1OWAA

Solution structural studies on human erythrocyte alpha spectrin n terminal tetramerization domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, erythrocyte
publication title Solution structural studies on human erythrocyte alpha-spectrin tetramerization site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1owaA01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1owaA02
4B86A 2XZRA 5APQA 2YNYA 1QUUA 2E43A 3NTNA 2P2UA 4HYTB 1SP4A 2KP8A 3TNUB 2QM8A 3M0DA 3F31A 1J2JB 1MUUA 1S9KE 1WLXA 5AW6B 3HE5B 5AVUB 3NFQA 1S9KD 3A2AA 3P8MC 3A7OA 5APWA 4JYBA 1H89A 4C46A 2WT7A 4EOTA 4AQRD 2SPCA 1GD2E 1GZLA 2Q5UA 3L35A 3VMZA 1SLQA 3T97A 5AVQB 3M91A 4C7NA 3HE4B 2ZFCA 4KHXA 3MGNA 2R5DA 3A3YB 1GU4A 3O8ZA 2ODVA 3HTKA 3VMXA 3M06A 3LBXA 5AW7B 1NAFA 3B8EB 3OAKA 1A02J 5APYA 5AW2B 3P32A 1CI6B 5AVZB 1FOSE 3V4WA 1YYCA 4I2LC 3P7KA 1FOSF 5AVTB 2Q7CA 4LC1A 3TYYA 3V5BA 3VTPC 2W27A 1IO4A 2Q3IA 2E42A 3VMYA 5AW8B 2XV5A 3NMDA 1HUCA 3SWFA 3L37A 1CUNA 1GK6A 3M9HA 1JNMA 3MD0A 3KDPB 5AW0B 2QM7A 5AVRB 5AW3B 2R3CA 2P67A 1GK4A 5APTA 3M0AA 1S35A 1T2KD 3HE5A 3LIEA 4GKGA 2R5BA 5AVSB 5AVWB 3V4QA 3IR9A 3UULA 1GTWA 3FB2A 2W6AA 3KQGA 2C9LY 1FAVA 2WPSA 1OWAA 4I6MC 2P7JA 3VYIA 2C9NY 5AVVB 1KQLA 3LIDA 2WTYA 3M9BA 4XE5B 1U5PA 4AUWA 1U4QA 3HE4A 3NXSA 4AYCA 3EDVA 1HWTC 4RESB 2Z5IA 2JJLA 5APSA 2WPQA 2R32A 2IPPA 2YO3A 4JYCA 1HCIA 2Z5HA 1X8YA 2WT7B 2H7HA 3TNUA 1A02F 1CI6A 5AW9B 1OXZA 5AVXB 5AW1B 1HBWA 1GU5A 1T2KC 2BASA 5APUA 3L36A 1AJ3A 2YO2A 3TK1A 1DH3A 3UIAA 4GT1A 4C7NB 3I5CA 1MFZA 1HJBA 2WWWA 1G2CB 4DZOA 1MV8A 5AW5B 2VRSA 2N9BA 3LBXB 3VN0A 3UUNA 3PE0A 2XU6A 1CSBA 2WPRA 4M3LA 1JUNA 3UUMA 5CMZA 2ZXEB 5APXA 5AVYB 3A5TA 1H88A 1H8AA 1CZQA 1NWQA 5APVA 5AW4B 2ODUA
chains in the Genus database with same CATH superfamily
4W7ZA 4GKJT 1LTAC 3PUXF 5KLIC 5HAXA 4U3FJ 2CMRA 3FBZA 3CMLA 3CX5D 3M0DA 2A72A 1JB0J 2W90A 1GL2B 2NRGA 5AW6B 3NFQA 2XUEA 1RF0C 3LG7A 1HGVA 4LF6T 2YMYA 1W2BO 1O3XA 2UXDT 4JV5T 1J1DC 3C4WA 3AXJA 2C5KT 5AVQB 2BEQD 3HE4B 3MGNA 1KMIZ 5LB7B 1RY3A 1U7JA 5CFBA 2JKVA 3M65A 1QVFO 2BS3A 3B8EB 3OAKA 2HHHT 1ZW0A 4QH5A 1U7MA 4DR5T 4IL4A 1IK9A 1SQXJ 1N86A 4I2LC 2N1TA 4H13B 2A06E 3HA4A 3R84B 4DR6T 4GIWA 3L75E 4N78E 3VMYA 1EXJA 1HUCA 4ZZBA 2KSEA 2XM1A 4HGAA 1L0ND 3OVUA 4PJ0H 1SQQG 2IYPA 2XM2A 2FXPA 3RK2C 5B5EE 2ZYGA 2P67A 1L0LJ 5APTA 1GL2D 1LWUC 2C5IT 5L3DB 2NR4A 4HJGH 4GKGA 4L75A 3CWBG 1W9RA 4I4TE 5ABHA 1IFJA 4TN7B 1PPJD 3UU8A 3KZIH 2Z4EA 3QC9A 4DMWA 3CXHI 3R6NA 4JI7T 4X20E 4I55E 1SFCC 4R4LA 3H1IG 1KB9I 5FL0A 5FXWA 2R44A 1NTKD 1NTMK 3FZLB 1MNDA 4QX7B 1BDCA 1IFMA 5AQMB 3ONJA 3KVAA 2Q3EA 3QUJA 3A0HE 2YO2A 4ZMDA 4GK5E 3LJCA 5JRCB 2GA1A 1G2CB 1KQFB 5DJTB 1FBMA 1FZBA 5L4EA 2FY8A 4YXWH 3X1DA 4DV4T 3C51A 2Y9YA 2CE7A 1AJYA 3D71A 1UUSA 3K3OA 5JQGE 4JI2T 1YI2P 2ZLYA 3ZT5A 4IFMA 4DV2T 4QXBB 3AE7C 3AAEB 2UXBT 5AW4B 1J1EB 4RO0A 1JY2O 1L0NJ 4U33A 2KNCA 1Z56A 4LF9T 4HH2A 1URQA 2CEAA 3HI2A 4RKUJ 4DO0A 1XNQT 3T1YT 2D0UA 2XAGB 5LNKA 2J4GA 1GDTA 2FJAA 2WZHA 4OYJA 3N9PA 1YTZT 3JCUH 2NPSA 4PJJA 2QGSA 1JY2N 1WR0A 2Q5UA 5ABEA 4LLHA 4IDNA 2K9AA 2YK0A 3ETUA 3M9QA 1YQ3A 2I6HA 4PD4H 4EAHA 3M91A 2K1AA 4I7ZB 1BGYG 4HWCA 3VMXA 1JTHB 4DV1T 5AW7B 1NTKJ 3DTOA 2MOZA 3FXEB 2XSBA 1X9VA 3HKDE 2O01N 4OFZA 3VU7H 4HFVA 2Q6QA 5AVTB 4J2CA 1UIXA 3ZPOA 3AECC 2XV5A 1R5SA 5TISH 1W2EA 1N7SD 3H1LJ 4UB8E 4CXXA 2Q9QB 3MD0A 4A56A 2QA4P 5AQVB 3PJAJ 1YQ3C 5JVDE 3G3ZA 3I0OA 2VL0A 2L5GB 3FBLA 1HJ0A 2XZEA 3L3PA 1PIXA 2JRKA 4LGDE 3SFEA 2XTLA 2LEHA 3AEGC 1EDLA 1KYOI 2RKLA 5JDQA 2VVSA 2CBJA 2EHOD 4XE5B 2WS3A 3E0ZA 2HLOA 3HE4A 3EDVA 4H9OC 1KEYA 4DV3T 2NZ2A 3B57A 2JJLA 4U3FE 3AE1A 2LRKA 4ADZA 5LYJE 5LJMA 1WFDA 2A06G 5CJ4A 4KX6A 3GA8A 3L75G 2J5UA 1GL2C 3Q2MA 3O1IA 3SS1A 3T97B 1NYHA 2HYNA 2X0YA 3LFMA 4H9PC 4GT1A 2CPTA 4H0LB 4IFDK 1BSNA 3CIRA 3ESLA 3LBXB 2WPRA 3NZPA 1SQVE 2KZ7B 5FY7A 3IA3A 5JDNA 2E8IA 3ZN1B 3KVBA 2FJEA 3C8VA 4YXDA 4O9BA 3U1AA 4H44B 5KLVD 2K9YA 1FDMA 3AE3A 4OVNF 2UUCT 1VQ6P 3RYFE 3AE2C 3CC4P 4PJ0E 1SQQD 4HB1A 2XQ3A 1NTZK 4HWHA 4N6JA 3L09A 3C50A 5HEUA 2CXLA 1SLQA 2KWIB 3B4SA 5ABGA 5EK4A 5JRCA 4KHXA 4CPGA 1N8RQ 2KSRA 5JH7E 5AQJB 1G2CA 3KZIE 1X79A 2NW8A 3LK3B 4L0RA 3GLMA 5FMNA 1S2EA 3ZJ2A 1CI6B 1ZMEC 3H1HE 4WWIA 3U59A 1D0ZA 2P9BA 1LT9C 2FXMA 2KK7A 5E79H 1SQPK 2XNXA 4LC1A 3O1JA 4ASWA 5GONE 3RKGA 4LFCT 4O4HE 1YJ9P 1LNQA 2O01H 1AQTA 4H44D 4EEBA 2X67A 1M1KQ 4X65T 2BEZF 1EXIA 3UQ4A 2P1JA 4NPEA 3QOFA 2ZVNB 2CRBA 3N2OA 1ZOYA 4HFDA 4XBFB 2WQYC 1OEDE 3RH3A 2UXCT 4WBAA 1K9MQ 4KP3C 2YKPA 1SQBK 1ZV8A 2FKWB 3F57A 1D1AA 3NXSA 1P84I 1J1EC 2XNDH 5ADXL 4WBOA 1SQQJ 4X5TA 4IHJE 4XAXB 3OKQA 3A8YC 4LF7T 2IPPA 3FXEA 3V2NA 3GMIA 1N7SC 1X8YA 3BASA 3MUDA 3HUSB 3H1JE 2OYHB 2W63A 2E76D 5AQFB 4JI8T 3CWBJ 3JCUE 4F6RC 4HTEA 4R4MA 4C7NB 5CGMA 2VVNA 1KFMA 3BQKA 2J62A 1FEWA 2CCQA 2YEVC 2QJYB 1FZFA 2Q9QA 1AV1A 3VN0A 4PD4E 2H89C 4UV8B 4EB6E 1BGYD 1R8IA 4ISTA 2CWOA 3H1IJ 3PU3A 1XZYA 2FJDA 4DOJA 1H88A 4ZI2C 4GDOA 3NKZA 1T3UA 1ZV4X 4DT0A 1LTIC 1UX4A 2UUBT 4U7JA 1QUUA 2YDQA 3QWOC 3PHLA 1E2AA 4TT3H 4MHCA 4GOEA 3JAFA 4U3FG 3CX7B 2JQKA 5TISE 3VOPA 5KMGP 1MNEA 3H1LE 4H63V 3PUSA 1HG2A 3OYZA 2BBJA 3RRWA 4EOTA 4EDFA 2HPCA 2I0MA 3Q9DA 1ZR2A 2OTLP 3SWKA 2NW9A 3T97A 3UU4A 2FJBA 1H7CA 2E9XB 4NPFX 1IFIA 1R5LA 3NBXX 2GM4A 2YU2A 1CHUA 2L8KA 3LBXA 1NAFA 1SQVG 5HXRA 2ZT9D 5LHGB 1KILE 1M57D 4MFRA 1W09A 4Q25A 4B3ST 2YN6A 2K3RA 3AEBC 2FBWA 2JEEA 2QEXP 1E7PA 3V5BA 3K1SA 3AVRA 1X9BA 4MN4C 2Y6XA 2A06D 3V2PA 2XQ8A 3L75D 4N78D 1BR4A 2CM0A 3MXZA 4L9IA 4C91A 1HNWT 5CCGD 1KFNA 1BGYJ 1S35A 5AQHB 1IBKT 3N7NA 3Q5DA 5AVWB 3GF7A 3RYHE 4OX9T 3Q5EA 2OGUA 1AA0A 3W15B 2VKHA 3ZMZB 4CXYA 3ZMTB 2B9BA 2DHRA 5KLIB 1WT6A 2WB5A 1FU1A 2UWJE 1EDJA 2KOGA 2R3SA 4YTPA 2W66A 3SSUA 1KORA 1M1JC 2E9XD 2P58A 4MBQA 3A0BH 4KHZF 5LHIB 3H1HG 4U7YA 4JYCA 4KBMB 4H44C 2XAJB 2OYIC 2VWAA 1CI6A 2V7QJ 2QJKC 2V7QH 4BXLA 3AE4C 3CX5I 5FP3A 1GU5A 3AA1B 1BR2A 2QVAA 2ACZA 1ZP0C 4X66T 4EYYQ 3CKDA 1HJBA 1YJWP 4TWFA 1NH4A 2P10A 1NJIQ 4X1KE 3UUNA 1CW5A 2WSFJ 4A98A 3D0TA 2JMKA 3CCEP 4AQYT 2BG9A 2ACXA 3L75J 3PUWF 2I8DA 1NTME 5E79E 5F3JA 2X68A 2E76C 1DEBA 1Q2NA 3C4ZA 2ZM0A 3HE5B 3H1JG 4JLEA 5LXTE 1USDA 4GIFA 5APWA 4EYUA 4JYBA 3J7Yq 3UFGA 1LTJA 5KKZB 3HUSA 1H0TB 2CXFA 2J47A 2JJ9A 2OYHA 3ZSSA 2ZM8A 1PV3A 1KNPA 1T8ZA 3CX6B 5J1GA 4C7NA 4TWDA 5CJ0A 3EVYA 1GU4A 3P4QA 4U2ZA 1SFCB 2YKOA 3VR9A 2FYUG 1JY3P 1ZN5A 4HKZH 1D1CA 3EI0A 3Q5PA 4MALA 4CQIA 3PLNA 3N9NA 5LBQB 1HTJF 2PFXA 1IFNA 2Q3IA 4AKHA 2JQ9A 5AW8B 1NEKA 1JNMA 3AE8A 3USSA 5CB4E 2CBIA 3CWBE 5IUXA 4IL6H 5AVRB 3H1LG 1LTSC 3M0AA 4P1NA 4KJMA 3V4QA 4U2YA 3L72E 4H9SE 2QJYC 3T1HT 3K3NA 1FAVA 2D2SA 2QYWA 2DWGA 3H1IE 2ZT9C 3UUBA 1Q7YQ 1HGZA 1U5PA 4PAGA 1MZ9A 3PUGA 3PU8A 1FIOA 2JP3A 2Z5IA 3RIAA 5KJ7D 4B3TT 2QJPB 4U3FD 2DW3A 2WDRA 2YIUC 3SFDC 1NU1K 3NVOA 5CCGC 3RL0D 5AVXB 3H37A 4KMCA 4EOZB 2WPVB 1LP1A 2E74B 3B5NB 1FZAA 2WBLA 4YY3T 4O2AE 2XSAA 1LTTC 2X0LB 3I5CA 4ZI7E 5AQIB 2WWWA 4O8SA 1LVFA 4TNWA 1ZLLA 3OYXA 1X0TA 5LGUB 2X9WA 2WMNA 3MZWB 2E9XC 4IGUA 1D7MA 3RK3E 4K0UA 3OA7A 1OW8A 1SQVD 2A3DA 4DVDA 3AE5C 2RMZA 4AKIA 3V2RA 5JR9B 4JF7A 3P8CE 4FJOA 4ZS2A 3WU2H 1ZHCA 5LCYA 5JTGA 3TNUB 3QB5K 3BQLA 2QM8A 1JEKA 3FZMB 5DABA 4WBNE 3RQUA 3HR0A 1M7LA 1RF0A 4C90A 1VOMA 3B5ND 2MJZA 2YMKA 5EK3A 5LA6E 5HWXA 1OEDB 3N9OA 2LSIA 3RQWA 1S4XA 3TLVA 1J1JA 2R5DA 3I9YA 3H32A 4HEAA 5DQVA 3HTKA 1NHLA 3L70E 4JBZA 1QLED 3AE6C 2A45I 2X9YA 1VQ9P 2XHEB 2E5VA 5L2LA 3LSVA 2Y9ZA 3V4WA 3NZQA 2XQ9A 3A0BE 3H1HD 1NTMG 3II6A 1FOSF 2M5AB 3TYYA 2RN0A 2W27A 1LJ2A 1N73B 1NTZE 4YPCA 2O3JA 2Q1KA 2L91A 4WY4D 3EUHA 4YTMA 5K5GB 1LWUA 2C0XA 2V4HA 2D9DA 2OTKE 3HE5A 2R5BA 1DD3A 1SQVJ 1GTWA 4JEHB 4NUUA 2Y8DA 2Y48B 4EYYR 3ZT6A 1H0TA 3ZMVB 3FX0A 3IBPA 4CN6A 3GHGB 4GYSA 2C9NY 2LM9A 5HWYA 1SQPE 3E08A 3F2EA 5KX5E 1HWTC 4M1PA 1SFCA 4AIUA 2V26A 4YHHT 5F8PA 2YO3A 2LKMA 4AKLA 1FZCC 2IHR1 3H1JD 1GMJA 4AXPA 1K8AQ 1M8OB 1YKHB 2IDBA 5KKZC 4ZZCA 1XNRT 2N9BA 4K0KT 4UR9A 3L72G 2VKDA 3CQCB 1M62A 1SQBE 4PD4D 3QK6A 3OPCA 1LT9B 2BVMA 3H1HJ 2WSSH 2X9HA 3EHZA 3AE7A 3ZSTA 2E75D 5IHYA 2XJ7A 4O4LE 5KJ7C 2W6BA 4ZNCA 2FUPA 2HODB 1PZQA 3RL0C 1MMGA 1T3JA 3SWHA 3F31A 2YOEA 1YHQP 4ZI3D 5M1BA 4V1Av 3GW6A 4BRYB 1LGHB 1OFCX 3GMAA 4IL6E 3H1LD 1Y9BA 2KZJA 3RGUA 4OGQD 5KAFH 1Z8UA 3UU3A 3RIFA 3U78A 1L0VA 4ILBA 1BCCE 4C7RA 4TNVA 2OV9A 4EI2A 2W83C 2CLYB 1HF9A 1IJDB 3CMAP 1I94T 3E7KA 4IFFA 1N7SB 1V9DA 3P4RA 3H1JJ 1KILD 1D0YA 5FVKA 1M90Q 3QH9A 5AQQB 4DJGA 3PUYF 3AECA 1Q90D 2QJPC 2QRXA 3NMDA 3ZLIA 3P4PA 4ILAA 5DJUB 3AEAC 2QE7H 4P0AA 4ZOLE 3B5NC 2E74C 5AW0B 3IFMA 5L47A 2I1JA 5KLVK 4TWHA 2EHOB 1T2KD 1OIPA 4ASVA 3CD6P 2WCAA 2FYUJ 2ZXXA 1JMMA 5BR8T 2IAKA 4JI4T 1Q81Q 4DIDB 3AEGA 5A1LA 1RE3C 1VF5D 2JMHA 3TLTA 1QSDA 3U1CA 3L70G 3EDUA 1U4QA 4NXMT 3H3MA 2KS1B 2L9QA 3WU2E 5JR9C 1J5ET 4WY4C 1MIYA 2WMMA 4IL9A 1AFOA 1FS0E 3H3AA 2LSGA 2LSJA 5HXEA 2AEMA 3B5MA 1GL2A 1NTZG 1ZEEA 4IE6A 2M5AA 2ZVOB 4D6TE 1ZRTE 1HVVA 2ZYAA 3L74G 2CHNA 4Y99C 5AW5B 1IK7A 1OEDC 1WRDA 3QB5A 4GK0E 1HH0A 4M3LA 1JNRA 3L39A 4UF0B 2YU1A 2Y0EA 1G1IA 3A5TA 1MKMA 4AKGA 1J5WA 3L4FA 1JCCA 4B86A 3VMAA 4JI0T 3GHGA 1SQPG 2W61A 4HWIB 4UVCB 3IN6A 2PAJA 1NTMD 4O2BE 4O4IE 1VCTA 4PK5A 5LMNT 4PW8A 2NWBA 3HD7D 1UCUA 2GUSA 2IBZE 1N73C 1WLXA 3AE2A 3AEDC 5C8YE 3PDYA 1HX1B 1OMIA 1N32T 1GW4A 3S4RA 1OVUA 2PG8A 2WITA 4YSXA 1MMAA 2LJLA 2O1KA 2WZIA 3K3QC 5CHXA 3LW5H 2K9JB 1MMNA 4K3AA 1M1JB 3WUVA 2W67A 2E75C 2KUBA 3GHGC 1SQBG 3Q1MA 1HS7A 4ILCA 3CX8B 2OYIB 3FZKB 1YIJP 2QJKB 1LT9A 4QXCB 1YYCA 2WY2A 2XQ6A 5CJ5A 3ZCIA 3CCLP 5JDMA 3UUXB 3G4SP 4IT4A 2Q7CA 2E42A 2K37A 4ZI3C 2WAUA 5J0ZA 1N34T 3AA0B 4B3RT 1CUNA 3AEEC 2HODA 1UK5A 4OGQC 3CWBD 3V5SA 1S1CX 3MACA 4IL6X 4U74A 1IFPA 2CXDA 2W6AA 4GOUA 2FXOA 1PP9E 3L72D 5LG3A 1FMWA 2MYSA 3TGUG 4JBWF 2WQYA 3RHWA 3RK3B 2XQ7A 5FXVA 2I1KA 3ZJ1A 1NTMJ 5AQOB 1BCCG 2IIUA 2E76B 3H1ID 3LIDA 4ZEYA 1N36T 2HH7A 1KILC 4PV1B 5LMUT 1T72A 4RESB 1YKEB 2BCCG 3VHLA 4LF4T 2LHRA 2O01J 2H88C 3I9WA 1N7SA 3CCUP 2KLQA 2NOXA 2Z5HA 5AW9B 4Z90A 3AE9C 2H7OA 3TF5A 1T2KC 3ZDMA 3ETVA 4QX8B 5KAIH 3UIAA 5KAFE 4DV5T 3KV6A 2V8SV 1MFZA 4DR4T 1UGOA 4YSYA 3MZKB 2H89A 1VQ7P 1VF5C 1CSBA 1QL2A 3RIUC 1JUNA 4UIGA 1PGQA 5AQTB 1JTHA 2CLYC 3PJSK 2K24A 3RK3D 2H8PD 3CCSP 1U57A 2RP4A 3WAJA 3Q3DA 1HNZT 1NU1E 3NTNA 2HPJA 4PV1D 1SP4A 3P8CD 4UB6H 1T98A 4O4JE 2KS1A 3P8MC 4AQGA 5HCMA 3E1IA 3L72J 3O6QB 5FKYA 1YD8G 3GF3A 2VURA 4L74A 3UU5A 1GD2E 4D6TG 2ZT9B 2EHOC 2FYUE 1KQSO 4B3MT 3CXHH 2XKMA 2LOPA 2WP9A 2IC6A 2WWUA 1YQ4C 1G73A 5C2TA 1IAPA 1KB9H 3L70D 3PUZF 2YIUB 1EZVE 2SPZA 2JQHA 4CN4A 5AVZB 3AEBA 2WSEH 1DIPA 5LP6E 3HD7C 1DD4A 1DEEG 1PGPA 2IDOB 1T6AA 5TJHA 1S72P 3PRJA 2MPKA 3M9HA 1NTZD 2IW5B 2IBZG 3BCCJ 1NKZB 3EABA 1BE3E 2M6IA 3U3IA 3RRCA 3A5XA 2WM9A 1XDPA 3GN5B 3N2KE 3WUTA 2D2CD 2DWKA 2RA1A 4DBQA 2YXQB 3E1RA 5TAOA 2L3LA 5BU8B 3RC8A 3UU6A 2PBIA 4JEUB 4IDZA 3L71E 1FJPA 1EDKA 1M1JA 3AA7B 4FI5A 4HFBA 4U7IA 1SQPD 4OHFA 1GQEA 4CI3B 2I59A 5CCHD 1AQ5A 3BK9A 4KI0F 1YW0A 2B87B 2WPQA 4IOIH 1HX8A 4QH1A 2OYIA 2E5YA 3FXDB 2C5JA 3AE4A 1NWMX 4DBRA 1NO4A 2E5TA 1BR1A 1ZP0A 2M8RA 1NOHA 1KFYA 3NRYA 4MLKA 5IWAT 3CL3D 4P09A 3AEFC 1QX8A 3L70J 4UVBB 2B1EA 2PP6A 3PE0A 2OARA 2A2FX 4PFPA 4JI5T 3UUMA 2V6XA 5J2UE 1PP9G 1SQBD 2VQFT 3WI3A 2OLTA 1CZQA 1Y47A 3QNUA 1E79H 4B6XA 2XZRA 1NTZJ 4Z1MH 2JO1A 1Y01A 2E43A 4CN1A 3VRAA 1LRZA 3EFGA 4WB4A 2E2AA 3WMM0 2XASB 3L74J 1S9KE 2ZMAA 3KDSE 1IBLT 4ILUA 3EFFK 3A2AA 2UUAT 4KUMB 4C46A 2CHOA 2K48A 2G0UA 5EK2A 5AQPB 2DCFA 2H43A 2V7JA 4AI6A 4Z8XA 5AQKB 1XDOA 1XWMA 5IYZE 1KYOH 4UELA 3KHUA 1SQPJ 3OW2O 3KYQA 4Y28J 5FYMA 3W67A 2LOSA 3RK3C 1BCCD 1JMBA 4UVAB 1L4AD 1IC2A 2J59M 2BVLA 3C4XA 1FZCB 1A02J 4I43B 5AW2B 2KB7P 3P32A 4PV1C 2OQQA 3P7KA 1B7TA 3OBVE 1NU1G 2IZ1A 3VTPC 2XAFB 4DNDA 4PJNA 1GK6A 4EZ4A 2VB6A 2V1DB 4PNIA 3CK6A 2CPBA 5KAIE 1SQXK 1QVGO 4E7SA 3ONLC 3WAKA 1SQBJ 2FYZA 5F5WA 1FDOA 3O6QA 4ZKUA 3H6PA 2R6GF 2LLYA 3RL0B 1L0LK 4PD4I 4ISSA 4AYCA 3MJXA 3VP9A 2B76A 5H2FH 1EZVG 2DL1A 1KTMA 5LHHB 2WSCH 3SFDA 3OJAB 4UB6E 5DJQC 5CCGA 1K04A 2AXCA 3MIWA 2IYOA 3RGLA 1EZ3A 2JWAA 3L36A 3GG2A 1AJ3A 3TGUJ 5L3FB 1SUMB 3AA6B 4AISA 2IMLA 4D6TD 1WMKA 1BCCJ 1ZRTD 3KPEA 2UXNB 3KV5A 1BE3G 4DR2T 4DZOA 1EC5A 1MV8A 3B71A 4HFIA 1RF1C 1OW6A 4IE0A 5AQNB 1RE4C 5ETWA 3CXHE 4DV0T 2F4VT 2XU6A 2QSIA 4IDPA 2BCCJ 2KMFA 1NAYA 3RK2D 2E9XA 5APXA 1T8BA 2BKNA 2E5LT 4U3CA 1NWQA 1KB9E 3AE5A 4A97A 4EGWA 4W80A 4WYVA 3L71G 4DR7T 4L5GA 5APQA 3CCJP 3ZEFB 1LT1A 3A7MA 2WZ7A 2YKQA 1NKNA 1VQPP 4AQFC 2W8ZA 2WSSV 1Z0PA 2X51A 3SRZA 2N1TD 1PFIA 5AVUB 2IBZD 1L0NK 3BCCE 2LT3A 3Q5RA 1IZNB 2ZAEB 4AQRD 3ZN0B 3VMZA 1QL1A 3C9IA 3TSIA 3P4SA 4P0BA 4NPPA 4TV9E 1VPCA 2FFDC 3FGAD 1K05A 1P84H 3AE6A 4JYAT 2LXBA 4JI6T 4WY4B 3RKOA 3F89A 3EWKA 2W00A 2KNCB 1SE7A 1URQB 3R2PA 4LMJA 4TZ4C 3S1KA 2W62A 4D6TJ 3M3ZB 5FY0A 1NTKK 4DUZT 3S4UA 3FWLA 4Y99B 3ZT7A 2CWYA 2ZM6T 5AW3B 2B88A 2XDJA 5BU5A 2N9DA 3H1KJ 4CI2B 4XFJA 4LMKA 3P7IA 1DX7A 5HEOA 1L4AC 4QKNA 4K35A 5ABFB 1PP9D 2HG5D 4AKRB 2ES0A 2VASA 2BG9E 2KT9A 4YFSA 3CCMP 4HFEA 1BSHA 2Q9IA 3ABVC 1FZCA 4BAYB 1URQD 1VQ8P 3L73E 1OZHA 5JDHA 3L74E 5AW1B 1K73Q 5GTIH 3TK1A 3MTUE 2HFED 2E75B 1N33T 2BS2A 5BMVE 2K88A 2NPSD 3UQ7A 5HXCA 1KYOE 4L76A 2Y0DA 3ONXA 5AVYB 2JR8A 3VKHA 4G2AA 1OVRA 5KJ7A 3I0QA 2ODUA 3D6YA 2LM2A 2X9XA 3TLSA 4OGQB 4EV6A 2LR2A 4PK6A 1NU1D 1Y8AA 5AQLB 2FYNC 3HL6A 3M0DC 1N2DC 5FL1A 3NWIA 2WDVA 1FE6A 3W68A 2MKVA 5KLVG 3KBTA 4UV9B 3OJAA 3HRNA 3N9LA 1PP9J 2V6YB 1GZLA 2D5UA 1KZUB 1YXRA 3VKGA 1KILB 2FYUD 2MTQA 4G63A 3O9XA 1S5LH 3O8ZA 1HG5A 4ZHQE 2LE8A 2XAHB 2XPKA 4BWNA 2DNXA 2V7LA 3I1AA 3ZYLA 4DUYT 4X1YE 3CQGB 1NENA 3P4WA 2JIWA 2G8YA 5H2FE 3ZKRA 1EZVD 3PH0A 4XA4A 4EXTA 3SOLA 4HN9A 1KC8Q 3CX5H 2N1TC 2VL8A 1R8EA 4PFOA 3AEAA 1WCRA 4WVZA 5KTBA 5HEHA 2BZBA 1IBMT 3B5NA 4Z91A 1PL5A 2XY8B 2QM7A 3G71P 3TGUE 5LGTB 1VF5B 1RHZB 2R3CA 3MP7B 3HKEE 3BCCG 4IE7A 4H13D 1BE3D 3LIEA 5CBOA 1LTBC 1VQNP 3UULA 3KQGA 2ZJSE 5FY1A 1MMDA 1IFDA 3TDKA 2BCCE 3FWNA 3NRXA 1X79B 1RE3A 3KFWX 2W2UA 2AE9A 2Y0CA 4NPDA 4L73A 5AVVB 1NU1J 3PP5A 2WTYA 5FNVE 3L71D 2OA5A 1XMOT 3C1LA 3LDQB 5JR9A 5HXHA 4WY4A 2R32A 2WT7B 3TNUA 4YHJA 4I0UA 1L2PA 2LSKA 3CCQP 3C98B 3CWZB 1OVVA 3RI5A 1SQQK 4W7YA 2C0WA 2ITAA 3GWHA 3JCFA 1Y64B 1G8XA 2M6BA 2VRSA 2AXTH 5L3CB 1OEDA 2WWVA 1VQKP 1P84E 3JSVC 3JC6D 3HD7B 2A9UA 3F5HA 1USEA 2QG4A 3TLWA 2PFVA 3LK42 4A7PA 2UU9T 2K3WA 2LKHA 3ZYMA 5ABFA 2YNYA 2AEJA 1URQC 2IFMA 2KLUA 4JPZB 2P2UA 2IX7C 4F8HA 1IJ5A 4XZCA 1FZEA 5HYAA 3WUUA 1VL2A 4PJMA 2VK9A 5KXJA 1N73A 1J2JB 1BE3J 3AEDA 3CLQA 3L73G 1VQMP 1S9KD 1DU2A 2Z6EA 2NPSC 3FZFB 1QGKB 1SS1A 3VP8A 3L35A 4ZXLA 3H1KE 1EDIA 3HKCE 5LOVE 1W0BA 3L71J 3N9QA 5KDMC 5FXZA 4YSZA 4QMAA 4NIQA 3G06A 1Q86Q 1FOSE 5L4HA 2IFNA 2OYOA 1D0XA 2PRRA 3Q2YA 4ZI2D 3AEEA 1FZGA 4WW0A 2IUBA 3CPZA 3T8OA 3PJAA 4LFBT 4H9RC 4BA9A 3LW5J 3CQXC 5GTIE 5CA0E 2HPCB 3IHRA 5EFWB 2H7VC 1HTLC 3ZMUB 4QXHB 3IR9A 4CZZB 3FB2A 2C9LY 5FXXA 5JDFA 3AAAB 5AQRB 3KV9A 3BATA 4GOFA 3CC7P 4NUVA 2V6YA 3SFEC 1OWAA 3VYIA 2Q9QD 4IIJE 4U31A 2JWDA 4JQ0D 1KQLA 1KILA 3M9BA 1BDDA 3V5UA 2UXXB 2POHA 4DMVA 2H3RA 2KZIA 2HN2A 2X66A 2H88A 3S9OA 3AE1C 5LJNA 5JDGA 4DV6T 1OW7A 1SQXE 3AE9A 3K8PC 2J58A 1S3JA 2BASA 5APUA 4BRYA 4H13C 3EAMA 3RBZA 2KYVA 2IC9A 3ZC1A 3H25A 2BKOA 1N7LA 5AQGB 1YTZI 1L0LE 4OK0A 3RIUA 2A45H 1S5LE 4IDOA 3CXHD 2VKJA 3VR8A 1Q82Q 2CA5A 3Q5XA 5C3JA 1OX3A 4H0LD 3V6IA 2NP9A 3BRTB 1KB9D 1KQGB 1ZKEA 4UEMA 3J9X1 3MKDA 1XTGB 4WNKA 3CX5E 4YXDC 1MFTA 5BVZA 2M3EA 4JI1T 1RQVA 2HPLA 3AE3C 2HN1A 3UFEA 4RJTA 5H6RB 5LGNB 3A7OA 5JREA 1H89A 2WT7A 2ZYDA 1HFAA 3BCCD 2EHOA 2N9YB 1JY3O 4I1LA 1QLBA 1VRBA 3ZYKA 4HKAA 3JC6C 2C0SA 3P50A 3RYCE 3AB3B 2RPAA 1VQ5P 2KLVA 2HR3A 2ZFCA 4OH8B 1SA0E 1YQ4A 2BS4A 2GK9A 4YT0A 3FZHB 1G1JA 2BG9B 3Q5WA 5FVLA 4BJNA 4H9NC 4LMLA 2CK3H 2RH0A 1AVOA 1JOCA 3ANWB 3RC3A 4DR3T 1JY3N 5KLVJ 3HD7A 2W4XA 2BDEA 4ERRA 1JY2P 1EQ7A 4HFCA 3R4YA 1L0NE 2D2CB 2M0BA 5LBMA 2KNDA 1FC2C 1RF1B 4EIJA 3K5BA 2KINB 5GTHH 1LTJB 1YBKA 2KXPB 4YTNA 1US7B 5B66H 3MHVA 2V5DA 2DLRA 2WU2A 2AXTE 5E0OA 2G3AA 3H1KG 1SVFA 1PPJE 4KHPT 1LVKA 1WRGA 1UIIA 1ZOYC 2P7JA 4UF0A 2WSEJ 1JCDA 1VQ4P 1VQLP 1JM0A 2NTYA 1SHZC 5AQSB 3BRVB 4EIWA 4I7ZC 2V7MA 1NTKE 1VDFA 3MUDC 5AFUL 2BKPA 2W0GA 3L73D 2YDSA 3C64A 3L74D 3MA9A 4A5XA 2JPFA 3CMEP 5L3EB 5L8RJ 3MK7C 5EZYE 2FFDB 4YJ3E 1DH3A 3E22E 2IBZI 4COFA 3SWYA 3AEFA 4X1IE 2QIWA 2M3BA 2XAQB 2Q9QC 1M7KA 2K9JA 3CI9A 3G6EP 1KV4A 1YJNP 3IF4A 4TV8E 1HR0T 1KYOD 4EEDA 1FDIA 4X62T 4U72A 3KV4A 4JUYA 2K5BB 1T7SA 1FMVA 3ZC0A 5HXSA 1KK7A 3LK2B 4HYTB 3Q5SA 4QHOA 1RQUA 1MUUA 2MAWA 3CC2P 1LP1B 1NGMB 1BR0A 3TLUA 1KNRA 4ANJA 3AVSA 1SQXG 1I6ZA 1LKXA 4X64T 1NVOA 1L4AB 2M67A 3UTKA 3CCVP 3AAIA 3PTZA 1JO5A 1MIWA 1UX5A 1JNZA 1HNXT 2J1DG 4DR1T 2XQYA 2IZ0A 3I56P 3UT5E 2B89A 2PJQA 1L0LG 3A3YB 2PTFA 4H0LC 3G9RA 1TU3F 1S5LX 3TKLB 3HKBE 2ZM2A 3RLFF 3ZCJA 4TX5A 3L73J 5HEGA 3JADA 2FBWC 2XQ5A 3PUVF 1LTGC 4OYKA 2N2NA 3PV0F 1IO4A 3IAOA 3EQ2A 3L37A 3B13A 2V5CA 4JI3T 4UXNB 2YINA 1GK4A 3TGUD 2GUVA 3IF8B 3KBUA 1J1DB 3DP7A 3RX6A 4DV7T 1ZXGA 4OWFA 2WPSA 5J2TE 3H32B 1RH5B 3HTKB 2BCCD 3I55P 1UURA 2LRLA 4LFAT 2KI7B 4YTPC 2WSFH 1HF8A 5HCJA 5HEJA 2FYNB 1SQVK 1KF6A 2WVRA 5APSA 2CPSA 4GYRA 2OTJP 2H7HA 4I50E 1GW3A 1A02F 3ANWA 1L0NG 4KT0J 3CVRA 3RK2B 2VQET 2V7KA 1KD1Q 3AXJB 1LWUB 5B5EH 2KSJA 4DCKA 3KINB 3N9MA 1QEXA 1RF1A 1RE4A 5JDLA 2KWHA 1XTCC 3RL0g 4GODA 2NTXA 4QWNB 5CMZA 1PPJG 2ZXEB 1WR6A 3RF1A 1MIVA 1P84D 5CCHA 2QA7A 2N1TB 5H6QB 4H63H 5L3GB 2WSCJ 3BVHA 2BG9C 4WZXA 3PTRB 5KLVE 2N1GA 1EZVI 2KP8A 4AQFA 5AQUB 2BBHA 1NTKG 1SQQE 3PURA 2D2CC 2DI4A 2XQ4A 2X0HA 2NW7A 5GTHE 4ZKPA 3A0HH 4YJ2E 3ITKA 1IJ6A 3L8RA 5B66E 1LTJC 2SPCA 3HUSC 3RPUA 4HWDA 2OYHC 4HE8A 3FHNA 3GN5A 2O1JA 4ZS3A 3H1KD 3BQIA 3JC22 5CCHC 2FFDA 4CXWA 1AVYA 2ODVA 1WYCA 4TUYE 3V2QA 1VQOP 4PK4A 1PGJA 4CI1B 3M06A 1E5WA 3VRBA 2LHNA 5APYA 1WYBA 3O1HA 1KN7A 4HFHA 1FJKA 3N2GE 4IE5A 1VCSA 3RBXA 1XMQT 4NXNT 2AXDS 2B87A 2YXRB 4GKKT 1SFCD 3SWFA 3FXDA 3O4XE 2LKGA 2V7IA 2WDQA 3AE8C 3KDPB 1D1BA 5DQWA 3PUAA 5L3BB 3DJBA 1FJGT 4IE4A 2WMOA 2VKOA 5AVSB 1KNZA 3KXDA 4QH4A 5C39A 1L4AA 2LSYA 2LXCB 4TLFA 3OTOT 1E1HB 3N4XA 1YITP 4I6MC 4BJMA 3RYIE 5LG4A 3IEEA 3ZMSB 4AUWA 2FYUK 4H9QC 1X22A 1M56D 4LF8T 4E7ZA 2YKSA 4LF5T 3ABVA 4IREA 2XQAA 2NPSB 1HCIA 3N5LA 1W0AA 3D70A 3JAEA 1OXZA 2W6JH 1S94A 1HBWA 3D6ZA 1SQXD 4UB8H 1ZR4A 2WU5A 2KIKA 4N3YB 2MBGA 1W5CE 4PJLA 3CCRP 4ASKA 2JQQA 2PGDA 1BGYE 4EZHA 3CPWO 4IDQA 2E74D 1L0LD 4YLHA 2AEFA 2D0TA 2A45G 3PUQA 1PGOA 5CA1E 2JDIH 5CBNA 2YDRA 5M4YA 1H8AA 5APVA 4HWFA
chains in the Genus database with same CATH topology
4W7ZA 1LTAC 5HAXA 2CMRA 3FBZA 3CMLA 3M0DA 2A72A 1GL2B 5AW6B 3NFQA 2XUEA 1RF0C 3LG7A 1HGVA 2YMYA 1O3XA 1J1DC 3C4WA 2C5KT 5AVQB 3HE4B 3MGNA 1RY3A 3M65A 3B8EB 3OAKA 1IK9A 1N86A 4I2LC 2N1TA 3HA4A 3R84B 4GIWA 4N78E 3VMYA 1HUCA 4HGAA 3RK2C 2P67A 5APTA 1GL2D 1LWUC 2C5IT 5L3DB 4GKGA 4I4TE 1IFJA 4TN7B 2Z4EA 3QC9A 4DMWA 3R6NA 4X20E 4I55E 1SFCC 5FXWA 1NTMK 1MNDA 4QX7B 1IFMA 3KVAA 3QUJA 2YO2A 4GK5E 3LJCA 5JRCB 1G2CB 1FBMA 1FZBA 3C51A 2CE7A 3K3OA 5JQGE 2ZLYA 4IFMA 4QXBB 3AAEB 5AW4B 1J1EB 1JY2O 1Z56A 4HH2A 1URQA 2CEAA 3HI2A 4DO0A 2D0UA 2XAGB 5LNKA 1GDTA 4OYJA 3N9PA 1YTZT 4PJJA 2NPSA 2QGSA 1JY2N 2Q5UA 4LLHA 2K9AA 2YK0A 3ETUA 3M9QA 4EAHA 3M91A 3VMXA 1JTHB 5AW7B 3DTOA 2MOZA 3FXEB 1X9VA 3HKDE 4OFZA 3VU7H 4HFVA 5AVTB 4J2CA 3ZPOA 2XV5A 1W2EA 1N7SD 4CXXA 2Q9QB 3MD0A 4A56A 5JVDE 3G3ZA 3I0OA 2L5GB 3FBLA 3L3PA 2JRKA 4LGDE 2XTLA 2LEHA 5JDQA 2EHOD 4XE5B 3E0ZA 2HLOA 3HE4A 3EDVA 4H9OC 3B57A 2JJLA 4ADZA 5LYJE 5LJMA 5CJ4A 3GA8A 1GL2C 3Q2MA 3O1IA 3SS1A 2HYNA 3LFMA 4H9PC 4GT1A 4IFDK 3ESLA 3LBXB 2WPRA 3NZPA 2KZ7B 5FY7A 5JDNA 2E8IA 3ZN1B 3KVBA 4O9BA 3U1AA 1FDMA 3RYFE 1NTZK 4N6JA 3L09A 3C50A 2CXLA 1SLQA 2KWIB 5EK4A 5JRCA 4KHXA 5JH7E 1G2CA 1X79A 2NW8A 3LK3B 4L0RA 5FMNA 3ZJ2A 1CI6B 3U59A 1D0ZA 2P9BA 1LT9C 2FXMA 1SQPK 2XNXA 4LC1A 3O1JA 5GONE 4O4HE 2O01H 2X67A 2P1JA 3N2OA 4XBFB 3RH3A 4WBAA 4KP3C 2YKPA 1SQBK 1ZV8A 2FKWB 3F57A 1D1AA 3NXSA 1J1EC 5ADXL 4WBOA 4XAXB 4IHJE 3OKQA 2IPPA 3V2NA 3GMIA 1N7SC 1X8YA 3BASA 3MUDA 3HUSB 2OYHB 2W63A 4F6RC 4HTEA 4C7NB 3BQKA 1KFMA 1FEWA 2CCQA 2YEVC 1FZFA 2Q9QA 3VN0A 4UV8B 4EB6E 4ISTA 2CWOA 3PU3A 4DOJA 1H88A 4ZI2C 1T3UA 1ZV4X 1LTIC 1UX4A 1QUUA 4MHCA 3CX7B 3VOPA 5KMGP 1MNEA 4H63V 3PUSA 1HG2A 3OYZA 3RRWA 4EOTA 2HPCA 3Q9DA 1ZR2A 2NW9A 3T97A 1H7CA 2E9XB 3NBXX 1IFIA 2GM4A 2YU2A 2L8KA 3LBXA 1NAFA 5HXRA 5LHGB 4MFRA 2JEEA 3V5BA 3AVRA 2Y6XA 3V2PA 4N78D 1BR4A 2CM0A 3MXZA 4L9IA 4C91A 5CCGD 1KFNA 1S35A 3N7NA 5AVWB 3RYHE 3W15B 2VKHA 3ZMZB 4CXYA 3ZMTB 2DHRA 1WT6A 1FU1A 2KOGA 1M1JC 2E9XD 4MBQA 5LHIB 4KBMB 4JYCA 2XAJB 2OYIC 2VWAA 1CI6A 5FP3A 1GU5A 3AA1B 1BR2A 3CKDA 1HJBA 1NH4A 4X1KE 3UUNA 1CW5A 3D0TA 2JMKA 2ACXA 5F3JA 2X68A 1DEBA 3C4ZA 2ZM0A 3HE5B 4JLEA 5LXTE 4GIFA 5APWA 4EYUA 3J7Yq 4JYBA 1LTJA 3HUSA 2CXFA 2JJ9A 2OYHA 2ZM8A 1T8ZA 3CX6B 5J1GA 4C7NA 5CJ0A 3EVYA 1GU4A 1SFCB 2YKOA 1JY3P 1ZN5A 1D1CA 4MALA 4CQIA 3N9NA 5LBQB 1HTJF 1IFNA 2Q3IA 4AKHA 5AW8B 1JNMA 5CB4E 5AVRB 1LTSC 3M0AA 3V4QA 4H9SE 3K3NA 1FAVA 2D2SA 2DWGA 1HGZA 1U5PA 4PAGA 1MZ9A 3PUGA 3PU8A 1FIOA 2Z5IA 5KJ7D 1NU1K 5CCGC 3RL0D 5AVXB 3H37A 4KMCA 4EOZB 3B5NB 1FZAA 2WBLA 4O2AE 1LTTC 2X0LB 3I5CA 4ZI7E 2WWWA 4O8SA 1LVFA 1ZLLA 3OYXA 5LGUB 2X9WA 2WMNA 2E9XC 4IGUA 4K0UA 3OA7A 4DVDA 2A3DA 4AKIA 3V2RA 5JR9B 4JF7A 3P8CE 4FJOA 4ZS2A 1ZHCA 5LCYA 3TNUB 3BQLA 2QM8A 5DABA 4WBNE 3HR0A 1M7LA 1RF0A 4C90A 1VOMA 3B5ND 2MJZA 5EK3A 5LA6E 5HWXA 3N9OA 2LSIA 2R5DA 3I9YA 3H32A 4HEAA 5DQVA 3HTKA 1NHLA 2A45I 2X9YA 2XHEB 5L2LA 3V4WA 3NZQA 3II6A 1FOSF 3TYYA 2W27A 1N73B 4WY4D 3EUHA 1LWUA 2C0XA 3HE5A 2R5BA 1GTWA 4JEHB 4NUUA 2Y8DA 2Y48B 4EYYR 3ZMVB 3IBPA 3GHGB 4GYSA 2C9NY 2LM9A 5HWYA 3E08A 3F2EA 5KX5E 1HWTC 4M1PA 1SFCA 2V26A 5F8PA 2YO3A 2LKMA 4AKLA 1FZCC 4AXPA 1YKHB 2N9BA 2VKDA 3CQCB 3QK6A 1LT9B 2BVMA 2X9HA 5IHYA 4O4LE 5KJ7C 2W6BA 2HODB 3RL0C 1MMGA 1T3JA 3SWHA 3F31A 4ZI3D 4V1Av 1LGHB 3U78A 4C7RA 2CLYB 1IJDB 4IFFA 1N7SB 1V9DA 1KILD 1D0YA 3NMDA 3ZLIA 4P0AA 4ZOLE 3B5NC 5AW0B 3IFMA 2I1JA 5KLVK 2EHOB 1T2KD 1JMMA 2IAKA 5A1LA 1RE3C 2JMHA 1QSDA 3U1CA 3EDUA 1U4QA 2L9QA 5JR9C 4WY4C 1MIYA 1AFOA 3H3AA 2LSGA 2LSJA 5HXEA 1GL2A 1ZEEA 4IE6A 1HVVA 4Y99C 5AW5B 1WRDA 4GK0E 1HH0A 4M3LA 4UF0B 2YU1A 1G1IA 3A5TA 4AKGA 3L4FA 1JCCA 4B86A 3GHGA 2W61A 4UVCB 2PAJA 4O2BE 4O4IE 4PK5A 4PW8A 2NWBA 3HD7D 1UCUA 2GUSA 1N73C 1WLXA 5C8YE 3PDYA 1GW4A 2PG8A 2WITA 1MMAA 2LJLA 2O1KA 3K3QC 5CHXA 3LW5H 1MMNA 1M1JB 3GHGC 1HS7A 3CX8B 2OYIB 1LT9A 4QXCB 1YYCA 3ZCIA 5JDMA 3UUXB 2Q7CA 2E42A 4ZI3C 2WAUA 3AA0B 1CUNA 2HODA 3V5SA 3MACA 4U74A 2CXDA 2W6AA 4GOUA 1FMWA 2MYSA 3RK3B 5FXVA 2I1KA 3ZJ1A 3LIDA 2HH7A 1KILC 4RESB 1YKEB 3VHLA 2LHRA 3I9WA 1N7SA 2KLQA 2NOXA 2Z5HA 5AW9B 2H7OA 1T2KC 3ETVA 4QX8B 3UIAA 3KV6A 1MFZA 3MZKB 1CSBA 1QL2A 1JUNA 4UIGA 1JTHA 2CLYC 2K24A 3RK3D 2RP4A 2H8PD 3WAJA 3NTNA 2HPJA 1SP4A 3P8CD 1T98A 4O4JE 3P8MC 4AQGA 3E1IA 1YD8G 1GD2E 2EHOC 2XKMA 2LOPA 2IC6A 2WWUA 1G73A 1IAPA 5AVZB 2WSEH 5LP6E 3HD7C 3M9HA 2IW5B 1NKZB 3U3IA 3RRCA 3A5XA 2WM9A 3GN5B 3N2KE 2DWKA 2RA1A 4DBQA 5TAOA 2L3LA 5BU8B 3RC8A 2PBIA 4JEUB 4IDZA 1FJPA 1M1JA 3AA7B 4FI5A 4CI3B 4OHFA 2I59A 5CCHD 1AQ5A 3BK9A 1YW0A 2WPQA 1HX8A 2OYIA 3FXDB 2C5JA 1NWMX 4DBRA 1NO4A 1BR1A 2M8RA 1NOHA 3NRYA 4MLKA 3CL3D 4P09A 4UVBB 2B1EA 2PP6A 3PE0A 2OARA 2A2FX 4PFPA 3UUMA 5J2UE 3WI3A 1CZQA 4B6XA 2XZRA 2E43A 1LRZA 3EFGA 4WB4A 3WMM0 2XASB 1S9KE 2ZMAA 3KDSE 4ILUA 3A2AA 4KUMB 4C46A 2K48A 2G0UA 5EK2A 2DCFA 2H43A 2V7JA 4AI6A 4Z8XA 5IYZE 4UELA 3KYQA 5FYMA 2LOSA 3RK3C 4UVAB 1L4AD 1IC2A 2J59M 2BVLA 3C4XA 1FZCB 1A02J 4I43B 5AW2B 2KB7P 3P32A 3P7KA 1B7TA 3OBVE 2XAFB 3VTPC 4DNDA 4PJNA 1GK6A 4EZ4A 2VB6A 2V1DB 4PNIA 2CPBA 1SQXK 4E7SA 3WAKA 2FYZA 4ZKUA 3H6PA 3RL0B 1L0LK 4ISSA 4AYCA 3MJXA 3VP9A 5LHHB 2WSCH 3OJAB 5DJQC 5CCGA 3MIWA 1EZ3A 3L36A 1AJ3A 5L3FB 3AA6B 3KPEA 2UXNB 3KV5A 4DZOA 1MV8A 4IE0A 1RF1C 1RE4C 5ETWA 2XU6A 2KMFA 3RK2D 2E9XA 5APXA 1NWQA 4W80A 4L5GA 5APQA 3ZEFB 2WZ7A 2YKQA 1NKNA 4AQFC 2WSSV 1Z0PA 2X51A 3SRZA 2N1TD 1PFIA 5AVUB 1L0NK 2LT3A 1IZNB 4AQRD 3ZN0B 3VMZA 1QL1A 3C9IA 3TSIA 4P0BA 4TV9E 1VPCA 2FFDC 4WY4B 3RKOA 2W00A 1URQB 3R2PA 4TZ4C 2W62A 5FY0A 1NTKK 3S4UA 4Y99B 2CWYA 5AW3B 2XDJA 5BU5A 2N9DA 4CI2B 3P7IA 1DX7A 1L4AC 4QKNA 2HG5D 4AKRB 2ES0A 2VASA 2KT9A 4YFSA 2Q9IA 1FZCA 4BAYB 1URQD 5JDHA 5AW1B 3TK1A 3MTUE 2HFED 5BMVE 2NPSD 5HXCA 3ONXA 5AVYB 3VKHA 4G2AA 5KJ7A 3I0QA 2ODUA 2X9XA 4PK6A 3HL6A 3M0DC 1N2DC 3KBTA 4UV9B 3OJAA 3HRNA 3N9LA 1GZLA 2D5UA 1KZUB 3VKGA 1KILB 2MTQA 4G63A 3O9XA 3O8ZA 1HG5A 4ZHQE 2LE8A 2XAHB 3ZYLA 2DNXA 2V7LA 3I1AA 4X1YE 3CQGB 4XA4A 4EXTA 3SOLA 4HN9A 2N1TC 2VL8A 4PFOA 5KTBA 2BZBA 3B5NA 5LGTB 2QM7A 2R3CA 3HKEE 4IE7A 3LIEA 1LTBC 3UULA 3KQGA 5FY1A 1MMDA 1IFDA 3NRXA 1X79B 1RE3A 3KFWX 5AVVB 3PP5A 2WTYA 5FNVE 2OA5A 5JR9A 5HXHA 4WY4A 2R32A 2WT7B 3TNUA 4YHJA 2LSKA 3C98B 3CWZB 1SQQK 4W7YA 2C0WA 3GWHA 1Y64B 1G8XA 2VRSA 5L3CB 3JC6D 3HD7B 2PFVA 3LK42 3ZYMA 2YNYA 1URQC 2IFMA 2P2UA 2IX7C 1IJ5A 4XZCA 1FZEA 5HYAA 4PJMA 2VK9A 1N73A 1J2JB 3CLQA 1S9KD 2Z6EA 2NPSC 3VP8A 3L35A 3HKCE 5LOVE 3N9QA 5KDMC 5FXZA 1FOSE 2IFNA 1D0XA 4ZI2D 1FZGA 4WW0A 3CPZA 3T8OA 4H9RC 4BA9A 3CQXC 5CA0E 2HPCB 3IHRA 2H7VC 1HTLC 3ZMUB 4QXHB 3IR9A 4CZZB 3FB2A 2C9LY 5FXXA 5JDFA 3AAAB 3KV9A 3BATA 4NUVA 1OWAA 3VYIA 2Q9QD 4IIJE 1KQLA 1KILA 3M9BA 3V5UA 2UXXB 2POHA 4DMVA 2H3RA 2X66A 5LJNA 5JDGA 3K8PC 2J58A 2BASA 5APUA 2KYVA 2IC9A 3ZC1A 1N7LA 1YTZI 4OK0A 2A45H 2VKJA 2CA5A 3Q5XA 2NP9A 3BRTB 1ZKEA 4UEMA 3J9X1 3MKDA 1XTGB 4WNKA 5BVZA 2HPLA 3UFEA 5H6RB 5LGNB 3A7OA 5JREA 1H89A 2WT7A 1HFAA 2EHOA 1JY3O 4I1LA 1VRBA 3ZYKA 4HKAA 3JC6C 2C0SA 3RYCE 3AB3B 2KLVA 2ZFCA 4OH8B 1SA0E 2GK9A 1G1JA 3Q5WA 4BJNA 4H9NC 1JOCA 3ANWB 3RC3A 1JY3N 3HD7A 2BDEA 4ERRA 1JY2P 1EQ7A 5LBMA 2KNDA 1RF1B 4EIJA 2KINB 1LTJB 2KXPB 1US7B 2DLRA 5E0OA 1SVFA 1LVKA 1WRGA 2P7JA 4UF0A 1JCDA 2NTYA 1SHZC 3BRVB 4EIWA 2V7MA 1VDFA 5AFUL 2W0GA 3C64A 3MA9A 2JPFA 5L3EB 3MK7C 5EZYE 2FFDB 4YJ3E 1DH3A 3E22E 3SWYA 4X1IE 2M3BA 2XAQB 2Q9QC 3CI9A 4TV8E 4U72A 3KV4A 4JUYA 2K5BB 1FMVA 3ZC0A 5HXSA 1KK7A 3LK2B 4HYTB 4QHOA 1MUUA 1BR0A 4ANJA 3AVSA 1LKXA 1L4AB 2M67A 3UTKA 3AAIA 1JO5A 1MIWA 1UX5A 2J1DG 2XQYA 3UT5E 2PJQA 3A3YB 3TKLB 3HKBE 2ZM2A 3ZCJA 4TX5A 1LTGC 4OYKA 2N2NA 1IO4A 3EQ2A 3L37A 3B13A 4UXNB 2YINA 1GK4A 2GUVA 3IF8B 3KBUA 1J1DB 3DP7A 3RX6A 2WPSA 5J2TE 3H32B 3HTKB 2WSFH 1HF8A 1SQVK 5APSA 2CPSA 4GYRA 2H7HA 4I50E 1GW3A 1A02F 3ANWA 3CVRA 3RK2B 2V7KA 1LWUB 2KSJA 3KINB 3N9MA 1RF1A 1RE4A 5JDLA 2KWHA 1XTCC 4QWNB 2NTXA 5CMZA 2ZXEB 1WR6A 1MIVA 5CCHA 2QA7A 2N1TB 5H6QB 4H63H 5L3GB 3BVHA 3PTRB 2N1GA 2KP8A 4AQFA 3PURA 2DI4A 2NW7A 4ZKPA 4YJ2E 1IJ6A 1LTJC 2SPCA 3HUSC 3RPUA 2OYHC 4HE8A 3FHNA 3GN5A 2O1JA 4ZS3A 3BQIA 5CCHC 2FFDA 4CXWA 2ODVA 1WYCA 4TUYE 3V2QA 4PK4A 4CI1B 3M06A 1E5WA 2LHNA 5APYA 1WYBA 3O1HA 1FJKA 3N2GE 4IE5A 1SFCD 3SWFA 3O4XE 2V7IA 3KDPB 1D1BA 5DQWA 3PUAA 5L3BB 3DJBA 4IE4A 2WMOA 2VKOA 5AVSB 1KNZA 1L4AA 2LSYA 1E1HB 3N4XA 4I6MC 4BJMA 3RYIE 5LG4A 3IEEA 3ZMSB 4AUWA 2FYUK 4H9QC 4E7ZA 2NPSB 1HCIA 3N5LA 1OXZA 1S94A 1HBWA 1ZR4A 4N3YB 2MBGA 4PJLA 4ASKA 2JQQA 4EZHA 4YLHA 2D0TA 2A45G 3PUQA 5CA1E 5M4YA 1H8AA 5APVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B86 A;  2XZR A;  5APQ A;  2YNY A;  1QUU A;  2E43 A;  3NTN A;  2P2U A;  4HYT B;  1SP4 A;  2KP8 A;  3TNU B;  2QM8 A;  3M0D A;  3F31 A;  1J2J B;  1MUU A;  1S9K E;  1WLX A;  5AW6 B;  3HE5 B;  5AVU B;  3NFQ A;  1S9K D;  3A2A A;  3P8M C;  3A7O A;  5APW A;  4JYB A;  1H89 A;  4C46 A;  2WT7 A;  4EOT A;  4AQR D;  2SPC A;  1GD2 E;  1GZL A;  2Q5U A;  3L35 A;  3VMZ A;  1SLQ A;  3T97 A;  5AVQ B;  3M91 A;  4C7N A;  3HE4 B;  2ZFC A;  4KHX A;  3MGN A;  2R5D A;  3A3Y B;  1GU4 A;  3O8Z A;  2ODV A;  3HTK A;  3VMX A;  3M06 A;  3LBX A;  5AW7 B;  1NAF A;  3B8E B;  3OAK A;  1A02 J;  5APY A;  5AW2 B;  3P32 A;  1CI6 B;  5AVZ B;  1FOS E;  3V4W A;  1YYC A;  4I2L C;  3P7K A;  1FOS F;  5AVT B;  2Q7C A;  4LC1 A;  3TYY A;  3V5B A;  3VTP C;  2W27 A;  1IO4 A;  2Q3I A;  2E42 A;  3VMY A;  5AW8 B;  2XV5 A;  3NMD A;  1HUC A;  3SWF A;  3L37 A;  1CUN A;  1GK6 A;  3M9H A;  1JNM A;  3MD0 A;  3KDP B;  5AW0 B;  2QM7 A;  5AVR B;  5AW3 B;  2R3C A;  2P67 A;  1GK4 A;  5APT A;  3M0A A;  1S35 A;  1T2K D;  3HE5 A;  3LIE A;  4GKG A;  2R5B A;  5AVS B;  5AVW B;  3V4Q A;  3IR9 A;  3UUL A;  1GTW A;  3FB2 A;  2W6A A;  3KQG A;  2C9L Y;  1FAV A;  2WPS A;  1OWA A;  4I6M C;  2P7J A;  3VYI A;  2C9N Y;  5AVV B;  1KQL A;  3LID A;  2WTY A;  3M9B A;  4XE5 B;  1U5P A;  4AUW A;  1U4Q A;  3HE4 A;  3NXS A;  4AYC A;  3EDV A;  1HWT C;  4RES B;  2Z5I A;  2JJL A;  5APS A;  2WPQ A;  2R32 A;  2IPP A;  2YO3 A;  4JYC A;  1HCI A;  2Z5H A;  1X8Y A;  2WT7 B;  2H7H A;  3TNU A;  1A02 F;  1CI6 A;  5AW9 B;  1OXZ A;  5AVX B;  5AW1 B;  1HBW A;  1GU5 A;  1T2K C;  2BAS A;  5APU A;  3L36 A;  1AJ3 A;  2YO2 A;  3TK1 A;  1DH3 A;  3UIA A;  4GT1 A;  4C7N B;  3I5C A;  1MFZ A;  1HJB A;  2WWW A;  1G2C B;  4DZO A;  1MV8 A;  5AW5 B;  2VRS A;  2N9B A;  3LBX B;  3VN0 A;  3UUN A;  3PE0 A;  2XU6 A;  1CSB A;  2WPR A;  4M3L A;  1JUN A;  3UUM A;  5CMZ A;  2ZXE B;  5APX A;  5AVY B;  3A5T A;  1H88 A;  1H8A A;  1CZQ A;  1NWQ A;  5APV A;  5AW4 B;  2ODU A; 
#chains in the Genus database with same CATH topology
 4W7Z A;  4GKJ T;  1LTA C;  3PUX F;  5KLI C;  5HAX A;  4U3F J;  2CMR A;  3FBZ A;  3CML A;  3CX5 D;  3M0D A;  2A72 A;  1JB0 J;  2W90 A;  1GL2 B;  2NRG A;  5AW6 B;  3NFQ A;  2XUE A;  1RF0 C;  3LG7 A;  1HGV A;  4LF6 T;  2YMY A;  1W2B O;  1O3X A;  2UXD T;  4JV5 T;  1J1D C;  3C4W A;  3AXJ A;  2C5K T;  5AVQ B;  2BEQ D;  3HE4 B;  3MGN A;  1KMI Z;  5LB7 B;  1RY3 A;  1U7J A;  5CFB A;  2JKV A;  3M65 A;  1QVF O;  2BS3 A;  3B8E B;  3OAK A;  2HHH T;  1ZW0 A;  4QH5 A;  1U7M A;  4DR5 T;  4IL4 A;  1IK9 A;  1SQX J;  1N86 A;  4I2L C;  2N1T A;  4H13 B;  2A06 E;  3HA4 A;  3R84 B;  4DR6 T;  4GIW A;  3L75 E;  4N78 E;  3VMY A;  1EXJ A;  1HUC A;  4ZZB A;  2KSE A;  2XM1 A;  4HGA A;  1L0N D;  3OVU A;  4PJ0 H;  1SQQ G;  2IYP A;  2XM2 A;  2FXP A;  3RK2 C;  5B5E E;  2ZYG A;  2P67 A;  1L0L J;  5APT A;  1GL2 D;  1LWU C;  2C5I T;  5L3D B;  2NR4 A;  4HJG H;  4GKG A;  4L75 A;  3CWB G;  1W9R A;  4I4T E;  5ABH A;  1IFJ A;  4TN7 B;  1PPJ D;  3UU8 A;  3KZI H;  2Z4E A;  3QC9 A;  4DMW A;  3CXH I;  3R6N A;  4JI7 T;  4X20 E;  4I55 E;  1SFC C;  4R4L A;  3H1I G;  1KB9 I;  5FL0 A;  5FXW A;  2R44 A;  1NTK D;  1NTM K;  3FZL B;  1MND A;  4QX7 B;  1BDC A;  1IFM A;  5AQM B;  3ONJ A;  3KVA A;  2Q3E A;  3QUJ A;  3A0H E;  2YO2 A;  4ZMD A;  4GK5 E;  3LJC A;  5JRC B;  2GA1 A;  1G2C B;  1KQF B;  5DJT B;  1FBM A;  1FZB A;  5L4E A;  2FY8 A;  4YXW H;  3X1D A;  4DV4 T;  3C51 A;  2Y9Y A;  2CE7 A;  1AJY A;  3D71 A;  1UUS A;  3K3O A;  5JQG E;  4JI2 T;  1YI2 P;  2ZLY A;  3ZT5 A;  4IFM A;  4DV2 T;  4QXB B;  3AE7 C;  3AAE B;  2UXB T;  5AW4 B;  1J1E B;  4RO0 A;  1JY2 O;  1L0N J;  4U33 A;  2KNC A;  1Z56 A;  4LF9 T;  4HH2 A;  1URQ A;  2CEA A;  3HI2 A;  4RKU J;  4DO0 A;  1XNQ T;  3T1Y T;  2D0U A;  2XAG B;  5LNK A;  2J4G A;  1GDT A;  2FJA A;  2WZH A;  4OYJ A;  3N9P A;  1YTZ T;  3JCU H;  2NPS A;  4PJJ A;  2QGS A;  1JY2 N;  1WR0 A;  2Q5U A;  5ABE A;  4LLH A;  4IDN A;  2K9A A;  2YK0 A;  3ETU A;  3M9Q A;  1YQ3 A;  2I6H A;  4PD4 H;  4EAH A;  3M91 A;  2K1A A;  4I7Z B;  1BGY G;  4HWC A;  3VMX A;  1JTH B;  4DV1 T;  5AW7 B;  1NTK J;  3DTO A;  2MOZ A;  3FXE B;  2XSB A;  1X9V A;  3HKD E;  2O01 N;  4OFZ A;  3VU7 H;  4HFV A;  2Q6Q A;  5AVT B;  4J2C A;  1UIX A;  3ZPO A;  3AEC C;  2XV5 A;  1R5S A;  5TIS H;  1W2E A;  1N7S D;  3H1L J;  4UB8 E;  4CXX A;  2Q9Q B;  3MD0 A;  4A56 A;  2QA4 P;  5AQV B;  3PJA J;  1YQ3 C;  5JVD E;  3G3Z A;  3I0O A;  2VL0 A;  2L5G B;  3FBL A;  1HJ0 A;  2XZE A;  3L3P A;  1PIX A;  2JRK A;  4LGD E;  3SFE A;  2XTL A;  2LEH A;  3AEG C;  1EDL A;  1KYO I;  2RKL A;  5JDQ A;  2VVS A;  2CBJ A;  2EHO D;  4XE5 B;  2WS3 A;  3E0Z A;  2HLO A;  3HE4 A;  3EDV A;  4H9O C;  1KEY A;  4DV3 T;  2NZ2 A;  3B57 A;  2JJL A;  4U3F E;  3AE1 A;  2LRK A;  4ADZ A;  5LYJ E;  5LJM A;  1WFD A;  2A06 G;  5CJ4 A;  4KX6 A;  3GA8 A;  3L75 G;  2J5U A;  1GL2 C;  3Q2M A;  3O1I A;  3SS1 A;  3T97 B;  1NYH A;  2HYN A;  2X0Y A;  3LFM A;  4H9P C;  4GT1 A;  2CPT A;  4H0L B;  4IFD K;  1BSN A;  3CIR A;  3ESL A;  3LBX B;  2WPR A;  3NZP A;  1SQV E;  2KZ7 B;  5FY7 A;  3IA3 A;  5JDN A;  2E8I A;  3ZN1 B;  3KVB A;  2FJE A;  3C8V A;  4YXD A;  4O9B A;  3U1A A;  4H44 B;  5KLV D;  2K9Y A;  1FDM A;  3AE3 A;  4OVN F;  2UUC T;  1VQ6 P;  3RYF E;  3AE2 C;  3CC4 P;  4PJ0 E;  1SQQ D;  4HB1 A;  2XQ3 A;  1NTZ K;  4HWH A;  4N6J A;  3L09 A;  3C50 A;  5HEU A;  2CXL A;  1SLQ A;  2KWI B;  3B4S A;  5ABG A;  5EK4 A;  5JRC A;  4KHX A;  4CPG A;  1N8R Q;  2KSR A;  5JH7 E;  5AQJ B;  1G2C A;  3KZI E;  1X79 A;  2NW8 A;  3LK3 B;  4L0R A;  3GLM A;  5FMN A;  1S2E A;  3ZJ2 A;  1CI6 B;  1ZME C;  3H1H E;  4WWI A;  3U59 A;  1D0Z A;  2P9B A;  1LT9 C;  2FXM A;  2KK7 A;  5E79 H;  1SQP K;  2XNX A;  4LC1 A;  3O1J A;  4ASW A;  5GON E;  3RKG A;  4LFC T;  4O4H E;  1YJ9 P;  1LNQ A;  2O01 H;  1AQT A;  4H44 D;  4EEB A;  2X67 A;  1M1K Q;  4X65 T;  2BEZ F;  1EXI A;  3UQ4 A;  2P1J A;  4NPE A;  3QOF A;  2ZVN B;  2CRB A;  3N2O A;  1ZOY A;  4HFD A;  4XBF B;  2WQY C;  1OED E;  3RH3 A;  2UXC T;  4WBA A;  1K9M Q;  4KP3 C;  2YKP A;  1SQB K;  1ZV8 A;  2FKW B;  3F57 A;  1D1A A;  3NXS A;  1P84 I;  1J1E C;  2XND H;  5ADX L;  4WBO A;  1SQQ J;  4X5T A;  4IHJ E;  4XAX B;  3OKQ A;  3A8Y C;  4LF7 T;  2IPP A;  3FXE A;  3V2N A;  3GMI A;  1N7S C;  1X8Y A;  3BAS A;  3MUD A;  3HUS B;  3H1J E;  2OYH B;  2W63 A;  2E76 D;  5AQF B;  4JI8 T;  3CWB J;  3JCU E;  4F6R C;  4HTE A;  4R4M A;  4C7N B;  5CGM A;  2VVN A;  1KFM A;  3BQK A;  2J62 A;  1FEW A;  2CCQ A;  2YEV C;  2QJY B;  1FZF A;  2Q9Q A;  1AV1 A;  3VN0 A;  4PD4 E;  2H89 C;  4UV8 B;  4EB6 E;  1BGY D;  1R8I A;  4IST A;  2CWO A;  3H1I J;  3PU3 A;  1XZY A;  2FJD A;  4DOJ A;  1H88 A;  4ZI2 C;  4GDO A;  3NKZ A;  1T3U A;  1ZV4 X;  4DT0 A;  1LTI C;  1UX4 A;  2UUB T;  4U7J A;  1QUU A;  2YDQ A;  3QWO C;  3PHL A;  1E2A A;  4TT3 H;  4MHC A;  4GOE A;  3JAF A;  4U3F G;  3CX7 B;  2JQK A;  5TIS E;  3VOP A;  5KMG P;  1MNE A;  3H1L E;  4H63 V;  3PUS A;  1HG2 A;  3OYZ A;  2BBJ A;  3RRW A;  4EOT A;  4EDF A;  2HPC A;  2I0M A;  3Q9D A;  1ZR2 A;  2OTL P;  3SWK A;  2NW9 A;  3T97 A;  3UU4 A;  2FJB A;  1H7C A;  2E9X B;  4NPF X;  1IFI A;  1R5L A;  3NBX X;  2GM4 A;  2YU2 A;  1CHU A;  2L8K A;  3LBX A;  1NAF A;  1SQV G;  5HXR A;  2ZT9 D;  5LHG B;  1KIL E;  1M57 D;  4MFR A;  1W09 A;  4Q25 A;  4B3S T;  2YN6 A;  2K3R A;  3AEB C;  2FBW A;  2JEE A;  2QEX P;  1E7P A;  3V5B A;  3K1S A;  3AVR A;  1X9B A;  4MN4 C;  2Y6X A;  2A06 D;  3V2P A;  2XQ8 A;  3L75 D;  4N78 D;  1BR4 A;  2CM0 A;  3MXZ A;  4L9I A;  4C91 A;  1HNW T;  5CCG D;  1KFN A;  1BGY J;  1S35 A;  5AQH B;  1IBK T;  3N7N A;  3Q5D A;  5AVW B;  3GF7 A;  3RYH E;  4OX9 T;  3Q5E A;  2OGU A;  1AA0 A;  3W15 B;  2VKH A;  3ZMZ B;  4CXY A;  3ZMT B;  2B9B A;  2DHR A;  5KLI B;  1WT6 A;  2WB5 A;  1FU1 A;  2UWJ E;  1EDJ A;  2KOG A;  2R3S A;  4YTP A;  2W66 A;  3SSU A;  1KOR A;  1M1J C;  2E9X D;  2P58 A;  4MBQ A;  3A0B H;  4KHZ F;  5LHI B;  3H1H G;  4U7Y A;  4JYC A;  4KBM B;  4H44 C;  2XAJ B;  2OYI C;  2VWA A;  1CI6 A;  2V7Q J;  2QJK C;  2V7Q H;  4BXL A;  3AE4 C;  3CX5 I;  5FP3 A;  1GU5 A;  3AA1 B;  1BR2 A;  2QVA A;  2ACZ A;  1ZP0 C;  4X66 T;  4EYY Q;  3CKD A;  1HJB A;  1YJW P;  4TWF A;  1NH4 A;  2P10 A;  1NJI Q;  4X1K E;  3UUN A;  1CW5 A;  2WSF J;  4A98 A;  3D0T A;  2JMK A;  3CCE P;  4AQY T;  2BG9 A;  2ACX A;  3L75 J;  3PUW F;  2I8D A;  1NTM E;  5E79 E;  5F3J A;  2X68 A;  2E76 C;  1DEB A;  1Q2N A;  3C4Z A;  2ZM0 A;  3HE5 B;  3H1J G;  4JLE A;  5LXT E;  1USD A;  4GIF A;  5APW A;  4EYU A;  4JYB A;  3J7Y q;  3UFG A;  1LTJ A;  5KKZ B;  3HUS A;  1H0T B;  2CXF A;  2J47 A;  2JJ9 A;  2OYH A;  3ZSS A;  2ZM8 A;  1PV3 A;  1KNP A;  1T8Z A;  3CX6 B;  5J1G A;  4C7N A;  4TWD A;  5CJ0 A;  3EVY A;  1GU4 A;  3P4Q A;  4U2Z A;  1SFC B;  2YKO A;  3VR9 A;  2FYU G;  1JY3 P;  1ZN5 A;  4HKZ H;  1D1C A;  3EI0 A;  3Q5P A;  4MAL A;  4CQI A;  3PLN A;  3N9N A;  5LBQ B;  1HTJ F;  2PFX A;  1IFN A;  2Q3I A;  4AKH A;  2JQ9 A;  5AW8 B;  1NEK A;  1JNM A;  3AE8 A;  3USS A;  5CB4 E;  2CBI A;  3CWB E;  5IUX A;  4IL6 H;  5AVR B;  3H1L G;  1LTS C;  3M0A A;  4P1N A;  4KJM A;  3V4Q A;  4U2Y A;  3L72 E;  4H9S E;  2QJY C;  3T1H T;  3K3N A;  1FAV A;  2D2S A;  2QYW A;  2DWG A;  3H1I E;  2ZT9 C;  3UUB A;  1Q7Y Q;  1HGZ A;  1U5P A;  4PAG A;  1MZ9 A;  3PUG A;  3PU8 A;  1FIO A;  2JP3 A;  2Z5I A;  3RIA A;  5KJ7 D;  4B3T T;  2QJP B;  4U3F D;  2DW3 A;  2WDR A;  2YIU C;  3SFD C;  1NU1 K;  3NVO A;  5CCG C;  3RL0 D;  5AVX B;  3H37 A;  4KMC A;  4EOZ B;  2WPV B;  1LP1 A;  2E74 B;  3B5N B;  1FZA A;  2WBL A;  4YY3 T;  4O2A E;  2XSA A;  1LTT C;  2X0L B;  3I5C A;  4ZI7 E;  5AQI B;  2WWW A;  4O8S A;  1LVF A;  4TNW A;  1ZLL A;  3OYX A;  1X0T A;  5LGU B;  2X9W A;  2WMN A;  3MZW B;  2E9X C;  4IGU A;  1D7M A;  3RK3 E;  4K0U A;  3OA7 A;  1OW8 A;  1SQV D;  2A3D A;  4DVD A;  3AE5 C;  2RMZ A;  4AKI A;  3V2R A;  5JR9 B;  4JF7 A;  3P8C E;  4FJO A;  4ZS2 A;  3WU2 H;  1ZHC A;  5LCY A;  5JTG A;  3TNU B;  3QB5 K;  3BQL A;  2QM8 A;  1JEK A;  3FZM B;  5DAB A;  4WBN E;  3RQU A;  3HR0 A;  1M7L A;  1RF0 A;  4C90 A;  1VOM A;  3B5N D;  2MJZ A;  2YMK A;  5EK3 A;  5LA6 E;  5HWX A;  1OED B;  3N9O A;  2LSI A;  3RQW A;  1S4X A;  3TLV A;  1J1J A;  2R5D A;  3I9Y A;  3H32 A;  4HEA A;  5DQV A;  3HTK A;  1NHL A;  3L70 E;  4JBZ A;  1QLE D;  3AE6 C;  2A45 I;  2X9Y A;  1VQ9 P;  2XHE B;  2E5V A;  5L2L A;  3LSV A;  2Y9Z A;  3V4W A;  3NZQ A;  2XQ9 A;  3A0B E;  3H1H D;  1NTM G;  3II6 A;  1FOS F;  2M5A B;  3TYY A;  2RN0 A;  2W27 A;  1LJ2 A;  1N73 B;  1NTZ E;  4YPC A;  2O3J A;  2Q1K A;  2L91 A;  4WY4 D;  3EUH A;  4YTM A;  5K5G B;  1LWU A;  2C0X A;  2V4H A;  2D9D A;  2OTK E;  3HE5 A;  2R5B A;  1DD3 A;  1SQV J;  1GTW A;  4JEH B;  4NUU A;  2Y8D A;  2Y48 B;  4EYY R;  3ZT6 A;  1H0T A;  3ZMV B;  3FX0 A;  3IBP A;  4CN6 A;  3GHG B;  4GYS A;  2C9N Y;  2LM9 A;  5HWY A;  1SQP E;  3E08 A;  3F2E A;  5KX5 E;  1HWT C;  4M1P A;  1SFC A;  4AIU A;  2V26 A;  4YHH T;  5F8P A;  2YO3 A;  2LKM A;  4AKL A;  1FZC C;  2IHR 1;  3H1J D;  1GMJ A;  4AXP A;  1K8A Q;  1M8O B;  1YKH B;  2IDB A;  5KKZ C;  4ZZC A;  1XNR T;  2N9B A;  4K0K T;  4UR9 A;  3L72 G;  2VKD A;  3CQC B;  1M62 A;  1SQB E;  4PD4 D;  3QK6 A;  3OPC A;  1LT9 B;  2BVM A;  3H1H J;  2WSS H;  2X9H A;  3EHZ A;  3AE7 A;  3ZST A;  2E75 D;  5IHY A;  2XJ7 A;  4O4L E;  5KJ7 C;  2W6B A;  4ZNC A;  2FUP A;  2HOD B;  1PZQ A;  3RL0 C;  1MMG A;  1T3J A;  3SWH A;  3F31 A;  2YOE A;  1YHQ P;  4ZI3 D;  5M1B A;  4V1A v;  3GW6 A;  4BRY B;  1LGH B;  1OFC X;  3GMA A;  4IL6 E;  3H1L D;  1Y9B A;  2KZJ A;  3RGU A;  4OGQ D;  5KAF H;  1Z8U A;  3UU3 A;  3RIF A;  3U78 A;  1L0V A;  4ILB A;  1BCC E;  4C7R A;  4TNV A;  2OV9 A;  4EI2 A;  2W83 C;  2CLY B;  1HF9 A;  1IJD B;  3CMA P;  1I94 T;  3E7K A;  4IFF A;  1N7S B;  1V9D A;  3P4R A;  3H1J J;  1KIL D;  1D0Y A;  5FVK A;  1M90 Q;  3QH9 A;  5AQQ B;  4DJG A;  3PUY F;  3AEC A;  1Q90 D;  2QJP C;  2QRX A;  3NMD A;  3ZLI A;  3P4P A;  4ILA A;  5DJU B;  3AEA C;  2QE7 H;  4P0A A;  4ZOL E;  3B5N C;  2E74 C;  5AW0 B;  3IFM A;  5L47 A;  2I1J A;  5KLV K;  4TWH A;  2EHO B;  1T2K D;  1OIP A;  4ASV A;  3CD6 P;  2WCA A;  2FYU J;  2ZXX A;  1JMM A;  5BR8 T;  2IAK A;  4JI4 T;  1Q81 Q;  4DID B;  3AEG A;  5A1L A;  1RE3 C;  1VF5 D;  2JMH A;  3TLT A;  1QSD A;  3U1C A;  3L70 G;  3EDU A;  1U4Q A;  4NXM T;  3H3M A;  2KS1 B;  2L9Q A;  3WU2 E;  5JR9 C;  1J5E T;  4WY4 C;  1MIY A;  2WMM A;  4IL9 A;  1AFO A;  1FS0 E;  3H3A A;  2LSG A;  2LSJ A;  5HXE A;  2AEM A;  3B5M A;  1GL2 A;  1NTZ G;  1ZEE A;  4IE6 A;  2M5A A;  2ZVO B;  4D6T E;  1ZRT E;  1HVV A;  2ZYA A;  3L74 G;  2CHN A;  4Y99 C;  5AW5 B;  1IK7 A;  1OED C;  1WRD A;  3QB5 A;  4GK0 E;  1HH0 A;  4M3L A;  1JNR A;  3L39 A;  4UF0 B;  2YU1 A;  2Y0E A;  1G1I A;  3A5T A;  1MKM A;  4AKG A;  1J5W A;  3L4F A;  1JCC A;  4B86 A;  3VMA A;  4JI0 T;  3GHG A;  1SQP G;  2W61 A;  4HWI B;  4UVC B;  3IN6 A;  2PAJ A;  1NTM D;  4O2B E;  4O4I E;  1VCT A;  4PK5 A;  5LMN T;  4PW8 A;  2NWB A;  3HD7 D;  1UCU A;  2GUS A;  2IBZ E;  1N73 C;  1WLX A;  3AE2 A;  3AED C;  5C8Y E;  3PDY A;  1HX1 B;  1OMI A;  1N32 T;  1GW4 A;  3S4R A;  1OVU A;  2PG8 A;  2WIT A;  4YSX A;  1MMA A;  2LJL A;  2O1K A;  2WZI A;  3K3Q C;  5CHX A;  3LW5 H;  2K9J B;  1MMN A;  4K3A A;  1M1J B;  3WUV A;  2W67 A;  2E75 C;  2KUB A;  3GHG C;  1SQB G;  3Q1M A;  1HS7 A;  4ILC A;  3CX8 B;  2OYI B;  3FZK B;  1YIJ P;  2QJK B;  1LT9 A;  4QXC B;  1YYC A;  2WY2 A;  2XQ6 A;  5CJ5 A;  3ZCI A;  3CCL P;  5JDM A;  3UUX B;  3G4S P;  4IT4 A;  2Q7C A;  2E42 A;  2K37 A;  4ZI3 C;  2WAU A;  5J0Z A;  1N34 T;  3AA0 B;  4B3R T;  1CUN A;  3AEE C;  2HOD A;  1UK5 A;  4OGQ C;  3CWB D;  3V5S A;  1S1C X;  3MAC A;  4IL6 X;  4U74 A;  1IFP A;  2CXD A;  2W6A A;  4GOU A;  2FXO A;  1PP9 E;  3L72 D;  5LG3 A;  1FMW A;  2MYS A;  3TGU G;  4JBW F;  2WQY A;  3RHW A;  3RK3 B;  2XQ7 A;  5FXV A;  2I1K A;  3ZJ1 A;  1NTM J;  5AQO B;  1BCC G;  2IIU A;  2E76 B;  3H1I D;  3LID A;  4ZEY A;  1N36 T;  2HH7 A;  1KIL C;  4PV1 B;  5LMU T;  1T72 A;  4RES B;  1YKE B;  2BCC G;  3VHL A;  4LF4 T;  2LHR A;  2O01 J;  2H88 C;  3I9W A;  1N7S A;  3CCU P;  2KLQ A;  2NOX A;  2Z5H A;  5AW9 B;  4Z90 A;  3AE9 C;  2H7O A;  3TF5 A;  1T2K C;  3ZDM A;  3ETV A;  4QX8 B;  5KAI H;  3UIA A;  5KAF E;  4DV5 T;  3KV6 A;  2V8S V;  1MFZ A;  4DR4 T;  1UGO A;  4YSY A;  3MZK B;  2H89 A;  1VQ7 P;  1VF5 C;  1CSB A;  1QL2 A;  3RIU C;  1JUN A;  4UIG A;  1PGQ A;  5AQT B;  1JTH A;  2CLY C;  3PJS K;  2K24 A;  3RK3 D;  2H8P D;  3CCS P;  1U57 A;  2RP4 A;  3WAJ A;  3Q3D A;  1HNZ T;  1NU1 E;  3NTN A;  2HPJ A;  4PV1 D;  1SP4 A;  3P8C D;  4UB6 H;  1T98 A;  4O4J E;  2KS1 A;  3P8M C;  4AQG A;  5HCM A;  3E1I A;  3L72 J;  3O6Q B;  5FKY A;  1YD8 G;  3GF3 A;  2VUR A;  4L74 A;  3UU5 A;  1GD2 E;  4D6T G;  2ZT9 B;  2EHO C;  2FYU E;  1KQS O;  4B3M T;  3CXH H;  2XKM A;  2LOP A;  2WP9 A;  2IC6 A;  2WWU A;  1YQ4 C;  1G73 A;  5C2T A;  1IAP A;  1KB9 H;  3L70 D;  3PUZ F;  2YIU B;  1EZV E;  2SPZ A;  2JQH A;  4CN4 A;  5AVZ B;  3AEB A;  2WSE H;  1DIP A;  5LP6 E;  3HD7 C;  1DD4 A;  1DEE G;  1PGP A;  2IDO B;  1T6A A;  5TJH A;  1S72 P;  3PRJ A;  2MPK A;  3M9H A;  1NTZ D;  2IW5 B;  2IBZ G;  3BCC J;  1NKZ B;  3EAB A;  1BE3 E;  2M6I A;  3U3I A;  3RRC A;  3A5X A;  2WM9 A;  1XDP A;  3GN5 B;  3N2K E;  3WUT A;  2D2C D;  2DWK A;  2RA1 A;  4DBQ A;  2YXQ B;  3E1R A;  5TAO A;  2L3L A;  5BU8 B;  3RC8 A;  3UU6 A;  2PBI A;  4JEU B;  4IDZ A;  3L71 E;  1FJP A;  1EDK A;  1M1J A;  3AA7 B;  4FI5 A;  4HFB A;  4U7I A;  1SQP D;  4OHF A;  1GQE A;  4CI3 B;  2I59 A;  5CCH D;  1AQ5 A;  3BK9 A;  4KI0 F;  1YW0 A;  2B87 B;  2WPQ A;  4IOI H;  1HX8 A;  4QH1 A;  2OYI A;  2E5Y A;  3FXD B;  2C5J A;  3AE4 A;  1NWM X;  4DBR A;  1NO4 A;  2E5T A;  1BR1 A;  1ZP0 A;  2M8R A;  1NOH A;  1KFY A;  3NRY A;  4MLK A;  5IWA T;  3CL3 D;  4P09 A;  3AEF C;  1QX8 A;  3L70 J;  4UVB B;  2B1E A;  2PP6 A;  3PE0 A;  2OAR A;  2A2F X;  4PFP A;  4JI5 T;  3UUM A;  2V6X A;  5J2U E;  1PP9 G;  1SQB D;  2VQF T;  3WI3 A;  2OLT A;  1CZQ A;  1Y47 A;  3QNU A;  1E79 H;  4B6X A;  2XZR A;  1NTZ J;  4Z1M H;  2JO1 A;  1Y01 A;  2E43 A;  4CN1 A;  3VRA A;  1LRZ A;  3EFG A;  4WB4 A;  2E2A A;  3WMM 0;  2XAS B;  3L74 J;  1S9K E;  2ZMA A;  3KDS E;  1IBL T;  4ILU A;  3EFF K;  3A2A A;  2UUA T;  4KUM B;  4C46 A;  2CHO A;  2K48 A;  2G0U A;  5EK2 A;  5AQP B;  2DCF A;  2H43 A;  2V7J A;  4AI6 A;  4Z8X A;  5AQK B;  1XDO A;  1XWM A;  5IYZ E;  1KYO H;  4UEL A;  3KHU A;  1SQP J;  3OW2 O;  3KYQ A;  4Y28 J;  5FYM A;  3W67 A;  2LOS A;  3RK3 C;  1BCC D;  1JMB A;  4UVA B;  1L4A D;  1IC2 A;  2J59 M;  2BVL A;  3C4X A;  1FZC B;  1A02 J;  4I43 B;  5AW2 B;  2KB7 P;  3P32 A;  4PV1 C;  2OQQ A;  3P7K A;  1B7T A;  3OBV E;  1NU1 G;  2IZ1 A;  3VTP C;  2XAF B;  4DND A;  4PJN A;  1GK6 A;  4EZ4 A;  2VB6 A;  2V1D B;  4PNI A;  3CK6 A;  2CPB A;  5KAI E;  1SQX K;  1QVG O;  4E7S A;  3ONL C;  3WAK A;  1SQB J;  2FYZ A;  5F5W A;  1FDO A;  3O6Q A;  4ZKU A;  3H6P A;  2R6G F;  2LLY A;  3RL0 B;  1L0L K;  4PD4 I;  4ISS A;  4AYC A;  3MJX A;  3VP9 A;  2B76 A;  5H2F H;  1EZV G;  2DL1 A;  1KTM A;  5LHH B;  2WSC H;  3SFD A;  3OJA B;  4UB6 E;  5DJQ C;  5CCG A;  1K04 A;  2AXC A;  3MIW A;  2IYO A;  3RGL A;  1EZ3 A;  2JWA A;  3L36 A;  3GG2 A;  1AJ3 A;  3TGU J;  5L3F B;  1SUM B;  3AA6 B;  4AIS A;  2IML A;  4D6T D;  1WMK A;  1BCC J;  1ZRT D;  3KPE A;  2UXN B;  3KV5 A;  1BE3 G;  4DR2 T;  4DZO A;  1EC5 A;  1MV8 A;  3B71 A;  4HFI A;  1RF1 C;  1OW6 A;  4IE0 A;  5AQN B;  1RE4 C;  5ETW A;  3CXH E;  4DV0 T;  2F4V T;  2XU6 A;  2QSI A;  4IDP A;  2BCC J;  2KMF A;  1NAY A;  3RK2 D;  2E9X A;  5APX A;  1T8B A;  2BKN A;  2E5L T;  4U3C A;  1NWQ A;  1KB9 E;  3AE5 A;  4A97 A;  4EGW A;  4W80 A;  4WYV A;  3L71 G;  4DR7 T;  4L5G A;  5APQ A;  3CCJ P;  3ZEF B;  1LT1 A;  3A7M A;  2WZ7 A;  2YKQ A;  1NKN A;  1VQP P;  4AQF C;  2W8Z A;  2WSS V;  1Z0P A;  2X51 A;  3SRZ A;  2N1T D;  1PFI A;  5AVU B;  2IBZ D;  1L0N K;  3BCC E;  2LT3 A;  3Q5R A;  1IZN B;  2ZAE B;  4AQR D;  3ZN0 B;  3VMZ A;  1QL1 A;  3C9I A;  3TSI A;  3P4S A;  4P0B A;  4NPP A;  4TV9 E;  1VPC A;  2FFD C;  3FGA D;  1K05 A;  1P84 H;  3AE6 A;  4JYA T;  2LXB A;  4JI6 T;  4WY4 B;  3RKO A;  3F89 A;  3EWK A;  2W00 A;  2KNC B;  1SE7 A;  1URQ B;  3R2P A;  4LMJ A;  4TZ4 C;  3S1K A;  2W62 A;  4D6T J;  3M3Z B;  5FY0 A;  1NTK K;  4DUZ T;  3S4U A;  3FWL A;  4Y99 B;  3ZT7 A;  2CWY A;  2ZM6 T;  5AW3 B;  2B88 A;  2XDJ A;  5BU5 A;  2N9D A;  3H1K J;  4CI2 B;  4XFJ A;  4LMK A;  3P7I A;  1DX7 A;  5HEO A;  1L4A C;  4QKN A;  4K35 A;  5ABF B;  1PP9 D;  2HG5 D;  4AKR B;  2ES0 A;  2VAS A;  2BG9 E;  2KT9 A;  4YFS A;  3CCM P;  4HFE A;  1BSH A;  2Q9I A;  3ABV C;  1FZC A;  4BAY B;  1URQ D;  1VQ8 P;  3L73 E;  1OZH A;  5JDH A;  3L74 E;  5AW1 B;  1K73 Q;  5GTI H;  3TK1 A;  3MTU E;  2HFE D;  2E75 B;  1N33 T;  2BS2 A;  5BMV E;  2K88 A;  2NPS D;  3UQ7 A;  5HXC A;  1KYO E;  4L76 A;  2Y0D A;  3ONX A;  5AVY B;  2JR8 A;  3VKH A;  4G2A A;  1OVR A;  5KJ7 A;  3I0Q A;  2ODU A;  3D6Y A;  2LM2 A;  2X9X A;  3TLS A;  4OGQ B;  4EV6 A;  2LR2 A;  4PK6 A;  1NU1 D;  1Y8A A;  5AQL B;  2FYN C;  3HL6 A;  3M0D C;  1N2D C;  5FL1 A;  3NWI A;  2WDV A;  1FE6 A;  3W68 A;  2MKV A;  5KLV G;  3KBT A;  4UV9 B;  3OJA A;  3HRN A;  3N9L A;  1PP9 J;  2V6Y B;  1GZL A;  2D5U A;  1KZU B;  1YXR A;  3VKG A;  1KIL B;  2FYU D;  2MTQ A;  4G63 A;  3O9X A;  1S5L H;  3O8Z A;  1HG5 A;  4ZHQ E;  2LE8 A;  2XAH B;  2XPK A;  4BWN A;  2DNX A;  2V7L A;  3I1A A;  3ZYL A;  4DUY T;  4X1Y E;  3CQG B;  1NEN A;  3P4W A;  2JIW A;  2G8Y A;  5H2F E;  3ZKR A;  1EZV D;  3PH0 A;  4XA4 A;  4EXT A;  3SOL A;  4HN9 A;  1KC8 Q;  3CX5 H;  2N1T C;  2VL8 A;  1R8E A;  4PFO A;  3AEA A;  1WCR A;  4WVZ A;  5KTB A;  5HEH A;  2BZB A;  1IBM T;  3B5N A;  4Z91 A;  1PL5 A;  2XY8 B;  2QM7 A;  3G71 P;  3TGU E;  5LGT B;  1VF5 B;  1RHZ B;  2R3C A;  3MP7 B;  3HKE E;  3BCC G;  4IE7 A;  4H13 D;  1BE3 D;  3LIE A;  5CBO A;  1LTB C;  1VQN P;  3UUL A;  3KQG A;  2ZJS E;  5FY1 A;  1MMD A;  1IFD A;  3TDK A;  2BCC E;  3FWN A;  3NRX A;  1X79 B;  1RE3 A;  3KFW X;  2W2U A;  2AE9 A;  2Y0C A;  4NPD A;  4L73 A;  5AVV B;  1NU1 J;  3PP5 A;  2WTY A;  5FNV E;  3L71 D;  2OA5 A;  1XMO T;  3C1L A;  3LDQ B;  5JR9 A;  5HXH A;  4WY4 A;  2R32 A;  2WT7 B;  3TNU A;  4YHJ A;  4I0U A;  1L2P A;  2LSK A;  3CCQ P;  3C98 B;  3CWZ B;  1OVV A;  3RI5 A;  1SQQ K;  4W7Y A;  2C0W A;  2ITA A;  3GWH A;  3JCF A;  1Y64 B;  1G8X A;  2M6B A;  2VRS A;  2AXT H;  5L3C B;  1OED A;  2WWV A;  1VQK P;  1P84 E;  3JSV C;  3JC6 D;  3HD7 B;  2A9U A;  3F5H A;  1USE A;  2QG4 A;  3TLW A;  2PFV A;  3LK4 2;  4A7P A;  2UU9 T;  2K3W A;  2LKH A;  3ZYM A;  5ABF A;  2YNY A;  2AEJ A;  1URQ C;  2IFM A;  2KLU A;  4JPZ B;  2P2U A;  2IX7 C;  4F8H A;  1IJ5 A;  4XZC A;  1FZE A;  5HYA A;  3WUU A;  1VL2 A;  4PJM A;  2VK9 A;  5KXJ A;  1N73 A;  1J2J B;  1BE3 J;  3AED A;  3CLQ A;  3L73 G;  1VQM P;  1S9K D;  1DU2 A;  2Z6E A;  2NPS C;  3FZF B;  1QGK B;  1SS1 A;  3VP8 A;  3L35 A;  4ZXL A;  3H1K E;  1EDI A;  3HKC E;  5LOV E;  1W0B A;  3L71 J;  3N9Q A;  5KDM C;  5FXZ A;  4YSZ A;  4QMA A;  4NIQ A;  3G06 A;  1Q86 Q;  1FOS E;  5L4H A;  2IFN A;  2OYO A;  1D0X A;  2PRR A;  3Q2Y A;  4ZI2 D;  3AEE A;  1FZG A;  4WW0 A;  2IUB A;  3CPZ A;  3T8O A;  3PJA A;  4LFB T;  4H9R C;  4BA9 A;  3LW5 J;  3CQX C;  5GTI E;  5CA0 E;  2HPC B;  3IHR A;  5EFW B;  2H7V C;  1HTL C;  3ZMU B;  4QXH B;  3IR9 A;  4CZZ B;  3FB2 A;  2C9L Y;  5FXX A;  5JDF A;  3AAA B;  5AQR B;  3KV9 A;  3BAT A;  4GOF A;  3CC7 P;  4NUV A;  2V6Y A;  3SFE C;  1OWA A;  3VYI A;  2Q9Q D;  4IIJ E;  4U31 A;  2JWD A;  4JQ0 D;  1KQL A;  1KIL A;  3M9B A;  1BDD A;  3V5U A;  2UXX B;  2POH A;  4DMV A;  2H3R A;  2KZI A;  2HN2 A;  2X66 A;  2H88 A;  3S9O A;  3AE1 C;  5LJN A;  5JDG A;  4DV6 T;  1OW7 A;  1SQX E;  3AE9 A;  3K8P C;  2J58 A;  1S3J A;  2BAS A;  5APU A;  4BRY A;  4H13 C;  3EAM A;  3RBZ A;  2KYV A;  2IC9 A;  3ZC1 A;  3H25 A;  2BKO A;  1N7L A;  5AQG B;  1YTZ I;  1L0L E;  4OK0 A;  3RIU A;  2A45 H;  1S5L E;  4IDO A;  3CXH D;  2VKJ A;  3VR8 A;  1Q82 Q;  2CA5 A;  3Q5X A;  5C3J A;  1OX3 A;  4H0L D;  3V6I A;  2NP9 A;  3BRT B;  1KB9 D;  1KQG B;  1ZKE A;  4UEM A;  3J9X 1;  3MKD A;  1XTG B;  4WNK A;  3CX5 E;  4YXD C;  1MFT A;  5BVZ A;  2M3E A;  4JI1 T;  1RQV A;  2HPL A;  3AE3 C;  2HN1 A;  3UFE A;  4RJT A;  5H6R B;  5LGN B;  3A7O A;  5JRE A;  1H89 A;  2WT7 A;  2ZYD A;  1HFA A;  3BCC D;  2EHO A;  2N9Y B;  1JY3 O;  4I1L A;  1QLB A;  1VRB A;  3ZYK A;  4HKA A;  3JC6 C;  2C0S A;  3P50 A;  3RYC E;  3AB3 B;  2RPA A;  1VQ5 P;  2KLV A;  2HR3 A;  2ZFC A;  4OH8 B;  1SA0 E;  1YQ4 A;  2BS4 A;  2GK9 A;  4YT0 A;  3FZH B;  1G1J A;  2BG9 B;  3Q5W A;  5FVL A;  4BJN A;  4H9N C;  4LML A;  2CK3 H;  2RH0 A;  1AVO A;  1JOC A;  3ANW B;  3RC3 A;  4DR3 T;  1JY3 N;  5KLV J;  3HD7 A;  2W4X A;  2BDE A;  4ERR A;  1JY2 P;  1EQ7 A;  4HFC A;  3R4Y A;  1L0N E;  2D2C B;  2M0B A;  5LBM A;  2KND A;  1FC2 C;  1RF1 B;  4EIJ A;  3K5B A;  2KIN B;  5GTH H;  1LTJ B;  1YBK A;  2KXP B;  4YTN A;  1US7 B;  5B66 H;  3MHV A;  2V5D A;  2DLR A;  2WU2 A;  2AXT E;  5E0O A;  2G3A A;  3H1K G;  1SVF A;  1PPJ E;  4KHP T;  1LVK A;  1WRG A;  1UII A;  1ZOY C;  2P7J A;  4UF0 A;  2WSE J;  1JCD A;  1VQ4 P;  1VQL P;  1JM0 A;  2NTY A;  1SHZ C;  5AQS B;  3BRV B;  4EIW A;  4I7Z C;  2V7M A;  1NTK E;  1VDF A;  3MUD C;  5AFU L;  2BKP A;  2W0G A;  3L73 D;  2YDS A;  3C64 A;  3L74 D;  3MA9 A;  4A5X A;  2JPF A;  3CME P;  5L3E B;  5L8R J;  3MK7 C;  5EZY E;  2FFD B;  4YJ3 E;  1DH3 A;  3E22 E;  2IBZ I;  4COF A;  3SWY A;  3AEF A;  4X1I E;  2QIW A;  2M3B A;  2XAQ B;  2Q9Q C;  1M7K A;  2K9J A;  3CI9 A;  3G6E P;  1KV4 A;  1YJN P;  3IF4 A;  4TV8 E;  1HR0 T;  1KYO D;  4EED A;  1FDI A;  4X62 T;  4U72 A;  3KV4 A;  4JUY A;  2K5B B;  1T7S A;  1FMV A;  3ZC0 A;  5HXS A;  1KK7 A;  3LK2 B;  4HYT B;  3Q5S A;  4QHO A;  1RQU A;  1MUU A;  2MAW A;  3CC2 P;  1LP1 B;  1NGM B;  1BR0 A;  3TLU A;  1KNR A;  4ANJ A;  3AVS A;  1SQX G;  1I6Z A;  1LKX A;  4X64 T;  1NVO A;  1L4A B;  2M67 A;  3UTK A;  3CCV P;  3AAI A;  3PTZ A;  1JO5 A;  1MIW A;  1UX5 A;  1JNZ A;  1HNX T;  2J1D G;  4DR1 T;  2XQY A;  2IZ0 A;  3I56 P;  3UT5 E;  2B89 A;  2PJQ A;  1L0L G;  3A3Y B;  2PTF A;  4H0L C;  3G9R A;  1TU3 F;  1S5L X;  3TKL B;  3HKB E;  2ZM2 A;  3RLF F;  3ZCJ A;  4TX5 A;  3L73 J;  5HEG A;  3JAD A;  2FBW C;  2XQ5 A;  3PUV F;  1LTG C;  4OYK A;  2N2N A;  3PV0 F;  1IO4 A;  3IAO A;  3EQ2 A;  3L37 A;  3B13 A;  2V5C A;  4JI3 T;  4UXN B;  2YIN A;  1GK4 A;  3TGU D;  2GUV A;  3IF8 B;  3KBU A;  1J1D B;  3DP7 A;  3RX6 A;  4DV7 T;  1ZXG A;  4OWF A;  2WPS A;  5J2T E;  3H32 B;  1RH5 B;  3HTK B;  2BCC D;  3I55 P;  1UUR A;  2LRL A;  4LFA T;  2KI7 B;  4YTP C;  2WSF H;  1HF8 A;  5HCJ A;  5HEJ A;  2FYN B;  1SQV K;  1KF6 A;  2WVR A;  5APS A;  2CPS A;  4GYR A;  2OTJ P;  2H7H A;  4I50 E;  1GW3 A;  1A02 F;  3ANW A;  1L0N G;  4KT0 J;  3CVR A;  3RK2 B;  2VQE T;  2V7K A;  1KD1 Q;  3AXJ B;  1LWU B;  5B5E H;  2KSJ A;  4DCK A;  3KIN B;  3N9M A;  1QEX A;  1RF1 A;  1RE4 A;  5JDL A;  2KWH A;  1XTC C;  3RL0 g;  4GOD A;  2NTX A;  4QWN B;  5CMZ A;  1PPJ G;  2ZXE B;  1WR6 A;  3RF1 A;  1MIV A;  1P84 D;  5CCH A;  2QA7 A;  2N1T B;  5H6Q B;  4H63 H;  5L3G B;  2WSC J;  3BVH A;  2BG9 C;  4WZX A;  3PTR B;  5KLV E;  2N1G A;  1EZV I;  2KP8 A;  4AQF A;  5AQU B;  2BBH A;  1NTK G;  1SQQ E;  3PUR A;  2D2C C;  2DI4 A;  2XQ4 A;  2X0H A;  2NW7 A;  5GTH E;  4ZKP A;  3A0H H;  4YJ2 E;  3ITK A;  1IJ6 A;  3L8R A;  5B66 E;  1LTJ C;  2SPC A;  3HUS C;  3RPU A;  4HWD A;  2OYH C;  4HE8 A;  3FHN A;  3GN5 A;  2O1J A;  4ZS3 A;  3H1K D;  3BQI A;  3JC2 2;  5CCH C;  2FFD A;  4CXW A;  1AVY A;  2ODV A;  1WYC A;  4TUY E;  3V2Q A;  1VQO P;  4PK4 A;  1PGJ A;  4CI1 B;  3M06 A;  1E5W A;  3VRB A;  2LHN A;  5APY A;  1WYB A;  3O1H A;  1KN7 A;  4HFH A;  1FJK A;  3N2G E;  4IE5 A;  1VCS A;  3RBX A;  1XMQ T;  4NXN T;  2AXD S;  2B87 A;  2YXR B;  4GKK T;  1SFC D;  3SWF A;  3FXD A;  3O4X E;  2LKG A;  2V7I A;  2WDQ A;  3AE8 C;  3KDP B;  1D1B A;  5DQW A;  3PUA A;  5L3B B;  3DJB A;  1FJG T;  4IE4 A;  2WMO A;  2VKO A;  5AVS B;  1KNZ A;  3KXD A;  4QH4 A;  5C39 A;  1L4A A;  2LSY A;  2LXC B;  4TLF A;  3OTO T;  1E1H B;  3N4X A;  1YIT P;  4I6M C;  4BJM A;  3RYI E;  5LG4 A;  3IEE A;  3ZMS B;  4AUW A;  2FYU K;  4H9Q C;  1X22 A;  1M56 D;  4LF8 T;  4E7Z A;  2YKS A;  4LF5 T;  3ABV A;  4IRE A;  2XQA A;  2NPS B;  1HCI A;  3N5L A;  1W0A A;  3D70 A;  3JAE A;  1OXZ A;  2W6J H;  1S94 A;  1HBW A;  3D6Z A;  1SQX D;  4UB8 H;  1ZR4 A;  2WU5 A;  2KIK A;  4N3Y B;  2MBG A;  1W5C E;  4PJL A;  3CCR P;  4ASK A;  2JQQ A;  2PGD A;  1BGY E;  4EZH A;  3CPW O;  4IDQ A;  2E74 D;  1L0L D;  4YLH A;  2AEF A;  2D0T A;  2A45 G;  3PUQ A;  1PGO A;  5CA1 E;  2JDI H;  5CBN A;  2YDR A;  5M4Y A;  1H8A A;  5APV A;  4HWF A; 
#chains in the Genus database with same CATH homology
 4W7Z A;  1LTA C;  5HAX A;  2CMR A;  3FBZ A;  3CML A;  3M0D A;  2A72 A;  1GL2 B;  5AW6 B;  3NFQ A;  2XUE A;  1RF0 C;  3LG7 A;  1HGV A;  2YMY A;  1O3X A;  1J1D C;  3C4W A;  2C5K T;  5AVQ B;  3HE4 B;  3MGN A;  1RY3 A;  3M65 A;  3B8E B;  3OAK A;  1IK9 A;  1N86 A;  4I2L C;  2N1T A;  3HA4 A;  3R84 B;  4GIW A;  4N78 E;  3VMY A;  1HUC A;  4HGA A;  3RK2 C;  2P67 A;  5APT A;  1GL2 D;  1LWU C;  2C5I T;  5L3D B;  4GKG A;  4I4T E;  1IFJ A;  4TN7 B;  2Z4E A;  3QC9 A;  4DMW A;  3R6N A;  4X20 E;  4I55 E;  1SFC C;  5FXW A;  1NTM K;  1MND A;  4QX7 B;  1IFM A;  3KVA A;  3QUJ A;  2YO2 A;  4GK5 E;  3LJC A;  5JRC B;  1G2C B;  1FBM A;  1FZB A;  3C51 A;  2CE7 A;  3K3O A;  5JQG E;  2ZLY A;  4IFM A;  4QXB B;  3AAE B;  5AW4 B;  1J1E B;  1JY2 O;  1Z56 A;  4HH2 A;  1URQ A;  2CEA A;  3HI2 A;  4DO0 A;  2D0U A;  2XAG B;  5LNK A;  1GDT A;  4OYJ A;  3N9P A;  1YTZ T;  4PJJ A;  2NPS A;  2QGS A;  1JY2 N;  2Q5U A;  4LLH A;  2K9A A;  2YK0 A;  3ETU A;  3M9Q A;  4EAH A;  3M91 A;  3VMX A;  1JTH B;  5AW7 B;  3DTO A;  2MOZ A;  3FXE B;  1X9V A;  3HKD E;  4OFZ A;  3VU7 H;  4HFV A;  5AVT B;  4J2C A;  3ZPO A;  2XV5 A;  1W2E A;  1N7S D;  4CXX A;  2Q9Q B;  3MD0 A;  4A56 A;  5JVD E;  3G3Z A;  3I0O A;  2L5G B;  3FBL A;  3L3P A;  2JRK A;  4LGD E;  2XTL A;  2LEH A;  5JDQ A;  2EHO D;  4XE5 B;  3E0Z A;  2HLO A;  3HE4 A;  3EDV A;  4H9O C;  3B57 A;  2JJL A;  4ADZ A;  5LYJ E;  5LJM A;  5CJ4 A;  3GA8 A;  1GL2 C;  3Q2M A;  3O1I A;  3SS1 A;  2HYN A;  3LFM A;  4H9P C;  4GT1 A;  4IFD K;  3ESL A;  3LBX B;  2WPR A;  3NZP A;  2KZ7 B;  5FY7 A;  5JDN A;  2E8I A;  3ZN1 B;  3KVB A;  4O9B A;  3U1A A;  1FDM A;  3RYF E;  1NTZ K;  4N6J A;  3L09 A;  3C50 A;  2CXL A;  1SLQ A;  2KWI B;  5EK4 A;  5JRC A;  4KHX A;  5JH7 E;  1G2C A;  1X79 A;  2NW8 A;  3LK3 B;  4L0R A;  5FMN A;  3ZJ2 A;  1CI6 B;  3U59 A;  1D0Z A;  2P9B A;  1LT9 C;  2FXM A;  1SQP K;  2XNX A;  4LC1 A;  3O1J A;  5GON E;  4O4H E;  2O01 H;  2X67 A;  2P1J A;  3N2O A;  4XBF B;  3RH3 A;  4WBA A;  4KP3 C;  2YKP A;  1SQB K;  1ZV8 A;  2FKW B;  3F57 A;  1D1A A;  3NXS A;  1J1E C;  5ADX L;  4WBO A;  4XAX B;  4IHJ E;  3OKQ A;  2IPP A;  3V2N A;  3GMI A;  1N7S C;  1X8Y A;  3BAS A;  3MUD A;  3HUS B;  2OYH B;  2W63 A;  4F6R C;  4HTE A;  4C7N B;  3BQK A;  1KFM A;  1FEW A;  2CCQ A;  2YEV C;  1FZF A;  2Q9Q A;  3VN0 A;  4UV8 B;  4EB6 E;  4IST A;  2CWO A;  3PU3 A;  4DOJ A;  1H88 A;  4ZI2 C;  1T3U A;  1ZV4 X;  1LTI C;  1UX4 A;  1QUU A;  4MHC A;  3CX7 B;  3VOP A;  5KMG P;  1MNE A;  4H63 V;  3PUS A;  1HG2 A;  3OYZ A;  3RRW A;  4EOT A;  2HPC A;  3Q9D A;  1ZR2 A;  2NW9 A;  3T97 A;  1H7C A;  2E9X B;  3NBX X;  1IFI A;  2GM4 A;  2YU2 A;  2L8K A;  3LBX A;  1NAF A;  5HXR A;  5LHG B;  4MFR A;  2JEE A;  3V5B A;  3AVR A;  2Y6X A;  3V2P A;  4N78 D;  1BR4 A;  2CM0 A;  3MXZ A;  4L9I A;  4C91 A;  5CCG D;  1KFN A;  1S35 A;  3N7N A;  5AVW B;  3RYH E;  3W15 B;  2VKH A;  3ZMZ B;  4CXY A;  3ZMT B;  2DHR A;  1WT6 A;  1FU1 A;  2KOG A;  1M1J C;  2E9X D;  4MBQ A;  5LHI B;  4KBM B;  4JYC A;  2XAJ B;  2OYI C;  2VWA A;  1CI6 A;  5FP3 A;  1GU5 A;  3AA1 B;  1BR2 A;  3CKD A;  1HJB A;  1NH4 A;  4X1K E;  3UUN A;  1CW5 A;  3D0T A;  2JMK A;  2ACX A;  5F3J A;  2X68 A;  1DEB A;  3C4Z A;  2ZM0 A;  3HE5 B;  4JLE A;  5LXT E;  4GIF A;  5APW A;  4EYU A;  3J7Y q;  4JYB A;  1LTJ A;  3HUS A;  2CXF A;  2JJ9 A;  2OYH A;  2ZM8 A;  1T8Z A;  3CX6 B;  5J1G A;  4C7N A;  5CJ0 A;  3EVY A;  1GU4 A;  1SFC B;  2YKO A;  1JY3 P;  1ZN5 A;  1D1C A;  4MAL A;  4CQI A;  3N9N A;  5LBQ B;  1HTJ F;  1IFN A;  2Q3I A;  4AKH A;  5AW8 B;  1JNM A;  5CB4 E;  5AVR B;  1LTS C;  3M0A A;  3V4Q A;  4H9S E;  3K3N A;  1FAV A;  2D2S A;  2DWG A;  1HGZ A;  1U5P A;  4PAG A;  1MZ9 A;  3PUG A;  3PU8 A;  1FIO A;  2Z5I A;  5KJ7 D;  1NU1 K;  5CCG C;  3RL0 D;  5AVX B;  3H37 A;  4KMC A;  4EOZ B;  3B5N B;  1FZA A;  2WBL A;  4O2A E;  1LTT C;  2X0L B;  3I5C A;  4ZI7 E;  2WWW A;  4O8S A;  1LVF A;  1ZLL A;  3OYX A;  5LGU B;  2X9W A;  2WMN A;  2E9X C;  4IGU A;  4K0U A;  3OA7 A;  4DVD A;  2A3D A;  4AKI A;  3V2R A;  5JR9 B;  4JF7 A;  3P8C E;  4FJO A;  4ZS2 A;  1ZHC A;  5LCY A;  3TNU B;  3BQL A;  2QM8 A;  5DAB A;  4WBN E;  3HR0 A;  1M7L A;  1RF0 A;  4C90 A;  1VOM A;  3B5N D;  2MJZ A;  5EK3 A;  5LA6 E;  5HWX A;  3N9O A;  2LSI A;  2R5D A;  3I9Y A;  3H32 A;  4HEA A;  5DQV A;  3HTK A;  1NHL A;  2A45 I;  2X9Y A;  2XHE B;  5L2L A;  3V4W A;  3NZQ A;  3II6 A;  1FOS F;  3TYY A;  2W27 A;  1N73 B;  4WY4 D;  3EUH A;  1LWU A;  2C0X A;  3HE5 A;  2R5B A;  1GTW A;  4JEH B;  4NUU A;  2Y8D A;  2Y48 B;  4EYY R;  3ZMV B;  3IBP A;  3GHG B;  4GYS A;  2C9N Y;  2LM9 A;  5HWY A;  3E08 A;  3F2E A;  5KX5 E;  1HWT C;  4M1P A;  1SFC A;  2V26 A;  5F8P A;  2YO3 A;  2LKM A;  4AKL A;  1FZC C;  4AXP A;  1YKH B;  2N9B A;  2VKD A;  3CQC B;  3QK6 A;  1LT9 B;  2BVM A;  2X9H A;  5IHY A;  4O4L E;  5KJ7 C;  2W6B A;  2HOD B;  3RL0 C;  1MMG A;  1T3J A;  3SWH A;  3F31 A;  4ZI3 D;  4V1A v;  1LGH B;  3U78 A;  4C7R A;  2CLY B;  1IJD B;  4IFF A;  1N7S B;  1V9D A;  1KIL D;  1D0Y A;  3NMD A;  3ZLI A;  4P0A A;  4ZOL E;  3B5N C;  5AW0 B;  3IFM A;  2I1J A;  5KLV K;  2EHO B;  1T2K D;  1JMM A;  2IAK A;  5A1L A;  1RE3 C;  2JMH A;  1QSD A;  3U1C A;  3EDU A;  1U4Q A;  2L9Q A;  5JR9 C;  4WY4 C;  1MIY A;  1AFO A;  3H3A A;  2LSG A;  2LSJ A;  5HXE A;  1GL2 A;  1ZEE A;  4IE6 A;  1HVV A;  4Y99 C;  5AW5 B;  1WRD A;  4GK0 E;  1HH0 A;  4M3L A;  4UF0 B;  2YU1 A;  1G1I A;  3A5T A;  4AKG A;  3L4F A;  1JCC A;  4B86 A;  3GHG A;  2W61 A;  4UVC B;  2PAJ A;  4O2B E;  4O4I E;  4PK5 A;  4PW8 A;  2NWB A;  3HD7 D;  1UCU A;  2GUS A;  1N73 C;  1WLX A;  5C8Y E;  3PDY A;  1GW4 A;  2PG8 A;  2WIT A;  1MMA A;  2LJL A;  2O1K A;  3K3Q C;  5CHX A;  3LW5 H;  1MMN A;  1M1J B;  3GHG C;  1HS7 A;  3CX8 B;  2OYI B;  1LT9 A;  4QXC B;  1YYC A;  3ZCI A;  5JDM A;  3UUX B;  2Q7C A;  2E42 A;  4ZI3 C;  2WAU A;  3AA0 B;  1CUN A;  2HOD A;  3V5S A;  3MAC A;  4U74 A;  2CXD A;  2W6A A;  4GOU A;  1FMW A;  2MYS A;  3RK3 B;  5FXV A;  2I1K A;  3ZJ1 A;  3LID A;  2HH7 A;  1KIL C;  4RES B;  1YKE B;  3VHL A;  2LHR A;  3I9W A;  1N7S A;  2KLQ A;  2NOX A;  2Z5H A;  5AW9 B;  2H7O A;  1T2K C;  3ETV A;  4QX8 B;  3UIA A;  3KV6 A;  1MFZ A;  3MZK B;  1CSB A;  1QL2 A;  1JUN A;  4UIG A;  1JTH A;  2CLY C;  2K24 A;  3RK3 D;  2RP4 A;  2H8P D;  3WAJ A;  3NTN A;  2HPJ A;  1SP4 A;  3P8C D;  1T98 A;  4O4J E;  3P8M C;  4AQG A;  3E1I A;  1YD8 G;  1GD2 E;  2EHO C;  2XKM A;  2LOP A;  2IC6 A;  2WWU A;  1G73 A;  1IAP A;  5AVZ B;  2WSE H;  5LP6 E;  3HD7 C;  3M9H A;  2IW5 B;  1NKZ B;  3U3I A;  3RRC A;  3A5X A;  2WM9 A;  3GN5 B;  3N2K E;  2DWK A;  2RA1 A;  4DBQ A;  5TAO A;  2L3L A;  5BU8 B;  3RC8 A;  2PBI A;  4JEU B;  4IDZ A;  1FJP A;  1M1J A;  3AA7 B;  4FI5 A;  4CI3 B;  4OHF A;  2I59 A;  5CCH D;  1AQ5 A;  3BK9 A;  1YW0 A;  2WPQ A;  1HX8 A;  2OYI A;  3FXD B;  2C5J A;  1NWM X;  4DBR A;  1NO4 A;  1BR1 A;  2M8R A;  1NOH A;  3NRY A;  4MLK A;  3CL3 D;  4P09 A;  4UVB B;  2B1E A;  2PP6 A;  3PE0 A;  2OAR A;  2A2F X;  4PFP A;  3UUM A;  5J2U E;  3WI3 A;  1CZQ A;  4B6X A;  2XZR A;  2E43 A;  1LRZ A;  3EFG A;  4WB4 A;  3WMM 0;  2XAS B;  1S9K E;  2ZMA A;  3KDS E;  4ILU A;  3A2A A;  4KUM B;  4C46 A;  2K48 A;  2G0U A;  5EK2 A;  2DCF A;  2H43 A;  2V7J A;  4AI6 A;  4Z8X A;  5IYZ E;  4UEL A;  3KYQ A;  5FYM A;  2LOS A;  3RK3 C;  4UVA B;  1L4A D;  1IC2 A;  2J59 M;  2BVL A;  3C4X A;  1FZC B;  1A02 J;  4I43 B;  5AW2 B;  2KB7 P;  3P32 A;  3P7K A;  1B7T A;  3OBV E;  2XAF B;  3VTP C;  4DND A;  4PJN A;  1GK6 A;  4EZ4 A;  2VB6 A;  2V1D B;  4PNI A;  2CPB A;  1SQX K;  4E7S A;  3WAK A;  2FYZ A;  4ZKU A;  3H6P A;  3RL0 B;  1L0L K;  4ISS A;  4AYC A;  3MJX A;  3VP9 A;  5LHH B;  2WSC H;  3OJA B;  5DJQ C;  5CCG A;  3MIW A;  1EZ3 A;  3L36 A;  1AJ3 A;  5L3F B;  3AA6 B;  3KPE A;  2UXN B;  3KV5 A;  4DZO A;  1MV8 A;  4IE0 A;  1RF1 C;  1RE4 C;  5ETW A;  2XU6 A;  2KMF A;  3RK2 D;  2E9X A;  5APX A;  1NWQ A;  4W80 A;  4L5G A;  5APQ A;  3ZEF B;  2WZ7 A;  2YKQ A;  1NKN A;  4AQF C;  2WSS V;  1Z0P A;  2X51 A;  3SRZ A;  2N1T D;  1PFI A;  5AVU B;  1L0N K;  2LT3 A;  1IZN B;  4AQR D;  3ZN0 B;  3VMZ A;  1QL1 A;  3C9I A;  3TSI A;  4P0B A;  4TV9 E;  1VPC A;  2FFD C;  4WY4 B;  3RKO A;  2W00 A;  1URQ B;  3R2P A;  4TZ4 C;  2W62 A;  5FY0 A;  1NTK K;  3S4U A;  4Y99 B;  2CWY A;  5AW3 B;  2XDJ A;  5BU5 A;  2N9D A;  4CI2 B;  3P7I A;  1DX7 A;  1L4A C;  4QKN A;  2HG5 D;  4AKR B;  2ES0 A;  2VAS A;  2KT9 A;  4YFS A;  2Q9I A;  1FZC A;  4BAY B;  1URQ D;  5JDH A;  5AW1 B;  3TK1 A;  3MTU E;  2HFE D;  5BMV E;  2NPS D;  5HXC A;  3ONX A;  5AVY B;  3VKH A;  4G2A A;  5KJ7 A;  3I0Q A;  2ODU A;  2X9X A;  4PK6 A;  3HL6 A;  3M0D C;  1N2D C;  3KBT A;  4UV9 B;  3OJA A;  3HRN A;  3N9L A;  1GZL A;  2D5U A;  1KZU B;  3VKG A;  1KIL B;  2MTQ A;  4G63 A;  3O9X A;  3O8Z A;  1HG5 A;  4ZHQ E;  2LE8 A;  2XAH B;  3ZYL A;  2DNX A;  2V7L A;  3I1A A;  4X1Y E;  3CQG B;  4XA4 A;  4EXT A;  3SOL A;  4HN9 A;  2N1T C;  2VL8 A;  4PFO A;  5KTB A;  2BZB A;  3B5N A;  5LGT B;  2QM7 A;  2R3C A;  3HKE E;  4IE7 A;  3LIE A;  1LTB C;  3UUL A;  3KQG A;  5FY1 A;  1MMD A;  1IFD A;  3NRX A;  1X79 B;  1RE3 A;  3KFW X;  5AVV B;  3PP5 A;  2WTY A;  5FNV E;  2OA5 A;  5JR9 A;  5HXH A;  4WY4 A;  2R32 A;  2WT7 B;  3TNU A;  4YHJ A;  2LSK A;  3C98 B;  3CWZ B;  1SQQ K;  4W7Y A;  2C0W A;  3GWH A;  1Y64 B;  1G8X A;  2VRS A;  5L3C B;  3JC6 D;  3HD7 B;  2PFV A;  3LK4 2;  3ZYM A;  2YNY A;  1URQ C;  2IFM A;  2P2U A;  2IX7 C;  1IJ5 A;  4XZC A;  1FZE A;  5HYA A;  4PJM A;  2VK9 A;  1N73 A;  1J2J B;  3CLQ A;  1S9K D;  2Z6E A;  2NPS C;  3VP8 A;  3L35 A;  3HKC E;  5LOV E;  3N9Q A;  5KDM C;  5FXZ A;  1FOS E;  2IFN A;  1D0X A;  4ZI2 D;  1FZG A;  4WW0 A;  3CPZ A;  3T8O A;  4H9R C;  4BA9 A;  3CQX C;  5CA0 E;  2HPC B;  3IHR A;  2H7V C;  1HTL C;  3ZMU B;  4QXH B;  3IR9 A;  4CZZ B;  3FB2 A;  2C9L Y;  5FXX A;  5JDF A;  3AAA B;  3KV9 A;  3BAT A;  4NUV A;  1OWA A;  3VYI A;  2Q9Q D;  4IIJ E;  1KQL A;  1KIL A;  3M9B A;  3V5U A;  2UXX B;  2POH A;  4DMV A;  2H3R A;  2X66 A;  5LJN A;  5JDG A;  3K8P C;  2J58 A;  2BAS A;  5APU A;  2KYV A;  2IC9 A;  3ZC1 A;  1N7L A;  1YTZ I;  4OK0 A;  2A45 H;  2VKJ A;  2CA5 A;  3Q5X A;  2NP9 A;  3BRT B;  1ZKE A;  4UEM A;  3J9X 1;  3MKD A;  1XTG B;  4WNK A;  5BVZ A;  2HPL A;  3UFE A;  5H6R B;  5LGN B;  3A7O A;  5JRE A;  1H89 A;  2WT7 A;  1HFA A;  2EHO A;  1JY3 O;  4I1L A;  1VRB A;  3ZYK A;  4HKA A;  3JC6 C;  2C0S A;  3RYC E;  3AB3 B;  2KLV A;  2ZFC A;  4OH8 B;  1SA0 E;  2GK9 A;  1G1J A;  3Q5W A;  4BJN A;  4H9N C;  1JOC A;  3ANW B;  3RC3 A;  1JY3 N;  3HD7 A;  2BDE A;  4ERR A;  1JY2 P;  1EQ7 A;  5LBM A;  2KND A;  1RF1 B;  4EIJ A;  2KIN B;  1LTJ B;  2KXP B;  1US7 B;  2DLR A;  5E0O A;  1SVF A;  1LVK A;  1WRG A;  2P7J A;  4UF0 A;  1JCD A;  2NTY A;  1SHZ C;  3BRV B;  4EIW A;  2V7M A;  1VDF A;  5AFU L;  2W0G A;  3C64 A;  3MA9 A;  2JPF A;  5L3E B;  3MK7 C;  5EZY E;  2FFD B;  4YJ3 E;  1DH3 A;  3E22 E;  3SWY A;  4X1I E;  2M3B A;  2XAQ B;  2Q9Q C;  3CI9 A;  4TV8 E;  4U72 A;  3KV4 A;  4JUY A;  2K5B B;  1FMV A;  3ZC0 A;  5HXS A;  1KK7 A;  3LK2 B;  4HYT B;  4QHO A;  1MUU A;  1BR0 A;  4ANJ A;  3AVS A;  1LKX A;  1L4A B;  2M67 A;  3UTK A;  3AAI A;  1JO5 A;  1MIW A;  1UX5 A;  2J1D G;  2XQY A;  3UT5 E;  2PJQ A;  3A3Y B;  3TKL B;  3HKB E;  2ZM2 A;  3ZCJ A;  4TX5 A;  1LTG C;  4OYK A;  2N2N A;  1IO4 A;  3EQ2 A;  3L37 A;  3B13 A;  4UXN B;  2YIN A;  1GK4 A;  2GUV A;  3IF8 B;  3KBU A;  1J1D B;  3DP7 A;  3RX6 A;  2WPS A;  5J2T E;  3H32 B;  3HTK B;  2WSF H;  1HF8 A;  1SQV K;  5APS A;  2CPS A;  4GYR A;  2H7H A;  4I50 E;  1GW3 A;  1A02 F;  3ANW A;  3CVR A;  3RK2 B;  2V7K A;  1LWU B;  2KSJ A;  3KIN B;  3N9M A;  1RF1 A;  1RE4 A;  5JDL A;  2KWH A;  1XTC C;  4QWN B;  2NTX A;  5CMZ A;  2ZXE B;  1WR6 A;  1MIV A;  5CCH A;  2QA7 A;  2N1T B;  5H6Q B;  4H63 H;  5L3G B;  3BVH A;  3PTR B;  2N1G A;  2KP8 A;  4AQF A;  3PUR A;  2DI4 A;  2NW7 A;  4ZKP A;  4YJ2 E;  1IJ6 A;  1LTJ C;  2SPC A;  3HUS C;  3RPU A;  2OYH C;  4HE8 A;  3FHN A;  3GN5 A;  2O1J A;  4ZS3 A;  3BQI A;  5CCH C;  2FFD A;  4CXW A;  2ODV A;  1WYC A;  4TUY E;  3V2Q A;  4PK4 A;  4CI1 B;  3M06 A;  1E5W A;  2LHN A;  5APY A;  1WYB A;  3O1H A;  1FJK A;  3N2G E;  4IE5 A;  1SFC D;  3SWF A;  3O4X E;  2V7I A;  3KDP B;  1D1B A;  5DQW A;  3PUA A;  5L3B B;  3DJB A;  4IE4 A;  2WMO A;  2VKO A;  5AVS B;  1KNZ A;  1L4A A;  2LSY A;  1E1H B;  3N4X A;  4I6M C;  4BJM A;  3RYI E;  5LG4 A;  3IEE A;  3ZMS B;  4AUW A;  2FYU K;  4H9Q C;  4E7Z A;  2NPS B;  1HCI A;  3N5L A;  1OXZ A;  1S94 A;  1HBW A;  1ZR4 A;  4N3Y B;  2MBG A;  4PJL A;  4ASK A;  2JQQ A;  4EZH A;  4YLH A;  2D0T A;  2A45 G;  3PUQ A;  5CA1 E;  5M4Y A;  1H8A A;  5APV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...