2DWKA

Crystal structure of the run domain of mouse rap2 interacting protein x
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
162
Chain Sequence
b'MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RUFY3
molecule tags Protein binding
source organism Mus musculus
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
total genus 47
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwkA00
4GIWA 2CXLA 2DWKA 2DWGA 3CWZB 2CXFA
chains in the Genus database with same CATH superfamily
1YKEB 5LOVE 3WAJA 4YSXA 4ZI3C 4QH4A 1WYCA 3MZKB 2E9XB 3RI5A 4YSYA 2WZIA 2XAHB 4QXBB 3ZT6A 4YY3T 2M6IA 5HEJA 2UXDT 4WYVA 4LFCT 3ESLA 3VR9A 1LVFA 3LBXA 4NUVA 2E5LT 3KFWX 3RIUA 1UX4A 1R8IA 3RIUC 4I50E 1VCSA 1YKHB 3ANWA 3UUMA 2DHRA 1HX8A 4LF4T 4QXHB 4JEUB 1CHUA 1VOMA 4HFHA 2IC9A 2PTFA 3ZN0B 3PU8A 3TLVA 2C5KT 3SS1A 2V7KA 3FBZA 1XNRT 2KINB 3LK2B 2LOPA 3ZYKA 4UVAB 1KFYA 2X9YA 4H9SE 2LOSA 3RYIE 2ZLYA 4LF9T 4PW8A 1BR4A 1T7SA 1YQ4A 3KV5A 3N2OA 3M3ZB 2V7LA 5HEUA 1HCIA 3AEDA 4O2BE 2LHNA 4A97A 4CI3B 5ABHA 5JR9C 2OA5A 4P0AA 5LCYA 4JI7T 3UQ4A 3UUNA 4YXDA 3N2GE 4CI1B 2DWKA 5AQVB 5AQRB 2VL8A 3F31A 4B3TT 1M7KA 1X9BA 2ODVA 2WB5A 3A7MA 2VVSA 2KZ7B 3EVYA 4GK5E 2N1GA 4IE6A 5FP3A 3VU7H 2W4XA 1T72A 2V1DB 2EHOC 1WR0A 1QSDA 3KDSE 1U4QA 5IUXA 4LF8T 4IHJE 5L4EA 3ZYLA 2WDRA 3RYFE 4NXMT 1J5WA 5LJMA 1D1BA 3V5UA 3ZMUB 2F4VT 2IIUA 2YK0A 2K24A 1XNQT 3IF8B 4B3RT 5L3FB 2RA1A 2UUAT 3RC3A 3B5MA 4KHZF 1HS7A 2VURA 3UTKA 4CI2B 2CWYA 2BG9E 3F57A 4MBQA 4O4HE 4P1NA 4ZHQE 3N9QA 5C8YE 2VQFT 4JI4T 1WR6A 2XASB 3NZQA 4TZ4C 2UXCT 2AE9A 2W61A 2CLYC 5HXEA 5JDMA 4O4IE 2K9AA 3A8YC 2LSYA 3ABVA 4OFZA 5L2LA 2Y48B 2XQ4A 3AXJA 2MPKA 3CX8B 3H3MA 1ZOYA 4AIUA 4I43B 4BJNA 4DR1T 3CVRA 4JV5T 2X9HA 4HEAA 4PK6A 3JCFA 5JDHA 1YW0A 2V6YB 2IHR1 1G8XA 4Z90A 3SWHA 4IDNA 4CQIA 4YTNA 2ZM6T 1D0XA 3AE1A 3PUZF 5JH7E 1UURA 2E9XA 1CUNA 1ZV4X 4JI1T 3ZJ2A 4PAGA 3FHNA 5ETWA 3K3OA 2NW7A 4PJMA 5DQWA 2M67A 3H3AA 4C91A 5HXSA 3UQ7A 3PUSA 2K5BB 2WCAA 3CX6B 3MXZA 2UUCT 3QOFA 2XHEB 3L8RA 5LGUB 1OWAA 4DIDB 1DU2A 2FBWA 2Z6EA 2BG9A 3PTRB 2A2FX 5CA0E 3UU3A 2V26A 3AA0B 5F3JA 4JI5T 1NAFA 1XDPA 5FNVE 4HTEA 1IZNB 2CXLA 2N9DA 1OXZA 3C51A 3QUJA 2PG8A 4HWCA 2L8KA 3AB3B 2QGSA 2DWGA 2CXFA 4YT0A 3OTOT 4LF5T 4HFVA 3HKCE 5EK3A 5LGNB 4B3ST 4PFOA 3DP7A 2VB6A 3I9YA 5KMGP 2A9UA 2BKPA 2X9WA 1L0VA 1B7TA 5FXVA 4TWHA 3ZJ1A 2WP9A 4KMCA 3P4RA 2IMLA 4HKAA 2ZM2A 3AE5A 3O4XE 4NUUA 2JQHA 4YLHA 4HFEA 4PNIA 4LFBT 4ZI7E 3AA7B 4WBNE 5CJ5A 4PJJA 4EIWA 2LSGA 3NRXA 4MLKA 3QB5K 3RH3A 3C4ZA 4EYUA 2NR4A 4ADZA 1NENA 4U33A 3MKDA 2CM0A 4U3CA 2NP9A 1KNRA 4HWDA 1FIOA 2IC6A 2UXXB 3CQXC 4IL9A 5FXWA 3P4QA 3U78A 5JTGA 2J62A 2BVLA 3HI2A 3P4PA 3CQCB 4NIQA 2ZM0A 3LFMA 4H9QC 4KUMB 3Q2MA 3UUBA 2LKHA 3FXDB 4J2CA 3UFGA 2MOZA 4DV7T 2BS2A 4HWIB 4IIJE 3ZSTA 2I6HA 5AQUB 2JRKA 1IJ6A 1IAPA 2XSAA 5HAXA 5LBMA 1XWMA 4HFCA 4CN6A 2H88A 5L3CB 2LSIA 2XAQB 4GKJT 2CHNA 4X62T 3P8CD 2E9XC 3FZHB 2XZEA 3VKGA 1FEWA 2IDOB 4BAYB 4IL4A 1WFDA 3GN5A 3PUWF 2DLRA 3ZSSA 4DUZT 3RIAA 4ZZCA 1HF8A 1MNEA 2LHRA 3CIRA 1FJGT 1Y01A 3O1HA 1SA0E 4ILUA 4U2ZA 1E2AA 2YEVC 4GIWA 3KINB 5H6RB 4NXNT 2J1DG 2WDVA 2XQ8A 2XUEA 4UVBB 3LSVA 3X1DA 1IBLT 1OEDB 4TX5A 3RKOA 5CFBA 4LMKA 3MACA 3CK6A 2KLQA 4AI6A 3ANWB 3Q9DA 4DR7T 5LG4A 3H37A 3LG7A 3S4UA 2LM2A 4ILCA 2YDQA 4Z91A 3NKZA 3RYHE 5LHIB 4AQYT 1BR2A 5FMNA 2A3DA 2DCFA 5GONE 3AVSA 2D0UA 3TLUA 1T8BA 3P50A 5FL0A 1KEYA 1W09A 4ZOLE 2KWIB 2NOXA 2W2UA 2WWVA 3N2KE 2IAKA 1ZKEA 2E8IA 5JVDE 3ZEFB 4O2AE 2GK9A 5FY7A 3TLWA 3AVRA 1HG2A 2QYWA 3AE6A 4H9NC 5BR8T 2I0MA 2LLYA 3GN5B 3NBXX 3VRBA 5JDLA 5AQJB 5HXCA 3EDVA 2UUBT 4H9OC 3PUGA 4ISTA 3LK42 3ZMZB 4YJ2E 2C5IT 2V7IA 4A5XA 1HX1B 2LJLA 2N2NA 3MK7C 3MJXA 3O9XA 1IBKT 2QA7A 4UELA 3Q5DA 4X66T 2M6BA 5HCJA 1LVKA 2D0TA 1VCTA 2DL1A 2Q9QB 2XQ5A 2OV9A 5ADXL 5FL1A 1MIYA 4U2YA 1NWMX 5LMNT 2MBGA 2V6YA 2KXPB 4EB6E 3QB5A 5AFUL 2XAGB 4KHPT 3AEFA 3EI0A 3TLTA 4PK5A 4GYRA 5DQVA 4WW0A 2E2AA 3WAKA 2VKJA 1MMAA 2XQ3A 4O4JE 4ASKA 4KP3C 5A1LA 3T1YT 3RC8A 5AQSB 2NTYA 1KK7A 2WU2A 3KVBA 4QH5A 3C4XA 2WMOA 4ILBA 2XY8B 2NWBA 3C98B 2LE8A 3ONJA 2FJEA 2CBJA 2HPJA 2Q9QD 3EUHA 3PUQA 2X66A 2XTLA 4H9PC 3VR8A 1IBMT 1LKXA 4LFAT 3ZC0A 2KT9A 2CXDA 5C3JA 2X68A 3BQLA 1I6ZA 4ZI3D 2WAUA 1JNRA 1FMWA 3PDYA 1T98A 4EEBA 4F8HA 4WNKA 3AE8A 2JQQA 5AQMB 2BBJA 4MFRA 3ZCIA 3HKEE 5HWXA 2H7OA 4LF7T 2EHOD 4OK0A 3ZMTB 2LKGA 2YN6A 4DR2T 3FZKB 2EHOA 3LDQB 4F6RC 1V9DA 3RX6A 1MMDA 5FKYA 5JDNA 1MMNA 2JJ9A 2Q9QA 4G2AA 5L3BB 1OEDE 1MIWA 4ISSA 3F2EA 2FJDA 4YHJA 4BA9A 3K3NA 5AQPB 1I94T 3VHLA 3FZLB 2WZHA 5JDGA 3AE9A 3FZFB 4QX7B 4TV8E 5JRCB 1YD8G 5AQQB 4LMLA 2FUPA 3ZKRA 4EAHA 2IW5B 1XMQT 5H6QB 2BBHA 3ETVA 2CPTA 3LK3B 4MHCA 2XQ6A 3ZPOA 4IREA 3UULA 4ILAA 2W00A 2MYSA 4MALA 4ANJA 4EYYR 2WWUA 3C4WA 3WI3A 2BVMA 3J7Yq 3ZLIA 1WYBA 1D1AA 5KDMC 2MAWA 2BG9C 2RPAA 1UUSA 2VKHA 3QK6A 3CWZB 4UR9A 3ZN1B 5HCMA 2C5JA 3I0OA 3AEEA 2E9XD 3RPUA 4PJLA 1KNPA 2V5CA 2XAFB 2UXBT 4AKHA 2EHOB 2G0UA 4QHOA 4JI2T 5IYZE 3RHWA 4UEMA 5DABA 4O4LE 3Q5WA 2R6GF 4O8SA 2IUBA 3ONLC 3B57A 5L3GB 5AQTB 2VWAA 5JR9B 1NEKA 4Z8XA 2CHOA 1UCUA 2W62A 2D2SA 3OKQA 2A72A 4DMWA 4AKGA 5ABFB 3IBPA 3U3IA 2WS3A 4X5TA 4ERRA 5J1GA 3JAFA 4X1IE 4I55E 3EDUA 1W0AA 3R84B 4EZHA 2X9XA 2JIWA 1H7CA 1LRZA 3PU3A 3RYCE 4QH1A 4UV9B 2XJ7A 2BKNA 3PURA 2WBLA 3SFDA 5L3EB 4M1PA 4YJ3E 1GQEA 1E7PA 3I1AA 1JNZA 4EGWA 4U7IA 4DV6T 1M62A 5LP6E 1US7B 1VRBA 2PBIA 3Q5XA 4HFBA 1HFAA 2LT3A 3L39A 4B3MT 4IDQA 3CQGB 1W0BA 2VL0A 4CN4A 1Z8UA 5AQHB 3OVUA 3K3QC 3UU4A 4Q25A 2X51A 4DR5T 2JQ9A 4LF6T 4TWFA 4X1KE 5AQGB 5AQNB 4B6XA 2LSJA 3HL6A 2Y6XA 3AE7A 3GA8A 3OJAA 1W9RA 2PFVA 3KVAA 3E22E 3CMLA 2XQYA 5DJQC 5E0OA 3HA4A 1FMVA 4DBQA 1S35A 1Y64B 2CWOA 3PUAA 3PV0F 4TNVA 3ZT7A 1ZHCA 4FI5A 4X20E 1S94A 3ETUA 4IT4A 3FB2A 5LA6E 2XM1A 5LB7B 5F8PA 3JC6C 2UU9T 4EV6A 3OBVE 1YQ3A 3O1JA 5HXHA 1G73A 1XZYA 2ACZA 3O1IA 2H7VC 2WU5A 4EXTA 1SE7A 3QC9A 4IDOA 4DNDA 4L5GA 3UUXB 4YFSA 5LG3A 1XMOT 4DBRA 4JBWF 1SUMB 2V7MA 1N34T 1OEDA 2WMNA 2DNXA 2NW9A 2YU2A 2CEAA 4C90A 3N9NA 2KWHA 3RGLA 4HN9A 4U74A 5JDQA 3HKBE 1HNZT 4OYJA 2CLYB 3GMIA 3N9MA 3R6NA 4YSZA 4DUYT 2L9QA 2WDQA 5FVKA 4ZEYA 1WLXA 4KI0F 4DMVA 4UV8B 4X1YE 2XQ9A 3KBTA 1ZEEA 2J47A 3UT5E 4A98A 3N9LA 2J4GA 3FXEB 2X0LB 3M65A 5HEOA 3AEGA 5FY1A 2BZBA 3D0TA 2CA5A 1O3XA 4YTMA 4ZXLA 3VRAA 3ZMSB 4OX9T 1BR1A 2XSBA 3PJAJ 5LBQB 2X0HA 3E08A 4DV1T 4L0RA 5HWYA 4FJOA 3T8OA 3HKDE 2K48A 4TV9E 3PE0A 5KX5E 1KNZA 2I59A 2HN2A 1IJ5A 4UVCB 4HWFA 2WSSV 2NTXA 2ES0A 3AEBA 3P4WA 2YKSA 4TUYE 2CRBA 3AAIA 2W67A 2AXDS 2CBIA 4G63A 1MMGA 4AKRB 1Z0PA 4CXXA 3AE4A 5EK2A 4X65T 2BDEA 3KV6A 4DV0T 4XBFB 3AAAB 4JEHB 5CA1E 3ONXA 3JC6D 2SPCA 4JI6T 3T1HT 2MTQA 4GYSA 3DTOA 4HE8A 2HN1A 2ZM8A 4PFPA 3AAEB 4IE5A 3ZCJA 4COFA 3V5SA 1ZP0A 2LM9A 1BR0A 4V1Av 3SOLA 3CKDA 3NWIA 3RF1A 4CN1A 1XDOA 4AQFC 5AQIB 2HHHT 2ZMAA 1N32T 5JREA 2XQAA 4AQFA 2V5DA 4A56A 2KMFA 5F5WA 3SRZA 2VASA 5J0ZA 2ODUA 3BQIA 3IA3A 4H63H 4NPPA 2XM2A 4N78D 3RIFA 4JI0T 3AA1B 4DO0A 1E1HB 1MNDA 1WRDA 2B76A 2P9BA 2WY2A 3NVOA 1HG5A 2JMHA 2W66A 4HWHA 2WQYA 4PJNA 4TWDA 3JADA 5IWAT 1AJ3A 3GWHA 3UU6A 4YTPA 3UFEA 3I0QA 3ZMVB 2D9DA 4IGUA 5JQGE 4X64T 5EZYE 4YHHT 2PJQA 4OHFA 1N33T 4I4TE 4K0UA 2VK9A 2NW8A 3PUXF 3ZYMA 5AQFB 2BG9B 2E5VA 3MA9A 4U72A 4JYAT 2W63A 3CX7B 3RKGA 5HEHA 2CMRA 4GOUA 4QX8B 2HPLA 3FBLA 4HFDA 5BMVE 5L47A 1HR0T 1HTJF 3SFEA 5JRCA 4ZS2A 3E0ZA 3C50A 4UF0A 4UIGA 3NZPA 2X67A 2D5UA 5LHHB 2HH7A 5CB4E 2VQET 5FVLA 3AA6B 1X79A 4ZI2D 1J5ET 5ABFA 2JMKA 2QVAA 4DR6T 2YDSA 4AISA 3K8PC 3BK9A 5HEGA 2JQKA 2LRKA 3HR0A 3Q5EA 5JDFA 3AE2A 5JR9A 2DI4A 4DV5T 3LJCA 1MIVA 3AXJB 4GK0E 1QUUA 4H9RC 4KX6A 3DJBA 3PUYF 4AXPA 1D1CA 3J9X1 5LXTE 3LBXB 3KBUA 2YDRA 4OYKA 4DV2T 3ZC1A 3P7IA 3PJAA 3EAMA 5AQLB 2YINA 3N9OA 4EZ4A 1OEDC 4JUYA 2XQ7A 3C64A 2CE7A 3N5LA 3OPCA 4UF0B 4XAXB 4E7ZA 2FJAA 2YOEA 2VKOA 4IE0A 5LHGB 5LNKA 2LRLA 4K0KT 4JLEA 3B13A 3K1SA 2KSRA 4I0UA 4UXNB 3AE3A 5HXRA 4JI8T 5L3DB 4QWNB 5LGTB 2JPFA 5EK4A 2OLTA 1QLBA 3L09A 2LSKA 4IE4A 4IE7A 2XAJB 3VKHA 2XPKA 5ABEA 4DR3T 3CPZA 5AQOB 3RQUA 3FZMB 4WBOA 1SHZC 2W0GA 4DV3T 2H3RA 3IHRA 3OYXA 4TN7B 5C2TA 3PUVF 4P0BA 1HNXT 5FXXA 3UU8A 1HNWT 3OYZA 5IHYA 3G06A 4U7YA 4EOZB 4DV4T 3AECA 2WM9A 4DR4T 2Q9QC 3KV9A 1KF6A 4U31A 4DVDA 4AKIA 4JI3T 2BS4A 3IEEA 4H63V 4BJMA 4P09A 2VKDA 3NRYA 1U5PA 3N9PA 5FY0A 5J2UE 5LJNA 5KXJA 5LMUT 5L4HA 1D0YA 3TKLB 3JAEA 2BS3A 2ACXA 3QNUA 2H89A 4LMJA 3P4SA 5CGMA 5J2TE 4QXCB 5ABGA 3A5XA 4IDZA 2FJBA 2YU1A 3L3PA 3W15B 3RLFF 4EEDA 4GKKT 5AQKB 3KV4A 2B1EA 1J1JA 1YXRA 4L9IA 2CCQA 5TAOA 3RRWA 5HYAA 2V7JA 2L3LA 5M4YA 3TLSA 2RP4A 2K3WA 4ZS3A 5FXZA 2Y8DA 3AEAA 3BQKA 1EZ3A 4AQGA 4XZCA 4CXYA 2V6XA 4CXWA 4HFIA 1N36T 3ZT5A 2BKOA 2KNDA 4HGAA 4CZZB 5LYJE 4TNWA 1WCRA 2X0YA 2V8SV 3RQWA 3EABA 4IDPA 4PK4A 1D0ZA 2C0SA 2UXNB 3I9WA 4E7SA 4ZI2C 1UGOA 5FYMA 1UK5A 4AKLA 3RRCA 4WZXA 4KBMB 3EHZA 3UU5A 4ZZBA 2LEHA 2VVNA 2QRXA 4QKNA 1UX5A
chains in the Genus database with same CATH topology
1YKEB 5LOVE 3WAJA 4ZI3C 1WYCA 3MZKB 2E9XB 2XAHB 4QXBB 3ESLA 1LVFA 3LBXA 4NUVA 3KFWX 1UX4A 4I50E 3ANWA 1YKHB 3UUMA 2DHRA 1HX8A 4QXHB 4JEUB 1VOMA 2IC9A 3ZN0B 3PU8A 2C5KT 3SS1A 2V7KA 3FBZA 2KINB 3LK2B 2LOPA 3ZYKA 4UVAB 2X9YA 4H9SE 2LOSA 3RYIE 2ZLYA 4PW8A 1BR4A 3KV5A 3N2OA 5JVDE 4CI3B 5L3DB 2V7LA 1HCIA 4O2BE 2LHNA 5JR9C 2OA5A 4P0AA 5LCYA 3UUNA 3N2GE 4CI1B 2DWKA 2VL8A 3F31A 2ODVA 3UFEA 3S4UA 5FP3A 3EVYA 2KZ7B 4GK5E 2N1GA 4IE6A 3VU7H 2V1DB 2EHOC 1QSDA 3KDSE 1U4QA 4IHJE 3ZYLA 3RYFE 5LJMA 1D1BA 3V5UA 3ZMUB 2YK0A 2K24A 3IF8B 5L3FB 2RA1A 3RC3A 1HS7A 3UTKA 4CI2B 2CWYA 3F57A 4MBQA 4O4HE 5C8YE 4ZHQE 3N9QA 1WR6A 2XASB 3NZQA 4TZ4C 2W61A 5JDMA 2CLYC 5HXEA 4O4IE 2K9AA 4OFZA 2LSYA 5L2LA 2Y48B 5L3BB 3CX8B 4BJNA 4I43B 3CVRA 2X9HA 4HEAA 4PK6A 5JDHA 1YW0A 3SWHA 1G8XA 4CQIA 1D0XA 5JH7E 2E9XA 1CUNA 1ZV4X 3ZJ2A 4PAGA 3FHNA 5ETWA 3K3OA 2NW7A 4PJMA 5DQWA 2M67A 3H3AA 4C91A 5HXSA 3PUSA 2K5BB 3CX6B 3MXZA 2XHEB 5LGUB 1OWAA 2Z6EA 3PTRB 2A2FX 5CA0E 2V26A 3AA0B 5F3JA 1NAFA 5FNVE 4HTEA 1IZNB 2CXLA 2N9DA 1OXZA 3C51A 3QUJA 2PG8A 2L8KA 3AB3B 2DWGA 2QGSA 2CXFA 4HFVA 3HKCE 5EK3A 5LGNB 4PFOA 3DP7A 2VB6A 3I9YA 5KMGP 2X9WA 1B7TA 5FXVA 3ZJ1A 4KMCA 4HKAA 4YLHA 2ZM2A 4NUUA 3O4XE 4PNIA 4ZI7E 3AA7B 4WBNE 4PJJA 4EIWA 2LSGA 3NRXA 4MLKA 4EYUA 3RH3A 3C4ZA 4ADZA 3MKDA 2CM0A 2NP9A 1FIOA 2IC6A 2UXXB 3CQXC 5FXWA 3U78A 2BVLA 3HI2A 3CQCB 2ZM0A 3LFMA 4H9QC 4KUMB 3Q2MA 3FXDB 4J2CA 2MOZA 4IIJE 2JRKA 1IJ6A 1IAPA 5HAXA 5LBMA 5L3CB 2LSIA 2XAQB 3P8CD 2E9XC 3VKGA 1FEWA 4BAYB 3GN5A 2DLRA 1HF8A 1MNEA 2LHRA 3O1HA 1SA0E 4ILUA 2YEVC 4GIWA 3KINB 5H6RB 2J1DG 2XUEA 4UVBB 4TX5A 3RKOA 3MACA 2KLQA 4AI6A 3ANWB 3Q9DA 5LG4A 3H37A 3LG7A 3RYHE 5LHIB 1BR2A 5FMNA 2A3DA 2DCFA 5GONE 3AVSA 2D0UA 4ZOLE 2KWIB 2NOXA 3N2KE 2IAKA 1ZKEA 2E8IA 3ZEFB 4O2AE 2GK9A 5FY7A 3AVRA 1HG2A 4H9NC 3GN5B 3NBXX 5JDLA 5HXCA 3EDVA 4H9OC 3PUGA 4ISTA 3LK42 3ZMZB 4YJ2E 2C5IT 2V7IA 2N2NA 2LJLA 3MK7C 3MJXA 3O9XA 2QA7A 4UELA 1LVKA 2D0TA 2Q9QB 5ADXL 1MIYA 1NWMX 2MBGA 5AFUL 2KXPB 4EB6E 2XAGB 4PK5A 4GYRA 5DQVA 4WW0A 3WAKA 4ASKA 2VKJA 1MMAA 4O4JE 5A1LA 4KP3C 3RC8A 2NTYA 1KK7A 3KVBA 3C4XA 2WMOA 2NWBA 3C98B 2LE8A 3PUQA 2HPJA 3EUHA 2Q9QD 4H9PC 2X66A 2XTLA 1LKXA 3ZC0A 2KT9A 2CXDA 2X68A 3BQLA 4ZI3D 2WAUA 1FMWA 3PDYA 1T98A 4WNKA 2JQQA 3ZCIA 4MFRA 5HWXA 3HKEE 2H7OA 2EHOD 4OK0A 3ZMTB 2EHOA 4F6RC 1V9DA 3RX6A 1MMDA 5JDNA 1MMNA 2JJ9A 2Q9QA 4G2AA 1MIWA 4ISSA 3F2EA 4BA9A 4YHJA 3K3NA 3VHLA 5JDGA 4QX7B 4TV8E 5JRCB 1YD8G 4EAHA 2IW5B 5H6QB 3ETVA 3LK3B 4MHCA 3ZPOA 4ANJA 3UULA 4MALA 2W00A 2MYSA 4EYYR 2WWUA 3C4WA 3WI3A 2BVMA 3J7Yq 3ZLIA 1WYBA 1D1AA 5KDMC 2VKHA 3QK6A 3CWZB 3ZN1B 2C5JA 3I0OA 3RPUA 2E9XD 4AKHA 4PJLA 2XAFB 2EHOB 2G0UA 4QHOA 5IYZE 4UEMA 5DABA 4O4LE 3Q5WA 4O8SA 3B57A 5L3GB 2VWAA 5JR9B 4Z8XA 2W62A 1UCUA 2D2SA 3OKQA 2A72A 4DMWA 4AKGA 3IBPA 3U3IA 4ERRA 5J1GA 4X1IE 3R84B 4I55E 3EDUA 4EZHA 2X9XA 1H7CA 1LRZA 3PU3A 3RYCE 4UV9B 3PURA 5L3EB 2WBLA 4M1PA 4YJ3E 3I1AA 5LP6E 1US7B 1VRBA 2PBIA 3Q5XA 1HFAA 2LT3A 3CQGB 3K3QC 2X51A 4X1KE 4B6XA 2LSJA 3HL6A 2Y6XA 3GA8A 3OJAA 2PFVA 3KVAA 3E22E 3CMLA 2XQYA 5DJQC 5E0OA 3HA4A 1FMVA 4DBQA 1S35A 1Y64B 2CWOA 3PUAA 1ZHCA 4FI5A 4X20E 1S94A 3ETUA 3FB2A 5LA6E 5F8PA 3JC6C 3OBVE 3O1JA 5HXHA 1G73A 3O1IA 2H7VC 4EXTA 3QC9A 4DNDA 4L5GA 3UUXB 4YFSA 4DBRA 2V7MA 2WMNA 2DNXA 2NW9A 2YU2A 2CEAA 4C90A 3N9NA 2KWHA 4HN9A 4U74A 5JDQA 3HKBE 4OYJA 2CLYB 3GMIA 3N9MA 3R6NA 2L9QA 1WLXA 4DMVA 4UV8B 4X1YE 3KBTA 1ZEEA 3UT5E 3N9LA 3FXEB 2X0LB 3M65A 4AQGA 5FY1A 2BZBA 3D0TA 2CA5A 1O3XA 3ZMSB 1BR1A 5LBQB 3E08A 4L0RA 5HWYA 4FJOA 3T8OA 3HKDE 2K48A 4TV9E 3PE0A 5KX5E 1KNZA 2I59A 1IJ5A 4UVCB 2WSSV 2NTXA 2ES0A 4TUYE 3AAIA 4G63A 1MMGA 4AKRB 1Z0PA 4CXXA 5EK2A 2BDEA 3KV6A 4XBFB 3AAAB 4JEHB 5CA1E 3ONXA 3JC6D 2SPCA 2MTQA 4GYSA 3DTOA 4HE8A 2ZM8A 4PFPA 3AAEB 4IE5A 3ZCJA 3V5SA 2LM9A 1BR0A 4V1Av 3SOLA 3CKDA 4AQFC 2ZMAA 5JREA 4AQFA 4A56A 2KMFA 3SRZA 2VASA 2ODUA 3BQIA 4H63H 4N78D 3AA1B 4DO0A 1E1HB 1MNDA 1WRDA 2P9BA 1HG5A 2JMHA 1AJ3A 4PJNA 3GWHA 3I0QA 3ZMVB 4IGUA 5JQGE 5EZYE 2PJQA 4OHFA 4I4TE 4K0UA 2VK9A 2NW8A 3ZYMA 3MA9A 4U72A 2W63A 3CX7B 2CMRA 4GOUA 4QX8B 2HPLA 3FBLA 5BMVE 5JRCA 1HTJF 4ZS2A 3E0ZA 3C50A 4UF0A 4UIGA 3NZPA 2X67A 2D5UA 5LHHB 2HH7A 5CB4E 3AA6B 1X79A 4ZI2D 2JMKA 3K8PC 3BK9A 3HR0A 5JDFA 5JR9A 2DI4A 3LJCA 1MIVA 4GK0E 1QUUA 4H9RC 4AXPA 3DJBA 5LXTE 1D1CA 3J9X1 3LBXB 3KBUA 4OYKA 3ZC1A 3P7IA 2YINA 3N9OA 4EZ4A 4JUYA 3C64A 2CE7A 3N5LA 4UF0B 4E7ZA 4XAXB 5LHGB 2VKOA 4IE0A 5LNKA 4JLEA 3B13A 4UXNB 5HXRA 4QWNB 5LGTB 2JPFA 5EK4A 3L09A 2LSKA 4IE4A 4IE7A 2XAJB 3VKHA 3CPZA 4WBOA 1SHZC 2W0GA 2H3RA 3IHRA 3OYXA 4TN7B 4P0BA 5FXXA 3OYZA 5IHYA 4EOZB 4AKIA 2WM9A 2Q9QC 3KV9A 4DVDA 3IEEA 4H63V 4BJMA 4P09A 2VKDA 3NRYA 1U5PA 3N9PA 5FY0A 5J2UE 5LJNA 1D0YA 3TKLB 2ACXA 5J2TE 4QXCB 3A5XA 4IDZA 2YU1A 3L3PA 3W15B 3KV4A 2B1EA 3RRWA 4L9IA 5TAOA 2CCQA 5HYAA 5M4YA 2V7JA 2L3LA 2RP4A 4ZS3A 5FXZA 4CXYA 2Y8DA 3BQKA 1EZ3A 4XZCA 4CXWA 2KNDA 4HGAA 4CZZB 5LYJE 4PK4A 1D0ZA 2C0SA 2UXNB 3I9WA 4E7SA 4ZI2C 5FYMA 4AKLA 3RRCA 4KBMB 2LEHA 4QKNA 1UX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIW A;  2CXL A;  2DWK A;  2DWG A;  3CWZ B;  2CXF A; 
#chains in the Genus database with same CATH topology
 1YKE B;  5LOV E;  3WAJ A;  4YSX A;  4ZI3 C;  4QH4 A;  1WYC A;  3MZK B;  2E9X B;  3RI5 A;  4YSY A;  2WZI A;  2XAH B;  4QXB B;  3ZT6 A;  4YY3 T;  2M6I A;  5HEJ A;  2UXD T;  4WYV A;  4LFC T;  3ESL A;  3VR9 A;  1LVF A;  3LBX A;  4NUV A;  2E5L T;  3KFW X;  3RIU A;  1UX4 A;  1R8I A;  3RIU C;  4I50 E;  1VCS A;  1YKH B;  3ANW A;  3UUM A;  2DHR A;  1HX8 A;  4LF4 T;  4QXH B;  4JEU B;  1CHU A;  1VOM A;  4HFH A;  2IC9 A;  2PTF A;  3ZN0 B;  3PU8 A;  3TLV A;  2C5K T;  3SS1 A;  2V7K A;  3FBZ A;  1XNR T;  2KIN B;  3LK2 B;  2LOP A;  3ZYK A;  4UVA B;  1KFY A;  2X9Y A;  4H9S E;  2LOS A;  3RYI E;  2ZLY A;  4LF9 T;  4PW8 A;  1BR4 A;  1T7S A;  1YQ4 A;  3KV5 A;  3N2O A;  3M3Z B;  2V7L A;  5HEU A;  1HCI A;  3AED A;  4O2B E;  2LHN A;  4A97 A;  4CI3 B;  5ABH A;  5JR9 C;  2OA5 A;  4P0A A;  5LCY A;  4JI7 T;  3UQ4 A;  3UUN A;  4YXD A;  3N2G E;  4CI1 B;  2DWK A;  5AQV B;  5AQR B;  2VL8 A;  3F31 A;  4B3T T;  1M7K A;  1X9B A;  2ODV A;  2WB5 A;  3A7M A;  2VVS A;  2KZ7 B;  3EVY A;  4GK5 E;  2N1G A;  4IE6 A;  5FP3 A;  3VU7 H;  2W4X A;  1T72 A;  2V1D B;  2EHO C;  1WR0 A;  1QSD A;  3KDS E;  1U4Q A;  5IUX A;  4LF8 T;  4IHJ E;  5L4E A;  3ZYL A;  2WDR A;  3RYF E;  4NXM T;  1J5W A;  5LJM A;  1D1B A;  3V5U A;  3ZMU B;  2F4V T;  2IIU A;  2YK0 A;  2K24 A;  1XNQ T;  3IF8 B;  4B3R T;  5L3F B;  2RA1 A;  2UUA T;  3RC3 A;  3B5M A;  4KHZ F;  1HS7 A;  2VUR A;  3UTK A;  4CI2 B;  2CWY A;  2BG9 E;  3F57 A;  4MBQ A;  4O4H E;  4P1N A;  4ZHQ E;  3N9Q A;  5C8Y E;  2VQF T;  4JI4 T;  1WR6 A;  2XAS B;  3NZQ A;  4TZ4 C;  2UXC T;  2AE9 A;  2W61 A;  2CLY C;  5HXE A;  5JDM A;  4O4I E;  2K9A A;  3A8Y C;  2LSY A;  3ABV A;  4OFZ A;  5L2L A;  2Y48 B;  2XQ4 A;  3AXJ A;  2MPK A;  3CX8 B;  3H3M A;  1ZOY A;  4AIU A;  4I43 B;  4BJN A;  4DR1 T;  3CVR A;  4JV5 T;  2X9H A;  4HEA A;  4PK6 A;  3JCF A;  5JDH A;  1YW0 A;  2V6Y B;  2IHR 1;  1G8X A;  4Z90 A;  3SWH A;  4IDN A;  4CQI A;  4YTN A;  2ZM6 T;  1D0X A;  3AE1 A;  3PUZ F;  5JH7 E;  1UUR A;  2E9X A;  1CUN A;  1ZV4 X;  4JI1 T;  3ZJ2 A;  4PAG A;  3FHN A;  5ETW A;  3K3O A;  2NW7 A;  4PJM A;  5DQW A;  2M67 A;  3H3A A;  4C91 A;  5HXS A;  3UQ7 A;  3PUS A;  2K5B B;  2WCA A;  3CX6 B;  3MXZ A;  2UUC T;  3QOF A;  2XHE B;  3L8R A;  5LGU B;  1OWA A;  4DID B;  1DU2 A;  2FBW A;  2Z6E A;  2BG9 A;  3PTR B;  2A2F X;  5CA0 E;  3UU3 A;  2V26 A;  3AA0 B;  5F3J A;  4JI5 T;  1NAF A;  1XDP A;  5FNV E;  4HTE A;  1IZN B;  2CXL A;  2N9D A;  1OXZ A;  3C51 A;  3QUJ A;  2PG8 A;  4HWC A;  2L8K A;  3AB3 B;  2QGS A;  2DWG A;  2CXF A;  4YT0 A;  3OTO T;  4LF5 T;  4HFV A;  3HKC E;  5EK3 A;  5LGN B;  4B3S T;  4PFO A;  3DP7 A;  2VB6 A;  3I9Y A;  5KMG P;  2A9U A;  2BKP A;  2X9W A;  1L0V A;  1B7T A;  5FXV A;  4TWH A;  3ZJ1 A;  2WP9 A;  4KMC A;  3P4R A;  2IML A;  4HKA A;  2ZM2 A;  3AE5 A;  3O4X E;  4NUU A;  2JQH A;  4YLH A;  4HFE A;  4PNI A;  4LFB T;  4ZI7 E;  3AA7 B;  4WBN E;  5CJ5 A;  4PJJ A;  4EIW A;  2LSG A;  3NRX A;  4MLK A;  3QB5 K;  3RH3 A;  3C4Z A;  4EYU A;  2NR4 A;  4ADZ A;  1NEN A;  4U33 A;  3MKD A;  2CM0 A;  4U3C A;  2NP9 A;  1KNR A;  4HWD A;  1FIO A;  2IC6 A;  2UXX B;  3CQX C;  4IL9 A;  5FXW A;  3P4Q A;  3U78 A;  5JTG A;  2J62 A;  2BVL A;  3HI2 A;  3P4P A;  3CQC B;  4NIQ A;  2ZM0 A;  3LFM A;  4H9Q C;  4KUM B;  3Q2M A;  3UUB A;  2LKH A;  3FXD B;  4J2C A;  3UFG A;  2MOZ A;  4DV7 T;  2BS2 A;  4HWI B;  4IIJ E;  3ZST A;  2I6H A;  5AQU B;  2JRK A;  1IJ6 A;  1IAP A;  2XSA A;  5HAX A;  5LBM A;  1XWM A;  4HFC A;  4CN6 A;  2H88 A;  5L3C B;  2LSI A;  2XAQ B;  4GKJ T;  2CHN A;  4X62 T;  3P8C D;  2E9X C;  3FZH B;  2XZE A;  3VKG A;  1FEW A;  2IDO B;  4BAY B;  4IL4 A;  1WFD A;  3GN5 A;  3PUW F;  2DLR A;  3ZSS A;  4DUZ T;  3RIA A;  4ZZC A;  1HF8 A;  1MNE A;  2LHR A;  3CIR A;  1FJG T;  1Y01 A;  3O1H A;  1SA0 E;  4ILU A;  4U2Z A;  1E2A A;  2YEV C;  4GIW A;  3KIN B;  5H6R B;  4NXN T;  2J1D G;  2WDV A;  2XQ8 A;  2XUE A;  4UVB B;  3LSV A;  3X1D A;  1IBL T;  1OED B;  4TX5 A;  3RKO A;  5CFB A;  4LMK A;  3MAC A;  3CK6 A;  2KLQ A;  4AI6 A;  3ANW B;  3Q9D A;  4DR7 T;  5LG4 A;  3H37 A;  3LG7 A;  3S4U A;  2LM2 A;  4ILC A;  2YDQ A;  4Z91 A;  3NKZ A;  3RYH E;  5LHI B;  4AQY T;  1BR2 A;  5FMN A;  2A3D A;  2DCF A;  5GON E;  3AVS A;  2D0U A;  3TLU A;  1T8B A;  3P50 A;  5FL0 A;  1KEY A;  1W09 A;  4ZOL E;  2KWI B;  2NOX A;  2W2U A;  2WWV A;  3N2K E;  2IAK A;  1ZKE A;  2E8I A;  5JVD E;  3ZEF B;  4O2A E;  2GK9 A;  5FY7 A;  3TLW A;  3AVR A;  1HG2 A;  2QYW A;  3AE6 A;  4H9N C;  5BR8 T;  2I0M A;  2LLY A;  3GN5 B;  3NBX X;  3VRB A;  5JDL A;  5AQJ B;  5HXC A;  3EDV A;  2UUB T;  4H9O C;  3PUG A;  4IST A;  3LK4 2;  3ZMZ B;  4YJ2 E;  2C5I T;  2V7I A;  4A5X A;  1HX1 B;  2LJL A;  2N2N A;  3MK7 C;  3MJX A;  3O9X A;  1IBK T;  2QA7 A;  4UEL A;  3Q5D A;  4X66 T;  2M6B A;  5HCJ A;  1LVK A;  2D0T A;  1VCT A;  2DL1 A;  2Q9Q B;  2XQ5 A;  2OV9 A;  5ADX L;  5FL1 A;  1MIY A;  4U2Y A;  1NWM X;  5LMN T;  2MBG A;  2V6Y A;  2KXP B;  4EB6 E;  3QB5 A;  5AFU L;  2XAG B;  4KHP T;  3AEF A;  3EI0 A;  3TLT A;  4PK5 A;  4GYR A;  5DQV A;  4WW0 A;  2E2A A;  3WAK A;  2VKJ A;  1MMA A;  2XQ3 A;  4O4J E;  4ASK A;  4KP3 C;  5A1L A;  3T1Y T;  3RC8 A;  5AQS B;  2NTY A;  1KK7 A;  2WU2 A;  3KVB A;  4QH5 A;  3C4X A;  2WMO A;  4ILB A;  2XY8 B;  2NWB A;  3C98 B;  2LE8 A;  3ONJ A;  2FJE A;  2CBJ A;  2HPJ A;  2Q9Q D;  3EUH A;  3PUQ A;  2X66 A;  2XTL A;  4H9P C;  3VR8 A;  1IBM T;  1LKX A;  4LFA T;  3ZC0 A;  2KT9 A;  2CXD A;  5C3J A;  2X68 A;  3BQL A;  1I6Z A;  4ZI3 D;  2WAU A;  1JNR A;  1FMW A;  3PDY A;  1T98 A;  4EEB A;  4F8H A;  4WNK A;  3AE8 A;  2JQQ A;  5AQM B;  2BBJ A;  4MFR A;  3ZCI A;  3HKE E;  5HWX A;  2H7O A;  4LF7 T;  2EHO D;  4OK0 A;  3ZMT B;  2LKG A;  2YN6 A;  4DR2 T;  3FZK B;  2EHO A;  3LDQ B;  4F6R C;  1V9D A;  3RX6 A;  1MMD A;  5FKY A;  5JDN A;  1MMN A;  2JJ9 A;  2Q9Q A;  4G2A A;  5L3B B;  1OED E;  1MIW A;  4ISS A;  3F2E A;  2FJD A;  4YHJ A;  4BA9 A;  3K3N A;  5AQP B;  1I94 T;  3VHL A;  3FZL B;  2WZH A;  5JDG A;  3AE9 A;  3FZF B;  4QX7 B;  4TV8 E;  5JRC B;  1YD8 G;  5AQQ B;  4LML A;  2FUP A;  3ZKR A;  4EAH A;  2IW5 B;  1XMQ T;  5H6Q B;  2BBH A;  3ETV A;  2CPT A;  3LK3 B;  4MHC A;  2XQ6 A;  3ZPO A;  4IRE A;  3UUL A;  4ILA A;  2W00 A;  2MYS A;  4MAL A;  4ANJ A;  4EYY R;  2WWU A;  3C4W A;  3WI3 A;  2BVM A;  3J7Y q;  3ZLI A;  1WYB A;  1D1A A;  5KDM C;  2MAW A;  2BG9 C;  2RPA A;  1UUS A;  2VKH A;  3QK6 A;  3CWZ B;  4UR9 A;  3ZN1 B;  5HCM A;  2C5J A;  3I0O A;  3AEE A;  2E9X D;  3RPU A;  4PJL A;  1KNP A;  2V5C A;  2XAF B;  2UXB T;  4AKH A;  2EHO B;  2G0U A;  4QHO A;  4JI2 T;  5IYZ E;  3RHW A;  4UEM A;  5DAB A;  4O4L E;  3Q5W A;  2R6G F;  4O8S A;  2IUB A;  3ONL C;  3B57 A;  5L3G B;  5AQT B;  2VWA A;  5JR9 B;  1NEK A;  4Z8X A;  2CHO A;  1UCU A;  2W62 A;  2D2S A;  3OKQ A;  2A72 A;  4DMW A;  4AKG A;  5ABF B;  3IBP A;  3U3I A;  2WS3 A;  4X5T A;  4ERR A;  5J1G A;  3JAF A;  4X1I E;  4I55 E;  3EDU A;  1W0A A;  3R84 B;  4EZH A;  2X9X A;  2JIW A;  1H7C A;  1LRZ A;  3PU3 A;  3RYC E;  4QH1 A;  4UV9 B;  2XJ7 A;  2BKN A;  3PUR A;  2WBL A;  3SFD A;  5L3E B;  4M1P A;  4YJ3 E;  1GQE A;  1E7P A;  3I1A A;  1JNZ A;  4EGW A;  4U7I A;  4DV6 T;  1M62 A;  5LP6 E;  1US7 B;  1VRB A;  2PBI A;  3Q5X A;  4HFB A;  1HFA A;  2LT3 A;  3L39 A;  4B3M T;  4IDQ A;  3CQG B;  1W0B A;  2VL0 A;  4CN4 A;  1Z8U A;  5AQH B;  3OVU A;  3K3Q C;  3UU4 A;  4Q25 A;  2X51 A;  4DR5 T;  2JQ9 A;  4LF6 T;  4TWF A;  4X1K E;  5AQG B;  5AQN B;  4B6X A;  2LSJ A;  3HL6 A;  2Y6X A;  3AE7 A;  3GA8 A;  3OJA A;  1W9R A;  2PFV A;  3KVA A;  3E22 E;  3CML A;  2XQY A;  5DJQ C;  5E0O A;  3HA4 A;  1FMV A;  4DBQ A;  1S35 A;  1Y64 B;  2CWO A;  3PUA A;  3PV0 F;  4TNV A;  3ZT7 A;  1ZHC A;  4FI5 A;  4X20 E;  1S94 A;  3ETU A;  4IT4 A;  3FB2 A;  5LA6 E;  2XM1 A;  5LB7 B;  5F8P A;  3JC6 C;  2UU9 T;  4EV6 A;  3OBV E;  1YQ3 A;  3O1J A;  5HXH A;  1G73 A;  1XZY A;  2ACZ A;  3O1I A;  2H7V C;  2WU5 A;  4EXT A;  1SE7 A;  3QC9 A;  4IDO A;  4DND A;  4L5G A;  3UUX B;  4YFS A;  5LG3 A;  1XMO T;  4DBR A;  4JBW F;  1SUM B;  2V7M A;  1N34 T;  1OED A;  2WMN A;  2DNX A;  2NW9 A;  2YU2 A;  2CEA A;  4C90 A;  3N9N A;  2KWH A;  3RGL A;  4HN9 A;  4U74 A;  5JDQ A;  3HKB E;  1HNZ T;  4OYJ A;  2CLY B;  3GMI A;  3N9M A;  3R6N A;  4YSZ A;  4DUY T;  2L9Q A;  2WDQ A;  5FVK A;  4ZEY A;  1WLX A;  4KI0 F;  4DMV A;  4UV8 B;  4X1Y E;  2XQ9 A;  3KBT A;  1ZEE A;  2J47 A;  3UT5 E;  4A98 A;  3N9L A;  2J4G A;  3FXE B;  2X0L B;  3M65 A;  5HEO A;  3AEG A;  5FY1 A;  2BZB A;  3D0T A;  2CA5 A;  1O3X A;  4YTM A;  4ZXL A;  3VRA A;  3ZMS B;  4OX9 T;  1BR1 A;  2XSB A;  3PJA J;  5LBQ B;  2X0H A;  3E08 A;  4DV1 T;  4L0R A;  5HWY A;  4FJO A;  3T8O A;  3HKD E;  2K48 A;  4TV9 E;  3PE0 A;  5KX5 E;  1KNZ A;  2I59 A;  2HN2 A;  1IJ5 A;  4UVC B;  4HWF A;  2WSS V;  2NTX A;  2ES0 A;  3AEB A;  3P4W A;  2YKS A;  4TUY E;  2CRB A;  3AAI A;  2W67 A;  2AXD S;  2CBI A;  4G63 A;  1MMG A;  4AKR B;  1Z0P A;  4CXX A;  3AE4 A;  5EK2 A;  4X65 T;  2BDE A;  3KV6 A;  4DV0 T;  4XBF B;  3AAA B;  4JEH B;  5CA1 E;  3ONX A;  3JC6 D;  2SPC A;  4JI6 T;  3T1H T;  2MTQ A;  4GYS A;  3DTO A;  4HE8 A;  2HN1 A;  2ZM8 A;  4PFP A;  3AAE B;  4IE5 A;  3ZCJ A;  4COF A;  3V5S A;  1ZP0 A;  2LM9 A;  1BR0 A;  4V1A v;  3SOL A;  3CKD A;  3NWI A;  3RF1 A;  4CN1 A;  1XDO A;  4AQF C;  5AQI B;  2HHH T;  2ZMA A;  1N32 T;  5JRE A;  2XQA A;  4AQF A;  2V5D A;  4A56 A;  2KMF A;  5F5W A;  3SRZ A;  2VAS A;  5J0Z A;  2ODU A;  3BQI A;  3IA3 A;  4H63 H;  4NPP A;  2XM2 A;  4N78 D;  3RIF A;  4JI0 T;  3AA1 B;  4DO0 A;  1E1H B;  1MND A;  1WRD A;  2B76 A;  2P9B A;  2WY2 A;  3NVO A;  1HG5 A;  2JMH A;  2W66 A;  4HWH A;  2WQY A;  4PJN A;  4TWD A;  3JAD A;  5IWA T;  1AJ3 A;  3GWH A;  3UU6 A;  4YTP A;  3UFE A;  3I0Q A;  3ZMV B;  2D9D A;  4IGU A;  5JQG E;  4X64 T;  5EZY E;  4YHH T;  2PJQ A;  4OHF A;  1N33 T;  4I4T E;  4K0U A;  2VK9 A;  2NW8 A;  3PUX F;  3ZYM A;  5AQF B;  2BG9 B;  2E5V A;  3MA9 A;  4U72 A;  4JYA T;  2W63 A;  3CX7 B;  3RKG A;  5HEH A;  2CMR A;  4GOU A;  4QX8 B;  2HPL A;  3FBL A;  4HFD A;  5BMV E;  5L47 A;  1HR0 T;  1HTJ F;  3SFE A;  5JRC A;  4ZS2 A;  3E0Z A;  3C50 A;  4UF0 A;  4UIG A;  3NZP A;  2X67 A;  2D5U A;  5LHH B;  2HH7 A;  5CB4 E;  2VQE T;  5FVL A;  3AA6 B;  1X79 A;  4ZI2 D;  1J5E T;  5ABF A;  2JMK A;  2QVA A;  4DR6 T;  2YDS A;  4AIS A;  3K8P C;  3BK9 A;  5HEG A;  2JQK A;  2LRK A;  3HR0 A;  3Q5E A;  5JDF A;  3AE2 A;  5JR9 A;  2DI4 A;  4DV5 T;  3LJC A;  1MIV A;  3AXJ B;  4GK0 E;  1QUU A;  4H9R C;  4KX6 A;  3DJB A;  3PUY F;  4AXP A;  1D1C A;  3J9X 1;  5LXT E;  3LBX B;  3KBU A;  2YDR A;  4OYK A;  4DV2 T;  3ZC1 A;  3P7I A;  3PJA A;  3EAM A;  5AQL B;  2YIN A;  3N9O A;  4EZ4 A;  1OED C;  4JUY A;  2XQ7 A;  3C64 A;  2CE7 A;  3N5L A;  3OPC A;  4UF0 B;  4XAX B;  4E7Z A;  2FJA A;  2YOE A;  2VKO A;  4IE0 A;  5LHG B;  5LNK A;  2LRL A;  4K0K T;  4JLE A;  3B13 A;  3K1S A;  2KSR A;  4I0U A;  4UXN B;  3AE3 A;  5HXR A;  4JI8 T;  5L3D B;  4QWN B;  5LGT B;  2JPF A;  5EK4 A;  2OLT A;  1QLB A;  3L09 A;  2LSK A;  4IE4 A;  4IE7 A;  2XAJ B;  3VKH A;  2XPK A;  5ABE A;  4DR3 T;  3CPZ A;  5AQO B;  3RQU A;  3FZM B;  4WBO A;  1SHZ C;  2W0G A;  4DV3 T;  2H3R A;  3IHR A;  3OYX A;  4TN7 B;  5C2T A;  3PUV F;  4P0B A;  1HNX T;  5FXX A;  3UU8 A;  1HNW T;  3OYZ A;  5IHY A;  3G06 A;  4U7Y A;  4EOZ B;  4DV4 T;  3AEC A;  2WM9 A;  4DR4 T;  2Q9Q C;  3KV9 A;  1KF6 A;  4U31 A;  4DVD A;  4AKI A;  4JI3 T;  2BS4 A;  3IEE A;  4H63 V;  4BJM A;  4P09 A;  2VKD A;  3NRY A;  1U5P A;  3N9P A;  5FY0 A;  5J2U E;  5LJN A;  5KXJ A;  5LMU T;  5L4H A;  1D0Y A;  3TKL B;  3JAE A;  2BS3 A;  2ACX A;  3QNU A;  2H89 A;  4LMJ A;  3P4S A;  5CGM A;  5J2T E;  4QXC B;  5ABG A;  3A5X A;  4IDZ A;  2FJB A;  2YU1 A;  3L3P A;  3W15 B;  3RLF F;  4EED A;  4GKK T;  5AQK B;  3KV4 A;  2B1E A;  1J1J A;  1YXR A;  4L9I A;  2CCQ A;  5TAO A;  3RRW A;  5HYA A;  2V7J A;  2L3L A;  5M4Y A;  3TLS A;  2RP4 A;  2K3W A;  4ZS3 A;  5FXZ A;  2Y8D A;  3AEA A;  3BQK A;  1EZ3 A;  4AQG A;  4XZC A;  4CXY A;  2V6X A;  4CXW A;  4HFI A;  1N36 T;  3ZT5 A;  2BKO A;  2KND A;  4HGA A;  4CZZ B;  5LYJ E;  4TNW A;  1WCR A;  2X0Y A;  2V8S V;  3RQW A;  3EAB A;  4IDP A;  4PK4 A;  1D0Z A;  2C0S A;  2UXN B;  3I9W A;  4E7S A;  4ZI2 C;  1UGO A;  5FYM A;  1UK5 A;  4AKL A;  3RRC A;  4WZX A;  4KBM B;  3EHZ A;  3UU5 A;  4ZZB A;  2LEH A;  2VVN A;  2QRX A;  4QKN A;  1UX5 A; 
#chains in the Genus database with same CATH homology
 1YKE B;  5LOV E;  3WAJ A;  4ZI3 C;  1WYC A;  3MZK B;  2E9X B;  2XAH B;  4QXB B;  3ESL A;  1LVF A;  3LBX A;  4NUV A;  3KFW X;  1UX4 A;  4I50 E;  3ANW A;  1YKH B;  3UUM A;  2DHR A;  1HX8 A;  4QXH B;  4JEU B;  1VOM A;  2IC9 A;  3ZN0 B;  3PU8 A;  2C5K T;  3SS1 A;  2V7K A;  3FBZ A;  2KIN B;  3LK2 B;  2LOP A;  3ZYK A;  4UVA B;  2X9Y A;  4H9S E;  2LOS A;  3RYI E;  2ZLY A;  4PW8 A;  1BR4 A;  3KV5 A;  3N2O A;  5JVD E;  4CI3 B;  5L3D B;  2V7L A;  1HCI A;  4O2B E;  2LHN A;  5JR9 C;  2OA5 A;  4P0A A;  5LCY A;  3UUN A;  3N2G E;  4CI1 B;  2DWK A;  2VL8 A;  3F31 A;  2ODV A;  3UFE A;  3S4U A;  5FP3 A;  3EVY A;  2KZ7 B;  4GK5 E;  2N1G A;  4IE6 A;  3VU7 H;  2V1D B;  2EHO C;  1QSD A;  3KDS E;  1U4Q A;  4IHJ E;  3ZYL A;  3RYF E;  5LJM A;  1D1B A;  3V5U A;  3ZMU B;  2YK0 A;  2K24 A;  3IF8 B;  5L3F B;  2RA1 A;  3RC3 A;  1HS7 A;  3UTK A;  4CI2 B;  2CWY A;  3F57 A;  4MBQ A;  4O4H E;  5C8Y E;  4ZHQ E;  3N9Q A;  1WR6 A;  2XAS B;  3NZQ A;  4TZ4 C;  2W61 A;  5JDM A;  2CLY C;  5HXE A;  4O4I E;  2K9A A;  4OFZ A;  2LSY A;  5L2L A;  2Y48 B;  5L3B B;  3CX8 B;  4BJN A;  4I43 B;  3CVR A;  2X9H A;  4HEA A;  4PK6 A;  5JDH A;  1YW0 A;  3SWH A;  1G8X A;  4CQI A;  1D0X A;  5JH7 E;  2E9X A;  1CUN A;  1ZV4 X;  3ZJ2 A;  4PAG A;  3FHN A;  5ETW A;  3K3O A;  2NW7 A;  4PJM A;  5DQW A;  2M67 A;  3H3A A;  4C91 A;  5HXS A;  3PUS A;  2K5B B;  3CX6 B;  3MXZ A;  2XHE B;  5LGU B;  1OWA A;  2Z6E A;  3PTR B;  2A2F X;  5CA0 E;  2V26 A;  3AA0 B;  5F3J A;  1NAF A;  5FNV E;  4HTE A;  1IZN B;  2CXL A;  2N9D A;  1OXZ A;  3C51 A;  3QUJ A;  2PG8 A;  2L8K A;  3AB3 B;  2DWG A;  2QGS A;  2CXF A;  4HFV A;  3HKC E;  5EK3 A;  5LGN B;  4PFO A;  3DP7 A;  2VB6 A;  3I9Y A;  5KMG P;  2X9W A;  1B7T A;  5FXV A;  3ZJ1 A;  4KMC A;  4HKA A;  4YLH A;  2ZM2 A;  4NUU A;  3O4X E;  4PNI A;  4ZI7 E;  3AA7 B;  4WBN E;  4PJJ A;  4EIW A;  2LSG A;  3NRX A;  4MLK A;  4EYU A;  3RH3 A;  3C4Z A;  4ADZ A;  3MKD A;  2CM0 A;  2NP9 A;  1FIO A;  2IC6 A;  2UXX B;  3CQX C;  5FXW A;  3U78 A;  2BVL A;  3HI2 A;  3CQC B;  2ZM0 A;  3LFM A;  4H9Q C;  4KUM B;  3Q2M A;  3FXD B;  4J2C A;  2MOZ A;  4IIJ E;  2JRK A;  1IJ6 A;  1IAP A;  5HAX A;  5LBM A;  5L3C B;  2LSI A;  2XAQ B;  3P8C D;  2E9X C;  3VKG A;  1FEW A;  4BAY B;  3GN5 A;  2DLR A;  1HF8 A;  1MNE A;  2LHR A;  3O1H A;  1SA0 E;  4ILU A;  2YEV C;  4GIW A;  3KIN B;  5H6R B;  2J1D G;  2XUE A;  4UVB B;  4TX5 A;  3RKO A;  3MAC A;  2KLQ A;  4AI6 A;  3ANW B;  3Q9D A;  5LG4 A;  3H37 A;  3LG7 A;  3RYH E;  5LHI B;  1BR2 A;  5FMN A;  2A3D A;  2DCF A;  5GON E;  3AVS A;  2D0U A;  4ZOL E;  2KWI B;  2NOX A;  3N2K E;  2IAK A;  1ZKE A;  2E8I A;  3ZEF B;  4O2A E;  2GK9 A;  5FY7 A;  3AVR A;  1HG2 A;  4H9N C;  3GN5 B;  3NBX X;  5JDL A;  5HXC A;  3EDV A;  4H9O C;  3PUG A;  4IST A;  3LK4 2;  3ZMZ B;  4YJ2 E;  2C5I T;  2V7I A;  2N2N A;  2LJL A;  3MK7 C;  3MJX A;  3O9X A;  2QA7 A;  4UEL A;  1LVK A;  2D0T A;  2Q9Q B;  5ADX L;  1MIY A;  1NWM X;  2MBG A;  5AFU L;  2KXP B;  4EB6 E;  2XAG B;  4PK5 A;  4GYR A;  5DQV A;  4WW0 A;  3WAK A;  4ASK A;  2VKJ A;  1MMA A;  4O4J E;  5A1L A;  4KP3 C;  3RC8 A;  2NTY A;  1KK7 A;  3KVB A;  3C4X A;  2WMO A;  2NWB A;  3C98 B;  2LE8 A;  3PUQ A;  2HPJ A;  3EUH A;  2Q9Q D;  4H9P C;  2X66 A;  2XTL A;  1LKX A;  3ZC0 A;  2KT9 A;  2CXD A;  2X68 A;  3BQL A;  4ZI3 D;  2WAU A;  1FMW A;  3PDY A;  1T98 A;  4WNK A;  2JQQ A;  3ZCI A;  4MFR A;  5HWX A;  3HKE E;  2H7O A;  2EHO D;  4OK0 A;  3ZMT B;  2EHO A;  4F6R C;  1V9D A;  3RX6 A;  1MMD A;  5JDN A;  1MMN A;  2JJ9 A;  2Q9Q A;  4G2A A;  1MIW A;  4ISS A;  3F2E A;  4BA9 A;  4YHJ A;  3K3N A;  3VHL A;  5JDG A;  4QX7 B;  4TV8 E;  5JRC B;  1YD8 G;  4EAH A;  2IW5 B;  5H6Q B;  3ETV A;  3LK3 B;  4MHC A;  3ZPO A;  4ANJ A;  3UUL A;  4MAL A;  2W00 A;  2MYS A;  4EYY R;  2WWU A;  3C4W A;  3WI3 A;  2BVM A;  3J7Y q;  3ZLI A;  1WYB A;  1D1A A;  5KDM C;  2VKH A;  3QK6 A;  3CWZ B;  3ZN1 B;  2C5J A;  3I0O A;  3RPU A;  2E9X D;  4AKH A;  4PJL A;  2XAF B;  2EHO B;  2G0U A;  4QHO A;  5IYZ E;  4UEM A;  5DAB A;  4O4L E;  3Q5W A;  4O8S A;  3B57 A;  5L3G B;  2VWA A;  5JR9 B;  4Z8X A;  2W62 A;  1UCU A;  2D2S A;  3OKQ A;  2A72 A;  4DMW A;  4AKG A;  3IBP A;  3U3I A;  4ERR A;  5J1G A;  4X1I E;  3R84 B;  4I55 E;  3EDU A;  4EZH A;  2X9X A;  1H7C A;  1LRZ A;  3PU3 A;  3RYC E;  4UV9 B;  3PUR A;  5L3E B;  2WBL A;  4M1P A;  4YJ3 E;  3I1A A;  5LP6 E;  1US7 B;  1VRB A;  2PBI A;  3Q5X A;  1HFA A;  2LT3 A;  3CQG B;  3K3Q C;  2X51 A;  4X1K E;  4B6X A;  2LSJ A;  3HL6 A;  2Y6X A;  3GA8 A;  3OJA A;  2PFV A;  3KVA A;  3E22 E;  3CML A;  2XQY A;  5DJQ C;  5E0O A;  3HA4 A;  1FMV A;  4DBQ A;  1S35 A;  1Y64 B;  2CWO A;  3PUA A;  1ZHC A;  4FI5 A;  4X20 E;  1S94 A;  3ETU A;  3FB2 A;  5LA6 E;  5F8P A;  3JC6 C;  3OBV E;  3O1J A;  5HXH A;  1G73 A;  3O1I A;  2H7V C;  4EXT A;  3QC9 A;  4DND A;  4L5G A;  3UUX B;  4YFS A;  4DBR A;  2V7M A;  2WMN A;  2DNX A;  2NW9 A;  2YU2 A;  2CEA A;  4C90 A;  3N9N A;  2KWH A;  4HN9 A;  4U74 A;  5JDQ A;  3HKB E;  4OYJ A;  2CLY B;  3GMI A;  3N9M A;  3R6N A;  2L9Q A;  1WLX A;  4DMV A;  4UV8 B;  4X1Y E;  3KBT A;  1ZEE A;  3UT5 E;  3N9L A;  3FXE B;  2X0L B;  3M65 A;  4AQG A;  5FY1 A;  2BZB A;  3D0T A;  2CA5 A;  1O3X A;  3ZMS B;  1BR1 A;  5LBQ B;  3E08 A;  4L0R A;  5HWY A;  4FJO A;  3T8O A;  3HKD E;  2K48 A;  4TV9 E;  3PE0 A;  5KX5 E;  1KNZ A;  2I59 A;  1IJ5 A;  4UVC B;  2WSS V;  2NTX A;  2ES0 A;  4TUY E;  3AAI A;  4G63 A;  1MMG A;  4AKR B;  1Z0P A;  4CXX A;  5EK2 A;  2BDE A;  3KV6 A;  4XBF B;  3AAA B;  4JEH B;  5CA1 E;  3ONX A;  3JC6 D;  2SPC A;  2MTQ A;  4GYS A;  3DTO A;  4HE8 A;  2ZM8 A;  4PFP A;  3AAE B;  4IE5 A;  3ZCJ A;  3V5S A;  2LM9 A;  1BR0 A;  4V1A v;  3SOL A;  3CKD A;  4AQF C;  2ZMA A;  5JRE A;  4AQF A;  4A56 A;  2KMF A;  3SRZ A;  2VAS A;  2ODU A;  3BQI A;  4H63 H;  4N78 D;  3AA1 B;  4DO0 A;  1E1H B;  1MND A;  1WRD A;  2P9B A;  1HG5 A;  2JMH A;  1AJ3 A;  4PJN A;  3GWH A;  3I0Q A;  3ZMV B;  4IGU A;  5JQG E;  5EZY E;  2PJQ A;  4OHF A;  4I4T E;  4K0U A;  2VK9 A;  2NW8 A;  3ZYM A;  3MA9 A;  4U72 A;  2W63 A;  3CX7 B;  2CMR A;  4GOU A;  4QX8 B;  2HPL A;  3FBL A;  5BMV E;  5JRC A;  1HTJ F;  4ZS2 A;  3E0Z A;  3C50 A;  4UF0 A;  4UIG A;  3NZP A;  2X67 A;  2D5U A;  5LHH B;  2HH7 A;  5CB4 E;  3AA6 B;  1X79 A;  4ZI2 D;  2JMK A;  3K8P C;  3BK9 A;  3HR0 A;  5JDF A;  5JR9 A;  2DI4 A;  3LJC A;  1MIV A;  4GK0 E;  1QUU A;  4H9R C;  4AXP A;  3DJB A;  5LXT E;  1D1C A;  3J9X 1;  3LBX B;  3KBU A;  4OYK A;  3ZC1 A;  3P7I A;  2YIN A;  3N9O A;  4EZ4 A;  4JUY A;  3C64 A;  2CE7 A;  3N5L A;  4UF0 B;  4E7Z A;  4XAX B;  5LHG B;  2VKO A;  4IE0 A;  5LNK A;  4JLE A;  3B13 A;  4UXN B;  5HXR A;  4QWN B;  5LGT B;  2JPF A;  5EK4 A;  3L09 A;  2LSK A;  4IE4 A;  4IE7 A;  2XAJ B;  3VKH A;  3CPZ A;  4WBO A;  1SHZ C;  2W0G A;  2H3R A;  3IHR A;  3OYX A;  4TN7 B;  4P0B A;  5FXX A;  3OYZ A;  5IHY A;  4EOZ B;  4AKI A;  2WM9 A;  2Q9Q C;  3KV9 A;  4DVD A;  3IEE A;  4H63 V;  4BJM A;  4P09 A;  2VKD A;  3NRY A;  1U5P A;  3N9P A;  5FY0 A;  5J2U E;  5LJN A;  1D0Y A;  3TKL B;  2ACX A;  5J2T E;  4QXC B;  3A5X A;  4IDZ A;  2YU1 A;  3L3P A;  3W15 B;  3KV4 A;  2B1E A;  3RRW A;  4L9I A;  5TAO A;  2CCQ A;  5HYA A;  5M4Y A;  2V7J A;  2L3L A;  2RP4 A;  4ZS3 A;  5FXZ A;  4CXY A;  2Y8D A;  3BQK A;  1EZ3 A;  4XZC A;  4CXW A;  2KND A;  4HGA A;  4CZZ B;  5LYJ E;  4PK4 A;  1D0Z A;  2C0S A;  2UXN B;  3I9W A;  4E7S A;  4ZI2 C;  5FYM A;  4AKL A;  3RRC A;  4KBM B;  2LEH A;  4QKN A;  1UX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...