2NWBA

Crystal structure of a putative 2,3-dioxygenase (so4414) from shewanella oneidensis in complex with ferric heme. northeast structural genomics target sor52.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
392
structure length
379
Chain Sequence
b'TYNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYIAEPSVSMPLHVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLRLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
molecule tags Oxidoreductase
source organism Shewanella oneidensis
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
total genus 149
structure length 379
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08933 DUF1864 Domain of unknown function (DUF1864)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA02
1.20.58.600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA01
2X67A 1YW0A 2D0TA 5EK3A 2NWBA 2NOXA 2V7KA 4PW8A 2D0UA 3E08A 2X68A 4PK6A 5ETWA 2NW7A 2V7IA 5EK4A 2V7MA 2V7JA 3BK9A 2X66A 2NW8A 4HKAA 4PK5A 1ZEEA 4U72A 5EK2A 2V7LA 2NW9A 4U74A
chains in the Genus database with same CATH superfamily
3EDVA 2Q9QD 1NAFA 2C5JA 2K3WA 4ISTA 4A97A 3CX8B 3H37A 4IE6A 4NPPA 4AKRB 1WR0A 2EHOC 2ES0A 4EB6E 4JI2T 4KX6A 2DI4A 5LGTB 2WCAA 3A8YC 5JDFA 1FJGT 1NENA 1BR0A 2YKSA 5FYMA 4LFCT 4OFZA 3RYIE 2XUEA 3UULA 1LVKA 5H6RB 1HG5A 2IAKA 5FP3A 2X0HA 3EVYA 5HCJA 5ADXL 3ANWA 2CE7A 3AEBA 3FZKB 3JADA 3ZEFB 1MMAA 2YDQA 3H3AA 4L0RA 2EHOD 4X20E 5ETWA 3MXZA 5F5WA 3ZMTB 3ZMZB 2UXBT 2H88A 3DP7A 3MA9A 1U5PA 3OYXA 4HWIB 4TX5A 3SFDA 2CXLA 2KLQA 4H9QC 5JVDE 3AEDA 2VVSA 3N9PA 2HPJA 1VOMA 3VRBA 1HNZT 4DMVA 4QX7B 2JMHA 4ZI3D 4NUUA 3P4SA 4DBQA 5IWAT 5HYAA 2Q9QB 3AE9A 4ILUA 3HKBE 4AI6A 2YU1A 2KXPB 2XASB 2M6BA 4U3CA 1B7TA 4JEUB 2LSJA 5LHHB 2UUBT 2E8IA 1YKEB 4C90A 1E2AA 1MMDA 2IW5B 3EDUA 2V1DB 4WYVA 4KHPT 2BBJA 1YQ3A 3CMLA 1HR0T 2JQKA 4ZHQE 2W67A 3IEEA 3FHNA 2DCFA 5FVKA 2UXCT 2ZM6T 5JR9C 3RYFE 4JEHB 3C4WA 3PUVF 1L0VA 2LM2A 3I0OA 3WAJA 4B3RT 3PTRB 1XDPA 3UFGA 4ZEYA 4I55E 5LMNT 3BQKA 2G0UA 3ONLC 4I4TE 2NW9A 3W15B 4LFAT 1KNRA 2XQ5A 4GIWA 2N2NA 1XNQT 4DUZT 2NR4A 2CBIA 4EIWA 4JI3T 3ZKRA 3LJCA 1KK7A 1UK5A 1AJ3A 1GQEA 1IBMT 1OEDA 1OEDE 4U33A 3ZT7A 2D9DA 3PUSA 2I6HA 3N2OA 4P09A 4ASKA 5LGUB 4PJLA 1UGOA 4HFEA 5AQJB 4ZZCA 3O1IA 4LMLA 1D0ZA 2OA5A 3V5UA 4X66T 3ZN0B 3HR0A 4IT4A 3RPUA 3HI2A 2BS2A 1NWMX 2J62A 3K1SA 3KINB 4BJNA 4CI2B 2L3LA 2CPTA 2EHOB 2X68A 3FBZA 2H3RA 4I0UA 5IHYA 4XBFB 2WZIA 3AEAA 4NIQA 4YSZA 4TNVA 1KEYA 4YFSA 2LKHA 3BK9A 4TWHA 4HKAA 3HKDE 4EEDA 2F4VT 2EHOA 3ETUA 1WCRA 3IA3A 4ZOLE 3UUMA 3UUBA 5HXCA 2CWYA 3AXJA 4YTNA 3GMIA 5JDLA 3MACA 3RIFA 3FZMB 1D1BA 3HA4A 3P4QA 3ZCJA 3AE8A 3IF8B 4NXNT 4WW0A 5HEJA 3S4UA 4AISA 4HFDA 2LSIA 1T72A 4P0BA 3TLVA 4PFOA 3ZT5A 3AE7A 2DNXA 4H9SE 4B6XA 3AEEA 3G06A 2CLYC 4UV8B 4XAXB 3T8OA 4ZI2C 1FMWA 4Q25A 1G73A 2DWKA 3SWHA 3ZLIA 2RPAA 4DBRA 5JH7E 3VU7H 2WB5A 3HL6A 5CGMA 2PFVA 5L3FB 2V7KA 3N9LA 2JRKA 2YINA 3AEFA 2XAFB 3GN5A 2XQAA 2IUBA 3ZJ1A 5KDMC 5E0OA 4YLHA 4UF0A 2VKJA 2WY2A 3UU3A 2XTLA 2UXDT 5ABHA 4O4JE 3RI5A 1XDOA 3NKZA 2N9DA 4L9IA 3UU8A 2V7JA 1ZOYA 4H9RC 2JQQA 5L3BB 3P8CD 4EV6A 2LSKA 4HGAA 4QKNA 1MIYA 4AIUA 2AXDS 1CHUA 4HWDA 1XMQT 2OLTA 2B1EA 2E5VA 2JMKA 2Y48B 5H6QB 2V5DA 2ZLYA 1T8BA 4FJOA 2KZ7B 1WLXA 1MMGA 2XPKA 2BKNA 5LA6E 4A5XA 4CZZB 2E9XA 4PNIA 3C51A 1W0BA 3J7Yq 2B76A 2K48A 2YOEA 3OPCA 1G8XA 1KNPA 1JNRA 4QX8B 4IE0A 4QHOA 3ZT6A 4CN4A 2JPFA 3MJXA 4HTEA 5CB4E 2IC9A 1LRZA 3OTOT 3RKGA 2Y6XA 4ZI3C 3ZMSB 5L3DB 4X62T 2NTYA 2ODUA 2YU2A 3I0QA 5LHIB 4HFVA 1HFAA 5FXWA 5AQNB 4ILCA 4JI6T 2LEHA 1QLBA 1V9DA 4PK5A 4HEAA 2LJLA 4LMKA 2VQET 2W4XA 2HN2A 2RP4A 4PFPA 3RIUC 5JDNA 3E0ZA 3QOFA 5ABEA 2HH7A 2NP9A 4GKJT 4IL4A 3C98B 3P4RA 4TNWA 2CRBA 2K9AA 3GWHA 4H63H 4PK4A 4AKLA 4HWFA 2D0TA 2JQHA 4DR1T 4B3ST 3PE0A 3UTKA 4QH5A 4O2BE 4IE7A 4O4LE 2IHR1 5EK3A 5JR9B 3OYZA 4OK0A 2CXFA 2HN1A 3B13A 3UUNA 4DR6T 4EYYR 3PUWF 4DMWA 2W66A 2XSAA 3CQCB 3AXJB 3PU3A 5FXZA 4BJMA 3LK42 3AE1A 2ACZA 2XZEA 1NEKA 2CHNA 4UELA 5EK4A 2WZHA 1BR2A 3K3NA 5AQIB 2KNDA 5AQTB 5FL0A 3UQ7A 2YK0A 1J5ET 2YEVC 3P4PA 4KMCA 1M62A 4DUYT 5F3JA 2QRXA 3ANWB 4ZXLA 3C50A 1CUNA 3AVRA 1S94A 3C64A 3LSVA 4P0AA 5C2TA 2VKHA 4JI0T 4GYSA 1HS7A 3UT5E 3Q9DA 4V1Av 4NXMT 3ETVA 2BDEA 4X1KE 2CCQA 4TV8E 3N9NA 3Q5WA 3CQXC 4YHJA 1N32T 4Z8XA 4E7ZA 2XY8B 1IZNB 2CWOA 3RH3A 1BR4A 2AE9A 1UUSA 2NWBA 3KV4A 2NOXA 3ONXA 2XQYA 3N5LA 3QB5K 4MBQA 5AQVB 3VR8A 5AFUL 2KSRA 2UXNB 4DNDA 2N1GA 3TLUA 4LF6T 2J1DG 1US7B 4ERRA 3EUHA 5DABA 3SRZA 3AB3B 4U31A 3P4WA 4MFRA 3TLSA 4AXPA 2WDRA 4CXYA 2LSGA 1D1CA 2LM9A 5LBQB 3RRWA 2WU2A 4AQFC 4CQIA 1IBLT 3LBXB 3EABA 4I43B 1MIWA 3WAKA 4IDZA 4G63A 4DIDB 3RIUA 1LVFA 3UFEA 3LG7A 2Z6EA 3OKQA 4X1IE 4K0UA 4GOUA 5HEGA 4OYJA 4QH4A 5L4HA 2A9UA 3CQGB 5LOVE 5LB7B 4HFIA 2PTFA 4WBNE 1XZYA 4O4IE 5ABFA 1X79A 2LT3A 2R6GF 4HFHA 1T7SA 1LKXA 2FJAA 1D0XA 2JIWA 2ZM2A 3FZLB 3P50A 5FY0A 5J2UE 3GA8A 5FKYA 1HG2A 3NRXA 1MIVA 4DV0T 1ZHCA 2XQ3A 5L2LA 2MBGA 2KMFA 1W09A 1UX4A 4IL9A 5FXXA 4HE8A 4PK6A 3Q5XA 4JLEA 4P1NA 2ACXA 2QVAA 3UU4A 4X64T 2HHHT 4UVCB 2MOZA 2PJQA 3RRCA 3PJAA 4Z91A 2V7MA 3AA0B 3ZCIA 4UVAB 3RC3A 5BMVE 5JTGA 5HXEA 5KX5E 5L3CB 4H63V 2VWAA 3NBXX 3ZC0A 2V7LA 3NZQA 5KXJA 3WI3A 3CX7B 2BBHA 2C0SA 3ONJA 2WWVA 4YXDA 3B5MA 2X0YA 3F2EA 2DHRA 1SA0E 1XWMA 3M65A 5JRCB 4AKIA 1S35A 2ZMAA 3C4ZA 5AQGB 2VKOA 4A98A 2UUAT 1FEWA 4HWCA 3ESLA 4BA9A 3ZSTA 3RC8A 2M67A 3E22E 4PJJA 5ABGA 1HNWT 3N2KE 5JRCA 3OVUA 2A3DA 4PAGA 4EOZB 2WDVA 3N9QA 4UR9A 2ODVA 1UCUA 3NVOA 2XAGB 2LE8A 4TN7B 5J0ZA 4O8SA 2XQ4A 3AE2A 3CPZA 1QUUA 2WM9A 2BG9A 2BG9E 2WP9A 2YDRA 4PJNA 1KNZA 4KBMB 4M1PA 4UXNB 5DQVA 2V26A 2WU5A 4CXXA 2MYSA 2NW7A 5FL1A 2ZM8A 1HNXT 4DV2T 1YQ4A 3V5SA 3FZFB 4B3TT 3AA6B 3RQUA 3LFMA 2BVMA 3AE4A 5C8YE 1VCTA 2IMLA 3AE6A 3QNUA 4UF0B 1HCIA 2QA7A 3OBVE 3K8PC 3SS1A 4YT0A 4TWDA 3TLTA 5ABFB 3KDSE 3RIAA 1SHZC 1R8IA 4TZ4C 4O4HE 5IYZE 5IUXA 2FBWA 3L39A 3BQIA 5HEOA 5J1GA 2CM0A 2BVLA 3NWIA 4KHZF 3H3MA 2D5UA 2LSYA 3QC9A 3B57A 4UVBB 4OX9T 2KT9A 1FMVA 4DR3T 2KWHA 3PV0F 5LBMA 4JI5T 3MKDA 3U78A 3LBXA 2MAWA 2P9BA 2CXDA 4IGUA 3O1JA 4ZS2A 5FY7A 5FMNA 4HWHA 2XAJB 2CA5A 1ZV4X 4LF7T 3CK6A 3F31A 4UEMA 2WMOA 4HN9A 2J4GA 2W2UA 2BS4A 2L8KA 4QXCB 5L3EB 2X66A 3VKGA 1ZEEA 2YN6A 4J2CA 4AKGA 1W9RA 4H9OC 4OHFA 5CA1E 4AQYT 4O2AE 5LHGB 2BKPA 5CA0E 1XNRT 3CIRA 3FXEB 5HXHA 2BKOA 2JQ9A 3PU8A 1OWAA 4MALA 2XHEB 3KBUA 3PUGA 3Q5DA 4IREA 2QYWA 4QWNB 3P7IA 2BG9C 2X9HA 3VR9A 5HWXA 5JREA 2LRLA 3KV9A 1VRBA 1MNEA 4HFBA 5LXTE 3MZKB 3PUZF 3JAFA 5AQQB 3FB2A 1YW0A 2V6YB 2WMNA 3EI0A 1WFDA 2X9WA 3JC6D 4JI1T 3VKHA 2W61A 5FXVA 2JJ9A 4IE5A 5J2TE 2WSSV 3PUYF 2A2FX 3JC6C 3N9OA 5AQLB 4ANJA 4I50E 3KVAA 3TKLB 4KI0F 4X65T 2VB6A 4DV7T 2YDSA 4JI4T 4DR5T 2I59A 3ZMVB 5AQPB 2PG8A 2LKGA 4C91A 5JR9A 2V7IA 1E1HB 2E9XC 3IHRA 2NW8A 1H7CA 4NUVA 4U7YA 2C5IT 3CKDA 4X5TA 5EZYE 3RF1A 1IAPA 3ZYLA 1BR1A 1HF8A 2CLYB 4CI3B 1XMOT 1I6ZA 2WS3A 3Q2MA 4QXHB 3BQLA 4X1YE 3ZN1B 4ILBA 4U2ZA 5L3GB 4DV5T 3PUAA 5GONE 1E7PA 3ZYKA 1N34T 2X67A 4LF9T 4KUMB 4COFA 4N78D 3VRAA 3T1YT 3KV6A 2UUCT 3DJBA 2XM2A 1EZ3A 3A5XA 4TV9E 5BR8T 2IIUA 5JDQA 4AQFA 4GK5E 5LP6E 2E9XD 4ISSA 4JV5T 3L09A 3PUXF 2D0UA 3RKOA 2VKDA 5AQKB 4DR7T 2DL1A 3JCFA 2X9YA 5DJQC 1IJ5A 1WYBA 2XM1A 4FI5A 2CMRA 3AVSA 3AA1B 3UU6A 4U72A 2Q9QA 4BAYB 4DV4T 2KWIB 3K3QC 4LF5T 3KV5A 4LFBT 1DU2A 1OEDB 2ZM0A 2FJBA 4A56A 2E9XB 4YJ3E 1O3XA 3OJAA 4ZS3A 2IDOB 4EEBA 5AQSB 1N33T 3L8RA 3I9YA 5LJMA 4CXWA 4OYKA 4DR4T 2XQ9A 3K3OA 2WBLA 3N2GE 2FJEA 3NRYA 1KF6A 1OXZA 2PBIA 1ZKEA 4H9PC 3VHLA 4TUYE 5KMGP 2VQFT 3LK2B 2UXXB 2FJDA 2H7VC 2CHOA 5TAOA 5FNVE 4DO0A 4MLKA 4WBOA 3LDQB 3NZPA 1YXRA 3EAMA 3F57A 4JI7T 2H89A 2WWUA 2XQ8A 2BZBA 5HEHA 5LJNA 2J47A 3O1HA 2XSBA 4YTMA 5F8PA 2DLRA 2BG9B 2I0MA 3QK6A 3R6NA 1X9BA 3LK3B 1Z0PA 2A72A 5LYJE 2V8SV 2VURA 5C3JA 5HWYA 2IC6A 4DV1T 2BS3A 4EXTA 4L5GA 4YTPA 3I9WA 5FY1A 1QSDA 3UUXB 1HTJF 2OV9A 5JDMA 3ZJ2A 3KVBA 2XQ7A 4GYRA 4AKHA 4U2YA 2W0GA 4F8HA 3C4XA 4ZZBA 1IJ6A 1IBKT 3N9MA 1OEDC 1T98A 2X0LB 2CBJA 3IBPA 4QXBB 2RA1A 1SE7A 4YSXA 4DV6T 1WR6A 4IDPA 2XQ6A 3CWZB 3KBTA 3CX6B 3PJAJ 3PUQA 5AQHB 5AQFB 2K24A 4DR2T 4YY3T 3FXDB 4ZI2D 1UURA 2MPKA 2K5BB 2VL0A 4WNKA 4E7SA 3ZMUB 5JQGE 2UU9T 2X51A 5DQWA 2SPCA 3E08A 3UU5A 4EZ4A 5L47A 3O9XA 4B3MT 2GK9A 1J5WA 4H9NC 2VASA 3KFWX 4UV9B 1J1JA 1SUMB 1U4QA 3O4XE 3RQWA 3AE5A 4U7IA 4JYAT 3AAAB 2XAQB 3RYCE 2L9QA 4LMJA 2V6XA 4IDQA 3T1HT 3RX6A 1HX8A 1UX5A 5HEUA 4IDOA 5M4YA 3RHWA 3GN5B 4IE4A 5AQOB 2XAHB 4IHJE 1HX1B 1MMNA 3RLFF 5HAXA 3ZYMA 5AQMB 3DTOA 1Y64B 2W62A 2DWGA 2VL8A 4EGWA 2V6YA 5AQRB 3JAEA 3TLWA 4F6RC 3SOLA 5LNKA 3AAEB 2D2SA 1VCSA 3PDYA 4WZXA 4XZCA 1YD8G 1WYCA 3AAIA 3RYHE 3ABVA 3X1DA 4ADZA 4TWFA 5AQUB 3ZPOA 3AA7B 4EAHA 4LF4T 2Y8DA 3AE3A 5LG3A 2V5CA 2M6IA 5HXSA 4Z90A 5A1LA 5HXRA 4GKKT 3AECA 2LOPA 3RGLA 1FIOA 1Z8UA 3U3IA 2E5LT 3FBLA 2C5KT 5FVLA 4JI8T 4G2AA 2LHRA 4CN6A 5CFBA 2VVNA 4MHCA 5LGNB 1KFYA 2NTXA 4K0KT 4DV3T 1I94T 3I1AA 2KINB 4QH1A 4U74A 1ZP0A 1D1AA 1Y01A 3HKEE 3PURA 3J9X1 4CI1B 3A7MA 4HFCA 3L3PA 2X9XA 4ZI7E 2FUPA 3Q5EA 3QUJA 4GK0E 3R84B 4CN1A 3AEGA 2LHNA 4YSYA 1MNDA 4YJ2E 3ZC1A 2LLYA 1YKHB 3QB5A 3CVRA 4JBWF 3ZSSA 4YHHT 1D0YA 3FZHB 2E2AA 2LOSA 3MK7C 4PW8A 4UIGA 2CEAA 2WQYA 3M3ZB 5CJ5A 2QGSA 3HKCE 4ILAA 1JNZA 4LF8T 2HPLA 4AQGA 2VK9A 2W00A 2XJ7A 4IDNA 4JUYA 4EYUA 4DVDA 5JDGA 2H7OA 3UQ4A 5LCYA 1M7KA 2LRKA 2MTQA 3EHZA 2WDQA 5LG4A 5JDHA 5LMUT 2WAUA 4PJMA 3D0TA 1N36T 4EZHA 5EK2A 5L4EA 2Q9QC 1WRDA 4KP3C 3SFEA 2W63A 1W0AA 5HCMA 4IIJE
chains in the Genus database with same CATH topology
3EDVA 2Q9QD 1NAFA 2C5JA 4ISTA 3CX8B 3H37A 4IE6A 4AKRB 2EHOC 2ES0A 4EB6E 2DI4A 5LGTB 5JDFA 5FYMA 4OFZA 3RYIE 2XUEA 3UULA 1LVKA 5H6RB 1HG5A 2IAKA 5FP3A 5ADXL 3EVYA 3ANWA 2CE7A 3ZEFB 1MMAA 3H3AA 4L0RA 3ZMTB 2EHOD 4X20E 5ETWA 3MXZA 3ZMZB 3DP7A 3MA9A 1U5PA 3OYXA 4TX5A 2CXLA 2KLQA 4H9QC 5JVDE 3N9PA 2HPJA 1VOMA 4DMVA 4QX7B 2JMHA 4ZI3D 4NUUA 4DBQA 5HYAA 2Q9QB 4ILUA 3HKBE 2YU1A 2KXPB 2XASB 1B7TA 4JEUB 2LSJA 5LHHB 2E8IA 1YKEB 4C90A 1MMDA 2IW5B 3EDUA 2V1DB 3CMLA 4ZHQE 3IEEA 3FHNA 2DCFA 5JR9C 3RYFE 4JEHB 3C4WA 3WAJA 3I0OA 3PTRB 4I55E 3BQKA 2G0UA 4I4TE 2NW9A 3W15B 4GIWA 2N2NA 4EIWA 3LJCA 1KK7A 1AJ3A 3PUSA 3N2OA 4P09A 4ASKA 5LGUB 4PJLA 3O1IA 1D0ZA 2OA5A 3V5UA 3ZN0B 3HR0A 3RPUA 3HI2A 4BJNA 1NWMX 3KINB 4CI2B 2L3LA 2X68A 2EHOB 3FBZA 5IHYA 2H3RA 4XBFB 4YFSA 3BK9A 4HKAA 3HKDE 2EHOA 3ETUA 4ZOLE 3UUMA 5HXCA 2CWYA 5JDLA 3GMIA 3MACA 1D1BA 3HA4A 3ZCJA 3IF8B 4WW0A 3S4UA 2LSIA 4P0BA 4PFOA 2DNXA 4H9SE 4B6XA 3T8OA 2CLYC 4UV8B 4XAXB 4ZI2C 1FMWA 1G73A 2DWKA 3SWHA 3ZLIA 4DBRA 5JH7E 3VU7H 3HL6A 5L3FB 2PFVA 2V7KA 3N9LA 2JRKA 2YINA 5LP6E 2XAFB 3GN5A 3ZJ1A 5KDMC 5E0OA 4YLHA 4UF0A 2VKJA 2XTLA 4O4JE 2N9DA 4L9IA 2V7JA 4H9RC 5L3BB 2JQQA 3P8CD 2LSKA 4HGAA 4QKNA 1MIYA 2B1EA 2Y48B 2JMKA 5H6QB 2ZLYA 4FJOA 2KZ7B 1WLXA 1MMGA 5LA6E 4CZZB 2E9XA 4PNIA 3J7Yq 2K48A 1G8XA 4QX8B 4IE0A 4QHOA 2JPFA 3MJXA 4HTEA 5CB4E 2IC9A 1LRZA 2Y6XA 4ZI3C 3ZMSB 5L3DB 2NTYA 2ODUA 2YU2A 3I0QA 5LHIB 4HFVA 1HFAA 5FXWA 2LEHA 1V9DA 4PK5A 4HEAA 2LJLA 2RP4A 4PFPA 5JDNA 3E0ZA 2HH7A 2NP9A 3C98B 2K9AA 3GWHA 4H63H 4PK4A 4AKLA 2D0TA 3PE0A 3UTKA 5EK3A 4O2BE 4IE7A 4O4LE 5JR9B 3OYZA 4OK0A 2CXFA 3B13A 3UUNA 4EYYR 4DMWA 3CQCB 3PU3A 5FXZA 4BJMA 3LK42 4UELA 5EK4A 1BR2A 3K3NA 2KNDA 2YK0A 2YEVC 4KMCA 5F3JA 3ANWB 3C50A 1CUNA 3AVRA 1S94A 3C64A 4P0AA 1HS7A 2VKHA 4GYSA 3UT5E 3Q9DA 4V1Av 3ETVA 2BDEA 4X1KE 2CCQA 4TV8E 3N9NA 3Q5WA 3CQXC 4YHJA 4Z8XA 4E7ZA 1IZNB 2CWOA 3RH3A 1BR4A 2NWBA 3ONXA 3KV4A 2NOXA 2XQYA 3N5LA 4MBQA 5AFUL 2UXNB 4DNDA 2N1GA 2J1DG 1US7B 4ERRA 3EUHA 5DABA 3SRZA 3AB3B 4AXPA 4MFRA 4CXYA 1BR0A 2LSGA 1D1CA 2LM9A 5LBQB 3RRWA 4CQIA 3LBXB 4I43B 3WAKA 1MIWA 4IDZA 4G63A 1LVFA 3UFEA 3LG7A 2Z6EA 3OKQA 4X1IE 4K0UA 4GOUA 4OYJA 3CQGB 5LOVE 4WBNE 4O4IE 1X79A 2LT3A 1LKXA 1D0XA 2ZM2A 5J2UE 5FY0A 3GA8A 1HG2A 3NRXA 1MIVA 1ZHCA 5L2LA 2MBGA 2KMFA 1UX4A 5FXXA 4HE8A 4PK6A 3Q5XA 4JLEA 2ACXA 4UVCB 2MOZA 2PJQA 3RRCA 3ZCIA 5BMVE 2V7MA 3AA0B 4UVAB 3RC3A 5HXEA 5KX5E 5L3CB 4H63V 2VWAA 3NBXX 3ZC0A 2V7LA 3NZQA 3WI3A 3CX7B 2C0SA 3F2EA 2DHRA 1SA0E 3M65A 5JRCB 4AKIA 1S35A 2ZMAA 3C4ZA 2VKOA 1FEWA 4BA9A 3ESLA 3RC8A 2M67A 3E22E 4PJJA 3N2KE 5JRCA 2A3DA 4PAGA 4EOZB 3N9QA 2ODVA 1UCUA 4TN7B 2XAGB 2LE8A 4O8SA 3CPZA 1QUUA 2WM9A 1KNZA 4PJNA 4KBMB 4M1PA 4UXNB 5DQVA 2V26A 4CXXA 2MYSA 2NW7A 2ZM8A 3V5SA 3AA6B 3LFMA 2BVMA 5C8YE 4UF0B 3SS1A 1HCIA 2QA7A 3OBVE 3K8PC 3KDSE 1SHZC 4TZ4C 4O4HE 5IYZE 3BQIA 5J1GA 2CM0A 2BVLA 2D5UA 2LSYA 3QC9A 3B57A 4UVBB 2KT9A 1FMVA 2KWHA 5LBMA 3U78A 3MKDA 3LBXA 2P9BA 2CXDA 4IGUA 3O1JA 4ZS2A 5FY7A 5FMNA 2XAJB 2CA5A 1ZV4X 4UEMA 3F31A 2WMOA 4HN9A 2L8KA 4QXCB 5L3EB 2X66A 3VKGA 1ZEEA 4J2CA 4AKGA 4H9OC 4OHFA 5CA1E 4O2AE 5LHGB 5CA0E 3FXEB 5HXHA 3PU8A 4MALA 1OWAA 2XHEB 3KBUA 3PUGA 4QWNB 3P7IA 5HWXA 2X9HA 3KV9A 1VRBA 1MNEA 5LXTE 3MZKB 3FB2A 1YW0A 2WMNA 2X9WA 3VKHA 3JC6D 2W61A 5FXVA 2JJ9A 4IE5A 5J2TE 2WSSV 2A2FX 3JC6C 3N9OA 4ANJA 4I50E 3KVAA 3TKLB 2VB6A 2I59A 3ZMVB 2PG8A 4C91A 5JR9A 2V7IA 1E1HB 2E9XC 3IHRA 2NW8A 1H7CA 4NUVA 5EZYE 2C5IT 3CKDA 4AQFC 4CI3B 3ZYLA 1IAPA 1BR1A 1HF8A 2CLYB 4QXHB 3Q2MA 4X1YE 3BQLA 3ZN1B 5L3GB 3PUAA 5GONE 3ZYKA 2X67A 4KUMB 4N78D 3KV6A 3DJBA 1EZ3A 3A5XA 4TV9E 5JDQA 4AQFA 4GK5E 2E9XD 4ISSA 3L09A 3RKOA 2D0UA 2VKDA 2X9YA 5DJQC 1IJ5A 1WYBA 5JREA 4FI5A 2CMRA 3AVSA 3AA1B 4AKHA 4U72A 2Q9QA 4BAYB 2KWIB 3K3QC 3KV5A 2ZM0A 4A56A 2E9XB 4YJ3E 1O3XA 3OJAA 4ZS3A 3I9YA 5LJMA 4CXWA 4OYKA 3K3OA 2WBLA 3N2GE 3NRYA 4H9PC 3VHLA 1OXZA 2PBIA 1ZKEA 5KMGP 4TUYE 3LK2B 2UXXB 2H7VC 5TAOA 5FNVE 4DO0A 4MLKA 4WBOA 3NZPA 3F57A 2WWUA 2BZBA 5LJNA 3O1HA 5F8PA 2DLRA 3R6NA 3QK6A 5LYJE 3LK3B 1Z0PA 2A72A 5HWYA 2IC6A 4EXTA 4L5GA 3I9WA 5FY1A 1QSDA 3UUXB 1HTJF 5JDMA 3ZJ2A 3KVBA 4GYRA 2W0GA 3C4XA 1IJ6A 3N9MA 1T98A 2X0LB 3IBPA 4QXBB 2RA1A 1WR6A 4AI6A 3KBTA 3CWZB 3PUQA 3CX6B 2K24A 3FXDB 4ZI2D 2K5BB 4WNKA 4E7SA 3ZMUB 5JQGE 2X51A 5DQWA 2SPCA 3E08A 4EZ4A 3O9XA 2GK9A 4H9NC 2VASA 3KFWX 4UV9B 1U4QA 3O4XE 3AAAB 2XAQB 3RYCE 2L9QA 3RX6A 1HX8A 1UX5A 5M4YA 3GN5B 4IE4A 2XAHB 4IHJE 1MMNA 3ZYMA 5HAXA 3DTOA 1Y64B 2W62A 2DWGA 2VL8A 5LNKA 4F6RC 3SOLA 3AAEB 2D2SA 3PDYA 3RYHE 4XZCA 1YD8G 1WYCA 3AAIA 4ADZA 4EAHA 3ZPOA 3AA7B 2Y8DA 5HXSA 5A1LA 5HXRA 2LOPA 3U3IA 1FIOA 3FBLA 2C5KT 4G2AA 2LHRA 4MHCA 5LGNB 2NTXA 3I1AA 2KINB 4U74A 1D1AA 3HKEE 3PURA 3J9X1 4CI1B 4ZI7E 3L3PA 2X9XA 3QUJA 4GK0E 3R84B 2LHNA 1MNDA 4YJ2E 3ZC1A 1YKHB 3CVRA 1D0YA 3MK7C 2LOSA 4PW8A 4UIGA 2CEAA 2QGSA 3HKCE 2HPLA 4AQGA 2VK9A 2W00A 4JUYA 4EYUA 4DVDA 5JDGA 2H7OA 5LCYA 2MTQA 5LG4A 5JDHA 2WAUA 4PJMA 3D0TA 4EZHA 5EK2A 2Q9QC 1WRDA 4KP3C 2W63A 3C51A 4IIJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X67 A;  1YW0 A;  2D0T A;  5EK3 A;  2NWB A;  2NOX A;  2V7K A;  4PW8 A;  2D0U A;  3E08 A;  2X68 A;  4PK6 A;  5ETW A;  2NW7 A;  2V7I A;  5EK4 A;  2V7M A;  2V7J A;  3BK9 A;  2X66 A;  2NW8 A;  4HKA A;  4PK5 A;  1ZEE A;  4U72 A;  5EK2 A;  2V7L A;  2NW9 A;  4U74 A; 
#chains in the Genus database with same CATH topology
 3EDV A;  2Q9Q D;  1NAF A;  2C5J A;  2K3W A;  4IST A;  4A97 A;  3CX8 B;  3H37 A;  4IE6 A;  4NPP A;  4AKR B;  1WR0 A;  2EHO C;  2ES0 A;  4EB6 E;  4JI2 T;  4KX6 A;  2DI4 A;  5LGT B;  2WCA A;  3A8Y C;  5JDF A;  1FJG T;  1NEN A;  1BR0 A;  2YKS A;  5FYM A;  4LFC T;  4OFZ A;  3RYI E;  2XUE A;  3UUL A;  1LVK A;  5H6R B;  1HG5 A;  2IAK A;  5FP3 A;  2X0H A;  3EVY A;  5HCJ A;  5ADX L;  3ANW A;  2CE7 A;  3AEB A;  3FZK B;  3JAD A;  3ZEF B;  1MMA A;  2YDQ A;  3H3A A;  4L0R A;  2EHO D;  4X20 E;  5ETW A;  3MXZ A;  5F5W A;  3ZMT B;  3ZMZ B;  2UXB T;  2H88 A;  3DP7 A;  3MA9 A;  1U5P A;  3OYX A;  4HWI B;  4TX5 A;  3SFD A;  2CXL A;  2KLQ A;  4H9Q C;  5JVD E;  3AED A;  2VVS A;  3N9P A;  2HPJ A;  1VOM A;  3VRB A;  1HNZ T;  4DMV A;  4QX7 B;  2JMH A;  4ZI3 D;  4NUU A;  3P4S A;  4DBQ A;  5IWA T;  5HYA A;  2Q9Q B;  3AE9 A;  4ILU A;  3HKB E;  4AI6 A;  2YU1 A;  2KXP B;  2XAS B;  2M6B A;  4U3C A;  1B7T A;  4JEU B;  2LSJ A;  5LHH B;  2UUB T;  2E8I A;  1YKE B;  4C90 A;  1E2A A;  1MMD A;  2IW5 B;  3EDU A;  2V1D B;  4WYV A;  4KHP T;  2BBJ A;  1YQ3 A;  3CML A;  1HR0 T;  2JQK A;  4ZHQ E;  2W67 A;  3IEE A;  3FHN A;  2DCF A;  5FVK A;  2UXC T;  2ZM6 T;  5JR9 C;  3RYF E;  4JEH B;  3C4W A;  3PUV F;  1L0V A;  2LM2 A;  3I0O A;  3WAJ A;  4B3R T;  3PTR B;  1XDP A;  3UFG A;  4ZEY A;  4I55 E;  5LMN T;  3BQK A;  2G0U A;  3ONL C;  4I4T E;  2NW9 A;  3W15 B;  4LFA T;  1KNR A;  2XQ5 A;  4GIW A;  2N2N A;  1XNQ T;  4DUZ T;  2NR4 A;  2CBI A;  4EIW A;  4JI3 T;  3ZKR A;  3LJC A;  1KK7 A;  1UK5 A;  1AJ3 A;  1GQE A;  1IBM T;  1OED A;  1OED E;  4U33 A;  3ZT7 A;  2D9D A;  3PUS A;  2I6H A;  3N2O A;  4P09 A;  4ASK A;  5LGU B;  4PJL A;  1UGO A;  4HFE A;  5AQJ B;  4ZZC A;  3O1I A;  4LML A;  1D0Z A;  2OA5 A;  3V5U A;  4X66 T;  3ZN0 B;  3HR0 A;  4IT4 A;  3RPU A;  3HI2 A;  2BS2 A;  1NWM X;  2J62 A;  3K1S A;  3KIN B;  4BJN A;  4CI2 B;  2L3L A;  2CPT A;  2EHO B;  2X68 A;  3FBZ A;  2H3R A;  4I0U A;  5IHY A;  4XBF B;  2WZI A;  3AEA A;  4NIQ A;  4YSZ A;  4TNV A;  1KEY A;  4YFS A;  2LKH A;  3BK9 A;  4TWH A;  4HKA A;  3HKD E;  4EED A;  2F4V T;  2EHO A;  3ETU A;  1WCR A;  3IA3 A;  4ZOL E;  3UUM A;  3UUB A;  5HXC A;  2CWY A;  3AXJ A;  4YTN A;  3GMI A;  5JDL A;  3MAC A;  3RIF A;  3FZM B;  1D1B A;  3HA4 A;  3P4Q A;  3ZCJ A;  3AE8 A;  3IF8 B;  4NXN T;  4WW0 A;  5HEJ A;  3S4U A;  4AIS A;  4HFD A;  2LSI A;  1T72 A;  4P0B A;  3TLV A;  4PFO A;  3ZT5 A;  3AE7 A;  2DNX A;  4H9S E;  4B6X A;  3AEE A;  3G06 A;  2CLY C;  4UV8 B;  4XAX B;  3T8O A;  4ZI2 C;  1FMW A;  4Q25 A;  1G73 A;  2DWK A;  3SWH A;  3ZLI A;  2RPA A;  4DBR A;  5JH7 E;  3VU7 H;  2WB5 A;  3HL6 A;  5CGM A;  2PFV A;  5L3F B;  2V7K A;  3N9L A;  2JRK A;  2YIN A;  3AEF A;  2XAF B;  3GN5 A;  2XQA A;  2IUB A;  3ZJ1 A;  5KDM C;  5E0O A;  4YLH A;  4UF0 A;  2VKJ A;  2WY2 A;  3UU3 A;  2XTL A;  2UXD T;  5ABH A;  4O4J E;  3RI5 A;  1XDO A;  3NKZ A;  2N9D A;  4L9I A;  3UU8 A;  2V7J A;  1ZOY A;  4H9R C;  2JQQ A;  5L3B B;  3P8C D;  4EV6 A;  2LSK A;  4HGA A;  4QKN A;  1MIY A;  4AIU A;  2AXD S;  1CHU A;  4HWD A;  1XMQ T;  2OLT A;  2B1E A;  2E5V A;  2JMK A;  2Y48 B;  5H6Q B;  2V5D A;  2ZLY A;  1T8B A;  4FJO A;  2KZ7 B;  1WLX A;  1MMG A;  2XPK A;  2BKN A;  5LA6 E;  4A5X A;  4CZZ B;  2E9X A;  4PNI A;  3C51 A;  1W0B A;  3J7Y q;  2B76 A;  2K48 A;  2YOE A;  3OPC A;  1G8X A;  1KNP A;  1JNR A;  4QX8 B;  4IE0 A;  4QHO A;  3ZT6 A;  4CN4 A;  2JPF A;  3MJX A;  4HTE A;  5CB4 E;  2IC9 A;  1LRZ A;  3OTO T;  3RKG A;  2Y6X A;  4ZI3 C;  3ZMS B;  5L3D B;  4X62 T;  2NTY A;  2ODU A;  2YU2 A;  3I0Q A;  5LHI B;  4HFV A;  1HFA A;  5FXW A;  5AQN B;  4ILC A;  4JI6 T;  2LEH A;  1QLB A;  1V9D A;  4PK5 A;  4HEA A;  2LJL A;  4LMK A;  2VQE T;  2W4X A;  2HN2 A;  2RP4 A;  4PFP A;  3RIU C;  5JDN A;  3E0Z A;  3QOF A;  5ABE A;  2HH7 A;  2NP9 A;  4GKJ T;  4IL4 A;  3C98 B;  3P4R A;  4TNW A;  2CRB A;  2K9A A;  3GWH A;  4H63 H;  4PK4 A;  4AKL A;  4HWF A;  2D0T A;  2JQH A;  4DR1 T;  4B3S T;  3PE0 A;  3UTK A;  4QH5 A;  4O2B E;  4IE7 A;  4O4L E;  2IHR 1;  5EK3 A;  5JR9 B;  3OYZ A;  4OK0 A;  2CXF A;  2HN1 A;  3B13 A;  3UUN A;  4DR6 T;  4EYY R;  3PUW F;  4DMW A;  2W66 A;  2XSA A;  3CQC B;  3AXJ B;  3PU3 A;  5FXZ A;  4BJM A;  3LK4 2;  3AE1 A;  2ACZ A;  2XZE A;  1NEK A;  2CHN A;  4UEL A;  5EK4 A;  2WZH A;  1BR2 A;  3K3N A;  5AQI B;  2KND A;  5AQT B;  5FL0 A;  3UQ7 A;  2YK0 A;  1J5E T;  2YEV C;  3P4P A;  4KMC A;  1M62 A;  4DUY T;  5F3J A;  2QRX A;  3ANW B;  4ZXL A;  3C50 A;  1CUN A;  3AVR A;  1S94 A;  3C64 A;  3LSV A;  4P0A A;  5C2T A;  2VKH A;  4JI0 T;  4GYS A;  1HS7 A;  3UT5 E;  3Q9D A;  4V1A v;  4NXM T;  3ETV A;  2BDE A;  4X1K E;  2CCQ A;  4TV8 E;  3N9N A;  3Q5W A;  3CQX C;  4YHJ A;  1N32 T;  4Z8X A;  4E7Z A;  2XY8 B;  1IZN B;  2CWO A;  3RH3 A;  1BR4 A;  2AE9 A;  1UUS A;  2NWB A;  3KV4 A;  2NOX A;  3ONX A;  2XQY A;  3N5L A;  3QB5 K;  4MBQ A;  5AQV B;  3VR8 A;  5AFU L;  2KSR A;  2UXN B;  4DND A;  2N1G A;  3TLU A;  4LF6 T;  2J1D G;  1US7 B;  4ERR A;  3EUH A;  5DAB A;  3SRZ A;  3AB3 B;  4U31 A;  3P4W A;  4MFR A;  3TLS A;  4AXP A;  2WDR A;  4CXY A;  2LSG A;  1D1C A;  2LM9 A;  5LBQ B;  3RRW A;  2WU2 A;  4AQF C;  4CQI A;  1IBL T;  3LBX B;  3EAB A;  4I43 B;  1MIW A;  3WAK A;  4IDZ A;  4G63 A;  4DID B;  3RIU A;  1LVF A;  3UFE A;  3LG7 A;  2Z6E A;  3OKQ A;  4X1I E;  4K0U A;  4GOU A;  5HEG A;  4OYJ A;  4QH4 A;  5L4H A;  2A9U A;  3CQG B;  5LOV E;  5LB7 B;  4HFI A;  2PTF A;  4WBN E;  1XZY A;  4O4I E;  5ABF A;  1X79 A;  2LT3 A;  2R6G F;  4HFH A;  1T7S A;  1LKX A;  2FJA A;  1D0X A;  2JIW A;  2ZM2 A;  3FZL B;  3P50 A;  5FY0 A;  5J2U E;  3GA8 A;  5FKY A;  1HG2 A;  3NRX A;  1MIV A;  4DV0 T;  1ZHC A;  2XQ3 A;  5L2L A;  2MBG A;  2KMF A;  1W09 A;  1UX4 A;  4IL9 A;  5FXX A;  4HE8 A;  4PK6 A;  3Q5X A;  4JLE A;  4P1N A;  2ACX A;  2QVA A;  3UU4 A;  4X64 T;  2HHH T;  4UVC B;  2MOZ A;  2PJQ A;  3RRC A;  3PJA A;  4Z91 A;  2V7M A;  3AA0 B;  3ZCI A;  4UVA B;  3RC3 A;  5BMV E;  5JTG A;  5HXE A;  5KX5 E;  5L3C B;  4H63 V;  2VWA A;  3NBX X;  3ZC0 A;  2V7L A;  3NZQ A;  5KXJ A;  3WI3 A;  3CX7 B;  2BBH A;  2C0S A;  3ONJ A;  2WWV A;  4YXD A;  3B5M A;  2X0Y A;  3F2E A;  2DHR A;  1SA0 E;  1XWM A;  3M65 A;  5JRC B;  4AKI A;  1S35 A;  2ZMA A;  3C4Z A;  5AQG B;  2VKO A;  4A98 A;  2UUA T;  1FEW A;  4HWC A;  3ESL A;  4BA9 A;  3ZST A;  3RC8 A;  2M67 A;  3E22 E;  4PJJ A;  5ABG A;  1HNW T;  3N2K E;  5JRC A;  3OVU A;  2A3D A;  4PAG A;  4EOZ B;  2WDV A;  3N9Q A;  4UR9 A;  2ODV A;  1UCU A;  3NVO A;  2XAG B;  2LE8 A;  4TN7 B;  5J0Z A;  4O8S A;  2XQ4 A;  3AE2 A;  3CPZ A;  1QUU A;  2WM9 A;  2BG9 A;  2BG9 E;  2WP9 A;  2YDR A;  4PJN A;  1KNZ A;  4KBM B;  4M1P A;  4UXN B;  5DQV A;  2V26 A;  2WU5 A;  4CXX A;  2MYS A;  2NW7 A;  5FL1 A;  2ZM8 A;  1HNX T;  4DV2 T;  1YQ4 A;  3V5S A;  3FZF B;  4B3T T;  3AA6 B;  3RQU A;  3LFM A;  2BVM A;  3AE4 A;  5C8Y E;  1VCT A;  2IML A;  3AE6 A;  3QNU A;  4UF0 B;  1HCI A;  2QA7 A;  3OBV E;  3K8P C;  3SS1 A;  4YT0 A;  4TWD A;  3TLT A;  5ABF B;  3KDS E;  3RIA A;  1SHZ C;  1R8I A;  4TZ4 C;  4O4H E;  5IYZ E;  5IUX A;  2FBW A;  3L39 A;  3BQI A;  5HEO A;  5J1G A;  2CM0 A;  2BVL A;  3NWI A;  4KHZ F;  3H3M A;  2D5U A;  2LSY A;  3QC9 A;  3B57 A;  4UVB B;  4OX9 T;  2KT9 A;  1FMV A;  4DR3 T;  2KWH A;  3PV0 F;  5LBM A;  4JI5 T;  3MKD A;  3U78 A;  3LBX A;  2MAW A;  2P9B A;  2CXD A;  4IGU A;  3O1J A;  4ZS2 A;  5FY7 A;  5FMN A;  4HWH A;  2XAJ B;  2CA5 A;  1ZV4 X;  4LF7 T;  3CK6 A;  3F31 A;  4UEM A;  2WMO A;  4HN9 A;  2J4G A;  2W2U A;  2BS4 A;  2L8K A;  4QXC B;  5L3E B;  2X66 A;  3VKG A;  1ZEE A;  2YN6 A;  4J2C A;  4AKG A;  1W9R A;  4H9O C;  4OHF A;  5CA1 E;  4AQY T;  4O2A E;  5LHG B;  2BKP A;  5CA0 E;  1XNR T;  3CIR A;  3FXE B;  5HXH A;  2BKO A;  2JQ9 A;  3PU8 A;  1OWA A;  4MAL A;  2XHE B;  3KBU A;  3PUG A;  3Q5D A;  4IRE A;  2QYW A;  4QWN B;  3P7I A;  2BG9 C;  2X9H A;  3VR9 A;  5HWX A;  5JRE A;  2LRL A;  3KV9 A;  1VRB A;  1MNE A;  4HFB A;  5LXT E;  3MZK B;  3PUZ F;  3JAF A;  5AQQ B;  3FB2 A;  1YW0 A;  2V6Y B;  2WMN A;  3EI0 A;  1WFD A;  2X9W A;  3JC6 D;  4JI1 T;  3VKH A;  2W61 A;  5FXV A;  2JJ9 A;  4IE5 A;  5J2T E;  2WSS V;  3PUY F;  2A2F X;  3JC6 C;  3N9O A;  5AQL B;  4ANJ A;  4I50 E;  3KVA A;  3TKL B;  4KI0 F;  4X65 T;  2VB6 A;  4DV7 T;  2YDS A;  4JI4 T;  4DR5 T;  2I59 A;  3ZMV B;  5AQP B;  2PG8 A;  2LKG A;  4C91 A;  5JR9 A;  2V7I A;  1E1H B;  2E9X C;  3IHR A;  2NW8 A;  1H7C A;  4NUV A;  4U7Y A;  2C5I T;  3CKD A;  4X5T A;  5EZY E;  3RF1 A;  1IAP A;  3ZYL A;  1BR1 A;  1HF8 A;  2CLY B;  4CI3 B;  1XMO T;  1I6Z A;  2WS3 A;  3Q2M A;  4QXH B;  3BQL A;  4X1Y E;  3ZN1 B;  4ILB A;  4U2Z A;  5L3G B;  4DV5 T;  3PUA A;  5GON E;  1E7P A;  3ZYK A;  1N34 T;  2X67 A;  4LF9 T;  4KUM B;  4COF A;  4N78 D;  3VRA A;  3T1Y T;  3KV6 A;  2UUC T;  3DJB A;  2XM2 A;  1EZ3 A;  3A5X A;  4TV9 E;  5BR8 T;  2IIU A;  5JDQ A;  4AQF A;  4GK5 E;  5LP6 E;  2E9X D;  4ISS A;  4JV5 T;  3L09 A;  3PUX F;  2D0U A;  3RKO A;  2VKD A;  5AQK B;  4DR7 T;  2DL1 A;  3JCF A;  2X9Y A;  5DJQ C;  1IJ5 A;  1WYB A;  2XM1 A;  4FI5 A;  2CMR A;  3AVS A;  3AA1 B;  3UU6 A;  4U72 A;  2Q9Q A;  4BAY B;  4DV4 T;  2KWI B;  3K3Q C;  4LF5 T;  3KV5 A;  4LFB T;  1DU2 A;  1OED B;  2ZM0 A;  2FJB A;  4A56 A;  2E9X B;  4YJ3 E;  1O3X A;  3OJA A;  4ZS3 A;  2IDO B;  4EEB A;  5AQS B;  1N33 T;  3L8R A;  3I9Y A;  5LJM A;  4CXW A;  4OYK A;  4DR4 T;  2XQ9 A;  3K3O A;  2WBL A;  3N2G E;  2FJE A;  3NRY A;  1KF6 A;  1OXZ A;  2PBI A;  1ZKE A;  4H9P C;  3VHL A;  4TUY E;  5KMG P;  2VQF T;  3LK2 B;  2UXX B;  2FJD A;  2H7V C;  2CHO A;  5TAO A;  5FNV E;  4DO0 A;  4MLK A;  4WBO A;  3LDQ B;  3NZP A;  1YXR A;  3EAM A;  3F57 A;  4JI7 T;  2H89 A;  2WWU A;  2XQ8 A;  2BZB A;  5HEH A;  5LJN A;  2J47 A;  3O1H A;  2XSB A;  4YTM A;  5F8P A;  2DLR A;  2BG9 B;  2I0M A;  3QK6 A;  3R6N A;  1X9B A;  3LK3 B;  1Z0P A;  2A72 A;  5LYJ E;  2V8S V;  2VUR A;  5C3J A;  5HWY A;  2IC6 A;  4DV1 T;  2BS3 A;  4EXT A;  4L5G A;  4YTP A;  3I9W A;  5FY1 A;  1QSD A;  3UUX B;  1HTJ F;  2OV9 A;  5JDM A;  3ZJ2 A;  3KVB A;  2XQ7 A;  4GYR A;  4AKH A;  4U2Y A;  2W0G A;  4F8H A;  3C4X A;  4ZZB A;  1IJ6 A;  1IBK T;  3N9M A;  1OED C;  1T98 A;  2X0L B;  2CBJ A;  3IBP A;  4QXB B;  2RA1 A;  1SE7 A;  4YSX A;  4DV6 T;  1WR6 A;  4IDP A;  2XQ6 A;  3CWZ B;  3KBT A;  3CX6 B;  3PJA J;  3PUQ A;  5AQH B;  5AQF B;  2K24 A;  4DR2 T;  4YY3 T;  3FXD B;  4ZI2 D;  1UUR A;  2MPK A;  2K5B B;  2VL0 A;  4WNK A;  4E7S A;  3ZMU B;  5JQG E;  2UU9 T;  2X51 A;  5DQW A;  2SPC A;  3E08 A;  3UU5 A;  4EZ4 A;  5L47 A;  3O9X A;  4B3M T;  2GK9 A;  1J5W A;  4H9N C;  2VAS A;  3KFW X;  4UV9 B;  1J1J A;  1SUM B;  1U4Q A;  3O4X E;  3RQW A;  3AE5 A;  4U7I A;  4JYA T;  3AAA B;  2XAQ B;  3RYC E;  2L9Q A;  4LMJ A;  2V6X A;  4IDQ A;  3T1H T;  3RX6 A;  1HX8 A;  1UX5 A;  5HEU A;  4IDO A;  5M4Y A;  3RHW A;  3GN5 B;  4IE4 A;  5AQO B;  2XAH B;  4IHJ E;  1HX1 B;  1MMN A;  3RLF F;  5HAX A;  3ZYM A;  5AQM B;  3DTO A;  1Y64 B;  2W62 A;  2DWG A;  2VL8 A;  4EGW A;  2V6Y A;  5AQR B;  3JAE A;  3TLW A;  4F6R C;  3SOL A;  5LNK A;  3AAE B;  2D2S A;  1VCS A;  3PDY A;  4WZX A;  4XZC A;  1YD8 G;  1WYC A;  3AAI A;  3RYH E;  3ABV A;  3X1D A;  4ADZ A;  4TWF A;  5AQU B;  3ZPO A;  3AA7 B;  4EAH A;  4LF4 T;  2Y8D A;  3AE3 A;  5LG3 A;  2V5C A;  2M6I A;  5HXS A;  4Z90 A;  5A1L A;  5HXR A;  4GKK T;  3AEC A;  2LOP A;  3RGL A;  1FIO A;  1Z8U A;  3U3I A;  2E5L T;  3FBL A;  2C5K T;  5FVL A;  4JI8 T;  4G2A A;  2LHR A;  4CN6 A;  5CFB A;  2VVN A;  4MHC A;  5LGN B;  1KFY A;  2NTX A;  4K0K T;  4DV3 T;  1I94 T;  3I1A A;  2KIN B;  4QH1 A;  4U74 A;  1ZP0 A;  1D1A A;  1Y01 A;  3HKE E;  3PUR A;  3J9X 1;  4CI1 B;  3A7M A;  4HFC A;  3L3P A;  2X9X A;  4ZI7 E;  2FUP A;  3Q5E A;  3QUJ A;  4GK0 E;  3R84 B;  4CN1 A;  3AEG A;  2LHN A;  4YSY A;  1MND A;  4YJ2 E;  3ZC1 A;  2LLY A;  1YKH B;  3QB5 A;  3CVR A;  4JBW F;  3ZSS A;  4YHH T;  1D0Y A;  3FZH B;  2E2A A;  2LOS A;  3MK7 C;  4PW8 A;  4UIG A;  2CEA A;  2WQY A;  3M3Z B;  5CJ5 A;  2QGS A;  3HKC E;  4ILA A;  1JNZ A;  4LF8 T;  2HPL A;  4AQG A;  2VK9 A;  2W00 A;  2XJ7 A;  4IDN A;  4JUY A;  4EYU A;  4DVD A;  5JDG A;  2H7O A;  3UQ4 A;  5LCY A;  1M7K A;  2LRK A;  2MTQ A;  3EHZ A;  2WDQ A;  5LG4 A;  5JDH A;  5LMU T;  2WAU A;  4PJM A;  3D0T A;  1N36 T;  4EZH A;  5EK2 A;  5L4E A;  2Q9Q C;  1WRD A;  4KP3 C;  3SFE A;  2W63 A;  1W0A A;  5HCM A;  4IIJ E; 
#chains in the Genus database with same CATH homology
 3EDV A;  2Q9Q D;  1NAF A;  2C5J A;  4IST A;  3CX8 B;  3H37 A;  4IE6 A;  4AKR B;  2EHO C;  2ES0 A;  4EB6 E;  2DI4 A;  5LGT B;  5JDF A;  5FYM A;  4OFZ A;  3RYI E;  2XUE A;  3UUL A;  1LVK A;  5H6R B;  1HG5 A;  2IAK A;  5FP3 A;  5ADX L;  3EVY A;  3ANW A;  2CE7 A;  3ZEF B;  1MMA A;  3H3A A;  4L0R A;  3ZMT B;  2EHO D;  4X20 E;  5ETW A;  3MXZ A;  3ZMZ B;  3DP7 A;  3MA9 A;  1U5P A;  3OYX A;  4TX5 A;  2CXL A;  2KLQ A;  4H9Q C;  5JVD E;  3N9P A;  2HPJ A;  1VOM A;  4DMV A;  4QX7 B;  2JMH A;  4ZI3 D;  4NUU A;  4DBQ A;  5HYA A;  2Q9Q B;  4ILU A;  3HKB E;  2YU1 A;  2KXP B;  2XAS B;  1B7T A;  4JEU B;  2LSJ A;  5LHH B;  2E8I A;  1YKE B;  4C90 A;  1MMD A;  2IW5 B;  3EDU A;  2V1D B;  3CML A;  4ZHQ E;  3IEE A;  3FHN A;  2DCF A;  5JR9 C;  3RYF E;  4JEH B;  3C4W A;  3WAJ A;  3I0O A;  3PTR B;  4I55 E;  3BQK A;  2G0U A;  4I4T E;  2NW9 A;  3W15 B;  4GIW A;  2N2N A;  4EIW A;  3LJC A;  1KK7 A;  1AJ3 A;  3PUS A;  3N2O A;  4P09 A;  4ASK A;  5LGU B;  4PJL A;  3O1I A;  1D0Z A;  2OA5 A;  3V5U A;  3ZN0 B;  3HR0 A;  3RPU A;  3HI2 A;  4BJN A;  1NWM X;  3KIN B;  4CI2 B;  2L3L A;  2X68 A;  2EHO B;  3FBZ A;  5IHY A;  2H3R A;  4XBF B;  4YFS A;  3BK9 A;  4HKA A;  3HKD E;  2EHO A;  3ETU A;  4ZOL E;  3UUM A;  5HXC A;  2CWY A;  5JDL A;  3GMI A;  3MAC A;  1D1B A;  3HA4 A;  3ZCJ A;  3IF8 B;  4WW0 A;  3S4U A;  2LSI A;  4P0B A;  4PFO A;  2DNX A;  4H9S E;  4B6X A;  3T8O A;  2CLY C;  4UV8 B;  4XAX B;  4ZI2 C;  1FMW A;  1G73 A;  2DWK A;  3SWH A;  3ZLI A;  4DBR A;  5JH7 E;  3VU7 H;  3HL6 A;  5L3F B;  2PFV A;  2V7K A;  3N9L A;  2JRK A;  2YIN A;  5LP6 E;  2XAF B;  3GN5 A;  3ZJ1 A;  5KDM C;  5E0O A;  4YLH A;  4UF0 A;  2VKJ A;  2XTL A;  4O4J E;  2N9D A;  4L9I A;  2V7J A;  4H9R C;  5L3B B;  2JQQ A;  3P8C D;  2LSK A;  4HGA A;  4QKN A;  1MIY A;  2B1E A;  2Y48 B;  2JMK A;  5H6Q B;  2ZLY A;  4FJO A;  2KZ7 B;  1WLX A;  1MMG A;  5LA6 E;  4CZZ B;  2E9X A;  4PNI A;  3J7Y q;  2K48 A;  1G8X A;  4QX8 B;  4IE0 A;  4QHO A;  2JPF A;  3MJX A;  4HTE A;  5CB4 E;  2IC9 A;  1LRZ A;  2Y6X A;  4ZI3 C;  3ZMS B;  5L3D B;  2NTY A;  2ODU A;  2YU2 A;  3I0Q A;  5LHI B;  4HFV A;  1HFA A;  5FXW A;  2LEH A;  1V9D A;  4PK5 A;  4HEA A;  2LJL A;  2RP4 A;  4PFP A;  5JDN A;  3E0Z A;  2HH7 A;  2NP9 A;  3C98 B;  2K9A A;  3GWH A;  4H63 H;  4PK4 A;  4AKL A;  2D0T A;  3PE0 A;  3UTK A;  5EK3 A;  4O2B E;  4IE7 A;  4O4L E;  5JR9 B;  3OYZ A;  4OK0 A;  2CXF A;  3B13 A;  3UUN A;  4EYY R;  4DMW A;  3CQC B;  3PU3 A;  5FXZ A;  4BJM A;  3LK4 2;  4UEL A;  5EK4 A;  1BR2 A;  3K3N A;  2KND A;  2YK0 A;  2YEV C;  4KMC A;  5F3J A;  3ANW B;  3C50 A;  1CUN A;  3AVR A;  1S94 A;  3C64 A;  4P0A A;  1HS7 A;  2VKH A;  4GYS A;  3UT5 E;  3Q9D A;  4V1A v;  3ETV A;  2BDE A;  4X1K E;  2CCQ A;  4TV8 E;  3N9N A;  3Q5W A;  3CQX C;  4YHJ A;  4Z8X A;  4E7Z A;  1IZN B;  2CWO A;  3RH3 A;  1BR4 A;  2NWB A;  3ONX A;  3KV4 A;  2NOX A;  2XQY A;  3N5L A;  4MBQ A;  5AFU L;  2UXN B;  4DND A;  2N1G A;  2J1D G;  1US7 B;  4ERR A;  3EUH A;  5DAB A;  3SRZ A;  3AB3 B;  4AXP A;  4MFR A;  4CXY A;  1BR0 A;  2LSG A;  1D1C A;  2LM9 A;  5LBQ B;  3RRW A;  4CQI A;  3LBX B;  4I43 B;  3WAK A;  1MIW A;  4IDZ A;  4G63 A;  1LVF A;  3UFE A;  3LG7 A;  2Z6E A;  3OKQ A;  4X1I E;  4K0U A;  4GOU A;  4OYJ A;  3CQG B;  5LOV E;  4WBN E;  4O4I E;  1X79 A;  2LT3 A;  1LKX A;  1D0X A;  2ZM2 A;  5J2U E;  5FY0 A;  3GA8 A;  1HG2 A;  3NRX A;  1MIV A;  1ZHC A;  5L2L A;  2MBG A;  2KMF A;  1UX4 A;  5FXX A;  4HE8 A;  4PK6 A;  3Q5X A;  4JLE A;  2ACX A;  4UVC B;  2MOZ A;  2PJQ A;  3RRC A;  3ZCI A;  5BMV E;  2V7M A;  3AA0 B;  4UVA B;  3RC3 A;  5HXE A;  5KX5 E;  5L3C B;  4H63 V;  2VWA A;  3NBX X;  3ZC0 A;  2V7L A;  3NZQ A;  3WI3 A;  3CX7 B;  2C0S A;  3F2E A;  2DHR A;  1SA0 E;  3M65 A;  5JRC B;  4AKI A;  1S35 A;  2ZMA A;  3C4Z A;  2VKO A;  1FEW A;  4BA9 A;  3ESL A;  3RC8 A;  2M67 A;  3E22 E;  4PJJ A;  3N2K E;  5JRC A;  2A3D A;  4PAG A;  4EOZ B;  3N9Q A;  2ODV A;  1UCU A;  4TN7 B;  2XAG B;  2LE8 A;  4O8S A;  3CPZ A;  1QUU A;  2WM9 A;  1KNZ A;  4PJN A;  4KBM B;  4M1P A;  4UXN B;  5DQV A;  2V26 A;  4CXX A;  2MYS A;  2NW7 A;  2ZM8 A;  3V5S A;  3AA6 B;  3LFM A;  2BVM A;  5C8Y E;  4UF0 B;  3SS1 A;  1HCI A;  2QA7 A;  3OBV E;  3K8P C;  3KDS E;  1SHZ C;  4TZ4 C;  4O4H E;  5IYZ E;  3BQI A;  5J1G A;  2CM0 A;  2BVL A;  2D5U A;  2LSY A;  3QC9 A;  3B57 A;  4UVB B;  2KT9 A;  1FMV A;  2KWH A;  5LBM A;  3U78 A;  3MKD A;  3LBX A;  2P9B A;  2CXD A;  4IGU A;  3O1J A;  4ZS2 A;  5FY7 A;  5FMN A;  2XAJ B;  2CA5 A;  1ZV4 X;  4UEM A;  3F31 A;  2WMO A;  4HN9 A;  2L8K A;  4QXC B;  5L3E B;  2X66 A;  3VKG A;  1ZEE A;  4J2C A;  4AKG A;  4H9O C;  4OHF A;  5CA1 E;  4O2A E;  5LHG B;  5CA0 E;  3FXE B;  5HXH A;  3PU8 A;  4MAL A;  1OWA A;  2XHE B;  3KBU A;  3PUG A;  4QWN B;  3P7I A;  5HWX A;  2X9H A;  3KV9 A;  1VRB A;  1MNE A;  5LXT E;  3MZK B;  3FB2 A;  1YW0 A;  2WMN A;  2X9W A;  3VKH A;  3JC6 D;  2W61 A;  5FXV A;  2JJ9 A;  4IE5 A;  5J2T E;  2WSS V;  2A2F X;  3JC6 C;  3N9O A;  4ANJ A;  4I50 E;  3KVA A;  3TKL B;  2VB6 A;  2I59 A;  3ZMV B;  2PG8 A;  4C91 A;  5JR9 A;  2V7I A;  1E1H B;  2E9X C;  3IHR A;  2NW8 A;  1H7C A;  4NUV A;  5EZY E;  2C5I T;  3CKD A;  4AQF C;  4CI3 B;  3ZYL A;  1IAP A;  1BR1 A;  1HF8 A;  2CLY B;  4QXH B;  3Q2M A;  4X1Y E;  3BQL A;  3ZN1 B;  5L3G B;  3PUA A;  5GON E;  3ZYK A;  2X67 A;  4KUM B;  4N78 D;  3KV6 A;  3DJB A;  1EZ3 A;  3A5X A;  4TV9 E;  5JDQ A;  4AQF A;  4GK5 E;  2E9X D;  4ISS A;  3L09 A;  3RKO A;  2D0U A;  2VKD A;  2X9Y A;  5DJQ C;  1IJ5 A;  1WYB A;  5JRE A;  4FI5 A;  2CMR A;  3AVS A;  3AA1 B;  4AKH A;  4U72 A;  2Q9Q A;  4BAY B;  2KWI B;  3K3Q C;  3KV5 A;  2ZM0 A;  4A56 A;  2E9X B;  4YJ3 E;  1O3X A;  3OJA A;  4ZS3 A;  3I9Y A;  5LJM A;  4CXW A;  4OYK A;  3K3O A;  2WBL A;  3N2G E;  3NRY A;  4H9P C;  3VHL A;  1OXZ A;  2PBI A;  1ZKE A;  5KMG P;  4TUY E;  3LK2 B;  2UXX B;  2H7V C;  5TAO A;  5FNV E;  4DO0 A;  4MLK A;  4WBO A;  3NZP A;  3F57 A;  2WWU A;  2BZB A;  5LJN A;  3O1H A;  5F8P A;  2DLR A;  3R6N A;  3QK6 A;  5LYJ E;  3LK3 B;  1Z0P A;  2A72 A;  5HWY A;  2IC6 A;  4EXT A;  4L5G A;  3I9W A;  5FY1 A;  1QSD A;  3UUX B;  1HTJ F;  5JDM A;  3ZJ2 A;  3KVB A;  4GYR A;  2W0G A;  3C4X A;  1IJ6 A;  3N9M A;  1T98 A;  2X0L B;  3IBP A;  4QXB B;  2RA1 A;  1WR6 A;  4AI6 A;  3KBT A;  3CWZ B;  3PUQ A;  3CX6 B;  2K24 A;  3FXD B;  4ZI2 D;  2K5B B;  4WNK A;  4E7S A;  3ZMU B;  5JQG E;  2X51 A;  5DQW A;  2SPC A;  3E08 A;  4EZ4 A;  3O9X A;  2GK9 A;  4H9N C;  2VAS A;  3KFW X;  4UV9 B;  1U4Q A;  3O4X E;  3AAA B;  2XAQ B;  3RYC E;  2L9Q A;  3RX6 A;  1HX8 A;  1UX5 A;  5M4Y A;  3GN5 B;  4IE4 A;  2XAH B;  4IHJ E;  1MMN A;  3ZYM A;  5HAX A;  3DTO A;  1Y64 B;  2W62 A;  2DWG A;  2VL8 A;  5LNK A;  4F6R C;  3SOL A;  3AAE B;  2D2S A;  3PDY A;  3RYH E;  4XZC A;  1YD8 G;  1WYC A;  3AAI A;  4ADZ A;  4EAH A;  3ZPO A;  3AA7 B;  2Y8D A;  5HXS A;  5A1L A;  5HXR A;  2LOP A;  3U3I A;  1FIO A;  3FBL A;  2C5K T;  4G2A A;  2LHR A;  4MHC A;  5LGN B;  2NTX A;  3I1A A;  2KIN B;  4U74 A;  1D1A A;  3HKE E;  3PUR A;  3J9X 1;  4CI1 B;  4ZI7 E;  3L3P A;  2X9X A;  3QUJ A;  4GK0 E;  3R84 B;  2LHN A;  1MND A;  4YJ2 E;  3ZC1 A;  1YKH B;  3CVR A;  1D0Y A;  3MK7 C;  2LOS A;  4PW8 A;  4UIG A;  2CEA A;  2QGS A;  3HKC E;  2HPL A;  4AQG A;  2VK9 A;  2W00 A;  4JUY A;  4EYU A;  4DVD A;  5JDG A;  2H7O A;  5LCY A;  2MTQ A;  5LG4 A;  5JDH A;  2WAU A;  4PJM A;  3D0T A;  4EZH A;  5EK2 A;  2Q9Q C;  1WRD A;  4KP3 C;  2W63 A;  3C51 A;  4IIJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...