4JLEA

Structure of the p. falciparum pfi1780w phist domain
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
149
structure length
149
Chain Sequence
YTAEEINEMINSSNEFINRNDMNIIFSYVHESEREKFKKVEENIFKFIQSIVETYKIPDEYKMRKFKFAHFEMQGYALKQEKFLLEYAFLSLNGKLCERKKFKEVLEYVKREWIEFRKSMFDVWKEKLASEFREHGEMLNQKRKLKQHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHIST
publication title A Plasmodium falciparum PHIST protein binds the virulence factor PfEMP1 and comigrates to knobs on the host cell surface.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Protein binding
total genus 60
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09687 PRESAN Plasmodium RESA N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1760 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4jleA00
4JLEA
chains in the Genus database with same CATH superfamily
1XWMA 4I4TE 2LM2A 1FIOA 3MZKB 3LJCA 2FJEA 3ETVA 2VVSA 4GK0E 2WS3A 1SA0E 2W63A 3BQIA 2UU9T 5JR9A 5HCJA 1J5WA 2V6YA 3IEEA 4YSYA 3PUSA 3P8CD 1WCRA 2YDQA 4HFEA 5CA1E 4EXTA 4PJJA 2XM2A 4DR4T 4TWDA 5HWXA 4DV3T 2UXNB 4DR5T 3IBPA 2OLTA 2KSRA 3MXZA 2CPTA 4EOZB 4HWIB 1UCUA 1W9RA 4IE0A 5JREA 1T72A 2NP9A 1UGOA 2MBGA 2LSIA 2WAUA 4TV9E 5LGNB 4UV8B 2V5CA 3TLVA 2RPAA 5JR9B 4A97A 2W0GA 2Q9QD 1HCIA 2BVMA 3RYHE 2CLYB 5ADXL 1Y01A 5LG4A 4I0UA 4YY3T 3VKGA 3A5XA 4HWCA 2IMLA 3BK9A 3RF1A 2MTQA 1BR2A 4P0AA 3CK6A 4EYYR 2LE8A 4ERRA 3PUWF 2J1DG 3V5SA 1G8XA 3ANWA 2D0TA 3RC3A 3VR8A 2D5UA 3HKDE 5LHIB 3C64A 2VKHA 5ABGA 4MHCA 2CRBA 2XZEA 2K3WA 1YKHB 2QRXA 3BQLA 4COFA 3F31A 3CWZB 3U3IA 4B3ST 3C50A 4ASKA 3PUYF 2LSYA 4NIQA 2UXXB 3R84B 3AB3B 1UX5A 3UUNA 3WAKA 5LJNA 5AQRB 4DBRA 2WZHA 3ZSSA 4EEBA 3ANWB 3RIAA 2JQKA 2R6GF 3ZC0A 2A72A 2PG8A 5AQPB 3OPCA 4TWFA 3UFEA 5CJ5A 2C5KT 2X9YA 4YFSA 5F5WA 2NTXA 5JDLA 4ZZBA 2LOSA 4GYSA 5JDGA 3AA1B 1U4QA 3UU4A 4LFCT 2BS3A 2CBJA 2VKJA 2JQQA 2LRKA 5BMVE 4QH5A 2XAGB 5LA6E 4IL4A 5AQUB 3RKOA 2VB6A 5AQTB 4YXDA 3CIRA 5M4YA 2MPKA 2V1DB 4TX5A 4C90A 5KMGP 3FB2A 4V1Av 5TAOA 2ZM0A 4EB6E 2BVLA 3ABVA 4G2AA 1JNRA 4KHZF 1OEDC 4HWFA 4YTPA 4CI3B 5JDHA 2C5IT 4GOUA 5DABA 5J0ZA 3N2GE 3N2OA 4KBMB 2Z6EA 5AFUL 1HTJF 4HE8A 3CMLA 4X20E 3RRCA 2NR4A 4AIUA 2E9XA 3I0QA 3OKQA 2WMNA 3LDQB 3N9OA 3UQ4A 4DR7T 2X9HA 3EI0A 5ABHA 2DWGA 3VR9A 1E1HB 3OVUA 2OV9A 5EK3A 2GK9A 2YU1A 4JEUB 2HN2A 1MMDA 1BR4A 4JI0T 2VWAA 2KLQA 4UVCB 4TV8E 1OEDA 2V5DA 5HXRA 3AE5A 4PW8A 5FY0A 4LF5T 2CWOA 5FNVE 5L3FB 1IBKT 3T1YT 3EUHA 3EABA 2X0LB 2W2UA 2W61A 2JMHA 4Q25A 4H9OC 2YN6A 5LNKA 3H3AA 1HF8A 3M3ZB 4OHFA 3RGLA 1HX1B 1HR0T 5LHHB 1SE7A 3O1JA 3G06A 2KWIB 3JCFA 2XAFB 3AAEB 4HFIA 4EV6A 4PJMA 3UU5A 4XBFB 1OEDB 3KINB 2KINB 4AQYT 3J7Yq 4LF6T 3QOFA 2UUCT 2XSBA 5HEHA 3Q5EA 5AQOB 3NWIA 2WM9A 1MMNA 2JQ9A 3FZHB 1ZOYA 3I9WA 2HH7A 3RIFA 3ZMTB 1HNXT 3CQGB 2LJLA 3DJBA 4YLHA 3AEEA 3KFWX 4AKIA 3UU6A 4DMVA 2AXDS 2DHRA 2LHNA 3AE8A 3ZEFB 1AJ3A 3CKDA 2IDOB 5KDMC 3ZKRA 4IREA 3UU8A 2IC9A 4ADZA 3RX6A 1OXZA 4IT4A 3JAEA 5HEOA 1X79A 2IIUA 1UUSA 4HKAA 2QGSA 1B7TA 3PUQA 4KUMB 1ZKEA 4OYJA 2LRLA 4AKHA 4UXNB 4BJMA 4JI1T 3E0ZA 4U2YA 5HAXA 1G73A 1Y64B 5FXWA 2BBHA 2VK9A 4JV5T 3HI2A 5FMNA 3K3QC 1S94A 4XZCA 3AE1A 1BR0A 3ONJA 5L3CB 5IWAT 4QHOA 2IHR1 3PURA 5HEJA 2VURA 3P4RA 3TLWA 2XY8B 3HKEE 2CLYC 4B3TT 4LFBT 3K1SA 2I59A 1YD8G 3OYXA 5HXSA 3ZN1B 4ZS2A 2XSAA 4H9SE 4YHJA 3UT5E 3AEBA 1YW0A 3ZT6A 1ZV4X 3ZMVB 4N78D 1QLBA 2H7OA 3F57A 3ZYLA 1XNQT 4TNVA 4ZS3A 4U31A 4JYAT 3ESLA 1HNWT 3KBTA 5LOVE 5BR8T 5JRCA 2XQYA 3HKBE 4DR6T 3PE0A 4DVDA 5DQVA 3ZC1A 3OYZA 3P4SA 2XQ9A 1YXRA 3S4UA 1MMAA 2D9DA 3AA7B 2WDQA 1HX8A 2JRKA 1WFDA 3NZQA 5HXCA 3SFEA 3P4PA 4HTEA 2XM1A 4NUUA 1LVFA 3L3PA 4DV4T 4PAGA 5HXEA 5FL1A 2RP4A 4H9RC 5JDQA 5JDFA 3KBUA 4X1YE 3RI5A 4AQGA 1D1CA 1VCSA 2V6YB 1DU2A 1D1BA 3OJAA 2V7KA 4U33A 2P9BA 1HNZT 4ZXLA 4YHHT 4H63V 5EK2A 2A2FX 3N5LA 3AE7A 4DV5T 4AI6A 3Q5XA 2N9DA 2WBLA 4GKJT 3NRYA 4KI0F 4H9NC 5L47A 4DV7T 3AEGA 3GN5A 3QB5A 5L3DB 1N33T 1L0VA 2AE9A 2WCAA 2X9XA 3ETUA 2ZM8A 3SWHA 3MK7C 1MMGA 1O3XA 1XNRT 3RYCE 4CZZB 2B1EA 2QA7A 3T1HT 2XTLA 2X66A 3N9MA 4OK0A 2VQFT 4HFVA 3B5MA 2DWKA 5C3JA 3W15B 2XQ8A 3AEDA 3Q5DA 2JJ9A 1WYCA 2CXLA 3FZKB 1YQ4A 2FBWA 2JMKA 4FI5A 4EZ4A 5EK4A 4IE5A 2C0SA 2M67A 2WP9A 2BG9E 4HEAA 3NKZA 4DO0A 2VL8A 5FXVA 5F8PA 5KXJA 3O1HA 5J2TE 2LM9A 4O4IE 4X66T 5C2TA 2Y48B 1UK5A 2K48A 2I0MA 2XAQB 1KFYA 2VKOA 4UVAB 4DUZT 2WY2A 4KHPT 1IBLT 2KZ7B 3B57A 4UVBB 3L39A 2NW8A 1YQ3A 2XQ4A 2XQ3A 5L4HA 4XAXB 5IHYA 2JQHA 4PK6A 3SOLA 4WW0A 3ZMUB 4LF4T 5DQWA 2NW7A 2UUAT 3EHZA 2E9XC 3TLSA 3N9NA 4MALA 3IHRA 1XMOT 3BQKA 3HR0A 3B13A 4B3MT 3LK3B 5JDNA 3EAMA 4UF0A 3RIUA 4U2ZA 1M62A 1QUUA 1D0XA 5GONE 5JH7E 1D1AA 1WR0A 5H6QB 2CE7A 3PUVF 4X64T 1W0BA 2ACZA 3NVOA 1CUNA 2FJDA 4B6XA 1VRBA 4IHJE 4JI5T 2EHOC 4UV9B 4IDZA 3KVAA 2M6BA 3KDSE 3ONXA 5AQMB 3KV4A 4ANJA 4HWHA 2XQ7A 2E8IA 3AA6B 1US7B 1HS7A 3U78A 3TLTA 2IC6A 2BKOA 2BBJA 3LFMA 4QH1A 2IW5B 3FZLB 3MA9A 4FJOA 5ETWA 4I55E 2K24A 3NZPA 1E7PA 3C4ZA 1MIWA 2ACXA 3VKHA 4J2CA 3UU3A 3ZJ1A 3O1IA 4X62T 2V7IA 2X67A 4BA9A 2L9QA 4PFOA 5LP6E 3AXJA 3ZPOA 4JEHB 4ILBA 3PUXF 2EHOA 2VASA 2J4GA 3QUJA 2H7VC 4AISA 4O2BE 5HWYA 3ZMZB 1MNDA 4P1NA 2MOZA 4LF8T 5DJQC 4ISTA 1HG5A 2MAWA 5FY1A 4IDNA 2XQAA 2X0HA 3I0OA 3AECA 2E9XB 4JLEA 2NWBA 2XHEB 5L3GB 2IUBA 2L8KA 1ZEEA 2SPCA 1XZYA 2E9XD 1UURA 4L0RA 1IZNB 2V7LA 3E08A 5C8YE 4CN4A 3AE9A 3AXJB 4KP3C 2LEHA 2YEVC 2UXBT 3AEAA 2CM0A 3CVRA 3QB5K 2XAJB 4CN1A 2EHOB 4DNDA 4MFRA 1KEYA 1UX4A 4IE6A 4ZI2C 4TZ4C 2QVAA 4UELA 2HHHT 5JVDE 2BZBA 4K0KT 4PFPA 4ZHQE 4JUYA 5LMUT 1FMWA 2KNDA 4PK5A 4GK5E 5CB4E 1FEWA 2J47A 4YSXA 4X65T 2DI4A 3JADA 2H88A 4G63A 4LF9T 4EIWA 2JPFA 2XJ7A 1SUMB 3GWHA 4O2AE 4F8HA 4IGUA 3RQUA 3P50A 1GQEA 4IDPA 1N34T 2ZMAA 2WU5A 4ISSA 1W0AA 5ABFA 3E22E 5JTGA 4CXYA 5L2LA 4KX6A 3FXDB 1J5ET 5AQFB 4A56A 4HFBA 3JAFA 1NWMX 3L8RA 1D0ZA 1N36T 3CX7B 2W62A 4Z90A 4WYVA 3SS1A 2WDVA 4QH4A 3ZN0B 4H9PC 5J2UE 2Y8DA 3V5UA 3K3NA 5AQGB 2XAHB 3UQ7A 5AQQB 1XDOA 3AAAB 4JI3T 3FZFB 4DR1T 4P0BA 2CHNA 3RH3A 4CQIA 3FZMB 4EAHA 5FY7A 4BJNA 5ABFB 2XUEA 4AKGA 2D0UA 2ODVA 5LB7B 3KV6A 3TKLB 2B76A 3P4QA 5HEGA 4C91A 2Q9QC 4QKNA 3WAJA 5FVKA 4ZI2D 2MYSA 2IAKA 5FYMA 2VQET 4DV6T 1WRDA 2VL0A 2LKGA 4JI2T 5F3JA 1IJ6A 2L3LA 2W00A 2WMOA 3GMIA 4Z8XA 4EGWA 3MKDA 1E2AA 2WQYA 3DP7A 4AKRB 1XMQT 2LSGA 2PTFA 3H3MA 3OBVE 2CBIA 3IF8B 5AQVB 4YT0A 3QNUA 4H9QC 4IIJE 2M6IA 1X9BA 1NAFA 2CXDA 2NTYA 3AE3A 3MJXA 2V6XA 5AQJB 5L3EB 2Q9QA 2CMRA 4HWDA 2Y6XA 3RQWA 3PUAA 3SRZA 2WWVA 5LHGB 4MLKA 2K9AA 3P4WA 4DV1T 4GYRA 4CN6A 2YOEA 3AE4A 4EZHA 5LMNT 3I1AA 1VOMA 1ZP0A 1MIVA 2J62A 4LMKA 2E5LT 2VKDA 3NRXA 3F2EA 1KF6A 1KNZA 5E0OA 3RYFE 2FJBA 4JI4T 1KNRA 5FVLA 4PJLA 1W09A 2X51A 4ZEYA 5JRCB 3ZT5A 3K3OA 2V8SV 1OEDE 1T98A 4WZXA 2Q9QB 3CPZA 3KVBA 5FXZA 4TN7B 2KT9A 4F6RC 4CXWA 3Q2MA 4H63H 3PV0F 3UULA 2NW9A 3LSVA 2CCQA 1NENA 4O4JE 3ZYKA 3RHWA 2WWUA 3C4XA 1U5PA 2V26A 2XASB 2F4VT 2PFVA 4CI1B 2A9UA 4ILUA 5IUXA 3JC6C 2K5BB 2DLRA 4L9IA 5AQNB 2KMFA 3ZYMA 4DR2T 3FXEB 3UUMA 3FBZA 3QC9A 2N1GA 3QK6A 4IE7A 1S35A 3ZCJA 1V9DA 2FJAA 4TWHA 4NXNT 1NEKA 4IE4A 1T8BA 3RRWA 2BS4A 3A7MA 5AQLB 5FP3A 2X68A 4E7SA 2VVNA 4K0UA 2V7JA 1YKEB 3N9LA 5HEUA 3KV9A 4A98A 2BKPA 3RIUC 3GN5B 5JQGE 4OFZA 5CFBA 2W4XA 4E7ZA 2LSKA 1J1JA 4LMJA 3J9X1 2BDEA 1FJGT 3L09A 4TUYE 3SFDA 4QX7B 4JI7T 4NPPA 4X5TA 3RLFF 2YK0A 4OX9T 2ES0A 2I6HA 1Z8UA 2YU2A 3D0TA 4JI6T 1H7CA 4BAYB 5AQKB 3R6NA 1HG2A 3EVYA 2QYWA 3IA3A 3T8OA 2CHOA 4QWNB 4HFDA 3ZCIA 4B3RT 2CEAA 3I9YA 2CXFA 4NUVA 4HFCA 5LXTE 5LCYA 3LBXA 3C4WA 4JI8T 1WLXA 3H37A 2NOXA 4LFAT 4X1KE 2H3RA 5L4EA 3MACA 3CQXC 2ZM2A 2G0UA 4U7YA 3UUXB 4A5XA 3A8YC 4UR9A 3FBLA 2WZIA 4ZI7E 2LKHA 2PBIA 3JC6D 2LT3A 4P09A 1R8IA 2BS2A 3CQCB 2W67A 2W66A 4IDQA 3C51A 3PUZF 4M1PA 2ZM6T 4JBWF 4DV0T 3N2KE 2D2SA 2H89A 4I50E 2UXCT 2WU2A 2KWHA 3LBXB 2YDRA 4UF0B 1MNEA 1IJ5A 1BR1A 5AQSB 2LLYA 4DV2T 3AE6A 3ZMSB 5FXXA 1LVKA 3HL6A 4PK4A 4O8SA 4HFHA 3LG7A 4KMCA 5LYJE 3PU8A 2ODUA 5L3BB 2ZLYA 4ZI3C 3AAIA 5KX5E 4QXHB 2DNXA 3X1DA 1SHZC 1KNPA 4AKLA 5LGTB 2DL1A 4I43B 2YINA 5LGUB 3C98B 1I6ZA 4IDOA 2UXDT 3CX8B 4AQFC 4Z91A 1LKXA 4WBOA 2LHRA 2E5VA 5IYZE 1OWAA 4GKKT 2V7MA 2E2AA 3DTOA 4AXPA 3NBXX 3OTOT 3LK42 5HCMA 2LSJA 3EDVA 2CWYA 2BG9C 3P7IA 4PJNA 5FL0A 3GA8A 5H6RB 4YJ2E 4WNKA 3PU3A 3AVRA 4U72A 5JDMA 3WI3A 2PJQA 4U74A 4NXMT 5CGMA 5HYAA 3PDYA 3RC8A 4YTMA 4ILAA 3ZT7A 4DIDB 3UTKA 2EHOD 3Q9DA 2C5JA 3VU7H 2N2NA 2WDRA 5AQIB 1T7SA 3KV5A 3PUGA 5HXHA 3EDUA 4AQFA 5ABEA 2YKSA 1WR6A 4OYKA 3AE2A 5AQHB 2YDSA 4DMWA 3RYIE 3ONLC 1VCTA 1N32T 4ZZCA 3PJAA 2OA5A 2XPKA 2BG9A 4L5GA 5EZYE 1LRZA 2DCFA 3M65A 4YTNA 3RKGA 4WBNE 4QXCB 5LBQB 2X9WA 4UEMA 3VHLA 2RA1A 5A1LA 1FMVA 4YSZA 4UIGA 4QX8B 2HPLA 2BKNA 3ZSTA 1KK7A 3AEFA 1CHUA 4O4LE 2X0YA 4ZI3D 4ILCA 1M7KA 2JIWA 1HFAA 3UUBA 1MIYA 2FUPA 4O4HE 3FHNA 5LJMA 3TLUA 3N9QA 5LG3A 4CXXA 4LF7T 1Z0PA 4EEDA 4X1IE 2XQ6A 4MBQA 5CA0E 4DBQA 4TNWA 1EZ3A 2HN1A 5J1GA 4DUYT 2BG9B 4GIWA 4U3CA 3ZLIA 4EYUA 1WYBA 3Q5WA 2WB5A 2UUBT 2CA5A 4CI2B 1QSDA 4HN9A 4U7IA 4PNIA 4ZOLE 3HA4A 1XDPA 3O9XA 3AA0B 1IBMT 3CX6B 3O4XE 5JR9C 1IAPA 2XQ5A 4YJ3E 5LBMA 3K8PC 4HGAA 3PJAJ 5FKYA 2LOPA 3HKCE 3VRBA 4DR3T 2A3DA 3N9PA 2KXPB 3RPUA 1D0YA 3UFGA 3LK2B 1JNZA 3PTRB 4IL9A 2HPJA 1I94T 4LMLA 1ZHCA 4QXBB 3VRAA 2WSSV 3AVSA 3ZJ2A
chains in the Genus database with same CATH topology
1HS7A 3KFWX 4IE4A 3U78A 4AKIA 3RRWA 4I4TE 1FIOA 2IC6A 3MZKB 5FP3A 4DMVA 2X68A 4E7SA 2DHRA 3LJCA 3ETVA 3LFMA 4K0UA 4GK0E 2V7JA 2LHNA 1SA0E 2IW5B 2W63A 3MA9A 4FJOA 5ETWA 3BQIA 4I55E 1YKEB 2K24A 3NZPA 3ZEFB 1AJ3A 3N9LA 3C4ZA 3CKDA 3KV9A 5JR9A 1MIWA 2ACXA 3VKHA 5KDMC 4J2CA 3ZJ1A 3IEEA 3O1IA 3GN5B 3PUSA 2V7IA 3P8CD 2X67A 5JQGE 4OFZA 4BA9A 2IC9A 2L9QA 4ADZA 4E7ZA 4PFOA 5CA1E 5LP6E 3ZPOA 2LSKA 3RX6A 4EXTA 4JEHB 4PJJA 1OXZA 3J9X1 2BDEA 2EHOA 2VASA 3L09A 3QUJA 4TUYE 5HWXA 4QX7B 2UXNB 1X79A 2H7VC 4O2BE 5HWYA 3ZMZB 2YK0A 3IBPA 2ES0A 4HKAA 1MNDA 2MOZA 2QGSA 2YU2A 3D0TA 1B7TA 5DJQC 4ISTA 1HG5A 3PUQA 5FY1A 4KUMB 1H7CA 1ZKEA 4BAYB 3I0OA 3MXZA 3R6NA 1HG2A 3EVYA 4OYJA 2E9XB 4AKHA 4UXNB 4EOZB 4JLEA 2NWBA 4BJMA 1UCUA 3T8OA 4IE0A 4QWNB 5JREA 2XHEB 3E0ZA 5L3GB 5HAXA 3ZCIA 1G73A 1Y64B 5FXWA 2NP9A 2CEAA 2MBGA 2L8KA 2LSIA 2WAUA 4TV9E 4UV8B 5LGNB 3I9YA 1ZEEA 2VK9A 2SPCA 2E9XD 2CXFA 4NUVA 5JR9B 5LXTE 3HI2A 4L0RA 5LCYA 2W0GA 3LBXA 5FMNA 3C4WA 1IZNB 2V7LA 1WLXA 2Q9QD 3E08A 3H37A 1HCIA 2BVMA 3K3QC 3RYHE 2CLYB 2NOXA 1S94A 4XZCA 5C8YE 4X1KE 5ADXL 1BR0A 2H3RA 4KP3C 2LEHA 3MACA 3CQXC 2ZM2A 2YEVC 5L3CB 2G0UA 2CM0A 3CVRA 3UUXB 2XAJB 4QHOA 5LG4A 3PURA 2EHOB 3VKGA 4DNDA 3A5XA 2CLYC 3FBLA 3HKEE 4MFRA 4ZI7E 2PBIA 3BK9A 3JC6D 1UX4A 2I59A 1YD8G 4IE6A 2MTQA 4ZI2C 1BR2A 4TZ4C 3OYXA 5HXSA 3ZN1B 4ZS2A 4P0AA 4EYYR 4UELA 2LE8A 2LT3A 4ERRA 4P09A 5JVDE 4H9SE 2J1DG 4YHJA 3CQCB 3V5SA 2BZBA 3UT5E 1G8XA 1YW0A 1ZV4X 3C51A 4M1PA 3ANWA 4PFPA 4JUYA 4ZHQE 2D0TA 3RC3A 3ZMVB 1FMWA 2KNDA 3N2KE 4N78D 2D2SA 4PK5A 2H7OA 2D5UA 3HKDE 5LHIB 3C64A 4I50E 4GK5E 5CB4E 1FEWA 3F57A 2KWHA 2VKHA 3ZYLA 2DI4A 3LBXB 4MHCA 4G63A 4ZS3A 2JPFA 4UF0B 4EIWA 3GWHA 1MNEA 4O2AE 3ESLA 1IJ5A 1BR1A 4IGUA 3KBTA 5LOVE 1YKHB 5JRCA 2XQYA 3ZMSB 3HKBE 3BQLA 3F31A 2ZMAA 4ISSA 3PE0A 4DVDA 5FXXA 5DQVA 3CWZB 3OYZA 3U3IA 3ZC1A 3C50A 1LVKA 4ASKA 3HL6A 3E22E 4PK4A 4CXYA 3S4UA 5L2LA 1MMAA 4O8SA 2LSYA 3FXDB 3AA7B 2UXXB 3LG7A 4KMCA 5LYJE 3R84B 4A56A 3PU8A 1HX8A 2JRKA 1UX5A 3AB3B 1NWMX 3UUNA 3NZQA 5HXCA 3WAKA 2ODUA 5L3BB 5LJNA 4HTEA 4DBRA 2ZLYA 4ZI3C 1D0ZA 3AAIA 3CX7B 3ANWB 5KX5E 2W62A 4QXHB 3SS1A 2DNXA 3ZC0A 1SHZC 2A72A 2PG8A 4NUUA 4AKLA 3UFEA 5LGTB 4I43B 3ZN0B 4H9PC 1LVFA 2YINA 2C5KT 5LGUB 3C98B 5J2UE 2X9YA 2Y8DA 3CX8B 3L3PA 3V5UA 4PAGA 4YFSA 5HXEA 4AQFC 2NTXA 3K3NA 1LKXA 2RP4A 4H9RC 2XAHB 4WBOA 5JDLA 2LHRA 5JDQA 5IYZE 1OWAA 2LOSA 5JDFA 4GYSA 5JDGA 3AAAB 2V7MA 3KBUA 4P0BA 3DTOA 4AXPA 4X1YE 3NBXX 3RH3A 4AQGA 4CQIA 3AA1B 4EAHA 1D1CA 1U4QA 5FY7A 3LK42 4BJNA 2LSJA 2XUEA 1D1BA 3OJAA 3EDVA 2V7KA 2CWYA 2P9BA 3P7IA 4AKGA 2D0UA 2ODVA 4PJNA 2VKJA 2JQQA 3KV6A 3TKLB 5BMVE 3GA8A 5H6RB 4H63V 4YJ2E 4WNKA 3PU3A 2XAGB 4C91A 2Q9QC 4QKNA 5LA6E 3AVRA 5EK2A 2A2FX 3N5LA 4U72A 5JDMA 3WI3A 2PJQA 4U74A 3RKOA 5HYAA 3WAJA 4AI6A 2VB6A 3PDYA 3Q5XA 2N9DA 2WBLA 3RC8A 3NRYA 5M4YA 4ZI2D 2MYSA 2IAKA 2V1DB 4TX5A 4H9NC 4C90A 5FYMA 5KMGP 3UTKA 2EHOD 3FB2A 4V1Av 3Q9DA 2C5JA 5TAOA 1WRDA 3VU7H 2N2NA 3GN5A 5L3DB 2ZM0A 5F3JA 3KV5A 4EB6E 3PUGA 5HXHA 2BVLA 3EDUA 4AQFA 1IJ6A 2L3LA 2W00A 2WMOA 4G2AA 3GMIA 4Z8XA 1WR6A 4OYKA 3MKDA 2X9XA 4CI3B 3DP7A 3ETUA 3RYIE 4AKRB 4DMWA 5JDHA 2ZM8A 3SWHA 3MK7C 1MMGA 2LSGA 1O3XA 2C5IT 3OBVE 4GOUA 3RYCE 4CZZB 2B1EA 2QA7A 5DABA 3N2GE 3N2OA 2XTLA 2OA5A 2X66A 3IF8B 3N9MA 4KBMB 2Z6EA 4H9QC 4L5GA 5AFUL 1HTJF 4HE8A 3CMLA 4IIJE 4OK0A 4X20E 5EZYE 1NAFA 2CXDA 4HFVA 2DWKA 3RRCA 1LRZA 3W15B 2NTYA 2E9XA 2DCFA 3I0QA 3M65A 3MJXA 3OKQA 4WBNE 2JJ9A 4QXCB 2WMNA 1WYCA 2CXLA 5LBQB 5L3EB 2Q9QA 2X9WA 3N9OA 2CMRA 2JMKA 4FI5A 2Y6XA 4UEMA 4EZ4A 3VHLA 2RA1A 5EK4A 5A1LA 4IE5A 1FMVA 3PUAA 2C0SA 3SRZA 2M67A 5LHGB 4MLKA 4UIGA 4QX8B 2HPLA 2K9AA 2X9HA 4HEAA 4DO0A 2VL8A 1KK7A 4GYRA 2DWGA 1E1HB 5FXVA 4EZHA 4O4LE 5EK3A 2GK9A 2YU1A 4ZI3D 4JEUB 5F8PA 3I1AA 1MMDA 1HFAA 1BR4A 3O1HA 5J2TE 2LM9A 4O4IE 1MIYA 2Y48B 4O4HE 2VWAA 3FHNA 2K48A 5LJMA 2KLQA 2XAQB 1VOMA 4UVCB 4TV8E 1MIVA 3N9QA 4CXXA 2VKOA 4UVAB 2VKDA 3NRXA 3F2EA 5HXRA 4PW8A 5FY0A 2CWOA 5FNVE 5L3FB 1KNZA 1Z0PA 5E0OA 3RYFE 4X1IE 4MBQA 5CA0E 4DBQA 1EZ3A 5J1GA 3EUHA 4GIWA 2KZ7B 3B57A 4PJLA 4UVBB 2X51A 5JRCB 3ZLIA 2X0LB 4EYUA 2NW8A 3K3OA 4XAXB 5IHYA 1WYBA 3Q5WA 2W61A 4PK6A 1T98A 2JMHA 3SOLA 2Q9QB 3CPZA 4WW0A 4H9OC 3KVBA 3ZMUB 5FXZA 5DQWA 2NW7A 3H3AA 4TN7B 1HF8A 2CA5A 2KT9A 4CI2B 4CXWA 4F6RC 5LNKA 1QSDA 4OHFA 2E9XC 3Q2MA 3N9NA 4MALA 3IHRA 3BQKA 3HR0A 4H63H 4HN9A 3B13A 5LHHB 3LK3B 3UULA 3O1JA 5JDNA 4PNIA 2KWIB 4ZOLE 3HA4A 4UF0A 2NW9A 2XAFB 2CCQA 3O9XA 3AAEB 3AA0B 1QUUA 4O4JE 1D0XA 3CX6B 4PJMA 3ZYKA 3O4XE 5GONE 2WWUA 5JH7E 3C4XA 5JR9C 1D1AA 1U5PA 1IAPA 2V26A 2XASB 4XBFB 5H6QB 2CE7A 2PFVA 2KINB 3KINB 4CI1B 4YJ3E 5LBMA 3J7Yq 3K8PC 4HGAA 4ILUA 3JC6C 2K5BB 2DLRA 4L9IA 2KMFA 1US7B 1CUNA 3ZYMA 2LOPA 4B6XA 2WM9A 3HKCE 1VRBA 1MMNA 4IHJE 3I9WA 2EHOC 2A3DA 3N9PA 2KXPB 3RPUA 3FXEB 4UV9B 3UUMA 3FBZA 1D0YA 2HH7A 4IDZA 3KVAA 3QC9A 3ZMTB 3LK2B 2N1GA 3KDSE 3CQGB 3QK6A 3ONXA 3PTRB 2HPJA 4IE7A 1S35A 3ZCJA 1ZHCA 4QXBB 1V9DA 2LJLA 3KV4A 4ANJA 2WSSV 3DJBA 3AVSA 3ZJ2A 2E8IA 4YLHA 3AA6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLE A; 
#chains in the Genus database with same CATH topology
 1XWM A;  4I4T E;  2LM2 A;  1FIO A;  3MZK B;  3LJC A;  2FJE A;  3ETV A;  2VVS A;  4GK0 E;  2WS3 A;  1SA0 E;  2W63 A;  3BQI A;  2UU9 T;  5JR9 A;  5HCJ A;  1J5W A;  2V6Y A;  3IEE A;  4YSY A;  3PUS A;  3P8C D;  1WCR A;  2YDQ A;  4HFE A;  5CA1 E;  4EXT A;  4PJJ A;  2XM2 A;  4DR4 T;  4TWD A;  5HWX A;  4DV3 T;  2UXN B;  4DR5 T;  3IBP A;  2OLT A;  2KSR A;  3MXZ A;  2CPT A;  4EOZ B;  4HWI B;  1UCU A;  1W9R A;  4IE0 A;  5JRE A;  1T72 A;  2NP9 A;  1UGO A;  2MBG A;  2LSI A;  2WAU A;  4TV9 E;  5LGN B;  4UV8 B;  2V5C A;  3TLV A;  2RPA A;  5JR9 B;  4A97 A;  2W0G A;  2Q9Q D;  1HCI A;  2BVM A;  3RYH E;  2CLY B;  5ADX L;  1Y01 A;  5LG4 A;  4I0U A;  4YY3 T;  3VKG A;  3A5X A;  4HWC A;  2IML A;  3BK9 A;  3RF1 A;  2MTQ A;  1BR2 A;  4P0A A;  3CK6 A;  4EYY R;  2LE8 A;  4ERR A;  3PUW F;  2J1D G;  3V5S A;  1G8X A;  3ANW A;  2D0T A;  3RC3 A;  3VR8 A;  2D5U A;  3HKD E;  5LHI B;  3C64 A;  2VKH A;  5ABG A;  4MHC A;  2CRB A;  2XZE A;  2K3W A;  1YKH B;  2QRX A;  3BQL A;  4COF A;  3F31 A;  3CWZ B;  3U3I A;  4B3S T;  3C50 A;  4ASK A;  3PUY F;  2LSY A;  4NIQ A;  2UXX B;  3R84 B;  3AB3 B;  1UX5 A;  3UUN A;  3WAK A;  5LJN A;  5AQR B;  4DBR A;  2WZH A;  3ZSS A;  4EEB A;  3ANW B;  3RIA A;  2JQK A;  2R6G F;  3ZC0 A;  2A72 A;  2PG8 A;  5AQP B;  3OPC A;  4TWF A;  3UFE A;  5CJ5 A;  2C5K T;  2X9Y A;  4YFS A;  5F5W A;  2NTX A;  5JDL A;  4ZZB A;  2LOS A;  4GYS A;  5JDG A;  3AA1 B;  1U4Q A;  3UU4 A;  4LFC T;  2BS3 A;  2CBJ A;  2VKJ A;  2JQQ A;  2LRK A;  5BMV E;  4QH5 A;  2XAG B;  5LA6 E;  4IL4 A;  5AQU B;  3RKO A;  2VB6 A;  5AQT B;  4YXD A;  3CIR A;  5M4Y A;  2MPK A;  2V1D B;  4TX5 A;  4C90 A;  5KMG P;  3FB2 A;  4V1A v;  5TAO A;  2ZM0 A;  4EB6 E;  2BVL A;  3ABV A;  4G2A A;  1JNR A;  4KHZ F;  1OED C;  4HWF A;  4YTP A;  4CI3 B;  5JDH A;  2C5I T;  4GOU A;  5DAB A;  5J0Z A;  3N2G E;  3N2O A;  4KBM B;  2Z6E A;  5AFU L;  1HTJ F;  4HE8 A;  3CML A;  4X20 E;  3RRC A;  2NR4 A;  4AIU A;  2E9X A;  3I0Q A;  3OKQ A;  2WMN A;  3LDQ B;  3N9O A;  3UQ4 A;  4DR7 T;  2X9H A;  3EI0 A;  5ABH A;  2DWG A;  3VR9 A;  1E1H B;  3OVU A;  2OV9 A;  5EK3 A;  2GK9 A;  2YU1 A;  4JEU B;  2HN2 A;  1MMD A;  1BR4 A;  4JI0 T;  2VWA A;  2KLQ A;  4UVC B;  4TV8 E;  1OED A;  2V5D A;  5HXR A;  3AE5 A;  4PW8 A;  5FY0 A;  4LF5 T;  2CWO A;  5FNV E;  5L3F B;  1IBK T;  3T1Y T;  3EUH A;  3EAB A;  2X0L B;  2W2U A;  2W61 A;  2JMH A;  4Q25 A;  4H9O C;  2YN6 A;  5LNK A;  3H3A A;  1HF8 A;  3M3Z B;  4OHF A;  3RGL A;  1HX1 B;  1HR0 T;  5LHH B;  1SE7 A;  3O1J A;  3G06 A;  2KWI B;  3JCF A;  2XAF B;  3AAE B;  4HFI A;  4EV6 A;  4PJM A;  3UU5 A;  4XBF B;  1OED B;  3KIN B;  2KIN B;  4AQY T;  3J7Y q;  4LF6 T;  3QOF A;  2UUC T;  2XSB A;  5HEH A;  3Q5E A;  5AQO B;  3NWI A;  2WM9 A;  1MMN A;  2JQ9 A;  3FZH B;  1ZOY A;  3I9W A;  2HH7 A;  3RIF A;  3ZMT B;  1HNX T;  3CQG B;  2LJL A;  3DJB A;  4YLH A;  3AEE A;  3KFW X;  4AKI A;  3UU6 A;  4DMV A;  2AXD S;  2DHR A;  2LHN A;  3AE8 A;  3ZEF B;  1AJ3 A;  3CKD A;  2IDO B;  5KDM C;  3ZKR A;  4IRE A;  3UU8 A;  2IC9 A;  4ADZ A;  3RX6 A;  1OXZ A;  4IT4 A;  3JAE A;  5HEO A;  1X79 A;  2IIU A;  1UUS A;  4HKA A;  2QGS A;  1B7T A;  3PUQ A;  4KUM B;  1ZKE A;  4OYJ A;  2LRL A;  4AKH A;  4UXN B;  4BJM A;  4JI1 T;  3E0Z A;  4U2Y A;  5HAX A;  1G73 A;  1Y64 B;  5FXW A;  2BBH A;  2VK9 A;  4JV5 T;  3HI2 A;  5FMN A;  3K3Q C;  1S94 A;  4XZC A;  3AE1 A;  1BR0 A;  3ONJ A;  5L3C B;  5IWA T;  4QHO A;  2IHR 1;  3PUR A;  5HEJ A;  2VUR A;  3P4R A;  3TLW A;  2XY8 B;  3HKE E;  2CLY C;  4B3T T;  4LFB T;  3K1S A;  2I59 A;  1YD8 G;  3OYX A;  5HXS A;  3ZN1 B;  4ZS2 A;  2XSA A;  4H9S E;  4YHJ A;  3UT5 E;  3AEB A;  1YW0 A;  3ZT6 A;  1ZV4 X;  3ZMV B;  4N78 D;  1QLB A;  2H7O A;  3F57 A;  3ZYL A;  1XNQ T;  4TNV A;  4ZS3 A;  4U31 A;  4JYA T;  3ESL A;  1HNW T;  3KBT A;  5LOV E;  5BR8 T;  5JRC A;  2XQY A;  3HKB E;  4DR6 T;  3PE0 A;  4DVD A;  5DQV A;  3ZC1 A;  3OYZ A;  3P4S A;  2XQ9 A;  1YXR A;  3S4U A;  1MMA A;  2D9D A;  3AA7 B;  2WDQ A;  1HX8 A;  2JRK A;  1WFD A;  3NZQ A;  5HXC A;  3SFE A;  3P4P A;  4HTE A;  2XM1 A;  4NUU A;  1LVF A;  3L3P A;  4DV4 T;  4PAG A;  5HXE A;  5FL1 A;  2RP4 A;  4H9R C;  5JDQ A;  5JDF A;  3KBU A;  4X1Y E;  3RI5 A;  4AQG A;  1D1C A;  1VCS A;  2V6Y B;  1DU2 A;  1D1B A;  3OJA A;  2V7K A;  4U33 A;  2P9B A;  1HNZ T;  4ZXL A;  4YHH T;  4H63 V;  5EK2 A;  2A2F X;  3N5L A;  3AE7 A;  4DV5 T;  4AI6 A;  3Q5X A;  2N9D A;  2WBL A;  4GKJ T;  3NRY A;  4KI0 F;  4H9N C;  5L47 A;  4DV7 T;  3AEG A;  3GN5 A;  3QB5 A;  5L3D B;  1N33 T;  1L0V A;  2AE9 A;  2WCA A;  2X9X A;  3ETU A;  2ZM8 A;  3SWH A;  3MK7 C;  1MMG A;  1O3X A;  1XNR T;  3RYC E;  4CZZ B;  2B1E A;  2QA7 A;  3T1H T;  2XTL A;  2X66 A;  3N9M A;  4OK0 A;  2VQF T;  4HFV A;  3B5M A;  2DWK A;  5C3J A;  3W15 B;  2XQ8 A;  3AED A;  3Q5D A;  2JJ9 A;  1WYC A;  2CXL A;  3FZK B;  1YQ4 A;  2FBW A;  2JMK A;  4FI5 A;  4EZ4 A;  5EK4 A;  4IE5 A;  2C0S A;  2M67 A;  2WP9 A;  2BG9 E;  4HEA A;  3NKZ A;  4DO0 A;  2VL8 A;  5FXV A;  5F8P A;  5KXJ A;  3O1H A;  5J2T E;  2LM9 A;  4O4I E;  4X66 T;  5C2T A;  2Y48 B;  1UK5 A;  2K48 A;  2I0M A;  2XAQ B;  1KFY A;  2VKO A;  4UVA B;  4DUZ T;  2WY2 A;  4KHP T;  1IBL T;  2KZ7 B;  3B57 A;  4UVB B;  3L39 A;  2NW8 A;  1YQ3 A;  2XQ4 A;  2XQ3 A;  5L4H A;  4XAX B;  5IHY A;  2JQH A;  4PK6 A;  3SOL A;  4WW0 A;  3ZMU B;  4LF4 T;  5DQW A;  2NW7 A;  2UUA T;  3EHZ A;  2E9X C;  3TLS A;  3N9N A;  4MAL A;  3IHR A;  1XMO T;  3BQK A;  3HR0 A;  3B13 A;  4B3M T;  3LK3 B;  5JDN A;  3EAM A;  4UF0 A;  3RIU A;  4U2Z A;  1M62 A;  1QUU A;  1D0X A;  5GON E;  5JH7 E;  1D1A A;  1WR0 A;  5H6Q B;  2CE7 A;  3PUV F;  4X64 T;  1W0B A;  2ACZ A;  3NVO A;  1CUN A;  2FJD A;  4B6X A;  1VRB A;  4IHJ E;  4JI5 T;  2EHO C;  4UV9 B;  4IDZ A;  3KVA A;  2M6B A;  3KDS E;  3ONX A;  5AQM B;  3KV4 A;  4ANJ A;  4HWH A;  2XQ7 A;  2E8I A;  3AA6 B;  1US7 B;  1HS7 A;  3U78 A;  3TLT A;  2IC6 A;  2BKO A;  2BBJ A;  3LFM A;  4QH1 A;  2IW5 B;  3FZL B;  3MA9 A;  4FJO A;  5ETW A;  4I55 E;  2K24 A;  3NZP A;  1E7P A;  3C4Z A;  1MIW A;  2ACX A;  3VKH A;  4J2C A;  3UU3 A;  3ZJ1 A;  3O1I A;  4X62 T;  2V7I A;  2X67 A;  4BA9 A;  2L9Q A;  4PFO A;  5LP6 E;  3AXJ A;  3ZPO A;  4JEH B;  4ILB A;  3PUX F;  2EHO A;  2VAS A;  2J4G A;  3QUJ A;  2H7V C;  4AIS A;  4O2B E;  5HWY A;  3ZMZ B;  1MND A;  4P1N A;  2MOZ A;  4LF8 T;  5DJQ C;  4IST A;  1HG5 A;  2MAW A;  5FY1 A;  4IDN A;  2XQA A;  2X0H A;  3I0O A;  3AEC A;  2E9X B;  4JLE A;  2NWB A;  2XHE B;  5L3G B;  2IUB A;  2L8K A;  1ZEE A;  2SPC A;  1XZY A;  2E9X D;  1UUR A;  4L0R A;  1IZN B;  2V7L A;  3E08 A;  5C8Y E;  4CN4 A;  3AE9 A;  3AXJ B;  4KP3 C;  2LEH A;  2YEV C;  2UXB T;  3AEA A;  2CM0 A;  3CVR A;  3QB5 K;  2XAJ B;  4CN1 A;  2EHO B;  4DND A;  4MFR A;  1KEY A;  1UX4 A;  4IE6 A;  4ZI2 C;  4TZ4 C;  2QVA A;  4UEL A;  2HHH T;  5JVD E;  2BZB A;  4K0K T;  4PFP A;  4ZHQ E;  4JUY A;  5LMU T;  1FMW A;  2KND A;  4PK5 A;  4GK5 E;  5CB4 E;  1FEW A;  2J47 A;  4YSX A;  4X65 T;  2DI4 A;  3JAD A;  2H88 A;  4G63 A;  4LF9 T;  4EIW A;  2JPF A;  2XJ7 A;  1SUM B;  3GWH A;  4O2A E;  4F8H A;  4IGU A;  3RQU A;  3P50 A;  1GQE A;  4IDP A;  1N34 T;  2ZMA A;  2WU5 A;  4ISS A;  1W0A A;  5ABF A;  3E22 E;  5JTG A;  4CXY A;  5L2L A;  4KX6 A;  3FXD B;  1J5E T;  5AQF B;  4A56 A;  4HFB A;  3JAF A;  1NWM X;  3L8R A;  1D0Z A;  1N36 T;  3CX7 B;  2W62 A;  4Z90 A;  4WYV A;  3SS1 A;  2WDV A;  4QH4 A;  3ZN0 B;  4H9P C;  5J2U E;  2Y8D A;  3V5U A;  3K3N A;  5AQG B;  2XAH B;  3UQ7 A;  5AQQ B;  1XDO A;  3AAA B;  4JI3 T;  3FZF B;  4DR1 T;  4P0B A;  2CHN A;  3RH3 A;  4CQI A;  3FZM B;  4EAH A;  5FY7 A;  4BJN A;  5ABF B;  2XUE A;  4AKG A;  2D0U A;  2ODV A;  5LB7 B;  3KV6 A;  3TKL B;  2B76 A;  3P4Q A;  5HEG A;  4C91 A;  2Q9Q C;  4QKN A;  3WAJ A;  5FVK A;  4ZI2 D;  2MYS A;  2IAK A;  5FYM A;  2VQE T;  4DV6 T;  1WRD A;  2VL0 A;  2LKG A;  4JI2 T;  5F3J A;  1IJ6 A;  2L3L A;  2W00 A;  2WMO A;  3GMI A;  4Z8X A;  4EGW A;  3MKD A;  1E2A A;  2WQY A;  3DP7 A;  4AKR B;  1XMQ T;  2LSG A;  2PTF A;  3H3M A;  3OBV E;  2CBI A;  3IF8 B;  5AQV B;  4YT0 A;  3QNU A;  4H9Q C;  4IIJ E;  2M6I A;  1X9B A;  1NAF A;  2CXD A;  2NTY A;  3AE3 A;  3MJX A;  2V6X A;  5AQJ B;  5L3E B;  2Q9Q A;  2CMR A;  4HWD A;  2Y6X A;  3RQW A;  3PUA A;  3SRZ A;  2WWV A;  5LHG B;  4MLK A;  2K9A A;  3P4W A;  4DV1 T;  4GYR A;  4CN6 A;  2YOE A;  3AE4 A;  4EZH A;  5LMN T;  3I1A A;  1VOM A;  1ZP0 A;  1MIV A;  2J62 A;  4LMK A;  2E5L T;  2VKD A;  3NRX A;  3F2E A;  1KF6 A;  1KNZ A;  5E0O A;  3RYF E;  2FJB A;  4JI4 T;  1KNR A;  5FVL A;  4PJL A;  1W09 A;  2X51 A;  4ZEY A;  5JRC B;  3ZT5 A;  3K3O A;  2V8S V;  1OED E;  1T98 A;  4WZX A;  2Q9Q B;  3CPZ A;  3KVB A;  5FXZ A;  4TN7 B;  2KT9 A;  4F6R C;  4CXW A;  3Q2M A;  4H63 H;  3PV0 F;  3UUL A;  2NW9 A;  3LSV A;  2CCQ A;  1NEN A;  4O4J E;  3ZYK A;  3RHW A;  2WWU A;  3C4X A;  1U5P A;  2V26 A;  2XAS B;  2F4V T;  2PFV A;  4CI1 B;  2A9U A;  4ILU A;  5IUX A;  3JC6 C;  2K5B B;  2DLR A;  4L9I A;  5AQN B;  2KMF A;  3ZYM A;  4DR2 T;  3FXE B;  3UUM A;  3FBZ A;  3QC9 A;  2N1G A;  3QK6 A;  4IE7 A;  1S35 A;  3ZCJ A;  1V9D A;  2FJA A;  4TWH A;  4NXN T;  1NEK A;  4IE4 A;  1T8B A;  3RRW A;  2BS4 A;  3A7M A;  5AQL B;  5FP3 A;  2X68 A;  4E7S A;  2VVN A;  4K0U A;  2V7J A;  1YKE B;  3N9L A;  5HEU A;  3KV9 A;  4A98 A;  2BKP A;  3RIU C;  3GN5 B;  5JQG E;  4OFZ A;  5CFB A;  2W4X A;  4E7Z A;  2LSK A;  1J1J A;  4LMJ A;  3J9X 1;  2BDE A;  1FJG T;  3L09 A;  4TUY E;  3SFD A;  4QX7 B;  4JI7 T;  4NPP A;  4X5T A;  3RLF F;  2YK0 A;  4OX9 T;  2ES0 A;  2I6H A;  1Z8U A;  2YU2 A;  3D0T A;  4JI6 T;  1H7C A;  4BAY B;  5AQK B;  3R6N A;  1HG2 A;  3EVY A;  2QYW A;  3IA3 A;  3T8O A;  2CHO A;  4QWN B;  4HFD A;  3ZCI A;  4B3R T;  2CEA A;  3I9Y A;  2CXF A;  4NUV A;  4HFC A;  5LXT E;  5LCY A;  3LBX A;  3C4W A;  4JI8 T;  1WLX A;  3H37 A;  2NOX A;  4LFA T;  4X1K E;  2H3R A;  5L4E A;  3MAC A;  3CQX C;  2ZM2 A;  2G0U A;  4U7Y A;  3UUX B;  4A5X A;  3A8Y C;  4UR9 A;  3FBL A;  2WZI A;  4ZI7 E;  2LKH A;  2PBI A;  3JC6 D;  2LT3 A;  4P09 A;  1R8I A;  2BS2 A;  3CQC B;  2W67 A;  2W66 A;  4IDQ A;  3C51 A;  3PUZ F;  4M1P A;  2ZM6 T;  4JBW F;  4DV0 T;  3N2K E;  2D2S A;  2H89 A;  4I50 E;  2UXC T;  2WU2 A;  2KWH A;  3LBX B;  2YDR A;  4UF0 B;  1MNE A;  1IJ5 A;  1BR1 A;  5AQS B;  2LLY A;  4DV2 T;  3AE6 A;  3ZMS B;  5FXX A;  1LVK A;  3HL6 A;  4PK4 A;  4O8S A;  4HFH A;  3LG7 A;  4KMC A;  5LYJ E;  3PU8 A;  2ODU A;  5L3B B;  2ZLY A;  4ZI3 C;  3AAI A;  5KX5 E;  4QXH B;  2DNX A;  3X1D A;  1SHZ C;  1KNP A;  4AKL A;  5LGT B;  2DL1 A;  4I43 B;  2YIN A;  5LGU B;  3C98 B;  1I6Z A;  4IDO A;  2UXD T;  3CX8 B;  4AQF C;  4Z91 A;  1LKX A;  4WBO A;  2LHR A;  2E5V A;  5IYZ E;  1OWA A;  4GKK T;  2V7M A;  2E2A A;  3DTO A;  4AXP A;  3NBX X;  3OTO T;  3LK4 2;  5HCM A;  2LSJ A;  3EDV A;  2CWY A;  2BG9 C;  3P7I A;  4PJN A;  5FL0 A;  3GA8 A;  5H6R B;  4YJ2 E;  4WNK A;  3PU3 A;  3AVR A;  4U72 A;  5JDM A;  3WI3 A;  2PJQ A;  4U74 A;  4NXM T;  5CGM A;  5HYA A;  3PDY A;  3RC8 A;  4YTM A;  4ILA A;  3ZT7 A;  4DID B;  3UTK A;  2EHO D;  3Q9D A;  2C5J A;  3VU7 H;  2N2N A;  2WDR A;  5AQI B;  1T7S A;  3KV5 A;  3PUG A;  5HXH A;  3EDU A;  4AQF A;  5ABE A;  2YKS A;  1WR6 A;  4OYK A;  3AE2 A;  5AQH B;  2YDS A;  4DMW A;  3RYI E;  3ONL C;  1VCT A;  1N32 T;  4ZZC A;  3PJA A;  2OA5 A;  2XPK A;  2BG9 A;  4L5G A;  5EZY E;  1LRZ A;  2DCF A;  3M65 A;  4YTN A;  3RKG A;  4WBN E;  4QXC B;  5LBQ B;  2X9W A;  4UEM A;  3VHL A;  2RA1 A;  5A1L A;  1FMV A;  4YSZ A;  4UIG A;  4QX8 B;  2HPL A;  2BKN A;  3ZST A;  1KK7 A;  3AEF A;  1CHU A;  4O4L E;  2X0Y A;  4ZI3 D;  4ILC A;  1M7K A;  2JIW A;  1HFA A;  3UUB A;  1MIY A;  2FUP A;  4O4H E;  3FHN A;  5LJM A;  3TLU A;  3N9Q A;  5LG3 A;  4CXX A;  4LF7 T;  1Z0P A;  4EED A;  4X1I E;  2XQ6 A;  4MBQ A;  5CA0 E;  4DBQ A;  4TNW A;  1EZ3 A;  2HN1 A;  5J1G A;  4DUY T;  2BG9 B;  4GIW A;  4U3C A;  3ZLI A;  4EYU A;  1WYB A;  3Q5W A;  2WB5 A;  2UUB T;  2CA5 A;  4CI2 B;  1QSD A;  4HN9 A;  4U7I A;  4PNI A;  4ZOL E;  3HA4 A;  1XDP A;  3O9X A;  3AA0 B;  1IBM T;  3CX6 B;  3O4X E;  5JR9 C;  1IAP A;  2XQ5 A;  4YJ3 E;  5LBM A;  3K8P C;  4HGA A;  3PJA J;  5FKY A;  2LOP A;  3HKC E;  3VRB A;  4DR3 T;  2A3D A;  3N9P A;  2KXP B;  3RPU A;  1D0Y A;  3UFG A;  3LK2 B;  1JNZ A;  3PTR B;  4IL9 A;  2HPJ A;  1I94 T;  4LML A;  1ZHC A;  4QXB B;  3VRA A;  2WSS V;  3AVS A;  3ZJ2 A; 
#chains in the Genus database with same CATH homology
 1HS7 A;  3KFW X;  4IE4 A;  3U78 A;  4AKI A;  3RRW A;  4I4T E;  1FIO A;  2IC6 A;  3MZK B;  5FP3 A;  4DMV A;  2X68 A;  4E7S A;  2DHR A;  3LJC A;  3ETV A;  3LFM A;  4K0U A;  4GK0 E;  2V7J A;  2LHN A;  1SA0 E;  2IW5 B;  2W63 A;  3MA9 A;  4FJO A;  5ETW A;  3BQI A;  4I55 E;  1YKE B;  2K24 A;  3NZP A;  3ZEF B;  1AJ3 A;  3N9L A;  3C4Z A;  3CKD A;  3KV9 A;  5JR9 A;  1MIW A;  2ACX A;  3VKH A;  5KDM C;  4J2C A;  3ZJ1 A;  3IEE A;  3O1I A;  3GN5 B;  3PUS A;  2V7I A;  3P8C D;  2X67 A;  5JQG E;  4OFZ A;  4BA9 A;  2IC9 A;  2L9Q A;  4ADZ A;  4E7Z A;  4PFO A;  5CA1 E;  5LP6 E;  3ZPO A;  2LSK A;  3RX6 A;  4EXT A;  4JEH B;  4PJJ A;  1OXZ A;  3J9X 1;  2BDE A;  2EHO A;  2VAS A;  3L09 A;  3QUJ A;  4TUY E;  5HWX A;  4QX7 B;  2UXN B;  1X79 A;  2H7V C;  4O2B E;  5HWY A;  3ZMZ B;  2YK0 A;  3IBP A;  2ES0 A;  4HKA A;  1MND A;  2MOZ A;  2QGS A;  2YU2 A;  3D0T A;  1B7T A;  5DJQ C;  4IST A;  1HG5 A;  3PUQ A;  5FY1 A;  4KUM B;  1H7C A;  1ZKE A;  4BAY B;  3I0O A;  3MXZ A;  3R6N A;  1HG2 A;  3EVY A;  4OYJ A;  2E9X B;  4AKH A;  4UXN B;  4EOZ B;  4JLE A;  2NWB A;  4BJM A;  1UCU A;  3T8O A;  4IE0 A;  4QWN B;  5JRE A;  2XHE B;  3E0Z A;  5L3G B;  5HAX A;  3ZCI A;  1G73 A;  1Y64 B;  5FXW A;  2NP9 A;  2CEA A;  2MBG A;  2L8K A;  2LSI A;  2WAU A;  4TV9 E;  4UV8 B;  5LGN B;  3I9Y A;  1ZEE A;  2VK9 A;  2SPC A;  2E9X D;  2CXF A;  4NUV A;  5JR9 B;  5LXT E;  3HI2 A;  4L0R A;  5LCY A;  2W0G A;  3LBX A;  5FMN A;  3C4W A;  1IZN B;  2V7L A;  1WLX A;  2Q9Q D;  3E08 A;  3H37 A;  1HCI A;  2BVM A;  3K3Q C;  3RYH E;  2CLY B;  2NOX A;  1S94 A;  4XZC A;  5C8Y E;  4X1K E;  5ADX L;  1BR0 A;  2H3R A;  4KP3 C;  2LEH A;  3MAC A;  3CQX C;  2ZM2 A;  2YEV C;  5L3C B;  2G0U A;  2CM0 A;  3CVR A;  3UUX B;  2XAJ B;  4QHO A;  5LG4 A;  3PUR A;  2EHO B;  3VKG A;  4DND A;  3A5X A;  2CLY C;  3FBL A;  3HKE E;  4MFR A;  4ZI7 E;  2PBI A;  3BK9 A;  3JC6 D;  1UX4 A;  2I59 A;  1YD8 G;  4IE6 A;  2MTQ A;  4ZI2 C;  1BR2 A;  4TZ4 C;  3OYX A;  5HXS A;  3ZN1 B;  4ZS2 A;  4P0A A;  4EYY R;  4UEL A;  2LE8 A;  2LT3 A;  4ERR A;  4P09 A;  5JVD E;  4H9S E;  2J1D G;  4YHJ A;  3CQC B;  3V5S A;  2BZB A;  3UT5 E;  1G8X A;  1YW0 A;  1ZV4 X;  3C51 A;  4M1P A;  3ANW A;  4PFP A;  4JUY A;  4ZHQ E;  2D0T A;  3RC3 A;  3ZMV B;  1FMW A;  2KND A;  3N2K E;  4N78 D;  2D2S A;  4PK5 A;  2H7O A;  2D5U A;  3HKD E;  5LHI B;  3C64 A;  4I50 E;  4GK5 E;  5CB4 E;  1FEW A;  3F57 A;  2KWH A;  2VKH A;  3ZYL A;  2DI4 A;  3LBX B;  4MHC A;  4G63 A;  4ZS3 A;  2JPF A;  4UF0 B;  4EIW A;  3GWH A;  1MNE A;  4O2A E;  3ESL A;  1IJ5 A;  1BR1 A;  4IGU A;  3KBT A;  5LOV E;  1YKH B;  5JRC A;  2XQY A;  3ZMS B;  3HKB E;  3BQL A;  3F31 A;  2ZMA A;  4ISS A;  3PE0 A;  4DVD A;  5FXX A;  5DQV A;  3CWZ B;  3OYZ A;  3U3I A;  3ZC1 A;  3C50 A;  1LVK A;  4ASK A;  3HL6 A;  3E22 E;  4PK4 A;  4CXY A;  3S4U A;  5L2L A;  1MMA A;  4O8S A;  2LSY A;  3FXD B;  3AA7 B;  2UXX B;  3LG7 A;  4KMC A;  5LYJ E;  3R84 B;  4A56 A;  3PU8 A;  1HX8 A;  2JRK A;  1UX5 A;  3AB3 B;  1NWM X;  3UUN A;  3NZQ A;  5HXC A;  3WAK A;  2ODU A;  5L3B B;  5LJN A;  4HTE A;  4DBR A;  2ZLY A;  4ZI3 C;  1D0Z A;  3AAI A;  3CX7 B;  3ANW B;  5KX5 E;  2W62 A;  4QXH B;  3SS1 A;  2DNX A;  3ZC0 A;  1SHZ C;  2A72 A;  2PG8 A;  4NUU A;  4AKL A;  3UFE A;  5LGT B;  4I43 B;  3ZN0 B;  4H9P C;  1LVF A;  2YIN A;  2C5K T;  5LGU B;  3C98 B;  5J2U E;  2X9Y A;  2Y8D A;  3CX8 B;  3L3P A;  3V5U A;  4PAG A;  4YFS A;  5HXE A;  4AQF C;  2NTX A;  3K3N A;  1LKX A;  2RP4 A;  4H9R C;  2XAH B;  4WBO A;  5JDL A;  2LHR A;  5JDQ A;  5IYZ E;  1OWA A;  2LOS A;  5JDF A;  4GYS A;  5JDG A;  3AAA B;  2V7M A;  3KBU A;  4P0B A;  3DTO A;  4AXP A;  4X1Y E;  3NBX X;  3RH3 A;  4AQG A;  4CQI A;  3AA1 B;  4EAH A;  1D1C A;  1U4Q A;  5FY7 A;  3LK4 2;  4BJN A;  2LSJ A;  2XUE A;  1D1B A;  3OJA A;  3EDV A;  2V7K A;  2CWY A;  2P9B A;  3P7I A;  4AKG A;  2D0U A;  2ODV A;  4PJN A;  2VKJ A;  2JQQ A;  3KV6 A;  3TKL B;  5BMV E;  3GA8 A;  5H6R B;  4H63 V;  4YJ2 E;  4WNK A;  3PU3 A;  2XAG B;  4C91 A;  2Q9Q C;  4QKN A;  5LA6 E;  3AVR A;  5EK2 A;  2A2F X;  3N5L A;  4U72 A;  5JDM A;  3WI3 A;  2PJQ A;  4U74 A;  3RKO A;  5HYA A;  3WAJ A;  4AI6 A;  2VB6 A;  3PDY A;  3Q5X A;  2N9D A;  2WBL A;  3RC8 A;  3NRY A;  5M4Y A;  4ZI2 D;  2MYS A;  2IAK A;  2V1D B;  4TX5 A;  4H9N C;  4C90 A;  5FYM A;  5KMG P;  3UTK A;  2EHO D;  3FB2 A;  4V1A v;  3Q9D A;  2C5J A;  5TAO A;  1WRD A;  3VU7 H;  2N2N A;  3GN5 A;  5L3D B;  2ZM0 A;  5F3J A;  3KV5 A;  4EB6 E;  3PUG A;  5HXH A;  2BVL A;  3EDU A;  4AQF A;  1IJ6 A;  2L3L A;  2W00 A;  2WMO A;  4G2A A;  3GMI A;  4Z8X A;  1WR6 A;  4OYK A;  3MKD A;  2X9X A;  4CI3 B;  3DP7 A;  3ETU A;  3RYI E;  4AKR B;  4DMW A;  5JDH A;  2ZM8 A;  3SWH A;  3MK7 C;  1MMG A;  2LSG A;  1O3X A;  2C5I T;  3OBV E;  4GOU A;  3RYC E;  4CZZ B;  2B1E A;  2QA7 A;  5DAB A;  3N2G E;  3N2O A;  2XTL A;  2OA5 A;  2X66 A;  3IF8 B;  3N9M A;  4KBM B;  2Z6E A;  4H9Q C;  4L5G A;  5AFU L;  1HTJ F;  4HE8 A;  3CML A;  4IIJ E;  4OK0 A;  4X20 E;  5EZY E;  1NAF A;  2CXD A;  4HFV A;  2DWK A;  3RRC A;  1LRZ A;  3W15 B;  2NTY A;  2E9X A;  2DCF A;  3I0Q A;  3M65 A;  3MJX A;  3OKQ A;  4WBN E;  2JJ9 A;  4QXC B;  2WMN A;  1WYC A;  2CXL A;  5LBQ B;  5L3E B;  2Q9Q A;  2X9W A;  3N9O A;  2CMR A;  2JMK A;  4FI5 A;  2Y6X A;  4UEM A;  4EZ4 A;  3VHL A;  2RA1 A;  5EK4 A;  5A1L A;  4IE5 A;  1FMV A;  3PUA A;  2C0S A;  3SRZ A;  2M67 A;  5LHG B;  4MLK A;  4UIG A;  4QX8 B;  2HPL A;  2K9A A;  2X9H A;  4HEA A;  4DO0 A;  2VL8 A;  1KK7 A;  4GYR A;  2DWG A;  1E1H B;  5FXV A;  4EZH A;  4O4L E;  5EK3 A;  2GK9 A;  2YU1 A;  4ZI3 D;  4JEU B;  5F8P A;  3I1A A;  1MMD A;  1HFA A;  1BR4 A;  3O1H A;  5J2T E;  2LM9 A;  4O4I E;  1MIY A;  2Y48 B;  4O4H E;  2VWA A;  3FHN A;  2K48 A;  5LJM A;  2KLQ A;  2XAQ B;  1VOM A;  4UVC B;  4TV8 E;  1MIV A;  3N9Q A;  4CXX A;  2VKO A;  4UVA B;  2VKD A;  3NRX A;  3F2E A;  5HXR A;  4PW8 A;  5FY0 A;  2CWO A;  5FNV E;  5L3F B;  1KNZ A;  1Z0P A;  5E0O A;  3RYF E;  4X1I E;  4MBQ A;  5CA0 E;  4DBQ A;  1EZ3 A;  5J1G A;  3EUH A;  4GIW A;  2KZ7 B;  3B57 A;  4PJL A;  4UVB B;  2X51 A;  5JRC B;  3ZLI A;  2X0L B;  4EYU A;  2NW8 A;  3K3O A;  4XAX B;  5IHY A;  1WYB A;  3Q5W A;  2W61 A;  4PK6 A;  1T98 A;  2JMH A;  3SOL A;  2Q9Q B;  3CPZ A;  4WW0 A;  4H9O C;  3KVB A;  3ZMU B;  5FXZ A;  5DQW A;  2NW7 A;  3H3A A;  4TN7 B;  1HF8 A;  2CA5 A;  2KT9 A;  4CI2 B;  4CXW A;  4F6R C;  5LNK A;  1QSD A;  4OHF A;  2E9X C;  3Q2M A;  3N9N A;  4MAL A;  3IHR A;  3BQK A;  3HR0 A;  4H63 H;  4HN9 A;  3B13 A;  5LHH B;  3LK3 B;  3UUL A;  3O1J A;  5JDN A;  4PNI A;  2KWI B;  4ZOL E;  3HA4 A;  4UF0 A;  2NW9 A;  2XAF B;  2CCQ A;  3O9X A;  3AAE B;  3AA0 B;  1QUU A;  4O4J E;  1D0X A;  3CX6 B;  4PJM A;  3ZYK A;  3O4X E;  5GON E;  2WWU A;  5JH7 E;  3C4X A;  5JR9 C;  1D1A A;  1U5P A;  1IAP A;  2V26 A;  2XAS B;  4XBF B;  5H6Q B;  2CE7 A;  2PFV A;  2KIN B;  3KIN B;  4CI1 B;  4YJ3 E;  5LBM A;  3J7Y q;  3K8P C;  4HGA A;  4ILU A;  3JC6 C;  2K5B B;  2DLR A;  4L9I A;  2KMF A;  1US7 B;  1CUN A;  3ZYM A;  2LOP A;  4B6X A;  2WM9 A;  3HKC E;  1VRB A;  1MMN A;  4IHJ E;  3I9W A;  2EHO C;  2A3D A;  3N9P A;  2KXP B;  3RPU A;  3FXE B;  4UV9 B;  3UUM A;  3FBZ A;  1D0Y A;  2HH7 A;  4IDZ A;  3KVA A;  3QC9 A;  3ZMT B;  3LK2 B;  2N1G A;  3KDS E;  3CQG B;  3QK6 A;  3ONX A;  3PTR B;  2HPJ A;  4IE7 A;  1S35 A;  3ZCJ A;  1ZHC A;  4QXB B;  1V9D A;  2LJL A;  3KV4 A;  4ANJ A;  2WSS V;  3DJB A;  3AVS A;  3ZJ2 A;  2E8I A;  4YLH A;  3AA6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...