2DWKA

Crystal structure of the run domain of mouse rap2 interacting protein x
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
169
structure length
162
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Protein RUFY3
total genus 47
structure length 162
sequence length 169
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwkA00
2CXFA 2DWGA 2CXLA 4GIWA 2DWKA 3CWZB
chains in the Genus database with same CATH superfamily
4LF4T 2OV9A 5JTGA 5HEOA 3CK6A 3HKEE 4EB6E 4DR6T 2X9YA 4E7SA 1IBMT 2VQFT 4B3MT 4HWCA 2LE8A 1Z0PA 2VB6A 5DQWA 4JYAT 4WYVA 2BKPA 3CIRA 3N9OA 4AKIA 5C2TA 3T1HT 1XNQT 2RP4A 1KNPA 1X9BA 2FUPA 4PK5A 4YY3T 4AKHA 2XQ4A 2MTQA 1E7PA 2J47A 4L9IA 2LOSA 4P1NA 1T7SA 3ZMUB 3KVAA 1WLXA 3IF8B 4ZS3A 4BJNA 2WDQA 3C98B 1KK7A 2V7MA 1HG2A 3KV6A 4Z8XA 1YW0A 4IDZA 2AE9A 3NZQA 2BDEA 3Q9DA 2RA1A 1KEYA 4ANJA 3ZSTA 4JI2T 3O4XE 4PK6A 2Q9QC 1W09A 3IA3A 2NOXA 3JAEA 3KV4A 1US7B 5LB7B 2KT9A 2XQYA 3GWHA 1D0XA 4QX7B 3RGLA 4AQFA 4CXXA 3AAIA 5ABGA 3H3MA 1D1AA 2X9HA 5KDMC 2CM0A 2XQ7A 4H9RC 5JR9B 2BS2A 2I6HA 2JJ9A 1NEKA 1G8XA 1ZEEA 2W67A 3UU6A 3Q5XA 2W00A 1FIOA 4HEAA 1H7CA 3AEEA 5JDQA 1UK5A 2CWOA 2Z6EA 2CRBA 4HKAA 4PJMA 3IEEA 3K8PC 3WAKA 1LKXA 3P4WA 2CLYB 3CVRA 5IYZE 2HPJA 4K0UA 4DVDA 3OKQA 2BZBA 5L3EB 2AXDS 4UVBB 2E9XB 3RRCA 4ERRA 2BG9C 2LHRA 3QUJA 2WM9A 1SE7A 3LK42 3ABVA 3RQWA 3VU7H 4A98A 3OYXA 1CUNA 3KFWX 4ADZA 5JQGE 3ZMTB 3AE2A 2LLYA 5F8PA 5L4HA 1WRDA 5LP6E 1IBLT 1IZNB 3ETVA 2HH7A 3W15B 5ETWA 2JPFA 3QOFA 4YHHT 2NTYA 1V9DA 5F5WA 3AE9A 5IHYA 5FL1A 4PAGA 5J1GA 3NZPA 4QH1A 4EZ4A 3GA8A 4ILCA 2XHEB 2XAFB 4YSYA 4ZI3D 4LMLA 4DIDB 4HWDA 2VK9A 3R84B 1OEDC 3CPZA 5L3GB 2XQ8A 3AECA 3VR9A 2OLTA 4DV7T 2KSRA 2WMOA 2M67A 2LHNA 3RC8A 5AQFB 3LG7A 1D0YA 5AQNB 3I9WA 4V1Av 4UR9A 5BR8T 4HFHA 4X20E 2LM9A 5EK3A 3Q2MA 1KF6A 1OEDE 3BQKA 4H63H 5AQQB 4EXTA 5CFBA 4LFBT 2WDRA 3PUAA 2D9DA 3Q5EA 4H9QC 2FJDA 2ODUA 3C50A 2HPLA 3ZSSA 3OYZA 4XAXB 2BG9E 3ONJA 3G06A 2IC6A 2PJQA 4JEHB 4ZEYA 2JMKA 3K3OA 4NUUA 2VKDA 1WCRA 3E22E 5AQRB 2E5LT 2CLYC 5AQTB 2VVNA 3CWZB 3ZEFB 5CA1E 4LF9T 5A1LA 3HA4A 3LK3B 5FY1A 3LDQB 1U4QA 4OHFA 5L47A 4DR7T 2LSIA 2V6YA 3AEDA 4ZZBA 5ADXL 2IIUA 3DTOA 2W61A 2JQ9A 3CX8B 4O4JE 1HNZT 2D5UA 3AXJB 2X66A 2XJ7A 2YU2A 3EUHA 4YLHA 3TKLB 2E9XD 2QGSA 1XNRT 3J9X1 4P0BA 1FMWA 1OWAA 3M3ZB 2E5VA 2XTLA 3K3QC 5ABHA 4HE8A 3C4WA 1JNRA 2M6BA 3BQIA 2Q9QD 2LSGA 2A72A 2LSKA 3KBUA 3Q5WA 1L0VA 2V26A 4BJMA 2D2SA 5JDHA 4AI6A 3LJCA 1YQ3A 4KP3C 1YXRA 2PTFA 5LYJE 3RIAA 1QSDA 2LJLA 3MACA 3O1JA 4KX6A 3AA1B 3I9YA 2BG9B 4IE5A 4X62T 2W62A 3T1YT 3RIUC 3AXJA 2YKSA 4IL4A 5HXRA 3CKDA 5AQIB 3UUMA 3VRBA 3EI0A 3ZPOA 2EHOA 2NTXA 5LHGB 1KNRA 2LM2A 2VQET 3PUVF 1W0BA 5FNVE 2VWAA 1ZV4X 2DWKA 4ILBA 4X1YE 5CB4E 4YXDA 5L3FB 3ANWA 3SFEA 1MIWA 2HN1A 2BBJA 3I0QA 1UX4A 1OXZA 1ZKEA 2DWGA 2V7KA 5FKYA 4F6RC 2XQ6A 4WW0A 3ZMSB 4A56A 4Z90A 4X1KE 1IAPA 2FJBA 3RF1A 3F57A 1HFAA 2XM1A 3IBPA 1D1CA 3X1DA 1HX1B 2KWHA 3KV9A 3UQ4A 3ZYKA 4IHJE 3AE8A 5J2UE 3L8RA 4CN4A 1HR0T 5HEHA 4LF6T 3O1HA 1QLBA 4X1IE 3I1AA 3SWHA 2C5JA 1D1BA 1YKHB 2XAGB 4LF8T 4CI3B 2IC9A 5DQVA 1Y64B 2A3DA 2CA5A 3AE7A 2XASB 4QHOA 4UIGA 3AE3A 3MK7C 5DJQC 4ZI3C 3UU8A 3UU3A 1FJGT 2I0MA 4KI0F 4PJJA 5H6RB 1XMQT 3PUGA 5AQJB 1NWMX 2Y48B 5LCYA 2UUAT 2YDSA 2CMRA 4KMCA 3HKBE 4QH5A 4U2ZA 2DI4A 2FJAA 2H89A 4WBNE 4U33A 2HHHT 1DU2A 4ZI2D 3EHZA 2VVSA 1WFDA 3PUSA 4DBQA 1E1HB 2F4VT 1MMDA 3AA7B 5HCJA 4L5GA 3PU3A 4YTNA 2DLRA 1YKEB 3NWIA 3OPCA 5FP3A 5ABFA 5JRCB 3NBXX 2NW7A 1AJ3A 2A2FX 2VURA 4ISTA 4O2AE 3NVOA 1WYBA 3N2GE 4IIJE 4CZZB 3WAJA 5CJ5A 4CXYA 5L2LA 2VKOA 1NAFA 3PUYF 3C4XA 3FXDB 3PURA 5LBMA 3TLUA 2D0UA 2NP9A 2ACZA 3AAAB 3ZT6A 1N34T 5FXWA 5HEGA 5AQKB 3ZKRA 4O4LE 4H9NC 2EHOB 2JMHA 3RI5A 2XY8B 2XZEA 1HS7A 3UQ7A 2GK9A 1E2AA 2YOEA 1JNZA 3RYCE 5JDFA 3P4RA 4YSXA 2BBHA 2Y6XA 3AAEB 4DV0T 2YDQA 3VHLA 5E0OA 2XAJB 3AVSA 1MMGA 4TWHA 2W2UA 1WR0A 1UCUA 1N36T 4X5TA 1HG5A 3CQGB 1Y01A 3GN5B 3FB2A 2PFVA 2WQYA 3KVBA 3ONXA 4JLEA 5JR9A 3RC3A 4B6XA 5M4YA 1G73A 3VKHA 2J62A 1LRZA 2JQQA 5EK4A 4EYUA 3ETUA 4CN1A 1SA0E 2C0SA 1ZOYA 2CXLA 3P50A 3TLTA 4DBRA 4EYYR 1BR0A 4KBMB 3EDVA 3RKGA 3ZYLA 5J2TE 2A9UA 1M62A 3UFGA 4JI3T 3ZC1A 2V7IA 2X51A 2E9XA 4OFZA 2LKHA 3RYIE 4IE4A 1IJ6A 3UUNA 3ZCIA 2IUBA 3S4UA 5L3DB 3QNUA 5BMVE 2WCAA 3K1SA 5HXEA 2CEAA 2H7OA 3GN5A 4U31A 3LBXA 2V5DA 4KHPT 3PDYA 4IE6A 3WI3A 2VASA 5HYAA 4YFSA 2IHR1 4HTEA 4LMJA 4PNIA 5FL0A 4LF5T 3N5LA 3FBLA 1XDOA 5HEUA 5HWYA 5ABFB 2KWIB 3PU8A 4QX8B 5LG4A 5FXZA 1MMAA 2WWVA 2M6IA 3JC6C 3FBZA 2K48A 4DMWA 3AE4A 3E0ZA 4QH4A 5DABA 2WP9A 3ZMZB 3ZYMA 2V5CA 3JADA 4DR1T 3BK9A 2DHRA 4DUYT 2LRKA 3CQXC 4QXBB 4JI7T 1MIYA 1YQ4A 4PW8A 4HFEA 4TV9E 4GYSA 3UTKA 4P0AA 4UXNB 5JDGA 3N2KE 2KNDA 5L4EA 4B3ST 4JI4T 3FZLB 4YTPA 4ZOLE 2E8IA 2WU2A 5JH7E 4A97A 2HN2A 4HWFA 2X0LB 3A7MA 1OEDA 4CN6A 4GK0E 4EV6A 3FHNA 2WB5A 4MFRA 3EVYA 3R6NA 5KX5E 4AQFC 2Y8DA 2W4XA 4Q25A 2KXPB 4H63V 4U3CA 3FZFB 4O8SA 4AQYT 4JV5T 1YD8G 2WZIA 2G0UA 2BG9A 3RPUA 2CWYA 3MZKB 4HFIA 1I94T 2N1GA 2CHNA 2MAWA 3LK2B 5GONE 4B3TT 4I55E 3MXZA 2MPKA 2CHOA 3LSVA 4G63A 2BKNA 3FZHB 1HX8A 4L0RA 1T8BA 3KV5A 5TAOA 3AE1A 1NENA 4DNDA 3PUXF 2EHOC 2RPAA 2XQ9A 3NKZA 3JAFA 1Z8UA 4QWNB 4YHJA 5LMNT 2YU1A 3FXEB 4CQIA 1U5PA 2ODVA 3B5MA 4H9SE 2UU9T 1QUUA 5IWAT 1R8IA 3B13A 4DR4T 3UU5A 2JIWA 5EK2A 1VRBA 2CXDA 2WWUA 2V7JA 3N9QA 4AKLA 5HCMA 5AQUB 5HWXA 4XBFB 2BVLA 4K0KT 4H9OC 5LJMA 2J1DG 2IDOB 4HFCA 3UULA 2W66A 1MMNA 2FBWA 3PUQA 4IDNA 5LMUT 4IL9A 3ANWB 4UVCB 5J0ZA 3K3NA 4AIUA 4NIQA 3N9PA 3VR8A 3I0OA 3C64A 1ZHCA 2L8KA 5HXHA 2LSYA 3DJBA 1FMVA 3U78A 3AA0B 5LHHB 4ZI2C 2ZM2A 2IW5B 2Q9QA 4I50E 2XUEA 5FY7A 4OK0A 4WBOA 2UUCT 2YEVC 4IT4A 4M1PA 5FVKA 4GOUA 4EGWA 3HKDE 3ZMVB 3E08A 2UUBT 3DP7A 5LBQB 3UUXB 3RQUA 5AQLB 3F2EA 4MBQA 2K9AA 2BKOA 4ASKA 4DR5T 1HF8A 2CXFA 2L3LA 3RX6A 4MLKA 5HEJA 2C5IT 2XAQB 4JI6T 3N2OA 1LVKA 4UF0A 5LHIB 3AEGA 4N78D 5EZYE 5FYMA 4AKGA 3AB3B 3C51A 3O1IA 2NW9A 3RIFA 4LFCT 1BR2A 4IE0A 5CA0E 2MBGA 2BS3A 2WDVA 2UXDT 4HWIB 4NUVA 2DCFA 4TWFA 3UT5E 2H88A 2V6XA 2VL8A 3O9XA 3MJXA 2VKHA 1M7KA 4ZI7E 4TN7B 4C90A 3OTOT 2B1EA 4DV1T 2XQ5A 3HR0A 3P4SA 5HAXA 4DV4T 1N32T 3EABA 4KHZF 4AXPA 4JBWF 1LVFA 5F3JA 4KUMB 4JI0T 4U7YA 3D0TA 3PJAJ 2IMLA 3RLFF 4QXCB 5AQVB 3T8OA 1MIVA 4GK5E 1BR4A 3ZN1B 4EIWA 1XZYA 3CX6B 5JDNA 5AQSB 3L39A 4DMVA 3KBTA 1SUMB 3N9MA 4H9PC 3KDSE 1CHUA 3M65A 1XDPA 4X64T 4TV8E 1B7TA 2J4GA 2X68A 4UEMA 4AISA 4AKRB 5C8YE 5IUXA 2YDRA 4IREA 2XQAA 4HGAA 3ZN0B 1UURA 4DO0A 4O4HE 2ZM6T 3VRAA 3GMIA 2QRXA 4BAYB 3AEBA 2ZM0A 1W9RA 3OBVE 5FXXA 2SPCA 4NPPA 2KMFA 1UGOA 2B76A 2WS3A 5JVDE 4EEDA 4X65T 2UXNB 1J1JA 4I43B 3TLSA 2DNXA 2WAUA 4F8HA 4XZCA 3AE5A 5AFUL 3PE0A 3C4ZA 4MHCA 4YT0A 4HFBA 4J2CA 2K3WA 5JDLA 3HI2A 3QB5A 3QK6A 4ZZCA 5FY0A 2MYSA 2EHOD 2DL1A 2CCQA 2KZ7B 2NR4A 3A8YC 1J5ET 4UF0B 4TZ4C 5LA6E 2PG8A 3V5SA 5LJNA 4DV6T 1IBKT 5AQGB 3QB5K 3RHWA 3NRXA 4Z91A 3UFEA 1X79A 2X0YA 3PUWF 4TX5A 3BQLA 4U2YA 3HL6A 3ZT7A 4DR2T 2KLQA 4COFA 4JI1T 4QXHB 4NXMT 5AQOB 5LXTE 2ZLYA 3F31A 4ILAA 2E2AA 3P8CD 1J5WA 1KNZA 4CI2B 2X9WA 4ZHQE 1T72A 3A5XA 1XWMA 2OA5A 3OVUA 2P9BA 3ZLIA 3ZT5A 2LT3A 2XAHB 3L09A 3Q5DA 4FI5A 4PJLA 3RRWA 1WR6A 4OYJA 2WBLA 3N9NA 1VCSA 2PBIA 4YSZA 4NXNT 4E7ZA 1UX5A 3ZJ1A 3MKDA 3L3PA 3H37A 3SRZA 2QVAA 4HFVA 1HCIA 2KINB 4IDQA 4UV9B 3SFDA 1D0ZA 2I59A 2XSBA 4MALA 2NWBA 1XMOT 3NRYA 2X9XA 3PV0F 4B3RT 2K24A 2YK0A 4GIWA 4U72A 5ABEA 3JC6D 4JI5T 3TLVA 5HXSA 4TUYE 5LNKA 4OX9T 1FEWA 4QKNA 4UVAB 2V6YB 2CPTA 3PJAA 4DV5T 1KFYA 1O3XA 1HTJF 1GQEA 3QC9A 4WZXA 5AQMB 4A5XA 5C3JA 4GYRA 4JI8T 4X66T 3ZJ2A 4EEBA 4IGUA 5JDMA 4ILUA 4EZHA 3JCFA 1N33T 3N9LA 3FZKB 4FJOA 4ZS2A 4DV2T 3UU4A 4U7IA 4HN9A 2W0GA 2W63A 3B57A 1MNDA 5AQHB 5LGTB 4DUZT 2UXBT 3RKOA 2NW8A 2X0HA 2XM2A 2LOPA 2V7LA 5FVLA 5L3CB 3H3AA 3PTRB 2JRKA 1BR1A 2WSSV 3RH3A 3SOLA 3U3IA 3EDUA 4OYKA 5CGMA 5JRCA 2CE7A 2ZM8A 4TWDA 2ES0A 1UUSA 2LKGA 2WMNA 3CQCB 4WNKA 1HNWT 4G2AA 4LMKA 2Q9QB 3AA6B 4HFDA 4PFOA 4U74A 3AEFA 4YTMA 5L3BB 4YJ3E 4GKJT 2QA7A 2MOZA 3ZC0A 2YN6A 3ONLC 3OJAA 3RIUA 1VOMA 5LG3A 1HNXT 2VL0A 1SHZC 3VKGA 4PJNA 4YJ2E 3PUZF 1OEDB 2N2NA 2WZHA 3P7IA 4EOZB 1ZP0A 4EAHA 4CXWA 3MA9A 4O4IE 3AVRA 5KMGP 2C5KT 2H3RA 4UV8B 3EAMA 2BVMA 2XSAA 2BS4A 2CBJA 1VCTA 5FXVA 3RYFE 4PK4A 3AE6A 3P4PA 2XQ3A 4O2BE 1WYCA 2K5BB 3IHRA 2N9DA 2IAKA 5JREA 3ESLA 2XPKA 4IDOA 4IDPA 3AEAA 2LRLA 5HXCA 2JQHA 3V5UA 5LGUB 2VKJA 4JEUB 1S94A 3TLWA 1EZ3A 2V8SV 3LFMA 4IE7A 2CBIA 4JUYA 4UELA 4ZXLA 4GKKT 2LSJA 4P09A 4BA9A 3SS1A 2V1DB 4I0UA 3CMLA 5LGNB 3CX7B 2ZMAA 5LOVE 1S35A 2L9QA 2WU5A 4PFPA 3LBXB 3RYHE 5JR9C 5KXJA 3J7Yq 4DV3T 4DR3T 4HWHA 4LFAT 4C91A 2YINA 3HKCE 4TNVA 3UUBA 1MNEA 2LEHA 5FMNA 1IJ5A 2WY2A 3P4QA 4I4TE 2R6GF 2D0TA 3KINB 2FJEA 3ZCJA 3FZMB 4ISSA 4AQGA 2UXXB 5AQPB 2JQKA 5H6QB 2QYWA 2E9XC 2UXCT 4LF7T 1I6ZA 4TNWA 1T98A 1W0AA 2ACXA 4CI1B 2H7VC 2X67A
chains in the Genus database with same CATH topology
3HKEE 4EB6E 2X9YA 4E7SA 2LE8A 1Z0PA 2VB6A 5DQWA 3N9OA 2RP4A 4PK5A 4AKHA 2MTQA 4L9IA 2LOSA 3ZMUB 3KVAA 1WLXA 3IF8B 4ZS3A 4BJNA 3C98B 1KK7A 2V7MA 1HG2A 3KV6A 4Z8XA 1YW0A 4IDZA 3NZQA 3Q9DA 2BDEA 2RA1A 4ANJA 3O4XE 4PK6A 2Q9QC 4BA9A 4AKIA 2NOXA 3KV4A 1US7B 2KT9A 2XQYA 3GWHA 1D0XA 4QX7B 4CXXA 4AQFA 3AAIA 1D1AA 2X9HA 5KDMC 2CM0A 4H9RC 5JR9B 2JJ9A 1ZEEA 1G8XA 3Q5XA 2W00A 1FIOA 4HEAA 1H7CA 5JDQA 2Z6EA 2CWOA 4HKAA 4PJMA 3WAKA 3IEEA 3K8PC 1LKXA 2CLYB 3CVRA 5IYZE 2HPJA 4K0UA 4DVDA 3OKQA 2BZBA 5L3EB 4UVBB 2E9XB 3RRCA 4ERRA 2LHRA 3QUJA 2WM9A 3LK42 3VU7H 4ADZA 3OYXA 1CUNA 3KFWX 5JQGE 5LP6E 3ZMTB 5F8PA 1WRDA 1IZNB 3ETVA 2HH7A 3W15B 5ETWA 2JPFA 2NTYA 1V9DA 5IHYA 4PAGA 5J1GA 3NZPA 4EZ4A 3GA8A 2XHEB 2XAFB 4ZI3D 2VK9A 3R84B 5L3GB 3CPZA 2WMOA 2M67A 2LHNA 3RC8A 3LG7A 1D0YA 3I9WA 4V1Av 4X20E 2LM9A 5EK3A 3Q2MA 3BQKA 4H63H 4EXTA 3PUAA 4H9QC 2ODUA 3C50A 2HPLA 3OYZA 4XAXB 2IC6A 2PJQA 4JEHB 2JMKA 3K3OA 4NUUA 2VKDA 3E22E 2CLYC 5CA1E 3CWZB 3ZEFB 5A1LA 3HA4A 3LK3B 5FY1A 4OHFA 1U4QA 2LSIA 5ADXL 3DTOA 2W61A 4O4JE 3CX8B 2D5UA 2X66A 2YU2A 3EUHA 4YLHA 3TKLB 2E9XD 2QGSA 3J9X1 4P0BA 1FMWA 1OWAA 2XTLA 3K3QC 4HE8A 3C4WA 3KBUA 3BQIA 2Q9QD 2LSGA 2A72A 2LSKA 3Q5WA 5JDHA 4BJMA 2V26A 4AI6A 2D2SA 3LJCA 4KP3C 5LYJE 1QSDA 2LJLA 3MACA 3O1JA 3AA1B 3I9YA 4IE5A 2W62A 5HXRA 3CKDA 3ZPOA 3UUMA 2EHOA 2NTXA 5FNVE 2VWAA 1ZV4X 2DWKA 4X1YE 5CB4E 5L3FB 3ANWA 1MIWA 3I0QA 1UX4A 1OXZA 1ZKEA 2DWGA 2V7KA 4F6RC 4WW0A 3ZMSB 4A56A 4X1KE 1IAPA 3F57A 1HFAA 3IBPA 1D1CA 2KWHA 3KV9A 3ZYKA 4IHJE 5J2UE 3O1HA 4X1IE 3I1AA 3SWHA 2C5JA 1D1BA 1YKHB 2XAGB 4CI3B 2IC9A 5DQVA 1Y64B 2A3DA 2CA5A 4QHOA 2XASB 4UIGA 5DJQC 4ZI3C 3MK7C 3ZMZB 4PJJA 5H6RB 3PUGA 1NWMX 2Y48B 5LCYA 2CMRA 4KMCA 3HKBE 2DI4A 4WBNE 4ZI2D 3PUSA 4DBQA 1E1HB 1MMDA 3AA7B 4L5GA 3PU3A 5JRCB 2DLRA 1YKEB 5FP3A 1AJ3A 3NBXX 2NW7A 2A2FX 4ISTA 4O2AE 4CZZB 1WYBA 3N2GE 4IIJE 3WAJA 4CXYA 5L2LA 2VKOA 1NAFA 5LBMA 3C4XA 3FXDB 3PURA 2D0UA 2NP9A 3AAAB 5FXWA 4O4LE 4H9NC 2EHOB 2JMHA 1HS7A 2GK9A 3RYCE 5JDFA 2Y6XA 3AAEB 3VHLA 5E0OA 2XAJB 3AVSA 1MMGA 1UCUA 1HG5A 3CQGB 3RC3A 3GN5B 3FB2A 2PFVA 3KVBA 3ONXA 4JLEA 4B6XA 5JR9A 5M4YA 1G73A 3VKHA 1LRZA 2JQQA 5EK4A 4EYUA 3ETUA 1SA0E 2C0SA 2CXLA 4DBRA 4EYYR 1BR0A 4KBMB 3EDVA 3ZYLA 5J2TE 3ZC1A 2V7IA 2X51A 2E9XA 4OFZA 3ZCIA 3RYIE 4IE4A 1IJ6A 3UUNA 3S4UA 5L3DB 5BMVE 5HXEA 2CEAA 2H7OA 3GN5A 3LBXA 3PDYA 4IE6A 3WI3A 2VASA 5HYAA 4YFSA 4HTEA 4PNIA 3N5LA 3FBLA 5HWYA 2KWIB 3PU8A 4QX8B 5LG4A 5FXZA 1MMAA 3JC6C 3FBZA 2K48A 4DMWA 3E0ZA 5DABA 3ZYMA 3BK9A 2DHRA 3CQXC 4QXBB 1MIYA 4PW8A 4TV9E 4GYSA 3UTKA 4P0AA 4UXNB 5JDGA 3N2KE 2KNDA 4ZOLE 2E8IA 5JH7E 2X0LB 4GK0E 3FHNA 4MFRA 3EVYA 3R6NA 5KX5E 4AQFC 2Y8DA 2KXPB 4H63V 4O8SA 1YD8G 2G0UA 3RPUA 2CWYA 3MZKB 2N1GA 3LK2B 5GONE 4I55E 3MXZA 4G63A 1HX8A 4L0RA 5TAOA 3KV5A 4DNDA 2EHOC 4QWNB 4YHJA 2YU1A 3FXEB 4CQIA 1U5PA 2ODVA 4H9SE 1QUUA 3B13A 5EK2A 1VRBA 2CXDA 2WWUA 2V7JA 3N9QA 4AKLA 5HWXA 4XBFB 2BVLA 4H9OC 5LJMA 2J1DG 3UULA 1MMNA 3PUQA 4UVCB 3ANWB 3K3NA 3N9PA 3I0OA 3C64A 1ZHCA 2L8KA 5HXHA 2LSYA 3DJBA 1FMVA 3U78A 3AA0B 5LHHB 4ZI2C 2ZM2A 2IW5B 2Q9QA 4I50E 2XUEA 5FY7A 4OK0A 4WBOA 2YEVC 4M1PA 4GOUA 3HKDE 3ZMVB 3E08A 3DP7A 5LBQB 3UUXB 3F2EA 4MBQA 2K9AA 4ASKA 1HF8A 2CXFA 2L3LA 3RX6A 4MLKA 2C5IT 2XAQB 3N2OA 1LVKA 4UF0A 5LHIB 5EZYE 4N78D 5FYMA 4AKGA 3AB3B 3C51A 3O1IA 2NW9A 1BR2A 4IE0A 5CA0E 2MBGA 4NUVA 2DCFA 3UT5E 3O9XA 2VL8A 3MJXA 2VKHA 4ZI7E 4TN7B 4C90A 2B1EA 3HR0A 5HAXA 4AXPA 1LVFA 5F3JA 4KUMB 3D0TA 4QXCB 3T8OA 1MIVA 4GK5E 1BR4A 3ZN1B 4EIWA 3CX6B 5JDNA 4DMVA 3KBTA 3N9MA 4H9PC 3KDSE 3M65A 4TV8E 1B7TA 2X68A 4UEMA 4AKRB 5C8YE 4HGAA 3ZN0B 4DO0A 4O4HE 3GMIA 4BAYB 2ZM0A 3OBVE 5FXXA 2SPCA 2KMFA 5JVDE 2UXNB 4I43B 2DNXA 2WAUA 4XZCA 5AFUL 3PE0A 3C4ZA 4MHCA 5JDLA 4J2CA 3HI2A 3QK6A 5FY0A 2MYSA 2EHOD 2KZ7B 2CCQA 4UF0B 4TZ4C 5LA6E 2PG8A 3V5SA 5LJNA 3NRXA 3UFEA 1X79A 4TX5A 3BQLA 3HL6A 2KLQA 4QXHB 5LXTE 2ZLYA 3F31A 3P8CD 1KNZA 4CI2B 2X9WA 4ZHQE 3A5XA 2OA5A 2P9BA 3ZLIA 2LT3A 2XAHB 3L09A 4FI5A 3RRWA 4PJLA 1WR6A 4OYJA 2WBLA 3N9NA 2PBIA 4E7ZA 1UX5A 3ZJ1A 3MKDA 3L3PA 3H37A 3SRZA 4HFVA 1HCIA 2KINB 4UV9B 1D0ZA 2I59A 4MALA 2NWBA 3NRYA 2X9XA 2K24A 2YK0A 4GIWA 4U72A 3JC6D 5HXSA 5LNKA 4TUYE 1FEWA 4QKNA 4UVAB 1O3XA 1HTJF 3QC9A 4GYRA 3ZJ2A 4IGUA 5JDMA 4ILUA 4EZHA 3N9LA 4ZS2A 4FJOA 4HN9A 2W0GA 2W63A 3B57A 1MNDA 5LGTB 3RKOA 2NW8A 2LOPA 2V7LA 5L3CB 3H3AA 3PTRB 2JRKA 1BR1A 2WSSV 3RH3A 3SOLA 3U3IA 3EDUA 4OYKA 5JRCA 2CE7A 2ZM8A 2ES0A 2WMNA 3CQCB 4WNKA 4G2AA 2Q9QB 3AA6B 4PFOA 4U74A 5L3BB 4YJ3E 2QA7A 2MOZA 3ZC0A 3OJAA 1VOMA 1SHZC 3VKGA 4PJNA 4YJ2E 2N2NA 3P7IA 4EOZB 4EAHA 4CXWA 3MA9A 4O4IE 3AVRA 5KMGP 2C5KT 2H3RA 4UV8B 2BVMA 5FXVA 3RYFE 4PK4A 4O2BE 1WYCA 2K5BB 3IHRA 2N9DA 2IAKA 5JREA 3ESLA 5LHGB 5HXCA 3V5UA 5LGUB 2VKJA 4JEUB 1S94A 1EZ3A 3LFMA 4IE7A 4JUYA 4UELA 2LSJA 4P09A 3SS1A 2V1DB 3CMLA 5LGNB 3CX7B 2ZMAA 5LOVE 1S35A 2L9QA 4PFPA 3RYHE 3LBXB 5JR9C 3J7Yq 4C91A 2YINA 3HKCE 1MNEA 2LEHA 5FMNA 1IJ5A 4I4TE 2D0TA 3KINB 3ZCJA 4ISSA 4AQGA 2UXXB 5H6QB 2E9XC 1T98A 2ACXA 4CI1B 2H7VC 2X67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXF A;  2DWG A;  2CXL A;  4GIW A;  2DWK A;  3CWZ B; 
#chains in the Genus database with same CATH topology
 4LF4 T;  2OV9 A;  5JTG A;  5HEO A;  3CK6 A;  3HKE E;  4EB6 E;  4DR6 T;  2X9Y A;  4E7S A;  1IBM T;  2VQF T;  4B3M T;  4HWC A;  2LE8 A;  1Z0P A;  2VB6 A;  5DQW A;  4JYA T;  4WYV A;  2BKP A;  3CIR A;  3N9O A;  4AKI A;  5C2T A;  3T1H T;  1XNQ T;  2RP4 A;  1KNP A;  1X9B A;  2FUP A;  4PK5 A;  4YY3 T;  4AKH A;  2XQ4 A;  2MTQ A;  1E7P A;  2J47 A;  4L9I A;  2LOS A;  4P1N A;  1T7S A;  3ZMU B;  3KVA A;  1WLX A;  3IF8 B;  4ZS3 A;  4BJN A;  2WDQ A;  3C98 B;  1KK7 A;  2V7M A;  1HG2 A;  3KV6 A;  4Z8X A;  1YW0 A;  4IDZ A;  2AE9 A;  3NZQ A;  2BDE A;  3Q9D A;  2RA1 A;  1KEY A;  4ANJ A;  3ZST A;  4JI2 T;  3O4X E;  4PK6 A;  2Q9Q C;  1W09 A;  3IA3 A;  2NOX A;  3JAE A;  3KV4 A;  1US7 B;  5LB7 B;  2KT9 A;  2XQY A;  3GWH A;  1D0X A;  4QX7 B;  3RGL A;  4AQF A;  4CXX A;  3AAI A;  5ABG A;  3H3M A;  1D1A A;  2X9H A;  5KDM C;  2CM0 A;  2XQ7 A;  4H9R C;  5JR9 B;  2BS2 A;  2I6H A;  2JJ9 A;  1NEK A;  1G8X A;  1ZEE A;  2W67 A;  3UU6 A;  3Q5X A;  2W00 A;  1FIO A;  4HEA A;  1H7C A;  3AEE A;  5JDQ A;  1UK5 A;  2CWO A;  2Z6E A;  2CRB A;  4HKA A;  4PJM A;  3IEE A;  3K8P C;  3WAK A;  1LKX A;  3P4W A;  2CLY B;  3CVR A;  5IYZ E;  2HPJ A;  4K0U A;  4DVD A;  3OKQ A;  2BZB A;  5L3E B;  2AXD S;  4UVB B;  2E9X B;  3RRC A;  4ERR A;  2BG9 C;  2LHR A;  3QUJ A;  2WM9 A;  1SE7 A;  3LK4 2;  3ABV A;  3RQW A;  3VU7 H;  4A98 A;  3OYX A;  1CUN A;  3KFW X;  4ADZ A;  5JQG E;  3ZMT B;  3AE2 A;  2LLY A;  5F8P A;  5L4H A;  1WRD A;  5LP6 E;  1IBL T;  1IZN B;  3ETV A;  2HH7 A;  3W15 B;  5ETW A;  2JPF A;  3QOF A;  4YHH T;  2NTY A;  1V9D A;  5F5W A;  3AE9 A;  5IHY A;  5FL1 A;  4PAG A;  5J1G A;  3NZP A;  4QH1 A;  4EZ4 A;  3GA8 A;  4ILC A;  2XHE B;  2XAF B;  4YSY A;  4ZI3 D;  4LML A;  4DID B;  4HWD A;  2VK9 A;  3R84 B;  1OED C;  3CPZ A;  5L3G B;  2XQ8 A;  3AEC A;  3VR9 A;  2OLT A;  4DV7 T;  2KSR A;  2WMO A;  2M67 A;  2LHN A;  3RC8 A;  5AQF B;  3LG7 A;  1D0Y A;  5AQN B;  3I9W A;  4V1A v;  4UR9 A;  5BR8 T;  4HFH A;  4X20 E;  2LM9 A;  5EK3 A;  3Q2M A;  1KF6 A;  1OED E;  3BQK A;  4H63 H;  5AQQ B;  4EXT A;  5CFB A;  4LFB T;  2WDR A;  3PUA A;  2D9D A;  3Q5E A;  4H9Q C;  2FJD A;  2ODU A;  3C50 A;  2HPL A;  3ZSS A;  3OYZ A;  4XAX B;  2BG9 E;  3ONJ A;  3G06 A;  2IC6 A;  2PJQ A;  4JEH B;  4ZEY A;  2JMK A;  3K3O A;  4NUU A;  2VKD A;  1WCR A;  3E22 E;  5AQR B;  2E5L T;  2CLY C;  5AQT B;  2VVN A;  3CWZ B;  3ZEF B;  5CA1 E;  4LF9 T;  5A1L A;  3HA4 A;  3LK3 B;  5FY1 A;  3LDQ B;  1U4Q A;  4OHF A;  5L47 A;  4DR7 T;  2LSI A;  2V6Y A;  3AED A;  4ZZB A;  5ADX L;  2IIU A;  3DTO A;  2W61 A;  2JQ9 A;  3CX8 B;  4O4J E;  1HNZ T;  2D5U A;  3AXJ B;  2X66 A;  2XJ7 A;  2YU2 A;  3EUH A;  4YLH A;  3TKL B;  2E9X D;  2QGS A;  1XNR T;  3J9X 1;  4P0B A;  1FMW A;  1OWA A;  3M3Z B;  2E5V A;  2XTL A;  3K3Q C;  5ABH A;  4HE8 A;  3C4W A;  1JNR A;  2M6B A;  3BQI A;  2Q9Q D;  2LSG A;  2A72 A;  2LSK A;  3KBU A;  3Q5W A;  1L0V A;  2V26 A;  4BJM A;  2D2S A;  5JDH A;  4AI6 A;  3LJC A;  1YQ3 A;  4KP3 C;  1YXR A;  2PTF A;  5LYJ E;  3RIA A;  1QSD A;  2LJL A;  3MAC A;  3O1J A;  4KX6 A;  3AA1 B;  3I9Y A;  2BG9 B;  4IE5 A;  4X62 T;  2W62 A;  3T1Y T;  3RIU C;  3AXJ A;  2YKS A;  4IL4 A;  5HXR A;  3CKD A;  5AQI B;  3UUM A;  3VRB A;  3EI0 A;  3ZPO A;  2EHO A;  2NTX A;  5LHG B;  1KNR A;  2LM2 A;  2VQE T;  3PUV F;  1W0B A;  5FNV E;  2VWA A;  1ZV4 X;  2DWK A;  4ILB A;  4X1Y E;  5CB4 E;  4YXD A;  5L3F B;  3ANW A;  3SFE A;  1MIW A;  2HN1 A;  2BBJ A;  3I0Q A;  1UX4 A;  1OXZ A;  1ZKE A;  2DWG A;  2V7K A;  5FKY A;  4F6R C;  2XQ6 A;  4WW0 A;  3ZMS B;  4A56 A;  4Z90 A;  4X1K E;  1IAP A;  2FJB A;  3RF1 A;  3F57 A;  1HFA A;  2XM1 A;  3IBP A;  1D1C A;  3X1D A;  1HX1 B;  2KWH A;  3KV9 A;  3UQ4 A;  3ZYK A;  4IHJ E;  3AE8 A;  5J2U E;  3L8R A;  4CN4 A;  1HR0 T;  5HEH A;  4LF6 T;  3O1H A;  1QLB A;  4X1I E;  3I1A A;  3SWH A;  2C5J A;  1D1B A;  1YKH B;  2XAG B;  4LF8 T;  4CI3 B;  2IC9 A;  5DQV A;  1Y64 B;  2A3D A;  2CA5 A;  3AE7 A;  2XAS B;  4QHO A;  4UIG A;  3AE3 A;  3MK7 C;  5DJQ C;  4ZI3 C;  3UU8 A;  3UU3 A;  1FJG T;  2I0M A;  4KI0 F;  4PJJ A;  5H6R B;  1XMQ T;  3PUG A;  5AQJ B;  1NWM X;  2Y48 B;  5LCY A;  2UUA T;  2YDS A;  2CMR A;  4KMC A;  3HKB E;  4QH5 A;  4U2Z A;  2DI4 A;  2FJA A;  2H89 A;  4WBN E;  4U33 A;  2HHH T;  1DU2 A;  4ZI2 D;  3EHZ A;  2VVS A;  1WFD A;  3PUS A;  4DBQ A;  1E1H B;  2F4V T;  1MMD A;  3AA7 B;  5HCJ A;  4L5G A;  3PU3 A;  4YTN A;  2DLR A;  1YKE B;  3NWI A;  3OPC A;  5FP3 A;  5ABF A;  5JRC B;  3NBX X;  2NW7 A;  1AJ3 A;  2A2F X;  2VUR A;  4IST A;  4O2A E;  3NVO A;  1WYB A;  3N2G E;  4IIJ E;  4CZZ B;  3WAJ A;  5CJ5 A;  4CXY A;  5L2L A;  2VKO A;  1NAF A;  3PUY F;  3C4X A;  3FXD B;  3PUR A;  5LBM A;  3TLU A;  2D0U A;  2NP9 A;  2ACZ A;  3AAA B;  3ZT6 A;  1N34 T;  5FXW A;  5HEG A;  5AQK B;  3ZKR A;  4O4L E;  4H9N C;  2EHO B;  2JMH A;  3RI5 A;  2XY8 B;  2XZE A;  1HS7 A;  3UQ7 A;  2GK9 A;  1E2A A;  2YOE A;  1JNZ A;  3RYC E;  5JDF A;  3P4R A;  4YSX A;  2BBH A;  2Y6X A;  3AAE B;  4DV0 T;  2YDQ A;  3VHL A;  5E0O A;  2XAJ B;  3AVS A;  1MMG A;  4TWH A;  2W2U A;  1WR0 A;  1UCU A;  1N36 T;  4X5T A;  1HG5 A;  3CQG B;  1Y01 A;  3GN5 B;  3FB2 A;  2PFV A;  2WQY A;  3KVB A;  3ONX A;  4JLE A;  5JR9 A;  3RC3 A;  4B6X A;  5M4Y A;  1G73 A;  3VKH A;  2J62 A;  1LRZ A;  2JQQ A;  5EK4 A;  4EYU A;  3ETU A;  4CN1 A;  1SA0 E;  2C0S A;  1ZOY A;  2CXL A;  3P50 A;  3TLT A;  4DBR A;  4EYY R;  1BR0 A;  4KBM B;  3EDV A;  3RKG A;  3ZYL A;  5J2T E;  2A9U A;  1M62 A;  3UFG A;  4JI3 T;  3ZC1 A;  2V7I A;  2X51 A;  2E9X A;  4OFZ A;  2LKH A;  3RYI E;  4IE4 A;  1IJ6 A;  3UUN A;  3ZCI A;  2IUB A;  3S4U A;  5L3D B;  3QNU A;  5BMV E;  2WCA A;  3K1S A;  5HXE A;  2CEA A;  2H7O A;  3GN5 A;  4U31 A;  3LBX A;  2V5D A;  4KHP T;  3PDY A;  4IE6 A;  3WI3 A;  2VAS A;  5HYA A;  4YFS A;  2IHR 1;  4HTE A;  4LMJ A;  4PNI A;  5FL0 A;  4LF5 T;  3N5L A;  3FBL A;  1XDO A;  5HEU A;  5HWY A;  5ABF B;  2KWI B;  3PU8 A;  4QX8 B;  5LG4 A;  5FXZ A;  1MMA A;  2WWV A;  2M6I A;  3JC6 C;  3FBZ A;  2K48 A;  4DMW A;  3AE4 A;  3E0Z A;  4QH4 A;  5DAB A;  2WP9 A;  3ZMZ B;  3ZYM A;  2V5C A;  3JAD A;  4DR1 T;  3BK9 A;  2DHR A;  4DUY T;  2LRK A;  3CQX C;  4QXB B;  4JI7 T;  1MIY A;  1YQ4 A;  4PW8 A;  4HFE A;  4TV9 E;  4GYS A;  3UTK A;  4P0A A;  4UXN B;  5JDG A;  3N2K E;  2KND A;  5L4E A;  4B3S T;  4JI4 T;  3FZL B;  4YTP A;  4ZOL E;  2E8I A;  2WU2 A;  5JH7 E;  4A97 A;  2HN2 A;  4HWF A;  2X0L B;  3A7M A;  1OED A;  4CN6 A;  4GK0 E;  4EV6 A;  3FHN A;  2WB5 A;  4MFR A;  3EVY A;  3R6N A;  5KX5 E;  4AQF C;  2Y8D A;  2W4X A;  4Q25 A;  2KXP B;  4H63 V;  4U3C A;  3FZF B;  4O8S A;  4AQY T;  4JV5 T;  1YD8 G;  2WZI A;  2G0U A;  2BG9 A;  3RPU A;  2CWY A;  3MZK B;  4HFI A;  1I94 T;  2N1G A;  2CHN A;  2MAW A;  3LK2 B;  5GON E;  4B3T T;  4I55 E;  3MXZ A;  2MPK A;  2CHO A;  3LSV A;  4G63 A;  2BKN A;  3FZH B;  1HX8 A;  4L0R A;  1T8B A;  3KV5 A;  5TAO A;  3AE1 A;  1NEN A;  4DND A;  3PUX F;  2EHO C;  2RPA A;  2XQ9 A;  3NKZ A;  3JAF A;  1Z8U A;  4QWN B;  4YHJ A;  5LMN T;  2YU1 A;  3FXE B;  4CQI A;  1U5P A;  2ODV A;  3B5M A;  4H9S E;  2UU9 T;  1QUU A;  5IWA T;  1R8I A;  3B13 A;  4DR4 T;  3UU5 A;  2JIW A;  5EK2 A;  1VRB A;  2CXD A;  2WWU A;  2V7J A;  3N9Q A;  4AKL A;  5HCM A;  5AQU B;  5HWX A;  4XBF B;  2BVL A;  4K0K T;  4H9O C;  5LJM A;  2J1D G;  2IDO B;  4HFC A;  3UUL A;  2W66 A;  1MMN A;  2FBW A;  3PUQ A;  4IDN A;  5LMU T;  4IL9 A;  3ANW B;  4UVC B;  5J0Z A;  3K3N A;  4AIU A;  4NIQ A;  3N9P A;  3VR8 A;  3I0O A;  3C64 A;  1ZHC A;  2L8K A;  5HXH A;  2LSY A;  3DJB A;  1FMV A;  3U78 A;  3AA0 B;  5LHH B;  4ZI2 C;  2ZM2 A;  2IW5 B;  2Q9Q A;  4I50 E;  2XUE A;  5FY7 A;  4OK0 A;  4WBO A;  2UUC T;  2YEV C;  4IT4 A;  4M1P A;  5FVK A;  4GOU A;  4EGW A;  3HKD E;  3ZMV B;  3E08 A;  2UUB T;  3DP7 A;  5LBQ B;  3UUX B;  3RQU A;  5AQL B;  3F2E A;  4MBQ A;  2K9A A;  2BKO A;  4ASK A;  4DR5 T;  1HF8 A;  2CXF A;  2L3L A;  3RX6 A;  4MLK A;  5HEJ A;  2C5I T;  2XAQ B;  4JI6 T;  3N2O A;  1LVK A;  4UF0 A;  5LHI B;  3AEG A;  4N78 D;  5EZY E;  5FYM A;  4AKG A;  3AB3 B;  3C51 A;  3O1I A;  2NW9 A;  3RIF A;  4LFC T;  1BR2 A;  4IE0 A;  5CA0 E;  2MBG A;  2BS3 A;  2WDV A;  2UXD T;  4HWI B;  4NUV A;  2DCF A;  4TWF A;  3UT5 E;  2H88 A;  2V6X A;  2VL8 A;  3O9X A;  3MJX A;  2VKH A;  1M7K A;  4ZI7 E;  4TN7 B;  4C90 A;  3OTO T;  2B1E A;  4DV1 T;  2XQ5 A;  3HR0 A;  3P4S A;  5HAX A;  4DV4 T;  1N32 T;  3EAB A;  4KHZ F;  4AXP A;  4JBW F;  1LVF A;  5F3J A;  4KUM B;  4JI0 T;  4U7Y A;  3D0T A;  3PJA J;  2IML A;  3RLF F;  4QXC B;  5AQV B;  3T8O A;  1MIV A;  4GK5 E;  1BR4 A;  3ZN1 B;  4EIW A;  1XZY A;  3CX6 B;  5JDN A;  5AQS B;  3L39 A;  4DMV A;  3KBT A;  1SUM B;  3N9M A;  4H9P C;  3KDS E;  1CHU A;  3M65 A;  1XDP A;  4X64 T;  4TV8 E;  1B7T A;  2J4G A;  2X68 A;  4UEM A;  4AIS A;  4AKR B;  5C8Y E;  5IUX A;  2YDR A;  4IRE A;  2XQA A;  4HGA A;  3ZN0 B;  1UUR A;  4DO0 A;  4O4H E;  2ZM6 T;  3VRA A;  3GMI A;  2QRX A;  4BAY B;  3AEB A;  2ZM0 A;  1W9R A;  3OBV E;  5FXX A;  2SPC A;  4NPP A;  2KMF A;  1UGO A;  2B76 A;  2WS3 A;  5JVD E;  4EED A;  4X65 T;  2UXN B;  1J1J A;  4I43 B;  3TLS A;  2DNX A;  2WAU A;  4F8H A;  4XZC A;  3AE5 A;  5AFU L;  3PE0 A;  3C4Z A;  4MHC A;  4YT0 A;  4HFB A;  4J2C A;  2K3W A;  5JDL A;  3HI2 A;  3QB5 A;  3QK6 A;  4ZZC A;  5FY0 A;  2MYS A;  2EHO D;  2DL1 A;  2CCQ A;  2KZ7 B;  2NR4 A;  3A8Y C;  1J5E T;  4UF0 B;  4TZ4 C;  5LA6 E;  2PG8 A;  3V5S A;  5LJN A;  4DV6 T;  1IBK T;  5AQG B;  3QB5 K;  3RHW A;  3NRX A;  4Z91 A;  3UFE A;  1X79 A;  2X0Y A;  3PUW F;  4TX5 A;  3BQL A;  4U2Y A;  3HL6 A;  3ZT7 A;  4DR2 T;  2KLQ A;  4COF A;  4JI1 T;  4QXH B;  4NXM T;  5AQO B;  5LXT E;  2ZLY A;  3F31 A;  4ILA A;  2E2A A;  3P8C D;  1J5W A;  1KNZ A;  4CI2 B;  2X9W A;  4ZHQ E;  1T72 A;  3A5X A;  1XWM A;  2OA5 A;  3OVU A;  2P9B A;  3ZLI A;  3ZT5 A;  2LT3 A;  2XAH B;  3L09 A;  3Q5D A;  4FI5 A;  4PJL A;  3RRW A;  1WR6 A;  4OYJ A;  2WBL A;  3N9N A;  1VCS A;  2PBI A;  4YSZ A;  4NXN T;  4E7Z A;  1UX5 A;  3ZJ1 A;  3MKD A;  3L3P A;  3H37 A;  3SRZ A;  2QVA A;  4HFV A;  1HCI A;  2KIN B;  4IDQ A;  4UV9 B;  3SFD A;  1D0Z A;  2I59 A;  2XSB A;  4MAL A;  2NWB A;  1XMO T;  3NRY A;  2X9X A;  3PV0 F;  4B3R T;  2K24 A;  2YK0 A;  4GIW A;  4U72 A;  5ABE A;  3JC6 D;  4JI5 T;  3TLV A;  5HXS A;  4TUY E;  5LNK A;  4OX9 T;  1FEW A;  4QKN A;  4UVA B;  2V6Y B;  2CPT A;  3PJA A;  4DV5 T;  1KFY A;  1O3X A;  1HTJ F;  1GQE A;  3QC9 A;  4WZX A;  5AQM B;  4A5X A;  5C3J A;  4GYR A;  4JI8 T;  4X66 T;  3ZJ2 A;  4EEB A;  4IGU A;  5JDM A;  4ILU A;  4EZH A;  3JCF A;  1N33 T;  3N9L A;  3FZK B;  4FJO A;  4ZS2 A;  4DV2 T;  3UU4 A;  4U7I A;  4HN9 A;  2W0G A;  2W63 A;  3B57 A;  1MND A;  5AQH B;  5LGT B;  4DUZ T;  2UXB T;  3RKO A;  2NW8 A;  2X0H A;  2XM2 A;  2LOP A;  2V7L A;  5FVL A;  5L3C B;  3H3A A;  3PTR B;  2JRK A;  1BR1 A;  2WSS V;  3RH3 A;  3SOL A;  3U3I A;  3EDU A;  4OYK A;  5CGM A;  5JRC A;  2CE7 A;  2ZM8 A;  4TWD A;  2ES0 A;  1UUS A;  2LKG A;  2WMN A;  3CQC B;  4WNK A;  1HNW T;  4G2A A;  4LMK A;  2Q9Q B;  3AA6 B;  4HFD A;  4PFO A;  4U74 A;  3AEF A;  4YTM A;  5L3B B;  4YJ3 E;  4GKJ T;  2QA7 A;  2MOZ A;  3ZC0 A;  2YN6 A;  3ONL C;  3OJA A;  3RIU A;  1VOM A;  5LG3 A;  1HNX T;  2VL0 A;  1SHZ C;  3VKG A;  4PJN A;  4YJ2 E;  3PUZ F;  1OED B;  2N2N A;  2WZH A;  3P7I A;  4EOZ B;  1ZP0 A;  4EAH A;  4CXW A;  3MA9 A;  4O4I E;  3AVR A;  5KMG P;  2C5K T;  2H3R A;  4UV8 B;  3EAM A;  2BVM A;  2XSA A;  2BS4 A;  2CBJ A;  1VCT A;  5FXV A;  3RYF E;  4PK4 A;  3AE6 A;  3P4P A;  2XQ3 A;  4O2B E;  1WYC A;  2K5B B;  3IHR A;  2N9D A;  2IAK A;  5JRE A;  3ESL A;  2XPK A;  4IDO A;  4IDP A;  3AEA A;  2LRL A;  5HXC A;  2JQH A;  3V5U A;  5LGU B;  2VKJ A;  4JEU B;  1S94 A;  3TLW A;  1EZ3 A;  2V8S V;  3LFM A;  4IE7 A;  2CBI A;  4JUY A;  4UEL A;  4ZXL A;  4GKK T;  2LSJ A;  4P09 A;  4BA9 A;  3SS1 A;  2V1D B;  4I0U A;  3CML A;  5LGN B;  3CX7 B;  2ZMA A;  5LOV E;  1S35 A;  2L9Q A;  2WU5 A;  4PFP A;  3LBX B;  3RYH E;  5JR9 C;  5KXJ A;  3J7Y q;  4DV3 T;  4DR3 T;  4HWH A;  4LFA T;  4C91 A;  2YIN A;  3HKC E;  4TNV A;  3UUB A;  1MNE A;  2LEH A;  5FMN A;  1IJ5 A;  2WY2 A;  3P4Q A;  4I4T E;  2R6G F;  2D0T A;  3KIN B;  2FJE A;  3ZCJ A;  3FZM B;  4ISS A;  4AQG A;  2UXX B;  5AQP B;  2JQK A;  5H6Q B;  2QYW A;  2E9X C;  2UXC T;  4LF7 T;  1I6Z A;  4TNW A;  1T98 A;  1W0A A;  2ACX A;  4CI1 B;  2H7V C;  2X67 A; 
#chains in the Genus database with same CATH homology
 3HKE E;  4EB6 E;  2X9Y A;  4E7S A;  2LE8 A;  1Z0P A;  2VB6 A;  5DQW A;  3N9O A;  2RP4 A;  4PK5 A;  4AKH A;  2MTQ A;  4L9I A;  2LOS A;  3ZMU B;  3KVA A;  1WLX A;  3IF8 B;  4ZS3 A;  4BJN A;  3C98 B;  1KK7 A;  2V7M A;  1HG2 A;  3KV6 A;  4Z8X A;  1YW0 A;  4IDZ A;  3NZQ A;  3Q9D A;  2BDE A;  2RA1 A;  4ANJ A;  3O4X E;  4PK6 A;  2Q9Q C;  4BA9 A;  4AKI A;  2NOX A;  3KV4 A;  1US7 B;  2KT9 A;  2XQY A;  3GWH A;  1D0X A;  4QX7 B;  4CXX A;  4AQF A;  3AAI A;  1D1A A;  2X9H A;  5KDM C;  2CM0 A;  4H9R C;  5JR9 B;  2JJ9 A;  1ZEE A;  1G8X A;  3Q5X A;  2W00 A;  1FIO A;  4HEA A;  1H7C A;  5JDQ A;  2Z6E A;  2CWO A;  4HKA A;  4PJM A;  3WAK A;  3IEE A;  3K8P C;  1LKX A;  2CLY B;  3CVR A;  5IYZ E;  2HPJ A;  4K0U A;  4DVD A;  3OKQ A;  2BZB A;  5L3E B;  4UVB B;  2E9X B;  3RRC A;  4ERR A;  2LHR A;  3QUJ A;  2WM9 A;  3LK4 2;  3VU7 H;  4ADZ A;  3OYX A;  1CUN A;  3KFW X;  5JQG E;  5LP6 E;  3ZMT B;  5F8P A;  1WRD A;  1IZN B;  3ETV A;  2HH7 A;  3W15 B;  5ETW A;  2JPF A;  2NTY A;  1V9D A;  5IHY A;  4PAG A;  5J1G A;  3NZP A;  4EZ4 A;  3GA8 A;  2XHE B;  2XAF B;  4ZI3 D;  2VK9 A;  3R84 B;  5L3G B;  3CPZ A;  2WMO A;  2M67 A;  2LHN A;  3RC8 A;  3LG7 A;  1D0Y A;  3I9W A;  4V1A v;  4X20 E;  2LM9 A;  5EK3 A;  3Q2M A;  3BQK A;  4H63 H;  4EXT A;  3PUA A;  4H9Q C;  2ODU A;  3C50 A;  2HPL A;  3OYZ A;  4XAX B;  2IC6 A;  2PJQ A;  4JEH B;  2JMK A;  3K3O A;  4NUU A;  2VKD A;  3E22 E;  2CLY C;  5CA1 E;  3CWZ B;  3ZEF B;  5A1L A;  3HA4 A;  3LK3 B;  5FY1 A;  4OHF A;  1U4Q A;  2LSI A;  5ADX L;  3DTO A;  2W61 A;  4O4J E;  3CX8 B;  2D5U A;  2X66 A;  2YU2 A;  3EUH A;  4YLH A;  3TKL B;  2E9X D;  2QGS A;  3J9X 1;  4P0B A;  1FMW A;  1OWA A;  2XTL A;  3K3Q C;  4HE8 A;  3C4W A;  3KBU A;  3BQI A;  2Q9Q D;  2LSG A;  2A72 A;  2LSK A;  3Q5W A;  5JDH A;  4BJM A;  2V26 A;  4AI6 A;  2D2S A;  3LJC A;  4KP3 C;  5LYJ E;  1QSD A;  2LJL A;  3MAC A;  3O1J A;  3AA1 B;  3I9Y A;  4IE5 A;  2W62 A;  5HXR A;  3CKD A;  3ZPO A;  3UUM A;  2EHO A;  2NTX A;  5FNV E;  2VWA A;  1ZV4 X;  2DWK A;  4X1Y E;  5CB4 E;  5L3F B;  3ANW A;  1MIW A;  3I0Q A;  1UX4 A;  1OXZ A;  1ZKE A;  2DWG A;  2V7K A;  4F6R C;  4WW0 A;  3ZMS B;  4A56 A;  4X1K E;  1IAP A;  3F57 A;  1HFA A;  3IBP A;  1D1C A;  2KWH A;  3KV9 A;  3ZYK A;  4IHJ E;  5J2U E;  3O1H A;  4X1I E;  3I1A A;  3SWH A;  2C5J A;  1D1B A;  1YKH B;  2XAG B;  4CI3 B;  2IC9 A;  5DQV A;  1Y64 B;  2A3D A;  2CA5 A;  4QHO A;  2XAS B;  4UIG A;  5DJQ C;  4ZI3 C;  3MK7 C;  3ZMZ B;  4PJJ A;  5H6R B;  3PUG A;  1NWM X;  2Y48 B;  5LCY A;  2CMR A;  4KMC A;  3HKB E;  2DI4 A;  4WBN E;  4ZI2 D;  3PUS A;  4DBQ A;  1E1H B;  1MMD A;  3AA7 B;  4L5G A;  3PU3 A;  5JRC B;  2DLR A;  1YKE B;  5FP3 A;  1AJ3 A;  3NBX X;  2NW7 A;  2A2F X;  4IST A;  4O2A E;  4CZZ B;  1WYB A;  3N2G E;  4IIJ E;  3WAJ A;  4CXY A;  5L2L A;  2VKO A;  1NAF A;  5LBM A;  3C4X A;  3FXD B;  3PUR A;  2D0U A;  2NP9 A;  3AAA B;  5FXW A;  4O4L E;  4H9N C;  2EHO B;  2JMH A;  1HS7 A;  2GK9 A;  3RYC E;  5JDF A;  2Y6X A;  3AAE B;  3VHL A;  5E0O A;  2XAJ B;  3AVS A;  1MMG A;  1UCU A;  1HG5 A;  3CQG B;  3RC3 A;  3GN5 B;  3FB2 A;  2PFV A;  3KVB A;  3ONX A;  4JLE A;  4B6X A;  5JR9 A;  5M4Y A;  1G73 A;  3VKH A;  1LRZ A;  2JQQ A;  5EK4 A;  4EYU A;  3ETU A;  1SA0 E;  2C0S A;  2CXL A;  4DBR A;  4EYY R;  1BR0 A;  4KBM B;  3EDV A;  3ZYL A;  5J2T E;  3ZC1 A;  2V7I A;  2X51 A;  2E9X A;  4OFZ A;  3ZCI A;  3RYI E;  4IE4 A;  1IJ6 A;  3UUN A;  3S4U A;  5L3D B;  5BMV E;  5HXE A;  2CEA A;  2H7O A;  3GN5 A;  3LBX A;  3PDY A;  4IE6 A;  3WI3 A;  2VAS A;  5HYA A;  4YFS A;  4HTE A;  4PNI A;  3N5L A;  3FBL A;  5HWY A;  2KWI B;  3PU8 A;  4QX8 B;  5LG4 A;  5FXZ A;  1MMA A;  3JC6 C;  3FBZ A;  2K48 A;  4DMW A;  3E0Z A;  5DAB A;  3ZYM A;  3BK9 A;  2DHR A;  3CQX C;  4QXB B;  1MIY A;  4PW8 A;  4TV9 E;  4GYS A;  3UTK A;  4P0A A;  4UXN B;  5JDG A;  3N2K E;  2KND A;  4ZOL E;  2E8I A;  5JH7 E;  2X0L B;  4GK0 E;  3FHN A;  4MFR A;  3EVY A;  3R6N A;  5KX5 E;  4AQF C;  2Y8D A;  2KXP B;  4H63 V;  4O8S A;  1YD8 G;  2G0U A;  3RPU A;  2CWY A;  3MZK B;  2N1G A;  3LK2 B;  5GON E;  4I55 E;  3MXZ A;  4G63 A;  1HX8 A;  4L0R A;  5TAO A;  3KV5 A;  4DND A;  2EHO C;  4QWN B;  4YHJ A;  2YU1 A;  3FXE B;  4CQI A;  1U5P A;  2ODV A;  4H9S E;  1QUU A;  3B13 A;  5EK2 A;  1VRB A;  2CXD A;  2WWU A;  2V7J A;  3N9Q A;  4AKL A;  5HWX A;  4XBF B;  2BVL A;  4H9O C;  5LJM A;  2J1D G;  3UUL A;  1MMN A;  3PUQ A;  4UVC B;  3ANW B;  3K3N A;  3N9P A;  3I0O A;  3C64 A;  1ZHC A;  2L8K A;  5HXH A;  2LSY A;  3DJB A;  1FMV A;  3U78 A;  3AA0 B;  5LHH B;  4ZI2 C;  2ZM2 A;  2IW5 B;  2Q9Q A;  4I50 E;  2XUE A;  5FY7 A;  4OK0 A;  4WBO A;  2YEV C;  4M1P A;  4GOU A;  3HKD E;  3ZMV B;  3E08 A;  3DP7 A;  5LBQ B;  3UUX B;  3F2E A;  4MBQ A;  2K9A A;  4ASK A;  1HF8 A;  2CXF A;  2L3L A;  3RX6 A;  4MLK A;  2C5I T;  2XAQ B;  3N2O A;  1LVK A;  4UF0 A;  5LHI B;  5EZY E;  4N78 D;  5FYM A;  4AKG A;  3AB3 B;  3C51 A;  3O1I A;  2NW9 A;  1BR2 A;  4IE0 A;  5CA0 E;  2MBG A;  4NUV A;  2DCF A;  3UT5 E;  3O9X A;  2VL8 A;  3MJX A;  2VKH A;  4ZI7 E;  4TN7 B;  4C90 A;  2B1E A;  3HR0 A;  5HAX A;  4AXP A;  1LVF A;  5F3J A;  4KUM B;  3D0T A;  4QXC B;  3T8O A;  1MIV A;  4GK5 E;  1BR4 A;  3ZN1 B;  4EIW A;  3CX6 B;  5JDN A;  4DMV A;  3KBT A;  3N9M A;  4H9P C;  3KDS E;  3M65 A;  4TV8 E;  1B7T A;  2X68 A;  4UEM A;  4AKR B;  5C8Y E;  4HGA A;  3ZN0 B;  4DO0 A;  4O4H E;  3GMI A;  4BAY B;  2ZM0 A;  3OBV E;  5FXX A;  2SPC A;  2KMF A;  5JVD E;  2UXN B;  4I43 B;  2DNX A;  2WAU A;  4XZC A;  5AFU L;  3PE0 A;  3C4Z A;  4MHC A;  5JDL A;  4J2C A;  3HI2 A;  3QK6 A;  5FY0 A;  2MYS A;  2EHO D;  2KZ7 B;  2CCQ A;  4UF0 B;  4TZ4 C;  5LA6 E;  2PG8 A;  3V5S A;  5LJN A;  3NRX A;  3UFE A;  1X79 A;  4TX5 A;  3BQL A;  3HL6 A;  2KLQ A;  4QXH B;  5LXT E;  2ZLY A;  3F31 A;  3P8C D;  1KNZ A;  4CI2 B;  2X9W A;  4ZHQ E;  3A5X A;  2OA5 A;  2P9B A;  3ZLI A;  2LT3 A;  2XAH B;  3L09 A;  4FI5 A;  3RRW A;  4PJL A;  1WR6 A;  4OYJ A;  2WBL A;  3N9N A;  2PBI A;  4E7Z A;  1UX5 A;  3ZJ1 A;  3MKD A;  3L3P A;  3H37 A;  3SRZ A;  4HFV A;  1HCI A;  2KIN B;  4UV9 B;  1D0Z A;  2I59 A;  4MAL A;  2NWB A;  3NRY A;  2X9X A;  2K24 A;  2YK0 A;  4GIW A;  4U72 A;  3JC6 D;  5HXS A;  5LNK A;  4TUY E;  1FEW A;  4QKN A;  4UVA B;  1O3X A;  1HTJ F;  3QC9 A;  4GYR A;  3ZJ2 A;  4IGU A;  5JDM A;  4ILU A;  4EZH A;  3N9L A;  4ZS2 A;  4FJO A;  4HN9 A;  2W0G A;  2W63 A;  3B57 A;  1MND A;  5LGT B;  3RKO A;  2NW8 A;  2LOP A;  2V7L A;  5L3C B;  3H3A A;  3PTR B;  2JRK A;  1BR1 A;  2WSS V;  3RH3 A;  3SOL A;  3U3I A;  3EDU A;  4OYK A;  5JRC A;  2CE7 A;  2ZM8 A;  2ES0 A;  2WMN A;  3CQC B;  4WNK A;  4G2A A;  2Q9Q B;  3AA6 B;  4PFO A;  4U74 A;  5L3B B;  4YJ3 E;  2QA7 A;  2MOZ A;  3ZC0 A;  3OJA A;  1VOM A;  1SHZ C;  3VKG A;  4PJN A;  4YJ2 E;  2N2N A;  3P7I A;  4EOZ B;  4EAH A;  4CXW A;  3MA9 A;  4O4I E;  3AVR A;  5KMG P;  2C5K T;  2H3R A;  4UV8 B;  2BVM A;  5FXV A;  3RYF E;  4PK4 A;  4O2B E;  1WYC A;  2K5B B;  3IHR A;  2N9D A;  2IAK A;  5JRE A;  3ESL A;  5LHG B;  5HXC A;  3V5U A;  5LGU B;  2VKJ A;  4JEU B;  1S94 A;  1EZ3 A;  3LFM A;  4IE7 A;  4JUY A;  4UEL A;  2LSJ A;  4P09 A;  3SS1 A;  2V1D B;  3CML A;  5LGN B;  3CX7 B;  2ZMA A;  5LOV E;  1S35 A;  2L9Q A;  4PFP A;  3RYH E;  3LBX B;  5JR9 C;  3J7Y q;  4C91 A;  2YIN A;  3HKC E;  1MNE A;  2LEH A;  5FMN A;  1IJ5 A;  4I4T E;  2D0T A;  3KIN B;  3ZCJ A;  4ISS A;  4AQG A;  2UXX B;  5H6Q B;  2E9X C;  1T98 A;  2ACX A;  4CI1 B;  2H7V C;  2X67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...