  5AQF B;  4QH4 A;  1XNR T;  3ZYL A;  2L9Q A;  2MPK A;  2QYW A;  5IHY A;  2IC9 A;  2Z6E A;  4DV3 T;  2XJ7 A;  3PUW F;  5JDF A;  2X9H A;  4NUU A;  1WLX A;  3PUY F;  3ANW B;  5EZY E;  2UXB T;  4FJO A;  3KBU A;  3LDQ B;  3JAE A;  2EHO D;  3C4X A;  4IGU A;  3RRW A;  4H9S E;  4IDQ A;  2WSS V;  5IWA T;  3HI2 A;  4TWH A;  5HAX A;  4I43 B;  3NWI A;  1I6Z A;  3DJB A;  2K9A A;  3BQK A;  4WYV A;  1WR6 A;  1UUR A;  4LF6 T;  3N9N A;  4HN9 A;  1W0B A;  4BAY B;  1HG5 A;  2RP4 A;  3ABV A;  4O8S A;  2E5L T;  2E2A A;  5HXR A;  3T8O A;  2CBI A;  2D0T A;  2W66 A;  4IRE A;  2BG9 E;  1BR0 A;  1D0X A;  3A8Y C;  4DV6 T;  5J0Z A;  4OK0 A;  4KHP T;  4YT0 A;  3ZCI A;  4L5G A;  3LK2 B;  4OFZ A;  4U2Z A;  5FL1 A;  3CVR A;  4AIS A;  1IBK T;  3J7Y q;  3AE8 A;  3HKD E;  3RYC E;  4JV5 T;  3OYZ A;  3F57 A;  4UV8 B;  3AA1 B;  4ZHQ E;  3C4Z A;  3SS1 A;  4DBQ A;  5LXT E;  5LJN A;  4IL9 A;  4ZI2 C;  2HH7 A;  5ABG A;  2OV9 A;  3RH3 A;  5JDQ A;  2LJL A;  3L39 A;  5JVD E;  2JMH A;  4LFC T;  5CGM A;  4ZOL E;  5E0O A;  3KFW X;  3RLF F;  1UK5 A;  2ODV A;  2WBL A;  5C3J A;  2LLY A;  3ZCJ A;  4TNV A;  4H9P C;  4JEU B;  2RA1 A;  2YU2 A;  5FP3 A;  3E0Z A;  3AEG A;  2PTF A;  4OYK A;  4YLH A;  5L3B B;  3FHN A;  2WZH A;  2LE8 A;  4HFC A;  3UQ4 A;  1YD8 G;  2CWY A;  5M4Y A;  2BBH A;  3KVB A;  3Q5W A;  4CN4 A;  4HFD A;  2CRB A;  3LFM A;  4JI0 T;  1BR2 A;  3PUZ F;  3AEC A;  1V9D A;  3ANW A;  2CXF A;  4PW8 A;  2VAS A;  2B76 A;  4YY3 T;  3SRZ A;  5JDN A;  4AQF A;  4JBW F;  5LNK A;  4X1I E;  3K3N A;  2HHH T;  3AXJ B;  2Y8D A;  4ILC A;  2XQ8 A;  3C4W A;  4ISS A;  3RHW A;  4PJM A;  4A97 A;  5BR8 T;  3H37 A;  2X0Y A;  3U78 A;  1MMG A;  2WMO A;  2XSB A;  3ONL C;  5JRC B;  3HKB E;  5DAB A;  4B3M T;  3OJA A;  1AJ3 A;  1ZOY A;  2IHR 1;  4YXD A;  2V26 A;  1FIO A;  2NTX A;  1KK7 A;  4LF7 T;  3CIR A;  1LVF A;  4AKG A;  1HFA A;  5JDG A;  4HFB A;  2OLT A;  4AQG A;  1NEN A;  3O4X E;  4F6R C;  2JJ9 A;  2WWV A;  4DR2 T;  1KNZ A;  1SA0 E;  3RF1 A;  3ZMT B;  2KXP B;  5L47 A;  2YOE A;  3JCF A;  3T1H T;  4DMV A;  2N1G A;  4EV6 A;  5HEO A;  5L3F B;  2C5I T;  2L3L A;  4GIW A;  5LA6 E;  4HWF A;  4XBF B;  2WY2 A;  1QLB A;  3KDS E;  3UU3 A;  2KWH A;  4QHO A;  4AKL A;  3OKQ A;  3AAI A;  3AE9 A;  3AA6 B;  5L4H A;  4ERR A;  5HWY A;  3QC9 A;  1YKE B;  3AE4 A;  4LF5 T;  2C5J A;  3UQ7 A;  4COF A;  2W67 A;  3LSV A;  3B13 A;  2LHN A;  3ONX A;  1SHZ C;  3NZP A; 
#chains in the Genus database with same CATH homology
 2V7L A;  3KBT A;  1O3X A;  3JC6 D;  4X20 E;  2L8K A;  3ZMU B;  1UX5 A;  3RC3 A;  3ZMZ B;  4IE5 A;  2LOS A;  5FYM A;  2H7V C;  5LYJ E;  4UVB B;  4PFP A;  2XHE B;  3CPZ A;  4NUV A;  4M1P A;  3D0T A;  5DQW A;  3B57 A;  5F8P A;  4CQI A;  4EB6 E;  3VKG A;  4DND A;  3KIN B;  4B6X A;  4CXW A;  1IAP A;  2NW8 A;  3P8C D;  5DJQ C;  2GK9 A;  3ZLI A;  1YW0 A;  3GN5 B;  5IYZ E;  3MXZ A;  4CI3 B;  4MAL A;  1E1H B;  4YJ2 E;  1FMW A;  4H63 V;  4AI6 A;  1D0Y A;  2XTL A;  5HXH A;  5LJM A;  3GMI A;  1VRB A;  2Y48 B;  2DNX A;  3NRY A;  1D1A A;  4C90 A;  2HPL A;  4EZH A;  2MOZ A;  4JEH B;  5L3E B;  2E8I A;  1S35 A;  4CZZ B;  4ZI7 E;  1CUN A;  1UX4 A;  2W00 A;  4L9I A;  1G8X A;  4TX5 A;  2VK9 A;  3ETV A;  3HL6 A;  4GK5 E;  4DMW A;  5ADX L;  3ZN1 B;  3PU8 A;  4CI1 B;  4O4I E;  2Q9Q D;  3BQL A;  5J1G A;  4G63 A;  1MIW A;  1G73 A;  2IC6 A;  4PNI A;  4QX8 B;  4AQF C;  1U5P A;  4PJN A;  5CA1 E;  4P0A A;  5CB4 E;  2E9X C;  5LHH B;  4YJ3 E;  2V7K A;  3HKE E;  4EYY R;  4QXH B;  5H6Q B;  5FY7 A;  1T98 A;  4O4L E;  4U72 A;  4PFO A;  2PBI A;  3HKC E;  3KV6 A;  4J2C A;  4UV9 B;  3RRC A;  1NAF A;  3UUL A;  4XZC A;  2LSY A;  2YU1 A;  4CXX A;  4O4J E;  4H9O C;  5JRC A;  4U74 A;  3KV4 A;  2YIN A;  2LSK A;  3LK3 B;  1YKH B;  2YK0 A;  1Z0P A;  3BQI A;  1H7C A;  1QSD A;  1D1B A;  4BA9 A;  2UXX B;  4O4H E;  2K24 A;  2HPJ A;  2KND A;  4AKR B;  2I59 A;  3MK7 C;  3DP7 A;  3ZMV B;  4H9R C;  3H3A A;  2JMK A;  2Y6X A;  4L0R A;  4PJL A;  3UT5 E;  5LHG B;  3ZC0 A;  2X9Y A;  3ETU A;  2D0U A;  2XAQ B;  3OBV E;  5FY0 A;  3KV9 A;  5JR9 C;  2P9B A;  1HG2 A;  1X79 A;  4X1K E;  3CQG B;  3E22 E;  3VKH A;  3NBX X;  2OA5 A;  4QKN A;  3UFE A;  3V5U A;  4GYS A;  4Z8X A;  4CI2 B;  2Q9Q A;  3N9L A;  4H63 H;  2BDE A;  3E08 A;  4TV8 E;  3ZYL A;  2L9Q A;  4P09 A;  5EK2 A;  5IHY A;  2KWI B;  5GON E;  4EYU A;  2IC9 A;  3N9O A;  3R84 B;  2Z6E A;  2NTY A;  3I0O A;  1U4Q A;  4WBO A;  3EDU A;  5JDF A;  3CKD A;  1MND A;  2X9H A;  4NUU A;  1WLX A;  2CA5 A;  2QGS A;  4HE8 A;  3ANW B;  5EZY E;  4PK4 A;  3AA0 B;  2MTQ A;  4FJO A;  3KBU A;  2X51 A;  4UVC B;  3QUJ A;  5KDM C;  1MMD A;  3VHL A;  3M65 A;  4HTE A;  3UUX B;  4UEL A;  2EHO D;  2CE7 A;  3C4X A;  3LBX B;  4IGU A;  3RRW A;  3GA8 A;  4H9S E;  4ZI3 D;  2UXN B;  2IW5 B;  5FY1 A;  4EAH A;  3RPU A;  4GOU A;  2WSS V;  2XUE A;  5ETW A;  4DBR A;  2NP9 A;  2BVM A;  3HI2 A;  2E9X B;  3O1J A;  5HWX A;  5HAX A;  5J2T E;  4ANJ A;  4I43 B;  2ZM0 A;  4GK0 E;  3N5L A;  3DJB A;  4UEM A;  4WNK A;  4V1A v;  2K48 A;  2K9A A;  3BQK A;  4UF0 B;  4YFS A;  5LGT B;  1EZ3 A;  1WR6 A;  5FNV E;  3ZPO A;  3N9N A;  4IE6 A;  4HN9 A;  4ASK A;  3A5X A;  3HR0 A;  4ZS3 A;  3C51 A;  4IE7 A;  4IIJ E;  3AVS A;  2CXL A;  3J9X 1;  2A3D A;  4JUY A;  3S4U A;  4BAY B;  1HG5 A;  1BR1 A;  2LHR A;  5JR9 B;  1HF8 A;  2RP4 A;  3O1I A;  2VWA A;  2EHO A;  3I9Y A;  2ZM8 A;  2LEH A;  4O8S A;  4TUY E;  3N2K E;  2DI4 A;  4HFV A;  4MLK A;  5FXW A;  3N9Q A;  5HXR A;  3T8O A;  2DLR A;  2WMN A;  1HTJ F;  3FBZ A;  5L3D B;  2D0T A;  1VOM A;  2NW7 A;  1MMA A;  5LBQ B;  1BR0 A;  4ZS2 A;  4CXY A;  5FXZ A;  3R6N A;  3QK6 A;  4EXT A;  2KT9 A;  1D0X A;  3IEE A;  5LCY A;  5L2L A;  3K8P C;  2X66 A;  4OK0 A;  2CWO A;  4K0U A;  2D5U A;  4EZ4 A;  2LSI A;  3ZCI A;  3RX6 A;  2C0S A;  4L5G A;  3LK2 B;  4OFZ A;  4BJM A;  4I55 E;  3GN5 A;  2ODU A;  5JDL A;  3UUM A;  3CVR A;  3I9W A;  3Q9D A;  2PFV A;  3C64 A;  2NW9 A;  2V7M A;  2X9W A;  5A1L A;  3CX8 B;  3J7Y q;  3AB3 B;  3W15 B;  4BJN A;  3PE0 A;  5JQG E;  3HKD E;  3RYC E;  4C91 A;  3N9M A;  2LSJ A;  2YEV C;  3OYZ A;  5FMN A;  3F57 A;  3Q2M A;  1FEW A;  1ZKE A;  2ACX A;  3FXD B;  3AA1 B;  4PAG A;  4UV8 B;  4ZHQ E;  4TV9 E;  2WWU A;  3C4Z A;  3SS1 A;  4DBQ A;  4DO0 A;  5LXT E;  2EHO C;  4MBQ A;  1MMN A;  5LJN A;  5TAO A;  4ZI2 C;  2HH7 A;  3Q5X A;  5DQV A;  1IJ5 A;  4IDZ A;  2D2S A;  3DTO A;  2V7I A;  3RH3 A;  5JDQ A;  2XQY A;  3KVA A;  4I4T E;  2LJL A;  2XAG B;  3F2E A;  4HGA A;  3FXE B;  5JVD E;  2JMH A;  3ESL A;  4ZOL E;  4EIW A;  5L3G B;  5E0O A;  3LJC A;  5JRE A;  3JC6 C;  2M67 A;  3KFW X;  5HXC A;  4ADZ A;  4FI5 A;  3ZJ1 A;  3ZYM A;  2LT3 A;  2ODV A;  2WBL A;  3EVY A;  3CX6 B;  3FBL A;  4X1Y E;  2CEA A;  2BVL A;  1WYB A;  2LOP A;  2G0U A;  4AKI A;  3PUR A;  3ZCJ A;  4TZ4 C;  4H9P C;  4JEU B;  2ES0 A;  2VKD A;  5KMG P;  2RA1 A;  2ZM2 A;  3C50 A;  2JQQ A;  3WAJ A;  1LVK A;  2YU2 A;  5FP3 A;  4PK6 A;  1HCI A;  2CXD A;  3E0Z A;  1MNE A;  2MYS A;  2CLY C;  4XAX B;  3C98 B;  4OYK A;  3L09 A;  3RYH E;  2ZLY A;  4YLH A;  3P7I A;  4HEA A;  5LBM A;  1BR4 A;  5L3B B;  2PG8 A;  2SPC A;  3ZEF B;  2JRK A;  4IE4 A;  5LHI B;  3FHN A;  3UTK A;  2LE8 A;  1S94 A;  2KZ7 B;  3K3O A;  1YD8 G;  2CWY A;  4G2A A;  4PJJ A;  5M4Y A;  5JDH A;  3O1H A;  3KVB A;  3Q5W A;  3AA7 B;  4JLE A;  2KMF A;  3FB2 A;  2X9X A;  1NWM X;  2PJQ A;  1UCU A;  3LFM A;  3MZK B;  3ZJ2 A;  4E7S A;  2Q9Q C;  3N2G E;  1BR2 A;  3CQC B;  1V9D A;  4O2B E;  5FXX A;  2C5K T;  3ZC1 A;  3ANW A;  3GWH A;  3V5S A;  3MAC A;  4KP3 C;  1WYC A;  1QUU A;  1OXZ A;  3AAA B;  2KLQ A;  1OWA A;  4H9N C;  5LP6 E;  2CXF A;  2EHO B;  3OYX A;  4PW8 A;  2VAS A;  5JDM A;  1D0Z A;  4E7Z A;  2B1E A;  3LBX A;  5L3C B;  3WAK A;  3EDV A;  3K3Q C;  3SRZ A;  5JDN A;  4YHJ A;  4AQF A;  5LNK A;  2NWB A;  4X1I E;  3AAE B;  3K3N A;  2E9X A;  4N78 D;  2Y8D A;  1WRD A;  2DCF A;  3C4W A;  4H9Q C;  4ISS A;  5BMV E;  5C8Y E;  4PJM A;  4WBN E;  2DWG A;  3CX7 B;  4UVA B;  2H7O A;  3H37 A;  4UF0 A;  2W61 A;  1ZV4 X;  4HKA A;  3U78 A;  5J2U E;  5HXS A;  1MMG A;  3LK4 2;  2WMO A;  3N9P A;  5LGN B;  2CCQ A;  2W0G A;  5FXV A;  3PUQ A;  2V1D B;  2JPF A;  2W63 A;  2ZMA A;  2VKO A;  3PDY A;  2CMR A;  4KUM B;  3EUH A;  2J1D G;  1MIY A;  3HKB E;  5DAB A;  2H3R A;  5JRC B;  3OJA A;  3AVR A;  5JR9 A;  5H6R B;  1D1C A;  3CML A;  3ZN0 B;  2CLY B;  2XAJ B;  4P0B A;  4WW0 A;  1AJ3 A;  3RYF E;  4OYJ A;  3PU3 A;  2A2F X;  3HA4 A;  1HX8 A;  2LSG A;  3RYI E;  2V26 A;  2V7J A;  2DHR A;  1FIO A;  3UUN A;  2NTX A;  1KK7 A;  4EOZ B;  1LVF A;  4AKG A;  2X67 A;  1HFA A;  2VB6 A;  2CM0 A;  3ZYK A;  5JDG A;  3LG7 A;  3U3I A;  1IZN B;  4DVD A;  2WM9 A;  5LGU B;  3MJX A;  4ZI3 C;  4AQG A;  3O4X E;  4F6R C;  4KMC A;  2Q9Q B;  2JJ9 A;  2XAS B;  3NZQ A;  2IAK A;  4IHJ E;  5HXE A;  2K5B B;  4KBM B;  3NRX A;  4PK5 A;  3PUA A;  5KX5 E;  1KNZ A;  1SA0 E;  4ILU A;  1ZHC A;  1US7 B;  3RC8 A;  3ZMT B;  3RKO A;  5F3J A;  2KXP B;  5JH7 E;  2N2N A;  2XAH B;  4OHF A;  4IE0 A;  4TN7 B;  4MFR A;  4IST A;  4I50 E;  3IF8 B;  5EK4 A;  1IJ6 A;  3VU7 H;  4DMV A;  2BZB A;  2N1G A;  2VKH A;  5L3F B;  2X68 A;  3I1A A;  3SOL A;  2C5I T;  2L3L A;  3PTR B;  4GIW A;  4GYR A;  4QX7 B;  5LA6 E;  3SWH A;  3TKL B;  5CA0 E;  1FMV A;  4XBF B;  4AKH A;  2KIN B;  2N9D A;  5AFU L;  3KDS E;  2A72 A;  3I0Q A;  2KWH A;  2E9X D;  4QHO A;  4AKL A;  3CQX C;  3IHR A;  4QWN B;  3OKQ A;  2XAF B;  3AAI A;  3AA6 B;  1LRZ A;  3PUG A;  1B7T A;  4ERR A;  3L3P A;  5HWY A;  2X0L B;  3CWZ B;  3PUS A;  4QXB B;  1HS7 A;  1ZEE A;  2WAU A;  3N2O A;  3QC9 A;  1LKX A;  3BK9 A;  4A56 A;  1YKE B;  2VKJ A;  3MKD A;  4UIG A;  3ZMS B;  2C5J A;  3F31 A;  2LM9 A;  4ZI2 D;  4QXC B;  4AXP A;  5EK3 A;  2W62 A;  4MHC A;  3IBP A;  3KV5 A;  1Y64 B;  3O9X A;  4O2A E;  3B13 A;  2LHN A;  2VL8 A;  3ONX A;  2MBG A;  2QA7 A;  1MIV A;  4UXN B;  5HYA A;  5LG4 A;  1SHZ C;  3MA9 A;  3NZP A;  3WI3 A;  2DWK A;  5LOV E;  2NOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...