4JLEA

Structure of the p. falciparum pfi1780w phist domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
149
structure length
149
Chain Sequence
YTAEEINEMINSSNEFINRNDMNIIFSYVHESEREKFKKVEENIFKFIQSIVETYKIPDEYKMRKFKFAHFEMQGYALKQEKFLLEYAFLSLNGKLCERKKFKEVLEYVKREWIEFRKSMFDVWKEKLASEFREHGEMLNQKRKLKQHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Plasmodium falciparum PHIST protein binds the virulence factor PfEMP1 and comigrates to knobs on the host cell surface.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Protein binding
molecule keywords PHIST
total genus 60
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09687 PRESAN Plasmodium RESA N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jleA00
4JLEA
chains in the Genus database with same CATH superfamily
2YN6A 4DIDB 2IIUA 1KNRA 2BVLA 3AE5A 5LG3A 3K3NA 5AQOB 4ZI3D 1YXRA 2XQ5A 3T8OA 4DBQA 3OYZA 2V1DB 4PJMA 4O4HE 5LHHB 2NW8A 4KX6A 4WW0A 4JI5T 3VKHA 4JI8T 2YEVC 2X51A 2UU9T 2MTQA 2FJEA 4UELA 3I0OA 4CI2B 4JV5T 2NOXA 2Y8DA 3F2EA 1WCRA 2WDRA 4C91A 3K3OA 4ZXLA 3HA4A 4H63H 5LXTE 3KINB 3AAIA 3UU4A 5FXXA 5L2LA 3E22E 4HWIB 3UU6A 3FZLB 4ILAA 2L8KA 1FIOA 3U78A 1HNWT 5JREA 1N32T 4HWDA 3RIUA 5ABEA 1W0AA 3WAKA 3O1JA 4DMVA 2J4GA 4EGWA 2Q9QC 2DNXA 4QH5A 2BG9E 2LE8A 3KV4A 3JC6C 4HN9A 5AQPB 3UFGA 3LBXA 3N2GE 2LSGA 1SE7A 3ZMUB 4B6XA 2CMRA 3KDSE 1UK5A 4EZ4A 5DABA 2IW5B 5L4EA 1KK7A 1HF8A 1VCSA 4HFCA 3A7MA 3QUJA 5IHYA 1NEKA 2XASB 2H88A 2JMHA 4X62T 1IJ5A 4AISA 3NRYA 4HFDA 3MZKB 3CMLA 3W15B 4I50E 1T98A 5KX5E 2H3RA 2M6BA 2V6YB 4B3MT 3PUZF 4DR6T 3AEAA 3ONJA 5IUXA 3N5LA 3AE9A 3TLTA 3WI3A 2V6YA 4JI3T 2V8SV 4GYRA 3RX6A 3SOLA 4WNKA 2XAJB 4PNIA 4U7YA 2EHOA 1LRZA 2HN1A 2XQYA 2YDSA 3CQXC 3AEBA 1X9BA 1LVKA 2H7OA 4IDNA 3QC9A 2XM1A 4M1PA 1MMNA 4TUYE 3A8YC 2PG8A 2LSKA 1D0YA 4LMKA 4TX5A 5HWYA 2CHNA 3ZMSB 2A72A 1D0XA 5AQIB 3O9XA 5FL0A 1WRDA 2MPKA 2K3WA 2HN2A 1IZNB 2CA5A 3AVRA 3PUSA 3OYXA 2BS2A 2NW9A 4ASKA 1E2AA 1UX4A 2DWKA 2N1GA 2WS3A 4Q25A 3FBLA 4EAHA 2XPKA 3C4ZA 3N9QA 3MJXA 4B3TT 3T1YT 2W62A 3AE7A 4G2AA 4COFA 4JLEA 4DV1T 4DV5T 3FZHB 5EK2A 1S94A 1OXZA 4MBQA 4X1IE 2LKGA 4JUYA 2I0MA 5JDMA 1KEYA 4AI6A 2CBIA 2VKOA 3RKGA 2WBLA 3KV5A 5AQUB 4IIJE 4JEHB 2ES0A 3UUMA 1FMVA 2WP9A 2WZHA 3TKLB 5J2TE 4AKIA 1KF6A 3S4UA 4AIUA 2VKJA 4DV6T 3H37A 2R6GF 3IHRA 5ABHA 2VURA 3I0QA 2X0YA 3GN5A 3KV6A 4YLHA 5AQHB 2C0SA 2KNDA 2X0HA 2YU2A 4KHZF 4YY3T 1W09A 2KWHA 4ZI2C 5KMGP 1CUNA 3CKDA 3CX7B 4ZI2D 4LFAT 2V5DA 2VL0A 5FY7A 4CQIA 3B5MA 1MMAA 4A98A 2IAKA 4TNVA 3LDQB 1GQEA 2GK9A 5HCJA 2UXXB 2ZMAA 4AQGA 3OKQA 4CZZB 2V7JA 4WBNE 4GOUA 5CB4E 2X9WA 1QSDA 2LKHA 1OEDC 4DV2T 3RH3A 3PTRB 2XZEA 5HXSA 1LVFA 3U3IA 1G8XA 2LSIA 3ETVA 3KV9A 1U5PA 3AECA 4DR5T 2E5LT 4LF6T 4KBMB 4DR4T 4O4JE 5JDQA 1X79A 4YHHT 4EXTA 5LYJE 1W0BA 3AA1B 4UF0A 5AQJB 4JI2T 3TLUA 4ZEYA 2BVMA 5JH7E 5L3GB 2IC9A 3OJAA 4DVDA 4OHFA 2BS3A 1J5WA 4QXCB 2J47A 2K5BB 2UUAT 4WBOA 2KZ7B 4Z8XA 4EEDA 1M62A 2VQET 2F4VT 4DR7T 3EDUA 4KHPT 1VCTA 1FEWA 3Q9DA 3RQUA 4JI6T 2NTXA 2J1DG 2VKDA 2WCAA 2CXFA 4YTNA 3VRBA 1KFYA 2JPFA 4IL9A 4ZI7E 1J5ET 4XBFB 4I55E 3FHNA 2DL1A 1MIYA 1ZV4X 2CHOA 4ILBA 4CI3B 2NW7A 1XZYA 1US7B 3CQCB 3AE1A 3F31A 4QWNB 4PJNA 2CLYB 2CWOA 2PBIA 3ZEFB 4CXXA 3UT5E 2I6HA 5DJQC 3J7Yq 2AXDS 2D2SA 3N9PA 4UEMA 4FI5A 2W0GA 3ZJ1A 2K48A 1VRBA 3KVBA 1HG2A 4QX7B 4KP3C 4UIGA 3LBXB 2YK0A 5AQSB 2OA5A 3UUBA 3CX6B 5AQFB 4YSYA 4F8HA 4GKJT 5HXHA 3WAJA 2V26A 2YOEA 4IDQA 3JAEA 1I94T 4CXWA 1WR0A 1J1JA 1G73A 2XHEB 3CK6A 3QB5A 3F57A 4P0BA 5HEUA 5L47A 3MACA 4EYUA 3PUWF 4OYJA 5ETWA 2E8IA 4KMCA 3HKBE 4H9PC 3RI5A 3ZYKA 3BQLA 3AVSA 4DR3T 3AEDA 2X9YA 1D1AA 3RIFA 5HXEA 2LLYA 4TWHA 3CQGB 5C8YE 2UXBT 3K1SA 2XY8B 2ZLYA 4DR2T 2L9QA 2WDVA 3NKZA 4TN7B 2EHOB 2XM2A 5AQLB 3ZC1A 5BR8T 3RPUA 4JBWF 2KT9A 3AAAB 3Q2MA 3AE2A 4IL4A 2WQYA 4TWFA 3J9X1 2M67A 4IE0A 3RHWA 2WU5A 2N9DA 5JQGE 4K0KT 1FJGT 3RQWA 5IWAT 4NXNT 5KDMC 5AQNB 4PK5A 1JNRA 4ZS2A 4GK5E 2CXLA 2RA1A 3PV0F 1SHZC 3ZT6A 2JJ9A 4HFEA 5LA6E 2JQKA 1O3XA 3RYCE 4YFSA 4DBRA 2NP9A 5JR9A 5CJ5A 1MIWA 5TAOA 1D0ZA 4CXYA 1N33T 3GA8A 4QHOA 4YTPA 4DV4T 4JI7T 4CN6A 3ESLA 5HAXA 5FP3A 1R8IA 3ZPOA 3AXJB 4FJOA 3LJCA 4LF4T 4A56A 5JR9B 3HKDE 1YQ4A 3HL6A 4HFHA 2E9XC 3DTOA 4YSZA 4L9IA 4LMLA 4OYKA 3SFEA 3TLVA 4AQFC 1HS7A 2XQ7A 3A5XA 3PU8A 5EK3A 4YJ2E 3V5SA 3NVOA 2YINA 3EHZA 1CHUA 3B57A 3M65A 2K24A 3GWHA 4K0UA 3M3ZB 5LB7B 5L4HA 2JQHA 4YJ3E 3R6NA 3RC3A 2VB6A 3SRZA 5JDGA 4G63A 2VQFT 5HEGA 2IDOB 2CBJA 4DV7T 4TZ4C 3R84B 1BR4A 4PFOA 2DCFA 1HTJF 2XSBA 2V6XA 2A9UA 2QYWA 5DQVA 5JRCA 5AFUL 3PDYA 2ZM0A 3AEGA 5JVDE 4UV9B 3QB5K 3RIUC 3TLWA 3EUHA 2VL8A 4PAGA 3ZN1B 2V7KA 2BBHA 2XAGB 3N2KE 2G0UA 4UR9A 4IDZA 3OVUA 3SFDA 1LKXA 3I1AA 5AQGB 4QH4A 2ODVA 2XAHB 3AAEB 3N9OA 4IE4A 2OV9A 4NUUA 3FBZA 2W63A 4TV9E 2V7LA 5AQMB 5AQVB 2BG9C 3LG7A 4PW8A 3AA7B 5FNVE 3ZMZB 4EYYR 4GIWA 2ZM2A 3I9YA 2H89A 4NUVA 4UF0B 4WZXA 5FXWA 3RYHE 3IEEA 4ZHQE 2QVAA 3FZFB 4LF5T 1IBLT 3K8PC 1UCUA 2ACZA 2BS4A 3C4WA 3MXZA 4PJJA 5HXRA 1XNRT 2A2FX 3UUNA 5IYZE 2XSAA 2IMLA 2WM9A 4PJLA 1MNDA 3O4XE 1OEDE 2YU1A 5FKYA 3PUYF 3SS1A 2QRXA 3UU5A 3ZMTB 2KSRA 4U31A 4CN1A 5ABFA 1ZEEA 2XJ7A 5LJMA 3ETUA 4NPPA 2E2AA 4HEAA 4O4LE 1MMDA 5ABFB 5LHIB 3I9WA 2XQ9A 5C3JA 2FBWA 2MAWA 3RYIE 4ERRA 4LFBT 1DU2A 3RLFF 2FJDA 3N9MA 3CIRA 5CA1E 5FL1A 4WYVA 1IJ6A 2B1EA 1HX1B 2LSJA 2CCQA 2P9BA 3C51A 3AA6B 2V7MA 2LOPA 3HR0A 4ISSA 5AQTB 3ZN0B 4ANJA 5LP6E 3CVRA 4KUMB 2W00A 3ZCJA 4E7ZA 3ABVA 3P4WA 2ODUA 3DP7A 4XAXB 1JNZA 3OPCA 4HWCA 1HX8A 5HEOA 4Z90A 1T7SA 3FXDB 5HEHA 4P0AA 3EABA 3JADA 4HFBA 4O4IE 4UVAB 3TLSA 2IC6A 5JDLA 4H9NC 1UURA 1B7TA 4I0UA 2WZIA 4IGUA 4CI1B 4X65T 5BMVE 3IA3A 2W61A 4ILUA 1ZHCA 4IE7A 4EEBA 1AJ3A 4IE5A 4L0RA 3JAFA 3QK6A 3O1HA 2NR4A 4BJMA 4TV8E 1N34T 2KINB 3AE3A 4H9QC 3C98B 4HTEA 1Z8UA 1D1CA 2BDEA 1Y64B 2RPAA 3PUVF 5FMNA 2C5KT 1E7PA 3NBXX 4GYSA 4PK4A 2BZBA 5LNKA 3UQ7A 3X1DA 1MIVA 3SWHA 3DJBA 4E7SA 4L5GA 3LK3B 4V1Av 4X66T 2X0LB 2PTFA 2EHOD 1SA0E 2H7VC 2V7IA 1E1HB 4TNWA 1WYBA 4X1KE 2LM2A 3HKCE 4U2ZA 3ZJ2A 4N78D 4C90A 2VK9A 2FJAA 4HFVA 3UTKA 3LFMA 4OX9T 5HXCA 2ACXA 4ZZCA 2K9AA 1UGOA 2FJBA 2D5UA 2VKHA 4ZI3C 5LOVE 4HWFA 3ANWA 4AXPA 5J0ZA 1S35A 2XAFB 1ZP0A 3C64A 2EHOC 3B13A 4LF8T 3L39A 1SUMB 1YD8G 1YKEB 3AEFA 3AXJA 3C4XA 4X1YE 1IAPA 2PJQA 2I59A 1T72A 2LHRA 3AE4A 4NIQA 2CM0A 2XQ3A 4EB6E 4B3ST 3CX8B 3L3PA 2Q9QB 2VWAA 2W4XA 2WAUA 5EK4A 5J1GA 5JDNA 3N9LA 4YXDA 5LMUT 2QGSA 2B76A 4DUZT 3QNUA 3ZT5A 4IHJE 4EIWA 4DO0A 1V9DA 5J2UE 3VRAA 2JRKA 4DNDA 1OWAA 3PE0A 2UUCT 2X9XA 4MALA 1MMGA 4YTMA 3UQ4A 5L3CB 2JIWA 4DUYT 2BKOA 4QXHB 3P50A 4U7IA 2MBGA 1HFAA 2MOZA 3MKDA 3Q5XA 4Z91A 2XQ4A 2HHHT 4BJNA 3LSVA 2XAQB 4JI1T 3C50A 1HCIA 5JDFA 1IBMT 2LJLA 2CWYA 2W66A 2WB5A 4EZHA 3VKGA 1OEDA 3FZKB 4AKRB 3FZMB 4I43B 3N9NA 2WU2A 5LHGB 4O2BE 4LF9T 4UV8B 3GMIA 4UXNB 2NTYA 1BR1A 4AKGA 3PUGA 1HNZT 2LRLA 2DI4A 1MNEA 2MYSA 2D0TA 2A3DA 3KVAA 3VR9A 4BA9A 3UULA 5CFBA 5JDHA 3EDVA 3UFEA 1XNQT 3PUXF 5JTGA 4H63V 3PUAA 4YT0A 3UUXB 5L3EB 3KBTA 4LF7T 3NZPA 4AQFA 2YDRA 2WMOA 4CN4A 4ZOLE 3RKOA 3MK7C 1NAFA 3L8RA 1HNXT 2DWGA 3JC6D 3KBUA 2L3LA 2Q9QD 4U74A 1M7KA 2LOSA 2C5JA 3O1IA 4ILCA 1YW0A 2BG9B 3VHLA 2JQQA 5A1LA 3UU3A 5H6QB 2E9XB 3NZQA 5LJNA 2DLRA 2WDQA 2D9DA 4OFZA 5FXZA 3AEEA 2YDQA 3HI2A 4GKKT 1KNZA 2E9XA 5H6RB 3EVYA 2E9XD 1WYCA 3EAMA 3P4SA 2KLQA 3BQKA 3FB2A 4BAYB 2AE9A 5EZYE 3ZT7A 2J62A 5L3FB 2NWBA 2Y48B 4HKAA 2XQ6A 5LG4A 5M4YA 4PFPA 3ONLC 4ZS3A 5FYMA 4DR1T 1QLBA 2X68A 5AQQB 2WWUA 3NWIA 3PUQA 3Q5DA 2CXDA 4H9OC 5LMNT 4ADZA 4LFCT 1NENA 3IF8B 3Q5EA 3L09A 4HFIA 4I4TE 2DHRA 2VVNA 2JMKA 2ZM8A 4LMJA 3JCFA 3HKEE 3QOFA 4QKNA 4J2CA 5F8PA 4IE6A 5FVKA 4AKLA 3OTOT 5FY0A 2BKPA 2N2NA 5LGUB 3RIAA 2Z6EA 1BR2A 2LSYA 4U2YA 3G06A 4HE8A 4X64T 1XMOT 1UUSA 3BQIA 4O8SA 2KWIB 4YHJA 2QA7A 3ONXA 4MLKA 4ZZBA 2X66A 3ZC0A 5ADXL 3RRWA 1I6ZA 3T1HT 4P1NA 5HYAA 2XQ8A 1KNPA 3MA9A 1YQ3A 2YKSA 4GK0E 5HCMA 2WSSV 1BR0A 4DV0T 3KFWX 5HWXA 5DQWA 3AE8A 5GONE 1Y01A 1IBKT 1QUUA 3E0ZA 4HGAA 5LBQB 4QH1A 2XTLA 2HPJA 3PURA 2D0UA 2KMFA 4JYAT 2UUBT 1WR6A 3ZKRA 2ZM6T 2RP4A 4ISTA 2W67A 1XMQT 1N36T 2BKNA 2X9HA 3N2OA 4QXBB 5FXVA 1T8BA 1FMWA 1L0VA 2XUEA 4U72A 3ANWB 4QX8B 2CEAA 2IUBA 2WMNA 4MHCA 2CPTA 5JR9C 3P8CD 5C2TA 2KXPB 3FXEB 4YSXA 4HWHA 4AQYT 2M6IA 4P09A 2W2UA 4U33A 4H9RC 4IDPA 5LCYA 2E5VA 5JRCB 5E0OA 2Q9QA 3H3AA 3LK2B 2WY2A 2CE7A 2BBJA 3H3MA 3UU8A 3VR8A 2UXNB 3AA0B 1ZKEA 4XZCA 3D0TA 3RGLA 5KXJA 2LEHA 4NXMT 4PK6A 1XDOA 3ZYLA 3PJAJ 3IBPA 4AKHA 2V5CA 3AB3B 4EV6A 1U4QA 3RF1A 5CGMA 5AQKB 1UX5A 1VOMA 2LRKA 4X20E 4JI4T 4TWDA 3PU3A 1WLXA 2VVSA 3P4RA 1NWMX 2IHR1 2LT3A 4IREA 3ZSSA 3RC8A 3CPZA 4MFRA 1XDPA 3BK9A 3P7IA 1Z0PA 5FY1A 3ZLIA 5F5WA 4U3CA 2CLYC 4JI0T 3LK42 3ZMVB 1OEDB 1EZ3A 4H9SE 2LHNA 4IT4A 1XWMA 4KI0F 3P4QA 5LGTB 3P4PA 4DV3T 3GN5B 5ABGA 1H7CA 1HG5A 1W9RA 2SPCA 4O2AE 5FVLA 2HPLA 4EOZB 3PJAA 3RYFE 3OBVE 2WWVA 2UXCT 4F6RC 1WFDA 4X5TA 2PFVA 2XQAA 3VU7H 4A97A 3CWZB 5L3DB 3NRXA 3EI0A 4DMWA 2OLTA 4UVBB 3Q5WA 5CA0E 1D1BA 3ZCIA 2JQ9A 3K3QC 5LBMA 2X67A 2UXDT 4UVCB 3AE6A 3ZSTA 5LGNB 3V5UA 5F3JA 4IDOA 1YKHB 4OK0A 2FUPA 2VASA 2LM9A 3E08A 5AQRB 2BG9A 1HR0T 2Y6XA 2HH7A 4B3RT 2CRBA 1ZOYA 3ZYMA 3RRCA 4JEUB 4A5XA 5L3BB 5HEJA 2C5IT
chains in the Genus database with same CATH topology
2BVLA 3K3NA 4ZI3D 3T8OA 4DBQA 3OYZA 2V1DB 4PJMA 4O4HE 5LHHB 2NW8A 4WW0A 3VKHA 2YEVC 2X51A 2MTQA 4UELA 3I0OA 4CI2B 2NOXA 2Y8DA 3F2EA 4C91A 3K3OA 3HA4A 4H63H 5LXTE 3KINB 3AAIA 5FXXA 5L2LA 3E22E 2L8KA 1FIOA 3U78A 4DMVA 3WAKA 3O1JA 2Q9QC 2DNXA 2LE8A 3KV4A 3JC6C 4HN9A 3LBXA 3N2GE 2LSGA 3ZMUB 2CMRA 3KDSE 4EZ4A 5DABA 2IW5B 1KK7A 1HF8A 3QUJA 5IHYA 2XASB 2JMHA 1IJ5A 3NRYA 3MZKB 3CMLA 4I50E 1T98A 5KX5E 2H3RA 3N5LA 3WI3A 3RX6A 4GYRA 3SOLA 4WNKA 2XAJB 4PNIA 3W15B 2EHOA 1LRZA 2XQYA 4AKLA 3CQXC 5EK2A 1LVKA 2H7OA 4M1PA 3QC9A 4TUYE 5JRCA 1MMNA 5HWYA 2PG8A 2LSKA 1D0YA 4TX5A 3ZMSB 2A72A 1D0XA 3O9XA 1WRDA 1IZNB 2CA5A 3AVRA 3PUSA 3OYXA 2NW9A 4ASKA 2DWKA 1UX4A 4EAHA 2N1GA 3FBLA 3C4ZA 3N9QA 3MJXA 2W62A 4G2AA 4JLEA 1S94A 1OXZA 4MBQA 4X1IE 4JUYA 5JDMA 4AI6A 2VKOA 2WBLA 3KV5A 4IIJE 4JEHB 2ES0A 3UUMA 1FMVA 5J2TE 3TKLB 3S4UA 2VKJA 3H37A 3IHRA 3I0QA 4YLHA 3GN5A 3KV6A 2C0SA 2KNDA 2YU2A 2KWHA 4ZI2C 5KMGP 1CUNA 3CKDA 3CX7B 4ZI2D 5FY7A 4CQIA 1MMAA 2IAKA 2GK9A 2UXXB 2ZMAA 4AQGA 3OKQA 4CZZB 2V7JA 4WBNE 4GOUA 5CB4E 2X9WA 1QSDA 3RH3A 3PTRB 5HXSA 1LVFA 3U3IA 1G8XA 2LSIA 3ETVA 3KV9A 1U5PA 4KBMB 4O4JE 5JDQA 1X79A 4EXTA 5LYJE 3AA1B 4UF0A 5JH7E 2BVMA 5L3GB 2IC9A 3OJAA 4DVDA 4OHFA 4QXCB 2K5BB 4WBOA 2KZ7B 4Z8XA 3EDUA 1FEWA 3Q9DA 2NTXA 2J1DG 2VKDA 2CXFA 2JPFA 4ZI7E 4XBFB 4I55E 3FHNA 1MIYA 1ZV4X 4CI3B 2NW7A 1US7B 3CQCB 3F31A 4QWNB 4PJNA 2CLYB 2CWOA 2PBIA 3ZEFB 4CXXA 3UT5E 5DJQC 3J7Yq 3N9PA 2D2SA 4UEMA 4FI5A 2W0GA 3ZJ1A 2K48A 1VRBA 3KVBA 1HG2A 4QX7B 4KP3C 4UIGA 3LBXB 2YK0A 2OA5A 3CX6B 5HXHA 3WAJA 2V26A 4CXWA 1G73A 2XHEB 4P0BA 3F57A 3MACA 4EYUA 4OYJA 5ETWA 2E8IA 4KMCA 3HKBE 4H9PC 3ZYKA 3BQLA 3AVSA 2X9YA 1D1AA 5HXEA 5C8YE 3CQGB 2ZLYA 2L9QA 4TN7B 2EHOB 3ZC1A 3RPUA 2KT9A 3AAAB 3Q2MA 3J9X1 5JQGE 2M67A 4IE0A 2N9DA 5KDMC 4PK5A 4ZS2A 4GK5E 2CXLA 2RA1A 1SHZC 2JJ9A 5LA6E 1O3XA 3RYCE 4YFSA 4DBRA 2NP9A 5JR9A 1MIWA 5TAOA 1D0ZA 4CXYA 3GA8A 4QHOA 3ESLA 5HAXA 5FP3A 3ZPOA 4FJOA 3LJCA 4AKIA 4A56A 5JR9B 3HKDE 3HL6A 2E9XC 3DTOA 1HS7A 4L9IA 4OYKA 4AQFC 3A5XA 3PU8A 5EK3A 4YJ2E 3V5SA 2YINA 3B57A 3M65A 2K24A 3GWHA 4K0UA 3R6NA 3RC3A 4YJ3E 3SRZA 5JDGA 2VB6A 4G63A 4TZ4C 3R84B 1BR4A 4PFOA 2DCFA 1HTJF 5DQVA 3PDYA 2ZM0A 5JVDE 4UV9B 3EUHA 2VL8A 4PAGA 3ZN1B 2V7KA 2XAGB 3N2KE 2G0UA 4IDZA 1LKXA 3I1AA 2ODVA 2XAHB 3AAEB 3N9OA 4IE4A 4NUUA 5FY0A 3FBZA 2W63A 4TV9E 2V7LA 3ZMZB 4B6XA 4EYYR 3LG7A 4PW8A 3AA7B 5FNVE 4GIWA 2ZM2A 3I9YA 4NUVA 4UF0B 4ZHQE 5FXWA 3RYHE 3IEEA 3K8PC 1UCUA 3C4WA 4PJJA 3MXZA 5HXRA 2A2FX 3UUNA 5IYZE 2WM9A 4PJLA 1MNDA 3O4XE 2YU1A 5JREA 3ZMTB 3SS1A 5LJMA 1ZEEA 3ETUA 4O4LE 4HEAA 1MMDA 5LHIB 3I9WA 4ERRA 3RYIE 3N9MA 5CA1E 1IJ6A 2B1EA 2LSJA 2P9BA 2CCQA 3C51A 3HR0A 3AA6B 2V7MA 2LOPA 4ANJA 4ISSA 3ZN0B 5LP6E 3CVRA 4KUMB 2W00A 3ZCJA 4E7ZA 2ODUA 3DP7A 4XAXB 5AFUL 1HX8A 4P0AA 3FXDB 5JDLA 4O4IE 4UVAB 2IC6A 4H9NC 1B7TA 4IGUA 4CI1B 5BMVE 2W61A 4ILUA 1ZHCA 4IE7A 1AJ3A 4IE5A 4L0RA 3QK6A 3O1HA 4BJMA 4TV8E 2KINB 4H9QC 3C98B 4HTEA 1D1CA 2BDEA 1Y64B 5FMNA 2C5KT 4GYSA 3NBXX 4PK4A 2BZBA 5LNKA 1MIVA 3SWHA 3DJBA 4E7SA 4L5GA 3LK3B 4V1Av 2X0LB 2EHOD 1SA0E 2H7VC 2V7IA 1E1HB 4X1KE 1WYBA 3ZJ2A 3HKCE 4C90A 3VKGA 4N78D 2VK9A 4HFVA 3UTKA 3LFMA 5HXCA 2ACXA 2K9AA 5LOVE 2D5UA 2VKHA 4ZI3C 3ANWA 4AXPA 1S35A 2XAFB 3C64A 2EHOC 3B13A 1YD8G 1YKEB 3C4XA 4X1YE 1IAPA 2PJQA 2I59A 2LHRA 4EB6E 2CM0A 3CX8B 3L3PA 2Q9QB 2VWAA 2WAUA 5EK4A 5J1GA 5JDNA 3N9LA 2QGSA 4IHJE 4EIWA 4DO0A 1V9DA 5J2UE 2JRKA 4DNDA 1OWAA 3PE0A 2X9XA 4MALA 1MMGA 5L3CB 4QXHB 2MBGA 1HFAA 2MOZA 3MKDA 3Q5XA 4BJNA 2XAQB 3C50A 1HCIA 5JDFA 2LJLA 2CWYA 4EZHA 4AKRB 5LHGB 4I43B 3N9NA 4O2BE 4UV8B 3GMIA 4UXNB 2NTYA 1BR1A 4AKGA 3PUGA 2MYSA 2DI4A 1MNEA 4BA9A 2D0TA 2A3DA 3KVAA 5JDHA 3UULA 3EDVA 3UFEA 4H63V 3PUAA 3UUXB 5L3EB 3KBTA 3NZPA 4AQFA 2WMOA 4ZOLE 3RKOA 3MK7C 1NAFA 2DWGA 3JC6D 3KBUA 2L3LA 2Q9QD 4U74A 2LOSA 2C5JA 3O1IA 1YW0A 3VHLA 2JQQA 5A1LA 5LJNA 5H6QB 2E9XB 3NZQA 2DLRA 4OFZA 5FXZA 3HI2A 1KNZA 2E9XA 5H6RB 3EVYA 2E9XD 1WYCA 4BAYB 2KLQA 3BQKA 3FB2A 5EZYE 5L3FB 2NWBA 2Y48B 4HKAA 5LG4A 5M4YA 4PFPA 4ZS3A 5FYMA 2X68A 2WWUA 3PUQA 2CXDA 4H9OC 4ADZA 3IF8B 3L09A 4I4TE 2DHRA 2JMKA 2ZM8A 4QKNA 3HKEE 5F8PA 4J2CA 4IE6A 2N2NA 5LGUB 2Z6EA 1BR2A 2LSYA 4HE8A 4O8SA 3BQIA 2KWIB 4YHJA 2QA7A 3ONXA 4MLKA 2X66A 3ZC0A 5ADXL 3RRWA 5HYAA 3MA9A 1BR0A 4GK0E 2WSSV 3KFWX 5HWXA 5DQWA 5GONE 1QUUA 3E0ZA 4HGAA 5LBQB 2XTLA 2HPJA 3PURA 2D0UA 2KMFA 1WR6A 2RP4A 4ISTA 2X9HA 3N2OA 4QXBB 5FXVA 1FMWA 2XUEA 4U72A 3ANWB 4QX8B 2CEAA 2WMNA 4MHCA 5JR9C 3P8CD 2KXPB 3FXEB 4P09A 4H9RC 5LCYA 5JRCB 5E0OA 2Q9QA 3H3AA 3LK2B 2CE7A 2UXNB 3AA0B 1ZKEA 4XZCA 3D0TA 2LEHA 4PK6A 3ZYLA 3IBPA 4AKHA 3AB3B 1U4QA 1UX5A 1VOMA 4X20E 3PU3A 1WLXA 1NWMX 2LT3A 3RC8A 3CPZA 4MFRA 3BK9A 3P7IA 1Z0PA 5FY1A 3ZLIA 2CLYC 3LK42 3ZMVB 1EZ3A 4H9SE 2LHNA 5LGTB 3GN5B 1H7CA 1HG5A 2SPCA 4O2AE 2HPLA 4EOZB 3RYFE 3OBVE 4F6RC 3VU7H 2PFVA 5L3DB 3CWZB 3NRXA 4DMWA 4UVBB 3Q5WA 5CA0E 1D1BA 3ZCIA 3K3QC 5LBMA 2X67A 4UVCB 5LGNB 3V5UA 5F3JA 4OK0A 1YKHB 2VASA 2LM9A 3E08A 2Y6XA 2HH7A 3ZYMA 3RRCA 4JEUB 5L3BB 2C5IT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLE A; 
#chains in the Genus database with same CATH topology
 2YN6 A;  4DID B;  2IIU A;  1KNR A;  2BVL A;  3AE5 A;  5LG3 A;  3K3N A;  5AQO B;  4ZI3 D;  1YXR A;  2XQ5 A;  3T8O A;  4DBQ A;  3OYZ A;  2V1D B;  4PJM A;  4O4H E;  5LHH B;  2NW8 A;  4KX6 A;  4WW0 A;  4JI5 T;  3VKH A;  4JI8 T;  2YEV C;  2X51 A;  2UU9 T;  2MTQ A;  2FJE A;  4UEL A;  3I0O A;  4CI2 B;  4JV5 T;  2NOX A;  2Y8D A;  3F2E A;  1WCR A;  2WDR A;  4C91 A;  3K3O A;  4ZXL A;  3HA4 A;  4H63 H;  5LXT E;  3KIN B;  3AAI A;  3UU4 A;  5FXX A;  5L2L A;  3E22 E;  4HWI B;  3UU6 A;  3FZL B;  4ILA A;  2L8K A;  1FIO A;  3U78 A;  1HNW T;  5JRE A;  1N32 T;  4HWD A;  3RIU A;  5ABE A;  1W0A A;  3WAK A;  3O1J A;  4DMV A;  2J4G A;  4EGW A;  2Q9Q C;  2DNX A;  4QH5 A;  2BG9 E;  2LE8 A;  3KV4 A;  3JC6 C;  4HN9 A;  5AQP B;  3UFG A;  3LBX A;  3N2G E;  2LSG A;  1SE7 A;  3ZMU B;  4B6X A;  2CMR A;  3KDS E;  1UK5 A;  4EZ4 A;  5DAB A;  2IW5 B;  5L4E A;  1KK7 A;  1HF8 A;  1VCS A;  4HFC A;  3A7M A;  3QUJ A;  5IHY A;  1NEK A;  2XAS B;  2H88 A;  2JMH A;  4X62 T;  1IJ5 A;  4AIS A;  3NRY A;  4HFD A;  3MZK B;  3CML A;  3W15 B;  4I50 E;  1T98 A;  5KX5 E;  2H3R A;  2M6B A;  2V6Y B;  4B3M T;  3PUZ F;  4DR6 T;  3AEA A;  3ONJ A;  5IUX A;  3N5L A;  3AE9 A;  3TLT A;  3WI3 A;  2V6Y A;  4JI3 T;  2V8S V;  4GYR A;  3RX6 A;  3SOL A;  4WNK A;  2XAJ B;  4PNI A;  4U7Y A;  2EHO A;  1LRZ A;  2HN1 A;  2XQY A;  2YDS A;  3CQX C;  3AEB A;  1X9B A;  1LVK A;  2H7O A;  4IDN A;  3QC9 A;  2XM1 A;  4M1P A;  1MMN A;  4TUY E;  3A8Y C;  2PG8 A;  2LSK A;  1D0Y A;  4LMK A;  4TX5 A;  5HWY A;  2CHN A;  3ZMS B;  2A72 A;  1D0X A;  5AQI B;  3O9X A;  5FL0 A;  1WRD A;  2MPK A;  2K3W A;  2HN2 A;  1IZN B;  2CA5 A;  3AVR A;  3PUS A;  3OYX A;  2BS2 A;  2NW9 A;  4ASK A;  1E2A A;  1UX4 A;  2DWK A;  2N1G A;  2WS3 A;  4Q25 A;  3FBL A;  4EAH A;  2XPK A;  3C4Z A;  3N9Q A;  3MJX A;  4B3T T;  3T1Y T;  2W62 A;  3AE7 A;  4G2A A;  4COF A;  4JLE A;  4DV1 T;  4DV5 T;  3FZH B;  5EK2 A;  1S94 A;  1OXZ A;  4MBQ A;  4X1I E;  2LKG A;  4JUY A;  2I0M A;  5JDM A;  1KEY A;  4AI6 A;  2CBI A;  2VKO A;  3RKG A;  2WBL A;  3KV5 A;  5AQU B;  4IIJ E;  4JEH B;  2ES0 A;  3UUM A;  1FMV A;  2WP9 A;  2WZH A;  3TKL B;  5J2T E;  4AKI A;  1KF6 A;  3S4U A;  4AIU A;  2VKJ A;  4DV6 T;  3H37 A;  2R6G F;  3IHR A;  5ABH A;  2VUR A;  3I0Q A;  2X0Y A;  3GN5 A;  3KV6 A;  4YLH A;  5AQH B;  2C0S A;  2KND A;  2X0H A;  2YU2 A;  4KHZ F;  4YY3 T;  1W09 A;  2KWH A;  4ZI2 C;  5KMG P;  1CUN A;  3CKD A;  3CX7 B;  4ZI2 D;  4LFA T;  2V5D A;  2VL0 A;  5FY7 A;  4CQI A;  3B5M A;  1MMA A;  4A98 A;  2IAK A;  4TNV A;  3LDQ B;  1GQE A;  2GK9 A;  5HCJ A;  2UXX B;  2ZMA A;  4AQG A;  3OKQ A;  4CZZ B;  2V7J A;  4WBN E;  4GOU A;  5CB4 E;  2X9W A;  1QSD A;  2LKH A;  1OED C;  4DV2 T;  3RH3 A;  3PTR B;  2XZE A;  5HXS A;  1LVF A;  3U3I A;  1G8X A;  2LSI A;  3ETV A;  3KV9 A;  1U5P A;  3AEC A;  4DR5 T;  2E5L T;  4LF6 T;  4KBM B;  4DR4 T;  4O4J E;  5JDQ A;  1X79 A;  4YHH T;  4EXT A;  5LYJ E;  1W0B A;  3AA1 B;  4UF0 A;  5AQJ B;  4JI2 T;  3TLU A;  4ZEY A;  2BVM A;  5JH7 E;  5L3G B;  2IC9 A;  3OJA A;  4DVD A;  4OHF A;  2BS3 A;  1J5W A;  4QXC B;  2J47 A;  2K5B B;  2UUA T;  4WBO A;  2KZ7 B;  4Z8X A;  4EED A;  1M62 A;  2VQE T;  2F4V T;  4DR7 T;  3EDU A;  4KHP T;  1VCT A;  1FEW A;  3Q9D A;  3RQU A;  4JI6 T;  2NTX A;  2J1D G;  2VKD A;  2WCA A;  2CXF A;  4YTN A;  3VRB A;  1KFY A;  2JPF A;  4IL9 A;  4ZI7 E;  1J5E T;  4XBF B;  4I55 E;  3FHN A;  2DL1 A;  1MIY A;  1ZV4 X;  2CHO A;  4ILB A;  4CI3 B;  2NW7 A;  1XZY A;  1US7 B;  3CQC B;  3AE1 A;  3F31 A;  4QWN B;  4PJN A;  2CLY B;  2CWO A;  2PBI A;  3ZEF B;  4CXX A;  3UT5 E;  2I6H A;  5DJQ C;  3J7Y q;  2AXD S;  2D2S A;  3N9P A;  4UEM A;  4FI5 A;  2W0G A;  3ZJ1 A;  2K48 A;  1VRB A;  3KVB A;  1HG2 A;  4QX7 B;  4KP3 C;  4UIG A;  3LBX B;  2YK0 A;  5AQS B;  2OA5 A;  3UUB A;  3CX6 B;  5AQF B;  4YSY A;  4F8H A;  4GKJ T;  5HXH A;  3WAJ A;  2V26 A;  2YOE A;  4IDQ A;  3JAE A;  1I94 T;  4CXW A;  1WR0 A;  1J1J A;  1G73 A;  2XHE B;  3CK6 A;  3QB5 A;  3F57 A;  4P0B A;  5HEU A;  5L47 A;  3MAC A;  4EYU A;  3PUW F;  4OYJ A;  5ETW A;  2E8I A;  4KMC A;  3HKB E;  4H9P C;  3RI5 A;  3ZYK A;  3BQL A;  3AVS A;  4DR3 T;  3AED A;  2X9Y A;  1D1A A;  3RIF A;  5HXE A;  2LLY A;  4TWH A;  3CQG B;  5C8Y E;  2UXB T;  3K1S A;  2XY8 B;  2ZLY A;  4DR2 T;  2L9Q A;  2WDV A;  3NKZ A;  4TN7 B;  2EHO B;  2XM2 A;  5AQL B;  3ZC1 A;  5BR8 T;  3RPU A;  4JBW F;  2KT9 A;  3AAA B;  3Q2M A;  3AE2 A;  4IL4 A;  2WQY A;  4TWF A;  3J9X 1;  2M67 A;  4IE0 A;  3RHW A;  2WU5 A;  2N9D A;  5JQG E;  4K0K T;  1FJG T;  3RQW A;  5IWA T;  4NXN T;  5KDM C;  5AQN B;  4PK5 A;  1JNR A;  4ZS2 A;  4GK5 E;  2CXL A;  2RA1 A;  3PV0 F;  1SHZ C;  3ZT6 A;  2JJ9 A;  4HFE A;  5LA6 E;  2JQK A;  1O3X A;  3RYC E;  4YFS A;  4DBR A;  2NP9 A;  5JR9 A;  5CJ5 A;  1MIW A;  5TAO A;  1D0Z A;  4CXY A;  1N33 T;  3GA8 A;  4QHO A;  4YTP A;  4DV4 T;  4JI7 T;  4CN6 A;  3ESL A;  5HAX A;  5FP3 A;  1R8I A;  3ZPO A;  3AXJ B;  4FJO A;  3LJC A;  4LF4 T;  4A56 A;  5JR9 B;  3HKD E;  1YQ4 A;  3HL6 A;  4HFH A;  2E9X C;  3DTO A;  4YSZ A;  4L9I A;  4LML A;  4OYK A;  3SFE A;  3TLV A;  4AQF C;  1HS7 A;  2XQ7 A;  3A5X A;  3PU8 A;  5EK3 A;  4YJ2 E;  3V5S A;  3NVO A;  2YIN A;  3EHZ A;  1CHU A;  3B57 A;  3M65 A;  2K24 A;  3GWH A;  4K0U A;  3M3Z B;  5LB7 B;  5L4H A;  2JQH A;  4YJ3 E;  3R6N A;  3RC3 A;  2VB6 A;  3SRZ A;  5JDG A;  4G63 A;  2VQF T;  5HEG A;  2IDO B;  2CBJ A;  4DV7 T;  4TZ4 C;  3R84 B;  1BR4 A;  4PFO A;  2DCF A;  1HTJ F;  2XSB A;  2V6X A;  2A9U A;  2QYW A;  5DQV A;  5JRC A;  5AFU L;  3PDY A;  2ZM0 A;  3AEG A;  5JVD E;  4UV9 B;  3QB5 K;  3RIU C;  3TLW A;  3EUH A;  2VL8 A;  4PAG A;  3ZN1 B;  2V7K A;  2BBH A;  2XAG B;  3N2K E;  2G0U A;  4UR9 A;  4IDZ A;  3OVU A;  3SFD A;  1LKX A;  3I1A A;  5AQG B;  4QH4 A;  2ODV A;  2XAH B;  3AAE B;  3N9O A;  4IE4 A;  2OV9 A;  4NUU A;  3FBZ A;  2W63 A;  4TV9 E;  2V7L A;  5AQM B;  5AQV B;  2BG9 C;  3LG7 A;  4PW8 A;  3AA7 B;  5FNV E;  3ZMZ B;  4EYY R;  4GIW A;  2ZM2 A;  3I9Y A;  2H89 A;  4NUV A;  4UF0 B;  4WZX A;  5FXW A;  3RYH E;  3IEE A;  4ZHQ E;  2QVA A;  3FZF B;  4LF5 T;  1IBL T;  3K8P C;  1UCU A;  2ACZ A;  2BS4 A;  3C4W A;  3MXZ A;  4PJJ A;  5HXR A;  1XNR T;  2A2F X;  3UUN A;  5IYZ E;  2XSA A;  2IML A;  2WM9 A;  4PJL A;  1MND A;  3O4X E;  1OED E;  2YU1 A;  5FKY A;  3PUY F;  3SS1 A;  2QRX A;  3UU5 A;  3ZMT B;  2KSR A;  4U31 A;  4CN1 A;  5ABF A;  1ZEE A;  2XJ7 A;  5LJM A;  3ETU A;  4NPP A;  2E2A A;  4HEA A;  4O4L E;  1MMD A;  5ABF B;  5LHI B;  3I9W A;  2XQ9 A;  5C3J A;  2FBW A;  2MAW A;  3RYI E;  4ERR A;  4LFB T;  1DU2 A;  3RLF F;  2FJD A;  3N9M A;  3CIR A;  5CA1 E;  5FL1 A;  4WYV A;  1IJ6 A;  2B1E A;  1HX1 B;  2LSJ A;  2CCQ A;  2P9B A;  3C51 A;  3AA6 B;  2V7M A;  2LOP A;  3HR0 A;  4ISS A;  5AQT B;  3ZN0 B;  4ANJ A;  5LP6 E;  3CVR A;  4KUM B;  2W00 A;  3ZCJ A;  4E7Z A;  3ABV A;  3P4W A;  2ODU A;  3DP7 A;  4XAX B;  1JNZ A;  3OPC A;  4HWC A;  1HX8 A;  5HEO A;  4Z90 A;  1T7S A;  3FXD B;  5HEH A;  4P0A A;  3EAB A;  3JAD A;  4HFB A;  4O4I E;  4UVA B;  3TLS A;  2IC6 A;  5JDL A;  4H9N C;  1UUR A;  1B7T A;  4I0U A;  2WZI A;  4IGU A;  4CI1 B;  4X65 T;  5BMV E;  3IA3 A;  2W61 A;  4ILU A;  1ZHC A;  4IE7 A;  4EEB A;  1AJ3 A;  4IE5 A;  4L0R A;  3JAF A;  3QK6 A;  3O1H A;  2NR4 A;  4BJM A;  4TV8 E;  1N34 T;  2KIN B;  3AE3 A;  4H9Q C;  3C98 B;  4HTE A;  1Z8U A;  1D1C A;  2BDE A;  1Y64 B;  2RPA A;  3PUV F;  5FMN A;  2C5K T;  1E7P A;  3NBX X;  4GYS A;  4PK4 A;  2BZB A;  5LNK A;  3UQ7 A;  3X1D A;  1MIV A;  3SWH A;  3DJB A;  4E7S A;  4L5G A;  3LK3 B;  4V1A v;  4X66 T;  2X0L B;  2PTF A;  2EHO D;  1SA0 E;  2H7V C;  2V7I A;  1E1H B;  4TNW A;  1WYB A;  4X1K E;  2LM2 A;  3HKC E;  4U2Z A;  3ZJ2 A;  4N78 D;  4C90 A;  2VK9 A;  2FJA A;  4HFV A;  3UTK A;  3LFM A;  4OX9 T;  5HXC A;  2ACX A;  4ZZC A;  2K9A A;  1UGO A;  2FJB A;  2D5U A;  2VKH A;  4ZI3 C;  5LOV E;  4HWF A;  3ANW A;  4AXP A;  5J0Z A;  1S35 A;  2XAF B;  1ZP0 A;  3C64 A;  2EHO C;  3B13 A;  4LF8 T;  3L39 A;  1SUM B;  1YD8 G;  1YKE B;  3AEF A;  3AXJ A;  3C4X A;  4X1Y E;  1IAP A;  2PJQ A;  2I59 A;  1T72 A;  2LHR A;  3AE4 A;  4NIQ A;  2CM0 A;  2XQ3 A;  4EB6 E;  4B3S T;  3CX8 B;  3L3P A;  2Q9Q B;  2VWA A;  2W4X A;  2WAU A;  5EK4 A;  5J1G A;  5JDN A;  3N9L A;  4YXD A;  5LMU T;  2QGS A;  2B76 A;  4DUZ T;  3QNU A;  3ZT5 A;  4IHJ E;  4EIW A;  4DO0 A;  1V9D A;  5J2U E;  3VRA A;  2JRK A;  4DND A;  1OWA A;  3PE0 A;  2UUC T;  2X9X A;  4MAL A;  1MMG A;  4YTM A;  3UQ4 A;  5L3C B;  2JIW A;  4DUY T;  2BKO A;  4QXH B;  3P50 A;  4U7I A;  2MBG A;  1HFA A;  2MOZ A;  3MKD A;  3Q5X A;  4Z91 A;  2XQ4 A;  2HHH T;  4BJN A;  3LSV A;  2XAQ B;  4JI1 T;  3C50 A;  1HCI A;  5JDF A;  1IBM T;  2LJL A;  2CWY A;  2W66 A;  2WB5 A;  4EZH A;  3VKG A;  1OED A;  3FZK B;  4AKR B;  3FZM B;  4I43 B;  3N9N A;  2WU2 A;  5LHG B;  4O2B E;  4LF9 T;  4UV8 B;  3GMI A;  4UXN B;  2NTY A;  1BR1 A;  4AKG A;  3PUG A;  1HNZ T;  2LRL A;  2DI4 A;  1MNE A;  2MYS A;  2D0T A;  2A3D A;  3KVA A;  3VR9 A;  4BA9 A;  3UUL A;  5CFB A;  5JDH A;  3EDV A;  3UFE A;  1XNQ T;  3PUX F;  5JTG A;  4H63 V;  3PUA A;  4YT0 A;  3UUX B;  5L3E B;  3KBT A;  4LF7 T;  3NZP A;  4AQF A;  2YDR A;  2WMO A;  4CN4 A;  4ZOL E;  3RKO A;  3MK7 C;  1NAF A;  3L8R A;  1HNX T;  2DWG A;  3JC6 D;  3KBU A;  2L3L A;  2Q9Q D;  4U74 A;  1M7K A;  2LOS A;  2C5J A;  3O1I A;  4ILC A;  1YW0 A;  2BG9 B;  3VHL A;  2JQQ A;  5A1L A;  3UU3 A;  5H6Q B;  2E9X B;  3NZQ A;  5LJN A;  2DLR A;  2WDQ A;  2D9D A;  4OFZ A;  5FXZ A;  3AEE A;  2YDQ A;  3HI2 A;  4GKK T;  1KNZ A;  2E9X A;  5H6R B;  3EVY A;  2E9X D;  1WYC A;  3EAM A;  3P4S A;  2KLQ A;  3BQK A;  3FB2 A;  4BAY B;  2AE9 A;  5EZY E;  3ZT7 A;  2J62 A;  5L3F B;  2NWB A;  2Y48 B;  4HKA A;  2XQ6 A;  5LG4 A;  5M4Y A;  4PFP A;  3ONL C;  4ZS3 A;  5FYM A;  4DR1 T;  1QLB A;  2X68 A;  5AQQ B;  2WWU A;  3NWI A;  3PUQ A;  3Q5D A;  2CXD A;  4H9O C;  5LMN T;  4ADZ A;  4LFC T;  1NEN A;  3IF8 B;  3Q5E A;  3L09 A;  4HFI A;  4I4T E;  2DHR A;  2VVN A;  2JMK A;  2ZM8 A;  4LMJ A;  3JCF A;  3HKE E;  3QOF A;  4QKN A;  4J2C A;  5F8P A;  4IE6 A;  5FVK A;  4AKL A;  3OTO T;  5FY0 A;  2BKP A;  2N2N A;  5LGU B;  3RIA A;  2Z6E A;  1BR2 A;  2LSY A;  4U2Y A;  3G06 A;  4HE8 A;  4X64 T;  1XMO T;  1UUS A;  3BQI A;  4O8S A;  2KWI B;  4YHJ A;  2QA7 A;  3ONX A;  4MLK A;  4ZZB A;  2X66 A;  3ZC0 A;  5ADX L;  3RRW A;  1I6Z A;  3T1H T;  4P1N A;  5HYA A;  2XQ8 A;  1KNP A;  3MA9 A;  1YQ3 A;  2YKS A;  4GK0 E;  5HCM A;  2WSS V;  1BR0 A;  4DV0 T;  3KFW X;  5HWX A;  5DQW A;  3AE8 A;  5GON E;  1Y01 A;  1IBK T;  1QUU A;  3E0Z A;  4HGA A;  5LBQ B;  4QH1 A;  2XTL A;  2HPJ A;  3PUR A;  2D0U A;  2KMF A;  4JYA T;  2UUB T;  1WR6 A;  3ZKR A;  2ZM6 T;  2RP4 A;  4IST A;  2W67 A;  1XMQ T;  1N36 T;  2BKN A;  2X9H A;  3N2O A;  4QXB B;  5FXV A;  1T8B A;  1FMW A;  1L0V A;  2XUE A;  4U72 A;  3ANW B;  4QX8 B;  2CEA A;  2IUB A;  2WMN A;  4MHC A;  2CPT A;  5JR9 C;  3P8C D;  5C2T A;  2KXP B;  3FXE B;  4YSX A;  4HWH A;  4AQY T;  2M6I A;  4P09 A;  2W2U A;  4U33 A;  4H9R C;  4IDP A;  5LCY A;  2E5V A;  5JRC B;  5E0O A;  2Q9Q A;  3H3A A;  3LK2 B;  2WY2 A;  2CE7 A;  2BBJ A;  3H3M A;  3UU8 A;  3VR8 A;  2UXN B;  3AA0 B;  1ZKE A;  4XZC A;  3D0T A;  3RGL A;  5KXJ A;  2LEH A;  4NXM T;  4PK6 A;  1XDO A;  3ZYL A;  3PJA J;  3IBP A;  4AKH A;  2V5C A;  3AB3 B;  4EV6 A;  1U4Q A;  3RF1 A;  5CGM A;  5AQK B;  1UX5 A;  1VOM A;  2LRK A;  4X20 E;  4JI4 T;  4TWD A;  3PU3 A;  1WLX A;  2VVS A;  3P4R A;  1NWM X;  2IHR 1;  2LT3 A;  4IRE A;  3ZSS A;  3RC8 A;  3CPZ A;  4MFR A;  1XDP A;  3BK9 A;  3P7I A;  1Z0P A;  5FY1 A;  3ZLI A;  5F5W A;  4U3C A;  2CLY C;  4JI0 T;  3LK4 2;  3ZMV B;  1OED B;  1EZ3 A;  4H9S E;  2LHN A;  4IT4 A;  1XWM A;  4KI0 F;  3P4Q A;  5LGT B;  3P4P A;  4DV3 T;  3GN5 B;  5ABG A;  1H7C A;  1HG5 A;  1W9R A;  2SPC A;  4O2A E;  5FVL A;  2HPL A;  4EOZ B;  3PJA A;  3RYF E;  3OBV E;  2WWV A;  2UXC T;  4F6R C;  1WFD A;  4X5T A;  2PFV A;  2XQA A;  3VU7 H;  4A97 A;  3CWZ B;  5L3D B;  3NRX A;  3EI0 A;  4DMW A;  2OLT A;  4UVB B;  3Q5W A;  5CA0 E;  1D1B A;  3ZCI A;  2JQ9 A;  3K3Q C;  5LBM A;  2X67 A;  2UXD T;  4UVC B;  3AE6 A;  3ZST A;  5LGN B;  3V5U A;  5F3J A;  4IDO A;  1YKH B;  4OK0 A;  2FUP A;  2VAS A;  2LM9 A;  3E08 A;  5AQR B;  2BG9 A;  1HR0 T;  2Y6X A;  2HH7 A;  4B3R T;  2CRB A;  1ZOY A;  3ZYM A;  3RRC A;  4JEU B;  4A5X A;  5L3B B;  5HEJ A;  2C5I T; 
#chains in the Genus database with same CATH homology
 2BVL A;  3K3N A;  4ZI3 D;  3T8O A;  4DBQ A;  3OYZ A;  2V1D B;  4PJM A;  4O4H E;  5LHH B;  2NW8 A;  4WW0 A;  3VKH A;  2YEV C;  2X51 A;  2MTQ A;  4UEL A;  3I0O A;  4CI2 B;  2NOX A;  2Y8D A;  3F2E A;  4C91 A;  3K3O A;  3HA4 A;  4H63 H;  5LXT E;  3KIN B;  3AAI A;  5FXX A;  5L2L A;  3E22 E;  2L8K A;  1FIO A;  3U78 A;  4DMV A;  3WAK A;  3O1J A;  2Q9Q C;  2DNX A;  2LE8 A;  3KV4 A;  3JC6 C;  4HN9 A;  3LBX A;  3N2G E;  2LSG A;  3ZMU B;  2CMR A;  3KDS E;  4EZ4 A;  5DAB A;  2IW5 B;  1KK7 A;  1HF8 A;  3QUJ A;  5IHY A;  2XAS B;  2JMH A;  1IJ5 A;  3NRY A;  3MZK B;  3CML A;  4I50 E;  1T98 A;  5KX5 E;  2H3R A;  3N5L A;  3WI3 A;  3RX6 A;  4GYR A;  3SOL A;  4WNK A;  2XAJ B;  4PNI A;  3W15 B;  2EHO A;  1LRZ A;  2XQY A;  4AKL A;  3CQX C;  5EK2 A;  1LVK A;  2H7O A;  4M1P A;  3QC9 A;  4TUY E;  5JRC A;  1MMN A;  5HWY A;  2PG8 A;  2LSK A;  1D0Y A;  4TX5 A;  3ZMS B;  2A72 A;  1D0X A;  3O9X A;  1WRD A;  1IZN B;  2CA5 A;  3AVR A;  3PUS A;  3OYX A;  2NW9 A;  4ASK A;  2DWK A;  1UX4 A;  4EAH A;  2N1G A;  3FBL A;  3C4Z A;  3N9Q A;  3MJX A;  2W62 A;  4G2A A;  4JLE A;  1S94 A;  1OXZ A;  4MBQ A;  4X1I E;  4JUY A;  5JDM A;  4AI6 A;  2VKO A;  2WBL A;  3KV5 A;  4IIJ E;  4JEH B;  2ES0 A;  3UUM A;  1FMV A;  5J2T E;  3TKL B;  3S4U A;  2VKJ A;  3H37 A;  3IHR A;  3I0Q A;  4YLH A;  3GN5 A;  3KV6 A;  2C0S A;  2KND A;  2YU2 A;  2KWH A;  4ZI2 C;  5KMG P;  1CUN A;  3CKD A;  3CX7 B;  4ZI2 D;  5FY7 A;  4CQI A;  1MMA A;  2IAK A;  2GK9 A;  2UXX B;  2ZMA A;  4AQG A;  3OKQ A;  4CZZ B;  2V7J A;  4WBN E;  4GOU A;  5CB4 E;  2X9W A;  1QSD A;  3RH3 A;  3PTR B;  5HXS A;  1LVF A;  3U3I A;  1G8X A;  2LSI A;  3ETV A;  3KV9 A;  1U5P A;  4KBM B;  4O4J E;  5JDQ A;  1X79 A;  4EXT A;  5LYJ E;  3AA1 B;  4UF0 A;  5JH7 E;  2BVM A;  5L3G B;  2IC9 A;  3OJA A;  4DVD A;  4OHF A;  4QXC B;  2K5B B;  4WBO A;  2KZ7 B;  4Z8X A;  3EDU A;  1FEW A;  3Q9D A;  2NTX A;  2J1D G;  2VKD A;  2CXF A;  2JPF A;  4ZI7 E;  4XBF B;  4I55 E;  3FHN A;  1MIY A;  1ZV4 X;  4CI3 B;  2NW7 A;  1US7 B;  3CQC B;  3F31 A;  4QWN B;  4PJN A;  2CLY B;  2CWO A;  2PBI A;  3ZEF B;  4CXX A;  3UT5 E;  5DJQ C;  3J7Y q;  3N9P A;  2D2S A;  4UEM A;  4FI5 A;  2W0G A;  3ZJ1 A;  2K48 A;  1VRB A;  3KVB A;  1HG2 A;  4QX7 B;  4KP3 C;  4UIG A;  3LBX B;  2YK0 A;  2OA5 A;  3CX6 B;  5HXH A;  3WAJ A;  2V26 A;  4CXW A;  1G73 A;  2XHE B;  4P0B A;  3F57 A;  3MAC A;  4EYU A;  4OYJ A;  5ETW A;  2E8I A;  4KMC A;  3HKB E;  4H9P C;  3ZYK A;  3BQL A;  3AVS A;  2X9Y A;  1D1A A;  5HXE A;  5C8Y E;  3CQG B;  2ZLY A;  2L9Q A;  4TN7 B;  2EHO B;  3ZC1 A;  3RPU A;  2KT9 A;  3AAA B;  3Q2M A;  3J9X 1;  5JQG E;  2M67 A;  4IE0 A;  2N9D A;  5KDM C;  4PK5 A;  4ZS2 A;  4GK5 E;  2CXL A;  2RA1 A;  1SHZ C;  2JJ9 A;  5LA6 E;  1O3X A;  3RYC E;  4YFS A;  4DBR A;  2NP9 A;  5JR9 A;  1MIW A;  5TAO A;  1D0Z A;  4CXY A;  3GA8 A;  4QHO A;  3ESL A;  5HAX A;  5FP3 A;  3ZPO A;  4FJO A;  3LJC A;  4AKI A;  4A56 A;  5JR9 B;  3HKD E;  3HL6 A;  2E9X C;  3DTO A;  1HS7 A;  4L9I A;  4OYK A;  4AQF C;  3A5X A;  3PU8 A;  5EK3 A;  4YJ2 E;  3V5S A;  2YIN A;  3B57 A;  3M65 A;  2K24 A;  3GWH A;  4K0U A;  3R6N A;  3RC3 A;  4YJ3 E;  3SRZ A;  5JDG A;  2VB6 A;  4G63 A;  4TZ4 C;  3R84 B;  1BR4 A;  4PFO A;  2DCF A;  1HTJ F;  5DQV A;  3PDY A;  2ZM0 A;  5JVD E;  4UV9 B;  3EUH A;  2VL8 A;  4PAG A;  3ZN1 B;  2V7K A;  2XAG B;  3N2K E;  2G0U A;  4IDZ A;  1LKX A;  3I1A A;  2ODV A;  2XAH B;  3AAE B;  3N9O A;  4IE4 A;  4NUU A;  5FY0 A;  3FBZ A;  2W63 A;  4TV9 E;  2V7L A;  3ZMZ B;  4B6X A;  4EYY R;  3LG7 A;  4PW8 A;  3AA7 B;  5FNV E;  4GIW A;  2ZM2 A;  3I9Y A;  4NUV A;  4UF0 B;  4ZHQ E;  5FXW A;  3RYH E;  3IEE A;  3K8P C;  1UCU A;  3C4W A;  4PJJ A;  3MXZ A;  5HXR A;  2A2F X;  3UUN A;  5IYZ E;  2WM9 A;  4PJL A;  1MND A;  3O4X E;  2YU1 A;  5JRE A;  3ZMT B;  3SS1 A;  5LJM A;  1ZEE A;  3ETU A;  4O4L E;  4HEA A;  1MMD A;  5LHI B;  3I9W A;  4ERR A;  3RYI E;  3N9M A;  5CA1 E;  1IJ6 A;  2B1E A;  2LSJ A;  2P9B A;  2CCQ A;  3C51 A;  3HR0 A;  3AA6 B;  2V7M A;  2LOP A;  4ANJ A;  4ISS A;  3ZN0 B;  5LP6 E;  3CVR A;  4KUM B;  2W00 A;  3ZCJ A;  4E7Z A;  2ODU A;  3DP7 A;  4XAX B;  5AFU L;  1HX8 A;  4P0A A;  3FXD B;  5JDL A;  4O4I E;  4UVA B;  2IC6 A;  4H9N C;  1B7T A;  4IGU A;  4CI1 B;  5BMV E;  2W61 A;  4ILU A;  1ZHC A;  4IE7 A;  1AJ3 A;  4IE5 A;  4L0R A;  3QK6 A;  3O1H A;  4BJM A;  4TV8 E;  2KIN B;  4H9Q C;  3C98 B;  4HTE A;  1D1C A;  2BDE A;  1Y64 B;  5FMN A;  2C5K T;  4GYS A;  3NBX X;  4PK4 A;  2BZB A;  5LNK A;  1MIV A;  3SWH A;  3DJB A;  4E7S A;  4L5G A;  3LK3 B;  4V1A v;  2X0L B;  2EHO D;  1SA0 E;  2H7V C;  2V7I A;  1E1H B;  4X1K E;  1WYB A;  3ZJ2 A;  3HKC E;  4C90 A;  3VKG A;  4N78 D;  2VK9 A;  4HFV A;  3UTK A;  3LFM A;  5HXC A;  2ACX A;  2K9A A;  5LOV E;  2D5U A;  2VKH A;  4ZI3 C;  3ANW A;  4AXP A;  1S35 A;  2XAF B;  3C64 A;  2EHO C;  3B13 A;  1YD8 G;  1YKE B;  3C4X A;  4X1Y E;  1IAP A;  2PJQ A;  2I59 A;  2LHR A;  4EB6 E;  2CM0 A;  3CX8 B;  3L3P A;  2Q9Q B;  2VWA A;  2WAU A;  5EK4 A;  5J1G A;  5JDN A;  3N9L A;  2QGS A;  4IHJ E;  4EIW A;  4DO0 A;  1V9D A;  5J2U E;  2JRK A;  4DND A;  1OWA A;  3PE0 A;  2X9X A;  4MAL A;  1MMG A;  5L3C B;  4QXH B;  2MBG A;  1HFA A;  2MOZ A;  3MKD A;  3Q5X A;  4BJN A;  2XAQ B;  3C50 A;  1HCI A;  5JDF A;  2LJL A;  2CWY A;  4EZH A;  4AKR B;  5LHG B;  4I43 B;  3N9N A;  4O2B E;  4UV8 B;  3GMI A;  4UXN B;  2NTY A;  1BR1 A;  4AKG A;  3PUG A;  2MYS A;  2DI4 A;  1MNE A;  4BA9 A;  2D0T A;  2A3D A;  3KVA A;  5JDH A;  3UUL A;  3EDV A;  3UFE A;  4H63 V;  3PUA A;  3UUX B;  5L3E B;  3KBT A;  3NZP A;  4AQF A;  2WMO A;  4ZOL E;  3RKO A;  3MK7 C;  1NAF A;  2DWG A;  3JC6 D;  3KBU A;  2L3L A;  2Q9Q D;  4U74 A;  2LOS A;  2C5J A;  3O1I A;  1YW0 A;  3VHL A;  2JQQ A;  5A1L A;  5LJN A;  5H6Q B;  2E9X B;  3NZQ A;  2DLR A;  4OFZ A;  5FXZ A;  3HI2 A;  1KNZ A;  2E9X A;  5H6R B;  3EVY A;  2E9X D;  1WYC A;  4BAY B;  2KLQ A;  3BQK A;  3FB2 A;  5EZY E;  5L3F B;  2NWB A;  2Y48 B;  4HKA A;  5LG4 A;  5M4Y A;  4PFP A;  4ZS3 A;  5FYM A;  2X68 A;  2WWU A;  3PUQ A;  2CXD A;  4H9O C;  4ADZ A;  3IF8 B;  3L09 A;  4I4T E;  2DHR A;  2JMK A;  2ZM8 A;  4QKN A;  3HKE E;  5F8P A;  4J2C A;  4IE6 A;  2N2N A;  5LGU B;  2Z6E A;  1BR2 A;  2LSY A;  4HE8 A;  4O8S A;  3BQI A;  2KWI B;  4YHJ A;  2QA7 A;  3ONX A;  4MLK A;  2X66 A;  3ZC0 A;  5ADX L;  3RRW A;  5HYA A;  3MA9 A;  1BR0 A;  4GK0 E;  2WSS V;  3KFW X;  5HWX A;  5DQW A;  5GON E;  1QUU A;  3E0Z A;  4HGA A;  5LBQ B;  2XTL A;  2HPJ A;  3PUR A;  2D0U A;  2KMF A;  1WR6 A;  2RP4 A;  4IST A;  2X9H A;  3N2O A;  4QXB B;  5FXV A;  1FMW A;  2XUE A;  4U72 A;  3ANW B;  4QX8 B;  2CEA A;  2WMN A;  4MHC A;  5JR9 C;  3P8C D;  2KXP B;  3FXE B;  4P09 A;  4H9R C;  5LCY A;  5JRC B;  5E0O A;  2Q9Q A;  3H3A A;  3LK2 B;  2CE7 A;  2UXN B;  3AA0 B;  1ZKE A;  4XZC A;  3D0T A;  2LEH A;  4PK6 A;  3ZYL A;  3IBP A;  4AKH A;  3AB3 B;  1U4Q A;  1UX5 A;  1VOM A;  4X20 E;  3PU3 A;  1WLX A;  1NWM X;  2LT3 A;  3RC8 A;  3CPZ A;  4MFR A;  3BK9 A;  3P7I A;  1Z0P A;  5FY1 A;  3ZLI A;  2CLY C;  3LK4 2;  3ZMV B;  1EZ3 A;  4H9S E;  2LHN A;  5LGT B;  3GN5 B;  1H7C A;  1HG5 A;  2SPC A;  4O2A E;  2HPL A;  4EOZ B;  3RYF E;  3OBV E;  4F6R C;  3VU7 H;  2PFV A;  5L3D B;  3CWZ B;  3NRX A;  4DMW A;  4UVB B;  3Q5W A;  5CA0 E;  1D1B A;  3ZCI A;  3K3Q C;  5LBM A;  2X67 A;  4UVC B;  5LGN B;  3V5U A;  5F3J A;  4OK0 A;  1YKH B;  2VAS A;  2LM9 A;  3E08 A;  2Y6X A;  2HH7 A;  3ZYM A;  3RRC A;  4JEU B;  5L3B B;  2C5I T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...