2DWKA

Crystal structure of the run domain of mouse rap2 interacting protein x
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
162
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RUFY3
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 47
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwkA00
3CWZB 2DWKA 2DWGA 2CXLA 4GIWA 2CXFA
chains in the Genus database with same CATH superfamily
2B76A 4DV2T 2C5KT 2JPFA 2VWAA 3MZKB 3A5XA 3UU3A 4TWFA 3ZMUB 4JI5T 1XMQT 2LT3A 2BG9C 4H9OC 1D1AA 3F2EA 3O1HA 3N9QA 1Y64B 5LG3A 1UK5A 2UXXB 1IJ5A 3KV9A 3RHWA 2E8IA 4I0UA 4QH1A 2KNDA 3ZMZB 4IE5A 4TV8E 4JI1T 2RPAA 2YDQA 4ILUA 5L3CB 2X66A 4DV5T 1WYCA 2IC9A 4XZCA 2DL1A 4LMKA 1ZP0A 4IL4A 2EHOC 3PUAA 2NW7A 2DHRA 2YN6A 5FY1A 3HI2A 3L8RA 5HCMA 3P7IA 3NZQA 2V1DB 4WW0A 4B3TT 2H89A 5AQHB 5C8YE 2V7MA 2C5JA 5AQFB 3K1SA 3J9X1 5ABFA 1IJ6A 2I59A 4KX6A 3AECA 5H6QB 5JTGA 1XMOT 1WYBA 3L09A 2X9XA 3FZFB 3ZC1A 5FY0A 2UXBT 5LGNB 1UX5A 4OYKA 5LHHB 2WBLA 3C50A 2XASB 5AQGB 4CXYA 2VQET 3N2GE 4ZZBA 3FZKB 4TUYE 5FMNA 2BZBA 2QYWA 2W63A 5BMVE 4DR3T 2CHNA 3AEGA 5L3FB 4QHOA 2LEHA 4AISA 2A3DA 4DV3T 3P8CD 1VRBA 4YSXA 2LE8A 4H63V 2V7JA 5DQVA 3CMLA 4WNKA 1G8XA 5J0ZA 3PUVF 2DCFA 3AE6A 4MBQA 2YKSA 1I94T 5HYAA 2LRKA 2Z6EA 2WMNA 3RC8A 3TLVA 4AIUA 3V5UA 3ETUA 2XM1A 4GYRA 2YINA 3LDQB 4QXCB 4GOUA 2V7IA 1I6ZA 2A9UA 5JDHA 3O9XA 3ZJ2A 4GK5E 3C4ZA 4E7SA 3EAMA 1M62A 4UV8B 1OXZA 4BAYB 2WS3A 3LK42 4AQGA 3N2OA 4OHFA 1UCUA 2BDEA 3NKZA 2XY8B 4FI5A 2JJ9A 1HX8A 4ILCA 3MACA 4Q25A 2ZM8A 3P4RA 4HEAA 4G63A 3JC6C 2NOXA 2UUAT 3NRXA 4I4TE 4P09A 4TZ4C 4DR2T 4ANJA 2CRBA 3RQUA 2NWBA 4GKJT 2BS3A 5JRCA 2ZM2A 4ZI2D 2LSGA 1D1CA 4PFOA 4LMLA 1LVFA 2XJ7A 3P4WA 5KXJA 4O4HE 5FY7A 4U7YA 5AQKB 2JMKA 3LSVA 3PU8A 3EUHA 4EOZB 3AA0B 4AKHA 3KBTA 2LSYA 4HFHA 4EB6E 1KNZA 2F4VT 2UUBT 5FNVE 3OTOT 5JVDE 2CEAA 1HNWT 2XUEA 2N1GA 1KF6A 5F5WA 3AEDA 5FVLA 4DBQA 4P0AA 2XQAA 4IE4A 1WRDA 5HEHA 1B7TA 2XAGB 3NBXX 5LGTB 5H6RB 1IBKT 3CQXC 3BQLA 1HF8A 5LBQB 3LG7A 2WAUA 5AQMB 4C90A 4LMJA 2QA7A 3QB5A 3UQ7A 3KINB 2YK0A 4TX5A 4YLHA 4A56A 3J7Yq 1WR0A 4O2BE 4JI7T 4QX8B 2XHEB 2XQ9A 3EABA 5HWXA 2W0GA 2J1DG 3PJAA 3ZPOA 4TWHA 4JV5T 5L47A 3NWIA 4YJ3E 3LK3B 3Q9DA 5C3JA 2IMLA 1NAFA 1HNZT 2BBHA 4U31A 5FXXA 4DR5T 4ASKA 4F8HA 1MNDA 2NR4A 3IHRA 5F3JA 2FBWA 3KVBA 2J4GA 2LHRA 4U2ZA 3F57A 4GK0E 3K3NA 1KNRA 4C91A 3OPCA 5AQIB 4B3RT 4IDNA 2WB5A 2G0UA 2H3RA 3EVYA 2WY2A 4HFBA 2FJBA 4AKGA 3OYZA 3E0ZA 4H9NC 3PUGA 1MMDA 4HTEA 3ZEFB 1E7PA 5AQNB 2VKHA 5JH7E 4JI2T 1YQ4A 2X9HA 1XZYA 2H7OA 3AEFA 4ZI3C 2ODVA 4IIJE 2WDRA 1X9BA 4JEHB 4PJJA 3UQ4A 1SUMB 2DWGA 3Q5DA 4U7IA 5A1LA 2Q9QD 2PG8A 3QB5K 4UVAB 4DV6T 4IDZA 1BR2A 3AXJB 3GN5B 5JDLA 4EV6A 3CX8B 4IT4A 1YKEB 4NPPA 4F6RC 3KBUA 3I1AA 2QGSA 1OEDB 3BQKA 4DR7T 4EZ4A 4JEUB 3E08A 4YHJA 3P4SA 1QSDA 2V5DA 4JI0T 3AAAB 3AE9A 5LOVE 3AE7A 4CQIA 4I43B 3P4QA 2XAQB 4L0RA 4QXBB 4MFRA 1FMVA 2PTFA 3ESLA 4AI6A 2OA5A 3S4UA 2SPCA 4LF6T 2YU1A 3H37A 3HA4A 2XQ4A 2WU5A 3Q5XA 4JLEA 4IDOA 4JI8T 2UXDT 3ZT5A 3R84B 4CN1A 2VK9A 4DV7T 4NXMT 3AE5A 2VB6A 3BK9A 4EZHA 4GKKT 1ZOYA 3CWZB 4YHHT 2VL0A 2KINB 4QX7B 2UUCT 4UEMA 4QXHB 3K3QC 5ADXL 1MMAA 1J5ET 1YQ3A 2RA1A 4DIDB 2ZM6T 2CBIA 2I6HA 2LRLA 3VU7H 2BKOA 2MPKA 3CQCB 5FP3A 2L8KA 4M1PA 2R6GF 4X66T 5LBMA 3U78A 4HFDA 1VOMA 2LOSA 5AQSB 2JQ9A 4U72A 2KT9A 5CA0E 1HFAA 4WBNE 4ZEYA 2UXCT 5AQJB 4JI6T 3QK6A 1W0BA 1T8BA 2LLYA 4CN6A 5AQLB 3QNUA 2ACXA 3AXJA 5KDMC 3ZSSA 2J47A 2WU2A 3W15B 4DR6T 2HN1A 4QH5A 2BS2A 5HEGA 3T1YT 2LSJA 5LHIB 3P50A 1OEDA 3BQIA 4LFBT 5HXSA 3UUXB 2AXDS 2DNXA 3UUMA 2IHR1 4ZZCA 2MYSA 2E9XD 3UU4A 3IF8B 3VRAA 5IHYA 5L4EA 2V8SV 5EK2A 1FIOA 1XDPA 1HNXT 4DV0T 1O3XA 2B1EA 4PAGA 1FMWA 3ZCJA 4GIWA 4TNWA 2KSRA 1G73A 1FEWA 4IE6A 5FXZA 1ZV4X 4LF7T 4DMWA 1HS7A 2LKGA 3SFDA 5LGUB 3PV0F 1QUUA 4KHZF 2VASA 3N9PA 4U2YA 4AQFA 4ZHQE 1MIYA 1IBLT 3AAIA 1D0ZA 3PU3A 3ZYMA 4COFA 4B3ST 4LF4T 1M7KA 3PDYA 5AQPB 2Q9QB 4QH4A 5FL1A 3UTKA 3RF1A 1JNZA 1YXRA 3X1DA 5HXEA 3H3MA 3DJBA 4OYJA 2FJEA 4O4LE 5L3GB 1NWMX 2VVSA 5CA1E 5IUXA 3ONJA 2BBJA 4KHPT 2GK9A 4HWHA 4Z8XA 3RH3A 4JUYA 4K0KT 4K0UA 3C4XA 3ZC0A 2XQ3A 4I50E 3K8PC 2DI4A 4TNVA 2CA5A 2V7KA 4NIQA 4ILAA 3RI5A 3I0QA 2KWHA 3PUQA 3ZYKA 2NW9A 3RGLA 4ZI2C 3AA1B 2HPJA 3ZKRA 5AFUL 4YTMA 1OEDC 2PBIA 4L5GA 2VVNA 5EZYE 1S35A 4IE7A 4YSYA 2A72A 3AEAA 4JI3T 1U4QA 3UUNA 3PTRB 4H9SE 5LNKA 3JC6D 5L4HA 3GA8A 5DQWA 3OBVE 4MHCA 1BR1A 2W2UA 4PW8A 3Q2MA 2LKHA 1US7B 1HTJF 5JR9B 3MK7C 3D0TA 2XAFB 4GYSA 3I9YA 3K3OA 5KX5E 2QVAA 4L9IA 5LG4A 3HL6A 4DBRA 3FB2A 3MXZA 2W4XA 3PUXF 3OVUA 4UF0B 5JREA 1HX1B 4XAXB 4YJ2E 2BG9B 2BS4A 2VURA 4TN7B 2H88A 4EGWA 2K48A 2XTLA 1XNQT 3ZLIA 4AQFC 3HKEE 3FHNA 4CI3B 4DO0A 5HEOA 3Q5WA 4X20E 4EAHA 1UGOA 3N2KE 3UFEA 3PE0A 3TLUA 4EEDA 3P4PA 4HWFA 1SA0E 2EHOB 5DJQC 2X9WA 3KVAA 3T8OA 4HWIB 2WSSV 2CPTA 2W66A 4WYVA 4CN4A 3TLTA 2D9DA 2E9XB 4YXDA 1N33T 5AQQB 2UU9T 3FBLA 4UVBB 4U3CA 1LKXA 5JDGA 2UXNB 3ZT6A 5M4YA 5FKYA 3CKDA 4KUMB 4AQYT 4IHJE 3ANWB 5HEUA 4H9QC 4AXPA 4NUUA 4BJMA 2DWKA 2WDQA 2VKDA 2E5LT 5HCJA 3CX7B 2V6XA 3RIAA 2XQ8A 3AE1A 4IL9A 5AQUB 2W61A 2E5VA 2XAJB 5FXVA 5HWYA 2V6YB 3UU6A 4X1IE 4IE0A 2KWIB 3ZSTA 5JDFA 5C2TA 3TKLB 3U3IA 1D1BA 1WLXA 2K24A 1J5WA 4DMVA 4BA9A 2JQKA 3RIFA 4PK4A 4UF0A 4ILBA 4YTPA 2IDOB 3FXEB 3AEEA 4ISSA 3RRCA 3RX6A 5ABEA 3KV6A 2PFVA 4YT0A 2ZM0A 2X0LB 2W62A 2CCQA 2ZMAA 2CWYA 3O1JA 3PUZF 2X9YA 1KNPA 3VRBA 4PNIA 3G06A 4HN9A 5LMUT 1GQEA 5AQOB 5GONE 1N34T 4UV9B 1ZEEA 3EI0A 4UIGA 2DLRA 3AE4A 1ZKEA 3NVOA 5LB7B 1W9RA 3PUYF 4V1Av 2E9XA 4LF8T 4TWDA 4ZS2A 2KZ7B 1NENA 1Z8UA 2CM0A 3ZMVB 3MJXA 3I0OA 2WCAA 3ANWA 3NZPA 4MALA 2PJQA 5ABFB 2IC6A 4CXWA 1LRZA 3B5MA 3SOLA 3GMIA 3AE3A 3NRYA 5LMNT 2P9BA 2LHNA 3FXDB 2FJAA 3L39A 5J1GA 4X64T 2CBJA 2CLYB 4X1KE 4J2CA 3B13A 4YFSA 2J62A 2WP9A 4PFPA 2C0SA 3AAEB 3FZHB 5LJNA 2VKJA 5HAXA 3N9NA 5L3DB 3V5SA 3UULA 4Z91A 4ISTA 3C51A 2LJLA 4PJLA 1L0VA 2LSKA 3ETVA 4KP3C 4XBFB 2N9DA 1JNRA 4YY3T 4U33A 3PJAJ 5KMGP 3VHLA 3M65A 3O1IA 5L3BB 2N2NA 3OKQA 3SWHA 1MIWA 1XWMA 3TLSA 2XM2A 4HWDA 4FJOA 2WZIA 2Y8DA 4N78D 4ADZA 2XSBA 3A7MA 2KXPB 3LJCA 3C64A 5IWAT 5LP6E 1U5PA 3KV5A 3ZYLA 1UX4A 4HFIA 3CVRA 1CUNA 1OEDE 3GN5A 4X65T 4DV1T 1UUSA 4DVDA 3CQGB 2KLQA 4O4IE 2Y6XA 2EHOD 5ETWA 3RPUA 4H9RC 2E9XC 4DV4T 3IEEA 4E7ZA 2NP9A 4A97A 3CX6B 3DP7A 1T7SA 4OK0A 2D0TA 2X0YA 2BKNA 2D5UA 3AEBA 1KK7A 5L2LA 2RP4A 5CJ5A 1VCTA 2MOZA 2CWOA 4TV9E 3LK2B 5FVKA 3IA3A 3JAFA 3E22E 2OLTA 2FUPA 1WCRA 5JRCB 4DUZT 3AB3B 4CI2B 1OWAA 4PK5A 3CIRA 2BVMA 3RKOA 2XQYA 4LFAT 2YDSA 4HFVA 3WAJA 2ACZA 2CMRA 4WBOA 3KV4A 4AKRB 2LSIA 2VQFT 4EXTA 2VL8A 4HFEA 1T72A 5AQRB 4CZZB 4IDQA 3T1HT 4P1NA 2OV9A 3Q5EA 4O4JE 2L9QA 3KFWX 1X79A 3O4XE 3PURA 2LM9A 1FJGT 4KI0F 2WM9A 3JCFA 3ZN1B 3RYFE 3VR8A 3AVSA 3N9LA 1Y01A 3QOFA 4JYAT 2K3WA 4UR9A 4LF5T 1CHUA 4OFZA 2ZLYA 3N5LA 2E2AA 2C5IT 2AE9A 2CHOA 2XAHB 4EYYR 3UU5A 2K9AA 2LM2A 1D0YA 2D0UA 3JADA 1SHZC 1HCIA 2W67A 2WZHA 3RLFF 3RYIE 2XQ6A 1BR0A 2BKPA 3SFEA 4YTNA 3VKGA 3AA6B 2D2SA 2MBGA 3SS1A 5LJMA 3CK6A 2VKOA 4ERRA 2JQHA 2A2FX 4A5XA 3UFGA 4DUYT 2M6IA 5CFBA 1S94A 5HXCA 2V5CA 4ZOLE 3C4WA 3C98B 3HR0A 3AE8A 2IW5B 4ZXLA 2X68A 4PJNA 4O8SA 4BJNA 2WMOA 3RYHE 1MMNA 3ABVA 5HXHA 1DU2A 2CE7A 4AKIA 4AKLA 2V7LA 2FJDA 5LHGB 1LVKA 1H7CA 2NTXA 2HPLA 1NEKA 5LCYA 1YW0A 2CLYC 4QWNB 1EZ3A 4DR1T 2HHHT 4Z90A 1UURA 3IBPA 3KDSE 4NUVA 5EK3A 3RQWA 5E0OA 2IUBA 2JIWA 5L3EB 5FYMA 2LOPA 5JQGE 1V9DA 2JQQA 2JMHA 1IBMT 1XDOA 2Q9QA 4ZS3A 1HR0T 4LFCT 3EDVA 4HFCA 2MTQA 3OYXA 5FXWA 2WWVA 1KFYA 3WI3A 4G2AA 1J1JA 5JDQA 4MLKA 4ZI7E 4HE8A 2CXLA 3OJAA 4B3MT 5BR8T 5AQTB 1YD8G 3I9WA 5J2UE 3LBXB 2I0MA 3RRWA 2BVLA 3R6NA 3AA7B 4EYUA 3F31A 4HKAA 3VR9A 5EK4A 4OX9T 4O2AE 3AE2A 2HH7A 2HN2A 2IAKA 4KMCA 4JBWF 1KEYA 3QC9A 2MAWA 4X5TA 2M67A 1D0XA 1ZHCA 3UU8A 5LA6E 2IIUA 1N36T 2XSAA 3ZMSB 2X0HA 1WR6A 3CPZA 3ZMTB 3N9OA 5ABGA 5CGMA 2XZEA 4X62T 5DABA 3PUWF 3VKHA 1IZNB 3ONXA 1W0AA 3RYCE 5HEJA 2NW8A 3RIUA 1VCSA 4DNDA 4UVCB 1IAPA 4CI1B 5JDMA 3FBZA 3EDUA 5HXRA 5JDNA 2NTYA 4H9PC 2WQYA 4I55E 1W09A 3ZJ1A 4QKNA 5JR9A 4NXNT 2XPKA 2QRXA 2BG9E 2V26A 4CXXA 3QUJA 3N9MA 3DTOA 4PJMA 2K5BB 2XQ7A 2ODUA 2YEVC 4U74A 2H7VC 4JI4T 2BG9A 5LXTE 5F8PA 3TLWA 2XQ5A 2Y48B 5ABHA 1YKHB 4X1YE 1QLBA 1HG2A 2CXFA 3HKBE 5CB4E 4EEBA 4PK6A 2Q9QC 3FZLB 3H3AA 1E2AA 2X67A 3HKDE 3M3ZB 1N32T 1WFDA 2YOEA 2EHOA 2X51A 4P0BA 4HGAA 3LBXA 3GWHA 4H63H 1R8IA 1AJ3A 3JAEA 1MNEA 4ZI3D 4IDPA 1MMGA 3L3PA 3RC3A 1Z0PA 2JRKA 3FZMB 5IYZE 3SRZA 2YDRA 4DR4T 3UT5E 3PUSA 3LFMA 3ZCIA 2WDVA 3AVRA 1XNRT 3MA9A 2ES0A 3B57A 3ZN0B 1BR4A 2M6BA 4HWCA 5TAOA 3MKDA 3RKGA 2KMFA 3ONLC 5J2TE 3EHZA 4EIWA 1SE7A 4KBMB 3HKCE 4B6XA 4A98A 2V6YA 1HG5A 1E1HB 4UXNB 3WAKA 2YU2A 3RIUC 3UUBA 5FL0A 2CXDA 4IREA 4LF9T 5AQVB 4YSZA 3ZT7A 4WZXA 3A8YC 4IGUA 2WWUA 1MIVA 5JR9C 2L3LA 1T98A 2W00A 5LYJE 4UELA
chains in the Genus database with same CATH topology
3E0ZA 4TN7B 4H9NC 3PURA 2C5KT 2JPFA 2VWAA 2K48A 3MZKB 2XTLA 3A5XA 3ZLIA 4AQFC 3HKEE 3ZMUB 2LM9A 3PUGA 2LT3A 1MMDA 3FHNA 4CI3B 4DO0A 4HTEA 3ZEFB 2WM9A 4H9OC 3ZN1B 1D1AA 3F2EA 3O1HA 3Q5WA 3N9QA 2VKHA 5JH7E 3RYFE 1Y64B 4X20E 3AVSA 2X9HA 4EAHA 2UXXB 1IJ5A 2H7OA 3N9LA 3KV9A 2E8IA 3N2KE 4ZI3C 2ODVA 3UFEA 3PE0A 4IIJE 2KNDA 1SA0E 4IE5A 3ZMZB 2EHOB 4JEHB 4TV8E 4ILUA 5DJQC 5L3CB 2X9WA 2X66A 3KVAA 4PJJA 3T8OA 2DWGA 1WYCA 2IC9A 4XZCA 5A1LA 2Q9QD 2WSSV 2PG8A 4OFZA 2ZLYA 3N5LA 2EHOC 3PUAA 4UVAB 2C5IT 2NW7A 4IDZA 2E9XB 2DHRA 5FY1A 2XAHB 3HI2A 4EYYR 1BR2A 2K9AA 3GN5B 3P7IA 3FBLA 2V1DB 3NZQA 4UVBB 4WW0A 5JDLA 1LKXA 1D0YA 2D0UA 5JDGA 3CX8B 5C8YE 2UXNB 1SHZC 1YKEB 5M4YA 2V7MA 1HCIA 2C5JA 3CKDA 4KUMB 3RYIE 4F6RC 3KBUA 1BR0A 3I1AA 2QGSA 4IHJE 3J9X1 3ANWB 3VKGA 3AA6B 2D2SA 2MBGA 3SS1A 3BQKA 4H9QC 4EZ4A 4AXPA 4NUUA 5LJMA 1IJ6A 2I59A 4JEUB 2VKOA 3E08A 4BJMA 4ERRA 2DWKA 5H6QB 2A2FX 4YHJA 1WYBA 3L09A 1QSDA 2VKDA 2X9XA 3ZC1A 3CX7B 5FY0A 5LGNB 1UX5A 1S94A 5HXCA 4OYKA 5LHHB 4ZOLE 3AAAB 3C4WA 2WBLA 3C50A 3C98B 3HR0A 2XASB 5LOVE 2IW5B 4CQIA 4CXYA 4I43B 3N2GE 2X68A 2W61A 4O8SA 4PJNA 4BJNA 4TUYE 2WMOA 5FMNA 2BZBA 2XAQB 4L0RA 2XAJB 3RYHE 5FXVA 4QXBB 5HWYA 1MMNA 5HXHA 4MFRA 2W63A 5BMVE 1FMVA 4X1IE 4IE0A 2CE7A 2KWIB 3ESLA 4AKIA 4AKLA 4AI6A 2OA5A 2V7LA 3S4UA 2SPCA 5LHGB 2YU1A 1LVKA 3H37A 1H7CA 2NTXA 3HA4A 3Q5XA 4JLEA 2HPLA 5JDFA 5LCYA 3R84B 1YW0A 2CLYC 4QWNB 3TKLB 3U3IA 1EZ3A 5L3FB 4QHOA 1D1BA 3IBPA 2VK9A 1WLXA 2K24A 2LEHA 3KDSE 4NUVA 2VB6A 5EK3A 2A3DA 5E0OA 3P8CD 4DMVA 1VRBA 4BA9A 3BK9A 5FYMA 4EZHA 2LOPA 5JQGE 5L3EB 1V9DA 2LE8A 3CWZB 4H63V 2JQQA 4PK4A 4UF0A 2V7JA 5DQVA 2KINB 2JMHA 4QX7B 3CMLA 4UEMA 4QXHB 4WNKA 2Q9QA 3K3QC 4ZS3A 5ADXL 1G8XA 3FXEB 2DCFA 1MMAA 3EDVA 4ISSA 3RRCA 3RX6A 4MBQA 3KV6A 2PFVA 2RA1A 2ZM0A 2MTQA 5HYAA 2X0LB 2Z6EA 3OYXA 5FXWA 2W62A 2CCQA 3VU7H 2ZMAA 2WMNA 2CWYA 3WI3A 4G2AA 3O1JA 3CQCB 4MLKA 5FP3A 5JDQA 2L8KA 3RC8A 4ZI7E 4HE8A 2CXLA 2X9YA 4M1PA 3OJAA 3V5UA 5LBMA 3ETUA 1YD8G 4GYRA 4PNIA 3U78A 1VOMA 3I9WA 4HN9A 2YINA 5J2UE 3LBXB 2LOSA 5GONE 3RRWA 2BVLA 3R6NA 4QXCB 3AA7B 4GOUA 4U72A 2KT9A 3F31A 4EYUA 2V7IA 4HKAA 4UV9B 5EK4A 4O2AE 5JDHA 3O9XA 3ZJ2A 4GK5E 5CA0E 1HFAA 1ZEEA 3C4ZA 4UIGA 2DLRA 4WBNE 1ZKEA 2HH7A 4E7SA 3QK6A 4V1Av 2E9XA 2IAKA 4UV8B 1OXZA 4KMCA 4BAYB 2ACXA 5KDMC 3QC9A 3LK42 4ZS2A 2KZ7B 2M67A 4AQGA 1D0XA 3N2OA 4OHFA 1UCUA 1ZHCA 5LA6E 2BDEA 3W15B 2CM0A 3ZMVB 3MJXA 3ZMSB 2LSJA 3I0OA 5LHIB 1WR6A 4FI5A 2JJ9A 3CPZA 3ANWA 1HX8A 3ZMTB 3BQIA 3NZPA 3MACA 2ZM8A 4MALA 2PJQA 4HEAA 4G63A 5HXSA 3UUXB 2IC6A 2DNXA 4CXWA 1LRZA 3N9OA 3UUMA 3JC6C 2NOXA 3NRXA 2MYSA 4I4TE 3SOLA 3GMIA 2E9XD 5DABA 4P09A 4TZ4C 3IF8B 3NRYA 5IHYA 4ANJA 3VKHA 2NWBA 1IZNB 3ONXA 2P9BA 2LHNA 3RYCE 2NW8A 3FXDB 5EK2A 1FIOA 5JRCA 2ZM2A 4DNDA 2LSGA 5J1GA 4ZI2D 1D1CA 4PFOA 4UVCB 1IAPA 1LVFA 2CLYB 1O3XA 4CI1B 5JDMA 4X1KE 4O4HE 2B1EA 3FBZA 4J2CA 5FY7A 3EDUA 4PAGA 1FMWA 3B13A 5HXRA 2JMKA 3ZCJA 4YFSA 4GIWA 5JDNA 3PU8A 2NTYA 4H9PC 4I55E 1G73A 1FEWA 3EUHA 4IE6A 4PFPA 4EOZB 2C0SA 5FXZA 3AA0B 4AKHA 3AAEB 3ZJ1A 4QKNA 1ZV4X 5JR9A 5LJNA 2VKJA 5HAXA 3N9NA 3KBTA 4CXXA 2LSYA 2V26A 4DMWA 3QUJA 1HS7A 3N9MA 3DTOA 5LGUB 4EB6E 4PJMA 5L3DB 1KNZA 3V5SA 5FNVE 3UULA 5JVDE 2CEAA 1QUUA 2K5BB 2ODUA 3C51A 2LJLA 2XUEA 4ISTA 4PJLA 2YEVC 2LSKA 2VASA 3ETVA 4U74A 3N9PA 4KP3C 2N1GA 4AQFA 4ZHQE 4XBFB 2H7VC 1MIYA 5LXTE 4DBQA 3AAIA 1D0ZA 2N9DA 3PU3A 5F8PA 3ZYMA 4P0AA 3PDYA 2Y48B 4IE4A 1WRDA 1YKHB 2Q9QB 5KMGP 1B7TA 2XAGB 3NBXX 5LGTB 4X1YE 3UTKA 3VHLA 5H6RB 3M65A 3CQXC 3O1IA 3BQLA 1HG2A 2CXFA 3HKBE 1HF8A 5CB4E 5LBQB 3LG7A 5L3BB 2N2NA 3OKQA 4PK6A 3SWHA 5HXEA 2Q9QC 1MIWA 2WAUA 4C90A 3DJBA 4OYJA 3H3AA 4FJOA 2QA7A 4O4LE 5L3GB 2X67A 3HKDE 2Y8DA 1NWMX 4N78D 4ADZA 2EHOA 2X51A 4P0BA 4HGAA 5CA1E 3KINB 2YK0A 2KXPB 3LBXA 3LJCA 3C64A 3GWHA 4TX5A 4YLHA 5LP6E 4H63H 4A56A 3J7Yq 1U5PA 3KV5A 1AJ3A 3ZYLA 4O2BE 1MNEA 1UX4A 2GK9A 4Z8XA 3RH3A 4ZI3D 3CVRA 1CUNA 1MMGA 3GN5A 3L3PA 4JUYA 3RC3A 1Z0PA 4K0UA 4QX8B 2XHEB 3C4XA 2JRKA 5IYZE 3SRZA 4DVDA 3ZC0A 3UT5E 3CQGB 3PUSA 3LFMA 2KLQA 4O4IE 5HWXA 2W0GA 2J1DG 4I50E 3ZCIA 3K8PC 2Y6XA 3ZPOA 2EHOD 2DI4A 2CA5A 5ETWA 2V7KA 3AVRA 3RPUA 4H9RC 3MA9A 2E9XC 2ES0A 4YJ3E 3B57A 3IEEA 3ZN0B 1BR4A 4E7ZA 2NP9A 3I0QA 3LK3B 3CX6B 2KWHA 3DP7A 5TAOA 3PUQA 3MKDA 3Q9DA 3ZYKA 2KMFA 4OK0A 2D0TA 2NW9A 4ZI2C 1NAFA 3AA1B 5J2TE 2D5UA 4EIWA 2HPJA 5FXXA 5AFUL 1KK7A 4KBMB 5L2LA 2PBIA 4ASKA 2RP4A 4L5GA 5EZYE 2MOZA 2CWOA 1S35A 3HKCE 4TV9E 3LK2B 4IE7A 4B6XA 1MNDA 2A72A 1U4QA 3E22E 1HG5A 3IHRA 5F3JA 3UUNA 3PTRB 4H9SE 3KVBA 5JRCB 5LNKA 2LHRA 3AB3B 1E1HB 4UXNB 4CI2B 3WAKA 3JC6D 1OWAA 3F57A 3GA8A 4GK0E 4PK5A 5DQWA 3K3NA 2YU2A 3OBVE 2BVMA 3RKOA 4MHCA 4C91A 2XQYA 1BR1A 4PW8A 3Q2MA 4HFVA 3WAJA 2CXDA 1US7B 2CMRA 2G0UA 1HTJF 4WBOA 3MK7C 5JR9B 3KV4A 3D0TA 4AKRB 2XAFB 4GYSA 2LSIA 3I9YA 4EXTA 2H3RA 3K3OA 5KX5E 2VL8A 3EVYA 4L9IA 5LG4A 3HL6A 4IGUA 4DBRA 2WWUA 3FB2A 3MXZA 1MIVA 5JR9C 2L3LA 4UF0B 4AKGA 1T98A 4CZZB 3OYZA 5JREA 4O4JE 2W00A 2L9QA 4XAXB 4YJ2E 5LYJE 3KFWX 4UELA 1X79A 3O4XE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWZ B;  2DWK A;  2DWG A;  2CXL A;  4GIW A;  2CXF A; 
#chains in the Genus database with same CATH topology
 2B76 A;  4DV2 T;  2C5K T;  2JPF A;  2VWA A;  3MZK B;  3A5X A;  3UU3 A;  4TWF A;  3ZMU B;  4JI5 T;  1XMQ T;  2LT3 A;  2BG9 C;  4H9O C;  1D1A A;  3F2E A;  3O1H A;  3N9Q A;  1Y64 B;  5LG3 A;  1UK5 A;  2UXX B;  1IJ5 A;  3KV9 A;  3RHW A;  2E8I A;  4I0U A;  4QH1 A;  2KND A;  3ZMZ B;  4IE5 A;  4TV8 E;  4JI1 T;  2RPA A;  2YDQ A;  4ILU A;  5L3C B;  2X66 A;  4DV5 T;  1WYC A;  2IC9 A;  4XZC A;  2DL1 A;  4LMK A;  1ZP0 A;  4IL4 A;  2EHO C;  3PUA A;  2NW7 A;  2DHR A;  2YN6 A;  5FY1 A;  3HI2 A;  3L8R A;  5HCM A;  3P7I A;  3NZQ A;  2V1D B;  4WW0 A;  4B3T T;  2H89 A;  5AQH B;  5C8Y E;  2V7M A;  2C5J A;  5AQF B;  3K1S A;  3J9X 1;  5ABF A;  1IJ6 A;  2I59 A;  4KX6 A;  3AEC A;  5H6Q B;  5JTG A;  1XMO T;  1WYB A;  3L09 A;  2X9X A;  3FZF B;  3ZC1 A;  5FY0 A;  2UXB T;  5LGN B;  1UX5 A;  4OYK A;  5LHH B;  2WBL A;  3C50 A;  2XAS B;  5AQG B;  4CXY A;  2VQE T;  3N2G E;  4ZZB A;  3FZK B;  4TUY E;  5FMN A;  2BZB A;  2QYW A;  2W63 A;  5BMV E;  4DR3 T;  2CHN A;  3AEG A;  5L3F B;  4QHO A;  2LEH A;  4AIS A;  2A3D A;  4DV3 T;  3P8C D;  1VRB A;  4YSX A;  2LE8 A;  4H63 V;  2V7J A;  5DQV A;  3CML A;  4WNK A;  1G8X A;  5J0Z A;  3PUV F;  2DCF A;  3AE6 A;  4MBQ A;  2YKS A;  1I94 T;  5HYA A;  2LRK A;  2Z6E A;  2WMN A;  3RC8 A;  3TLV A;  4AIU A;  3V5U A;  3ETU A;  2XM1 A;  4GYR A;  2YIN A;  3LDQ B;  4QXC B;  4GOU A;  2V7I A;  1I6Z A;  2A9U A;  5JDH A;  3O9X A;  3ZJ2 A;  4GK5 E;  3C4Z A;  4E7S A;  3EAM A;  1M62 A;  4UV8 B;  1OXZ A;  4BAY B;  2WS3 A;  3LK4 2;  4AQG A;  3N2O A;  4OHF A;  1UCU A;  2BDE A;  3NKZ A;  2XY8 B;  4FI5 A;  2JJ9 A;  1HX8 A;  4ILC A;  3MAC A;  4Q25 A;  2ZM8 A;  3P4R A;  4HEA A;  4G63 A;  3JC6 C;  2NOX A;  2UUA T;  3NRX A;  4I4T E;  4P09 A;  4TZ4 C;  4DR2 T;  4ANJ A;  2CRB A;  3RQU A;  2NWB A;  4GKJ T;  2BS3 A;  5JRC A;  2ZM2 A;  4ZI2 D;  2LSG A;  1D1C A;  4PFO A;  4LML A;  1LVF A;  2XJ7 A;  3P4W A;  5KXJ A;  4O4H E;  5FY7 A;  4U7Y A;  5AQK B;  2JMK A;  3LSV A;  3PU8 A;  3EUH A;  4EOZ B;  3AA0 B;  4AKH A;  3KBT A;  2LSY A;  4HFH A;  4EB6 E;  1KNZ A;  2F4V T;  2UUB T;  5FNV E;  3OTO T;  5JVD E;  2CEA A;  1HNW T;  2XUE A;  2N1G A;  1KF6 A;  5F5W A;  3AED A;  5FVL A;  4DBQ A;  4P0A A;  2XQA A;  4IE4 A;  1WRD A;  5HEH A;  1B7T A;  2XAG B;  3NBX X;  5LGT B;  5H6R B;  1IBK T;  3CQX C;  3BQL A;  1HF8 A;  5LBQ B;  3LG7 A;  2WAU A;  5AQM B;  4C90 A;  4LMJ A;  2QA7 A;  3QB5 A;  3UQ7 A;  3KIN B;  2YK0 A;  4TX5 A;  4YLH A;  4A56 A;  3J7Y q;  1WR0 A;  4O2B E;  4JI7 T;  4QX8 B;  2XHE B;  2XQ9 A;  3EAB A;  5HWX A;  2W0G A;  2J1D G;  3PJA A;  3ZPO A;  4TWH A;  4JV5 T;  5L47 A;  3NWI A;  4YJ3 E;  3LK3 B;  3Q9D A;  5C3J A;  2IML A;  1NAF A;  1HNZ T;  2BBH A;  4U31 A;  5FXX A;  4DR5 T;  4ASK A;  4F8H A;  1MND A;  2NR4 A;  3IHR A;  5F3J A;  2FBW A;  3KVB A;  2J4G A;  2LHR A;  4U2Z A;  3F57 A;  4GK0 E;  3K3N A;  1KNR A;  4C91 A;  3OPC A;  5AQI B;  4B3R T;  4IDN A;  2WB5 A;  2G0U A;  2H3R A;  3EVY A;  2WY2 A;  4HFB A;  2FJB A;  4AKG A;  3OYZ A;  3E0Z A;  4H9N C;  3PUG A;  1MMD A;  4HTE A;  3ZEF B;  1E7P A;  5AQN B;  2VKH A;  5JH7 E;  4JI2 T;  1YQ4 A;  2X9H A;  1XZY A;  2H7O A;  3AEF A;  4ZI3 C;  2ODV A;  4IIJ E;  2WDR A;  1X9B A;  4JEH B;  4PJJ A;  3UQ4 A;  1SUM B;  2DWG A;  3Q5D A;  4U7I A;  5A1L A;  2Q9Q D;  2PG8 A;  3QB5 K;  4UVA B;  4DV6 T;  4IDZ A;  1BR2 A;  3AXJ B;  3GN5 B;  5JDL A;  4EV6 A;  3CX8 B;  4IT4 A;  1YKE B;  4NPP A;  4F6R C;  3KBU A;  3I1A A;  2QGS A;  1OED B;  3BQK A;  4DR7 T;  4EZ4 A;  4JEU B;  3E08 A;  4YHJ A;  3P4S A;  1QSD A;  2V5D A;  4JI0 T;  3AAA B;  3AE9 A;  5LOV E;  3AE7 A;  4CQI A;  4I43 B;  3P4Q A;  2XAQ B;  4L0R A;  4QXB B;  4MFR A;  1FMV A;  2PTF A;  3ESL A;  4AI6 A;  2OA5 A;  3S4U A;  2SPC A;  4LF6 T;  2YU1 A;  3H37 A;  3HA4 A;  2XQ4 A;  2WU5 A;  3Q5X A;  4JLE A;  4IDO A;  4JI8 T;  2UXD T;  3ZT5 A;  3R84 B;  4CN1 A;  2VK9 A;  4DV7 T;  4NXM T;  3AE5 A;  2VB6 A;  3BK9 A;  4EZH A;  4GKK T;  1ZOY A;  3CWZ B;  4YHH T;  2VL0 A;  2KIN B;  4QX7 B;  2UUC T;  4UEM A;  4QXH B;  3K3Q C;  5ADX L;  1MMA A;  1J5E T;  1YQ3 A;  2RA1 A;  4DID B;  2ZM6 T;  2CBI A;  2I6H A;  2LRL A;  3VU7 H;  2BKO A;  2MPK A;  3CQC B;  5FP3 A;  2L8K A;  4M1P A;  2R6G F;  4X66 T;  5LBM A;  3U78 A;  4HFD A;  1VOM A;  2LOS A;  5AQS B;  2JQ9 A;  4U72 A;  2KT9 A;  5CA0 E;  1HFA A;  4WBN E;  4ZEY A;  2UXC T;  5AQJ B;  4JI6 T;  3QK6 A;  1W0B A;  1T8B A;  2LLY A;  4CN6 A;  5AQL B;  3QNU A;  2ACX A;  3AXJ A;  5KDM C;  3ZSS A;  2J47 A;  2WU2 A;  3W15 B;  4DR6 T;  2HN1 A;  4QH5 A;  2BS2 A;  5HEG A;  3T1Y T;  2LSJ A;  5LHI B;  3P50 A;  1OED A;  3BQI A;  4LFB T;  5HXS A;  3UUX B;  2AXD S;  2DNX A;  3UUM A;  2IHR 1;  4ZZC A;  2MYS A;  2E9X D;  3UU4 A;  3IF8 B;  3VRA A;  5IHY A;  5L4E A;  2V8S V;  5EK2 A;  1FIO A;  1XDP A;  1HNX T;  4DV0 T;  1O3X A;  2B1E A;  4PAG A;  1FMW A;  3ZCJ A;  4GIW A;  4TNW A;  2KSR A;  1G73 A;  1FEW A;  4IE6 A;  5FXZ A;  1ZV4 X;  4LF7 T;  4DMW A;  1HS7 A;  2LKG A;  3SFD A;  5LGU B;  3PV0 F;  1QUU A;  4KHZ F;  2VAS A;  3N9P A;  4U2Y A;  4AQF A;  4ZHQ E;  1MIY A;  1IBL T;  3AAI A;  1D0Z A;  3PU3 A;  3ZYM A;  4COF A;  4B3S T;  4LF4 T;  1M7K A;  3PDY A;  5AQP B;  2Q9Q B;  4QH4 A;  5FL1 A;  3UTK A;  3RF1 A;  1JNZ A;  1YXR A;  3X1D A;  5HXE A;  3H3M A;  3DJB A;  4OYJ A;  2FJE A;  4O4L E;  5L3G B;  1NWM X;  2VVS A;  5CA1 E;  5IUX A;  3ONJ A;  2BBJ A;  4KHP T;  2GK9 A;  4HWH A;  4Z8X A;  3RH3 A;  4JUY A;  4K0K T;  4K0U A;  3C4X A;  3ZC0 A;  2XQ3 A;  4I50 E;  3K8P C;  2DI4 A;  4TNV A;  2CA5 A;  2V7K A;  4NIQ A;  4ILA A;  3RI5 A;  3I0Q A;  2KWH A;  3PUQ A;  3ZYK A;  2NW9 A;  3RGL A;  4ZI2 C;  3AA1 B;  2HPJ A;  3ZKR A;  5AFU L;  4YTM A;  1OED C;  2PBI A;  4L5G A;  2VVN A;  5EZY E;  1S35 A;  4IE7 A;  4YSY A;  2A72 A;  3AEA A;  4JI3 T;  1U4Q A;  3UUN A;  3PTR B;  4H9S E;  5LNK A;  3JC6 D;  5L4H A;  3GA8 A;  5DQW A;  3OBV E;  4MHC A;  1BR1 A;  2W2U A;  4PW8 A;  3Q2M A;  2LKH A;  1US7 B;  1HTJ F;  5JR9 B;  3MK7 C;  3D0T A;  2XAF B;  4GYS A;  3I9Y A;  3K3O A;  5KX5 E;  2QVA A;  4L9I A;  5LG4 A;  3HL6 A;  4DBR A;  3FB2 A;  3MXZ A;  2W4X A;  3PUX F;  3OVU A;  4UF0 B;  5JRE A;  1HX1 B;  4XAX B;  4YJ2 E;  2BG9 B;  2BS4 A;  2VUR A;  4TN7 B;  2H88 A;  4EGW A;  2K48 A;  2XTL A;  1XNQ T;  3ZLI A;  4AQF C;  3HKE E;  3FHN A;  4CI3 B;  4DO0 A;  5HEO A;  3Q5W A;  4X20 E;  4EAH A;  1UGO A;  3N2K E;  3UFE A;  3PE0 A;  3TLU A;  4EED A;  3P4P A;  4HWF A;  1SA0 E;  2EHO B;  5DJQ C;  2X9W A;  3KVA A;  3T8O A;  4HWI B;  2WSS V;  2CPT A;  2W66 A;  4WYV A;  4CN4 A;  3TLT A;  2D9D A;  2E9X B;  4YXD A;  1N33 T;  5AQQ B;  2UU9 T;  3FBL A;  4UVB B;  4U3C A;  1LKX A;  5JDG A;  2UXN B;  3ZT6 A;  5M4Y A;  5FKY A;  3CKD A;  4KUM B;  4AQY T;  4IHJ E;  3ANW B;  5HEU A;  4H9Q C;  4AXP A;  4NUU A;  4BJM A;  2DWK A;  2WDQ A;  2VKD A;  2E5L T;  5HCJ A;  3CX7 B;  2V6X A;  3RIA A;  2XQ8 A;  3AE1 A;  4IL9 A;  5AQU B;  2W61 A;  2E5V A;  2XAJ B;  5FXV A;  5HWY A;  2V6Y B;  3UU6 A;  4X1I E;  4IE0 A;  2KWI B;  3ZST A;  5JDF A;  5C2T A;  3TKL B;  3U3I A;  1D1B A;  1WLX A;  2K24 A;  1J5W A;  4DMV A;  4BA9 A;  2JQK A;  3RIF A;  4PK4 A;  4UF0 A;  4ILB A;  4YTP A;  2IDO B;  3FXE B;  3AEE A;  4ISS A;  3RRC A;  3RX6 A;  5ABE A;  3KV6 A;  2PFV A;  4YT0 A;  2ZM0 A;  2X0L B;  2W62 A;  2CCQ A;  2ZMA A;  2CWY A;  3O1J A;  3PUZ F;  2X9Y A;  1KNP A;  3VRB A;  4PNI A;  3G06 A;  4HN9 A;  5LMU T;  1GQE A;  5AQO B;  5GON E;  1N34 T;  4UV9 B;  1ZEE A;  3EI0 A;  4UIG A;  2DLR A;  3AE4 A;  1ZKE A;  3NVO A;  5LB7 B;  1W9R A;  3PUY F;  4V1A v;  2E9X A;  4LF8 T;  4TWD A;  4ZS2 A;  2KZ7 B;  1NEN A;  1Z8U A;  2CM0 A;  3ZMV B;  3MJX A;  3I0O A;  2WCA A;  3ANW A;  3NZP A;  4MAL A;  2PJQ A;  5ABF B;  2IC6 A;  4CXW A;  1LRZ A;  3B5M A;  3SOL A;  3GMI A;  3AE3 A;  3NRY A;  5LMN T;  2P9B A;  2LHN A;  3FXD B;  2FJA A;  3L39 A;  5J1G A;  4X64 T;  2CBJ A;  2CLY B;  4X1K E;  4J2C A;  3B13 A;  4YFS A;  2J62 A;  2WP9 A;  4PFP A;  2C0S A;  3AAE B;  3FZH B;  5LJN A;  2VKJ A;  5HAX A;  3N9N A;  5L3D B;  3V5S A;  3UUL A;  4Z91 A;  4IST A;  3C51 A;  2LJL A;  4PJL A;  1L0V A;  2LSK A;  3ETV A;  4KP3 C;  4XBF B;  2N9D A;  1JNR A;  4YY3 T;  4U33 A;  3PJA J;  5KMG P;  3VHL A;  3M65 A;  3O1I A;  5L3B B;  2N2N A;  3OKQ A;  3SWH A;  1MIW A;  1XWM A;  3TLS A;  2XM2 A;  4HWD A;  4FJO A;  2WZI A;  2Y8D A;  4N78 D;  4ADZ A;  2XSB A;  3A7M A;  2KXP B;  3LJC A;  3C64 A;  5IWA T;  5LP6 E;  1U5P A;  3KV5 A;  3ZYL A;  1UX4 A;  4HFI A;  3CVR A;  1CUN A;  1OED E;  3GN5 A;  4X65 T;  4DV1 T;  1UUS A;  4DVD A;  3CQG B;  2KLQ A;  4O4I E;  2Y6X A;  2EHO D;  5ETW A;  3RPU A;  4H9R C;  2E9X C;  4DV4 T;  3IEE A;  4E7Z A;  2NP9 A;  4A97 A;  3CX6 B;  3DP7 A;  1T7S A;  4OK0 A;  2D0T A;  2X0Y A;  2BKN A;  2D5U A;  3AEB A;  1KK7 A;  5L2L A;  2RP4 A;  5CJ5 A;  1VCT A;  2MOZ A;  2CWO A;  4TV9 E;  3LK2 B;  5FVK A;  3IA3 A;  3JAF A;  3E22 E;  2OLT A;  2FUP A;  1WCR A;  5JRC B;  4DUZ T;  3AB3 B;  4CI2 B;  1OWA A;  4PK5 A;  3CIR A;  2BVM A;  3RKO A;  2XQY A;  4LFA T;  2YDS A;  4HFV A;  3WAJ A;  2ACZ A;  2CMR A;  4WBO A;  3KV4 A;  4AKR B;  2LSI A;  2VQF T;  4EXT A;  2VL8 A;  4HFE A;  1T72 A;  5AQR B;  4CZZ B;  4IDQ A;  3T1H T;  4P1N A;  2OV9 A;  3Q5E A;  4O4J E;  2L9Q A;  3KFW X;  1X79 A;  3O4X E;  3PUR A;  2LM9 A;  1FJG T;  4KI0 F;  2WM9 A;  3JCF A;  3ZN1 B;  3RYF E;  3VR8 A;  3AVS A;  3N9L A;  1Y01 A;  3QOF A;  4JYA T;  2K3W A;  4UR9 A;  4LF5 T;  1CHU A;  4OFZ A;  2ZLY A;  3N5L A;  2E2A A;  2C5I T;  2AE9 A;  2CHO A;  2XAH B;  4EYY R;  3UU5 A;  2K9A A;  2LM2 A;  1D0Y A;  2D0U A;  3JAD A;  1SHZ C;  1HCI A;  2W67 A;  2WZH A;  3RLF F;  3RYI E;  2XQ6 A;  1BR0 A;  2BKP A;  3SFE A;  4YTN A;  3VKG A;  3AA6 B;  2D2S A;  2MBG A;  3SS1 A;  5LJM A;  3CK6 A;  2VKO A;  4ERR A;  2JQH A;  2A2F X;  4A5X A;  3UFG A;  4DUY T;  2M6I A;  5CFB A;  1S94 A;  5HXC A;  2V5C A;  4ZOL E;  3C4W A;  3C98 B;  3HR0 A;  3AE8 A;  2IW5 B;  4ZXL A;  2X68 A;  4PJN A;  4O8S A;  4BJN A;  2WMO A;  3RYH E;  1MMN A;  3ABV A;  5HXH A;  1DU2 A;  2CE7 A;  4AKI A;  4AKL A;  2V7L A;  2FJD A;  5LHG B;  1LVK A;  1H7C A;  2NTX A;  2HPL A;  1NEK A;  5LCY A;  1YW0 A;  2CLY C;  4QWN B;  1EZ3 A;  4DR1 T;  2HHH T;  4Z90 A;  1UUR A;  3IBP A;  3KDS E;  4NUV A;  5EK3 A;  3RQW A;  5E0O A;  2IUB A;  2JIW A;  5L3E B;  5FYM A;  2LOP A;  5JQG E;  1V9D A;  2JQQ A;  2JMH A;  1IBM T;  1XDO A;  2Q9Q A;  4ZS3 A;  1HR0 T;  4LFC T;  3EDV A;  4HFC A;  2MTQ A;  3OYX A;  5FXW A;  2WWV A;  1KFY A;  3WI3 A;  4G2A A;  1J1J A;  5JDQ A;  4MLK A;  4ZI7 E;  4HE8 A;  2CXL A;  3OJA A;  4B3M T;  5BR8 T;  5AQT B;  1YD8 G;  3I9W A;  5J2U E;  3LBX B;  2I0M A;  3RRW A;  2BVL A;  3R6N A;  3AA7 B;  4EYU A;  3F31 A;  4HKA A;  3VR9 A;  5EK4 A;  4OX9 T;  4O2A E;  3AE2 A;  2HH7 A;  2HN2 A;  2IAK A;  4KMC A;  4JBW F;  1KEY A;  3QC9 A;  2MAW A;  4X5T A;  2M67 A;  1D0X A;  1ZHC A;  3UU8 A;  5LA6 E;  2IIU A;  1N36 T;  2XSA A;  3ZMS B;  2X0H A;  1WR6 A;  3CPZ A;  3ZMT B;  3N9O A;  5ABG A;  5CGM A;  2XZE A;  4X62 T;  5DAB A;  3PUW F;  3VKH A;  1IZN B;  3ONX A;  1W0A A;  3RYC E;  5HEJ A;  2NW8 A;  3RIU A;  1VCS A;  4DND A;  4UVC B;  1IAP A;  4CI1 B;  5JDM A;  3FBZ A;  3EDU A;  5HXR A;  5JDN A;  2NTY A;  4H9P C;  2WQY A;  4I55 E;  1W09 A;  3ZJ1 A;  4QKN A;  5JR9 A;  4NXN T;  2XPK A;  2QRX A;  2BG9 E;  2V26 A;  4CXX A;  3QUJ A;  3N9M A;  3DTO A;  4PJM A;  2K5B B;  2XQ7 A;  2ODU A;  2YEV C;  4U74 A;  2H7V C;  4JI4 T;  2BG9 A;  5LXT E;  5F8P A;  3TLW A;  2XQ5 A;  2Y48 B;  5ABH A;  1YKH B;  4X1Y E;  1QLB A;  1HG2 A;  2CXF A;  3HKB E;  5CB4 E;  4EEB A;  4PK6 A;  2Q9Q C;  3FZL B;  3H3A A;  1E2A A;  2X67 A;  3HKD E;  3M3Z B;  1N32 T;  1WFD A;  2YOE A;  2EHO A;  2X51 A;  4P0B A;  4HGA A;  3LBX A;  3GWH A;  4H63 H;  1R8I A;  1AJ3 A;  3JAE A;  1MNE A;  4ZI3 D;  4IDP A;  1MMG A;  3L3P A;  3RC3 A;  1Z0P A;  2JRK A;  3FZM B;  5IYZ E;  3SRZ A;  2YDR A;  4DR4 T;  3UT5 E;  3PUS A;  3LFM A;  3ZCI A;  2WDV A;  3AVR A;  1XNR T;  3MA9 A;  2ES0 A;  3B57 A;  3ZN0 B;  1BR4 A;  2M6B A;  4HWC A;  5TAO A;  3MKD A;  3RKG A;  2KMF A;  3ONL C;  5J2T E;  3EHZ A;  4EIW A;  1SE7 A;  4KBM B;  3HKC E;  4B6X A;  4A98 A;  2V6Y A;  1HG5 A;  1E1H B;  4UXN B;  3WAK A;  2YU2 A;  3RIU C;  3UUB A;  5FL0 A;  2CXD A;  4IRE A;  4LF9 T;  5AQV B;  4YSZ A;  3ZT7 A;  4WZX A;  3A8Y C;  4IGU A;  2WWU A;  1MIV A;  5JR9 C;  2L3L A;  1T98 A;  2W00 A;  5LYJ E;  4UEL A; 
#chains in the Genus database with same CATH homology
 3E0Z A;  4TN7 B;  4H9N C;  3PUR A;  2C5K T;  2JPF A;  2VWA A;  2K48 A;  3MZK B;  2XTL A;  3A5X A;  3ZLI A;  4AQF C;  3HKE E;  3ZMU B;  2LM9 A;  3PUG A;  2LT3 A;  1MMD A;  3FHN A;  4CI3 B;  4DO0 A;  4HTE A;  3ZEF B;  2WM9 A;  4H9O C;  3ZN1 B;  1D1A A;  3F2E A;  3O1H A;  3Q5W A;  3N9Q A;  2VKH A;  5JH7 E;  3RYF E;  1Y64 B;  4X20 E;  3AVS A;  2X9H A;  4EAH A;  2UXX B;  1IJ5 A;  2H7O A;  3N9L A;  3KV9 A;  2E8I A;  3N2K E;  4ZI3 C;  2ODV A;  3UFE A;  3PE0 A;  4IIJ E;  2KND A;  1SA0 E;  4IE5 A;  3ZMZ B;  2EHO B;  4JEH B;  4TV8 E;  4ILU A;  5DJQ C;  5L3C B;  2X9W A;  2X66 A;  3KVA A;  4PJJ A;  3T8O A;  2DWG A;  1WYC A;  2IC9 A;  4XZC A;  5A1L A;  2Q9Q D;  2WSS V;  2PG8 A;  4OFZ A;  2ZLY A;  3N5L A;  2EHO C;  3PUA A;  4UVA B;  2C5I T;  2NW7 A;  4IDZ A;  2E9X B;  2DHR A;  5FY1 A;  2XAH B;  3HI2 A;  4EYY R;  1BR2 A;  2K9A A;  3GN5 B;  3P7I A;  3FBL A;  2V1D B;  3NZQ A;  4UVB B;  4WW0 A;  5JDL A;  1LKX A;  1D0Y A;  2D0U A;  5JDG A;  3CX8 B;  5C8Y E;  2UXN B;  1SHZ C;  1YKE B;  5M4Y A;  2V7M A;  1HCI A;  2C5J A;  3CKD A;  4KUM B;  3RYI E;  4F6R C;  3KBU A;  1BR0 A;  3I1A A;  2QGS A;  4IHJ E;  3J9X 1;  3ANW B;  3VKG A;  3AA6 B;  2D2S A;  2MBG A;  3SS1 A;  3BQK A;  4H9Q C;  4EZ4 A;  4AXP A;  4NUU A;  5LJM A;  1IJ6 A;  2I59 A;  4JEU B;  2VKO A;  3E08 A;  4BJM A;  4ERR A;  2DWK A;  5H6Q B;  2A2F X;  4YHJ A;  1WYB A;  3L09 A;  1QSD A;  2VKD A;  2X9X A;  3ZC1 A;  3CX7 B;  5FY0 A;  5LGN B;  1UX5 A;  1S94 A;  5HXC A;  4OYK A;  5LHH B;  4ZOL E;  3AAA B;  3C4W A;  2WBL A;  3C50 A;  3C98 B;  3HR0 A;  2XAS B;  5LOV E;  2IW5 B;  4CQI A;  4CXY A;  4I43 B;  3N2G E;  2X68 A;  2W61 A;  4O8S A;  4PJN A;  4BJN A;  4TUY E;  2WMO A;  5FMN A;  2BZB A;  2XAQ B;  4L0R A;  2XAJ B;  3RYH E;  5FXV A;  4QXB B;  5HWY A;  1MMN A;  5HXH A;  4MFR A;  2W63 A;  5BMV E;  1FMV A;  4X1I E;  4IE0 A;  2CE7 A;  2KWI B;  3ESL A;  4AKI A;  4AKL A;  4AI6 A;  2OA5 A;  2V7L A;  3S4U A;  2SPC A;  5LHG B;  2YU1 A;  1LVK A;  3H37 A;  1H7C A;  2NTX A;  3HA4 A;  3Q5X A;  4JLE A;  2HPL A;  5JDF A;  5LCY A;  3R84 B;  1YW0 A;  2CLY C;  4QWN B;  3TKL B;  3U3I A;  1EZ3 A;  5L3F B;  4QHO A;  1D1B A;  3IBP A;  2VK9 A;  1WLX A;  2K24 A;  2LEH A;  3KDS E;  4NUV A;  2VB6 A;  5EK3 A;  2A3D A;  5E0O A;  3P8C D;  4DMV A;  1VRB A;  4BA9 A;  3BK9 A;  5FYM A;  4EZH A;  2LOP A;  5JQG E;  5L3E B;  1V9D A;  2LE8 A;  3CWZ B;  4H63 V;  2JQQ A;  4PK4 A;  4UF0 A;  2V7J A;  5DQV A;  2KIN B;  2JMH A;  4QX7 B;  3CML A;  4UEM A;  4QXH B;  4WNK A;  2Q9Q A;  3K3Q C;  4ZS3 A;  5ADX L;  1G8X A;  3FXE B;  2DCF A;  1MMA A;  3EDV A;  4ISS A;  3RRC A;  3RX6 A;  4MBQ A;  3KV6 A;  2PFV A;  2RA1 A;  2ZM0 A;  2MTQ A;  5HYA A;  2X0L B;  2Z6E A;  3OYX A;  5FXW A;  2W62 A;  2CCQ A;  3VU7 H;  2ZMA A;  2WMN A;  2CWY A;  3WI3 A;  4G2A A;  3O1J A;  3CQC B;  4MLK A;  5FP3 A;  5JDQ A;  2L8K A;  3RC8 A;  4ZI7 E;  4HE8 A;  2CXL A;  2X9Y A;  4M1P A;  3OJA A;  3V5U A;  5LBM A;  3ETU A;  1YD8 G;  4GYR A;  4PNI A;  3U78 A;  1VOM A;  3I9W A;  4HN9 A;  2YIN A;  5J2U E;  3LBX B;  2LOS A;  5GON E;  3RRW A;  2BVL A;  3R6N A;  4QXC B;  3AA7 B;  4GOU A;  4U72 A;  2KT9 A;  3F31 A;  4EYU A;  2V7I A;  4HKA A;  4UV9 B;  5EK4 A;  4O2A E;  5JDH A;  3O9X A;  3ZJ2 A;  4GK5 E;  5CA0 E;  1HFA A;  1ZEE A;  3C4Z A;  4UIG A;  2DLR A;  4WBN E;  1ZKE A;  2HH7 A;  4E7S A;  3QK6 A;  4V1A v;  2E9X A;  2IAK A;  4UV8 B;  1OXZ A;  4KMC A;  4BAY B;  2ACX A;  5KDM C;  3QC9 A;  3LK4 2;  4ZS2 A;  2KZ7 B;  2M67 A;  4AQG A;  1D0X A;  3N2O A;  4OHF A;  1UCU A;  1ZHC A;  5LA6 E;  2BDE A;  3W15 B;  2CM0 A;  3ZMV B;  3MJX A;  3ZMS B;  2LSJ A;  3I0O A;  5LHI B;  1WR6 A;  4FI5 A;  2JJ9 A;  3CPZ A;  3ANW A;  1HX8 A;  3ZMT B;  3BQI A;  3NZP A;  3MAC A;  2ZM8 A;  4MAL A;  2PJQ A;  4HEA A;  4G63 A;  5HXS A;  3UUX B;  2IC6 A;  2DNX A;  4CXW A;  1LRZ A;  3N9O A;  3UUM A;  3JC6 C;  2NOX A;  3NRX A;  2MYS A;  4I4T E;  3SOL A;  3GMI A;  2E9X D;  5DAB A;  4P09 A;  4TZ4 C;  3IF8 B;  3NRY A;  5IHY A;  4ANJ A;  3VKH A;  2NWB A;  1IZN B;  3ONX A;  2P9B A;  2LHN A;  3RYC E;  2NW8 A;  3FXD B;  5EK2 A;  1FIO A;  5JRC A;  2ZM2 A;  4DND A;  2LSG A;  5J1G A;  4ZI2 D;  1D1C A;  4PFO A;  4UVC B;  1IAP A;  1LVF A;  2CLY B;  1O3X A;  4CI1 B;  5JDM A;  4X1K E;  4O4H E;  2B1E A;  3FBZ A;  4J2C A;  5FY7 A;  3EDU A;  4PAG A;  1FMW A;  3B13 A;  5HXR A;  2JMK A;  3ZCJ A;  4YFS A;  4GIW A;  5JDN A;  3PU8 A;  2NTY A;  4H9P C;  4I55 E;  1G73 A;  1FEW A;  3EUH A;  4IE6 A;  4PFP A;  4EOZ B;  2C0S A;  5FXZ A;  3AA0 B;  4AKH A;  3AAE B;  3ZJ1 A;  4QKN A;  1ZV4 X;  5JR9 A;  5LJN A;  2VKJ A;  5HAX A;  3N9N A;  3KBT A;  4CXX A;  2LSY A;  2V26 A;  4DMW A;  3QUJ A;  1HS7 A;  3N9M A;  3DTO A;  5LGU B;  4EB6 E;  4PJM A;  5L3D B;  1KNZ A;  3V5S A;  5FNV E;  3UUL A;  5JVD E;  2CEA A;  1QUU A;  2K5B B;  2ODU A;  3C51 A;  2LJL A;  2XUE A;  4IST A;  4PJL A;  2YEV C;  2LSK A;  2VAS A;  3ETV A;  4U74 A;  3N9P A;  4KP3 C;  2N1G A;  4AQF A;  4ZHQ E;  4XBF B;  2H7V C;  1MIY A;  5LXT E;  4DBQ A;  3AAI A;  1D0Z A;  2N9D A;  3PU3 A;  5F8P A;  3ZYM A;  4P0A A;  3PDY A;  2Y48 B;  4IE4 A;  1WRD A;  1YKH B;  2Q9Q B;  5KMG P;  1B7T A;  2XAG B;  3NBX X;  5LGT B;  4X1Y E;  3UTK A;  3VHL A;  5H6R B;  3M65 A;  3CQX C;  3O1I A;  3BQL A;  1HG2 A;  2CXF A;  3HKB E;  1HF8 A;  5CB4 E;  5LBQ B;  3LG7 A;  5L3B B;  2N2N A;  3OKQ A;  4PK6 A;  3SWH A;  5HXE A;  2Q9Q C;  1MIW A;  2WAU A;  4C90 A;  3DJB A;  4OYJ A;  3H3A A;  4FJO A;  2QA7 A;  4O4L E;  5L3G B;  2X67 A;  3HKD E;  2Y8D A;  1NWM X;  4N78 D;  4ADZ A;  2EHO A;  2X51 A;  4P0B A;  4HGA A;  5CA1 E;  3KIN B;  2YK0 A;  2KXP B;  3LBX A;  3LJC A;  3C64 A;  3GWH A;  4TX5 A;  4YLH A;  5LP6 E;  4H63 H;  4A56 A;  3J7Y q;  1U5P A;  3KV5 A;  1AJ3 A;  3ZYL A;  4O2B E;  1MNE A;  1UX4 A;  2GK9 A;  4Z8X A;  3RH3 A;  4ZI3 D;  3CVR A;  1CUN A;  1MMG A;  3GN5 A;  3L3P A;  4JUY A;  3RC3 A;  1Z0P A;  4K0U A;  4QX8 B;  2XHE B;  3C4X A;  2JRK A;  5IYZ E;  3SRZ A;  4DVD A;  3ZC0 A;  3UT5 E;  3CQG B;  3PUS A;  3LFM A;  2KLQ A;  4O4I E;  5HWX A;  2W0G A;  2J1D G;  4I50 E;  3ZCI A;  3K8P C;  2Y6X A;  3ZPO A;  2EHO D;  2DI4 A;  2CA5 A;  5ETW A;  2V7K A;  3AVR A;  3RPU A;  4H9R C;  3MA9 A;  2E9X C;  2ES0 A;  4YJ3 E;  3B57 A;  3IEE A;  3ZN0 B;  1BR4 A;  4E7Z A;  2NP9 A;  3I0Q A;  3LK3 B;  3CX6 B;  2KWH A;  3DP7 A;  5TAO A;  3PUQ A;  3MKD A;  3Q9D A;  3ZYK A;  2KMF A;  4OK0 A;  2D0T A;  2NW9 A;  4ZI2 C;  1NAF A;  3AA1 B;  5J2T E;  2D5U A;  4EIW A;  2HPJ A;  5FXX A;  5AFU L;  1KK7 A;  4KBM B;  5L2L A;  2PBI A;  4ASK A;  2RP4 A;  4L5G A;  5EZY E;  2MOZ A;  2CWO A;  1S35 A;  3HKC E;  4TV9 E;  3LK2 B;  4IE7 A;  4B6X A;  1MND A;  2A72 A;  1U4Q A;  3E22 E;  1HG5 A;  3IHR A;  5F3J A;  3UUN A;  3PTR B;  4H9S E;  3KVB A;  5JRC B;  5LNK A;  2LHR A;  3AB3 B;  1E1H B;  4UXN B;  4CI2 B;  3WAK A;  3JC6 D;  1OWA A;  3F57 A;  3GA8 A;  4GK0 E;  4PK5 A;  5DQW A;  3K3N A;  2YU2 A;  3OBV E;  2BVM A;  3RKO A;  4MHC A;  4C91 A;  2XQY A;  1BR1 A;  4PW8 A;  3Q2M A;  4HFV A;  3WAJ A;  2CXD A;  1US7 B;  2CMR A;  2G0U A;  1HTJ F;  4WBO A;  3MK7 C;  5JR9 B;  3KV4 A;  3D0T A;  4AKR B;  2XAF B;  4GYS A;  2LSI A;  3I9Y A;  4EXT A;  2H3R A;  3K3O A;  5KX5 E;  2VL8 A;  3EVY A;  4L9I A;  5LG4 A;  3HL6 A;  4IGU A;  4DBR A;  2WWU A;  3FB2 A;  3MXZ A;  1MIV A;  5JR9 C;  2L3L A;  4UF0 B;  4AKG A;  1T98 A;  4CZZ B;  3OYZ A;  5JRE A;  4O4J E;  2W00 A;  2L9Q A;  4XAX B;  4YJ2 E;  5LYJ E;  3KFW X;  4UEL A;  1X79 A;  3O4X E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...