1OWAA

Solution structural studies on human erythrocyte alpha spectrin n terminal tetramerization domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
b'MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, erythrocyte
publication title Solution structural studies on human erythrocyte alpha-spectrin tetramerization site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1owaA01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1owaA02
1OXZA 1A02J 5AVSB 3M0AA 1H88A 5AW6B 1U4QA 4RESB 1HCIA 3FB2A 1CI6A 1KQLA 4JYCA 3LBXB 3IR9A 5AVYB 3B8EB 4LC1A 5APQA 5APWA 5AVXB 3P32A 3M0DA 5AVWB 4AUWA 5AW1B 1U5PA 1YYCA 2YO2A 3OAKA 2Q7CA 5AW4B 3UIAA 1A02F 3HE5A 3M9BA 2C9LY 4DZOA 1GK6A 1GZLA 3MD0A 1GK4A 5APUA 5AVRB 3T97A 4B86A 1JUNA 4C7NA 2P7JA 1MV8A 1T2KD 1MUUA 3MGNA 4HYTB 2R3CA 1T2KC 1HUCA 2H7HA 2Z5HA 2ODUA 4EOTA 5CMZA 1S9KD 2WPSA 3HE4B 3NTNA 1NWQA 4M3LA 2Q3IA 1NAFA 5AVQB 3O8ZA 5AVVB 1IO4A 5AW8B 5AW7B 2R5DA 2WPRA 3A7OA 1GTWA 3VMYA 5APSA 1S35A 1FOSF 1H89A 2XV5A 5APYA 1HWTC 1FOSE 5AW0B 4AQRD 4I2LC 1CZQA 1OWAA 5AVUB 4I6MC 2QM7A 3TNUA 1JNMA 1CI6B 3M91A 2ZFCA 2WT7A 3I5CA 5AVZB 3VN0A 3M06A 2KP8A 5APXA 3UUNA 1GD2E 3M9HA 1J2JB 3V5BA 1MFZA 2P67A 3V4WA 3TYYA 1SLQA 3HE5B 2Q5UA 2WWWA 2WTYA 1HJBA 5AVTB 2E42A 2R32A 3P8MC 2W6AA 5APTA 3F31A 4JYBA 3UULA 2QM8A 3UUMA 3L36A 4C7NB 3A2AA 3KDPB 2W27A 3LIEA 3VMXA 5AW5B 3L37A 3VMZA 5AW3B 1HBWA 3V4QA 4XE5B 1SP4A 3TK1A 3LBXA 1X8YA 1S9KE 1QUUA 2ODVA 2N9BA 2WPQA 1DH3A 3VYIA 3L35A 1H8AA 3A5TA 2R5BA 1AJ3A 3NMDA 2C9NY 2BASA 4GT1A 2XZRA 5AW2B 4KHXA 4C46A 3A3YB 2YNYA 5AW9B 1CSBA 2YO3A 3P7KA 2SPCA 3PE0A 3NXSA 3TNUB 1GU4A 2Z5IA 1GU5A 4GKGA 2WT7B 1FAVA 2XU6A 5APVA 4AYCA 2VRSA 3HE4A 3HTKA 2IPPA 3LIDA 2ZXEB 3VTPC 2E43A 3EDVA 1WLXA 1CUNA 2JJLA 3NFQA 3SWFA 3KQGA 1G2CB 2P2UA
chains in the Genus database with same CATH superfamily
1KYOD 5LHHB 4OVNF 2X68A 4H9NC 5B5EH 2ZM6T 4OYJA 2FJAA 1K04A 2W6JH 5ADXL 3SWYA 3P4RA 1MNEA 5A1LA 4JYCA 1URQB 4LC1A 1VQ6P 5KXJA 1NKNA 1XTCC 1ZRTE 2QJPB 3SS1A 3AEAA 3H32B 5AQSB 3GG2A 2G3AA 4B86A 1VPCA 2A06G 1N73C 4M1PA 3RGLA 2AXCA 1YD8G 1T2KD 2D2CC 5AQTB 5JR9C 3UUXB 1P84E 3C50A 5K5GB 3MP7B 3H1KG 1SQXD 3WI3A 1JTHA 2E76C 4YXWH 1QEXA 5HEJA 2H7HA 1S9KD 1Q2NA 5FL1A 2Q6QA 2X67A 4TV8E 5HCMA 2PG8A 1RE3A 2K1AA 4K3AA 3R84B 2WPRA 3LW5H 4EI2A 5DQWA 5APYA 4KBMB 3H1HE 3SSUA 3L39A 1OEDA 3R4YA 4QXBB 4GKKT 1N34T 4LF8T 4IL6E 4ZS3A 5CA0E 3VR8A 1FZCC 4AKGA 3I5CA 3VN0A 1FZBA 2CHNA 3M9QA 3V2RA 5LBQB 3CI9A 3E1IA 4ERRA 2EHOB 3GA8A 1L0LG 3R6NA 5IYZE 1Y01A 4RO0A 1QX8A 4ZKPA 1WR0A 3D6ZA 3ZYKA 3VMXA 1Y47A 3JC22 4GDOA 3CX5I 4XE5B 5L4EA 1IJDB 1BGYG 5HWXA 4IE6A 2O01H 3JSVC 1OZHA 4H0LD 2RN0A 1KILA 4ADZA 4CN1A 4WNKA 3P7KA 3SWHA 4KHPT 4DV2T 1YITP 2CCQA 2V7KA 2P9BA 4YSXA 5L47A 4LF6T 4MLKA 3PUYF 3KFWX 1L0NK 3RBXA 1LWUA 2M3BA 1NO4A 3GLMA 3P8CD 3HUSB 1XMQT 2K3WA 3B4SA 3ZC0A 5L8RJ 1VRBA 3FWNA 2OARA 4I7ZC 2JJLA 1MIYA 3K3NA 4HWCA 4CN6A 3AEEA 1NOHA 3VRBA 4XBFB 2BCCG 4UV8B 5AQOB 5FYMA 5AW6B 3H1LJ 4OGQD 1AQ5A 3PU3A 3VP9A 1IBMT 4ZI3C 3H3MA 3X1DA 4H0LC 3AE3A 3GW6A 1KTMA 1L4AC 1FDIA 2ZYDA 3G4SP 4QKNA 2YXQB 4U3CA 2DL1A 1Q7YQ 4A98A 1PZQA 2BZBA 3C4ZA 2D5UA 3ZLIA 2J58A 1GK6A 2XASB 3AVRA 5KJ7C 5FNVE 2FBWC 1N7SD 4WBNE 1RF1B 1MUUA 4HYTB 3HD7B 4UB6H 4CI1B 3IBPA 2XQ3A 2ODUA 2XQYA 2OA5A 1K8AQ 3BCCE 2LLYA 1Q90D 2E8IA 5DJUB 2OV9A 3VKHA 2OTJP 5KLVJ 1JY3O 3RYHE 1KYOE 3CQCB 1EZVD 3PH0A 2V7MA 3AAAB 1JM0A 3Q5PA 4CN4A 1YQ3C 4YT0A 1JNMA 1LTTC 2N1TD 1FBMA 2V26A 2IDBA 1H7CA 2XZEA 2BVLA 2L91A 2Y8DA 3BRVB 1W9RA 4JI1T 1PIXA 3EI0A 1JNZA 1NTKE 5KAIE 1QL1A 1NWMX 3ONLC 1FZGA 1QSDA 1FE6A 1VQLP 1M1JC 3AE8A 2H89C 4H9SE 3UU5A 1SQXE 5LGNB 2CHOA 1S9KE 2J5UA 3AECC 5AQJB 2LOSA 2BVMA 2ZYGA 1UIIA 1VDFA 1ZKEA 4TWFA 2N1TC 1AFOA 3HKBE 3N9OA 3ONJA 4EYUA 2CBIA 2YNYA 3CWBD 1OVVA 2WBLA 1OVUA 4GK5E 3RRWA 2IFMA 5LOVE 2XUEA 1EC5A 2E9XA 3OKQA 3CQXC 3SRZA 3HTKA 4YTNA 3A5XA 4B3ST 1T8ZA 3EFGA 5JQGE 1LT9C 3G06A 1G2CB 3CC2P 3CC4P 1IFMA 5AVSB 3M0AA 2FJDA 1OW6A 2BG9C 3U59A 2AE9A 4PV1D 3G6EP 4IGUA 1YW0A 2JMHA 2C5IT 2QA4P 1WRDA 5AVYB 3B8EB 3L70G 1DX7A 5AW1B 4DOJA 1ZR4A 1EDLA 1SQQD 4JI4T 4JQ0D 2MPKA 2O1KA 4L5GA 4N78D 2KNCA 1SQVG 1SQPJ 2BKNA 2JRKA 2YU2A 3A7MA 3UQ4A 5HEUA 1HS7A 1BDDA 4H13B 4D6TG 3UQ7A 3RIUC 3P8CE 4IDZA 2XAHB 3NTNA 4X1IE 3AE7C 4HKAA 2VURA 3B5ND 4AKRB 2XNDH 3CWZB 3A0HH 1FDOA 2VKDA 4J2CA 4U3FD 4CZZB 4DR1T 3A7OA 3FXEB 1ZP0C 2JEEA 3B57A 2B88A 1FOSE 2A45I 3CMEP 2UXCT 1NKZB 4I2LC 4IFDK 3H1JG 1VQ5P 4PFPA 2KSJA 1S5LX 1YKEB 4P1NA 2AEMA 1L0VA 1JY2P 3C9IA 2JDIH 1HNZT 2NW7A 2WU5A 2WMOA 3RI5A 3V4WA 3AEAC 1DD4A 1FJPA 1AV1A 2W6AA 2ZM8A 1W2EA 2VQET 2A06D 3G71P 3AXJB 4MN4C 4KHZF 4DMVA 4MHCA 1NTKK 2HH7A 3H1KD 4O2AE 3B5NC 4TWDA 2GUSA 1SUMB 4C90A 5FL0A 4UB6E 3RK3B 5KTBA 1URQA 2QG4A 2XQ9A 1SQXK 3O1IA 3V5UA 1RY3A 3VYIA 1BDCA 1KZUB 5CCHA 5HEGA 1RE4C 4YTPA 2RKLA 3CK6A 3H32A 1GMJA 2M8RA 3C98B 3H37A 3RK2C 2FYUJ 4DIDB 2IYOA 1JO5A 1YBKA 3FZFB 3CQGB 1WMKA 5IUXA 1EZVE 2Z6EA 4R4MA 1UIXA 3EVYA 3CMLA 2R44A 1RH5B 2D0TA 4A56A 3AE4A 4JV5T 4TV9E 4KJMA 4UR9A 3WUTA 2BS3A 3PJAA 3OPCA 3KQGA 2VQFT 1UURA 2E74B 3ESLA 1GL2C 3CD6P 3RIFA 2X66A 5AQVB 3QOFA 1PGPA 1NTZJ 1MNDA 1ZOYC 3QWOC 1X79B 4OHFA 1BGYD 4OFZA 3V2PA 2UUCT 3OAKA 4EV6A 2W0GA 2XQ6A 3M9BA 3L72G 3GWHA 2HFED 2D9DA 4UELA 3S4UA 5APUA 3CWBE 3ABVA 1G73A 1UGOA 3MA9A 4ZZBA 3P4QA 3AA7B 5LHIB 4CXYA 3JC6D 2NTYA 5GTHH 1B7TA 4I4TE 3KPEA 2Q3EA 3L71J 3RK3E 2HODB 3OYXA 4BA9A 2KXPB 3CMAP 1X22A 3C1LA 2QSIA 2KT9A 2BCCD 4X65T 2ACZA 3J7Yq 2CA5A 2UXDT 1HF9A 3N2GE 3MHVA 1NTMJ 2Q9QC 1XTGB 3AE3C 3MUDA 2DNXA 4QH4A 3HUSA 2KSRA 4X66T 2H7OA 3O1HA 3OTOT 4Y99B 3H1LD 4C7RA 1UCUA 4CI3B 3CPZA 4B3TT 1HH0A 1SQQE 2W8ZA 5JDGA 3UULA 2KUBA 1J1DB 1RF0A 2KMFA 4IL6X 1LNQA 5HXHA 3C51A 5BVZA 4HN9A 2HLOA 1SVFA 1X8YA 2CXLA 2WPQA 4BXLA 4ZEYA 1YXRA 3WMM0 2GUVA 1KFNA 1H8AA 2LRLA 1LRZA 3N2OA 2YEVC 3E0ZA 4Q25A 2XZRA 4U3FE 5LYJE 2VL0A 3A0HE 4U74A 5LJMA 3AE5C 1HJ0A 3CX6B 1RF1A 1MIWA 2UXBT 3HD7A 4L75A 4AQYT 1MIVA 3AAEB 1Z0PA 2M6BA 2IX7C 4AYCA 3LIDA 2ZVNB 3BRTB 3ZMTB 2WMNA 4JPZB 3AE1C 1W09A 1PV3A 1EDKA 3Q5EA 2A06E 2K9AA 3A8YC 1M57D 1H88A 3N2KE 3AE6C 3PUAA 3K1SA 1HCIA 3RQUA 3H1KE 2WSEJ 2VKJA 4MALA 3AEFC 3AE9A 1VCSA 2E5TA 2UUAT 2M5AB 2KI7B 1SQBJ 3KVBA 3PRJA 2W00A 1PGQA 3M0DA 3EDUA 4C91A 5C39A 3I56P 3PUVF 1X9VA 2LOPA 5TAOA 1KEYA 3K3QC 2P7JA 3N9NA 3AEGC 3NRYA 3RPUA 1ZN5A 2E9XC 2QJKB 3LSVA 1PL5A 1EZVG 3ETUA 1NU1K 3SFDA 1XMOT 3KVAA 3D70A 2QJYC 4MFRA 1QVGO 1L0LE 1JB0J 4EZ4A 1HFAA 4JF7A 3GF3A 4DR5T 1PGJA 1VF5D 1LTSC 3OJAB 3RH3A 1D1AA 4I6MC 3ZMZB 3HL6A 1JMBA 2JPFA 3JCFA 3GHGC 5KAFH 4QXHB 3L75G 1BGYE 4ZI7E 4UIGA 4AISA 2ZAEB 2HPLA 2WB5A 3KBUA 2MYSA 3PTZA 1HJBA 4AI6A 1J1EC 4WY4D 2LKGA 4GKJT 1G2CA 4JYBA 4HFVA 4NPFX 1WT6A 1VQOP 4HTEA 1SQVD 3ITKA 1ZHCA 5JDNA 3KZIH 3B71A 2JJ9A 2KNDA 3P7IA 4B6XA 3RBZA 4JI8T 2NPSD 2WP9A 3CWBG 2OLTA 1DH3A 4ZKUA 5GTHE 2YMKA 1VF5C 1VQ8P 2V5CA 3IHRA 4X62T 5FY0A 2K48A 4DO0A 1MKMA 2CPTA 3AEBC 3N9QA 2BCCE 1Y64B 2B76A 3L8RA 1HR0T 2ITAA 1JMMA 4JI6T 4OH8B 4EGWA 2L5GB 1NYHA 4WY4C 4A97A 1MMNA 2IC6A 2WSCJ 3H1LE 5AQKB 3VMAA 2XSBA 2OYHC 3J9X1 3SWFA 3CCLP 2E75B 3FXEA 2CWOA 2CM0A 1YIJP 2KZJA 1T8BA 3V5SA 2W61A 1SQQG 4I1LA 1U7MA 2GA1A 4H44D 4DVDA 1Q86Q 1D7MA 5APWA 2QIWA 2WZHA 3PJSK 2QJPC 4W7ZA 1AQTA 2OYIC 3ETVA 4JEUB 2RH0A 4IOIH 3I55P 2DHRA 4IE0A 2UXNB 2D2CD 3MD0A 5AVRB 3AXJA 3TGUG 1JUNA 2E76D 1O3XA 4ILBA 5JH7E 5LCYA 3CCQP 1AJYA 3L73J 2X9XA 1UX5A 2V1DB 2K24A 5KX5E 2OTKE 4U3FG 2R3CA 1HGVA 2RPAA 4EOZB 4BJMA 3ZT7A 3LK2B 3LG7A 2X0HA 4GK0E 2MTQA 2Q3IA 5L3EB 2AXDS 1TU3F 4H44C 1E79H 5AVVB 5AW8B 5AW7B 4Z91A 1D1BA 1NHLA 1GQEA 1IBKT 1YQ4A 4TNWA 2WS3A 4HWDA 1L0LK 3V2NA 4IHJE 3CKDA 4H9OC 4DV1T 2I6HA 2I0MA 1QLED 2LSIA 4XAXB 5L3GB 1N2DC 4YSZA 3FBLA 5FP3A 1W0AA 3VU7H 1PPJG 5AQIB 3TLUA 3L72D 2YIUB 1NTZD 3SWKA 2EHOC 4I0UA 4Z8XA 3F57A 4DR2T 1YJNP 2WQYA 2KINB 3I9WA 2R6GF 2Y0DA 3PURA 4NXNT 2XSAA 5HYAA 2LHRA 4HB1A 5AQPB 1ZXGA 1HBWA 2CXDA 4DV5T 3FZKB 1X79A 3Q5DA 4IIJE 2H43A 3VOPA 2FYNC 2N9DA 3PUGA 1LP1B 3NMDA 5H2FH 3A0BE 3RGUA 4GT1A 2UXXB 2VWAA 4Z90A 4KI0F 4HFCA 2I1JA 2XQ4A 1LTJC 3RF1A 4TN7B 2D0UA 1BE3J 5ABEA 3MZKB 4YTMA 3L70E 1T3UA 2HODA 2IPPA 4PK5A 2BKOA 2P58A 3GN5B 1NTMD 2KS1B 1CUNA 2VKHA 3HA4A 4LF7T 2ZMAA 5JR9B 2D2CB 1NJIQ 1SE7A 4ZI3D 1EZ3A 3H1IJ 1SQVE 2GK9A 4KP3C 4U2ZA 2H8PD 1XDOA 3KZIE 4D6TE 4HFIA 4ZI2D 1L4AD 5L4HA 3KYQA 3IF8B 1N86A 3LBXB 1VQ4P 1DIPA 5CCGC 1KN7A 1LTAC 3L74J 1Q82Q 3FZLB 2WSSH 4UVBB 2MJZA 5KJ7D 1D1CA 1GZLA 3Q1MA 5CJ4A 1YI2P 1D0YA 1XWMA 3VHLA 4EIJA 4OX9T 4QWNB 2FYZA 5C8YE 3H1JE 1EDIA 2Y0EA 3MGNA 4EYYQ 1YHQP 5JDQA 5CMZA 3QB5K 2POHA 2VVNA 2W63A 2LXCB 3RRCA 2G8YA 4NXMT 5JDLA 1IO4A 4ZI2C 4DUZT 1KB9H 5HXEA 3PUZF 3H1LG 1H89A 2H3RA 4EDFA 1KFYA 3CXHH 5AVUB 1QGKB 2CPSA 1HG2A 1IFNA 4WB4A 2WSEH 4RKUJ 3AA6B 3WAKA 3NRXA 4O2BE 5LGTB 1IFPA 1FDMA 1SLQA 2L3LA 4LMJA 5AVTB 3SFEA 2OYOA 2Y9YA 1G8XA 1P84I 1I94T 3FGAD 3JCUH 4Y28J 1L0NJ 2WSFH 4GOFA 1IK7A 4U72A 3ZJ2A 2M5AA 2ODVA 5CGMA 4I7ZB 5B5EE 2IBZG 1Y8AA 1LT1A 5KLVG 2FXMA 2HR3A 1KNRA 4H9RC 2YOEA 5JREA 1S1CX 3P4PA 4CXXA 1MMAA 2FFDC 2M0BA 3PE0A 3DJBA 4H0LB 2UWJE 3BQIA 1BR0A 5FY7A 2A3DA 4NPDA 4P0AA 2AEFA 3L75D 3RL0C 3IA3A 2J47A 3DP7A 1LKXA 2JP3A 3V2QA 5JVDE 2J59M 4ANJA 3L72E 2K9YA 3GMIA 2XY8B 4IE5A 3JAEA 5L3BB 4Z1MH 3AE2C 3OJAA 1KK7A 4GOUA 4TT3H 1SFCC 1BR1A 3P50A 4OGQB 4HFDA 2V7LA 4AQGA 5ABFB 3U1AA 2WDQA 3NZPA 1YYCA 3WUVA 4DR3T 2Q7CA 5C2TA 1FJGT 4IFMA 2B87B 2XM2A 1HX8A 5H2FE 4HJGH 3T1YT 3QB5A 5FMNA 1Z8UA 3QH9A 4H13C 4AKHA 5GONE 3H1HJ 5JDMA 5LXTE 3LDQB 2V6YB 2I8DA 3CCEP 1N7SB 5B66H 2O01N 4P0BA 3UUBA 3AB3B 5L3CB 3HE4B 1YJ9P 4YXDC 4EIWA 1W2BO 1BCCJ 1R5SA 4IL9A 4EYYR 3CL3D 1K9MQ 3C4XA 2WITA 2WSCH 1SS1A 3B13A 3E08A 2D2SA 2PP6A 4WW0A 2HG5D 2QM7A 2ZFCA 2W66A 1T98A 1DU2A 2N1TB 4X5TA 2XDJA 3KV4A 1LTGC 2B1EA 3V5BA 3O1JA 2P1JA 2IZ1A 3TGUD 2WU2A 3NKZA 2DLRA 3U1CA 1SQPG 4HGAA 2W27A 5J2TE 1J5WA 1AA0A 2O3JA 1US7B 2H88A 2LEHA 4BJNA 2MKVA 5AQLB 5LMNT 3IEEA 2V7IA 1GW3A 1CW5A 1LT9B 3RK2D 2QA7A 4TNVA 2BG9B 1KYOI 1YQ4C 2PGDA 3ZSTA 4I50E 3PJAJ 5ETWA 5HAXA 2BEZF 2CMRA 1FJKA 1M1KQ 1VQ9P 2PJQA 2QEXP 2LM9A 1PPJD 5J2UE 1VQKP 3EUHA 2VRSA 1T6AA 3PUQA 4JBZA 3KV9A 3Q5RA 3BASA 1GL2D 1BSHA 2N2NA 5CB4E 3RL0g 1RE3C 1U4QA 3EWKA 5E79H 2H7VC 2LKMA 2NOXA 2HPJA 1PP9J 1OEDC 4PV1B 4WBAA 5M1BA 3LJCA 1JY2O 4HWIB 2Q1KA 2JQHA 3BCCJ 3ANWB 3E7KA 5LMUT 1OFCX 2FYUG 1JY3N 1Q81Q 4UVCB 4ZMDA 2YKOA 2HPCB 1N36T 4K0UA 3PUXF 1ZW0A 3Q2MA 2A45G 4MBQA 1W5CE 1J5ET 3F89A 4EOTA 3L75E 4YPCA 3WUUA 3UU3A 1NAFA 5LA6E 1LP1A 1BE3D 2KLVA 2QVAA 4IFFA 2R5DA 2BG9E 3B5NB 1GTWA 1NTKJ 1RHZB 2XV5A 2Q9QD 1M56D 5ABGA 1KILC 1NTZG 4AIUA 3FZMB 2PBIA 1CI6B 1QLBA 5TISH 2N9YB 3MJXA 3CCMP 2BS2A 1SQXJ 4GOEA 3H1ID 2IC9A 1PFIA 2XQAA 3RK2B 3UUNA 4UB8H 1LWUC 3M9HA 3W67A 3AA1B 5HEHA 2K3RA 3GN5A 2KS1A 4FJOA 5JR9A 3HKEE 3NBXX 3P8MC 5LP6E 3EQ2A 4ISTA 4AQFA 5KKZC 4XZCA 2QM8A 1ZMEC 4TWHA 4XFJA 4DR7T 3AEEC 4PW8A 2E2AA 5BU8B 1VL2A 4PNIA 5AW5B 2ZVOB 3LW5J 1KF6A 5AQUB 4GODA 3V4QA 5HWYA 3L71G 3LBXA 3S9OA 3JADA 3F2EA 4EB6E 3Q5XA 5B66E 2NRGA 5M4YA 2JWDA 2LRKA 2BKPA 1GL2B 3PUWF 2C9NY 3E22E 4U31A 1JEKA 3VRAA 1S3JA 1M8OB 3O4XE 5AQFB 3FZHB 2DW3A 1IAPA 1NTMG 3HKCE 5AQRB 1T7SA 2CLYC 2WSSV 2I59A 3CX5H 4UVAB 4N78E 3VR9A 1VQNP 3CX5D 1YKHB 2YN6A 4DR6T 5E0OA 4DBRA 4O4LE 4WYVA 2K9JB 4WBOA 1IC2A 5GTIH 2FXOA 2P2UA 3O6QB 1OXZA 3TGUE 1LVFA 3ZKRA 4F6RC 2YK0A 2J1DG 3N9PA 3II6A 1NH4A 3MXZA 2YDSA 2HHHT 1BSNA 4B3MT 5LHGB 3MTUE 2E5LT 1FC2C 1KQLA 2VASA 4TUYE 3EHZA 2IBZD 4AKIA 2YKSA 5KLVD 4IREA 3F5HA 1L0ND 1D0XA 4QXCB 1USDA 2L9QA 2NTXA 1EZVI 2XQ5A 4BWNA 2Q9QB 3KV5A 4IDQA 3BVHA 4G63A 5CFBA 2E9XD 1OW8A 3FX0A 4K35A 3AE8C 2LSGA 4LFCT 1PPJE 5FXWA 4YJ3E 2WPSA 4HFEA 1GDTA 3U3IA 3K3OA 5H6RB 2W90A 3FWLA 5KLIC 2V4HA 3FHNA 2MOZA 1FZEA 5FKYA 5E79E 1K05A 2KK7A 1SQBG 3N9MA 4H9QC 4TX5A 3ZEFB 2KP8A 1U57A 1BR2A 1R8IA 1V9DA 2NW9A 2ZT9D 4KT0J 3CPWO 2LHNA 3PDYA 3HE5B 2Q5UA 5KJ7A 2E42A 1IJ5A 2FBWA 2C0WA 3AAIA 3I9YA 2Q9IA 4IDOA 4W7YA 4JI0T 4HE8A 2ACXA 4RJTA 3VMZA 3PTRB 1T3JA 3QUJA 2DI4A 1QUUA 4I55E 2OQQA 4ZS2A 4X20E 5ABFA 3P4SA 3L35A 2B87A 1IFDA 2KSEA 4P09A 4NUUA 1FZFA 1ZLLA 1NVOA 1YQ3A 2JR8A 5AW2B 3AEDA 2YO3A 3LFMA 3LK42 1KORA 2W83C 3BQLA 1K73Q 4UF0B 1BCCD 2ZT9C 2CXFA 2A72A 3CCRP 2WT7B 2V6YA 1N7SA 5EK4A 1SQQK 4YJ2E 4BAYB 5TISE 3ZN0B 3H1IE 3HE4A 3EDVA 3VTPC 3Q2YA 5KDMC 3M3ZB 3NFQA 4UB8E 1I6ZA 1D0ZA 2H89A 2IW5B 2E75C 3UFGA 3ZCIA 1A02J 1SQPD 3K5BA 2DCFA 2LKHA 1KNPA 3ZMSB 4QH1A 5ABHA 4PAGA 4BRYB 1L2PA 1URQD 3S1KA 3FB2A 3AECA 4QH5A 1NU1J 2VKOA 2WM9A 2QJYB 5CCHD 4WVZA 2BS4A 2M6IA 3HI2A 4LMLA 2XHEB 2N1TA 3SOLA 4PJNA 4UEMA 4HFBA 2J62A 2Y6XA 2ZLYA 3OBVE 4OK0A 1XZYA 3S4RA 4QHOA 4V1Av 4E7SA 4IL4A 1MZ9A 3GHGB 4LF5T 3CX5E 3M65A 5HXSA 1J1EB 1LT9A 1NWQA 2UUBT 1NENA 4PJJA 3O8ZA 1URQC 2BG9A 4YTPC 5CCHC 2IZ0A 1N8RQ 3VMYA 5APSA 3QNUA 5GTIE 3Q9DA 4A5XA 5AQMB 2VVSA 1VF5B 5CHXA 3RYFE 4UXNB 4LMKA 2IBZE 2EHOD 1UX4A 5KLVE 1NAYA 3WAJA 2FYUD 1UK5A 4O8SA 1NEKA 3AE4C 2WWWA 3CCSP 4F8HA 1PP9D 3ONXA 3TLWA 3ZDMA 2HN1A 5AQHB 2FY8A 2XM1A 3RKGA 5CJ5A 3T97B 2A45H 3WU2H 3L36A 3L73G 4C7NB 4WY4B 3ZYLA 3RIUA 3LIEA 3L09A 3L37A 4H63H 3AE7A 4U7IA 1FMWA 1ZEEA 3N4XA 2OYHB 3BK9A 4FI5A 3RLFF 3R2PA 2KB7P 2NPSB 4KX6A 2LSKA 3PP5A 3A5TA 3ANWA 4CXWA 2KZIA 1ZP0A 4X1YE 2N1GA 4XA4A 4JYAT 2K88A 2MBGA 3NWIA 2V7QJ 5IHYA 2HPCA 2SPCA 1Y9BA 3LK3B 2WVRA 3TNUB 2Z5IA 4GKGA 3H1KJ 2OYIB 2X0LB 2B9BA 5KAIH 3ABVC 1NTKD 2IUBA 1H0TB 2YXRB 2ES0A 4UV9B 1VOMA 1YTZI 4AQFC 3B5NA 4ZNCA 2Y9ZA 4L73A 4RESB 1EDJA 4CQIA 4JEHB 2QYWA 3QK6A 1CI6A 1USEA 3L71D 5CCGD 3ZT5A 1RQUA 3VP8A 1RE4A 3IR9A 4PJLA 2FJEA 4H44B 2XJ7A 3K8PC 4DV7T 3MUDC 5JTGA 3HUSC 1LJ2A 4O4HE 4GYRA 2XKMA 2LT3A 1L0LJ 3HD7D 5KAFE 5FY1A 1N73B 1PGOA 3TKLB 1N32T 1BE3G 1BCCE 2IMLA 1W0BA 2PFXA 1T2KC 1KFMA 1RF0C 2E76B 1E2AA 2ZYAA 2XAJB 5KMGP 4M3LA 1N33T 1BGYJ 1GL2A 3PHLA 1IK9A 3H1IG 3UT5E 1MMDA 1SQPE 1EQ7A 4AXPA 2G0UA 1ZOYA 5CBNA 5CA1E 3JAFA 2FYNB 1FZCB 4KMCA 1RF1C 3HD7C 3L74G 5HEOA 3D6YA 1GD2E 3I0OA 5F5WA 2VK9A 2P67A 1LTJB 2BBJA 2K9JA 1KQGB 2KYVA 1OVRA 3O6QA 5KLVK 4QMAA 1M62A 2X9WA 2BCCJ 3UUMA 2IBZI 4G2AA 1SA0E 3RX6A 3KXDA 5LB7B 2F4VT 2Y48B 1KB9D 3TK1A 3NVOA 2QE7H 4EEBA 4O4JE 3AE9C 3CXHD 5BR8T 4TZ4C 1NGMB 2XQ8A 4ILCA 1JY3P 5AQNB 1LGHB 3M0DC 4ILUA 4C46A 2Q9QA 4DNDA 1G1JA 3BQKA 4PD4H 2KWHA 3RL0D 1SQBD 4DJGA 4LLHA 4COFA 2E5YA 4PD4D 4LFAT 2AXTH 5APVA 2JQ9A 1DD3A 1CHUA 1WLXA 2KWIB 2FYUE 2CRBA 3SFDC 3B5MA 4YHJA 1PP9E 3E1RA 2W62A 1SFCD 1L0NG 5L3FB 3VKGA 4U2YA 1JCCA 3WU2E 3GMAA 4OGQC 2WPVB 3NZQA 1R5LA 1WCRA 3CX7B 1R8EA 5APQA 4CPGA 3ZCJA 2CPBA 1L4AB 3P32A 1XNQT 1JNRA 4PK6A 1M90Q 4YLHA 3HE5A 3RYCE 3AE5A 5FXZA 5AQQB 1QL2A 2LR2A 3CCVP 3AEDC 1QVFO 4H13D 2WZIA 3ZPOA 1KNZA 2C0XA 1NTZE 2XAFB 4JI7T 4L0RA 2CWYA 3Q3DA 1N7SC 2Z5HA 2NWBA 3FXDB 3AE1A 2BDEA 1SQVK 3RC3A 4JI5T 5AVQB 5EZYE 3AE6A 2C5JA 2NW8A 2X9YA 2WMMA 4YFSA 3AEFA 1WYCA 1FOSF 4X64T 1HWTC 5AW0B 4AQRD 5EFWB 4UF0A 1M7KA 5AFUL 3C4WA 5LNKA 1SQPK 4L76A 3L71E 2WT7A 2DWGA 5LG3A 3CVRA 1LTBC 2JQQA 3HKDE 5APXA 2FUPA 1HTLC 4NUVA 2FFDB 1IJ6A 5LG4A 1OIPA 2M67A 1NU1D 2R32A 2CBJA 2XAGB 2CE7A 3AEGA 1KV4A 2W6BA 4JLEA 5DQVA 5FVLA 1NTME 3A2AA 1M1JB 3KDPB 3H1HG 3RK3D 2LJLA 4BRYA 3RL0B 1HF8A 2XPKA 4OYKA 5AW3B 4WZXA 2RMZA 2QRXA 3CC7P 4W80A 2A2FX 1BCCG 3L70J 4O9BA 5BMVE 3C8VA 3AVSA 2ZJSE 2IAKA 4LF9T 1SFCB 3A3YB 1CSBA 1OMIA 3NXSA 4OWFA 4DR4T 1FZAA 1SQVJ 3GHGA 1GU5A 1FAVA 5CJ0A 4NIQA 4D6TJ 5FXXA 2KLQA 1ZV4X 3P4WA 3Q5WA 2ZXEB 1JCDA 2E74D 3RK3C 3H3AA 4LGDE 3TDKA 1HG5A 4H9PC 5LGUB 2A9UA 2YU1A 2L8KA 4PJMA 4JI2T 3L4FA 3L73D 2GM4A 2FYUK 1DEEG 3UU8A 1HNXT 3QC9A 5F8PA 2WDRA 1MFTA 3H1JJ 3IFMA 2JWAA 5EK3A 4PV1C 1KB9E 2KIKA 3G9RA 5AVXB 3AEBA 1U5PA 3CXHE 2YO2A 3UIAA 1S4XA 5AW4B 1A02F 3N5LA 3KHUA 2OTLP 2C9LY 2IYPA 1ZV8A 3T97A 2YDRA 4C7NA 4WY4A 3CX8B 4ASVA 1S72P 4YSYA 2E74C 2WQYC 4ILAA 2V7QH 1HUCA 1SQBE 1WR6A 1NTZK 4PD4E 3HRNA 2OYHA 2QGSA 5JRCB 3T8OA 2NPSA 3JCUE 2AXTE 1KQSO 3ZYMA 4H63V 2FJBA 1MMGA 4I43B 3U78A 1KILD 2C0SA 4HFHA 4O4IE 3HR0A 2W4XA 2WCAA 4GYSA 1AVOA 3IN6A 3ZT6A 2X51A 1CZQA 1DEBA 4ZHQE 3TNUA 1PP9G 1SHZC 2OYIA 3ZMUB 2KZ7B 5AVZB 1IZNB 1KC8Q 2IDOB 3BCCG 3DTOA 3UFEA 1UUSA 2YKQA 2C5KT 2DWKA 1H0TA 3KINB 5APTA 2JIWA 4IDNA 4B3RT 2E5VA 1WFDA 4DT0A 3H25A 2J4GA 4AKLA 1JTHB 2WWUA 1IFIA 1NTMK 1SP4A 3OA7A 2RP4A 1L0LD 2PFVA 1HX1B 2N9BA 5DJQC 4DV3T 2W2UA 4QX7B 4JBWF 5HCJA 1HNWT 5FXVA 4DV6T 1FU1A 1E5WA 4IE7A 4HKZH 4Y99C 1NTKG 4TLFA 2IHR1 3L72J 5AW9B 4X1KE 1N73A 1WYBA 1OEDB 2W67A 1KMIZ 2I1KA 1S5LH 1J1DC 1SQXG 2XU6A 4PK4A 3L74D 2ZM2A 1EXIA 2EHOA 2YINA 5DABA 2E43A 3ZN1B 1YJWP 4GIWA 1NU1E 1OW7A 3CIRA 3MKDA 5F3JA 4N3YB 4ASKA 2OGUA 2ZM0A 2FXPA 2X9HA 4PJ0H 3L3PA 4CI2B 4ZZCA 5JDHA 4EZHA 3GF7A 2R3SA 5DJTB 3UU6A 1FZCA 1ZR2A 3MACA 5IWAT 4IDPA 3AA0B 4ZOLE 4AUWA 5AVWB 5BU5A 2K5BB 2NR4A 4E7ZA 1LTJA 1GW4A 3RQWA 4HWFA 4DZOA 1KILB 3MIWA 3RYIE 4EEDA 1KB9I 4NPPA 4U7JA 1MV8A 3PUSA 3SFEC 5TJHA 5L2LA 3CXHI 3MK7C 3I1AA 1LWUB 2IFNA 2O01J 3JC6C 2LSJA 4DUYT 3OYZA 3ZSSA 1SQBK 5H6QB 1AVYA 1EXJA 5KKZB 3PU8A 3T1HT 3CLQA 1S35A 4PD4I 3UU4A 3KDSE 3L73E 1Z56A 2V7JA 4JUYA 4A7PA 3RKOA 1JOCA 2WDVA 1T72A 4LF4T 1OEDE 1OX3A 5CCGA 2PRRA 4DCKA 2LXBA 4R4LA 1N7LA 1KQFB 1VQPP 3M06A 2NP9A 2K37A 2QJKC 3EAMA 4JI3T 3TYYA 3F31A 3RC8A 5J1GA 2CLYB 1FIOA 2LSYA 2JO1A 3Q5SA 2KOGA 1M7LA 2X0YA 4HWHA 3D71A 1VCTA 4U33A 1L4AA 1ZRTD 3V6IA 3OW2O 2JKVA 3TLSA 4U7YA 4HH2A 1P84H 4KHXA 1KILE 4EAHA 1RQVA 1HGZA 1P84D 4DBQA 1BR4A 5EK2A 3KV6A 1J1JA 1HVVA 3EFFK 3FXDA 1LTIC 4PFOA 5J0ZA 3CCJP 2RA1A 2WSFJ 1JY2N 2CK3H 2E75D 2SPZA 2Y0CA 1VQMP 1XDPA 5HXRA 3USSA 1X0TA 3IF4A 1OWAA 4L9IA 3CCUP 1FEWA 3H6PA 2CEAA 2WY2A 5HXCA 3H1HD 4IL6H 1BE3E 2WWVA 4ASWA 2BBHA 1U7JA 3TSIA 3A0BH 2JQKA 3G3ZA 2KLUA 3TLVA 3W68A 2FKWB 2P10A 2AEJA 5KLIB 1FS0E 3L75J 2FFDA 5LJNA 5AQGB 2Z4EA 1E7PA 2VB6A 1GK4A 2XQ7A 4IT4A 3BATA 3L70D 2V5DA 1M1JA 2LE8A 1G1IA 3RIAA 2IIUA 2E9XB 4KUMB 3L74E 5L3DB 1S5LE 3CWBJ 3HTKB 2H88C 5FVKA 2XTLA 4NPEA 2V6XA 3W15B 3AE2A 1YTZT 2PTFA 4D6TD 1SFCA 4L74A 2LM2A 3O9XA 1KD1Q 2XNXA 1E1HB 2ZXXA 2BEQD 1NU1G 1HTJF 3UTKA 1S94A 4PJ0E 4ZXLA 4WWIA 2YKPA 4HEAA 1FMVA 4LFBT 1J2JB 1MFZA 1LVKA 2NZ2A 2WTYA 4IE4A 3H1JD 1IBLT 4EXTA 2ZT9B 5LBMA 4DV4T 3PV0F 3IAOA 2PAJA 2HYNA 2KNCB 3TF5A 3TLTA 4YY3T 1SQQJ 4QX8B 3N7NA 4YXDA 2YMYA 1S2EA 2YDQA 3FBZA 5C3JA 2NPSC 2HN2A 3D0TA 4DMWA 2VL8A 2WZ7A 5CBOA 3EABA 3KBTA 2O1JA 2R5BA 1AJ3A 2M3EA 3I0QA 3ZMVB 3PLNA 2BASA 4YHHT 3C64A 4ISSA 1VQ7P 2B89A 2YIUC 1L0NE 3N9LA 1WRGA 3TGUJ 2UU9T 1GU4A 3OVUA 4GIFA 4N6JA 2WAUA 5JDFA 2JMKA 4U3FJ 1X9BA 2XAQB 3BCCD 1IFJA 5JRCA 3ZC1A 3RHWA 4DV0T 3MZWB 3ZJ1A 1XNRT 1KYOH 2V8SV 2MAWA 4K0KT 3M91A
chains in the Genus database with same CATH topology
5LHHB 2X68A 4H9NC 4OYJA 5ADXL 3SWYA 1MNEA 5A1LA 4JYCA 1URQB 4LC1A 1NKNA 1XTCC 3SS1A 3H32B 4B86A 1VPCA 1N73C 4M1PA 1YD8G 5JR9C 1T2KD 3UUXB 3C50A 3WI3A 1JTHA 2H7HA 1S9KD 2X67A 4TV8E 2PG8A 1RE3A 3R84B 2WPRA 3LW5H 5DQWA 5APYA 4KBMB 4QXBB 4ZS3A 5CA0E 1FZCC 4AKGA 3I5CA 3VN0A 1FZBA 3M9QA 3V2RA 5LBQB 3CI9A 3E1IA 4ERRA 2EHOB 3GA8A 3R6NA 5IYZE 4ZKPA 3ZYKA 3VMXA 4XE5B 1IJDB 5HWXA 4IE6A 2O01H 4ADZA 1KILA 4WNKA 3P7KA 3SWHA 2V7KA 2CCQA 2P9BA 4MLKA 3KFWX 1L0NK 1LWUA 2M3BA 1NO4A 3P8CD 3HUSB 3ZC0A 1VRBA 2OARA 2JJLA 1MIYA 3K3NA 1NOHA 4XBFB 4UV8B 5FYMA 5AW6B 3PU3A 1AQ5A 3VP9A 4ZI3C 1L4AC 4QKNA 2BZBA 3C4ZA 2D5UA 3ZLIA 2J58A 1GK6A 2XASB 3AVRA 5KJ7C 5FNVE 1N7SD 4WBNE 1RF1B 1MUUA 4HYTB 3HD7B 4CI1B 3IBPA 2ODUA 2XQYA 2OA5A 2E8IA 3VKHA 1JY3O 3RYHE 3CQCB 2V7MA 3AAAB 1JNMA 1LTTC 2N1TD 1FBMA 2V26A 1H7CA 2BVLA 2Y8DA 3BRVB 1QL1A 1NWMX 1FZGA 1QSDA 1M1JC 4H9SE 5LGNB 1S9KE 2LOSA 2BVMA 1VDFA 1ZKEA 2N1TC 1AFOA 3HKBE 3N9OA 4EYUA 2YNYA 2WBLA 4GK5E 3RRWA 2IFMA 5LOVE 2XUEA 2E9XA 3OKQA 3CQXC 3SRZA 3HTKA 3A5XA 1T8ZA 3EFGA 5JQGE 1LT9C 1G2CB 1IFMA 5AVSB 3M0AA 3U59A 4IGUA 1YW0A 2JMHA 2C5IT 1WRDA 5AVYB 3B8EB 1DX7A 5AW1B 4DOJA 1ZR4A 2O1KA 4L5GA 4N78D 2JRKA 2YU2A 1HS7A 3P8CE 4IDZA 2XAHB 3NTNA 4X1IE 4HKAA 3B5ND 4AKRB 3CWZB 2VKDA 4J2CA 4CZZB 3A7OA 3FXEB 2JEEA 3B57A 1FOSE 2A45I 1NKZB 4I2LC 4IFDK 4PFPA 2KSJA 1YKEB 1JY2P 3C9IA 2NW7A 2WMOA 3V4WA 1FJPA 2W6AA 2ZM8A 1W2EA 4DMVA 4MHCA 1NTKK 2HH7A 4O2AE 3B5NC 2GUSA 4C90A 3RK3B 5KTBA 1URQA 1SQXK 3V5UA 3O1IA 1RY3A 3VYIA 1KZUB 5CCHA 1RE4C 3H32A 2M8RA 3C98B 3H37A 3RK2C 1JO5A 3CQGB 2Z6EA 3EVYA 3CMLA 2D0TA 4A56A 4TV9E 3KQGA 3ESLA 1GL2C 2X66A 1MNDA 1X79B 4OHFA 4OFZA 3V2PA 3OAKA 2W0GA 3M9BA 3GWHA 2HFED 4UELA 3S4UA 5APUA 1G73A 3MA9A 5LHIB 3AA7B 4CXYA 3JC6D 2NTYA 1B7TA 4I4TE 3KPEA 2HODB 3OYXA 4BA9A 2KXPB 2KT9A 3J7Yq 2CA5A 3N2GE 2Q9QC 1XTGB 3MUDA 2DNXA 3HUSA 2H7OA 3O1HA 4Y99B 4C7RA 1UCUA 4CI3B 3CPZA 1HH0A 5JDGA 3UULA 1J1DB 1RF0A 2KMFA 5HXHA 3C51A 5BVZA 4HN9A 2HLOA 1SVFA 1X8YA 2CXLA 2WPQA 3WMM0 2GUVA 1KFNA 1H8AA 1LRZA 3N2OA 2YEVC 3E0ZA 2XZRA 5LYJE 4U74A 5LJMA 3CX6B 1RF1A 1MIWA 3HD7A 1MIVA 3AAEB 1Z0PA 2IX7C 4AYCA 3LIDA 3BRTB 3ZMTB 2WMNA 2K9AA 1H88A 3N2KE 3PUAA 1HCIA 4MALA 2VKJA 3KVBA 2W00A 3M0DA 3EDUA 4C91A 1X9VA 2LOPA 5TAOA 3K3QC 2P7JA 3N9NA 3NRYA 3RPUA 1ZN5A 2E9XC 3ETUA 1NU1K 3KVAA 4MFRA 4EZ4A 1HFAA 4JF7A 1LTSC 3OJAB 3RH3A 1D1AA 4I6MC 3ZMZB 3HL6A 2JPFA 3GHGC 4QXHB 4ZI7E 4UIGA 2HPLA 3KBUA 2MYSA 1HJBA 4AI6A 1J1EC 4WY4D 1G2CA 4JYBA 4HFVA 1WT6A 4HTEA 1ZHCA 5JDNA 2JJ9A 2KNDA 3P7IA 4B6XA 2NPSD 1DH3A 4ZKUA 3IHRA 5FY0A 2K48A 4DO0A 3N9QA 1Y64B 1JMMA 4OH8B 2L5GB 4WY4C 1MMNA 2IC6A 2OYHC 3J9X1 3SWFA 2CWOA 2CM0A 3V5SA 2W61A 4I1LA 4DVDA 5APWA 4W7ZA 2OYIC 3ETVA 4JEUB 2DHRA 4IE0A 2UXNB 3MD0A 5AVRB 1JUNA 1O3XA 5JH7E 5LCYA 2X9XA 1UX5A 2V1DB 2K24A 5KX5E 2R3CA 1HGVA 4EOZB 4BJMA 3LK2B 3LG7A 4GK0E 2MTQA 2Q3IA 5L3EB 5AVVB 5AW8B 5AW7B 1D1BA 1NHLA 1L0LK 3V2NA 4IHJE 3CKDA 4H9OC 2LSIA 4XAXB 5L3GB 1N2DC 3FBLA 5FP3A 3VU7H 2EHOC 4Z8XA 3F57A 2KINB 3I9WA 3PURA 5HYAA 2LHRA 1HBWA 2CXDA 1X79A 4IIJE 2H43A 3VOPA 3PUGA 2N9DA 3NMDA 4GT1A 2UXXB 2VWAA 2I1JA 1LTJC 4TN7B 2D0UA 3MZKB 1T3UA 2HODA 2IPPA 4PK5A 3GN5B 1CUNA 2VKHA 3HA4A 2ZMAA 5JR9B 4ZI3D 1EZ3A 2GK9A 4KP3C 2H8PD 4ZI2D 1L4AD 3KYQA 3IF8B 1N86A 3LBXB 5CCGC 1LTAC 4UVBB 2MJZA 5KJ7D 1D1CA 1GZLA 5CJ4A 1D0YA 3VHLA 4EIJA 4QWNB 2FYZA 5C8YE 5JDQA 3MGNA 5CMZA 2POHA 2W63A 3RRCA 5JDLA 1IO4A 4ZI2C 5HXEA 1H89A 2H3RA 5AVUB 2CPSA 1HG2A 1IFNA 4WB4A 2WSEH 3AA6B 3WAKA 3NRXA 4O2BE 5LGTB 1FDMA 1SLQA 2L3LA 5AVTB 1G8XA 2WSFH 4U72A 3ZJ2A 2ODVA 2FXMA 4H9RC 5JREA 4CXXA 1MMAA 2FFDC 3PE0A 3DJBA 3BQIA 1BR0A 5FY7A 2A3DA 4P0AA 3RL0C 3DP7A 1LKXA 3V2QA 5JVDE 2J59M 4ANJA 3GMIA 4IE5A 5L3BB 3OJAA 1KK7A 4GOUA 1SFCC 1BR1A 2V7LA 4AQGA 3U1AA 3NZPA 1YYCA 2Q7CA 4IFMA 1HX8A 5FMNA 4AKHA 5GONE 5JDMA 5LXTE 1N7SB 4P0BA 3AB3B 5L3CB 3HE4B 4EIWA 4EYYR 3CL3D 3C4XA 2WITA 2WSCH 3B13A 3E08A 2D2SA 2PP6A 4WW0A 2HG5D 2QM7A 2ZFCA 1T98A 2N1TB 2XDJA 3KV4A 1LTGC 2B1EA 3V5BA 3O1JA 2P1JA 2DLRA 3U1CA 4HGAA 2W27A 5J2TE 1US7B 2LEHA 4BJNA 3IEEA 2V7IA 1GW3A 1CW5A 1LT9B 3RK2D 2QA7A 4I50E 5ETWA 5HAXA 2CMRA 1FJKA 2PJQA 2LM9A 5J2UE 3EUHA 2VRSA 3PUQA 3KV9A 1GL2D 3BASA 2N2NA 5CB4E 1RE3C 1U4QA 2H7VC 2LKMA 2NOXA 2HPJA 4WBAA 3LJCA 1JY2O 3ANWB 1JY3N 4UVCB 2YKOA 2HPCB 4K0UA 3Q2MA 2A45G 4MBQA 4EOTA 1NAFA 5LA6E 2KLVA 4IFFA 2R5DA 3B5NB 1GTWA 2XV5A 2Q9QD 1KILC 2PBIA 1CI6B 3MJXA 2IC9A 1PFIA 3RK2B 3UUNA 1LWUC 3M9HA 3AA1B 3GN5A 4FJOA 5JR9A 3HKEE 3NBXX 3P8MC 5LP6E 3EQ2A 4ISTA 4AQFA 4XZCA 2QM8A 4PW8A 4PNIA 5BU8B 5AW5B 3V4QA 5HWYA 3LBXA 3F2EA 4EB6E 3Q5XA 5M4YA 1GL2B 2C9NY 3E22E 3O4XE 1IAPA 3HKCE 2CLYC 2WSSV 2I59A 4UVAB 4N78E 1YKHB 5E0OA 4DBRA 4O4LE 4WBOA 1IC2A 2P2UA 1OXZA 1LVFA 4F6RC 2YK0A 2J1DG 3N9PA 3II6A 1NH4A 3MXZA 5LHGB 3MTUE 4TUYE 1KQLA 2VASA 4AKIA 1D0XA 4QXCB 2L9QA 2NTXA 2Q9QB 3KV5A 3BVHA 4G63A 2E9XD 2LSGA 5FXWA 4YJ3E 2WPSA 1GDTA 3U3IA 3K3OA 5H6RB 3FHNA 2MOZA 1FZEA 3N9MA 4H9QC 4TX5A 3ZEFB 2KP8A 1BR2A 1V9DA 2NW9A 2LHNA 3PDYA 3HE5B 2Q5UA 5KJ7A 2E42A 1IJ5A 2C0WA 3AAIA 3I9YA 2Q9IA 4W7YA 4HE8A 2ACXA 3VMZA 3PTRB 1T3JA 3QUJA 2DI4A 1QUUA 4I55E 4ZS2A 4X20E 3L35A 4P09A 1IFDA 4NUUA 1FZFA 1ZLLA 5AW2B 2YO3A 3LFMA 3LK42 3BQLA 4UF0B 2CXFA 2A72A 2WT7B 1N7SA 5EK4A 1SQQK 4YJ2E 4BAYB 3ZN0B 3EDVA 3HE4A 3VTPC 5KDMC 3NFQA 1D0ZA 2IW5B 3ZCIA 1A02J 2DCFA 3ZMSB 4PAGA 1URQD 3FB2A 2VKOA 2WM9A 5CCHD 3HI2A 2XHEB 2N1TA 3SOLA 4PJNA 4UEMA 2Y6XA 2ZLYA 3OBVE 4OK0A 4QHOA 4V1Av 4E7SA 1MZ9A 3GHGB 3M65A 5HXSA 1J1EB 1LT9A 1NWQA 4PJJA 3O8ZA 1URQC 5CCHC 3VMYA 5APSA 3Q9DA 5CHXA 3RYFE 4UXNB 2EHOD 1UX4A 3WAJA 4O8SA 2WWWA 3ONXA 2A45H 3L36A 4C7NB 4WY4B 3ZYLA 3LIEA 3L09A 3L37A 4H63H 1FMWA 1ZEEA 3N4XA 2OYHB 3BK9A 4FI5A 3R2PA 2KB7P 2NPSB 2LSKA 3PP5A 3A5TA 3ANWA 4CXWA 4X1YE 2N1GA 4XA4A 2MBGA 5IHYA 2HPCA 2SPCA 3LK3B 3TNUB 2Z5IA 4GKGA 2X0LB 2OYIB 2ES0A 4UV9B 1VOMA 1YTZI 4AQFC 3B5NA 4RESB 4CQIA 4JEHB 3QK6A 1CI6A 5CCGD 3VP8A 1RE4A 3IR9A 4PJLA 3K8PC 3HUSC 4O4HE 4GYRA 2XKMA 2LT3A 3HD7D 5FY1A 1N73B 3TKLB 1T2KC 1KFMA 1RF0C 2XAJB 5KMGP 4M3LA 1GL2A 1IK9A 3UT5E 1MMDA 1EQ7A 4AXPA 2G0UA 5CA1E 4KMCA 1FZCB 1RF1C 3HD7C 1GD2E 3I0OA 2VK9A 2P67A 1LTJB 2KYVA 5KLVK 2X9WA 3UUMA 4G2AA 1SA0E 3RX6A 2Y48B 3TK1A 4O4JE 4TZ4C 1JY3P 1LGHB 3M0DC 4ILUA 4C46A 2Q9QA 4DNDA 1G1JA 3BQKA 2KWHA 3RL0D 4LLHA 5APVA 1WLXA 2KWIB 4YHJA 2W62A 1SFCD 5L3FB 3VKGA 1JCCA 3NZQA 3CX7B 5APQA 3ZCJA 2CPBA 1L4AB 3P32A 4PK6A 4YLHA 3HE5A 3RYCE 5FXZA 1QL2A 3ZPOA 1KNZA 2C0XA 2XAFB 4L0RA 2CWYA 1N7SC 2Z5HA 2NWBA 3FXDB 2BDEA 1SQVK 3RC3A 5AVQB 5EZYE 2C5JA 2NW8A 2X9YA 4YFSA 1WYCA 1FOSF 1HWTC 5AW0B 4AQRD 4UF0A 5AFUL 3C4WA 5LNKA 1SQPK 2WT7A 2DWGA 3CVRA 1LTBC 2JQQA 3HKDE 5APXA 1HTLC 4NUVA 2FFDB 1IJ6A 5LG4A 2M67A 2R32A 2XAGB 2CE7A 2W6BA 4JLEA 5DQVA 3A2AA 1M1JB 3KDPB 3RK3D 2LJLA 3RL0B 1HF8A 4OYKA 5AW3B 4W80A 2A2FX 4O9BA 5BMVE 3AVSA 2IAKA 1SFCB 3A3YB 1CSBA 3NXSA 1FZAA 3GHGA 1GU5A 1FAVA 5CJ0A 5FXXA 2KLQA 1ZV4X 3Q5WA 2ZXEB 1JCDA 3RK3C 3H3AA 4LGDE 1HG5A 4H9PC 5LGUB 2YU1A 2L8KA 4PJMA 3L4FA 2GM4A 2FYUK 3QC9A 5F8PA 3IFMA 5EK3A 5AVXB 1U5PA 2YO2A 3UIAA 5AW4B 1A02F 3N5LA 2C9LY 1ZV8A 3T97A 4C7NA 4WY4A 3CX8B 1HUCA 1WR6A 1NTZK 3HRNA 2OYHA 2QGSA 5JRCB 3T8OA 2NPSA 3ZYMA 4H63V 1MMGA 4I43B 3U78A 1KILD 2C0SA 4O4IE 3HR0A 4GYSA 2X51A 1CZQA 1DEBA 4ZHQE 3TNUA 1SHZC 2OYIA 3ZMUB 2KZ7B 5AVZB 1IZNB 3UFEA 3DTOA 2C5KT 2YKQA 2DWKA 3KINB 5APTA 4AKLA 1JTHB 2WWUA 1IFIA 1NTMK 1SP4A 3OA7A 2RP4A 2PFVA 2N9BA 5DJQC 4QX7B 5FXVA 1FU1A 1E5WA 4IE7A 4Y99C 4X1KE 5AW9B 1N73A 1WYBA 2I1KA 1J1DC 2XU6A 4PK4A 2ZM2A 2EHOA 2YINA 5DABA 2E43A 3ZN1B 4GIWA 3MKDA 5F3JA 4N3YB 4ASKA 2ZM0A 2X9HA 3L3PA 4CI2B 5JDHA 4EZHA 1FZCA 1ZR2A 3MACA 3AA0B 4ZOLE 4AUWA 5AVWB 5BU5A 2K5BB 4E7ZA 1LTJA 1GW4A 4DZOA 1KILB 3MIWA 3RYIE 1MV8A 3PUSA 5L2LA 3MK7C 3I1AA 1LWUB 2IFNA 3JC6C 2LSJA 3OYZA 1SQBK 5H6QB 3PU8A 3CLQA 1S35A 3KDSE 2V7JA 1Z56A 4JUYA 3RKOA 1JOCA 5CCGA 1N7LA 3M06A 2NP9A 3TYYA 3F31A 3RC8A 5J1GA 2CLYB 1FIOA 2LSYA 2KOGA 1M7LA 1L4AA 4HH2A 4KHXA 4EAHA 1HGZA 4DBQA 1BR4A 5EK2A 3KV6A 1HVVA 1LTIC 4PFOA 2RA1A 1JY2N 5HXRA 1OWAA 4L9IA 1FEWA 3H6PA 2CEAA 5HXCA 3TSIA 3G3ZA 2FKWB 2FFDA 5LJNA 2Z4EA 2VB6A 1GK4A 3BATA 1M1JA 2LE8A 1G1IA 2E9XB 4KUMB 5L3DB 3HTKB 2XTLA 3W15B 1YTZT 1SFCA 3O9XA 2XNXA 1E1HB 1HTJF 3UTKA 1S94A 2YKPA 4HEAA 1FMVA 1J2JB 1MFZA 1LVKA 2WTYA 4IE4A 4EXTA 5LBMA 2PAJA 2HYNA 4QX8B 3N7NA 2YMYA 3FBZA 2NPSC 3D0TA 4DMWA 2VL8A 2WZ7A 3KBTA 2O1JA 2R5BA 1AJ3A 3I0QA 3ZMVB 2BASA 3C64A 4ISSA 3N9LA 1WRGA 1GU4A 4GIFA 4N6JA 2WAUA 5JDFA 2JMKA 2XAQB 1IFJA 5JRCA 3ZC1A 3ZJ1A 3M91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXZ A;  1A02 J;  5AVS B;  3M0A A;  1H88 A;  5AW6 B;  1U4Q A;  4RES B;  1HCI A;  3FB2 A;  1CI6 A;  1KQL A;  4JYC A;  3LBX B;  3IR9 A;  5AVY B;  3B8E B;  4LC1 A;  5APQ A;  5APW A;  5AVX B;  3P32 A;  3M0D A;  5AVW B;  4AUW A;  5AW1 B;  1U5P A;  1YYC A;  2YO2 A;  3OAK A;  2Q7C A;  5AW4 B;  3UIA A;  1A02 F;  3HE5 A;  3M9B A;  2C9L Y;  4DZO A;  1GK6 A;  1GZL A;  3MD0 A;  1GK4 A;  5APU A;  5AVR B;  3T97 A;  4B86 A;  1JUN A;  4C7N A;  2P7J A;  1MV8 A;  1T2K D;  1MUU A;  3MGN A;  4HYT B;  2R3C A;  1T2K C;  1HUC A;  2H7H A;  2Z5H A;  2ODU A;  4EOT A;  5CMZ A;  1S9K D;  2WPS A;  3HE4 B;  3NTN A;  1NWQ A;  4M3L A;  2Q3I A;  1NAF A;  5AVQ B;  3O8Z A;  5AVV B;  1IO4 A;  5AW8 B;  5AW7 B;  2R5D A;  2WPR A;  3A7O A;  1GTW A;  3VMY A;  5APS A;  1S35 A;  1FOS F;  1H89 A;  2XV5 A;  5APY A;  1HWT C;  1FOS E;  5AW0 B;  4AQR D;  4I2L C;  1CZQ A;  1OWA A;  5AVU B;  4I6M C;  2QM7 A;  3TNU A;  1JNM A;  1CI6 B;  3M91 A;  2ZFC A;  2WT7 A;  3I5C A;  5AVZ B;  3VN0 A;  3M06 A;  2KP8 A;  5APX A;  3UUN A;  1GD2 E;  3M9H A;  1J2J B;  3V5B A;  1MFZ A;  2P67 A;  3V4W A;  3TYY A;  1SLQ A;  3HE5 B;  2Q5U A;  2WWW A;  2WTY A;  1HJB A;  5AVT B;  2E42 A;  2R32 A;  3P8M C;  2W6A A;  5APT A;  3F31 A;  4JYB A;  3UUL A;  2QM8 A;  3UUM A;  3L36 A;  4C7N B;  3A2A A;  3KDP B;  2W27 A;  3LIE A;  3VMX A;  5AW5 B;  3L37 A;  3VMZ A;  5AW3 B;  1HBW A;  3V4Q A;  4XE5 B;  1SP4 A;  3TK1 A;  3LBX A;  1X8Y A;  1S9K E;  1QUU A;  2ODV A;  2N9B A;  2WPQ A;  1DH3 A;  3VYI A;  3L35 A;  1H8A A;  3A5T A;  2R5B A;  1AJ3 A;  3NMD A;  2C9N Y;  2BAS A;  4GT1 A;  2XZR A;  5AW2 B;  4KHX A;  4C46 A;  3A3Y B;  2YNY A;  5AW9 B;  1CSB A;  2YO3 A;  3P7K A;  2SPC A;  3PE0 A;  3NXS A;  3TNU B;  1GU4 A;  2Z5I A;  1GU5 A;  4GKG A;  2WT7 B;  1FAV A;  2XU6 A;  5APV A;  4AYC A;  2VRS A;  3HE4 A;  3HTK A;  2IPP A;  3LID A;  2ZXE B;  3VTP C;  2E43 A;  3EDV A;  1WLX A;  1CUN A;  2JJL A;  3NFQ A;  3SWF A;  3KQG A;  1G2C B;  2P2U A; 
#chains in the Genus database with same CATH topology
 1KYO D;  5LHH B;  4OVN F;  2X68 A;  4H9N C;  5B5E H;  2ZM6 T;  4OYJ A;  2FJA A;  1K04 A;  2W6J H;  5ADX L;  3SWY A;  3P4R A;  1MNE A;  5A1L A;  4JYC A;  1URQ B;  4LC1 A;  1VQ6 P;  5KXJ A;  1NKN A;  1XTC C;  1ZRT E;  2QJP B;  3SS1 A;  3AEA A;  3H32 B;  5AQS B;  3GG2 A;  2G3A A;  4B86 A;  1VPC A;  2A06 G;  1N73 C;  4M1P A;  3RGL A;  2AXC A;  1YD8 G;  1T2K D;  2D2C C;  5AQT B;  5JR9 C;  3UUX B;  1P84 E;  3C50 A;  5K5G B;  3MP7 B;  3H1K G;  1SQX D;  3WI3 A;  1JTH A;  2E76 C;  4YXW H;  1QEX A;  5HEJ A;  2H7H A;  1S9K D;  1Q2N A;  5FL1 A;  2Q6Q A;  2X67 A;  4TV8 E;  5HCM A;  2PG8 A;  1RE3 A;  2K1A A;  4K3A A;  3R84 B;  2WPR A;  3LW5 H;  4EI2 A;  5DQW A;  5APY A;  4KBM B;  3H1H E;  3SSU A;  3L39 A;  1OED A;  3R4Y A;  4QXB B;  4GKK T;  1N34 T;  4LF8 T;  4IL6 E;  4ZS3 A;  5CA0 E;  3VR8 A;  1FZC C;  4AKG A;  3I5C A;  3VN0 A;  1FZB A;  2CHN A;  3M9Q A;  3V2R A;  5LBQ B;  3CI9 A;  3E1I A;  4ERR A;  2EHO B;  3GA8 A;  1L0L G;  3R6N A;  5IYZ E;  1Y01 A;  4RO0 A;  1QX8 A;  4ZKP A;  1WR0 A;  3D6Z A;  3ZYK A;  3VMX A;  1Y47 A;  3JC2 2;  4GDO A;  3CX5 I;  4XE5 B;  5L4E A;  1IJD B;  1BGY G;  5HWX A;  4IE6 A;  2O01 H;  3JSV C;  1OZH A;  4H0L D;  2RN0 A;  1KIL A;  4ADZ A;  4CN1 A;  4WNK A;  3P7K A;  3SWH A;  4KHP T;  4DV2 T;  1YIT P;  2CCQ A;  2V7K A;  2P9B A;  4YSX A;  5L47 A;  4LF6 T;  4MLK A;  3PUY F;  3KFW X;  1L0N K;  3RBX A;  1LWU A;  2M3B A;  1NO4 A;  3GLM A;  3P8C D;  3HUS B;  1XMQ T;  2K3W A;  3B4S A;  3ZC0 A;  5L8R J;  1VRB A;  3FWN A;  2OAR A;  4I7Z C;  2JJL A;  1MIY A;  3K3N A;  4HWC A;  4CN6 A;  3AEE A;  1NOH A;  3VRB A;  4XBF B;  2BCC G;  4UV8 B;  5AQO B;  5FYM A;  5AW6 B;  3H1L J;  4OGQ D;  1AQ5 A;  3PU3 A;  3VP9 A;  1IBM T;  4ZI3 C;  3H3M A;  3X1D A;  4H0L C;  3AE3 A;  3GW6 A;  1KTM A;  1L4A C;  1FDI A;  2ZYD A;  3G4S P;  4QKN A;  2YXQ B;  4U3C A;  2DL1 A;  1Q7Y Q;  4A98 A;  1PZQ A;  2BZB A;  3C4Z A;  2D5U A;  3ZLI A;  2J58 A;  1GK6 A;  2XAS B;  3AVR A;  5KJ7 C;  5FNV E;  2FBW C;  1N7S D;  4WBN E;  1RF1 B;  1MUU A;  4HYT B;  3HD7 B;  4UB6 H;  4CI1 B;  3IBP A;  2XQ3 A;  2ODU A;  2XQY A;  2OA5 A;  1K8A Q;  3BCC E;  2LLY A;  1Q90 D;  2E8I A;  5DJU B;  2OV9 A;  3VKH A;  2OTJ P;  5KLV J;  1JY3 O;  3RYH E;  1KYO E;  3CQC B;  1EZV D;  3PH0 A;  2V7M A;  3AAA B;  1JM0 A;  3Q5P A;  4CN4 A;  1YQ3 C;  4YT0 A;  1JNM A;  1LTT C;  2N1T D;  1FBM A;  2V26 A;  2IDB A;  1H7C A;  2XZE A;  2BVL A;  2L91 A;  2Y8D A;  3BRV B;  1W9R A;  4JI1 T;  1PIX A;  3EI0 A;  1JNZ A;  1NTK E;  5KAI E;  1QL1 A;  1NWM X;  3ONL C;  1FZG A;  1QSD A;  1FE6 A;  1VQL P;  1M1J C;  3AE8 A;  2H89 C;  4H9S E;  3UU5 A;  1SQX E;  5LGN B;  2CHO A;  1S9K E;  2J5U A;  3AEC C;  5AQJ B;  2LOS A;  2BVM A;  2ZYG A;  1UII A;  1VDF A;  1ZKE A;  4TWF A;  2N1T C;  1AFO A;  3HKB E;  3N9O A;  3ONJ A;  4EYU A;  2CBI A;  2YNY A;  3CWB D;  1OVV A;  2WBL A;  1OVU A;  4GK5 E;  3RRW A;  2IFM A;  5LOV E;  2XUE A;  1EC5 A;  2E9X A;  3OKQ A;  3CQX C;  3SRZ A;  3HTK A;  4YTN A;  3A5X A;  4B3S T;  1T8Z A;  3EFG A;  5JQG E;  1LT9 C;  3G06 A;  1G2C B;  3CC2 P;  3CC4 P;  1IFM A;  5AVS B;  3M0A A;  2FJD A;  1OW6 A;  2BG9 C;  3U59 A;  2AE9 A;  4PV1 D;  3G6E P;  4IGU A;  1YW0 A;  2JMH A;  2C5I T;  2QA4 P;  1WRD A;  5AVY B;  3B8E B;  3L70 G;  1DX7 A;  5AW1 B;  4DOJ A;  1ZR4 A;  1EDL A;  1SQQ D;  4JI4 T;  4JQ0 D;  2MPK A;  2O1K A;  4L5G A;  4N78 D;  2KNC A;  1SQV G;  1SQP J;  2BKN A;  2JRK A;  2YU2 A;  3A7M A;  3UQ4 A;  5HEU A;  1HS7 A;  1BDD A;  4H13 B;  4D6T G;  3UQ7 A;  3RIU C;  3P8C E;  4IDZ A;  2XAH B;  3NTN A;  4X1I E;  3AE7 C;  4HKA A;  2VUR A;  3B5N D;  4AKR B;  2XND H;  3CWZ B;  3A0H H;  1FDO A;  2VKD A;  4J2C A;  4U3F D;  4CZZ B;  4DR1 T;  3A7O A;  3FXE B;  1ZP0 C;  2JEE A;  3B57 A;  2B88 A;  1FOS E;  2A45 I;  3CME P;  2UXC T;  1NKZ B;  4I2L C;  4IFD K;  3H1J G;  1VQ5 P;  4PFP A;  2KSJ A;  1S5L X;  1YKE B;  4P1N A;  2AEM A;  1L0V A;  1JY2 P;  3C9I A;  2JDI H;  1HNZ T;  2NW7 A;  2WU5 A;  2WMO A;  3RI5 A;  3V4W A;  3AEA C;  1DD4 A;  1FJP A;  1AV1 A;  2W6A A;  2ZM8 A;  1W2E A;  2VQE T;  2A06 D;  3G71 P;  3AXJ B;  4MN4 C;  4KHZ F;  4DMV A;  4MHC A;  1NTK K;  2HH7 A;  3H1K D;  4O2A E;  3B5N C;  4TWD A;  2GUS A;  1SUM B;  4C90 A;  5FL0 A;  4UB6 E;  3RK3 B;  5KTB A;  1URQ A;  2QG4 A;  2XQ9 A;  1SQX K;  3O1I A;  3V5U A;  1RY3 A;  3VYI A;  1BDC A;  1KZU B;  5CCH A;  5HEG A;  1RE4 C;  4YTP A;  2RKL A;  3CK6 A;  3H32 A;  1GMJ A;  2M8R A;  3C98 B;  3H37 A;  3RK2 C;  2FYU J;  4DID B;  2IYO A;  1JO5 A;  1YBK A;  3FZF B;  3CQG B;  1WMK A;  5IUX A;  1EZV E;  2Z6E A;  4R4M A;  1UIX A;  3EVY A;  3CML A;  2R44 A;  1RH5 B;  2D0T A;  4A56 A;  3AE4 A;  4JV5 T;  4TV9 E;  4KJM A;  4UR9 A;  3WUT A;  2BS3 A;  3PJA A;  3OPC A;  3KQG A;  2VQF T;  1UUR A;  2E74 B;  3ESL A;  1GL2 C;  3CD6 P;  3RIF A;  2X66 A;  5AQV B;  3QOF A;  1PGP A;  1NTZ J;  1MND A;  1ZOY C;  3QWO C;  1X79 B;  4OHF A;  1BGY D;  4OFZ A;  3V2P A;  2UUC T;  3OAK A;  4EV6 A;  2W0G A;  2XQ6 A;  3M9B A;  3L72 G;  3GWH A;  2HFE D;  2D9D A;  4UEL A;  3S4U A;  5APU A;  3CWB E;  3ABV A;  1G73 A;  1UGO A;  3MA9 A;  4ZZB A;  3P4Q A;  3AA7 B;  5LHI B;  4CXY A;  3JC6 D;  2NTY A;  5GTH H;  1B7T A;  4I4T E;  3KPE A;  2Q3E A;  3L71 J;  3RK3 E;  2HOD B;  3OYX A;  4BA9 A;  2KXP B;  3CMA P;  1X22 A;  3C1L A;  2QSI A;  2KT9 A;  2BCC D;  4X65 T;  2ACZ A;  3J7Y q;  2CA5 A;  2UXD T;  1HF9 A;  3N2G E;  3MHV A;  1NTM J;  2Q9Q C;  1XTG B;  3AE3 C;  3MUD A;  2DNX A;  4QH4 A;  3HUS A;  2KSR A;  4X66 T;  2H7O A;  3O1H A;  3OTO T;  4Y99 B;  3H1L D;  4C7R A;  1UCU A;  4CI3 B;  3CPZ A;  4B3T T;  1HH0 A;  1SQQ E;  2W8Z A;  5JDG A;  3UUL A;  2KUB A;  1J1D B;  1RF0 A;  2KMF A;  4IL6 X;  1LNQ A;  5HXH A;  3C51 A;  5BVZ A;  4HN9 A;  2HLO A;  1SVF A;  1X8Y A;  2CXL A;  2WPQ A;  4BXL A;  4ZEY A;  1YXR A;  3WMM 0;  2GUV A;  1KFN A;  1H8A A;  2LRL A;  1LRZ A;  3N2O A;  2YEV C;  3E0Z A;  4Q25 A;  2XZR A;  4U3F E;  5LYJ E;  2VL0 A;  3A0H E;  4U74 A;  5LJM A;  3AE5 C;  1HJ0 A;  3CX6 B;  1RF1 A;  1MIW A;  2UXB T;  3HD7 A;  4L75 A;  4AQY T;  1MIV A;  3AAE B;  1Z0P A;  2M6B A;  2IX7 C;  4AYC A;  3LID A;  2ZVN B;  3BRT B;  3ZMT B;  2WMN A;  4JPZ B;  3AE1 C;  1W09 A;  1PV3 A;  1EDK A;  3Q5E A;  2A06 E;  2K9A A;  3A8Y C;  1M57 D;  1H88 A;  3N2K E;  3AE6 C;  3PUA A;  3K1S A;  1HCI A;  3RQU A;  3H1K E;  2WSE J;  2VKJ A;  4MAL A;  3AEF C;  3AE9 A;  1VCS A;  2E5T A;  2UUA T;  2M5A B;  2KI7 B;  1SQB J;  3KVB A;  3PRJ A;  2W00 A;  1PGQ A;  3M0D A;  3EDU A;  4C91 A;  5C39 A;  3I56 P;  3PUV F;  1X9V A;  2LOP A;  5TAO A;  1KEY A;  3K3Q C;  2P7J A;  3N9N A;  3AEG C;  3NRY A;  3RPU A;  1ZN5 A;  2E9X C;  2QJK B;  3LSV A;  1PL5 A;  1EZV G;  3ETU A;  1NU1 K;  3SFD A;  1XMO T;  3KVA A;  3D70 A;  2QJY C;  4MFR A;  1QVG O;  1L0L E;  1JB0 J;  4EZ4 A;  1HFA A;  4JF7 A;  3GF3 A;  4DR5 T;  1PGJ A;  1VF5 D;  1LTS C;  3OJA B;  3RH3 A;  1D1A A;  4I6M C;  3ZMZ B;  3HL6 A;  1JMB A;  2JPF A;  3JCF A;  3GHG C;  5KAF H;  4QXH B;  3L75 G;  1BGY E;  4ZI7 E;  4UIG A;  4AIS A;  2ZAE B;  2HPL A;  2WB5 A;  3KBU A;  2MYS A;  3PTZ A;  1HJB A;  4AI6 A;  1J1E C;  4WY4 D;  2LKG A;  4GKJ T;  1G2C A;  4JYB A;  4HFV A;  4NPF X;  1WT6 A;  1VQO P;  4HTE A;  1SQV D;  3ITK A;  1ZHC A;  5JDN A;  3KZI H;  3B71 A;  2JJ9 A;  2KND A;  3P7I A;  4B6X A;  3RBZ A;  4JI8 T;  2NPS D;  2WP9 A;  3CWB G;  2OLT A;  1DH3 A;  4ZKU A;  5GTH E;  2YMK A;  1VF5 C;  1VQ8 P;  2V5C A;  3IHR A;  4X62 T;  5FY0 A;  2K48 A;  4DO0 A;  1MKM A;  2CPT A;  3AEB C;  3N9Q A;  2BCC E;  1Y64 B;  2B76 A;  3L8R A;  1HR0 T;  2ITA A;  1JMM A;  4JI6 T;  4OH8 B;  4EGW A;  2L5G B;  1NYH A;  4WY4 C;  4A97 A;  1MMN A;  2IC6 A;  2WSC J;  3H1L E;  5AQK B;  3VMA A;  2XSB A;  2OYH C;  3J9X 1;  3SWF A;  3CCL P;  2E75 B;  3FXE A;  2CWO A;  2CM0 A;  1YIJ P;  2KZJ A;  1T8B A;  3V5S A;  2W61 A;  1SQQ G;  4I1L A;  1U7M A;  2GA1 A;  4H44 D;  4DVD A;  1Q86 Q;  1D7M A;  5APW A;  2QIW A;  2WZH A;  3PJS K;  2QJP C;  4W7Z A;  1AQT A;  2OYI C;  3ETV A;  4JEU B;  2RH0 A;  4IOI H;  3I55 P;  2DHR A;  4IE0 A;  2UXN B;  2D2C D;  3MD0 A;  5AVR B;  3AXJ A;  3TGU G;  1JUN A;  2E76 D;  1O3X A;  4ILB A;  5JH7 E;  5LCY A;  3CCQ P;  1AJY A;  3L73 J;  2X9X A;  1UX5 A;  2V1D B;  2K24 A;  5KX5 E;  2OTK E;  4U3F G;  2R3C A;  1HGV A;  2RPA A;  4EOZ B;  4BJM A;  3ZT7 A;  3LK2 B;  3LG7 A;  2X0H A;  4GK0 E;  2MTQ A;  2Q3I A;  5L3E B;  2AXD S;  1TU3 F;  4H44 C;  1E79 H;  5AVV B;  5AW8 B;  5AW7 B;  4Z91 A;  1D1B A;  1NHL A;  1GQE A;  1IBK T;  1YQ4 A;  4TNW A;  2WS3 A;  4HWD A;  1L0L K;  3V2N A;  4IHJ E;  3CKD A;  4H9O C;  4DV1 T;  2I6H A;  2I0M A;  1QLE D;  2LSI A;  4XAX B;  5L3G B;  1N2D C;  4YSZ A;  3FBL A;  5FP3 A;  1W0A A;  3VU7 H;  1PPJ G;  5AQI B;  3TLU A;  3L72 D;  2YIU B;  1NTZ D;  3SWK A;  2EHO C;  4I0U A;  4Z8X A;  3F57 A;  4DR2 T;  1YJN P;  2WQY A;  2KIN B;  3I9W A;  2R6G F;  2Y0D A;  3PUR A;  4NXN T;  2XSA A;  5HYA A;  2LHR A;  4HB1 A;  5AQP B;  1ZXG A;  1HBW A;  2CXD A;  4DV5 T;  3FZK B;  1X79 A;  3Q5D A;  4IIJ E;  2H43 A;  3VOP A;  2FYN C;  2N9D A;  3PUG A;  1LP1 B;  3NMD A;  5H2F H;  3A0B E;  3RGU A;  4GT1 A;  2UXX B;  2VWA A;  4Z90 A;  4KI0 F;  4HFC A;  2I1J A;  2XQ4 A;  1LTJ C;  3RF1 A;  4TN7 B;  2D0U A;  1BE3 J;  5ABE A;  3MZK B;  4YTM A;  3L70 E;  1T3U A;  2HOD A;  2IPP A;  4PK5 A;  2BKO A;  2P58 A;  3GN5 B;  1NTM D;  2KS1 B;  1CUN A;  2VKH A;  3HA4 A;  4LF7 T;  2ZMA A;  5JR9 B;  2D2C B;  1NJI Q;  1SE7 A;  4ZI3 D;  1EZ3 A;  3H1I J;  1SQV E;  2GK9 A;  4KP3 C;  4U2Z A;  2H8P D;  1XDO A;  3KZI E;  4D6T E;  4HFI A;  4ZI2 D;  1L4A D;  5L4H A;  3KYQ A;  3IF8 B;  1N86 A;  3LBX B;  1VQ4 P;  1DIP A;  5CCG C;  1KN7 A;  1LTA C;  3L74 J;  1Q82 Q;  3FZL B;  2WSS H;  4UVB B;  2MJZ A;  5KJ7 D;  1D1C A;  1GZL A;  3Q1M A;  5CJ4 A;  1YI2 P;  1D0Y A;  1XWM A;  3VHL A;  4EIJ A;  4OX9 T;  4QWN B;  2FYZ A;  5C8Y E;  3H1J E;  1EDI A;  2Y0E A;  3MGN A;  4EYY Q;  1YHQ P;  5JDQ A;  5CMZ A;  3QB5 K;  2POH A;  2VVN A;  2W63 A;  2LXC B;  3RRC A;  2G8Y A;  4NXM T;  5JDL A;  1IO4 A;  4ZI2 C;  4DUZ T;  1KB9 H;  5HXE A;  3PUZ F;  3H1L G;  1H89 A;  2H3R A;  4EDF A;  1KFY A;  3CXH H;  5AVU B;  1QGK B;  2CPS A;  1HG2 A;  1IFN A;  4WB4 A;  2WSE H;  4RKU J;  3AA6 B;  3WAK A;  3NRX A;  4O2B E;  5LGT B;  1IFP A;  1FDM A;  1SLQ A;  2L3L A;  4LMJ A;  5AVT B;  3SFE A;  2OYO A;  2Y9Y A;  1G8X A;  1P84 I;  1I94 T;  3FGA D;  3JCU H;  4Y28 J;  1L0N J;  2WSF H;  4GOF A;  1IK7 A;  4U72 A;  3ZJ2 A;  2M5A A;  2ODV A;  5CGM A;  4I7Z B;  5B5E E;  2IBZ G;  1Y8A A;  1LT1 A;  5KLV G;  2FXM A;  2HR3 A;  1KNR A;  4H9R C;  2YOE A;  5JRE A;  1S1C X;  3P4P A;  4CXX A;  1MMA A;  2FFD C;  2M0B A;  3PE0 A;  3DJB A;  4H0L B;  2UWJ E;  3BQI A;  1BR0 A;  5FY7 A;  2A3D A;  4NPD A;  4P0A A;  2AEF A;  3L75 D;  3RL0 C;  3IA3 A;  2J47 A;  3DP7 A;  1LKX A;  2JP3 A;  3V2Q A;  5JVD E;  2J59 M;  4ANJ A;  3L72 E;  2K9Y A;  3GMI A;  2XY8 B;  4IE5 A;  3JAE A;  5L3B B;  4Z1M H;  3AE2 C;  3OJA A;  1KK7 A;  4GOU A;  4TT3 H;  1SFC C;  1BR1 A;  3P50 A;  4OGQ B;  4HFD A;  2V7L A;  4AQG A;  5ABF B;  3U1A A;  2WDQ A;  3NZP A;  1YYC A;  3WUV A;  4DR3 T;  2Q7C A;  5C2T A;  1FJG T;  4IFM A;  2B87 B;  2XM2 A;  1HX8 A;  5H2F E;  4HJG H;  3T1Y T;  3QB5 A;  5FMN A;  1Z8U A;  3QH9 A;  4H13 C;  4AKH A;  5GON E;  3H1H J;  5JDM A;  5LXT E;  3LDQ B;  2V6Y B;  2I8D A;  3CCE P;  1N7S B;  5B66 H;  2O01 N;  4P0B A;  3UUB A;  3AB3 B;  5L3C B;  3HE4 B;  1YJ9 P;  4YXD C;  4EIW A;  1W2B O;  1BCC J;  1R5S A;  4IL9 A;  4EYY R;  3CL3 D;  1K9M Q;  3C4X A;  2WIT A;  2WSC H;  1SS1 A;  3B13 A;  3E08 A;  2D2S A;  2PP6 A;  4WW0 A;  2HG5 D;  2QM7 A;  2ZFC A;  2W66 A;  1T98 A;  1DU2 A;  2N1T B;  4X5T A;  2XDJ A;  3KV4 A;  1LTG C;  2B1E A;  3V5B A;  3O1J A;  2P1J A;  2IZ1 A;  3TGU D;  2WU2 A;  3NKZ A;  2DLR A;  3U1C A;  1SQP G;  4HGA A;  2W27 A;  5J2T E;  1J5W A;  1AA0 A;  2O3J A;  1US7 B;  2H88 A;  2LEH A;  4BJN A;  2MKV A;  5AQL B;  5LMN T;  3IEE A;  2V7I A;  1GW3 A;  1CW5 A;  1LT9 B;  3RK2 D;  2QA7 A;  4TNV A;  2BG9 B;  1KYO I;  1YQ4 C;  2PGD A;  3ZST A;  4I50 E;  3PJA J;  5ETW A;  5HAX A;  2BEZ F;  2CMR A;  1FJK A;  1M1K Q;  1VQ9 P;  2PJQ A;  2QEX P;  2LM9 A;  1PPJ D;  5J2U E;  1VQK P;  3EUH A;  2VRS A;  1T6A A;  3PUQ A;  4JBZ A;  3KV9 A;  3Q5R A;  3BAS A;  1GL2 D;  1BSH A;  2N2N A;  5CB4 E;  3RL0 g;  1RE3 C;  1U4Q A;  3EWK A;  5E79 H;  2H7V C;  2LKM A;  2NOX A;  2HPJ A;  1PP9 J;  1OED C;  4PV1 B;  4WBA A;  5M1B A;  3LJC A;  1JY2 O;  4HWI B;  2Q1K A;  2JQH A;  3BCC J;  3ANW B;  3E7K A;  5LMU T;  1OFC X;  2FYU G;  1JY3 N;  1Q81 Q;  4UVC B;  4ZMD A;  2YKO A;  2HPC B;  1N36 T;  4K0U A;  3PUX F;  1ZW0 A;  3Q2M A;  2A45 G;  4MBQ A;  1W5C E;  1J5E T;  3F89 A;  4EOT A;  3L75 E;  4YPC A;  3WUU A;  3UU3 A;  1NAF A;  5LA6 E;  1LP1 A;  1BE3 D;  2KLV A;  2QVA A;  4IFF A;  2R5D A;  2BG9 E;  3B5N B;  1GTW A;  1NTK J;  1RHZ B;  2XV5 A;  2Q9Q D;  1M56 D;  5ABG A;  1KIL C;  1NTZ G;  4AIU A;  3FZM B;  2PBI A;  1CI6 B;  1QLB A;  5TIS H;  2N9Y B;  3MJX A;  3CCM P;  2BS2 A;  1SQX J;  4GOE A;  3H1I D;  2IC9 A;  1PFI A;  2XQA A;  3RK2 B;  3UUN A;  4UB8 H;  1LWU C;  3M9H A;  3W67 A;  3AA1 B;  5HEH A;  2K3R A;  3GN5 A;  2KS1 A;  4FJO A;  5JR9 A;  3HKE E;  3NBX X;  3P8M C;  5LP6 E;  3EQ2 A;  4IST A;  4AQF A;  5KKZ C;  4XZC A;  2QM8 A;  1ZME C;  4TWH A;  4XFJ A;  4DR7 T;  3AEE C;  4PW8 A;  2E2A A;  5BU8 B;  1VL2 A;  4PNI A;  5AW5 B;  2ZVO B;  3LW5 J;  1KF6 A;  5AQU B;  4GOD A;  3V4Q A;  5HWY A;  3L71 G;  3LBX A;  3S9O A;  3JAD A;  3F2E A;  4EB6 E;  3Q5X A;  5B66 E;  2NRG A;  5M4Y A;  2JWD A;  2LRK A;  2BKP A;  1GL2 B;  3PUW F;  2C9N Y;  3E22 E;  4U31 A;  1JEK A;  3VRA A;  1S3J A;  1M8O B;  3O4X E;  5AQF B;  3FZH B;  2DW3 A;  1IAP A;  1NTM G;  3HKC E;  5AQR B;  1T7S A;  2CLY C;  2WSS V;  2I59 A;  3CX5 H;  4UVA B;  4N78 E;  3VR9 A;  1VQN P;  3CX5 D;  1YKH B;  2YN6 A;  4DR6 T;  5E0O A;  4DBR A;  4O4L E;  4WYV A;  2K9J B;  4WBO A;  1IC2 A;  5GTI H;  2FXO A;  2P2U A;  3O6Q B;  1OXZ A;  3TGU E;  1LVF A;  3ZKR A;  4F6R C;  2YK0 A;  2J1D G;  3N9P A;  3II6 A;  1NH4 A;  3MXZ A;  2YDS A;  2HHH T;  1BSN A;  4B3M T;  5LHG B;  3MTU E;  2E5L T;  1FC2 C;  1KQL A;  2VAS A;  4TUY E;  3EHZ A;  2IBZ D;  4AKI A;  2YKS A;  5KLV D;  4IRE A;  3F5H A;  1L0N D;  1D0X A;  4QXC B;  1USD A;  2L9Q A;  2NTX A;  1EZV I;  2XQ5 A;  4BWN A;  2Q9Q B;  3KV5 A;  4IDQ A;  3BVH A;  4G63 A;  5CFB A;  2E9X D;  1OW8 A;  3FX0 A;  4K35 A;  3AE8 C;  2LSG A;  4LFC T;  1PPJ E;  5FXW A;  4YJ3 E;  2WPS A;  4HFE A;  1GDT A;  3U3I A;  3K3O A;  5H6R B;  2W90 A;  3FWL A;  5KLI C;  2V4H A;  3FHN A;  2MOZ A;  1FZE A;  5FKY A;  5E79 E;  1K05 A;  2KK7 A;  1SQB G;  3N9M A;  4H9Q C;  4TX5 A;  3ZEF B;  2KP8 A;  1U57 A;  1BR2 A;  1R8I A;  1V9D A;  2NW9 A;  2ZT9 D;  4KT0 J;  3CPW O;  2LHN A;  3PDY A;  3HE5 B;  2Q5U A;  5KJ7 A;  2E42 A;  1IJ5 A;  2FBW A;  2C0W A;  3AAI A;  3I9Y A;  2Q9I A;  4IDO A;  4W7Y A;  4JI0 T;  4HE8 A;  2ACX A;  4RJT A;  3VMZ A;  3PTR B;  1T3J A;  3QUJ A;  2DI4 A;  1QUU A;  4I55 E;  2OQQ A;  4ZS2 A;  4X20 E;  5ABF A;  3P4S A;  3L35 A;  2B87 A;  1IFD A;  2KSE A;  4P09 A;  4NUU A;  1FZF A;  1ZLL A;  1NVO A;  1YQ3 A;  2JR8 A;  5AW2 B;  3AED A;  2YO3 A;  3LFM A;  3LK4 2;  1KOR A;  2W83 C;  3BQL A;  1K73 Q;  4UF0 B;  1BCC D;  2ZT9 C;  2CXF A;  2A72 A;  3CCR P;  2WT7 B;  2V6Y A;  1N7S A;  5EK4 A;  1SQQ K;  4YJ2 E;  4BAY B;  5TIS E;  3ZN0 B;  3H1I E;  3HE4 A;  3EDV A;  3VTP C;  3Q2Y A;  5KDM C;  3M3Z B;  3NFQ A;  4UB8 E;  1I6Z A;  1D0Z A;  2H89 A;  2IW5 B;  2E75 C;  3UFG A;  3ZCI A;  1A02 J;  1SQP D;  3K5B A;  2DCF A;  2LKH A;  1KNP A;  3ZMS B;  4QH1 A;  5ABH A;  4PAG A;  4BRY B;  1L2P A;  1URQ D;  3S1K A;  3FB2 A;  3AEC A;  4QH5 A;  1NU1 J;  2VKO A;  2WM9 A;  2QJY B;  5CCH D;  4WVZ A;  2BS4 A;  2M6I A;  3HI2 A;  4LML A;  2XHE B;  2N1T A;  3SOL A;  4PJN A;  4UEM A;  4HFB A;  2J62 A;  2Y6X A;  2ZLY A;  3OBV E;  4OK0 A;  1XZY A;  3S4R A;  4QHO A;  4V1A v;  4E7S A;  4IL4 A;  1MZ9 A;  3GHG B;  4LF5 T;  3CX5 E;  3M65 A;  5HXS A;  1J1E B;  1LT9 A;  1NWQ A;  2UUB T;  1NEN A;  4PJJ A;  3O8Z A;  1URQ C;  2BG9 A;  4YTP C;  5CCH C;  2IZ0 A;  1N8R Q;  3VMY A;  5APS A;  3QNU A;  5GTI E;  3Q9D A;  4A5X A;  5AQM B;  2VVS A;  1VF5 B;  5CHX A;  3RYF E;  4UXN B;  4LMK A;  2IBZ E;  2EHO D;  1UX4 A;  5KLV E;  1NAY A;  3WAJ A;  2FYU D;  1UK5 A;  4O8S A;  1NEK A;  3AE4 C;  2WWW A;  3CCS P;  4F8H A;  1PP9 D;  3ONX A;  3TLW A;  3ZDM A;  2HN1 A;  5AQH B;  2FY8 A;  2XM1 A;  3RKG A;  5CJ5 A;  3T97 B;  2A45 H;  3WU2 H;  3L36 A;  3L73 G;  4C7N B;  4WY4 B;  3ZYL A;  3RIU A;  3LIE A;  3L09 A;  3L37 A;  4H63 H;  3AE7 A;  4U7I A;  1FMW A;  1ZEE A;  3N4X A;  2OYH B;  3BK9 A;  4FI5 A;  3RLF F;  3R2P A;  2KB7 P;  2NPS B;  4KX6 A;  2LSK A;  3PP5 A;  3A5T A;  3ANW A;  4CXW A;  2KZI A;  1ZP0 A;  4X1Y E;  2N1G A;  4XA4 A;  4JYA T;  2K88 A;  2MBG A;  3NWI A;  2V7Q J;  5IHY A;  2HPC A;  2SPC A;  1Y9B A;  3LK3 B;  2WVR A;  3TNU B;  2Z5I A;  4GKG A;  3H1K J;  2OYI B;  2X0L B;  2B9B A;  5KAI H;  3ABV C;  1NTK D;  2IUB A;  1H0T B;  2YXR B;  2ES0 A;  4UV9 B;  1VOM A;  1YTZ I;  4AQF C;  3B5N A;  4ZNC A;  2Y9Z A;  4L73 A;  4RES B;  1EDJ A;  4CQI A;  4JEH B;  2QYW A;  3QK6 A;  1CI6 A;  1USE A;  3L71 D;  5CCG D;  3ZT5 A;  1RQU A;  3VP8 A;  1RE4 A;  3IR9 A;  4PJL A;  2FJE A;  4H44 B;  2XJ7 A;  3K8P C;  4DV7 T;  3MUD C;  5JTG A;  3HUS C;  1LJ2 A;  4O4H E;  4GYR A;  2XKM A;  2LT3 A;  1L0L J;  3HD7 D;  5KAF E;  5FY1 A;  1N73 B;  1PGO A;  3TKL B;  1N32 T;  1BE3 G;  1BCC E;  2IML A;  1W0B A;  2PFX A;  1T2K C;  1KFM A;  1RF0 C;  2E76 B;  1E2A A;  2ZYA A;  2XAJ B;  5KMG P;  4M3L A;  1N33 T;  1BGY J;  1GL2 A;  3PHL A;  1IK9 A;  3H1I G;  3UT5 E;  1MMD A;  1SQP E;  1EQ7 A;  4AXP A;  2G0U A;  1ZOY A;  5CBN A;  5CA1 E;  3JAF A;  2FYN B;  1FZC B;  4KMC A;  1RF1 C;  3HD7 C;  3L74 G;  5HEO A;  3D6Y A;  1GD2 E;  3I0O A;  5F5W A;  2VK9 A;  2P67 A;  1LTJ B;  2BBJ A;  2K9J A;  1KQG B;  2KYV A;  1OVR A;  3O6Q A;  5KLV K;  4QMA A;  1M62 A;  2X9W A;  2BCC J;  3UUM A;  2IBZ I;  4G2A A;  1SA0 E;  3RX6 A;  3KXD A;  5LB7 B;  2F4V T;  2Y48 B;  1KB9 D;  3TK1 A;  3NVO A;  2QE7 H;  4EEB A;  4O4J E;  3AE9 C;  3CXH D;  5BR8 T;  4TZ4 C;  1NGM B;  2XQ8 A;  4ILC A;  1JY3 P;  5AQN B;  1LGH B;  3M0D C;  4ILU A;  4C46 A;  2Q9Q A;  4DND A;  1G1J A;  3BQK A;  4PD4 H;  2KWH A;  3RL0 D;  1SQB D;  4DJG A;  4LLH A;  4COF A;  2E5Y A;  4PD4 D;  4LFA T;  2AXT H;  5APV A;  2JQ9 A;  1DD3 A;  1CHU A;  1WLX A;  2KWI B;  2FYU E;  2CRB A;  3SFD C;  3B5M A;  4YHJ A;  1PP9 E;  3E1R A;  2W62 A;  1SFC D;  1L0N G;  5L3F B;  3VKG A;  4U2Y A;  1JCC A;  3WU2 E;  3GMA A;  4OGQ C;  2WPV B;  3NZQ A;  1R5L A;  1WCR A;  3CX7 B;  1R8E A;  5APQ A;  4CPG A;  3ZCJ A;  2CPB A;  1L4A B;  3P32 A;  1XNQ T;  1JNR A;  4PK6 A;  1M90 Q;  4YLH A;  3HE5 A;  3RYC E;  3AE5 A;  5FXZ A;  5AQQ B;  1QL2 A;  2LR2 A;  3CCV P;  3AED C;  1QVF O;  4H13 D;  2WZI A;  3ZPO A;  1KNZ A;  2C0X A;  1NTZ E;  2XAF B;  4JI7 T;  4L0R A;  2CWY A;  3Q3D A;  1N7S C;  2Z5H A;  2NWB A;  3FXD B;  3AE1 A;  2BDE A;  1SQV K;  3RC3 A;  4JI5 T;  5AVQ B;  5EZY E;  3AE6 A;  2C5J A;  2NW8 A;  2X9Y A;  2WMM A;  4YFS A;  3AEF A;  1WYC A;  1FOS F;  4X64 T;  1HWT C;  5AW0 B;  4AQR D;  5EFW B;  4UF0 A;  1M7K A;  5AFU L;  3C4W A;  5LNK A;  1SQP K;  4L76 A;  3L71 E;  2WT7 A;  2DWG A;  5LG3 A;  3CVR A;  1LTB C;  2JQQ A;  3HKD E;  5APX A;  2FUP A;  1HTL C;  4NUV A;  2FFD B;  1IJ6 A;  5LG4 A;  1OIP A;  2M67 A;  1NU1 D;  2R32 A;  2CBJ A;  2XAG B;  2CE7 A;  3AEG A;  1KV4 A;  2W6B A;  4JLE A;  5DQV A;  5FVL A;  1NTM E;  3A2A A;  1M1J B;  3KDP B;  3H1H G;  3RK3 D;  2LJL A;  4BRY A;  3RL0 B;  1HF8 A;  2XPK A;  4OYK A;  5AW3 B;  4WZX A;  2RMZ A;  2QRX A;  3CC7 P;  4W80 A;  2A2F X;  1BCC G;  3L70 J;  4O9B A;  5BMV E;  3C8V A;  3AVS A;  2ZJS E;  2IAK A;  4LF9 T;  1SFC B;  3A3Y B;  1CSB A;  1OMI A;  3NXS A;  4OWF A;  4DR4 T;  1FZA A;  1SQV J;  3GHG A;  1GU5 A;  1FAV A;  5CJ0 A;  4NIQ A;  4D6T J;  5FXX A;  2KLQ A;  1ZV4 X;  3P4W A;  3Q5W A;  2ZXE B;  1JCD A;  2E74 D;  3RK3 C;  3H3A A;  4LGD E;  3TDK A;  1HG5 A;  4H9P C;  5LGU B;  2A9U A;  2YU1 A;  2L8K A;  4PJM A;  4JI2 T;  3L4F A;  3L73 D;  2GM4 A;  2FYU K;  1DEE G;  3UU8 A;  1HNX T;  3QC9 A;  5F8P A;  2WDR A;  1MFT A;  3H1J J;  3IFM A;  2JWA A;  5EK3 A;  4PV1 C;  1KB9 E;  2KIK A;  3G9R A;  5AVX B;  3AEB A;  1U5P A;  3CXH E;  2YO2 A;  3UIA A;  1S4X A;  5AW4 B;  1A02 F;  3N5L A;  3KHU A;  2OTL P;  2C9L Y;  2IYP A;  1ZV8 A;  3T97 A;  2YDR A;  4C7N A;  4WY4 A;  3CX8 B;  4ASV A;  1S72 P;  4YSY A;  2E74 C;  2WQY C;  4ILA A;  2V7Q H;  1HUC A;  1SQB E;  1WR6 A;  1NTZ K;  4PD4 E;  3HRN A;  2OYH A;  2QGS A;  5JRC B;  3T8O A;  2NPS A;  3JCU E;  2AXT E;  1KQS O;  3ZYM A;  4H63 V;  2FJB A;  1MMG A;  4I43 B;  3U78 A;  1KIL D;  2C0S A;  4HFH A;  4O4I E;  3HR0 A;  2W4X A;  2WCA A;  4GYS A;  1AVO A;  3IN6 A;  3ZT6 A;  2X51 A;  1CZQ A;  1DEB A;  4ZHQ E;  3TNU A;  1PP9 G;  1SHZ C;  2OYI A;  3ZMU B;  2KZ7 B;  5AVZ B;  1IZN B;  1KC8 Q;  2IDO B;  3BCC G;  3DTO A;  3UFE A;  1UUS A;  2YKQ A;  2C5K T;  2DWK A;  1H0T A;  3KIN B;  5APT A;  2JIW A;  4IDN A;  4B3R T;  2E5V A;  1WFD A;  4DT0 A;  3H25 A;  2J4G A;  4AKL A;  1JTH B;  2WWU A;  1IFI A;  1NTM K;  1SP4 A;  3OA7 A;  2RP4 A;  1L0L D;  2PFV A;  1HX1 B;  2N9B A;  5DJQ C;  4DV3 T;  2W2U A;  4QX7 B;  4JBW F;  5HCJ A;  1HNW T;  5FXV A;  4DV6 T;  1FU1 A;  1E5W A;  4IE7 A;  4HKZ H;  4Y99 C;  1NTK G;  4TLF A;  2IHR 1;  3L72 J;  5AW9 B;  4X1K E;  1N73 A;  1WYB A;  1OED B;  2W67 A;  1KMI Z;  2I1K A;  1S5L H;  1J1D C;  1SQX G;  2XU6 A;  4PK4 A;  3L74 D;  2ZM2 A;  1EXI A;  2EHO A;  2YIN A;  5DAB A;  2E43 A;  3ZN1 B;  1YJW P;  4GIW A;  1NU1 E;  1OW7 A;  3CIR A;  3MKD A;  5F3J A;  4N3Y B;  4ASK A;  2OGU A;  2ZM0 A;  2FXP A;  2X9H A;  4PJ0 H;  3L3P A;  4CI2 B;  4ZZC A;  5JDH A;  4EZH A;  3GF7 A;  2R3S A;  5DJT B;  3UU6 A;  1FZC A;  1ZR2 A;  3MAC A;  5IWA T;  4IDP A;  3AA0 B;  4ZOL E;  4AUW A;  5AVW B;  5BU5 A;  2K5B B;  2NR4 A;  4E7Z A;  1LTJ A;  1GW4 A;  3RQW A;  4HWF A;  4DZO A;  1KIL B;  3MIW A;  3RYI E;  4EED A;  1KB9 I;  4NPP A;  4U7J A;  1MV8 A;  3PUS A;  3SFE C;  5TJH A;  5L2L A;  3CXH I;  3MK7 C;  3I1A A;  1LWU B;  2IFN A;  2O01 J;  3JC6 C;  2LSJ A;  4DUY T;  3OYZ A;  3ZSS A;  1SQB K;  5H6Q B;  1AVY A;  1EXJ A;  5KKZ B;  3PU8 A;  3T1H T;  3CLQ A;  1S35 A;  4PD4 I;  3UU4 A;  3KDS E;  3L73 E;  1Z56 A;  2V7J A;  4JUY A;  4A7P A;  3RKO A;  1JOC A;  2WDV A;  1T72 A;  4LF4 T;  1OED E;  1OX3 A;  5CCG A;  2PRR A;  4DCK A;  2LXB A;  4R4L A;  1N7L A;  1KQF B;  1VQP P;  3M06 A;  2NP9 A;  2K37 A;  2QJK C;  3EAM A;  4JI3 T;  3TYY A;  3F31 A;  3RC8 A;  5J1G A;  2CLY B;  1FIO A;  2LSY A;  2JO1 A;  3Q5S A;  2KOG A;  1M7L A;  2X0Y A;  4HWH A;  3D71 A;  1VCT A;  4U33 A;  1L4A A;  1ZRT D;  3V6I A;  3OW2 O;  2JKV A;  3TLS A;  4U7Y A;  4HH2 A;  1P84 H;  4KHX A;  1KIL E;  4EAH A;  1RQV A;  1HGZ A;  1P84 D;  4DBQ A;  1BR4 A;  5EK2 A;  3KV6 A;  1J1J A;  1HVV A;  3EFF K;  3FXD A;  1LTI C;  4PFO A;  5J0Z A;  3CCJ P;  2RA1 A;  2WSF J;  1JY2 N;  2CK3 H;  2E75 D;  2SPZ A;  2Y0C A;  1VQM P;  1XDP A;  5HXR A;  3USS A;  1X0T A;  3IF4 A;  1OWA A;  4L9I A;  3CCU P;  1FEW A;  3H6P A;  2CEA A;  2WY2 A;  5HXC A;  3H1H D;  4IL6 H;  1BE3 E;  2WWV A;  4ASW A;  2BBH A;  1U7J A;  3TSI A;  3A0B H;  2JQK A;  3G3Z A;  2KLU A;  3TLV A;  3W68 A;  2FKW B;  2P10 A;  2AEJ A;  5KLI B;  1FS0 E;  3L75 J;  2FFD A;  5LJN A;  5AQG B;  2Z4E A;  1E7P A;  2VB6 A;  1GK4 A;  2XQ7 A;  4IT4 A;  3BAT A;  3L70 D;  2V5D A;  1M1J A;  2LE8 A;  1G1I A;  3RIA A;  2IIU A;  2E9X B;  4KUM B;  3L74 E;  5L3D B;  1S5L E;  3CWB J;  3HTK B;  2H88 C;  5FVK A;  2XTL A;  4NPE A;  2V6X A;  3W15 B;  3AE2 A;  1YTZ T;  2PTF A;  4D6T D;  1SFC A;  4L74 A;  2LM2 A;  3O9X A;  1KD1 Q;  2XNX A;  1E1H B;  2ZXX A;  2BEQ D;  1NU1 G;  1HTJ F;  3UTK A;  1S94 A;  4PJ0 E;  4ZXL A;  4WWI A;  2YKP A;  4HEA A;  1FMV A;  4LFB T;  1J2J B;  1MFZ A;  1LVK A;  2NZ2 A;  2WTY A;  4IE4 A;  3H1J D;  1IBL T;  4EXT A;  2ZT9 B;  5LBM A;  4DV4 T;  3PV0 F;  3IAO A;  2PAJ A;  2HYN A;  2KNC B;  3TF5 A;  3TLT A;  4YY3 T;  1SQQ J;  4QX8 B;  3N7N A;  4YXD A;  2YMY A;  1S2E A;  2YDQ A;  3FBZ A;  5C3J A;  2NPS C;  2HN2 A;  3D0T A;  4DMW A;  2VL8 A;  2WZ7 A;  5CBO A;  3EAB A;  3KBT A;  2O1J A;  2R5B A;  1AJ3 A;  2M3E A;  3I0Q A;  3ZMV B;  3PLN A;  2BAS A;  4YHH T;  3C64 A;  4ISS A;  1VQ7 P;  2B89 A;  2YIU C;  1L0N E;  3N9L A;  1WRG A;  3TGU J;  2UU9 T;  1GU4 A;  3OVU A;  4GIF A;  4N6J A;  2WAU A;  5JDF A;  2JMK A;  4U3F J;  1X9B A;  2XAQ B;  3BCC D;  1IFJ A;  5JRC A;  3ZC1 A;  3RHW A;  4DV0 T;  3MZW B;  3ZJ1 A;  1XNR T;  1KYO H;  2V8S V;  2MAW A;  4K0K T;  3M91 A; 
#chains in the Genus database with same CATH homology
 5LHH B;  2X68 A;  4H9N C;  4OYJ A;  5ADX L;  3SWY A;  1MNE A;  5A1L A;  4JYC A;  1URQ B;  4LC1 A;  1NKN A;  1XTC C;  3SS1 A;  3H32 B;  4B86 A;  1VPC A;  1N73 C;  4M1P A;  1YD8 G;  5JR9 C;  1T2K D;  3UUX B;  3C50 A;  3WI3 A;  1JTH A;  2H7H A;  1S9K D;  2X67 A;  4TV8 E;  2PG8 A;  1RE3 A;  3R84 B;  2WPR A;  3LW5 H;  5DQW A;  5APY A;  4KBM B;  4QXB B;  4ZS3 A;  5CA0 E;  1FZC C;  4AKG A;  3I5C A;  3VN0 A;  1FZB A;  3M9Q A;  3V2R A;  5LBQ B;  3CI9 A;  3E1I A;  4ERR A;  2EHO B;  3GA8 A;  3R6N A;  5IYZ E;  4ZKP A;  3ZYK A;  3VMX A;  4XE5 B;  1IJD B;  5HWX A;  4IE6 A;  2O01 H;  4ADZ A;  1KIL A;  4WNK A;  3P7K A;  3SWH A;  2V7K A;  2CCQ A;  2P9B A;  4MLK A;  3KFW X;  1L0N K;  1LWU A;  2M3B A;  1NO4 A;  3P8C D;  3HUS B;  3ZC0 A;  1VRB A;  2OAR A;  2JJL A;  1MIY A;  3K3N A;  1NOH A;  4XBF B;  4UV8 B;  5FYM A;  5AW6 B;  3PU3 A;  1AQ5 A;  3VP9 A;  4ZI3 C;  1L4A C;  4QKN A;  2BZB A;  3C4Z A;  2D5U A;  3ZLI A;  2J58 A;  1GK6 A;  2XAS B;  3AVR A;  5KJ7 C;  5FNV E;  1N7S D;  4WBN E;  1RF1 B;  1MUU A;  4HYT B;  3HD7 B;  4CI1 B;  3IBP A;  2ODU A;  2XQY A;  2OA5 A;  2E8I A;  3VKH A;  1JY3 O;  3RYH E;  3CQC B;  2V7M A;  3AAA B;  1JNM A;  1LTT C;  2N1T D;  1FBM A;  2V26 A;  1H7C A;  2BVL A;  2Y8D A;  3BRV B;  1QL1 A;  1NWM X;  1FZG A;  1QSD A;  1M1J C;  4H9S E;  5LGN B;  1S9K E;  2LOS A;  2BVM A;  1VDF A;  1ZKE A;  2N1T C;  1AFO A;  3HKB E;  3N9O A;  4EYU A;  2YNY A;  2WBL A;  4GK5 E;  3RRW A;  2IFM A;  5LOV E;  2XUE A;  2E9X A;  3OKQ A;  3CQX C;  3SRZ A;  3HTK A;  3A5X A;  1T8Z A;  3EFG A;  5JQG E;  1LT9 C;  1G2C B;  1IFM A;  5AVS B;  3M0A A;  3U59 A;  4IGU A;  1YW0 A;  2JMH A;  2C5I T;  1WRD A;  5AVY B;  3B8E B;  1DX7 A;  5AW1 B;  4DOJ A;  1ZR4 A;  2O1K A;  4L5G A;  4N78 D;  2JRK A;  2YU2 A;  1HS7 A;  3P8C E;  4IDZ A;  2XAH B;  3NTN A;  4X1I E;  4HKA A;  3B5N D;  4AKR B;  3CWZ B;  2VKD A;  4J2C A;  4CZZ B;  3A7O A;  3FXE B;  2JEE A;  3B57 A;  1FOS E;  2A45 I;  1NKZ B;  4I2L C;  4IFD K;  4PFP A;  2KSJ A;  1YKE B;  1JY2 P;  3C9I A;  2NW7 A;  2WMO A;  3V4W A;  1FJP A;  2W6A A;  2ZM8 A;  1W2E A;  4DMV A;  4MHC A;  1NTK K;  2HH7 A;  4O2A E;  3B5N C;  2GUS A;  4C90 A;  3RK3 B;  5KTB A;  1URQ A;  1SQX K;  3V5U A;  3O1I A;  1RY3 A;  3VYI A;  1KZU B;  5CCH A;  1RE4 C;  3H32 A;  2M8R A;  3C98 B;  3H37 A;  3RK2 C;  1JO5 A;  3CQG B;  2Z6E A;  3EVY A;  3CML A;  2D0T A;  4A56 A;  4TV9 E;  3KQG A;  3ESL A;  1GL2 C;  2X66 A;  1MND A;  1X79 B;  4OHF A;  4OFZ A;  3V2P A;  3OAK A;  2W0G A;  3M9B A;  3GWH A;  2HFE D;  4UEL A;  3S4U A;  5APU A;  1G73 A;  3MA9 A;  5LHI B;  3AA7 B;  4CXY A;  3JC6 D;  2NTY A;  1B7T A;  4I4T E;  3KPE A;  2HOD B;  3OYX A;  4BA9 A;  2KXP B;  2KT9 A;  3J7Y q;  2CA5 A;  3N2G E;  2Q9Q C;  1XTG B;  3MUD A;  2DNX A;  3HUS A;  2H7O A;  3O1H A;  4Y99 B;  4C7R A;  1UCU A;  4CI3 B;  3CPZ A;  1HH0 A;  5JDG A;  3UUL A;  1J1D B;  1RF0 A;  2KMF A;  5HXH A;  3C51 A;  5BVZ A;  4HN9 A;  2HLO A;  1SVF A;  1X8Y A;  2CXL A;  2WPQ A;  3WMM 0;  2GUV A;  1KFN A;  1H8A A;  1LRZ A;  3N2O A;  2YEV C;  3E0Z A;  2XZR A;  5LYJ E;  4U74 A;  5LJM A;  3CX6 B;  1RF1 A;  1MIW A;  3HD7 A;  1MIV A;  3AAE B;  1Z0P A;  2IX7 C;  4AYC A;  3LID A;  3BRT B;  3ZMT B;  2WMN A;  2K9A A;  1H88 A;  3N2K E;  3PUA A;  1HCI A;  4MAL A;  2VKJ A;  3KVB A;  2W00 A;  3M0D A;  3EDU A;  4C91 A;  1X9V A;  2LOP A;  5TAO A;  3K3Q C;  2P7J A;  3N9N A;  3NRY A;  3RPU A;  1ZN5 A;  2E9X C;  3ETU A;  1NU1 K;  3KVA A;  4MFR A;  4EZ4 A;  1HFA A;  4JF7 A;  1LTS C;  3OJA B;  3RH3 A;  1D1A A;  4I6M C;  3ZMZ B;  3HL6 A;  2JPF A;  3GHG C;  4QXH B;  4ZI7 E;  4UIG A;  2HPL A;  3KBU A;  2MYS A;  1HJB A;  4AI6 A;  1J1E C;  4WY4 D;  1G2C A;  4JYB A;  4HFV A;  1WT6 A;  4HTE A;  1ZHC A;  5JDN A;  2JJ9 A;  2KND A;  3P7I A;  4B6X A;  2NPS D;  1DH3 A;  4ZKU A;  3IHR A;  5FY0 A;  2K48 A;  4DO0 A;  3N9Q A;  1Y64 B;  1JMM A;  4OH8 B;  2L5G B;  4WY4 C;  1MMN A;  2IC6 A;  2OYH C;  3J9X 1;  3SWF A;  2CWO A;  2CM0 A;  3V5S A;  2W61 A;  4I1L A;  4DVD A;  5APW A;  4W7Z A;  2OYI C;  3ETV A;  4JEU B;  2DHR A;  4IE0 A;  2UXN B;  3MD0 A;  5AVR B;  1JUN A;  1O3X A;  5JH7 E;  5LCY A;  2X9X A;  1UX5 A;  2V1D B;  2K24 A;  5KX5 E;  2R3C A;  1HGV A;  4EOZ B;  4BJM A;  3LK2 B;  3LG7 A;  4GK0 E;  2MTQ A;  2Q3I A;  5L3E B;  5AVV B;  5AW8 B;  5AW7 B;  1D1B A;  1NHL A;  1L0L K;  3V2N A;  4IHJ E;  3CKD A;  4H9O C;  2LSI A;  4XAX B;  5L3G B;  1N2D C;  3FBL A;  5FP3 A;  3VU7 H;  2EHO C;  4Z8X A;  3F57 A;  2KIN B;  3I9W A;  3PUR A;  5HYA A;  2LHR A;  1HBW A;  2CXD A;  1X79 A;  4IIJ E;  2H43 A;  3VOP A;  3PUG A;  2N9D A;  3NMD A;  4GT1 A;  2UXX B;  2VWA A;  2I1J A;  1LTJ C;  4TN7 B;  2D0U A;  3MZK B;  1T3U A;  2HOD A;  2IPP A;  4PK5 A;  3GN5 B;  1CUN A;  2VKH A;  3HA4 A;  2ZMA A;  5JR9 B;  4ZI3 D;  1EZ3 A;  2GK9 A;  4KP3 C;  2H8P D;  4ZI2 D;  1L4A D;  3KYQ A;  3IF8 B;  1N86 A;  3LBX B;  5CCG C;  1LTA C;  4UVB B;  2MJZ A;  5KJ7 D;  1D1C A;  1GZL A;  5CJ4 A;  1D0Y A;  3VHL A;  4EIJ A;  4QWN B;  2FYZ A;  5C8Y E;  5JDQ A;  3MGN A;  5CMZ A;  2POH A;  2W63 A;  3RRC A;  5JDL A;  1IO4 A;  4ZI2 C;  5HXE A;  1H89 A;  2H3R A;  5AVU B;  2CPS A;  1HG2 A;  1IFN A;  4WB4 A;  2WSE H;  3AA6 B;  3WAK A;  3NRX A;  4O2B E;  5LGT B;  1FDM A;  1SLQ A;  2L3L A;  5AVT B;  1G8X A;  2WSF H;  4U72 A;  3ZJ2 A;  2ODV A;  2FXM A;  4H9R C;  5JRE A;  4CXX A;  1MMA A;  2FFD C;  3PE0 A;  3DJB A;  3BQI A;  1BR0 A;  5FY7 A;  2A3D A;  4P0A A;  3RL0 C;  3DP7 A;  1LKX A;  3V2Q A;  5JVD E;  2J59 M;  4ANJ A;  3GMI A;  4IE5 A;  5L3B B;  3OJA A;  1KK7 A;  4GOU A;  1SFC C;  1BR1 A;  2V7L A;  4AQG A;  3U1A A;  3NZP A;  1YYC A;  2Q7C A;  4IFM A;  1HX8 A;  5FMN A;  4AKH A;  5GON E;  5JDM A;  5LXT E;  1N7S B;  4P0B A;  3AB3 B;  5L3C B;  3HE4 B;  4EIW A;  4EYY R;  3CL3 D;  3C4X A;  2WIT A;  2WSC H;  3B13 A;  3E08 A;  2D2S A;  2PP6 A;  4WW0 A;  2HG5 D;  2QM7 A;  2ZFC A;  1T98 A;  2N1T B;  2XDJ A;  3KV4 A;  1LTG C;  2B1E A;  3V5B A;  3O1J A;  2P1J A;  2DLR A;  3U1C A;  4HGA A;  2W27 A;  5J2T E;  1US7 B;  2LEH A;  4BJN A;  3IEE A;  2V7I A;  1GW3 A;  1CW5 A;  1LT9 B;  3RK2 D;  2QA7 A;  4I50 E;  5ETW A;  5HAX A;  2CMR A;  1FJK A;  2PJQ A;  2LM9 A;  5J2U E;  3EUH A;  2VRS A;  3PUQ A;  3KV9 A;  1GL2 D;  3BAS A;  2N2N A;  5CB4 E;  1RE3 C;  1U4Q A;  2H7V C;  2LKM A;  2NOX A;  2HPJ A;  4WBA A;  3LJC A;  1JY2 O;  3ANW B;  1JY3 N;  4UVC B;  2YKO A;  2HPC B;  4K0U A;  3Q2M A;  2A45 G;  4MBQ A;  4EOT A;  1NAF A;  5LA6 E;  2KLV A;  4IFF A;  2R5D A;  3B5N B;  1GTW A;  2XV5 A;  2Q9Q D;  1KIL C;  2PBI A;  1CI6 B;  3MJX A;  2IC9 A;  1PFI A;  3RK2 B;  3UUN A;  1LWU C;  3M9H A;  3AA1 B;  3GN5 A;  4FJO A;  5JR9 A;  3HKE E;  3NBX X;  3P8M C;  5LP6 E;  3EQ2 A;  4IST A;  4AQF A;  4XZC A;  2QM8 A;  4PW8 A;  4PNI A;  5BU8 B;  5AW5 B;  3V4Q A;  5HWY A;  3LBX A;  3F2E A;  4EB6 E;  3Q5X A;  5M4Y A;  1GL2 B;  2C9N Y;  3E22 E;  3O4X E;  1IAP A;  3HKC E;  2CLY C;  2WSS V;  2I59 A;  4UVA B;  4N78 E;  1YKH B;  5E0O A;  4DBR A;  4O4L E;  4WBO A;  1IC2 A;  2P2U A;  1OXZ A;  1LVF A;  4F6R C;  2YK0 A;  2J1D G;  3N9P A;  3II6 A;  1NH4 A;  3MXZ A;  5LHG B;  3MTU E;  4TUY E;  1KQL A;  2VAS A;  4AKI A;  1D0X A;  4QXC B;  2L9Q A;  2NTX A;  2Q9Q B;  3KV5 A;  3BVH A;  4G63 A;  2E9X D;  2LSG A;  5FXW A;  4YJ3 E;  2WPS A;  1GDT A;  3U3I A;  3K3O A;  5H6R B;  3FHN A;  2MOZ A;  1FZE A;  3N9M A;  4H9Q C;  4TX5 A;  3ZEF B;  2KP8 A;  1BR2 A;  1V9D A;  2NW9 A;  2LHN A;  3PDY A;  3HE5 B;  2Q5U A;  5KJ7 A;  2E42 A;  1IJ5 A;  2C0W A;  3AAI A;  3I9Y A;  2Q9I A;  4W7Y A;  4HE8 A;  2ACX A;  3VMZ A;  3PTR B;  1T3J A;  3QUJ A;  2DI4 A;  1QUU A;  4I55 E;  4ZS2 A;  4X20 E;  3L35 A;  4P09 A;  1IFD A;  4NUU A;  1FZF A;  1ZLL A;  5AW2 B;  2YO3 A;  3LFM A;  3LK4 2;  3BQL A;  4UF0 B;  2CXF A;  2A72 A;  2WT7 B;  1N7S A;  5EK4 A;  1SQQ K;  4YJ2 E;  4BAY B;  3ZN0 B;  3EDV A;  3HE4 A;  3VTP C;  5KDM C;  3NFQ A;  1D0Z A;  2IW5 B;  3ZCI A;  1A02 J;  2DCF A;  3ZMS B;  4PAG A;  1URQ D;  3FB2 A;  2VKO A;  2WM9 A;  5CCH D;  3HI2 A;  2XHE B;  2N1T A;  3SOL A;  4PJN A;  4UEM A;  2Y6X A;  2ZLY A;  3OBV E;  4OK0 A;  4QHO A;  4V1A v;  4E7S A;  1MZ9 A;  3GHG B;  3M65 A;  5HXS A;  1J1E B;  1LT9 A;  1NWQ A;  4PJJ A;  3O8Z A;  1URQ C;  5CCH C;  3VMY A;  5APS A;  3Q9D A;  5CHX A;  3RYF E;  4UXN B;  2EHO D;  1UX4 A;  3WAJ A;  4O8S A;  2WWW A;  3ONX A;  2A45 H;  3L36 A;  4C7N B;  4WY4 B;  3ZYL A;  3LIE A;  3L09 A;  3L37 A;  4H63 H;  1FMW A;  1ZEE A;  3N4X A;  2OYH B;  3BK9 A;  4FI5 A;  3R2P A;  2KB7 P;  2NPS B;  2LSK A;  3PP5 A;  3A5T A;  3ANW A;  4CXW A;  4X1Y E;  2N1G A;  4XA4 A;  2MBG A;  5IHY A;  2HPC A;  2SPC A;  3LK3 B;  3TNU B;  2Z5I A;  4GKG A;  2X0L B;  2OYI B;  2ES0 A;  4UV9 B;  1VOM A;  1YTZ I;  4AQF C;  3B5N A;  4RES B;  4CQI A;  4JEH B;  3QK6 A;  1CI6 A;  5CCG D;  3VP8 A;  1RE4 A;  3IR9 A;  4PJL A;  3K8P C;  3HUS C;  4O4H E;  4GYR A;  2XKM A;  2LT3 A;  3HD7 D;  5FY1 A;  1N73 B;  3TKL B;  1T2K C;  1KFM A;  1RF0 C;  2XAJ B;  5KMG P;  4M3L A;  1GL2 A;  1IK9 A;  3UT5 E;  1MMD A;  1EQ7 A;  4AXP A;  2G0U A;  5CA1 E;  4KMC A;  1FZC B;  1RF1 C;  3HD7 C;  1GD2 E;  3I0O A;  2VK9 A;  2P67 A;  1LTJ B;  2KYV A;  5KLV K;  2X9W A;  3UUM A;  4G2A A;  1SA0 E;  3RX6 A;  2Y48 B;  3TK1 A;  4O4J E;  4TZ4 C;  1JY3 P;  1LGH B;  3M0D C;  4ILU A;  4C46 A;  2Q9Q A;  4DND A;  1G1J A;  3BQK A;  2KWH A;  3RL0 D;  4LLH A;  5APV A;  1WLX A;  2KWI B;  4YHJ A;  2W62 A;  1SFC D;  5L3F B;  3VKG A;  1JCC A;  3NZQ A;  3CX7 B;  5APQ A;  3ZCJ A;  2CPB A;  1L4A B;  3P32 A;  4PK6 A;  4YLH A;  3HE5 A;  3RYC E;  5FXZ A;  1QL2 A;  3ZPO A;  1KNZ A;  2C0X A;  2XAF B;  4L0R A;  2CWY A;  1N7S C;  2Z5H A;  2NWB A;  3FXD B;  2BDE A;  1SQV K;  3RC3 A;  5AVQ B;  5EZY E;  2C5J A;  2NW8 A;  2X9Y A;  4YFS A;  1WYC A;  1FOS F;  1HWT C;  5AW0 B;  4AQR D;  4UF0 A;  5AFU L;  3C4W A;  5LNK A;  1SQP K;  2WT7 A;  2DWG A;  3CVR A;  1LTB C;  2JQQ A;  3HKD E;  5APX A;  1HTL C;  4NUV A;  2FFD B;  1IJ6 A;  5LG4 A;  2M67 A;  2R32 A;  2XAG B;  2CE7 A;  2W6B A;  4JLE A;  5DQV A;  3A2A A;  1M1J B;  3KDP B;  3RK3 D;  2LJL A;  3RL0 B;  1HF8 A;  4OYK A;  5AW3 B;  4W80 A;  2A2F X;  4O9B A;  5BMV E;  3AVS A;  2IAK A;  1SFC B;  3A3Y B;  1CSB A;  3NXS A;  1FZA A;  3GHG A;  1GU5 A;  1FAV A;  5CJ0 A;  5FXX A;  2KLQ A;  1ZV4 X;  3Q5W A;  2ZXE B;  1JCD A;  3RK3 C;  3H3A A;  4LGD E;  1HG5 A;  4H9P C;  5LGU B;  2YU1 A;  2L8K A;  4PJM A;  3L4F A;  2GM4 A;  2FYU K;  3QC9 A;  5F8P A;  3IFM A;  5EK3 A;  5AVX B;  1U5P A;  2YO2 A;  3UIA A;  5AW4 B;  1A02 F;  3N5L A;  2C9L Y;  1ZV8 A;  3T97 A;  4C7N A;  4WY4 A;  3CX8 B;  1HUC A;  1WR6 A;  1NTZ K;  3HRN A;  2OYH A;  2QGS A;  5JRC B;  3T8O A;  2NPS A;  3ZYM A;  4H63 V;  1MMG A;  4I43 B;  3U78 A;  1KIL D;  2C0S A;  4O4I E;  3HR0 A;  4GYS A;  2X51 A;  1CZQ A;  1DEB A;  4ZHQ E;  3TNU A;  1SHZ C;  2OYI A;  3ZMU B;  2KZ7 B;  5AVZ B;  1IZN B;  3UFE A;  3DTO A;  2C5K T;  2YKQ A;  2DWK A;  3KIN B;  5APT A;  4AKL A;  1JTH B;  2WWU A;  1IFI A;  1NTM K;  1SP4 A;  3OA7 A;  2RP4 A;  2PFV A;  2N9B A;  5DJQ C;  4QX7 B;  5FXV A;  1FU1 A;  1E5W A;  4IE7 A;  4Y99 C;  4X1K E;  5AW9 B;  1N73 A;  1WYB A;  2I1K A;  1J1D C;  2XU6 A;  4PK4 A;  2ZM2 A;  2EHO A;  2YIN A;  5DAB A;  2E43 A;  3ZN1 B;  4GIW A;  3MKD A;  5F3J A;  4N3Y B;  4ASK A;  2ZM0 A;  2X9H A;  3L3P A;  4CI2 B;  5JDH A;  4EZH A;  1FZC A;  1ZR2 A;  3MAC A;  3AA0 B;  4ZOL E;  4AUW A;  5AVW B;  5BU5 A;  2K5B B;  4E7Z A;  1LTJ A;  1GW4 A;  4DZO A;  1KIL B;  3MIW A;  3RYI E;  1MV8 A;  3PUS A;  5L2L A;  3MK7 C;  3I1A A;  1LWU B;  2IFN A;  3JC6 C;  2LSJ A;  3OYZ A;  1SQB K;  5H6Q B;  3PU8 A;  3CLQ A;  1S35 A;  3KDS E;  2V7J A;  1Z56 A;  4JUY A;  3RKO A;  1JOC A;  5CCG A;  1N7L A;  3M06 A;  2NP9 A;  3TYY A;  3F31 A;  3RC8 A;  5J1G A;  2CLY B;  1FIO A;  2LSY A;  2KOG A;  1M7L A;  1L4A A;  4HH2 A;  4KHX A;  4EAH A;  1HGZ A;  4DBQ A;  1BR4 A;  5EK2 A;  3KV6 A;  1HVV A;  1LTI C;  4PFO A;  2RA1 A;  1JY2 N;  5HXR A;  1OWA A;  4L9I A;  1FEW A;  3H6P A;  2CEA A;  5HXC A;  3TSI A;  3G3Z A;  2FKW B;  2FFD A;  5LJN A;  2Z4E A;  2VB6 A;  1GK4 A;  3BAT A;  1M1J A;  2LE8 A;  1G1I A;  2E9X B;  4KUM B;  5L3D B;  3HTK B;  2XTL A;  3W15 B;  1YTZ T;  1SFC A;  3O9X A;  2XNX A;  1E1H B;  1HTJ F;  3UTK A;  1S94 A;  2YKP A;  4HEA A;  1FMV A;  1J2J B;  1MFZ A;  1LVK A;  2WTY A;  4IE4 A;  4EXT A;  5LBM A;  2PAJ A;  2HYN A;  4QX8 B;  3N7N A;  2YMY A;  3FBZ A;  2NPS C;  3D0T A;  4DMW A;  2VL8 A;  2WZ7 A;  3KBT A;  2O1J A;  2R5B A;  1AJ3 A;  3I0Q A;  3ZMV B;  2BAS A;  3C64 A;  4ISS A;  3N9L A;  1WRG A;  1GU4 A;  4GIF A;  4N6J A;  2WAU A;  5JDF A;  2JMK A;  2XAQ B;  1IFJ A;  5JRC A;  3ZC1 A;  3ZJ1 A;  3M91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...