2NWBA

Crystal structure of a putative 2,3-dioxygenase (so4414) from shewanella oneidensis in complex with ferric heme. northeast structural genomics target sor52.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
392
structure length
379
Chain Sequence
TYNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYIAEPSVSMPLHVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLRLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Oxidoreductase
total genus 149
structure length 379
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08933 DUF1864 Domain of unknown function (DUF1864)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA02
1.20.58.600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA01
2V7JA 3BK9A 2NW7A 4U74A 4PW8A 2NWBA 5EK3A 2X66A 2V7KA 2X67A 2V7LA 4PK6A 5ETWA 2NW8A 2X68A 2D0TA 5EK4A 5EK2A 3E08A 1ZEEA 4HKAA 4PK5A 2V7IA 1YW0A 2D0UA 2NOXA 4U72A 2V7MA 2NW9A
chains in the Genus database with same CATH superfamily
2KWIB 4TV9E 2K48A 3B13A 5J1GA 1WLXA 3ZPOA 3UUMA 1IJ5A 3N2GE 4CXWA 4PJMA 5EK2A 5AQJB 3D0TA 4DBRA 1XDPA 3PUWF 3OTOT 3Q5EA 4DV4T 4EZ4A 4TV8E 2FJEA 4QX7B 3A5XA 5LJMA 1D0XA 3AEDA 3QUJA 1UX4A 5FL1A 3VR8A 4PW8A 3R84B 3N9LA 2WU5A 2CWOA 2A9UA 5FXWA 3W15B 3G06A 5KXJA 5JR9A 3PTRB 3JAFA 4FJOA 4NIQA 4KMCA 2UUAT 3JC6C 1S35A 5HAXA 2BS2A 4JI4T 5L47A 4QH1A 2KZ7B 4MHCA 5M4YA 1T98A 3AB3B 4PFPA 3UFEA 1WFDA 4X64T 3O9XA 4EB6E 2H89A 2LSKA 4QHOA 1MMNA 5L3DB 3Q5DA 2R6GF 4YLHA 3WAKA 1J5WA 2XQ4A 4QXCB 3QB5A 2XAJB 3L09A 5C8YE 3GN5A 3P4SA 4H63H 5LYJE 5L4HA 2DL1A 3RQUA 2BG9C 4DR6T 5LB7B 5JTGA 1E1HB 2IMLA 2IIUA 2M6IA 2E9XD 3O1HA 2XQ9A 2WS3A 2V26A 1W0AA 5LMUT 4CI2B 4JLEA 4LF7T 2JMHA 3LDQB 4XAXB 4OFZA 4IE6A 2WDQA 3TLSA 4X5TA 5ABFA 4PK4A 3H37A 2X67A 4UF0A 3QK6A 1KF6A 3CX8B 3FXDB 5L3EB 3C4ZA 1US7B 1MMGA 4YJ2E 1Z0PA 5LBQB 2PJQA 4U3CA 3QNUA 4KUMB 2E5VA 2XZEA 4FI5A 1D1AA 5J2TE 2BKOA 2XQAA 1NWMX 4K0UA 3RQWA 2XAFB 4ISSA 2K24A 3EDVA 3VU7H 3C51A 1SA0E 3LG7A 1J1JA 2VVNA 3ETUA 2UUBT 5C3JA 1FMVA 4JI7T 1WRDA 1MNEA 2PBIA 3P4QA 4MBQA 3RLFF 3TKLB 2Y6XA 1D0ZA 3AA1B 2BG9B 4WZXA 1W9RA 5HWXA 1O3XA 3ZMUB 4K0KT 2BZBA 3AE7A 3UFGA 1LVFA 2VKDA 4EEBA 2HN2A 3HKBE 1W09A 1M7KA 3RYHE 5GONE 2CM0A 2WCAA 4TNVA 1HX8A 2HH7A 3RPUA 2Q9QC 2WDRA 4EAHA 5CA0E 3ZJ1A 1E2AA 3RI5A 4JBWF 4YHHT 3ZMVB 4NXNT 3P4PA 1NAFA 4JI2T 3HKEE 2YK0A 1HR0T 2NOXA 3I1AA 3O1JA 4ISTA 1M62A 1JNRA 2DI4A 5HXSA 2LSIA 4L9IA 5LG3A 5JQGE 1XMQT 3AAIA 2V1DB 1HNWT 4YT0A 2CHNA 2JQ9A 2WMOA 1T7SA 3I0QA 4IDPA 2N9DA 3RRWA 4ZI2D 4H9SE 3DJBA 4QH4A 4ADZA 2ZLYA 1YQ3A 4B6XA 1KEYA 3CK6A 2Y8DA 2BKNA 3H3AA 3HKDE 3RRCA 5ABHA 1IJ6A 1W0BA 2C5KT 1ZEEA 3I9WA 1QLBA 2NTXA 2XQ3A 3PUSA 1VCTA 3ZT6A 4B3RT 1S94A 4ZI7E 2ZM0A 4LFBT 2MPKA 4HWDA 2LEHA 4GIWA 3KV4A 4BAYB 3SFDA 2UU9T 3HKCE 2QA7A 3PE0A 2IAKA 4BJMA 2Q9QB 3UU8A 3HA4A 3AAEB 2BG9A 3CPZA 1X79A 2XY8B 2OA5A 5FY7A 5HEGA 1KNZA 4V1Av 4IE0A 3MACA 4PJJA 1FIOA 2G0UA 2KLQA 2RA1A 5AQNB 3L39A 1YD8G 5LP6E 3T1YT 2IHR1 2H7VC 1WCRA 3P4RA 3VRAA 4DV1T 2LSYA 2X66A 4CI3B 5HEHA 5LJNA 4DV7T 3MXZA 5JDLA 5HCJA 2H88A 1OEDE 3ETVA 4MLKA 2D0UA 4Z8XA 5JDFA 3VKGA 1BR1A 4ANJA 4PJLA 4ILBA 3OJAA 5L3FB 1YKEB 4IT4A 2FUPA 2D2SA 2YDQA 4LF9T 2RP4A 3MA9A 3AE6A 3UU6A 2ODUA 3ZYKA 4I0UA 3KVBA 3AEBA 5E0OA 2LE8A 3A8YC 2DCFA 4ZXLA 4HFBA 2XHEB 4P09A 2FJAA 3IA3A 5AQQB 3LJCA 3UT5E 3K3OA 3SOLA 3KVAA 1D0YA 1YW0A 4IDOA 2V7MA 3T1HT 4JI8T 2L9QA 2UXCT 3RKOA 4LFCT 2W2UA 2X9XA 2B1EA 5L3BB 1QUUA 4H9NC 2HN1A 5J2UE 4GYRA 1Y01A 4DR5T 4LMKA 2Q9QA 4YXDA 4X65T 4UV8B 3K1SA 2QVAA 4EXTA 1T8BA 2LOPA 4EYUA 4JV5T 4ASKA 3QB5K 2N1GA 4GOUA 4U7IA 4HEAA 4YSXA 1LVKA 4P0BA 4X1YE 2YDSA 2KNDA 3EDUA 4TNWA 3Q5XA 5JRCA 4WNKA 5HYAA 5FXVA 3PDYA 3UUXB 5CJ5A 3FZHB 3F57A 3N9NA 1HCIA 2V7LA 2L3LA 1GQEA 1ZHCA 2F4VT 2VASA 4H63V 5HXEA 2MYSA 3ONJA 4ILAA 3UUBA 4IDNA 3N2OA 4AIUA 3T8OA 5AQPB 2K3WA 4UVAB 3EHZA 5JDQA 3OKQA 1KFYA 5FY0A 5BMVE 2AXDS 3IEEA 2M6BA 3ANWA 2W00A 1N33T 4DV3T 2A2FX 5FVKA 3FBZA 2WSSV 3N5LA 2L8KA 2LT3A 3ZC1A 1NEKA 1HG2A 5HXRA 5L2LA 4AI6A 3SFEA 3ZT7A 4U72A 3ZYLA 3I0OA 1MMAA 3LBXB 2V5DA 4H9QC 5ABGA 3LK2B 5HEUA 1IBMT 5BR8T 4CN4A 4A98A 3KFWX 3PUYF 1HTJF 3BK9A 5IUXA 2W0GA 2WBLA 2WWVA 5LGUB 2CE7A 4I4TE 3F2EA 1ZOYA 3AXJB 4NUUA 4YSZA 3FXEB 2XQYA 2MTQA 1XNQT 2LKGA 1BR4A 4JYAT 1Y64B 3FB2A 5LHIB 2H7OA 5FXXA 5AQIB 2WWUA 4TWFA 3K3NA 2OV9A 3RX6A 2XPKA 2RPAA 3K3QC 4KHZF 3X1DA 2I0MA 3N9QA 5LNKA 4HFEA 4J2CA 4U33A 4ZEYA 3AVSA 4DIDB 2V6XA 2VB6A 5EK4A 1OXZA 3NBXX 4LMLA 4DNDA 3OYZA 1SUMB 4DUZT 1U4QA 1N36T 2VK9A 4ZS2A 1WR0A 2V7JA 4QH5A 4CXXA 3NZQA 4X66T 4KBMB 5AQVB 3CX7B 4KHPT 4UIGA 2Z6EA 3IF8B 1SHZC 5ABEA 3FHNA 4U7YA 3AEFA 5CA1E 3LBXA 4DR7T 1UK5A 4X20E 2VQET 5TAOA 4BJNA 4G63A 3RIAA 3TLUA 4F8HA 3RIFA 2XAQB 5JDNA 1HX1B 2LOSA 3RKGA 2XM1A 1H7CA 1HG5A 3L8RA 3S4UA 3N2KE 1MIYA 4ZOLE 2AE9A 4TN7B 5JDGA 2W63A 2KT9A 2X9HA 1D1CA 2E8IA 3VKHA 1KK7A 5DQVA 2VURA 4O4LE 2JIWA 2VWAA 2E5LT 3AA7B 5JDHA 1UURA 3ZMSB 3ABVA 2LKHA 5AQFB 2JJ9A 3EVYA 2W4XA 2LRKA 2N2NA 3V5SA 4GKKT 4M1PA 3TLVA 2UXNB 1ZV4X 4I55E 3AEAA 3OPCA 2W67A 2CXLA 2WY2A 3FZMB 3VHLA 2DHRA 1N32T 4WBOA 2A3DA 5FYMA 2VKHA 2IDOB 3PUXF 2WU2A 5KDMC 2C0SA 3ZMZB 3PU3A 3N9OA 2MBGA 2UXXB 4YY3T 4G2AA 3NRYA 5F5WA 1EZ3A 2VKOA 3CX6B 2XUEA 4GKJT 3FZLB 4IGUA 1MNDA 2VQFT 4EGWA 5IHYA 1WR6A 4QXHB 1UX5A 1J5ET 4L0RA 3QC9A 1VRBA 2WB5A 3IHRA 2LRLA 4H9PC 5L3GB 2M67A 5LXTE 3DP7A 3L3PA 4XBFB 2WDVA 4B3TT 3AE1A 4AKGA 5AQRB 1HNXT 3KV6A 3I9YA 4AQFC 2YKSA 3CMLA 2UXDT 2X51A 2XQ5A 4EOZB 3NKZA 4XZCA 4UR9A 3UTKA 2QRXA 3KDSE 1DU2A 3PJAJ 3ZEFB 3CQGB 4EZHA 2NTYA 1U5PA 3EUHA 2PTFA 5FMNA 2E2AA 5ETWA 3HL6A 4TZ4C 4HWCA 3PURA 3NWIA 2VKJA 4YJ3E 2JQHA 5HWYA 5LA6E 1HF8A 1MMDA 3C64A 4AKHA 4H9RC 5J0ZA 4P0AA 3ONLC 1WYCA 3LK3B 3AE9A 3A7MA 5HXCA 1HFAA 4NUVA 4GK5E 2E9XB 3KINB 3V5UA 3CIRA 3ZJ2A 3ZSSA 5H6RB 1NENA 3O4XE 4LMJA 4U2YA 3EI0A 3EABA 1I6ZA 2CBIA 5CGMA 5HEOA 4LF5T 5FL0A 3PU8A 3BQIA 2DNXA 2OLTA 4OX9T 3CQXC 4QXBB 4O2BE 5LHGB 2BVLA 5ADXL 4KX6A 2X9WA 4ILUA 4AQYT 2KMFA 3SWHA 4AKLA 4JI3T 4HWFA 4Z90A 4HFVA 1IBKT 4IE5A 4PJNA 2K5BB 3NRXA 3Q2MA 2JQKA 5LMNT 2J1DG 3CVRA 4ZS3A 1R8IA 4A56A 3P50A 2YU2A 1OWAA 3AA0B 3FZKB 1Z8UA 3JC6D 3IBPA 4HTEA 2C5IT 2C5JA 5EZYE 2BKPA 2YU1A 5JR9B 3LFMA 3KBTA 3P7IA 4GYSA 3PUZF 3PUAA 3RHWA 1OEDC 2WQYA 1IAPA 1CHUA 1HS7A 4O4HE 4C90A 2IC6A 4YTMA 3R6NA 3M3ZB 2UUCT 4IE4A 4Z91A 3VR9A 5LGNB 1ZKEA 4YFSA 4TWHA 2XSAA 5FNVE 5AQMB 3ZT5A 3P4WA 5DQWA 3WAJA 2Y48B 4ILCA 2CXDA 2JQQA 3ESLA 4MFRA 2IW5B 5F3JA 3GN5B 4AQFA 3ZCJA 4HWIB 1JNZA 2V8SV 5LHHB 2WZHA 5AQSB 2XQ8A 4N78D 4JI6T 4PAGA 2B76A 4IDQA 2ZM8A 4AISA 1I94T 3Q5WA 1G73A 3ZSTA 3UQ4A 4GK0E 4B3ST 2A72A 3E0ZA 2BG9E 5FKYA 2CCQA 1AJ3A 3PUQA 4DMWA 5IYZE 5ABFB 3C4WA 4UF0B 4CN1A 4HFIA 3PUVF 4PNIA 2JMKA 4L5GA 2X0YA 1XDOA 2CBJA 4QX8B 1OEDB 2XQ7A 2VL8A 3OYXA 3QOFA 1B7TA 3NZPA 2ACZA 3C98B 1MIVA 3AA6B 2WAUA 2NWBA 3JADA 3HR0A 4JI1T 3F31A 4DR4T 3MKDA 4E7ZA 4HKAA 4UEMA 4IE7A 3B5MA 3OVUA 4ZI3C 4UVBB 4DMVA 2NW9A 2J47A 2VVSA 4YHJA 2YINA 4UVCB 2CRBA 3ZMTB 2ES0A 2BVMA 3ZN0B 5F8PA 2EHOC 3OBVE 3WI3A 4JEUB 2Q9QD 4LF8T 2KWHA 2W62A 2BDEA 2WZIA 4IL9A 4UXNB 2CEAA 4DR3T 3ONXA 3UU5A 2V6YB 3C50A 4WW0A 5HCMA 2PG8A 1UCUA 2DLRA 2HPLA 1KNRA 2XASB 2I6HA 4QKNA 1HNZT 3HI2A 4LF6T 3GMIA 2XAHB 5A1LA 4HFCA 2LHNA 5KX5E 3E22E 2NP9A 5HEJA 4BA9A 2IC9A 4E7SA 2YN6A 4I43B 5CB4E 4CZZB 5KMGP 2ACXA 3U3IA 4O4JE 3N9MA 2BBJA 4UELA 2UXBT 5LOVE 5C2TA 2ZM6T 5AQLB 1WYBA 4KI0F 3ZN1B 2I59A 2QGSA 2V7IA 4O2AE 4O4IE 2YDRA 2XJ7A 1OEDA 4HGAA 2XAGB 5JREA 2FJDA 2YEVC 3GWHA 2EHOB 4ZHQE 4JI5T 2CLYC 1ZP0A 4IREA 4DBQA 2D0TA 3E08A 2W66A 2XTLA 4U31A 5HXHA 4HWHA 4OK0A 5CFBA 4B3MT 3PV0F 2QYWA 3AXJA 3KV9A 4YSYA 2CHOA 4WBNE 4UV9B 3U78A 3AE4A 1FMWA 3J9X1 5AQOB 2MOZA 1UUSA 3ZLIA 4LF4T 2LSGA 4DUYT 4LFAT 2JRKA 2NR4A 3MZKB 1MIWA 4C91A 3KV5A 1XNRT 2V6YA 5LBMA 2BS3A 3ZYMA 2LSJA 3SS1A 4DR2T 3LK42 4AKIA 4DR1T 4HE8A 1QSDA 4EEDA 1LKXA 2KSRA 3PUGA 3B57A 5EK3A 4F6RC 4DV2T 4HN9A 2MAWA 3BQLA 3RC8A 4HFDA 1VOMA 2IUBA 2X68A 5AQGB 1IBLT 2HHHT 1XWMA 1FJGT 5FVLA 3H3MA 3NVOA 2H3RA 2K9AA 2GK9A 2E9XC 4OHFA 4JEHB 2CLYB 5AQKB 4AKRB 2DWGA 3JCFA 4NXMT 3RYIE 3VRBA 4TWDA 4X1KE 3RIUC 2PFVA 4IDZA 4AQGA 1XMOT 4YTPA 5AQUB 2CPTA 4DVDA 4DO0A 2JPFA 4O8SA 3C4XA 1CUNA 1BR0A 2XSBA 4QWNB 4COFA 4U74A 2ZM2A 3KBUA 2EHOA 3AEEA 3AAAB 4MALA 4PK6A 4CXYA 3P8CD 1LRZA 3RC3A 5DJQC 1UGOA 3M65A 1E7PA 4CQIA 1T72A 3RF1A 4IL4A 3UQ7A 2WMNA 3UU3A 3MK7C 3BQKA 3CWZB 1YKHB 4IIJE 1V9DA 3CKDA 4NPPA 3RGLA 4OYKA 4I50E 3SRZA 5LCYA 2WP9A 4X62T 3DTOA 1N34T 3RYFE 4HFHA 2V7KA 2V5CA 4JI0T 1XZYA 4YTNA 5JDMA 1FEWA 4EYYR 5JR9C 3UULA 2DWKA 2BBHA 2HPJA 5JRCB 3FZFB 3RYCE 4WYVA 3GA8A 3O1IA 5AQTB 3LSVA 2X0HA 2FJBA 3CQCB 3PJAA 1X9BA 1KNPA 2XM2A 2X0LB 4EIWA 2WM9A 3ZKRA 3UUNA 4JUYA 3K8PC 1BR2A 3EAMA 2LHRA 4EV6A 3AE2A 2CWYA 5IWAT 4DV6T 1VCSA 1L0VA 4A5XA 3ANWB 2LM2A 3FBLA 4H9OC 4DV5T 2ZMAA 5JH7E 5L4EA 5AFUL 2KINB 2FBWA 1YQ4A 3TLTA 4ZI2C 2LLYA 2CXFA 2NW8A 1SE7A 2D5UA 3JAEA 5LGTB 3MJXA 2LM9A 5DABA 3RH3A 4Q25A 3ZC0A 5FP3A 2CA5A 4U2ZA 5H6QB 2YOEA 4ZI3D 5FY1A 2X9YA 2W61A 4P1NA 2ODVA 5LG4A 2EHOD 4CN6A 1IZNB 2NW7A 3Q9DA 5JVDE 3AEGA 4TX5A 2VL0A 5L3CB 1G8XA 1YXRA 3AVRA 3AE5A 2J62A 5AQHB 2BS4A 4DV0T 3ZCIA 4IHJE 4OYJA 1D1BA 3UU4A 2E9XA 2CMRA 2XQ6A 2SPCA 2KXPB 2P9BA 4A97A 4KP3C 3RIUA 2D9DA 3AE8A 4PK5A 4X1IE 4CI1B 4TUYE 3TLWA 3AE3A 3AECA 4AXPA 3N9PA 4PFOA 2J4GA 4ERRA 3J7Yq 2LJLA 4ZZBA 5FXZA 4ZZCA
chains in the Genus database with same CATH topology
2DCFA 2KWIB 2M67A 5LOVE 5LXTE 2XHEB 4P09A 3DP7A 4TV9E 2K48A 3B13A 3L3PA 5J1GA 1WLXA 3ZPOA 4XBFB 1WYBA 3UUMA 3LJCA 3UT5E 3K3OA 1IJ5A 3SOLA 3ZN1B 3N2GE 4CXWA 2I59A 4PJMA 5EK2A 2QGSA 4DBRA 3D0TA 2V7IA 3KVAA 1D0YA 4AKGA 4O2AE 4O4IE 1YW0A 4EZ4A 4TV8E 3KV6A 4QX7B 2V7MA 3A5XA 3I9YA 4AQFC 4HGAA 5LJMA 1D0XA 2XAGB 3QUJA 5JREA 2YEVC 1UX4A 3GWHA 2L9QA 2EHOB 4ZHQE 3CMLA 4PW8A 2X51A 3RKOA 2CLYC 4EOZB 3R84B 3N9LA 2X9XA 2B1EA 5L3BB 4XZCA 3UTKA 2CWOA 4DBQA 2D0TA 1QUUA 5FXWA 3W15B 3KDSE 3E08A 3ZEFB 5JR9A 2XTLA 4H9NC 5J2UE 5HXHA 3CQGB 4OK0A 4GYRA 4EZHA 3PTRB 2NTYA 4FJOA 1U5PA 2Q9QA 3KV9A 4KMCA 4UV8B 4WBNE 3JC6C 3EUHA 1S35A 4UV9B 3U78A 4EXTA 5FMNA 5HAXA 2LOPA 4EYUA 5ETWA 1FMWA 3J9X1 3HL6A 4ASKA 4TZ4C 2MOZA 2N1GA 4GOUA 4HEAA 3ZLIA 2KZ7B 3PURA 4MHCA 1LVKA 2LSGA 4P0BA 4X1YE 5M4YA 1T98A 2VKJA 5L3GB 3AB3B 4YJ3E 4PFPA 2KNDA 2JRKA 3EDUA 3UFEA 3Q5XA 3MZKB 1MIWA 5HWYA 3KV5A 5LA6E 4C91A 5JRCA 3O9XA 1HF8A 4WNKA 5HYAA 4EB6E 1MMDA 5FXVA 3PDYA 3C64A 5LBMA 3UUXB 4AKHA 3ZYMA 2LSKA 2LSJA 3F57A 3N9NA 1HCIA 1MMNA 4H9RC 4QHOA 3SS1A 2V7LA 5L3DB 4P0AA 2L3LA 1WYCA 4YLHA 3WAKA 3LK3B 5HXCA 1ZHCA 3LK42 4QXCB 4AKIA 1HFAA 2VASA 4GK5E 4NUVA 2XAJB 4H63V 5HXEA 2E9XB 2MYSA 3L09A 3KINB 3V5UA 5C8YE 3GN5A 4H63H 4HE8A 5LYJE 3ZJ2A 5H6RB 1QSDA 1LKXA 3O4XE 3N2OA 3PUGA 3B57A 3T8OA 5EK3A 4F6RC 1E1HB 4UVAB 4HN9A 3RC8A 3BQLA 5JDQA 1VOMA 3OKQA 2E9XD 2X68A 3O1HA 5FY0A 3PU8A 3BQIA 5BMVE 2DNXA 2V26A 4CI2B 4JLEA 3CQXC 2H3RA 4QXBB 4O2BE 2JMHA 3IEEA 5LHGB 2K9AA 3ANWA 2GK9A 2BVLA 2E9XC 4OHFA 4JEHB 2W00A 4XAXB 4OFZA 5ADXL 2CLYB 4IE6A 2X9WA 4ILUA 4AKRB 2DWGA 2A2FX 2KMFA 3FBZA 4PK4A 2WSSV 2X67A 3H37A 4UF0A 3RYIE 3QK6A 3SWHA 4AKLA 3N5LA 4X1KE 2L8KA 2LT3A 2PFVA 4IDZA 4AQGA 3ZC1A 3CX8B 1HG2A 3FXDB 4HFVA 5HXRA 5L2LA 4DVDA 4AI6A 4DO0A 2JPFA 4IE5A 4O8SA 4PJNA 5L3EB 2K5BB 3C4XA 3C4ZA 4U72A 3ZYLA 1US7B 3I0OA 3NRXA 1MMGA 1CUNA 3Q2MA 1BR0A 4YJ2E 1Z0PA 4QWNB 5LBQB 2J1DG 2PJQA 4U74A 3CVRA 4ZS3A 1MMAA 2ZM2A 3LBXB 3KBUA 2EHOA 4H9QC 4KUMB 3AAAB 4FI5A 4A56A 3LK2B 1D1AA 5J2TE 4MALA 2YU2A 4PK6A 1OWAA 3P8CD 4CXYA 1NWMX 4K0UA 2XAFB 1LRZA 3RC3A 3AA0B 5DJQC 3JC6D 3M65A 3KFWX 4ISSA 4CQIA 2K24A 3EDVA 3VU7H 3C51A 1HTJF 1SA0E 3BK9A 3LG7A 3IBPA 3ETUA 2W0GA 2WBLA 4HTEA 2WMNA 2C5IT 2C5JA 5EZYE 1FMVA 3MK7C 5LGUB 3BQKA 3CWZB 1WRDA 2YU1A 1MNEA 2PBIA 5JR9B 1YKHB 2CE7A 4IIJE 1V9DA 4I4TE 3LFMA 4MBQA 3KBTA 3TKLB 3P7IA 3CKDA 4GYSA 3F2EA 2Y6XA 4OYKA 4I50E 3PUAA 1D0ZA 3SRZA 4NUUA 3AA1B 5LCYA 3DTOA 3FXEB 2XQYA 1IAPA 5HWXA 1O3XA 3ZMUB 2MTQA 1HS7A 2BZBA 1BR4A 4O4HE 3RYFE 1LVFA 1Y64B 3FB2A 5LHIB 2H7OA 5FXXA 4C90A 2V7KA 2IC6A 2VKDA 3R6NA 2WWUA 3K3NA 3HKBE 3RX6A 3RYHE 5JDMA 1FEWA 4EYYR 5JR9C 4IE4A 5GONE 2CM0A 3K3QC 1ZKEA 2DWKA 3UULA 1HX8A 5LGNB 2HH7A 3RPUA 3N9QA 2HPJA 4YFSA 5JRCB 2Q9QC 4EAHA 5CA0E 3ZJ1A 5LNKA 5FNVE 3RYCE 4J2CA 3AVSA 3GA8A 3O1IA 3ZMVB 5DQWA 2VB6A 3WAJA 2Y48B 5EK4A 1OXZA 2CXDA 3NBXX 4DNDA 2JQQA 1NAFA 3OYZA 3ESLA 4MFRA 2IW5B 3HKEE 5F3JA 3GN5B 2YK0A 4AQFA 1U4QA 3ZCJA 2NOXA 3I1AA 3O1JA 4ISTA 3CQCB 2VK9A 4ZS2A 5LHHB 2DI4A 2V7JA 5HXSA 2LSIA 4L9IA 2X0LB 4EIWA 4CXXA 2WM9A 4N78D 3UUNA 3NZQA 4PAGA 5JQGE 4JUYA 3AAIA 3K8PC 2V1DB 4KBMB 2ZM8A 1BR2A 2LHRA 2WMOA 2CWYA 3I0QA 3Q5WA 3CX7B 1G73A 2N9DA 4GK0E 3RRWA 4ZI2D 2A72A 3ANWB 3E0ZA 4H9SE 3FBLA 2Z6EA 4UIGA 4H9OC 3DJBA 2ZMAA 2CCQA 3IF8B 1SHZC 4ADZA 2ZLYA 3FHNA 5JH7E 5AFUL 2KINB 1AJ3A 3PUQA 5CA1E 4DMWA 4B6XA 5IYZE 3LBXA 4X20E 2Y8DA 3C4WA 4UF0B 5TAOA 4ZI2C 3H3AA 4BJNA 3HKDE 4G63A 3RRCA 2CXFA 1IJ6A 2NW8A 2XAQB 2D5UA 5JDNA 2C5KT 4PNIA 1ZEEA 3I9WA 2JMKA 5LGTB 2NTXA 3PUSA 3MJXA 4L5GA 2LM9A 1S94A 4QX8B 2LOSA 5DABA 1H7CA 1HG5A 3RH3A 2VL8A 4ZI7E 3OYXA 1B7TA 2ZM0A 3ZC0A 3S4UA 3NZPA 2LEHA 3N2KE 4GIWA 1MIYA 4ZOLE 3C98B 2CA5A 5FP3A 1MIVA 3AA6B 2WAUA 2NWBA 4TN7B 5H6QB 4ZI3D 3HR0A 3KV4A 5JDGA 4BAYB 2W63A 2KT9A 5FY1A 2X9YA 3F31A 2X9HA 1D1CA 2W61A 3MKDA 4E7ZA 2E8IA 2ODVA 4HKAA 3HKCE 4UEMA 3VKHA 2QA7A 3PE0A 4IE7A 2IAKA 5LG4A 1KK7A 2EHOD 5DQVA 4ZI3C 4BJMA 4O4LE 1IZNB 4UVBB 4DMVA 2VWAA 2NW9A 2Q9QB 3AA7B 5JDHA 3HA4A 3AAEB 3ZMSB 2NW7A 3Q9DA 4YHJA 2YINA 3CPZA 5JVDE 4UVCB 3ZMTB 2ES0A 1X79A 2BVMA 3ZN0B 4TX5A 2EHOC 3OBVE 5F8PA 2OA5A 3WI3A 5FY7A 1KNZA 2JJ9A 4V1Av 3EVYA 5L3CB 4IE0A 1G8XA 3MACA 3AVRA 4JEUB 2N2NA 3V5SA 2Q9QD 4PJJA 3ZCIA 4M1PA 2KWHA 2W62A 1FIOA 2G0UA 4IHJE 2KLQA 2UXNB 2BDEA 4OYJA 1D1BA 2RA1A 1ZV4X 2E9XA 4I55E 2CMRA 4UXNB 1YD8G 5LP6E 2CEAA 3ONXA 2H7VC 2SPCA 2CXLA 3VHLA 2DHRA 2KXPB 3C50A 4WW0A 2PG8A 2LSYA 2X66A 4WBOA 4CI3B 1UCUA 2P9BA 2A3DA 5FYMA 2VKHA 5LJNA 2DLRA 2HPLA 4KP3C 5KDMC 2C0SA 3ZMZB 3MXZA 2XASB 3PU3A 3N9OA 4PK5A 5JDLA 4QKNA 4X1IE 2MBGA 2UXXB 3ETVA 3HI2A 2D0UA 4MLKA 4Z8XA 3GMIA 5JDFA 2XAHB 4CI1B 3VKGA 5A1LA 1BR1A 2LHNA 3NRYA 4G2AA 4TUYE 4ANJA 5KX5E 4PJLA 1EZ3A 2VKOA 3OJAA 5L3FB 3E22E 2NP9A 3CX6B 1YKEB 2XUEA 2D2SA 4BA9A 2IC9A 4E7SA 4AXPA 4IGUA 1MNDA 3N9PA 4I43B 4PFOA 5CB4E 5IHYA 1WR6A 2RP4A 3MA9A 4ERRA 4QXHB 4CZZB 1UX5A 2ODUA 3ZYKA 5KMGP 2ACXA 3U3IA 3J7Yq 4O4JE 3KVBA 4L0RA 3N9MA 5E0OA 2LJLA 4UELA 3QC9A 1VRBA 5FXZA 3IHRA 4H9PC 2LE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7J A;  3BK9 A;  2NW7 A;  4U74 A;  4PW8 A;  2NWB A;  5EK3 A;  2X66 A;  2V7K A;  2X67 A;  2V7L A;  4PK6 A;  5ETW A;  2NW8 A;  2X68 A;  2D0T A;  5EK4 A;  5EK2 A;  3E08 A;  1ZEE A;  4HKA A;  4PK5 A;  2V7I A;  1YW0 A;  2D0U A;  2NOX A;  4U72 A;  2V7M A;  2NW9 A; 
#chains in the Genus database with same CATH topology
 2KWI B;  4TV9 E;  2K48 A;  3B13 A;  5J1G A;  1WLX A;  3ZPO A;  3UUM A;  1IJ5 A;  3N2G E;  4CXW A;  4PJM A;  5EK2 A;  5AQJ B;  3D0T A;  4DBR A;  1XDP A;  3PUW F;  3OTO T;  3Q5E A;  4DV4 T;  4EZ4 A;  4TV8 E;  2FJE A;  4QX7 B;  3A5X A;  5LJM A;  1D0X A;  3AED A;  3QUJ A;  1UX4 A;  5FL1 A;  3VR8 A;  4PW8 A;  3R84 B;  3N9L A;  2WU5 A;  2CWO A;  2A9U A;  5FXW A;  3W15 B;  3G06 A;  5KXJ A;  5JR9 A;  3PTR B;  3JAF A;  4FJO A;  4NIQ A;  4KMC A;  2UUA T;  3JC6 C;  1S35 A;  5HAX A;  2BS2 A;  4JI4 T;  5L47 A;  4QH1 A;  2KZ7 B;  4MHC A;  5M4Y A;  1T98 A;  3AB3 B;  4PFP A;  3UFE A;  1WFD A;  4X64 T;  3O9X A;  4EB6 E;  2H89 A;  2LSK A;  4QHO A;  1MMN A;  5L3D B;  3Q5D A;  2R6G F;  4YLH A;  3WAK A;  1J5W A;  2XQ4 A;  4QXC B;  3QB5 A;  2XAJ B;  3L09 A;  5C8Y E;  3GN5 A;  3P4S A;  4H63 H;  5LYJ E;  5L4H A;  2DL1 A;  3RQU A;  2BG9 C;  4DR6 T;  5LB7 B;  5JTG A;  1E1H B;  2IML A;  2IIU A;  2M6I A;  2E9X D;  3O1H A;  2XQ9 A;  2WS3 A;  2V26 A;  1W0A A;  5LMU T;  4CI2 B;  4JLE A;  4LF7 T;  2JMH A;  3LDQ B;  4XAX B;  4OFZ A;  4IE6 A;  2WDQ A;  3TLS A;  4X5T A;  5ABF A;  4PK4 A;  3H37 A;  2X67 A;  4UF0 A;  3QK6 A;  1KF6 A;  3CX8 B;  3FXD B;  5L3E B;  3C4Z A;  1US7 B;  1MMG A;  4YJ2 E;  1Z0P A;  5LBQ B;  2PJQ A;  4U3C A;  3QNU A;  4KUM B;  2E5V A;  2XZE A;  4FI5 A;  1D1A A;  5J2T E;  2BKO A;  2XQA A;  1NWM X;  4K0U A;  3RQW A;  2XAF B;  4ISS A;  2K24 A;  3EDV A;  3VU7 H;  3C51 A;  1SA0 E;  3LG7 A;  1J1J A;  2VVN A;  3ETU A;  2UUB T;  5C3J A;  1FMV A;  4JI7 T;  1WRD A;  1MNE A;  2PBI A;  3P4Q A;  4MBQ A;  3RLF F;  3TKL B;  2Y6X A;  1D0Z A;  3AA1 B;  2BG9 B;  4WZX A;  1W9R A;  5HWX A;  1O3X A;  3ZMU B;  4K0K T;  2BZB A;  3AE7 A;  3UFG A;  1LVF A;  2VKD A;  4EEB A;  2HN2 A;  3HKB E;  1W09 A;  1M7K A;  3RYH E;  5GON E;  2CM0 A;  2WCA A;  4TNV A;  1HX8 A;  2HH7 A;  3RPU A;  2Q9Q C;  2WDR A;  4EAH A;  5CA0 E;  3ZJ1 A;  1E2A A;  3RI5 A;  4JBW F;  4YHH T;  3ZMV B;  4NXN T;  3P4P A;  1NAF A;  4JI2 T;  3HKE E;  2YK0 A;  1HR0 T;  2NOX A;  3I1A A;  3O1J A;  4IST A;  1M62 A;  1JNR A;  2DI4 A;  5HXS A;  2LSI A;  4L9I A;  5LG3 A;  5JQG E;  1XMQ T;  3AAI A;  2V1D B;  1HNW T;  4YT0 A;  2CHN A;  2JQ9 A;  2WMO A;  1T7S A;  3I0Q A;  4IDP A;  2N9D A;  3RRW A;  4ZI2 D;  4H9S E;  3DJB A;  4QH4 A;  4ADZ A;  2ZLY A;  1YQ3 A;  4B6X A;  1KEY A;  3CK6 A;  2Y8D A;  2BKN A;  3H3A A;  3HKD E;  3RRC A;  5ABH A;  1IJ6 A;  1W0B A;  2C5K T;  1ZEE A;  3I9W A;  1QLB A;  2NTX A;  2XQ3 A;  3PUS A;  1VCT A;  3ZT6 A;  4B3R T;  1S94 A;  4ZI7 E;  2ZM0 A;  4LFB T;  2MPK A;  4HWD A;  2LEH A;  4GIW A;  3KV4 A;  4BAY B;  3SFD A;  2UU9 T;  3HKC E;  2QA7 A;  3PE0 A;  2IAK A;  4BJM A;  2Q9Q B;  3UU8 A;  3HA4 A;  3AAE B;  2BG9 A;  3CPZ A;  1X79 A;  2XY8 B;  2OA5 A;  5FY7 A;  5HEG A;  1KNZ A;  4V1A v;  4IE0 A;  3MAC A;  4PJJ A;  1FIO A;  2G0U A;  2KLQ A;  2RA1 A;  5AQN B;  3L39 A;  1YD8 G;  5LP6 E;  3T1Y T;  2IHR 1;  2H7V C;  1WCR A;  3P4R A;  3VRA A;  4DV1 T;  2LSY A;  2X66 A;  4CI3 B;  5HEH A;  5LJN A;  4DV7 T;  3MXZ A;  5JDL A;  5HCJ A;  2H88 A;  1OED E;  3ETV A;  4MLK A;  2D0U A;  4Z8X A;  5JDF A;  3VKG A;  1BR1 A;  4ANJ A;  4PJL A;  4ILB A;  3OJA A;  5L3F B;  1YKE B;  4IT4 A;  2FUP A;  2D2S A;  2YDQ A;  4LF9 T;  2RP4 A;  3MA9 A;  3AE6 A;  3UU6 A;  2ODU A;  3ZYK A;  4I0U A;  3KVB A;  3AEB A;  5E0O A;  2LE8 A;  3A8Y C;  2DCF A;  4ZXL A;  4HFB A;  2XHE B;  4P09 A;  2FJA A;  3IA3 A;  5AQQ B;  3LJC A;  3UT5 E;  3K3O A;  3SOL A;  3KVA A;  1D0Y A;  1YW0 A;  4IDO A;  2V7M A;  3T1H T;  4JI8 T;  2L9Q A;  2UXC T;  3RKO A;  4LFC T;  2W2U A;  2X9X A;  2B1E A;  5L3B B;  1QUU A;  4H9N C;  2HN1 A;  5J2U E;  4GYR A;  1Y01 A;  4DR5 T;  4LMK A;  2Q9Q A;  4YXD A;  4X65 T;  4UV8 B;  3K1S A;  2QVA A;  4EXT A;  1T8B A;  2LOP A;  4EYU A;  4JV5 T;  4ASK A;  3QB5 K;  2N1G A;  4GOU A;  4U7I A;  4HEA A;  4YSX A;  1LVK A;  4P0B A;  4X1Y E;  2YDS A;  2KND A;  3EDU A;  4TNW A;  3Q5X A;  5JRC A;  4WNK A;  5HYA A;  5FXV A;  3PDY A;  3UUX B;  5CJ5 A;  3FZH B;  3F57 A;  3N9N A;  1HCI A;  2V7L A;  2L3L A;  1GQE A;  1ZHC A;  2F4V T;  2VAS A;  4H63 V;  5HXE A;  2MYS A;  3ONJ A;  4ILA A;  3UUB A;  4IDN A;  3N2O A;  4AIU A;  3T8O A;  5AQP B;  2K3W A;  4UVA B;  3EHZ A;  5JDQ A;  3OKQ A;  1KFY A;  5FY0 A;  5BMV E;  2AXD S;  3IEE A;  2M6B A;  3ANW A;  2W00 A;  1N33 T;  4DV3 T;  2A2F X;  5FVK A;  3FBZ A;  2WSS V;  3N5L A;  2L8K A;  2LT3 A;  3ZC1 A;  1NEK A;  1HG2 A;  5HXR A;  5L2L A;  4AI6 A;  3SFE A;  3ZT7 A;  4U72 A;  3ZYL A;  3I0O A;  1MMA A;  3LBX B;  2V5D A;  4H9Q C;  5ABG A;  3LK2 B;  5HEU A;  1IBM T;  5BR8 T;  4CN4 A;  4A98 A;  3KFW X;  3PUY F;  1HTJ F;  3BK9 A;  5IUX A;  2W0G A;  2WBL A;  2WWV A;  5LGU B;  2CE7 A;  4I4T E;  3F2E A;  1ZOY A;  3AXJ B;  4NUU A;  4YSZ A;  3FXE B;  2XQY A;  2MTQ A;  1XNQ T;  2LKG A;  1BR4 A;  4JYA T;  1Y64 B;  3FB2 A;  5LHI B;  2H7O A;  5FXX A;  5AQI B;  2WWU A;  4TWF A;  3K3N A;  2OV9 A;  3RX6 A;  2XPK A;  2RPA A;  3K3Q C;  4KHZ F;  3X1D A;  2I0M A;  3N9Q A;  5LNK A;  4HFE A;  4J2C A;  4U33 A;  4ZEY A;  3AVS A;  4DID B;  2V6X A;  2VB6 A;  5EK4 A;  1OXZ A;  3NBX X;  4LML A;  4DND A;  3OYZ A;  1SUM B;  4DUZ T;  1U4Q A;  1N36 T;  2VK9 A;  4ZS2 A;  1WR0 A;  2V7J A;  4QH5 A;  4CXX A;  3NZQ A;  4X66 T;  4KBM B;  5AQV B;  3CX7 B;  4KHP T;  4UIG A;  2Z6E A;  3IF8 B;  1SHZ C;  5ABE A;  3FHN A;  4U7Y A;  3AEF A;  5CA1 E;  3LBX A;  4DR7 T;  1UK5 A;  4X20 E;  2VQE T;  5TAO A;  4BJN A;  4G63 A;  3RIA A;  3TLU A;  4F8H A;  3RIF A;  2XAQ B;  5JDN A;  1HX1 B;  2LOS A;  3RKG A;  2XM1 A;  1H7C A;  1HG5 A;  3L8R A;  3S4U A;  3N2K E;  1MIY A;  4ZOL E;  2AE9 A;  4TN7 B;  5JDG A;  2W63 A;  2KT9 A;  2X9H A;  1D1C A;  2E8I A;  3VKH A;  1KK7 A;  5DQV A;  2VUR A;  4O4L E;  2JIW A;  2VWA A;  2E5L T;  3AA7 B;  5JDH A;  1UUR A;  3ZMS B;  3ABV A;  2LKH A;  5AQF B;  2JJ9 A;  3EVY A;  2W4X A;  2LRK A;  2N2N A;  3V5S A;  4GKK T;  4M1P A;  3TLV A;  2UXN B;  1ZV4 X;  4I55 E;  3AEA A;  3OPC A;  2W67 A;  2CXL A;  2WY2 A;  3FZM B;  3VHL A;  2DHR A;  1N32 T;  4WBO A;  2A3D A;  5FYM A;  2VKH A;  2IDO B;  3PUX F;  2WU2 A;  5KDM C;  2C0S A;  3ZMZ B;  3PU3 A;  3N9O A;  2MBG A;  2UXX B;  4YY3 T;  4G2A A;  3NRY A;  5F5W A;  1EZ3 A;  2VKO A;  3CX6 B;  2XUE A;  4GKJ T;  3FZL B;  4IGU A;  1MND A;  2VQF T;  4EGW A;  5IHY A;  1WR6 A;  4QXH B;  1UX5 A;  1J5E T;  4L0R A;  3QC9 A;  1VRB A;  2WB5 A;  3IHR A;  2LRL A;  4H9P C;  5L3G B;  2M67 A;  5LXT E;  3DP7 A;  3L3P A;  4XBF B;  2WDV A;  4B3T T;  3AE1 A;  4AKG A;  5AQR B;  1HNX T;  3KV6 A;  3I9Y A;  4AQF C;  2YKS A;  3CML A;  2UXD T;  2X51 A;  2XQ5 A;  4EOZ B;  3NKZ A;  4XZC A;  4UR9 A;  3UTK A;  2QRX A;  3KDS E;  1DU2 A;  3PJA J;  3ZEF B;  3CQG B;  4EZH A;  2NTY A;  1U5P A;  3EUH A;  2PTF A;  5FMN A;  2E2A A;  5ETW A;  3HL6 A;  4TZ4 C;  4HWC A;  3PUR A;  3NWI A;  2VKJ A;  4YJ3 E;  2JQH A;  5HWY A;  5LA6 E;  1HF8 A;  1MMD A;  3C64 A;  4AKH A;  4H9R C;  5J0Z A;  4P0A A;  3ONL C;  1WYC A;  3LK3 B;  3AE9 A;  3A7M A;  5HXC A;  1HFA A;  4NUV A;  4GK5 E;  2E9X B;  3KIN B;  3V5U A;  3CIR A;  3ZJ2 A;  3ZSS A;  5H6R B;  1NEN A;  3O4X E;  4LMJ A;  4U2Y A;  3EI0 A;  3EAB A;  1I6Z A;  2CBI A;  5CGM A;  5HEO A;  4LF5 T;  5FL0 A;  3PU8 A;  3BQI A;  2DNX A;  2OLT A;  4OX9 T;  3CQX C;  4QXB B;  4O2B E;  5LHG B;  2BVL A;  5ADX L;  4KX6 A;  2X9W A;  4ILU A;  4AQY T;  2KMF A;  3SWH A;  4AKL A;  4JI3 T;  4HWF A;  4Z90 A;  4HFV A;  1IBK T;  4IE5 A;  4PJN A;  2K5B B;  3NRX A;  3Q2M A;  2JQK A;  5LMN T;  2J1D G;  3CVR A;  4ZS3 A;  1R8I A;  4A56 A;  3P50 A;  2YU2 A;  1OWA A;  3AA0 B;  3FZK B;  1Z8U A;  3JC6 D;  3IBP A;  4HTE A;  2C5I T;  2C5J A;  5EZY E;  2BKP A;  2YU1 A;  5JR9 B;  3LFM A;  3KBT A;  3P7I A;  4GYS A;  3PUZ F;  3PUA A;  3RHW A;  1OED C;  2WQY A;  1IAP A;  1CHU A;  1HS7 A;  4O4H E;  4C90 A;  2IC6 A;  4YTM A;  3R6N A;  3M3Z B;  2UUC T;  4IE4 A;  4Z91 A;  3VR9 A;  5LGN B;  1ZKE A;  4YFS A;  4TWH A;  2XSA A;  5FNV E;  5AQM B;  3ZT5 A;  3P4W A;  5DQW A;  3WAJ A;  2Y48 B;  4ILC A;  2CXD A;  2JQQ A;  3ESL A;  4MFR A;  2IW5 B;  5F3J A;  3GN5 B;  4AQF A;  3ZCJ A;  4HWI B;  1JNZ A;  2V8S V;  5LHH B;  2WZH A;  5AQS B;  2XQ8 A;  4N78 D;  4JI6 T;  4PAG A;  2B76 A;  4IDQ A;  2ZM8 A;  4AIS A;  1I94 T;  3Q5W A;  1G73 A;  3ZST A;  3UQ4 A;  4GK0 E;  4B3S T;  2A72 A;  3E0Z A;  2BG9 E;  5FKY A;  2CCQ A;  1AJ3 A;  3PUQ A;  4DMW A;  5IYZ E;  5ABF B;  3C4W A;  4UF0 B;  4CN1 A;  4HFI A;  3PUV F;  4PNI A;  2JMK A;  4L5G A;  2X0Y A;  1XDO A;  2CBJ A;  4QX8 B;  1OED B;  2XQ7 A;  2VL8 A;  3OYX A;  3QOF A;  1B7T A;  3NZP A;  2ACZ A;  3C98 B;  1MIV A;  3AA6 B;  2WAU A;  2NWB A;  3JAD A;  3HR0 A;  4JI1 T;  3F31 A;  4DR4 T;  3MKD A;  4E7Z A;  4HKA A;  4UEM A;  4IE7 A;  3B5M A;  3OVU A;  4ZI3 C;  4UVB B;  4DMV A;  2NW9 A;  2J47 A;  2VVS A;  4YHJ A;  2YIN A;  4UVC B;  2CRB A;  3ZMT B;  2ES0 A;  2BVM A;  3ZN0 B;  5F8P A;  2EHO C;  3OBV E;  3WI3 A;  4JEU B;  2Q9Q D;  4LF8 T;  2KWH A;  2W62 A;  2BDE A;  2WZI A;  4IL9 A;  4UXN B;  2CEA A;  4DR3 T;  3ONX A;  3UU5 A;  2V6Y B;  3C50 A;  4WW0 A;  5HCM A;  2PG8 A;  1UCU A;  2DLR A;  2HPL A;  1KNR A;  2XAS B;  2I6H A;  4QKN A;  1HNZ T;  3HI2 A;  4LF6 T;  3GMI A;  2XAH B;  5A1L A;  4HFC A;  2LHN A;  5KX5 E;  3E22 E;  2NP9 A;  5HEJ A;  4BA9 A;  2IC9 A;  4E7S A;  2YN6 A;  4I43 B;  5CB4 E;  4CZZ B;  5KMG P;  2ACX A;  3U3I A;  4O4J E;  3N9M A;  2BBJ A;  4UEL A;  2UXB T;  5LOV E;  5C2T A;  2ZM6 T;  5AQL B;  1WYB A;  4KI0 F;  3ZN1 B;  2I59 A;  2QGS A;  2V7I A;  4O2A E;  4O4I E;  2YDR A;  2XJ7 A;  1OED A;  4HGA A;  2XAG B;  5JRE A;  2FJD A;  2YEV C;  3GWH A;  2EHO B;  4ZHQ E;  4JI5 T;  2CLY C;  1ZP0 A;  4IRE A;  4DBQ A;  2D0T A;  3E08 A;  2W66 A;  2XTL A;  4U31 A;  5HXH A;  4HWH A;  4OK0 A;  5CFB A;  4B3M T;  3PV0 F;  2QYW A;  3AXJ A;  3KV9 A;  4YSY A;  2CHO A;  4WBN E;  4UV9 B;  3U78 A;  3AE4 A;  1FMW A;  3J9X 1;  5AQO B;  2MOZ A;  1UUS A;  3ZLI A;  4LF4 T;  2LSG A;  4DUY T;  4LFA T;  2JRK A;  2NR4 A;  3MZK B;  1MIW A;  4C91 A;  3KV5 A;  1XNR T;  2V6Y A;  5LBM A;  2BS3 A;  3ZYM A;  2LSJ A;  3SS1 A;  4DR2 T;  3LK4 2;  4AKI A;  4DR1 T;  4HE8 A;  1QSD A;  4EED A;  1LKX A;  2KSR A;  3PUG A;  3B57 A;  5EK3 A;  4F6R C;  4DV2 T;  4HN9 A;  2MAW A;  3BQL A;  3RC8 A;  4HFD A;  1VOM A;  2IUB A;  2X68 A;  5AQG B;  1IBL T;  2HHH T;  1XWM A;  1FJG T;  5FVL A;  3H3M A;  3NVO A;  2H3R A;  2K9A A;  2GK9 A;  2E9X C;  4OHF A;  4JEH B;  2CLY B;  5AQK B;  4AKR B;  2DWG A;  3JCF A;  4NXM T;  3RYI E;  3VRB A;  4TWD A;  4X1K E;  3RIU C;  2PFV A;  4IDZ A;  4AQG A;  1XMO T;  4YTP A;  5AQU B;  2CPT A;  4DVD A;  4DO0 A;  2JPF A;  4O8S A;  3C4X A;  1CUN A;  1BR0 A;  2XSB A;  4QWN B;  4COF A;  4U74 A;  2ZM2 A;  3KBU A;  2EHO A;  3AEE A;  3AAA B;  4MAL A;  4PK6 A;  4CXY A;  3P8C D;  1LRZ A;  3RC3 A;  5DJQ C;  1UGO A;  3M65 A;  1E7P A;  4CQI A;  1T72 A;  3RF1 A;  4IL4 A;  3UQ7 A;  2WMN A;  3UU3 A;  3MK7 C;  3BQK A;  3CWZ B;  1YKH B;  4IIJ E;  1V9D A;  3CKD A;  4NPP A;  3RGL A;  4OYK A;  4I50 E;  3SRZ A;  5LCY A;  2WP9 A;  4X62 T;  3DTO A;  1N34 T;  3RYF E;  4HFH A;  2V7K A;  2V5C A;  4JI0 T;  1XZY A;  4YTN A;  5JDM A;  1FEW A;  4EYY R;  5JR9 C;  3UUL A;  2DWK A;  2BBH A;  2HPJ A;  5JRC B;  3FZF B;  3RYC E;  4WYV A;  3GA8 A;  3O1I A;  5AQT B;  3LSV A;  2X0H A;  2FJB A;  3CQC B;  3PJA A;  1X9B A;  1KNP A;  2XM2 A;  2X0L B;  4EIW A;  2WM9 A;  3ZKR A;  3UUN A;  4JUY A;  3K8P C;  1BR2 A;  3EAM A;  2LHR A;  4EV6 A;  3AE2 A;  2CWY A;  5IWA T;  4DV6 T;  1VCS A;  1L0V A;  4A5X A;  3ANW B;  2LM2 A;  3FBL A;  4H9O C;  4DV5 T;  2ZMA A;  5JH7 E;  5L4E A;  5AFU L;  2KIN B;  2FBW A;  1YQ4 A;  3TLT A;  4ZI2 C;  2LLY A;  2CXF A;  2NW8 A;  1SE7 A;  2D5U A;  3JAE A;  5LGT B;  3MJX A;  2LM9 A;  5DAB A;  3RH3 A;  4Q25 A;  3ZC0 A;  5FP3 A;  2CA5 A;  4U2Z A;  5H6Q B;  2YOE A;  4ZI3 D;  5FY1 A;  2X9Y A;  2W61 A;  4P1N A;  2ODV A;  5LG4 A;  2EHO D;  4CN6 A;  1IZN B;  2NW7 A;  3Q9D A;  5JVD E;  3AEG A;  4TX5 A;  2VL0 A;  5L3C B;  1G8X A;  1YXR A;  3AVR A;  3AE5 A;  2J62 A;  5AQH B;  2BS4 A;  4DV0 T;  3ZCI A;  4IHJ E;  4OYJ A;  1D1B A;  3UU4 A;  2E9X A;  2CMR A;  2XQ6 A;  2SPC A;  2KXP B;  2P9B A;  4A97 A;  4KP3 C;  3RIU A;  2D9D A;  3AE8 A;  4PK5 A;  4X1I E;  4CI1 B;  4TUY E;  3TLW A;  3AE3 A;  3AEC A;  4AXP A;  3N9P A;  4PFO A;  2J4G A;  4ERR A;  3J7Y q;  2LJL A;  4ZZB A;  5FXZ A;  4ZZC A; 
#chains in the Genus database with same CATH homology
 2DCF A;  2KWI B;  2M67 A;  5LOV E;  5LXT E;  2XHE B;  4P09 A;  3DP7 A;  4TV9 E;  2K48 A;  3B13 A;  3L3P A;  5J1G A;  1WLX A;  3ZPO A;  4XBF B;  1WYB A;  3UUM A;  3LJC A;  3UT5 E;  3K3O A;  1IJ5 A;  3SOL A;  3ZN1 B;  3N2G E;  4CXW A;  2I59 A;  4PJM A;  5EK2 A;  2QGS A;  4DBR A;  3D0T A;  2V7I A;  3KVA A;  1D0Y A;  4AKG A;  4O2A E;  4O4I E;  1YW0 A;  4EZ4 A;  4TV8 E;  3KV6 A;  4QX7 B;  2V7M A;  3A5X A;  3I9Y A;  4AQF C;  4HGA A;  5LJM A;  1D0X A;  2XAG B;  3QUJ A;  5JRE A;  2YEV C;  1UX4 A;  3GWH A;  2L9Q A;  2EHO B;  4ZHQ E;  3CML A;  4PW8 A;  2X51 A;  3RKO A;  2CLY C;  4EOZ B;  3R84 B;  3N9L A;  2X9X A;  2B1E A;  5L3B B;  4XZC A;  3UTK A;  2CWO A;  4DBQ A;  2D0T A;  1QUU A;  5FXW A;  3W15 B;  3KDS E;  3E08 A;  3ZEF B;  5JR9 A;  2XTL A;  4H9N C;  5J2U E;  5HXH A;  3CQG B;  4OK0 A;  4GYR A;  4EZH A;  3PTR B;  2NTY A;  4FJO A;  1U5P A;  2Q9Q A;  3KV9 A;  4KMC A;  4UV8 B;  4WBN E;  3JC6 C;  3EUH A;  1S35 A;  4UV9 B;  3U78 A;  4EXT A;  5FMN A;  5HAX A;  2LOP A;  4EYU A;  5ETW A;  1FMW A;  3J9X 1;  3HL6 A;  4ASK A;  4TZ4 C;  2MOZ A;  2N1G A;  4GOU A;  4HEA A;  3ZLI A;  2KZ7 B;  3PUR A;  4MHC A;  1LVK A;  2LSG A;  4P0B A;  4X1Y E;  5M4Y A;  1T98 A;  2VKJ A;  5L3G B;  3AB3 B;  4YJ3 E;  4PFP A;  2KND A;  2JRK A;  3EDU A;  3UFE A;  3Q5X A;  3MZK B;  1MIW A;  5HWY A;  3KV5 A;  5LA6 E;  4C91 A;  5JRC A;  3O9X A;  1HF8 A;  4WNK A;  5HYA A;  4EB6 E;  1MMD A;  5FXV A;  3PDY A;  3C64 A;  5LBM A;  3UUX B;  4AKH A;  3ZYM A;  2LSK A;  2LSJ A;  3F57 A;  3N9N A;  1HCI A;  1MMN A;  4H9R C;  4QHO A;  3SS1 A;  2V7L A;  5L3D B;  4P0A A;  2L3L A;  1WYC A;  4YLH A;  3WAK A;  3LK3 B;  5HXC A;  1ZHC A;  3LK4 2;  4QXC B;  4AKI A;  1HFA A;  2VAS A;  4GK5 E;  4NUV A;  2XAJ B;  4H63 V;  5HXE A;  2E9X B;  2MYS A;  3L09 A;  3KIN B;  3V5U A;  5C8Y E;  3GN5 A;  4H63 H;  4HE8 A;  5LYJ E;  3ZJ2 A;  5H6R B;  1QSD A;  1LKX A;  3O4X E;  3N2O A;  3PUG A;  3B57 A;  3T8O A;  5EK3 A;  4F6R C;  1E1H B;  4UVA B;  4HN9 A;  3RC8 A;  3BQL A;  5JDQ A;  1VOM A;  3OKQ A;  2E9X D;  2X68 A;  3O1H A;  5FY0 A;  3PU8 A;  3BQI A;  5BMV E;  2DNX A;  2V26 A;  4CI2 B;  4JLE A;  3CQX C;  2H3R A;  4QXB B;  4O2B E;  2JMH A;  3IEE A;  5LHG B;  2K9A A;  3ANW A;  2GK9 A;  2BVL A;  2E9X C;  4OHF A;  4JEH B;  2W00 A;  4XAX B;  4OFZ A;  5ADX L;  2CLY B;  4IE6 A;  2X9W A;  4ILU A;  4AKR B;  2DWG A;  2A2F X;  2KMF A;  3FBZ A;  4PK4 A;  2WSS V;  2X67 A;  3H37 A;  4UF0 A;  3RYI E;  3QK6 A;  3SWH A;  4AKL A;  3N5L A;  4X1K E;  2L8K A;  2LT3 A;  2PFV A;  4IDZ A;  4AQG A;  3ZC1 A;  3CX8 B;  1HG2 A;  3FXD B;  4HFV A;  5HXR A;  5L2L A;  4DVD A;  4AI6 A;  4DO0 A;  2JPF A;  4IE5 A;  4O8S A;  4PJN A;  5L3E B;  2K5B B;  3C4X A;  3C4Z A;  4U72 A;  3ZYL A;  1US7 B;  3I0O A;  3NRX A;  1MMG A;  1CUN A;  3Q2M A;  1BR0 A;  4YJ2 E;  1Z0P A;  4QWN B;  5LBQ B;  2J1D G;  2PJQ A;  4U74 A;  3CVR A;  4ZS3 A;  1MMA A;  2ZM2 A;  3LBX B;  3KBU A;  2EHO A;  4H9Q C;  4KUM B;  3AAA B;  4FI5 A;  4A56 A;  3LK2 B;  1D1A A;  5J2T E;  4MAL A;  2YU2 A;  4PK6 A;  1OWA A;  3P8C D;  4CXY A;  1NWM X;  4K0U A;  2XAF B;  1LRZ A;  3RC3 A;  3AA0 B;  5DJQ C;  3JC6 D;  3M65 A;  3KFW X;  4ISS A;  4CQI A;  2K24 A;  3EDV A;  3VU7 H;  3C51 A;  1HTJ F;  1SA0 E;  3BK9 A;  3LG7 A;  3IBP A;  3ETU A;  2W0G A;  2WBL A;  4HTE A;  2WMN A;  2C5I T;  2C5J A;  5EZY E;  1FMV A;  3MK7 C;  5LGU B;  3BQK A;  3CWZ B;  1WRD A;  2YU1 A;  1MNE A;  2PBI A;  5JR9 B;  1YKH B;  2CE7 A;  4IIJ E;  1V9D A;  4I4T E;  3LFM A;  4MBQ A;  3KBT A;  3TKL B;  3P7I A;  3CKD A;  4GYS A;  3F2E A;  2Y6X A;  4OYK A;  4I50 E;  3PUA A;  1D0Z A;  3SRZ A;  4NUU A;  3AA1 B;  5LCY A;  3DTO A;  3FXE B;  2XQY A;  1IAP A;  5HWX A;  1O3X A;  3ZMU B;  2MTQ A;  1HS7 A;  2BZB A;  1BR4 A;  4O4H E;  3RYF E;  1LVF A;  1Y64 B;  3FB2 A;  5LHI B;  2H7O A;  5FXX A;  4C90 A;  2V7K A;  2IC6 A;  2VKD A;  3R6N A;  2WWU A;  3K3N A;  3HKB E;  3RX6 A;  3RYH E;  5JDM A;  1FEW A;  4EYY R;  5JR9 C;  4IE4 A;  5GON E;  2CM0 A;  3K3Q C;  1ZKE A;  2DWK A;  3UUL A;  1HX8 A;  5LGN B;  2HH7 A;  3RPU A;  3N9Q A;  2HPJ A;  4YFS A;  5JRC B;  2Q9Q C;  4EAH A;  5CA0 E;  3ZJ1 A;  5LNK A;  5FNV E;  3RYC E;  4J2C A;  3AVS A;  3GA8 A;  3O1I A;  3ZMV B;  5DQW A;  2VB6 A;  3WAJ A;  2Y48 B;  5EK4 A;  1OXZ A;  2CXD A;  3NBX X;  4DND A;  2JQQ A;  1NAF A;  3OYZ A;  3ESL A;  4MFR A;  2IW5 B;  3HKE E;  5F3J A;  3GN5 B;  2YK0 A;  4AQF A;  1U4Q A;  3ZCJ A;  2NOX A;  3I1A A;  3O1J A;  4IST A;  3CQC B;  2VK9 A;  4ZS2 A;  5LHH B;  2DI4 A;  2V7J A;  5HXS A;  2LSI A;  4L9I A;  2X0L B;  4EIW A;  4CXX A;  2WM9 A;  4N78 D;  3UUN A;  3NZQ A;  4PAG A;  5JQG E;  4JUY A;  3AAI A;  3K8P C;  2V1D B;  4KBM B;  2ZM8 A;  1BR2 A;  2LHR A;  2WMO A;  2CWY A;  3I0Q A;  3Q5W A;  3CX7 B;  1G73 A;  2N9D A;  4GK0 E;  3RRW A;  4ZI2 D;  2A72 A;  3ANW B;  3E0Z A;  4H9S E;  3FBL A;  2Z6E A;  4UIG A;  4H9O C;  3DJB A;  2ZMA A;  2CCQ A;  3IF8 B;  1SHZ C;  4ADZ A;  2ZLY A;  3FHN A;  5JH7 E;  5AFU L;  2KIN B;  1AJ3 A;  3PUQ A;  5CA1 E;  4DMW A;  4B6X A;  5IYZ E;  3LBX A;  4X20 E;  2Y8D A;  3C4W A;  4UF0 B;  5TAO A;  4ZI2 C;  3H3A A;  4BJN A;  3HKD E;  4G63 A;  3RRC A;  2CXF A;  1IJ6 A;  2NW8 A;  2XAQ B;  2D5U A;  5JDN A;  2C5K T;  4PNI A;  1ZEE A;  3I9W A;  2JMK A;  5LGT B;  2NTX A;  3PUS A;  3MJX A;  4L5G A;  2LM9 A;  1S94 A;  4QX8 B;  2LOS A;  5DAB A;  1H7C A;  1HG5 A;  3RH3 A;  2VL8 A;  4ZI7 E;  3OYX A;  1B7T A;  2ZM0 A;  3ZC0 A;  3S4U A;  3NZP A;  2LEH A;  3N2K E;  4GIW A;  1MIY A;  4ZOL E;  3C98 B;  2CA5 A;  5FP3 A;  1MIV A;  3AA6 B;  2WAU A;  2NWB A;  4TN7 B;  5H6Q B;  4ZI3 D;  3HR0 A;  3KV4 A;  5JDG A;  4BAY B;  2W63 A;  2KT9 A;  5FY1 A;  2X9Y A;  3F31 A;  2X9H A;  1D1C A;  2W61 A;  3MKD A;  4E7Z A;  2E8I A;  2ODV A;  4HKA A;  3HKC E;  4UEM A;  3VKH A;  2QA7 A;  3PE0 A;  4IE7 A;  2IAK A;  5LG4 A;  1KK7 A;  2EHO D;  5DQV A;  4ZI3 C;  4BJM A;  4O4L E;  1IZN B;  4UVB B;  4DMV A;  2VWA A;  2NW9 A;  2Q9Q B;  3AA7 B;  5JDH A;  3HA4 A;  3AAE B;  3ZMS B;  2NW7 A;  3Q9D A;  4YHJ A;  2YIN A;  3CPZ A;  5JVD E;  4UVC B;  3ZMT B;  2ES0 A;  1X79 A;  2BVM A;  3ZN0 B;  4TX5 A;  2EHO C;  3OBV E;  5F8P A;  2OA5 A;  3WI3 A;  5FY7 A;  1KNZ A;  2JJ9 A;  4V1A v;  3EVY A;  5L3C B;  4IE0 A;  1G8X A;  3MAC A;  3AVR A;  4JEU B;  2N2N A;  3V5S A;  2Q9Q D;  4PJJ A;  3ZCI A;  4M1P A;  2KWH A;  2W62 A;  1FIO A;  2G0U A;  4IHJ E;  2KLQ A;  2UXN B;  2BDE A;  4OYJ A;  1D1B A;  2RA1 A;  1ZV4 X;  2E9X A;  4I55 E;  2CMR A;  4UXN B;  1YD8 G;  5LP6 E;  2CEA A;  3ONX A;  2H7V C;  2SPC A;  2CXL A;  3VHL A;  2DHR A;  2KXP B;  3C50 A;  4WW0 A;  2PG8 A;  2LSY A;  2X66 A;  4WBO A;  4CI3 B;  1UCU A;  2P9B A;  2A3D A;  5FYM A;  2VKH A;  5LJN A;  2DLR A;  2HPL A;  4KP3 C;  5KDM C;  2C0S A;  3ZMZ B;  3MXZ A;  2XAS B;  3PU3 A;  3N9O A;  4PK5 A;  5JDL A;  4QKN A;  4X1I E;  2MBG A;  2UXX B;  3ETV A;  3HI2 A;  2D0U A;  4MLK A;  4Z8X A;  3GMI A;  5JDF A;  2XAH B;  4CI1 B;  3VKG A;  5A1L A;  1BR1 A;  2LHN A;  3NRY A;  4G2A A;  4TUY E;  4ANJ A;  5KX5 E;  4PJL A;  1EZ3 A;  2VKO A;  3OJA A;  5L3F B;  3E22 E;  2NP9 A;  3CX6 B;  1YKE B;  2XUE A;  2D2S A;  4BA9 A;  2IC9 A;  4E7S A;  4AXP A;  4IGU A;  1MND A;  3N9P A;  4I43 B;  4PFO A;  5CB4 E;  5IHY A;  1WR6 A;  2RP4 A;  3MA9 A;  4ERR A;  4QXH B;  4CZZ B;  1UX5 A;  2ODU A;  3ZYK A;  5KMG P;  2ACX A;  3U3I A;  3J7Y q;  4O4J E;  3KVB A;  4L0R A;  3N9M A;  5E0O A;  2LJL A;  4UEL A;  3QC9 A;  1VRB A;  5FXZ A;  3IHR A;  4H9P C;  2LE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...