2DWKA

Crystal structure of the run domain of mouse rap2 interacting protein x
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
162
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Protein RUFY3
total genus 47
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwkA00
2DWGA 2DWKA 4GIWA 2CXLA 2CXFA 3CWZB
chains in the Genus database with same CATH superfamily
2YEVC 2ZMAA 3UU6A 3ANWB 3AE5A 2CXDA 3QOFA 1BR0A 1HG2A 2X66A 4QH1A 1YQ4A 3JC6D 2WS3A 3MA9A 2VL8A 2LRLA 2XAJB 3ESLA 1CHUA 2FJDA 5AQNB 5AQVB 2ZM6T 3T1HT 4G2AA 2K24A 4NUVA 1Z0PA 2JQKA 2QGSA 3LK42 2CWOA 4HWFA 5LJMA 2UXDT 3RH3A 4YSXA 4HFBA 2ES0A 2P9BA 3JAEA 4HFVA 4UV9B 3C51A 3UQ4A 2VVSA 5JREA 2W2UA 4EAHA 3SS1A 4QH5A 2V8SV 5LBMA 4AIUA 5J2UE 2NTXA 4B3RT 1KNPA 2A3DA 2XQ8A 5AQOB 1IBLT 4HFDA 4O8SA 4DV4T 4WW0A 2N9DA 4HE8A 1YW0A 4U33A 3QB5K 4H63V 5AFUL 4UXNB 1HG5A 4FJOA 2XJ7A 5HWXA 1B7TA 1UX5A 2VKJA 3PU3A 4IIJE 4OHFA 3L8RA 4A98A 1HFAA 4DUYT 2VKOA 3CX6B 3UUXB 5FVLA 4C90A 5CA0E 5L3CB 1VOMA 4OX9T 3H3MA 1JNRA 4UVBB 2HPJA 4TWFA 2RA1A 2X9HA 3QK6A 3PUWF 3TLWA 4JLEA 2IDOB 4UIGA 1X79A 1D1CA 1FEWA 2VVNA 4LF5T 3C98B 3EUHA 5AQPB 2WDVA 2ZLYA 2CBJA 4ZI3C 5A1LA 4DV3T 3B57A 1XWMA 2X67A 1HNWT 4Z90A 3ZPOA 5DABA 5HXRA 1HTJF 2CEAA 4PFPA 5L3FB 4JI6T 2LRKA 1LVKA 2C5KT 2WU5A 5JRCA 2NWBA 3EI0A 4IE5A 4U2YA 5LB7B 3ZCIA 4LF7T 3VU7H 4EGWA 3DP7A 5FL0A 4AQFA 4X1IE 4M1PA 3AE2A 4UF0A 4X62T 2BBHA 2LOPA 2V7LA 3OVUA 5HCMA 3UTKA 5BMVE 2CLYB 2W66A 1HX1B 1VRBA 2XQ4A 2Y8DA 3N9LA 4ILUA 2VKHA 4I43B 5JVDE 3ZJ1A 1Z8UA 2YDQA 2WP9A 3LK2B 3N9PA 3ETVA 5EZYE 2BS3A 2J4GA 3QB5A 3CMLA 4H9RC 3L39A 2D0TA 3RIFA 2CPTA 2DHRA 2LSKA 4HN9A 3J9X1 2Z6EA 3AEAA 3AE6A 4ILCA 5EK4A 4PJNA 4YSZA 2I59A 2V5CA 1YD8G 1BR2A 4TWHA 2X0LB 1N32T 4CI2B 4N78D 2A9UA 2LSYA 3N2KE 2LHNA 4LMKA 3AEFA 4IL4A 5AQFB 5JDNA 4AQYT 2G0UA 2GK9A 3MXZA 1N34T 4JI1T 4YHHT 5DQVA 3SRZA 3RC8A 5CJ5A 4YY3T 4L9IA 3KDSE 2WSSV 5EK2A 4JI4T 1XNRT 3C50A 2LM2A 5LXTE 4EB6E 2N2NA 2XQAA 3AEDA 4H63H 4CZZB 3P4PA 4DMWA 2V26A 4QWNB 4PK6A 2Q9QD 1E7PA 1MNDA 1D0YA 3A7MA 4HWIB 1HCIA 3KBTA 4IREA 3DJBA 3V5UA 4OFZA 3RF1A 3WAKA 1GQEA 2LSIA 2CXLA 1LRZA 5JQGE 4O2BE 2WDQA 3LJCA 5L4HA 3TKLB 2CLYC 3FZHB 4BAYB 4U7YA 4EOZB 5HXSA 3KBUA 4LF4T 4GIWA 2VL0A 3J7Yq 2IIUA 3AA1B 5DJQC 3PUYF 3ZJ2A 3HA4A 4QX7B 1QLBA 2AE9A 3FZFB 4DUZT 1XZYA 1XDOA 3AA7B 2XY8B 3ZYMA 3ZT5A 4O4LE 3D0TA 4DO0A 4JBWF 5JDLA 1D0ZA 4AKLA 3ZYLA 3A5XA 3RKGA 3RX6A 5LGTB 2W0GA 4LF8T 4GK0E 2XZEA 3EABA 4NPPA 2NTYA 2IUBA 3RKOA 4MBQA 3U3IA 2IC9A 1ZV4X 2WDRA 2MTQA 3P7IA 5FVKA 4ZHQE 3HKCE 5FP3A 3UUBA 2XQ7A 3I9WA 3OTOT 2DLRA 3QNUA 4PJJA 2NOXA 3BQKA 4Z91A 3AE4A 4UV8B 1V9DA 2MPKA 3CIRA 2ZM0A 4KP3C 3ABVA 5FXVA 3CQGB 4IDOA 2E9XA 1Y01A 3EVYA 3PUZF 3RQWA 3TLTA 4DIDB 2M6BA 4ILBA 4DBQA 2J1DG 5M4YA 2X51A 1J1JA 2Y48B 3ZC0A 5IUXA 2QYWA 3F2EA 3LDQB 4AKGA 2JJ9A 3X1DA 1OEDB 1E2AA 2DWKA 1KK7A 2FUPA 2JQQA 3C4WA 3CKDA 4K0UA 1LKXA 2KLQA 3K8PC 4FI5A 1OXZA 2NW9A 4ERRA 2XUEA 4YSYA 1YKHB 2XPKA 3WAJA 2UU9T 3U78A 2WZHA 3AAIA 2VKDA 1U5PA 5HYAA 4EIWA 5L3DB 3UQ7A 2KXPB 4X66T 2NW8A 4QXCB 1XMOT 3SFDA 3AECA 3Q5DA 4YFSA 2YKSA 2XAFB 4UF0B 3I0OA 4ADZA 2CCQA 4O2AE 5C2TA 2JQHA 2WM9A 5HXEA 4ZXLA 4JI7T 1WRDA 2RP4A 2V7MA 3RC3A 3ZKRA 1DU2A 4EYYR 3AE8A 4P0BA 2WQYA 4YTPA 2D0UA 2WWVA 3TLUA 2XQ9A 4UVCB 2XQ3A 3I0QA 2E5LT 2XQYA 3N2OA 1L0VA 2V7IA 3RYFE 4B3ST 2EHOC 2XSAA 5LNKA 5HEUA 4E7ZA 1SHZC 3LSVA 4EXTA 4YHJA 4IL9A 4TUYE 4KX6A 2X9YA 2MYSA 2EHOB 2WB5A 3ONXA 2J47A 2LLYA 1NWMX 3C64A 4JI0T 3Q5XA 4P0AA 3OYZA 4MLKA 4ZEYA 3FZMB 2VURA 3Q2MA 1MMDA 3IA3A 4MALA 2M67A 2LKGA 2BBJA 3O1JA 4UEMA 3ETUA 5FXXA 4K0KT 4OK0A 4PK5A 5IHYA 2EHOD 4U7IA 5IWAT 3ZN0B 3UUNA 3LBXA 4BJMA 4AKHA 5AQMB 3ZT7A 4ZI2D 2B76A 3VKHA 4Z8XA 1G73A 1UURA 4UR9A 2WBLA 3PUSA 3VR9A 1UGOA 4KI0F 3P8CD 2JQ9A 2UUCT 2A2FX 2WZIA 1W9RA 4I50E 1HF8A 3K3NA 4MHCA 4DR3T 3N5LA 2Q9QC 2LSGA 3O1IA 3ZSTA 3OBVE 3KVAA 1IBKT 1E1HB 2W67A 4TNVA 3B5MA 5AQSB 5CA1E 4H9NC 3ZMVB 1X9BA 1W0BA 4PAGA 5CB4E 4UVAB 5ABGA 3FBLA 4J2CA 3AE1A 4DR1T 3T1YT 3RLFF 2SPCA 2F4VT 3JADA 2I6HA 4JEHB 3HKBE 5AQLB 5AQRB 5FY1A 1FIOA 5JR9A 1S35A 3IBPA 2D5UA 4WBNE 2ACZA 3QUJA 1M7KA 2YDRA 3P4QA 4IE6A 5C8YE 5L3EB 5BR8T 2UUAT 2IHR1 2OLTA 2D9DA 4H9OC 3AVSA 3T8OA 2L8KA 1WYCA 3N9NA 2WCAA 4A97A 1N33T 3I1AA 3TLSA 4HFCA 3DTOA 2Q9QA 3E22E 3UT5E 2LHRA 4ASKA 5LP6E 3SOLA 3GA8A 4I55E 4YJ2E 2A72A 2YDSA 4LFBT 2C0SA 5LHHB 2KT9A 3PUGA 5E0OA 2CBIA 2CMRA 2LKHA 2Q9QB 2R6GF 1WFDA 4IE4A 1YQ3A 2X68A 3CPZA 4PJLA 2K5BB 2WWUA 3PDYA 2E8IA 2B1EA 3ZLIA 2ODUA 3NVOA 2LEHA 3RYIE 2WMOA 4GOUA 2V5DA 2KWIB 2BKOA 3CX7B 1IZNB 4IT4A 4DR4T 2BG9B 3H3AA 2H3RA 1EZ3A 2MOZA 3M65A 3UFGA 4OYKA 5L4EA 4DVDA 3AXJB 3TLVA 1ZOYA 3AE7A 2XM2A 1T8BA 3HKEE 3KV5A 3BQIA 4WYVA 3UULA 3IHRA 1JNZA 2DNXA 2BKNA 1KNRA 2V7KA 3N9MA 4JI5T 3CQCB 3R6NA 4CN6A 4DV5T 1I6ZA 5FNVE 3JAFA 4PW8A 1WYBA 2PTFA 4U72A 4PJMA 3O1HA 2VWAA 4YJ3E 3ZT6A 4JI3T 5JDGA 1MIYA 2XASB 3BK9A 3GN5B 4HEAA 4TN7B 2VB6A 3AEEA 3PUAA 5HAXA 1MMNA 2QRXA 3VKGA 5HEJA 1XDPA 1ZEEA 2LE8A 2E2AA 3K3OA 1VCSA 1YXRA 2FBWA 4EEBA 2NR4A 4KHZF 3KVBA 3PJAA 4AQFC 4CQIA 3ONJA 1BR4A 1UK5A 3CK6A 5HXHA 3L3PA 1SE7A 2JRKA 3AAAB 4I4TE 3QC9A 4UELA 3FB2A 4U31A 1SUMB 3JCFA 4DBRA 4AISA 5J2TE 1MIVA 4X65T 2VQET 2LT3A 3CVRA 2N1GA 2XAHB 2EHOA 4XZCA 1T98A 3P4WA 2UUBT 3FZKB 3O9XA 2YU2A 3ZEFB 1BR1A 3PE0A 5L3BB 3FXDB 4ZS2A 3KFWX 3PJAJ 2CHNA 1OEDC 2WU2A 3AE3A 2V6YB 2DL1A 5AQUB 5HXCA 5LA6E 1OEDE 2ZM2A 2ZM8A 1W09A 3M3ZB 5FXWA 3VRBA 5LG4A 2FJBA 2XQ6A 3LK3B 3LFMA 1ZP0A 3LBXB 2V1DB 4QXHB 5HEHA 4BA9A 2XAGB 1HX8A 1M62A 1S94A 2LSJA 3PUVF 4H9PC 4ZOLE 5AQTB 4ZZCA 3IF8B 4B3TT 2UXCT 5H6RB 1N36T 5LCYA 2KSRA 2KWHA 1WCRA 3EDVA 3MACA 4DR7T 4ZI3D 5JTGA 5FYMA 4F8HA 3RIUC 4QXBB 3RRCA 4YXDA 3PTRB 5JDMA 4KHPT 2UXBT 3AEGA 4YTMA 2YU1A 5AQGB 3AE9A 3UU4A 4EZ4A 3MKDA 1HS7A 3PV0F 3ZMUB 1R8IA 4GKKT 3NZQA 4P1NA 3HL6A 1OEDA 3AVRA 1ZKEA 1XNQT 5L2LA 4LFCT 4GYSA 3CX8B 2IAKA 2JIWA 2YK0A 1HNZT 4IE7A 4KUMB 3E08A 2DI4A 2E9XB 1D0XA 4NIQA 4LMJA 5LBQB 4ZI2C 1QSDA 4DR5T 3I9YA 5EK3A 4IDQA 1QUUA 2IMLA 4CI1B 5LMNT 1MMGA 2PBIA 2WAUA 3VHLA 4TV8E 4L5GA 3EAMA 3NWIA 5AQIB 4DV2T 4CXWA 2W63A 4HWHA 4HFIA 4U3CA 3UFEA 4A5XA 4JI8T 4O4IE 2NP9A 1MMAA 4G63A 1WLXA 2WMNA 3P50A 3MZKB 3AEBA 4AQGA 1ZHCA 2JMKA 2RPAA 3IEEA 3K1SA 4JUYA 5LGUB 4DV7T 1O3XA 5KXJA 3C4XA 3KV6A 2HHHT 4AKRB 2K9AA 2XQ5A 5AQKB 2PJQA 4DV1T 4EYUA 3UUMA 2C5IT 2L3LA 2ODVA 3G06A 4Q25A 1T7SA 5LMUT 4NXNT 4PK4A 5JRCB 3ZCJA 1CUNA 4YT0A 2M6IA 5AQHB 1T72A 2BS2A 3GMIA 4QHOA 4F6RC 1HNXT 2DWGA 2V6YA 4A56A 4OYJA 4EZHA 5KMGP 2OA5A 2CRBA 2W00A 5J0ZA 1SA0E 5ABEA 2Y6XA 1D1BA 1Y64B 2BKPA 1FJGT 1US7B 4ISTA 2FJAA 2FJEA 2HPLA 5F5WA 2AXDS 2CHOA 2YINA 4I0UA 3OJAA 5DQWA 4EV6A 5LHIB 2UXXB 3ZMTB 4PNIA 4GK5E 5J1GA 5LHGB 4LF6T 5JDQA 5TAOA 5CFBA 4QX8B 3RYCE 3ZN1B 3N2GE 4H9SE 5AQJB 1LVFA 3CWZB 3JC6C 4WBOA 4H9QC 1H7CA 4KMCA 5AQQB 3ZC1A 5KX5E 1NENA 2IC6A 2QA7A 4ILAA 2LOSA 2PG8A 2BVMA 3KINB 4HGAA 2DCFA 2XSBA 4O4JE 3UU8A 3NKZA 3B13A 3H37A 3OYXA 2VQFT 3EDUA 2KINB 4GYRA 2X9WA 2XTLA 3RI5A 4ZI7E 2V7JA 5FL1A 3C4ZA 3S4UA 3CQXC 5ABHA 2H7VC 4QKNA 2J62A 2BZBA 3RGLA 2QVAA 3RPUA 2ACXA 1I94T 1VCTA 2LM9A 2OV9A 5HCJA 3SFEA 2XHEB 1UX4A 3VRAA 4JYAT 3P4RA 3VR8A 3MK7C 3OKQA 3FXEB 3RHWA 3FHNA 1W0AA 3F57A 4JV5T 4PFOA 4IGUA 1KNZA 2VASA 4E7SA 3ANWA 5HWYA 3HI2A 4CXYA 2E5VA 1U4QA 2BG9A 2H88A 3OPCA 3PUXF 4HWCA 4LF9T 5F8PA 2BVLA 3P4SA 2KZ7B 1UCUA 2HN1A 4DR6T 2BDEA 3NBXX 3A8YC 4KBMB 4O4HE 4QH4A 3N9OA 2JMHA 2W61A 2PFVA 4V1Av 4B6XA 4CI3B 4ZZBA 2W4XA 3NZPA 4X20E 3WI3A 2X0YA 3RRWA 4DR2T 4AI6A 2CWYA 4BJNA 3N9QA 4EEDA 1WR0A 2HN2A 2JPFA 3PURA 4IDPA 4U74A 1UUSA 4XBFB 4LFAT 3RIUA 4NUUA 4X1KE 3FBZA 5HEOA 3FZLB 4TX5A 3ZMZB 3MJXA 5ABFB 4HFHA 3NRYA 1YKEB 4DMVA 2CXFA 4ISSA 4LMLA 4IHJE 5JDFA 2CM0A 4YLHA 4AXPA 3AB3B 5JH7E 2X9XA 2BG9C 2D2SA 3GWHA 3KV4A 3NRXA 4HWDA 2XM1A 4COFA 4CN1A 5LGNB 2WY2A 5ETWA 5JR9B 4XAXB 3W15B 4TZ4C 3ZSSA 2CA5A 4WZXA 4B3MT 3UU3A 4AKIA 1FMVA 5CGMA 3GN5A 2E9XC 1AJ3A 2NW7A 5JR9C 3K3QC 1FMWA 3Q9DA 2HH7A 5L47A 2H7OA 2BS4A 5FKYA 5H6QB 5LOVE 2IW5B 2E9XD 4U2ZA 3L09A 5HEGA 3O4XE 4IDNA 5GONE 1J5ET 2KMFA 4TNWA 4CXXA 5F3JA 3AA0B 5LG3A 2K48A 2YOEA 5FY7A 3ZMSB 2BG9E 4X1YE 5C3JA 5LJNA 1D1AA 1WR6A 3HKDE 2MBGA 1KFYA 4CN4A 5ADXL 1IJ6A 5L3GB 1MNEA 4ZS3A 1OWAA 3ZYKA 5IYZE 1J5WA 3AA6B 3BQLA 3F31A 3KV9A 3LG7A 2XAQB 4L0RA 2KNDA 4DV6T 1IBMT 2W62A 1KF6A 1MIWA 2YN6A 4WNKA 4X5TA 2I0MA 4JEUB 4MFRA 3SWHA 4YTNA 4X64T 1HR0T 2VK9A 2X0HA 2UXNB 5ABFA 1IAPA 5FY0A 3V5SA 3HR0A 4TV9E 5KDMC 1XMQT 3R84B 5FMNA 3Q5EA 4HFEA 3UU5A 2K3WA 2MAWA 2L9QA 4DV0T 4ANJA 2LJLA 3E0ZA 2V6XA 4JI2T 5JDHA 4IE0A 3ONLC 4NXMT 4DNDA 4TWDA 3RYHE 2CE7A 4C91A 3EHZA 1NAFA 2C5JA 3PU8A 3AXJA 1NEKA 3Q5WA 4IDZA 4HTEA 1IJ5A 5FXZA 4HKAA 3RIAA 2H89A 3PUQA 3RQUA 4GKJT 1G8XA 1KEYA 3AAEB 4P09A 5LYJE
chains in the Genus database with same CATH topology
2YEVC 2ZMAA 3ANWB 2CXDA 1BR0A 1HG2A 2X66A 3JC6D 3MA9A 2VL8A 2XAJB 3ESLA 4G2AA 2K24A 4NUVA 1Z0PA 2QGSA 3LK42 5LJMA 2CWOA 3RH3A 2ES0A 2P9BA 4HFVA 4UV9B 3C51A 5JREA 4EAHA 3SS1A 5LBMA 5J2UE 2NTXA 2A3DA 4O8SA 4WW0A 2N9DA 4HE8A 1YW0A 4H63V 5AFUL 4UXNB 1HG5A 4FJOA 5HWXA 1B7TA 1UX5A 2VKJA 3PU3A 4IIJE 4OHFA 1HFAA 2VKOA 3CX6B 3UUXB 4C90A 5CA0E 5L3CB 1VOMA 4UVBB 2HPJA 2RA1A 2X9HA 3QK6A 4JLEA 4UIGA 1X79A 1D1CA 1FEWA 3C98B 3EUHA 4ZI3C 2ZLYA 5A1LA 3B57A 2X67A 3ZPOA 5DABA 5HXRA 1HTJF 2CEAA 4PFPA 5L3FB 1LVKA 2C5KT 5JRCA 2NWBA 4IE5A 3ZCIA 3VU7H 3DP7A 4AQFA 4X1IE 4M1PA 4UF0A 2LOPA 3UTKA 2V7LA 5BMVE 2CLYB 1VRBA 2Y8DA 4I43B 3N9LA 4ILUA 2VKHA 3ZJ1A 5JVDE 5EZYE 3N9PA 3LK2B 3ETVA 3CMLA 4H9RC 2D0TA 2DHRA 2LSKA 4HN9A 3J9X1 2Z6EA 5EK4A 4PJNA 2I59A 1YD8G 1BR2A 2X0LB 4CI2B 4N78D 2LSYA 3N2KE 2LHNA 5JDNA 2G0UA 2GK9A 3MXZA 5DQVA 3SRZA 3RC8A 4L9IA 3KDSE 2WSSV 5EK2A 3C50A 5LXTE 4EB6E 2N2NA 4H63H 4CZZB 4DMWA 2V26A 4QWNB 4PK6A 2Q9QD 1MNDA 1D0YA 1HCIA 3KBTA 3DJBA 3V5UA 4OFZA 3WAKA 2LSIA 5JQGE 2CXLA 1LRZA 4O2BE 3LJCA 3TKLB 2CLYC 4BAYB 4EOZB 5HXSA 3KBUA 4GIWA 3AA1B 5DJQC 3ZJ2A 3HA4A 4QX7B 3AA7B 3ZYMA 4O4LE 3D0TA 4DO0A 5JDLA 1D0ZA 4AKLA 3ZYLA 3A5XA 5LGTB 3RX6A 2W0GA 4GK0E 2NTYA 3RKOA 4MBQA 3U3IA 2IC9A 1ZV4X 3P7IA 2MTQA 4ZHQE 3HKCE 5FP3A 3I9WA 2DLRA 5LHGB 4PJJA 2NOXA 3BQKA 4UV8B 1V9DA 4KP3C 2ZM0A 5FXVA 3CQGB 2E9XA 3EVYA 4DBQA 2J1DG 5M4YA 2X51A 2Y48B 3ZC0A 3F2EA 4AKGA 2JJ9A 2DWKA 1KK7A 3C4WA 2JQQA 4K0UA 3CKDA 2NW9A 1LKXA 2KLQA 3K8PC 4FI5A 1OXZA 4ERRA 3WAJA 2XUEA 1YKHB 3U78A 3AAIA 2VKDA 1U5PA 4EIWA 5L3DB 2KXPB 2NW8A 4QXCB 4ADZA 4YFSA 2XAFB 4UF0B 3I0OA 5HXEA 2CCQA 4O2AE 2WM9A 1WRDA 2RP4A 2V7MA 3RC3A 4EYYR 4P0BA 2D0UA 4UVCB 3I0QA 2XQYA 3N2OA 3RYFE 2V7IA 2EHOC 5LNKA 4E7ZA 1SHZC 4YHJA 4TUYE 2X9YA 2MYSA 2EHOB 3ONXA 1NWMX 3C64A 3Q5XA 4P0AA 3OYZA 4MLKA 3Q2MA 1MMDA 4MALA 2M67A 5FXXA 3O1JA 4UEMA 3ETUA 4OK0A 4PK5A 5IHYA 2EHOD 3ZN0B 3UUNA 3LBXA 4BJMA 4AKHA 4ZI2D 3VKHA 4Z8XA 1G73A 2WBLA 3PUSA 3P8CD 2A2FX 4I50E 1HF8A 3K3NA 4MHCA 3N5LA 2Q9QC 2LSGA 3O1IA 3OBVE 3KVAA 1E1HB 5CA1E 4H9NC 3ZMVB 4PAGA 5CB4E 4UVAB 3FBLA 4J2CA 2SPCA 5FY1A 4JEHB 3HKBE 1FIOA 5JR9A 1S35A 3IBPA 2D5UA 4WBNE 3QUJA 5L3EB 4IE6A 5C8YE 4H9OC 3AVSA 3T8OA 2L8KA 1WYCA 3N9NA 3I1AA 3DTOA 2Q9QA 3E22E 3UT5E 2LHRA 4ASKA 5LP6E 3SOLA 3GA8A 4I55E 4YJ2E 2A72A 2C0SA 5LHHB 2KT9A 3PUGA 5E0OA 2CMRA 2Q9QB 4IE4A 4PJLA 3J7Yq 2X68A 3CPZA 2K5BB 2WWUA 3PDYA 2E8IA 2B1EA 3ZLIA 2ODUA 2LEHA 3RYIE 2WMOA 4GOUA 3CX7B 2KWIB 1IZNB 3H3AA 2H3RA 1EZ3A 2MOZA 3M65A 4OYKA 4DVDA 3HKEE 3KV5A 3BQIA 3UULA 3IHRA 2DNXA 2V7KA 3R6NA 3N9MA 3CQCB 5FNVE 4PW8A 1WYBA 4U72A 4PJMA 3O1HA 2VWAA 4YJ3E 5JDGA 1MIYA 2XASB 3BK9A 3GN5B 4HEAA 4TN7B 2VB6A 3PUAA 5HAXA 1MMNA 3VKGA 1ZEEA 3K3OA 2LE8A 3KVBA 4AQFC 4CQIA 1BR4A 5HXHA 3L3PA 2JRKA 3AAAB 4I4TE 3QC9A 4UELA 3FB2A 4DBRA 5J2TE 1MIVA 2LT3A 3CVRA 2N1GA 2XAHB 2EHOA 4XZCA 1T98A 3O9XA 2YU2A 3ZEFB 1BR1A 3PE0A 5L3BB 3FXDB 4ZS2A 3KFWX 5HXCA 3ZMUB 5LA6E 5FXWA 2ZM2A 2ZM8A 5LG4A 3LK3B 3LFMA 3LBXB 4QXHB 2V1DB 2XAGB 1HX8A 1S94A 2LSJA 4ZOLE 4H9PC 3IF8B 5H6RB 5LCYA 3MACA 2KWHA 3EDVA 4ZI3D 5FYMA 4QXBB 3RRCA 5JDMA 3PTRB 2YU1A 4EZ4A 3MKDA 1HS7A 3NZQA 3HL6A 3AVRA 1ZKEA 5L2LA 4GYSA 3CX8B 2IAKA 2YK0A 4IE7A 4KUMB 3E08A 2DI4A 2E9XB 1D0XA 5LBQB 4ZI2C 1QSDA 3I9YA 5EK3A 1QUUA 4CI1B 1MMGA 2PBIA 2WAUA 3VHLA 4TV8E 4L5GA 4CXWA 2W63A 3UFEA 4O4IE 2NP9A 1MMAA 4G63A 1WLXA 2WMNA 3MZKB 4AQGA 1ZHCA 2JMKA 3IEEA 4JUYA 5LGUB 1O3XA 3C4XA 3KV6A 4AKRB 2K9AA 2PJQA 4EYUA 3UUMA 2C5IT 2L3LA 2ODVA 5JRCB 4PK4A 3ZCJA 1CUNA 3GMIA 4QHOA 4F6RC 2DWGA 4A56A 4OYJA 4EZHA 5KMGP 2OA5A 2W00A 1SA0E 2Y6XA 1D1BA 1Y64B 1US7B 4ISTA 2HPLA 5LHIB 2YINA 3OJAA 5DQWA 2UXXB 3ZMTB 4PNIA 4GK5E 5J1GA 5JDQA 5TAOA 4QX8B 3RYCE 3ZN1B 3N2GE 4H9SE 1LVFA 3CWZB 3JC6C 4WBOA 4H9QC 1H7CA 4KMCA 3ZC1A 5KX5E 2QA7A 2IC6A 2LOSA 2PG8A 2BVMA 3KINB 4HGAA 2DCFA 4O4JE 4BA9A 3B13A 3H37A 3OYXA 3EDUA 2KINB 4GYRA 2X9WA 2XTLA 4ZI7E 2V7JA 3C4ZA 3S4UA 3CQXC 2H7VC 4QKNA 2BZBA 3RPUA 2ACXA 2LM9A 2XHEB 1UX4A 3MK7C 3OKQA 3FXEB 3FHNA 3F57A 4PFOA 4IGUA 1KNZA 2VASA 4E7SA 3ANWA 5HWYA 3HI2A 4CXYA 1U4QA 5F8PA 2BVLA 2KZ7B 1UCUA 2BDEA 3NBXX 4KBMB 4O4HE 3N9OA 2JMHA 2W61A 2PFVA 4V1Av 4B6XA 4CI3B 4AI6A 3NZPA 4X20E 3WI3A 3RRWA 2CWYA 4BJNA 3N9QA 2JPFA 3PURA 4U74A 4XBFB 4NUUA 4X1KE 3FBZA 4TX5A 3ZMZB 3MJXA 4DMVA 3NRYA 1YKEB 2CXFA 4ISSA 5JDFA 4IHJE 2CM0A 4YLHA 4AXPA 3AB3B 5JH7E 2X9XA 2D2SA 3KV4A 3GWHA 3NRXA 5LGNB 5ETWA 5JR9B 4XAXB 3W15B 4TZ4C 2CA5A 4AKIA 1FMVA 3GN5A 2E9XC 1AJ3A 2NW7A 5JR9C 3K3QC 1FMWA 3Q9DA 2HH7A 2H7OA 5LOVE 5H6QB 2IW5B 2E9XD 3L09A 3O4XE 5GONE 2KMFA 4CXXA 5F3JA 3AA0B 2K48A 5LJNA 5FY7A 3ZMSB 4X1YE 1D1AA 1WR6A 3HKDE 2MBGA 5ADXL 5L3GB 1IJ6A 1MNEA 4ZS3A 1OWAA 3ZYKA 5IYZE 3AA6B 3BQLA 3F31A 3KV9A 3LG7A 2XAQB 4L0RA 2KNDA 2W62A 1MIWA 4WNKA 3SWHA 4JEUB 4MFRA 2VK9A 2UXNB 5KDMC 1IAPA 5FY0A 3V5SA 3HR0A 4TV9E 3R84B 5FMNA 2L9QA 4ANJA 2LJLA 3E0ZA 5JDHA 4IE0A 4DNDA 4EXTA 3RYHE 2CE7A 4C91A 1NAFA 2C5JA 3PU8A 4IDZA 5FXZA 3Q5WA 5HYAA 4HTEA 1IJ5A 4HKAA 3PUQA 1G8XA 3AAEB 4P09A 5LYJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWG A;  2DWK A;  4GIW A;  2CXL A;  2CXF A;  3CWZ B; 
#chains in the Genus database with same CATH topology
 2YEV C;  2ZMA A;  3UU6 A;  3ANW B;  3AE5 A;  2CXD A;  3QOF A;  1BR0 A;  1HG2 A;  2X66 A;  4QH1 A;  1YQ4 A;  3JC6 D;  2WS3 A;  3MA9 A;  2VL8 A;  2LRL A;  2XAJ B;  3ESL A;  1CHU A;  2FJD A;  5AQN B;  5AQV B;  2ZM6 T;  3T1H T;  4G2A A;  2K24 A;  4NUV A;  1Z0P A;  2JQK A;  2QGS A;  3LK4 2;  2CWO A;  4HWF A;  5LJM A;  2UXD T;  3RH3 A;  4YSX A;  4HFB A;  2ES0 A;  2P9B A;  3JAE A;  4HFV A;  4UV9 B;  3C51 A;  3UQ4 A;  2VVS A;  5JRE A;  2W2U A;  4EAH A;  3SS1 A;  4QH5 A;  2V8S V;  5LBM A;  4AIU A;  5J2U E;  2NTX A;  4B3R T;  1KNP A;  2A3D A;  2XQ8 A;  5AQO B;  1IBL T;  4HFD A;  4O8S A;  4DV4 T;  4WW0 A;  2N9D A;  4HE8 A;  1YW0 A;  4U33 A;  3QB5 K;  4H63 V;  5AFU L;  4UXN B;  1HG5 A;  4FJO A;  2XJ7 A;  5HWX A;  1B7T A;  1UX5 A;  2VKJ A;  3PU3 A;  4IIJ E;  4OHF A;  3L8R A;  4A98 A;  1HFA A;  4DUY T;  2VKO A;  3CX6 B;  3UUX B;  5FVL A;  4C90 A;  5CA0 E;  5L3C B;  1VOM A;  4OX9 T;  3H3M A;  1JNR A;  4UVB B;  2HPJ A;  4TWF A;  2RA1 A;  2X9H A;  3QK6 A;  3PUW F;  3TLW A;  4JLE A;  2IDO B;  4UIG A;  1X79 A;  1D1C A;  1FEW A;  2VVN A;  4LF5 T;  3C98 B;  3EUH A;  5AQP B;  2WDV A;  2ZLY A;  2CBJ A;  4ZI3 C;  5A1L A;  4DV3 T;  3B57 A;  1XWM A;  2X67 A;  1HNW T;  4Z90 A;  3ZPO A;  5DAB A;  5HXR A;  1HTJ F;  2CEA A;  4PFP A;  5L3F B;  4JI6 T;  2LRK A;  1LVK A;  2C5K T;  2WU5 A;  5JRC A;  2NWB A;  3EI0 A;  4IE5 A;  4U2Y A;  5LB7 B;  3ZCI A;  4LF7 T;  3VU7 H;  4EGW A;  3DP7 A;  5FL0 A;  4AQF A;  4X1I E;  4M1P A;  3AE2 A;  4UF0 A;  4X62 T;  2BBH A;  2LOP A;  2V7L A;  3OVU A;  5HCM A;  3UTK A;  5BMV E;  2CLY B;  2W66 A;  1HX1 B;  1VRB A;  2XQ4 A;  2Y8D A;  3N9L A;  4ILU A;  2VKH A;  4I43 B;  5JVD E;  3ZJ1 A;  1Z8U A;  2YDQ A;  2WP9 A;  3LK2 B;  3N9P A;  3ETV A;  5EZY E;  2BS3 A;  2J4G A;  3QB5 A;  3CML A;  4H9R C;  3L39 A;  2D0T A;  3RIF A;  2CPT A;  2DHR A;  2LSK A;  4HN9 A;  3J9X 1;  2Z6E A;  3AEA A;  3AE6 A;  4ILC A;  5EK4 A;  4PJN A;  4YSZ A;  2I59 A;  2V5C A;  1YD8 G;  1BR2 A;  4TWH A;  2X0L B;  1N32 T;  4CI2 B;  4N78 D;  2A9U A;  2LSY A;  3N2K E;  2LHN A;  4LMK A;  3AEF A;  4IL4 A;  5AQF B;  5JDN A;  4AQY T;  2G0U A;  2GK9 A;  3MXZ A;  1N34 T;  4JI1 T;  4YHH T;  5DQV A;  3SRZ A;  3RC8 A;  5CJ5 A;  4YY3 T;  4L9I A;  3KDS E;  2WSS V;  5EK2 A;  4JI4 T;  1XNR T;  3C50 A;  2LM2 A;  5LXT E;  4EB6 E;  2N2N A;  2XQA A;  3AED A;  4H63 H;  4CZZ B;  3P4P A;  4DMW A;  2V26 A;  4QWN B;  4PK6 A;  2Q9Q D;  1E7P A;  1MND A;  1D0Y A;  3A7M A;  4HWI B;  1HCI A;  3KBT A;  4IRE A;  3DJB A;  3V5U A;  4OFZ A;  3RF1 A;  3WAK A;  1GQE A;  2LSI A;  2CXL A;  1LRZ A;  5JQG E;  4O2B E;  2WDQ A;  3LJC A;  5L4H A;  3TKL B;  2CLY C;  3FZH B;  4BAY B;  4U7Y A;  4EOZ B;  5HXS A;  3KBU A;  4LF4 T;  4GIW A;  2VL0 A;  3J7Y q;  2IIU A;  3AA1 B;  5DJQ C;  3PUY F;  3ZJ2 A;  3HA4 A;  4QX7 B;  1QLB A;  2AE9 A;  3FZF B;  4DUZ T;  1XZY A;  1XDO A;  3AA7 B;  2XY8 B;  3ZYM A;  3ZT5 A;  4O4L E;  3D0T A;  4DO0 A;  4JBW F;  5JDL A;  1D0Z A;  4AKL A;  3ZYL A;  3A5X A;  3RKG A;  3RX6 A;  5LGT B;  2W0G A;  4LF8 T;  4GK0 E;  2XZE A;  3EAB A;  4NPP A;  2NTY A;  2IUB A;  3RKO A;  4MBQ A;  3U3I A;  2IC9 A;  1ZV4 X;  2WDR A;  2MTQ A;  3P7I A;  5FVK A;  4ZHQ E;  3HKC E;  5FP3 A;  3UUB A;  2XQ7 A;  3I9W A;  3OTO T;  2DLR A;  3QNU A;  4PJJ A;  2NOX A;  3BQK A;  4Z91 A;  3AE4 A;  4UV8 B;  1V9D A;  2MPK A;  3CIR A;  2ZM0 A;  4KP3 C;  3ABV A;  5FXV A;  3CQG B;  4IDO A;  2E9X A;  1Y01 A;  3EVY A;  3PUZ F;  3RQW A;  3TLT A;  4DID B;  2M6B A;  4ILB A;  4DBQ A;  2J1D G;  5M4Y A;  2X51 A;  1J1J A;  2Y48 B;  3ZC0 A;  5IUX A;  2QYW A;  3F2E A;  3LDQ B;  4AKG A;  2JJ9 A;  3X1D A;  1OED B;  1E2A A;  2DWK A;  1KK7 A;  2FUP A;  2JQQ A;  3C4W A;  3CKD A;  4K0U A;  1LKX A;  2KLQ A;  3K8P C;  4FI5 A;  1OXZ A;  2NW9 A;  4ERR A;  2XUE A;  4YSY A;  1YKH B;  2XPK A;  3WAJ A;  2UU9 T;  3U78 A;  2WZH A;  3AAI A;  2VKD A;  1U5P A;  5HYA A;  4EIW A;  5L3D B;  3UQ7 A;  2KXP B;  4X66 T;  2NW8 A;  4QXC B;  1XMO T;  3SFD A;  3AEC A;  3Q5D A;  4YFS A;  2YKS A;  2XAF B;  4UF0 B;  3I0O A;  4ADZ A;  2CCQ A;  4O2A E;  5C2T A;  2JQH A;  2WM9 A;  5HXE A;  4ZXL A;  4JI7 T;  1WRD A;  2RP4 A;  2V7M A;  3RC3 A;  3ZKR A;  1DU2 A;  4EYY R;  3AE8 A;  4P0B A;  2WQY A;  4YTP A;  2D0U A;  2WWV A;  3TLU A;  2XQ9 A;  4UVC B;  2XQ3 A;  3I0Q A;  2E5L T;  2XQY A;  3N2O A;  1L0V A;  2V7I A;  3RYF E;  4B3S T;  2EHO C;  2XSA A;  5LNK A;  5HEU A;  4E7Z A;  1SHZ C;  3LSV A;  4EXT A;  4YHJ A;  4IL9 A;  4TUY E;  4KX6 A;  2X9Y A;  2MYS A;  2EHO B;  2WB5 A;  3ONX A;  2J47 A;  2LLY A;  1NWM X;  3C64 A;  4JI0 T;  3Q5X A;  4P0A A;  3OYZ A;  4MLK A;  4ZEY A;  3FZM B;  2VUR A;  3Q2M A;  1MMD A;  3IA3 A;  4MAL A;  2M67 A;  2LKG A;  2BBJ A;  3O1J A;  4UEM A;  3ETU A;  5FXX A;  4K0K T;  4OK0 A;  4PK5 A;  5IHY A;  2EHO D;  4U7I A;  5IWA T;  3ZN0 B;  3UUN A;  3LBX A;  4BJM A;  4AKH A;  5AQM B;  3ZT7 A;  4ZI2 D;  2B76 A;  3VKH A;  4Z8X A;  1G73 A;  1UUR A;  4UR9 A;  2WBL A;  3PUS A;  3VR9 A;  1UGO A;  4KI0 F;  3P8C D;  2JQ9 A;  2UUC T;  2A2F X;  2WZI A;  1W9R A;  4I50 E;  1HF8 A;  3K3N A;  4MHC A;  4DR3 T;  3N5L A;  2Q9Q C;  2LSG A;  3O1I A;  3ZST A;  3OBV E;  3KVA A;  1IBK T;  1E1H B;  2W67 A;  4TNV A;  3B5M A;  5AQS B;  5CA1 E;  4H9N C;  3ZMV B;  1X9B A;  1W0B A;  4PAG A;  5CB4 E;  4UVA B;  5ABG A;  3FBL A;  4J2C A;  3AE1 A;  4DR1 T;  3T1Y T;  3RLF F;  2SPC A;  2F4V T;  3JAD A;  2I6H A;  4JEH B;  3HKB E;  5AQL B;  5AQR B;  5FY1 A;  1FIO A;  5JR9 A;  1S35 A;  3IBP A;  2D5U A;  4WBN E;  2ACZ A;  3QUJ A;  1M7K A;  2YDR A;  3P4Q A;  4IE6 A;  5C8Y E;  5L3E B;  5BR8 T;  2UUA T;  2IHR 1;  2OLT A;  2D9D A;  4H9O C;  3AVS A;  3T8O A;  2L8K A;  1WYC A;  3N9N A;  2WCA A;  4A97 A;  1N33 T;  3I1A A;  3TLS A;  4HFC A;  3DTO A;  2Q9Q A;  3E22 E;  3UT5 E;  2LHR A;  4ASK A;  5LP6 E;  3SOL A;  3GA8 A;  4I55 E;  4YJ2 E;  2A72 A;  2YDS A;  4LFB T;  2C0S A;  5LHH B;  2KT9 A;  3PUG A;  5E0O A;  2CBI A;  2CMR A;  2LKH A;  2Q9Q B;  2R6G F;  1WFD A;  4IE4 A;  1YQ3 A;  2X68 A;  3CPZ A;  4PJL A;  2K5B B;  2WWU A;  3PDY A;  2E8I A;  2B1E A;  3ZLI A;  2ODU A;  3NVO A;  2LEH A;  3RYI E;  2WMO A;  4GOU A;  2V5D A;  2KWI B;  2BKO A;  3CX7 B;  1IZN B;  4IT4 A;  4DR4 T;  2BG9 B;  3H3A A;  2H3R A;  1EZ3 A;  2MOZ A;  3M65 A;  3UFG A;  4OYK A;  5L4E A;  4DVD A;  3AXJ B;  3TLV A;  1ZOY A;  3AE7 A;  2XM2 A;  1T8B A;  3HKE E;  3KV5 A;  3BQI A;  4WYV A;  3UUL A;  3IHR A;  1JNZ A;  2DNX A;  2BKN A;  1KNR A;  2V7K A;  3N9M A;  4JI5 T;  3CQC B;  3R6N A;  4CN6 A;  4DV5 T;  1I6Z A;  5FNV E;  3JAF A;  4PW8 A;  1WYB A;  2PTF A;  4U72 A;  4PJM A;  3O1H A;  2VWA A;  4YJ3 E;  3ZT6 A;  4JI3 T;  5JDG A;  1MIY A;  2XAS B;  3BK9 A;  3GN5 B;  4HEA A;  4TN7 B;  2VB6 A;  3AEE A;  3PUA A;  5HAX A;  1MMN A;  2QRX A;  3VKG A;  5HEJ A;  1XDP A;  1ZEE A;  2LE8 A;  2E2A A;  3K3O A;  1VCS A;  1YXR A;  2FBW A;  4EEB A;  2NR4 A;  4KHZ F;  3KVB A;  3PJA A;  4AQF C;  4CQI A;  3ONJ A;  1BR4 A;  1UK5 A;  3CK6 A;  5HXH A;  3L3P A;  1SE7 A;  2JRK A;  3AAA B;  4I4T E;  3QC9 A;  4UEL A;  3FB2 A;  4U31 A;  1SUM B;  3JCF A;  4DBR A;  4AIS A;  5J2T E;  1MIV A;  4X65 T;  2VQE T;  2LT3 A;  3CVR A;  2N1G A;  2XAH B;  2EHO A;  4XZC A;  1T98 A;  3P4W A;  2UUB T;  3FZK B;  3O9X A;  2YU2 A;  3ZEF B;  1BR1 A;  3PE0 A;  5L3B B;  3FXD B;  4ZS2 A;  3KFW X;  3PJA J;  2CHN A;  1OED C;  2WU2 A;  3AE3 A;  2V6Y B;  2DL1 A;  5AQU B;  5HXC A;  5LA6 E;  1OED E;  2ZM2 A;  2ZM8 A;  1W09 A;  3M3Z B;  5FXW A;  3VRB A;  5LG4 A;  2FJB A;  2XQ6 A;  3LK3 B;  3LFM A;  1ZP0 A;  3LBX B;  2V1D B;  4QXH B;  5HEH A;  4BA9 A;  2XAG B;  1HX8 A;  1M62 A;  1S94 A;  2LSJ A;  3PUV F;  4H9P C;  4ZOL E;  5AQT B;  4ZZC A;  3IF8 B;  4B3T T;  2UXC T;  5H6R B;  1N36 T;  5LCY A;  2KSR A;  2KWH A;  1WCR A;  3EDV A;  3MAC A;  4DR7 T;  4ZI3 D;  5JTG A;  5FYM A;  4F8H A;  3RIU C;  4QXB B;  3RRC A;  4YXD A;  3PTR B;  5JDM A;  4KHP T;  2UXB T;  3AEG A;  4YTM A;  2YU1 A;  5AQG B;  3AE9 A;  3UU4 A;  4EZ4 A;  3MKD A;  1HS7 A;  3PV0 F;  3ZMU B;  1R8I A;  4GKK T;  3NZQ A;  4P1N A;  3HL6 A;  1OED A;  3AVR A;  1ZKE A;  1XNQ T;  5L2L A;  4LFC T;  4GYS A;  3CX8 B;  2IAK A;  2JIW A;  2YK0 A;  1HNZ T;  4IE7 A;  4KUM B;  3E08 A;  2DI4 A;  2E9X B;  1D0X A;  4NIQ A;  4LMJ A;  5LBQ B;  4ZI2 C;  1QSD A;  4DR5 T;  3I9Y A;  5EK3 A;  4IDQ A;  1QUU A;  2IML A;  4CI1 B;  5LMN T;  1MMG A;  2PBI A;  2WAU A;  3VHL A;  4TV8 E;  4L5G A;  3EAM A;  3NWI A;  5AQI B;  4DV2 T;  4CXW A;  2W63 A;  4HWH A;  4HFI A;  4U3C A;  3UFE A;  4A5X A;  4JI8 T;  4O4I E;  2NP9 A;  1MMA A;  4G63 A;  1WLX A;  2WMN A;  3P50 A;  3MZK B;  3AEB A;  4AQG A;  1ZHC A;  2JMK A;  2RPA A;  3IEE A;  3K1S A;  4JUY A;  5LGU B;  4DV7 T;  1O3X A;  5KXJ A;  3C4X A;  3KV6 A;  2HHH T;  4AKR B;  2K9A A;  2XQ5 A;  5AQK B;  2PJQ A;  4DV1 T;  4EYU A;  3UUM A;  2C5I T;  2L3L A;  2ODV A;  3G06 A;  4Q25 A;  1T7S A;  5LMU T;  4NXN T;  4PK4 A;  5JRC B;  3ZCJ A;  1CUN A;  4YT0 A;  2M6I A;  5AQH B;  1T72 A;  2BS2 A;  3GMI A;  4QHO A;  4F6R C;  1HNX T;  2DWG A;  2V6Y A;  4A56 A;  4OYJ A;  4EZH A;  5KMG P;  2OA5 A;  2CRB A;  2W00 A;  5J0Z A;  1SA0 E;  5ABE A;  2Y6X A;  1D1B A;  1Y64 B;  2BKP A;  1FJG T;  1US7 B;  4IST A;  2FJA A;  2FJE A;  2HPL A;  5F5W A;  2AXD S;  2CHO A;  2YIN A;  4I0U A;  3OJA A;  5DQW A;  4EV6 A;  5LHI B;  2UXX B;  3ZMT B;  4PNI A;  4GK5 E;  5J1G A;  5LHG B;  4LF6 T;  5JDQ A;  5TAO A;  5CFB A;  4QX8 B;  3RYC E;  3ZN1 B;  3N2G E;  4H9S E;  5AQJ B;  1LVF A;  3CWZ B;  3JC6 C;  4WBO A;  4H9Q C;  1H7C A;  4KMC A;  5AQQ B;  3ZC1 A;  5KX5 E;  1NEN A;  2IC6 A;  2QA7 A;  4ILA A;  2LOS A;  2PG8 A;  2BVM A;  3KIN B;  4HGA A;  2DCF A;  2XSB A;  4O4J E;  3UU8 A;  3NKZ A;  3B13 A;  3H37 A;  3OYX A;  2VQF T;  3EDU A;  2KIN B;  4GYR A;  2X9W A;  2XTL A;  3RI5 A;  4ZI7 E;  2V7J A;  5FL1 A;  3C4Z A;  3S4U A;  3CQX C;  5ABH A;  2H7V C;  4QKN A;  2J62 A;  2BZB A;  3RGL A;  2QVA A;  3RPU A;  2ACX A;  1I94 T;  1VCT A;  2LM9 A;  2OV9 A;  5HCJ A;  3SFE A;  2XHE B;  1UX4 A;  3VRA A;  4JYA T;  3P4R A;  3VR8 A;  3MK7 C;  3OKQ A;  3FXE B;  3RHW A;  3FHN A;  1W0A A;  3F57 A;  4JV5 T;  4PFO A;  4IGU A;  1KNZ A;  2VAS A;  4E7S A;  3ANW A;  5HWY A;  3HI2 A;  4CXY A;  2E5V A;  1U4Q A;  2BG9 A;  2H88 A;  3OPC A;  3PUX F;  4HWC A;  4LF9 T;  5F8P A;  2BVL A;  3P4S A;  2KZ7 B;  1UCU A;  2HN1 A;  4DR6 T;  2BDE A;  3NBX X;  3A8Y C;  4KBM B;  4O4H E;  4QH4 A;  3N9O A;  2JMH A;  2W61 A;  2PFV A;  4V1A v;  4B6X A;  4CI3 B;  4ZZB A;  2W4X A;  3NZP A;  4X20 E;  3WI3 A;  2X0Y A;  3RRW A;  4DR2 T;  4AI6 A;  2CWY A;  4BJN A;  3N9Q A;  4EED A;  1WR0 A;  2HN2 A;  2JPF A;  3PUR A;  4IDP A;  4U74 A;  1UUS A;  4XBF B;  4LFA T;  3RIU A;  4NUU A;  4X1K E;  3FBZ A;  5HEO A;  3FZL B;  4TX5 A;  3ZMZ B;  3MJX A;  5ABF B;  4HFH A;  3NRY A;  1YKE B;  4DMV A;  2CXF A;  4ISS A;  4LML A;  4IHJ E;  5JDF A;  2CM0 A;  4YLH A;  4AXP A;  3AB3 B;  5JH7 E;  2X9X A;  2BG9 C;  2D2S A;  3GWH A;  3KV4 A;  3NRX A;  4HWD A;  2XM1 A;  4COF A;  4CN1 A;  5LGN B;  2WY2 A;  5ETW A;  5JR9 B;  4XAX B;  3W15 B;  4TZ4 C;  3ZSS A;  2CA5 A;  4WZX A;  4B3M T;  3UU3 A;  4AKI A;  1FMV A;  5CGM A;  3GN5 A;  2E9X C;  1AJ3 A;  2NW7 A;  5JR9 C;  3K3Q C;  1FMW A;  3Q9D A;  2HH7 A;  5L47 A;  2H7O A;  2BS4 A;  5FKY A;  5H6Q B;  5LOV E;  2IW5 B;  2E9X D;  4U2Z A;  3L09 A;  5HEG A;  3O4X E;  4IDN A;  5GON E;  1J5E T;  2KMF A;  4TNW A;  4CXX A;  5F3J A;  3AA0 B;  5LG3 A;  2K48 A;  2YOE A;  5FY7 A;  3ZMS B;  2BG9 E;  4X1Y E;  5C3J A;  5LJN A;  1D1A A;  1WR6 A;  3HKD E;  2MBG A;  1KFY A;  4CN4 A;  5ADX L;  1IJ6 A;  5L3G B;  1MNE A;  4ZS3 A;  1OWA A;  3ZYK A;  5IYZ E;  1J5W A;  3AA6 B;  3BQL A;  3F31 A;  3KV9 A;  3LG7 A;  2XAQ B;  4L0R A;  2KND A;  4DV6 T;  1IBM T;  2W62 A;  1KF6 A;  1MIW A;  2YN6 A;  4WNK A;  4X5T A;  2I0M A;  4JEU B;  4MFR A;  3SWH A;  4YTN A;  4X64 T;  1HR0 T;  2VK9 A;  2X0H A;  2UXN B;  5ABF A;  1IAP A;  5FY0 A;  3V5S A;  3HR0 A;  4TV9 E;  5KDM C;  1XMQ T;  3R84 B;  5FMN A;  3Q5E A;  4HFE A;  3UU5 A;  2K3W A;  2MAW A;  2L9Q A;  4DV0 T;  4ANJ A;  2LJL A;  3E0Z A;  2V6X A;  4JI2 T;  5JDH A;  4IE0 A;  3ONL C;  4NXM T;  4DND A;  4TWD A;  3RYH E;  2CE7 A;  4C91 A;  3EHZ A;  1NAF A;  2C5J A;  3PU8 A;  3AXJ A;  1NEK A;  3Q5W A;  4IDZ A;  4HTE A;  1IJ5 A;  5FXZ A;  4HKA A;  3RIA A;  2H89 A;  3PUQ A;  3RQU A;  4GKJ T;  1G8X A;  1KEY A;  3AAE B;  4P09 A;  5LYJ E; 
#chains in the Genus database with same CATH homology
 2YEV C;  2ZMA A;  3ANW B;  2CXD A;  1BR0 A;  1HG2 A;  2X66 A;  3JC6 D;  3MA9 A;  2VL8 A;  2XAJ B;  3ESL A;  4G2A A;  2K24 A;  4NUV A;  1Z0P A;  2QGS A;  3LK4 2;  5LJM A;  2CWO A;  3RH3 A;  2ES0 A;  2P9B A;  4HFV A;  4UV9 B;  3C51 A;  5JRE A;  4EAH A;  3SS1 A;  5LBM A;  5J2U E;  2NTX A;  2A3D A;  4O8S A;  4WW0 A;  2N9D A;  4HE8 A;  1YW0 A;  4H63 V;  5AFU L;  4UXN B;  1HG5 A;  4FJO A;  5HWX A;  1B7T A;  1UX5 A;  2VKJ A;  3PU3 A;  4IIJ E;  4OHF A;  1HFA A;  2VKO A;  3CX6 B;  3UUX B;  4C90 A;  5CA0 E;  5L3C B;  1VOM A;  4UVB B;  2HPJ A;  2RA1 A;  2X9H A;  3QK6 A;  4JLE A;  4UIG A;  1X79 A;  1D1C A;  1FEW A;  3C98 B;  3EUH A;  4ZI3 C;  2ZLY A;  5A1L A;  3B57 A;  2X67 A;  3ZPO A;  5DAB A;  5HXR A;  1HTJ F;  2CEA A;  4PFP A;  5L3F B;  1LVK A;  2C5K T;  5JRC A;  2NWB A;  4IE5 A;  3ZCI A;  3VU7 H;  3DP7 A;  4AQF A;  4X1I E;  4M1P A;  4UF0 A;  2LOP A;  3UTK A;  2V7L A;  5BMV E;  2CLY B;  1VRB A;  2Y8D A;  4I43 B;  3N9L A;  4ILU A;  2VKH A;  3ZJ1 A;  5JVD E;  5EZY E;  3N9P A;  3LK2 B;  3ETV A;  3CML A;  4H9R C;  2D0T A;  2DHR A;  2LSK A;  4HN9 A;  3J9X 1;  2Z6E A;  5EK4 A;  4PJN A;  2I59 A;  1YD8 G;  1BR2 A;  2X0L B;  4CI2 B;  4N78 D;  2LSY A;  3N2K E;  2LHN A;  5JDN A;  2G0U A;  2GK9 A;  3MXZ A;  5DQV A;  3SRZ A;  3RC8 A;  4L9I A;  3KDS E;  2WSS V;  5EK2 A;  3C50 A;  5LXT E;  4EB6 E;  2N2N A;  4H63 H;  4CZZ B;  4DMW A;  2V26 A;  4QWN B;  4PK6 A;  2Q9Q D;  1MND A;  1D0Y A;  1HCI A;  3KBT A;  3DJB A;  3V5U A;  4OFZ A;  3WAK A;  2LSI A;  5JQG E;  2CXL A;  1LRZ A;  4O2B E;  3LJC A;  3TKL B;  2CLY C;  4BAY B;  4EOZ B;  5HXS A;  3KBU A;  4GIW A;  3AA1 B;  5DJQ C;  3ZJ2 A;  3HA4 A;  4QX7 B;  3AA7 B;  3ZYM A;  4O4L E;  3D0T A;  4DO0 A;  5JDL A;  1D0Z A;  4AKL A;  3ZYL A;  3A5X A;  5LGT B;  3RX6 A;  2W0G A;  4GK0 E;  2NTY A;  3RKO A;  4MBQ A;  3U3I A;  2IC9 A;  1ZV4 X;  3P7I A;  2MTQ A;  4ZHQ E;  3HKC E;  5FP3 A;  3I9W A;  2DLR A;  5LHG B;  4PJJ A;  2NOX A;  3BQK A;  4UV8 B;  1V9D A;  4KP3 C;  2ZM0 A;  5FXV A;  3CQG B;  2E9X A;  3EVY A;  4DBQ A;  2J1D G;  5M4Y A;  2X51 A;  2Y48 B;  3ZC0 A;  3F2E A;  4AKG A;  2JJ9 A;  2DWK A;  1KK7 A;  3C4W A;  2JQQ A;  4K0U A;  3CKD A;  2NW9 A;  1LKX A;  2KLQ A;  3K8P C;  4FI5 A;  1OXZ A;  4ERR A;  3WAJ A;  2XUE A;  1YKH B;  3U78 A;  3AAI A;  2VKD A;  1U5P A;  4EIW A;  5L3D B;  2KXP B;  2NW8 A;  4QXC B;  4ADZ A;  4YFS A;  2XAF B;  4UF0 B;  3I0O A;  5HXE A;  2CCQ A;  4O2A E;  2WM9 A;  1WRD A;  2RP4 A;  2V7M A;  3RC3 A;  4EYY R;  4P0B A;  2D0U A;  4UVC B;  3I0Q A;  2XQY A;  3N2O A;  3RYF E;  2V7I A;  2EHO C;  5LNK A;  4E7Z A;  1SHZ C;  4YHJ A;  4TUY E;  2X9Y A;  2MYS A;  2EHO B;  3ONX A;  1NWM X;  3C64 A;  3Q5X A;  4P0A A;  3OYZ A;  4MLK A;  3Q2M A;  1MMD A;  4MAL A;  2M67 A;  5FXX A;  3O1J A;  4UEM A;  3ETU A;  4OK0 A;  4PK5 A;  5IHY A;  2EHO D;  3ZN0 B;  3UUN A;  3LBX A;  4BJM A;  4AKH A;  4ZI2 D;  3VKH A;  4Z8X A;  1G73 A;  2WBL A;  3PUS A;  3P8C D;  2A2F X;  4I50 E;  1HF8 A;  3K3N A;  4MHC A;  3N5L A;  2Q9Q C;  2LSG A;  3O1I A;  3OBV E;  3KVA A;  1E1H B;  5CA1 E;  4H9N C;  3ZMV B;  4PAG A;  5CB4 E;  4UVA B;  3FBL A;  4J2C A;  2SPC A;  5FY1 A;  4JEH B;  3HKB E;  1FIO A;  5JR9 A;  1S35 A;  3IBP A;  2D5U A;  4WBN E;  3QUJ A;  5L3E B;  4IE6 A;  5C8Y E;  4H9O C;  3AVS A;  3T8O A;  2L8K A;  1WYC A;  3N9N A;  3I1A A;  3DTO A;  2Q9Q A;  3E22 E;  3UT5 E;  2LHR A;  4ASK A;  5LP6 E;  3SOL A;  3GA8 A;  4I55 E;  4YJ2 E;  2A72 A;  2C0S A;  5LHH B;  2KT9 A;  3PUG A;  5E0O A;  2CMR A;  2Q9Q B;  4IE4 A;  4PJL A;  3J7Y q;  2X68 A;  3CPZ A;  2K5B B;  2WWU A;  3PDY A;  2E8I A;  2B1E A;  3ZLI A;  2ODU A;  2LEH A;  3RYI E;  2WMO A;  4GOU A;  3CX7 B;  2KWI B;  1IZN B;  3H3A A;  2H3R A;  1EZ3 A;  2MOZ A;  3M65 A;  4OYK A;  4DVD A;  3HKE E;  3KV5 A;  3BQI A;  3UUL A;  3IHR A;  2DNX A;  2V7K A;  3R6N A;  3N9M A;  3CQC B;  5FNV E;  4PW8 A;  1WYB A;  4U72 A;  4PJM A;  3O1H A;  2VWA A;  4YJ3 E;  5JDG A;  1MIY A;  2XAS B;  3BK9 A;  3GN5 B;  4HEA A;  4TN7 B;  2VB6 A;  3PUA A;  5HAX A;  1MMN A;  3VKG A;  1ZEE A;  3K3O A;  2LE8 A;  3KVB A;  4AQF C;  4CQI A;  1BR4 A;  5HXH A;  3L3P A;  2JRK A;  3AAA B;  4I4T E;  3QC9 A;  4UEL A;  3FB2 A;  4DBR A;  5J2T E;  1MIV A;  2LT3 A;  3CVR A;  2N1G A;  2XAH B;  2EHO A;  4XZC A;  1T98 A;  3O9X A;  2YU2 A;  3ZEF B;  1BR1 A;  3PE0 A;  5L3B B;  3FXD B;  4ZS2 A;  3KFW X;  5HXC A;  3ZMU B;  5LA6 E;  5FXW A;  2ZM2 A;  2ZM8 A;  5LG4 A;  3LK3 B;  3LFM A;  3LBX B;  4QXH B;  2V1D B;  2XAG B;  1HX8 A;  1S94 A;  2LSJ A;  4ZOL E;  4H9P C;  3IF8 B;  5H6R B;  5LCY A;  3MAC A;  2KWH A;  3EDV A;  4ZI3 D;  5FYM A;  4QXB B;  3RRC A;  5JDM A;  3PTR B;  2YU1 A;  4EZ4 A;  3MKD A;  1HS7 A;  3NZQ A;  3HL6 A;  3AVR A;  1ZKE A;  5L2L A;  4GYS A;  3CX8 B;  2IAK A;  2YK0 A;  4IE7 A;  4KUM B;  3E08 A;  2DI4 A;  2E9X B;  1D0X A;  5LBQ B;  4ZI2 C;  1QSD A;  3I9Y A;  5EK3 A;  1QUU A;  4CI1 B;  1MMG A;  2PBI A;  2WAU A;  3VHL A;  4TV8 E;  4L5G A;  4CXW A;  2W63 A;  3UFE A;  4O4I E;  2NP9 A;  1MMA A;  4G63 A;  1WLX A;  2WMN A;  3MZK B;  4AQG A;  1ZHC A;  2JMK A;  3IEE A;  4JUY A;  5LGU B;  1O3X A;  3C4X A;  3KV6 A;  4AKR B;  2K9A A;  2PJQ A;  4EYU A;  3UUM A;  2C5I T;  2L3L A;  2ODV A;  5JRC B;  4PK4 A;  3ZCJ A;  1CUN A;  3GMI A;  4QHO A;  4F6R C;  2DWG A;  4A56 A;  4OYJ A;  4EZH A;  5KMG P;  2OA5 A;  2W00 A;  1SA0 E;  2Y6X A;  1D1B A;  1Y64 B;  1US7 B;  4IST A;  2HPL A;  5LHI B;  2YIN A;  3OJA A;  5DQW A;  2UXX B;  3ZMT B;  4PNI A;  4GK5 E;  5J1G A;  5JDQ A;  5TAO A;  4QX8 B;  3RYC E;  3ZN1 B;  3N2G E;  4H9S E;  1LVF A;  3CWZ B;  3JC6 C;  4WBO A;  4H9Q C;  1H7C A;  4KMC A;  3ZC1 A;  5KX5 E;  2QA7 A;  2IC6 A;  2LOS A;  2PG8 A;  2BVM A;  3KIN B;  4HGA A;  2DCF A;  4O4J E;  4BA9 A;  3B13 A;  3H37 A;  3OYX A;  3EDU A;  2KIN B;  4GYR A;  2X9W A;  2XTL A;  4ZI7 E;  2V7J A;  3C4Z A;  3S4U A;  3CQX C;  2H7V C;  4QKN A;  2BZB A;  3RPU A;  2ACX A;  2LM9 A;  2XHE B;  1UX4 A;  3MK7 C;  3OKQ A;  3FXE B;  3FHN A;  3F57 A;  4PFO A;  4IGU A;  1KNZ A;  2VAS A;  4E7S A;  3ANW A;  5HWY A;  3HI2 A;  4CXY A;  1U4Q A;  5F8P A;  2BVL A;  2KZ7 B;  1UCU A;  2BDE A;  3NBX X;  4KBM B;  4O4H E;  3N9O A;  2JMH A;  2W61 A;  2PFV A;  4V1A v;  4B6X A;  4CI3 B;  4AI6 A;  3NZP A;  4X20 E;  3WI3 A;  3RRW A;  2CWY A;  4BJN A;  3N9Q A;  2JPF A;  3PUR A;  4U74 A;  4XBF B;  4NUU A;  4X1K E;  3FBZ A;  4TX5 A;  3ZMZ B;  3MJX A;  4DMV A;  3NRY A;  1YKE B;  2CXF A;  4ISS A;  5JDF A;  4IHJ E;  2CM0 A;  4YLH A;  4AXP A;  3AB3 B;  5JH7 E;  2X9X A;  2D2S A;  3KV4 A;  3GWH A;  3NRX A;  5LGN B;  5ETW A;  5JR9 B;  4XAX B;  3W15 B;  4TZ4 C;  2CA5 A;  4AKI A;  1FMV A;  3GN5 A;  2E9X C;  1AJ3 A;  2NW7 A;  5JR9 C;  3K3Q C;  1FMW A;  3Q9D A;  2HH7 A;  2H7O A;  5LOV E;  5H6Q B;  2IW5 B;  2E9X D;  3L09 A;  3O4X E;  5GON E;  2KMF A;  4CXX A;  5F3J A;  3AA0 B;  2K48 A;  5LJN A;  5FY7 A;  3ZMS B;  4X1Y E;  1D1A A;  1WR6 A;  3HKD E;  2MBG A;  5ADX L;  5L3G B;  1IJ6 A;  1MNE A;  4ZS3 A;  1OWA A;  3ZYK A;  5IYZ E;  3AA6 B;  3BQL A;  3F31 A;  3KV9 A;  3LG7 A;  2XAQ B;  4L0R A;  2KND A;  2W62 A;  1MIW A;  4WNK A;  3SWH A;  4JEU B;  4MFR A;  2VK9 A;  2UXN B;  5KDM C;  1IAP A;  5FY0 A;  3V5S A;  3HR0 A;  4TV9 E;  3R84 B;  5FMN A;  2L9Q A;  4ANJ A;  2LJL A;  3E0Z A;  5JDH A;  4IE0 A;  4DND A;  4EXT A;  3RYH E;  2CE7 A;  4C91 A;  1NAF A;  2C5J A;  3PU8 A;  4IDZ A;  5FXZ A;  3Q5W A;  5HYA A;  4HTE A;  1IJ5 A;  4HKA A;  3PUQ A;  1G8X A;  3AAE B;  4P09 A;  5LYJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...