1OWAA

Solution structural studies on human erythrocyte alpha spectrin n terminal tetramerization domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structural studies on human erythrocyte alpha-spectrin tetramerization site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Spectrin alpha chain, erythrocyte
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1owaA01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1owaA02
3LIEA 5AW0B 3HE5A 2WPQA 3SWFA 3A5TA 1NWQA 1GK4A 2R32A 4B86A 2E43A 1H88A 3IR9A 3VMZA 1HJBA 3EDVA 4C7NA 2BASA 5AVSB 3V4QA 5AW6B 1CI6B 1IO4A 2WT7A 2C9NY 5AVWB 2Q5UA 1MUUA 5APTA 5AVTB 2P67A 2XU6A 1HWTC 3TNUA 3VTPC 3NFQA 3VN0A 1YYCA 3M9HA 5AW2B 3V4WA 2VRSA 2R5BA 3L35A 2Z5IA 4DZOA 1X8YA 2YO3A 3HTKA 3HE4A 2H7HA 3M91A 4JYBA 1JNMA 1JUNA 2YNYA 1CUNA 5AVYB 3TYYA 1U5PA 5CMZA 1DH3A 2QM8A 2IPPA 2XV5A 2KP8A 2XZRA 5AVVB 1HUCA 5AVZB 5AW5B 1GTWA 2C9LY 5AW1B 3KQGA 3VMXA 1GU4A 3LBXA 3UULA 2Q7CA 5APYA 5AVXB 1CI6A 1OXZA 2Q3IA 3VMYA 5APXA 4AQRD 3M0AA 3P7KA 1H8AA 5AVUB 3VYIA 3NMDA 3PE0A 1GK6A 3L36A 1GU5A 1A02J 1MV8A 5APUA 4GKGA 5AW9B 2ODVA 2JJLA 2SPCA 2WTYA 1FOSF 1HBWA 3M06A 5AW8B 3HE5B 3T97A 1T2KC 2QM7A 3LIDA 1GZLA 4GT1A 1S9KE 4KHXA 3V5BA 4M3LA 5APQA 5AVQB 5APVA 1T2KD 3UUMA 4C46A 1MFZA 2P2UA 3HE4B 1AJ3A 2WPSA 2ZFCA 2N9BA 2P7JA 5AW4B 3P8MC 4LC1A 3P32A 4RESB 1GD2E 4AUWA 3MGNA 2WT7B 2E42A 5APWA 4HYTB 1OWAA 3A2AA 3A7OA 3UIAA 3A3YB 1A02F 3MD0A 3F31A 2WPRA 3L37A 2Z5HA 3OAKA 2R3CA 4I6MC 5AW3B 1WLXA 2YO2A 1CZQA 2W27A 2R5DA 4I2LC 3TNUB 4EOTA 1CSBA 1SP4A 1HCIA 4AYCA 1G2CB 1S9KD 1FAVA 5APSA 1S35A 1QUUA 3NTNA 3B8EB 4C7NB 2ZXEB 3M9BA 5AW7B 3M0DA 1J2JB 4JYCA 1H89A 1FOSE 3UUNA 1NAFA 1SLQA 2ODUA 2W6AA 5AVRB 3FB2A 3TK1A 3NXSA 3KDPB 3LBXB 2WWWA 4XE5B 3O8ZA 1U4QA 3I5CA 1KQLA
chains in the Genus database with same CATH superfamily
2BCCG 2IBZE 3HE5A 1SQQD 2E43A 5KJ7D 1VRBA 1BE3J 1USEA 2VKJA 2CWOA 2CPTA 4N6JA 4CI1B 2V4HA 1N36T 4ASWA 2POHA 3NKZA 2JQKA 2NRGA 3FXDB 3ZPOA 2WZ7A 1BCCE 3P4RA 2K3RA 5KTBA 3RHWA 3PJAJ 1LGHB 4WY4A 3JC22 4PV1B 2XASB 4YFSA 5L8RJ 5B5EH 2L5GB 2BKPA 3L8RA 4O2AE 1X9BA 3GMAA 4MN4C 4TV8E 4IHJE 3QH9A 2CRBA 4DV1T 2HG5D 2WSCH 1RF0C 2O01J 1HUCA 3CMLA 5AQNB 1N73A 2XTLA 2E76C 3L70G 2Q7CA 5APYA 5M1BA 5AVXB 2W61A 2NR4A 4UXNB 3O1HA 3M0AA 2DL1A 5BMVE 1LWUB 2FYNC 2XM1A 1GK6A 2JO1A 2WBLA 2X0YA 1SQBK 3ANWB 1FZCC 3C51A 3QWOC 5LJNA 3HI2A 2W6BA 4DO0A 2X67A 3V2RA 2LOPA 4GKKT 4L75A 1T2KD 3H1HE 1XWMA 4XAXB 5FY1A 5B66E 2WPSA 3PUYF 4TWDA 1HNWT 3AE9C 1SQXK 1EQ7A 1SQVK 2HR3A 2WU5A 5L3BB 2QVAA 4L76A 4CXWA 2E74B 1NTZD 3G71P 3MGNA 4UB6E 1JY3P 1ZMEC 2HLOA 2IBZI 2RA1A 3ZC0A 2I6HA 1Y01A 5AW3B 1BR2A 1PL5A 3ETUA 3RL0C 1T7SA 2K48A 2H89C 4EZ4A 1KB9E 2ZVOB 2BKOA 3V5SA 4RKUJ 1BE3G 1LTJA 3PUGA 4L0RA 1H89A 5KXJA 1NAFA 1GDTA 1E1HB 1N8RQ 2WQYC 2WWUA 5H2FH 5J0ZA 3L75E 1XTGB 2E76D 2WSEH 3TK1A 4AKLA 4ZOLE 4XE5B 3AE1C 2BDEA 3I5CA 2B88A 2N1TC 1LVKA 4AXPA 4AKHA 1KV4A 5KJ7C 2NZ2A 3CC7P 2AXTH 4B3RT 3V4QA 4C7RA 4HWFA 1VPCA 5AVWB 2R44A 1YXRA 2LHNA 1MIWA 1PPJE 2Y9ZA 4QKNA 3RK3D 5AQPB 1PGPA 3B5NA 3EFFK 4JI0T 2JP3A 2O01H 2JQQA 3M9HA 2M3EA 4PV1D 1R8IA 1QL2A 1FDIA 4GOFA 3L74G 1BE3E 4BWNA 3D6ZA 5HXSA 3EWKA 2K9JB 4O4JE 3DJBA 1LRZA 2K9AA 1LTIC 1UIXA 1JNMA 5LGTB 2QJPB 2Q6QA 1FDOA 1CUNA 3WUUA 1DH3A 2LSGA 3AEAA 2BEQD 1MZ9A 4IDQA 1KILE 2Y6XA 5KX5E 5HWXA 5AW5B 3L72D 5AW1B 3KQGA 5FL0A 4DR7T 1KYOE 2JPFA 3ZT7A 2HPJA 1PP9E 1L0NJ 1H0TB 3AE3C 1UX4A 4UF0A 1S1CX 2WTYA 3LK3B 2UWJE 4CZZB 4GOUA 3PUSA 1NAYA 1EZ3A 4D6TJ 3L71E 5DABA 4HFHA 4GK5E 2BS4A 3BCCJ 4HFBA 4M3LA 5GTIH 3UU4A 2L9QA 2CLYC 1IK9A 2JWAA 1UCUA 4CN1A 1EXJA 1FZBA 4HWDA 2IFNA 2KK7A 2IHR1 3TLVA 1GL2C 4A7PA 4AUWA 3U59A 1LTAC 2DCFA 1EZVI 3ZYMA 3H1HJ 4IREA 1OWAA 3CX8B 3A7OA 1SQXG 1RH5B 3GHGC 2ZM8A 1KMIZ 4WW0A 1SS1A 1S9KD 5JR9A 5L3CB 1FAVA 2A45G 1ZRTE 4WZXA 3ZC1A 1ZEEA 2IIUA 3T8OA 2UXDT 3ZDMA 2NPSC 3E1IA 1SLQA 1OW8A 3FZHB 3HKEE 4ILBA 2KI7B 3Q2MA 3Q5WA 4LLHA 4JI3T 5HEOA 4MLKA 2D0TA 3KV5A 3CX6B 2WWVA 3PHLA 1L4AB 1H88A 1HJBA 1QX8A 3G9RA 3P8CD 3L75J 1SQQG 2V7JA 2PTFA 4BA9A 3F5HA 1U7JA 2W6JH 3AEDA 4OYKA 4E7SA 5KKZC 1OVUA 1GW4A 1XTCC 3H1JJ 3NFQA 4PD4E 2XQAA 2UUBT 4TWFA 2OQQA 3CWBE 1Z56A 4F6RC 4DZOA 2QEXP 1JTHA 3BATA 3FZKB 1M7LA 1NU1E 3K8PC 2KS1A 1QLBA 3W67A 5LG4A 3CD6P 3EHZA 4OYJA 3LDQB 1UIIA 2K1AA 2WY2A 2VASA 5AVVB 2FJDA 1KTMA 1S72P 4H9NC 1E79H 4HKZH 5JQGE 5FNVE 3A0HE 4DUYT 3UU5A 2IYPA 5APXA 2KSJA 4DR1T 3AVSA 1Q7YQ 3C98B 2GA1A 2VVSA 3H1KJ 1SQBG 3ZT6A 3N2KE 1FOSF 2WDVA 3E1RA 1HBWA 3PU8A 3AA6B 3AEFA 4TX5A 4EI2A 2M6BA 4IDNA 1Z0PA 3AE8A 3SWHA 5JDNA 3SWKA 2HPCA 1IBLT 5AQRB 4C91A 1NWMX 1VF5B 5LOVE 4HKAA 1L0LK 4JI1T 3P7IA 4LFBT 2CHOA 3H32B 2HPCB 2YIUC 1JCCA 1YQ4C 1G2CA 2FYUG 4H13B 4UR9A 1HNXT 3GW6A 1PPJD 4B3ST 4U31A 1L0NK 1IFDA 3KINB 3R84B 2XJ7A 1S3JA 3H1LD 3RK2C 4DV5T 4WY4B 3L71G 2BVLA 4X1YE 4L74A 1NTMG 5AQFB 4R4MA 4ISSA 4IFFA 5TISE 3O6QA 4WY4C 5M4YA 3L73J 3HKBE 4JYCA 2YU2A 3ONJA 2O1JA 3P4SA 2E76B 3JC6D 3FB2A 2IDBA 3BQLA 1N33T 5DJQC 5LMNT 3NWIA 2KLVA 1US7B 3FXEB 2WPQA 1OIPA 1NWQA 3N9NA 1S5LH 4PJJA 5AQOB 2XAJB 3KBTA 4U7IA 5AVSB 1LTGC 4OGQC 3CX5D 4NPPA 4H0LC 5APTA 1JY2O 2ITAA 4Y28J 3N2OA 5KDMC 3PUQA 3GA8A 2B1EA 3J7Yq 5TAOA 2V1DB 4HWIB 3MTUE 2OTKE 2B87B 4X20E 3E08A 1KFNA 1D0XA 5CCGD 2W83C 2KUBA 4HGAA 4EZHA 4AKGA 2YO3A 1DD3A 2YKQA 5JH7E 3PUAA 1KORA 1W2BO 3AE9A 4Y99C 1NOHA 3MHVA 4U3FE 3JAFA 3AXJA 4EIJA 1HR0T 2W66A 2WPVB 3JCUE 2IC6A 3LG7A 4JLEA 2XZRA 3RKOA 4DR4T 2A3DA 4IOIH 3F2EA 2AXDS 1SQQK 5AVZB 1J5ET 1X9VA 3RGUA 1M1JA 1L4AD 5AQJB 5GTIE 3CQXC 4ZI2C 3T97B 2H89A 3HD7C 1S5LX 2YMYA 3L36A 2JKVA 4GKGA 3H37A 3WAKA 2AXTE 1SFCD 3UT5E 2M8RA 2H88A 2WQYA 3M06A 2WSFJ 4ASKA 4XFJA 1RF1C 4JBWF 2O01N 4OWFA 4AQFA 4EIWA 3EVYA 2LLYA 2N1TA 2EHOC 2V7QJ 4TUYE 1FMVA 3RIUC 1YBKA 1M8OB 5KJ7A 1AJ3A 3I9WA 2E9XB 2K3WA 2ZVNB 2IDOB 1NH4A 1P84H 3AECC 5DQVA 2RPAA 3UU6A 4RESB 4PJ0H 4HWCA 2RH0A 4HFDA 1PGJA 2XQ5A 3HD7B 2YN6A 3B5NC 1N86A 4K35A 5AQHB 4NXNT 4BAYB 2L3LA 2R3SA 3E0ZA 5JRCA 3UFGA 1NVOA 1KNPA 3NTNA 1QL1A 1NTMK 4X62T 2ZXEB 2CM0A 5AW7B 4GIWA 3M0DA 2X68A 3N9PA 2KZIA 3CCJP 1HTLC 4LF4T 4YLHA 3L70J 2ZT9D 2VURA 2W4XA 3RQWA 3LIEA 1NTME 4UELA 1T98A 2BEZF 5TISH 1VQ6P 2OYHC 3AAIA 3QUJA 1FJGT 2AEFA 2D2SA 5AQKB 3I56P 1N7SC 5AVTB 2X51A 2N9DA 2E74D 1HX8A 1PFIA 2ZM2A 3H1ID 2DHRA 1IFPA 5JDMA 4YTPC 3RRWA 2V5CA 1SQBJ 4CN6A 1KEYA 3ZSSA 2E2AA 5AQLB 4B6XA 2NPSD 2WSFH 4X65T 2HN1A 1KF6A 3TLSA 1OEDE 1WT6A 2WITA 4F8HA 2KLUA 4L9IA 4H63H 3P8CE 2Q9QA 1KQSO 3I0QA 4YHHT 1EZVG 3CC4P 1E7PA 2XQ6A 1HGVA 4HH2A 1GL2A 3RK3B 4R4LA 5KLVK 2QM8A 2A06G 3C8VA 2HN2A 2PFVA 3PTRB 1LVFA 4NUVA 1WYCA 4DNDA 1Y64B 3RL0g 1GTWA 1SQVJ 4I4TE 2AXCA 1OXZA 3HUSB 2AEMA 1QEXA 4UV8B 4H13C 3FX0A 1ZKEA 2M67A 2MOZA 4JI6T 5JDHA 4DVDA 4YSXA 1IJDB 3KVBA 2NPSA 5KLIC 2XSBA 3RF1A 2L91A 2HPLA 3P4WA 1ZLLA 5BVZA 2ZM0A 2JR8A 1ZV8A 2FYUE 4DR3T 2JEEA 5CHXA 4KHXA 3H3AA 1IZNB 2ZT9C 1Y47A 2X9HA 5HAXA 1SQQJ 4YPCA 3L75G 1LT9A 4NPEA 4H44B 5AW4B 5JDLA 2HFED 3AE2A 2N9YB 2OTJP 4YXDA 4JQ0D 2XSAA 2H7VC 1D0ZA 1T8BA 2V7MA 4KHZF 2GUVA 3RYFE 4QX7B 4I7ZB 3I1AA 4LMKA 1W9RA 3UIAA 1JO5A 1XNQT 2PAJA 3E22E 4H44C 1VQNP 1TU3F 4TV9E 2C0SA 3KVAA 3PV0F 2ZT9B 2K9YA 3VKHA 2ODUA 3OPCA 1XDOA 3T1YT 3OKQA 1FU1A 3MJXA 3H1HG 1Q81Q 4IDPA 2M6IA 2FKWB 3TSIA 5KLIB 3P50A 2KWHA 1MNEA 3I0OA 3ZJ2A 4GYSA 2RKLA 4B86A 4ZEYA 1ZW0A 5FY0A 5CCGC 2K5BB 1BGYG 3PDYA 2XQ3A 2AE9A 3ONXA 2CCQA 2Q5UA 1MUUA 2WU2A 5E0OA 1SQBD 3HD7D 4GDOA 2XPKA 3OTOT 4QMAA 1NTMJ 1KILA 2N1TD 4TN7B 3L71J 1NU1K 2LXBA 3AEFC 3WU2H 2GUSA 4YJ3E 3A8YC 5AW2B 1YIJP 3B5MA 2V26A 1NTZJ 4ZS3A 3AE7C 2VRSA 2VQFT 1FZFA 1OW7A 1SFCA 1AVOA 3EFGA 1NEKA 2XAHB 3HKDE 1O3XA 2IBZG 1AJYA 4OHFA 1FEWA 1BGYJ 2JWDA 5A1LA 3NRXA 3RL0D 2C5JA 1T3UA 1DD4A 2WP9A 2FYUK 4NUUA 3G6EP 3CXHH 2IPPA 1SFCB 1CW5A 3KXDA 4BXLA 4QXCB 4KJMA 5KLVG 1GMJA 2BVMA 2YDQA 3GHGB 4PK6A 2JDIH 1GU4A 1AFOA 5C8YE 2PBIA 3L75D 3LBXA 1PGOA 3W15B 1CI6A 2IFMA 3PRJA 4NPFX 3BRVB 4IT4A 3ZJ1A 4YSZA 3PE0A 1KFYA 4EGWA 2ZAEB 1KB9D 2V5DA 3M9QA 4YY3T 2SPCA 4AQYT 1KQGB 2VB6A 2FJBA 2VKDA 4K0UA 1MMGA 1SQXJ 1LP1A 5AQGB 1AQTA 3AE6A 2WCAA 2MKVA 5LNKA 3L4FA 3IEEA 1X22A 3FWLA 4U2YA 4EV6A 4LFAT 1HG2A 3AXJB 1NTKJ 1NENA 3Q9DA 2P10A 1PIXA 3B13A 3H1HD 3IAOA 3EDUA 2V6YA 3BCCE 3CCSP 4GKJT 1PP9G 3LK2B 2Y9YA 4V1Av 1KB9H 3JSVC 4QWNB 2Q9QD 3MUDC 1N73B 2QA4P 4OFZA 3SFDA 3CXHD 1W0AA 3GLMA 2KSRA 3KDPB 1HF8A 3USSA 3G3ZA 4U72A 2JQ9A 1HJ0A 2LKGA 1L0LD 1GW3A 1OX3A 2ACZA 2BASA 1SQVD 1CI6B 3HD7A 5JDGA 3Q5SA 2N2NA 2C9NY 4TNVA 1NTZK 2YKPA 4H13D 3LK42 2J4GA 4DUZT 4X5TA 3OJAA 2H88C 5AQVB 3FBZA 1N2DC 1G73A 4U33A 3SS1A 4AQFC 2QSIA 1URQC 4BRYB 2XHEB 2R5BA 5FXZA 2W0GA 1URQD 2YOEA 3N9MA 4I43B 3CPZA 4I7ZC 4EEDA 4RO0A 3TGUJ 3ZMTB 3OA7A 2B9BA 1V9DA 1NHLA 2YDRA 1KYOI 3AEEC 3AECA 1IFNA 4P09A 3RIAA 3QB5K 2K88A 2NTYA 1EDLA 4DMVA 2QJKC 3BCCG 1ZOYA 2ZM6T 1P84D 3WMM0 4CPGA 2XQ7A 1ZN5A 1BDDA 1LTJB 4PJNA 3P7KA 2BG9C 5AVUB 1FC2C 2DNXA 1YQ3C 3L74E 1A02J 1L0LE 3M0DC 3AA1B 5LBQB 2LM2A 3KV4A 3RKGA 3RL0B 5LBMA 3NZQA 2DWKA 2MJZA 3V5BA 5JDFA 2WZHA 2IAKA 5CBOA 2ZYAA 4LF6T 1VQOP 2Q9QB 1OVVA 2P7JA 5L3GB 3AAAB 3C1LA 2FFDB 4Z90A 2OYIA 2I0MA 5FVLA 1GD2E 1LNQA 5EZYE 3B5NB 1N7SA 4B3MT 5EFWB 5LP6E 4IL6E 1RF1B 3CMEP 2DI4A 1A02F 1J1EB 4ILUA 3MD0A 2LKMA 2YIUB 3V2QA 4UVCB 3JAEA 2R3CA 2NP9A 3U78A 2LOSA 4YTPA 4KUMB 3H1KD 3F57A 3EQ2A 2BS2A 3OW2O 3IF8B 5LXTE 5KAIE 1FOSE 2GK9A 3X1DA 2XDJA 2KNDA 1EZVD 5JRCB 4O2BE 2NTXA 5LYJE 1ZP0C 2UU9T 2M5AB 4HN9A 4PW8A 2E5VA 1MFTA 2NW9A 5CA0E 4JV5T 3II6A 3CLQA 4EYYR 1RF0A 1PV3A 2XNDH 5K5GB 1XNRT 2WDRA 5ABFB 3RGLA 1KZUB 3IHRA 3H1IE 1L2PA 3CCUP 2ZXXA 5TJHA 1YD8G 3J9X1 1WRGA 1HWTC 1YTZT 1RE3A 3TNUA 2Q9IA 1M7KA 4XZCA 3UUBA 1DU2A 3PP5A 2J59M 3TLUA 2LRLA 4N3YB 3L35A 5GTHH 1NTMD 3TDKA 1PGQA 3M91A 3A7MA 2LXCB 2YNYA 3D6YA 4EEBA 1J1EC 3ZCJA 2FUPA 1HH0A 3V6IA 3ZSTA 3HUSC 3L72E 4IFDK 1S2EA 4NIQA 3KZIH 4G63A 3GF7A 2JIWA 4U3FJ 2V7IA 2J5UA 4KHPT 1VL2A 3RK2D 1M1KQ 3PUZF 4IE6A 1LTJC 4EDFA 1YITP 4NXMT 2YKSA 3C9IA 3CVRA 1GZLA 3AE1A 1IBMT 2D2CC 2K24A 3UUMA 2NPSB 4C46A 3ESLA 2VL0A 3O1IA 5GONE 2KOGA 2LR2A 1NTKG 3ABVA 2LKHA 2XQ8A 1WCRA 1LT1A 5CCGA 1OZHA 4LC1A 3PUWF 3RX6A 4PD4H 5DQWA 1WMKA 3RBXA 3ZN1B 4IE7A 1QVGO 1UURA 1VCTA 2KINB 5LHHB 1NU1D 2V7LA 4I6MC 1WLXA 2Z4EA 5CGMA 1M62A 3LJCA 3VR9A 3AVRA 3H1KG 3CWBD 3O4XE 2XQYA 5L3FB 4JPZB 2LRKA 4LGDE 4IE5A 1SQPD 2J62A 3EI0A 4U3FD 4AKIA 2CXLA 2FYUD 1D7MA 2VQET 1VQ4P 2CMRA 1J1DB 3B57A 2W8ZA 4BRYA 2D2CB 2PG8A 1GK4A 5CJ0A 1EZVE 5FXWA 2PFXA 1L0LG 1KNRA 3RH3A 2IMLA 2V6YB 3OBVE 1VQMP 1FIOA 4CI3B 2B87A 1ZR4A 1U57A 2O1KA 5FKYA 4D6TG 4IE0A 3ZCIA 4H44D 3CX5H 3PUVF 1KYOH 1JNZA 3H1IJ 2ZMAA 3WUTA 1DEBA 4QH4A 5FMNA 3BK9A 3H32A 3L39A 5CJ4A 4OK0A 4ZI3D 4JYBA 1N7LA 2HODA 5CCHC 3FWNA 4JI4T 1U5PA 5FVKA 3RIFA 1NKNA 2YMKA 3AEBC 3VP8A 2W67A 4YTMA 3RC3A 3VP9A 1FJPA 4ILAA 2KT9A 3H1LE 4OH8B 5JR9C 2P1JA 1KC8Q 3NMDA 3RC8A 3OJAB 1JNRA 1KQFB 2DLRA 1T3JA 5L47A 3SFDC 1VCSA 4AQGA 1YI2P 1SE7A 4OVNF 2C5KT 2JQHA 1JMMA 3PLNA 4DV2T 2UXNB 4Y99B 3LSVA 2QJYC 3UQ4A 5APQA 2KZJA 3UFEA 3W68A 4B3TT 4W7YA 4DV3T 3H1JD 5FXXA 5HXRA 1OEDC 3P8MC 2ES0A 4X66T 3PH0A 1PZQA 3KPEA 2KYVA 3HRNA 5F3JA 1RQVA 2ZYDA 1SHZC 2QGSA 3H1JE 2E74C 4DOJA 5FXVA 2UUAT 5HCJA 1SP4A 1X0TA 5H6QB 2YINA 3AA0B 4H9RC 3RYCE 4Q25A 1NU1J 1IJ6A 1D0YA 4H0LB 4D6TD 5AVRB 2YEVC 1JEKA 2Y0EA 4O9BA 3B71A 4XA4A 3OYXA 3HA4A 3O8ZA 1KQLA 5AW0B 4LF9T 3RK2B 2LM9A 4YTNA 1IFMA 4KT0J 1LWUC 3VMZA 4LF7T 2QJKB 4WBAA 2E9XA 2G8YA 3DTOA 1RE4A 3MIWA 1ZR2A 5L3DB 1Q82Q 4I50E 4UB8E 2FXOA 3NBXX 1QGKB 1ZHCA 3AE5C 2JJ9A 2X9WA 5KLVJ 3KYQA 4ZI3C 3BCCD 3KV9A 3R6NA 2MPKA 2I1JA 1N7SB 1GQEA 1WR0A 1UK5A 1JUNA 4COFA 4ZZBA 1HS7A 1FBMA 3TYYA 2I8DA 4AKRB 2D9DA 3GN5A 5JREA 4XBFB 3TF5A 4ZS2A 1NTZE 2KP8A 5LMUT 1QSDA 4YXWH 2XZEA 5LHIB 2PP6A 1L0NE 1VQLP 4MBQA 3H1JG 3CI9A 3BRTB 2KMFA 3RQUA 2D2CD 2M3BA 4ZI2D 1BDCA 3L73E 3VOPA 3SFEA 3K1SA 3WUVA 5B5EE 3D71A 2A45H 2NWBA 2XM2A 2KZ7B 1SQPE 2C5IT 4H63V 5ABEA 1ZP0A 3I9YA 4GT1A 4HE8A 1S94A 5APVA 2WVRA 3RK3C 2AEJA 1W2EA 3HKCE 1CHUA 1R8EA 5ABGA 3KDSE 1FZEA 2WSSH 2VKOA 1K9MQ 3KHUA 3K3QC 3QOFA 1JM0A 5KKZB 2E42A 1E5WA 2A06D 2E75D 2E5TA 4CXYA 1XMQT 3A2AA 1DIPA 1L4AC 2WPRA 1N73C 4O4LE 5HEGA 3MXZA 2CPSA 4I2LC 1JOCA 2X9XA 3CIRA 2X9YA 4AI6A 1SQBE 5APSA 3OYZA 1KILD 3GWHA 2XQ4A 3HR0A 2IZ1A 3C4WA 4X1KE 1LJ2A 3D0TA 3AE4C 5ETWA 3VMAA 1I6ZA 4LFCT 3QB5A 4ILCA 3GG2A 2OYOA 2D0UA 3KFWX 4I55E 2J1DG 3HUSA 2BKNA 2Y0DA 3U1CA 4WY4D 1DX7A 1M1JC 1L0VA 1UUSA 1VQ9P 4HEAA 2QIWA 1JY2N 3N9LA 3HTKB 1NGMB 1EDKA 4A97A 1XZYA 4M1PA 4YHJA 3ZMUB 2WM9A 2BZBA 3L72G 5J2UE 3ZLIA 4YJ2E 2GM4A 3HE4A 4LF5T 1YJNP 1WR6A 2HH7A 5F5WA 5LCYA 5GTHE 3U3IA 4DT0A 2ZJSE 4PD4D 4DR2T 3CPWO 4QXBB 4ZHQE 2CLYB 4UB8H 1YKEB 1ZXGA 2XY8B 1W5CE 2NW7A 4NPDA 2I59A 4GYRA 1QLED 1EXIA 4MHCA 2H43A 2E5LT 5C39A 4IL6X 4QX8B 3RBZA 3ITKA 1KFMA 4TWHA 1JY2P 4PAGA 4PNIA 4WYVA 3OVUA 5AW8B 3HE5B 1JY3O 2WMOA 3BQIA 4WWIA 1BR0A 3H1KE 3IA3A 3N2GE 2MTQA 4W7ZA 2FJEA 4GK0E 5L3EB 5BR8T 2DW3A 2ZFCA 3EAMA 1AA0A 4H9OC 3ZYLA 3PU3A 2OYHA 2UUCT 3P32A 4QH5A 3Q5DA 3P4QA 1SA0E 1BR4A 3AEAC 2K37A 4H9PC 1M1JB 3CWZB 3PJAA 4HFVA 1HF9A 4QH1A 2O3JA 2W27A 2R5DA 5CFBA 4EOTA 4J2CA 1LTTC 5LB7B 4ZNCA 1NU1G 3CC2P 2L8KA 3AE3A 3VU7H 2VKHA 1BGYE 4PD4I 1KN7A 2W6AA 2W00A 2JRKA 5HEJA 2FXMA 3Q2YA 1W0BA 4UVAB 1NTKD 4L5GA 4DV4T 3T1HT 3AB3B 3AEBA 1S5LE 4IFMA 4AIUA 4JUYA 4IL6H 3MKDA 2K9JA 4C7NA 1KD1Q 1BCCD 3Q5XA 2W63A 2WMNA 1KYOD 3H1LJ 2KLQA 3ZT5A 4PJ0E 2WT7A 1BCCJ 3ZN0B 5ADXL 1LP1B 2RN0A 1M56D 2OV9A 3MK7C 2XAFB 3M3ZB 3PUXF 1YYCA 4PJMA 1XDPA 2FYZA 3BVHA 4Z91A 2YKOA 3S4RA 5EK3A 1Y9BA 3L70D 3U1AA 2Z5IA 3C4ZA 1SQQE 1X8YA 4EAHA 1SQPK 1LT9C 2YU1A 3N9OA 3AE2C 1SQXD 1T8ZA 4N78E 4UF0B 4JI2T 4DBQA 3JCUH 4JEHB 3I55P 3TGUG 2OA5A 3FZMB 3NRYA 3BQKA 2OLTA 2XKMA 3CWBG 3RK3E 3N9QA 1VQ5P 2IYOA 1E2AA 2FYNB 1X79A 2A2FX 2A45I 2C0XA 3VMYA 1IFJA 2CE7A 1JB0J 1IAPA 1IK7A 4AQRD 2QYWA 2KNCA 4QHOA 1FZCB 1HTJF 4LMJA 3ZEFB 4WBNE 1NTZG 2JJLA 4E7ZA 2CPBA 3O6QB 4HFIA 4PK5A 2E5YA 4PV1C 3T97A 2EHOD 4A5XA 1WYBA 1JMBA 1IBKT 4JI8T 2WS3A 1LWUA 1GL2B 1Q2NA 2H3RA 2Y0CA 3O1JA 1M90Q 2E75B 1FJKA 2CBJA 2IW5B 3MZWB 2WT7B 3S9OA 4X64T 2M5AA 2P58A 4G2AA 4U7YA 5KAFH 2Z5HA 3OAKA 4JBZA 2V6XA 1IJ5A 1HCIA 3AE5A 4AYCA 2V8SV 3DP7A 5ABFA 1L0NG 1SFCC 2RMZA 1AVYA 2BS3A 5JVDE 3TGUE 5KMGP 4ZKPA 3BASA 2CK3H 2KB7P 3CMAP 4YT0A 2YXQB 1H0TA 5CJ5A 4PFPA 5AQTB 3K3NA 3VR8A 5H2FE 3AE8C 1U4QA 3KBUA 2OARA 2CXDA 4ADZA 4KX6A 4YSYA 4GIFA 2IX7C 2LE8A 1VQ7P 3A5TA 2D5UA 3AEGA 4DV6T 4TT3H 3FZLB 3JCFA 2UXBT 3FZFB 2C0WA 1IO4A 3SFEC 1Y8AA 4U3CA 4A56A 1N34T 3L74J 2DWGA 1YQ4A 1VQKP 1SQPJ 2WSCJ 2Z6EA 3UU3A 2E75C 3AE6C 3UU8A 5IUXA 2KIKA 2QE7H 2KXPB 4DR5T 2MBGA 4KP3C 5CMZA 2FFDA 1FE6A 1Z8UA 2N1GA 2BBHA 5HEHA 2VVNA 2J47A 2OTLP 1L4AA 1YJ9P 2X0LB 5AQUB 1MMNA 3K3OA 1G8XA 4HWHA 1H8AA 3N5LA 1OFCX 3SOLA 3MZKB 2Y8DA 3L72J 5APUA 2PGDA 3ZYKA 4WB4A 3AAEB 3AE4A 1SQVG 4H0LD 2NOXA 2X0HA 4UV9B 2UXCT 2Q3EA 3TLTA 4CXXA 2A06E 4U7JA 2LSJA 2P2UA 3HE4B 4HJGH 4JI7T 5FP3A 2ZYGA 3CX5I 3M65A 4HB1A 4L73A 3GMIA 5L4EA 4WBOA 3F31A 5E79E 4CQIA 5LHGB 2YO2A 3LFMA 3G06A 1URQA 5KLVE 1JTHB 4DIDB 3TNUB 2KSEA 5LGUB 3SRZA 3R2PA 1S35A 3L73D 1K8AQ 3S1KA 4UVBB 4P0AA 4O4IE 1PPJG 5DJTB 3UTKA 1XMOT 1YTZI 2HYNA 2EHOB 1NO4A 3AEEA 4A98A 3TGUD 3VRAA 3H25A 4PJLA 2JMKA 3VHLA 2WAUA 4UEMA 1OEDB 1RF1A 2H7OA 3NXSA 1UGOA 5KAFE 2EHOA 1ZOYC 3JADA 3RIUA 3CCLP 3IR9A 1P84I 1K05A 2WSEJ 1AV1A 2BG9A 4FJOA 2FBWC 4DV7T 4DBRA 3MP7B 4JF7A 1FZGA 4HFEA 1ZRTD 2OYHB 2F4VT 3WU2E 4ZZCA 4ZMDA 1B7TA 1MIYA 1YJWP 4U3FG 4I0UA 4BJMA 1HVVA 1HX1B 2Q1KA 4EYYQ 1GL2D 3VTPC 3V4WA 1EC5A 5HWYA 2CWYA 2E9XD 4ISTA 3NVOA 1HFAA 5BU5A 5JTGA 4IGUA 3HTKA 1OVRA 2ACXA 3Q1MA 2FJAA 2OYIC 2B89A 4ANJA 3UQ7A 3PJSK 1HG5A 1G1JA 4OX9T 2LSYA 2XV5A 4WVZA 2X66A 3K5BA 2VK9A 4AISA 4JEUB 5IYZE 4P1NA 3VKGA 4O4HE 3SSUA 3L71D 4I1LA 2J58A 4W80A 4D6TE 2Q3IA 5HCMA 4ZXLA 5DJUB 1FS0E 1SUMB 4EB6E 3RPUA 1GU5A 4X1IE 3A0HH 1PP9D 2KWIB 1P84E 4HFCA 5HEUA 1R5LA 2E8IA 4FI5A 1D1AA 4PFOA 3FXEA 3EABA 1W09A 3LIDA 4K3AA 2OGUA 1LKXA 5ABHA 2YK0A 1IC2A 1EDJA 1ZV4X 1M57D 5KAIH 5CCHD 2CXFA 1D1CA 1JCDA 4UB6H 2Q9QC 3ZKRA 1KB9I 3LW5J 5FL1A 2LSIA 1J1DC 1LTSC 3FXDA 4IL9A 3ETVA 2HODB 1BE3D 3B5ND 4GODA 4ERRA 5IWAT 3FBLA 1RE3C 2YXRB 3QK6A 2KNCB 4JI5T 1SQVE 1OMIA 3L73G 3Q5RA 1VF5D 3D70A 1G2CB 1MMAA 5LGNB 3M9BA 1NKZB 3A0BE 3RYIE 1J2JB 4MALA 5C2TA 5LJMA 1Q86Q 2BG9E 1FZCA 3CX7B 3RLFF 3CXHE 3MA9A 2FYUJ 3UULA 1S4XA 3CK6A 5E79H 3SWFA 1YW0A 2R32A 4H9QC 5BU8B 3EDVA 2PRRA 5AW6B 4DJGA 3QNUA 4YXDC 1MIVA 2P67A 3PTZA 4OGQB 2QJPC 4P0BA 1DEEG 4MFRA 2IZ0A 1YHQP 3L3PA 1SQPG 3FGAD 4O8SA 2A72A 1BSNA 2SPZA 1RQUA 3O9XA 5C3JA 2FXPA 3KZIE 2QRXA 2CA5A 3ABVC 3IN6A 2A9UA 3S4UA 3C64A 4H9SE 1NTKK 3TKLB 3CX5E 4IDOA 2HHHT 5AQIB 3RI5A 4EOZB 1KNZA 3EUHA 3LW5H 4Z8XA 5FYMA 3VMXA 1USDA 1J1JA 1FMWA 3VYIA 3Q5PA 4LF8T 1FZAA 2XQ9A 3NZPA 3H1IG 1X79B 1LTBC 1R5SA 1KILC 4GOEA 5CA1E 1T2KC 2MAWA 1QVFO 2OYIB 3V2NA 1G1IA 1J5WA 2R6GF 2XUEA 3JC6C 2BCCJ 3AE7A 3Q5EA 4UIGA 3CCRP 4DMWA 5JDQA 2CBIA 1URQB 1BCCG 3AEGC 5CBNA 4ZI7E 1VQPP 1VDFA 3ANWA 3C4XA 2N1TB 4EXTA 5F8PA 2PJQA 3CXHI 4QXHB 5HXHA 3E7KA 4OGQD 2WZIA 3A5XA 5JR9B 2ZLYA 4HYTB 1MMDA 3MACA 5LA6E 1I94T 3SWYA 1VQ8P 3L37A 1BR1A 2QJYB 4C90A 3G4SP 1AQ5A 1CSBA 4IE4A 3N4XA 1PP9J 3L70E 1U7MA 2G3AA 3UUXB 1QUUA 3B8EB 1H7CA 2WSSV 3CCQP 5H6RB 3V2PA 2G0UA 5CCHA 4TZ4C 5L2LA 2FFDC 3CCVP 4HTEA 2W2UA 4IDZA 4PK4A 1WRDA 3AA7B 2VL8A 1SVFA 2Y48B 3GN5B 2IBZD 3CCMP 1NJIQ 2YDSA 4TLFA 2JMHA 4DR6T 2NW8A 2LHRA 1BSHA 3C50A 2VWAA 1NTKE 2I1KA 2IC9A 2QA7A 3F89A 2W62A 2WB5A 2P9BA 1VOMA 3H3MA 3A0BH 2XU6A 4EYUA 2H8PD 5LG3A 1BGYD 2CEAA 3RRCA 1YKHB 3VN0A 3GHGA 4U2ZA 2BBJA 2V7KA 1IFIA 1LT9B 3MUDA 2RP4A 3ONLC 4RJTA 2BCCD 4Z1MH 2LT3A 2LJLA 1UX5A 4WNKA 3H1LG 2H7HA 1OEDA 1HNZT 5AQMB 1K73Q 4KMCA 5AQSB 3IBPA 5AVYB 5EK4A 3CCEP 1K04A 3CQCB 3ZMVB 1VF5C 4U74A 1FDMA 2MYSA 1L0ND 5B66H 2B76A 3IFMA 2C9LY 4CN4A 2BG9B 5J2TE 4ZKUA 1MNDA 5EK2A 1T6AA 4ASVA 1T72A 3HL6A 3GF3A 1HGZA 1MV8A 2ODVA 5AW9B 5HXCA 3VRBA 1RY3A 4DCKA 1OW6A 3AEDC 2M0BA 5IHYA 1D1BA 3R4YA 1N32T 3ZMSB 4BJNA 4JYAT 1N7SD 2QM7A 3CWBJ 1S9KE 1KILB 5AVQB 1Q90D 1MFZA 3WI3A 4IL4A 5CB4E 2XAQB 4K0KT 2N9BA 4KBMB 3WAJA 4DV0T 5AQQB 1KK7A 2E9XC 2FBWA 3V5UA 3QC9A 1RE4C 3H6PA 5J1GA 5KLVD 5L4HA 2WMMA 2V7QH 5HXEA 3CQGB 4IIJE 5HYAA 2BCCE 4TNWA 4LMLA 5APWA 2XAGB 3L09A 1WFDA 2QG4A 1NYHA 2W90A 2IUBA 3A3YB 3KV6A 2CHNA 2WDQA 2UXXB 1CZQA 3IF4A 3RYHE 3FHNA 1MKMA 3TLWA 3Q3DA 3L74D 2FY8A 2LSKA 4C7NB 1YQ3A 2KS1B 3B4SA 3ZMZB 1JY3N 4CI2B 3UUNA 5FY7A 1L0LJ 3P4PA 3CL3D 2LEHA 4KI0F 1SQXE 4N78D 3PURA 1RHZB 1EDIA 3N7NA 3LBXB 2WWWA 5AFUL 2XNXA 3CKDA
chains in the Genus database with same CATH topology
3LIEA 3B57A 3HE5A 2OARA 2CXDA 4UELA 4ADZA 4GIFA 2IX7C 2LE8A 3A5TA 2D5UA 1GK4A 2E43A 2PG8A 1T98A 5CJ0A 5KJ7D 4AKHA 5FXWA 2OYHC 3AAIA 3QUJA 5JR9C 2C0WA 3RH3A 4EXTA 1IO4A 2D2SA 1VRBA 2VKJA 3OBVE 1FIOA 2CWOA 4CI3B 1N7SC 5AVTB 1ZR4A 4A56A 2X51A 4N6JA 2DWGA 2N9DA 4CI1B 2O1KA 1HX8A 2POHA 1PFIA 3FXDB 4IE0A 2ZM2A 3ZPOA 2WZ7A 3ZCIA 2Z6EA 4UVAB 2DHRA 5JDMA 2ZMAA 3RRWA 1DEBA 5KTBA 5FMNA 3BK9A 4B6XA 3H32A 2NPSD 2WSFH 1LGHB 5CJ4A 4WY4A 4OK0A 1WT6A 2WITA 2KXPB 4L9IA 2XASB 4H63H 4ZI3D 3P8CE 4JYBA 2Q9QA 1N7LA 3I0QA 4YFSA 2MBGA 2HODA 5CCHC 2L5GB 4KP3C 1HGVA 4HH2A 1GL2A 5CMZA 3RK3B 2FFDA 1U5PA 4O2AE 5KLVK 2QM8A 2N1GA 3PTRB 1NKNA 2PFVA 4TV8E 4IHJE 1LVFA 2HG5D 2WSCH 4NUVA 1RF0C 3VP8A 1WYCA 1HUCA 1L4AA 3CMLA 1N73A 4DNDA 1Y64B 1GTWA 3VP9A 1FJPA 2XTLA 3RC3A 4I4TE 2Q7CA 5APYA 2W61A 5AVXB 2KT9A 2X0LB 1OXZA 3HUSB 1MMNA 4OH8B 4UV8B 4UXNB 3K3OA 3M0AA 1G8XA 2P1JA 1H8AA 1ZKEA 1LWUB 3NMDA 2M67A 2MOZA 3N5LA 5BMVE 3SOLA 3RC8A 3OJAB 1GK6A 2WBLA 2Y8DA 3MZKB 5APUA 2DLRA 5JDHA 4DVDA 1SQBK 1T3JA 1IJDB 3ANWB 3KVBA 3ZYKA 2NPSA 2HPLA 1FZCC 4WB4A 3AAEB 3C51A 1ZLLA 4AQGA 5BVZA 5LJNA 2C5KT 2ZM0A 1JMMA 2NOXA 3HI2A 1ZV8A 2W6BA 4DO0A 2X67A 4UV9B 5CA0E 2JEEA 3V2RA 4Y99B 5CHXA 2UXNB 2LOPA 4KHXA 4CXXA 5APQA 1T2KD 3UFEA 3H3AA 1IZNB 2LSJA 2P2UA 3HE4B 4XAXB 5FY1A 4W7YA 2X9HA 2WPSA 5HAXA 5FP3A 1LT9A 5AW4B 5FXXA 5HXRA 5JDLA 2HFED 1SQXK 3P8MC 1EQ7A 1SQVK 5L3BB 3M65A 4H9PC 2ES0A 4CXWA 4PK6A 2H7VC 1D0ZA 3KPEA 3MGNA 2V7MA 2KYVA 3HRNA 5F3JA 1JY3P 2GUVA 1SHZC 2QGSA 3GMIA 4QX7B 3RYFE 3I1AA 4WBOA 3F31A 3UIAA 1JO5A 4CQIA 5LHGB 2HLOA 2RA1A 3ZC0A 4DOJA 2PAJA 5AW3B 1BR2A 5FXVA 2YO2A 3LFMA 3E22E 1URQA 5LGUB 1JTHB 3TNUB 1SP4A 3SRZA 3ETUA 3R2PA 3RL0C 5H6QB 2YINA 2K48A 3AA0B 1S35A 4H9RC 3RYCE 4EZ4A 4UVBB 3RRCA 3V5SA 4TV9E 4O4IE 2C0SA 3KVAA 3UTKA 4P0AA 1LTJA 1YTZI 2HYNA 3PUGA 1H89A 1NO4A 2EHOB 4L0RA 1IJ6A 1D0YA 3VKHA 1NAFA 1GDTA 1E1HB 2WWUA 4PJLA 2ODUA 2JMKA 3VHLA 2WAUA 1XTGB 5AVRB 2YEVC 4UEMA 3OKQA 1RF1A 4O9BA 1FU1A 4XA4A 2WSEH 3TK1A 2H7OA 3NXSA 3OYXA 3MJXA 4ZOLE 4AKLA 3HA4A 4XE5B 3O8ZA 2BDEA 3I5CA 2N1TC 2FKWB 1KQLA 5AW0B 3TSIA 3RK2B 1LVKA 2EHOA 2KWHA 5KJ7C 1MNEA 2LM9A 3I0OA 3ZJ2A 4GYSA 4B86A 1IFMA 3IR9A 1LWUC 3VMZA 5FY0A 3V4QA 5CCGC 4C7RA 1VPCA 4WBAA 2E9XA 2K5BB 3DTOA 1RE4A 3PDYA 4FJOA 3ONXA 5AVWB 2Q5UA 3MIWA 4JF7A 1ZR2A 1FZGA 1MUUA 2CCQA 4DBRA 5L3DB 5E0OA 3HD7D 2LHNA 2OYHB 1MIWA 4QKNA 1B7TA 3RK3D 1MIYA 1KILA 2N1TD 4I50E 4TN7B 4BJMA 1NU1K 1HVVA 3B5NA 2GUSA 4YJ3E 1GL2D 2O01H 3VTPC 3M9HA 5AW2B 3V4WA 2JQQA 3NBXX 2V26A 1ZHCA 1QL2A 5HWYA 2JJ9A 4ZS3A 2VRSA 2CWYA 2E9XD 2X9WA 4ISTA 1FZFA 1SFCA 3EFGA 3KYQA 2XAHB 1HFAA 5BU5A 3HKDE 1O3XA 4O4JE 3KV9A 4ZI3C 3R6NA 4IGUA 2I1JA 3HTKA 1FEWA 1LRZA 3DJBA 1N7SB 2ACXA 3NRXA 2K9AA 5A1LA 1LTIC 1JNMA 5HXSA 2OYIC 5LGTB 3RL0D 1JUNA 2C5JA 1T3UA 1FBMA 1CUNA 4ANJA 3TYYA 1HS7A 1HG5A 1G1JA 2FYUK 3GN5A 1DH3A 4NUUA 4AKRB 5JREA 2IPPA 1SFCB 1CW5A 2XV5A 2KP8A 2LSYA 4QXCB 4ZS2A 2LSGA 2X66A 1MZ9A 1QSDA 2VK9A 2Y6XA 2BVMA 4JEUB 5IYZE 5KX5E 3GHGB 5AW5B 5HWXA 5LHIB 3VKGA 2PP6A 4O4HE 5AW1B 3KQGA 1GU4A 1AFOA 2PBIA 3LBXA 4MBQA 4I1LA 2J58A 3CI9A 4W80A 3W15B 1CI6A 2IFMA 2Q3IA 3BRTB 2KMFA 3BRVB 3ZJ1A 2JPFA 3PE0A 4EB6E 2M3BA 4ZI2D 3RPUA 3VOPA 2HPJA 1GU5A 4X1IE 2KWIB 3M9QA 3R84B 2A45H 1UX4A 2NWBA 4UF0A 4AXPA 2E8IA 2KZ7B 2WTYA 2SPCA 2VB6A 3LK3B 2C5IT 4CZZB 4FI5A 1D1AA 3PUSA 4GOUA 4H63V 4PFOA 2VKDA 1EZ3A 4K0UA 1MMGA 3I9YA 3CKDA 5DABA 4GK5E 3LIDA 4GT1A 4HE8A 1LKXA 4M3LA 1S94A 4ILUA 5APVA 3RK3C 2L9QA 1IC2A 2YK0A 1ZV4X 5LNKA 1W2EA 2CLYC 1IK9A 3L4FA 3HKCE 1UCUA 5CCHD 3IEEA 2CXFA 1D1CA 1JCDA 1FZBA 3KDSE 2Q9QC 1HG2A 3Q9DA 2IFNA 1FZEA 2LSIA 1J1DC 1GL2C 1LTSC 4AUWA 3U59A 1LTAC 2DCFA 2VKOA 3B13A 3EDUA 3K3QC 2E42A 1E5WA 3ETVA 3ZYMA 2HODB 3B5ND 3LK2B 4ERRA 4V1Av 4CXYA 1OWAA 3CX8B 3A2AA 3A7OA 3FBLA 1L4AC 2WPRA 1N73C 1RE3C 4O4LE 3QK6A 4PJMA 3O1HA 3MXZA 3GHGC 4QWNB 2CPSA 4I2LC 2ZM8A 1JOCA 2X9XA 2Q9QD 1N73B 1G2CB 1S9KD 2X9YA 4WW0A 5JR9A 5L3CB 1FAVA 5APSA 2A45G 4AI6A 3ZC1A 1MMAA 1ZEEA 3OYZA 5LGNB 1KILD 3M9BA 3GWHA 4OFZA 1NKZB 3T8OA 3RYIE 3HR0A 1J2JB 4MALA 2NPSC 5LJMA 5KDMC 3C4WA 3E1IA 4X1KE 1SLQA 1FZCA 3HKEE 5ETWA 3D0TA 3CX7B 3MA9A 3Q2MA 2D0UA 3KFWX 3KDPB 4LLHA 1HF8A 3Q5WA 4I55E 4XBFB 2J1DG 3G3ZA 3HUSA 4U72A 3UULA 4MLKA 5J2UE 2D0TA 3U1CA 3KV5A 3SWFA 1GW3A 1YW0A 3CX6B 2R32A 1L4AB 4WY4D 1H88A 1M1JC 5BU8B 1DX7A 1HJBA 4H9QC 3P8CD 3EDVA 2BASA 5AW6B 2V7JA 1CI6B 3HD7A 4BA9A 5JDGA 2N2NA 2C9NY 1NTZK 2YKPA 1MIVA 3LK42 2P67A 3OJAA 4HEAA 4P0BA 4OYKA 4MFRA 4E7SA 1JY2N 3FBZA 1N2DC 3N9LA 3HTKB 1GW4A 1XTCC 1G73A 3L3PA 3NFQA 4O8SA 4M1PA 4YHJA 2A72A 3SS1A 3ZMUB 4AQFC 1URQC 2XHEB 3O9XA 2R5BA 2WM9A 1Z56A 5FXZA 2BZBA 1URQD 4DZOA 2W0GA 3N9MA 3ZLIA 4F6RC 4I43B 3CPZA 5C8YE 4YJ2E 2GM4A 3OA7A 3ZMTB 1JTHA 2CA5A 1V9DA 3HE4A 1NHLA 3BATA 3S4UA 3C64A 1M7LA 1WR6A 2HH7A 5LCYA 4H9SE 3U3IA 1IFNA 4P09A 3K8PC 5LG4A 1NTKK 2NTYA 3TKLB 4OYJA 4DMVA 4QXBB 4EOZB 4ZHQE 1KNZA 2CLYB 2VASA 3EUHA 5AVVB 3LW5H 4H9NC 4Z8XA 1YKEB 5JQGE 5FYMA 3WMM0 3VMXA 5FNVE 2NW7A 1ZN5A 1LTJB 2I59A 4PJNA 4GYRA 5APXA 2KSJA 1FMWA 3P7KA 5AVUB 3VYIA 2H43A 2DNXA 3AVSA 3C98B 4MHCA 1FZAA 1A02J 3M0DC 4QX8B 3AA1B 3NZPA 1X79B 5LBQB 1KFMA 1LTBC 1FOSF 3KV4A 1HBWA 1JY2P 1KILC 3AA6B 3N2KE 3PU8A 4PAGA 4PNIA 2NW9A 5AW8B 3HE5B 1JY3O 3RL0B 2WMOA 3BQIA 3NZQA 4TX5A 5LBMA 2DWKA 5CA1E 1T2KC 1BR0A 2OYIB 2MJZA 3V2NA 1G1IA 3JC6C 3V5BA 2XUEA 1Z0PA 3N2GE 4UIGA 2MTQA 5JDFA 3SWHA 2HPCA 4DMWA 5JDQA 4W7ZA 2IAKA 1URQB 4C91A 1NWMX 4GK0E 5L3EB 5LOVE 2Q9QB 4HKAA 2ZFCA 1L0LK 4H9OC 4ZI7E 3ZYLA 2P7JA 1VDFA 5L3GB 3P7IA 3PU3A 3AAAB 2FFDB 2OYHA 3H32B 2OYIA 3P32A 3ANWA 3C4XA 2N1TB 1GD2E 2HPCB 5EZYE 3B5NB 1N7SA 1BR4A 1SA0E 2PJQA 3E08A 4QXHB 5F8PA 1JCCA 5HXHA 3A5XA 1G2CA 5JR9B 5LP6E 2ZLYA 4HYTB 1RF1B 2DI4A 1MMDA 1L0NK 1IFDA 1A02F 1J1EB 3KINB 3MACA 3MD0A 2LKMA 1M1JB 3L37A 3SWYA 1BR1A 3V2QA 3CWZB 4HFVA 4UVCB 2R3CA 3ZMVB 4C90A 2NP9A 3RK2C 2W27A 2R5DA 3U78A 4WY4B 4EOTA 1AQ5A 2BVLA 1CSBA 1LTTC 2LOSA 4IE4A 4J2CA 4X1YE 5LA6E 3N4XA 4KUMB 3F57A 3EQ2A 4ISSA 4IFFA 3UUXB 1QUUA 3B8EB 4WY4C 3IF8B 2L8KA 1H7CA 5LXTE 3HKBE 3VU7H 4JYCA 1FOSE 2GK9A 2VKHA 2O1JA 2YU2A 5M4YA 2WSSV 5H6RB 3V2PA 2XDJA 5CCHA 2G0UA 2KNDA 4TZ4C 2W6AA 2W00A 3JC6D 3FB2A 4O2BE 2NTXA 2FFDC 5LYJE 5L2LA 2JRKA 5JRCB 4HTEA 4IDZA 4HN9A 4PW8A 2FXMA 4PK4A 1WRDA 3AA7B 2VL8A 3II6A 1SVFA 3BQLA 2Y48B 3GN5B 3CLQA 4L5GA 5DJQC 4EYYR 3AB3B 1RF0A 2KLVA 3PUQA 1US7B 3FXEB 4IFMA 2WPQA 2JMHA 1NWQA 3N9NA 4JUYA 4PJJA 2NW8A 3MKDA 2XAJB 1KZUB 2LHRA 3KBTA 4C7NA 3Q5XA 5AVSB 1LTGC 2W63A 2WMNA 3C50A 3IHRA 2KLQA 2VWAA 2WT7A 2I1KA 2IC9A 3ZN0B 5APTA 1JY2O 5ADXL 2QA7A 2W62A 2P9BA 1VOMA 5JDNA 5J2TE 3N2OA 1YD8G 2XU6A 1WRGA 4XZCA 3MK7C 2H8PD 2XAFB 3J9X1 1HWTC 4EYUA 1YTZT 1RE3A 3TNUA 2Q9IA 3VN0A 1YKHB 2CEAA 1YYCA 3GA8A 3PP5A 2B1EA 2FYZA 2J59M 3GHGA 3BVHA 3MTUE 2YKOA 2V1DB 5TAOA 3J7Yq 4N3YB 2V7KA 1IFIA 4X20E 1LT9B 1KFNA 3MUDA 3U1AA 3L35A 2Z5IA 5CCGD 1D0XA 2RP4A 3C4ZA 2LT3A 2LJLA 1UX5A 1X8YA 4HGAA 2YO3A 4EAHA 4EZHA 2YKQA 4AKGA 4WNKA 5JH7E 3PUAA 1SQPK 1LT9C 2H7HA 2YU1A 3M91A 3N9OA 4Y99C 1T8ZA 4N78E 4KMCA 1NOHA 2YNYA 5AVYB 3IBPA 4UF0B 4JEHB 4DBQA 4EIJA 5EK4A 2OA5A 2IC6A 3NRYA 1J1EC 3LG7A 4JLEA 2XZRA 3CQCB 1HH0A 2A3DA 3BQKA 3RKOA 3ZCJA 3F2EA 4U74A 3HUSC 1FDMA 2MYSA 1SQQK 2XKMA 5AVZB 3N9QA 4IFDK 1X9VA 3IFMA 2C9LY 1X79A 2A2FX 2A45I 1M1JA 1L4AD 4G63A 2C0XA 3VMYA 4ZKUA 1IFJA 1MNDA 1IAPA 2CE7A 3CQXC 5EK3A 4AQRD 4ZI2C 5EK2A 2V7IA 3RK2D 3HD7C 1FZCB 4QHOA 3HL6A 1HTJF 2YMYA 3ZEFB 1HGZA 3L36A 1MV8A 2ODVA 4GKGA 1LTJC 5AW9B 3H37A 4IE6A 5HXCA 3WAKA 4WBNE 1SFCD 1RY3A 2JJLA 4OHFA 2CPBA 3UT5E 2M8RA 4E7ZA 4PK5A 5IHYA 3M06A 4ASKA 1D1BA 3T97A 1RF1C 3ZMSB 3C9IA 2EHOD 1N7SD 2QM7A 4AQFA 4BJNA 3CVRA 1GZLA 1S9KE 1KILB 3EVYA 4EIWA 1WYBA 2N1TA 5AVQB 2EHOC 2K24A 2NPSB 1FMVA 4TUYE 3UUMA 4C46A 5KJ7A 1MFZA 3ESLA 3O1IA 3I9WA 2E9XB 5GONE 3WI3A 5CB4E 1AJ3A 2KOGA 2XAQB 2N9BA 1NH4A 4KBMB 1LWUA 3WAJA 1GL2B 1KK7A 5CCGA 5DQVA 2E9XC 3V5UA 4LC1A 4RESB 1RE4C 3H6PA 2H3RA 3QC9A 5J1GA 3RX6A 3O1JA 5DQWA 5HXEA 1FJKA 3CQGB 3HD7B 4IIJE 2IW5B 2WT7B 5HYAA 3ZN1B 5APWA 4IE7A 2XAGB 3L09A 3A3YB 2KINB 3KV6A 3B5NC 4G2AA 5LHHB 1N86A 2V7LA 2Z5HA 3OAKA 4I6MC 4BAYB 1WLXA 2UXXB 1CZQA 2Z4EA 2L3LA 1IJ5A 1HCIA 3RYHE 3E0ZA 4AYCA 3FHNA 3DP7A 3LJCA 5JRCA 3AVRA 1SFCC 3O4XE 2XQYA 5L3FB 2LSKA 3NTNA 4C7NB 1QL1A 1NTMK 5JVDE 2ZXEB 2CM0A 5AW7B 4GIWA 1JY3N 3M0DA 4LGDE 4IE5A 2X68A 3N9PA 3ZMZB 3UUNA 4ZKPA 4CI2B 5KMGP 3BASA 2KB7P 5FY7A 1HTLC 3CL3D 2LEHA 4N78D 4YLHA 3PURA 4AKIA 2CXLA 4PFPA 3N7NA 3LBXB 2WWWA 3K3NA 5AFUL 2XNXA 3KBUA 1U4QA 2CMRA 1J1DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  5AW0 B;  3HE5 A;  2WPQ A;  3SWF A;  3A5T A;  1NWQ A;  1GK4 A;  2R32 A;  4B86 A;  2E43 A;  1H88 A;  3IR9 A;  3VMZ A;  1HJB A;  3EDV A;  4C7N A;  2BAS A;  5AVS B;  3V4Q A;  5AW6 B;  1CI6 B;  1IO4 A;  2WT7 A;  2C9N Y;  5AVW B;  2Q5U A;  1MUU A;  5APT A;  5AVT B;  2P67 A;  2XU6 A;  1HWT C;  3TNU A;  3VTP C;  3NFQ A;  3VN0 A;  1YYC A;  3M9H A;  5AW2 B;  3V4W A;  2VRS A;  2R5B A;  3L35 A;  2Z5I A;  4DZO A;  1X8Y A;  2YO3 A;  3HTK A;  3HE4 A;  2H7H A;  3M91 A;  4JYB A;  1JNM A;  1JUN A;  2YNY A;  1CUN A;  5AVY B;  3TYY A;  1U5P A;  5CMZ A;  1DH3 A;  2QM8 A;  2IPP A;  2XV5 A;  2KP8 A;  2XZR A;  5AVV B;  1HUC A;  5AVZ B;  5AW5 B;  1GTW A;  2C9L Y;  5AW1 B;  3KQG A;  3VMX A;  1GU4 A;  3LBX A;  3UUL A;  2Q7C A;  5APY A;  5AVX B;  1CI6 A;  1OXZ A;  2Q3I A;  3VMY A;  5APX A;  4AQR D;  3M0A A;  3P7K A;  1H8A A;  5AVU B;  3VYI A;  3NMD A;  3PE0 A;  1GK6 A;  3L36 A;  1GU5 A;  1A02 J;  1MV8 A;  5APU A;  4GKG A;  5AW9 B;  2ODV A;  2JJL A;  2SPC A;  2WTY A;  1FOS F;  1HBW A;  3M06 A;  5AW8 B;  3HE5 B;  3T97 A;  1T2K C;  2QM7 A;  3LID A;  1GZL A;  4GT1 A;  1S9K E;  4KHX A;  3V5B A;  4M3L A;  5APQ A;  5AVQ B;  5APV A;  1T2K D;  3UUM A;  4C46 A;  1MFZ A;  2P2U A;  3HE4 B;  1AJ3 A;  2WPS A;  2ZFC A;  2N9B A;  2P7J A;  5AW4 B;  3P8M C;  4LC1 A;  3P32 A;  4RES B;  1GD2 E;  4AUW A;  3MGN A;  2WT7 B;  2E42 A;  5APW A;  4HYT B;  1OWA A;  3A2A A;  3A7O A;  3UIA A;  3A3Y B;  1A02 F;  3MD0 A;  3F31 A;  2WPR A;  3L37 A;  2Z5H A;  3OAK A;  2R3C A;  4I6M C;  5AW3 B;  1WLX A;  2YO2 A;  1CZQ A;  2W27 A;  2R5D A;  4I2L C;  3TNU B;  4EOT A;  1CSB A;  1SP4 A;  1HCI A;  4AYC A;  1G2C B;  1S9K D;  1FAV A;  5APS A;  1S35 A;  1QUU A;  3NTN A;  3B8E B;  4C7N B;  2ZXE B;  3M9B A;  5AW7 B;  3M0D A;  1J2J B;  4JYC A;  1H89 A;  1FOS E;  3UUN A;  1NAF A;  1SLQ A;  2ODU A;  2W6A A;  5AVR B;  3FB2 A;  3TK1 A;  3NXS A;  3KDP B;  3LBX B;  2WWW A;  4XE5 B;  3O8Z A;  1U4Q A;  3I5C A;  1KQL A; 
#chains in the Genus database with same CATH topology
 2BCC G;  2IBZ E;  3HE5 A;  1SQQ D;  2E43 A;  5KJ7 D;  1VRB A;  1BE3 J;  1USE A;  2VKJ A;  2CWO A;  2CPT A;  4N6J A;  4CI1 B;  2V4H A;  1N36 T;  4ASW A;  2POH A;  3NKZ A;  2JQK A;  2NRG A;  3FXD B;  3ZPO A;  2WZ7 A;  1BCC E;  3P4R A;  2K3R A;  5KTB A;  3RHW A;  3PJA J;  1LGH B;  4WY4 A;  3JC2 2;  4PV1 B;  2XAS B;  4YFS A;  5L8R J;  5B5E H;  2L5G B;  2BKP A;  3L8R A;  4O2A E;  1X9B A;  3GMA A;  4MN4 C;  4TV8 E;  4IHJ E;  3QH9 A;  2CRB A;  4DV1 T;  2HG5 D;  2WSC H;  1RF0 C;  2O01 J;  1HUC A;  3CML A;  5AQN B;  1N73 A;  2XTL A;  2E76 C;  3L70 G;  2Q7C A;  5APY A;  5M1B A;  5AVX B;  2W61 A;  2NR4 A;  4UXN B;  3O1H A;  3M0A A;  2DL1 A;  5BMV E;  1LWU B;  2FYN C;  2XM1 A;  1GK6 A;  2JO1 A;  2WBL A;  2X0Y A;  1SQB K;  3ANW B;  1FZC C;  3C51 A;  3QWO C;  5LJN A;  3HI2 A;  2W6B A;  4DO0 A;  2X67 A;  3V2R A;  2LOP A;  4GKK T;  4L75 A;  1T2K D;  3H1H E;  1XWM A;  4XAX B;  5FY1 A;  5B66 E;  2WPS A;  3PUY F;  4TWD A;  1HNW T;  3AE9 C;  1SQX K;  1EQ7 A;  1SQV K;  2HR3 A;  2WU5 A;  5L3B B;  2QVA A;  4L76 A;  4CXW A;  2E74 B;  1NTZ D;  3G71 P;  3MGN A;  4UB6 E;  1JY3 P;  1ZME C;  2HLO A;  2IBZ I;  2RA1 A;  3ZC0 A;  2I6H A;  1Y01 A;  5AW3 B;  1BR2 A;  1PL5 A;  3ETU A;  3RL0 C;  1T7S A;  2K48 A;  2H89 C;  4EZ4 A;  1KB9 E;  2ZVO B;  2BKO A;  3V5S A;  4RKU J;  1BE3 G;  1LTJ A;  3PUG A;  4L0R A;  1H89 A;  5KXJ A;  1NAF A;  1GDT A;  1E1H B;  1N8R Q;  2WQY C;  2WWU A;  5H2F H;  5J0Z A;  3L75 E;  1XTG B;  2E76 D;  2WSE H;  3TK1 A;  4AKL A;  4ZOL E;  4XE5 B;  3AE1 C;  2BDE A;  3I5C A;  2B88 A;  2N1T C;  1LVK A;  4AXP A;  4AKH A;  1KV4 A;  5KJ7 C;  2NZ2 A;  3CC7 P;  2AXT H;  4B3R T;  3V4Q A;  4C7R A;  4HWF A;  1VPC A;  5AVW B;  2R44 A;  1YXR A;  2LHN A;  1MIW A;  1PPJ E;  2Y9Z A;  4QKN A;  3RK3 D;  5AQP B;  1PGP A;  3B5N A;  3EFF K;  4JI0 T;  2JP3 A;  2O01 H;  2JQQ A;  3M9H A;  2M3E A;  4PV1 D;  1R8I A;  1QL2 A;  1FDI A;  4GOF A;  3L74 G;  1BE3 E;  4BWN A;  3D6Z A;  5HXS A;  3EWK A;  2K9J B;  4O4J E;  3DJB A;  1LRZ A;  2K9A A;  1LTI C;  1UIX A;  1JNM A;  5LGT B;  2QJP B;  2Q6Q A;  1FDO A;  1CUN A;  3WUU A;  1DH3 A;  2LSG A;  3AEA A;  2BEQ D;  1MZ9 A;  4IDQ A;  1KIL E;  2Y6X A;  5KX5 E;  5HWX A;  5AW5 B;  3L72 D;  5AW1 B;  3KQG A;  5FL0 A;  4DR7 T;  1KYO E;  2JPF A;  3ZT7 A;  2HPJ A;  1PP9 E;  1L0N J;  1H0T B;  3AE3 C;  1UX4 A;  4UF0 A;  1S1C X;  2WTY A;  3LK3 B;  2UWJ E;  4CZZ B;  4GOU A;  3PUS A;  1NAY A;  1EZ3 A;  4D6T J;  3L71 E;  5DAB A;  4HFH A;  4GK5 E;  2BS4 A;  3BCC J;  4HFB A;  4M3L A;  5GTI H;  3UU4 A;  2L9Q A;  2CLY C;  1IK9 A;  2JWA A;  1UCU A;  4CN1 A;  1EXJ A;  1FZB A;  4HWD A;  2IFN A;  2KK7 A;  2IHR 1;  3TLV A;  1GL2 C;  4A7P A;  4AUW A;  3U59 A;  1LTA C;  2DCF A;  1EZV I;  3ZYM A;  3H1H J;  4IRE A;  1OWA A;  3CX8 B;  3A7O A;  1SQX G;  1RH5 B;  3GHG C;  2ZM8 A;  1KMI Z;  4WW0 A;  1SS1 A;  1S9K D;  5JR9 A;  5L3C B;  1FAV A;  2A45 G;  1ZRT E;  4WZX A;  3ZC1 A;  1ZEE A;  2IIU A;  3T8O A;  2UXD T;  3ZDM A;  2NPS C;  3E1I A;  1SLQ A;  1OW8 A;  3FZH B;  3HKE E;  4ILB A;  2KI7 B;  3Q2M A;  3Q5W A;  4LLH A;  4JI3 T;  5HEO A;  4MLK A;  2D0T A;  3KV5 A;  3CX6 B;  2WWV A;  3PHL A;  1L4A B;  1H88 A;  1HJB A;  1QX8 A;  3G9R A;  3P8C D;  3L75 J;  1SQQ G;  2V7J A;  2PTF A;  4BA9 A;  3F5H A;  1U7J A;  2W6J H;  3AED A;  4OYK A;  4E7S A;  5KKZ C;  1OVU A;  1GW4 A;  1XTC C;  3H1J J;  3NFQ A;  4PD4 E;  2XQA A;  2UUB T;  4TWF A;  2OQQ A;  3CWB E;  1Z56 A;  4F6R C;  4DZO A;  2QEX P;  1JTH A;  3BAT A;  3FZK B;  1M7L A;  1NU1 E;  3K8P C;  2KS1 A;  1QLB A;  3W67 A;  5LG4 A;  3CD6 P;  3EHZ A;  4OYJ A;  3LDQ B;  1UII A;  2K1A A;  2WY2 A;  2VAS A;  5AVV B;  2FJD A;  1KTM A;  1S72 P;  4H9N C;  1E79 H;  4HKZ H;  5JQG E;  5FNV E;  3A0H E;  4DUY T;  3UU5 A;  2IYP A;  5APX A;  2KSJ A;  4DR1 T;  3AVS A;  1Q7Y Q;  3C98 B;  2GA1 A;  2VVS A;  3H1K J;  1SQB G;  3ZT6 A;  3N2K E;  1FOS F;  2WDV A;  3E1R A;  1HBW A;  3PU8 A;  3AA6 B;  3AEF A;  4TX5 A;  4EI2 A;  2M6B A;  4IDN A;  1Z0P A;  3AE8 A;  3SWH A;  5JDN A;  3SWK A;  2HPC A;  1IBL T;  5AQR B;  4C91 A;  1NWM X;  1VF5 B;  5LOV E;  4HKA A;  1L0L K;  4JI1 T;  3P7I A;  4LFB T;  2CHO A;  3H32 B;  2HPC B;  2YIU C;  1JCC A;  1YQ4 C;  1G2C A;  2FYU G;  4H13 B;  4UR9 A;  1HNX T;  3GW6 A;  1PPJ D;  4B3S T;  4U31 A;  1L0N K;  1IFD A;  3KIN B;  3R84 B;  2XJ7 A;  1S3J A;  3H1L D;  3RK2 C;  4DV5 T;  4WY4 B;  3L71 G;  2BVL A;  4X1Y E;  4L74 A;  1NTM G;  5AQF B;  4R4M A;  4ISS A;  4IFF A;  5TIS E;  3O6Q A;  4WY4 C;  5M4Y A;  3L73 J;  3HKB E;  4JYC A;  2YU2 A;  3ONJ A;  2O1J A;  3P4S A;  2E76 B;  3JC6 D;  3FB2 A;  2IDB A;  3BQL A;  1N33 T;  5DJQ C;  5LMN T;  3NWI A;  2KLV A;  1US7 B;  3FXE B;  2WPQ A;  1OIP A;  1NWQ A;  3N9N A;  1S5L H;  4PJJ A;  5AQO B;  2XAJ B;  3KBT A;  4U7I A;  5AVS B;  1LTG C;  4OGQ C;  3CX5 D;  4NPP A;  4H0L C;  5APT A;  1JY2 O;  2ITA A;  4Y28 J;  3N2O A;  5KDM C;  3PUQ A;  3GA8 A;  2B1E A;  3J7Y q;  5TAO A;  2V1D B;  4HWI B;  3MTU E;  2OTK E;  2B87 B;  4X20 E;  3E08 A;  1KFN A;  1D0X A;  5CCG D;  2W83 C;  2KUB A;  4HGA A;  4EZH A;  4AKG A;  2YO3 A;  1DD3 A;  2YKQ A;  5JH7 E;  3PUA A;  1KOR A;  1W2B O;  3AE9 A;  4Y99 C;  1NOH A;  3MHV A;  4U3F E;  3JAF A;  3AXJ A;  4EIJ A;  1HR0 T;  2W66 A;  2WPV B;  3JCU E;  2IC6 A;  3LG7 A;  4JLE A;  2XZR A;  3RKO A;  4DR4 T;  2A3D A;  4IOI H;  3F2E A;  2AXD S;  1SQQ K;  5AVZ B;  1J5E T;  1X9V A;  3RGU A;  1M1J A;  1L4A D;  5AQJ B;  5GTI E;  3CQX C;  4ZI2 C;  3T97 B;  2H89 A;  3HD7 C;  1S5L X;  2YMY A;  3L36 A;  2JKV A;  4GKG A;  3H37 A;  3WAK A;  2AXT E;  1SFC D;  3UT5 E;  2M8R A;  2H88 A;  2WQY A;  3M06 A;  2WSF J;  4ASK A;  4XFJ A;  1RF1 C;  4JBW F;  2O01 N;  4OWF A;  4AQF A;  4EIW A;  3EVY A;  2LLY A;  2N1T A;  2EHO C;  2V7Q J;  4TUY E;  1FMV A;  3RIU C;  1YBK A;  1M8O B;  5KJ7 A;  1AJ3 A;  3I9W A;  2E9X B;  2K3W A;  2ZVN B;  2IDO B;  1NH4 A;  1P84 H;  3AEC C;  5DQV A;  2RPA A;  3UU6 A;  4RES B;  4PJ0 H;  4HWC A;  2RH0 A;  4HFD A;  1PGJ A;  2XQ5 A;  3HD7 B;  2YN6 A;  3B5N C;  1N86 A;  4K35 A;  5AQH B;  4NXN T;  4BAY B;  2L3L A;  2R3S A;  3E0Z A;  5JRC A;  3UFG A;  1NVO A;  1KNP A;  3NTN A;  1QL1 A;  1NTM K;  4X62 T;  2ZXE B;  2CM0 A;  5AW7 B;  4GIW A;  3M0D A;  2X68 A;  3N9P A;  2KZI A;  3CCJ P;  1HTL C;  4LF4 T;  4YLH A;  3L70 J;  2ZT9 D;  2VUR A;  2W4X A;  3RQW A;  3LIE A;  1NTM E;  4UEL A;  1T98 A;  2BEZ F;  5TIS H;  1VQ6 P;  2OYH C;  3AAI A;  3QUJ A;  1FJG T;  2AEF A;  2D2S A;  5AQK B;  3I56 P;  1N7S C;  5AVT B;  2X51 A;  2N9D A;  2E74 D;  1HX8 A;  1PFI A;  2ZM2 A;  3H1I D;  2DHR A;  1IFP A;  5JDM A;  4YTP C;  3RRW A;  2V5C A;  1SQB J;  4CN6 A;  1KEY A;  3ZSS A;  2E2A A;  5AQL B;  4B6X A;  2NPS D;  2WSF H;  4X65 T;  2HN1 A;  1KF6 A;  3TLS A;  1OED E;  1WT6 A;  2WIT A;  4F8H A;  2KLU A;  4L9I A;  4H63 H;  3P8C E;  2Q9Q A;  1KQS O;  3I0Q A;  4YHH T;  1EZV G;  3CC4 P;  1E7P A;  2XQ6 A;  1HGV A;  4HH2 A;  1GL2 A;  3RK3 B;  4R4L A;  5KLV K;  2QM8 A;  2A06 G;  3C8V A;  2HN2 A;  2PFV A;  3PTR B;  1LVF A;  4NUV A;  1WYC A;  4DND A;  1Y64 B;  3RL0 g;  1GTW A;  1SQV J;  4I4T E;  2AXC A;  1OXZ A;  3HUS B;  2AEM A;  1QEX A;  4UV8 B;  4H13 C;  3FX0 A;  1ZKE A;  2M67 A;  2MOZ A;  4JI6 T;  5JDH A;  4DVD A;  4YSX A;  1IJD B;  3KVB A;  2NPS A;  5KLI C;  2XSB A;  3RF1 A;  2L91 A;  2HPL A;  3P4W A;  1ZLL A;  5BVZ A;  2ZM0 A;  2JR8 A;  1ZV8 A;  2FYU E;  4DR3 T;  2JEE A;  5CHX A;  4KHX A;  3H3A A;  1IZN B;  2ZT9 C;  1Y47 A;  2X9H A;  5HAX A;  1SQQ J;  4YPC A;  3L75 G;  1LT9 A;  4NPE A;  4H44 B;  5AW4 B;  5JDL A;  2HFE D;  3AE2 A;  2N9Y B;  2OTJ P;  4YXD A;  4JQ0 D;  2XSA A;  2H7V C;  1D0Z A;  1T8B A;  2V7M A;  4KHZ F;  2GUV A;  3RYF E;  4QX7 B;  4I7Z B;  3I1A A;  4LMK A;  1W9R A;  3UIA A;  1JO5 A;  1XNQ T;  2PAJ A;  3E22 E;  4H44 C;  1VQN P;  1TU3 F;  4TV9 E;  2C0S A;  3KVA A;  3PV0 F;  2ZT9 B;  2K9Y A;  3VKH A;  2ODU A;  3OPC A;  1XDO A;  3T1Y T;  3OKQ A;  1FU1 A;  3MJX A;  3H1H G;  1Q81 Q;  4IDP A;  2M6I A;  2FKW B;  3TSI A;  5KLI B;  3P50 A;  2KWH A;  1MNE A;  3I0O A;  3ZJ2 A;  4GYS A;  2RKL A;  4B86 A;  4ZEY A;  1ZW0 A;  5FY0 A;  5CCG C;  2K5B B;  1BGY G;  3PDY A;  2XQ3 A;  2AE9 A;  3ONX A;  2CCQ A;  2Q5U A;  1MUU A;  2WU2 A;  5E0O A;  1SQB D;  3HD7 D;  4GDO A;  2XPK A;  3OTO T;  4QMA A;  1NTM J;  1KIL A;  2N1T D;  4TN7 B;  3L71 J;  1NU1 K;  2LXB A;  3AEF C;  3WU2 H;  2GUS A;  4YJ3 E;  3A8Y C;  5AW2 B;  1YIJ P;  3B5M A;  2V26 A;  1NTZ J;  4ZS3 A;  3AE7 C;  2VRS A;  2VQF T;  1FZF A;  1OW7 A;  1SFC A;  1AVO A;  3EFG A;  1NEK A;  2XAH B;  3HKD E;  1O3X A;  2IBZ G;  1AJY A;  4OHF A;  1FEW A;  1BGY J;  2JWD A;  5A1L A;  3NRX A;  3RL0 D;  2C5J A;  1T3U A;  1DD4 A;  2WP9 A;  2FYU K;  4NUU A;  3G6E P;  3CXH H;  2IPP A;  1SFC B;  1CW5 A;  3KXD A;  4BXL A;  4QXC B;  4KJM A;  5KLV G;  1GMJ A;  2BVM A;  2YDQ A;  3GHG B;  4PK6 A;  2JDI H;  1GU4 A;  1AFO A;  5C8Y E;  2PBI A;  3L75 D;  3LBX A;  1PGO A;  3W15 B;  1CI6 A;  2IFM A;  3PRJ A;  4NPF X;  3BRV B;  4IT4 A;  3ZJ1 A;  4YSZ A;  3PE0 A;  1KFY A;  4EGW A;  2ZAE B;  1KB9 D;  2V5D A;  3M9Q A;  4YY3 T;  2SPC A;  4AQY T;  1KQG B;  2VB6 A;  2FJB A;  2VKD A;  4K0U A;  1MMG A;  1SQX J;  1LP1 A;  5AQG B;  1AQT A;  3AE6 A;  2WCA A;  2MKV A;  5LNK A;  3L4F A;  3IEE A;  1X22 A;  3FWL A;  4U2Y A;  4EV6 A;  4LFA T;  1HG2 A;  3AXJ B;  1NTK J;  1NEN A;  3Q9D A;  2P10 A;  1PIX A;  3B13 A;  3H1H D;  3IAO A;  3EDU A;  2V6Y A;  3BCC E;  3CCS P;  4GKJ T;  1PP9 G;  3LK2 B;  2Y9Y A;  4V1A v;  1KB9 H;  3JSV C;  4QWN B;  2Q9Q D;  3MUD C;  1N73 B;  2QA4 P;  4OFZ A;  3SFD A;  3CXH D;  1W0A A;  3GLM A;  2KSR A;  3KDP B;  1HF8 A;  3USS A;  3G3Z A;  4U72 A;  2JQ9 A;  1HJ0 A;  2LKG A;  1L0L D;  1GW3 A;  1OX3 A;  2ACZ A;  2BAS A;  1SQV D;  1CI6 B;  3HD7 A;  5JDG A;  3Q5S A;  2N2N A;  2C9N Y;  4TNV A;  1NTZ K;  2YKP A;  4H13 D;  3LK4 2;  2J4G A;  4DUZ T;  4X5T A;  3OJA A;  2H88 C;  5AQV B;  3FBZ A;  1N2D C;  1G73 A;  4U33 A;  3SS1 A;  4AQF C;  2QSI A;  1URQ C;  4BRY B;  2XHE B;  2R5B A;  5FXZ A;  2W0G A;  1URQ D;  2YOE A;  3N9M A;  4I43 B;  3CPZ A;  4I7Z C;  4EED A;  4RO0 A;  3TGU J;  3ZMT B;  3OA7 A;  2B9B A;  1V9D A;  1NHL A;  2YDR A;  1KYO I;  3AEE C;  3AEC A;  1IFN A;  4P09 A;  3RIA A;  3QB5 K;  2K88 A;  2NTY A;  1EDL A;  4DMV A;  2QJK C;  3BCC G;  1ZOY A;  2ZM6 T;  1P84 D;  3WMM 0;  4CPG A;  2XQ7 A;  1ZN5 A;  1BDD A;  1LTJ B;  4PJN A;  3P7K A;  2BG9 C;  5AVU B;  1FC2 C;  2DNX A;  1YQ3 C;  3L74 E;  1A02 J;  1L0L E;  3M0D C;  3AA1 B;  5LBQ B;  2LM2 A;  3KV4 A;  3RKG A;  3RL0 B;  5LBM A;  3NZQ A;  2DWK A;  2MJZ A;  3V5B A;  5JDF A;  2WZH A;  2IAK A;  5CBO A;  2ZYA A;  4LF6 T;  1VQO P;  2Q9Q B;  1OVV A;  2P7J A;  5L3G B;  3AAA B;  3C1L A;  2FFD B;  4Z90 A;  2OYI A;  2I0M A;  5FVL A;  1GD2 E;  1LNQ A;  5EZY E;  3B5N B;  1N7S A;  4B3M T;  5EFW B;  5LP6 E;  4IL6 E;  1RF1 B;  3CME P;  2DI4 A;  1A02 F;  1J1E B;  4ILU A;  3MD0 A;  2LKM A;  2YIU B;  3V2Q A;  4UVC B;  3JAE A;  2R3C A;  2NP9 A;  3U78 A;  2LOS A;  4YTP A;  4KUM B;  3H1K D;  3F57 A;  3EQ2 A;  2BS2 A;  3OW2 O;  3IF8 B;  5LXT E;  5KAI E;  1FOS E;  2GK9 A;  3X1D A;  2XDJ A;  2KND A;  1EZV D;  5JRC B;  4O2B E;  2NTX A;  5LYJ E;  1ZP0 C;  2UU9 T;  2M5A B;  4HN9 A;  4PW8 A;  2E5V A;  1MFT A;  2NW9 A;  5CA0 E;  4JV5 T;  3II6 A;  3CLQ A;  4EYY R;  1RF0 A;  1PV3 A;  2XND H;  5K5G B;  1XNR T;  2WDR A;  5ABF B;  3RGL A;  1KZU B;  3IHR A;  3H1I E;  1L2P A;  3CCU P;  2ZXX A;  5TJH A;  1YD8 G;  3J9X 1;  1WRG A;  1HWT C;  1YTZ T;  1RE3 A;  3TNU A;  2Q9I A;  1M7K A;  4XZC A;  3UUB A;  1DU2 A;  3PP5 A;  2J59 M;  3TLU A;  2LRL A;  4N3Y B;  3L35 A;  5GTH H;  1NTM D;  3TDK A;  1PGQ A;  3M91 A;  3A7M A;  2LXC B;  2YNY A;  3D6Y A;  4EEB A;  1J1E C;  3ZCJ A;  2FUP A;  1HH0 A;  3V6I A;  3ZST A;  3HUS C;  3L72 E;  4IFD K;  1S2E A;  4NIQ A;  3KZI H;  4G63 A;  3GF7 A;  2JIW A;  4U3F J;  2V7I A;  2J5U A;  4KHP T;  1VL2 A;  3RK2 D;  1M1K Q;  3PUZ F;  4IE6 A;  1LTJ C;  4EDF A;  1YIT P;  4NXM T;  2YKS A;  3C9I A;  3CVR A;  1GZL A;  3AE1 A;  1IBM T;  2D2C C;  2K24 A;  3UUM A;  2NPS B;  4C46 A;  3ESL A;  2VL0 A;  3O1I A;  5GON E;  2KOG A;  2LR2 A;  1NTK G;  3ABV A;  2LKH A;  2XQ8 A;  1WCR A;  1LT1 A;  5CCG A;  1OZH A;  4LC1 A;  3PUW F;  3RX6 A;  4PD4 H;  5DQW A;  1WMK A;  3RBX A;  3ZN1 B;  4IE7 A;  1QVG O;  1UUR A;  1VCT A;  2KIN B;  5LHH B;  1NU1 D;  2V7L A;  4I6M C;  1WLX A;  2Z4E A;  5CGM A;  1M62 A;  3LJC A;  3VR9 A;  3AVR A;  3H1K G;  3CWB D;  3O4X E;  2XQY A;  5L3F B;  4JPZ B;  2LRK A;  4LGD E;  4IE5 A;  1SQP D;  2J62 A;  3EI0 A;  4U3F D;  4AKI A;  2CXL A;  2FYU D;  1D7M A;  2VQE T;  1VQ4 P;  2CMR A;  1J1D B;  3B57 A;  2W8Z A;  4BRY A;  2D2C B;  2PG8 A;  1GK4 A;  5CJ0 A;  1EZV E;  5FXW A;  2PFX A;  1L0L G;  1KNR A;  3RH3 A;  2IML A;  2V6Y B;  3OBV E;  1VQM P;  1FIO A;  4CI3 B;  2B87 A;  1ZR4 A;  1U57 A;  2O1K A;  5FKY A;  4D6T G;  4IE0 A;  3ZCI A;  4H44 D;  3CX5 H;  3PUV F;  1KYO H;  1JNZ A;  3H1I J;  2ZMA A;  3WUT A;  1DEB A;  4QH4 A;  5FMN A;  3BK9 A;  3H32 A;  3L39 A;  5CJ4 A;  4OK0 A;  4ZI3 D;  4JYB A;  1N7L A;  2HOD A;  5CCH C;  3FWN A;  4JI4 T;  1U5P A;  5FVK A;  3RIF A;  1NKN A;  2YMK A;  3AEB C;  3VP8 A;  2W67 A;  4YTM A;  3RC3 A;  3VP9 A;  1FJP A;  4ILA A;  2KT9 A;  3H1L E;  4OH8 B;  5JR9 C;  2P1J A;  1KC8 Q;  3NMD A;  3RC8 A;  3OJA B;  1JNR A;  1KQF B;  2DLR A;  1T3J A;  5L47 A;  3SFD C;  1VCS A;  4AQG A;  1YI2 P;  1SE7 A;  4OVN F;  2C5K T;  2JQH A;  1JMM A;  3PLN A;  4DV2 T;  2UXN B;  4Y99 B;  3LSV A;  2QJY C;  3UQ4 A;  5APQ A;  2KZJ A;  3UFE A;  3W68 A;  4B3T T;  4W7Y A;  4DV3 T;  3H1J D;  5FXX A;  5HXR A;  1OED C;  3P8M C;  2ES0 A;  4X66 T;  3PH0 A;  1PZQ A;  3KPE A;  2KYV A;  3HRN A;  5F3J A;  1RQV A;  2ZYD A;  1SHZ C;  2QGS A;  3H1J E;  2E74 C;  4DOJ A;  5FXV A;  2UUA T;  5HCJ A;  1SP4 A;  1X0T A;  5H6Q B;  2YIN A;  3AA0 B;  4H9R C;  3RYC E;  4Q25 A;  1NU1 J;  1IJ6 A;  1D0Y A;  4H0L B;  4D6T D;  5AVR B;  2YEV C;  1JEK A;  2Y0E A;  4O9B A;  3B71 A;  4XA4 A;  3OYX A;  3HA4 A;  3O8Z A;  1KQL A;  5AW0 B;  4LF9 T;  3RK2 B;  2LM9 A;  4YTN A;  1IFM A;  4KT0 J;  1LWU C;  3VMZ A;  4LF7 T;  2QJK B;  4WBA A;  2E9X A;  2G8Y A;  3DTO A;  1RE4 A;  3MIW A;  1ZR2 A;  5L3D B;  1Q82 Q;  4I50 E;  4UB8 E;  2FXO A;  3NBX X;  1QGK B;  1ZHC A;  3AE5 C;  2JJ9 A;  2X9W A;  5KLV J;  3KYQ A;  4ZI3 C;  3BCC D;  3KV9 A;  3R6N A;  2MPK A;  2I1J A;  1N7S B;  1GQE A;  1WR0 A;  1UK5 A;  1JUN A;  4COF A;  4ZZB A;  1HS7 A;  1FBM A;  3TYY A;  2I8D A;  4AKR B;  2D9D A;  3GN5 A;  5JRE A;  4XBF B;  3TF5 A;  4ZS2 A;  1NTZ E;  2KP8 A;  5LMU T;  1QSD A;  4YXW H;  2XZE A;  5LHI B;  2PP6 A;  1L0N E;  1VQL P;  4MBQ A;  3H1J G;  3CI9 A;  3BRT B;  2KMF A;  3RQU A;  2D2C D;  2M3B A;  4ZI2 D;  1BDC A;  3L73 E;  3VOP A;  3SFE A;  3K1S A;  3WUV A;  5B5E E;  3D71 A;  2A45 H;  2NWB A;  2XM2 A;  2KZ7 B;  1SQP E;  2C5I T;  4H63 V;  5ABE A;  1ZP0 A;  3I9Y A;  4GT1 A;  4HE8 A;  1S94 A;  5APV A;  2WVR A;  3RK3 C;  2AEJ A;  1W2E A;  3HKC E;  1CHU A;  1R8E A;  5ABG A;  3KDS E;  1FZE A;  2WSS H;  2VKO A;  1K9M Q;  3KHU A;  3K3Q C;  3QOF A;  1JM0 A;  5KKZ B;  2E42 A;  1E5W A;  2A06 D;  2E75 D;  2E5T A;  4CXY A;  1XMQ T;  3A2A A;  1DIP A;  1L4A C;  2WPR A;  1N73 C;  4O4L E;  5HEG A;  3MXZ A;  2CPS A;  4I2L C;  1JOC A;  2X9X A;  3CIR A;  2X9Y A;  4AI6 A;  1SQB E;  5APS A;  3OYZ A;  1KIL D;  3GWH A;  2XQ4 A;  3HR0 A;  2IZ1 A;  3C4W A;  4X1K E;  1LJ2 A;  3D0T A;  3AE4 C;  5ETW A;  3VMA A;  1I6Z A;  4LFC T;  3QB5 A;  4ILC A;  3GG2 A;  2OYO A;  2D0U A;  3KFW X;  4I55 E;  2J1D G;  3HUS A;  2BKN A;  2Y0D A;  3U1C A;  4WY4 D;  1DX7 A;  1M1J C;  1L0V A;  1UUS A;  1VQ9 P;  4HEA A;  2QIW A;  1JY2 N;  3N9L A;  3HTK B;  1NGM B;  1EDK A;  4A97 A;  1XZY A;  4M1P A;  4YHJ A;  3ZMU B;  2WM9 A;  2BZB A;  3L72 G;  5J2U E;  3ZLI A;  4YJ2 E;  2GM4 A;  3HE4 A;  4LF5 T;  1YJN P;  1WR6 A;  2HH7 A;  5F5W A;  5LCY A;  5GTH E;  3U3I A;  4DT0 A;  2ZJS E;  4PD4 D;  4DR2 T;  3CPW O;  4QXB B;  4ZHQ E;  2CLY B;  4UB8 H;  1YKE B;  1ZXG A;  2XY8 B;  1W5C E;  2NW7 A;  4NPD A;  2I59 A;  4GYR A;  1QLE D;  1EXI A;  4MHC A;  2H43 A;  2E5L T;  5C39 A;  4IL6 X;  4QX8 B;  3RBZ A;  3ITK A;  1KFM A;  4TWH A;  1JY2 P;  4PAG A;  4PNI A;  4WYV A;  3OVU A;  5AW8 B;  3HE5 B;  1JY3 O;  2WMO A;  3BQI A;  4WWI A;  1BR0 A;  3H1K E;  3IA3 A;  3N2G E;  2MTQ A;  4W7Z A;  2FJE A;  4GK0 E;  5L3E B;  5BR8 T;  2DW3 A;  2ZFC A;  3EAM A;  1AA0 A;  4H9O C;  3ZYL A;  3PU3 A;  2OYH A;  2UUC T;  3P32 A;  4QH5 A;  3Q5D A;  3P4Q A;  1SA0 E;  1BR4 A;  3AEA C;  2K37 A;  4H9P C;  1M1J B;  3CWZ B;  3PJA A;  4HFV A;  1HF9 A;  4QH1 A;  2O3J A;  2W27 A;  2R5D A;  5CFB A;  4EOT A;  4J2C A;  1LTT C;  5LB7 B;  4ZNC A;  1NU1 G;  3CC2 P;  2L8K A;  3AE3 A;  3VU7 H;  2VKH A;  1BGY E;  4PD4 I;  1KN7 A;  2W6A A;  2W00 A;  2JRK A;  5HEJ A;  2FXM A;  3Q2Y A;  1W0B A;  4UVA B;  1NTK D;  4L5G A;  4DV4 T;  3T1H T;  3AB3 B;  3AEB A;  1S5L E;  4IFM A;  4AIU A;  4JUY A;  4IL6 H;  3MKD A;  2K9J A;  4C7N A;  1KD1 Q;  1BCC D;  3Q5X A;  2W63 A;  2WMN A;  1KYO D;  3H1L J;  2KLQ A;  3ZT5 A;  4PJ0 E;  2WT7 A;  1BCC J;  3ZN0 B;  5ADX L;  1LP1 B;  2RN0 A;  1M56 D;  2OV9 A;  3MK7 C;  2XAF B;  3M3Z B;  3PUX F;  1YYC A;  4PJM A;  1XDP A;  2FYZ A;  3BVH A;  4Z91 A;  2YKO A;  3S4R A;  5EK3 A;  1Y9B A;  3L70 D;  3U1A A;  2Z5I A;  3C4Z A;  1SQQ E;  1X8Y A;  4EAH A;  1SQP K;  1LT9 C;  2YU1 A;  3N9O A;  3AE2 C;  1SQX D;  1T8Z A;  4N78 E;  4UF0 B;  4JI2 T;  4DBQ A;  3JCU H;  4JEH B;  3I55 P;  3TGU G;  2OA5 A;  3FZM B;  3NRY A;  3BQK A;  2OLT A;  2XKM A;  3CWB G;  3RK3 E;  3N9Q A;  1VQ5 P;  2IYO A;  1E2A A;  2FYN B;  1X79 A;  2A2F X;  2A45 I;  2C0X A;  3VMY A;  1IFJ A;  2CE7 A;  1JB0 J;  1IAP A;  1IK7 A;  4AQR D;  2QYW A;  2KNC A;  4QHO A;  1FZC B;  1HTJ F;  4LMJ A;  3ZEF B;  4WBN E;  1NTZ G;  2JJL A;  4E7Z A;  2CPB A;  3O6Q B;  4HFI A;  4PK5 A;  2E5Y A;  4PV1 C;  3T97 A;  2EHO D;  4A5X A;  1WYB A;  1JMB A;  1IBK T;  4JI8 T;  2WS3 A;  1LWU A;  1GL2 B;  1Q2N A;  2H3R A;  2Y0C A;  3O1J A;  1M90 Q;  2E75 B;  1FJK A;  2CBJ A;  2IW5 B;  3MZW B;  2WT7 B;  3S9O A;  4X64 T;  2M5A A;  2P58 A;  4G2A A;  4U7Y A;  5KAF H;  2Z5H A;  3OAK A;  4JBZ A;  2V6X A;  1IJ5 A;  1HCI A;  3AE5 A;  4AYC A;  2V8S V;  3DP7 A;  5ABF A;  1L0N G;  1SFC C;  2RMZ A;  1AVY A;  2BS3 A;  5JVD E;  3TGU E;  5KMG P;  4ZKP A;  3BAS A;  2CK3 H;  2KB7 P;  3CMA P;  4YT0 A;  2YXQ B;  1H0T A;  5CJ5 A;  4PFP A;  5AQT B;  3K3N A;  3VR8 A;  5H2F E;  3AE8 C;  1U4Q A;  3KBU A;  2OAR A;  2CXD A;  4ADZ A;  4KX6 A;  4YSY A;  4GIF A;  2IX7 C;  2LE8 A;  1VQ7 P;  3A5T A;  2D5U A;  3AEG A;  4DV6 T;  4TT3 H;  3FZL B;  3JCF A;  2UXB T;  3FZF B;  2C0W A;  1IO4 A;  3SFE C;  1Y8A A;  4U3C A;  4A56 A;  1N34 T;  3L74 J;  2DWG A;  1YQ4 A;  1VQK P;  1SQP J;  2WSC J;  2Z6E A;  3UU3 A;  2E75 C;  3AE6 C;  3UU8 A;  5IUX A;  2KIK A;  2QE7 H;  2KXP B;  4DR5 T;  2MBG A;  4KP3 C;  5CMZ A;  2FFD A;  1FE6 A;  1Z8U A;  2N1G A;  2BBH A;  5HEH A;  2VVN A;  2J47 A;  2OTL P;  1L4A A;  1YJ9 P;  2X0L B;  5AQU B;  1MMN A;  3K3O A;  1G8X A;  4HWH A;  1H8A A;  3N5L A;  1OFC X;  3SOL A;  3MZK B;  2Y8D A;  3L72 J;  5APU A;  2PGD A;  3ZYK A;  4WB4 A;  3AAE B;  3AE4 A;  1SQV G;  4H0L D;  2NOX A;  2X0H A;  4UV9 B;  2UXC T;  2Q3E A;  3TLT A;  4CXX A;  2A06 E;  4U7J A;  2LSJ A;  2P2U A;  3HE4 B;  4HJG H;  4JI7 T;  5FP3 A;  2ZYG A;  3CX5 I;  3M65 A;  4HB1 A;  4L73 A;  3GMI A;  5L4E A;  4WBO A;  3F31 A;  5E79 E;  4CQI A;  5LHG B;  2YO2 A;  3LFM A;  3G06 A;  1URQ A;  5KLV E;  1JTH B;  4DID B;  3TNU B;  2KSE A;  5LGU B;  3SRZ A;  3R2P A;  1S35 A;  3L73 D;  1K8A Q;  3S1K A;  4UVB B;  4P0A A;  4O4I E;  1PPJ G;  5DJT B;  3UTK A;  1XMO T;  1YTZ I;  2HYN A;  2EHO B;  1NO4 A;  3AEE A;  4A98 A;  3TGU D;  3VRA A;  3H25 A;  4PJL A;  2JMK A;  3VHL A;  2WAU A;  4UEM A;  1OED B;  1RF1 A;  2H7O A;  3NXS A;  1UGO A;  5KAF E;  2EHO A;  1ZOY C;  3JAD A;  3RIU A;  3CCL P;  3IR9 A;  1P84 I;  1K05 A;  2WSE J;  1AV1 A;  2BG9 A;  4FJO A;  2FBW C;  4DV7 T;  4DBR A;  3MP7 B;  4JF7 A;  1FZG A;  4HFE A;  1ZRT D;  2OYH B;  2F4V T;  3WU2 E;  4ZZC A;  4ZMD A;  1B7T A;  1MIY A;  1YJW P;  4U3F G;  4I0U A;  4BJM A;  1HVV A;  1HX1 B;  2Q1K A;  4EYY Q;  1GL2 D;  3VTP C;  3V4W A;  1EC5 A;  5HWY A;  2CWY A;  2E9X D;  4IST A;  3NVO A;  1HFA A;  5BU5 A;  5JTG A;  4IGU A;  3HTK A;  1OVR A;  2ACX A;  3Q1M A;  2FJA A;  2OYI C;  2B89 A;  4ANJ A;  3UQ7 A;  3PJS K;  1HG5 A;  1G1J A;  4OX9 T;  2LSY A;  2XV5 A;  4WVZ A;  2X66 A;  3K5B A;  2VK9 A;  4AIS A;  4JEU B;  5IYZ E;  4P1N A;  3VKG A;  4O4H E;  3SSU A;  3L71 D;  4I1L A;  2J58 A;  4W80 A;  4D6T E;  2Q3I A;  5HCM A;  4ZXL A;  5DJU B;  1FS0 E;  1SUM B;  4EB6 E;  3RPU A;  1GU5 A;  4X1I E;  3A0H H;  1PP9 D;  2KWI B;  1P84 E;  4HFC A;  5HEU A;  1R5L A;  2E8I A;  4FI5 A;  1D1A A;  4PFO A;  3FXE A;  3EAB A;  1W09 A;  3LID A;  4K3A A;  2OGU A;  1LKX A;  5ABH A;  2YK0 A;  1IC2 A;  1EDJ A;  1ZV4 X;  1M57 D;  5KAI H;  5CCH D;  2CXF A;  1D1C A;  1JCD A;  4UB6 H;  2Q9Q C;  3ZKR A;  1KB9 I;  3LW5 J;  5FL1 A;  2LSI A;  1J1D C;  1LTS C;  3FXD A;  4IL9 A;  3ETV A;  2HOD B;  1BE3 D;  3B5N D;  4GOD A;  4ERR A;  5IWA T;  3FBL A;  1RE3 C;  2YXR B;  3QK6 A;  2KNC B;  4JI5 T;  1SQV E;  1OMI A;  3L73 G;  3Q5R A;  1VF5 D;  3D70 A;  1G2C B;  1MMA A;  5LGN B;  3M9B A;  1NKZ B;  3A0B E;  3RYI E;  1J2J B;  4MAL A;  5C2T A;  5LJM A;  1Q86 Q;  2BG9 E;  1FZC A;  3CX7 B;  3RLF F;  3CXH E;  3MA9 A;  2FYU J;  3UUL A;  1S4X A;  3CK6 A;  5E79 H;  3SWF A;  1YW0 A;  2R32 A;  4H9Q C;  5BU8 B;  3EDV A;  2PRR A;  5AW6 B;  4DJG A;  3QNU A;  4YXD C;  1MIV A;  2P67 A;  3PTZ A;  4OGQ B;  2QJP C;  4P0B A;  1DEE G;  4MFR A;  2IZ0 A;  1YHQ P;  3L3P A;  1SQP G;  3FGA D;  4O8S A;  2A72 A;  1BSN A;  2SPZ A;  1RQU A;  3O9X A;  5C3J A;  2FXP A;  3KZI E;  2QRX A;  2CA5 A;  3ABV C;  3IN6 A;  2A9U A;  3S4U A;  3C64 A;  4H9S E;  1NTK K;  3TKL B;  3CX5 E;  4IDO A;  2HHH T;  5AQI B;  3RI5 A;  4EOZ B;  1KNZ A;  3EUH A;  3LW5 H;  4Z8X A;  5FYM A;  3VMX A;  1USD A;  1J1J A;  1FMW A;  3VYI A;  3Q5P A;  4LF8 T;  1FZA A;  2XQ9 A;  3NZP A;  3H1I G;  1X79 B;  1LTB C;  1R5S A;  1KIL C;  4GOE A;  5CA1 E;  1T2K C;  2MAW A;  1QVF O;  2OYI B;  3V2N A;  1G1I A;  1J5W A;  2R6G F;  2XUE A;  3JC6 C;  2BCC J;  3AE7 A;  3Q5E A;  4UIG A;  3CCR P;  4DMW A;  5JDQ A;  2CBI A;  1URQ B;  1BCC G;  3AEG C;  5CBN A;  4ZI7 E;  1VQP P;  1VDF A;  3ANW A;  3C4X A;  2N1T B;  4EXT A;  5F8P A;  2PJQ A;  3CXH I;  4QXH B;  5HXH A;  3E7K A;  4OGQ D;  2WZI A;  3A5X A;  5JR9 B;  2ZLY A;  4HYT B;  1MMD A;  3MAC A;  5LA6 E;  1I94 T;  3SWY A;  1VQ8 P;  3L37 A;  1BR1 A;  2QJY B;  4C90 A;  3G4S P;  1AQ5 A;  1CSB A;  4IE4 A;  3N4X A;  1PP9 J;  3L70 E;  1U7M A;  2G3A A;  3UUX B;  1QUU A;  3B8E B;  1H7C A;  2WSS V;  3CCQ P;  5H6R B;  3V2P A;  2G0U A;  5CCH A;  4TZ4 C;  5L2L A;  2FFD C;  3CCV P;  4HTE A;  2W2U A;  4IDZ A;  4PK4 A;  1WRD A;  3AA7 B;  2VL8 A;  1SVF A;  2Y48 B;  3GN5 B;  2IBZ D;  3CCM P;  1NJI Q;  2YDS A;  4TLF A;  2JMH A;  4DR6 T;  2NW8 A;  2LHR A;  1BSH A;  3C50 A;  2VWA A;  1NTK E;  2I1K A;  2IC9 A;  2QA7 A;  3F89 A;  2W62 A;  2WB5 A;  2P9B A;  1VOM A;  3H3M A;  3A0B H;  2XU6 A;  4EYU A;  2H8P D;  5LG3 A;  1BGY D;  2CEA A;  3RRC A;  1YKH B;  3VN0 A;  3GHG A;  4U2Z A;  2BBJ A;  2V7K A;  1IFI A;  1LT9 B;  3MUD A;  2RP4 A;  3ONL C;  4RJT A;  2BCC D;  4Z1M H;  2LT3 A;  2LJL A;  1UX5 A;  4WNK A;  3H1L G;  2H7H A;  1OED A;  1HNZ T;  5AQM B;  1K73 Q;  4KMC A;  5AQS B;  3IBP A;  5AVY B;  5EK4 A;  3CCE P;  1K04 A;  3CQC B;  3ZMV B;  1VF5 C;  4U74 A;  1FDM A;  2MYS A;  1L0N D;  5B66 H;  2B76 A;  3IFM A;  2C9L Y;  4CN4 A;  2BG9 B;  5J2T E;  4ZKU A;  1MND A;  5EK2 A;  1T6A A;  4ASV A;  1T72 A;  3HL6 A;  3GF3 A;  1HGZ A;  1MV8 A;  2ODV A;  5AW9 B;  5HXC A;  3VRB A;  1RY3 A;  4DCK A;  1OW6 A;  3AED C;  2M0B A;  5IHY A;  1D1B A;  3R4Y A;  1N32 T;  3ZMS B;  4BJN A;  4JYA T;  1N7S D;  2QM7 A;  3CWB J;  1S9K E;  1KIL B;  5AVQ B;  1Q90 D;  1MFZ A;  3WI3 A;  4IL4 A;  5CB4 E;  2XAQ B;  4K0K T;  2N9B A;  4KBM B;  3WAJ A;  4DV0 T;  5AQQ B;  1KK7 A;  2E9X C;  2FBW A;  3V5U A;  3QC9 A;  1RE4 C;  3H6P A;  5J1G A;  5KLV D;  5L4H A;  2WMM A;  2V7Q H;  5HXE A;  3CQG B;  4IIJ E;  5HYA A;  2BCC E;  4TNW A;  4LML A;  5APW A;  2XAG B;  3L09 A;  1WFD A;  2QG4 A;  1NYH A;  2W90 A;  2IUB A;  3A3Y B;  3KV6 A;  2CHN A;  2WDQ A;  2UXX B;  1CZQ A;  3IF4 A;  3RYH E;  3FHN A;  1MKM A;  3TLW A;  3Q3D A;  3L74 D;  2FY8 A;  2LSK A;  4C7N B;  1YQ3 A;  2KS1 B;  3B4S A;  3ZMZ B;  1JY3 N;  4CI2 B;  3UUN A;  5FY7 A;  1L0L J;  3P4P A;  3CL3 D;  2LEH A;  4KI0 F;  1SQX E;  4N78 D;  3PUR A;  1RHZ B;  1EDI A;  3N7N A;  3LBX B;  2WWW A;  5AFU L;  2XNX A;  3CKD A; 
#chains in the Genus database with same CATH homology
 3LIE A;  3B57 A;  3HE5 A;  2OAR A;  2CXD A;  4UEL A;  4ADZ A;  4GIF A;  2IX7 C;  2LE8 A;  3A5T A;  2D5U A;  1GK4 A;  2E43 A;  2PG8 A;  1T98 A;  5CJ0 A;  5KJ7 D;  4AKH A;  5FXW A;  2OYH C;  3AAI A;  3QUJ A;  5JR9 C;  2C0W A;  3RH3 A;  4EXT A;  1IO4 A;  2D2S A;  1VRB A;  2VKJ A;  3OBV E;  1FIO A;  2CWO A;  4CI3 B;  1N7S C;  5AVT B;  1ZR4 A;  4A56 A;  2X51 A;  4N6J A;  2DWG A;  2N9D A;  4CI1 B;  2O1K A;  1HX8 A;  2POH A;  1PFI A;  3FXD B;  4IE0 A;  2ZM2 A;  3ZPO A;  2WZ7 A;  3ZCI A;  2Z6E A;  4UVA B;  2DHR A;  5JDM A;  2ZMA A;  3RRW A;  1DEB A;  5KTB A;  5FMN A;  3BK9 A;  4B6X A;  3H32 A;  2NPS D;  2WSF H;  1LGH B;  5CJ4 A;  4WY4 A;  4OK0 A;  1WT6 A;  2WIT A;  2KXP B;  4L9I A;  2XAS B;  4H63 H;  4ZI3 D;  3P8C E;  4JYB A;  2Q9Q A;  1N7L A;  3I0Q A;  4YFS A;  2MBG A;  2HOD A;  5CCH C;  2L5G B;  4KP3 C;  1HGV A;  4HH2 A;  1GL2 A;  5CMZ A;  3RK3 B;  2FFD A;  1U5P A;  4O2A E;  5KLV K;  2QM8 A;  2N1G A;  3PTR B;  1NKN A;  2PFV A;  4TV8 E;  4IHJ E;  1LVF A;  2HG5 D;  2WSC H;  4NUV A;  1RF0 C;  3VP8 A;  1WYC A;  1HUC A;  1L4A A;  3CML A;  1N73 A;  4DND A;  1Y64 B;  1GTW A;  3VP9 A;  1FJP A;  2XTL A;  3RC3 A;  4I4T E;  2Q7C A;  5APY A;  2W61 A;  5AVX B;  2KT9 A;  2X0L B;  1OXZ A;  3HUS B;  1MMN A;  4OH8 B;  4UV8 B;  4UXN B;  3K3O A;  3M0A A;  1G8X A;  2P1J A;  1H8A A;  1ZKE A;  1LWU B;  3NMD A;  2M67 A;  2MOZ A;  3N5L A;  5BMV E;  3SOL A;  3RC8 A;  3OJA B;  1GK6 A;  2WBL A;  2Y8D A;  3MZK B;  5APU A;  2DLR A;  5JDH A;  4DVD A;  1SQB K;  1T3J A;  1IJD B;  3ANW B;  3KVB A;  3ZYK A;  2NPS A;  2HPL A;  1FZC C;  4WB4 A;  3AAE B;  3C51 A;  1ZLL A;  4AQG A;  5BVZ A;  5LJN A;  2C5K T;  2ZM0 A;  1JMM A;  2NOX A;  3HI2 A;  1ZV8 A;  2W6B A;  4DO0 A;  2X67 A;  4UV9 B;  5CA0 E;  2JEE A;  3V2R A;  4Y99 B;  5CHX A;  2UXN B;  2LOP A;  4KHX A;  4CXX A;  5APQ A;  1T2K D;  3UFE A;  3H3A A;  1IZN B;  2LSJ A;  2P2U A;  3HE4 B;  4XAX B;  5FY1 A;  4W7Y A;  2X9H A;  2WPS A;  5HAX A;  5FP3 A;  1LT9 A;  5AW4 B;  5FXX A;  5HXR A;  5JDL A;  2HFE D;  1SQX K;  3P8M C;  1EQ7 A;  1SQV K;  5L3B B;  3M65 A;  4H9P C;  2ES0 A;  4CXW A;  4PK6 A;  2H7V C;  1D0Z A;  3KPE A;  3MGN A;  2V7M A;  2KYV A;  3HRN A;  5F3J A;  1JY3 P;  2GUV A;  1SHZ C;  2QGS A;  3GMI A;  4QX7 B;  3RYF E;  3I1A A;  4WBO A;  3F31 A;  3UIA A;  1JO5 A;  4CQI A;  5LHG B;  2HLO A;  2RA1 A;  3ZC0 A;  4DOJ A;  2PAJ A;  5AW3 B;  1BR2 A;  5FXV A;  2YO2 A;  3LFM A;  3E22 E;  1URQ A;  5LGU B;  1JTH B;  3TNU B;  1SP4 A;  3SRZ A;  3ETU A;  3R2P A;  3RL0 C;  5H6Q B;  2YIN A;  2K48 A;  3AA0 B;  1S35 A;  4H9R C;  3RYC E;  4EZ4 A;  4UVB B;  3RRC A;  3V5S A;  4TV9 E;  4O4I E;  2C0S A;  3KVA A;  3UTK A;  4P0A A;  1LTJ A;  1YTZ I;  2HYN A;  3PUG A;  1H89 A;  1NO4 A;  2EHO B;  4L0R A;  1IJ6 A;  1D0Y A;  3VKH A;  1NAF A;  1GDT A;  1E1H B;  2WWU A;  4PJL A;  2ODU A;  2JMK A;  3VHL A;  2WAU A;  1XTG B;  5AVR B;  2YEV C;  4UEM A;  3OKQ A;  1RF1 A;  4O9B A;  1FU1 A;  4XA4 A;  2WSE H;  3TK1 A;  2H7O A;  3NXS A;  3OYX A;  3MJX A;  4ZOL E;  4AKL A;  3HA4 A;  4XE5 B;  3O8Z A;  2BDE A;  3I5C A;  2N1T C;  2FKW B;  1KQL A;  5AW0 B;  3TSI A;  3RK2 B;  1LVK A;  2EHO A;  2KWH A;  5KJ7 C;  1MNE A;  2LM9 A;  3I0O A;  3ZJ2 A;  4GYS A;  4B86 A;  1IFM A;  3IR9 A;  1LWU C;  3VMZ A;  5FY0 A;  3V4Q A;  5CCG C;  4C7R A;  1VPC A;  4WBA A;  2E9X A;  2K5B B;  3DTO A;  1RE4 A;  3PDY A;  4FJO A;  3ONX A;  5AVW B;  2Q5U A;  3MIW A;  4JF7 A;  1ZR2 A;  1FZG A;  1MUU A;  2CCQ A;  4DBR A;  5L3D B;  5E0O A;  3HD7 D;  2LHN A;  2OYH B;  1MIW A;  4QKN A;  1B7T A;  3RK3 D;  1MIY A;  1KIL A;  2N1T D;  4I50 E;  4TN7 B;  4BJM A;  1NU1 K;  1HVV A;  3B5N A;  2GUS A;  4YJ3 E;  1GL2 D;  2O01 H;  3VTP C;  3M9H A;  5AW2 B;  3V4W A;  2JQQ A;  3NBX X;  2V26 A;  1ZHC A;  1QL2 A;  5HWY A;  2JJ9 A;  4ZS3 A;  2VRS A;  2CWY A;  2E9X D;  2X9W A;  4IST A;  1FZF A;  1SFC A;  3EFG A;  3KYQ A;  2XAH B;  1HFA A;  5BU5 A;  3HKD E;  1O3X A;  4O4J E;  3KV9 A;  4ZI3 C;  3R6N A;  4IGU A;  2I1J A;  3HTK A;  1FEW A;  1LRZ A;  3DJB A;  1N7S B;  2ACX A;  3NRX A;  2K9A A;  5A1L A;  1LTI C;  1JNM A;  5HXS A;  2OYI C;  5LGT B;  3RL0 D;  1JUN A;  2C5J A;  1T3U A;  1FBM A;  1CUN A;  4ANJ A;  3TYY A;  1HS7 A;  1HG5 A;  1G1J A;  2FYU K;  3GN5 A;  1DH3 A;  4NUU A;  4AKR B;  5JRE A;  2IPP A;  1SFC B;  1CW5 A;  2XV5 A;  2KP8 A;  2LSY A;  4QXC B;  4ZS2 A;  2LSG A;  2X66 A;  1MZ9 A;  1QSD A;  2VK9 A;  2Y6X A;  2BVM A;  4JEU B;  5IYZ E;  5KX5 E;  3GHG B;  5AW5 B;  5HWX A;  5LHI B;  3VKG A;  2PP6 A;  4O4H E;  5AW1 B;  3KQG A;  1GU4 A;  1AFO A;  2PBI A;  3LBX A;  4MBQ A;  4I1L A;  2J58 A;  3CI9 A;  4W80 A;  3W15 B;  1CI6 A;  2IFM A;  2Q3I A;  3BRT B;  2KMF A;  3BRV B;  3ZJ1 A;  2JPF A;  3PE0 A;  4EB6 E;  2M3B A;  4ZI2 D;  3RPU A;  3VOP A;  2HPJ A;  1GU5 A;  4X1I E;  2KWI B;  3M9Q A;  3R84 B;  2A45 H;  1UX4 A;  2NWB A;  4UF0 A;  4AXP A;  2E8I A;  2KZ7 B;  2WTY A;  2SPC A;  2VB6 A;  3LK3 B;  2C5I T;  4CZZ B;  4FI5 A;  1D1A A;  3PUS A;  4GOU A;  4H63 V;  4PFO A;  2VKD A;  1EZ3 A;  4K0U A;  1MMG A;  3I9Y A;  3CKD A;  5DAB A;  4GK5 E;  3LID A;  4GT1 A;  4HE8 A;  1LKX A;  4M3L A;  1S94 A;  4ILU A;  5APV A;  3RK3 C;  2L9Q A;  1IC2 A;  2YK0 A;  1ZV4 X;  5LNK A;  1W2E A;  2CLY C;  1IK9 A;  3L4F A;  3HKC E;  1UCU A;  5CCH D;  3IEE A;  2CXF A;  1D1C A;  1JCD A;  1FZB A;  3KDS E;  2Q9Q C;  1HG2 A;  3Q9D A;  2IFN A;  1FZE A;  2LSI A;  1J1D C;  1GL2 C;  1LTS C;  4AUW A;  3U59 A;  1LTA C;  2DCF A;  2VKO A;  3B13 A;  3EDU A;  3K3Q C;  2E42 A;  1E5W A;  3ETV A;  3ZYM A;  2HOD B;  3B5N D;  3LK2 B;  4ERR A;  4V1A v;  4CXY A;  1OWA A;  3CX8 B;  3A2A A;  3A7O A;  3FBL A;  1L4A C;  2WPR A;  1N73 C;  1RE3 C;  4O4L E;  3QK6 A;  4PJM A;  3O1H A;  3MXZ A;  3GHG C;  4QWN B;  2CPS A;  4I2L C;  2ZM8 A;  1JOC A;  2X9X A;  2Q9Q D;  1N73 B;  1G2C B;  1S9K D;  2X9Y A;  4WW0 A;  5JR9 A;  5L3C B;  1FAV A;  5APS A;  2A45 G;  4AI6 A;  3ZC1 A;  1MMA A;  1ZEE A;  3OYZ A;  5LGN B;  1KIL D;  3M9B A;  3GWH A;  4OFZ A;  1NKZ B;  3T8O A;  3RYI E;  3HR0 A;  1J2J B;  4MAL A;  2NPS C;  5LJM A;  5KDM C;  3C4W A;  3E1I A;  4X1K E;  1SLQ A;  1FZC A;  3HKE E;  5ETW A;  3D0T A;  3CX7 B;  3MA9 A;  3Q2M A;  2D0U A;  3KFW X;  3KDP B;  4LLH A;  1HF8 A;  3Q5W A;  4I55 E;  4XBF B;  2J1D G;  3G3Z A;  3HUS A;  4U72 A;  3UUL A;  4MLK A;  5J2U E;  2D0T A;  3U1C A;  3KV5 A;  3SWF A;  1GW3 A;  1YW0 A;  3CX6 B;  2R32 A;  1L4A B;  4WY4 D;  1H88 A;  1M1J C;  5BU8 B;  1DX7 A;  1HJB A;  4H9Q C;  3P8C D;  3EDV A;  2BAS A;  5AW6 B;  2V7J A;  1CI6 B;  3HD7 A;  4BA9 A;  5JDG A;  2N2N A;  2C9N Y;  1NTZ K;  2YKP A;  1MIV A;  3LK4 2;  2P67 A;  3OJA A;  4HEA A;  4P0B A;  4OYK A;  4MFR A;  4E7S A;  1JY2 N;  3FBZ A;  1N2D C;  3N9L A;  3HTK B;  1GW4 A;  1XTC C;  1G73 A;  3L3P A;  3NFQ A;  4O8S A;  4M1P A;  4YHJ A;  2A72 A;  3SS1 A;  3ZMU B;  4AQF C;  1URQ C;  2XHE B;  3O9X A;  2R5B A;  2WM9 A;  1Z56 A;  5FXZ A;  2BZB A;  1URQ D;  4DZO A;  2W0G A;  3N9M A;  3ZLI A;  4F6R C;  4I43 B;  3CPZ A;  5C8Y E;  4YJ2 E;  2GM4 A;  3OA7 A;  3ZMT B;  1JTH A;  2CA5 A;  1V9D A;  3HE4 A;  1NHL A;  3BAT A;  3S4U A;  3C64 A;  1M7L A;  1WR6 A;  2HH7 A;  5LCY A;  4H9S E;  3U3I A;  1IFN A;  4P09 A;  3K8P C;  5LG4 A;  1NTK K;  2NTY A;  3TKL B;  4OYJ A;  4DMV A;  4QXB B;  4EOZ B;  4ZHQ E;  1KNZ A;  2CLY B;  2VAS A;  3EUH A;  5AVV B;  3LW5 H;  4H9N C;  4Z8X A;  1YKE B;  5JQG E;  5FYM A;  3WMM 0;  3VMX A;  5FNV E;  2NW7 A;  1ZN5 A;  1LTJ B;  2I59 A;  4PJN A;  4GYR A;  5APX A;  2KSJ A;  1FMW A;  3P7K A;  5AVU B;  3VYI A;  2H43 A;  2DNX A;  3AVS A;  3C98 B;  4MHC A;  1FZA A;  1A02 J;  3M0D C;  4QX8 B;  3AA1 B;  3NZP A;  1X79 B;  5LBQ B;  1KFM A;  1LTB C;  1FOS F;  3KV4 A;  1HBW A;  1JY2 P;  1KIL C;  3AA6 B;  3N2K E;  3PU8 A;  4PAG A;  4PNI A;  2NW9 A;  5AW8 B;  3HE5 B;  1JY3 O;  3RL0 B;  2WMO A;  3BQI A;  3NZQ A;  4TX5 A;  5LBM A;  2DWK A;  5CA1 E;  1T2K C;  1BR0 A;  2OYI B;  2MJZ A;  3V2N A;  1G1I A;  3JC6 C;  3V5B A;  2XUE A;  1Z0P A;  3N2G E;  4UIG A;  2MTQ A;  5JDF A;  3SWH A;  2HPC A;  4DMW A;  5JDQ A;  4W7Z A;  2IAK A;  1URQ B;  4C91 A;  1NWM X;  4GK0 E;  5L3E B;  5LOV E;  2Q9Q B;  4HKA A;  2ZFC A;  1L0L K;  4H9O C;  4ZI7 E;  3ZYL A;  2P7J A;  1VDF A;  5L3G B;  3P7I A;  3PU3 A;  3AAA B;  2FFD B;  2OYH A;  3H32 B;  2OYI A;  3P32 A;  3ANW A;  3C4X A;  2N1T B;  1GD2 E;  2HPC B;  5EZY E;  3B5N B;  1N7S A;  1BR4 A;  1SA0 E;  2PJQ A;  3E08 A;  4QXH B;  5F8P A;  1JCC A;  5HXH A;  3A5X A;  1G2C A;  5JR9 B;  5LP6 E;  2ZLY A;  4HYT B;  1RF1 B;  2DI4 A;  1MMD A;  1L0N K;  1IFD A;  1A02 F;  1J1E B;  3KIN B;  3MAC A;  3MD0 A;  2LKM A;  1M1J B;  3L37 A;  3SWY A;  1BR1 A;  3V2Q A;  3CWZ B;  4HFV A;  4UVC B;  2R3C A;  3ZMV B;  4C90 A;  2NP9 A;  3RK2 C;  2W27 A;  2R5D A;  3U78 A;  4WY4 B;  4EOT A;  1AQ5 A;  2BVL A;  1CSB A;  1LTT C;  2LOS A;  4IE4 A;  4J2C A;  4X1Y E;  5LA6 E;  3N4X A;  4KUM B;  3F57 A;  3EQ2 A;  4ISS A;  4IFF A;  3UUX B;  1QUU A;  3B8E B;  4WY4 C;  3IF8 B;  2L8K A;  1H7C A;  5LXT E;  3HKB E;  3VU7 H;  4JYC A;  1FOS E;  2GK9 A;  2VKH A;  2O1J A;  2YU2 A;  5M4Y A;  2WSS V;  5H6R B;  3V2P A;  2XDJ A;  5CCH A;  2G0U A;  2KND A;  4TZ4 C;  2W6A A;  2W00 A;  3JC6 D;  3FB2 A;  4O2B E;  2NTX A;  2FFD C;  5LYJ E;  5L2L A;  2JRK A;  5JRC B;  4HTE A;  4IDZ A;  4HN9 A;  4PW8 A;  2FXM A;  4PK4 A;  1WRD A;  3AA7 B;  2VL8 A;  3II6 A;  1SVF A;  3BQL A;  2Y48 B;  3GN5 B;  3CLQ A;  4L5G A;  5DJQ C;  4EYY R;  3AB3 B;  1RF0 A;  2KLV A;  3PUQ A;  1US7 B;  3FXE B;  4IFM A;  2WPQ A;  2JMH A;  1NWQ A;  3N9N A;  4JUY A;  4PJJ A;  2NW8 A;  3MKD A;  2XAJ B;  1KZU B;  2LHR A;  3KBT A;  4C7N A;  3Q5X A;  5AVS B;  1LTG C;  2W63 A;  2WMN A;  3C50 A;  3IHR A;  2KLQ A;  2VWA A;  2WT7 A;  2I1K A;  2IC9 A;  3ZN0 B;  5APT A;  1JY2 O;  5ADX L;  2QA7 A;  2W62 A;  2P9B A;  1VOM A;  5JDN A;  5J2T E;  3N2O A;  1YD8 G;  2XU6 A;  1WRG A;  4XZC A;  3MK7 C;  2H8P D;  2XAF B;  3J9X 1;  1HWT C;  4EYU A;  1YTZ T;  1RE3 A;  3TNU A;  2Q9I A;  3VN0 A;  1YKH B;  2CEA A;  1YYC A;  3GA8 A;  3PP5 A;  2B1E A;  2FYZ A;  2J59 M;  3GHG A;  3BVH A;  3MTU E;  2YKO A;  2V1D B;  5TAO A;  3J7Y q;  4N3Y B;  2V7K A;  1IFI A;  4X20 E;  1LT9 B;  1KFN A;  3MUD A;  3U1A A;  3L35 A;  2Z5I A;  5CCG D;  1D0X A;  2RP4 A;  3C4Z A;  2LT3 A;  2LJL A;  1UX5 A;  1X8Y A;  4HGA A;  2YO3 A;  4EAH A;  4EZH A;  2YKQ A;  4AKG A;  4WNK A;  5JH7 E;  3PUA A;  1SQP K;  1LT9 C;  2H7H A;  2YU1 A;  3M91 A;  3N9O A;  4Y99 C;  1T8Z A;  4N78 E;  4KMC A;  1NOH A;  2YNY A;  5AVY B;  3IBP A;  4UF0 B;  4JEH B;  4DBQ A;  4EIJ A;  5EK4 A;  2OA5 A;  2IC6 A;  3NRY A;  1J1E C;  3LG7 A;  4JLE A;  2XZR A;  3CQC B;  1HH0 A;  2A3D A;  3BQK A;  3RKO A;  3ZCJ A;  3F2E A;  4U74 A;  3HUS C;  1FDM A;  2MYS A;  1SQQ K;  2XKM A;  5AVZ B;  3N9Q A;  4IFD K;  1X9V A;  3IFM A;  2C9L Y;  1X79 A;  2A2F X;  2A45 I;  1M1J A;  1L4A D;  4G63 A;  2C0X A;  3VMY A;  4ZKU A;  1IFJ A;  1MND A;  1IAP A;  2CE7 A;  3CQX C;  5EK3 A;  4AQR D;  4ZI2 C;  5EK2 A;  2V7I A;  3RK2 D;  3HD7 C;  1FZC B;  4QHO A;  3HL6 A;  1HTJ F;  2YMY A;  3ZEF B;  1HGZ A;  3L36 A;  1MV8 A;  2ODV A;  4GKG A;  1LTJ C;  5AW9 B;  3H37 A;  4IE6 A;  5HXC A;  3WAK A;  4WBN E;  1SFC D;  1RY3 A;  2JJL A;  4OHF A;  2CPB A;  3UT5 E;  2M8R A;  4E7Z A;  4PK5 A;  5IHY A;  3M06 A;  4ASK A;  1D1B A;  3T97 A;  1RF1 C;  3ZMS B;  3C9I A;  2EHO D;  1N7S D;  2QM7 A;  4AQF A;  4BJN A;  3CVR A;  1GZL A;  1S9K E;  1KIL B;  3EVY A;  4EIW A;  1WYB A;  2N1T A;  5AVQ B;  2EHO C;  2K24 A;  2NPS B;  1FMV A;  4TUY E;  3UUM A;  4C46 A;  5KJ7 A;  1MFZ A;  3ESL A;  3O1I A;  3I9W A;  2E9X B;  5GON E;  3WI3 A;  5CB4 E;  1AJ3 A;  2KOG A;  2XAQ B;  2N9B A;  1NH4 A;  4KBM B;  1LWU A;  3WAJ A;  1GL2 B;  1KK7 A;  5CCG A;  5DQV A;  2E9X C;  3V5U A;  4LC1 A;  4RES B;  1RE4 C;  3H6P A;  2H3R A;  3QC9 A;  5J1G A;  3RX6 A;  3O1J A;  5DQW A;  5HXE A;  1FJK A;  3CQG B;  3HD7 B;  4IIJ E;  2IW5 B;  2WT7 B;  5HYA A;  3ZN1 B;  5APW A;  4IE7 A;  2XAG B;  3L09 A;  3A3Y B;  2KIN B;  3KV6 A;  3B5N C;  4G2A A;  5LHH B;  1N86 A;  2V7L A;  2Z5H A;  3OAK A;  4I6M C;  4BAY B;  1WLX A;  2UXX B;  1CZQ A;  2Z4E A;  2L3L A;  1IJ5 A;  1HCI A;  3RYH E;  3E0Z A;  4AYC A;  3FHN A;  3DP7 A;  3LJC A;  5JRC A;  3AVR A;  1SFC C;  3O4X E;  2XQY A;  5L3F B;  2LSK A;  3NTN A;  4C7N B;  1QL1 A;  1NTM K;  5JVD E;  2ZXE B;  2CM0 A;  5AW7 B;  4GIW A;  1JY3 N;  3M0D A;  4LGD E;  4IE5 A;  2X68 A;  3N9P A;  3ZMZ B;  3UUN A;  4ZKP A;  4CI2 B;  5KMG P;  3BAS A;  2KB7 P;  5FY7 A;  1HTL C;  3CL3 D;  2LEH A;  4N78 D;  4YLH A;  3PUR A;  4AKI A;  2CXL A;  4PFP A;  3N7N A;  3LBX B;  2WWW A;  3K3N A;  5AFU L;  2XNX A;  3KBU A;  1U4Q A;  2CMR A;  1J1D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...