1OWAA

Solution structural studies on human erythrocyte alpha spectrin n terminal tetramerization domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structural studies on human erythrocyte alpha-spectrin tetramerization site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Spectrin alpha chain, erythrocyte
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1owaA01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1owaA02
4C46A 5AW7B 3A3YB 4B86A 3HE5B 4I2LC 3T97A 1S9KE 1OWAA 2XZRA 3V5BA 3VYIA 5AVSB 5AVTB 1WLXA 2BASA 1CUNA 1CI6A 3SWFA 3M9HA 1KQLA 2WPRA 1MV8A 3L35A 5APXA 1NWQA 3UUNA 1GZLA 3A2AA 3FB2A 2WWWA 5AVWB 2W6AA 2WTYA 2YO2A 5APVA 5AW0B 2XU6A 1DH3A 3VMYA 3TNUB 3V4WA 2KP8A 3M0AA 2Z5HA 1HBWA 3VN0A 4DZOA 2WPQA 5AW6B 1OXZA 2R32A 3LIEA 5AW4B 2ZFCA 1A02J 4RESB 4GKGA 2ODUA 2SPCA 2VRSA 1NAFA 1FOSF 2Q7CA 1YYCA 1FAVA 3MD0A 3PE0A 2R5DA 3UUMA 4AQRD 1CZQA 1CSBA 3A5TA 1CI6B 3M06A 1GU4A 4I6MC 2E43A 5AVZB 4HYTB 5CMZA 3L36A 3TK1A 3I5CA 2Q5UA 5APSA 2IPPA 2C9LY 5APUA 4GT1A 5AW3B 2W27A 1X8YA 1T2KC 1FOSE 3P7KA 3EDVA 3L37A 4XE5B 5AVQB 3KQGA 3VTPC 2Q3IA 2H7HA 1GK4A 3HTKA 3VMXA 2ODVA 3UIAA 3OAKA 3P32A 1GU5A 3V4QA 3NFQA 2N9BA 3B8EB 3NTNA 3TNUA 4C7NB 3MGNA 2P7JA 1HWTC 2E42A 2WPSA 4AYCA 2JJLA 3A7OA 2P2UA 2QM8A 3TYYA 5AW8B 4LC1A 5AVYB 3HE4B 5APTA 3NMDA 1H89A 1A02F 5AW1B 5AW5B 1HJBA 4EOTA 2YNYA 3M9BA 1SLQA 3LBXA 1IO4A 1QUUA 5AW2B 3VMZA 2YO3A 2R3CA 5AVVB 1U5PA 2Z5IA 2WT7A 1GK6A 3O8ZA 1H88A 1AJ3A 3M0DA 4JYCA 2WT7B 1SP4A 2QM7A 1S9KD 1GTWA 3LBXB 1GD2E 1G2CB 3IR9A 2C9NY 5APWA 3F31A 5AVUB 3NXSA 3P8MC 3LIDA 2P67A 3HE4A 1H8AA 3UULA 5APYA 2R5BA 5AW9B 4JYBA 3HE5A 3M91A 5AVRB 1HUCA 5APQA 4C7NA 1S35A 2ZXEB 1HCIA 4AUWA 4KHXA 3KDPB 1J2JB 1U4QA 5AVXB 4M3LA 1JUNA 1MUUA 1MFZA 1T2KD 1JNMA 2XV5A
chains in the Genus database with same CATH superfamily
4TZ4C 2BS3A 5CHXA 5AVTB 4PAGA 3EWKA 1FZEA 4L5GA 4UVCB 3L35A 2WSCH 4H44C 2YMKA 1KF6A 1SQPJ 3D71A 1KYOD 1T98A 5KDMC 4U3FJ 2AE9A 3PUZF 1UX5A 5FNVE 3JCFA 1Y8AA 1HR0T 3FZLB 3AEGA 1EDKA 2LHNA 2OTKE 2LM9A 1SQXE 4GKKT 3UTKA 4ZOLE 3LIEA 1UIXA 1JY2O 2K24A 2R6GF 1HG5A 4H0LC 2XQ7A 4OYJA 4Z91A 3AEFA 4DR4T 3I56P 5KX5E 1BSNA 4W7YA 3A0BH 3L8RA 1EZ3A 4GDOA 1LWUC 3M06A 5FY7A 2LJLA 4AKIA 4HYTB 5CMZA 1L4AB 2B9BA 4UV8B 3L36A 2X68A 5FL0A 4IOIH 2VL8A 5APUA 1SQBJ 2C5KT 3RPUA 1GL2B 5JDMA 4CN4A 1NGMB 1EDIA 2H89C 1K05A 3RGLA 3UU6A 1LP1B 1LTJA 2D5UA 4KBMB 4EYUA 5KLVG 5M4YA 2E74D 1YQ3A 1OEDB 2LSGA 4H63V 2B76A 5LHHB 1DEBA 1QLED 2D2CB 2BEQD 2XNDH 3NTNA 2HPCB 2PG8A 4UB8E 3AE5A 5L4HA 2NW7A 1W2BO 3JAFA 3M9BA 1SLQA 3CMAP 1VQPP 5AW2B 5LGUB 1ZN5A 1SQQD 2ZMAA 2N1TB 2HPJA 1Z8UA 5CBNA 3WAJA 3AECA 1UUSA 2UXCT 3IR9A 3PH0A 4UELA 2LRLA 1NTME 2H8PD 3WUTA 3H1LE 4GYRA 3SFEA 3AE3C 1SQBE 2LSJA 1ZR2A 4B6XA 2CPBA 3V2PA 3SS1A 3SWKA 1ZXGA 2EHOA 3JAEA 4HN9A 4JBZA 1L4AC 2BVMA 3BCCG 5APQA 4IE0A 4KHXA 4ZEYA 3EVYA 2K1AA 2E9XD 2JWDA 3CIRA 4JI4T 1G1IA 3H1IG 3PJAJ 2CPSA 3A3YB 1FJKA 3ZMZB 4ANJA 4WW0A 5LBQB 3VYIA 1R8IA 1GL2A 1G1JA 2Q6QA 3CWBE 5AQNB 1NKNA 2HG5D 1KQLA 2FYZA 2V7LA 3V5UA 4DR7T 2IUBA 4MBQA 5AQHB 1VQ8P 5EK4A 2UXDT 3H3MA 2X0YA 4GK5E 1UCUA 2YO2A 4JPZB 4KHZF 3P8CD 4Y99C 4DT0A 4WZXA 1Y47A 3AA0B 3CXHH 5B5EH 3QC9A 2KP8A 2LM2A 1T8BA 3H1HG 5CA1E 3AE1C 1KNPA 2WDQA 1K04A 2XQ6A 5LB7B 3MXZA 2ZFCA 3OTOT 2XQ9A 2Q7CA 4YPCA 2XAJB 3WMM0 2UUAT 1KQGB 3EHZA 2E43A 2G3AA 5AVZB 2W8ZA 4IFDK 2DL1A 1LVKA 5IWAT 2IPPA 2BBJA 3U78A 2R3SA 2V4HA 3QWOC 2O01J 4D6TE 3LK2B 1VQ4P 4ZXLA 4H9QC 2CCQA 1URQA 2XQ3A 4Z8XA 3RK2B 2M0BA 3Q3DA 3MK7C 3NVOA 2WSFH 3N5LA 3KXDA 4U3FG 1IK9A 4Y99B 2QSIA 4C90A 2CLYC 4CN6A 3GW6A 3H1KE 4PJ0H 1Y9BA 5HYAA 5KTBA 1HJBA 1NU1D 1IO4A 1RE3A 4GYSA 5AVVB 3PU3A 1HX1B 4EYYR 3C4WA 2D9DA 2CBJA 3CQCB 3PTZA 1GD2E 2E5VA 2H88A 4DV2T 1BCCG 2NPSC 2FFDA 3CL3D 2QE7H 2CEAA 2R5BA 1HNZT 1HH0A 5L47A 2XQ5A 1BE3E 5ETWA 2WWUA 1SQQE 1B7TA 3RIFA 2KIKA 4YTPC 3N9QA 5AQQB 3FXDA 1AJYA 2V7QJ 1NTMG 3U59A 2LKHA 3UUXB 3CI9A 2VWAA 1RQUA 2V6YB 4AQGA 1SQPD 1YI2P 2QJKB 1FJPA 4BWNA 1W09A 5F8PA 3ONLC 3H1IE 5JDFA 5AQIB 1XWMA 3A2AA 3AE6A 3O1JA 4K0UA 2WWWA 2BG9A 4QMAA 2OLTA 1SFCA 5JDHA 4XAXB 1LGHB 3KV9A 2P58A 1PP9D 2CWOA 1OEDE 4ISTA 1HFAA 1ZMEC 2I6HA 3EDUA 4AIUA 1KFNA 2BCCG 3HUSB 3D6ZA 4YTNA 4IGUA 2VK9A 2K48A 3RIAA 3U1AA 1IFDA 5KKZC 4PK4A 3EQ2A 4ILAA 1G73A 2CHNA 1CHUA 1SE7A 2KLQA 3R2PA 3PUGA 1CSBA 3P4WA 1GW3A 5M1BA 4DIDB 2HODB 1L4AD 3LDQB 3ZT5A 1HGZA 4IREA 1VQNP 2CWYA 5ABGA 3USSA 5BU8B 3FZMB 2WAUA 4JLEA 3VMAA 2NW8A 1LKXA 2XQ8A 3T1HT 2LSYA 2W27A 4K3AA 1KNRA 3EDVA 1NU1K 1UURA 1NAYA 4DMWA 3U1CA 3A0HH 2XAHB 5H2FH 2ZAEB 4YXWH 4ZS3A 1BGYE 1KB9E 3AVSA 4P0AA 4X5TA 3S4UA 1EZVG 1LTBC 3BQKA 3ANWB 3CC4P 3KFWX 1OEDC 3X1DA 4IDNA 2YXRB 2XSBA 1X22A 2NPSA 2GM4A 3FZHB 2H7OA 2LT3A 4MLKA 2BEZF 1QUUA 3GF3A 4HFBA 2BCCD 4DUYT 3JCUE 4EDFA 3RHWA 1LTIC 2UXBT 1AJ3A 2V7KA 3GWHA 4EOZB 2X9YA 1S9KD 2WSCJ 2JRKA 2C9NY 3E1IA 4KHPT 4EI2A 2XASB 3TGUD 3TLVA 3BASA 1FMWA 1E2AA 4QKNA 4JYBA 4L0RA 3M91A 3GN5A 4DNDA 5LG4A 4IDPA 2BS2A 2ZXEB 3RL0g 1IK7A 2YU1A 4EGWA 3Q5XA 3KV6A 3IF4A 1D0ZA 1KFMA 4H9NC 3AE4C 3L74E 3EI0A 2WPVB 3LW5J 5AVSB 3C50A 5AQFB 1SA0E 2I1KA 3AEEC 2WQYA 3OJAA 1HS7A 1H0TA 3NRYA 1HTLC 3UUNA 1GZLA 2BBHA 1VQ9P 4I43B 2XNXA 5L4EA 1EZVD 4HGAA 4GOFA 3CWBJ 5TISE 4COFA 1M90Q 2IFMA 3O1HA 3ZT7A 4I7ZC 2ACZA 1MKMA 2B1EA 4LFBT 4TT3H 4HE8A 4YFSA 4JI0T 3H1IJ 3ZC0A 3L09A 1BE3J 4QH1A 5LMNT 3ETVA 3L39A 3Q1MA 3RYCE 2RH0A 1KB9H 1RE3C 1WMKA 2QJPB 4OWFA 4O2BE 5GTIH 1CZQA 3FXEA 4ZKUA 1Q81Q 3NZPA 1JNZA 3PP5A 1NHLA 1OW8A 4UB8H 1XNRT 2UWJE 2KNDA 1JCCA 3MKDA 2M67A 4PJMA 4LFAT 4DR5T 4YSZA 4U3CA 1O3XA 3EABA 3TLWA 5LGNB 4G2AA 3RRWA 1PL5A 1ZV8A 2Q9IA 5EK2A 1FOSE 3AEDC 2JIWA 2UXNB 1AFOA 4WY4D 3VHLA 2W66A 3L37A 4CQIA 4XE5B 2XY8B 2K37A 4ILCA 3ZCJA 5FXWA 3K1SA 4B3ST 3H1JJ 2JP3A 4JF7A 5C3JA 4OH8B 3GMIA 5E0OA 5CB4E 3UFGA 2Y0EA 3CCUP 2H3RA 1UK5A 2IYPA 3TNUA 3A8YC 2KZ7B 1NU1J 3A7OA 4HFDA 1KILD 4DBQA 1E5WA 2CM0A 3P4PA 1FDOA 3B57A 4A98A 4CXXA 2E9XB 5KJ7D 2IHR1 5AQGB 2CXLA 4PNIA 1SQBG 2WITA 2WS3A 2FYNB 3WI3A 2YK0A 2QM7A 1VQ6P 1MMAA 2CXFA 5BU5A 3TLSA 4OX9T 4F8HA 3HE4A 4X1KE 4LMKA 4DV4T 2W00A 2MBGA 1SHZC 3GMAA 4QH5A 3CXHE 1SVFA 5B5EE 3AEEA 3M3ZB 5AVXB 5CBOA 4B3MT 1J1DC 3VRAA 2QVAA 2Q9QB 3LSVA 5CJ5A 1SQXD 1W9RA 1CUNA 2IIUA 1SQPG 3M65A 3EUHA 2VKHA 4O2AE 2QJKC 1PP9E 1LT1A 3PV0F 3PU8A 5GTHE 5E79E 3EAMA 3VOPA 3PURA 3RC3A 1E7PA 5HEGA 1M57D 3ZKRA 2O01N 1N73A 3PJAA 1MFTA 3MUDA 4KX6A 2MAWA 2BG9E 1FZCB 3MD0A 3AE1A 3HUSC 3N2GE 4AQRD 1EZVI 1EXIA 3FHNA 4FI5A 2PP6A 3F57A 2QA4P 3K3NA 2YIUC 4IL9A 2J59M 5HCMA 2GA1A 4LF8T 5AQPB 4X66T 2CPTA 2LSKA 4OYKA 2Y0CA 1Q90D 4RKUJ 1H7CA 2M5AB 4PFOA 3VR8A 5FY0A 3C9IA 5HXRA 1TU3F 1GK4A 2WMMA 3CQXC 3JC6C 1LTSC 4CXYA 3UIAA 2V7MA 1PPJD 1SQQJ 4PW8A 2E75C 1GU5A 2Q9QD 4HWIB 5GTIE 4L75A 1URQC 5H6QB 3CCLP 3RL0D 2M3EA 5LA6E 4X65T 1YKEB 1ZOYA 2KSEA 2WDRA 3UU5A 1A02F 2ZM2A 2K88A 4Q25A 2YNYA 2IC6A 5ADXL 2BVLA 1VL2A 3PLNA 1GQEA 1ZOYC 1GK6A 1JCDA 2KYVA 5KXJA 1NTMK 3AXJB 3ANWA 4TN7B 1XZYA 4JI7T 4Z1MH 5JDLA 1VF5B 3AEAA 2O3JA 3KVBA 2P67A 3RH3A 5BVZA 4GOEA 3HE5A 5KAIE 1L0NE 4IDQA 1L0VA 4DV3T 2LE8A 2OYHC 3B4SA 4HTEA 1U4QA 2X66A 5FYMA 3GHGC 3WUUA 3T97A 3HD7A 2XZRA 3ZC1A 4HEAA 2YDSA 5LOVE 5CCGA 2BASA 2VQFT 2KK7A 1N7SD 4BRYA 4W7ZA 3L71J 1Y64B 1L0NG 2ZT9C 5CJ4A 1FIOA 3H1ID 4R4LA 1HF8A 2XQ4A 1MMDA 2X9WA 4TV9E 4IHJE 1SQPE 5LBMA 3AE8C 4HKAA 3KBUA 5KJ7C 1S3JA 2L8KA 5L2LA 3H1KG 1D1AA 1D0YA 3KINB 5ABFA 2WPQA 5AW6B 1KYOH 3RBZA 4PFPA 1I6ZA 4YXDC 1NO4A 4ERRA 4UB6H 1NAFA 2WMOA 4O9BA 4GODA 2D2CC 2IYOA 3RF1A 2XAGB 3I55P 3MA9A 3A5TA 4CXWA 1IBKT 2MJZA 1FEWA 4DUZT 2M8RA 4EEBA 4ILUA 3LG7A 3KPEA 3C4XA 3E0ZA 1Y01A 3GHGB 1IFMA 2I8DA 3N4XA 1L0ND 4JI6T 2BKNA 1PGQA 3TGUJ 4UR9A 2ZM6T 3RK3B 4I0UA 4DR6T 2NP9A 3PUXF 1VQKP 2N9BA 2KB7P 3MGNA 3ZYLA 5L3EB 3L72D 4TV8E 5H6RB 5HCJA 4LC1A 5AVYB 2WZIA 1FBMA 1MIWA 3Q5DA 2FFDC 5JRCA 5CJ0A 2ZJSE 4A97A 1SQXK 3RYIE 4DV6T 1FDIA 1W2EA 3L3PA 1M1JB 3OKQA 1FZBA 1OIPA 2DW3A 1IFNA 3RQUA 4BJMA 2J47A 2B89A 2C5JA 4ISSA 1NWMX 1OMIA 5APWA 2BDEA 3HR0A 3VKGA 2KLUA 1UGOA 3AEDA 2KOGA 1JEKA 5KJ7A 5AW9B 2XHEB 3H6PA 4ZNCA 3Q2YA 3AB3B 3ABVA 4PK5A 4NPDA 1SQQK 2E5TA 4ASVA 1BR0A 4PV1D 2QRXA 2G0UA 2WQYC 1SQVD 2PBIA 3I9YA 2JMKA 3TF5A 4U3FD 1D1CA 3CX8B 4V1Av 4UB6E 2KWHA 2MTQA 3HI2A 3FBZA 5CCHC 3CCMP 3CC2P 3UU8A 3RGUA 2Q9QC 3RKOA 4H9PC 4DOJA 1FZCA 2V1DB 1T72A 3AE9A 5ABHA 2V26A 4CI1B 1XNQT 3AAEB 3CKDA 5ABFB 1USDA 3MZKB 1T3UA 4O4LE 3II6A 1KEYA 3UU3A 4DR2T 1WR6A 1NKZB 2HFED 1VF5D 1S5LE 4B3RT 2FYNC 1N8RQ 2JO1A 2HYNA 3ZYMA 4DO0A 1IBLT 3CXHD 5KLIC 2C5IT 5ABEA 5LG3A 2X51A 2OYIB 5FL1A 2M5AA 2Y6XA 4ZS2A 5TISH 2M6BA 1M56D 2XKMA 2KSRA 2BS4A 1KILB 2C9LY 1P84E 1NH4A 3L71D 3MIWA 4F6RC 3I0QA 1KK7A 3JADA 2V5DA 4JEHB 3SOLA 5AVQB 2L9QA 4IIJE 2QYWA 2IBZD 3AA6B 3OBVE 2K3WA 2CBIA 2MOZA 2ODVA 3FXEB 2HLOA 1VQLP 1T6AA 3P4SA 3D70A 3ZYKA 1D1BA 3SWHA 1NTZK 3N9MA 2D0UA 2JJLA 3FWNA 5DQWA 3TGUE 4U72A 4OHFA 3HE4B 2V8SV 4HWHA 3P50A 1LTAC 1AV1A 2A45I 4CI3B 4EB6E 2RA1A 3VMZA 3UUBA 4CI2B 2CLYB 2HH7A 1N7LA 4U31A 4B3TT 4NPEA 2V5CA 4AQFC 1LT9B 3NZQA 3L71G 5HXSA 4MHCA 1V9DA 2K5BB 5AQMB 1S35A 2JWAA 4N6JA 5FP3A 1ZP0C 1KD1Q 2VKOA 5HWXA 2DLRA 2IX7C 2KXPB 5HEUA 1JNMA 2XV5A 3TGUG 2ACXA 1S9KE 3B5MA 1L4AA 3V5BA 2WSEJ 1IJ6A 5BR8T 4P0BA 2FBWC 3GLMA 2KS1B 2JMHA 1LTTC 1YIJP 2QJYB 2E75D 2NWBA 4OFZA 5FXZA 1S72P 2E75B 2WZ7A 2JPFA 2OV9A 2WTYA 3L72J 1IC2A 3L74J 2OYIA 3RIUA 1MIYA 3N7NA 3CWBG 2IC9A 3QK6A 3N9PA 2AEMA 5AQLB 1K73Q 1P84H 3QNUA 4P09A 4AKHA 3J7Yq 2CHOA 2NOXA 4H9SE 1AVOA 1S5LX 1L0LG 1OZHA 1JY3O 3PTRB 1OW7A 3NKZA 2X67A 2LLYA 1FOSF 1JO5A 1L0LK 4GIFA 2IBZI 3PE0A 1N33T 3W15B 2VKDA 1Q86Q 5KKZB 3OVUA 1LTJC 3RK3D 5LMUT 2W90A 2KI7B 2Y48B 1NTZD 2O1KA 1WRDA 3BCCJ 1US7B 1JY2P 2OYHB 5AW3B 2X9HA 2ZM8A 4QXHB 3HKCE 5HXCA 2PTFA 2P9BA 1KYOE 3GN5B 1PPJG 5DABA 1ZR4A 2L91A 3AAAB 3H1JG 1RQVA 3H1LD 1KN7A 2QM8A 1OVUA 3TYYA 1DIPA 2ITAA 1QSDA 3UQ4A 2I59A 4JI2T 2WVRA 5AW5B 4OGQB 2JQKA 4YHHT 1N2DC 3IA3A 1H0TB 1PPJE 3IBPA 2JEEA 1PGPA 4JEUB 2YDRA 4IDZA 1SP4A 2XAQB 2YKQA 2PJQA 1AQTA 2UUCT 5B66H 3ZMSB 3V2NA 5KLVJ 3G3ZA 4LF6T 1ZW0A 3BK9A 4YT0A 2YOEA 1QVFO 2VB6A 3Q5PA 3L4FA 1RF1C 2W6JH 5AQVB 4IFFA 5LGTB 1NTZG 3T8OA 4UV9B 3KDPB 1MZ9A 1NTZJ 1RY3A 1X9VA 4TWFA 1MFZA 5KLVE 2NTYA 5DJQC 1DEEG 4KT0J 4DV1T 1LJ2A 4X64T 1J1EC 1SFCC 3H37A 1SQVK 1LT9A 3RL0B 1VCTA 1Q7YQ 1Z0PA 2KMFA 4U74A 2K9YA 2YIUB 1GMJA 1NTKG 1VOMA 3F5HA 3JSVC 3FWLA 4W80A 5JDQA 2YXQB 2H43A 4X1YE 2N1TD 1BGYD 1QLBA 3HUSA 1S94A 2A72A 1AQ5A 2WM9A 3QOFA 2OTJP 3SWYA 1WYCA 3R4YA 1VQMP 3A0HE 3ABVC 2AXDS 3C51A 3HKDE 3C98B 1I94T 4U7YA 3UUMA 2R5DA 2J58A 2X9XA 3ZMVB 5C2TA 3H1LJ 1XTCC 3L73E 1WT6A 1IFIA 3O4XE 2A45H 3H1LG 3HD7D 4EIJA 1RHZB 3AEBC 1RF1B 4AQFA 5GTHH 3RYHE 3H1KD 2A06G 2DWGA 1M8OB 4X1IE 3ZJ1A 3E08A 2W4XA 3L73D 4I1LA 2PFVA 1T8ZA 1JMBA 3OAKA 5CCHD 4H0LB 4XFJA 3NBXX 3CVRA 2CXDA 2P7JA 1SQQG 1NTKD 5JVDE 5JQGE 2CE7A 4O8SA 4UEMA 2H88C 2ZVOB 4ASWA 1M1JA 3NMDA 5DQVA 3CLQA 1EZVE 2W2UA 1N36T 4QH4A 4QWNB 2KNCA 4QX8B 5F3JA 2V6YA 4ZI7E 5LJMA 1VCSA 3L72E 1GTWA 3LBXB 3ZMTB 3J9X1 2FXPA 1P84I 4GIWA 5APYA 5KLIB 2Y8DA 2LXBA 1IBMT 1L2PA 2RKLA 5CCGC 1X79B 3P7IA 3AVRA 2IBZE 5LYJE 1MUUA 1NTMD 1HGVA 3L70E 2K3RA 1T2KD 2QGSA 4NUVA 3C1LA 4WY4C 5AW7B 4I2LC 3L75D 4KUMB 4I50E 4J2CA 1KV4A 1FZCC 4DCKA 3JCUH 4E7SA 4JI5T 2V6XA 3N9NA 4H13B 2WPRA 4A56A 3CPWO 2AXTH 3NWIA 3E22E 3BCCE 1HF9A 4H9OC 4XZCA 4AKGA 3FB2A 2LOPA 5J0ZA 2E76B 5AW0B 1HVVA 1YHQP 4U3FE 3RC8A 2J62A 5JR9A 3RKGA 3CWBD 1NTKE 3IFMA 4ZHQE 2YKPA 5C39A 2ODUA 2SPCA 4BAYB 2XSAA 4LMLA 1QL2A 2N9YB 1U7MA 2E74B 2FJAA 3BRTB 1URQB 1DX7A 4HFIA 4TNWA 3FBLA 1YBKA 1GU4A 4U7IA 4NPPA 2W83C 4YTPA 1SQVJ 2FBWA 1K9MQ 4PJ0E 1EDJA 3ZEFB 2QG4A 1T7SA 3IEEA 1L0NK 1BR1A 5E79H 2LKGA 3OA7A 2EHOC 3MJXA 4GT1A 4X62T 3OYZA 2OTLP 1RF1A 2K9JA 2YINA 5AQKB 2H7HA 1SFCD 3N9OA 3ZLIA 4ZI3D 1QEXA 4WB4A 4IE5A 1YTZI 2GUVA 3M9QA 3L75E 3WU2H 4TX5A 3R6NA 2AEFA 3H1JD 3SFDC 2IDOB 4EXTA 4ADZA 3PUYF 3ZJ2A 2K9AA 2V7JA 2M6IA 5AW1B 2O01H 5FXXA 1N7SA 4BRYB 4TUYE 5HXHA 2HPLA 1M7KA 4ASKA 3O8ZA 2Y9YA 1QVGO 1KMIZ 3RX6A 3HD7B 1VQ5P 5FVLA 4JV5T 1XMOT 3CCQP 2QEXP 5EFWB 4U7JA 2RN0A 3CMEP 3I9WA 4AKLA 1JB0J 1LTJB 3F2EA 2EHOB 1FJGT 1DD4A 5JH7E 2XTLA 1BSHA 4IE6A 4WBNE 3ESLA 1YJNP 1E1HB 5HEOA 2UU9T 2C0SA 1OWAA 3O6QB 3AXJA 4LF4T 2CK3H 3P4RA 3RIUC 1CI6A 4LMJA 2D0TA 2PGDA 2KZJA 1MV8A 4U33A 4ZI3C 4TLFA 4YJ2E 1SQVG 3KYQA 1URQD 1W0AA 1WFDA 3H32A 2A06D 4AISA 4WBAA 2E8IA 4HWCA 4YLHA 2BCCJ 3A5XA 3LK3B 1QL1A 2Q1KA 4DMVA 1WRGA 3F89A 5AQRB 4DZOA 3H1HD 3PJSK 2R32A 2WZHA 2K9JB 4OGQD 1SUMB 3A7MA 1GW4A 4DBRA 3ZCIA 1S1CX 1NTKJ 4UIGA 2OARA 4TNVA 2Y0DA 3P8CE 2WP9A 1FE6A 1S4XA 2Y9ZA 3DJBA 2KUBA 3I5CA 3L73J 1HX8A 2FJEA 3MACA 1SQPK 3L73G 1EC5A 5DJTB 3HA4A 3P7KA 4K35A 2ES0A 2XQAA 3KHUA 1BE3D 3N9LA 4M1PA 1J1EB 2UUBT 1IFPA 4L76A 1ZRTD 3K3QC 1N7SC 2WWVA 1NTZE 4U2ZA 1R5SA 2BCCE 3VR9A 5JR9C 4EEDA 3Q2MA 1N32T 1HJ0A 4NIQA 4AI6A 3KZIH 5AW8B 4P1NA 2W0GA 4AXPA 4R4MA 1PV3A 3PUQA 5APTA 5LCYA 3GF7A 3D6YA 5J1GA 2B87A 3H1KJ 5IHYA 4PV1B 3AA1B 1RF0C 4JBWF 2R3CA 1KB9D 2Q3EA 3M0DA 2WT7B 1EDLA 2XJ7A 3G71P 3VRBA 1SQBK 1G2CB 2E9XA 2MYSA 5H2FE 2LKMA 2YEVC 4PK6A 4HFCA 5FMNA 2VKJA 3PRJA 3RBXA 3LIDA 3VP8A 4ZZCA 1VDFA 3RYFE 2LEHA 4HJGH 1HUCA 4WBOA 4C7RA 3AE3A 5TAOA 3L75G 5AQOB 1FDMA 3HTKB 1M62A 1LVFA 2DCFA 1FZFA 2VVNA 3AAIA 4UF0B 2N9DA 2IBZG 1USEA 1G8XA 2LOSA 3V5SA 1WCRA 1KILA 2O1JA 3QH9A 2FYUG 3ZDMA 4E7ZA 1WYBA 5C8YE 3IN6A 5AVWB 4U2YA 2FYUJ 4HH2A 5APVA 2XU6A 3PUAA 3V2QA 1KILC 1DH3A 1N73B 2KLVA 3CCJP 4ILBA 3DP7A 1UX4A 2WSFJ 4PJLA 4NXNT 3LW5H 3CCEP 3V6IA 1OXZA 3CX5E 1A02J 2A2FX 1LWUB 4I55E 4QHOA 2F4VT 2J4GA 3AA7B 1MMNA 2NPSD 1L0LD 2WB5A 2KZIA 1MNEA 3VKHA 3I1AA 4H63H 3V2RA 4L9IA 2N2NA 3G9RA 4I6MC 2LHRA 3SSUA 2FUPA 5FXVA 3VU7H 2WSEH 1AVYA 2ZXXA 5APSA 2E9XC 3SFEC 5GONE 3EFFK 3H3AA 5AFUL 3ITKA 2H7VC 2WMNA 3K8PC 3ONXA 1EXJA 4WWIA 2HN1A 4WY4B 3VTPC 2Q3IA 3HTKA 1SS1A 3BATA 3L70J 4N3YB 4H44D 2KSJA 3NFQA 3AE4A 5EZYE 3L70G 4AYCA 1G2CA 4RO0A 2I0MA 1OX3A 1JY2N 1MIVA 1N73C 2WY2A 4IDOA 2E76C 2N1TC 3MHVA 2FYUK 3AEAC 3K5BA 1XDOA 3FZFB 1FC2C 2JR8A 1NENA 2YO3A 4LF9T 5CGMA 3OW2O 4ZZBA 2IFNA 1JOCA 1H88A 2IMLA 5HEJA 4XBFB 3D0TA 2ZT9B 1VQOP 2B87B 1KILE 2JJ9A 3UFEA 2ZVNB 5CA0E 4FJOA 1JY3P 3P8MC 1H8AA 3UULA 5JREA 2FYUD 1SQBD 3HD7C 1J5WA 4DJGA 2LR2A 2JQHA 4C7NA 1HCIA 2PRRA 1LT9C 4C91A 2LXCB 1YJ9P 4IL6X 3CWZB 3I0OA 5HXEA 2POHA 1N34T 2L5GB 2V7IA 5LNKA 3TSIA 1R5LA 2XPKA 4JI1T 1SQVE 3ETUA 4IFMA 5EK3A 2W6BA 5HEHA 3Q5SA 3M9HA 2WSSV 3TDKA 1ZV4X 1PGOA 2A06E 3BQLA 1KQFB 2IW5B 1T3JA 2PFXA 4NUUA 1RF0A 3TLTA 1HTJF 4H9RC 4EV6A 1JNRA 3VMYA 2DI4A 4G63A 2DHRA 3TNUB 5JRCB 4EZHA 2BG9C 3PUSA 2X0LB 3JC22 3M0AA 3RLFF 2CA5A 1WR0A 2MKVA 2XM2A 4KI0F 1S2EA 2LSIA 4ZMDA 3ZT6A 1FAVA 3AEGC 3RK2D 3IF8B 3O1IA 1FZAA 2OYOA 1CI6B 4D6TG 2E5LT 2Z4EA 5CCGD 3PDYA 4D6TJ 2HODA 1VQ7P 2GUSA 1GL2D 1X9BA 2A9UA 3AEFC 1KZUB 2XUEA 4WYVA 3H1HJ 4I7ZB 3O9XA 2G8YA 1LWUA 1S5LH 4GK0E 3SFDA 3VMXA 1FS0E 2NR4A 2IZ0A 1PIXA 1L0LE 3L72G 3V4QA 1JTHB 3AE8A 1IAPA 1HWTC 1U57A 2E42A 2P1JA 2VL0A 3QB5A 4LF5T 4LFCT 2XQYA 2QJPC 4IL6H 3H1HE 4ZKPA 2BG9B 3RRCA 1BGYG 5L3BB 1D7MA 4DV7T 2NPSB 3CCSP 3AE6C 3BRVB 3H32B 3ZN0B 1SFCB 1BDDA 3HL6A 1KORA 1R8EA 2W61A 3MP7B 4OGQC 4YY3T 3AEBA 2E5YA 4Z90A 2ZM0A 4DVDA 3FXDB 2AXTE 3C64A 4MFRA 1FZGA 1IJ5A 3RK2C 2NRGA 4OK0A 3CX5I 4HFEA 1DU2A 1DD3A 4DR1T 3T97B 2VQET 3N2KE 3L74G 1NOHA 1KC8Q 4AUWA 1YKHB 3BQIA 3G06A 3UT5E 1J2JB 1J5ET 3CQGB 4IE7A 5LHGB 5BMVE 4A5XA 4MN4C 2P10A 3FX0A 3PUVF 3UU4A 3WAKA 3HE5B 3GG2A 4A7PA 3JC6D 1NYHA 4BJNA 3SWFA 4YJ3E 3C8VA 3A0BE 5APXA 1N7SB 2AEJA 4Y28J 5DJUB 4I4TE 3M0DC 3NRXA 3MZWB 1UIIA 1YTZT 4YTMA 4LLHA 3RL0C 4TWHA 1PP9J 2E76D 5KAIH 3L75J 3B5NB 2BKOA 3V4WA 4JI3T 2X0HA 2OQQA 2Z5HA 4H13D 4BXLA 4QX7B 2VVSA 3UQ7A 1VRBA 5AW4B 1Q2NA 4RESB 4QXBB 4GKGA 5IUXA 5L3CB 1BCCD 3AE2A 1J1DB 3CD6P 3B5NA 3GHGA 3ZPOA 3S9OA 3G6EP 2XAFB 1NJIQ 3FGAD 3AE2C 3O6QA 5HWYA 4NXMT 3L74D 1SQXG 2YMYA 1BCCE 2KINB 3KVAA 1BE3G 3CK6A 1X8YA 1JM0A 1YQ4A 5AQUB 3S4RA 1RH5B 2Q9QA 3QUJA 5KMGP 5B66E 4DR3T 2ZLYA 2BKPA 3PHLA 4DV5T 5KLVD 2J1DG 3TKLB 3P32A 2BZBA 1ZEEA 2E2AA 4C7NB 1M1KQ 1XTGB 2WPSA 2W62A 2YKOA 1GDTA 4K0KT 5L3GB 3KV4A 1M7LA 3H25A 3AE7A 3CXHI 1ZRTE 2HHHT 3LBXA 3E1RA 1VPCA 1AA0A 3LFMA 1KYOI 2XDJA 1MMGA 4IE4A 5L3FB 5FY1A 2C0XA 4CPGA 3CCVP 2KWIB 4IT4A 3TLUA 2IDBA 3F31A 1JTHA 2D2CD 1XMQT 4JYAT 5AVUB 2D2SA 1BCCJ 1J1JA 3DTOA 4PD4E 4TWDA 1LTGC 3HKEE 4HFHA 5LJNA 1YD8G 4N78E 1IJDB 4PD4I 4GKJT 1Q82Q 2RPAA 1PFIA 2B88A 3BCCD 1EQ7A 5HAXA 1GL2C 2QA7A 3ONJA 1OW6A 2FFDB 1NTMJ 1D0XA 4C46A 3FZKB 2WBLA 4EYYQ 1HG2A 5KLVK 4KMCA 2M3BA 4ZI2C 1M1JC 2N1TA 4O4HE 4N78D 2E74C 2MPKA 2LRKA 2OYHA 1YW0A 3CX6B 3T1YT 2CRBA 1NWQA 4GOUA 2WCAA 1U7JA 1YQ4C 2W6AA 2XZEA 2PAJA 1X0TA 3CX7B 1MNDA 3OYXA 4NPFX 2SPZA 5KAFH 1KB9I 4IL4A 1HBWA 1OEDA 3IAOA 3VN0A 2YKSA 5JR9B 5CFBA 3SRZA 4UVAB 1ZLLA 2HPCA 2VRSA 1HNXT 3W67A 2WU5A 4HWDA 5L3DB 4D6TD 3QB5K 3HRNA 4UVBB 3GA8A 3MUDC 1LRZA 1LP1A 2L3LA 1OFCX 5AQJB 5TJHA 2DWKA 5CCHA 2RMZA 2NZ2A 2ZYAA 3OJAB 1IFJA 3R84B 4PD4D 2KS1A 3E7KA 2J5UA 2ZYGA 3H1JE 2Z6EA 4PJJA 2JQ9A 2YN6A 2IAKA 3CMLA 5F5WA 1W5CE 5A1LA 4DV0T 3N2OA 3CX5H 1KTMA 1NU1E 3AE7C 4OVNF 1N86A 3KDSE 2C0WA 2FJBA 2HR3A 1ZP0A 1BDCA 3K3OA 1P84D 1K8AQ 1QGKB 2P2UA 1BR4A 4CZZB 3C4ZA 1Z56A 1NTKK 5IYZE 4JUYA 5J2TE 4EOTA 5AQSB 1YJWP 3S1KA 2FXMA 3Q5RA 2Z5IA 1NVOA 3B71A 2WT7A 3RI5A 3ZSSA 5LXTE 3KV5A 4EIWA 1ZHCA 1QX8A 4O4JE 2VURA 4EZ4A 1PGJA 5FVKA 1JMMA 1OVRA 3WU2E 3PUWF 1X79A 1L0NJ 2OGUA 3RK3C 3WUVA 2V7QH 3OPCA 4WY4A 1HNWT 4AKRB 1SQXJ 4EAHA 2UXXB 2YDQA 3LJCA 1PP9G 5JDNA 1YQ3C 2QIWA 2Q5UA 3KBTA 1FMVA 4B86A 4MALA 4UXNB 4HFVA 2KNCB 2GK9A 1IZNB 3L71E 3MTUE 1BR2A 5K5GB 2FY8A 2H89A 3Q9DA 1NEKA 1KFYA 5LHIB 4BA9A 2FKWB 2CMRA 5JTGA 1JY3N 1ZKEA 1KNZA 2HN2A 4LF7T 2NTXA 1RE4C 4KP3C 4RJTA 4KJMA 2IZ1A 3AECC 1L0LJ 3B5ND 4L73A 3ZMUB 5LP6E 2I1JA 4LGDE 4PJNA 3AE5C 4JQ0D 3AE9C 3VP9A 2W67A 4X20E 2A45G 3BVHA 3B13A 3RQWA 1PZQA 1YYCA 4CN1A 2QJYC 2KT9A 3KZIE 2YU2A 3TK1A 5JDGA 2NW9A 4PV1C 3W68A 4QXCB 2JDIH 1XDPA 3CC7P 1T2KC 4UF0A 3CX5D 4YSYA 4HKZH 3LK42 4AQYT 1FU1A 4HB1A 2AXCA 3KQGA 3CCRP 4L74A 2OA5A 2JQQA 4ZI2D 4WNKA 3RK3E 1KQSO 2DNXA 2WU2A 2ZYDA 1OVVA 3EFGA 3HKBE 3ZSTA 4PD4H 2XM1A 4JI8T 5FKYA 1WLXA 3B8EB 2RP4A 2ZT9D 1LNQA 4H44B 3ZN1B 2FXOA 2R44A 2FYUE 2FJDA 4O4IE 1NU1G 4YSXA 1H89A 1YITP 2WSSH 3Q5WA 3B5NC 2N1GA 2JKVA 2A3DA 2OYIC 4H13C 1VF5C 1U5PA 3L70D 1W0BA 2VASA 4JYCA 3CPZA 4H0LD 1RE4A 3NXSA 4XA4A 3IHRA 1YXRA 3U3IA 1E79H 4YHJA 4WVZA 4HWFA 2W63A 5AVRB 1CW5A 4YXDA 3Q5EA 5KAFE 4IL6E 3P4QA 5J2UE 3G4SP 2EHOD 4M3LA 1JUNA 1BGYJ 2WDVA 5L8RJ 5AQTB
chains in the Genus database with same CATH topology
4TZ4C 2Q9QB 3ETUA 1J1EC 4IFMA 5CHXA 5AVTB 4PAGA 1SFCC 5EK3A 3H37A 1FZEA 2W6BA 1CUNA 1SQVK 1LT9A 3M9HA 3RL0B 4L5GA 2WSSV 1Z0PA 4UVCB 3L35A 2KMFA 4U74A 2WSCH 1ZV4X 3M65A 3EUHA 2VKHA 1VOMA 3BQLA 4O2AE 2IW5B 1T3JA 4NUUA 1T98A 1RF0A 5KDMC 4W80A 5JDQA 2H43A 3PU8A 1UX5A 5FNVE 1HTJF 4H9RC 4X1YE 2N1TD 3VMYA 2DI4A 3HUSA 1S94A 2A72A 3TNUB 2DHRA 2LHNA 3VOPA 4G63A 4EZHA 5JRCB 3PUSA 3PURA 2X0LB 3RC3A 3M0AA 1AQ5A 2CA5A 2WM9A 2LM9A 3SWYA 1N73A 1WYCA 3UTKA 3MUDA 3LIEA 4ZOLE 4IE5A 1JY2O 2K24A 3C51A 3HKDE 3C98B 1HG5A 1FZCB 2LSIA 1FAVA 3MD0A 3UUMA 2R5DA 3HUSC 2J58A 3RK2D 3N2GE 4AQRD 2X9XA 3IF8B 3FHNA 4OYJA 3ZMVB 5KX5E 3O1IA 1FZAA 4W7YA 1XTCC 1WT6A 4FI5A 1IFIA 2PP6A 1CI6B 1LWUC 2A45H 3HD7D 3M06A 4EIJA 1EZ3A 2LJLA 1RF1B 3F57A 4AKIA 2Z4EA 4HYTB 5CMZA 1L4AB 5CCGD 5FY7A 4AQFA 3WAJA 3PDYA 3K3NA 4UV8B 2HODA 3L36A 2X68A 3RYHE 2GUSA 2J59M 1GL2D 2VL8A 5APUA 2C5KT 2LSKA 4OYKA 3RPUA 1GL2B 2DWGA 3ZJ1A 4X1IE 5JDMA 1KZUB 1H7CA 2XUEA 3E08A 3O9XA 4PFOA 1LWUA 4EYUA 1LTJA 4I1LA 2D5UA 2PFVA 1T8ZA 3C9IA 4GK0E 4KBMB 5FY0A 5HXRA 1GK4A 3CQXC 3JC6C 5M4YA 1LTSC 4CXYA 3VMXA 3UIAA 2LSGA 4H63V 3OAKA 2V7MA 5LHHB 5CCHD 1DEBA 4PW8A 3NBXX 1GU5A 3V4QA 2Q9QD 1JTHB 1IAPA 3CVRA 3NTNA 2HPCB 2CXDA 2P7JA 1HWTC 2PG8A 2E42A 2P1JA 5JVDE 5JQGE 1URQC 2CE7A 4O8SA 5H6QB 4UEMA 3RL0D 2XQYA 5LA6E 1YKEB 1M1JA 3NMDA 4ZKPA 5DQVA 3RRCA 1A02F 2NW7A 2ZM2A 3CLQA 5L3BB 2YNYA 3M9BA 1SLQA 2IC6A 5ADXL 2BVLA 5AW2B 2NPSB 4QWNB 5LGUB 1ZN5A 3BRVB 3H32B 4QX8B 2ZMAA 1GK6A 1JCDA 1SFCB 2KYVA 2N1TB 1NTMK 2HPJA 3HL6A 3ZN0B 4ZI7E 2W61A 3ANWA 5F3JA 5LJMA 4TN7B 1GTWA 3LBXB 4DVDA 1KNZA 2ZM0A 3IR9A 4UELA 3ZMTB 3FXDB 2H8PD 3C64A 4MFRA 1FZGA 1IJ5A 4GYRA 5JDLA 3RK2C 3J9X1 2LSJA 1ZR2A 3KVBA 2CPBA 4GIWA 3V2PA 2P67A 4OK0A 3RH3A 3SS1A 5APYA 2EHOA 2Y8DA 4HN9A 1L4AC 5BVZA 3HE5A 2BVMA 3N2KE 5APQA 5CCGC 4QHOA 4IE0A 1NOHA 1YKHB 4AUWA 1X79B 4KHXA 2OYHC 2LE8A 3BQIA 1J2JB 3EVYA 1U4QA 2E9XD 3P7IA 4HTEA 3AVRA 3UT5E 3CQGB 4IE7A 5LYJE 2X66A 5LHGB 1MUUA 5FYMA 1HGVA 5BMVE 3GHGC 1T2KD 2QGSA 1G1IA 4NUVA 3WAKA 2CPSA 3A3YB 1FJKA 4WY4C 3HE5B 4I2LC 5AW7B 3T97A 4I50E 3HD7A 4KUMB 4WW0A 5LBQB 2XZRA 3VYIA 4J2CA 4ANJA 3ZC1A 1FZCC 4HEAA 5LOVE 3JC6D 1GL2A 5CCGA 2BASA 1G1JA 4E7SA 4BJNA 3SWFA 1NKNA 2HG5D 1KQLA 2FYZA 2V7LA 1N7SD 3N9NA 4YJ3E 2WPRA 3V5UA 4A56A 4W7ZA 5APXA 4MBQA 1Y64B 1N7SB 3E22E 4H9OC 4XZCA 4AKGA 5EK4A 5CJ4A 3FB2A 1FIOA 2LOPA 4GK5E 4I4TE 3M0DC 1UCUA 3NRXA 2YO2A 1YTZT 5AW0B 4LLHA 1HF8A 1HVVA 3RL0C 3P8CD 4Y99C 3RC8A 1MMDA 5JR9A 3B5NB 2X9WA 4TV9E 4IHJE 5LBMA 3AA0B 3V4WA 4HKAA 3QC9A 2KP8A 3KBUA 5CA1E 5KJ7C 2L8KA 3IFMA 2Z5HA 4ZHQE 5L2LA 1D0YA 1D1AA 3KINB 4QX7B 2WPQA 5AW6B 3MXZA 1VRBA 4PFPA 5AW4B 1AJ3A 2ZFCA 2YKPA 4RESB 4GKGA 4QXBB 1NO4A 2ODUA 2SPCA 4ERRA 5L3CB 1NAFA 4BAYB 2WMOA 4O9BA 2V7IA 2Q7CA 1J1DB 1QL2A 2XAJB 3B5NA 3GHGA 2XAGB 3MA9A 3A5TA 3BRTB 1URQB 3WMM0 1DX7A 3ZPOA 4CXWA 2MJZA 3FBLA 1GU4A 2XAFB 1FEWA 2M8RA 2E43A 5AVZB 4ILUA 4IFDK 3LG7A 5HWYA 1LVKA 3ZEFB 3KPEA 3C4XA 3IEEA 3E0ZA 1L0NK 2IPPA 1BR1A 2YMYA 3U78A 3GHGB 3OA7A 2EHOC 2KINB 4GT1A 3KVAA 3MJXA 3OYZA 1IFMA 1X8YA 3N4XA 3LK2B 1RF1A 2Q9QA 3QUJA 4H9QC 5KMGP 2CCQA 2ZLYA 2YINA 1J1DC 2H7HA 1SFCD 1URQA 3N9OA 3RK3B 4Z8XA 3RK2B 3ZLIA 2J1DG 2NP9A 3MK7C 3TKLB 4WB4A 3P32A 1YTZI 2GUVA 2WSFH 3M9QA 1ZEEA 2BZBA 2N9BA 3N5LA 4TX5A 2KB7P 4C7NB 3MGNA 3R6NA 1XTGB 3ZYLA 2WPSA 1IK9A 5L3EB 2W62A 4TV8E 4Y99B 5H6RB 4EXTA 4ADZA 4LC1A 2YKOA 5AVYB 1GDTA 3O4XE 3ZJ2A 4C90A 2K9AA 2V7JA 2CLYC 1FBMA 5L3GB 5HYAA 5AW1B 1MIWA 5KTBA 1HJBA 1M7LA 2O01H 2FFDC 5CJ0A 3KV4A 1N7SA 1SQXK 5FXXA 5JRCA 3RYIE 4TUYE 5HXHA 3LBXA 1IO4A 1RE3A 2HPLA 1VPCA 4GYSA 3LFMA 5AVVB 3PU3A 1W2EA 2XDJA 3L3PA 1MMGA 1M1JB 4IE4A 4ASKA 3O8ZA 3C4WA 3CQCB 2C0XA 1FZBA 3OKQA 5FY1A 3RX6A 5L3FB 1IFNA 4BJMA 4B6XA 3HD7B 4EIWA 2KWIB 1GD2E 2C5JA 4ISSA 1NWMX 5APWA 3F31A 1JTHA 2NPSC 2BDEA 2FFDA 3HR0A 3VKGA 5AVUB 3CL3D 2D2SA 3DTOA 2KOGA 5KJ7A 2CEAA 2R5BA 1LTGC 3I9WA 5AW9B 3HKEE 4AKLA 1HH0A 2XHEB 3H6PA 1YD8G 4N78E 5LJNA 3AB3B 1IJDB 1LTJB 3F2EA 4PK5A 5ETWA 1SQQK 1PFIA 2EHOB 1BR0A 1EQ7A 2WWUA 5HAXA 1GL2C 2QA7A 5JH7E 2XTLA 2FFDB 1B7TA 4IE6A 2G0UA 2PBIA 3ESLA 3I9YA 3N9QA 4WBNE 1E1HB 1D0XA 2JMKA 4C46A 2WBLA 3U59A 1D1CA 1HG2A 2C0SA 1OWAA 3CI9A 5KLVK 2VWAA 3CX8B 2M3BA 4KMCA 4V1Av 4AQGA 1M1JC 4ZI2C 2N1TA 2KWHA 1FJPA 2MTQA 4N78D 1CI6A 4O4HE 3HI2A 2D0TA 2OYHA 1YW0A 3CX6B 3FBZA 5F8PA 5CCHC 1MV8A 1NWQA 4ZI3C 5JDFA 3RKOA 2Q9QC 4DNDA 4GOUA 4YJ2E 3A2AA 3O1JA 4H9PC 4DOJA 2WWWA 4K0UA 1FZCA 2W6AA 3KYQA 1SFCA 1URQD 2V1DB 5JDHA 2PAJA 3H32A 3CX7B 4XAXB 1LGHB 1MNDA 3OYXA 4WBAA 3KV9A 2V26A 4CI1B 2CWOA 3AAEB 3CKDA 4ISTA 2E8IA 1HFAA 3MZKB 1T3UA 4O4LE 3II6A 4YLHA 3EDUA 3A5XA 3LK3B 1WR6A 1NKZB 1QL1A 1KFNA 2HFED 1WRGA 3HUSB 1HBWA 3VN0A 4DZOA 4IGUA 4DMVA 2VK9A 5JR9B 2K48A 3U1AA 2R32A 1IFDA 3SRZA 4UVAB 1ZLLA 2HPCA 4PK4A 2VRSA 1GW4A 3EQ2A 4DBRA 5LNKA 2HYNA 1G73A 3ZCIA 3ZYMA 4DO0A 5L3DB 2KLQA 4UIGA 3HRNA 3R2PA 2C5IT 1CSBA 3PUGA 3GA8A 4UVBB 2OARA 1LRZA 1GW3A 4EYYR 2X51A 2HODB 3P8CE 1L4AD 2L3LA 2OYIB 2Y6XA 1HGZA 4ZS2A 2XKMA 2DWKA 3DJBA 2CWYA 3I5CA 1HX8A 5CCHA 3OJAB 1KILB 3R84B 1IFJA 5BU8B 2C9LY 1NH4A 1SQPK 2WAUA 3MACA 4JLEA 2NW8A 1LKXA 3MIWA 2Z6EA 2LSYA 2W27A 1KK7A 3HA4A 3I0QA 4PJJA 4F6RC 3P7KA 2IAKA 3CMLA 2ES0A 3SOLA 4JEHB 3EDVA 1NU1K 5AVQB 3N9LA 4M1PA 5A1LA 2L9QA 4IIJE 3U1CA 4DMWA 3N2OA 3AA6B 2XAHB 1J1EB 3OBVE 3FXEB 2MOZA 2ODVA 4ZS3A 2HLOA 3K3QC 1N7SC 1N86A 3KDSE 2C0WA 1D1BA 3AVSA 3ZMZB 3ZYKA 5JR9C 4P0AA 3K3OA 3S4UA 5LG4A 3SWHA 1NTZK 3N9MA 1LTBC 2D0UA 3Q2MA 3UUXB 2JJLA 3BQKA 2P2UA 5DQWA 4AI6A 4U72A 3ANWB 3KFWX 1BR4A 5AW8B 3C4ZA 1Z56A 2W0GA 4OHFA 3HE4B 4AXPA 4CZZB 3PUQA 1NTKK 5APTA 5IYZE 5LCYA 1LTAC 2NPSA 2GM4A 4JUYA 2H7OA 2LT3A 5J2TE 2A45I 4EOTA 4MLKA 5J1GA 5IHYA 4CI3B 4EB6E 3AA1B 1RF0C 1QUUA 2RA1A 2FXMA 3VMZA 2R3CA 2Z5IA 2WT7A 5LXTE 4CI2B 3KV5A 2CLYB 1ZHCA 1LTIC 3M0DA 1N7LA 2WT7B 2HH7A 2V7KA 3GWHA 2X9YA 1S9KD 4EOZB 4O4JE 2JRKA 1SQBK 1G2CB 2E9XA 2C9NY 4EZ4A 3E1IA 2MYSA 4AQFC 1LT9B 2LKMA 2YEVC 4PK6A 5FMNA 2VKJA 2XASB 1JMMA 3NZQA 3LIDA 3VP8A 5HXSA 3BASA 1X79A 1FMWA 4MHCA 1VDFA 3RK3C 1V9DA 4JYBA 2LEHA 2K5BB 3M91A 3GN5A 4L0RA 4QKNA 1HUCA 3RYFE 4WY4A 1S35A 4WBOA 4AKRB 2ZXEB 4EAHA 4C7RA 2UXXB 2YU1A 3LJCA 5TAOA 4N6JA 5FP3A 3Q5XA 5JDNA 2VKOA 5HWXA 1FDMA 3HTKB 2IX7C 2DLRA 2KXPB 1JNMA 2Q5UA 2XV5A 3KBTA 3KV6A 2ACXA 1FMVA 4B86A 1S9KE 1D0ZA 1KFMA 4H9NC 1LVFA 1L4AA 1FZFA 3V5BA 2DCFA 1IJ6A 3AAIA 5AVSB 3C50A 4P0BA 4MALA 4UF0B 4UXNB 2N9DA 4HFVA 1SA0E 2GK9A 2JMHA 2I1KA 1G8XA 1IZNB 3MTUE 1LTTC 2LOSA 3V5SA 1KILA 1BR2A 3OJAA 2O1JA 3NRYA 1HS7A 1HTLC 2NWBA 3Q9DA 1GZLA 4OFZA 4I43B 3UUNA 1WYBA 5FXZA 4E7ZA 5C8YE 2XNXA 5AVWB 2WZ7A 4HGAA 2JPFA 5LHIB 2WTYA 4BA9A 1IC2A 2FKWB 4HH2A 2OYIA 5APVA 2CMRA 4ZI2D 2IFMA 1MIYA 2XU6A 1JY3N 3N7NA 1ZKEA 3V2QA 2IC9A 3N9PA 3O1HA 1KILC 3PUAA 3QK6A 2NTXA 1DH3A 2B1EA 1RE4C 1N73B 4P09A 2KLVA 4KP3C 4AKHA 4HE8A 4YFSA 3DP7A 3B5ND 1UX4A 3J7Yq 2NOXA 4H9SE 4PJLA 3ZMUB 5LP6E 3ZC0A 2I1JA 3L09A 3LW5H 4LGDE 4PJNA 1OXZA 1JY3O 3PTRB 1A02J 2A2FX 3ETVA 3VP9A 1LWUB 2X67A 4I55E 4X20E 2A45G 3RYCE 3BVHA 1FOSF 1JO5A 1L0LK 3B13A 1YYCA 1RE3C 4GIFA 3AA7B 1MMNA 2NPSD 3PE0A 4O2BE 1CZQA 4ZKUA 3NZPA 3W15B 2KT9A 3PP5A 3VKHA 1MNEA 2VKDA 1NHLA 2YU2A 3V2RA 3I1AA 1LTJC 3RK3D 4I6MC 2N2NA 2LHRA 4H63H 2KNDA 1JCCA 3MKDA 2M67A 5FXVA 4PJMA 3VU7H 2Y48B 2WSEH 2O1KA 1WRDA 3TK1A 5JDGA 2NW9A 5APSA 1O3XA 1US7B 1JY2P 2E9XC 5LGNB 4G2AA 3RRWA 2OYHB 1ZV8A 4QXCB 2Q9IA 5GONE 5AW3B 5EK2A 3H3AA 2X9HA 1T2KC 2ZM8A 1FOSE 2UXNB 4QXHB 2H7VC 1AFOA 4WY4D 2WMNA 3HKCE 3K8PC 3LK42 3ONXA 1FU1A 3L37A 4XE5B 5HXCA 3KQGA 3VHLA 4CQIA 4WY4B 3VTPC 2JQQA 2OA5A 2Q3IA 2P9BA 3GN5B 4WNKA 5FXWA 3ZCJA 3HTKA 2DNXA 5DABA 1ZR4A 4JF7A 3AAAB 4OH8B 3GMIA 5E0OA 5CB4E 3EFGA 3HKBE 3BATA 2H3RA 4N3YB 2KSJA 3NFQA 3B8EB 3TNUA 1WLXA 2RP4A 5EZYE 2KZ7B 1G2CA 4AYCA 3A7OA 3ZN1B 1JY2N 2QM8A 3TYYA 1MIVA 4O4IE 1N73C 1QSDA 2I59A 1KILD 1H89A 1E5WA 2N1TC 2CM0A 4DBQA 3Q5WA 2FYUK 3B57A 5AW5B 3B5NC 1N2DC 2N1GA 4CXXA 2E9XB 5KJ7D 2A3DA 2OYIC 2CXLA 4PNIA 2YO3A 3IBPA 4ZI3D 2JEEA 1U5PA 2WITA 2IFNA 4JEUB 1JOCA 1H88A 2VASA 4IDZA 4JYCA 4XBFB 3D0TA 1SP4A 2XAQB 2YKQA 2QM7A 2PJQA 2YK0A 1MMAA 4L9IA 3WI3A 3ZMSB 3CPZA 3V2NA 1RE4A 3G3ZA 5BU5A 2CXFA 2JJ9A 3UFEA 5AFUL 5CA0E 3NXSA 3BK9A 1JY3P 4XA4A 3IHRA 4FJOA 3P8MC 3U3IA 1H8AA 3HE4A 3UULA 4X1KE 4YHJA 5JREA 2VB6A 2W00A 3HD7C 2W63A 2MBGA 5AVRB 1CW5A 4C7NA 3L4FA 1HCIA 1RF1C 1SHZC 4IFFA 1LT9C 5LGTB 3T8OA 1SVFA 3KDPB 4UV9B 4C91A 4UF0A 5J2UE 1MZ9A 5AVXB 1RY3A 1X9VA 2EHOD 4M3LA 1JUNA 3CWZB 3I0OA 1MFZA 2NTYA 5DJQC 2POHA 5HXEA 2L5GB 3TSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C46 A;  5AW7 B;  3A3Y B;  4B86 A;  3HE5 B;  4I2L C;  3T97 A;  1S9K E;  1OWA A;  2XZR A;  3V5B A;  3VYI A;  5AVS B;  5AVT B;  1WLX A;  2BAS A;  1CUN A;  1CI6 A;  3SWF A;  3M9H A;  1KQL A;  2WPR A;  1MV8 A;  3L35 A;  5APX A;  1NWQ A;  3UUN A;  1GZL A;  3A2A A;  3FB2 A;  2WWW A;  5AVW B;  2W6A A;  2WTY A;  2YO2 A;  5APV A;  5AW0 B;  2XU6 A;  1DH3 A;  3VMY A;  3TNU B;  3V4W A;  2KP8 A;  3M0A A;  2Z5H A;  1HBW A;  3VN0 A;  4DZO A;  2WPQ A;  5AW6 B;  1OXZ A;  2R32 A;  3LIE A;  5AW4 B;  2ZFC A;  1A02 J;  4RES B;  4GKG A;  2ODU A;  2SPC A;  2VRS A;  1NAF A;  1FOS F;  2Q7C A;  1YYC A;  1FAV A;  3MD0 A;  3PE0 A;  2R5D A;  3UUM A;  4AQR D;  1CZQ A;  1CSB A;  3A5T A;  1CI6 B;  3M06 A;  1GU4 A;  4I6M C;  2E43 A;  5AVZ B;  4HYT B;  5CMZ A;  3L36 A;  3TK1 A;  3I5C A;  2Q5U A;  5APS A;  2IPP A;  2C9L Y;  5APU A;  4GT1 A;  5AW3 B;  2W27 A;  1X8Y A;  1T2K C;  1FOS E;  3P7K A;  3EDV A;  3L37 A;  4XE5 B;  5AVQ B;  3KQG A;  3VTP C;  2Q3I A;  2H7H A;  1GK4 A;  3HTK A;  3VMX A;  2ODV A;  3UIA A;  3OAK A;  3P32 A;  1GU5 A;  3V4Q A;  3NFQ A;  2N9B A;  3B8E B;  3NTN A;  3TNU A;  4C7N B;  3MGN A;  2P7J A;  1HWT C;  2E42 A;  2WPS A;  4AYC A;  2JJL A;  3A7O A;  2P2U A;  2QM8 A;  3TYY A;  5AW8 B;  4LC1 A;  5AVY B;  3HE4 B;  5APT A;  3NMD A;  1H89 A;  1A02 F;  5AW1 B;  5AW5 B;  1HJB A;  4EOT A;  2YNY A;  3M9B A;  1SLQ A;  3LBX A;  1IO4 A;  1QUU A;  5AW2 B;  3VMZ A;  2YO3 A;  2R3C A;  5AVV B;  1U5P A;  2Z5I A;  2WT7 A;  1GK6 A;  3O8Z A;  1H88 A;  1AJ3 A;  3M0D A;  4JYC A;  2WT7 B;  1SP4 A;  2QM7 A;  1S9K D;  1GTW A;  3LBX B;  1GD2 E;  1G2C B;  3IR9 A;  2C9N Y;  5APW A;  3F31 A;  5AVU B;  3NXS A;  3P8M C;  3LID A;  2P67 A;  3HE4 A;  1H8A A;  3UUL A;  5APY A;  2R5B A;  5AW9 B;  4JYB A;  3HE5 A;  3M91 A;  5AVR B;  1HUC A;  5APQ A;  4C7N A;  1S35 A;  2ZXE B;  1HCI A;  4AUW A;  4KHX A;  3KDP B;  1J2J B;  1U4Q A;  5AVX B;  4M3L A;  1JUN A;  1MUU A;  1MFZ A;  1T2K D;  1JNM A;  2XV5 A; 
#chains in the Genus database with same CATH topology
 4TZ4 C;  2BS3 A;  5CHX A;  5AVT B;  4PAG A;  3EWK A;  1FZE A;  4L5G A;  4UVC B;  3L35 A;  2WSC H;  4H44 C;  2YMK A;  1KF6 A;  1SQP J;  3D71 A;  1KYO D;  1T98 A;  5KDM C;  4U3F J;  2AE9 A;  3PUZ F;  1UX5 A;  5FNV E;  3JCF A;  1Y8A A;  1HR0 T;  3FZL B;  3AEG A;  1EDK A;  2LHN A;  2OTK E;  2LM9 A;  1SQX E;  4GKK T;  3UTK A;  4ZOL E;  3LIE A;  1UIX A;  1JY2 O;  2K24 A;  2R6G F;  1HG5 A;  4H0L C;  2XQ7 A;  4OYJ A;  4Z91 A;  3AEF A;  4DR4 T;  3I56 P;  5KX5 E;  1BSN A;  4W7Y A;  3A0B H;  3L8R A;  1EZ3 A;  4GDO A;  1LWU C;  3M06 A;  5FY7 A;  2LJL A;  4AKI A;  4HYT B;  5CMZ A;  1L4A B;  2B9B A;  4UV8 B;  3L36 A;  2X68 A;  5FL0 A;  4IOI H;  2VL8 A;  5APU A;  1SQB J;  2C5K T;  3RPU A;  1GL2 B;  5JDM A;  4CN4 A;  1NGM B;  1EDI A;  2H89 C;  1K05 A;  3RGL A;  3UU6 A;  1LP1 B;  1LTJ A;  2D5U A;  4KBM B;  4EYU A;  5KLV G;  5M4Y A;  2E74 D;  1YQ3 A;  1OED B;  2LSG A;  4H63 V;  2B76 A;  5LHH B;  1DEB A;  1QLE D;  2D2C B;  2BEQ D;  2XND H;  3NTN A;  2HPC B;  2PG8 A;  4UB8 E;  3AE5 A;  5L4H A;  2NW7 A;  1W2B O;  3JAF A;  3M9B A;  1SLQ A;  3CMA P;  1VQP P;  5AW2 B;  5LGU B;  1ZN5 A;  1SQQ D;  2ZMA A;  2N1T B;  2HPJ A;  1Z8U A;  5CBN A;  3WAJ A;  3AEC A;  1UUS A;  2UXC T;  3IR9 A;  3PH0 A;  4UEL A;  2LRL A;  1NTM E;  2H8P D;  3WUT A;  3H1L E;  4GYR A;  3SFE A;  3AE3 C;  1SQB E;  2LSJ A;  1ZR2 A;  4B6X A;  2CPB A;  3V2P A;  3SS1 A;  3SWK A;  1ZXG A;  2EHO A;  3JAE A;  4HN9 A;  4JBZ A;  1L4A C;  2BVM A;  3BCC G;  5APQ A;  4IE0 A;  4KHX A;  4ZEY A;  3EVY A;  2K1A A;  2E9X D;  2JWD A;  3CIR A;  4JI4 T;  1G1I A;  3H1I G;  3PJA J;  2CPS A;  3A3Y B;  1FJK A;  3ZMZ B;  4ANJ A;  4WW0 A;  5LBQ B;  3VYI A;  1R8I A;  1GL2 A;  1G1J A;  2Q6Q A;  3CWB E;  5AQN B;  1NKN A;  2HG5 D;  1KQL A;  2FYZ A;  2V7L A;  3V5U A;  4DR7 T;  2IUB A;  4MBQ A;  5AQH B;  1VQ8 P;  5EK4 A;  2UXD T;  3H3M A;  2X0Y A;  4GK5 E;  1UCU A;  2YO2 A;  4JPZ B;  4KHZ F;  3P8C D;  4Y99 C;  4DT0 A;  4WZX A;  1Y47 A;  3AA0 B;  3CXH H;  5B5E H;  3QC9 A;  2KP8 A;  2LM2 A;  1T8B A;  3H1H G;  5CA1 E;  3AE1 C;  1KNP A;  2WDQ A;  1K04 A;  2XQ6 A;  5LB7 B;  3MXZ A;  2ZFC A;  3OTO T;  2XQ9 A;  2Q7C A;  4YPC A;  2XAJ B;  3WMM 0;  2UUA T;  1KQG B;  3EHZ A;  2E43 A;  2G3A A;  5AVZ B;  2W8Z A;  4IFD K;  2DL1 A;  1LVK A;  5IWA T;  2IPP A;  2BBJ A;  3U78 A;  2R3S A;  2V4H A;  3QWO C;  2O01 J;  4D6T E;  3LK2 B;  1VQ4 P;  4ZXL A;  4H9Q C;  2CCQ A;  1URQ A;  2XQ3 A;  4Z8X A;  3RK2 B;  2M0B A;  3Q3D A;  3MK7 C;  3NVO A;  2WSF H;  3N5L A;  3KXD A;  4U3F G;  1IK9 A;  4Y99 B;  2QSI A;  4C90 A;  2CLY C;  4CN6 A;  3GW6 A;  3H1K E;  4PJ0 H;  1Y9B A;  5HYA A;  5KTB A;  1HJB A;  1NU1 D;  1IO4 A;  1RE3 A;  4GYS A;  5AVV B;  3PU3 A;  1HX1 B;  4EYY R;  3C4W A;  2D9D A;  2CBJ A;  3CQC B;  3PTZ A;  1GD2 E;  2E5V A;  2H88 A;  4DV2 T;  1BCC G;  2NPS C;  2FFD A;  3CL3 D;  2QE7 H;  2CEA A;  2R5B A;  1HNZ T;  1HH0 A;  5L47 A;  2XQ5 A;  1BE3 E;  5ETW A;  2WWU A;  1SQQ E;  1B7T A;  3RIF A;  2KIK A;  4YTP C;  3N9Q A;  5AQQ B;  3FXD A;  1AJY A;  2V7Q J;  1NTM G;  3U59 A;  2LKH A;  3UUX B;  3CI9 A;  2VWA A;  1RQU A;  2V6Y B;  4AQG A;  1SQP D;  1YI2 P;  2QJK B;  1FJP A;  4BWN A;  1W09 A;  5F8P A;  3ONL C;  3H1I E;  5JDF A;  5AQI B;  1XWM A;  3A2A A;  3AE6 A;  3O1J A;  4K0U A;  2WWW A;  2BG9 A;  4QMA A;  2OLT A;  1SFC A;  5JDH A;  4XAX B;  1LGH B;  3KV9 A;  2P58 A;  1PP9 D;  2CWO A;  1OED E;  4IST A;  1HFA A;  1ZME C;  2I6H A;  3EDU A;  4AIU A;  1KFN A;  2BCC G;  3HUS B;  3D6Z A;  4YTN A;  4IGU A;  2VK9 A;  2K48 A;  3RIA A;  3U1A A;  1IFD A;  5KKZ C;  4PK4 A;  3EQ2 A;  4ILA A;  1G73 A;  2CHN A;  1CHU A;  1SE7 A;  2KLQ A;  3R2P A;  3PUG A;  1CSB A;  3P4W A;  1GW3 A;  5M1B A;  4DID B;  2HOD B;  1L4A D;  3LDQ B;  3ZT5 A;  1HGZ A;  4IRE A;  1VQN P;  2CWY A;  5ABG A;  3USS A;  5BU8 B;  3FZM B;  2WAU A;  4JLE A;  3VMA A;  2NW8 A;  1LKX A;  2XQ8 A;  3T1H T;  2LSY A;  2W27 A;  4K3A A;  1KNR A;  3EDV A;  1NU1 K;  1UUR A;  1NAY A;  4DMW A;  3U1C A;  3A0H H;  2XAH B;  5H2F H;  2ZAE B;  4YXW H;  4ZS3 A;  1BGY E;  1KB9 E;  3AVS A;  4P0A A;  4X5T A;  3S4U A;  1EZV G;  1LTB C;  3BQK A;  3ANW B;  3CC4 P;  3KFW X;  1OED C;  3X1D A;  4IDN A;  2YXR B;  2XSB A;  1X22 A;  2NPS A;  2GM4 A;  3FZH B;  2H7O A;  2LT3 A;  4MLK A;  2BEZ F;  1QUU A;  3GF3 A;  4HFB A;  2BCC D;  4DUY T;  3JCU E;  4EDF A;  3RHW A;  1LTI C;  2UXB T;  1AJ3 A;  2V7K A;  3GWH A;  4EOZ B;  2X9Y A;  1S9K D;  2WSC J;  2JRK A;  2C9N Y;  3E1I A;  4KHP T;  4EI2 A;  2XAS B;  3TGU D;  3TLV A;  3BAS A;  1FMW A;  1E2A A;  4QKN A;  4JYB A;  4L0R A;  3M91 A;  3GN5 A;  4DND A;  5LG4 A;  4IDP A;  2BS2 A;  2ZXE B;  3RL0 g;  1IK7 A;  2YU1 A;  4EGW A;  3Q5X A;  3KV6 A;  3IF4 A;  1D0Z A;  1KFM A;  4H9N C;  3AE4 C;  3L74 E;  3EI0 A;  2WPV B;  3LW5 J;  5AVS B;  3C50 A;  5AQF B;  1SA0 E;  2I1K A;  3AEE C;  2WQY A;  3OJA A;  1HS7 A;  1H0T A;  3NRY A;  1HTL C;  3UUN A;  1GZL A;  2BBH A;  1VQ9 P;  4I43 B;  2XNX A;  5L4E A;  1EZV D;  4HGA A;  4GOF A;  3CWB J;  5TIS E;  4COF A;  1M90 Q;  2IFM A;  3O1H A;  3ZT7 A;  4I7Z C;  2ACZ A;  1MKM A;  2B1E A;  4LFB T;  4TT3 H;  4HE8 A;  4YFS A;  4JI0 T;  3H1I J;  3ZC0 A;  3L09 A;  1BE3 J;  4QH1 A;  5LMN T;  3ETV A;  3L39 A;  3Q1M A;  3RYC E;  2RH0 A;  1KB9 H;  1RE3 C;  1WMK A;  2QJP B;  4OWF A;  4O2B E;  5GTI H;  1CZQ A;  3FXE A;  4ZKU A;  1Q81 Q;  3NZP A;  1JNZ A;  3PP5 A;  1NHL A;  1OW8 A;  4UB8 H;  1XNR T;  2UWJ E;  2KND A;  1JCC A;  3MKD A;  2M67 A;  4PJM A;  4LFA T;  4DR5 T;  4YSZ A;  4U3C A;  1O3X A;  3EAB A;  3TLW A;  5LGN B;  4G2A A;  3RRW A;  1PL5 A;  1ZV8 A;  2Q9I A;  5EK2 A;  1FOS E;  3AED C;  2JIW A;  2UXN B;  1AFO A;  4WY4 D;  3VHL A;  2W66 A;  3L37 A;  4CQI A;  4XE5 B;  2XY8 B;  2K37 A;  4ILC A;  3ZCJ A;  5FXW A;  3K1S A;  4B3S T;  3H1J J;  2JP3 A;  4JF7 A;  5C3J A;  4OH8 B;  3GMI A;  5E0O A;  5CB4 E;  3UFG A;  2Y0E A;  3CCU P;  2H3R A;  1UK5 A;  2IYP A;  3TNU A;  3A8Y C;  2KZ7 B;  1NU1 J;  3A7O A;  4HFD A;  1KIL D;  4DBQ A;  1E5W A;  2CM0 A;  3P4P A;  1FDO A;  3B57 A;  4A98 A;  4CXX A;  2E9X B;  5KJ7 D;  2IHR 1;  5AQG B;  2CXL A;  4PNI A;  1SQB G;  2WIT A;  2WS3 A;  2FYN B;  3WI3 A;  2YK0 A;  2QM7 A;  1VQ6 P;  1MMA A;  2CXF A;  5BU5 A;  3TLS A;  4OX9 T;  4F8H A;  3HE4 A;  4X1K E;  4LMK A;  4DV4 T;  2W00 A;  2MBG A;  1SHZ C;  3GMA A;  4QH5 A;  3CXH E;  1SVF A;  5B5E E;  3AEE A;  3M3Z B;  5AVX B;  5CBO A;  4B3M T;  1J1D C;  3VRA A;  2QVA A;  2Q9Q B;  3LSV A;  5CJ5 A;  1SQX D;  1W9R A;  1CUN A;  2IIU A;  1SQP G;  3M65 A;  3EUH A;  2VKH A;  4O2A E;  2QJK C;  1PP9 E;  1LT1 A;  3PV0 F;  3PU8 A;  5GTH E;  5E79 E;  3EAM A;  3VOP A;  3PUR A;  3RC3 A;  1E7P A;  5HEG A;  1M57 D;  3ZKR A;  2O01 N;  1N73 A;  3PJA A;  1MFT A;  3MUD A;  4KX6 A;  2MAW A;  2BG9 E;  1FZC B;  3MD0 A;  3AE1 A;  3HUS C;  3N2G E;  4AQR D;  1EZV I;  1EXI A;  3FHN A;  4FI5 A;  2PP6 A;  3F57 A;  2QA4 P;  3K3N A;  2YIU C;  4IL9 A;  2J59 M;  5HCM A;  2GA1 A;  4LF8 T;  5AQP B;  4X66 T;  2CPT A;  2LSK A;  4OYK A;  2Y0C A;  1Q90 D;  4RKU J;  1H7C A;  2M5A B;  4PFO A;  3VR8 A;  5FY0 A;  3C9I A;  5HXR A;  1TU3 F;  1GK4 A;  2WMM A;  3CQX C;  3JC6 C;  1LTS C;  4CXY A;  3UIA A;  2V7M A;  1PPJ D;  1SQQ J;  4PW8 A;  2E75 C;  1GU5 A;  2Q9Q D;  4HWI B;  5GTI E;  4L75 A;  1URQ C;  5H6Q B;  3CCL P;  3RL0 D;  2M3E A;  5LA6 E;  4X65 T;  1YKE B;  1ZOY A;  2KSE A;  2WDR A;  3UU5 A;  1A02 F;  2ZM2 A;  2K88 A;  4Q25 A;  2YNY A;  2IC6 A;  5ADX L;  2BVL A;  1VL2 A;  3PLN A;  1GQE A;  1ZOY C;  1GK6 A;  1JCD A;  2KYV A;  5KXJ A;  1NTM K;  3AXJ B;  3ANW A;  4TN7 B;  1XZY A;  4JI7 T;  4Z1M H;  5JDL A;  1VF5 B;  3AEA A;  2O3J A;  3KVB A;  2P67 A;  3RH3 A;  5BVZ A;  4GOE A;  3HE5 A;  5KAI E;  1L0N E;  4IDQ A;  1L0V A;  4DV3 T;  2LE8 A;  2OYH C;  3B4S A;  4HTE A;  1U4Q A;  2X66 A;  5FYM A;  3GHG C;  3WUU A;  3T97 A;  3HD7 A;  2XZR A;  3ZC1 A;  4HEA A;  2YDS A;  5LOV E;  5CCG A;  2BAS A;  2VQF T;  2KK7 A;  1N7S D;  4BRY A;  4W7Z A;  3L71 J;  1Y64 B;  1L0N G;  2ZT9 C;  5CJ4 A;  1FIO A;  3H1I D;  4R4L A;  1HF8 A;  2XQ4 A;  1MMD A;  2X9W A;  4TV9 E;  4IHJ E;  1SQP E;  5LBM A;  3AE8 C;  4HKA A;  3KBU A;  5KJ7 C;  1S3J A;  2L8K A;  5L2L A;  3H1K G;  1D1A A;  1D0Y A;  3KIN B;  5ABF A;  2WPQ A;  5AW6 B;  1KYO H;  3RBZ A;  4PFP A;  1I6Z A;  4YXD C;  1NO4 A;  4ERR A;  4UB6 H;  1NAF A;  2WMO A;  4O9B A;  4GOD A;  2D2C C;  2IYO A;  3RF1 A;  2XAG B;  3I55 P;  3MA9 A;  3A5T A;  4CXW A;  1IBK T;  2MJZ A;  1FEW A;  4DUZ T;  2M8R A;  4EEB A;  4ILU A;  3LG7 A;  3KPE A;  3C4X A;  3E0Z A;  1Y01 A;  3GHG B;  1IFM A;  2I8D A;  3N4X A;  1L0N D;  4JI6 T;  2BKN A;  1PGQ A;  3TGU J;  4UR9 A;  2ZM6 T;  3RK3 B;  4I0U A;  4DR6 T;  2NP9 A;  3PUX F;  1VQK P;  2N9B A;  2KB7 P;  3MGN A;  3ZYL A;  5L3E B;  3L72 D;  4TV8 E;  5H6R B;  5HCJ A;  4LC1 A;  5AVY B;  2WZI A;  1FBM A;  1MIW A;  3Q5D A;  2FFD C;  5JRC A;  5CJ0 A;  2ZJS E;  4A97 A;  1SQX K;  3RYI E;  4DV6 T;  1FDI A;  1W2E A;  3L3P A;  1M1J B;  3OKQ A;  1FZB A;  1OIP A;  2DW3 A;  1IFN A;  3RQU A;  4BJM A;  2J47 A;  2B89 A;  2C5J A;  4ISS A;  1NWM X;  1OMI A;  5APW A;  2BDE A;  3HR0 A;  3VKG A;  2KLU A;  1UGO A;  3AED A;  2KOG A;  1JEK A;  5KJ7 A;  5AW9 B;  2XHE B;  3H6P A;  4ZNC A;  3Q2Y A;  3AB3 B;  3ABV A;  4PK5 A;  4NPD A;  1SQQ K;  2E5T A;  4ASV A;  1BR0 A;  4PV1 D;  2QRX A;  2G0U A;  2WQY C;  1SQV D;  2PBI A;  3I9Y A;  2JMK A;  3TF5 A;  4U3F D;  1D1C A;  3CX8 B;  4V1A v;  4UB6 E;  2KWH A;  2MTQ A;  3HI2 A;  3FBZ A;  5CCH C;  3CCM P;  3CC2 P;  3UU8 A;  3RGU A;  2Q9Q C;  3RKO A;  4H9P C;  4DOJ A;  1FZC A;  2V1D B;  1T72 A;  3AE9 A;  5ABH A;  2V26 A;  4CI1 B;  1XNQ T;  3AAE B;  3CKD A;  5ABF B;  1USD A;  3MZK B;  1T3U A;  4O4L E;  3II6 A;  1KEY A;  3UU3 A;  4DR2 T;  1WR6 A;  1NKZ B;  2HFE D;  1VF5 D;  1S5L E;  4B3R T;  2FYN C;  1N8R Q;  2JO1 A;  2HYN A;  3ZYM A;  4DO0 A;  1IBL T;  3CXH D;  5KLI C;  2C5I T;  5ABE A;  5LG3 A;  2X51 A;  2OYI B;  5FL1 A;  2M5A A;  2Y6X A;  4ZS2 A;  5TIS H;  2M6B A;  1M56 D;  2XKM A;  2KSR A;  2BS4 A;  1KIL B;  2C9L Y;  1P84 E;  1NH4 A;  3L71 D;  3MIW A;  4F6R C;  3I0Q A;  1KK7 A;  3JAD A;  2V5D A;  4JEH B;  3SOL A;  5AVQ B;  2L9Q A;  4IIJ E;  2QYW A;  2IBZ D;  3AA6 B;  3OBV E;  2K3W A;  2CBI A;  2MOZ A;  2ODV A;  3FXE B;  2HLO A;  1VQL P;  1T6A A;  3P4S A;  3D70 A;  3ZYK A;  1D1B A;  3SWH A;  1NTZ K;  3N9M A;  2D0U A;  2JJL A;  3FWN A;  5DQW A;  3TGU E;  4U72 A;  4OHF A;  3HE4 B;  2V8S V;  4HWH A;  3P50 A;  1LTA C;  1AV1 A;  2A45 I;  4CI3 B;  4EB6 E;  2RA1 A;  3VMZ A;  3UUB A;  4CI2 B;  2CLY B;  2HH7 A;  1N7L A;  4U31 A;  4B3T T;  4NPE A;  2V5C A;  4AQF C;  1LT9 B;  3NZQ A;  3L71 G;  5HXS A;  4MHC A;  1V9D A;  2K5B B;  5AQM B;  1S35 A;  2JWA A;  4N6J A;  5FP3 A;  1ZP0 C;  1KD1 Q;  2VKO A;  5HWX A;  2DLR A;  2IX7 C;  2KXP B;  5HEU A;  1JNM A;  2XV5 A;  3TGU G;  2ACX A;  1S9K E;  3B5M A;  1L4A A;  3V5B A;  2WSE J;  1IJ6 A;  5BR8 T;  4P0B A;  2FBW C;  3GLM A;  2KS1 B;  2JMH A;  1LTT C;  1YIJ P;  2QJY B;  2E75 D;  2NWB A;  4OFZ A;  5FXZ A;  1S72 P;  2E75 B;  2WZ7 A;  2JPF A;  2OV9 A;  2WTY A;  3L72 J;  1IC2 A;  3L74 J;  2OYI A;  3RIU A;  1MIY A;  3N7N A;  3CWB G;  2IC9 A;  3QK6 A;  3N9P A;  2AEM A;  5AQL B;  1K73 Q;  1P84 H;  3QNU A;  4P09 A;  4AKH A;  3J7Y q;  2CHO A;  2NOX A;  4H9S E;  1AVO A;  1S5L X;  1L0L G;  1OZH A;  1JY3 O;  3PTR B;  1OW7 A;  3NKZ A;  2X67 A;  2LLY A;  1FOS F;  1JO5 A;  1L0L K;  4GIF A;  2IBZ I;  3PE0 A;  1N33 T;  3W15 B;  2VKD A;  1Q86 Q;  5KKZ B;  3OVU A;  1LTJ C;  3RK3 D;  5LMU T;  2W90 A;  2KI7 B;  2Y48 B;  1NTZ D;  2O1K A;  1WRD A;  3BCC J;  1US7 B;  1JY2 P;  2OYH B;  5AW3 B;  2X9H A;  2ZM8 A;  4QXH B;  3HKC E;  5HXC A;  2PTF A;  2P9B A;  1KYO E;  3GN5 B;  1PPJ G;  5DAB A;  1ZR4 A;  2L91 A;  3AAA B;  3H1J G;  1RQV A;  3H1L D;  1KN7 A;  2QM8 A;  1OVU A;  3TYY A;  1DIP A;  2ITA A;  1QSD A;  3UQ4 A;  2I59 A;  4JI2 T;  2WVR A;  5AW5 B;  4OGQ B;  2JQK A;  4YHH T;  1N2D C;  3IA3 A;  1H0T B;  1PPJ E;  3IBP A;  2JEE A;  1PGP A;  4JEU B;  2YDR A;  4IDZ A;  1SP4 A;  2XAQ B;  2YKQ A;  2PJQ A;  1AQT A;  2UUC T;  5B66 H;  3ZMS B;  3V2N A;  5KLV J;  3G3Z A;  4LF6 T;  1ZW0 A;  3BK9 A;  4YT0 A;  2YOE A;  1QVF O;  2VB6 A;  3Q5P A;  3L4F A;  1RF1 C;  2W6J H;  5AQV B;  4IFF A;  5LGT B;  1NTZ G;  3T8O A;  4UV9 B;  3KDP B;  1MZ9 A;  1NTZ J;  1RY3 A;  1X9V A;  4TWF A;  1MFZ A;  5KLV E;  2NTY A;  5DJQ C;  1DEE G;  4KT0 J;  4DV1 T;  1LJ2 A;  4X64 T;  1J1E C;  1SFC C;  3H37 A;  1SQV K;  1LT9 A;  3RL0 B;  1VCT A;  1Q7Y Q;  1Z0P A;  2KMF A;  4U74 A;  2K9Y A;  2YIU B;  1GMJ A;  1NTK G;  1VOM A;  3F5H A;  3JSV C;  3FWL A;  4W80 A;  5JDQ A;  2YXQ B;  2H43 A;  4X1Y E;  2N1T D;  1BGY D;  1QLB A;  3HUS A;  1S94 A;  2A72 A;  1AQ5 A;  2WM9 A;  3QOF A;  2OTJ P;  3SWY A;  1WYC A;  3R4Y A;  1VQM P;  3A0H E;  3ABV C;  2AXD S;  3C51 A;  3HKD E;  3C98 B;  1I94 T;  4U7Y A;  3UUM A;  2R5D A;  2J58 A;  2X9X A;  3ZMV B;  5C2T A;  3H1L J;  1XTC C;  3L73 E;  1WT6 A;  1IFI A;  3O4X E;  2A45 H;  3H1L G;  3HD7 D;  4EIJ A;  1RHZ B;  3AEB C;  1RF1 B;  4AQF A;  5GTH H;  3RYH E;  3H1K D;  2A06 G;  2DWG A;  1M8O B;  4X1I E;  3ZJ1 A;  3E08 A;  2W4X A;  3L73 D;  4I1L A;  2PFV A;  1T8Z A;  1JMB A;  3OAK A;  5CCH D;  4H0L B;  4XFJ A;  3NBX X;  3CVR A;  2CXD A;  2P7J A;  1SQQ G;  1NTK D;  5JVD E;  5JQG E;  2CE7 A;  4O8S A;  4UEM A;  2H88 C;  2ZVO B;  4ASW A;  1M1J A;  3NMD A;  5DQV A;  3CLQ A;  1EZV E;  2W2U A;  1N36 T;  4QH4 A;  4QWN B;  2KNC A;  4QX8 B;  5F3J A;  2V6Y A;  4ZI7 E;  5LJM A;  1VCS A;  3L72 E;  1GTW A;  3LBX B;  3ZMT B;  3J9X 1;  2FXP A;  1P84 I;  4GIW A;  5APY A;  5KLI B;  2Y8D A;  2LXB A;  1IBM T;  1L2P A;  2RKL A;  5CCG C;  1X79 B;  3P7I A;  3AVR A;  2IBZ E;  5LYJ E;  1MUU A;  1NTM D;  1HGV A;  3L70 E;  2K3R A;  1T2K D;  2QGS A;  4NUV A;  3C1L A;  4WY4 C;  5AW7 B;  4I2L C;  3L75 D;  4KUM B;  4I50 E;  4J2C A;  1KV4 A;  1FZC C;  4DCK A;  3JCU H;  4E7S A;  4JI5 T;  2V6X A;  3N9N A;  4H13 B;  2WPR A;  4A56 A;  3CPW O;  2AXT H;  3NWI A;  3E22 E;  3BCC E;  1HF9 A;  4H9O C;  4XZC A;  4AKG A;  3FB2 A;  2LOP A;  5J0Z A;  2E76 B;  5AW0 B;  1HVV A;  1YHQ P;  4U3F E;  3RC8 A;  2J62 A;  5JR9 A;  3RKG A;  3CWB D;  1NTK E;  3IFM A;  4ZHQ E;  2YKP A;  5C39 A;  2ODU A;  2SPC A;  4BAY B;  2XSA A;  4LML A;  1QL2 A;  2N9Y B;  1U7M A;  2E74 B;  2FJA A;  3BRT B;  1URQ B;  1DX7 A;  4HFI A;  4TNW A;  3FBL A;  1YBK A;  1GU4 A;  4U7I A;  4NPP A;  2W83 C;  4YTP A;  1SQV J;  2FBW A;  1K9M Q;  4PJ0 E;  1EDJ A;  3ZEF B;  2QG4 A;  1T7S A;  3IEE A;  1L0N K;  1BR1 A;  5E79 H;  2LKG A;  3OA7 A;  2EHO C;  3MJX A;  4GT1 A;  4X62 T;  3OYZ A;  2OTL P;  1RF1 A;  2K9J A;  2YIN A;  5AQK B;  2H7H A;  1SFC D;  3N9O A;  3ZLI A;  4ZI3 D;  1QEX A;  4WB4 A;  4IE5 A;  1YTZ I;  2GUV A;  3M9Q A;  3L75 E;  3WU2 H;  4TX5 A;  3R6N A;  2AEF A;  3H1J D;  3SFD C;  2IDO B;  4EXT A;  4ADZ A;  3PUY F;  3ZJ2 A;  2K9A A;  2V7J A;  2M6I A;  5AW1 B;  2O01 H;  5FXX A;  1N7S A;  4BRY B;  4TUY E;  5HXH A;  2HPL A;  1M7K A;  4ASK A;  3O8Z A;  2Y9Y A;  1QVG O;  1KMI Z;  3RX6 A;  3HD7 B;  1VQ5 P;  5FVL A;  4JV5 T;  1XMO T;  3CCQ P;  2QEX P;  5EFW B;  4U7J A;  2RN0 A;  3CME P;  3I9W A;  4AKL A;  1JB0 J;  1LTJ B;  3F2E A;  2EHO B;  1FJG T;  1DD4 A;  5JH7 E;  2XTL A;  1BSH A;  4IE6 A;  4WBN E;  3ESL A;  1YJN P;  1E1H B;  5HEO A;  2UU9 T;  2C0S A;  1OWA A;  3O6Q B;  3AXJ A;  4LF4 T;  2CK3 H;  3P4R A;  3RIU C;  1CI6 A;  4LMJ A;  2D0T A;  2PGD A;  2KZJ A;  1MV8 A;  4U33 A;  4ZI3 C;  4TLF A;  4YJ2 E;  1SQV G;  3KYQ A;  1URQ D;  1W0A A;  1WFD A;  3H32 A;  2A06 D;  4AIS A;  4WBA A;  2E8I A;  4HWC A;  4YLH A;  2BCC J;  3A5X A;  3LK3 B;  1QL1 A;  2Q1K A;  4DMV A;  1WRG A;  3F89 A;  5AQR B;  4DZO A;  3H1H D;  3PJS K;  2R32 A;  2WZH A;  2K9J B;  4OGQ D;  1SUM B;  3A7M A;  1GW4 A;  4DBR A;  3ZCI A;  1S1C X;  1NTK J;  4UIG A;  2OAR A;  4TNV A;  2Y0D A;  3P8C E;  2WP9 A;  1FE6 A;  1S4X A;  2Y9Z A;  3DJB A;  2KUB A;  3I5C A;  3L73 J;  1HX8 A;  2FJE A;  3MAC A;  1SQP K;  3L73 G;  1EC5 A;  5DJT B;  3HA4 A;  3P7K A;  4K35 A;  2ES0 A;  2XQA A;  3KHU A;  1BE3 D;  3N9L A;  4M1P A;  1J1E B;  2UUB T;  1IFP A;  4L76 A;  1ZRT D;  3K3Q C;  1N7S C;  2WWV A;  1NTZ E;  4U2Z A;  1R5S A;  2BCC E;  3VR9 A;  5JR9 C;  4EED A;  3Q2M A;  1N32 T;  1HJ0 A;  4NIQ A;  4AI6 A;  3KZI H;  5AW8 B;  4P1N A;  2W0G A;  4AXP A;  4R4M A;  1PV3 A;  3PUQ A;  5APT A;  5LCY A;  3GF7 A;  3D6Y A;  5J1G A;  2B87 A;  3H1K J;  5IHY A;  4PV1 B;  3AA1 B;  1RF0 C;  4JBW F;  2R3C A;  1KB9 D;  2Q3E A;  3M0D A;  2WT7 B;  1EDL A;  2XJ7 A;  3G71 P;  3VRB A;  1SQB K;  1G2C B;  2E9X A;  2MYS A;  5H2F E;  2LKM A;  2YEV C;  4PK6 A;  4HFC A;  5FMN A;  2VKJ A;  3PRJ A;  3RBX A;  3LID A;  3VP8 A;  4ZZC A;  1VDF A;  3RYF E;  2LEH A;  4HJG H;  1HUC A;  4WBO A;  4C7R A;  3AE3 A;  5TAO A;  3L75 G;  5AQO B;  1FDM A;  3HTK B;  1M62 A;  1LVF A;  2DCF A;  1FZF A;  2VVN A;  3AAI A;  4UF0 B;  2N9D A;  2IBZ G;  1USE A;  1G8X A;  2LOS A;  3V5S A;  1WCR A;  1KIL A;  2O1J A;  3QH9 A;  2FYU G;  3ZDM A;  4E7Z A;  1WYB A;  5C8Y E;  3IN6 A;  5AVW B;  4U2Y A;  2FYU J;  4HH2 A;  5APV A;  2XU6 A;  3PUA A;  3V2Q A;  1KIL C;  1DH3 A;  1N73 B;  2KLV A;  3CCJ P;  4ILB A;  3DP7 A;  1UX4 A;  2WSF J;  4PJL A;  4NXN T;  3LW5 H;  3CCE P;  3V6I A;  1OXZ A;  3CX5 E;  1A02 J;  2A2F X;  1LWU B;  4I55 E;  4QHO A;  2F4V T;  2J4G A;  3AA7 B;  1MMN A;  2NPS D;  1L0L D;  2WB5 A;  2KZI A;  1MNE A;  3VKH A;  3I1A A;  4H63 H;  3V2R A;  4L9I A;  2N2N A;  3G9R A;  4I6M C;  2LHR A;  3SSU A;  2FUP A;  5FXV A;  3VU7 H;  2WSE H;  1AVY A;  2ZXX A;  5APS A;  2E9X C;  3SFE C;  5GON E;  3EFF K;  3H3A A;  5AFU L;  3ITK A;  2H7V C;  2WMN A;  3K8P C;  3ONX A;  1EXJ A;  4WWI A;  2HN1 A;  4WY4 B;  3VTP C;  2Q3I A;  3HTK A;  1SS1 A;  3BAT A;  3L70 J;  4N3Y B;  4H44 D;  2KSJ A;  3NFQ A;  3AE4 A;  5EZY E;  3L70 G;  4AYC A;  1G2C A;  4RO0 A;  2I0M A;  1OX3 A;  1JY2 N;  1MIV A;  1N73 C;  2WY2 A;  4IDO A;  2E76 C;  2N1T C;  3MHV A;  2FYU K;  3AEA C;  3K5B A;  1XDO A;  3FZF B;  1FC2 C;  2JR8 A;  1NEN A;  2YO3 A;  4LF9 T;  5CGM A;  3OW2 O;  4ZZB A;  2IFN A;  1JOC A;  1H88 A;  2IML A;  5HEJ A;  4XBF B;  3D0T A;  2ZT9 B;  1VQO P;  2B87 B;  1KIL E;  2JJ9 A;  3UFE A;  2ZVN B;  5CA0 E;  4FJO A;  1JY3 P;  3P8M C;  1H8A A;  3UUL A;  5JRE A;  2FYU D;  1SQB D;  3HD7 C;  1J5W A;  4DJG A;  2LR2 A;  2JQH A;  4C7N A;  1HCI A;  2PRR A;  1LT9 C;  4C91 A;  2LXC B;  1YJ9 P;  4IL6 X;  3CWZ B;  3I0O A;  5HXE A;  2POH A;  1N34 T;  2L5G B;  2V7I A;  5LNK A;  3TSI A;  1R5L A;  2XPK A;  4JI1 T;  1SQV E;  3ETU A;  4IFM A;  5EK3 A;  2W6B A;  5HEH A;  3Q5S A;  3M9H A;  2WSS V;  3TDK A;  1ZV4 X;  1PGO A;  2A06 E;  3BQL A;  1KQF B;  2IW5 B;  1T3J A;  2PFX A;  4NUU A;  1RF0 A;  3TLT A;  1HTJ F;  4H9R C;  4EV6 A;  1JNR A;  3VMY A;  2DI4 A;  4G63 A;  2DHR A;  3TNU B;  5JRC B;  4EZH A;  2BG9 C;  3PUS A;  2X0L B;  3JC2 2;  3M0A A;  3RLF F;  2CA5 A;  1WR0 A;  2MKV A;  2XM2 A;  4KI0 F;  1S2E A;  2LSI A;  4ZMD A;  3ZT6 A;  1FAV A;  3AEG C;  3RK2 D;  3IF8 B;  3O1I A;  1FZA A;  2OYO A;  1CI6 B;  4D6T G;  2E5L T;  2Z4E A;  5CCG D;  3PDY A;  4D6T J;  2HOD A;  1VQ7 P;  2GUS A;  1GL2 D;  1X9B A;  2A9U A;  3AEF C;  1KZU B;  2XUE A;  4WYV A;  3H1H J;  4I7Z B;  3O9X A;  2G8Y A;  1LWU A;  1S5L H;  4GK0 E;  3SFD A;  3VMX A;  1FS0 E;  2NR4 A;  2IZ0 A;  1PIX A;  1L0L E;  3L72 G;  3V4Q A;  1JTH B;  3AE8 A;  1IAP A;  1HWT C;  1U57 A;  2E42 A;  2P1J A;  2VL0 A;  3QB5 A;  4LF5 T;  4LFC T;  2XQY A;  2QJP C;  4IL6 H;  3H1H E;  4ZKP A;  2BG9 B;  3RRC A;  1BGY G;  5L3B B;  1D7M A;  4DV7 T;  2NPS B;  3CCS P;  3AE6 C;  3BRV B;  3H32 B;  3ZN0 B;  1SFC B;  1BDD A;  3HL6 A;  1KOR A;  1R8E A;  2W61 A;  3MP7 B;  4OGQ C;  4YY3 T;  3AEB A;  2E5Y A;  4Z90 A;  2ZM0 A;  4DVD A;  3FXD B;  2AXT E;  3C64 A;  4MFR A;  1FZG A;  1IJ5 A;  3RK2 C;  2NRG A;  4OK0 A;  3CX5 I;  4HFE A;  1DU2 A;  1DD3 A;  4DR1 T;  3T97 B;  2VQE T;  3N2K E;  3L74 G;  1NOH A;  1KC8 Q;  4AUW A;  1YKH B;  3BQI A;  3G06 A;  3UT5 E;  1J2J B;  1J5E T;  3CQG B;  4IE7 A;  5LHG B;  5BMV E;  4A5X A;  4MN4 C;  2P10 A;  3FX0 A;  3PUV F;  3UU4 A;  3WAK A;  3HE5 B;  3GG2 A;  4A7P A;  3JC6 D;  1NYH A;  4BJN A;  3SWF A;  4YJ3 E;  3C8V A;  3A0B E;  5APX A;  1N7S B;  2AEJ A;  4Y28 J;  5DJU B;  4I4T E;  3M0D C;  3NRX A;  3MZW B;  1UII A;  1YTZ T;  4YTM A;  4LLH A;  3RL0 C;  4TWH A;  1PP9 J;  2E76 D;  5KAI H;  3L75 J;  3B5N B;  2BKO A;  3V4W A;  4JI3 T;  2X0H A;  2OQQ A;  2Z5H A;  4H13 D;  4BXL A;  4QX7 B;  2VVS A;  3UQ7 A;  1VRB A;  5AW4 B;  1Q2N A;  4RES B;  4QXB B;  4GKG A;  5IUX A;  5L3C B;  1BCC D;  3AE2 A;  1J1D B;  3CD6 P;  3B5N A;  3GHG A;  3ZPO A;  3S9O A;  3G6E P;  2XAF B;  1NJI Q;  3FGA D;  3AE2 C;  3O6Q A;  5HWY A;  4NXM T;  3L74 D;  1SQX G;  2YMY A;  1BCC E;  2KIN B;  3KVA A;  1BE3 G;  3CK6 A;  1X8Y A;  1JM0 A;  1YQ4 A;  5AQU B;  3S4R A;  1RH5 B;  2Q9Q A;  3QUJ A;  5KMG P;  5B66 E;  4DR3 T;  2ZLY A;  2BKP A;  3PHL A;  4DV5 T;  5KLV D;  2J1D G;  3TKL B;  3P32 A;  2BZB A;  1ZEE A;  2E2A A;  4C7N B;  1M1K Q;  1XTG B;  2WPS A;  2W62 A;  2YKO A;  1GDT A;  4K0K T;  5L3G B;  3KV4 A;  1M7L A;  3H25 A;  3AE7 A;  3CXH I;  1ZRT E;  2HHH T;  3LBX A;  3E1R A;  1VPC A;  1AA0 A;  3LFM A;  1KYO I;  2XDJ A;  1MMG A;  4IE4 A;  5L3F B;  5FY1 A;  2C0X A;  4CPG A;  3CCV P;  2KWI B;  4IT4 A;  3TLU A;  2IDB A;  3F31 A;  1JTH A;  2D2C D;  1XMQ T;  4JYA T;  5AVU B;  2D2S A;  1BCC J;  1J1J A;  3DTO A;  4PD4 E;  4TWD A;  1LTG C;  3HKE E;  4HFH A;  5LJN A;  1YD8 G;  4N78 E;  1IJD B;  4PD4 I;  4GKJ T;  1Q82 Q;  2RPA A;  1PFI A;  2B88 A;  3BCC D;  1EQ7 A;  5HAX A;  1GL2 C;  2QA7 A;  3ONJ A;  1OW6 A;  2FFD B;  1NTM J;  1D0X A;  4C46 A;  3FZK B;  2WBL A;  4EYY Q;  1HG2 A;  5KLV K;  4KMC A;  2M3B A;  4ZI2 C;  1M1J C;  2N1T A;  4O4H E;  4N78 D;  2E74 C;  2MPK A;  2LRK A;  2OYH A;  1YW0 A;  3CX6 B;  3T1Y T;  2CRB A;  1NWQ A;  4GOU A;  2WCA A;  1U7J A;  1YQ4 C;  2W6A A;  2XZE A;  2PAJ A;  1X0T A;  3CX7 B;  1MND A;  3OYX A;  4NPF X;  2SPZ A;  5KAF H;  1KB9 I;  4IL4 A;  1HBW A;  1OED A;  3IAO A;  3VN0 A;  2YKS A;  5JR9 B;  5CFB A;  3SRZ A;  4UVA B;  1ZLL A;  2HPC A;  2VRS A;  1HNX T;  3W67 A;  2WU5 A;  4HWD A;  5L3D B;  4D6T D;  3QB5 K;  3HRN A;  4UVB B;  3GA8 A;  3MUD C;  1LRZ A;  1LP1 A;  2L3L A;  1OFC X;  5AQJ B;  5TJH A;  2DWK A;  5CCH A;  2RMZ A;  2NZ2 A;  2ZYA A;  3OJA B;  1IFJ A;  3R84 B;  4PD4 D;  2KS1 A;  3E7K A;  2J5U A;  2ZYG A;  3H1J E;  2Z6E A;  4PJJ A;  2JQ9 A;  2YN6 A;  2IAK A;  3CML A;  5F5W A;  1W5C E;  5A1L A;  4DV0 T;  3N2O A;  3CX5 H;  1KTM A;  1NU1 E;  3AE7 C;  4OVN F;  1N86 A;  3KDS E;  2C0W A;  2FJB A;  2HR3 A;  1ZP0 A;  1BDC A;  3K3O A;  1P84 D;  1K8A Q;  1QGK B;  2P2U A;  1BR4 A;  4CZZ B;  3C4Z A;  1Z56 A;  1NTK K;  5IYZ E;  4JUY A;  5J2T E;  4EOT A;  5AQS B;  1YJW P;  3S1K A;  2FXM A;  3Q5R A;  2Z5I A;  1NVO A;  3B71 A;  2WT7 A;  3RI5 A;  3ZSS A;  5LXT E;  3KV5 A;  4EIW A;  1ZHC A;  1QX8 A;  4O4J E;  2VUR A;  4EZ4 A;  1PGJ A;  5FVK A;  1JMM A;  1OVR A;  3WU2 E;  3PUW F;  1X79 A;  1L0N J;  2OGU A;  3RK3 C;  3WUV A;  2V7Q H;  3OPC A;  4WY4 A;  1HNW T;  4AKR B;  1SQX J;  4EAH A;  2UXX B;  2YDQ A;  3LJC A;  1PP9 G;  5JDN A;  1YQ3 C;  2QIW A;  2Q5U A;  3KBT A;  1FMV A;  4B86 A;  4MAL A;  4UXN B;  4HFV A;  2KNC B;  2GK9 A;  1IZN B;  3L71 E;  3MTU E;  1BR2 A;  5K5G B;  2FY8 A;  2H89 A;  3Q9D A;  1NEK A;  1KFY A;  5LHI B;  4BA9 A;  2FKW B;  2CMR A;  5JTG A;  1JY3 N;  1ZKE A;  1KNZ A;  2HN2 A;  4LF7 T;  2NTX A;  1RE4 C;  4KP3 C;  4RJT A;  4KJM A;  2IZ1 A;  3AEC C;  1L0L J;  3B5N D;  4L73 A;  3ZMU B;  5LP6 E;  2I1J A;  4LGD E;  4PJN A;  3AE5 C;  4JQ0 D;  3AE9 C;  3VP9 A;  2W67 A;  4X20 E;  2A45 G;  3BVH A;  3B13 A;  3RQW A;  1PZQ A;  1YYC A;  4CN1 A;  2QJY C;  2KT9 A;  3KZI E;  2YU2 A;  3TK1 A;  5JDG A;  2NW9 A;  4PV1 C;  3W68 A;  4QXC B;  2JDI H;  1XDP A;  3CC7 P;  1T2K C;  4UF0 A;  3CX5 D;  4YSY A;  4HKZ H;  3LK4 2;  4AQY T;  1FU1 A;  4HB1 A;  2AXC A;  3KQG A;  3CCR P;  4L74 A;  2OA5 A;  2JQQ A;  4ZI2 D;  4WNK A;  3RK3 E;  1KQS O;  2DNX A;  2WU2 A;  2ZYD A;  1OVV A;  3EFG A;  3HKB E;  3ZST A;  4PD4 H;  2XM1 A;  4JI8 T;  5FKY A;  1WLX A;  3B8E B;  2RP4 A;  2ZT9 D;  1LNQ A;  4H44 B;  3ZN1 B;  2FXO A;  2R44 A;  2FYU E;  2FJD A;  4O4I E;  1NU1 G;  4YSX A;  1H89 A;  1YIT P;  2WSS H;  3Q5W A;  3B5N C;  2N1G A;  2JKV A;  2A3D A;  2OYI C;  4H13 C;  1VF5 C;  1U5P A;  3L70 D;  1W0B A;  2VAS A;  4JYC A;  3CPZ A;  4H0L D;  1RE4 A;  3NXS A;  4XA4 A;  3IHR A;  1YXR A;  3U3I A;  1E79 H;  4YHJ A;  4WVZ A;  4HWF A;  2W63 A;  5AVR B;  1CW5 A;  4YXD A;  3Q5E A;  5KAF E;  4IL6 E;  3P4Q A;  5J2U E;  3G4S P;  2EHO D;  4M3L A;  1JUN A;  1BGY J;  2WDV A;  5L8R J;  5AQT B; 
#chains in the Genus database with same CATH homology
 4TZ4 C;  2Q9Q B;  3ETU A;  1J1E C;  4IFM A;  5CHX A;  5AVT B;  4PAG A;  1SFC C;  5EK3 A;  3H37 A;  1FZE A;  2W6B A;  1CUN A;  1SQV K;  1LT9 A;  3M9H A;  3RL0 B;  4L5G A;  2WSS V;  1Z0P A;  4UVC B;  3L35 A;  2KMF A;  4U74 A;  2WSC H;  1ZV4 X;  3M65 A;  3EUH A;  2VKH A;  1VOM A;  3BQL A;  4O2A E;  2IW5 B;  1T3J A;  4NUU A;  1T98 A;  1RF0 A;  5KDM C;  4W80 A;  5JDQ A;  2H43 A;  3PU8 A;  1UX5 A;  5FNV E;  1HTJ F;  4H9R C;  4X1Y E;  2N1T D;  3VMY A;  2DI4 A;  3HUS A;  1S94 A;  2A72 A;  3TNU B;  2DHR A;  2LHN A;  3VOP A;  4G63 A;  4EZH A;  5JRC B;  3PUS A;  3PUR A;  2X0L B;  3RC3 A;  3M0A A;  1AQ5 A;  2CA5 A;  2WM9 A;  2LM9 A;  3SWY A;  1N73 A;  1WYC A;  3UTK A;  3MUD A;  3LIE A;  4ZOL E;  4IE5 A;  1JY2 O;  2K24 A;  3C51 A;  3HKD E;  3C98 B;  1HG5 A;  1FZC B;  2LSI A;  1FAV A;  3MD0 A;  3UUM A;  2R5D A;  3HUS C;  2J58 A;  3RK2 D;  3N2G E;  4AQR D;  2X9X A;  3IF8 B;  3FHN A;  4OYJ A;  3ZMV B;  5KX5 E;  3O1I A;  1FZA A;  4W7Y A;  1XTC C;  1WT6 A;  4FI5 A;  1IFI A;  2PP6 A;  1CI6 B;  1LWU C;  2A45 H;  3HD7 D;  3M06 A;  4EIJ A;  1EZ3 A;  2LJL A;  1RF1 B;  3F57 A;  4AKI A;  2Z4E A;  4HYT B;  5CMZ A;  1L4A B;  5CCG D;  5FY7 A;  4AQF A;  3WAJ A;  3PDY A;  3K3N A;  4UV8 B;  2HOD A;  3L36 A;  2X68 A;  3RYH E;  2GUS A;  2J59 M;  1GL2 D;  2VL8 A;  5APU A;  2C5K T;  2LSK A;  4OYK A;  3RPU A;  1GL2 B;  2DWG A;  3ZJ1 A;  4X1I E;  5JDM A;  1KZU B;  1H7C A;  2XUE A;  3E08 A;  3O9X A;  4PFO A;  1LWU A;  4EYU A;  1LTJ A;  4I1L A;  2D5U A;  2PFV A;  1T8Z A;  3C9I A;  4GK0 E;  4KBM B;  5FY0 A;  5HXR A;  1GK4 A;  3CQX C;  3JC6 C;  5M4Y A;  1LTS C;  4CXY A;  3VMX A;  3UIA A;  2LSG A;  4H63 V;  3OAK A;  2V7M A;  5LHH B;  5CCH D;  1DEB A;  4PW8 A;  3NBX X;  1GU5 A;  3V4Q A;  2Q9Q D;  1JTH B;  1IAP A;  3CVR A;  3NTN A;  2HPC B;  2CXD A;  2P7J A;  1HWT C;  2PG8 A;  2E42 A;  2P1J A;  5JVD E;  5JQG E;  1URQ C;  2CE7 A;  4O8S A;  5H6Q B;  4UEM A;  3RL0 D;  2XQY A;  5LA6 E;  1YKE B;  1M1J A;  3NMD A;  4ZKP A;  5DQV A;  3RRC A;  1A02 F;  2NW7 A;  2ZM2 A;  3CLQ A;  5L3B B;  2YNY A;  3M9B A;  1SLQ A;  2IC6 A;  5ADX L;  2BVL A;  5AW2 B;  2NPS B;  4QWN B;  5LGU B;  1ZN5 A;  3BRV B;  3H32 B;  4QX8 B;  2ZMA A;  1GK6 A;  1JCD A;  1SFC B;  2KYV A;  2N1T B;  1NTM K;  2HPJ A;  3HL6 A;  3ZN0 B;  4ZI7 E;  2W61 A;  3ANW A;  5F3J A;  5LJM A;  4TN7 B;  1GTW A;  3LBX B;  4DVD A;  1KNZ A;  2ZM0 A;  3IR9 A;  4UEL A;  3ZMT B;  3FXD B;  2H8P D;  3C64 A;  4MFR A;  1FZG A;  1IJ5 A;  4GYR A;  5JDL A;  3RK2 C;  3J9X 1;  2LSJ A;  1ZR2 A;  3KVB A;  2CPB A;  4GIW A;  3V2P A;  2P67 A;  4OK0 A;  3RH3 A;  3SS1 A;  5APY A;  2EHO A;  2Y8D A;  4HN9 A;  1L4A C;  5BVZ A;  3HE5 A;  2BVM A;  3N2K E;  5APQ A;  5CCG C;  4QHO A;  4IE0 A;  1NOH A;  1YKH B;  4AUW A;  1X79 B;  4KHX A;  2OYH C;  2LE8 A;  3BQI A;  1J2J B;  3EVY A;  1U4Q A;  2E9X D;  3P7I A;  4HTE A;  3AVR A;  3UT5 E;  3CQG B;  4IE7 A;  5LYJ E;  2X66 A;  5LHG B;  1MUU A;  5FYM A;  1HGV A;  5BMV E;  3GHG C;  1T2K D;  2QGS A;  1G1I A;  4NUV A;  3WAK A;  2CPS A;  3A3Y B;  1FJK A;  4WY4 C;  3HE5 B;  4I2L C;  5AW7 B;  3T97 A;  4I50 E;  3HD7 A;  4KUM B;  4WW0 A;  5LBQ B;  2XZR A;  3VYI A;  4J2C A;  4ANJ A;  3ZC1 A;  1FZC C;  4HEA A;  5LOV E;  3JC6 D;  1GL2 A;  5CCG A;  2BAS A;  1G1J A;  4E7S A;  4BJN A;  3SWF A;  1NKN A;  2HG5 D;  1KQL A;  2FYZ A;  2V7L A;  1N7S D;  3N9N A;  4YJ3 E;  2WPR A;  3V5U A;  4A56 A;  4W7Z A;  5APX A;  4MBQ A;  1Y64 B;  1N7S B;  3E22 E;  4H9O C;  4XZC A;  4AKG A;  5EK4 A;  5CJ4 A;  3FB2 A;  1FIO A;  2LOP A;  4GK5 E;  4I4T E;  3M0D C;  1UCU A;  3NRX A;  2YO2 A;  1YTZ T;  5AW0 B;  4LLH A;  1HF8 A;  1HVV A;  3RL0 C;  3P8C D;  4Y99 C;  3RC8 A;  1MMD A;  5JR9 A;  3B5N B;  2X9W A;  4TV9 E;  4IHJ E;  5LBM A;  3AA0 B;  3V4W A;  4HKA A;  3QC9 A;  2KP8 A;  3KBU A;  5CA1 E;  5KJ7 C;  2L8K A;  3IFM A;  2Z5H A;  4ZHQ E;  5L2L A;  1D0Y A;  1D1A A;  3KIN B;  4QX7 B;  2WPQ A;  5AW6 B;  3MXZ A;  1VRB A;  4PFP A;  5AW4 B;  1AJ3 A;  2ZFC A;  2YKP A;  4RES B;  4GKG A;  4QXB B;  1NO4 A;  2ODU A;  2SPC A;  4ERR A;  5L3C B;  1NAF A;  4BAY B;  2WMO A;  4O9B A;  2V7I A;  2Q7C A;  1J1D B;  1QL2 A;  2XAJ B;  3B5N A;  3GHG A;  2XAG B;  3MA9 A;  3A5T A;  3BRT B;  1URQ B;  3WMM 0;  1DX7 A;  3ZPO A;  4CXW A;  2MJZ A;  3FBL A;  1GU4 A;  2XAF B;  1FEW A;  2M8R A;  2E43 A;  5AVZ B;  4ILU A;  4IFD K;  3LG7 A;  5HWY A;  1LVK A;  3ZEF B;  3KPE A;  3C4X A;  3IEE A;  3E0Z A;  1L0N K;  2IPP A;  1BR1 A;  2YMY A;  3U78 A;  3GHG B;  3OA7 A;  2EHO C;  2KIN B;  4GT1 A;  3KVA A;  3MJX A;  3OYZ A;  1IFM A;  1X8Y A;  3N4X A;  3LK2 B;  1RF1 A;  2Q9Q A;  3QUJ A;  4H9Q C;  5KMG P;  2CCQ A;  2ZLY A;  2YIN A;  1J1D C;  2H7H A;  1SFC D;  1URQ A;  3N9O A;  3RK3 B;  4Z8X A;  3RK2 B;  3ZLI A;  2J1D G;  2NP9 A;  3MK7 C;  3TKL B;  4WB4 A;  3P32 A;  1YTZ I;  2GUV A;  2WSF H;  3M9Q A;  1ZEE A;  2BZB A;  2N9B A;  3N5L A;  4TX5 A;  2KB7 P;  4C7N B;  3MGN A;  3R6N A;  1XTG B;  3ZYL A;  2WPS A;  1IK9 A;  5L3E B;  2W62 A;  4TV8 E;  4Y99 B;  5H6R B;  4EXT A;  4ADZ A;  4LC1 A;  2YKO A;  5AVY B;  1GDT A;  3O4X E;  3ZJ2 A;  4C90 A;  2K9A A;  2V7J A;  2CLY C;  1FBM A;  5L3G B;  5HYA A;  5AW1 B;  1MIW A;  5KTB A;  1HJB A;  1M7L A;  2O01 H;  2FFD C;  5CJ0 A;  3KV4 A;  1N7S A;  1SQX K;  5FXX A;  5JRC A;  3RYI E;  4TUY E;  5HXH A;  3LBX A;  1IO4 A;  1RE3 A;  2HPL A;  1VPC A;  4GYS A;  3LFM A;  5AVV B;  3PU3 A;  1W2E A;  2XDJ A;  3L3P A;  1MMG A;  1M1J B;  4IE4 A;  4ASK A;  3O8Z A;  3C4W A;  3CQC B;  2C0X A;  1FZB A;  3OKQ A;  5FY1 A;  3RX6 A;  5L3F B;  1IFN A;  4BJM A;  4B6X A;  3HD7 B;  4EIW A;  2KWI B;  1GD2 E;  2C5J A;  4ISS A;  1NWM X;  5APW A;  3F31 A;  1JTH A;  2NPS C;  2BDE A;  2FFD A;  3HR0 A;  3VKG A;  5AVU B;  3CL3 D;  2D2S A;  3DTO A;  2KOG A;  5KJ7 A;  2CEA A;  2R5B A;  1LTG C;  3I9W A;  5AW9 B;  3HKE E;  4AKL A;  1HH0 A;  2XHE B;  3H6P A;  1YD8 G;  4N78 E;  5LJN A;  3AB3 B;  1IJD B;  1LTJ B;  3F2E A;  4PK5 A;  5ETW A;  1SQQ K;  1PFI A;  2EHO B;  1BR0 A;  1EQ7 A;  2WWU A;  5HAX A;  1GL2 C;  2QA7 A;  5JH7 E;  2XTL A;  2FFD B;  1B7T A;  4IE6 A;  2G0U A;  2PBI A;  3ESL A;  3I9Y A;  3N9Q A;  4WBN E;  1E1H B;  1D0X A;  2JMK A;  4C46 A;  2WBL A;  3U59 A;  1D1C A;  1HG2 A;  2C0S A;  1OWA A;  3CI9 A;  5KLV K;  2VWA A;  3CX8 B;  2M3B A;  4KMC A;  4V1A v;  4AQG A;  1M1J C;  4ZI2 C;  2N1T A;  2KWH A;  1FJP A;  2MTQ A;  4N78 D;  1CI6 A;  4O4H E;  3HI2 A;  2D0T A;  2OYH A;  1YW0 A;  3CX6 B;  3FBZ A;  5F8P A;  5CCH C;  1MV8 A;  1NWQ A;  4ZI3 C;  5JDF A;  3RKO A;  2Q9Q C;  4DND A;  4GOU A;  4YJ2 E;  3A2A A;  3O1J A;  4H9P C;  4DOJ A;  2WWW A;  4K0U A;  1FZC A;  2W6A A;  3KYQ A;  1SFC A;  1URQ D;  2V1D B;  5JDH A;  2PAJ A;  3H32 A;  3CX7 B;  4XAX B;  1LGH B;  1MND A;  3OYX A;  4WBA A;  3KV9 A;  2V26 A;  4CI1 B;  2CWO A;  3AAE B;  3CKD A;  4IST A;  2E8I A;  1HFA A;  3MZK B;  1T3U A;  4O4L E;  3II6 A;  4YLH A;  3EDU A;  3A5X A;  3LK3 B;  1WR6 A;  1NKZ B;  1QL1 A;  1KFN A;  2HFE D;  1WRG A;  3HUS B;  1HBW A;  3VN0 A;  4DZO A;  4IGU A;  4DMV A;  2VK9 A;  5JR9 B;  2K48 A;  3U1A A;  2R32 A;  1IFD A;  3SRZ A;  4UVA B;  1ZLL A;  2HPC A;  4PK4 A;  2VRS A;  1GW4 A;  3EQ2 A;  4DBR A;  5LNK A;  2HYN A;  1G73 A;  3ZCI A;  3ZYM A;  4DO0 A;  5L3D B;  2KLQ A;  4UIG A;  3HRN A;  3R2P A;  2C5I T;  1CSB A;  3PUG A;  3GA8 A;  4UVB B;  2OAR A;  1LRZ A;  1GW3 A;  4EYY R;  2X51 A;  2HOD B;  3P8C E;  1L4A D;  2L3L A;  2OYI B;  2Y6X A;  1HGZ A;  4ZS2 A;  2XKM A;  2DWK A;  3DJB A;  2CWY A;  3I5C A;  1HX8 A;  5CCH A;  3OJA B;  1KIL B;  3R84 B;  1IFJ A;  5BU8 B;  2C9L Y;  1NH4 A;  1SQP K;  2WAU A;  3MAC A;  4JLE A;  2NW8 A;  1LKX A;  3MIW A;  2Z6E A;  2LSY A;  2W27 A;  1KK7 A;  3HA4 A;  3I0Q A;  4PJJ A;  4F6R C;  3P7K A;  2IAK A;  3CML A;  2ES0 A;  3SOL A;  4JEH B;  3EDV A;  1NU1 K;  5AVQ B;  3N9L A;  4M1P A;  5A1L A;  2L9Q A;  4IIJ E;  3U1C A;  4DMW A;  3N2O A;  3AA6 B;  2XAH B;  1J1E B;  3OBV E;  3FXE B;  2MOZ A;  2ODV A;  4ZS3 A;  2HLO A;  3K3Q C;  1N7S C;  1N86 A;  3KDS E;  2C0W A;  1D1B A;  3AVS A;  3ZMZ B;  3ZYK A;  5JR9 C;  4P0A A;  3K3O A;  3S4U A;  5LG4 A;  3SWH A;  1NTZ K;  3N9M A;  1LTB C;  2D0U A;  3Q2M A;  3UUX B;  2JJL A;  3BQK A;  2P2U A;  5DQW A;  4AI6 A;  4U72 A;  3ANW B;  3KFW X;  1BR4 A;  5AW8 B;  3C4Z A;  1Z56 A;  2W0G A;  4OHF A;  3HE4 B;  4AXP A;  4CZZ B;  3PUQ A;  1NTK K;  5APT A;  5IYZ E;  5LCY A;  1LTA C;  2NPS A;  2GM4 A;  4JUY A;  2H7O A;  2LT3 A;  5J2T E;  2A45 I;  4EOT A;  4MLK A;  5J1G A;  5IHY A;  4CI3 B;  4EB6 E;  3AA1 B;  1RF0 C;  1QUU A;  2RA1 A;  2FXM A;  3VMZ A;  2R3C A;  2Z5I A;  2WT7 A;  5LXT E;  4CI2 B;  3KV5 A;  2CLY B;  1ZHC A;  1LTI C;  3M0D A;  1N7L A;  2WT7 B;  2HH7 A;  2V7K A;  3GWH A;  2X9Y A;  1S9K D;  4EOZ B;  4O4J E;  2JRK A;  1SQB K;  1G2C B;  2E9X A;  2C9N Y;  4EZ4 A;  3E1I A;  2MYS A;  4AQF C;  1LT9 B;  2LKM A;  2YEV C;  4PK6 A;  5FMN A;  2VKJ A;  2XAS B;  1JMM A;  3NZQ A;  3LID A;  3VP8 A;  5HXS A;  3BAS A;  1X79 A;  1FMW A;  4MHC A;  1VDF A;  3RK3 C;  1V9D A;  4JYB A;  2LEH A;  2K5B B;  3M91 A;  3GN5 A;  4L0R A;  4QKN A;  1HUC A;  3RYF E;  4WY4 A;  1S35 A;  4WBO A;  4AKR B;  2ZXE B;  4EAH A;  4C7R A;  2UXX B;  2YU1 A;  3LJC A;  5TAO A;  4N6J A;  5FP3 A;  3Q5X A;  5JDN A;  2VKO A;  5HWX A;  1FDM A;  3HTK B;  2IX7 C;  2DLR A;  2KXP B;  1JNM A;  2Q5U A;  2XV5 A;  3KBT A;  3KV6 A;  2ACX A;  1FMV A;  4B86 A;  1S9K E;  1D0Z A;  1KFM A;  4H9N C;  1LVF A;  1L4A A;  1FZF A;  3V5B A;  2DCF A;  1IJ6 A;  3AAI A;  5AVS B;  3C50 A;  4P0B A;  4MAL A;  4UF0 B;  4UXN B;  2N9D A;  4HFV A;  1SA0 E;  2GK9 A;  2JMH A;  2I1K A;  1G8X A;  1IZN B;  3MTU E;  1LTT C;  2LOS A;  3V5S A;  1KIL A;  1BR2 A;  3OJA A;  2O1J A;  3NRY A;  1HS7 A;  1HTL C;  2NWB A;  3Q9D A;  1GZL A;  4OFZ A;  4I43 B;  3UUN A;  1WYB A;  5FXZ A;  4E7Z A;  5C8Y E;  2XNX A;  5AVW B;  2WZ7 A;  4HGA A;  2JPF A;  5LHI B;  2WTY A;  4BA9 A;  1IC2 A;  2FKW B;  4HH2 A;  2OYI A;  5APV A;  2CMR A;  4ZI2 D;  2IFM A;  1MIY A;  2XU6 A;  1JY3 N;  3N7N A;  1ZKE A;  3V2Q A;  2IC9 A;  3N9P A;  3O1H A;  1KIL C;  3PUA A;  3QK6 A;  2NTX A;  1DH3 A;  2B1E A;  1RE4 C;  1N73 B;  4P09 A;  2KLV A;  4KP3 C;  4AKH A;  4HE8 A;  4YFS A;  3DP7 A;  3B5N D;  1UX4 A;  3J7Y q;  2NOX A;  4H9S E;  4PJL A;  3ZMU B;  5LP6 E;  3ZC0 A;  2I1J A;  3L09 A;  3LW5 H;  4LGD E;  4PJN A;  1OXZ A;  1JY3 O;  3PTR B;  1A02 J;  2A2F X;  3ETV A;  3VP9 A;  1LWU B;  2X67 A;  4I55 E;  4X20 E;  2A45 G;  3RYC E;  3BVH A;  1FOS F;  1JO5 A;  1L0L K;  3B13 A;  1YYC A;  1RE3 C;  4GIF A;  3AA7 B;  1MMN A;  2NPS D;  3PE0 A;  4O2B E;  1CZQ A;  4ZKU A;  3NZP A;  3W15 B;  2KT9 A;  3PP5 A;  3VKH A;  1MNE A;  2VKD A;  1NHL A;  2YU2 A;  3V2R A;  3I1A A;  1LTJ C;  3RK3 D;  4I6M C;  2N2N A;  2LHR A;  4H63 H;  2KND A;  1JCC A;  3MKD A;  2M67 A;  5FXV A;  4PJM A;  3VU7 H;  2Y48 B;  2WSE H;  2O1K A;  1WRD A;  3TK1 A;  5JDG A;  2NW9 A;  5APS A;  1O3X A;  1US7 B;  1JY2 P;  2E9X C;  5LGN B;  4G2A A;  3RRW A;  2OYH B;  1ZV8 A;  4QXC B;  2Q9I A;  5GON E;  5AW3 B;  5EK2 A;  3H3A A;  2X9H A;  1T2K C;  2ZM8 A;  1FOS E;  2UXN B;  4QXH B;  2H7V C;  1AFO A;  4WY4 D;  2WMN A;  3HKC E;  3K8P C;  3LK4 2;  3ONX A;  1FU1 A;  3L37 A;  4XE5 B;  5HXC A;  3KQG A;  3VHL A;  4CQI A;  4WY4 B;  3VTP C;  2JQQ A;  2OA5 A;  2Q3I A;  2P9B A;  3GN5 B;  4WNK A;  5FXW A;  3ZCJ A;  3HTK A;  2DNX A;  5DAB A;  1ZR4 A;  4JF7 A;  3AAA B;  4OH8 B;  3GMI A;  5E0O A;  5CB4 E;  3EFG A;  3HKB E;  3BAT A;  2H3R A;  4N3Y B;  2KSJ A;  3NFQ A;  3B8E B;  3TNU A;  1WLX A;  2RP4 A;  5EZY E;  2KZ7 B;  1G2C A;  4AYC A;  3A7O A;  3ZN1 B;  1JY2 N;  2QM8 A;  3TYY A;  1MIV A;  4O4I E;  1N73 C;  1QSD A;  2I59 A;  1KIL D;  1H89 A;  1E5W A;  2N1T C;  2CM0 A;  4DBQ A;  3Q5W A;  2FYU K;  3B57 A;  5AW5 B;  3B5N C;  1N2D C;  2N1G A;  4CXX A;  2E9X B;  5KJ7 D;  2A3D A;  2OYI C;  2CXL A;  4PNI A;  2YO3 A;  3IBP A;  4ZI3 D;  2JEE A;  1U5P A;  2WIT A;  2IFN A;  4JEU B;  1JOC A;  1H88 A;  2VAS A;  4IDZ A;  4JYC A;  4XBF B;  3D0T A;  1SP4 A;  2XAQ B;  2YKQ A;  2QM7 A;  2PJQ A;  2YK0 A;  1MMA A;  4L9I A;  3WI3 A;  3ZMS B;  3CPZ A;  3V2N A;  1RE4 A;  3G3Z A;  5BU5 A;  2CXF A;  2JJ9 A;  3UFE A;  5AFU L;  5CA0 E;  3NXS A;  3BK9 A;  1JY3 P;  4XA4 A;  3IHR A;  4FJO A;  3P8M C;  3U3I A;  1H8A A;  3HE4 A;  3UUL A;  4X1K E;  4YHJ A;  5JRE A;  2VB6 A;  2W00 A;  3HD7 C;  2W63 A;  2MBG A;  5AVR B;  1CW5 A;  4C7N A;  3L4F A;  1HCI A;  1RF1 C;  1SHZ C;  4IFF A;  1LT9 C;  5LGT B;  3T8O A;  1SVF A;  3KDP B;  4UV9 B;  4C91 A;  4UF0 A;  5J2U E;  1MZ9 A;  5AVX B;  1RY3 A;  1X9V A;  2EHO D;  4M3L A;  1JUN A;  3CWZ B;  3I0O A;  1MFZ A;  2NTY A;  5DJQ C;  2POH A;  5HXE A;  2L5G B;  3TSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...