4JLEA

Structure of the p. falciparum pfi1780w phist domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
149
structure length
149
Chain Sequence
YTAEEINEMINSSNEFINRNDMNIIFSYVHESEREKFKKVEENIFKFIQSIVETYKIPDEYKMRKFKFAHFEMQGYALKQEKFLLEYAFLSLNGKLCERKKFKEVLEYVKREWIEFRKSMFDVWKEKLASEFREHGEMLNQKRKLKQHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords PHIST
publication title A Plasmodium falciparum PHIST protein binds the virulence factor PfEMP1 and comigrates to knobs on the host cell surface.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 60
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09687 PRESAN Plasmodium RESA N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jleA00
4JLEA
chains in the Genus database with same CATH superfamily
4KHPT 4IDPA 2WU2A 3OPCA 2QVAA 4E7SA 4DVDA 2IHR1 3RI5A 3BQKA 4PFOA 1LVKA 2WDVA 3GN5B 4OX9T 3EI0A 4AKLA 4X5TA 5IHYA 3HKEE 3CQXC 4COFA 4IDOA 2LSJA 3AEDA 4O8SA 1XDPA 2UUBT 3E22E 2JQKA 4CN1A 5HEOA 3KV4A 3I9YA 5DJQC 3ZJ1A 4IE4A 1M62A 4DV0T 2XPKA 3K1SA 4YJ2E 3RRWA 3QOFA 3RQUA 3ZSTA 2WBLA 3ETUA 3ONLC 5FVKA 4GK0E 5FXWA 3QK6A 2WMNA 5JDLA 2V5CA 2LM2A 1XDOA 3OKQA 2YU2A 3IEEA 4U2ZA 4IE5A 3ZT7A 4NPPA 4IREA 3SWHA 2D0UA 4HWHA 2VWAA 5LMUT 2PBIA 4ASKA 4DO0A 5AQVB 2B1EA 5FY1A 2I6HA 3C98B 4UVCB 1KK7A 5AQKB 3FXEB 4ZHQE 1HF8A 2XAQB 5HAXA 4M1PA 3HKCE 4JI7T 3AEAA 2X9WA 1MNDA 2LHRA 1UURA 4ERRA 2WB5A 2XQ6A 1JNZA 2X0LB 4I0UA 3PDYA 1J1JA 2LJLA 1Z8UA 2E9XC 2X0YA 1D0XA 4XAXB 2IAKA 1IBMT 5CFBA 4YJ3E 3RX6A 4FJOA 3A8YC 5LBMA 1IJ5A 4U2YA 3B5MA 1FMWA 3K3QC 2VK9A 3KDSE 3CMLA 3ZN1B 3UQ7A 4I55E 2CEAA 4HTEA 4CI3B 3ZC0A 3RH3A 1N32T 4ILBA 2B76A 4QH1A 2W0GA 3CK6A 3JADA 3ZN0B 4ANJA 5FVLA 4DNDA 3EDVA 3Q5WA 2IC9A 4QX8B 3WAJA 4IHJE 3UULA 2D9DA 3LFMA 5LHGB 3MK7C 4YHHT 4HEAA 3O1IA 2JIWA 3NZQA 5L3BB 5AQPB 3ZCJA 5HXSA 2KLQA 3RHWA 5JREA 4ZXLA 5ADXL 4GK5E 2ZLYA 3N9PA 4HFEA 2KWHA 4EEBA 3VKHA 1DU2A 4AQFA 1W09A 3AAAB 1WR0A 2Q9QD 3VRBA 4ILUA 1VCSA 5KX5E 3TLSA 4DV3T 3QNUA 2LT3A 1IAPA 2NW9A 4HFVA 4ZI2D 2CE7A 4JV5T 2XY8B 2F4VT 4XZCA 2J1DG 4YSZA 4ILCA 5F3JA 4LF6T 2CBJA 3ZC1A 5JR9B 3KVAA 5LGUB 2XM2A 3MJXA 1OEDB 3PUGA 4O4LE 3JAEA 2WSSV 1VRBA 3AAEB 5AQNB 2UXDT 2K3WA 4TNWA 4IT4A 3WI3A 1WLXA 2YOEA 5HWXA 3RYIE 2JMHA 3A5XA 2DI4A 3FXDB 3VR9A 5ABFA 4IDNA 4GIWA 2M67A 4PJLA 5AFUL 2XASB 3I0OA 4PK6A 4LFBT 5AQTB 4OK0A 4MFRA 5C3JA 5JDHA 1OXZA 2CHOA 4UF0A 2KMFA 2BG9A 3N2GE 2XSAA 4JLEA 4HWCA 4NXNT 4NXMT 4U33A 1BR0A 2FJDA 5KDMC 4P0BA 3FHNA 5ETWA 4X20E 2J62A 4L0RA 2FJEA 4PK4A 4KMCA 2V6YA 5KMGP 4LF5T 4X65T 3PE0A 3N9OA 2DLRA 2YDSA 5JRCB 2H7OA 3E08A 5LNKA 5A1LA 3D0TA 3TKLB 3FZMB 5LBQB 4AKRB 2ZM8A 2RPAA 1YQ4A 3C50A 4UV8B 3UUBA 3AVRA 1W0BA 1YQ3A 2KNDA 4YLHA 4LF8T 2W4XA 5EK4A 2BZBA 3ZYMA 4HFDA 2CWYA 1WYBA 5DQVA 3KFWX 4U31A 1HS7A 3DTOA 4CI1B 2BG9E 3MZKB 2XUEA 5L4HA 4EYUA 2WY2A 5DQWA 3AEBA 4L5GA 4ISTA 2G0UA 3T8OA 1AJ3A 5AQUB 5JDNA 1MMGA 5FYMA 5FXZA 2MTQA 5FP3A 4DV5T 1Z0PA 5HWYA 3ZMUB 4TWHA 3CX8B 3T1HT 2NP9A 3VRAA 5LOVE 4GYRA 5LHIB 3H3AA 3RIFA 2WZHA 2ZM0A 1XMOT 3DP7A 5L3EB 4MHCA 1BR1A 2BS2A 2FUPA 2H88A 2V8SV 4LFCT 2UXCT 3QB5K 1SHZC 2PFVA 3V5UA 2V7MA 4WNKA 2CA5A 3UU6A 2SPCA 3KBTA 4AKIA 3KBUA 2RA1A 1HCIA 2E5LT 3TLUA 3P4WA 5AQOB 3UU8A 2VKOA 2WM9A 4YSXA 3S4UA 3NRXA 5LHHB 3ZKRA 4DV7T 3WAKA 1E2AA 3R6NA 2H3RA 4DR5T 4PJMA 2V5DA 3PURA 4KI0F 5LJNA 2XQ8A 3PUQA 3OBVE 3N2KE 3ONXA 3FZLB 4JI5T 3AE4A 1SUMB 2BG9C 2E2AA 2BKNA 4IE7A 2YDRA 2JJ9A 4LF7T 1HNWT 3HA4A 5CA0E 4JI3T 2XSBA 3PUXF 3I0QA 3KVBA 3ZYLA 2WU5A 4DR4T 1XNRT 4IDQA 3P8CD 3N9LA 4DR1T 3LG7A 5HXEA 4FI5A 4IL9A 4TN7B 2HHHT 3CVRA 5LP6E 2EHOA 3PV0F 3UU3A 3QC9A 2R6GF 5HEJA 4ZOLE 3PTRB 3ZMSB 2X67A 2CLYC 5LMNT 5LGTB 1ZKEA 5LXTE 4EGWA 3ANWA 2CXFA 3ZCIA 4UVAB 2CXDA 5CA1E 2L9QA 4UV9B 5JDMA 2HPLA 4PNIA 5LYJE 4LMJA 4QH4A 2D5UA 4EAHA 4U7YA 4O4HE 3RKGA 3F57A 5FKYA 4QX7B 2Q9QC 3UU5A 1YKHB 1US7B 3EDUA 4QHOA 5LB7B 4ILAA 2WWVA 2FJAA 3GN5A 3UUXB 2XQ4A 4YHJA 5BMVE 4JYAT 4LF9T 5BR8T 4X66T 4HWDA 4WBOA 4DBRA 3L39A 3AXJA 1LRZA 4QXHB 2DCFA 3BQIA 2YKSA 2W2UA 4TV8E 3P4QA 2K48A 3NVOA 2VVSA 1O3XA 4OFZA 5IWAT 2NOXA 2XQYA 4AKHA 4NIQA 1HNXT 2GK9A 2BKPA 2XQ7A 4PW8A 3PUWF 4JI0T 3W15B 3BK9A 2W63A 3CKDA 3EVYA 3RKOA 3JC6D 4F6RC 2A9UA 1CUNA 4J2CA 5HXCA 1HFAA 1XNQT 4EZ4A 3UFEA 4HFIA 2BS3A 4UELA 3Q5DA 3L09A 2AXDS 2QGSA 5FY7A 3C4ZA 2NTYA 3EAMA 1UX5A 2X9HA 1L0VA 3AE2A 3ZT6A 1I94T 3R84B 3Q5EA 5F5WA 5JDGA 3EHZA 4JEUB 3AECA 3Q9DA 5IYZE 1G73A 4U3CA 3N2OA 2N1GA 3P4SA 2ZM2A 2V7KA 3ZLIA 3UUMA 1U5PA 5ABEA 4UVBB 4DV4T 2EHOC 3VU7H 5IUXA 2ACZA 2LHNA 2YK0A 1G8XA 4QXCB 2X51A 4KP3C 4K0KT 4TX5A 1LKXA 2WMOA 4LMLA 4YSYA 2DHRA 3FZFB 3VHLA 2YU1A 2FJBA 3CX7B 4Z91A 2Y8DA 1HG5A 4BAYB 3PUYF 5ABFB 5L47A 4PAGA 4O2BE 2XTLA 3K3OA 2VB6A 4JI1T 4HE8A 1SA0E 1J5ET 5CJ5A 4KHZF 5ABHA 1QSDA 3PJAJ 4AISA 4GKJT 4H9SE 4KUMB 2W67A 4E7ZA 2BS4A 4PFPA 4OHFA 2CCQA 2ZMAA 2Z6EA 4EYYR 2IDOB 5J2TE 4QH5A 4DR3T 4B3MT 2NW8A 2LRKA 3LK3B 4H9OC 3V5SA 3LSVA 1MNEA 4ZI3D 4EOZB 2WDQA 4H9QC 2NTXA 2LLYA 4C91A 4P09A 1J5WA 2LOPA 3ONJA 2MAWA 2OLTA 2A3DA 2C5JA 3NRYA 4AIUA 2H89A 5AQRB 4ZS3A 2XAJB 3H37A 2KT9A 3QB5A 4ZZBA 4DR7T 2IMLA 1D1BA 5LG4A 2MOZA 4I50E 1XWMA 1S35A 4MLKA 2VKHA 3AEEA 2VQFT 1UX4A 4LFAT 4IL4A 2HPJA 4HN9A 2VL0A 4ISSA 3H3MA 1QLBA 5HEGA 2M6IA 2LSGA 1IBKT 4GKKT 1OEDA 2L8KA 3N9MA 4L9IA 4V1Av 3KV6A 2NWBA 4IE0A 3EABA 2ES0A 3RPUA 3RQWA 2QA7A 4DR6T 3CIRA 5F8PA 3AE9A 5L3CB 4OYKA 4DV6T 3LK42 3GMIA 3RYHE 5FXXA 2IW5B 1FMVA 4YTPA 2NW7A 3U78A 3VR8A 5JH7E 3OYXA 3ZT5A 3T1YT 4A98A 4WYVA 4B3RT 3UFGA 2W66A 4IDZA 4TV9E 1UUSA 2E5VA 4B6XA 5AQFB 5HXRA 1ZP0A 1UCUA 4HFCA 3MXZA 4YTNA 1OEDE 3LBXA 5AQGB 4X1YE 2LEHA 4AQGA 2UU9T 3J7Yq 2E9XB 4IGUA 2BDEA 3PUVF 4TWDA 2W00A 2Q9QA 2DL1A 2CXLA 3C4XA 1V9DA 1HR0T 3AA7B 2DWKA 2BVMA 5AQLB 2CPTA 4JI8T 1HX1B 4IIJE 4JEHB 3ZJ2A 1KF6A 1N36T 1FEWA 4QKNA 2WDRA 4CI2B 1U4QA 1MIYA 1NEKA 2WS3A 4DUZT 5JTGA 2VVNA 1T7SA 1KNZA 1E7PA 1HNZT 3SFDA 1GQEA 3MACA 4PJJA 1WR6A 4C90A 3F2EA 3U3IA 3AA0B 5H6QB 3HR0A 3P50A 2A2FX 5EK3A 3M3ZB 3UUNA 2K5BB 3AE6A 4DMWA 2EHOB 2D0TA 2V6XA 1D1AA 2AE9A 1KEYA 3NBXX 5AQSB 4K0UA 1CHUA 3AA1B 1NENA 3ANWB 4EB6E 2BVLA 4DV2T 2DNXA 2W61A 2MBGA 2VASA 3NZPA 2KXPB 2YN6A 1FIOA 1WRDA 2M6BA 2V7IA 3AEGA 4ZZCA 5FXVA 4O4IE 3OVUA 2ZM6T 1UGOA 4H9RC 3N5LA 2RP4A 3I9WA 1OEDC 4X62T 2J47A 3KV5A 2K24A 1JNRA 2IC6A 5L3GB 4N78D 2V7LA 2MYSA 5TAOA 2JQQA 2I59A 1IZNB 3ETVA 1M7KA 3RRCA 2PTFA 5DABA 4U72A 3IF8B 5AQIB 2XAFB 3AVSA 4DV1T 5AQJB 4P0AA 2V7JA 5FMNA 4ZEYA 3AXJB 3SOLA 3CQGB 3O1JA 2LRLA 3OYZA 1Y01A 3SRZA 5L2LA 2V1DB 3AEFA 3IA3A 3AE5A 4ZS2A 2XZEA 4O4JE 4IE6A 2JPFA 3ABVA 4DR2T 1HX8A 2QRXA 2OA5A 2MPKA 4EEDA 4LF4T 4H63H 4G2AA 4YXDA 3HKDE 4ZI2C 4EV6A 3Q2MA 3I1AA 2HN2A 3VKGA 1MIWA 3ZMZB 3UTKA 4F8HA 2LOSA 1VCTA 3PUSA 4AKGA 2XQ9A 4CQIA 3RC8A 2JMKA 3TLTA 3OTOT 2UXNB 1HG2A 1X9BA 1BR2A 1YD8G 2N2NA 5AQQB 4Z8XA 4H9NC 4DMVA 4I43B 3C64A 3TLWA 2XAHB 4ZI3C 4WW0A 5LCYA 3PU3A 5JVDE 3JCFA 4TWFA 3UT5E 5M4YA 1KNRA 3L8RA 3RIUA 3N9NA 4H9PC 4HWFA 4EZHA 3MKDA 1MMNA 3K3NA 1XMQT 4HKAA 1S94A 5HYAA 2V26A 3ZEFB 2CWOA 4CN6A 2CM0A 2VQET 3FBLA 3AAIA 3RYFE 2YDQA 3B13A 3GWHA 2VKDA 3Q5XA 2WZIA 2WAUA 2JQHA 3HL6A 5FNVE 3EUHA 1KNPA 1MIVA 2XQAA 1N34T 2BBHA 5EZYE 4UXNB 3BQLA 4MALA 3SS1A 1T72A 2YEVC 4MBQA 1KFYA 3LJCA 3AE8A 4NUVA 3J9X1 2KSRA 4GYSA 2BBJA 2OV9A 3RIAA 2IIUA 5C2TA 3AB3B 2UUAT 4QXBB 5LA6E 4A56A 4U74A 1BR4A 3ZSSA 2X68A 2WWUA 4A5XA 5HXHA 4G63A 3A7MA 5J1GA 4GOUA 2HH7A 5GONE 5JDQA 3PUZF 4AI6A 3SFEA 3CX6B 2CMRA 5L3DB 2W62A 3AE7A 3FZHB 2LM9A 5C8YE 4CN4A 2JQ9A 1WYCA 5AQHB 3KINB 4PJNA 3HI2A 4TZ4C 2L3LA 1ZOYA 4X64T 1T98A 2N9DA 2J4GA 4JI2T 3B57A 4YY3T 3K8PC 5HEHA 2CHNA 4UF0B 5FY0A 3ZMTB 2BG9B 3FBZA 2HN1A 4JI4T 2C5IT 2Y6XA 2UXXB 2XM1A 4YTMA 3NWIA 2KZ7B 3C4WA 3RC3A 4KBMB 4UEMA 3LK2B 3C51A 1NWMX 4YFSA 3PUAA 2VKJA 1ZEEA 4BJMA 1E1HB 2V6YB 4CXYA 2ODUA 3CQCB 4XBFB 1YXRA 4JI6T 5J2UE 2KWIB 2X9XA 2H7VC 2VURA 4A97A 3IHRA 2Y48B 5HCMA 2UXBT 2D2SA 2JRKA 5CB4E 1X79A 2KINB 1WCRA 4WBNE 2LKGA 5J0ZA 2QYWA 2X0HA 5JDFA 1I6ZA 1SE7A 2CLYB 2K9AA 2XJ7A 4BA9A 2E9XD 2LKHA 1OWAA 1WFDA 3ESLA 1D1CA 2I0MA 2CRBA 3RIUC 4NUUA 3QUJA 1IJ6A 3RYCE 2PJQA 4PK5A 4AQYT 2IUBA 4HWIB 4TUYE 5L3FB 2P9BA 5LJMA 4HFBA 5HCJA 5H6RB 5JR9A 3ZYKA 1NAFA 4UR9A 4U7IA 3N9QA 3LBXB 4CXXA 1D0ZA 4OYJA 5HEUA 4WZXA 2Q9QB 2X66A 5L4EA 3F31A 4ADZA 5E0OA 3JAFA 5ABGA 1FJGT 2EHOD 4Q25A 2LE8A 3PJAA 3L3PA 4CZZB 3NKZA 3OJAA 1YKEB 3ZMVB 1R8IA 2X9YA 2LSYA 3P7IA 2PG8A 4X1IE 2CBIA 1W9RA 3M65A 5KXJA 2LSIA 5FL0A 1XZYA 3IBPA 2ACXA 4B3ST 1B7TA 3ZPOA 3G06A 3O1HA 4P1NA 4AXPA 3P4RA 2XAGB 3MA9A 3AA6B 3P4PA 3AE3A 3CPZA 5LG3A 1D0YA 1MMDA 1N33T 4DIDB 4I4TE 4EIWA 1YW0A 1H7CA 4QWNB 5JRCA 4AQFC 1UK5A 2XQ3A 4B3TT 2XQ5A 3LDQB 2WP9A 1MMAA 3RGLA 4O2AE 3DJBA 5CGMA 5LGNB 3RF1A 2WCAA 4EXTA 2ODVA 3FB2A 5FL1A 3PU8A 3KV9A 3E0ZA 2VL8A 1W0AA 4BJNA 5JQGE 4TNVA 1EZ3A 1Y64B 3UU4A 4JBWF 4HGAA 3HKBE 2WQYA 3AE1A 2E8IA 4UIGA 3FZKB 4ZI7E 3RLFF 4X1KE 2DWGA 2YINA 2UUCT 1IBLT 3UQ4A 4JUYA 5EK2A 4H63V 2XHEB 3CWZB 3O4XE 3O9XA 5AQMB 2C0SA 1VOMA 3X1DA 3TLVA 2E9XA 4KX6A 1ZV4X 4DBQA 2LSKA 1HTJF 1T8BA 2C5KT 3JC6C 4Z90A 4YT0A 4HFHA 4CXWA 2NR4A 1ZHCA 2FBWA 2A72A 4LMKA 5JR9C 1LVFA 4DUYT 2BKOA 3GA8A 1QUUA
chains in the Genus database with same CATH topology
2G0UA 3UT5E 5M4YA 3T8OA 1AJ3A 2Z6EA 4EYYR 5J2TE 3N9NA 5JDNA 4E7SA 4H9PC 1MMGA 4DVDA 5FYMA 4EZHA 2NW8A 3LK3B 5FXZA 2MTQA 3BQKA 1MMNA 3MKDA 4PFOA 1LVKA 5FP3A 1Z0PA 3K3NA 5HWYA 3GN5B 4H9OC 3V5SA 4HKAA 3ZMUB 3CX8B 1S94A 4AKLA 2NP9A 5HYAA 2V26A 1MNEA 5IHYA 4ZI3D 4EOZB 3HKEE 3ZEFB 2CWOA 4H9QC 5LOVE 2CM0A 3FBLA 3AAIA 3CQXC 4GYRA 3B13A 3RYFE 2NTXA 4C91A 3GWHA 2VKDA 2LSJA 3Q5XA 5LHIB 2WAUA 3H3AA 4P09A 4O8SA 3HL6A 2LOPA 5FNVE 2ZM0A 3EUHA 3DP7A 5L3EB 3E22E 2A3DA 4MHCA 1MIVA 1BR1A 5EZYE 2C5JA 3KV4A 4UXNB 3I9YA 5DJQC 3NRYA 4IE4A 3ZJ1A 3BQLA 4MALA 4ZS3A 3SS1A 2XAJB 3H37A 2YEVC 4YJ2E 1SHZC 2KT9A 2PFVA 4MBQA 3RRWA 2V7MA 3V5UA 4WNKA 3LJCA 4NUVA 2CA5A 1D1BA 2SPCA 3J9X1 2MOZA 3KBTA 5LG4A 2WBLA 4AKIA 3KBUA 4I50E 3ETUA 4GK0E 4GYSA 1S35A 3QK6A 4MLKA 2WMNA 5FXWA 2RA1A 1HCIA 2VKHA 5JDLA 2VKOA 1UX4A 3AB3B 2WM9A 2HPJA 4HN9A 4QXBB 3S4UA 3OKQA 2YU2A 3IEEA 3NRXA 5LA6E 4A56A 4ISSA 4U74A 1BR4A 5LHHB 4IE5A 2LSGA 2X68A 2WWUA 3WAKA 5HXHA 4G63A 5J1GA 3SWHA 3R6NA 2H3RA 2L8KA 3N9MA 2D0UA 4PJMA 4L9IA 4GOUA 2HH7A 2VWAA 5GONE 3PURA 2PBIA 4V1Av 3KV6A 5JDQA 4AI6A 4ASKA 2NWBA 3CX6B 4IE0A 4DO0A 2CMRA 5L3DB 2W62A 5LJNA 2B1EA 5FY1A 3PUQA 3OBVE 2LM9A 2ES0A 3RPUA 5C8YE 3N2KE 3C98B 2QA7A 1WYCA 4UVCB 3ONXA 5F8PA 3KINB 4PJNA 1KK7A 3HI2A 4TZ4C 2L3LA 5L3CB 4OYKA 3FXEB 4ZHQE 3LK42 1HF8A 1T98A 2N9DA 2XAQB 3GMIA 5HAXA 3RYHE 3B57A 4IE7A 4M1PA 5FXXA 2IW5B 3HKCE 1FMVA 2JJ9A 3K8PC 2X9WA 4UF0B 1MNDA 2NW7A 5FY0A 3ZMTB 3U78A 3HA4A 5CA0E 5JH7E 2LHRA 3FBZA 3OYXA 4ERRA 2C5IT 2Y6XA 5JVDE 2UXXB 2X0LB 2KZ7B 3I0QA 3KVBA 3C4WA 3RC3A 3ZYLA 4KBMB 4UEMA 4IDZA 3LK2B 3C51A 1NWMX 3P8CD 4TV9E 3N9LA 3PDYA 4YFSA 3PUAA 2LJLA 2VKJA 3LG7A 4B6XA 1ZEEA 4BJMA 5HXRA 1E1HB 5HXEA 1UCUA 4FI5A 3MXZA 4CXYA 2E9XC 2ODUA 3CQCB 4TN7B 4XBFB 1D0XA 3CVRA 4XAXB 5LP6E 2EHOA 2IAKA 3LBXA 5J2UE 2KWIB 2X9XA 4X1YE 2H7VC 2LEHA 4AQGA 3QC9A 3IHRA 3J7Yq 2E9XB 4YJ3E 2Y48B 4IGUA 3RX6A 2BDEA 4FJOA 4ZOLE 2W00A 5LBMA 2Q9QA 2D2SA 3PTRB 2JRKA 2CXLA 1X79A 2CLYC 1V9DA 2X67A 3C4XA 2KINB 3AA7B 5CB4E 5LGTB 2DWKA 1ZKEA 2BVMA 5LXTE 4WBNE 3ANWA 5JDFA 2CXFA 1IJ5A 2CLYB 3ZCIA 4UVAB 2CXDA 1FMWA 2K9AA 3K3QC 4IIJE 4JEHB 3ZJ2A 2VK9A 1FEWA 4BA9A 5CA1E 2E9XD 3KDSE 4QKNA 2L9QA 3CMLA 4UV9B 1OWAA 3ZN1B 4I55E 3ESLA 5JDMA 4CI2B 1D1CA 2HPLA 1U4QA 4PNIA 1MIYA 2CEAA 5LYJE 4HTEA 4CI3B 4NUUA 3QUJA 1IJ6A 3RH3A 3ZC0A 2D5UA 3RYCE 2PJQA 1KNZA 4PK5A 2W0GA 4EAHA 3MACA 3ZN0B 4PJJA 4ANJA 1WR6A 4DNDA 3EDVA 4C90A 3F2EA 4TUYE 3Q5WA 5L3FB 3U3IA 2IC9A 4QX8B 3AA0B 5H6QB 3HR0A 2A2FX 5EK3A 2P9BA 3WAJA 4IHJE 5LJMA 3UULA 5H6RB 5JR9A 3ZYKA 3LFMA 1NAFA 5LHGB 4O4HE 3UUNA 2K5BB 3MK7C 3N9QA 4HEAA 3F57A 4DMWA 4QX7B 2Q9QC 3O1IA 2EHOB 1YKHB 2D0TA 3LBXB 3NZQA 4CXXA 1D0ZA 1D1AA 4OYJA 1US7B 3EDUA 4QHOA 5L3BB 3ZCJA 5HXSA 2KLQA 2Q9QB 5JREA 3GN5A 3NBXX 3UUXB 2X66A 4K0UA 3AA1B 3ANWB 3F31A 4YHJA 4ADZA 5BMVE 4EB6E 5E0OA 5ADXL 4GK5E 2BVLA 2EHOD 2ZLYA 3N9PA 2DNXA 2KWHA 2LE8A 3VKHA 3L3PA 2W61A 4AQFA 2MBGA 4WBOA 3AAAB 4CZZB 2VASA 3NZPA 4DBRA 3OJAA 1YKEB 1LRZA 4QXHB 2KXPB 3ZMVB 2Q9QD 2X9YA 1FIOA 1WRDA 4ILUA 2DCFA 2LSYA 3P7IA 3BQIA 4TV8E 5KX5E 2PG8A 2K48A 2V7IA 2LT3A 4X1IE 5FXVA 4O4IE 1IAPA 2NW9A 4HFVA 3M65A 4ZI2D 2CE7A 1O3XA 4XZCA 2J1DG 2LSIA 4OFZA 4H9RC 3N5LA 2RP4A 3I9WA 3IBPA 5F3JA 2NOXA 2XQYA 3KV5A 4AKHA 2ACXA 2K24A 2GK9A 1B7TA 3ZPOA 3ZC1A 5JR9B 3KVAA 5LGUB 3O1HA 4PW8A 4AXPA 3W15B 2IC6A 3MJXA 2XAGB 3MA9A 3BK9A 4N78D 3AA6B 2W63A 2V7LA 3PUGA 4O4LE 5L3GB 2MYSA 3CKDA 2WSSV 3EVYA 1VRBA 3CPZA 3RKOA 3AAEB 5TAOA 1D0YA 3JC6D 1MMDA 3WI3A 1WLXA 2I59A 2JQQA 4F6RC 1IZNB 4I4TE 3ETVA 4EIWA 1CUNA 1YW0A 3RRCA 4J2CA 5HXCA 1HFAA 1H7CA 4EZ4A 4QWNB 5JRCA 5HWXA 3RYIE 4AQFC 3A5XA 2JMHA 3UFEA 2DI4A 3FXDB 5DABA 4UELA 4U72A 3IF8B 2XAFB 1MMAA 3L09A 4GIWA 3AVSA 2M67A 4PJLA 5AFUL 4P0AA 2QGSA 5FY7A 2XASB 2V7JA 3C4ZA 3I0OA 2NTYA 4O2AE 4PK6A 3DJBA 5FMNA 1UX5A 3CQGB 3SOLA 2X9HA 5LGNB 3O1JA 3OYZA 3R84B 5JDGA 4EXTA 4JEUB 4OK0A 4MFRA 2ODVA 3FB2A 3Q9DA 5IYZE 3SRZA 1G73A 3PU8A 3KV9A 5L2LA 2V1DB 3N2OA 3E0ZA 2N1GA 4ZS2A 2VL8A 4BJNA 5JDHA 5JQGE 1OXZA 2ZM2A 3ZMSB 4O4JE 1EZ3A 2V7KA 3ZLIA 3UUMA 4UF0A 1U5PA 1Y64B 2KMFA 4IE6A 4UVBB 2EHOC 3N2GE 3VU7H 2JPFA 4JLEA 4HGAA 2LHNA 2YK0A 1G8XA 3HKBE 1BR0A 2E8IA 5KDMC 1HX8A 4UIGA 4QXCB 4P0BA 4ZI7E 2OA5A 3FHNA 5ETWA 2X51A 4KP3C 4X1KE 2DWGA 2YINA 4H63H 4X20E 4G2AA 4L0RA 4TX5A 1LKXA 2WMOA 4PK4A 5EK2A 4JUYA 4KMCA 4H63V 2XHEB 5KMGP 3HKDE 4ZI2C 3CWZB 2DHRA 3PE0A 3N9OA 3O4XE 3O9XA 3Q2MA 3I1AA 3VHLA 2C0SA 2DLRA 5JRCB 2YU1A 3VKGA 3CX7B 1MIWA 3ZMZB 1VOMA 2H7OA 2Y8DA 3E08A 3UTKA 1HG5A 2E9XA 5LNKA 5A1LA 2LOSA 3D0TA 4BAYB 3TKLB 5LBQB 1ZV4X 3PUSA 4AKRB 4AKGA 2ZM8A 4PAGA 4CQIA 3RC8A 2JMKA 3C50A 4O2BE 4UV8B 4DBQA 2XTLA 3AVRA 2LSKA 3K3OA 1HTJF 2VB6A 4YLHA 2KNDA 2UXNB 1HG2A 4HE8A 1BR2A 1SA0E 2C5KT 1YD8G 2N2NA 3JC6C 5EK4A 4Z8XA 4H9NC 4CXWA 4DMVA 4I43B 1ZHCA 1QSDA 2A72A 2BZBA 3ZYMA 2CWYA 3C64A 5JR9C 1WYBA 1LVFA 2XAHB 3KFWX 5DQVA 4ZI3C 1HS7A 3DTOA 3GA8A 1QUUA 3MZKB 4H9SE 4KUMB 4WW0A 2XUEA 3PU3A 5LCYA 4E7ZA 4CI1B 4EYUA 4PFPA 4OHFA 5DQWA 2CCQA 2ZMAA 4L5GA 4ISTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLE A; 
#chains in the Genus database with same CATH topology
 4KHP T;  4IDP A;  2WU2 A;  3OPC A;  2QVA A;  4E7S A;  4DVD A;  2IHR 1;  3RI5 A;  3BQK A;  4PFO A;  1LVK A;  2WDV A;  3GN5 B;  4OX9 T;  3EI0 A;  4AKL A;  4X5T A;  5IHY A;  3HKE E;  3CQX C;  4COF A;  4IDO A;  2LSJ A;  3AED A;  4O8S A;  1XDP A;  2UUB T;  3E22 E;  2JQK A;  4CN1 A;  5HEO A;  3KV4 A;  3I9Y A;  5DJQ C;  3ZJ1 A;  4IE4 A;  1M62 A;  4DV0 T;  2XPK A;  3K1S A;  4YJ2 E;  3RRW A;  3QOF A;  3RQU A;  3ZST A;  2WBL A;  3ETU A;  3ONL C;  5FVK A;  4GK0 E;  5FXW A;  3QK6 A;  2WMN A;  5JDL A;  2V5C A;  2LM2 A;  1XDO A;  3OKQ A;  2YU2 A;  3IEE A;  4U2Z A;  4IE5 A;  3ZT7 A;  4NPP A;  4IRE A;  3SWH A;  2D0U A;  4HWH A;  2VWA A;  5LMU T;  2PBI A;  4ASK A;  4DO0 A;  5AQV B;  2B1E A;  5FY1 A;  2I6H A;  3C98 B;  4UVC B;  1KK7 A;  5AQK B;  3FXE B;  4ZHQ E;  1HF8 A;  2XAQ B;  5HAX A;  4M1P A;  3HKC E;  4JI7 T;  3AEA A;  2X9W A;  1MND A;  2LHR A;  1UUR A;  4ERR A;  2WB5 A;  2XQ6 A;  1JNZ A;  2X0L B;  4I0U A;  3PDY A;  1J1J A;  2LJL A;  1Z8U A;  2E9X C;  2X0Y A;  1D0X A;  4XAX B;  2IAK A;  1IBM T;  5CFB A;  4YJ3 E;  3RX6 A;  4FJO A;  3A8Y C;  5LBM A;  1IJ5 A;  4U2Y A;  3B5M A;  1FMW A;  3K3Q C;  2VK9 A;  3KDS E;  3CML A;  3ZN1 B;  3UQ7 A;  4I55 E;  2CEA A;  4HTE A;  4CI3 B;  3ZC0 A;  3RH3 A;  1N32 T;  4ILB A;  2B76 A;  4QH1 A;  2W0G A;  3CK6 A;  3JAD A;  3ZN0 B;  4ANJ A;  5FVL A;  4DND A;  3EDV A;  3Q5W A;  2IC9 A;  4QX8 B;  3WAJ A;  4IHJ E;  3UUL A;  2D9D A;  3LFM A;  5LHG B;  3MK7 C;  4YHH T;  4HEA A;  3O1I A;  2JIW A;  3NZQ A;  5L3B B;  5AQP B;  3ZCJ A;  5HXS A;  2KLQ A;  3RHW A;  5JRE A;  4ZXL A;  5ADX L;  4GK5 E;  2ZLY A;  3N9P A;  4HFE A;  2KWH A;  4EEB A;  3VKH A;  1DU2 A;  4AQF A;  1W09 A;  3AAA B;  1WR0 A;  2Q9Q D;  3VRB A;  4ILU A;  1VCS A;  5KX5 E;  3TLS A;  4DV3 T;  3QNU A;  2LT3 A;  1IAP A;  2NW9 A;  4HFV A;  4ZI2 D;  2CE7 A;  4JV5 T;  2XY8 B;  2F4V T;  4XZC A;  2J1D G;  4YSZ A;  4ILC A;  5F3J A;  4LF6 T;  2CBJ A;  3ZC1 A;  5JR9 B;  3KVA A;  5LGU B;  2XM2 A;  3MJX A;  1OED B;  3PUG A;  4O4L E;  3JAE A;  2WSS V;  1VRB A;  3AAE B;  5AQN B;  2UXD T;  2K3W A;  4TNW A;  4IT4 A;  3WI3 A;  1WLX A;  2YOE A;  5HWX A;  3RYI E;  2JMH A;  3A5X A;  2DI4 A;  3FXD B;  3VR9 A;  5ABF A;  4IDN A;  4GIW A;  2M67 A;  4PJL A;  5AFU L;  2XAS B;  3I0O A;  4PK6 A;  4LFB T;  5AQT B;  4OK0 A;  4MFR A;  5C3J A;  5JDH A;  1OXZ A;  2CHO A;  4UF0 A;  2KMF A;  2BG9 A;  3N2G E;  2XSA A;  4JLE A;  4HWC A;  4NXN T;  4NXM T;  4U33 A;  1BR0 A;  2FJD A;  5KDM C;  4P0B A;  3FHN A;  5ETW A;  4X20 E;  2J62 A;  4L0R A;  2FJE A;  4PK4 A;  4KMC A;  2V6Y A;  5KMG P;  4LF5 T;  4X65 T;  3PE0 A;  3N9O A;  2DLR A;  2YDS A;  5JRC B;  2H7O A;  3E08 A;  5LNK A;  5A1L A;  3D0T A;  3TKL B;  3FZM B;  5LBQ B;  4AKR B;  2ZM8 A;  2RPA A;  1YQ4 A;  3C50 A;  4UV8 B;  3UUB A;  3AVR A;  1W0B A;  1YQ3 A;  2KND A;  4YLH A;  4LF8 T;  2W4X A;  5EK4 A;  2BZB A;  3ZYM A;  4HFD A;  2CWY A;  1WYB A;  5DQV A;  3KFW X;  4U31 A;  1HS7 A;  3DTO A;  4CI1 B;  2BG9 E;  3MZK B;  2XUE A;  5L4H A;  4EYU A;  2WY2 A;  5DQW A;  3AEB A;  4L5G A;  4IST A;  2G0U A;  3T8O A;  1AJ3 A;  5AQU B;  5JDN A;  1MMG A;  5FYM A;  5FXZ A;  2MTQ A;  5FP3 A;  4DV5 T;  1Z0P A;  5HWY A;  3ZMU B;  4TWH A;  3CX8 B;  3T1H T;  2NP9 A;  3VRA A;  5LOV E;  4GYR A;  5LHI B;  3H3A A;  3RIF A;  2WZH A;  2ZM0 A;  1XMO T;  3DP7 A;  5L3E B;  4MHC A;  1BR1 A;  2BS2 A;  2FUP A;  2H88 A;  2V8S V;  4LFC T;  2UXC T;  3QB5 K;  1SHZ C;  2PFV A;  3V5U A;  2V7M A;  4WNK A;  2CA5 A;  3UU6 A;  2SPC A;  3KBT A;  4AKI A;  3KBU A;  2RA1 A;  1HCI A;  2E5L T;  3TLU A;  3P4W A;  5AQO B;  3UU8 A;  2VKO A;  2WM9 A;  4YSX A;  3S4U A;  3NRX A;  5LHH B;  3ZKR A;  4DV7 T;  3WAK A;  1E2A A;  3R6N A;  2H3R A;  4DR5 T;  4PJM A;  2V5D A;  3PUR A;  4KI0 F;  5LJN A;  2XQ8 A;  3PUQ A;  3OBV E;  3N2K E;  3ONX A;  3FZL B;  4JI5 T;  3AE4 A;  1SUM B;  2BG9 C;  2E2A A;  2BKN A;  4IE7 A;  2YDR A;  2JJ9 A;  4LF7 T;  1HNW T;  3HA4 A;  5CA0 E;  4JI3 T;  2XSB A;  3PUX F;  3I0Q A;  3KVB A;  3ZYL A;  2WU5 A;  4DR4 T;  1XNR T;  4IDQ A;  3P8C D;  3N9L A;  4DR1 T;  3LG7 A;  5HXE A;  4FI5 A;  4IL9 A;  4TN7 B;  2HHH T;  3CVR A;  5LP6 E;  2EHO A;  3PV0 F;  3UU3 A;  3QC9 A;  2R6G F;  5HEJ A;  4ZOL E;  3PTR B;  3ZMS B;  2X67 A;  2CLY C;  5LMN T;  5LGT B;  1ZKE A;  5LXT E;  4EGW A;  3ANW A;  2CXF A;  3ZCI A;  4UVA B;  2CXD A;  5CA1 E;  2L9Q A;  4UV9 B;  5JDM A;  2HPL A;  4PNI A;  5LYJ E;  4LMJ A;  4QH4 A;  2D5U A;  4EAH A;  4U7Y A;  4O4H E;  3RKG A;  3F57 A;  5FKY A;  4QX7 B;  2Q9Q C;  3UU5 A;  1YKH B;  1US7 B;  3EDU A;  4QHO A;  5LB7 B;  4ILA A;  2WWV A;  2FJA A;  3GN5 A;  3UUX B;  2XQ4 A;  4YHJ A;  5BMV E;  4JYA T;  4LF9 T;  5BR8 T;  4X66 T;  4HWD A;  4WBO A;  4DBR A;  3L39 A;  3AXJ A;  1LRZ A;  4QXH B;  2DCF A;  3BQI A;  2YKS A;  2W2U A;  4TV8 E;  3P4Q A;  2K48 A;  3NVO A;  2VVS A;  1O3X A;  4OFZ A;  5IWA T;  2NOX A;  2XQY A;  4AKH A;  4NIQ A;  1HNX T;  2GK9 A;  2BKP A;  2XQ7 A;  4PW8 A;  3PUW F;  4JI0 T;  3W15 B;  3BK9 A;  2W63 A;  3CKD A;  3EVY A;  3RKO A;  3JC6 D;  4F6R C;  2A9U A;  1CUN A;  4J2C A;  5HXC A;  1HFA A;  1XNQ T;  4EZ4 A;  3UFE A;  4HFI A;  2BS3 A;  4UEL A;  3Q5D A;  3L09 A;  2AXD S;  2QGS A;  5FY7 A;  3C4Z A;  2NTY A;  3EAM A;  1UX5 A;  2X9H A;  1L0V A;  3AE2 A;  3ZT6 A;  1I94 T;  3R84 B;  3Q5E A;  5F5W A;  5JDG A;  3EHZ A;  4JEU B;  3AEC A;  3Q9D A;  5IYZ E;  1G73 A;  4U3C A;  3N2O A;  2N1G A;  3P4S A;  2ZM2 A;  2V7K A;  3ZLI A;  3UUM A;  1U5P A;  5ABE A;  4UVB B;  4DV4 T;  2EHO C;  3VU7 H;  5IUX A;  2ACZ A;  2LHN A;  2YK0 A;  1G8X A;  4QXC B;  2X51 A;  4KP3 C;  4K0K T;  4TX5 A;  1LKX A;  2WMO A;  4LML A;  4YSY A;  2DHR A;  3FZF B;  3VHL A;  2YU1 A;  2FJB A;  3CX7 B;  4Z91 A;  2Y8D A;  1HG5 A;  4BAY B;  3PUY F;  5ABF B;  5L47 A;  4PAG A;  4O2B E;  2XTL A;  3K3O A;  2VB6 A;  4JI1 T;  4HE8 A;  1SA0 E;  1J5E T;  5CJ5 A;  4KHZ F;  5ABH A;  1QSD A;  3PJA J;  4AIS A;  4GKJ T;  4H9S E;  4KUM B;  2W67 A;  4E7Z A;  2BS4 A;  4PFP A;  4OHF A;  2CCQ A;  2ZMA A;  2Z6E A;  4EYY R;  2IDO B;  5J2T E;  4QH5 A;  4DR3 T;  4B3M T;  2NW8 A;  2LRK A;  3LK3 B;  4H9O C;  3V5S A;  3LSV A;  1MNE A;  4ZI3 D;  4EOZ B;  2WDQ A;  4H9Q C;  2NTX A;  2LLY A;  4C91 A;  4P09 A;  1J5W A;  2LOP A;  3ONJ A;  2MAW A;  2OLT A;  2A3D A;  2C5J A;  3NRY A;  4AIU A;  2H89 A;  5AQR B;  4ZS3 A;  2XAJ B;  3H37 A;  2KT9 A;  3QB5 A;  4ZZB A;  4DR7 T;  2IML A;  1D1B A;  5LG4 A;  2MOZ A;  4I50 E;  1XWM A;  1S35 A;  4MLK A;  2VKH A;  3AEE A;  2VQF T;  1UX4 A;  4LFA T;  4IL4 A;  2HPJ A;  4HN9 A;  2VL0 A;  4ISS A;  3H3M A;  1QLB A;  5HEG A;  2M6I A;  2LSG A;  1IBK T;  4GKK T;  1OED A;  2L8K A;  3N9M A;  4L9I A;  4V1A v;  3KV6 A;  2NWB A;  4IE0 A;  3EAB A;  2ES0 A;  3RPU A;  3RQW A;  2QA7 A;  4DR6 T;  3CIR A;  5F8P A;  3AE9 A;  5L3C B;  4OYK A;  4DV6 T;  3LK4 2;  3GMI A;  3RYH E;  5FXX A;  2IW5 B;  1FMV A;  4YTP A;  2NW7 A;  3U78 A;  3VR8 A;  5JH7 E;  3OYX A;  3ZT5 A;  3T1Y T;  4A98 A;  4WYV A;  4B3R T;  3UFG A;  2W66 A;  4IDZ A;  4TV9 E;  1UUS A;  2E5V A;  4B6X A;  5AQF B;  5HXR A;  1ZP0 A;  1UCU A;  4HFC A;  3MXZ A;  4YTN A;  1OED E;  3LBX A;  5AQG B;  4X1Y E;  2LEH A;  4AQG A;  2UU9 T;  3J7Y q;  2E9X B;  4IGU A;  2BDE A;  3PUV F;  4TWD A;  2W00 A;  2Q9Q A;  2DL1 A;  2CXL A;  3C4X A;  1V9D A;  1HR0 T;  3AA7 B;  2DWK A;  2BVM A;  5AQL B;  2CPT A;  4JI8 T;  1HX1 B;  4IIJ E;  4JEH B;  3ZJ2 A;  1KF6 A;  1N36 T;  1FEW A;  4QKN A;  2WDR A;  4CI2 B;  1U4Q A;  1MIY A;  1NEK A;  2WS3 A;  4DUZ T;  5JTG A;  2VVN A;  1T7S A;  1KNZ A;  1E7P A;  1HNZ T;  3SFD A;  1GQE A;  3MAC A;  4PJJ A;  1WR6 A;  4C90 A;  3F2E A;  3U3I A;  3AA0 B;  5H6Q B;  3HR0 A;  3P50 A;  2A2F X;  5EK3 A;  3M3Z B;  3UUN A;  2K5B B;  3AE6 A;  4DMW A;  2EHO B;  2D0T A;  2V6X A;  1D1A A;  2AE9 A;  1KEY A;  3NBX X;  5AQS B;  4K0U A;  1CHU A;  3AA1 B;  1NEN A;  3ANW B;  4EB6 E;  2BVL A;  4DV2 T;  2DNX A;  2W61 A;  2MBG A;  2VAS A;  3NZP A;  2KXP B;  2YN6 A;  1FIO A;  1WRD A;  2M6B A;  2V7I A;  3AEG A;  4ZZC A;  5FXV A;  4O4I E;  3OVU A;  2ZM6 T;  1UGO A;  4H9R C;  3N5L A;  2RP4 A;  3I9W A;  1OED C;  4X62 T;  2J47 A;  3KV5 A;  2K24 A;  1JNR A;  2IC6 A;  5L3G B;  4N78 D;  2V7L A;  2MYS A;  5TAO A;  2JQQ A;  2I59 A;  1IZN B;  3ETV A;  1M7K A;  3RRC A;  2PTF A;  5DAB A;  4U72 A;  3IF8 B;  5AQI B;  2XAF B;  3AVS A;  4DV1 T;  5AQJ B;  4P0A A;  2V7J A;  5FMN A;  4ZEY A;  3AXJ B;  3SOL A;  3CQG B;  3O1J A;  2LRL A;  3OYZ A;  1Y01 A;  3SRZ A;  5L2L A;  2V1D B;  3AEF A;  3IA3 A;  3AE5 A;  4ZS2 A;  2XZE A;  4O4J E;  4IE6 A;  2JPF A;  3ABV A;  4DR2 T;  1HX8 A;  2QRX A;  2OA5 A;  2MPK A;  4EED A;  4LF4 T;  4H63 H;  4G2A A;  4YXD A;  3HKD E;  4ZI2 C;  4EV6 A;  3Q2M A;  3I1A A;  2HN2 A;  3VKG A;  1MIW A;  3ZMZ B;  3UTK A;  4F8H A;  2LOS A;  1VCT A;  3PUS A;  4AKG A;  2XQ9 A;  4CQI A;  3RC8 A;  2JMK A;  3TLT A;  3OTO T;  2UXN B;  1HG2 A;  1X9B A;  1BR2 A;  1YD8 G;  2N2N A;  5AQQ B;  4Z8X A;  4H9N C;  4DMV A;  4I43 B;  3C64 A;  3TLW A;  2XAH B;  4ZI3 C;  4WW0 A;  5LCY A;  3PU3 A;  5JVD E;  3JCF A;  4TWF A;  3UT5 E;  5M4Y A;  1KNR A;  3L8R A;  3RIU A;  3N9N A;  4H9P C;  4HWF A;  4EZH A;  3MKD A;  1MMN A;  3K3N A;  1XMQ T;  4HKA A;  1S94 A;  5HYA A;  2V26 A;  3ZEF B;  2CWO A;  4CN6 A;  2CM0 A;  2VQE T;  3FBL A;  3AAI A;  3RYF E;  2YDQ A;  3B13 A;  3GWH A;  2VKD A;  3Q5X A;  2WZI A;  2WAU A;  2JQH A;  3HL6 A;  5FNV E;  3EUH A;  1KNP A;  1MIV A;  2XQA A;  1N34 T;  2BBH A;  5EZY E;  4UXN B;  3BQL A;  4MAL A;  3SS1 A;  1T72 A;  2YEV C;  4MBQ A;  1KFY A;  3LJC A;  3AE8 A;  4NUV A;  3J9X 1;  2KSR A;  4GYS A;  2BBJ A;  2OV9 A;  3RIA A;  2IIU A;  5C2T A;  3AB3 B;  2UUA T;  4QXB B;  5LA6 E;  4A56 A;  4U74 A;  1BR4 A;  3ZSS A;  2X68 A;  2WWU A;  4A5X A;  5HXH A;  4G63 A;  3A7M A;  5J1G A;  4GOU A;  2HH7 A;  5GON E;  5JDQ A;  3PUZ F;  4AI6 A;  3SFE A;  3CX6 B;  2CMR A;  5L3D B;  2W62 A;  3AE7 A;  3FZH B;  2LM9 A;  5C8Y E;  4CN4 A;  2JQ9 A;  1WYC A;  5AQH B;  3KIN B;  4PJN A;  3HI2 A;  4TZ4 C;  2L3L A;  1ZOY A;  4X64 T;  1T98 A;  2N9D A;  2J4G A;  4JI2 T;  3B57 A;  4YY3 T;  3K8P C;  5HEH A;  2CHN A;  4UF0 B;  5FY0 A;  3ZMT B;  2BG9 B;  3FBZ A;  2HN1 A;  4JI4 T;  2C5I T;  2Y6X A;  2UXX B;  2XM1 A;  4YTM A;  3NWI A;  2KZ7 B;  3C4W A;  3RC3 A;  4KBM B;  4UEM A;  3LK2 B;  3C51 A;  1NWM X;  4YFS A;  3PUA A;  2VKJ A;  1ZEE A;  4BJM A;  1E1H B;  2V6Y B;  4CXY A;  2ODU A;  3CQC B;  4XBF B;  1YXR A;  4JI6 T;  5J2U E;  2KWI B;  2X9X A;  2H7V C;  2VUR A;  4A97 A;  3IHR A;  2Y48 B;  5HCM A;  2UXB T;  2D2S A;  2JRK A;  5CB4 E;  1X79 A;  2KIN B;  1WCR A;  4WBN E;  2LKG A;  5J0Z A;  2QYW A;  2X0H A;  5JDF A;  1I6Z A;  1SE7 A;  2CLY B;  2K9A A;  2XJ7 A;  4BA9 A;  2E9X D;  2LKH A;  1OWA A;  1WFD A;  3ESL A;  1D1C A;  2I0M A;  2CRB A;  3RIU C;  4NUU A;  3QUJ A;  1IJ6 A;  3RYC E;  2PJQ A;  4PK5 A;  4AQY T;  2IUB A;  4HWI B;  4TUY E;  5L3F B;  2P9B A;  5LJM A;  4HFB A;  5HCJ A;  5H6R B;  5JR9 A;  3ZYK A;  1NAF A;  4UR9 A;  4U7I A;  3N9Q A;  3LBX B;  4CXX A;  1D0Z A;  4OYJ A;  5HEU A;  4WZX A;  2Q9Q B;  2X66 A;  5L4E A;  3F31 A;  4ADZ A;  5E0O A;  3JAF A;  5ABG A;  1FJG T;  2EHO D;  4Q25 A;  2LE8 A;  3PJA A;  3L3P A;  4CZZ B;  3NKZ A;  3OJA A;  1YKE B;  3ZMV B;  1R8I A;  2X9Y A;  2LSY A;  3P7I A;  2PG8 A;  4X1I E;  2CBI A;  1W9R A;  3M65 A;  5KXJ A;  2LSI A;  5FL0 A;  1XZY A;  3IBP A;  2ACX A;  4B3S T;  1B7T A;  3ZPO A;  3G06 A;  3O1H A;  4P1N A;  4AXP A;  3P4R A;  2XAG B;  3MA9 A;  3AA6 B;  3P4P A;  3AE3 A;  3CPZ A;  5LG3 A;  1D0Y A;  1MMD A;  1N33 T;  4DID B;  4I4T E;  4EIW A;  1YW0 A;  1H7C A;  4QWN B;  5JRC A;  4AQF C;  1UK5 A;  2XQ3 A;  4B3T T;  2XQ5 A;  3LDQ B;  2WP9 A;  1MMA A;  3RGL A;  4O2A E;  3DJB A;  5CGM A;  5LGN B;  3RF1 A;  2WCA A;  4EXT A;  2ODV A;  3FB2 A;  5FL1 A;  3PU8 A;  3KV9 A;  3E0Z A;  2VL8 A;  1W0A A;  4BJN A;  5JQG E;  4TNV A;  1EZ3 A;  1Y64 B;  3UU4 A;  4JBW F;  4HGA A;  3HKB E;  2WQY A;  3AE1 A;  2E8I A;  4UIG A;  3FZK B;  4ZI7 E;  3RLF F;  4X1K E;  2DWG A;  2YIN A;  2UUC T;  1IBL T;  3UQ4 A;  4JUY A;  5EK2 A;  4H63 V;  2XHE B;  3CWZ B;  3O4X E;  3O9X A;  5AQM B;  2C0S A;  1VOM A;  3X1D A;  3TLV A;  2E9X A;  4KX6 A;  1ZV4 X;  4DBQ A;  2LSK A;  1HTJ F;  1T8B A;  2C5K T;  3JC6 C;  4Z90 A;  4YT0 A;  4HFH A;  4CXW A;  2NR4 A;  1ZHC A;  2FBW A;  2A72 A;  4LMK A;  5JR9 C;  1LVF A;  4DUY T;  2BKO A;  3GA8 A;  1QUU A; 
#chains in the Genus database with same CATH homology
 2G0U A;  3UT5 E;  5M4Y A;  3T8O A;  1AJ3 A;  2Z6E A;  4EYY R;  5J2T E;  3N9N A;  5JDN A;  4E7S A;  4H9P C;  1MMG A;  4DVD A;  5FYM A;  4EZH A;  2NW8 A;  3LK3 B;  5FXZ A;  2MTQ A;  3BQK A;  1MMN A;  3MKD A;  4PFO A;  1LVK A;  5FP3 A;  1Z0P A;  3K3N A;  5HWY A;  3GN5 B;  4H9O C;  3V5S A;  4HKA A;  3ZMU B;  3CX8 B;  1S94 A;  4AKL A;  2NP9 A;  5HYA A;  2V26 A;  1MNE A;  5IHY A;  4ZI3 D;  4EOZ B;  3HKE E;  3ZEF B;  2CWO A;  4H9Q C;  5LOV E;  2CM0 A;  3FBL A;  3AAI A;  3CQX C;  4GYR A;  3B13 A;  3RYF E;  2NTX A;  4C91 A;  3GWH A;  2VKD A;  2LSJ A;  3Q5X A;  5LHI B;  2WAU A;  3H3A A;  4P09 A;  4O8S A;  3HL6 A;  2LOP A;  5FNV E;  2ZM0 A;  3EUH A;  3DP7 A;  5L3E B;  3E22 E;  2A3D A;  4MHC A;  1MIV A;  1BR1 A;  5EZY E;  2C5J A;  3KV4 A;  4UXN B;  3I9Y A;  5DJQ C;  3NRY A;  4IE4 A;  3ZJ1 A;  3BQL A;  4MAL A;  4ZS3 A;  3SS1 A;  2XAJ B;  3H37 A;  2YEV C;  4YJ2 E;  1SHZ C;  2KT9 A;  2PFV A;  4MBQ A;  3RRW A;  2V7M A;  3V5U A;  4WNK A;  3LJC A;  4NUV A;  2CA5 A;  1D1B A;  2SPC A;  3J9X 1;  2MOZ A;  3KBT A;  5LG4 A;  2WBL A;  4AKI A;  3KBU A;  4I50 E;  3ETU A;  4GK0 E;  4GYS A;  1S35 A;  3QK6 A;  4MLK A;  2WMN A;  5FXW A;  2RA1 A;  1HCI A;  2VKH A;  5JDL A;  2VKO A;  1UX4 A;  3AB3 B;  2WM9 A;  2HPJ A;  4HN9 A;  4QXB B;  3S4U A;  3OKQ A;  2YU2 A;  3IEE A;  3NRX A;  5LA6 E;  4A56 A;  4ISS A;  4U74 A;  1BR4 A;  5LHH B;  4IE5 A;  2LSG A;  2X68 A;  2WWU A;  3WAK A;  5HXH A;  4G63 A;  5J1G A;  3SWH A;  3R6N A;  2H3R A;  2L8K A;  3N9M A;  2D0U A;  4PJM A;  4L9I A;  4GOU A;  2HH7 A;  2VWA A;  5GON E;  3PUR A;  2PBI A;  4V1A v;  3KV6 A;  5JDQ A;  4AI6 A;  4ASK A;  2NWB A;  3CX6 B;  4IE0 A;  4DO0 A;  2CMR A;  5L3D B;  2W62 A;  5LJN A;  2B1E A;  5FY1 A;  3PUQ A;  3OBV E;  2LM9 A;  2ES0 A;  3RPU A;  5C8Y E;  3N2K E;  3C98 B;  2QA7 A;  1WYC A;  4UVC B;  3ONX A;  5F8P A;  3KIN B;  4PJN A;  1KK7 A;  3HI2 A;  4TZ4 C;  2L3L A;  5L3C B;  4OYK A;  3FXE B;  4ZHQ E;  3LK4 2;  1HF8 A;  1T98 A;  2N9D A;  2XAQ B;  3GMI A;  5HAX A;  3RYH E;  3B57 A;  4IE7 A;  4M1P A;  5FXX A;  2IW5 B;  3HKC E;  1FMV A;  2JJ9 A;  3K8P C;  2X9W A;  4UF0 B;  1MND A;  2NW7 A;  5FY0 A;  3ZMT B;  3U78 A;  3HA4 A;  5CA0 E;  5JH7 E;  2LHR A;  3FBZ A;  3OYX A;  4ERR A;  2C5I T;  2Y6X A;  5JVD E;  2UXX B;  2X0L B;  2KZ7 B;  3I0Q A;  3KVB A;  3C4W A;  3RC3 A;  3ZYL A;  4KBM B;  4UEM A;  4IDZ A;  3LK2 B;  3C51 A;  1NWM X;  3P8C D;  4TV9 E;  3N9L A;  3PDY A;  4YFS A;  3PUA A;  2LJL A;  2VKJ A;  3LG7 A;  4B6X A;  1ZEE A;  4BJM A;  5HXR A;  1E1H B;  5HXE A;  1UCU A;  4FI5 A;  3MXZ A;  4CXY A;  2E9X C;  2ODU A;  3CQC B;  4TN7 B;  4XBF B;  1D0X A;  3CVR A;  4XAX B;  5LP6 E;  2EHO A;  2IAK A;  3LBX A;  5J2U E;  2KWI B;  2X9X A;  4X1Y E;  2H7V C;  2LEH A;  4AQG A;  3QC9 A;  3IHR A;  3J7Y q;  2E9X B;  4YJ3 E;  2Y48 B;  4IGU A;  3RX6 A;  2BDE A;  4FJO A;  4ZOL E;  2W00 A;  5LBM A;  2Q9Q A;  2D2S A;  3PTR B;  2JRK A;  2CXL A;  1X79 A;  2CLY C;  1V9D A;  2X67 A;  3C4X A;  2KIN B;  3AA7 B;  5CB4 E;  5LGT B;  2DWK A;  1ZKE A;  2BVM A;  5LXT E;  4WBN E;  3ANW A;  5JDF A;  2CXF A;  1IJ5 A;  2CLY B;  3ZCI A;  4UVA B;  2CXD A;  1FMW A;  2K9A A;  3K3Q C;  4IIJ E;  4JEH B;  3ZJ2 A;  2VK9 A;  1FEW A;  4BA9 A;  5CA1 E;  2E9X D;  3KDS E;  4QKN A;  2L9Q A;  3CML A;  4UV9 B;  1OWA A;  3ZN1 B;  4I55 E;  3ESL A;  5JDM A;  4CI2 B;  1D1C A;  2HPL A;  1U4Q A;  4PNI A;  1MIY A;  2CEA A;  5LYJ E;  4HTE A;  4CI3 B;  4NUU A;  3QUJ A;  1IJ6 A;  3RH3 A;  3ZC0 A;  2D5U A;  3RYC E;  2PJQ A;  1KNZ A;  4PK5 A;  2W0G A;  4EAH A;  3MAC A;  3ZN0 B;  4PJJ A;  4ANJ A;  1WR6 A;  4DND A;  3EDV A;  4C90 A;  3F2E A;  4TUY E;  3Q5W A;  5L3F B;  3U3I A;  2IC9 A;  4QX8 B;  3AA0 B;  5H6Q B;  3HR0 A;  2A2F X;  5EK3 A;  2P9B A;  3WAJ A;  4IHJ E;  5LJM A;  3UUL A;  5H6R B;  5JR9 A;  3ZYK A;  3LFM A;  1NAF A;  5LHG B;  4O4H E;  3UUN A;  2K5B B;  3MK7 C;  3N9Q A;  4HEA A;  3F57 A;  4DMW A;  4QX7 B;  2Q9Q C;  3O1I A;  2EHO B;  1YKH B;  2D0T A;  3LBX B;  3NZQ A;  4CXX A;  1D0Z A;  1D1A A;  4OYJ A;  1US7 B;  3EDU A;  4QHO A;  5L3B B;  3ZCJ A;  5HXS A;  2KLQ A;  2Q9Q B;  5JRE A;  3GN5 A;  3NBX X;  3UUX B;  2X66 A;  4K0U A;  3AA1 B;  3ANW B;  3F31 A;  4YHJ A;  4ADZ A;  5BMV E;  4EB6 E;  5E0O A;  5ADX L;  4GK5 E;  2BVL A;  2EHO D;  2ZLY A;  3N9P A;  2DNX A;  2KWH A;  2LE8 A;  3VKH A;  3L3P A;  2W61 A;  4AQF A;  2MBG A;  4WBO A;  3AAA B;  4CZZ B;  2VAS A;  3NZP A;  4DBR A;  3OJA A;  1YKE B;  1LRZ A;  4QXH B;  2KXP B;  3ZMV B;  2Q9Q D;  2X9Y A;  1FIO A;  1WRD A;  4ILU A;  2DCF A;  2LSY A;  3P7I A;  3BQI A;  4TV8 E;  5KX5 E;  2PG8 A;  2K48 A;  2V7I A;  2LT3 A;  4X1I E;  5FXV A;  4O4I E;  1IAP A;  2NW9 A;  4HFV A;  3M65 A;  4ZI2 D;  2CE7 A;  1O3X A;  4XZC A;  2J1D G;  2LSI A;  4OFZ A;  4H9R C;  3N5L A;  2RP4 A;  3I9W A;  3IBP A;  5F3J A;  2NOX A;  2XQY A;  3KV5 A;  4AKH A;  2ACX A;  2K24 A;  2GK9 A;  1B7T A;  3ZPO A;  3ZC1 A;  5JR9 B;  3KVA A;  5LGU B;  3O1H A;  4PW8 A;  4AXP A;  3W15 B;  2IC6 A;  3MJX A;  2XAG B;  3MA9 A;  3BK9 A;  4N78 D;  3AA6 B;  2W63 A;  2V7L A;  3PUG A;  4O4L E;  5L3G B;  2MYS A;  3CKD A;  2WSS V;  3EVY A;  1VRB A;  3CPZ A;  3RKO A;  3AAE B;  5TAO A;  1D0Y A;  3JC6 D;  1MMD A;  3WI3 A;  1WLX A;  2I59 A;  2JQQ A;  4F6R C;  1IZN B;  4I4T E;  3ETV A;  4EIW A;  1CUN A;  1YW0 A;  3RRC A;  4J2C A;  5HXC A;  1HFA A;  1H7C A;  4EZ4 A;  4QWN B;  5JRC A;  5HWX A;  3RYI E;  4AQF C;  3A5X A;  2JMH A;  3UFE A;  2DI4 A;  3FXD B;  5DAB A;  4UEL A;  4U72 A;  3IF8 B;  2XAF B;  1MMA A;  3L09 A;  4GIW A;  3AVS A;  2M67 A;  4PJL A;  5AFU L;  4P0A A;  2QGS A;  5FY7 A;  2XAS B;  2V7J A;  3C4Z A;  3I0O A;  2NTY A;  4O2A E;  4PK6 A;  3DJB A;  5FMN A;  1UX5 A;  3CQG B;  3SOL A;  2X9H A;  5LGN B;  3O1J A;  3OYZ A;  3R84 B;  5JDG A;  4EXT A;  4JEU B;  4OK0 A;  4MFR A;  2ODV A;  3FB2 A;  3Q9D A;  5IYZ E;  3SRZ A;  1G73 A;  3PU8 A;  3KV9 A;  5L2L A;  2V1D B;  3N2O A;  3E0Z A;  2N1G A;  4ZS2 A;  2VL8 A;  4BJN A;  5JDH A;  5JQG E;  1OXZ A;  2ZM2 A;  3ZMS B;  4O4J E;  1EZ3 A;  2V7K A;  3ZLI A;  3UUM A;  4UF0 A;  1U5P A;  1Y64 B;  2KMF A;  4IE6 A;  4UVB B;  2EHO C;  3N2G E;  3VU7 H;  2JPF A;  4JLE A;  4HGA A;  2LHN A;  2YK0 A;  1G8X A;  3HKB E;  1BR0 A;  2E8I A;  5KDM C;  1HX8 A;  4UIG A;  4QXC B;  4P0B A;  4ZI7 E;  2OA5 A;  3FHN A;  5ETW A;  2X51 A;  4KP3 C;  4X1K E;  2DWG A;  2YIN A;  4H63 H;  4X20 E;  4G2A A;  4L0R A;  4TX5 A;  1LKX A;  2WMO A;  4PK4 A;  5EK2 A;  4JUY A;  4KMC A;  4H63 V;  2XHE B;  5KMG P;  3HKD E;  4ZI2 C;  3CWZ B;  2DHR A;  3PE0 A;  3N9O A;  3O4X E;  3O9X A;  3Q2M A;  3I1A A;  3VHL A;  2C0S A;  2DLR A;  5JRC B;  2YU1 A;  3VKG A;  3CX7 B;  1MIW A;  3ZMZ B;  1VOM A;  2H7O A;  2Y8D A;  3E08 A;  3UTK A;  1HG5 A;  2E9X A;  5LNK A;  5A1L A;  2LOS A;  3D0T A;  4BAY B;  3TKL B;  5LBQ B;  1ZV4 X;  3PUS A;  4AKR B;  4AKG A;  2ZM8 A;  4PAG A;  4CQI A;  3RC8 A;  2JMK A;  3C50 A;  4O2B E;  4UV8 B;  4DBQ A;  2XTL A;  3AVR A;  2LSK A;  3K3O A;  1HTJ F;  2VB6 A;  4YLH A;  2KND A;  2UXN B;  1HG2 A;  4HE8 A;  1BR2 A;  1SA0 E;  2C5K T;  1YD8 G;  2N2N A;  3JC6 C;  5EK4 A;  4Z8X A;  4H9N C;  4CXW A;  4DMV A;  4I43 B;  1ZHC A;  1QSD A;  2A72 A;  2BZB A;  3ZYM A;  2CWY A;  3C64 A;  5JR9 C;  1WYB A;  1LVF A;  2XAH B;  3KFW X;  5DQV A;  4ZI3 C;  1HS7 A;  3DTO A;  3GA8 A;  1QUU A;  3MZK B;  4H9S E;  4KUM B;  4WW0 A;  2XUE A;  3PU3 A;  5LCY A;  4E7Z A;  4CI1 B;  4EYU A;  4PFP A;  4OHF A;  5DQW A;  2CCQ A;  2ZMA A;  4L5G A;  4IST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...