4JLEA

Structure of the p. falciparum pfi1780w phist domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
149
structure length
149
Chain Sequence
YTAEEINEMINSSNEFINRNDMNIIFSYVHESEREKFKKVEENIFKFIQSIVETYKIPDEYKMRKFKFAHFEMQGYALKQEKFLLEYAFLSLNGKLCERKKFKEVLEYVKREWIEFRKSMFDVWKEKLASEFREHGEMLNQKRKLKQHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHIST
publication title A Plasmodium falciparum PHIST protein binds the virulence factor PfEMP1 and comigrates to knobs on the host cell surface.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Protein binding
total genus 60
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09687 PRESAN Plasmodium RESA N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jleA00
4JLEA
chains in the Genus database with same CATH superfamily
4UV9B 3JAFA 2WDVA 2BBHA 4X20E 2AXDS 4OYJA 4CN4A 5E0OA 3ZPOA 4CXXA 2WU2A 1KFYA 4DV5T 2D2SA 4KHPT 2VASA 1Z0PA 4AQFA 2ZLYA 2IUBA 3KV4A 5L2LA 3KBTA 3FXDB 4IIJE 5ADXL 4MLKA 3R6NA 3BQKA 5AQFB 2Q9QA 2JQHA 2X67A 2CMRA 5BR8T 5AQLB 2ODVA 5JH7E 4DV0T 2K24A 2N2NA 4ADZA 2WM9A 5IWAT 1HG2A 3PUXF 5LB7B 4HTEA 4J2CA 2YDSA 3ONXA 3W15B 5FXZA 3H37A 3ZCIA 3N9PA 3LK2B 3AA0B 3PU3A 1OEDC 3K3OA 4IE5A 3ZYLA 3ZMVB 4IDZA 4AQGA 5AQJB 3GWHA 1VCSA 5AQRB 5LGUB 3UU8A 4I43B 4NPPA 1V9DA 2IMLA 4B3MT 4TWDA 2LT3A 3SOLA 5HEUA 2D5UA 5ETWA 3PJAJ 4O2AE 2CXLA 2D9DA 2HH7A 2LOPA 3Q5EA 4X5TA 3IF8B 4P0BA 4GKKT 3HR0A 2MPKA 3C50A 3F31A 4KBMB 4O8SA 3BQIA 4UF0B 4O2BE 2UUAT 1HCIA 3T8OA 4KP3C 3C4XA 3L8RA 4H9NC 3AVSA 3TLWA 1HR0T 4U3CA 3UUBA 5A1LA 2XTLA 4DR6T 5FNVE 3VR9A 2LJLA 3KINB 3ZCJA 5ABEA 4JI8T 3VRAA 5KMGP 4CZZB 3I9YA 2DHRA 3PDYA 3M65A 4HFHA 3NRXA 4GYRA 4X1IE 4HWCA 4YSYA 3WAKA 3AXJB 4UEMA 4LF6T 2WMOA 3GA8A 3IEEA 2JQ9A 1NWMX 4ZI2D 1E2AA 2XM2A 1XNRT 2DWKA 3NKZA 3QB5K 2CE7A 5LNKA 3X1DA 4BA9A 3FZKB 2NW9A 1VRBA 4UF0A 3EAMA 5FVKA 3MZKB 4U2YA 4I0UA 2UXNB 2FJAA 4WBNE 3RF1A 5DABA 2V7IA 5FKYA 4JI3T 5FXVA 4IL4A 2M6BA 3HL6A 3RIAA 2J47A 4DBQA 4LFAT 3N2GE 5FXWA 4I50E 1E7PA 1IJ6A 5IHYA 4UVBB 1YW0A 4H63H 5LGTB 1OWAA 2H7OA 2LSGA 2XY8B 2ACZA 3OBVE 3RYFE 1M62A 2YDRA 3SRZA 2WWUA 5JVDE 2H7VC 4JBWF 3N2OA 3ZEFB 3AXJA 3Q2MA 4PAGA 2X0LB 4GIWA 4AQYT 3ZYKA 3EHZA 5LXTE 3E08A 3GN5B 5J2UE 5HCMA 4PJJA 4EZHA 3MK7C 3RYHE 3KV9A 2XQAA 3R84B 3AECA 4ZI3C 3C4ZA 1HFAA 4ISTA 5AQUB 2QRXA 3F57A 2JMHA 4QXCB 5JRCB 3AAEB 4XAXB 3O4XE 5JDNA 3LJCA 3FZFB 4MBQA 4KX6A 3N2KE 3ZN0B 2KWIB 2E9XC 4LF7T 3K3NA 3QK6A 4KI0F 5AQVB 4EIWA 4YFSA 3N9MA 4YTPA 1O3XA 2WAUA 3O9XA 3ONJA 4X1KE 4V1Av 4CXYA 5L3GB 2VVNA 3GN5A 1KNZA 1HNZT 2B76A 4N78D 4QX7B 2VKOA 3CVRA 3ZSSA 1D1AA 3BK9A 3I0QA 1IBMT 2CWYA 3ZSTA 3FHNA 3RQUA 3M3ZB 5EZYE 3UU4A 3A7MA 2ES0A 4XBFB 5C2TA 1MIYA 3LK42 3JC6C 2BS2A 1M7KA 4LF9T 4DV4T 2MAWA 3F2EA 3EVYA 2YN6A 3RKOA 1G8XA 2WB5A 4QH5A 4UVCB 2IHR1 2E8IA 2CCQA 3KV6A 4AQFC 2ZMAA 4WW0A 4JI4T 4PK4A 3TLVA 1NEKA 4ZS2A 1WR6A 3VR8A 4NIQA 5AQPB 4CI1B 3I9WA 3AA1B 3CX7B 4DV1T 1L0VA 3D0TA 2Q9QC 5L4EA 4DR1T 4HFDA 3RIFA 1HNXT 4DVDA 4UIGA 1YD8G 2E2AA 4H9SE 1OXZA 2WDQA 4HWDA 4A98A 4YHJA 4TV8E 2FBWA 3KVAA 4EAHA 1WR0A 1D0YA 2EHOA 5JDHA 4NUUA 5JREA 3DTOA 3U3IA 5JDGA 5ABFB 4JUYA 4ZHQE 3N9LA 5ABHA 4YXDA 3B5MA 2PTFA 3N9OA 5FVLA 3ZMTB 2VKDA 4AIUA 1FMVA 2QYWA 4TN7B 1N33T 5IYZE 2Y8DA 4ANJA 2HPJA 2QVAA 2VQET 2K48A 4AISA 4H9RC 2A9UA 3V5SA 2K3WA 3V5UA 3VU7H 5H6QB 4UV8B 4WBOA 1ZV4X 2FJDA 4OK0A 3U78A 1Z8UA 1MNEA 3TLUA 5HWXA 5KXJA 5AQQB 4IREA 2X68A 4A5XA 4YT0A 3AB3B 2NR4A 1HTJF 2LHRA 5FP3A 4IGUA 2JJ9A 2NWBA 1XNQT 4DR4T 1JNZA 1SHZC 1W0AA 4TV9E 4YLHA 5ABFA 5J1GA 1U5PA 3AE6A 3BQLA 4HN9A 4E7SA 2ODUA 4COFA 3UU3A 2IC6A 2Z6EA 4GK5E 4L5GA 2JPFA 3TLTA 2RP4A 4IDOA 4JYAT 3PUVF 3LSVA 4PJLA 3UUXB 5AQOB 3OYXA 1W09A 4M1PA 3IA3A 4H9OC 5HXSA 3ZJ2A 3E0ZA 2DCFA 2WZIA 2XAJB 1FMWA 2WMNA 5AQKB 2DLRA 3GMIA 1JNRA 3AA6B 3AEBA 5HEGA 2KXPB 2YU2A 2X0YA 1E1HB 3PUYF 2LLYA 2X9WA 4Z8XA 1G73A 2IAKA 5GONE 2WU5A 4E7ZA 2W4XA 3UUMA 4JI1T 5AQHB 2W00A 2Y48B 4LMJA 4PNIA 4EXTA 2AE9A 1WYCA 3ZMSB 4A97A 3N9QA 5TAOA 3NWIA 2KMFA 2NTYA 5AQGB 2L8KA 5AFUL 4L0RA 5FY7A 4EYYR 1MIVA 2FJBA 2VQFT 3VKHA 4YJ3E 2WSSV 3RC8A 1D1CA 3TKLB 4U7IA 1W0BA 2BG9B 4DV2T 2VURA 4IL9A 1N34T 5LA6E 4DR5T 2V5CA 2X9XA 5HWYA 1W9RA 2LKGA 5LBMA 3J7Yq 5LYJE 1IZNB 2XQ7A 5FYMA 5AQNB 3RPUA 3H3AA 1N36T 5L3CB 2QA7A 5LHIB 4I4TE 3Q9DA 1HF8A 1UGOA 2G0UA 3RHWA 3AA7B 4DBRA 2JMKA 3RYIE 3KDSE 1D1BA 4NUVA 1CUNA 2VKHA 2Y6XA 3PUAA 5HEJA 5C8YE 2CA5A 2J62A 4UXNB 4JI2T 4ZZCA 2CHNA 3EI0A 2K9AA 2LE8A 5LG3A 3RIUA 5F8PA 4ZOLE 4HWHA 2D0TA 2FJEA 2NP9A 2BG9A 2XAQB 2ZM0A 4U7YA 4GK0E 1HG5A 5FY1A 4OYKA 2PBIA 4KHZF 2I6HA 2SPCA 4X65T 2YK0A 3RGLA 4WYVA 4X66T 1Y64B 2XHEB 1U4QA 2LM2A 3AE1A 3T1HT 4ILCA 2NTXA 4JEUB 5HCJA 4LF5T 2J4GA 1IAPA 4NXMT 4O4JE 1IJ5A 1LVKA 2I59A 2VKJA 1SUMB 1QLBA 1J5WA 2XM1A 2YKSA 3MA9A 1MMNA 2CBJA 4DIDB 3VKGA 2BBJA 2H88A 4ILBA 3S4UA 4YSXA 3L39A 5JR9B 4QH4A 1X79A 3FBLA 2C0SA 2XQ6A 5FL0A 1YQ3A 2W2UA 2FUPA 2CEAA 2YU1A 3HKBE 2UXCT 1VCTA 2JIWA 3P4RA 4HEAA 3QOFA 1HX1B 2UUCT 3ZC1A 3MKDA 5L3FB 2BKPA 5LHGB 3LDQB 2V7MA 3N5LA 2X51A 1SA0E 5EK2A 3UU5A 4IE7A 2WP9A 4DUYT 2EHOC 4U31A 1BR1A 3IHRA 1BR2A 2LOSA 3PURA 4EYUA 4HFEA 2XQYA 4WNKA 2F4VT 1KF6A 1DU2A 1UCUA 2CXDA 3RKGA 1HX8A 2IC9A 2R6GF 4LFBT 3KVBA 4C90A 4DMWA 4GKJT 3ANWB 4CI3B 5JR9A 3E22E 2YINA 2VB6A 5LHHB 3PJAA 4PK5A 3UQ7A 2UXXB 5IUXA 1I94T 4ILAA 5LCYA 5HEOA 3OTOT 4X62T 4PFOA 4FJOA 5LJMA 4MALA 1FIOA 2XQ3A 4LMLA 4OHFA 1WRDA 2V7KA 3KBUA 4TUYE 3H3MA 2B1EA 2EHOB 4PJMA 4JI7T 3FZHB 1YKEB 2K5BB 1KNPA 5H6RB 2BZBA 5M4YA 2LSJA 3ZYMA 5LMUT 2XJ7A 4ASKA 4B3RT 3ONLC 2RA1A 3AEGA 3FZLB 1YXRA 1ZEEA 4PJNA 3P4PA 4JI5T 2C5IT 3SWHA 4JV5T 5EK3A 4PK6A 3ZT6A 5LGNB 4DR2T 1BR0A 3JADA 3P8CD 2VL8A 3Q5WA 2M67A 2KLQA 5JQGE 3ANWA 3KV5A 2WZHA 1S94A 4P0AA 4Z90A 4UVAB 2BVMA 4DUZT 2V1DB 4C91A 2LSKA 5KX5E 3QB5A 4EEDA 5KDMC 1BR4A 2XSBA 4UELA 2H89A 2UXDT 5ABGA 5FMNA 4EB6E 3OPCA 4H9PC 3RLFF 4Z91A 3K1SA 4A56A 2WY2A 3AE9A 3EUHA 3Q5DA 4DV3T 3RX6A 1MMGA 3EABA 2NW8A 4EEBA 2UXBT 2UUBT 2C5JA 1QUUA 2BS4A 4GYSA 5FXXA 1NENA 5HXCA 2BG9E 2W63A 3DP7A 4IDNA 2X0HA 4YSZA 2XSAA 3LFMA 2WDRA 1UK5A 1LKXA 4YTMA 4F8HA 3UU6A 1AJ3A 2XQ4A 3ZMUB 3ZT7A 3G06A 4LF8T 2CM0A 4CN1A 3A8YC 4ISSA 5HXEA 2IW5B 5CGMA 1J1JA 4ZI3D 5HXHA 2LSIA 3I1AA 5CB4E 1MIWA 4IE6A 5F5WA 2N1GA 2C5KT 4UR9A 5LMNT 1UURA 3SS1A 3HA4A 2DWGA 4P1NA 4ZXLA 2JQKA 4YTNA 4O4LE 4DR3T 1IBLT 1T7SA 2E9XD 3O1JA 1HNWT 5C3JA 3VHLA 2A72A 4HFVA 4ZI2C 2KT9A 3NZPA 2V8SV 3MACA 3T1YT 2V7JA 4QX8B 4U2ZA 4AI6A 3AEFA 4ZS3A 3ZN1B 1ZKEA 4ZEYA 5CFBA 3CQCB 1NAFA 2BKOA 4K0UA 3ZKRA 2LEHA 3P4SA 2KWHA 4XZCA 1Y01A 2LSYA 2HPLA 2OV9A 3FZMB 4TZ4C 3FBZA 3L3PA 5JTGA 3Q5XA 2PG8A 4ILUA 2UU9T 5J2TE 2XQ8A 3RIUC 1MMDA 3UQ4A 3AE5A 2XUEA 2BG9C 2RPAA 4TX5A 4FI5A 2LM9A 3C64A 2W62A 2BVLA 5LG4A 4IDQA 2ZM6T 4BJNA 3CKDA 3UFEA 3AEDA 4TNVA 4IT4A 3AEEA 5FL1A 2XPKA 2MTQA 2WWVA 2LKHA 1SE7A 2HN2A 4HKAA 4DV6T 4DR7T 1IBKT 2XASB 3JC6D 2BS3A 3C51A 1WLXA 3FXEB 4DO0A 1KNRA 3K3QC 5EK4A 5BMVE 4MFRA 3UFGA 3B57A 2LRLA 3PUGA 3QC9A 3JCFA 3CX8B 2WS3A 1VOMA 4CXWA 4HWFA 2Q9QD 3LG7A 4B3TT 2X9YA 5JDMA 4DMVA 1S35A 4AKLA 1UX4A 1US7B 2V6YB 5CJ5A 5AQIB 1R8IA 2L9QA 3O1IA 5HAXA 1D0ZA 5DQVA 4IE0A 2CHOA 3A5XA 4YHHT 2I0MA 3AAIA 1HS7A 3NRYA 5AQMB 1D0XA 2MOZA 2WQYA 3EDUA 2E5LT 2ACXA 4OFZA 5LJNA 2ZM2A 4IDPA 3SFDA 2VL0A 4B6XA 3HKEE 1OEDB 4K0KT 4DNDA 2OLTA 4EV6A 5F3JA 3RI5A 2HHHT 2P9BA 1ZHCA 3HKDE 3PE0A 5FY0A 2LHNA 2NW7A 5L47A 3C4WA 4QHOA 5L3BB 1XMQT 3CWZB 5JR9C 3ABVA 1UUSA 3CQGB 2ZM8A 3PU8A 4ERRA 1XZYA 4IHJE 2VWAA 1WCRA 2A2FX 3FB2A 3UUNA 3ZC0A 2WBLA 2V6YA 2V5DA 2X9HA 3AE7A 3HI2A 2CPTA 2XZEA 1MMAA 2IDOB 2V6XA 4YY3T 5LOVE 4X64T 2JRKA 2W0GA 2X66A 3MXZA 1XDOA 3OVUA 2XAFB 4QWNB 3OJAA 1XDPA 2JQQA 2YOEA 5JDQA 3AVRA 2YDQA 1KEYA 2XAGB 2DL1A 1N32T 4GOUA 3NBXX 5CA1E 4MHCA 3MJXA 4G63A 1OEDA 1KK7A 2MYSA 5HEHA 3P4QA 3ZLIA 3KFWX 3ETUA 5DQWA 4O4IE 4CQIA 5L3DB 2N9DA 4AXPA 1MNDA 3EDVA 3RRCA 2XQ5A 2V7LA 4QXHB 4TNWA 3RC3A 3C98B 3CQXC 4QH1A 3PUQA 5LP6E 2KZ7B 4OX9T 3OYZA 3ZT5A 3ETVA 3AE3A 3QUJA 1LVFA 3CPZA 3I0OA 5J0ZA 4QKNA 1H7CA 4EGWA 3AAAB 4LF4T 1XWMA 3DJBA 2PFVA 3PUWF 2CLYC 4U33A 3PUZF 2HN1A 3LBXB 3O1HA 2DI4A 2D0UA 3WAJA 3RRWA 1YKHB 3CIRA 2A3DA 3RYCE 4Q25A 3RQWA 3ZJ1A 4O4HE 1T98A 1FEWA 4JLEA 4EOZB 4H63V 4AKGA 4CI2B 4BJMA 1GQEA 3CK6A 3UTKA 5AQTB 4AKHA 3AE4A 3L09A 4ZI7E 4HWIB 4PW8A 3HKCE 4G2AA 1XMOT 2W61A 4HFIA 4IE4A 2NOXA 3P7IA 5L3EB 5L4HA 1YQ4A 2DNXA 5DJQC 2CLYB 3AEAA 4LMKA 5JDFA 2E9XB 2W67A 1T8BA 3PTRB 2M6IA 5JRCA 1QSDA 4JI0T 1EZ3A 4DV7T 5AQSB 4KUMB 2H3RA 3UULA 3ZMZB 3LBXA 3P4WA 3J9X1 3PUSA 1T72A 2WCAA 2MBGA 2XQ9A 3LK3B 3AE2A 3NZQA 4QXBB 4HFBA 3SFEA 3WI3A 4AKIA 4L9IA 3N9NA 2L3LA 4H9QC 2KSRA 3TLSA 1ZOYA 1FJGT 2BDEA 4U74A 4ZZBA 2IIUA 4HFCA 4TWFA 4YJ2E 2GK9A 4HGAA 2KNDA 5CA0E 4X1YE 3JAEA 1WFDA 1J5ET 4P09A 2W66A 2VVSA 2XAHB 4B3ST 2LRKA 3P50A 2OA5A 4WZXA 3VRBA 2E5VA 4U72A 3IBPA 2KINB 2J1DG 5HYAA 3NVOA 2E9XA 4CN6A 2YEVC 4KMCA 4BAYB 1WYBA 2BKNA 2PJQA 4JI6T 3CX6B 4JEHB 4EZ4A 3AE8A 2V26A 3OKQA 4PFPA 3ESLA 1LRZA 2Q9QB 1I6ZA 5JDLA 2EHOD 2VK9A 4TWHA 2CBIA 5HXRA 4HE8A 1UX5A 1CHUA 3K8PC 5LBQB 3QNUA 1X9BA 3RH3A 1OEDE 4F6RC 1ZP0A 4LFCT 3UT5E 2QGSA 3CMLA 4I55E 4NXNT 3PV0F 2CRBA 1B7TA 3B13A 4AKRB 2CXFA 2CWOA
chains in the Genus database with same CATH topology
2ZMAA 1D0XA 4WW0A 4HEAA 4UV9B 4PK4A 2MOZA 4X20E 3ZC1A 4ZS2A 1WR6A 3EDUA 3MKDA 5L3FB 4OYJA 2ACXA 5E0OA 3ZPOA 4OFZA 3I9WA 4CXXA 4CI1B 5LJNA 2ZM2A 3AA1B 5LHGB 2D2SA 2V7MA 3CX7B 2X51A 3N5LA 4B6XA 3D0TA 2VASA 3HKEE 2Q9QC 1SA0E 1Z0PA 4AQFA 2ZLYA 5EK2A 4DNDA 3KV4A 4IE7A 2EHOC 5F3JA 5L2LA 2P9BA 1ZHCA 3HKDE 1BR1A 3KBTA 3PE0A 5FY0A 2LHNA 4DVDA 2NW7A 3IHRA 3C4WA 3FXDB 4QHOA 4UIGA 4IIJE 1YD8G 1BR2A 4H9SE 1OXZA 5L3BB 5ADXL 2LOSA 3PURA 4EYUA 4YHJA 3CWZB 2XQYA 4MLKA 3R6NA 4WNKA 5JR9C 3BQKA 2Q9QA 3CQGB 4TV8E 2ZM8A 3KVAA 2X67A 4EAHA 3PU8A 4ERRA 4IHJE 1D0YA 2CMRA 2VWAA 1UCUA 2EHOA 2CXDA 2ODVA 1HX8A 5JH7E 5JDHA 2A2FX 2IC9A 4NUUA 5JREA 2K24A 3FB2A 3UUNA 3DTOA 2N2NA 3U3IA 5JDGA 3ZC0A 4JUYA 4ZHQE 4ADZA 2WBLA 3KVBA 3N9LA 4C90A 4DMWA 2WM9A 2X9HA 3ANWB 3HI2A 4CI3B 1HG2A 5JR9A 1MMAA 3E22E 2YINA 2VB6A 5LOVE 5LHHB 4HTEA 4J2CA 4PK5A 2JRKA 3ONXA 3W15B 2W0GA 2X66A 3MXZA 3N9OA 2UXXB 5FXZA 3H37A 3ZMTB 3ZCIA 2VKDA 5LCYA 2XAFB 3N9PA 1FMVA 4QWNB 3OJAA 3LK2B 3AA0B 4TN7B 4PFOA 4FJOA 5LJMA 3PU3A 4MALA 1FIOA 2JQQA 3K3OA 5JDQA 4IE5A 5IYZE 2Y8DA 4ANJA 2HPJA 4OHFA 1WRDA 3AVRA 2V7KA 3ZYLA 3KBUA 4TUYE 3ZMVB 2B1EA 4IDZA 2EHOB 2K48A 4PJMA 2XAGB 4H9RC 4AQGA 3V5SA 3V5UA 3GWHA 4GOUA 3VU7H 1YKEB 5H6QB 3NBXX 2K5BB 5CA1E 4MHCA 4UV8B 5LGUB 3MJXA 4G63A 4WBOA 4I43B 1V9DA 5H6RB 1KK7A 1ZV4X 2BZBA 2MYSA 4OK0A 5M4YA 3U78A 3ZLIA 2LSJA 3ZYMA 3KFWX 2LT3A 3SOLA 4ASKA 3ETUA 2RA1A 1MNEA 2D5UA 5HWXA 1ZEEA 5ETWA 4PJNA 5DQWA 3SWHA 2C5IT 2X68A 4O2AE 2CXLA 5EK3A 4O4IE 4CQIA 3AB3B 5L3DB 1HTJF 2LHRA 2N9DA 4AXPA 1MNDA 2HH7A 4PK6A 5FP3A 4IGUA 5LGNB 2LOPA 2JJ9A 2NWBA 1BR0A 3IF8B 4P0BA 3HR0A 3C50A 3F31A 3P8CD 4KBMB 4O8SA 1SHZC 4TV9E 3BQIA 4UF0B 2VL8A 3EDVA 3Q5WA 4O2BE 4YLHA 3RRCA 2M67A 5J1GA 1U5PA 1HCIA 2KLQA 3T8OA 4KP3C 5JQGE 2V7LA 3C4XA 3BQLA 3ANWA 3KV5A 1S94A 4P0AA 4H9NC 4UVAB 4HN9A 4E7SA 2BVMA 3AVSA 4QXHB 3RC3A 2ODUA 2V1DB 3C98B 3CQXC 4C91A 2LSKA 5A1LA 2IC6A 2Z6EA 5KX5E 2XTLA 3PUQA 4GK5E 4L5GA 2JPFA 5LP6E 5KDMC 2KZ7B 1BR4A 2RP4A 5FNVE 3OYZA 2LJLA 4UELA 3KINB 4PJLA 3ZCJA 3UUXB 3ETVA 3QUJA 3OYXA 1LVFA 3CPZA 3I0OA 5FMNA 4EB6E 4M1PA 4QKNA 4H9PC 5KMGP 4CZZB 1H7CA 3I9YA 2DHRA 4H9OC 5HXSA 3ZJ2A 3PDYA 3AAAB 4A56A 3E0ZA 3EUHA 2DCFA 3M65A 3NRXA 4GYRA 4X1IE 3DJBA 2PFVA 2XAJB 3RX6A 1FMWA 2WMNA 2DLRA 1MMGA 3WAKA 2NW8A 2CLYC 3GMIA 3AA6B 2KXPB 3LBXB 3O1HA 2DI4A 2C5JA 1QUUA 4UEMA 2D0UA 3WAJA 2YU2A 4GYSA 3RRWA 1E1HB 1YKHB 2WMOA 5FXXA 2A3DA 3RYCE 3GA8A 5HXCA 3IEEA 2W63A 1NWMX 2X9WA 3DP7A 4Z8XA 4ZI2D 1G73A 3ZJ1A 2IAKA 2DWKA 4O4HE 5GONE 1T98A 1FEWA 4E7ZA 3LFMA 2CE7A 3UUMA 5LNKA 4JLEA 1LKXA 4EOZB 4H63V 2W00A 4BA9A 2Y48B 1AJ3A 2NW9A 4PNIA 4AKGA 4EXTA 4CI2B 1VRBA 4UF0A 3ZMUB 1WYCA 4BJMA 3MZKB 3UTKA 2CM0A 4AKHA 2UXNB 4WBNE 3L09A 3ZMSB 4ISSA 4ZI7E 5HXEA 3N9QA 5DABA 2V7IA 2IW5B 4PW8A 5TAOA 2KMFA 2NTYA 4ZI3D 5HXHA 2LSIA 2L8KA 3HKCE 5FXVA 3I1AA 4G2AA 5AFUL 3HL6A 4L0RA 5FY7A 5CB4E 4EYYR 1MIWA 1MIVA 3VKHA 4DBQA 4IE6A 2N1GA 2C5KT 3N2GE 2W61A 4YJ3E 2WSSV 5FXWA 4I50E 2NOXA 4IE4A 3RC8A 1D1CA 3P7IA 3TKLB 1IJ6A 5IHYA 4UVBB 5L3EB 1YW0A 4H63H 3SS1A 5LGTB 3HA4A 2DWGA 1OWAA 2H7OA 2LSGA 5LA6E 2DNXA 3OBVE 3RYFE 5DJQC 3SRZA 2CLYB 2WWUA 2X9XA 5HWYA 4O4LE 5JDFA 2E9XB 2E9XD 5JVDE 3O1JA 3PTRB 5JRCA 2H7VC 2A72A 5LBMA 3VHLA 4HFVA 1QSDA 4ZI2C 3J7Yq 2KT9A 3NZPA 5LYJE 1IZNB 1EZ3A 3MACA 3N2OA 5FYMA 3ZEFB 2V7JA 3Q2MA 4PAGA 4QX8B 3RPUA 4AI6A 2X0LB 4KUMB 3H3AA 2H3RA 4ZS3A 4GIWA 5L3CB 3UULA 3ZMZB 2QA7A 3LBXA 3ZN1B 5LHIB 1ZKEA 4I4TE 3J9X1 3PUSA 3CQCB 3ZYKA 5LXTE 3Q9DA 2MBGA 1HF8A 1NAFA 3LK3B 3E08A 3GN5B 2G0UA 5J2UE 3AA7B 3NZQA 4PJJA 4EZHA 4K0UA 4QXBB 3MK7C 3RYHE 3KV9A 4DBRA 2LEHA 3R84B 2KWHA 4XZCA 2JMKA 2LSYA 3WI3A 2HPLA 4AKIA 4L9IA 4ZI3C 3C4ZA 3RYIE 1HFAA 3N9NA 4TZ4C 3KDSE 2L3LA 1D1BA 3FBZA 3L3PA 4ISTA 4H9QC 3Q5XA 4NUVA 2PG8A 4ILUA 3F57A 5J2TE 2BDEA 1CUNA 2VKHA 2Y6XA 1MMDA 4U74A 3PUAA 2JMHA 2XUEA 5C8YE 4QXCB 5JRCB 2CA5A 4TX5A 3AAEB 4XAXB 3O4XE 4FI5A 2LM9A 5JDNA 3C64A 3LJCA 4UXNB 4MBQA 4YJ2E 3N2KE 2W62A 2BVLA 5LG4A 3ZN0B 2K9AA 2LE8A 2KWIB 2GK9A 2E9XC 3CKDA 3UFEA 4BJNA 4HGAA 2KNDA 3K3NA 5CA0E 3QK6A 4X1YE 4ZOLE 5F8PA 4EIWA 2D0TA 2NP9A 2MTQA 2XAQB 2ZM0A 4P09A 4YFSA 2XAHB 4HKAA 4GK0E 3N9MA 2OA5A 1HG5A 5FY1A 2XASB 3JC6D 4OYKA 4U72A 1O3XA 3IBPA 2KINB 2PBIA 2J1DG 5HYAA 3C51A 1WLXA 2E9XA 3FXEB 4DO0A 2YEVC 2WAUA 4KMCA 3O9XA 2SPCA 3K3QC 4BAYB 2YK0A 5EK4A 4X1KE 5BMVE 4MFRA 1WYBA 1Y64B 2PJQA 2XHEB 1U4QA 4V1Av 4CXYA 5L3GB 3CX6B 4JEHB 4EZ4A 3B57A 3PUGA 2NTXA 3OKQA 2V26A 3QC9A 4JEUB 3CX8B 1IAPA 4PFPA 1VOMA 3ESLA 1IJ5A 1LRZA 3GN5A 4O4JE 4CXWA 1LVKA 2I59A 2VKJA 2Q9QB 2Q9QD 1KNZA 3LG7A 4N78D 2X9YA 5JDMA 4QX7B 2VKOA 5JDLA 2EHOD 2VK9A 3CVRA 3MA9A 1MMNA 1D1AA 5HXRA 4DMVA 4HE8A 1UX5A 1S35A 3BK9A 4AKLA 3VKGA 3I0QA 2CWYA 1UX4A 1US7B 3K8PC 5LBQB 3FHNA 3RH3A 4F6RC 3S4UA 5EZYE 5JR9B 2L9QA 3O1IA 3UT5E 2QGSA 1X79A 3CMLA 2ES0A 4I55E 4XBFB 1MIYA 3FBLA 5HAXA 3LK42 1D0ZA 2C0SA 3JC6C 5DQVA 4IE0A 3A5XA 1B7TA 3F2EA 3EVYA 3AAIA 3B13A 3RKOA 4AKRB 1G8XA 2CXFA 2CEAA 2YU1A 3HKBE 4UVCB 1HS7A 3NRYA 2E8IA 2CWOA 2CCQA 3KV6A 4AQFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLE A; 
#chains in the Genus database with same CATH topology
 4UV9 B;  3JAF A;  2WDV A;  2BBH A;  4X20 E;  2AXD S;  4OYJ A;  4CN4 A;  5E0O A;  3ZPO A;  4CXX A;  2WU2 A;  1KFY A;  4DV5 T;  2D2S A;  4KHP T;  2VAS A;  1Z0P A;  4AQF A;  2ZLY A;  2IUB A;  3KV4 A;  5L2L A;  3KBT A;  3FXD B;  4IIJ E;  5ADX L;  4MLK A;  3R6N A;  3BQK A;  5AQF B;  2Q9Q A;  2JQH A;  2X67 A;  2CMR A;  5BR8 T;  5AQL B;  2ODV A;  5JH7 E;  4DV0 T;  2K24 A;  2N2N A;  4ADZ A;  2WM9 A;  5IWA T;  1HG2 A;  3PUX F;  5LB7 B;  4HTE A;  4J2C A;  2YDS A;  3ONX A;  3W15 B;  5FXZ A;  3H37 A;  3ZCI A;  3N9P A;  3LK2 B;  3AA0 B;  3PU3 A;  1OED C;  3K3O A;  4IE5 A;  3ZYL A;  3ZMV B;  4IDZ A;  4AQG A;  5AQJ B;  3GWH A;  1VCS A;  5AQR B;  5LGU B;  3UU8 A;  4I43 B;  4NPP A;  1V9D A;  2IML A;  4B3M T;  4TWD A;  2LT3 A;  3SOL A;  5HEU A;  2D5U A;  5ETW A;  3PJA J;  4O2A E;  2CXL A;  2D9D A;  2HH7 A;  2LOP A;  3Q5E A;  4X5T A;  3IF8 B;  4P0B A;  4GKK T;  3HR0 A;  2MPK A;  3C50 A;  3F31 A;  4KBM B;  4O8S A;  3BQI A;  4UF0 B;  4O2B E;  2UUA T;  1HCI A;  3T8O A;  4KP3 C;  3C4X A;  3L8R A;  4H9N C;  3AVS A;  3TLW A;  1HR0 T;  4U3C A;  3UUB A;  5A1L A;  2XTL A;  4DR6 T;  5FNV E;  3VR9 A;  2LJL A;  3KIN B;  3ZCJ A;  5ABE A;  4JI8 T;  3VRA A;  5KMG P;  4CZZ B;  3I9Y A;  2DHR A;  3PDY A;  3M65 A;  4HFH A;  3NRX A;  4GYR A;  4X1I E;  4HWC A;  4YSY A;  3WAK A;  3AXJ B;  4UEM A;  4LF6 T;  2WMO A;  3GA8 A;  3IEE A;  2JQ9 A;  1NWM X;  4ZI2 D;  1E2A A;  2XM2 A;  1XNR T;  2DWK A;  3NKZ A;  3QB5 K;  2CE7 A;  5LNK A;  3X1D A;  4BA9 A;  3FZK B;  2NW9 A;  1VRB A;  4UF0 A;  3EAM A;  5FVK A;  3MZK B;  4U2Y A;  4I0U A;  2UXN B;  2FJA A;  4WBN E;  3RF1 A;  5DAB A;  2V7I A;  5FKY A;  4JI3 T;  5FXV A;  4IL4 A;  2M6B A;  3HL6 A;  3RIA A;  2J47 A;  4DBQ A;  4LFA T;  3N2G E;  5FXW A;  4I50 E;  1E7P A;  1IJ6 A;  5IHY A;  4UVB B;  1YW0 A;  4H63 H;  5LGT B;  1OWA A;  2H7O A;  2LSG A;  2XY8 B;  2ACZ A;  3OBV E;  3RYF E;  1M62 A;  2YDR A;  3SRZ A;  2WWU A;  5JVD E;  2H7V C;  4JBW F;  3N2O A;  3ZEF B;  3AXJ A;  3Q2M A;  4PAG A;  2X0L B;  4GIW A;  4AQY T;  3ZYK A;  3EHZ A;  5LXT E;  3E08 A;  3GN5 B;  5J2U E;  5HCM A;  4PJJ A;  4EZH A;  3MK7 C;  3RYH E;  3KV9 A;  2XQA A;  3R84 B;  3AEC A;  4ZI3 C;  3C4Z A;  1HFA A;  4IST A;  5AQU B;  2QRX A;  3F57 A;  2JMH A;  4QXC B;  5JRC B;  3AAE B;  4XAX B;  3O4X E;  5JDN A;  3LJC A;  3FZF B;  4MBQ A;  4KX6 A;  3N2K E;  3ZN0 B;  2KWI B;  2E9X C;  4LF7 T;  3K3N A;  3QK6 A;  4KI0 F;  5AQV B;  4EIW A;  4YFS A;  3N9M A;  4YTP A;  1O3X A;  2WAU A;  3O9X A;  3ONJ A;  4X1K E;  4V1A v;  4CXY A;  5L3G B;  2VVN A;  3GN5 A;  1KNZ A;  1HNZ T;  2B76 A;  4N78 D;  4QX7 B;  2VKO A;  3CVR A;  3ZSS A;  1D1A A;  3BK9 A;  3I0Q A;  1IBM T;  2CWY A;  3ZST A;  3FHN A;  3RQU A;  3M3Z B;  5EZY E;  3UU4 A;  3A7M A;  2ES0 A;  4XBF B;  5C2T A;  1MIY A;  3LK4 2;  3JC6 C;  2BS2 A;  1M7K A;  4LF9 T;  4DV4 T;  2MAW A;  3F2E A;  3EVY A;  2YN6 A;  3RKO A;  1G8X A;  2WB5 A;  4QH5 A;  4UVC B;  2IHR 1;  2E8I A;  2CCQ A;  3KV6 A;  4AQF C;  2ZMA A;  4WW0 A;  4JI4 T;  4PK4 A;  3TLV A;  1NEK A;  4ZS2 A;  1WR6 A;  3VR8 A;  4NIQ A;  5AQP B;  4CI1 B;  3I9W A;  3AA1 B;  3CX7 B;  4DV1 T;  1L0V A;  3D0T A;  2Q9Q C;  5L4E A;  4DR1 T;  4HFD A;  3RIF A;  1HNX T;  4DVD A;  4UIG A;  1YD8 G;  2E2A A;  4H9S E;  1OXZ A;  2WDQ A;  4HWD A;  4A98 A;  4YHJ A;  4TV8 E;  2FBW A;  3KVA A;  4EAH A;  1WR0 A;  1D0Y A;  2EHO A;  5JDH A;  4NUU A;  5JRE A;  3DTO A;  3U3I A;  5JDG A;  5ABF B;  4JUY A;  4ZHQ E;  3N9L A;  5ABH A;  4YXD A;  3B5M A;  2PTF A;  3N9O A;  5FVL A;  3ZMT B;  2VKD A;  4AIU A;  1FMV A;  2QYW A;  4TN7 B;  1N33 T;  5IYZ E;  2Y8D A;  4ANJ A;  2HPJ A;  2QVA A;  2VQE T;  2K48 A;  4AIS A;  4H9R C;  2A9U A;  3V5S A;  2K3W A;  3V5U A;  3VU7 H;  5H6Q B;  4UV8 B;  4WBO A;  1ZV4 X;  2FJD A;  4OK0 A;  3U78 A;  1Z8U A;  1MNE A;  3TLU A;  5HWX A;  5KXJ A;  5AQQ B;  4IRE A;  2X68 A;  4A5X A;  4YT0 A;  3AB3 B;  2NR4 A;  1HTJ F;  2LHR A;  5FP3 A;  4IGU A;  2JJ9 A;  2NWB A;  1XNQ T;  4DR4 T;  1JNZ A;  1SHZ C;  1W0A A;  4TV9 E;  4YLH A;  5ABF A;  5J1G A;  1U5P A;  3AE6 A;  3BQL A;  4HN9 A;  4E7S A;  2ODU A;  4COF A;  3UU3 A;  2IC6 A;  2Z6E A;  4GK5 E;  4L5G A;  2JPF A;  3TLT A;  2RP4 A;  4IDO A;  4JYA T;  3PUV F;  3LSV A;  4PJL A;  3UUX B;  5AQO B;  3OYX A;  1W09 A;  4M1P A;  3IA3 A;  4H9O C;  5HXS A;  3ZJ2 A;  3E0Z A;  2DCF A;  2WZI A;  2XAJ B;  1FMW A;  2WMN A;  5AQK B;  2DLR A;  3GMI A;  1JNR A;  3AA6 B;  3AEB A;  5HEG A;  2KXP B;  2YU2 A;  2X0Y A;  1E1H B;  3PUY F;  2LLY A;  2X9W A;  4Z8X A;  1G73 A;  2IAK A;  5GON E;  2WU5 A;  4E7Z A;  2W4X A;  3UUM A;  4JI1 T;  5AQH B;  2W00 A;  2Y48 B;  4LMJ A;  4PNI A;  4EXT A;  2AE9 A;  1WYC A;  3ZMS B;  4A97 A;  3N9Q A;  5TAO A;  3NWI A;  2KMF A;  2NTY A;  5AQG B;  2L8K A;  5AFU L;  4L0R A;  5FY7 A;  4EYY R;  1MIV A;  2FJB A;  2VQF T;  3VKH A;  4YJ3 E;  2WSS V;  3RC8 A;  1D1C A;  3TKL B;  4U7I A;  1W0B A;  2BG9 B;  4DV2 T;  2VUR A;  4IL9 A;  1N34 T;  5LA6 E;  4DR5 T;  2V5C A;  2X9X A;  5HWY A;  1W9R A;  2LKG A;  5LBM A;  3J7Y q;  5LYJ E;  1IZN B;  2XQ7 A;  5FYM A;  5AQN B;  3RPU A;  3H3A A;  1N36 T;  5L3C B;  2QA7 A;  5LHI B;  4I4T E;  3Q9D A;  1HF8 A;  1UGO A;  2G0U A;  3RHW A;  3AA7 B;  4DBR A;  2JMK A;  3RYI E;  3KDS E;  1D1B A;  4NUV A;  1CUN A;  2VKH A;  2Y6X A;  3PUA A;  5HEJ A;  5C8Y E;  2CA5 A;  2J62 A;  4UXN B;  4JI2 T;  4ZZC A;  2CHN A;  3EI0 A;  2K9A A;  2LE8 A;  5LG3 A;  3RIU A;  5F8P A;  4ZOL E;  4HWH A;  2D0T A;  2FJE A;  2NP9 A;  2BG9 A;  2XAQ B;  2ZM0 A;  4U7Y A;  4GK0 E;  1HG5 A;  5FY1 A;  4OYK A;  2PBI A;  4KHZ F;  2I6H A;  2SPC A;  4X65 T;  2YK0 A;  3RGL A;  4WYV A;  4X66 T;  1Y64 B;  2XHE B;  1U4Q A;  2LM2 A;  3AE1 A;  3T1H T;  4ILC A;  2NTX A;  4JEU B;  5HCJ A;  4LF5 T;  2J4G A;  1IAP A;  4NXM T;  4O4J E;  1IJ5 A;  1LVK A;  2I59 A;  2VKJ A;  1SUM B;  1QLB A;  1J5W A;  2XM1 A;  2YKS A;  3MA9 A;  1MMN A;  2CBJ A;  4DID B;  3VKG A;  2BBJ A;  2H88 A;  4ILB A;  3S4U A;  4YSX A;  3L39 A;  5JR9 B;  4QH4 A;  1X79 A;  3FBL A;  2C0S A;  2XQ6 A;  5FL0 A;  1YQ3 A;  2W2U A;  2FUP A;  2CEA A;  2YU1 A;  3HKB E;  2UXC T;  1VCT A;  2JIW A;  3P4R A;  4HEA A;  3QOF A;  1HX1 B;  2UUC T;  3ZC1 A;  3MKD A;  5L3F B;  2BKP A;  5LHG B;  3LDQ B;  2V7M A;  3N5L A;  2X51 A;  1SA0 E;  5EK2 A;  3UU5 A;  4IE7 A;  2WP9 A;  4DUY T;  2EHO C;  4U31 A;  1BR1 A;  3IHR A;  1BR2 A;  2LOS A;  3PUR A;  4EYU A;  4HFE A;  2XQY A;  4WNK A;  2F4V T;  1KF6 A;  1DU2 A;  1UCU A;  2CXD A;  3RKG A;  1HX8 A;  2IC9 A;  2R6G F;  4LFB T;  3KVB A;  4C90 A;  4DMW A;  4GKJ T;  3ANW B;  4CI3 B;  5JR9 A;  3E22 E;  2YIN A;  2VB6 A;  5LHH B;  3PJA A;  4PK5 A;  3UQ7 A;  2UXX B;  5IUX A;  1I94 T;  4ILA A;  5LCY A;  5HEO A;  3OTO T;  4X62 T;  4PFO A;  4FJO A;  5LJM A;  4MAL A;  1FIO A;  2XQ3 A;  4LML A;  4OHF A;  1WRD A;  2V7K A;  3KBU A;  4TUY E;  3H3M A;  2B1E A;  2EHO B;  4PJM A;  4JI7 T;  3FZH B;  1YKE B;  2K5B B;  1KNP A;  5H6R B;  2BZB A;  5M4Y A;  2LSJ A;  3ZYM A;  5LMU T;  2XJ7 A;  4ASK A;  4B3R T;  3ONL C;  2RA1 A;  3AEG A;  3FZL B;  1YXR A;  1ZEE A;  4PJN A;  3P4P A;  4JI5 T;  2C5I T;  3SWH A;  4JV5 T;  5EK3 A;  4PK6 A;  3ZT6 A;  5LGN B;  4DR2 T;  1BR0 A;  3JAD A;  3P8C D;  2VL8 A;  3Q5W A;  2M67 A;  2KLQ A;  5JQG E;  3ANW A;  3KV5 A;  2WZH A;  1S94 A;  4P0A A;  4Z90 A;  4UVA B;  2BVM A;  4DUZ T;  2V1D B;  4C91 A;  2LSK A;  5KX5 E;  3QB5 A;  4EED A;  5KDM C;  1BR4 A;  2XSB A;  4UEL A;  2H89 A;  2UXD T;  5ABG A;  5FMN A;  4EB6 E;  3OPC A;  4H9P C;  3RLF F;  4Z91 A;  3K1S A;  4A56 A;  2WY2 A;  3AE9 A;  3EUH A;  3Q5D A;  4DV3 T;  3RX6 A;  1MMG A;  3EAB A;  2NW8 A;  4EEB A;  2UXB T;  2UUB T;  2C5J A;  1QUU A;  2BS4 A;  4GYS A;  5FXX A;  1NEN A;  5HXC A;  2BG9 E;  2W63 A;  3DP7 A;  4IDN A;  2X0H A;  4YSZ A;  2XSA A;  3LFM A;  2WDR A;  1UK5 A;  1LKX A;  4YTM A;  4F8H A;  3UU6 A;  1AJ3 A;  2XQ4 A;  3ZMU B;  3ZT7 A;  3G06 A;  4LF8 T;  2CM0 A;  4CN1 A;  3A8Y C;  4ISS A;  5HXE A;  2IW5 B;  5CGM A;  1J1J A;  4ZI3 D;  5HXH A;  2LSI A;  3I1A A;  5CB4 E;  1MIW A;  4IE6 A;  5F5W A;  2N1G A;  2C5K T;  4UR9 A;  5LMN T;  1UUR A;  3SS1 A;  3HA4 A;  2DWG A;  4P1N A;  4ZXL A;  2JQK A;  4YTN A;  4O4L E;  4DR3 T;  1IBL T;  1T7S A;  2E9X D;  3O1J A;  1HNW T;  5C3J A;  3VHL A;  2A72 A;  4HFV A;  4ZI2 C;  2KT9 A;  3NZP A;  2V8S V;  3MAC A;  3T1Y T;  2V7J A;  4QX8 B;  4U2Z A;  4AI6 A;  3AEF A;  4ZS3 A;  3ZN1 B;  1ZKE A;  4ZEY A;  5CFB A;  3CQC B;  1NAF A;  2BKO A;  4K0U A;  3ZKR A;  2LEH A;  3P4S A;  2KWH A;  4XZC A;  1Y01 A;  2LSY A;  2HPL A;  2OV9 A;  3FZM B;  4TZ4 C;  3FBZ A;  3L3P A;  5JTG A;  3Q5X A;  2PG8 A;  4ILU A;  2UU9 T;  5J2T E;  2XQ8 A;  3RIU C;  1MMD A;  3UQ4 A;  3AE5 A;  2XUE A;  2BG9 C;  2RPA A;  4TX5 A;  4FI5 A;  2LM9 A;  3C64 A;  2W62 A;  2BVL A;  5LG4 A;  4IDQ A;  2ZM6 T;  4BJN A;  3CKD A;  3UFE A;  3AED A;  4TNV A;  4IT4 A;  3AEE A;  5FL1 A;  2XPK A;  2MTQ A;  2WWV A;  2LKH A;  1SE7 A;  2HN2 A;  4HKA A;  4DV6 T;  4DR7 T;  1IBK T;  2XAS B;  3JC6 D;  2BS3 A;  3C51 A;  1WLX A;  3FXE B;  4DO0 A;  1KNR A;  3K3Q C;  5EK4 A;  5BMV E;  4MFR A;  3UFG A;  3B57 A;  2LRL A;  3PUG A;  3QC9 A;  3JCF A;  3CX8 B;  2WS3 A;  1VOM A;  4CXW A;  4HWF A;  2Q9Q D;  3LG7 A;  4B3T T;  2X9Y A;  5JDM A;  4DMV A;  1S35 A;  4AKL A;  1UX4 A;  1US7 B;  2V6Y B;  5CJ5 A;  5AQI B;  1R8I A;  2L9Q A;  3O1I A;  5HAX A;  1D0Z A;  5DQV A;  4IE0 A;  2CHO A;  3A5X A;  4YHH T;  2I0M A;  3AAI A;  1HS7 A;  3NRY A;  5AQM B;  1D0X A;  2MOZ A;  2WQY A;  3EDU A;  2E5L T;  2ACX A;  4OFZ A;  5LJN A;  2ZM2 A;  4IDP A;  3SFD A;  2VL0 A;  4B6X A;  3HKE E;  1OED B;  4K0K T;  4DND A;  2OLT A;  4EV6 A;  5F3J A;  3RI5 A;  2HHH T;  2P9B A;  1ZHC A;  3HKD E;  3PE0 A;  5FY0 A;  2LHN A;  2NW7 A;  5L47 A;  3C4W A;  4QHO A;  5L3B B;  1XMQ T;  3CWZ B;  5JR9 C;  3ABV A;  1UUS A;  3CQG B;  2ZM8 A;  3PU8 A;  4ERR A;  1XZY A;  4IHJ E;  2VWA A;  1WCR A;  2A2F X;  3FB2 A;  3UUN A;  3ZC0 A;  2WBL A;  2V6Y A;  2V5D A;  2X9H A;  3AE7 A;  3HI2 A;  2CPT A;  2XZE A;  1MMA A;  2IDO B;  2V6X A;  4YY3 T;  5LOV E;  4X64 T;  2JRK A;  2W0G A;  2X66 A;  3MXZ A;  1XDO A;  3OVU A;  2XAF B;  4QWN B;  3OJA A;  1XDP A;  2JQQ A;  2YOE A;  5JDQ A;  3AVR A;  2YDQ A;  1KEY A;  2XAG B;  2DL1 A;  1N32 T;  4GOU A;  3NBX X;  5CA1 E;  4MHC A;  3MJX A;  4G63 A;  1OED A;  1KK7 A;  2MYS A;  5HEH A;  3P4Q A;  3ZLI A;  3KFW X;  3ETU A;  5DQW A;  4O4I E;  4CQI A;  5L3D B;  2N9D A;  4AXP A;  1MND A;  3EDV A;  3RRC A;  2XQ5 A;  2V7L A;  4QXH B;  4TNW A;  3RC3 A;  3C98 B;  3CQX C;  4QH1 A;  3PUQ A;  5LP6 E;  2KZ7 B;  4OX9 T;  3OYZ A;  3ZT5 A;  3ETV A;  3AE3 A;  3QUJ A;  1LVF A;  3CPZ A;  3I0O A;  5J0Z A;  4QKN A;  1H7C A;  4EGW A;  3AAA B;  4LF4 T;  1XWM A;  3DJB A;  2PFV A;  3PUW F;  2CLY C;  4U33 A;  3PUZ F;  2HN1 A;  3LBX B;  3O1H A;  2DI4 A;  2D0U A;  3WAJ A;  3RRW A;  1YKH B;  3CIR A;  2A3D A;  3RYC E;  4Q25 A;  3RQW A;  3ZJ1 A;  4O4H E;  1T98 A;  1FEW A;  4JLE A;  4EOZ B;  4H63 V;  4AKG A;  4CI2 B;  4BJM A;  1GQE A;  3CK6 A;  3UTK A;  5AQT B;  4AKH A;  3AE4 A;  3L09 A;  4ZI7 E;  4HWI B;  4PW8 A;  3HKC E;  4G2A A;  1XMO T;  2W61 A;  4HFI A;  4IE4 A;  2NOX A;  3P7I A;  5L3E B;  5L4H A;  1YQ4 A;  2DNX A;  5DJQ C;  2CLY B;  3AEA A;  4LMK A;  5JDF A;  2E9X B;  2W67 A;  1T8B A;  3PTR B;  2M6I A;  5JRC A;  1QSD A;  4JI0 T;  1EZ3 A;  4DV7 T;  5AQS B;  4KUM B;  2H3R A;  3UUL A;  3ZMZ B;  3LBX A;  3P4W A;  3J9X 1;  3PUS A;  1T72 A;  2WCA A;  2MBG A;  2XQ9 A;  3LK3 B;  3AE2 A;  3NZQ A;  4QXB B;  4HFB A;  3SFE A;  3WI3 A;  4AKI A;  4L9I A;  3N9N A;  2L3L A;  4H9Q C;  2KSR A;  3TLS A;  1ZOY A;  1FJG T;  2BDE A;  4U74 A;  4ZZB A;  2IIU A;  4HFC A;  4TWF A;  4YJ2 E;  2GK9 A;  4HGA A;  2KND A;  5CA0 E;  4X1Y E;  3JAE A;  1WFD A;  1J5E T;  4P09 A;  2W66 A;  2VVS A;  2XAH B;  4B3S T;  2LRK A;  3P50 A;  2OA5 A;  4WZX A;  3VRB A;  2E5V A;  4U72 A;  3IBP A;  2KIN B;  2J1D G;  5HYA A;  3NVO A;  2E9X A;  4CN6 A;  2YEV C;  4KMC A;  4BAY B;  1WYB A;  2BKN A;  2PJQ A;  4JI6 T;  3CX6 B;  4JEH B;  4EZ4 A;  3AE8 A;  2V26 A;  3OKQ A;  4PFP A;  3ESL A;  1LRZ A;  2Q9Q B;  1I6Z A;  5JDL A;  2EHO D;  2VK9 A;  4TWH A;  2CBI A;  5HXR A;  4HE8 A;  1UX5 A;  1CHU A;  3K8P C;  5LBQ B;  3QNU A;  1X9B A;  3RH3 A;  1OED E;  4F6R C;  1ZP0 A;  4LFC T;  3UT5 E;  2QGS A;  3CML A;  4I55 E;  4NXN T;  3PV0 F;  2CRB A;  1B7T A;  3B13 A;  4AKR B;  2CXF A;  2CWO A; 
#chains in the Genus database with same CATH homology
 2ZMA A;  1D0X A;  4WW0 A;  4HEA A;  4UV9 B;  4PK4 A;  2MOZ A;  4X20 E;  3ZC1 A;  4ZS2 A;  1WR6 A;  3EDU A;  3MKD A;  5L3F B;  4OYJ A;  2ACX A;  5E0O A;  3ZPO A;  4OFZ A;  3I9W A;  4CXX A;  4CI1 B;  5LJN A;  2ZM2 A;  3AA1 B;  5LHG B;  2D2S A;  2V7M A;  3CX7 B;  2X51 A;  3N5L A;  4B6X A;  3D0T A;  2VAS A;  3HKE E;  2Q9Q C;  1SA0 E;  1Z0P A;  4AQF A;  2ZLY A;  5EK2 A;  4DND A;  3KV4 A;  4IE7 A;  2EHO C;  5F3J A;  5L2L A;  2P9B A;  1ZHC A;  3HKD E;  1BR1 A;  3KBT A;  3PE0 A;  5FY0 A;  2LHN A;  4DVD A;  2NW7 A;  3IHR A;  3C4W A;  3FXD B;  4QHO A;  4UIG A;  4IIJ E;  1YD8 G;  1BR2 A;  4H9S E;  1OXZ A;  5L3B B;  5ADX L;  2LOS A;  3PUR A;  4EYU A;  4YHJ A;  3CWZ B;  2XQY A;  4MLK A;  3R6N A;  4WNK A;  5JR9 C;  3BQK A;  2Q9Q A;  3CQG B;  4TV8 E;  2ZM8 A;  3KVA A;  2X67 A;  4EAH A;  3PU8 A;  4ERR A;  4IHJ E;  1D0Y A;  2CMR A;  2VWA A;  1UCU A;  2EHO A;  2CXD A;  2ODV A;  1HX8 A;  5JH7 E;  5JDH A;  2A2F X;  2IC9 A;  4NUU A;  5JRE A;  2K24 A;  3FB2 A;  3UUN A;  3DTO A;  2N2N A;  3U3I A;  5JDG A;  3ZC0 A;  4JUY A;  4ZHQ E;  4ADZ A;  2WBL A;  3KVB A;  3N9L A;  4C90 A;  4DMW A;  2WM9 A;  2X9H A;  3ANW B;  3HI2 A;  4CI3 B;  1HG2 A;  5JR9 A;  1MMA A;  3E22 E;  2YIN A;  2VB6 A;  5LOV E;  5LHH B;  4HTE A;  4J2C A;  4PK5 A;  2JRK A;  3ONX A;  3W15 B;  2W0G A;  2X66 A;  3MXZ A;  3N9O A;  2UXX B;  5FXZ A;  3H37 A;  3ZMT B;  3ZCI A;  2VKD A;  5LCY A;  2XAF B;  3N9P A;  1FMV A;  4QWN B;  3OJA A;  3LK2 B;  3AA0 B;  4TN7 B;  4PFO A;  4FJO A;  5LJM A;  3PU3 A;  4MAL A;  1FIO A;  2JQQ A;  3K3O A;  5JDQ A;  4IE5 A;  5IYZ E;  2Y8D A;  4ANJ A;  2HPJ A;  4OHF A;  1WRD A;  3AVR A;  2V7K A;  3ZYL A;  3KBU A;  4TUY E;  3ZMV B;  2B1E A;  4IDZ A;  2EHO B;  2K48 A;  4PJM A;  2XAG B;  4H9R C;  4AQG A;  3V5S A;  3V5U A;  3GWH A;  4GOU A;  3VU7 H;  1YKE B;  5H6Q B;  3NBX X;  2K5B B;  5CA1 E;  4MHC A;  4UV8 B;  5LGU B;  3MJX A;  4G63 A;  4WBO A;  4I43 B;  1V9D A;  5H6R B;  1KK7 A;  1ZV4 X;  2BZB A;  2MYS A;  4OK0 A;  5M4Y A;  3U78 A;  3ZLI A;  2LSJ A;  3ZYM A;  3KFW X;  2LT3 A;  3SOL A;  4ASK A;  3ETU A;  2RA1 A;  1MNE A;  2D5U A;  5HWX A;  1ZEE A;  5ETW A;  4PJN A;  5DQW A;  3SWH A;  2C5I T;  2X68 A;  4O2A E;  2CXL A;  5EK3 A;  4O4I E;  4CQI A;  3AB3 B;  5L3D B;  1HTJ F;  2LHR A;  2N9D A;  4AXP A;  1MND A;  2HH7 A;  4PK6 A;  5FP3 A;  4IGU A;  5LGN B;  2LOP A;  2JJ9 A;  2NWB A;  1BR0 A;  3IF8 B;  4P0B A;  3HR0 A;  3C50 A;  3F31 A;  3P8C D;  4KBM B;  4O8S A;  1SHZ C;  4TV9 E;  3BQI A;  4UF0 B;  2VL8 A;  3EDV A;  3Q5W A;  4O2B E;  4YLH A;  3RRC A;  2M67 A;  5J1G A;  1U5P A;  1HCI A;  2KLQ A;  3T8O A;  4KP3 C;  5JQG E;  2V7L A;  3C4X A;  3BQL A;  3ANW A;  3KV5 A;  1S94 A;  4P0A A;  4H9N C;  4UVA B;  4HN9 A;  4E7S A;  2BVM A;  3AVS A;  4QXH B;  3RC3 A;  2ODU A;  2V1D B;  3C98 B;  3CQX C;  4C91 A;  2LSK A;  5A1L A;  2IC6 A;  2Z6E A;  5KX5 E;  2XTL A;  3PUQ A;  4GK5 E;  4L5G A;  2JPF A;  5LP6 E;  5KDM C;  2KZ7 B;  1BR4 A;  2RP4 A;  5FNV E;  3OYZ A;  2LJL A;  4UEL A;  3KIN B;  4PJL A;  3ZCJ A;  3UUX B;  3ETV A;  3QUJ A;  3OYX A;  1LVF A;  3CPZ A;  3I0O A;  5FMN A;  4EB6 E;  4M1P A;  4QKN A;  4H9P C;  5KMG P;  4CZZ B;  1H7C A;  3I9Y A;  2DHR A;  4H9O C;  5HXS A;  3ZJ2 A;  3PDY A;  3AAA B;  4A56 A;  3E0Z A;  3EUH A;  2DCF A;  3M65 A;  3NRX A;  4GYR A;  4X1I E;  3DJB A;  2PFV A;  2XAJ B;  3RX6 A;  1FMW A;  2WMN A;  2DLR A;  1MMG A;  3WAK A;  2NW8 A;  2CLY C;  3GMI A;  3AA6 B;  2KXP B;  3LBX B;  3O1H A;  2DI4 A;  2C5J A;  1QUU A;  4UEM A;  2D0U A;  3WAJ A;  2YU2 A;  4GYS A;  3RRW A;  1E1H B;  1YKH B;  2WMO A;  5FXX A;  2A3D A;  3RYC E;  3GA8 A;  5HXC A;  3IEE A;  2W63 A;  1NWM X;  2X9W A;  3DP7 A;  4Z8X A;  4ZI2 D;  1G73 A;  3ZJ1 A;  2IAK A;  2DWK A;  4O4H E;  5GON E;  1T98 A;  1FEW A;  4E7Z A;  3LFM A;  2CE7 A;  3UUM A;  5LNK A;  4JLE A;  1LKX A;  4EOZ B;  4H63 V;  2W00 A;  4BA9 A;  2Y48 B;  1AJ3 A;  2NW9 A;  4PNI A;  4AKG A;  4EXT A;  4CI2 B;  1VRB A;  4UF0 A;  3ZMU B;  1WYC A;  4BJM A;  3MZK B;  3UTK A;  2CM0 A;  4AKH A;  2UXN B;  4WBN E;  3L09 A;  3ZMS B;  4ISS A;  4ZI7 E;  5HXE A;  3N9Q A;  5DAB A;  2V7I A;  2IW5 B;  4PW8 A;  5TAO A;  2KMF A;  2NTY A;  4ZI3 D;  5HXH A;  2LSI A;  2L8K A;  3HKC E;  5FXV A;  3I1A A;  4G2A A;  5AFU L;  3HL6 A;  4L0R A;  5FY7 A;  5CB4 E;  4EYY R;  1MIW A;  1MIV A;  3VKH A;  4DBQ A;  4IE6 A;  2N1G A;  2C5K T;  3N2G E;  2W61 A;  4YJ3 E;  2WSS V;  5FXW A;  4I50 E;  2NOX A;  4IE4 A;  3RC8 A;  1D1C A;  3P7I A;  3TKL B;  1IJ6 A;  5IHY A;  4UVB B;  5L3E B;  1YW0 A;  4H63 H;  3SS1 A;  5LGT B;  3HA4 A;  2DWG A;  1OWA A;  2H7O A;  2LSG A;  5LA6 E;  2DNX A;  3OBV E;  3RYF E;  5DJQ C;  3SRZ A;  2CLY B;  2WWU A;  2X9X A;  5HWY A;  4O4L E;  5JDF A;  2E9X B;  2E9X D;  5JVD E;  3O1J A;  3PTR B;  5JRC A;  2H7V C;  2A72 A;  5LBM A;  3VHL A;  4HFV A;  1QSD A;  4ZI2 C;  3J7Y q;  2KT9 A;  3NZP A;  5LYJ E;  1IZN B;  1EZ3 A;  3MAC A;  3N2O A;  5FYM A;  3ZEF B;  2V7J A;  3Q2M A;  4PAG A;  4QX8 B;  3RPU A;  4AI6 A;  2X0L B;  4KUM B;  3H3A A;  2H3R A;  4ZS3 A;  4GIW A;  5L3C B;  3UUL A;  3ZMZ B;  2QA7 A;  3LBX A;  3ZN1 B;  5LHI B;  1ZKE A;  4I4T E;  3J9X 1;  3PUS A;  3CQC B;  3ZYK A;  5LXT E;  3Q9D A;  2MBG A;  1HF8 A;  1NAF A;  3LK3 B;  3E08 A;  3GN5 B;  2G0U A;  5J2U E;  3AA7 B;  3NZQ A;  4PJJ A;  4EZH A;  4K0U A;  4QXB B;  3MK7 C;  3RYH E;  3KV9 A;  4DBR A;  2LEH A;  3R84 B;  2KWH A;  4XZC A;  2JMK A;  2LSY A;  3WI3 A;  2HPL A;  4AKI A;  4L9I A;  4ZI3 C;  3C4Z A;  3RYI E;  1HFA A;  3N9N A;  4TZ4 C;  3KDS E;  2L3L A;  1D1B A;  3FBZ A;  3L3P A;  4IST A;  4H9Q C;  3Q5X A;  4NUV A;  2PG8 A;  4ILU A;  3F57 A;  5J2T E;  2BDE A;  1CUN A;  2VKH A;  2Y6X A;  1MMD A;  4U74 A;  3PUA A;  2JMH A;  2XUE A;  5C8Y E;  4QXC B;  5JRC B;  2CA5 A;  4TX5 A;  3AAE B;  4XAX B;  3O4X E;  4FI5 A;  2LM9 A;  5JDN A;  3C64 A;  3LJC A;  4UXN B;  4MBQ A;  4YJ2 E;  3N2K E;  2W62 A;  2BVL A;  5LG4 A;  3ZN0 B;  2K9A A;  2LE8 A;  2KWI B;  2GK9 A;  2E9X C;  3CKD A;  3UFE A;  4BJN A;  4HGA A;  2KND A;  3K3N A;  5CA0 E;  3QK6 A;  4X1Y E;  4ZOL E;  5F8P A;  4EIW A;  2D0T A;  2NP9 A;  2MTQ A;  2XAQ B;  2ZM0 A;  4P09 A;  4YFS A;  2XAH B;  4HKA A;  4GK0 E;  3N9M A;  2OA5 A;  1HG5 A;  5FY1 A;  2XAS B;  3JC6 D;  4OYK A;  4U72 A;  1O3X A;  3IBP A;  2KIN B;  2PBI A;  2J1D G;  5HYA A;  3C51 A;  1WLX A;  2E9X A;  3FXE B;  4DO0 A;  2YEV C;  2WAU A;  4KMC A;  3O9X A;  2SPC A;  3K3Q C;  4BAY B;  2YK0 A;  5EK4 A;  4X1K E;  5BMV E;  4MFR A;  1WYB A;  1Y64 B;  2PJQ A;  2XHE B;  1U4Q A;  4V1A v;  4CXY A;  5L3G B;  3CX6 B;  4JEH B;  4EZ4 A;  3B57 A;  3PUG A;  2NTX A;  3OKQ A;  2V26 A;  3QC9 A;  4JEU B;  3CX8 B;  1IAP A;  4PFP A;  1VOM A;  3ESL A;  1IJ5 A;  1LRZ A;  3GN5 A;  4O4J E;  4CXW A;  1LVK A;  2I59 A;  2VKJ A;  2Q9Q B;  2Q9Q D;  1KNZ A;  3LG7 A;  4N78 D;  2X9Y A;  5JDM A;  4QX7 B;  2VKO A;  5JDL A;  2EHO D;  2VK9 A;  3CVR A;  3MA9 A;  1MMN A;  1D1A A;  5HXR A;  4DMV A;  4HE8 A;  1UX5 A;  1S35 A;  3BK9 A;  4AKL A;  3VKG A;  3I0Q A;  2CWY A;  1UX4 A;  1US7 B;  3K8P C;  5LBQ B;  3FHN A;  3RH3 A;  4F6R C;  3S4U A;  5EZY E;  5JR9 B;  2L9Q A;  3O1I A;  3UT5 E;  2QGS A;  1X79 A;  3CML A;  2ES0 A;  4I55 E;  4XBF B;  1MIY A;  3FBL A;  5HAX A;  3LK4 2;  1D0Z A;  2C0S A;  3JC6 C;  5DQV A;  4IE0 A;  3A5X A;  1B7T A;  3F2E A;  3EVY A;  3AAI A;  3B13 A;  3RKO A;  4AKR B;  1G8X A;  2CXF A;  2CEA A;  2YU1 A;  3HKB E;  4UVC B;  1HS7 A;  3NRY A;  2E8I A;  2CWO A;  2CCQ A;  3KV6 A;  4AQF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...