2DWKA

Crystal structure of the run domain of mouse rap2 interacting protein x
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
162
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RUFY3
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 47
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwkA00
3CWZB 4GIWA 2DWGA 2CXLA 2DWKA 2CXFA
chains in the Genus database with same CATH superfamily
3AECA 4YTPA 5H6RB 2XM2A 3ZYLA 2ACXA 5JDLA 2V26A 3LDQB 3QB5K 3JC6C 5ADXL 2X68A 1HFAA 3K8PC 4DVDA 2ZM6T 4O4LE 1CUNA 4HFEA 3HKDE 4P0BA 3ONLC 3RC8A 3MXZA 2R6GF 4P09A 2WY2A 5ETWA 2OLTA 1IZNB 3ABVA 3E0ZA 3GN5A 3C4XA 3ZN0B 1T8BA 4GKKT 4IHJE 3Q5XA 4EZ4A 3FZKB 4DV3T 2CMRA 3A8YC 4XBFB 1YW0A 1WLXA 4CXXA 3RGLA 3C64A 4ILUA 1HX1B 3AE3A 2PJQA 2C5KT 3ZMZB 4I55E 3DP7A 1US7B 1UCUA 4IIJE 3ZMSB 3RPUA 5LBQB 5JR9B 2IC6A 2BS2A 3HKEE 3UTKA 4WNKA 3NZQA 4CN1A 2HPLA 4JI4T 4UVCB 2LHRA 3OBVE 1SUMB 1Y01A 5AQMB 3ZN1B 4AKHA 2IDOB 1NWMX 4HWHA 3QB5A 3ZC1A 2FJAA 2WQYA 3FZFB 3KV4A 3DTOA 2NTXA 2XSBA 3PUGA 4O4HE 4ILAA 2MPKA 2QGSA 2CE7A 4IE4A 5FVKA 1UX5A 2J4GA 2BKNA 2WU5A 3HA4A 5L2LA 4LMKA 3QUJA 3LK3B 2LSGA 2X9XA 4U31A 2WDRA 2BKOA 4JBWF 5AQLB 4ZI3C 4GK5E 2UUAT 5FXXA 1HF8A 4HFHA 2HH7A 3AEGA 2BS4A 3AAIA 2W67A 3Q9DA 2B76A 2X9WA 1IBMT 5AQOB 2X0YA 5HXRA 4QH4A 4QHOA 3VKHA 1VCTA 3EAMA 4O4IE 3I1AA 3EI0A 2DCFA 4YT0A 4I4TE 2WBLA 2QRXA 2WWUA 2EHOC 5HXSA 3CX8B 2X0LB 4TX5A 3UU6A 2W0GA 2AXDS 4ZI7E 3M3ZB 2VVNA 2IIUA 3E08A 3F31A 2ZM8A 5HXCA 1IJ5A 3VRBA 3VRAA 1W9RA 2WM9A 3WAJA 2CWYA 3NWIA 4L0RA 4TWHA 3M65A 1NENA 5LXTE 5JRCB 2ZM0A 2PTFA 5LYJE 4JEUB 4NUVA 4UV9B 3RIFA 2MTQA 3LBXB 4O8SA 2JJ9A 3I0OA 3CQGB 3UUMA 3K3QC 5L3FB 2N2NA 4TWDA 2X9HA 3CPZA 3AB3B 3Q5WA 5HEGA 3ETUA 1MMAA 2LE8A 2CCQA 4X1IE 5GONE 3H3MA 3KVAA 2FUPA 4EGWA 5IHYA 3UU5A 3C50A 3PV0F 3FBZA 1D1AA 4HWIB 5L3GB 3IBPA 4HGAA 1KFYA 3KV6A 4ERRA 1D1CA 4TWFA 1FMWA 4PK4A 3RYHE 2H7OA 3Q5EA 3WAKA 2C5JA 5JH7E 3KV5A 3IF8B 5FVLA 4DNDA 2NP9A 2BG9A 3AEFA 1XDPA 3V5SA 5L47A 4ZI2C 1G73A 3P8CD 4JI6T 1MMNA 2LT3A 3X1DA 5HWYA 2CXFA 3PUQA 3PURA 2WDQA 1B7TA 3NKZA 3RF1A 2JRKA 2VQFT 5FY7A 2M6BA 2XZEA 4DR3T 3JCFA 2CXLA 2A9UA 1OEDE 4QX8B 4ILCA 2K48A 2XTLA 4MALA 2D0UA 1OEDB 4AKIA 3W15B 4L9IA 4DV2T 2CBIA 2WSSV 2V6YA 3A5XA 3ZKRA 3MKDA 2LKGA 2WB5A 4ZEYA 3HI2A 3AE6A 2ODVA 3NBXX 3AE4A 3ZSSA 5FKYA 2LRLA 1FIOA 2BVLA 5FMNA 1MNEA 4CXWA 3L3PA 4JV5T 3OPCA 4CN4A 4DO0A 4ILBA 4IDZA 5ABFB 4LFBT 3ZPOA 2K24A 4Z8XA 1S35A 4CXYA 4IDQA 1D1BA 1W0AA 2JMHA 2CBJA 2LM9A 5HEJA 2Z6EA 4QH1A 3AE5A 3B57A 4YTNA 4J2CA 4NUUA 4DV4T 2LM2A 3T8OA 4B3ST 2YINA 1NEKA 1O3XA 2X51A 2IW5B 5AQNB 2H3RA 3S4UA 5FY0A 3AE9A 2J1DG 4KBMB 1V9DA 2X67A 4WZXA 1X9BA 4XAXB 2V1DB 3NZPA 2LSKA 5LBMA 5LP6E 2ZLYA 2XPKA 3TLVA 4I50E 2X0HA 4ANJA 3O4XE 2UUCT 4A97A 3OYXA 1WRDA 3AEAA 3JAEA 4YY3T 1N36T 3ESLA 3SFEA 2DWKA 3AAAB 2KLQA 3FHNA 2DLRA 3PU8A 4LF6T 3OKQA 4B3TT 3TLTA 3PUVF 2NOXA 1YXRA 3AA1B 4HFDA 1WR6A 2CM0A 2VWAA 2KNDA 4H9NC 2V5CA 5DJQC 4BJNA 4C91A 4DBQA 2A2FX 4DUYT 1KEYA 1OXZA 2JQ9A 3P4PA 5BMVE 4GK0E 2Q9QA 3T1YT 5HXHA 3AE8A 3EABA 2NR4A 4ISSA 3A7MA 3GN5B 4LF8T 4DR7T 4YXDA 2OV9A 4KHPT 5FL1A 1QUUA 3IA3A 4KMCA 4PK5A 2KT9A 3UT5E 3NVOA 5FXWA 3J7Yq 2JPFA 1G8XA 4PJJA 2KXPB 4MBQA 2D2SA 2V7KA 2GK9A 3FXEB 4LF7T 2WWVA 4IDPA 4MHCA 3AE7A 4GIWA 4HWCA 4JI7T 3FBLA 5L4EA 1YQ3A 3CK6A 2DNXA 2VQET 2IAKA 5JDHA 2XAFB 2DL1A 2WZIA 4DV6T 4U7IA 3BQKA 5L3DB 4AQGA 4JI8T 1SHZC 4K0KT 4PK6A 3RYFE 2XAGB 3EDVA 2FBWA 4CI2B 4TNVA 2CA5A 2YEVC 4KX6A 1ZHCA 4ZZCA 4X1KE 1ZP0A 4IGUA 4JI2T 4AIUA 4K0UA 3UUXB 4TZ4C 5HWXA 5JDQA 4AISA 3HL6A 3UU3A 4HWDA 4IDOA 5AQPB 4U74A 5LGUB 2XQYA 2PFVA 5JR9A 4PJLA 1MIVA 3PUAA 1VCSA 4P0AA 2VKDA 4Z90A 4UVBB 4PJNA 3ZSTA 1E2AA 4EXTA 4TV8E 4KI0F 1QSDA 2W66A 5AQHB 3N9MA 2Q9QD 3O1HA 2VKOA 3CVRA 4JEHB 3AVSA 2XAQB 5JREA 2M6IA 4X65T 4JYAT 3GMIA 3N9OA 4AQFA 1J1JA 4WW0A 3IHRA 4B6XA 4CI1B 2E9XD 1ZV4X 3NRXA 2YDSA 1DU2A 5H6QB 2XJ7A 3RH3A 5HYAA 3AA7B 3D0TA 5LGNB 2HN1A 4UF0A 2VL0A 4H63V 4X20E 1N32T 1XMQT 1E7PA 2XUEA 3AAEB 4LMJA 4PW8A 4A98A 2BKPA 3PUXF 4JI3T 2XQ4A 1LVKA 4LF9T 1IAPA 4HFCA 4ISTA 3T1HT 4JI0T 4JLEA 5FL0A 4IE7A 1ZKEA 5HEUA 2DHRA 4ZHQE 4H9OC 2X9YA 2LLYA 2EHOB 4CZZB 4YFSA 5M4YA 1W0BA 2LOPA 1BR4A 3OYZA 4NXNT 2JIWA 3ANWB 2VL8A 3AA0B 1HNXT 5J2UE 3ZYKA 2WS3A 4DMVA 4HFBA 4DV0T 4I43B 2D9DA 1N33T 4UV8B 3VR8A 4UELA 3TKLB 3SS1A 4MLKA 2KSRA 3AXJB 2KINB 3O1JA 5ABGA 3AA6B 3L09A 1MIYA 2K9AA 5JRCA 2VKJA 1FMVA 2L8KA 3UUBA 4YJ2E 2YN6A 3LK42 1UK5A 4Q25A 3RIUA 1WYBA 2XAHB 3TLWA 3KBTA 3ZJ2A 3RKGA 2FJBA 3ZYMA 4UEMA 2WDVA 3RC3A 2XQ9A 1HS7A 2LOSA 3LJCA 4H9PC 5HAXA 3U3IA 3JADA 4DBRA 1YKHB 2H7VC 2XASB 2LJLA 2UUBT 4ZS2A 3P50A 2CHOA 1UURA 3RQWA 4KUMB 5CB4E 2VB6A 5BR8T 3RX6A 4WYVA 2BBJA 2NW8A 5FP3A 2V6YB 3CX7B 5EZYE 4LF4T 5AQQB 4EOZB 1LKXA 4OYKA 5LG3A 1M62A 2W00A 4LF5T 1SE7A 2YDQA 3F57A 2CXDA 4U3CA 3AE2A 4A56A 2JMKA 3O9XA 4NIQA 3UU4A 4EYUA 3PUZF 5CA1E 2P9BA 1XDOA 5EK2A 4DR4T 4X5TA 3VHLA 3EVYA 3ZMUB 2JQQA 2I59A 1T98A 3CIRA 3Q2MA 5HCJA 2LKHA 1D0ZA 2BS3A 3LSVA 5C3JA 1I6ZA 2V7JA 4NXMT 5C2TA 1XNQT 2QYWA 5KMGP 2KZ7B 1OEDA 2W62A 3RRWA 3P4WA 1T7SA 1JNRA 5LA6E 2XHEB 2YOEA 5AQRB 4AKRB 2V7MA 3GA8A 3EHZA 3UULA 3VKGA 3P4QA 5LCYA 2N1GA 2XM1A 1U5PA 3N9LA 2K3WA 3P4SA 3RHWA 5FXZA 2ACZA 3ONXA 2WU2A 1HTJF 2AE9A 1YKEB 3ZT7A 2N9DA 5EK3A 3BQLA 4HE8A 5F5WA 5FNVE 3FB2A 3RRCA 5ABFA 3HKCE 3UU8A 4OFZA 3RYCE 4X1YE 4OYJA 3SRZA 2W61A 2V7LA 4TN7B 3RI5A 4XZCA 4PNIA 5ABHA 4YLHA 1IJ6A 4IE5A 1J5WA 3AVRA 5AQTB 3MA9A 3SOLA 3PE0A 3RQUA 3ETVA 4YSYA 3JAFA 2UU9T 3UFGA 5ABEA 4LMLA 2Q9QC 2L9QA 1HG5A 2XQ6A 2I6HA 3BQIA 3VR9A 1KK7A 1OWAA 2BDEA 5LGTB 4TNWA 3C4ZA 4DR6T 2D0TA 2XQAA 2Y8DA 2YDRA 4M1PA 2BBHA 5FXVA 4P1NA 1BR2A 2CWOA 3LFMA 5C8YE 3OVUA 3N9PA 5DABA 1WR0A 5AQFB 3SWHA 3CX6B 5E0OA 4N78D 1KF6A 3PDYA 1M7KA 3ZC0A 3K1SA 5LJMA 2V8SV 5HCMA 5A1LA 5CJ5A 1HR0T 4EV6A 3RIAA 2YU1A 5EK4A 3CWZB 4X62T 3HKBE 1HX8A 3EDUA 5LB7B 3PUYF 1GQEA 1XZYA 3SFDA 2KWIB 2MBGA 4HEAA 4A5XA 3ZT5A 2RA1A 4MFRA 5LG4A 3MK7C 3AE1A 3ZCIA 2PBIA 4JI1T 3L8RA 1WYCA 1U4QA 4EAHA 4QX7B 3BK9A 3I9WA 4O2AE 4YJ3E 4H63H 2PG8A 2E9XA 5J0ZA 5HEOA 3FZLB 5JDGA 3PU3A 3PTRB 3K3OA 4YSXA 2BVMA 3C4WA 3NRYA 2ODUA 1MNDA 5JDMA 3I0QA 5J2TE 3QK6A 4NPPA 2UXBT 3ONJA 2W2UA 2UXXB 5JR9C 2RP4A 2B1EA 4HTEA 2VASA 5AQIB 5JDNA 4U33A 4LFAT 2MYSA 3N9NA 1L0VA 2E2AA 4WBNE 2W63A 4IDNA 3E22E 4QH5A 3Q5DA 1SA0E 5AQVB 3B13A 2HN2A 4ZXLA 2QA7A 2XSAA 5LHGB 4EEBA 3QOFA 4JUYA 4AQFC 1ZEEA 1UX4A 3H3AA 4LFCT 1WFDA 3N9QA 4G63A 3ZMVB 3KV9A 1R8IA 3OJAA 4JI5T 2A72A 2CPTA 1XNRT 3CMLA 3HR0A 2KWHA 4H9RC 4L5GA 4IE6A 3KVBA 1H7CA 4OK0A 2NW7A 4AXPA 4UXNB 4EZHA 3B5MA 4OX9T 2IMLA 4FI5A 4EYYR 5AQGB 4B3RT 1QLBA 5F8PA 4TV9E 4DMWA 2CLYC 2UXDT 3KBUA 1N34T 5JQGE 3LG7A 1HG2A 4UF0B 3PUSA 4PFOA 3IEEA 1CHUA 5L4HA 2LSYA 3QNUA 5LOVE 2VKHA 2LEHA 3PJAA 2XQ5A 1Z8UA 4DIDB 2F4VT 1UGOA 2W4XA 4H9SE 3KDSE 2CLYB 3L39A 2NTYA 3UUNA 2WMNA 2CEAA 4DUZT 5CGMA 2IUBA 2V6XA 4I0UA 3RLFF 5HXEA 5LHIB 3FXDB 2YKSA 3DJBA 4KHZF 1MMGA 4CN6A 2UXCT 4E7SA 1I94T 4HFIA 2WMOA 4UR9A 3FZHB 4U7YA 3J9X1 5KXJA 5L3CB 4H9QC 3N2KE 1WCRA 3JC6D 4DV5T 1J5ET 4IT4A 1YD8G 1IBLT 4IREA 1IBKT 2V7IA 4BAYB 3R6NA 3RIUC 3VU7H 3QC9A 2IC9A 3AEDA 2C0SA 2X66A 3N2GE 4TUYE 4UVAB 2BG9C 4U72A 5L3EB 2NW9A 2MOZA 2IHR1 4YHJA 2V5DA 3N5LA 1JNZA 1FJGT 4QXCB 2K5BB 2NWBA 2EHOA 2ZMAA 1VOMA 1XWMA 3ZCJA 4COFA 1S94A 1KNZA 1VRBA 2H89A 4PAGA 2UXNB 5DQWA 4EIWA 2BG9E 2DWGA 4U2YA 1HNZT 4EEDA 2WZHA 2BG9B 2VK9A 1YQ4A 5FY1A 3H37A 2E5LT 4CQIA 3ANWA 3LBXA 3ZJ1A 2LSJA 4GYSA 2L3LA 2WAUA 3UFEA 2OA5A 3PUWF 5LJNA 2FJEA 1AJ3A 1HCIA 5KX5E 3AEBA 2KMFA 4AKGA 4HN9A 4ADZA 3AXJA 4DV7T 3ZMTB 4FJOA 3UQ7A 4QXHB 3I9YA 1W09A 4UIGA 3N2OA 1MMDA 4DV1T 1KNRA 3RKOA 1Y64B 4U2ZA 3CQXC 2FJDA 1OEDC 2I0MA 1Z0PA 5LNKA 5TAOA 4AKLA 2J62A 4ZS3A 1UUSA 1ZOYA 2XQ8A 4EB6E 1LRZA 3FZMB 1FEWA 4O4JE 5LMNT 5AQUB 3C51A 1HNWT 3WI3A 1NAFA 2JQKA 1BR1A 4X64T 5J1GA 4ZI3D 2LRKA 2ZM2A 2A3DA 3ZT6A 3MJXA 4V1Av 4GKJT 5L3BB 4F8HA 2XY8B 3ZLIA 4C90A 3TLUA 1E1HB 4ZOLE 3CQCB 4BJMA 3MACA 2MAWA 3TLSA 1KNPA 3LK2B 2LSIA 4F6RC 4DR5T 4BA9A 5JTGA 3P4RA 1T72A 2VURA 5LHHB 3CKDA 4GOUA 2D5UA 3MZKB 4DR2T 2EHOD 4B3MT 2XQ7A 3U78A 2RPAA 1MIWA 5KDMC 5AFUL 2VVSA 4CI3B 2DI4A 1D0YA 3AEEA 4IL4A 1X79A 3G06A 4YSZA 2G0UA 3UQ4A 4X66T 1BR0A 5CFBA 3OTOT 4Z91A 3KFWX 3K3NA 2ES0A 2XAJB 3RYIE 5IUXA 4YHHT 2C5IT 1LVFA 2WCAA 3F2EA 3PJAJ 2HPJA 4G2AA 2HHHT 2BZBA 5JDFA 5AQKB 5JVDE 4HFVA 3ZEFB 4ZZBA 5DQVA 3P7IA 4QWNB 4AQYT 4GYRA 2H88A 3EUHA 4HWFA 2CRBA 4ASKA 4OHFA 2QVAA 2E9XC 4IE0A 2JQHA 2E5VA 4IL9A 3KINB 4WBOA 4PJMA 2E8IA 2YU2A 4AI6A 3C98B 4KP3C 2J47A 5HEHA 2SPCA 2Q9QB 5FYMA 1EZ3A 1XMOT 5IYZE 5AQJB 2CHNA 4QKNA 4HKAA 4O2BE 3R84B 2E9XB 5F3JA 4DR1T 4YTMA 3V5UA 2WP9A 4ZI2D 3O1IA 4E7ZA 5CA0E 4QXBB 5LMUT 2Y48B 5IWAT 2M67A 2XQ3A 2LHNA 3GWHA 4PFPA 2YK0A 2Y6XA 1D0XA 5AQSB
chains in the Genus database with same CATH topology
4IDZA 2KINB 3O1JA 5H6RB 3ZYLA 2ACXA 3KBUA 3AA6B 3L09A 1MIYA 2V26A 5JDLA 2K9AA 5JRCA 2VKJA 5JQGE 3ZPOA 3JC6C 1HG2A 3LG7A 5ADXL 1FMVA 4UF0B 2K24A 4Z8XA 3PUSA 2X68A 4PFOA 3IEEA 1HFAA 2L8KA 3K8PC 4DVDA 4YJ2E 1S35A 4O4LE 4CXYA 1CUNA 1D1BA 3HKDE 3LK42 2JMHA 2LSYA 5LOVE 2VKHA 4P0BA 2LM9A 2LEHA 2Z6EA 3B57A 3RC8A 1WYBA 2XAHB 3MXZA 4J2CA 3KBTA 3ZJ2A 4NUUA 3T8OA 4H9SE 4P09A 5ETWA 2YINA 3ZYMA 4UEMA 3RC3A 3KDSE 2CLYB 1IZNB 1O3XA 2X51A 2NTYA 2IW5B 3E0ZA 1HS7A 2LOSA 3C4XA 3GN5A 3UUNA 3ZN0B 3LJCA 2H3RA 4H9PC 5HAXA 3U3IA 2WMNA 2CEAA 4IHJE 3S4UA 3Q5XA 4DBRA 5FY0A 1YKHB 2H7VC 2XASB 4EZ4A 2LJLA 4ZS2A 5HXEA 5LHIB 2CMRA 3FXDB 4XBFB 1YW0A 1WLXA 4KUMB 5CB4E 2VB6A 4CXXA 2J1DG 4KBMB 1V9DA 3DJBA 3RX6A 2NW8A 3C64A 5FP3A 4ILUA 1MMGA 3CX7B 5EZYE 2X67A 4E7SA 4XAXB 2PJQA 4EOZB 1LKXA 2C5KT 4OYKA 2V1DB 2WMOA 3ZMZB 2W00A 3NZPA 4I55E 3J9X1 3DP7A 1US7B 1UCUA 4IIJE 2LSKA 5LBMA 3ZMSB 3F57A 5LP6E 2CXDA 3RPUA 5L3CB 2ZLYA 5LBQB 5JR9B 2IC6A 3HKEE 4H9QC 3UTKA 3N2KE 4WNKA 3JC6D 4I50E 3NZQA 4ANJA 3O4XE 1YD8G 4A56A 2JMKA 3O9XA 3OYXA 1WRDA 2HPLA 2V7IA 4BAYB 4EYUA 4UVCB 5CA1E 3R6NA 2P9BA 5EK2A 2LHRA 3OBVE 3VU7H 3QC9A 3ESLA 2IC9A 2X66A 2C0SA 2DWKA 3VHLA 3ZN1B 3N2GE 4TUYE 4UVAB 4AKHA 3AAAB 3EVYA 2KLQA 3ZMUB 2JQQA 1NWMX 2I59A 1T98A 4U72A 5L3EB 2NW9A 2MOZA 2DLRA 3FHNA 3PU8A 3Q2MA 3OKQA 1D0ZA 2NOXA 3AA1B 3ZC1A 2V7JA 1WR6A 4YHJA 2CM0A 3KV4A 3DTOA 3N5LA 2VWAA 2KNDA 4H9NC 5KMGP 4QXCB 2NTXA 5DJQC 2K5BB 3PUGA 4O4HE 2KZ7B 4BJNA 4C91A 4DBQA 2NWBA 2EHOA 2QGSA 2W62A 2ZMAA 2A2FX 1VOMA 3RRWA 3ZCJA 5LA6E 1OXZA 2XHEB 2CE7A 4IE4A 1S94A 1UX5A 1VRBA 4AKRB 1KNZA 2V7MA 4PAGA 2UXNB 5DQWA 4EIWA 5BMVE 3HA4A 4GK0E 5L2LA 2DWGA 3QUJA 3GA8A 3LK3B 3UULA 2LSGA 2Q9QA 2X9XA 5HXHA 3VKGA 2VK9A 5FY1A 3H37A 5LCYA 2N1GA 4ISSA 4CQIA 3ANWA 1U5PA 3LBXA 4ZI3C 3ZJ1A 3N9LA 3GN5B 2LSJA 4GK5E 4GYSA 5FXZA 5FXXA 2L3LA 2WAUA 3ONXA 1HF8A 3UFEA 1HTJF 2OA5A 5LJNA 1YKEB 2HH7A 1AJ3A 1HCIA 5KX5E 2KMFA 3AAIA 4AKGA 4HN9A 2N9DA 1QUUA 4ADZA 5EK3A 3BQLA 4HE8A 4KMCA 3Q9DA 4PK5A 5FNVE 3FB2A 2KT9A 3UT5E 2X9WA 5FXWA 3J7Yq 3ZMTB 4FJOA 2JPFA 4QHOA 5HXRA 1G8XA 3RRCA 4QXHB 3VKHA 3HKCE 4OFZA 4PJJA 3I9YA 3RYCE 4X1YE 4OYJA 2KXPB 4MBQA 4O4IE 4UIGA 2D2SA 3I1AA 3SRZA 2V7KA 2DCFA 3N2OA 2GK9A 2W61A 2V7LA 1MMDA 3FXEB 4I4TE 4TN7B 4MHCA 4XZCA 3RKOA 1Y64B 2WBLA 4GIWA 2WWUA 4PNIA 3CQXC 4YLHA 1IJ6A 3FBLA 2EHOC 4IE5A 5HXSA 3CX8B 2X0LB 3AVRA 2DNXA 3MA9A 4TX5A 3SOLA 3PE0A 1Z0PA 5LNKA 2IAKA 3ETVA 2XAFB 5TAOA 5JDHA 4AKLA 4ZS3A 2Q9QC 3BQKA 5L3DB 4AQGA 2W0GA 4EB6E 2L9QA 1HG5A 1LRZA 4ZI7E 1FEWA 3BQIA 4O4JE 1KK7A 3C51A 1SHZC 1OWAA 3WI3A 2BDEA 5LGTB 1NAFA 3E08A 4PK6A 3F31A 3RYFE 2XAGB 1BR1A 2ZM8A 5J1GA 3C4ZA 4ZI3D 5HXCA 3EDVA 1IJ5A 2ZM2A 2A3DA 2D0TA 4CI2B 2Y8DA 2WM9A 3WAJA 2CA5A 3MJXA 2YEVC 4V1Av 5L3BB 4M1PA 1ZHCA 4X1KE 2CWYA 4L0RA 5FXVA 3ZLIA 4C90A 4IGUA 1E1HB 4ZOLE 4K0UA 3M65A 3CQCB 4BJMA 1BR2A 2CWOA 3LFMA 3MACA 4TZ4C 3UUXB 5C8YE 5HWXA 3N9PA 5LXTE 5JDQA 2ZM0A 5DABA 5JRCB 3HL6A 3SWHA 5LYJE 3CX6B 4JEUB 3LK2B 4NUVA 2LSIA 4UV9B 5E0OA 4F6RC 4N78D 3PDYA 3ZC0A 5LJMA 4U74A 5A1LA 5LGUB 2XQYA 2PFVA 2MTQA 4BA9A 3LBXB 4O8SA 2JJ9A 3I0OA 5JR9A 4PJLA 3CQGB 1MIVA 5LHHB 3UUMA 3CKDA 3K3QC 3PUAA 4GOUA 5L3FB 2N2NA 2D5UA 2X9HA 3MZKB 2YU1A 4P0AA 3CPZA 2VKDA 5EK4A 3CWZB 3AB3B 4UVBB 2EHOD 3HKBE 1HX8A 3Q5WA 3EDUA 4PJNA 3ETUA 1MMAA 2LE8A 2CCQA 2KWIB 3U78A 2MBGA 4HEAA 4EXTA 2RA1A 4MFRA 4TV8E 5LG4A 1QSDA 3MK7C 3ZCIA 2PBIA 4X1IE 1MIWA 5GONE 5KDMC 3N9MA 5AFUL 1WYCA 4CI3B 1U4QA 2DI4A 4EAHA 3KVAA 2Q9QD 3O1HA 4QX7B 2VKOA 3BK9A 3CVRA 3I9WA 4JEHB 3AVSA 2XAQB 4O2AE 4YJ3E 5IHYA 5JREA 4H63H 2PG8A 1D0YA 3GMIA 2E9XA 3N9OA 3C50A 3FBZA 1X79A 1D1AA 5JDGA 4AQFA 5L3GB 4WW0A 3IBPA 3IHRA 4B6XA 2G0UA 4HGAA 3PU3A 4CI1B 2E9XD 1ZV4X 3KV6A 4ERRA 1BR0A 1D1CA 3NRXA 3PTRB 3K3OA 1FMWA 4PK4A 3KFWX 5H6QB 3RYHE 2H7OA 2BVMA 3WAKA 3C4WA 2C5JA 3NRYA 2ODUA 1MNDA 3RH3A 5JH7E 3KV5A 5HYAA 3AA7B 3K3NA 3D0TA 3IF8B 5JDMA 3I0QA 4DNDA 5LGNB 2ES0A 2XAJB 5J2TE 4UF0A 3RYIE 2NP9A 4H63V 3QK6A 4X20E 2C5IT 1LVFA 3V5SA 2XUEA 3AAEB 2UXXB 4ZI2C 5JR9C 1G73A 3P8CD 4PW8A 2RP4A 3F2EA 2B1EA 1MMNA 2LT3A 4HTEA 2HPJA 4G2AA 2BZBA 5HWYA 2VASA 5JDFA 5JDNA 5JVDE 2CXFA 3PUQA 3PURA 1LVKA 4HFVA 3ZEFB 2MYSA 5DQVA 1B7TA 3N9NA 3P7IA 4QWNB 4WBNE 2W63A 2JRKA 5FY7A 1IAPA 4GYRA 3E22E 3EUHA 1SA0E 4ISTA 3B13A 4JLEA 4ASKA 4OHFA 2CXLA 2QA7A 2E9XC 5LHGB 4IE7A 1ZKEA 4IE0A 4QX8B 4JUYA 2DHRA 4ZHQE 2K48A 4AQFC 4H9OC 2XTLA 4MALA 2X9YA 2D0UA 1ZEEA 2EHOB 3KINB 4AKIA 3W15B 1UX4A 4WBOA 4PJMA 4L9IA 2E8IA 3H3AA 2YU2A 4AI6A 4CZZB 3C98B 3N9QA 2WSSV 4YFSA 4G63A 3A5XA 5M4YA 3ZMVB 4KP3C 2LOPA 3KV9A 1BR4A 3MKDA 3OJAA 2A72A 2SPCA 3OYZA 2Q9QB 3HI2A 5FYMA 1EZ3A 5IYZE 2ODVA 3NBXX 4QKNA 3CMLA 3HR0A 4HKAA 3ANWB 2KWHA 2VL8A 4H9RC 4O2BE 3R84B 3AA0B 4L5GA 1FIOA 4IE6A 2BVLA 3KVBA 5J2UE 1H7CA 2E9XB 5FMNA 4OK0A 3ZYKA 4DMVA 5F3JA 4I43B 2NW7A 3V5UA 4AXPA 4UXNB 4EZHA 4ZI2D 3O1IA 1MNEA 4UV8B 4E7ZA 5CA0E 4QXBB 4FI5A 4CXWA 4EYYR 2Y48B 3L3PA 4UELA 3TKLB 3SS1A 2M67A 5F8PA 4MLKA 2LHNA 3GWHA 4PFPA 4TV9E 2YK0A 4DMWA 2Y6XA 1D0XA 4DO0A 2CLYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWZ B;  4GIW A;  2DWG A;  2CXL A;  2DWK A;  2CXF A; 
#chains in the Genus database with same CATH topology
 3AEC A;  4YTP A;  5H6R B;  2XM2 A;  3ZYL A;  2ACX A;  5JDL A;  2V26 A;  3LDQ B;  3QB5 K;  3JC6 C;  5ADX L;  2X68 A;  1HFA A;  3K8P C;  4DVD A;  2ZM6 T;  4O4L E;  1CUN A;  4HFE A;  3HKD E;  4P0B A;  3ONL C;  3RC8 A;  3MXZ A;  2R6G F;  4P09 A;  2WY2 A;  5ETW A;  2OLT A;  1IZN B;  3ABV A;  3E0Z A;  3GN5 A;  3C4X A;  3ZN0 B;  1T8B A;  4GKK T;  4IHJ E;  3Q5X A;  4EZ4 A;  3FZK B;  4DV3 T;  2CMR A;  3A8Y C;  4XBF B;  1YW0 A;  1WLX A;  4CXX A;  3RGL A;  3C64 A;  4ILU A;  1HX1 B;  3AE3 A;  2PJQ A;  2C5K T;  3ZMZ B;  4I55 E;  3DP7 A;  1US7 B;  1UCU A;  4IIJ E;  3ZMS B;  3RPU A;  5LBQ B;  5JR9 B;  2IC6 A;  2BS2 A;  3HKE E;  3UTK A;  4WNK A;  3NZQ A;  4CN1 A;  2HPL A;  4JI4 T;  4UVC B;  2LHR A;  3OBV E;  1SUM B;  1Y01 A;  5AQM B;  3ZN1 B;  4AKH A;  2IDO B;  1NWM X;  4HWH A;  3QB5 A;  3ZC1 A;  2FJA A;  2WQY A;  3FZF B;  3KV4 A;  3DTO A;  2NTX A;  2XSB A;  3PUG A;  4O4H E;  4ILA A;  2MPK A;  2QGS A;  2CE7 A;  4IE4 A;  5FVK A;  1UX5 A;  2J4G A;  2BKN A;  2WU5 A;  3HA4 A;  5L2L A;  4LMK A;  3QUJ A;  3LK3 B;  2LSG A;  2X9X A;  4U31 A;  2WDR A;  2BKO A;  4JBW F;  5AQL B;  4ZI3 C;  4GK5 E;  2UUA T;  5FXX A;  1HF8 A;  4HFH A;  2HH7 A;  3AEG A;  2BS4 A;  3AAI A;  2W67 A;  3Q9D A;  2B76 A;  2X9W A;  1IBM T;  5AQO B;  2X0Y A;  5HXR A;  4QH4 A;  4QHO A;  3VKH A;  1VCT A;  3EAM A;  4O4I E;  3I1A A;  3EI0 A;  2DCF A;  4YT0 A;  4I4T E;  2WBL A;  2QRX A;  2WWU A;  2EHO C;  5HXS A;  3CX8 B;  2X0L B;  4TX5 A;  3UU6 A;  2W0G A;  2AXD S;  4ZI7 E;  3M3Z B;  2VVN A;  2IIU A;  3E08 A;  3F31 A;  2ZM8 A;  5HXC A;  1IJ5 A;  3VRB A;  3VRA A;  1W9R A;  2WM9 A;  3WAJ A;  2CWY A;  3NWI A;  4L0R A;  4TWH A;  3M65 A;  1NEN A;  5LXT E;  5JRC B;  2ZM0 A;  2PTF A;  5LYJ E;  4JEU B;  4NUV A;  4UV9 B;  3RIF A;  2MTQ A;  3LBX B;  4O8S A;  2JJ9 A;  3I0O A;  3CQG B;  3UUM A;  3K3Q C;  5L3F B;  2N2N A;  4TWD A;  2X9H A;  3CPZ A;  3AB3 B;  3Q5W A;  5HEG A;  3ETU A;  1MMA A;  2LE8 A;  2CCQ A;  4X1I E;  5GON E;  3H3M A;  3KVA A;  2FUP A;  4EGW A;  5IHY A;  3UU5 A;  3C50 A;  3PV0 F;  3FBZ A;  1D1A A;  4HWI B;  5L3G B;  3IBP A;  4HGA A;  1KFY A;  3KV6 A;  4ERR A;  1D1C A;  4TWF A;  1FMW A;  4PK4 A;  3RYH E;  2H7O A;  3Q5E A;  3WAK A;  2C5J A;  5JH7 E;  3KV5 A;  3IF8 B;  5FVL A;  4DND A;  2NP9 A;  2BG9 A;  3AEF A;  1XDP A;  3V5S A;  5L47 A;  4ZI2 C;  1G73 A;  3P8C D;  4JI6 T;  1MMN A;  2LT3 A;  3X1D A;  5HWY A;  2CXF A;  3PUQ A;  3PUR A;  2WDQ A;  1B7T A;  3NKZ A;  3RF1 A;  2JRK A;  2VQF T;  5FY7 A;  2M6B A;  2XZE A;  4DR3 T;  3JCF A;  2CXL A;  2A9U A;  1OED E;  4QX8 B;  4ILC A;  2K48 A;  2XTL A;  4MAL A;  2D0U A;  1OED B;  4AKI A;  3W15 B;  4L9I A;  4DV2 T;  2CBI A;  2WSS V;  2V6Y A;  3A5X A;  3ZKR A;  3MKD A;  2LKG A;  2WB5 A;  4ZEY A;  3HI2 A;  3AE6 A;  2ODV A;  3NBX X;  3AE4 A;  3ZSS A;  5FKY A;  2LRL A;  1FIO A;  2BVL A;  5FMN A;  1MNE A;  4CXW A;  3L3P A;  4JV5 T;  3OPC A;  4CN4 A;  4DO0 A;  4ILB A;  4IDZ A;  5ABF B;  4LFB T;  3ZPO A;  2K24 A;  4Z8X A;  1S35 A;  4CXY A;  4IDQ A;  1D1B A;  1W0A A;  2JMH A;  2CBJ A;  2LM9 A;  5HEJ A;  2Z6E A;  4QH1 A;  3AE5 A;  3B57 A;  4YTN A;  4J2C A;  4NUU A;  4DV4 T;  2LM2 A;  3T8O A;  4B3S T;  2YIN A;  1NEK A;  1O3X A;  2X51 A;  2IW5 B;  5AQN B;  2H3R A;  3S4U A;  5FY0 A;  3AE9 A;  2J1D G;  4KBM B;  1V9D A;  2X67 A;  4WZX A;  1X9B A;  4XAX B;  2V1D B;  3NZP A;  2LSK A;  5LBM A;  5LP6 E;  2ZLY A;  2XPK A;  3TLV A;  4I50 E;  2X0H A;  4ANJ A;  3O4X E;  2UUC T;  4A97 A;  3OYX A;  1WRD A;  3AEA A;  3JAE A;  4YY3 T;  1N36 T;  3ESL A;  3SFE A;  2DWK A;  3AAA B;  2KLQ A;  3FHN A;  2DLR A;  3PU8 A;  4LF6 T;  3OKQ A;  4B3T T;  3TLT A;  3PUV F;  2NOX A;  1YXR A;  3AA1 B;  4HFD A;  1WR6 A;  2CM0 A;  2VWA A;  2KND A;  4H9N C;  2V5C A;  5DJQ C;  4BJN A;  4C91 A;  4DBQ A;  2A2F X;  4DUY T;  1KEY A;  1OXZ A;  2JQ9 A;  3P4P A;  5BMV E;  4GK0 E;  2Q9Q A;  3T1Y T;  5HXH A;  3AE8 A;  3EAB A;  2NR4 A;  4ISS A;  3A7M A;  3GN5 B;  4LF8 T;  4DR7 T;  4YXD A;  2OV9 A;  4KHP T;  5FL1 A;  1QUU A;  3IA3 A;  4KMC A;  4PK5 A;  2KT9 A;  3UT5 E;  3NVO A;  5FXW A;  3J7Y q;  2JPF A;  1G8X A;  4PJJ A;  2KXP B;  4MBQ A;  2D2S A;  2V7K A;  2GK9 A;  3FXE B;  4LF7 T;  2WWV A;  4IDP A;  4MHC A;  3AE7 A;  4GIW A;  4HWC A;  4JI7 T;  3FBL A;  5L4E A;  1YQ3 A;  3CK6 A;  2DNX A;  2VQE T;  2IAK A;  5JDH A;  2XAF B;  2DL1 A;  2WZI A;  4DV6 T;  4U7I A;  3BQK A;  5L3D B;  4AQG A;  4JI8 T;  1SHZ C;  4K0K T;  4PK6 A;  3RYF E;  2XAG B;  3EDV A;  2FBW A;  4CI2 B;  4TNV A;  2CA5 A;  2YEV C;  4KX6 A;  1ZHC A;  4ZZC A;  4X1K E;  1ZP0 A;  4IGU A;  4JI2 T;  4AIU A;  4K0U A;  3UUX B;  4TZ4 C;  5HWX A;  5JDQ A;  4AIS A;  3HL6 A;  3UU3 A;  4HWD A;  4IDO A;  5AQP B;  4U74 A;  5LGU B;  2XQY A;  2PFV A;  5JR9 A;  4PJL A;  1MIV A;  3PUA A;  1VCS A;  4P0A A;  2VKD A;  4Z90 A;  4UVB B;  4PJN A;  3ZST A;  1E2A A;  4EXT A;  4TV8 E;  4KI0 F;  1QSD A;  2W66 A;  5AQH B;  3N9M A;  2Q9Q D;  3O1H A;  2VKO A;  3CVR A;  4JEH B;  3AVS A;  2XAQ B;  5JRE A;  2M6I A;  4X65 T;  4JYA T;  3GMI A;  3N9O A;  4AQF A;  1J1J A;  4WW0 A;  3IHR A;  4B6X A;  4CI1 B;  2E9X D;  1ZV4 X;  3NRX A;  2YDS A;  1DU2 A;  5H6Q B;  2XJ7 A;  3RH3 A;  5HYA A;  3AA7 B;  3D0T A;  5LGN B;  2HN1 A;  4UF0 A;  2VL0 A;  4H63 V;  4X20 E;  1N32 T;  1XMQ T;  1E7P A;  2XUE A;  3AAE B;  4LMJ A;  4PW8 A;  4A98 A;  2BKP A;  3PUX F;  4JI3 T;  2XQ4 A;  1LVK A;  4LF9 T;  1IAP A;  4HFC A;  4IST A;  3T1H T;  4JI0 T;  4JLE A;  5FL0 A;  4IE7 A;  1ZKE A;  5HEU A;  2DHR A;  4ZHQ E;  4H9O C;  2X9Y A;  2LLY A;  2EHO B;  4CZZ B;  4YFS A;  5M4Y A;  1W0B A;  2LOP A;  1BR4 A;  3OYZ A;  4NXN T;  2JIW A;  3ANW B;  2VL8 A;  3AA0 B;  1HNX T;  5J2U E;  3ZYK A;  2WS3 A;  4DMV A;  4HFB A;  4DV0 T;  4I43 B;  2D9D A;  1N33 T;  4UV8 B;  3VR8 A;  4UEL A;  3TKL B;  3SS1 A;  4MLK A;  2KSR A;  3AXJ B;  2KIN B;  3O1J A;  5ABG A;  3AA6 B;  3L09 A;  1MIY A;  2K9A A;  5JRC A;  2VKJ A;  1FMV A;  2L8K A;  3UUB A;  4YJ2 E;  2YN6 A;  3LK4 2;  1UK5 A;  4Q25 A;  3RIU A;  1WYB A;  2XAH B;  3TLW A;  3KBT A;  3ZJ2 A;  3RKG A;  2FJB A;  3ZYM A;  4UEM A;  2WDV A;  3RC3 A;  2XQ9 A;  1HS7 A;  2LOS A;  3LJC A;  4H9P C;  5HAX A;  3U3I A;  3JAD A;  4DBR A;  1YKH B;  2H7V C;  2XAS B;  2LJL A;  2UUB T;  4ZS2 A;  3P50 A;  2CHO A;  1UUR A;  3RQW A;  4KUM B;  5CB4 E;  2VB6 A;  5BR8 T;  3RX6 A;  4WYV A;  2BBJ A;  2NW8 A;  5FP3 A;  2V6Y B;  3CX7 B;  5EZY E;  4LF4 T;  5AQQ B;  4EOZ B;  1LKX A;  4OYK A;  5LG3 A;  1M62 A;  2W00 A;  4LF5 T;  1SE7 A;  2YDQ A;  3F57 A;  2CXD A;  4U3C A;  3AE2 A;  4A56 A;  2JMK A;  3O9X A;  4NIQ A;  3UU4 A;  4EYU A;  3PUZ F;  5CA1 E;  2P9B A;  1XDO A;  5EK2 A;  4DR4 T;  4X5T A;  3VHL A;  3EVY A;  3ZMU B;  2JQQ A;  2I59 A;  1T98 A;  3CIR A;  3Q2M A;  5HCJ A;  2LKH A;  1D0Z A;  2BS3 A;  3LSV A;  5C3J A;  1I6Z A;  2V7J A;  4NXM T;  5C2T A;  1XNQ T;  2QYW A;  5KMG P;  2KZ7 B;  1OED A;  2W62 A;  3RRW A;  3P4W A;  1T7S A;  1JNR A;  5LA6 E;  2XHE B;  2YOE A;  5AQR B;  4AKR B;  2V7M A;  3GA8 A;  3EHZ A;  3UUL A;  3VKG A;  3P4Q A;  5LCY A;  2N1G A;  2XM1 A;  1U5P A;  3N9L A;  2K3W A;  3P4S A;  3RHW A;  5FXZ A;  2ACZ A;  3ONX A;  2WU2 A;  1HTJ F;  2AE9 A;  1YKE B;  3ZT7 A;  2N9D A;  5EK3 A;  3BQL A;  4HE8 A;  5F5W A;  5FNV E;  3FB2 A;  3RRC A;  5ABF A;  3HKC E;  3UU8 A;  4OFZ A;  3RYC E;  4X1Y E;  4OYJ A;  3SRZ A;  2W61 A;  2V7L A;  4TN7 B;  3RI5 A;  4XZC A;  4PNI A;  5ABH A;  4YLH A;  1IJ6 A;  4IE5 A;  1J5W A;  3AVR A;  5AQT B;  3MA9 A;  3SOL A;  3PE0 A;  3RQU A;  3ETV A;  4YSY A;  3JAF A;  2UU9 T;  3UFG A;  5ABE A;  4LML A;  2Q9Q C;  2L9Q A;  1HG5 A;  2XQ6 A;  2I6H A;  3BQI A;  3VR9 A;  1KK7 A;  1OWA A;  2BDE A;  5LGT B;  4TNW A;  3C4Z A;  4DR6 T;  2D0T A;  2XQA A;  2Y8D A;  2YDR A;  4M1P A;  2BBH A;  5FXV A;  4P1N A;  1BR2 A;  2CWO A;  3LFM A;  5C8Y E;  3OVU A;  3N9P A;  5DAB A;  1WR0 A;  5AQF B;  3SWH A;  3CX6 B;  5E0O A;  4N78 D;  1KF6 A;  3PDY A;  1M7K A;  3ZC0 A;  3K1S A;  5LJM A;  2V8S V;  5HCM A;  5A1L A;  5CJ5 A;  1HR0 T;  4EV6 A;  3RIA A;  2YU1 A;  5EK4 A;  3CWZ B;  4X62 T;  3HKB E;  1HX8 A;  3EDU A;  5LB7 B;  3PUY F;  1GQE A;  1XZY A;  3SFD A;  2KWI B;  2MBG A;  4HEA A;  4A5X A;  3ZT5 A;  2RA1 A;  4MFR A;  5LG4 A;  3MK7 C;  3AE1 A;  3ZCI A;  2PBI A;  4JI1 T;  3L8R A;  1WYC A;  1U4Q A;  4EAH A;  4QX7 B;  3BK9 A;  3I9W A;  4O2A E;  4YJ3 E;  4H63 H;  2PG8 A;  2E9X A;  5J0Z A;  5HEO A;  3FZL B;  5JDG A;  3PU3 A;  3PTR B;  3K3O A;  4YSX A;  2BVM A;  3C4W A;  3NRY A;  2ODU A;  1MND A;  5JDM A;  3I0Q A;  5J2T E;  3QK6 A;  4NPP A;  2UXB T;  3ONJ A;  2W2U A;  2UXX B;  5JR9 C;  2RP4 A;  2B1E A;  4HTE A;  2VAS A;  5AQI B;  5JDN A;  4U33 A;  4LFA T;  2MYS A;  3N9N A;  1L0V A;  2E2A A;  4WBN E;  2W63 A;  4IDN A;  3E22 E;  4QH5 A;  3Q5D A;  1SA0 E;  5AQV B;  3B13 A;  2HN2 A;  4ZXL A;  2QA7 A;  2XSA A;  5LHG B;  4EEB A;  3QOF A;  4JUY A;  4AQF C;  1ZEE A;  1UX4 A;  3H3A A;  4LFC T;  1WFD A;  3N9Q A;  4G63 A;  3ZMV B;  3KV9 A;  1R8I A;  3OJA A;  4JI5 T;  2A72 A;  2CPT A;  1XNR T;  3CML A;  3HR0 A;  2KWH A;  4H9R C;  4L5G A;  4IE6 A;  3KVB A;  1H7C A;  4OK0 A;  2NW7 A;  4AXP A;  4UXN B;  4EZH A;  3B5M A;  4OX9 T;  2IML A;  4FI5 A;  4EYY R;  5AQG B;  4B3R T;  1QLB A;  5F8P A;  4TV9 E;  4DMW A;  2CLY C;  2UXD T;  3KBU A;  1N34 T;  5JQG E;  3LG7 A;  1HG2 A;  4UF0 B;  3PUS A;  4PFO A;  3IEE A;  1CHU A;  5L4H A;  2LSY A;  3QNU A;  5LOV E;  2VKH A;  2LEH A;  3PJA A;  2XQ5 A;  1Z8U A;  4DID B;  2F4V T;  1UGO A;  2W4X A;  4H9S E;  3KDS E;  2CLY B;  3L39 A;  2NTY A;  3UUN A;  2WMN A;  2CEA A;  4DUZ T;  5CGM A;  2IUB A;  2V6X A;  4I0U A;  3RLF F;  5HXE A;  5LHI B;  3FXD B;  2YKS A;  3DJB A;  4KHZ F;  1MMG A;  4CN6 A;  2UXC T;  4E7S A;  1I94 T;  4HFI A;  2WMO A;  4UR9 A;  3FZH B;  4U7Y A;  3J9X 1;  5KXJ A;  5L3C B;  4H9Q C;  3N2K E;  1WCR A;  3JC6 D;  4DV5 T;  1J5E T;  4IT4 A;  1YD8 G;  1IBL T;  4IRE A;  1IBK T;  2V7I A;  4BAY B;  3R6N A;  3RIU C;  3VU7 H;  3QC9 A;  2IC9 A;  3AED A;  2C0S A;  2X66 A;  3N2G E;  4TUY E;  4UVA B;  2BG9 C;  4U72 A;  5L3E B;  2NW9 A;  2MOZ A;  2IHR 1;  4YHJ A;  2V5D A;  3N5L A;  1JNZ A;  1FJG T;  4QXC B;  2K5B B;  2NWB A;  2EHO A;  2ZMA A;  1VOM A;  1XWM A;  3ZCJ A;  4COF A;  1S94 A;  1KNZ A;  1VRB A;  2H89 A;  4PAG A;  2UXN B;  5DQW A;  4EIW A;  2BG9 E;  2DWG A;  4U2Y A;  1HNZ T;  4EED A;  2WZH A;  2BG9 B;  2VK9 A;  1YQ4 A;  5FY1 A;  3H37 A;  2E5L T;  4CQI A;  3ANW A;  3LBX A;  3ZJ1 A;  2LSJ A;  4GYS A;  2L3L A;  2WAU A;  3UFE A;  2OA5 A;  3PUW F;  5LJN A;  2FJE A;  1AJ3 A;  1HCI A;  5KX5 E;  3AEB A;  2KMF A;  4AKG A;  4HN9 A;  4ADZ A;  3AXJ A;  4DV7 T;  3ZMT B;  4FJO A;  3UQ7 A;  4QXH B;  3I9Y A;  1W09 A;  4UIG A;  3N2O A;  1MMD A;  4DV1 T;  1KNR A;  3RKO A;  1Y64 B;  4U2Z A;  3CQX C;  2FJD A;  1OED C;  2I0M A;  1Z0P A;  5LNK A;  5TAO A;  4AKL A;  2J62 A;  4ZS3 A;  1UUS A;  1ZOY A;  2XQ8 A;  4EB6 E;  1LRZ A;  3FZM B;  1FEW A;  4O4J E;  5LMN T;  5AQU B;  3C51 A;  1HNW T;  3WI3 A;  1NAF A;  2JQK A;  1BR1 A;  4X64 T;  5J1G A;  4ZI3 D;  2LRK A;  2ZM2 A;  2A3D A;  3ZT6 A;  3MJX A;  4V1A v;  4GKJ T;  5L3B B;  4F8H A;  2XY8 B;  3ZLI A;  4C90 A;  3TLU A;  1E1H B;  4ZOL E;  3CQC B;  4BJM A;  3MAC A;  2MAW A;  3TLS A;  1KNP A;  3LK2 B;  2LSI A;  4F6R C;  4DR5 T;  4BA9 A;  5JTG A;  3P4R A;  1T72 A;  2VUR A;  5LHH B;  3CKD A;  4GOU A;  2D5U A;  3MZK B;  4DR2 T;  2EHO D;  4B3M T;  2XQ7 A;  3U78 A;  2RPA A;  1MIW A;  5KDM C;  5AFU L;  2VVS A;  4CI3 B;  2DI4 A;  1D0Y A;  3AEE A;  4IL4 A;  1X79 A;  3G06 A;  4YSZ A;  2G0U A;  3UQ4 A;  4X66 T;  1BR0 A;  5CFB A;  3OTO T;  4Z91 A;  3KFW X;  3K3N A;  2ES0 A;  2XAJ B;  3RYI E;  5IUX A;  4YHH T;  2C5I T;  1LVF A;  2WCA A;  3F2E A;  3PJA J;  2HPJ A;  4G2A A;  2HHH T;  2BZB A;  5JDF A;  5AQK B;  5JVD E;  4HFV A;  3ZEF B;  4ZZB A;  5DQV A;  3P7I A;  4QWN B;  4AQY T;  4GYR A;  2H88 A;  3EUH A;  4HWF A;  2CRB A;  4ASK A;  4OHF A;  2QVA A;  2E9X C;  4IE0 A;  2JQH A;  2E5V A;  4IL9 A;  3KIN B;  4WBO A;  4PJM A;  2E8I A;  2YU2 A;  4AI6 A;  3C98 B;  4KP3 C;  2J47 A;  5HEH A;  2SPC A;  2Q9Q B;  5FYM A;  1EZ3 A;  1XMO T;  5IYZ E;  5AQJ B;  2CHN A;  4QKN A;  4HKA A;  4O2B E;  3R84 B;  2E9X B;  5F3J A;  4DR1 T;  4YTM A;  3V5U A;  2WP9 A;  4ZI2 D;  3O1I A;  4E7Z A;  5CA0 E;  4QXB B;  5LMU T;  2Y48 B;  5IWA T;  2M67 A;  2XQ3 A;  2LHN A;  3GWH A;  4PFP A;  2YK0 A;  2Y6X A;  1D0X A;  5AQS B; 
#chains in the Genus database with same CATH homology
 4IDZ A;  2KIN B;  3O1J A;  5H6R B;  3ZYL A;  2ACX A;  3KBU A;  3AA6 B;  3L09 A;  1MIY A;  2V26 A;  5JDL A;  2K9A A;  5JRC A;  2VKJ A;  5JQG E;  3ZPO A;  3JC6 C;  1HG2 A;  3LG7 A;  5ADX L;  1FMV A;  4UF0 B;  2K24 A;  4Z8X A;  3PUS A;  2X68 A;  4PFO A;  3IEE A;  1HFA A;  2L8K A;  3K8P C;  4DVD A;  4YJ2 E;  1S35 A;  4O4L E;  4CXY A;  1CUN A;  1D1B A;  3HKD E;  3LK4 2;  2JMH A;  2LSY A;  5LOV E;  2VKH A;  4P0B A;  2LM9 A;  2LEH A;  2Z6E A;  3B57 A;  3RC8 A;  1WYB A;  2XAH B;  3MXZ A;  4J2C A;  3KBT A;  3ZJ2 A;  4NUU A;  3T8O A;  4H9S E;  4P09 A;  5ETW A;  2YIN A;  3ZYM A;  4UEM A;  3RC3 A;  3KDS E;  2CLY B;  1IZN B;  1O3X A;  2X51 A;  2NTY A;  2IW5 B;  3E0Z A;  1HS7 A;  2LOS A;  3C4X A;  3GN5 A;  3UUN A;  3ZN0 B;  3LJC A;  2H3R A;  4H9P C;  5HAX A;  3U3I A;  2WMN A;  2CEA A;  4IHJ E;  3S4U A;  3Q5X A;  4DBR A;  5FY0 A;  1YKH B;  2H7V C;  2XAS B;  4EZ4 A;  2LJL A;  4ZS2 A;  5HXE A;  5LHI B;  2CMR A;  3FXD B;  4XBF B;  1YW0 A;  1WLX A;  4KUM B;  5CB4 E;  2VB6 A;  4CXX A;  2J1D G;  4KBM B;  1V9D A;  3DJB A;  3RX6 A;  2NW8 A;  3C64 A;  5FP3 A;  4ILU A;  1MMG A;  3CX7 B;  5EZY E;  2X67 A;  4E7S A;  4XAX B;  2PJQ A;  4EOZ B;  1LKX A;  2C5K T;  4OYK A;  2V1D B;  2WMO A;  3ZMZ B;  2W00 A;  3NZP A;  4I55 E;  3J9X 1;  3DP7 A;  1US7 B;  1UCU A;  4IIJ E;  2LSK A;  5LBM A;  3ZMS B;  3F57 A;  5LP6 E;  2CXD A;  3RPU A;  5L3C B;  2ZLY A;  5LBQ B;  5JR9 B;  2IC6 A;  3HKE E;  4H9Q C;  3UTK A;  3N2K E;  4WNK A;  3JC6 D;  4I50 E;  3NZQ A;  4ANJ A;  3O4X E;  1YD8 G;  4A56 A;  2JMK A;  3O9X A;  3OYX A;  1WRD A;  2HPL A;  2V7I A;  4BAY B;  4EYU A;  4UVC B;  5CA1 E;  3R6N A;  2P9B A;  5EK2 A;  2LHR A;  3OBV E;  3VU7 H;  3QC9 A;  3ESL A;  2IC9 A;  2X66 A;  2C0S A;  2DWK A;  3VHL A;  3ZN1 B;  3N2G E;  4TUY E;  4UVA B;  4AKH A;  3AAA B;  3EVY A;  2KLQ A;  3ZMU B;  2JQQ A;  1NWM X;  2I59 A;  1T98 A;  4U72 A;  5L3E B;  2NW9 A;  2MOZ A;  2DLR A;  3FHN A;  3PU8 A;  3Q2M A;  3OKQ A;  1D0Z A;  2NOX A;  3AA1 B;  3ZC1 A;  2V7J A;  1WR6 A;  4YHJ A;  2CM0 A;  3KV4 A;  3DTO A;  3N5L A;  2VWA A;  2KND A;  4H9N C;  5KMG P;  4QXC B;  2NTX A;  5DJQ C;  2K5B B;  3PUG A;  4O4H E;  2KZ7 B;  4BJN A;  4C91 A;  4DBQ A;  2NWB A;  2EHO A;  2QGS A;  2W62 A;  2ZMA A;  2A2F X;  1VOM A;  3RRW A;  3ZCJ A;  5LA6 E;  1OXZ A;  2XHE B;  2CE7 A;  4IE4 A;  1S94 A;  1UX5 A;  1VRB A;  4AKR B;  1KNZ A;  2V7M A;  4PAG A;  2UXN B;  5DQW A;  4EIW A;  5BMV E;  3HA4 A;  4GK0 E;  5L2L A;  2DWG A;  3QUJ A;  3GA8 A;  3LK3 B;  3UUL A;  2LSG A;  2Q9Q A;  2X9X A;  5HXH A;  3VKG A;  2VK9 A;  5FY1 A;  3H37 A;  5LCY A;  2N1G A;  4ISS A;  4CQI A;  3ANW A;  1U5P A;  3LBX A;  4ZI3 C;  3ZJ1 A;  3N9L A;  3GN5 B;  2LSJ A;  4GK5 E;  4GYS A;  5FXZ A;  5FXX A;  2L3L A;  2WAU A;  3ONX A;  1HF8 A;  3UFE A;  1HTJ F;  2OA5 A;  5LJN A;  1YKE B;  2HH7 A;  1AJ3 A;  1HCI A;  5KX5 E;  2KMF A;  3AAI A;  4AKG A;  4HN9 A;  2N9D A;  1QUU A;  4ADZ A;  5EK3 A;  3BQL A;  4HE8 A;  4KMC A;  3Q9D A;  4PK5 A;  5FNV E;  3FB2 A;  2KT9 A;  3UT5 E;  2X9W A;  5FXW A;  3J7Y q;  3ZMT B;  4FJO A;  2JPF A;  4QHO A;  5HXR A;  1G8X A;  3RRC A;  4QXH B;  3VKH A;  3HKC E;  4OFZ A;  4PJJ A;  3I9Y A;  3RYC E;  4X1Y E;  4OYJ A;  2KXP B;  4MBQ A;  4O4I E;  4UIG A;  2D2S A;  3I1A A;  3SRZ A;  2V7K A;  2DCF A;  3N2O A;  2GK9 A;  2W61 A;  2V7L A;  1MMD A;  3FXE B;  4I4T E;  4TN7 B;  4MHC A;  4XZC A;  3RKO A;  1Y64 B;  2WBL A;  4GIW A;  2WWU A;  4PNI A;  3CQX C;  4YLH A;  1IJ6 A;  3FBL A;  2EHO C;  4IE5 A;  5HXS A;  3CX8 B;  2X0L B;  3AVR A;  2DNX A;  3MA9 A;  4TX5 A;  3SOL A;  3PE0 A;  1Z0P A;  5LNK A;  2IAK A;  3ETV A;  2XAF B;  5TAO A;  5JDH A;  4AKL A;  4ZS3 A;  2Q9Q C;  3BQK A;  5L3D B;  4AQG A;  2W0G A;  4EB6 E;  2L9Q A;  1HG5 A;  1LRZ A;  4ZI7 E;  1FEW A;  3BQI A;  4O4J E;  1KK7 A;  3C51 A;  1SHZ C;  1OWA A;  3WI3 A;  2BDE A;  5LGT B;  1NAF A;  3E08 A;  4PK6 A;  3F31 A;  3RYF E;  2XAG B;  1BR1 A;  2ZM8 A;  5J1G A;  3C4Z A;  4ZI3 D;  5HXC A;  3EDV A;  1IJ5 A;  2ZM2 A;  2A3D A;  2D0T A;  4CI2 B;  2Y8D A;  2WM9 A;  3WAJ A;  2CA5 A;  3MJX A;  2YEV C;  4V1A v;  5L3B B;  4M1P A;  1ZHC A;  4X1K E;  2CWY A;  4L0R A;  5FXV A;  3ZLI A;  4C90 A;  4IGU A;  1E1H B;  4ZOL E;  4K0U A;  3M65 A;  3CQC B;  4BJM A;  1BR2 A;  2CWO A;  3LFM A;  3MAC A;  4TZ4 C;  3UUX B;  5C8Y E;  5HWX A;  3N9P A;  5LXT E;  5JDQ A;  2ZM0 A;  5DAB A;  5JRC B;  3HL6 A;  3SWH A;  5LYJ E;  3CX6 B;  4JEU B;  3LK2 B;  4NUV A;  2LSI A;  4UV9 B;  5E0O A;  4F6R C;  4N78 D;  3PDY A;  3ZC0 A;  5LJM A;  4U74 A;  5A1L A;  5LGU B;  2XQY A;  2PFV A;  2MTQ A;  4BA9 A;  3LBX B;  4O8S A;  2JJ9 A;  3I0O A;  5JR9 A;  4PJL A;  3CQG B;  1MIV A;  5LHH B;  3UUM A;  3CKD A;  3K3Q C;  3PUA A;  4GOU A;  5L3F B;  2N2N A;  2D5U A;  2X9H A;  3MZK B;  2YU1 A;  4P0A A;  3CPZ A;  2VKD A;  5EK4 A;  3CWZ B;  3AB3 B;  4UVB B;  2EHO D;  3HKB E;  1HX8 A;  3Q5W A;  3EDU A;  4PJN A;  3ETU A;  1MMA A;  2LE8 A;  2CCQ A;  2KWI B;  3U78 A;  2MBG A;  4HEA A;  4EXT A;  2RA1 A;  4MFR A;  4TV8 E;  5LG4 A;  1QSD A;  3MK7 C;  3ZCI A;  2PBI A;  4X1I E;  1MIW A;  5GON E;  5KDM C;  3N9M A;  5AFU L;  1WYC A;  4CI3 B;  1U4Q A;  2DI4 A;  4EAH A;  3KVA A;  2Q9Q D;  3O1H A;  4QX7 B;  2VKO A;  3BK9 A;  3CVR A;  3I9W A;  4JEH B;  3AVS A;  2XAQ B;  4O2A E;  4YJ3 E;  5IHY A;  5JRE A;  4H63 H;  2PG8 A;  1D0Y A;  3GMI A;  2E9X A;  3N9O A;  3C50 A;  3FBZ A;  1X79 A;  1D1A A;  5JDG A;  4AQF A;  5L3G B;  4WW0 A;  3IBP A;  3IHR A;  4B6X A;  2G0U A;  4HGA A;  3PU3 A;  4CI1 B;  2E9X D;  1ZV4 X;  3KV6 A;  4ERR A;  1BR0 A;  1D1C A;  3NRX A;  3PTR B;  3K3O A;  1FMW A;  4PK4 A;  3KFW X;  5H6Q B;  3RYH E;  2H7O A;  2BVM A;  3WAK A;  3C4W A;  2C5J A;  3NRY A;  2ODU A;  1MND A;  3RH3 A;  5JH7 E;  3KV5 A;  5HYA A;  3AA7 B;  3K3N A;  3D0T A;  3IF8 B;  5JDM A;  3I0Q A;  4DND A;  5LGN B;  2ES0 A;  2XAJ B;  5J2T E;  4UF0 A;  3RYI E;  2NP9 A;  4H63 V;  3QK6 A;  4X20 E;  2C5I T;  1LVF A;  3V5S A;  2XUE A;  3AAE B;  2UXX B;  4ZI2 C;  5JR9 C;  1G73 A;  3P8C D;  4PW8 A;  2RP4 A;  3F2E A;  2B1E A;  1MMN A;  2LT3 A;  4HTE A;  2HPJ A;  4G2A A;  2BZB A;  5HWY A;  2VAS A;  5JDF A;  5JDN A;  5JVD E;  2CXF A;  3PUQ A;  3PUR A;  1LVK A;  4HFV A;  3ZEF B;  2MYS A;  5DQV A;  1B7T A;  3N9N A;  3P7I A;  4QWN B;  4WBN E;  2W63 A;  2JRK A;  5FY7 A;  1IAP A;  4GYR A;  3E22 E;  3EUH A;  1SA0 E;  4IST A;  3B13 A;  4JLE A;  4ASK A;  4OHF A;  2CXL A;  2QA7 A;  2E9X C;  5LHG B;  4IE7 A;  1ZKE A;  4IE0 A;  4QX8 B;  4JUY A;  2DHR A;  4ZHQ E;  2K48 A;  4AQF C;  4H9O C;  2XTL A;  4MAL A;  2X9Y A;  2D0U A;  1ZEE A;  2EHO B;  3KIN B;  4AKI A;  3W15 B;  1UX4 A;  4WBO A;  4PJM A;  4L9I A;  2E8I A;  3H3A A;  2YU2 A;  4AI6 A;  4CZZ B;  3C98 B;  3N9Q A;  2WSS V;  4YFS A;  4G63 A;  3A5X A;  5M4Y A;  3ZMV B;  4KP3 C;  2LOP A;  3KV9 A;  1BR4 A;  3MKD A;  3OJA A;  2A72 A;  2SPC A;  3OYZ A;  2Q9Q B;  3HI2 A;  5FYM A;  1EZ3 A;  5IYZ E;  2ODV A;  3NBX X;  4QKN A;  3CML A;  3HR0 A;  4HKA A;  3ANW B;  2KWH A;  2VL8 A;  4H9R C;  4O2B E;  3R84 B;  3AA0 B;  4L5G A;  1FIO A;  4IE6 A;  2BVL A;  3KVB A;  5J2U E;  1H7C A;  2E9X B;  5FMN A;  4OK0 A;  3ZYK A;  4DMV A;  5F3J A;  4I43 B;  2NW7 A;  3V5U A;  4AXP A;  4UXN B;  4EZH A;  4ZI2 D;  3O1I A;  1MNE A;  4UV8 B;  4E7Z A;  5CA0 E;  4QXB B;  4FI5 A;  4CXW A;  4EYY R;  2Y48 B;  3L3P A;  4UEL A;  3TKL B;  3SS1 A;  2M67 A;  5F8P A;  4MLK A;  2LHN A;  3GWH A;  4PFP A;  4TV9 E;  2YK0 A;  4DMW A;  2Y6X A;  1D0X A;  4DO0 A;  2CLY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...