2DWKA

Crystal structure of the run domain of mouse rap2 interacting protein x
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
162
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein RUFY3
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwkA00
4GIWA 2CXFA 3CWZB 2DWGA 2DWKA 2CXLA
chains in the Genus database with same CATH superfamily
4UVBB 1M7KA 4TZ4C 4OHFA 1U5PA 2HN2A 4EYUA 4IE7A 2YINA 3ZYLA 3KVBA 4LMKA 3HR0A 3EUHA 3DTOA 3SS1A 5J0ZA 1LVKA 5FXWA 4WBOA 3ABVA 4JI7T 5HXRA 2NWBA 1MMGA 3AA6B 4QX8B 4ZI3D 4HFIA 1X9BA 2WAUA 2BKNA 3LBXB 2NP9A 3F31A 2KINB 4CI3B 4OX9T 3M3ZB 4IDPA 5EK3A 4CN4A 1Y01A 3AXJA 4G2AA 4YHHT 4DV5T 2HPLA 2E9XD 2FUPA 5L47A 3ZPOA 2LSKA 3ZEFB 3RYFE 2IMLA 1MMDA 3UU6A 3TKLB 3UUNA 4QHOA 1YQ4A 4I55E 4F6RC 3ZKRA 4AKHA 3JADA 3L39A 5ABHA 1D1CA 4GOUA 3J7Yq 3ZMVB 2VURA 2XZEA 2VL0A 2BVLA 4CI1B 3A7MA 4ZS2A 4HGAA 3ZYKA 2DL1A 2WDVA 2JRKA 2MAWA 3RYCE 1B7TA 3AEBA 4EGWA 5L2LA 2WDQA 2H7VC 3Q9DA 3RRCA 5AQOB 2HH7A 2WM9A 1E7PA 4NUUA 4AKIA 3PDYA 5FP3A 4DV4T 4P09A 3EDUA 4OYJA 4HWFA 1SA0E 2WS3A 5LB7B 4DMWA 2K5BB 4HFCA 4QXHB 2X66A 2XAJB 4DV2T 3T1YT 3I9YA 3DJBA 3ZT7A 2BKPA 4YTPA 2V5CA 2VASA 4OYKA 4IIJE 2IDOB 4B3RT 2BS2A 5FVLA 2VWAA 1UGOA 5F5WA 1W9RA 2Y6XA 4EEDA 3AE5A 3PUWF 4DV0T 1KF6A 5C8YE 3AXJB 3FXEB 2ZMAA 3HKCE 4EOZB 2X0LB 4ZXLA 3RIFA 2VQFT 1U4QA 5CB4E 1OXZA 4DNDA 2KSRA 2V7MA 3AVRA 4JYAT 2NW7A 3Q5XA 1WYCA 4TX5A 4WNKA 1T7SA 2L3LA 3RX6A 2BG9E 3CIRA 1R8IA 2BBHA 3CVRA 2FJEA 1D0YA 2ES0A 4DV3T 1XMOT 3W15B 2V1DB 2IHR1 2JQHA 1YD8G 2EHOC 5H6QB 4FJOA 4B6XA 5AQPB 3EABA 4IREA 3O9XA 3LDQB 3L8RA 1VOMA 4BJMA 3ESLA 2UXCT 5JRCA 3WAKA 5DQVA 5TAOA 2YEVC 2WQYA 3Q5DA 5DJQC 4DR1T 5KMGP 3PUZF 5LJNA 2FJAA 3ETVA 2I6HA 3AA1B 3D0TA 4COFA 2ZM2A 3GMIA 3CMLA 4HWHA 2Q9QD 2M67A 4I0UA 3N9LA 2WZIA 3N9PA 2X9XA 2LLYA 1ZKEA 1VRBA 3ZYMA 2M6BA 4AQGA 1NEKA 4HFEA 4ILAA 3E22E 1NENA 4Q25A 2VL8A 3ZT6A 2VKOA 3PV0F 4PAGA 1T98A 4UIGA 4UEMA 2YOEA 4ILBA 4Z8XA 2KT9A 4YFSA 1ZOYA 3H3MA 2XM1A 4OK0A 2W63A 3LSVA 5EK4A 4ZHQE 2WP9A 2XHEB 3O1IA 1X79A 3PE0A 3ZLIA 3FZFB 3I0OA 4NXNT 3FBLA 1BR4A 4N78D 4DBQA 3JC6C 3UULA 4FI5A 5HEGA 3CK6A 2CLYC 5JR9C 2BDEA 3ZN1B 5JRCB 5DQWA 1UX4A 4GKJT 4P1NA 3J9X1 3MA9A 2DNXA 4H63H 5HEJA 5ETWA 1HG2A 2CWYA 4LFBT 4PJLA 3PUSA 2W2UA 1QLBA 2LHNA 4H9NC 4O8SA 3Q5EA 4ZZCA 2JQQA 2JJ9A 4YSXA 2RPAA 2MPKA 4KMCA 1HX8A 4PJJA 1H7CA 3UQ4A 3P8CD 4JBWF 1O3XA 4AIUA 4PW8A 4TWDA 3TLWA 1Y64B 3AE4A 3T8OA 5CJ5A 3AE1A 5BMVE 4AI6A 1HX1B 5J2TE 3SFEA 3AEGA 4EYYR 5HXHA 4UELA 4O4HE 3ZN0B 4KHPT 4YSYA 3R84B 4TNWA 4DBRA 3MACA 3C98B 4JI3T 2FBWA 4ZOLE 3P50A 4X62T 5FL0A 3JCFA 3GN5A 1WLXA 2KXPB 3P4QA 3MZKB 3ZMZB 3CX7B 1FEWA 2CM0A 3RKOA 4LF8T 3K1SA 5LMUT 1MIWA 4PK6A 4K0UA 4QXBB 5DABA 2WWUA 4LFCT 4EEBA 3L09A 3ZMUB 4JI8T 3ZMSB 2LT3A 4EV6A 3K3NA 4PK5A 3VRBA 4PK4A 1ZV4X 3A8YC 1MNEA 2LKHA 5LHHB 2XTLA 4HFHA 1S94A 3RHWA 4DR2T 1UK5A 1Z8UA 2XUEA 2YU1A 4UV8B 1KK7A 4JEHB 2JQKA 3ZJ2A 3AEDA 4IGUA 4ZI2D 1KNZA 3HL6A 3FHNA 1HNWT 3I1AA 3C51A 3AB3B 4QKNA 3RI5A 3UU8A 4CXXA 3VKGA 2MOZA 2K9AA 2KMFA 1CUNA 5LXTE 3I0QA 5LA6E 5EK2A 2CPTA 4GKKT 2E8IA 3TLSA 3GWHA 1CHUA 2DHRA 2XQ8A 3P7IA 1UURA 4AXPA 1KNRA 3FZKB 2K3WA 2G0UA 4X65T 3SRZA 4X20E 1YW0A 2JIWA 5LJMA 3QOFA 2WCAA 4DVDA 4MHCA 5AQVB 3GN5B 2LSIA 4DMVA 1AJ3A 4J2CA 4JLEA 2XQ9A 3C4ZA 5JDLA 1KFYA 2D2SA 2N9DA 2WB5A 2UUAT 1NAFA 2BKOA 5LP6E 3K3OA 4TWFA 4AQFC 4UR9A 4V1Av 4A98A 3PUYF 3ANWA 5JTGA 1WCRA 2OLTA 3EHZA 4C91A 2A3DA 3KFWX 4ISSA 2CEAA 4DR4T 2XM2A 3AA0B 1HNZT 3ONXA 5LGNB 3C4WA 2D9DA 3PUAA 3PURA 4A5XA 4LF7T 1WR6A 4ZI3C 2UU9T 3ZCJA 1XWMA 1J5WA 2VQET 2E9XC 4H9SE 3RQUA 2IC6A 2PJQA 3N9QA 2C5KT 1XMQT 2HN1A 2EHOA 2KWHA 2SPCA 2W62A 3UUXB 3ZC0A 2WDRA 4AISA 2V7LA 3G06A 3OPCA 4DIDB 1YKHB 4ADZA 2D0UA 5KX5E 3RKGA 3KV4A 4CN1A 2LM9A 3PTRB 3AE7A 4YXDA 2CBIA 4YSZA 4YHJA 5HEHA 2KLQA 2CRBA 5LG3A 2ZM8A 3F2EA 3FBZA 4LFAT 4LF9T 2LOPA 4G63A 3C50A 4F8HA 3OKQA 1SE7A 2XQ6A 4U3CA 2JQ9A 3QB5K 2X0HA 4UV9B 4LMLA 1FIOA 4ZEYA 4GYRA 2UUBT 1I94T 3PUGA 4TNVA 3SOLA 5J1GA 3AE8A 3U3IA 1DU2A 3ANWB 4CZZB 4H9PC 3AE2A 2WU2A 3NRYA 4C90A 4JI4T 2A72A 3P4SA 4B3TT 2XQYA 5FMNA 5JDQA 1YXRA 2X67A 4JI5T 2NTYA 2WY2A 3CQCB 2LEHA 3RPUA 3MK7C 2E5VA 2XAFB 2XJ7A 1MIVA 4IHJE 5L3GB 4YTNA 5JREA 2YDQA 2WMOA 4IE0A 1XDOA 3L3PA 2EHOB 5LBMA 2YKSA 5JR9A 1HNXT 5KDMC 4U7YA 4H63V 5HAXA 2FJDA 2XQ5A 4P0BA 3CQXC 2BG9C 3NZPA 3ZMTB 4HN9A 1N32T 2IUBA 4GK0E 5LBQB 1IZNB 3OBVE 4H9RC 5LGUB 2OA5A 2V7IA 2J62A 1NWMX 2N2NA 2ZLYA 2V8SV 3ZCIA 1T72A 3FXDB 2M6IA 4HKAA 4Z90A 4YT0A 4HWIB 3LFMA 3O4XE 3VU7H 4HFBA 2BS4A 3N2GE 2XQ3A 3IEEA 2ACXA 5AQTB 2LSJA 5IWAT 4X1KE 3BQLA 3R6NA 2WMNA 2QVAA 4QXCB 2DWKA 3OYZA 3KBTA 4Z91A 4UVAB 3CKDA 4E7SA 4XAXB 4MFRA 5AQLB 2CMRA 4M1PA 4DV7T 2WWVA 2VVNA 1IBKT 5L3CB 5C2TA 2YN6A 4PFOA 4ILCA 4AQYT 5ABEA 2QGSA 1VCSA 4CXYA 2LRKA 4UF0A 3TLVA 3UU4A 2Q9QC 3UUBA 4X66T 2E2AA 4IE5A 5L4EA 3C4XA 2DLRA 4GIWA 3LJCA 2XQ7A 2PG8A 1HCIA 3NVOA 2WU5A 3IA3A 2V6XA 5GONE 2CLYB 3EI0A 5JR9B 3AECA 3VRAA 2XSBA 4HEAA 3ZC1A 1J1JA 5LYJE 4QH1A 4I50E 2BVMA 2IC9A 5HEUA 2MYSA 4MLKA 4CQIA 1JNRA 3HI2A 4P0AA 5AQQB 2J47A 4BA9A 5AQJB 1IJ6A 5FY7A 5F8PA 3UT5E 2JMKA 4QX7B 4B3MT 4HE8A 3QK6A 2YDRA 4MBQA 3FZMB 2CHNA 2VB6A 3K3QC 2OV9A 3KV6A 3IHRA 4LF5T 3OTOT 4IDZA 3CWZB 4WBNE 5E0OA 4XZCA 4TWHA 3NBXX 4O4JE 1MNDA 2C5JA 3AE9A 3TLTA 1MIYA 2PBIA 2LHRA 3X1DA 3QB5A 3LK2B 4PNIA 5H6RB 3VR8A 4DR7T 1US7B 2IW5B 3UTKA 4KI0F 4JEUB 4DR3T 4UF0B 5JVDE 3RIAA 2XY8B 1BR1A 5AQIB 1N33T 2RA1A 2X0YA 3HKDE 2V6YA 3RLFF 5JDGA 4HFVA 4KP3C 2L8KA 2H88A 3SWHA 2VKJA 4TV9E 5LGTB 5AQRB 1OEDC 2MTQA 2UXXB 3N2OA 3KBUA 5IYZE 3RGLA 1MMNA 4YTMA 2XAQB 1KNPA 2ZM0A 3UFGA 4NUVA 3ONJA 2X9HA 2ZM6T 4JI0T 4JI1T 3VKHA 1WYBA 1WR0A 3EDVA 4IDOA 2LM2A 1IBLT 3AE3A 2XAHB 4U33A 4LMJA 4PJMA 1IJ5A 3B5MA 1IBMT 4AQFA 4AKGA 2A9UA 3B13A 5IHYA 3N5LA 4NIQA 3KVAA 3LG7A 5LOVE 4U74A 2B76A 1UUSA 3QUJA 4JUYA 1N36T 3PJAA 5A1LA 3UU3A 4X5TA 3RIUC 3ZJ1A 3FZLB 4PFPA 2K24A 5JDHA 4A97A 3QNUA 2W4XA 2DI4A 3OJAA 2HPJA 2E9XA 2XSAA 2HHHT 4BAYB 2PFVA 1BR2A 5L4HA 4CN6A 2V6YB 4U2YA 2CA5A 2QYWA 2W0GA 3RYIE 2X51A 3N9MA 3EAMA 3PU8A 5J2UE 3N2KE 4PJNA 4DUYT 2Y8DA 2I59A 2WBLA 3CPZA 4KHZF 3U78A 3AAIA 2A2FX 4WYVA 5F3JA 3JAEA 5JDMA 2GK9A 2W00A 4DR5T 4ZI2C 4QH5A 5HXCA 3O1JA 5LHGB 4O4LE 3V5SA 3AEAA 5FNVE 5L3BB 1HS7A 5HWXA 1T8BA 3A5XA 4KUMB 4K0KT 2QRXA 2V7JA 3AEEA 1IAPA 5IUXA 5BR8T 2NW8A 3S4UA 4YJ3E 1W0AA 5L3FB 2V7KA 5FXZA 1HR0T 4UVCB 4A56A 5AQFB 2Z6EA 2N1GA 2VVSA 3E08A 3PUXF 3NWIA 3ONLC 3RH3A 3EVYA 2E9XB 5FYMA 2CWOA 1LVFA 4EB6E 1ZEEA 1M62A 5L3DB 1HFAA 3GA8A 4BJNA 2NW9A 4QH4A 2MBGA 2V26A 4AKRB 2LSGA 5M4YA 2W66A 3UU5A 4IT4A 3AE6A 2CXFA 2BG9A 3NRXA 2FJBA 4I4TE 5HWYA 2CCQA 2YDSA 2X9YA 1FMVA 2VKDA 3FZHB 1YKEB 2W67A 1I6ZA 1UX5A 5CA0E 4O2AE 4WW0A 5L3EB 4ERRA 1MMAA 3RRWA 3CX8B 1WRDA 2DCFA 5JH7E 5JDNA 4UXNB 4JV5T 4ZZBA 4HWDA 4HTEA 1D1BA 3HA4A 1E2AA 3MXZA 3MKDA 5HXEA 1JNZA 2B1EA 3UUMA 5CA1E 3IF8B 4LF6T 3RC8A 4H9OC 3V5UA 2LE8A 5FY0A 5HYAA 1QSDA 4DUZT 4ASKA 2D5UA 2NTXA 2UXNB 4U2ZA 3SFDA 1EZ3A 5FL1A 2Q9QA 2P9BA 1XDPA 1GQEA 4QWNB 2EHOD 2DWGA 3B57A 3OYXA 2IAKA 1D0ZA 2LKGA 3HKEE 3ZT5A 1LRZA 3Q5WA 5FXXA 3LK3B 3PJAJ 3RC3A 2UUCT 2UXDT 2CHOA 1UCUA 2BG9B 3HKBE 1OWAA 5AQGB 3F57A 1WFDA 2KWIB 2CE7A 5AQKB 1SHZC 5ADXL 2LRLA 3H37A 5AQMB 2L9QA 3P4WA 4IE6A 2R6GF 2IIUA 2QA7A 3PUVF 2BBJA 1VCTA 5JQGE 5CGMA 3AA7B 2K48A 2XQ4A 4TV8E 1N34T 3BQKA 5LG4A 4IDQA 4CXWA 4NXMT 2ODUA 3UFEA 4WZXA 4LF4T 3P4PA 5HEOA 5KXJA 2E5LT 5FVKA 5FY1A 3JAFA 1FMWA 3KV9A 5ABFA 4ZS3A 2Y48B 5AQSB 1G8XA 3TLUA 2H3RA 2F4VT 1QUUA 3ETUA 4IL9A 3VR9A 4ANJA 3NKZA 2NOXA 3C64A 2XASB 2Q9QB 4TUYE 2W61A 2PTFA 5ABGA 2NR4A 4O2BE 1KEYA 2H7OA 4X1IE 3M65A 4MALA 3JC6D 2V5DA 3FB2A 3AAEB 3QC9A 1OEDA 1Z0PA 3KDSE 1D1AA 3Q2MA 3IBPA 2JPFA 1BR0A 5AQHB 4O4IE 3I9WA 4DO0A 2BZBA 3H3AA 3ZSTA 3WAJA 2J4GA 3NZQA 4YJ2E 3AVSA 2J1DG 4NPPA 5LNKA 1SUMB 3ZSSA 4L0RA 2H89A 2C0SA 5FXVA 3CX6B 5CFBA 2KZ7B 2CXDA 5C3JA 4DR6T 2AXDS 2ACZA 1E1HB 2XQAA 3N9OA 2YU2A 4DV6T 5EZYE 5AFUL 4ISTA 3KV5A 4TN7B 5HCJA 3AEFA 1ZHCA 2CBJA 3RIUA 1V9DA 5ABFB 3AAAB 3LK42 5HCMA 4U31A 4JI6T 1ZP0A 1L0VA 3RQWA 2XPKA 2WSSV 2X9WA 3E0ZA 4YY3T 1XNRT 2LJLA 4IL4A 2BS3A 3CQGB 4U7IA 4L5GA 4DV1T 2WZHA 1W09A 3RF1A 4OFZA 2KNDA 3O1HA 1HF8A 4X64T 4EAHA 1OEDE 4AKLA 4HFDA 5AQUB 1OEDB 3K8PC 4GYSA 4IE4A 1S35A 3BK9A 1D0XA 4KBMB 4L9IA 1HTJF 4E7ZA 2VKHA 3PU3A 3MJXA 4ZI7E 4EZ4A 4JI2T 2LSYA 3OVUA 2AE9A 4KX6A 3RYHE 5LHIB 2C5IT 5JDFA 1W0BA 3N9NA 5LCYA 2CXLA 3DP7A 4ILUA 5HXSA 4HWCA 3UQ7A 4GK5E 2D0TA 4I43B 2X68A 4EZHA 3P4RA 2VK9A 3KINB 3LBXA 4IDNA 2RP4A 1XNQT 3PUQA 4YLHA 1LKXA 1FJGT 2LOSA 2XAGB 4XBFB 1XZYA 2ODVA 4X1YE 1J5ET 4U72A 2JMHA 1YQ3A 1G73A 4B3ST 5AQNB 4H9QC 4EIWA 3BQIA 2YK0A 2I0MA 4EXTA 5FKYA 3T1HT 4CI2B 5LMNT 1HG5A 2UXBT 3WI3A 3VHLA
chains in the Genus database with same CATH topology
3OYZA 3KBTA 3RRWA 4UVBB 3CX8B 1WRDA 2DCFA 3CKDA 4TZ4C 4UVAB 5BMVE 4OHFA 4E7SA 4XAXB 4UXNB 5JDNA 5JH7E 1U5PA 4MFRA 4EYUA 4HTEA 2CMRA 1D1BA 4M1PA 4AI6A 3HA4A 3MXZA 3MKDA 5HXEA 4IE7A 5L3CB 2YINA 5J2TE 3ZYLA 3KVBA 4PFOA 2B1EA 3UUMA 3HR0A 5CA1E 4EYYR 2QGSA 3IF8B 5HXHA 4CXYA 3RC8A 3EUHA 4H9OC 3V5UA 2LE8A 5FY0A 5HYAA 4UELA 3DTOA 1QSDA 4O4HE 4ASKA 3SS1A 2D5UA 1LVKA 5FXWA 3ZN0B 4WBOA 2NTXA 3R84B 4UF0A 2Q9QC 4IE5A 3C4XA 4DBRA 2DLRA 2UXNB 3C98B 3MACA 4GIWA 3LJCA 5HXRA 1EZ3A 4ZOLE 2NWBA 1MMGA 3AA6B 4QX8B 2Q9QA 4ZI3D 2P9BA 2WAUA 2PG8A 3LBXB 1HCIA 2NP9A 3F31A 2KINB 4CI3B 5EK3A 4QWNB 4G2AA 2EHOD 3GN5A 2DWGA 3B57A 1WLXA 2KXPB 5GONE 3MZKB 2HPLA 3OYXA 2CLYB 2E9XD 3CX7B 3ZMZB 1FEWA 5JR9B 2CM0A 2IAKA 3RKOA 1D0ZA 3HKEE 3ZPOA 2LSKA 1MIWA 4PK6A 3ZEFB 1LRZA 3Q5WA 3RYFE 5FXXA 1MMDA 3LK3B 4K0UA 4QXBB 5DABA 2WWUA 3TKLB 4HEAA 3UUNA 3RC3A 3ZC1A 4QHOA 3L09A 3ZMUB 3ZMSB 5LYJE 1UCUA 2LT3A 4I50E 4I55E 2BVMA 4F6RC 3HKBE 1OWAA 3K3NA 2IC9A 4PK5A 4AKHA 2MYSA 4MLKA 3F57A 1D1CA 4GOUA 4PK4A 3J7Yq 4CQIA 3ZMVB 2KWIB 1ZV4X 1MNEA 2CE7A 3HI2A 4P0AA 5LHHB 2BVLA 1SHZC 4CI1B 5ADXL 3H37A 4ZS2A 2XTLA 1S94A 2L9QA 4BA9A 4HGAA 4IE6A 1IJ6A 2QA7A 3ZYKA 5FY7A 2JRKA 5JQGE 3AA7B 2XUEA 5F8PA 3UT5E 2JMKA 2K48A 2YU1A 4TV8E 4QX7B 4UV8B 3RYCE 1KK7A 3BQKA 1B7TA 4JEHB 5LG4A 4HE8A 5L2LA 3QK6A 4CXWA 2H7VC 2ODUA 4MBQA 3ZJ2A 3Q9DA 3RRCA 2HH7A 2VB6A 2WM9A 3UFEA 4NUUA 3K3QC 4IGUA 4AKIA 3PDYA 3KV6A 4ZI2D 1KNZA 5FP3A 3IHRA 4IDZA 3CWZB 3EDUA 3HL6A 4P09A 5E0OA 3FHNA 4OYJA 3I1AA 3NBXX 4XZCA 5FY1A 4O4JE 1MNDA 1FMWA 3C51A 3AB3B 2C5JA 1SA0E 4QKNA 1MIYA 2PBIA 2LHRA 4DMWA 2K5BB 4QXHB 2X66A 2XAJB 3KV9A 3LK2B 4PNIA 2MOZA 3I9YA 5H6RB 4CXXA 3VKGA 2K9AA 2KMFA 3DJBA 1US7B 1CUNA 4ZS3A 2IW5B 2Y48B 3UTKA 5LXTE 3I0QA 5LA6E 5EK2A 1G8XA 2H3RA 2VASA 4OYKA 4JEUB 1QUUA 4UF0B 4IIJE 3ETUA 5JVDE 2E8IA 4ANJA 3GWHA 1BR1A 3VHLA 2VWAA 2DHRA 2RA1A 3HKDE 5JDGA 3P7IA 2NOXA 3C64A 4HFVA 2XASB 4AXPA 4KP3C 2L8KA 2Q9QB 2Y6XA 4TUYE 3SWHA 2G0UA 2VKJA 3SRZA 2W61A 4X20E 1YW0A 5C8YE 5LJMA 4TV9E 4O2BE 4DVDA 4MHCA 5LGTB 2H7OA 4X1IE 3M65A 3FXEB 2MTQA 3GN5B 2UXXB 4MALA 3JC6D 2ZMAA 2LSIA 3N2OA 3FB2A 3HKCE 4EOZB 4DMVA 3AAEB 2X0LB 3KBUA 5IYZE 1AJ3A 3QC9A 4J2CA 1MMNA 1Z0PA 2XAQB 4JLEA 2ZM0A 3C4ZA 5JDLA 1U4QA 5CB4E 1OXZA 3KDSE 1D1AA 3Q2MA 4NUVA 4DNDA 3IBPA 2JPFA 2V7MA 2D2SA 2N9DA 1BR0A 2X9HA 3AVRA 4O4IE 3I9WA 4DO0A 3VKHA 2BZBA 3H3AA 1WYBA 3EDVA 3WAJA 1NAFA 2NW7A 3Q5XA 5LP6E 3K3OA 1WYCA 4TX5A 3NZQA 4WNKA 4AQFC 2XAHB 2L3LA 3RX6A 4V1Av 3ANWA 4YJ2E 3AVSA 4PJMA 1IJ5A 2J1DG 4C91A 5LNKA 4AQFA 4AKGA 4L0RA 2A3DA 2C0SA 5FXVA 3B13A 3KFWX 4ISSA 5IHYA 2CEAA 3CVRA 1D0YA 3CX6B 2KZ7B 2ES0A 3N5LA 3KVAA 3AA0B 3LG7A 2CXDA 3ONXA 5LGNB 3C4WA 4U74A 3PUAA 5LOVE 3PURA 3QUJA 1WR6A 4ZI3C 3W15B 4JUYA 1E1HB 2V1DB 3N9OA 3ZCJA 2YU2A 5A1LA 1YD8G 2EHOC 5EZYE 4FJOA 5H6QB 3ZJ1A 4B6XA 5AFUL 4PFPA 4ISTA 2E9XC 4H9SE 3O9XA 2K24A 3KV5A 2IC6A 2PJQA 3N9QA 5JDHA 2C5KT 4TN7B 1VOMA 4BJMA 3ESLA 1ZHCA 1V9DA 2DI4A 2EHOA 3OJAA 3AAAB 5JRCA 3WAKA 2HPJA 2KWHA 2SPCA 2E9XA 2W62A 3LK42 5DQVA 3UUXB 3ZC0A 5TAOA 2V7LA 2YEVC 4BAYB 2PFVA 1BR2A 5DJQC 1YKHB 5KMGP 4ADZA 2WSSV 5LJNA 3ETVA 2X9WA 3E0ZA 3AA1B 3D0TA 2D0UA 2ZM2A 3GMIA 5KX5E 2CA5A 2W0GA 3CMLA 2LJLA 3KV4A 3CQGB 2Q9QD 2LM9A 3PTRB 3RYIE 4L5GA 2X51A 2M67A 4OFZA 3N9MA 4YHJA 3PU8A 3N9LA 2KNDA 3O1HA 5J2UE 3N2KE 2KLQA 1HF8A 3N9PA 4EAHA 2X9XA 2ZM8A 4PJNA 4AKLA 3F2EA 3FBZA 2Y8DA 1ZKEA 2LOPA 3K8PC 4GYSA 1VRBA 3C50A 4G63A 2I59A 3ZYMA 4AQGA 4IE4A 2WBLA 3CPZA 3OKQA 1S35A 3U78A 3AAIA 2A2FX 3E22E 5F3JA 3BK9A 2VL8A 4UV9B 2VKOA 1D0XA 4PAGA 1T98A 4UIGA 5JDMA 4KBMB 1FIOA 4UEMA 2GK9A 2W00A 4GYRA 4L9IA 1HTJF 4Z8XA 4ZI2C 4E7ZA 2VKHA 3PU3A 3MJXA 4ZI7E 3PUGA 2KT9A 4YFSA 4EZ4A 5HXCA 3SOLA 5J1GA 2LSYA 3O1JA 3U3IA 5LHGB 4O4LE 3ANWB 4OK0A 4CZZB 4H9PC 3V5SA 3RYHE 5LHIB 3NRYA 2C5IT 4C90A 2A72A 5FNVE 5L3BB 5JDFA 2W63A 1HS7A 5EK4A 4ZHQE 5HWXA 3A5XA 3N9NA 4KUMB 2XQYA 5LCYA 2CXLA 2XHEB 5FMNA 5JDQA 3O1IA 1X79A 2V7JA 3DP7A 2X67A 3PE0A 2NTYA 3CQCB 4ILUA 5HXSA 1IAPA 3ZLIA 4GK5E 3I0OA 2NW8A 3S4UA 2LEHA 2D0TA 4YJ3E 3RPUA 5L3FB 3MK7C 2XAFB 4I43B 2X68A 3FBLA 1MIVA 2V7KA 5FXZA 4IHJE 1BR4A 4N78D 4UVCB 4A56A 4DBQA 4EZHA 2Z6EA 3JC6C 3UULA 5L3GB 2VK9A 2N1GA 4FI5A 5JREA 3KINB 2WMOA 2CLYC 4IE0A 3E08A 3LBXA 5JR9C 2RP4A 3L3PA 2EHOB 2BDEA 5LBMA 3ZN1B 5JRCB 5DQWA 3PUQA 4YLHA 3RH3A 3EVYA 2E9XB 5FYMA 2CWOA 1LKXA 1LVFA 4EB6E 1ZEEA 2LOSA 5L3DB 2XAGB 5JR9A 1UX4A 1HFAA 3GA8A 4BJNA 3J9X1 2NW9A 5KDMC 4XBFB 3MA9A 4H63V 2MBGA 2DNXA 5HAXA 4H63H 4P0BA 2ODVA 5ETWA 3CQXC 4X1YE 3NZPA 1HG2A 2CWYA 3ZMTB 2V26A 4HN9A 2JMHA 4U72A 4AKRB 4GK0E 2LSGA 5LBQB 4PJLA 3PUSA 1IZNB 5M4YA 3OBVE 1G73A 4H9RC 5LGUB 2OA5A 2V7IA 2CXFA 2LHNA 4H9NC 1NWMX 2N2NA 4H9QC 2ZLYA 4EIWA 3BQIA 3NRXA 4O8SA 2YK0A 3ZCIA 4I4TE 3FXDB 2CCQA 5HWYA 4HKAA 2JQQA 4EXTA 2X9YA 1FMVA 2JJ9A 2VKDA 1YKEB 4WBNE 3LFMA 3O4XE 3VU7H 4CI2B 4KMCA 1HX8A 1UX5A 4PJJA 1H7CA 3N2GE 5CA0E 3IEEA 3P8CD 2ACXA 1O3XA 2LSJA 4O2AE 4WW0A 4X1KE 5L3EB 3BQLA 1HG5A 3R6NA 2WMNA 4PW8A 4ERRA 1Y64B 1MMAA 3WI3A 3T8OA 4QXCB 2DWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIW A;  2CXF A;  3CWZ B;  2DWG A;  2DWK A;  2CXL A; 
#chains in the Genus database with same CATH topology
 4UVB B;  1M7K A;  4TZ4 C;  4OHF A;  1U5P A;  2HN2 A;  4EYU A;  4IE7 A;  2YIN A;  3ZYL A;  3KVB A;  4LMK A;  3HR0 A;  3EUH A;  3DTO A;  3SS1 A;  5J0Z A;  1LVK A;  5FXW A;  4WBO A;  3ABV A;  4JI7 T;  5HXR A;  2NWB A;  1MMG A;  3AA6 B;  4QX8 B;  4ZI3 D;  4HFI A;  1X9B A;  2WAU A;  2BKN A;  3LBX B;  2NP9 A;  3F31 A;  2KIN B;  4CI3 B;  4OX9 T;  3M3Z B;  4IDP A;  5EK3 A;  4CN4 A;  1Y01 A;  3AXJ A;  4G2A A;  4YHH T;  4DV5 T;  2HPL A;  2E9X D;  2FUP A;  5L47 A;  3ZPO A;  2LSK A;  3ZEF B;  3RYF E;  2IML A;  1MMD A;  3UU6 A;  3TKL B;  3UUN A;  4QHO A;  1YQ4 A;  4I55 E;  4F6R C;  3ZKR A;  4AKH A;  3JAD A;  3L39 A;  5ABH A;  1D1C A;  4GOU A;  3J7Y q;  3ZMV B;  2VUR A;  2XZE A;  2VL0 A;  2BVL A;  4CI1 B;  3A7M A;  4ZS2 A;  4HGA A;  3ZYK A;  2DL1 A;  2WDV A;  2JRK A;  2MAW A;  3RYC E;  1B7T A;  3AEB A;  4EGW A;  5L2L A;  2WDQ A;  2H7V C;  3Q9D A;  3RRC A;  5AQO B;  2HH7 A;  2WM9 A;  1E7P A;  4NUU A;  4AKI A;  3PDY A;  5FP3 A;  4DV4 T;  4P09 A;  3EDU A;  4OYJ A;  4HWF A;  1SA0 E;  2WS3 A;  5LB7 B;  4DMW A;  2K5B B;  4HFC A;  4QXH B;  2X66 A;  2XAJ B;  4DV2 T;  3T1Y T;  3I9Y A;  3DJB A;  3ZT7 A;  2BKP A;  4YTP A;  2V5C A;  2VAS A;  4OYK A;  4IIJ E;  2IDO B;  4B3R T;  2BS2 A;  5FVL A;  2VWA A;  1UGO A;  5F5W A;  1W9R A;  2Y6X A;  4EED A;  3AE5 A;  3PUW F;  4DV0 T;  1KF6 A;  5C8Y E;  3AXJ B;  3FXE B;  2ZMA A;  3HKC E;  4EOZ B;  2X0L B;  4ZXL A;  3RIF A;  2VQF T;  1U4Q A;  5CB4 E;  1OXZ A;  4DND A;  2KSR A;  2V7M A;  3AVR A;  4JYA T;  2NW7 A;  3Q5X A;  1WYC A;  4TX5 A;  4WNK A;  1T7S A;  2L3L A;  3RX6 A;  2BG9 E;  3CIR A;  1R8I A;  2BBH A;  3CVR A;  2FJE A;  1D0Y A;  2ES0 A;  4DV3 T;  1XMO T;  3W15 B;  2V1D B;  2IHR 1;  2JQH A;  1YD8 G;  2EHO C;  5H6Q B;  4FJO A;  4B6X A;  5AQP B;  3EAB A;  4IRE A;  3O9X A;  3LDQ B;  3L8R A;  1VOM A;  4BJM A;  3ESL A;  2UXC T;  5JRC A;  3WAK A;  5DQV A;  5TAO A;  2YEV C;  2WQY A;  3Q5D A;  5DJQ C;  4DR1 T;  5KMG P;  3PUZ F;  5LJN A;  2FJA A;  3ETV A;  2I6H A;  3AA1 B;  3D0T A;  4COF A;  2ZM2 A;  3GMI A;  3CML A;  4HWH A;  2Q9Q D;  2M67 A;  4I0U A;  3N9L A;  2WZI A;  3N9P A;  2X9X A;  2LLY A;  1ZKE A;  1VRB A;  3ZYM A;  2M6B A;  4AQG A;  1NEK A;  4HFE A;  4ILA A;  3E22 E;  1NEN A;  4Q25 A;  2VL8 A;  3ZT6 A;  2VKO A;  3PV0 F;  4PAG A;  1T98 A;  4UIG A;  4UEM A;  2YOE A;  4ILB A;  4Z8X A;  2KT9 A;  4YFS A;  1ZOY A;  3H3M A;  2XM1 A;  4OK0 A;  2W63 A;  3LSV A;  5EK4 A;  4ZHQ E;  2WP9 A;  2XHE B;  3O1I A;  1X79 A;  3PE0 A;  3ZLI A;  3FZF B;  3I0O A;  4NXN T;  3FBL A;  1BR4 A;  4N78 D;  4DBQ A;  3JC6 C;  3UUL A;  4FI5 A;  5HEG A;  3CK6 A;  2CLY C;  5JR9 C;  2BDE A;  3ZN1 B;  5JRC B;  5DQW A;  1UX4 A;  4GKJ T;  4P1N A;  3J9X 1;  3MA9 A;  2DNX A;  4H63 H;  5HEJ A;  5ETW A;  1HG2 A;  2CWY A;  4LFB T;  4PJL A;  3PUS A;  2W2U A;  1QLB A;  2LHN A;  4H9N C;  4O8S A;  3Q5E A;  4ZZC A;  2JQQ A;  2JJ9 A;  4YSX A;  2RPA A;  2MPK A;  4KMC A;  1HX8 A;  4PJJ A;  1H7C A;  3UQ4 A;  3P8C D;  4JBW F;  1O3X A;  4AIU A;  4PW8 A;  4TWD A;  3TLW A;  1Y64 B;  3AE4 A;  3T8O A;  5CJ5 A;  3AE1 A;  5BMV E;  4AI6 A;  1HX1 B;  5J2T E;  3SFE A;  3AEG A;  4EYY R;  5HXH A;  4UEL A;  4O4H E;  3ZN0 B;  4KHP T;  4YSY A;  3R84 B;  4TNW A;  4DBR A;  3MAC A;  3C98 B;  4JI3 T;  2FBW A;  4ZOL E;  3P50 A;  4X62 T;  5FL0 A;  3JCF A;  3GN5 A;  1WLX A;  2KXP B;  3P4Q A;  3MZK B;  3ZMZ B;  3CX7 B;  1FEW A;  2CM0 A;  3RKO A;  4LF8 T;  3K1S A;  5LMU T;  1MIW A;  4PK6 A;  4K0U A;  4QXB B;  5DAB A;  2WWU A;  4LFC T;  4EEB A;  3L09 A;  3ZMU B;  4JI8 T;  3ZMS B;  2LT3 A;  4EV6 A;  3K3N A;  4PK5 A;  3VRB A;  4PK4 A;  1ZV4 X;  3A8Y C;  1MNE A;  2LKH A;  5LHH B;  2XTL A;  4HFH A;  1S94 A;  3RHW A;  4DR2 T;  1UK5 A;  1Z8U A;  2XUE A;  2YU1 A;  4UV8 B;  1KK7 A;  4JEH B;  2JQK A;  3ZJ2 A;  3AED A;  4IGU A;  4ZI2 D;  1KNZ A;  3HL6 A;  3FHN A;  1HNW T;  3I1A A;  3C51 A;  3AB3 B;  4QKN A;  3RI5 A;  3UU8 A;  4CXX A;  3VKG A;  2MOZ A;  2K9A A;  2KMF A;  1CUN A;  5LXT E;  3I0Q A;  5LA6 E;  5EK2 A;  2CPT A;  4GKK T;  2E8I A;  3TLS A;  3GWH A;  1CHU A;  2DHR A;  2XQ8 A;  3P7I A;  1UUR A;  4AXP A;  1KNR A;  3FZK B;  2K3W A;  2G0U A;  4X65 T;  3SRZ A;  4X20 E;  1YW0 A;  2JIW A;  5LJM A;  3QOF A;  2WCA A;  4DVD A;  4MHC A;  5AQV B;  3GN5 B;  2LSI A;  4DMV A;  1AJ3 A;  4J2C A;  4JLE A;  2XQ9 A;  3C4Z A;  5JDL A;  1KFY A;  2D2S A;  2N9D A;  2WB5 A;  2UUA T;  1NAF A;  2BKO A;  5LP6 E;  3K3O A;  4TWF A;  4AQF C;  4UR9 A;  4V1A v;  4A98 A;  3PUY F;  3ANW A;  5JTG A;  1WCR A;  2OLT A;  3EHZ A;  4C91 A;  2A3D A;  3KFW X;  4ISS A;  2CEA A;  4DR4 T;  2XM2 A;  3AA0 B;  1HNZ T;  3ONX A;  5LGN B;  3C4W A;  2D9D A;  3PUA A;  3PUR A;  4A5X A;  4LF7 T;  1WR6 A;  4ZI3 C;  2UU9 T;  3ZCJ A;  1XWM A;  1J5W A;  2VQE T;  2E9X C;  4H9S E;  3RQU A;  2IC6 A;  2PJQ A;  3N9Q A;  2C5K T;  1XMQ T;  2HN1 A;  2EHO A;  2KWH A;  2SPC A;  2W62 A;  3UUX B;  3ZC0 A;  2WDR A;  4AIS A;  2V7L A;  3G06 A;  3OPC A;  4DID B;  1YKH B;  4ADZ A;  2D0U A;  5KX5 E;  3RKG A;  3KV4 A;  4CN1 A;  2LM9 A;  3PTR B;  3AE7 A;  4YXD A;  2CBI A;  4YSZ A;  4YHJ A;  5HEH A;  2KLQ A;  2CRB A;  5LG3 A;  2ZM8 A;  3F2E A;  3FBZ A;  4LFA T;  4LF9 T;  2LOP A;  4G63 A;  3C50 A;  4F8H A;  3OKQ A;  1SE7 A;  2XQ6 A;  4U3C A;  2JQ9 A;  3QB5 K;  2X0H A;  4UV9 B;  4LML A;  1FIO A;  4ZEY A;  4GYR A;  2UUB T;  1I94 T;  3PUG A;  4TNV A;  3SOL A;  5J1G A;  3AE8 A;  3U3I A;  1DU2 A;  3ANW B;  4CZZ B;  4H9P C;  3AE2 A;  2WU2 A;  3NRY A;  4C90 A;  4JI4 T;  2A72 A;  3P4S A;  4B3T T;  2XQY A;  5FMN A;  5JDQ A;  1YXR A;  2X67 A;  4JI5 T;  2NTY A;  2WY2 A;  3CQC B;  2LEH A;  3RPU A;  3MK7 C;  2E5V A;  2XAF B;  2XJ7 A;  1MIV A;  4IHJ E;  5L3G B;  4YTN A;  5JRE A;  2YDQ A;  2WMO A;  4IE0 A;  1XDO A;  3L3P A;  2EHO B;  5LBM A;  2YKS A;  5JR9 A;  1HNX T;  5KDM C;  4U7Y A;  4H63 V;  5HAX A;  2FJD A;  2XQ5 A;  4P0B A;  3CQX C;  2BG9 C;  3NZP A;  3ZMT B;  4HN9 A;  1N32 T;  2IUB A;  4GK0 E;  5LBQ B;  1IZN B;  3OBV E;  4H9R C;  5LGU B;  2OA5 A;  2V7I A;  2J62 A;  1NWM X;  2N2N A;  2ZLY A;  2V8S V;  3ZCI A;  1T72 A;  3FXD B;  2M6I A;  4HKA A;  4Z90 A;  4YT0 A;  4HWI B;  3LFM A;  3O4X E;  3VU7 H;  4HFB A;  2BS4 A;  3N2G E;  2XQ3 A;  3IEE A;  2ACX A;  5AQT B;  2LSJ A;  5IWA T;  4X1K E;  3BQL A;  3R6N A;  2WMN A;  2QVA A;  4QXC B;  2DWK A;  3OYZ A;  3KBT A;  4Z91 A;  4UVA B;  3CKD A;  4E7S A;  4XAX B;  4MFR A;  5AQL B;  2CMR A;  4M1P A;  4DV7 T;  2WWV A;  2VVN A;  1IBK T;  5L3C B;  5C2T A;  2YN6 A;  4PFO A;  4ILC A;  4AQY T;  5ABE A;  2QGS A;  1VCS A;  4CXY A;  2LRK A;  4UF0 A;  3TLV A;  3UU4 A;  2Q9Q C;  3UUB A;  4X66 T;  2E2A A;  4IE5 A;  5L4E A;  3C4X A;  2DLR A;  4GIW A;  3LJC A;  2XQ7 A;  2PG8 A;  1HCI A;  3NVO A;  2WU5 A;  3IA3 A;  2V6X A;  5GON E;  2CLY B;  3EI0 A;  5JR9 B;  3AEC A;  3VRA A;  2XSB A;  4HEA A;  3ZC1 A;  1J1J A;  5LYJ E;  4QH1 A;  4I50 E;  2BVM A;  2IC9 A;  5HEU A;  2MYS A;  4MLK A;  4CQI A;  1JNR A;  3HI2 A;  4P0A A;  5AQQ B;  2J47 A;  4BA9 A;  5AQJ B;  1IJ6 A;  5FY7 A;  5F8P A;  3UT5 E;  2JMK A;  4QX7 B;  4B3M T;  4HE8 A;  3QK6 A;  2YDR A;  4MBQ A;  3FZM B;  2CHN A;  2VB6 A;  3K3Q C;  2OV9 A;  3KV6 A;  3IHR A;  4LF5 T;  3OTO T;  4IDZ A;  3CWZ B;  4WBN E;  5E0O A;  4XZC A;  4TWH A;  3NBX X;  4O4J E;  1MND A;  2C5J A;  3AE9 A;  3TLT A;  1MIY A;  2PBI A;  2LHR A;  3X1D A;  3QB5 A;  3LK2 B;  4PNI A;  5H6R B;  3VR8 A;  4DR7 T;  1US7 B;  2IW5 B;  3UTK A;  4KI0 F;  4JEU B;  4DR3 T;  4UF0 B;  5JVD E;  3RIA A;  2XY8 B;  1BR1 A;  5AQI B;  1N33 T;  2RA1 A;  2X0Y A;  3HKD E;  2V6Y A;  3RLF F;  5JDG A;  4HFV A;  4KP3 C;  2L8K A;  2H88 A;  3SWH A;  2VKJ A;  4TV9 E;  5LGT B;  5AQR B;  1OED C;  2MTQ A;  2UXX B;  3N2O A;  3KBU A;  5IYZ E;  3RGL A;  1MMN A;  4YTM A;  2XAQ B;  1KNP A;  2ZM0 A;  3UFG A;  4NUV A;  3ONJ A;  2X9H A;  2ZM6 T;  4JI0 T;  4JI1 T;  3VKH A;  1WYB A;  1WR0 A;  3EDV A;  4IDO A;  2LM2 A;  1IBL T;  3AE3 A;  2XAH B;  4U33 A;  4LMJ A;  4PJM A;  1IJ5 A;  3B5M A;  1IBM T;  4AQF A;  4AKG A;  2A9U A;  3B13 A;  5IHY A;  3N5L A;  4NIQ A;  3KVA A;  3LG7 A;  5LOV E;  4U74 A;  2B76 A;  1UUS A;  3QUJ A;  4JUY A;  1N36 T;  3PJA A;  5A1L A;  3UU3 A;  4X5T A;  3RIU C;  3ZJ1 A;  3FZL B;  4PFP A;  2K24 A;  5JDH A;  4A97 A;  3QNU A;  2W4X A;  2DI4 A;  3OJA A;  2HPJ A;  2E9X A;  2XSA A;  2HHH T;  4BAY B;  2PFV A;  1BR2 A;  5L4H A;  4CN6 A;  2V6Y B;  4U2Y A;  2CA5 A;  2QYW A;  2W0G A;  3RYI E;  2X51 A;  3N9M A;  3EAM A;  3PU8 A;  5J2U E;  3N2K E;  4PJN A;  4DUY T;  2Y8D A;  2I59 A;  2WBL A;  3CPZ A;  4KHZ F;  3U78 A;  3AAI A;  2A2F X;  4WYV A;  5F3J A;  3JAE A;  5JDM A;  2GK9 A;  2W00 A;  4DR5 T;  4ZI2 C;  4QH5 A;  5HXC A;  3O1J A;  5LHG B;  4O4L E;  3V5S A;  3AEA A;  5FNV E;  5L3B B;  1HS7 A;  5HWX A;  1T8B A;  3A5X A;  4KUM B;  4K0K T;  2QRX A;  2V7J A;  3AEE A;  1IAP A;  5IUX A;  5BR8 T;  2NW8 A;  3S4U A;  4YJ3 E;  1W0A A;  5L3F B;  2V7K A;  5FXZ A;  1HR0 T;  4UVC B;  4A56 A;  5AQF B;  2Z6E A;  2N1G A;  2VVS A;  3E08 A;  3PUX F;  3NWI A;  3ONL C;  3RH3 A;  3EVY A;  2E9X B;  5FYM A;  2CWO A;  1LVF A;  4EB6 E;  1ZEE A;  1M62 A;  5L3D B;  1HFA A;  3GA8 A;  4BJN A;  2NW9 A;  4QH4 A;  2MBG A;  2V26 A;  4AKR B;  2LSG A;  5M4Y A;  2W66 A;  3UU5 A;  4IT4 A;  3AE6 A;  2CXF A;  2BG9 A;  3NRX A;  2FJB A;  4I4T E;  5HWY A;  2CCQ A;  2YDS A;  2X9Y A;  1FMV A;  2VKD A;  3FZH B;  1YKE B;  2W67 A;  1I6Z A;  1UX5 A;  5CA0 E;  4O2A E;  4WW0 A;  5L3E B;  4ERR A;  1MMA A;  3RRW A;  3CX8 B;  1WRD A;  2DCF A;  5JH7 E;  5JDN A;  4UXN B;  4JV5 T;  4ZZB A;  4HWD A;  4HTE A;  1D1B A;  3HA4 A;  1E2A A;  3MXZ A;  3MKD A;  5HXE A;  1JNZ A;  2B1E A;  3UUM A;  5CA1 E;  3IF8 B;  4LF6 T;  3RC8 A;  4H9O C;  3V5U A;  2LE8 A;  5FY0 A;  5HYA A;  1QSD A;  4DUZ T;  4ASK A;  2D5U A;  2NTX A;  2UXN B;  4U2Z A;  3SFD A;  1EZ3 A;  5FL1 A;  2Q9Q A;  2P9B A;  1XDP A;  1GQE A;  4QWN B;  2EHO D;  2DWG A;  3B57 A;  3OYX A;  2IAK A;  1D0Z A;  2LKG A;  3HKE E;  3ZT5 A;  1LRZ A;  3Q5W A;  5FXX A;  3LK3 B;  3PJA J;  3RC3 A;  2UUC T;  2UXD T;  2CHO A;  1UCU A;  2BG9 B;  3HKB E;  1OWA A;  5AQG B;  3F57 A;  1WFD A;  2KWI B;  2CE7 A;  5AQK B;  1SHZ C;  5ADX L;  2LRL A;  3H37 A;  5AQM B;  2L9Q A;  3P4W A;  4IE6 A;  2R6G F;  2IIU A;  2QA7 A;  3PUV F;  2BBJ A;  1VCT A;  5JQG E;  5CGM A;  3AA7 B;  2K48 A;  2XQ4 A;  4TV8 E;  1N34 T;  3BQK A;  5LG4 A;  4IDQ A;  4CXW A;  4NXM T;  2ODU A;  3UFE A;  4WZX A;  4LF4 T;  3P4P A;  5HEO A;  5KXJ A;  2E5L T;  5FVK A;  5FY1 A;  3JAF A;  1FMW A;  3KV9 A;  5ABF A;  4ZS3 A;  2Y48 B;  5AQS B;  1G8X A;  3TLU A;  2H3R A;  2F4V T;  1QUU A;  3ETU A;  4IL9 A;  3VR9 A;  4ANJ A;  3NKZ A;  2NOX A;  3C64 A;  2XAS B;  2Q9Q B;  4TUY E;  2W61 A;  2PTF A;  5ABG A;  2NR4 A;  4O2B E;  1KEY A;  2H7O A;  4X1I E;  3M65 A;  4MAL A;  3JC6 D;  2V5D A;  3FB2 A;  3AAE B;  3QC9 A;  1OED A;  1Z0P A;  3KDS E;  1D1A A;  3Q2M A;  3IBP A;  2JPF A;  1BR0 A;  5AQH B;  4O4I E;  3I9W A;  4DO0 A;  2BZB A;  3H3A A;  3ZST A;  3WAJ A;  2J4G A;  3NZQ A;  4YJ2 E;  3AVS A;  2J1D G;  4NPP A;  5LNK A;  1SUM B;  3ZSS A;  4L0R A;  2H89 A;  2C0S A;  5FXV A;  3CX6 B;  5CFB A;  2KZ7 B;  2CXD A;  5C3J A;  4DR6 T;  2AXD S;  2ACZ A;  1E1H B;  2XQA A;  3N9O A;  2YU2 A;  4DV6 T;  5EZY E;  5AFU L;  4IST A;  3KV5 A;  4TN7 B;  5HCJ A;  3AEF A;  1ZHC A;  2CBJ A;  3RIU A;  1V9D A;  5ABF B;  3AAA B;  3LK4 2;  5HCM A;  4U31 A;  4JI6 T;  1ZP0 A;  1L0V A;  3RQW A;  2XPK A;  2WSS V;  2X9W A;  3E0Z A;  4YY3 T;  1XNR T;  2LJL A;  4IL4 A;  2BS3 A;  3CQG B;  4U7I A;  4L5G A;  4DV1 T;  2WZH A;  1W09 A;  3RF1 A;  4OFZ A;  2KND A;  3O1H A;  1HF8 A;  4X64 T;  4EAH A;  1OED E;  4AKL A;  4HFD A;  5AQU B;  1OED B;  3K8P C;  4GYS A;  4IE4 A;  1S35 A;  3BK9 A;  1D0X A;  4KBM B;  4L9I A;  1HTJ F;  4E7Z A;  2VKH A;  3PU3 A;  3MJX A;  4ZI7 E;  4EZ4 A;  4JI2 T;  2LSY A;  3OVU A;  2AE9 A;  4KX6 A;  3RYH E;  5LHI B;  2C5I T;  5JDF A;  1W0B A;  3N9N A;  5LCY A;  2CXL A;  3DP7 A;  4ILU A;  5HXS A;  4HWC A;  3UQ7 A;  4GK5 E;  2D0T A;  4I43 B;  2X68 A;  4EZH A;  3P4R A;  2VK9 A;  3KIN B;  3LBX A;  4IDN A;  2RP4 A;  1XNQ T;  3PUQ A;  4YLH A;  1LKX A;  1FJG T;  2LOS A;  2XAG B;  4XBF B;  1XZY A;  2ODV A;  4X1Y E;  1J5E T;  4U72 A;  2JMH A;  1YQ3 A;  1G73 A;  4B3S T;  5AQN B;  4H9Q C;  4EIW A;  3BQI A;  2YK0 A;  2I0M A;  4EXT A;  5FKY A;  3T1H T;  4CI2 B;  5LMN T;  1HG5 A;  2UXB T;  3WI3 A;  3VHL A; 
#chains in the Genus database with same CATH homology
 3OYZ A;  3KBT A;  3RRW A;  4UVB B;  3CX8 B;  1WRD A;  2DCF A;  3CKD A;  4TZ4 C;  4UVA B;  5BMV E;  4OHF A;  4E7S A;  4XAX B;  4UXN B;  5JDN A;  5JH7 E;  1U5P A;  4MFR A;  4EYU A;  4HTE A;  2CMR A;  1D1B A;  4M1P A;  4AI6 A;  3HA4 A;  3MXZ A;  3MKD A;  5HXE A;  4IE7 A;  5L3C B;  2YIN A;  5J2T E;  3ZYL A;  3KVB A;  4PFO A;  2B1E A;  3UUM A;  3HR0 A;  5CA1 E;  4EYY R;  2QGS A;  3IF8 B;  5HXH A;  4CXY A;  3RC8 A;  3EUH A;  4H9O C;  3V5U A;  2LE8 A;  5FY0 A;  5HYA A;  4UEL A;  3DTO A;  1QSD A;  4O4H E;  4ASK A;  3SS1 A;  2D5U A;  1LVK A;  5FXW A;  3ZN0 B;  4WBO A;  2NTX A;  3R84 B;  4UF0 A;  2Q9Q C;  4IE5 A;  3C4X A;  4DBR A;  2DLR A;  2UXN B;  3C98 B;  3MAC A;  4GIW A;  3LJC A;  5HXR A;  1EZ3 A;  4ZOL E;  2NWB A;  1MMG A;  3AA6 B;  4QX8 B;  2Q9Q A;  4ZI3 D;  2P9B A;  2WAU A;  2PG8 A;  3LBX B;  1HCI A;  2NP9 A;  3F31 A;  2KIN B;  4CI3 B;  5EK3 A;  4QWN B;  4G2A A;  2EHO D;  3GN5 A;  2DWG A;  3B57 A;  1WLX A;  2KXP B;  5GON E;  3MZK B;  2HPL A;  3OYX A;  2CLY B;  2E9X D;  3CX7 B;  3ZMZ B;  1FEW A;  5JR9 B;  2CM0 A;  2IAK A;  3RKO A;  1D0Z A;  3HKE E;  3ZPO A;  2LSK A;  1MIW A;  4PK6 A;  3ZEF B;  1LRZ A;  3Q5W A;  3RYF E;  5FXX A;  1MMD A;  3LK3 B;  4K0U A;  4QXB B;  5DAB A;  2WWU A;  3TKL B;  4HEA A;  3UUN A;  3RC3 A;  3ZC1 A;  4QHO A;  3L09 A;  3ZMU B;  3ZMS B;  5LYJ E;  1UCU A;  2LT3 A;  4I50 E;  4I55 E;  2BVM A;  4F6R C;  3HKB E;  1OWA A;  3K3N A;  2IC9 A;  4PK5 A;  4AKH A;  2MYS A;  4MLK A;  3F57 A;  1D1C A;  4GOU A;  4PK4 A;  3J7Y q;  4CQI A;  3ZMV B;  2KWI B;  1ZV4 X;  1MNE A;  2CE7 A;  3HI2 A;  4P0A A;  5LHH B;  2BVL A;  1SHZ C;  4CI1 B;  5ADX L;  3H37 A;  4ZS2 A;  2XTL A;  1S94 A;  2L9Q A;  4BA9 A;  4HGA A;  4IE6 A;  1IJ6 A;  2QA7 A;  3ZYK A;  5FY7 A;  2JRK A;  5JQG E;  3AA7 B;  2XUE A;  5F8P A;  3UT5 E;  2JMK A;  2K48 A;  2YU1 A;  4TV8 E;  4QX7 B;  4UV8 B;  3RYC E;  1KK7 A;  3BQK A;  1B7T A;  4JEH B;  5LG4 A;  4HE8 A;  5L2L A;  3QK6 A;  4CXW A;  2H7V C;  2ODU A;  4MBQ A;  3ZJ2 A;  3Q9D A;  3RRC A;  2HH7 A;  2VB6 A;  2WM9 A;  3UFE A;  4NUU A;  3K3Q C;  4IGU A;  4AKI A;  3PDY A;  3KV6 A;  4ZI2 D;  1KNZ A;  5FP3 A;  3IHR A;  4IDZ A;  3CWZ B;  3EDU A;  3HL6 A;  4P09 A;  5E0O A;  3FHN A;  4OYJ A;  3I1A A;  3NBX X;  4XZC A;  5FY1 A;  4O4J E;  1MND A;  1FMW A;  3C51 A;  3AB3 B;  2C5J A;  1SA0 E;  4QKN A;  1MIY A;  2PBI A;  2LHR A;  4DMW A;  2K5B B;  4QXH B;  2X66 A;  2XAJ B;  3KV9 A;  3LK2 B;  4PNI A;  2MOZ A;  3I9Y A;  5H6R B;  4CXX A;  3VKG A;  2K9A A;  2KMF A;  3DJB A;  1US7 B;  1CUN A;  4ZS3 A;  2IW5 B;  2Y48 B;  3UTK A;  5LXT E;  3I0Q A;  5LA6 E;  5EK2 A;  1G8X A;  2H3R A;  2VAS A;  4OYK A;  4JEU B;  1QUU A;  4UF0 B;  4IIJ E;  3ETU A;  5JVD E;  2E8I A;  4ANJ A;  3GWH A;  1BR1 A;  3VHL A;  2VWA A;  2DHR A;  2RA1 A;  3HKD E;  5JDG A;  3P7I A;  2NOX A;  3C64 A;  4HFV A;  2XAS B;  4AXP A;  4KP3 C;  2L8K A;  2Q9Q B;  2Y6X A;  4TUY E;  3SWH A;  2G0U A;  2VKJ A;  3SRZ A;  2W61 A;  4X20 E;  1YW0 A;  5C8Y E;  5LJM A;  4TV9 E;  4O2B E;  4DVD A;  4MHC A;  5LGT B;  2H7O A;  4X1I E;  3M65 A;  3FXE B;  2MTQ A;  3GN5 B;  2UXX B;  4MAL A;  3JC6 D;  2ZMA A;  2LSI A;  3N2O A;  3FB2 A;  3HKC E;  4EOZ B;  4DMV A;  3AAE B;  2X0L B;  3KBU A;  5IYZ E;  1AJ3 A;  3QC9 A;  4J2C A;  1MMN A;  1Z0P A;  2XAQ B;  4JLE A;  2ZM0 A;  3C4Z A;  5JDL A;  1U4Q A;  5CB4 E;  1OXZ A;  3KDS E;  1D1A A;  3Q2M A;  4NUV A;  4DND A;  3IBP A;  2JPF A;  2V7M A;  2D2S A;  2N9D A;  1BR0 A;  2X9H A;  3AVR A;  4O4I E;  3I9W A;  4DO0 A;  3VKH A;  2BZB A;  3H3A A;  1WYB A;  3EDV A;  3WAJ A;  1NAF A;  2NW7 A;  3Q5X A;  5LP6 E;  3K3O A;  1WYC A;  4TX5 A;  3NZQ A;  4WNK A;  4AQF C;  2XAH B;  2L3L A;  3RX6 A;  4V1A v;  3ANW A;  4YJ2 E;  3AVS A;  4PJM A;  1IJ5 A;  2J1D G;  4C91 A;  5LNK A;  4AQF A;  4AKG A;  4L0R A;  2A3D A;  2C0S A;  5FXV A;  3B13 A;  3KFW X;  4ISS A;  5IHY A;  2CEA A;  3CVR A;  1D0Y A;  3CX6 B;  2KZ7 B;  2ES0 A;  3N5L A;  3KVA A;  3AA0 B;  3LG7 A;  2CXD A;  3ONX A;  5LGN B;  3C4W A;  4U74 A;  3PUA A;  5LOV E;  3PUR A;  3QUJ A;  1WR6 A;  4ZI3 C;  3W15 B;  4JUY A;  1E1H B;  2V1D B;  3N9O A;  3ZCJ A;  2YU2 A;  5A1L A;  1YD8 G;  2EHO C;  5EZY E;  4FJO A;  5H6Q B;  3ZJ1 A;  4B6X A;  5AFU L;  4PFP A;  4IST A;  2E9X C;  4H9S E;  3O9X A;  2K24 A;  3KV5 A;  2IC6 A;  2PJQ A;  3N9Q A;  5JDH A;  2C5K T;  4TN7 B;  1VOM A;  4BJM A;  3ESL A;  1ZHC A;  1V9D A;  2DI4 A;  2EHO A;  3OJA A;  3AAA B;  5JRC A;  3WAK A;  2HPJ A;  2KWH A;  2SPC A;  2E9X A;  2W62 A;  3LK4 2;  5DQV A;  3UUX B;  3ZC0 A;  5TAO A;  2V7L A;  2YEV C;  4BAY B;  2PFV A;  1BR2 A;  5DJQ C;  1YKH B;  5KMG P;  4ADZ A;  2WSS V;  5LJN A;  3ETV A;  2X9W A;  3E0Z A;  3AA1 B;  3D0T A;  2D0U A;  2ZM2 A;  3GMI A;  5KX5 E;  2CA5 A;  2W0G A;  3CML A;  2LJL A;  3KV4 A;  3CQG B;  2Q9Q D;  2LM9 A;  3PTR B;  3RYI E;  4L5G A;  2X51 A;  2M67 A;  4OFZ A;  3N9M A;  4YHJ A;  3PU8 A;  3N9L A;  2KND A;  3O1H A;  5J2U E;  3N2K E;  2KLQ A;  1HF8 A;  3N9P A;  4EAH A;  2X9X A;  2ZM8 A;  4PJN A;  4AKL A;  3F2E A;  3FBZ A;  2Y8D A;  1ZKE A;  2LOP A;  3K8P C;  4GYS A;  1VRB A;  3C50 A;  4G63 A;  2I59 A;  3ZYM A;  4AQG A;  4IE4 A;  2WBL A;  3CPZ A;  3OKQ A;  1S35 A;  3U78 A;  3AAI A;  2A2F X;  3E22 E;  5F3J A;  3BK9 A;  2VL8 A;  4UV9 B;  2VKO A;  1D0X A;  4PAG A;  1T98 A;  4UIG A;  5JDM A;  4KBM B;  1FIO A;  4UEM A;  2GK9 A;  2W00 A;  4GYR A;  4L9I A;  1HTJ F;  4Z8X A;  4ZI2 C;  4E7Z A;  2VKH A;  3PU3 A;  3MJX A;  4ZI7 E;  3PUG A;  2KT9 A;  4YFS A;  4EZ4 A;  5HXC A;  3SOL A;  5J1G A;  2LSY A;  3O1J A;  3U3I A;  5LHG B;  4O4L E;  3ANW B;  4OK0 A;  4CZZ B;  4H9P C;  3V5S A;  3RYH E;  5LHI B;  3NRY A;  2C5I T;  4C90 A;  2A72 A;  5FNV E;  5L3B B;  5JDF A;  2W63 A;  1HS7 A;  5EK4 A;  4ZHQ E;  5HWX A;  3A5X A;  3N9N A;  4KUM B;  2XQY A;  5LCY A;  2CXL A;  2XHE B;  5FMN A;  5JDQ A;  3O1I A;  1X79 A;  2V7J A;  3DP7 A;  2X67 A;  3PE0 A;  2NTY A;  3CQC B;  4ILU A;  5HXS A;  1IAP A;  3ZLI A;  4GK5 E;  3I0O A;  2NW8 A;  3S4U A;  2LEH A;  2D0T A;  4YJ3 E;  3RPU A;  5L3F B;  3MK7 C;  2XAF B;  4I43 B;  2X68 A;  3FBL A;  1MIV A;  2V7K A;  5FXZ A;  4IHJ E;  1BR4 A;  4N78 D;  4UVC B;  4A56 A;  4DBQ A;  4EZH A;  2Z6E A;  3JC6 C;  3UUL A;  5L3G B;  2VK9 A;  2N1G A;  4FI5 A;  5JRE A;  3KIN B;  2WMO A;  2CLY C;  4IE0 A;  3E08 A;  3LBX A;  5JR9 C;  2RP4 A;  3L3P A;  2EHO B;  2BDE A;  5LBM A;  3ZN1 B;  5JRC B;  5DQW A;  3PUQ A;  4YLH A;  3RH3 A;  3EVY A;  2E9X B;  5FYM A;  2CWO A;  1LKX A;  1LVF A;  4EB6 E;  1ZEE A;  2LOS A;  5L3D B;  2XAG B;  5JR9 A;  1UX4 A;  1HFA A;  3GA8 A;  4BJN A;  3J9X 1;  2NW9 A;  5KDM C;  4XBF B;  3MA9 A;  4H63 V;  2MBG A;  2DNX A;  5HAX A;  4H63 H;  4P0B A;  2ODV A;  5ETW A;  3CQX C;  4X1Y E;  3NZP A;  1HG2 A;  2CWY A;  3ZMT B;  2V26 A;  4HN9 A;  2JMH A;  4U72 A;  4AKR B;  4GK0 E;  2LSG A;  5LBQ B;  4PJL A;  3PUS A;  1IZN B;  5M4Y A;  3OBV E;  1G73 A;  4H9R C;  5LGU B;  2OA5 A;  2V7I A;  2CXF A;  2LHN A;  4H9N C;  1NWM X;  2N2N A;  4H9Q C;  2ZLY A;  4EIW A;  3BQI A;  3NRX A;  4O8S A;  2YK0 A;  3ZCI A;  4I4T E;  3FXD B;  2CCQ A;  5HWY A;  4HKA A;  2JQQ A;  4EXT A;  2X9Y A;  1FMV A;  2JJ9 A;  2VKD A;  1YKE B;  4WBN E;  3LFM A;  3O4X E;  3VU7 H;  4CI2 B;  4KMC A;  1HX8 A;  1UX5 A;  4PJJ A;  1H7C A;  3N2G E;  5CA0 E;  3IEE A;  3P8C D;  2ACX A;  1O3X A;  2LSJ A;  4O2A E;  4WW0 A;  4X1K E;  5L3E B;  3BQL A;  1HG5 A;  3R6N A;  2WMN A;  4PW8 A;  4ERR A;  1Y64 B;  1MMA A;  3WI3 A;  3T8O A;  4QXC B;  2DWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...