2NWBA

Crystal structure of a putative 2,3-dioxygenase (so4414) from shewanella oneidensis in complex with ferric heme. northeast structural genomics target sor52.
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
392
structure length
379
Chain Sequence
TYNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYIAEPSVSMPLHVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLRLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Oxidoreductase
total genus 149
structure length 379
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08933 DUF1864 Domain of unknown function (DUF1864)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA02
1.20.58.600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nwbA01
4PK5A 2NOXA 2NW8A 2D0TA 4U74A 2D0UA 2NW7A 2NWBA 4HKAA 4U72A 2V7LA 5ETWA 3BK9A 3E08A 1ZEEA 2V7KA 2V7MA 2X67A 5EK4A 4PW8A 5EK2A 2X66A 2V7JA 2NW9A 5EK3A 2V7IA 1YW0A 4PK6A 2X68A
chains in the Genus database with same CATH superfamily
5IWAT 4U2ZA 3JAFA 4DR4T 3JCFA 3PUWF 2WU2A 4KHPT 5LBQB 4DBRA 1T7SA 1KNZA 4GIWA 2CBJA 2XQYA 5AQMB 2HHHT 3CX8B 3FZKB 3QNUA 1HF8A 4HKAA 1D0XA 3UULA 2DCFA 2XAHB 5A1LA 4LF6T 2W0GA 2XTLA 3N9MA 4TV9E 4IHJE 2XAQB 4QWNB 2YU1A 3IBPA 1D0YA 3OKQA 4GK0E 2MPKA 2VKJA 2DWGA 2X9HA 4O2AE 3AVRA 5TAOA 3RC3A 2CEAA 5DQVA 3UU3A 3UQ7A 2IC6A 2W62A 2X9YA 3UUMA 4MFRA 4DV4T 5JDNA 3E08A 2I0MA 3RH3A 1KFYA 3CK6A 4DIDB 2IMLA 2WQYA 4LFCT 3G06A 1Z0PA 2Y6XA 3AAIA 4V1Av 3E0ZA 2I59A 4U7IA 1QUUA 2XJ7A 2DHRA 2XUEA 4DV7T 4A98A 3MKDA 1ZKEA 2GK9A 4KI0F 1M7KA 3FXEB 5HXSA 4ADZA 3CWZB 3VR9A 2VK9A 5HAXA 1NWMX 4QH5A 5JRCB 2BVLA 2BBJA 2N9DA 2VB6A 4PJLA 3Q5EA 3AB3B 3U78A 1GQEA 4I0UA 2KNDA 3A8YC 1ZV4X 3J7Yq 5AQUB 3P50A 2ZLYA 2ACXA 1VCTA 3N9PA 3EDVA 2N1GA 4U74A 1J1JA 3AEGA 4BA9A 4JV5T 1WCRA 3AEDA 4AQFC 4YJ2E 2DWKA 3ZJ2A 4EZHA 2RP4A 2CE7A 4CXXA 4AIUA 2DLRA 1IBLT 4DMVA 3MK7C 3PUVF 3WAJA 2B1EA 4B3TT 4IDPA 2AE9A 5FMNA 2FUPA 4L9IA 4HFBA 2MOZA 2WSSV 3O1IA 2FJBA 1QLBA 1H7CA 2X68A 3RYFE 5IHYA 1B7TA 1XMQT 2N2NA 5L3DB 3MZKB 3L09A 4CN4A 2LLYA 2WZIA 4YTPA 2D9DA 4TV8E 1Y64B 5JDMA 4Z91A 3SS1A 4DR6T 1X79A 1XZYA 2VASA 4JI7T 1UGOA 2XSAA 4CI1B 5AQVB 3A5XA 1BR0A 2C5KT 5JTGA 4KUMB 2BG9B 1UX4A 1R8IA 1KF6A 1OEDB 4IE7A 2D0TA 4O4IE 4UVCB 3AE9A 2YKSA 5KDMC 3NVOA 4DR3T 2RA1A 4JI5T 4NUVA 3H3MA 3TLSA 1UX5A 1US7B 3ZC1A 4QKNA 2KLQA 3RIFA 2NW8A 2A9UA 1OEDE 5AQHB 1SA0E 2XPKA 4M1PA 4X1IE 5JR9B 3IEEA 1S35A 5ABEA 2H7OA 5FY7A 4ZZCA 2XHEB 4YSXA 3AEFA 4QXCB 4FI5A 2PG8A 4WW0A 2V7MA 2Y8DA 4O4HE 2IDOB 3I0QA 2NTXA 4UR9A 1W09A 1T72A 4YHHT 4EYYR 4JI4T 3ZT6A 2JPFA 3GMIA 3HKEE 2EHOA 3RIUA 2YDSA 4GK5E 4ILUA 4O2BE 4AQYT 3Q5DA 2V1DB 2F4VT 3ANWB 1HTJF 4EZ4A 2I6HA 3CX6B 4I50E 3UQ4A 2L8KA 4JI6T 3ETVA 3OYXA 4ZEYA 2XQ6A 2YDRA 5AQQB 1NEKA 4LF7T 5AQGB 2WZHA 2Q9QB 2WU5A 3K3NA 4GKJT 2JQHA 1XMOT 1MMAA 3PUYF 5LGUB 2ZM2A 4PJNA 3ZT7A 2X67A 1FIOA 1T8BA 2YOEA 3RKGA 2CXFA 1E1HB 3RYIE 3AEEA 2PBIA 4CI2B 5L3GB 3I1AA 5LXTE 5FL1A 4IDQA 3UUNA 3ZYMA 2L3LA 2V5DA 4EYUA 3AXJB 3ONJA 2ZM0A 3O1HA 2BVMA 4Q25A 4EB6E 2CHOA 5EK4A 3UU6A 4LFBT 3N2OA 3SFEA 3FB2A 2LEHA 3PUGA 5IYZE 4DR2T 4ILBA 5ADXL 2YDQA 3CVRA 4X64T 2ODVA 2K48A 4LF5T 2XQ7A 5FXZA 3AAEB 5H6RB 1IBMT 2K5BB 2M6IA 2XM1A 5LHIB 2JMKA 3PTRB 3X1DA 2NOXA 3ETUA 3RYHE 2XQAA 4HWHA 3TKLB 1UUSA 3OPCA 5KXJA 2P9BA 1LKXA 2B76A 3ZPOA 5CA0E 5L3BB 3ZMVB 1W9RA 3EI0A 3AEBA 2K9AA 5CJ5A 2IW5B 5JREA 2BS2A 2CRBA 2LKHA 5EK3A 3P4RA 4DV5T 3PJAA 3TLWA 4YHJA 4EV6A 2LOPA 2YN6A 2DL1A 3C50A 4HFEA 4AKIA 5EZYE 4EEDA 3MXZA 4DR7T 2VL8A 2WDQA 5JVDE 4MHCA 3R84B 1MIWA 2Y48B 4I55E 3QUJA 2WMNA 5JDQA 4OX9T 3T1HT 3KV6A 3MA9A 2CA5A 3TLTA 4HWCA 4A97A 4NPPA 2W67A 3C51A 3LDQB 1U5PA 4QH1A 4PFPA 1BR4A 3NZQA 3K8PC 4X20E 3DP7A 4LMKA 5FVLA 1IBKT 3CPZA 1I6ZA 5JH7E 4TWFA 1FMVA 5HEUA 2D0UA 5FYMA 2MTQA 1WYBA 5LJNA 2KWHA 1ZHCA 3AE3A 2IAKA 5E0OA 2QGSA 2XY8B 4BJNA 4AKRB 4CQIA 2WB5A 1S94A 1N36T 5JDFA 3EVYA 4LF4T 4X5TA 2V8SV 2V7LA 4UVBB 4ZI2D 5BR8T 1J5WA 1ZEEA 2LSIA 3JAEA 2D2SA 3CQCB 1YXRA 4U7YA 3PU3A 4KP3C 3P4SA 3ZMUB 5JDLA 3UFEA 1LRZA 4ZZBA 4B3MT 3PUQA 4TN7B 3HI2A 5DJQC 3M3ZB 3NZPA 3C4ZA 4DV6T 5LHGB 2BG9C 3PE0A 5FVKA 1OEDC 3NRXA 4DNDA 3AE1A 4JEUB 5AQKB 4X1YE 1HX1B 4AI6A 2MAWA 3OYZA 4HWDA 4DUYT 2VKDA 2WS3A 2E9XD 5C3JA 4PAGA 4AQGA 5J2TE 2E8IA 5LNKA 5FL0A 2XQ8A 2MYSA 4YLHA 4HEAA 2WDVA 3CQGB 2FJEA 3ZC0A 2UUBT 4IT4A 1BR2A 2LJLA 4IE4A 5JR9C 3SFDA 5JRCA 1XDPA 1HFAA 4L5GA 2LOSA 2VURA 2XAFB 2UXDT 5LA6E 4WZXA 3OJAA 4JI0T 2JQKA 4TNWA 4F8HA 2WP9A 4QHOA 1JNZA 3AE8A 4KX6A 5FNVE 3P4QA 4HFHA 4JYAT 3V5UA 1VRBA 5AQFB 1YKHB 4H9PC 4C91A 3NRYA 4JI2T 1D1BA 4DV3T 3FBZA 3BQIA 2W61A 2Q9QD 5HXRA 3PUZF 2ACZA 2LKGA 2W66A 4COFA 2M67A 5ETWA 4BAYB 3IF8B 2LM2A 3GN5A 2XAJB 5GONE 1CUNA 2CWYA 2W4XA 2XQ4A 5AQLB 2Q9QC 5FXXA 2V6YB 3VRAA 5FXWA 3KBTA 3N9NA 4TX5A 2HPJA 2H88A 4KHZF 4K0UA 4OK0A 3LBXB 4IL9A 3EAMA 1HCIA 4ANJA 2KT9A 4WBNE 2Z6EA 3AA1B 3BQLA 4P1NA 5J1GA 5F8PA 4HGAA 2LSGA 4JUYA 5LGNB 1KNRA 1U4QA 2V5CA 4JI8T 4HFCA 2J47A 2K3WA 2ZM8A 2BG9A 2E9XB 4NUUA 5L3FB 3K1SA 3Q9DA 2CLYB 5ABGA 1YQ4A 4A5XA 1N34T 5LOVE 3UU8A 5HEGA 4JEHB 4ASKA 1KNPA 2EHOB 2A72A 3KV5A 3VR8A 4DR1T 1I94T 2KXPB 4P09A 3NBXX 3ZCIA 1IJ5A 2QRXA 4AQFA 3KV9A 1HNXT 5JR9A 1YKEB 2CCQA 3ABVA 3FZHB 3SWHA 2UUAT 2WAUA 5M4YA 3KINB 5L4HA 2R6GF 3AA6B 4ZS2A 3LFMA 4PK4A 3AE5A 3SRZA 4N78D 3L3PA 3CKDA 4XAXB 2CHNA 2MBGA 2KINB 2HN2A 2YINA 1KEYA 4AKGA 4ISSA 1D0ZA 2VWAA 5LP6E 4TNVA 4KMCA 2J4GA 2FJAA 4ZI3D 4HFVA 1L0VA 5L3EB 1E2AA 4B3RT 2WY2A 1E7PA 3J9X1 5IUXA 2CPTA 3A7MA 4X62T 3E22E 3ESLA 5LCYA 3UU4A 3L8RA 1ZOYA 2XQ9A 4K0KT 3OBVE 3AAAB 4QX7B 3KBUA 3FXDB 3LG7A 2W63A 4H63V 3LSVA 5H6QB 4PJJA 2E2AA 1D1CA 4O4JE 3FHNA 5AQNB 3H3AA 2D5UA 2NW9A 1X9BA 1V9DA 2ES0A 3OVUA 4UV8B 3TLUA 4OYKA 5CB4E 1QSDA 3AA7B 2BKNA 3HA4A 2H89A 3ZT5A 1MMNA 3B13A 4J2CA 3GA8A 2WWUA 5C8YE 4XBFB 1WRDA 5LGTB 3ZMSB 2JMHA 5L2LA 1HNZT 2LSJA 2BDEA 4HN9A 2KSRA 4UELA 3AE2A 2CBIA 3KVAA 2BS3A 4C90A 4UEMA 3RHWA 1BR1A 3HKDE 3K3OA 5HXCA 3N9LA 4X1KE 2W00A 4NXNT 4ZHQE 1MMGA 5LG4A 3Q5XA 3IA3A 5ABFA 2M6BA 4YSYA 1W0BA 3AECA 3UFGA 4PNIA 4I43B 4UV9B 4IDZA 3B57A 4QXHB 2OA5A 3ZLIA 3KFWX 1MNDA 4H9SE 2A3DA 3I9WA 4PJMA 4P0BA 3VU7H 5KX5E 4QH4A 3PU8A 4UF0A 1N33T 2YK0A 2QYWA 3I0OA 2LSYA 3RLFF 1NENA 4CN6A 2FJDA 2CM0A 5HXHA 2H3RA 1FMWA 5LB7B 5JDHA 4DV2T 1VCSA 1NAFA 3N2KE 2UXXB 5AQPB 1HX8A 4CZZB 2OLTA 3EABA 3RQWA 3JC6D 3RC8A 4PK5A 4NIQA 3L39A 3QB5K 4HE8A 3WI3A 4TWDA 3KDSE 4EEBA 4Z8XA 3AEAA 2ODUA 2LRLA 2X9XA 1O3XA 4MBQA 4GYRA 4UVAB 2RPAA 3JC6C 3P4WA 4TWHA 5CA1E 2V26A 3ZN0B 4ILCA 4QX8B 2UXCT 1HR0T 1OXZA 2XZEA 2X0LB 4ZXLA 4CN1A 5F3JA 5AQJB 1HNWT 4AXPA 2XSBA 3U3IA 1Y01A 2LHNA 2L9QA 2G0UA 2HPLA 4I4TE 2NWBA 2LE8A 2XASB 4IE0A 4CXWA 3T8OA 4O4LE 3TLVA 4HWIB 1OWAA 3HL6A 3JADA 3ZMTB 4IE5A 4YSZA 1KK7A 1WFDA 2XM2A 4AKLA 1IAPA 3I9YA 4ZI2C 3ZN1B 4U3CA 3LJCA 3OTOT 1J5ET 2VVSA 5FXVA 3RI5A 5BMVE 3QOFA 1G73A 3K3QC 4B6XA 4ISTA 2LM9A 2LHRA 3F31A 2X0HA 5AFUL 5HWXA 2J62A 5KMGP 4OYJA 1D1AA 1YD8G 4LF8T 3RIAA 2VVNA 3UU5A 4ZS3A 3QK6A 3C4XA 4U72A 2DI4A 4WBOA 4EOZB 2EHOD 2E9XC 3P4PA 4EAHA 2PFVA 2JRKA 1EZ3A 2CLYC 4WYVA 3W15B 3Q5WA 3PUXF 1VOMA 3RKOA 2E5VA 4YJ3E 3VHLA 1SUMB 2LT3A 3N5LA 1N32T 4H9OC 4LMLA 3RQUA 2EHOC 2NR4A 3O9XA 4E7ZA 3RIUC 3PJAJ 3EHZA 3PUSA 4EGWA 4ILAA 5JDGA 3B5MA 3NKZA 5HEHA 5LBMA 4P0AA 3BK9A 4U33A 1MIYA 4LF9T 3PDYA 2UU9T 3GN5B 5EK2A 2X66A 2YEVC 2HN1A 1G8XA 4EXTA 2FBWA 1WR0A 1LVFA 1WR6A 2VL0A 3AE7A 5AQIB 3DJBA 4YT0A 5L3CB 4G2AA 4TZ4C 4NXMT 2DNXA 1DU2A 5L4EA 5CFBA 4X66T 3H37A 1UK5A 4ZOLE 2C5JA 2CMRA 2CXDA 4LFAT 5FY0A 2BKPA 4YY3T 1YQ3A 2KWIB 4GYSA 3ONLC 4HFDA 3RRCA 5DQWA 1W0AA 2IUBA 2W2UA 1FEWA 1JNRA 2C0SA 2QA7A 2V6XA 5LJMA 4UXNB 1HG5A 2J1DG 2X9WA 4IGUA 3P8CD 2LRKA 5DABA 2BKOA 3IHRA 3UTKA 5F5WA 2A2FX 2VKOA 5C2TA 3ZMZB 1UURA 3CIRA 4JI3T 1M62A 3RF1A 2V6YA 3C98B 3GWHA 2IHR1 4PFOA 4G63A 3D0TA 5J2UE 1OEDA 4HWFA 3HKBE 2XAGB 3VKHA 4CXYA 4ZI7E 3KV4A 3MACA 1MMDA 2BG9E 3M65A 4EIWA 4XZCA 4IREA 3LBXA 5HWYA 3FZLB 3PURA 5AQSB 2BZBA 2OV9A 2V7JA 5HXEA 3T1YT 1FJGT 5LMNT 5HYAA 3O4XE 3S4UA 5AQOB 2ZMAA 3VRBA 2NW7A 1HS7A 3ZSTA 1ZP0A 3V5SA 2E9XA 1XNQT 3ZCJA 5L47A 4IDOA 4PW8A 1Z8UA 5LYJE 4CI3B 4DR5T 1WYCA 4JBWF 1MNEA 3RYCE 5CGMA 3FBLA 2K24A 2AXDS 4YTMA 5FKYA 4F6RC 3ONXA 4H9NC 3KVBA 2IIUA 3HKCE 3RGLA 3R6NA 1AJ3A 3AVSA 4MLKA 4DUZT 1UCUA 2JIWA 5LMUT 5HCMA 4DMWA 3Q2MA 4IDNA 2KMFA 2NP9A 2VQFT 5LG3A 1XWMA 5HEJA 2WM9A 2BBHA 3DTOA 2X51A 4U2YA 4DVDA 3AE4A 2XQ3A 3HR0A 4WNKA 4ZI3C 3ANWA 1XDOA 4JI1T 4DO0A 2CXLA 4OHFA 2KZ7B 3CQXC 4FJOA 4ERRA 2IC9A 4UIGA 3ZJ1A 2C5IT 4KBMB 3UUXB 4HFIA 2ZM6T 2HH7A 2VKHA 2Q9QA 4YFSA 2LSKA 4LMJA 1YW0A 4PK6A 3N9OA 3CX7B 4DV0T 2CWOA 4BJMA 3FZMB 5LHHB 4IE6A 4OFZA 4A56A 1LVKA 4IL4A 2JQ9A 3AA0B 2WMOA 2V7KA 3NWIA 2UUCT 4YTNA 3QB5A 3LK3B 2WBLA 3RRWA 4L0RA 1WLXA 2YU2A 4JLEA 2PJQA 4U31A 5ABFB 1SE7A 3WAKA 3N9QA 4IIJE 3QC9A 2JQQA 4X65T 3F57A 3ZEFB 4MALA 5AQRB 1SHZC 4H63H 3UT5E 4H9QC 4QXBB 3SOLA 2WWVA 2XQ5A 4Z90A 3AXJA 4H9RC 2SPCA 3F2EA 3LK2B 2NTYA 4UF0B 2JJ9A 3ZYKA 3N2GE 3PUAA 1HG2A 4YXDA 3RX6A 2QVAA 3LK42 4GKKT 2WCAA 3C64A 3ZYLA 2X0YA 3ZSSA 5J0ZA 1CHUA 2WDRA 5JQGE 3AE6A 2UXNB 5FY1A 3FZFB 3MJXA 3ZKRA 3EUHA 4B3ST 1IJ6A 5FP3A 2VQET 3BQKA 1IZNB 4TUYE 4DBQA 5AQTB 4AISA 4DV1T 2V7IA 5ABHA 3RPUA 2BS4A 4O8SA 1MIVA 5HEOA 3P7IA 3UUBA 4HTEA 3EDUA 3O1JA 4GOUA 3C4WA 1T98A 1XNRT 2H7VC 3PV0F 3VKGA 2E5LT 3CMLA 2UXBT 4E7SA 5HCJA 2PTFA 4AKHA
chains in the Genus database with same CATH topology
2Z6EA 3AA1B 2CXFA 3BQLA 1E1HB 3RYIE 5J1GA 4ZS3A 3QK6A 5F8PA 4HGAA 2LSGA 3C4XA 4JUYA 5LBQB 4DBRA 5LGNB 1U4QA 1KNZA 4U72A 2DI4A 4WBOA 2PBIA 4GIWA 4CI2B 5L3GB 4EOZB 2ZM8A 2E9XB 4NUUA 5L3FB 3I1AA 5LXTE 2XQYA 2EHOD 2E9XC 4EAHA 2PFVA 3Q9DA 3UUNA 2CLYB 2JRKA 1EZ3A 2CLYC 3ZYMA 3W15B 2L3LA 3Q5WA 4EYUA 5LOVE 3CX8B 1VOMA 3RKOA 1HF8A 4YJ3E 3VHLA 4HKAA 2ZM0A 1D0XA 3O1HA 3UULA 2DCFA 2XAHB 4JEHB 4ASKA 5A1LA 2BVMA 2LT3A 3N5LA 2W0GA 4EB6E 2XTLA 4H9OC 3N9MA 2EHOB 2A72A 5EK4A 4TV9E 2EHOC 3KV5A 3N2OA 4E7ZA 3O9XA 3FB2A 2LEHA 3PUGA 5IYZE 2KXPB 3PUSA 4IHJE 4P09A 2XAQB 4QWNB 2YU1A 3NBXX 5ADXL 3CVRA 3ZCIA 5JDGA 1IJ5A 3IBPA 2ODVA 1D0YA 4AQFA 3OKQA 2K48A 3KV9A 5LBMA 4P0AA 3BK9A 4GK0E 1MIYA 2VKJA 2DWGA 1YKEB 5JR9A 5FXZA 2CCQA 3AAEB 2X9HA 5H6RB 4O2AE 3PDYA 3AVRA 3GN5B 3SWHA 2K5BB 5EK2A 2X66A 5TAOA 2YEVC 5LHIB 2WAUA 3RC3A 2CEAA 5DQVA 5M4YA 3KINB 2JMKA 3PTRB 3AA6B 4ZS2A 3LFMA 1G8XA 4EXTA 2NOXA 4PK4A 3SRZA 1LVFA 3ETUA 4N78D 1WR6A 3RYHE 2IC6A 3L3PA 2W62A 2X9YA 3CKDA 4MFRA 4XAXB 2MBGA 3TKLB 2KINB 3UUMA 5JDNA 2YINA 4AKGA 3DJBA 3E08A 4ISSA 1D0ZA 2VWAA 5L3CB 3RH3A 5LP6E 4G2AA 4TZ4C 2DNXA 2P9BA 1LKXA 4KMCA 3H37A 3ZPOA 4ZOLE 4ZI3D 2C5JA 2CMRA 4HFVA 2CXDA 5CA0E 5L3EB 5FY0A 1Z0PA 2Y6XA 5L3BB 3AAIA 4V1Av 3E0ZA 3ZMVB 4GYSA 2KWIB 3J9X1 2I59A 2K9AA 1QUUA 2IW5B 2DHRA 2XUEA 3RRCA 3MKDA 5JREA 5DQWA 1ZKEA 2GK9A 3E22E 3FXEB 5HXSA 4ADZA 3ESLA 3CWZB 2VK9A 5HAXA 1FEWA 5LCYA 1NWMX 2C0SA 2QA7A 5EK3A 4UXNB 5LJMA 1HG5A 2J1DG 2X9WA 4IGUA 3P8CD 4YHJA 3OBVE 5DABA 2LOPA 3AAAB 2BVLA 5JRCB 3IHRA 4QX7B 3UTKA 3KBUA 2N9DA 3C50A 3FXDB 2VB6A 2A2FX 2VKOA 3LG7A 4PJLA 3ZMZB 4AKIA 2W63A 4H63V 5EZYE 5H6QB 3MXZA 4PJJA 3AB3B 3U78A 2VL8A 1D1CA 2KNDA 3C98B 3GWHA 4O4JE 4PFOA 1ZV4X 3FHNA 4G63A 3D0TA 5JVDE 3H3AA 2D5UA 4MHCA 2NW9A 5J2UE 1V9DA 3J7Yq 2ES0A 1MIWA 2XAGB 2Y48B 3HKBE 4I55E 3QUJA 3R84B 2ZLYA 2ACXA 4CXYA 2WMNA 5JDQA 4UV8B 4OYKA 5CB4E 3N9PA 4ZI7E 1QSDA 3EDVA 3KV4A 3AA7B 2N1GA 1MMDA 3KV6A 3MACA 3MA9A 4U74A 3HA4A 3M65A 4EIWA 2CA5A 4XZCA 1MMNA 4BA9A 3B13A 4J2CA 3GA8A 4AQFC 3LBXA 4YJ2E 2DWKA 3ZJ2A 5HWYA 3C51A 3PURA 1U5PA 4EZHA 2BZBA 2RP4A 2WWUA 5C8YE 4XBFB 1WRDA 2CE7A 2V7JA 4PFPA 4CXXA 5HXEA 5LGTB 1BR4A 3ZMSB 2JMHA 3K8PC 2DLRA 3NZQA 4X20E 3DP7A 5L2LA 4DMVA 3MK7C 5HYAA 3CPZA 3O4XE 2B1EA 3WAJA 2LSJA 3S4UA 2BDEA 5FMNA 2ZMAA 4HN9A 5JH7E 4UELA 1FMVA 2D0UA 2NW7A 5FYMA 1HS7A 2MTQA 3KVAA 4L9IA 1WYBA 3V5SA 5LJNA 4C90A 2E9XA 2KWHA 1ZHCA 4UEMA 2MOZA 3ZCJA 1BR1A 2IAKA 2WSSV 3HKDE 2QGSA 3O1IA 5E0OA 4PW8A 3K3OA 5HXCA 3N9LA 4BJNA 4X1KE 1H7CA 2W00A 4AKRB 2X68A 4CQIA 3RYFE 4ZHQE 1MMGA 1S94A 5IHYA 1B7TA 5JDFA 5LG4A 3EVYA 5LYJE 2N2NA 4CI3B 3Q5XA 5L3DB 3MZKB 1WYCA 3L09A 4PNIA 4TV8E 2V7LA 4I43B 1MNEA 4UV9B 3RYCE 4IDZA 1Y64B 3B57A 4QXHB 3FBLA 2K24A 2OA5A 4UVBB 1ZEEA 3KFWX 3ZLIA 4ZI2D 2LSIA 4F6RC 1MNDA 3ONXA 5JDMA 4H9NC 4H9SE 2D2SA 3KVBA 3HKCE 3SS1A 2A3DA 3CQCB 3R6NA 1AJ3A 3I9WA 1X79A 3AVSA 4MLKA 4PJMA 4P0BA 1UCUA 3VU7H 2VASA 3PU3A 5KX5E 3PU8A 4KP3C 4UF0A 3ZMUB 5JDLA 3UFEA 2YK0A 4DMWA 1LRZA 3Q2MA 3I0OA 2LSYA 2KMFA 2NP9A 3PUQA 4CI1B 4TN7B 3A5XA 3HI2A 1BR0A 5DJQC 2C5KT 2WM9A 3DTOA 2X51A 4DVDA 2CM0A 5HXHA 2H3RA 3NZPA 3HR0A 1FMWA 3C4ZA 4WNKA 4KUMB 1UX4A 5JDHA 5LHGB 4ZI3C 3ANWA 3PE0A 4DO0A 2CXLA 4OHFA 2KZ7B 3NRXA 3CQXC 4DNDA 4IE7A 1NAFA 2D0TA 4FJOA 4O4IE 4ERRA 4JEUB 4UVCB 2IC9A 4UIGA 4X1YE 3ZJ1A 5KDMC 2C5IT 4AI6A 4KBMB 3N2KE 3OYZA 3UUXB 2UXXB 2VKDA 2HH7A 2VKHA 2Q9QA 1HX8A 2RA1A 4CZZB 4YFSA 2E9XD 4NUVA 4PAGA 1UX5A 2LSKA 4AQGA 1US7B 5J2TE 1YW0A 3JC6D 4PK6A 3ZC1A 2E8IA 3N9OA 3CX7B 2KLQA 4PK5A 4QKNA 3RC8A 5LNKA 2CWOA 4BJMA 2NW8A 5LHHB 2MYSA 4YLHA 4IE6A 4OFZA 4HEAA 4A56A 4HE8A 3WI3A 3CQGB 1LVKA 3KDSE 4Z8XA 3ZC0A 1SA0E 2ODUA 3AA0B 2X9XA 2WMOA 2V7KA 3VKHA 1BR2A 4M1PA 4X1IE 2LJLA 1O3XA 5JR9B 4IE4A 3IEEA 5JR9C 4MBQA 4GYRA 4UVAB 1S35A 3LK3B 3JC6C 2WBLA 3RRWA 5JRCA 5CA1E 2V26A 1HFAA 4L0RA 4L5GA 3ZN0B 1WLXA 2LOSA 2YU2A 2H7OA 4JLEA 4QX8B 5FY7A 2PJQA 2XAFB 5LA6E 1OXZA 3WAKA 2XHEB 3OJAA 3N9QA 4IIJE 2X0LB 2JQQA 3QC9A 4QXCB 3F57A 5F3JA 3ZEFB 4FI5A 2PG8A 4WW0A 4MALA 2V7MA 2Y8DA 1SHZC 4AXPA 4H63H 4O4HE 3UT5E 4H9QC 4QHOA 3I0QA 2NTXA 4QXBB 3SOLA 3U3IA 2LHNA 2L9QA 2G0UA 4H9RC 5FNVE 2HPLA 2SPCA 3F2EA 3LK2B 2NTYA 4UF0B 2JJ9A 4EYYR 4I4TE 3V5UA 3ZYKA 2NWBA 3N2GE 3PUAA 1VRBA 2JPFA 1HG2A 3GMIA 1YKHB 2LE8A 3HKEE 2EHOA 4H9PC 2XASB 3RX6A 4C91A 3NRYA 3LK42 4IE0A 3C64A 3ZYLA 4CXWA 1D1BA 4GK5E 3T8OA 3FBZA 3BQIA 2W61A 2Q9QD 4ILUA 4O2BE 5HXRA 4O4LE 2V1DB 3ANWB 5JQGE 1OWAA 3HL6A 2UXNB 3ZMTB 5FY1A 4IE5A 1KK7A 1HTJF 4EZ4A 3CX6B 2M67A 4I50E 4AKLA 3MJXA 2L8KA 3EUHA 1IJ6A 5FP3A 3ETVA 3OYXA 5ETWA 4BAYB 3BQKA 1IAPA 3IF8B 3I9YA 1IZNB 3GN5A 4TUYE 2XAJB 5GONE 4ZI2C 1CUNA 4DBQA 2CWYA 3ZN1B 2Q9QB 3LJCA 5FXVA 2Q9QC 5FXXA 5BMVE 2V7IA 1G73A 3K3NA 3K3QC 5FXWA 3RPUA 4O8SA 1MIVA 3KBTA 4B6XA 4ISTA 3P7IA 2LM9A 3N9NA 4HTEA 2LHRA 3EDUA 4TX5A 3O1JA 4GOUA 2HPJA 3C4WA 1T98A 3F31A 1MMAA 2H7VC 5AFUL 5HWXA 5LGUB 3VKGA 3CMLA 2ZM2A 4PJNA 5KMGP 4K0UA 2X67A 4OK0A 4OYJA 4E7SA 3LBXB 1D1AA 1FIOA 1YD8G 1HCIA 4AKHA 4ANJA 2KT9A 4WBNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PK5 A;  2NOX A;  2NW8 A;  2D0T A;  4U74 A;  2D0U A;  2NW7 A;  2NWB A;  4HKA A;  4U72 A;  2V7L A;  5ETW A;  3BK9 A;  3E08 A;  1ZEE A;  2V7K A;  2V7M A;  2X67 A;  5EK4 A;  4PW8 A;  5EK2 A;  2X66 A;  2V7J A;  2NW9 A;  5EK3 A;  2V7I A;  1YW0 A;  4PK6 A;  2X68 A; 
#chains in the Genus database with same CATH topology
 5IWA T;  4U2Z A;  3JAF A;  4DR4 T;  3JCF A;  3PUW F;  2WU2 A;  4KHP T;  5LBQ B;  4DBR A;  1T7S A;  1KNZ A;  4GIW A;  2CBJ A;  2XQY A;  5AQM B;  2HHH T;  3CX8 B;  3FZK B;  3QNU A;  1HF8 A;  4HKA A;  1D0X A;  3UUL A;  2DCF A;  2XAH B;  5A1L A;  4LF6 T;  2W0G A;  2XTL A;  3N9M A;  4TV9 E;  4IHJ E;  2XAQ B;  4QWN B;  2YU1 A;  3IBP A;  1D0Y A;  3OKQ A;  4GK0 E;  2MPK A;  2VKJ A;  2DWG A;  2X9H A;  4O2A E;  3AVR A;  5TAO A;  3RC3 A;  2CEA A;  5DQV A;  3UU3 A;  3UQ7 A;  2IC6 A;  2W62 A;  2X9Y A;  3UUM A;  4MFR A;  4DV4 T;  5JDN A;  3E08 A;  2I0M A;  3RH3 A;  1KFY A;  3CK6 A;  4DID B;  2IML A;  2WQY A;  4LFC T;  3G06 A;  1Z0P A;  2Y6X A;  3AAI A;  4V1A v;  3E0Z A;  2I59 A;  4U7I A;  1QUU A;  2XJ7 A;  2DHR A;  2XUE A;  4DV7 T;  4A98 A;  3MKD A;  1ZKE A;  2GK9 A;  4KI0 F;  1M7K A;  3FXE B;  5HXS A;  4ADZ A;  3CWZ B;  3VR9 A;  2VK9 A;  5HAX A;  1NWM X;  4QH5 A;  5JRC B;  2BVL A;  2BBJ A;  2N9D A;  2VB6 A;  4PJL A;  3Q5E A;  3AB3 B;  3U78 A;  1GQE A;  4I0U A;  2KND A;  3A8Y C;  1ZV4 X;  3J7Y q;  5AQU B;  3P50 A;  2ZLY A;  2ACX A;  1VCT A;  3N9P A;  3EDV A;  2N1G A;  4U74 A;  1J1J A;  3AEG A;  4BA9 A;  4JV5 T;  1WCR A;  3AED A;  4AQF C;  4YJ2 E;  2DWK A;  3ZJ2 A;  4EZH A;  2RP4 A;  2CE7 A;  4CXX A;  4AIU A;  2DLR A;  1IBL T;  4DMV A;  3MK7 C;  3PUV F;  3WAJ A;  2B1E A;  4B3T T;  4IDP A;  2AE9 A;  5FMN A;  2FUP A;  4L9I A;  4HFB A;  2MOZ A;  2WSS V;  3O1I A;  2FJB A;  1QLB A;  1H7C A;  2X68 A;  3RYF E;  5IHY A;  1B7T A;  1XMQ T;  2N2N A;  5L3D B;  3MZK B;  3L09 A;  4CN4 A;  2LLY A;  2WZI A;  4YTP A;  2D9D A;  4TV8 E;  1Y64 B;  5JDM A;  4Z91 A;  3SS1 A;  4DR6 T;  1X79 A;  1XZY A;  2VAS A;  4JI7 T;  1UGO A;  2XSA A;  4CI1 B;  5AQV B;  3A5X A;  1BR0 A;  2C5K T;  5JTG A;  4KUM B;  2BG9 B;  1UX4 A;  1R8I A;  1KF6 A;  1OED B;  4IE7 A;  2D0T A;  4O4I E;  4UVC B;  3AE9 A;  2YKS A;  5KDM C;  3NVO A;  4DR3 T;  2RA1 A;  4JI5 T;  4NUV A;  3H3M A;  3TLS A;  1UX5 A;  1US7 B;  3ZC1 A;  4QKN A;  2KLQ A;  3RIF A;  2NW8 A;  2A9U A;  1OED E;  5AQH B;  1SA0 E;  2XPK A;  4M1P A;  4X1I E;  5JR9 B;  3IEE A;  1S35 A;  5ABE A;  2H7O A;  5FY7 A;  4ZZC A;  2XHE B;  4YSX A;  3AEF A;  4QXC B;  4FI5 A;  2PG8 A;  4WW0 A;  2V7M A;  2Y8D A;  4O4H E;  2IDO B;  3I0Q A;  2NTX A;  4UR9 A;  1W09 A;  1T72 A;  4YHH T;  4EYY R;  4JI4 T;  3ZT6 A;  2JPF A;  3GMI A;  3HKE E;  2EHO A;  3RIU A;  2YDS A;  4GK5 E;  4ILU A;  4O2B E;  4AQY T;  3Q5D A;  2V1D B;  2F4V T;  3ANW B;  1HTJ F;  4EZ4 A;  2I6H A;  3CX6 B;  4I50 E;  3UQ4 A;  2L8K A;  4JI6 T;  3ETV A;  3OYX A;  4ZEY A;  2XQ6 A;  2YDR A;  5AQQ B;  1NEK A;  4LF7 T;  5AQG B;  2WZH A;  2Q9Q B;  2WU5 A;  3K3N A;  4GKJ T;  2JQH A;  1XMO T;  1MMA A;  3PUY F;  5LGU B;  2ZM2 A;  4PJN A;  3ZT7 A;  2X67 A;  1FIO A;  1T8B A;  2YOE A;  3RKG A;  2CXF A;  1E1H B;  3RYI E;  3AEE A;  2PBI A;  4CI2 B;  5L3G B;  3I1A A;  5LXT E;  5FL1 A;  4IDQ A;  3UUN A;  3ZYM A;  2L3L A;  2V5D A;  4EYU A;  3AXJ B;  3ONJ A;  2ZM0 A;  3O1H A;  2BVM A;  4Q25 A;  4EB6 E;  2CHO A;  5EK4 A;  3UU6 A;  4LFB T;  3N2O A;  3SFE A;  3FB2 A;  2LEH A;  3PUG A;  5IYZ E;  4DR2 T;  4ILB A;  5ADX L;  2YDQ A;  3CVR A;  4X64 T;  2ODV A;  2K48 A;  4LF5 T;  2XQ7 A;  5FXZ A;  3AAE B;  5H6R B;  1IBM T;  2K5B B;  2M6I A;  2XM1 A;  5LHI B;  2JMK A;  3PTR B;  3X1D A;  2NOX A;  3ETU A;  3RYH E;  2XQA A;  4HWH A;  3TKL B;  1UUS A;  3OPC A;  5KXJ A;  2P9B A;  1LKX A;  2B76 A;  3ZPO A;  5CA0 E;  5L3B B;  3ZMV B;  1W9R A;  3EI0 A;  3AEB A;  2K9A A;  5CJ5 A;  2IW5 B;  5JRE A;  2BS2 A;  2CRB A;  2LKH A;  5EK3 A;  3P4R A;  4DV5 T;  3PJA A;  3TLW A;  4YHJ A;  4EV6 A;  2LOP A;  2YN6 A;  2DL1 A;  3C50 A;  4HFE A;  4AKI A;  5EZY E;  4EED A;  3MXZ A;  4DR7 T;  2VL8 A;  2WDQ A;  5JVD E;  4MHC A;  3R84 B;  1MIW A;  2Y48 B;  4I55 E;  3QUJ A;  2WMN A;  5JDQ A;  4OX9 T;  3T1H T;  3KV6 A;  3MA9 A;  2CA5 A;  3TLT A;  4HWC A;  4A97 A;  4NPP A;  2W67 A;  3C51 A;  3LDQ B;  1U5P A;  4QH1 A;  4PFP A;  1BR4 A;  3NZQ A;  3K8P C;  4X20 E;  3DP7 A;  4LMK A;  5FVL A;  1IBK T;  3CPZ A;  1I6Z A;  5JH7 E;  4TWF A;  1FMV A;  5HEU A;  2D0U A;  5FYM A;  2MTQ A;  1WYB A;  5LJN A;  2KWH A;  1ZHC A;  3AE3 A;  2IAK A;  5E0O A;  2QGS A;  2XY8 B;  4BJN A;  4AKR B;  4CQI A;  2WB5 A;  1S94 A;  1N36 T;  5JDF A;  3EVY A;  4LF4 T;  4X5T A;  2V8S V;  2V7L A;  4UVB B;  4ZI2 D;  5BR8 T;  1J5W A;  1ZEE A;  2LSI A;  3JAE A;  2D2S A;  3CQC B;  1YXR A;  4U7Y A;  3PU3 A;  4KP3 C;  3P4S A;  3ZMU B;  5JDL A;  3UFE A;  1LRZ A;  4ZZB A;  4B3M T;  3PUQ A;  4TN7 B;  3HI2 A;  5DJQ C;  3M3Z B;  3NZP A;  3C4Z A;  4DV6 T;  5LHG B;  2BG9 C;  3PE0 A;  5FVK A;  1OED C;  3NRX A;  4DND A;  3AE1 A;  4JEU B;  5AQK B;  4X1Y E;  1HX1 B;  4AI6 A;  2MAW A;  3OYZ A;  4HWD A;  4DUY T;  2VKD A;  2WS3 A;  2E9X D;  5C3J A;  4PAG A;  4AQG A;  5J2T E;  2E8I A;  5LNK A;  5FL0 A;  2XQ8 A;  2MYS A;  4YLH A;  4HEA A;  2WDV A;  3CQG B;  2FJE A;  3ZC0 A;  2UUB T;  4IT4 A;  1BR2 A;  2LJL A;  4IE4 A;  5JR9 C;  3SFD A;  5JRC A;  1XDP A;  1HFA A;  4L5G A;  2LOS A;  2VUR A;  2XAF B;  2UXD T;  5LA6 E;  4WZX A;  3OJA A;  4JI0 T;  2JQK A;  4TNW A;  4F8H A;  2WP9 A;  4QHO A;  1JNZ A;  3AE8 A;  4KX6 A;  5FNV E;  3P4Q A;  4HFH A;  4JYA T;  3V5U A;  1VRB A;  5AQF B;  1YKH B;  4H9P C;  4C91 A;  3NRY A;  4JI2 T;  1D1B A;  4DV3 T;  3FBZ A;  3BQI A;  2W61 A;  2Q9Q D;  5HXR A;  3PUZ F;  2ACZ A;  2LKG A;  2W66 A;  4COF A;  2M67 A;  5ETW A;  4BAY B;  3IF8 B;  2LM2 A;  3GN5 A;  2XAJ B;  5GON E;  1CUN A;  2CWY A;  2W4X A;  2XQ4 A;  5AQL B;  2Q9Q C;  5FXX A;  2V6Y B;  3VRA A;  5FXW A;  3KBT A;  3N9N A;  4TX5 A;  2HPJ A;  2H88 A;  4KHZ F;  4K0U A;  4OK0 A;  3LBX B;  4IL9 A;  3EAM A;  1HCI A;  4ANJ A;  2KT9 A;  4WBN E;  2Z6E A;  3AA1 B;  3BQL A;  4P1N A;  5J1G A;  5F8P A;  4HGA A;  2LSG A;  4JUY A;  5LGN B;  1KNR A;  1U4Q A;  2V5C A;  4JI8 T;  4HFC A;  2J47 A;  2K3W A;  2ZM8 A;  2BG9 A;  2E9X B;  4NUU A;  5L3F B;  3K1S A;  3Q9D A;  2CLY B;  5ABG A;  1YQ4 A;  4A5X A;  1N34 T;  5LOV E;  3UU8 A;  5HEG A;  4JEH B;  4ASK A;  1KNP A;  2EHO B;  2A72 A;  3KV5 A;  3VR8 A;  4DR1 T;  1I94 T;  2KXP B;  4P09 A;  3NBX X;  3ZCI A;  1IJ5 A;  2QRX A;  4AQF A;  3KV9 A;  1HNX T;  5JR9 A;  1YKE B;  2CCQ A;  3ABV A;  3FZH B;  3SWH A;  2UUA T;  2WAU A;  5M4Y A;  3KIN B;  5L4H A;  2R6G F;  3AA6 B;  4ZS2 A;  3LFM A;  4PK4 A;  3AE5 A;  3SRZ A;  4N78 D;  3L3P A;  3CKD A;  4XAX B;  2CHN A;  2MBG A;  2KIN B;  2HN2 A;  2YIN A;  1KEY A;  4AKG A;  4ISS A;  1D0Z A;  2VWA A;  5LP6 E;  4TNV A;  4KMC A;  2J4G A;  2FJA A;  4ZI3 D;  4HFV A;  1L0V A;  5L3E B;  1E2A A;  4B3R T;  2WY2 A;  1E7P A;  3J9X 1;  5IUX A;  2CPT A;  3A7M A;  4X62 T;  3E22 E;  3ESL A;  5LCY A;  3UU4 A;  3L8R A;  1ZOY A;  2XQ9 A;  4K0K T;  3OBV E;  3AAA B;  4QX7 B;  3KBU A;  3FXD B;  3LG7 A;  2W63 A;  4H63 V;  3LSV A;  5H6Q B;  4PJJ A;  2E2A A;  1D1C A;  4O4J E;  3FHN A;  5AQN B;  3H3A A;  2D5U A;  2NW9 A;  1X9B A;  1V9D A;  2ES0 A;  3OVU A;  4UV8 B;  3TLU A;  4OYK A;  5CB4 E;  1QSD A;  3AA7 B;  2BKN A;  3HA4 A;  2H89 A;  3ZT5 A;  1MMN A;  3B13 A;  4J2C A;  3GA8 A;  2WWU A;  5C8Y E;  4XBF B;  1WRD A;  5LGT B;  3ZMS B;  2JMH A;  5L2L A;  1HNZ T;  2LSJ A;  2BDE A;  4HN9 A;  2KSR A;  4UEL A;  3AE2 A;  2CBI A;  3KVA A;  2BS3 A;  4C90 A;  4UEM A;  3RHW A;  1BR1 A;  3HKD E;  3K3O A;  5HXC A;  3N9L A;  4X1K E;  2W00 A;  4NXN T;  4ZHQ E;  1MMG A;  5LG4 A;  3Q5X A;  3IA3 A;  5ABF A;  2M6B A;  4YSY A;  1W0B A;  3AEC A;  3UFG A;  4PNI A;  4I43 B;  4UV9 B;  4IDZ A;  3B57 A;  4QXH B;  2OA5 A;  3ZLI A;  3KFW X;  1MND A;  4H9S E;  2A3D A;  3I9W A;  4PJM A;  4P0B A;  3VU7 H;  5KX5 E;  4QH4 A;  3PU8 A;  4UF0 A;  1N33 T;  2YK0 A;  2QYW A;  3I0O A;  2LSY A;  3RLF F;  1NEN A;  4CN6 A;  2FJD A;  2CM0 A;  5HXH A;  2H3R A;  1FMW A;  5LB7 B;  5JDH A;  4DV2 T;  1VCS A;  1NAF A;  3N2K E;  2UXX B;  5AQP B;  1HX8 A;  4CZZ B;  2OLT A;  3EAB A;  3RQW A;  3JC6 D;  3RC8 A;  4PK5 A;  4NIQ A;  3L39 A;  3QB5 K;  4HE8 A;  3WI3 A;  4TWD A;  3KDS E;  4EEB A;  4Z8X A;  3AEA A;  2ODU A;  2LRL A;  2X9X A;  1O3X A;  4MBQ A;  4GYR A;  4UVA B;  2RPA A;  3JC6 C;  3P4W A;  4TWH A;  5CA1 E;  2V26 A;  3ZN0 B;  4ILC A;  4QX8 B;  2UXC T;  1HR0 T;  1OXZ A;  2XZE A;  2X0L B;  4ZXL A;  4CN1 A;  5F3J A;  5AQJ B;  1HNW T;  4AXP A;  2XSB A;  3U3I A;  1Y01 A;  2LHN A;  2L9Q A;  2G0U A;  2HPL A;  4I4T E;  2NWB A;  2LE8 A;  2XAS B;  4IE0 A;  4CXW A;  3T8O A;  4O4L E;  3TLV A;  4HWI B;  1OWA A;  3HL6 A;  3JAD A;  3ZMT B;  4IE5 A;  4YSZ A;  1KK7 A;  1WFD A;  2XM2 A;  4AKL A;  1IAP A;  3I9Y A;  4ZI2 C;  3ZN1 B;  4U3C A;  3LJC A;  3OTO T;  1J5E T;  2VVS A;  5FXV A;  3RI5 A;  5BMV E;  3QOF A;  1G73 A;  3K3Q C;  4B6X A;  4IST A;  2LM9 A;  2LHR A;  3F31 A;  2X0H A;  5AFU L;  5HWX A;  2J62 A;  5KMG P;  4OYJ A;  1D1A A;  1YD8 G;  4LF8 T;  3RIA A;  2VVN A;  3UU5 A;  4ZS3 A;  3QK6 A;  3C4X A;  4U72 A;  2DI4 A;  4WBO A;  4EOZ B;  2EHO D;  2E9X C;  3P4P A;  4EAH A;  2PFV A;  2JRK A;  1EZ3 A;  2CLY C;  4WYV A;  3W15 B;  3Q5W A;  3PUX F;  1VOM A;  3RKO A;  2E5V A;  4YJ3 E;  3VHL A;  1SUM B;  2LT3 A;  3N5L A;  1N32 T;  4H9O C;  4LML A;  3RQU A;  2EHO C;  2NR4 A;  3O9X A;  4E7Z A;  3RIU C;  3PJA J;  3EHZ A;  3PUS A;  4EGW A;  4ILA A;  5JDG A;  3B5M A;  3NKZ A;  5HEH A;  5LBM A;  4P0A A;  3BK9 A;  4U33 A;  1MIY A;  4LF9 T;  3PDY A;  2UU9 T;  3GN5 B;  5EK2 A;  2X66 A;  2YEV C;  2HN1 A;  1G8X A;  4EXT A;  2FBW A;  1WR0 A;  1LVF A;  1WR6 A;  2VL0 A;  3AE7 A;  5AQI B;  3DJB A;  4YT0 A;  5L3C B;  4G2A A;  4TZ4 C;  4NXM T;  2DNX A;  1DU2 A;  5L4E A;  5CFB A;  4X66 T;  3H37 A;  1UK5 A;  4ZOL E;  2C5J A;  2CMR A;  2CXD A;  4LFA T;  5FY0 A;  2BKP A;  4YY3 T;  1YQ3 A;  2KWI B;  4GYS A;  3ONL C;  4HFD A;  3RRC A;  5DQW A;  1W0A A;  2IUB A;  2W2U A;  1FEW A;  1JNR A;  2C0S A;  2QA7 A;  2V6X A;  5LJM A;  4UXN B;  1HG5 A;  2J1D G;  2X9W A;  4IGU A;  3P8C D;  2LRK A;  5DAB A;  2BKO A;  3IHR A;  3UTK A;  5F5W A;  2A2F X;  2VKO A;  5C2T A;  3ZMZ B;  1UUR A;  3CIR A;  4JI3 T;  1M62 A;  3RF1 A;  2V6Y A;  3C98 B;  3GWH A;  2IHR 1;  4PFO A;  4G63 A;  3D0T A;  5J2U E;  1OED A;  4HWF A;  3HKB E;  2XAG B;  3VKH A;  4CXY A;  4ZI7 E;  3KV4 A;  3MAC A;  1MMD A;  2BG9 E;  3M65 A;  4EIW A;  4XZC A;  4IRE A;  3LBX A;  5HWY A;  3FZL B;  3PUR A;  5AQS B;  2BZB A;  2OV9 A;  2V7J A;  5HXE A;  3T1Y T;  1FJG T;  5LMN T;  5HYA A;  3O4X E;  3S4U A;  5AQO B;  2ZMA A;  3VRB A;  2NW7 A;  1HS7 A;  3ZST A;  1ZP0 A;  3V5S A;  2E9X A;  1XNQ T;  3ZCJ A;  5L47 A;  4IDO A;  4PW8 A;  1Z8U A;  5LYJ E;  4CI3 B;  4DR5 T;  1WYC A;  4JBW F;  1MNE A;  3RYC E;  5CGM A;  3FBL A;  2K24 A;  2AXD S;  4YTM A;  5FKY A;  4F6R C;  3ONX A;  4H9N C;  3KVB A;  2IIU A;  3HKC E;  3RGL A;  3R6N A;  1AJ3 A;  3AVS A;  4MLK A;  4DUZ T;  1UCU A;  2JIW A;  5LMU T;  5HCM A;  4DMW A;  3Q2M A;  4IDN A;  2KMF A;  2NP9 A;  2VQF T;  5LG3 A;  1XWM A;  5HEJ A;  2WM9 A;  2BBH A;  3DTO A;  2X51 A;  4U2Y A;  4DVD A;  3AE4 A;  2XQ3 A;  3HR0 A;  4WNK A;  4ZI3 C;  3ANW A;  1XDO A;  4JI1 T;  4DO0 A;  2CXL A;  4OHF A;  2KZ7 B;  3CQX C;  4FJO A;  4ERR A;  2IC9 A;  4UIG A;  3ZJ1 A;  2C5I T;  4KBM B;  3UUX B;  4HFI A;  2ZM6 T;  2HH7 A;  2VKH A;  2Q9Q A;  4YFS A;  2LSK A;  4LMJ A;  1YW0 A;  4PK6 A;  3N9O A;  3CX7 B;  4DV0 T;  2CWO A;  4BJM A;  3FZM B;  5LHH B;  4IE6 A;  4OFZ A;  4A56 A;  1LVK A;  4IL4 A;  2JQ9 A;  3AA0 B;  2WMO A;  2V7K A;  3NWI A;  2UUC T;  4YTN A;  3QB5 A;  3LK3 B;  2WBL A;  3RRW A;  4L0R A;  1WLX A;  2YU2 A;  4JLE A;  2PJQ A;  4U31 A;  5ABF B;  1SE7 A;  3WAK A;  3N9Q A;  4IIJ E;  3QC9 A;  2JQQ A;  4X65 T;  3F57 A;  3ZEF B;  4MAL A;  5AQR B;  1SHZ C;  4H63 H;  3UT5 E;  4H9Q C;  4QXB B;  3SOL A;  2WWV A;  2XQ5 A;  4Z90 A;  3AXJ A;  4H9R C;  2SPC A;  3F2E A;  3LK2 B;  2NTY A;  4UF0 B;  2JJ9 A;  3ZYK A;  3N2G E;  3PUA A;  1HG2 A;  4YXD A;  3RX6 A;  2QVA A;  3LK4 2;  4GKK T;  2WCA A;  3C64 A;  3ZYL A;  2X0Y A;  3ZSS A;  5J0Z A;  1CHU A;  2WDR A;  5JQG E;  3AE6 A;  2UXN B;  5FY1 A;  3FZF B;  3MJX A;  3ZKR A;  3EUH A;  4B3S T;  1IJ6 A;  5FP3 A;  2VQE T;  3BQK A;  1IZN B;  4TUY E;  4DBQ A;  5AQT B;  4AIS A;  4DV1 T;  2V7I A;  5ABH A;  3RPU A;  2BS4 A;  4O8S A;  1MIV A;  5HEO A;  3P7I A;  3UUB A;  4HTE A;  3EDU A;  3O1J A;  4GOU A;  3C4W A;  1T98 A;  1XNR T;  2H7V C;  3PV0 F;  3VKG A;  2E5L T;  3CML A;  2UXB T;  4E7S A;  5HCJ A;  2PTF A;  4AKH A; 
#chains in the Genus database with same CATH homology
 2Z6E A;  3AA1 B;  2CXF A;  3BQL A;  1E1H B;  3RYI E;  5J1G A;  4ZS3 A;  3QK6 A;  5F8P A;  4HGA A;  2LSG A;  3C4X A;  4JUY A;  5LBQ B;  4DBR A;  5LGN B;  1U4Q A;  1KNZ A;  4U72 A;  2DI4 A;  4WBO A;  2PBI A;  4GIW A;  4CI2 B;  5L3G B;  4EOZ B;  2ZM8 A;  2E9X B;  4NUU A;  5L3F B;  3I1A A;  5LXT E;  2XQY A;  2EHO D;  2E9X C;  4EAH A;  2PFV A;  3Q9D A;  3UUN A;  2CLY B;  2JRK A;  1EZ3 A;  2CLY C;  3ZYM A;  3W15 B;  2L3L A;  3Q5W A;  4EYU A;  5LOV E;  3CX8 B;  1VOM A;  3RKO A;  1HF8 A;  4YJ3 E;  3VHL A;  4HKA A;  2ZM0 A;  1D0X A;  3O1H A;  3UUL A;  2DCF A;  2XAH B;  4JEH B;  4ASK A;  5A1L A;  2BVM A;  2LT3 A;  3N5L A;  2W0G A;  4EB6 E;  2XTL A;  4H9O C;  3N9M A;  2EHO B;  2A72 A;  5EK4 A;  4TV9 E;  2EHO C;  3KV5 A;  3N2O A;  4E7Z A;  3O9X A;  3FB2 A;  2LEH A;  3PUG A;  5IYZ E;  2KXP B;  3PUS A;  4IHJ E;  4P09 A;  2XAQ B;  4QWN B;  2YU1 A;  3NBX X;  5ADX L;  3CVR A;  3ZCI A;  5JDG A;  1IJ5 A;  3IBP A;  2ODV A;  1D0Y A;  4AQF A;  3OKQ A;  2K48 A;  3KV9 A;  5LBM A;  4P0A A;  3BK9 A;  4GK0 E;  1MIY A;  2VKJ A;  2DWG A;  1YKE B;  5JR9 A;  5FXZ A;  2CCQ A;  3AAE B;  2X9H A;  5H6R B;  4O2A E;  3PDY A;  3AVR A;  3GN5 B;  3SWH A;  2K5B B;  5EK2 A;  2X66 A;  5TAO A;  2YEV C;  5LHI B;  2WAU A;  3RC3 A;  2CEA A;  5DQV A;  5M4Y A;  3KIN B;  2JMK A;  3PTR B;  3AA6 B;  4ZS2 A;  3LFM A;  1G8X A;  4EXT A;  2NOX A;  4PK4 A;  3SRZ A;  1LVF A;  3ETU A;  4N78 D;  1WR6 A;  3RYH E;  2IC6 A;  3L3P A;  2W62 A;  2X9Y A;  3CKD A;  4MFR A;  4XAX B;  2MBG A;  3TKL B;  2KIN B;  3UUM A;  5JDN A;  2YIN A;  4AKG A;  3DJB A;  3E08 A;  4ISS A;  1D0Z A;  2VWA A;  5L3C B;  3RH3 A;  5LP6 E;  4G2A A;  4TZ4 C;  2DNX A;  2P9B A;  1LKX A;  4KMC A;  3H37 A;  3ZPO A;  4ZOL E;  4ZI3 D;  2C5J A;  2CMR A;  4HFV A;  2CXD A;  5CA0 E;  5L3E B;  5FY0 A;  1Z0P A;  2Y6X A;  5L3B B;  3AAI A;  4V1A v;  3E0Z A;  3ZMV B;  4GYS A;  2KWI B;  3J9X 1;  2I59 A;  2K9A A;  1QUU A;  2IW5 B;  2DHR A;  2XUE A;  3RRC A;  3MKD A;  5JRE A;  5DQW A;  1ZKE A;  2GK9 A;  3E22 E;  3FXE B;  5HXS A;  4ADZ A;  3ESL A;  3CWZ B;  2VK9 A;  5HAX A;  1FEW A;  5LCY A;  1NWM X;  2C0S A;  2QA7 A;  5EK3 A;  4UXN B;  5LJM A;  1HG5 A;  2J1D G;  2X9W A;  4IGU A;  3P8C D;  4YHJ A;  3OBV E;  5DAB A;  2LOP A;  3AAA B;  2BVL A;  5JRC B;  3IHR A;  4QX7 B;  3UTK A;  3KBU A;  2N9D A;  3C50 A;  3FXD B;  2VB6 A;  2A2F X;  2VKO A;  3LG7 A;  4PJL A;  3ZMZ B;  4AKI A;  2W63 A;  4H63 V;  5EZY E;  5H6Q B;  3MXZ A;  4PJJ A;  3AB3 B;  3U78 A;  2VL8 A;  1D1C A;  2KND A;  3C98 B;  3GWH A;  4O4J E;  4PFO A;  1ZV4 X;  3FHN A;  4G63 A;  3D0T A;  5JVD E;  3H3A A;  2D5U A;  4MHC A;  2NW9 A;  5J2U E;  1V9D A;  3J7Y q;  2ES0 A;  1MIW A;  2XAG B;  2Y48 B;  3HKB E;  4I55 E;  3QUJ A;  3R84 B;  2ZLY A;  2ACX A;  4CXY A;  2WMN A;  5JDQ A;  4UV8 B;  4OYK A;  5CB4 E;  3N9P A;  4ZI7 E;  1QSD A;  3EDV A;  3KV4 A;  3AA7 B;  2N1G A;  1MMD A;  3KV6 A;  3MAC A;  3MA9 A;  4U74 A;  3HA4 A;  3M65 A;  4EIW A;  2CA5 A;  4XZC A;  1MMN A;  4BA9 A;  3B13 A;  4J2C A;  3GA8 A;  4AQF C;  3LBX A;  4YJ2 E;  2DWK A;  3ZJ2 A;  5HWY A;  3C51 A;  3PUR A;  1U5P A;  4EZH A;  2BZB A;  2RP4 A;  2WWU A;  5C8Y E;  4XBF B;  1WRD A;  2CE7 A;  2V7J A;  4PFP A;  4CXX A;  5HXE A;  5LGT B;  1BR4 A;  3ZMS B;  2JMH A;  3K8P C;  2DLR A;  3NZQ A;  4X20 E;  3DP7 A;  5L2L A;  4DMV A;  3MK7 C;  5HYA A;  3CPZ A;  3O4X E;  2B1E A;  3WAJ A;  2LSJ A;  3S4U A;  2BDE A;  5FMN A;  2ZMA A;  4HN9 A;  5JH7 E;  4UEL A;  1FMV A;  2D0U A;  2NW7 A;  5FYM A;  1HS7 A;  2MTQ A;  3KVA A;  4L9I A;  1WYB A;  3V5S A;  5LJN A;  4C90 A;  2E9X A;  2KWH A;  1ZHC A;  4UEM A;  2MOZ A;  3ZCJ A;  1BR1 A;  2IAK A;  2WSS V;  3HKD E;  2QGS A;  3O1I A;  5E0O A;  4PW8 A;  3K3O A;  5HXC A;  3N9L A;  4BJN A;  4X1K E;  1H7C A;  2W00 A;  4AKR B;  2X68 A;  4CQI A;  3RYF E;  4ZHQ E;  1MMG A;  1S94 A;  5IHY A;  1B7T A;  5JDF A;  5LG4 A;  3EVY A;  5LYJ E;  2N2N A;  4CI3 B;  3Q5X A;  5L3D B;  3MZK B;  1WYC A;  3L09 A;  4PNI A;  4TV8 E;  2V7L A;  4I43 B;  1MNE A;  4UV9 B;  3RYC E;  4IDZ A;  1Y64 B;  3B57 A;  4QXH B;  3FBL A;  2K24 A;  2OA5 A;  4UVB B;  1ZEE A;  3KFW X;  3ZLI A;  4ZI2 D;  2LSI A;  4F6R C;  1MND A;  3ONX A;  5JDM A;  4H9N C;  4H9S E;  2D2S A;  3KVB A;  3HKC E;  3SS1 A;  2A3D A;  3CQC B;  3R6N A;  1AJ3 A;  3I9W A;  1X79 A;  3AVS A;  4MLK A;  4PJM A;  4P0B A;  1UCU A;  3VU7 H;  2VAS A;  3PU3 A;  5KX5 E;  3PU8 A;  4KP3 C;  4UF0 A;  3ZMU B;  5JDL A;  3UFE A;  2YK0 A;  4DMW A;  1LRZ A;  3Q2M A;  3I0O A;  2LSY A;  2KMF A;  2NP9 A;  3PUQ A;  4CI1 B;  4TN7 B;  3A5X A;  3HI2 A;  1BR0 A;  5DJQ C;  2C5K T;  2WM9 A;  3DTO A;  2X51 A;  4DVD A;  2CM0 A;  5HXH A;  2H3R A;  3NZP A;  3HR0 A;  1FMW A;  3C4Z A;  4WNK A;  4KUM B;  1UX4 A;  5JDH A;  5LHG B;  4ZI3 C;  3ANW A;  3PE0 A;  4DO0 A;  2CXL A;  4OHF A;  2KZ7 B;  3NRX A;  3CQX C;  4DND A;  4IE7 A;  1NAF A;  2D0T A;  4FJO A;  4O4I E;  4ERR A;  4JEU B;  4UVC B;  2IC9 A;  4UIG A;  4X1Y E;  3ZJ1 A;  5KDM C;  2C5I T;  4AI6 A;  4KBM B;  3N2K E;  3OYZ A;  3UUX B;  2UXX B;  2VKD A;  2HH7 A;  2VKH A;  2Q9Q A;  1HX8 A;  2RA1 A;  4CZZ B;  4YFS A;  2E9X D;  4NUV A;  4PAG A;  1UX5 A;  2LSK A;  4AQG A;  1US7 B;  5J2T E;  1YW0 A;  3JC6 D;  4PK6 A;  3ZC1 A;  2E8I A;  3N9O A;  3CX7 B;  2KLQ A;  4PK5 A;  4QKN A;  3RC8 A;  5LNK A;  2CWO A;  4BJM A;  2NW8 A;  5LHH B;  2MYS A;  4YLH A;  4IE6 A;  4OFZ A;  4HEA A;  4A56 A;  4HE8 A;  3WI3 A;  3CQG B;  1LVK A;  3KDS E;  4Z8X A;  3ZC0 A;  1SA0 E;  2ODU A;  3AA0 B;  2X9X A;  2WMO A;  2V7K A;  3VKH A;  1BR2 A;  4M1P A;  4X1I E;  2LJL A;  1O3X A;  5JR9 B;  4IE4 A;  3IEE A;  5JR9 C;  4MBQ A;  4GYR A;  4UVA B;  1S35 A;  3LK3 B;  3JC6 C;  2WBL A;  3RRW A;  5JRC A;  5CA1 E;  2V26 A;  1HFA A;  4L0R A;  4L5G A;  3ZN0 B;  1WLX A;  2LOS A;  2YU2 A;  2H7O A;  4JLE A;  4QX8 B;  5FY7 A;  2PJQ A;  2XAF B;  5LA6 E;  1OXZ A;  3WAK A;  2XHE B;  3OJA A;  3N9Q A;  4IIJ E;  2X0L B;  2JQQ A;  3QC9 A;  4QXC B;  3F57 A;  5F3J A;  3ZEF B;  4FI5 A;  2PG8 A;  4WW0 A;  4MAL A;  2V7M A;  2Y8D A;  1SHZ C;  4AXP A;  4H63 H;  4O4H E;  3UT5 E;  4H9Q C;  4QHO A;  3I0Q A;  2NTX A;  4QXB B;  3SOL A;  3U3I A;  2LHN A;  2L9Q A;  2G0U A;  4H9R C;  5FNV E;  2HPL A;  2SPC A;  3F2E A;  3LK2 B;  2NTY A;  4UF0 B;  2JJ9 A;  4EYY R;  4I4T E;  3V5U A;  3ZYK A;  2NWB A;  3N2G E;  3PUA A;  1VRB A;  2JPF A;  1HG2 A;  3GMI A;  1YKH B;  2LE8 A;  3HKE E;  2EHO A;  4H9P C;  2XAS B;  3RX6 A;  4C91 A;  3NRY A;  3LK4 2;  4IE0 A;  3C64 A;  3ZYL A;  4CXW A;  1D1B A;  4GK5 E;  3T8O A;  3FBZ A;  3BQI A;  2W61 A;  2Q9Q D;  4ILU A;  4O2B E;  5HXR A;  4O4L E;  2V1D B;  3ANW B;  5JQG E;  1OWA A;  3HL6 A;  2UXN B;  3ZMT B;  5FY1 A;  4IE5 A;  1KK7 A;  1HTJ F;  4EZ4 A;  3CX6 B;  2M67 A;  4I50 E;  4AKL A;  3MJX A;  2L8K A;  3EUH A;  1IJ6 A;  5FP3 A;  3ETV A;  3OYX A;  5ETW A;  4BAY B;  3BQK A;  1IAP A;  3IF8 B;  3I9Y A;  1IZN B;  3GN5 A;  4TUY E;  2XAJ B;  5GON E;  4ZI2 C;  1CUN A;  4DBQ A;  2CWY A;  3ZN1 B;  2Q9Q B;  3LJC A;  5FXV A;  2Q9Q C;  5FXX A;  5BMV E;  2V7I A;  1G73 A;  3K3N A;  3K3Q C;  5FXW A;  3RPU A;  4O8S A;  1MIV A;  3KBT A;  4B6X A;  4IST A;  3P7I A;  2LM9 A;  3N9N A;  4HTE A;  2LHR A;  3EDU A;  4TX5 A;  3O1J A;  4GOU A;  2HPJ A;  3C4W A;  1T98 A;  3F31 A;  1MMA A;  2H7V C;  5AFU L;  5HWX A;  5LGU B;  3VKG A;  3CML A;  2ZM2 A;  4PJN A;  5KMG P;  4K0U A;  2X67 A;  4OK0 A;  4OYJ A;  4E7S A;  3LBX B;  1D1A A;  1FIO A;  1YD8 G;  1HCI A;  4AKH A;  4ANJ A;  2KT9 A;  4WBN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...