2NWBA

Crystal structure of a putative 2,3-dioxygenase (so4414) from shewanella oneidensis in complex with ferric heme. northeast structural genomics target sor52.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
392
structure length
379
Chain Sequence
TYNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYIAEPSVSMPLHVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLRLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Conserved domain protein
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 149
structure length 379
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08933 DUF1864 Domain of unknown function (DUF1864)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA02
1.20.58.600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA01
5EK3A 2NW9A 2V7KA 1ZEEA 2D0UA 3E08A 2NW8A 5EK4A 3BK9A 2D0TA 4PK6A 4U72A 2X66A 2V7LA 4PW8A 1YW0A 2X68A 2NW7A 2V7MA 2X67A 5ETWA 2NOXA 2V7JA 4U74A 4PK5A 5EK2A 2NWBA 4HKAA 2V7IA
chains in the Genus database with same CATH superfamily
5AQOB 3IF8B 5FL0A 2BS2A 3Q5WA 2BS3A 2BG9A 4DR6T 4LFCT 5LJNA 5AQSB 4ASKA 2UUBT 1BR0A 4B3TT 3KFWX 4BA9A 4I4TE 5KMGP 2M6BA 2QVAA 2XQYA 5FKYA 3MA9A 2ES0A 4AQGA 4HTEA 1BR2A 1WFDA 3AEBA 1UX4A 1OEDB 3SOLA 2LEHA 2A72A 2A3DA 2JRKA 2X0LB 2VQET 1SUMB 3TLVA 3JAFA 3L39A 2CE7A 3EUHA 3LJCA 2QA7A 2QRXA 5JQGE 1VRBA 4TNWA 2ACZA 1I6ZA 3OTOT 3QNUA 4WBOA 4HFDA 4GOUA 3K8PC 2VVNA 2LE8A 2X0HA 4OYKA 2AE9A 3I9YA 4DR7T 2UXXB 2V7KA 4MFRA 3HR0A 2A2FX 4Z90A 3JCFA 2CHNA 3GN5B 2XQ8A 2CPTA 5ABEA 3C64A 2LOSA 1CHUA 2ZM6T 4QH4A 5L3GB 1MMDA 5J2UE 4ZI2C 4TUYE 3SWHA 3WAKA 2I6HA 4LFBT 2B1EA 4L0RA 1S94A 3RIFA 1ZKEA 4M1PA 5KDMC 4JI8T 1X79A 3RPUA 5L2LA 4TV9E 4AKRB 2JMHA 5HCJA 2V26A 3RI5A 5EZYE 5LYJE 1MIWA 3AE3A 3OYZA 1IBLT 3K3OA 3Q5EA 4UV9B 4TWHA 5JH7E 3ZCIA 2X9YA 1J1JA 4CQIA 2E8IA 3CIRA 4ZI7E 1UK5A 4V1Av 1XDPA 5CA0E 3W15B 1S35A 1O3XA 4DVDA 2H7OA 5J0ZA 5L3FB 2NTYA 1NEKA 1X9BA 4DUZT 2CXFA 4QKNA 5LGUB 3ZC1A 5L3DB 3ZMZB 4A5XA 5AQHB 1UUSA 4AKGA 2ZM2A 5AQKB 5JDNA 3MACA 1E1HB 2HPJA 2DNXA 5LBMA 4O4IE 4L5GA 2W0GA 3VKHA 2KSRA 3BK9A 2QYWA 4U2YA 4AISA 4N78D 2KLQA 3MXZA 5AQNB 5HEUA 1HX8A 3V5UA 3AE4A 5FXZA 3RYIE 5JVDE 4DV6T 5FVLA 4HWFA 4IT4A 3EI0A 4NIQA 1EZ3A 4ZZBA 4JUYA 2K24A 3ZPOA 2K5BB 4PJMA 1XNQT 3ABVA 5FY0A 5A1LA 5L4HA 2E2AA 5CJ5A 5JRCA 4UEMA 1ZEEA 2XQ6A 3ZSSA 4WNKA 3ZYMA 4DV5T 3N9NA 2C5JA 4UF0A 2JMKA 3I0QA 3AA7B 4YT0A 3VR9A 4TX5A 5L3BB 2FBWA 2XQ4A 4PK5A 4UF0B 3T8OA 3RIUC 4CXYA 1WYBA 3RLFF 1XWMA 2YOEA 2UU9T 2Q9QB 4P09A 5F3JA 5C2TA 2DWGA 3UUNA 2Z6EA 3CX7B 1KFYA 3KVAA 4G63A 2LSKA 4UV8B 3UUBA 1SHZC 2XQ7A 2D2SA 4IGUA 4B3ST 2CBJA 4ISSA 4EYUA 4TNVA 1Y64B 2XY8B 2ZM8A 4PK6A 2YU1A 5LOVE 4JI7T 3I1AA 1I94T 4TZ4C 2XAGB 1KNZA 4HFEA 4O2AE 5HYAA 2LRKA 4B3RT 4QXCB 2ZLYA 5H6QB 3CQXC 2WU2A 3VU7H 1US7B 2LSGA 1J5ET 3A7MA 3JC6C 1W0AA 3LK2B 5DABA 3T1HT 4A98A 2CXLA 5HEOA 4KMCA 4ZI3C 4G2AA 3VRAA 4YTNA 4YXDA 1SA0E 3BQLA 3I0OA 5LB7B 4JI3T 1OWAA 5EK3A 1U5PA 2K3WA 3ZLIA 1KF6A 5LHHB 4U31A 4CI1B 2LSYA 5ABHA 5JR9C 1VCTA 2KWIB 5HEGA 4HFVA 5HWYA 4IHJE 3PUZF 3CX8B 4O8SA 1G8XA 4X20E 4O4HE 2XAQB 3UFEA 3PURA 2V1DB 2LLYA 5HXRA 2K9AA 4JEHB 2WU5A 4Q25A 5ABGA 2OV9A 3SFEA 3O1IA 2C5IT 2ACXA 4U74A 4K0KT 5AQVB 5FXWA 2Y8DA 4GKJT 1YKEB 4DMVA 3K1SA 4A97A 1DU2A 2V7LA 2IUBA 3RKGA 4IDZA 2NWBA 2CWYA 4P0BA 2N2NA 5AQIB 1D1AA 4CN1A 1UURA 4IE7A 2XAFB 2LM2A 2NW7A 4CXWA 3P4SA 3V5SA 4TV8E 2KZ7B 3FXEB 3RC8A 4PJJA 1HTJF 1MNEA 1IBMT 1FEWA 4U7YA 3AA1B 5JDQA 5JDLA 5JR9A 4P1NA 1FIOA 3MK7C 4LMLA 1FJGT 4YLHA 3PV0F 5JDGA 2NR4A 5JR9B 3EHZA 2RP4A 1MMNA 4AKHA 3FZHB 1Z0PA 3AXJA 2WB5A 2KINB 4JI1T 3AEGA 1XNRT 2W62A 2LHRA 2J4GA 1HNWT 2Y6XA 3AXJB 1XMQT 1LRZA 4XZCA 2VL0A 2UUAT 3QB5A 3DTOA 3FZLB 3AA0B 4X5TA 2BDEA 1D0XA 2I0MA 2OLTA 3FB2A 4QXHB 3RIAA 3ZMSB 2E5LT 1HCIA 3OPCA 3ZMVB 2UXDT 2WDRA 5CFBA 2CMRA 3LSVA 3B57A 1OEDA 1M7KA 4ANJA 3ONJA 2BBHA 1HG5A 2V7JA 1IZNB 1MIYA 3FBLA 5JTGA 3PUWF 4YY3T 2EHOC 4GIWA 3E0ZA 4HN9A 1T98A 4PFPA 3ETVA 4QWNB 2A9UA 2W67A 4EEBA 3GN5A 1NAFA 2D0UA 4IIJE 4AQFC 4DO0A 3J7Yq 2DHRA 3AECA 2CXDA 5TAOA 4DR4T 4H9OC 4ZI3D 2X67A 4ZEYA 4U3CA 3X1DA 2HHHT 4ISTA 1WR6A 2CM0A 4MHCA 1NWMX 4E7SA 5AQGB 4BJMA 3PUQA 2MOZA 3KVBA 2ZMAA 2WDVA 2R6GF 4EAHA 3PJAA 2V7MA 5AQJB 1UCUA 4DR2T 4YHJA 3HI2A 3NRXA 1N32T 1WRDA 2DWKA 3CKDA 1W09A 3L3PA 5LGNB 5CA1E 3H3MA 4H63H 2XHEB 4ZXLA 3HKDE 3ZEFB 3CMLA 2L8KA 2JQQA 4O2BE 2VL8A 4JLEA 2LKGA 3RHWA 2IDOB 5EK2A 2W2UA 2VQFT 2X0YA 4U2ZA 2D9DA 2XTLA 2IHR1 5FVKA 2XM2A 3PJAJ 5J1GA 3JADA 4YSXA 3NZPA 5LJMA 4EOZB 3ZN1B 1VOMA 2Q9QC 4I0UA 3C4WA 2FUPA 2EHOB 5F8PA 3D0TA 3A8YC 3UUXB 3C51A 3RRCA 2VASA 1T72A 3P4PA 1KNPA 1YKHB 1JNZA 5AFUL 2UXNB 5L4EA 4EGWA 1KEYA 3Q5DA 3Q9DA 3M65A 1ZOYA 1MNDA 2W4XA 4FJOA 2JQHA 4C91A 5FYMA 3AEAA 4DMWA 2BBJA 3PDYA 2DL1A 1FMVA 1GQEA 5JREA 4F6RC 2N1GA 3E22E 3ANWB 3I9WA 3RRWA 4UVCB 4WZXA 4WBNE 3FZFB 2JPFA 2V5DA 3PU3A 2VURA 1YD8G 1E7PA 3K3QC 3AEEA 1HS7A 3ZYKA 1R8IA 5HWXA 3HKEE 4PJNA 3LBXB 4DR3T 3AVSA 4K0UA 2RA1A 2WWVA 4HEAA 2KT9A 4HFCA 5HEHA 3IA3A 2Y48B 3L8RA 1AJ3A 2N9DA 3NKZA 3WI3A 2WSSV 4DV0T 2PTFA 1LVFA 4LF4T 2C0SA 2Q9QA 2M6IA 1CUNA 3N2OA 4OFZA 2BKNA 2WZHA 5HXCA 5HAXA 2XSAA 2MBGA 2V8SV 4OX9T 5JDMA 5BR8T 1MMGA 2W61A 2BVMA 3C4ZA 3CVRA 2KXPB 1VCSA 1YXRA 3AE8A 4IDPA 2D5UA 4NXNT 3N5LA 2H88A 2FJDA 2HPLA 4ZS2A 3RYFE 4DBQA 4JI0T 3AE1A 4IL4A 4TN7B 4YTPA 3ESLA 2PJQA 5AQMB 3N9PA 2DCFA 2ZM0A 3ZT6A 1OXZA 3N9OA 3N9MA 4DV4T 2YN6A 3QOFA 2X66A 3UULA 3CPZA 5LMNT 2YK0A 2PBIA 3ONLC 4NUUA 3RQUA 1W0BA 3KV5A 4ZI2D 3IBPA 3PTRB 4HFHA 2YDRA 4C90A 3RF1A 3HL6A 1LKXA 3C4XA 4QH1A 3BQKA 3U78A 2X9XA 3EABA 4EB6E 2NTXA 3VR8A 4CN4A 2NOXA 3FHNA 3TKLB 4L9IA 3L09A 4UIGA 2KMFA 3RIUA 4DV7T 1BR4A 5LGTB 3C50A 5M4YA 2L9QA 4XAXB 2LHNA 5BMVE 3EAMA 1HNZT 2LKHA 4PW8A 3NVOA 2VKOA 3U3IA 2G0UA 3TLWA 2J1DG 2X9WA 4HWIB 3DP7A 3E08A 3QC9A 2IMLA 5EK4A 4ILUA 2ODVA 3NRYA 5HCMA 2V6YB 3NZQA 3OJAA 3AE7A 3AE5A 4Z8XA 2WBLA 1QSDA 3PUYF 3MJXA 3AA6B 3N2GE 2C5KT 2Q9QD 3AAIA 3MKDA 2FJBA 3PUVF 1WR0A 2BKOA 5FP3A 4ERRA 2NW8A 2WWUA 5KX5E 3GMIA 1JNRA 3AAEB 1QUUA 4GYSA 2NP9A 4DV2T 2WAUA 1HNXT 2NW9A 1U4QA 2WP9A 2CRBA 2BG9C 2SPCA 2WS3A 3F57A 3GA8A 1N33T 5DQWA 3ZMUB 2IC6A 1Z8UA 3KINB 2BG9E 2XQ5A 1N36T 3UFGA 3AE2A 2E9XC 4PJLA 2I59A 4PAGA 4EYYR 4DUYT 5AQQB 4U72A 3RYCE 3HKCE 2YDQA 4PFOA 1YW0A 5HEJA 2KNDA 1ZV4X 3CK6A 3VHLA 3AEDA 1IBKT 5AQFB 3FBZA 4ZZCA 4YSYA 4DBRA 4FI5A 5CGMA 4DV1T 3ZT5A 5FY1A 3OVUA 4E7ZA 4AQYT 2PG8A 4X64T 1MIVA 3KV4A 2H7VC 2J47A 4KX6A 1BR1A 4X1IE 2WDQA 3CX6B 3Q2MA 4BAYB 3DJBA 5LNKA 5AQUB 5ABFB 4HGAA 3N9QA 4I55E 4IDOA 3SFDA 3TLSA 4LFAT 4JI4T 2YINA 4QHOA 1IAPA 5FXVA 4ILBA 5LHGB 3RX6A 5LHIB 4DR1T 2J62A 5AQRB 4DV3T 5IHYA 1M62A 3UTKA 2W00A 2BG9B 3QB5K 4A56A 2VK9A 1HFAA 2E9XA 2MYSA 3RC3A 4QH5A 3KV9A 4KUMB 2V6XA 2XQ3A 5FNVE 5C3JA 2DLRA 2HN2A 4TWFA 2E9XB 4IE5A 5GONE 4UELA 4NXMT 4GK0E 2H89A 3MZKB 3PUSA 2B76A 4EZ4A 3ZJ2A 4ILAA 2LSIA 4DNDA 3P4RA 4ZHQE 1KK7A 1YQ4A 3S4UA 2YKSA 3JC6D 4QXBB 2WMNA 2WM9A 3N9LA 3UQ4A 1YQ3A 3LDQB 2BVLA 3C98B 3ZMTB 3CWZB 3UUMA 2P9BA 5L47A 4X66T 3KV6A 3TLUA 5CB4E 4JBWF 5IUXA 5FY7A 4WYVA 3EDVA 2UUCT 2XPKA 2CEAA 4CN6A 4LF5T 1E2AA 4O4LE 3LFMA 3ZN0B 4KP3C 2M67A 3UT5E 1HF8A 2FJEA 1QLBA 2UXBT 2VKDA 3TLTA 4KHZF 3GWHA 5ETWA 2XQAA 1WCRA 4YFSA 3KBTA 3AEFA 2YEVC 3JAEA 2YU2A 2X51A 5E0OA 4EEDA 1KNRA 4AKIA 3IEEA 3ZT7A 4AIUA 3UU3A 3P7IA 1LVKA 3M3ZB 1D1CA 4UVAB 4B6XA 5DQVA 5JDHA 4I50E 4LF9T 2W63A 4AXPA 3OYXA 3F2EA 5HXEA 4X62T 2JJ9A 2F4VT 3UU8A 2VVSA 2K48A 1IJ6A 4Z91A 3R6NA 2JIWA 3SRZA 3HA4A 5FXXA 4ZS3A 3QUJA 2EHOA 2VKJA 3ZJ1A 5C8YE 4JV5T 2XASB 2WY2A 4PNIA 3FXDB 3ZC0A 2BKPA 3EVYA 3PUGA 3PUAA 4HWDA 5JDFA 2AXDS 1G73A 4EZHA 4HWHA 4YSZA 2V5CA 4LMJA 4AQFA 4X1YE 4KBMB 3UU5A 4COFA 4BJNA 2ODUA 4CI3B 4JYAT 3PUXF 5IYZE 3H3AA 2V7IA 5LG4A 1WLXA 4HFIA 4H9PC 3LK3B 2E9XD 2BS4A 4MBQA 4CXXA 2DI4A 3ZSTA 3ANWA 3RYHE 1IJ5A 3KDSE 2FJAA 2JQ9A 2MPKA 2L3LA 3A5XA 4XBFB 3VKGA 2VB6A 4LF7T 4YJ2E 4IL9A 4ADZA 3SS1A 2LOPA 3LBXA 3RKOA 1D0YA 2JQKA 4IE6A 4TWDA 4EIWA 4LMKA 5LCYA 1J5WA 4HKAA 5LA6E 1HG2A 3ETUA 2D0TA 4X1KE 4CI2B 3CQCB 1N34T 2QGSA 4U7IA 3AB3B 4GK5E 3RH3A 2CA5A 2IW5B 1D0ZA 1UGOA 4I43B 5LP6E 2IIUA 2XSBA 5JRCB 3J9X1 3O9XA 2WZIA 3HKBE 4MLKA 3OKQA 5HXHA 4U33A 5FL1A 2HH7A 2X9HA 4UVBB 4HFBA 4EXTA 5FMNA 2VKHA 4H9SE 4YTMA 5H6RB 3UU6A 4WW0A 3RGLA 1V9DA 4AKLA 4OYJA 4DR5T 3OBVE 4ILCA 1XMOT 2LJLA 2EHOD 2LM9A 3G06A 3P4WA 4X65T 4YJ3E 3IHRA 3P50A 3O4XE 5DJQC 2IAKA 3LG7A 1MMAA 4NUVA 3ONXA 4IE4A 1SE7A 2E5VA 4OK0A 2CHOA 1NENA 2OA5A 2LSJA 4YHHT 1L0VA 5LXTE 3B13A 4HWCA 2XJ7A 4NPPA 4UR9A 5LG3A 5J2TE 3CQGB 3PU8A 2BZBA 2UXCT 4JI5T 3T1YT 1W9RA 2H3RA 4AI6A 1B7TA 3P8CD 2YDSA 2PFVA 4CZZB 1HR0T 4HE8A 2CLYC 4H63V 3AE6A 2CCQA 3BQIA 4H9NC 1H7CA 4QX8B 4GYRA 2V6YA 4B3MT 1T8BA 3LK42 4QX7B 1FMWA 4LF6T 5AQLB 1ZHCA 3PE0A 2CBIA 2W66A 3UQ7A 3RQWA 3FZKB 1XDOA 4IDQA 5ADXL 3KBUA 2XUEA 3FZMB 2XAJB 2IC9A 3ZCJA 3R84B 2GK9A 3Q5XA 1UX5A 3EDUA 4JI6T 4DIDB 4PK4A 4EV6A 2WQYA 2KWHA 4KI0F 4P0AA 4KHPT 5HXSA 2MTQA 5L3CB 2X68A 3B5MA 1Y01A 3WAJA 2VWAA 3NWIA 3H37A 5AQTB 3O1JA 3VRBA 4IREA 1OEDC 4J2CA 5LBQB 4JEUB 1D1BA 5KXJA 2XAHB 2XQ9A 1OEDE 4OHFA 2MAWA 3P4QA 3N2KE 3O1HA 2XZEA 4ZOLE 4H9RC 1XZYA 5AQPB 3AAAB 4H9QC 4LF8T 2CLYB 4MALA 1WYCA 4JI2T 2LT3A 3AE9A 2RPAA 4F8HA 2CWOA 2WCAA 2HN1A 3QK6A 3NBXX 4UXNB 3UU4A 1ZP0A 2XM1A 5LMUT 5ABFA 1HX1B 4O4JE 5L3EB 5F5WA 3F31A 4IE0A 4GKKT 2LRLA 4IDNA 1T7SA 3K3NA 3ZYLA 5IWAT 3ZKRA 3AVRA 2WMOA
chains in the Genus database with same CATH topology
4X20E 3N2OA 4O4HE 2K48A 2XAQB 3IF8B 1IJ6A 3Q5WA 3UFEA 3R6NA 3PURA 4OFZA 2V1DB 5HXCA 5HXRA 5HAXA 3SRZA 3HA4A 5FXXA 4ZS3A 5LJNA 2K9AA 3QUJA 2EHOA 4JEHB 2MBGA 2VKJA 3ZJ1A 4ASKA 5C8YE 2XASB 1BR0A 4PNIA 3O1IA 2C5IT 3FXDB 5JDMA 3ZC0A 3EVYA 2ACXA 4U74A 3KFWX 3PUAA 3PUGA 4BA9A 1MMGA 2W61A 2Y8DA 5FXWA 2BVMA 5JDFA 4I4TE 3C4ZA 5KMGP 1G73A 2XQYA 4EZHA 3CVRA 1YKEB 2KXPB 3MA9A 2ES0A 4AQGA 4HTEA 4AQFA 1BR2A 4X1YE 2D5UA 4KBMB 4DMVA 3N5LA 4BJNA 2HPLA 2V7LA 2ODUA 4ZS2A 3RYFE 4DBQA 4CI3B 5IYZE 1UX4A 4TN7B 3SOLA 2LEHA 4IDZA 3ESLA 2NWBA 2CWYA 3H3AA 2PJQA 2V7IA 2A72A 4P0BA 1WLXA 5LG4A 2A3DA 2JRKA 2N2NA 4H9PC 3LK3B 2E9XD 2X0LB 3N9PA 2DCFA 1D1AA 2CE7A 3EUHA 3LJCA 4MBQA 4CXXA 2ZM0A 2QA7A 4IE7A 1OXZA 5JQGE 2XAFB 2DI4A 1VRBA 3ANWA 3N9MA 3N9OA 3RYHE 1IJ5A 2X66A 3UULA 3KDSE 4WBOA 2NW7A 4CXWA 4GOUA 3CPZA 3K8PC 2YK0A 3V5SA 4TV8E 2LE8A 2PBIA 4OYKA 2KZ7B 3I9YA 4NUUA 3FXEB 3RC8A 3KV5A 2L3LA 3A5XA 4ZI2D 4XBFB 2UXXB 2V7KA 3IBPA 1HTJF 3PTRB 4PJJA 4MFRA 1MNEA 3VKGA 1FEWA 3HR0A 4C90A 2VB6A 2A2FX 3HL6A 3AA1B 1LKXA 3C4XA 4YJ2E 5JDQA 3BQKA 3GN5B 2X9XA 3SS1A 3U78A 5JR9A 4ADZA 5JDLA 2LOPA 4EB6E 3C64A 3LBXA 3RKOA 1FIOA 2LOSA 1D0YA 3MK7C 2NTXA 5L3GB 1MMDA 5J2UE 4ZI2C 4IE6A 4TUYE 4YLHA 4EIWA 2NOXA 5JDGA 3FHNA 3TKLB 5LCYA 4HKAA 5JR9B 4L9IA 3SWHA 3WAKA 3L09A 4UIGA 2KMFA 5LA6E 1BR4A 5LGTB 2RP4A 1HG2A 3C50A 5M4YA 2B1EA 2L9QA 3ETUA 4XAXB 2LHNA 5BMVE 4L0RA 2D0TA 1S94A 1ZKEA 4X1KE 1MMNA 4M1PA 5KDMC 4CI2B 4AKHA 3CQCB 4PW8A 1X79A 3RPUA 5L2LA 4TV9E 2VKOA 4AKRB 1Z0PA 2QGSA 3U3IA 2JMHA 2V26A 3AB3B 2KINB 4GK5E 3RH3A 2G0UA 2CA5A 2W62A 2IW5B 2LHRA 1D0ZA 5EZYE 2J1DG 4I43B 5LYJE 2X9WA 1MIWA 3DP7A 3E08A 3OYZA 3QC9A 2Y6XA 1LRZA 4XZCA 3K3OA 5LP6E 5EK4A 4ILUA 2ODVA 4UV9B 3DTOA 5JRCB 3J9X1 3O9XA 3NRYA 3OJAA 3NZQA 3AA0B 3HKBE 4MLKA 3OKQA 5JH7E 3ZCIA 5HXHA 2X9YA 2BDEA 2HH7A 1D0XA 2E8IA 4Z8XA 2WBLA 4CQIA 1QSDA 2X9HA 3FB2A 4UVBB 4QXHB 4EXTA 3MJXA 4ZI7E 5FMNA 3AA6B 3ZMSB 3N2GE 2C5KT 2Q9QD 3AAIA 1HCIA 3MKDA 2VKHA 3ZMVB 4H9SE 5FP3A 5H6RB 4ERRA 2CMRA 2NW8A 4V1Av 2WWUA 5CA0E 3B57A 1S35A 3W15B 4WW0A 1V9DA 3GMIA 5KX5E 1O3XA 4DVDA 4AKLA 4ANJA 4OYJA 2H7OA 3AAEB 1QUUA 3OBVE 1HG5A 2LJLA 2EHOD 2LM9A 5L3FB 2NTYA 2V7JA 4GYSA 2NP9A 4YJ3E 3IHRA 2WAUA 2NW9A 2CXFA 1U4QA 3O4XE 1IZNB 4QKNA 1MIYA 5DJQC 3FBLA 5LGUB 2SPCA 3ZC1A 5L3DB 2IAKA 3F57A 3LG7A 3ZMZB 1MMAA 3GA8A 5DQWA 4NUVA 3ONXA 2EHOC 3ZMUB 2IC6A 3KINB 4GIWA 3E0ZA 4IE4A 4HN9A 4AKGA 1T98A 2ZM2A 4PFPA 3ETVA 4QWNB 5JDNA 4OK0A 3MACA 1E1HB 2HPJA 2E9XC 4PJLA 3GN5A 2I59A 2OA5A 1NAFA 2DNXA 5LBMA 4O4IE 2LSJA 4L5GA 5LXTE 4PAGA 3B13A 2W0GA 4EYYR 2D0UA 4IIJE 4AQFC 3VKHA 4DO0A 3J7Yq 2DHRA 3BK9A 4U72A 3RYCE 5J2TE 2CXDA 3HKCE 3CQGB 5TAOA 4PFOA 1YW0A 3PU8A 4H9OC 4ZI3D 2X67A 2BZBA 2KNDA 1ZV4X 4N78D 2KLQA 3MXZA 3VHLA 2H3RA 1HX8A 3V5UA 5FXZA 4AI6A 3FBZA 1B7TA 3RYIE 5JVDE 4ISTA 4DBRA 3P8CD 1WR6A 4FI5A 2CM0A 4MHCA 1NWMX 4E7SA 2PFVA 4BJMA 4CZZB 5FY1A 3PUQA 2MOZA 3KVBA 4HE8A 2ZMAA 2CLYC 1EZ3A 4E7ZA 4JUYA 2K24A 3ZPOA 4EAHA 2PG8A 2K5BB 4H63V 2V7MA 4PJMA 1MIVA 3KV4A 2CCQA 5FY0A 1UCUA 5A1LA 3BQIA 2H7VC 4YHJA 1BR1A 3HI2A 3NRXA 1WRDA 4H9NC 1H7CA 4QX8B 4X1IE 5JRCA 4UEMA 1ZEEA 2DWKA 3CX6B 4GYRA 3CKDA 4WNKA 3ZYMA 3L3PA 3N9NA 5LGNB 5CA1E 2C5JA 4H63H 4UF0A 3LK42 3Q2MA 2XHEB 4BAYB 2JMKA 4QX7B 1FMWA 3DJBA 3I0QA 3HKDE 3ZEFB 5LNKA 3AA7B 1ZHCA 3CMLA 2L8KA 2JQQA 3PE0A 4O2BE 2VL8A 4JLEA 4TX5A 4HGAA 5L3BB 3N9QA 4I55E 4PK5A 5EK2A 4UF0B 3T8OA 2YINA 4QHOA 1IAPA 5FXVA 2XTLA 4CXYA 5LHGB 1WYBA 3RX6A 5LHIB 2Q9QB 5ADXL 3KBUA 4P09A 2XUEA 5IHYA 3UTKA 5F3JA 2W00A 5J1GA 2XAJB 2IC9A 3NZPA 5LJMA 2DWGA 3ZCJA 3R84B 3UUNA 2Z6EA 2GK9A 4A56A 3CX7B 2VK9A 4EOZB 3ZN1B 1VOMA 3Q5XA 2Q9QC 1HFAA 2E9XA 2MYSA 2LSKA 3KVAA 4G63A 3C4WA 3RC3A 4UV8B 2EHOB 1UX5A 3KV9A 5F8PA 3D0TA 1SHZC 4KUMB 3EDUA 3UUXB 3C51A 2D2SA 4IGUA 5FNVE 3RRCA 2DLRA 4PK4A 4ISSA 2KWHA 4EYUA 4P0AA 5HXSA 2E9XB 1Y64B 2VASA 2ZM8A 4PK6A 2YU1A 2MTQA 5L3CB 4IE5A 5GONE 5LOVE 1YKHB 2X68A 4UELA 5AFUL 2UXNB 3I1AA 4GK0E 4TZ4C 3MZKB 3PUSA 2VWAA 3WAJA 2XAGB 1KNZA 3H37A 4O2AE 3ZJ2A 4EZ4A 5HYAA 2LSIA 4DNDA 3Q9DA 4ZHQE 3M65A 1KK7A 3S4UA 4QXCB 2ZLYA 1MNDA 3JC6D 5H6QB 4FJOA 4QXBB 2WMNA 3O1JA 4C91A 2WM9A 3CQXC 5FYMA 3N9LA 4J2CA 2BVLA 5LBQB 4DMWA 4JEUB 3C98B 3VU7H 1D1BA 1US7B 2LSGA 2XAHB 3ZMTB 4OHFA 3PDYA 3CWZB 3N2KE 3O1HA 3UUMA 1FMVA 4ZOLE 5JREA 2P9BA 3JC6C 4F6RC 4H9RC 2N1GA 3KV6A 3E22E 3LK2B 3AAAB 3ANWB 3I9WA 3RRWA 5CB4E 4UVCB 4H9QC 5DABA 2CLYB 4WBNE 5FY7A 2JPFA 3EDVA 4MALA 2CXLA 1WYCA 3PU3A 2CEAA 4O4LE 4KMCA 4ZI3C 3LFMA 4G2AA 2LT3A 3ZN0B 4KP3C 2M67A 3UT5E 1HF8A 1YD8G 2VKDA 3GWHA 1SA0E 5ETWA 3K3QC 4YFSA 3BQLA 3KBTA 3I0OA 1HS7A 3ZYKA 2YEVC 2CWOA 2YU2A 2X51A 5E0OA 1OWAA 5HWXA 3HKEE 5EK3A 3QK6A 1U5PA 4PJNA 3LBXB 3NBXX 4UXNB 4AKIA 3IEEA 3ZLIA 3AVSA 4K0UA 5LHHB 2RA1A 3P7IA 1LVKA 4CI1B 2LSYA 4HEAA 4O4JE 1D1CA 2KT9A 4UVAB 4B6XA 5L3EB 5JR9C 2Y48B 5DQVA 5JDHA 3F31A 1AJ3A 4I50E 2KWIB 2N9DA 4IE0A 4HFVA 5HWYA 2W63A 4AXPA 3OYXA 3WI3A 3K3NA 4IHJE 3ZYLA 2WSSV 3F2EA 1LVFA 3AVRA 5HXEA 2WMOA 2C0SA 2JJ9A 2Q9QA 3CX8B 1CUNA 4O8SA 1G8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EK3 A;  2NW9 A;  2V7K A;  1ZEE A;  2D0U A;  3E08 A;  2NW8 A;  5EK4 A;  3BK9 A;  2D0T A;  4PK6 A;  4U72 A;  2X66 A;  2V7L A;  4PW8 A;  1YW0 A;  2X68 A;  2NW7 A;  2V7M A;  2X67 A;  5ETW A;  2NOX A;  2V7J A;  4U74 A;  4PK5 A;  5EK2 A;  2NWB A;  4HKA A;  2V7I A; 
#chains in the Genus database with same CATH topology
 5AQO B;  3IF8 B;  5FL0 A;  2BS2 A;  3Q5W A;  2BS3 A;  2BG9 A;  4DR6 T;  4LFC T;  5LJN A;  5AQS B;  4ASK A;  2UUB T;  1BR0 A;  4B3T T;  3KFW X;  4BA9 A;  4I4T E;  5KMG P;  2M6B A;  2QVA A;  2XQY A;  5FKY A;  3MA9 A;  2ES0 A;  4AQG A;  4HTE A;  1BR2 A;  1WFD A;  3AEB A;  1UX4 A;  1OED B;  3SOL A;  2LEH A;  2A72 A;  2A3D A;  2JRK A;  2X0L B;  2VQE T;  1SUM B;  3TLV A;  3JAF A;  3L39 A;  2CE7 A;  3EUH A;  3LJC A;  2QA7 A;  2QRX A;  5JQG E;  1VRB A;  4TNW A;  2ACZ A;  1I6Z A;  3OTO T;  3QNU A;  4WBO A;  4HFD A;  4GOU A;  3K8P C;  2VVN A;  2LE8 A;  2X0H A;  4OYK A;  2AE9 A;  3I9Y A;  4DR7 T;  2UXX B;  2V7K A;  4MFR A;  3HR0 A;  2A2F X;  4Z90 A;  3JCF A;  2CHN A;  3GN5 B;  2XQ8 A;  2CPT A;  5ABE A;  3C64 A;  2LOS A;  1CHU A;  2ZM6 T;  4QH4 A;  5L3G B;  1MMD A;  5J2U E;  4ZI2 C;  4TUY E;  3SWH A;  3WAK A;  2I6H A;  4LFB T;  2B1E A;  4L0R A;  1S94 A;  3RIF A;  1ZKE A;  4M1P A;  5KDM C;  4JI8 T;  1X79 A;  3RPU A;  5L2L A;  4TV9 E;  4AKR B;  2JMH A;  5HCJ A;  2V26 A;  3RI5 A;  5EZY E;  5LYJ E;  1MIW A;  3AE3 A;  3OYZ A;  1IBL T;  3K3O A;  3Q5E A;  4UV9 B;  4TWH A;  5JH7 E;  3ZCI A;  2X9Y A;  1J1J A;  4CQI A;  2E8I A;  3CIR A;  4ZI7 E;  1UK5 A;  4V1A v;  1XDP A;  5CA0 E;  3W15 B;  1S35 A;  1O3X A;  4DVD A;  2H7O A;  5J0Z A;  5L3F B;  2NTY A;  1NEK A;  1X9B A;  4DUZ T;  2CXF A;  4QKN A;  5LGU B;  3ZC1 A;  5L3D B;  3ZMZ B;  4A5X A;  5AQH B;  1UUS A;  4AKG A;  2ZM2 A;  5AQK B;  5JDN A;  3MAC A;  1E1H B;  2HPJ A;  2DNX A;  5LBM A;  4O4I E;  4L5G A;  2W0G A;  3VKH A;  2KSR A;  3BK9 A;  2QYW A;  4U2Y A;  4AIS A;  4N78 D;  2KLQ A;  3MXZ A;  5AQN B;  5HEU A;  1HX8 A;  3V5U A;  3AE4 A;  5FXZ A;  3RYI E;  5JVD E;  4DV6 T;  5FVL A;  4HWF A;  4IT4 A;  3EI0 A;  4NIQ A;  1EZ3 A;  4ZZB A;  4JUY A;  2K24 A;  3ZPO A;  2K5B B;  4PJM A;  1XNQ T;  3ABV A;  5FY0 A;  5A1L A;  5L4H A;  2E2A A;  5CJ5 A;  5JRC A;  4UEM A;  1ZEE A;  2XQ6 A;  3ZSS A;  4WNK A;  3ZYM A;  4DV5 T;  3N9N A;  2C5J A;  4UF0 A;  2JMK A;  3I0Q A;  3AA7 B;  4YT0 A;  3VR9 A;  4TX5 A;  5L3B B;  2FBW A;  2XQ4 A;  4PK5 A;  4UF0 B;  3T8O A;  3RIU C;  4CXY A;  1WYB A;  3RLF F;  1XWM A;  2YOE A;  2UU9 T;  2Q9Q B;  4P09 A;  5F3J A;  5C2T A;  2DWG A;  3UUN A;  2Z6E A;  3CX7 B;  1KFY A;  3KVA A;  4G63 A;  2LSK A;  4UV8 B;  3UUB A;  1SHZ C;  2XQ7 A;  2D2S A;  4IGU A;  4B3S T;  2CBJ A;  4ISS A;  4EYU A;  4TNV A;  1Y64 B;  2XY8 B;  2ZM8 A;  4PK6 A;  2YU1 A;  5LOV E;  4JI7 T;  3I1A A;  1I94 T;  4TZ4 C;  2XAG B;  1KNZ A;  4HFE A;  4O2A E;  5HYA A;  2LRK A;  4B3R T;  4QXC B;  2ZLY A;  5H6Q B;  3CQX C;  2WU2 A;  3VU7 H;  1US7 B;  2LSG A;  1J5E T;  3A7M A;  3JC6 C;  1W0A A;  3LK2 B;  5DAB A;  3T1H T;  4A98 A;  2CXL A;  5HEO A;  4KMC A;  4ZI3 C;  4G2A A;  3VRA A;  4YTN A;  4YXD A;  1SA0 E;  3BQL A;  3I0O A;  5LB7 B;  4JI3 T;  1OWA A;  5EK3 A;  1U5P A;  2K3W A;  3ZLI A;  1KF6 A;  5LHH B;  4U31 A;  4CI1 B;  2LSY A;  5ABH A;  5JR9 C;  1VCT A;  2KWI B;  5HEG A;  4HFV A;  5HWY A;  4IHJ E;  3PUZ F;  3CX8 B;  4O8S A;  1G8X A;  4X20 E;  4O4H E;  2XAQ B;  3UFE A;  3PUR A;  2V1D B;  2LLY A;  5HXR A;  2K9A A;  4JEH B;  2WU5 A;  4Q25 A;  5ABG A;  2OV9 A;  3SFE A;  3O1I A;  2C5I T;  2ACX A;  4U74 A;  4K0K T;  5AQV B;  5FXW A;  2Y8D A;  4GKJ T;  1YKE B;  4DMV A;  3K1S A;  4A97 A;  1DU2 A;  2V7L A;  2IUB A;  3RKG A;  4IDZ A;  2NWB A;  2CWY A;  4P0B A;  2N2N A;  5AQI B;  1D1A A;  4CN1 A;  1UUR A;  4IE7 A;  2XAF B;  2LM2 A;  2NW7 A;  4CXW A;  3P4S A;  3V5S A;  4TV8 E;  2KZ7 B;  3FXE B;  3RC8 A;  4PJJ A;  1HTJ F;  1MNE A;  1IBM T;  1FEW A;  4U7Y A;  3AA1 B;  5JDQ A;  5JDL A;  5JR9 A;  4P1N A;  1FIO A;  3MK7 C;  4LML A;  1FJG T;  4YLH A;  3PV0 F;  5JDG A;  2NR4 A;  5JR9 B;  3EHZ A;  2RP4 A;  1MMN A;  4AKH A;  3FZH B;  1Z0P A;  3AXJ A;  2WB5 A;  2KIN B;  4JI1 T;  3AEG A;  1XNR T;  2W62 A;  2LHR A;  2J4G A;  1HNW T;  2Y6X A;  3AXJ B;  1XMQ T;  1LRZ A;  4XZC A;  2VL0 A;  2UUA T;  3QB5 A;  3DTO A;  3FZL B;  3AA0 B;  4X5T A;  2BDE A;  1D0X A;  2I0M A;  2OLT A;  3FB2 A;  4QXH B;  3RIA A;  3ZMS B;  2E5L T;  1HCI A;  3OPC A;  3ZMV B;  2UXD T;  2WDR A;  5CFB A;  2CMR A;  3LSV A;  3B57 A;  1OED A;  1M7K A;  4ANJ A;  3ONJ A;  2BBH A;  1HG5 A;  2V7J A;  1IZN B;  1MIY A;  3FBL A;  5JTG A;  3PUW F;  4YY3 T;  2EHO C;  4GIW A;  3E0Z A;  4HN9 A;  1T98 A;  4PFP A;  3ETV A;  4QWN B;  2A9U A;  2W67 A;  4EEB A;  3GN5 A;  1NAF A;  2D0U A;  4IIJ E;  4AQF C;  4DO0 A;  3J7Y q;  2DHR A;  3AEC A;  2CXD A;  5TAO A;  4DR4 T;  4H9O C;  4ZI3 D;  2X67 A;  4ZEY A;  4U3C A;  3X1D A;  2HHH T;  4IST A;  1WR6 A;  2CM0 A;  4MHC A;  1NWM X;  4E7S A;  5AQG B;  4BJM A;  3PUQ A;  2MOZ A;  3KVB A;  2ZMA A;  2WDV A;  2R6G F;  4EAH A;  3PJA A;  2V7M A;  5AQJ B;  1UCU A;  4DR2 T;  4YHJ A;  3HI2 A;  3NRX A;  1N32 T;  1WRD A;  2DWK A;  3CKD A;  1W09 A;  3L3P A;  5LGN B;  5CA1 E;  3H3M A;  4H63 H;  2XHE B;  4ZXL A;  3HKD E;  3ZEF B;  3CML A;  2L8K A;  2JQQ A;  4O2B E;  2VL8 A;  4JLE A;  2LKG A;  3RHW A;  2IDO B;  5EK2 A;  2W2U A;  2VQF T;  2X0Y A;  4U2Z A;  2D9D A;  2XTL A;  2IHR 1;  5FVK A;  2XM2 A;  3PJA J;  5J1G A;  3JAD A;  4YSX A;  3NZP A;  5LJM A;  4EOZ B;  3ZN1 B;  1VOM A;  2Q9Q C;  4I0U A;  3C4W A;  2FUP A;  2EHO B;  5F8P A;  3D0T A;  3A8Y C;  3UUX B;  3C51 A;  3RRC A;  2VAS A;  1T72 A;  3P4P A;  1KNP A;  1YKH B;  1JNZ A;  5AFU L;  2UXN B;  5L4E A;  4EGW A;  1KEY A;  3Q5D A;  3Q9D A;  3M65 A;  1ZOY A;  1MND A;  2W4X A;  4FJO A;  2JQH A;  4C91 A;  5FYM A;  3AEA A;  4DMW A;  2BBJ A;  3PDY A;  2DL1 A;  1FMV A;  1GQE A;  5JRE A;  4F6R C;  2N1G A;  3E22 E;  3ANW B;  3I9W A;  3RRW A;  4UVC B;  4WZX A;  4WBN E;  3FZF B;  2JPF A;  2V5D A;  3PU3 A;  2VUR A;  1YD8 G;  1E7P A;  3K3Q C;  3AEE A;  1HS7 A;  3ZYK A;  1R8I A;  5HWX A;  3HKE E;  4PJN A;  3LBX B;  4DR3 T;  3AVS A;  4K0U A;  2RA1 A;  2WWV A;  4HEA A;  2KT9 A;  4HFC A;  5HEH A;  3IA3 A;  2Y48 B;  3L8R A;  1AJ3 A;  2N9D A;  3NKZ A;  3WI3 A;  2WSS V;  4DV0 T;  2PTF A;  1LVF A;  4LF4 T;  2C0S A;  2Q9Q A;  2M6I A;  1CUN A;  3N2O A;  4OFZ A;  2BKN A;  2WZH A;  5HXC A;  5HAX A;  2XSA A;  2MBG A;  2V8S V;  4OX9 T;  5JDM A;  5BR8 T;  1MMG A;  2W61 A;  2BVM A;  3C4Z A;  3CVR A;  2KXP B;  1VCS A;  1YXR A;  3AE8 A;  4IDP A;  2D5U A;  4NXN T;  3N5L A;  2H88 A;  2FJD A;  2HPL A;  4ZS2 A;  3RYF E;  4DBQ A;  4JI0 T;  3AE1 A;  4IL4 A;  4TN7 B;  4YTP A;  3ESL A;  2PJQ A;  5AQM B;  3N9P A;  2DCF A;  2ZM0 A;  3ZT6 A;  1OXZ A;  3N9O A;  3N9M A;  4DV4 T;  2YN6 A;  3QOF A;  2X66 A;  3UUL A;  3CPZ A;  5LMN T;  2YK0 A;  2PBI A;  3ONL C;  4NUU A;  3RQU A;  1W0B A;  3KV5 A;  4ZI2 D;  3IBP A;  3PTR B;  4HFH A;  2YDR A;  4C90 A;  3RF1 A;  3HL6 A;  1LKX A;  3C4X A;  4QH1 A;  3BQK A;  3U78 A;  2X9X A;  3EAB A;  4EB6 E;  2NTX A;  3VR8 A;  4CN4 A;  2NOX A;  3FHN A;  3TKL B;  4L9I A;  3L09 A;  4UIG A;  2KMF A;  3RIU A;  4DV7 T;  1BR4 A;  5LGT B;  3C50 A;  5M4Y A;  2L9Q A;  4XAX B;  2LHN A;  5BMV E;  3EAM A;  1HNZ T;  2LKH A;  4PW8 A;  3NVO A;  2VKO A;  3U3I A;  2G0U A;  3TLW A;  2J1D G;  2X9W A;  4HWI B;  3DP7 A;  3E08 A;  3QC9 A;  2IML A;  5EK4 A;  4ILU A;  2ODV A;  3NRY A;  5HCM A;  2V6Y B;  3NZQ A;  3OJA A;  3AE7 A;  3AE5 A;  4Z8X A;  2WBL A;  1QSD A;  3PUY F;  3MJX A;  3AA6 B;  3N2G E;  2C5K T;  2Q9Q D;  3AAI A;  3MKD A;  2FJB A;  3PUV F;  1WR0 A;  2BKO A;  5FP3 A;  4ERR A;  2NW8 A;  2WWU A;  5KX5 E;  3GMI A;  1JNR A;  3AAE B;  1QUU A;  4GYS A;  2NP9 A;  4DV2 T;  2WAU A;  1HNX T;  2NW9 A;  1U4Q A;  2WP9 A;  2CRB A;  2BG9 C;  2SPC A;  2WS3 A;  3F57 A;  3GA8 A;  1N33 T;  5DQW A;  3ZMU B;  2IC6 A;  1Z8U A;  3KIN B;  2BG9 E;  2XQ5 A;  1N36 T;  3UFG A;  3AE2 A;  2E9X C;  4PJL A;  2I59 A;  4PAG A;  4EYY R;  4DUY T;  5AQQ B;  4U72 A;  3RYC E;  3HKC E;  2YDQ A;  4PFO A;  1YW0 A;  5HEJ A;  2KND A;  1ZV4 X;  3CK6 A;  3VHL A;  3AED A;  1IBK T;  5AQF B;  3FBZ A;  4ZZC A;  4YSY A;  4DBR A;  4FI5 A;  5CGM A;  4DV1 T;  3ZT5 A;  5FY1 A;  3OVU A;  4E7Z A;  4AQY T;  2PG8 A;  4X64 T;  1MIV A;  3KV4 A;  2H7V C;  2J47 A;  4KX6 A;  1BR1 A;  4X1I E;  2WDQ A;  3CX6 B;  3Q2M A;  4BAY B;  3DJB A;  5LNK A;  5AQU B;  5ABF B;  4HGA A;  3N9Q A;  4I55 E;  4IDO A;  3SFD A;  3TLS A;  4LFA T;  4JI4 T;  2YIN A;  4QHO A;  1IAP A;  5FXV A;  4ILB A;  5LHG B;  3RX6 A;  5LHI B;  4DR1 T;  2J62 A;  5AQR B;  4DV3 T;  5IHY A;  1M62 A;  3UTK A;  2W00 A;  2BG9 B;  3QB5 K;  4A56 A;  2VK9 A;  1HFA A;  2E9X A;  2MYS A;  3RC3 A;  4QH5 A;  3KV9 A;  4KUM B;  2V6X A;  2XQ3 A;  5FNV E;  5C3J A;  2DLR A;  2HN2 A;  4TWF A;  2E9X B;  4IE5 A;  5GON E;  4UEL A;  4NXM T;  4GK0 E;  2H89 A;  3MZK B;  3PUS A;  2B76 A;  4EZ4 A;  3ZJ2 A;  4ILA A;  2LSI A;  4DND A;  3P4R A;  4ZHQ E;  1KK7 A;  1YQ4 A;  3S4U A;  2YKS A;  3JC6 D;  4QXB B;  2WMN A;  2WM9 A;  3N9L A;  3UQ4 A;  1YQ3 A;  3LDQ B;  2BVL A;  3C98 B;  3ZMT B;  3CWZ B;  3UUM A;  2P9B A;  5L47 A;  4X66 T;  3KV6 A;  3TLU A;  5CB4 E;  4JBW F;  5IUX A;  5FY7 A;  4WYV A;  3EDV A;  2UUC T;  2XPK A;  2CEA A;  4CN6 A;  4LF5 T;  1E2A A;  4O4L E;  3LFM A;  3ZN0 B;  4KP3 C;  2M67 A;  3UT5 E;  1HF8 A;  2FJE A;  1QLB A;  2UXB T;  2VKD A;  3TLT A;  4KHZ F;  3GWH A;  5ETW A;  2XQA A;  1WCR A;  4YFS A;  3KBT A;  3AEF A;  2YEV C;  3JAE A;  2YU2 A;  2X51 A;  5E0O A;  4EED A;  1KNR A;  4AKI A;  3IEE A;  3ZT7 A;  4AIU A;  3UU3 A;  3P7I A;  1LVK A;  3M3Z B;  1D1C A;  4UVA B;  4B6X A;  5DQV A;  5JDH A;  4I50 E;  4LF9 T;  2W63 A;  4AXP A;  3OYX A;  3F2E A;  5HXE A;  4X62 T;  2JJ9 A;  2F4V T;  3UU8 A;  2VVS A;  2K48 A;  1IJ6 A;  4Z91 A;  3R6N A;  2JIW A;  3SRZ A;  3HA4 A;  5FXX A;  4ZS3 A;  3QUJ A;  2EHO A;  2VKJ A;  3ZJ1 A;  5C8Y E;  4JV5 T;  2XAS B;  2WY2 A;  4PNI A;  3FXD B;  3ZC0 A;  2BKP A;  3EVY A;  3PUG A;  3PUA A;  4HWD A;  5JDF A;  2AXD S;  1G73 A;  4EZH A;  4HWH A;  4YSZ A;  2V5C A;  4LMJ A;  4AQF A;  4X1Y E;  4KBM B;  3UU5 A;  4COF A;  4BJN A;  2ODU A;  4CI3 B;  4JYA T;  3PUX F;  5IYZ E;  3H3A A;  2V7I A;  5LG4 A;  1WLX A;  4HFI A;  4H9P C;  3LK3 B;  2E9X D;  2BS4 A;  4MBQ A;  4CXX A;  2DI4 A;  3ZST A;  3ANW A;  3RYH E;  1IJ5 A;  3KDS E;  2FJA A;  2JQ9 A;  2MPK A;  2L3L A;  3A5X A;  4XBF B;  3VKG A;  2VB6 A;  4LF7 T;  4YJ2 E;  4IL9 A;  4ADZ A;  3SS1 A;  2LOP A;  3LBX A;  3RKO A;  1D0Y A;  2JQK A;  4IE6 A;  4TWD A;  4EIW A;  4LMK A;  5LCY A;  1J5W A;  4HKA A;  5LA6 E;  1HG2 A;  3ETU A;  2D0T A;  4X1K E;  4CI2 B;  3CQC B;  1N34 T;  2QGS A;  4U7I A;  3AB3 B;  4GK5 E;  3RH3 A;  2CA5 A;  2IW5 B;  1D0Z A;  1UGO A;  4I43 B;  5LP6 E;  2IIU A;  2XSB A;  5JRC B;  3J9X 1;  3O9X A;  2WZI A;  3HKB E;  4MLK A;  3OKQ A;  5HXH A;  4U33 A;  5FL1 A;  2HH7 A;  2X9H A;  4UVB B;  4HFB A;  4EXT A;  5FMN A;  2VKH A;  4H9S E;  4YTM A;  5H6R B;  3UU6 A;  4WW0 A;  3RGL A;  1V9D A;  4AKL A;  4OYJ A;  4DR5 T;  3OBV E;  4ILC A;  1XMO T;  2LJL A;  2EHO D;  2LM9 A;  3G06 A;  3P4W A;  4X65 T;  4YJ3 E;  3IHR A;  3P50 A;  3O4X E;  5DJQ C;  2IAK A;  3LG7 A;  1MMA A;  4NUV A;  3ONX A;  4IE4 A;  1SE7 A;  2E5V A;  4OK0 A;  2CHO A;  1NEN A;  2OA5 A;  2LSJ A;  4YHH T;  1L0V A;  5LXT E;  3B13 A;  4HWC A;  2XJ7 A;  4NPP A;  4UR9 A;  5LG3 A;  5J2T E;  3CQG B;  3PU8 A;  2BZB A;  2UXC T;  4JI5 T;  3T1Y T;  1W9R A;  2H3R A;  4AI6 A;  1B7T A;  3P8C D;  2YDS A;  2PFV A;  4CZZ B;  1HR0 T;  4HE8 A;  2CLY C;  4H63 V;  3AE6 A;  2CCQ A;  3BQI A;  4H9N C;  1H7C A;  4QX8 B;  4GYR A;  2V6Y A;  4B3M T;  1T8B A;  3LK4 2;  4QX7 B;  1FMW A;  4LF6 T;  5AQL B;  1ZHC A;  3PE0 A;  2CBI A;  2W66 A;  3UQ7 A;  3RQW A;  3FZK B;  1XDO A;  4IDQ A;  5ADX L;  3KBU A;  2XUE A;  3FZM B;  2XAJ B;  2IC9 A;  3ZCJ A;  3R84 B;  2GK9 A;  3Q5X A;  1UX5 A;  3EDU A;  4JI6 T;  4DID B;  4PK4 A;  4EV6 A;  2WQY A;  2KWH A;  4KI0 F;  4P0A A;  4KHP T;  5HXS A;  2MTQ A;  5L3C B;  2X68 A;  3B5M A;  1Y01 A;  3WAJ A;  2VWA A;  3NWI A;  3H37 A;  5AQT B;  3O1J A;  3VRB A;  4IRE A;  1OED C;  4J2C A;  5LBQ B;  4JEU B;  1D1B A;  5KXJ A;  2XAH B;  2XQ9 A;  1OED E;  4OHF A;  2MAW A;  3P4Q A;  3N2K E;  3O1H A;  2XZE A;  4ZOL E;  4H9R C;  1XZY A;  5AQP B;  3AAA B;  4H9Q C;  4LF8 T;  2CLY B;  4MAL A;  1WYC A;  4JI2 T;  2LT3 A;  3AE9 A;  2RPA A;  4F8H A;  2CWO A;  2WCA A;  2HN1 A;  3QK6 A;  3NBX X;  4UXN B;  3UU4 A;  1ZP0 A;  2XM1 A;  5LMU T;  5ABF A;  1HX1 B;  4O4J E;  5L3E B;  5F5W A;  3F31 A;  4IE0 A;  4GKK T;  2LRL A;  4IDN A;  1T7S A;  3K3N A;  3ZYL A;  5IWA T;  3ZKR A;  3AVR A;  2WMO A; 
#chains in the Genus database with same CATH homology
 4X20 E;  3N2O A;  4O4H E;  2K48 A;  2XAQ B;  3IF8 B;  1IJ6 A;  3Q5W A;  3UFE A;  3R6N A;  3PUR A;  4OFZ A;  2V1D B;  5HXC A;  5HXR A;  5HAX A;  3SRZ A;  3HA4 A;  5FXX A;  4ZS3 A;  5LJN A;  2K9A A;  3QUJ A;  2EHO A;  4JEH B;  2MBG A;  2VKJ A;  3ZJ1 A;  4ASK A;  5C8Y E;  2XAS B;  1BR0 A;  4PNI A;  3O1I A;  2C5I T;  3FXD B;  5JDM A;  3ZC0 A;  3EVY A;  2ACX A;  4U74 A;  3KFW X;  3PUA A;  3PUG A;  4BA9 A;  1MMG A;  2W61 A;  2Y8D A;  5FXW A;  2BVM A;  5JDF A;  4I4T E;  3C4Z A;  5KMG P;  1G73 A;  2XQY A;  4EZH A;  3CVR A;  1YKE B;  2KXP B;  3MA9 A;  2ES0 A;  4AQG A;  4HTE A;  4AQF A;  1BR2 A;  4X1Y E;  2D5U A;  4KBM B;  4DMV A;  3N5L A;  4BJN A;  2HPL A;  2V7L A;  2ODU A;  4ZS2 A;  3RYF E;  4DBQ A;  4CI3 B;  5IYZ E;  1UX4 A;  4TN7 B;  3SOL A;  2LEH A;  4IDZ A;  3ESL A;  2NWB A;  2CWY A;  3H3A A;  2PJQ A;  2V7I A;  2A72 A;  4P0B A;  1WLX A;  5LG4 A;  2A3D A;  2JRK A;  2N2N A;  4H9P C;  3LK3 B;  2E9X D;  2X0L B;  3N9P A;  2DCF A;  1D1A A;  2CE7 A;  3EUH A;  3LJC A;  4MBQ A;  4CXX A;  2ZM0 A;  2QA7 A;  4IE7 A;  1OXZ A;  5JQG E;  2XAF B;  2DI4 A;  1VRB A;  3ANW A;  3N9M A;  3N9O A;  3RYH E;  1IJ5 A;  2X66 A;  3UUL A;  3KDS E;  4WBO A;  2NW7 A;  4CXW A;  4GOU A;  3CPZ A;  3K8P C;  2YK0 A;  3V5S A;  4TV8 E;  2LE8 A;  2PBI A;  4OYK A;  2KZ7 B;  3I9Y A;  4NUU A;  3FXE B;  3RC8 A;  3KV5 A;  2L3L A;  3A5X A;  4ZI2 D;  4XBF B;  2UXX B;  2V7K A;  3IBP A;  1HTJ F;  3PTR B;  4PJJ A;  4MFR A;  1MNE A;  3VKG A;  1FEW A;  3HR0 A;  4C90 A;  2VB6 A;  2A2F X;  3HL6 A;  3AA1 B;  1LKX A;  3C4X A;  4YJ2 E;  5JDQ A;  3BQK A;  3GN5 B;  2X9X A;  3SS1 A;  3U78 A;  5JR9 A;  4ADZ A;  5JDL A;  2LOP A;  4EB6 E;  3C64 A;  3LBX A;  3RKO A;  1FIO A;  2LOS A;  1D0Y A;  3MK7 C;  2NTX A;  5L3G B;  1MMD A;  5J2U E;  4ZI2 C;  4IE6 A;  4TUY E;  4YLH A;  4EIW A;  2NOX A;  5JDG A;  3FHN A;  3TKL B;  5LCY A;  4HKA A;  5JR9 B;  4L9I A;  3SWH A;  3WAK A;  3L09 A;  4UIG A;  2KMF A;  5LA6 E;  1BR4 A;  5LGT B;  2RP4 A;  1HG2 A;  3C50 A;  5M4Y A;  2B1E A;  2L9Q A;  3ETU A;  4XAX B;  2LHN A;  5BMV E;  4L0R A;  2D0T A;  1S94 A;  1ZKE A;  4X1K E;  1MMN A;  4M1P A;  5KDM C;  4CI2 B;  4AKH A;  3CQC B;  4PW8 A;  1X79 A;  3RPU A;  5L2L A;  4TV9 E;  2VKO A;  4AKR B;  1Z0P A;  2QGS A;  3U3I A;  2JMH A;  2V26 A;  3AB3 B;  2KIN B;  4GK5 E;  3RH3 A;  2G0U A;  2CA5 A;  2W62 A;  2IW5 B;  2LHR A;  1D0Z A;  5EZY E;  2J1D G;  4I43 B;  5LYJ E;  2X9W A;  1MIW A;  3DP7 A;  3E08 A;  3OYZ A;  3QC9 A;  2Y6X A;  1LRZ A;  4XZC A;  3K3O A;  5LP6 E;  5EK4 A;  4ILU A;  2ODV A;  4UV9 B;  3DTO A;  5JRC B;  3J9X 1;  3O9X A;  3NRY A;  3OJA A;  3NZQ A;  3AA0 B;  3HKB E;  4MLK A;  3OKQ A;  5JH7 E;  3ZCI A;  5HXH A;  2X9Y A;  2BDE A;  2HH7 A;  1D0X A;  2E8I A;  4Z8X A;  2WBL A;  4CQI A;  1QSD A;  2X9H A;  3FB2 A;  4UVB B;  4QXH B;  4EXT A;  3MJX A;  4ZI7 E;  5FMN A;  3AA6 B;  3ZMS B;  3N2G E;  2C5K T;  2Q9Q D;  3AAI A;  1HCI A;  3MKD A;  2VKH A;  3ZMV B;  4H9S E;  5FP3 A;  5H6R B;  4ERR A;  2CMR A;  2NW8 A;  4V1A v;  2WWU A;  5CA0 E;  3B57 A;  1S35 A;  3W15 B;  4WW0 A;  1V9D A;  3GMI A;  5KX5 E;  1O3X A;  4DVD A;  4AKL A;  4ANJ A;  4OYJ A;  2H7O A;  3AAE B;  1QUU A;  3OBV E;  1HG5 A;  2LJL A;  2EHO D;  2LM9 A;  5L3F B;  2NTY A;  2V7J A;  4GYS A;  2NP9 A;  4YJ3 E;  3IHR A;  2WAU A;  2NW9 A;  2CXF A;  1U4Q A;  3O4X E;  1IZN B;  4QKN A;  1MIY A;  5DJQ C;  3FBL A;  5LGU B;  2SPC A;  3ZC1 A;  5L3D B;  2IAK A;  3F57 A;  3LG7 A;  3ZMZ B;  1MMA A;  3GA8 A;  5DQW A;  4NUV A;  3ONX A;  2EHO C;  3ZMU B;  2IC6 A;  3KIN B;  4GIW A;  3E0Z A;  4IE4 A;  4HN9 A;  4AKG A;  1T98 A;  2ZM2 A;  4PFP A;  3ETV A;  4QWN B;  5JDN A;  4OK0 A;  3MAC A;  1E1H B;  2HPJ A;  2E9X C;  4PJL A;  3GN5 A;  2I59 A;  2OA5 A;  1NAF A;  2DNX A;  5LBM A;  4O4I E;  2LSJ A;  4L5G A;  5LXT E;  4PAG A;  3B13 A;  2W0G A;  4EYY R;  2D0U A;  4IIJ E;  4AQF C;  3VKH A;  4DO0 A;  3J7Y q;  2DHR A;  3BK9 A;  4U72 A;  3RYC E;  5J2T E;  2CXD A;  3HKC E;  3CQG B;  5TAO A;  4PFO A;  1YW0 A;  3PU8 A;  4H9O C;  4ZI3 D;  2X67 A;  2BZB A;  2KND A;  1ZV4 X;  4N78 D;  2KLQ A;  3MXZ A;  3VHL A;  2H3R A;  1HX8 A;  3V5U A;  5FXZ A;  4AI6 A;  3FBZ A;  1B7T A;  3RYI E;  5JVD E;  4IST A;  4DBR A;  3P8C D;  1WR6 A;  4FI5 A;  2CM0 A;  4MHC A;  1NWM X;  4E7S A;  2PFV A;  4BJM A;  4CZZ B;  5FY1 A;  3PUQ A;  2MOZ A;  3KVB A;  4HE8 A;  2ZMA A;  2CLY C;  1EZ3 A;  4E7Z A;  4JUY A;  2K24 A;  3ZPO A;  4EAH A;  2PG8 A;  2K5B B;  4H63 V;  2V7M A;  4PJM A;  1MIV A;  3KV4 A;  2CCQ A;  5FY0 A;  1UCU A;  5A1L A;  3BQI A;  2H7V C;  4YHJ A;  1BR1 A;  3HI2 A;  3NRX A;  1WRD A;  4H9N C;  1H7C A;  4QX8 B;  4X1I E;  5JRC A;  4UEM A;  1ZEE A;  2DWK A;  3CX6 B;  4GYR A;  3CKD A;  4WNK A;  3ZYM A;  3L3P A;  3N9N A;  5LGN B;  5CA1 E;  2C5J A;  4H63 H;  4UF0 A;  3LK4 2;  3Q2M A;  2XHE B;  4BAY B;  2JMK A;  4QX7 B;  1FMW A;  3DJB A;  3I0Q A;  3HKD E;  3ZEF B;  5LNK A;  3AA7 B;  1ZHC A;  3CML A;  2L8K A;  2JQQ A;  3PE0 A;  4O2B E;  2VL8 A;  4JLE A;  4TX5 A;  4HGA A;  5L3B B;  3N9Q A;  4I55 E;  4PK5 A;  5EK2 A;  4UF0 B;  3T8O A;  2YIN A;  4QHO A;  1IAP A;  5FXV A;  2XTL A;  4CXY A;  5LHG B;  1WYB A;  3RX6 A;  5LHI B;  2Q9Q B;  5ADX L;  3KBU A;  4P09 A;  2XUE A;  5IHY A;  3UTK A;  5F3J A;  2W00 A;  5J1G A;  2XAJ B;  2IC9 A;  3NZP A;  5LJM A;  2DWG A;  3ZCJ A;  3R84 B;  3UUN A;  2Z6E A;  2GK9 A;  4A56 A;  3CX7 B;  2VK9 A;  4EOZ B;  3ZN1 B;  1VOM A;  3Q5X A;  2Q9Q C;  1HFA A;  2E9X A;  2MYS A;  2LSK A;  3KVA A;  4G63 A;  3C4W A;  3RC3 A;  4UV8 B;  2EHO B;  1UX5 A;  3KV9 A;  5F8P A;  3D0T A;  1SHZ C;  4KUM B;  3EDU A;  3UUX B;  3C51 A;  2D2S A;  4IGU A;  5FNV E;  3RRC A;  2DLR A;  4PK4 A;  4ISS A;  2KWH A;  4EYU A;  4P0A A;  5HXS A;  2E9X B;  1Y64 B;  2VAS A;  2ZM8 A;  4PK6 A;  2YU1 A;  2MTQ A;  5L3C B;  4IE5 A;  5GON E;  5LOV E;  1YKH B;  2X68 A;  4UEL A;  5AFU L;  2UXN B;  3I1A A;  4GK0 E;  4TZ4 C;  3MZK B;  3PUS A;  2VWA A;  3WAJ A;  2XAG B;  1KNZ A;  3H37 A;  4O2A E;  3ZJ2 A;  4EZ4 A;  5HYA A;  2LSI A;  4DND A;  3Q9D A;  4ZHQ E;  3M65 A;  1KK7 A;  3S4U A;  4QXC B;  2ZLY A;  1MND A;  3JC6 D;  5H6Q B;  4FJO A;  4QXB B;  2WMN A;  3O1J A;  4C91 A;  2WM9 A;  3CQX C;  5FYM A;  3N9L A;  4J2C A;  2BVL A;  5LBQ B;  4DMW A;  4JEU B;  3C98 B;  3VU7 H;  1D1B A;  1US7 B;  2LSG A;  2XAH B;  3ZMT B;  4OHF A;  3PDY A;  3CWZ B;  3N2K E;  3O1H A;  3UUM A;  1FMV A;  4ZOL E;  5JRE A;  2P9B A;  3JC6 C;  4F6R C;  4H9R C;  2N1G A;  3KV6 A;  3E22 E;  3LK2 B;  3AAA B;  3ANW B;  3I9W A;  3RRW A;  5CB4 E;  4UVC B;  4H9Q C;  5DAB A;  2CLY B;  4WBN E;  5FY7 A;  2JPF A;  3EDV A;  4MAL A;  2CXL A;  1WYC A;  3PU3 A;  2CEA A;  4O4L E;  4KMC A;  4ZI3 C;  3LFM A;  4G2A A;  2LT3 A;  3ZN0 B;  4KP3 C;  2M67 A;  3UT5 E;  1HF8 A;  1YD8 G;  2VKD A;  3GWH A;  1SA0 E;  5ETW A;  3K3Q C;  4YFS A;  3BQL A;  3KBT A;  3I0O A;  1HS7 A;  3ZYK A;  2YEV C;  2CWO A;  2YU2 A;  2X51 A;  5E0O A;  1OWA A;  5HWX A;  3HKE E;  5EK3 A;  3QK6 A;  1U5P A;  4PJN A;  3LBX B;  3NBX X;  4UXN B;  4AKI A;  3IEE A;  3ZLI A;  3AVS A;  4K0U A;  5LHH B;  2RA1 A;  3P7I A;  1LVK A;  4CI1 B;  2LSY A;  4HEA A;  4O4J E;  1D1C A;  2KT9 A;  4UVA B;  4B6X A;  5L3E B;  5JR9 C;  2Y48 B;  5DQV A;  5JDH A;  3F31 A;  1AJ3 A;  4I50 E;  2KWI B;  2N9D A;  4IE0 A;  4HFV A;  5HWY A;  2W63 A;  4AXP A;  3OYX A;  3WI3 A;  3K3N A;  4IHJ E;  3ZYL A;  2WSS V;  3F2E A;  1LVF A;  3AVR A;  5HXE A;  2WMO A;  2C0S A;  2JJ9 A;  2Q9Q A;  3CX8 B;  1CUN A;  4O8S A;  1G8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...