1OWAA

Solution structural studies on human erythrocyte alpha spectrin n terminal tetramerization domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Spectrin alpha chain, erythrocyte
publication title Solution structural studies on human erythrocyte alpha-spectrin tetramerization site.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1owaA01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1owaA02
3HE4A 1S9KE 3NXSA 5AVTB 2YO3A 2ZXEB 3KDPB 2WPSA 4DZOA 3TYYA 5AVXB 1CZQA 1SLQA 5AVQB 2P67A 3L36A 1J2JB 2P7JA 4AUWA 5AW7B 1HBWA 2IPPA 4RESB 1YYCA 5AVVB 2WTYA 3M9BA 4JYBA 1HWTC 5AW5B 1HUCA 1CI6B 2XZRA 1QUUA 1HJBA 2W27A 3M0DA 3MD0A 3OAKA 1U5PA 1T2KD 4I6MC 4XE5B 3NFQA 1A02J 5AVZB 3HE5A 3VMZA 1FAVA 4C46A 2Q3IA 4EOTA 5AW8B 3TK1A 1GU4A 1FOSF 1GZLA 1CI6A 3VMXA 5AVUB 2WT7B 1H8AA 3VMYA 1OXZA 1JUNA 5AW3B 1MFZA 5APQA 2W6AA 5APYA 4GKGA 3MGNA 2Q7CA 2KP8A 2XU6A 1GTWA 3UULA 2E43A 1GK4A 3SWFA 3I5CA 2WT7A 4C7NB 3A2AA 1MV8A 2R5DA 5APWA 2R32A 1GK6A 3L35A 3HTKA 4JYCA 2Z5IA 3V4WA 3F31A 3M0AA 3B8EB 3M91A 4GT1A 3VN0A 2WWWA 5AW1B 1GD2E 1FOSE 5AVYB 4AQRD 4B86A 3V4QA 2ZFCA 1SP4A 3UIAA 2ODUA 3P8MC 2BASA 2C9LY 3VTPC 3A5TA 5AW6B 1NWQA 5AW4B 2N9BA 5AW9B 4LC1A 2Z5HA 4AYCA 1JNMA 3LIDA 3UUMA 2WPQA 3LBXB 3L37A 1H89A 3IR9A 2C9NY 2WPRA 5AW2B 1U4QA 3PE0A 1OWAA 3M9HA 3P32A 2JJLA 1IO4A 4I2LC 1A02F 5APUA 1CSBA 5CMZA 1T2KC 2SPCA 2E42A 3LBXA 2YO2A 2QM8A 1S35A 4C7NA 1S9KD 2H7HA 3TNUB 3A7OA 5APSA 3LIEA 1H88A 1AJ3A 3FB2A 3T97A 1MUUA 3V5BA 3UUNA 2R5BA 3HE5B 2P2UA 2VRSA 4KHXA 1CUNA 1G2CB 1X8YA 2YNYA 3VYIA 1KQLA 5AVRB 3A3YB 5AVSB 3TNUA 1NAFA 3HE4B 5AW0B 4M3LA 3NMDA 1DH3A 3KQGA 3O8ZA 2QM7A 3M06A 4HYTB 5APTA 5AVWB 5APXA 1GU5A 2ODVA 3NTNA 1HCIA 5APVA 3EDVA 2XV5A 3P7KA 1WLXA 2Q5UA 2R3CA
chains in the Genus database with same CATH superfamily
1E7PA 3GN5A 2QJYC 3AEGA 3A7MA 3TLTA 2WITA 4JEHB 4LFAT 1SQVG 3ZKRA 1J2JB 4H44C 2CCQA 4L73A 3FZLB 1HJ0A 4TWHA 3UU3A 3H1LE 3AE1A 5EFWB 2J5UA 4TN7B 4U72A 1U5PA 4OGQD 1T2KD 5H2FE 1HTLC 1KB9E 3L70G 1L4AD 5KTBA 5CCGC 2HPJA 2EHOB 2YKPA 1FOSF 1I94T 2J1DG 3BASA 3ZMUB 3CX5E 3P8CD 1Z0PA 3LG7A 2CHOA 4CXXA 1EZVE 3M9QA 4UXNB 3UFGA 5KKZC 2DCFA 3N5LA 3VOPA 1IBKT 4A97A 2A2FX 3RK2B 3VKGA 2KWHA 3ANWB 3I5CA 2XAGB 3CK6A 2LM9A 3Q5EA 4IDOA 2FBWA 3RX6A 1D1BA 3KV9A 1EZ3A 3ZC1A 2XQAA 1YJWP 4HN9A 3HL6A 4IDPA 4B3MT 2KNCA 2CPTA 1LVKA 5HEHA 4TLFA 1KILC 1L0LG 3V4QA 4AKRB 2HFED 3W67A 3AAIA 4U31A 2BASA 4H63H 3CWBE 2B9BA 1JMBA 5HXCA 5A1LA 3AE9C 2BVLA 2FXPA 3PHLA 1U4QA 2G8YA 1EQ7A 3M9HA 5H6QB 3H1LG 3PTRB 1HS7A 1PGOA 1NVOA 3V2RA 2D0TA 3IHRA 4IFDK 1U7JA 2YK0A 4KUMB 3A0HH 3GWHA 4B3ST 1SFCD 3ESLA 5AQRB 4CN1A 5E79H 1SQPJ 4PJ0H 3K1SA 3CXHH 5FL0A 1VQLP 5EZYE 3KXDA 4YJ3E 3WI3A 3A3YB 2NPSC 2I1KA 1GDTA 3PUVF 2CBIA 2AEFA 3PU3A 2L5GB 3P7IA 1SQQE 2X66A 2PP6A 1KV4A 3V5SA 4ZZCA 1IJDB 3CX7B 3AE4C 3CC7P 4LF7T 2Q5UA 3AE2C 2LSKA 2XAHB 5HEGA 1IK9A 2CRBA 4ILBA 1SQBD 1SHZC 3P4PA 4BAYB 2VKHA 2WPSA 3TYYA 2V4HA 2KWIB 1SLQA 5H2FH 1KB9H 4UVBB 2BG9A 4E7ZA 3H32A 4AUWA 3PV0F 1LP1A 5AW7B 1SQQK 4TZ4C 4AKIA 1VQPP 1URQC 1YTZT 3CX5H 4ZKUA 4FI5A 1HJBA 4YXDA 1XNQT 2JEEA 3M0DA 3TGUD 1NGMB 2GUSA 2A45I 4XE5B 2V6XA 4NUUA 2O01J 2IDOB 4U7IA 3CI9A 2K9JA 3RK3B 1W09A 2CWOA 3FZFB 3EFGA 4DR6T 3VMYA 3E22E 4H9NC 2E76B 1HTJF 1R5LA 2HN2A 5F8PA 1ZP0C 2P9BA 2M8RA 1DIPA 1G73A 4O4JE 2PJQA 1YQ4C 5JDHA 1PP9G 4WYVA 2B76A 4AQYT 1N86A 3AEBA 1MV8A 3Q2YA 1FIOA 1WT6A 3V4WA 1HX8A 2CM0A 2VKJA 1UK5A 3UQ4A 3ZMTB 1UX5A 2AE9A 2FXMA 4A7PA 5FKYA 4AQRD 2ACXA 4ZMDA 3P8CE 1XZYA 4X20E 2YKSA 1Y64B 3SS1A 3UIAA 2JDIH 1LTIC 1ZMEC 1E2AA 2Y8DA 3CLQA 4LC1A 5FL1A 2WWVA 2E8IA 5FXVA 1EXIA 2PRRA 4QXBB 1J1EC 3UU5A 1EXJA 1FDMA 5L3GB 4WVZA 3PUZF 4TT3H 1NTZJ 2Y9ZA 2XPKA 1FZFA 2X68A 1RE4A 2ZAEB 5DJTB 4KJMA 1QLBA 4QH5A 4QXHB 3ZN1B 1X79B 1LTJC 3V5BA 4JLEA 2I1JA 2P2UA 4PD4I 2F4VT 4RKUJ 4TNVA 2VQFT 4JI7T 1PPJD 3RIFA 2IYPA 5APXA 1L0VA 3NTNA 2QRXA 2LKGA 4N78D 2AXDS 4MBQA 4DNDA 1WLXA 2L91A 4Z91A 1SA0E 1IK7A 3FZMB 3LDQB 2W6BA 4HTEA 2LRLA 3CL3D 2N2NA 2LR2A 3RC8A 3J9X1 3UFEA 1KFNA 2E5VA 5LOVE 5AVZB 2QYWA 2LM2A 5JR9B 4UF0A 4HWFA 1Y8AA 1LT9B 2WU5A 4Q25A 5JDQA 4EZHA 1CHUA 4JQ0D 1AA0A 3FXEB 4GK0E 2QEXP 2WDRA 4HKZH 3VP9A 3B5NC 2XTLA 1M8OB 4EXTA 3ABVC 4HWHA 1BGYD 3DJBA 3N9OA 2WCAA 2JQ9A 3TGUE 4PK6A 1SQPG 3AEAA 5B5EE 1SQBK 3M91A 1LTGC 5FY0A 2FFDB 5LXTE 3TSIA 1OW7A 3R6NA 4YHJA 3N7NA 4JYAT 4YLHA 5C8YE 2W2UA 2E74C 2KUBA 3A5TA 1XMQT 4W80A 4MALA 1VQ5P 5KLVJ 2WPQA 2KINB 2OYOA 3ZSTA 2HODB 1KQSO 1E79H 3KVAA 3EABA 5IWAT 4U2YA 1HVVA 2BS2A 2YMYA 3KPEA 4ISSA 4OGQC 3GMAA 1T2KC 2BCCD 2ZXXA 1Q82Q 4EOZB 1BE3D 1L4AC 5TISE 3A7OA 4U3FD 4LMJA 4HH2A 2ITAA 3ONJA 2A9UA 3OYZA 1KNRA 1LWUA 3RI5A 4CXYA 3OA7A 2XNXA 2UXBT 1NTMD 4LLHA 3F2EA 4M3LA 3NMDA 2WSFH 3O8ZA 5APTA 5AVWB 1D7MA 2M3BA 2D2CB 2V5CA 1EC5A 4NIQA 3VRAA 4JI0T 1UCUA 3KDPB 2KI7B 2X9HA 4DV3T 3ETVA 2DWKA 2P7JA 2YMKA 1N8RQ 4OK0A 1VQ6P 4Y99C 3AVRA 3DTOA 4HB1A 1IFDA 5AQKB 1VQNP 3AE6A 1PPJE 4O8SA 3RGLA 5H6RB 4IL6E 4N78E 2LSIA 1KQFB 3JADA 2C0XA 3DP7A 2WBLA 4EV6A 3L75J 1KYOD 2N9DA 1OXZA 3W15B 4ASKA 4EZ4A 3NZQA 2JRKA 2WSSH 3H1HJ 2CHNA 5B5EH 2Q7CA 5JR9A 1SFCC 4BXLA 1DD3A 1RE3C 1LT9A 3MHVA 1MIVA 5LMNT 5L3FB 1VF5B 3P4WA 2BG9E 3IFMA 4N3YB 1T6AA 5CHXA 3RL0D 3B57A 3OYXA 2UU9T 1QVGO 2D0UA 2E76D 4DR5T 2Z6EA 4UVAB 1UGOA 4HE8A 1VL2A 3WUTA 3VN0A 3WUUA 4JF7A 4OHFA 1SQXD 4ZS3A 1FZCA 4TWFA 5E0OA 2OYHB 4B86A 4KT0J 4W7ZA 3MJXA 3C1LA 4DOJA 1NTKD 3RIAA 4IHJE 1QEXA 3GHGC 3CCJP 1YBKA 2FFDA 2E5LT 3AEGC 1AVYA 5KMGP 3IR9A 1N7SB 3D6ZA 5LMUT 1BGYE 5KLVE 2PBIA 3FBZA 4B3TT 5KAFE 2J47A 4MN4C 2W61A 5L47A 1JY2N 1Y9BA 3HKEE 2SPCA 3AE1C 4DJGA 4H0LB 4U2ZA 1XDPA 2BKPA 2K37A 3MZWB 3OW2O 3KBUA 5L2LA 4K0KT 5KAIE 5LP6E 3ZDMA 5HCMA 2R5BA 2YDSA 3OKQA 4H63V 3L70J 4YSYA 3VYIA 4UIGA 2K1AA 4O2AE 5IUXA 2KS1B 3SWHA 3TLVA 1LT1A 5AQOB 2MPKA 1HCIA 3L8RA 2ZVOB 4AKHA 4CN4A 2XV5A 2BCCE 3O6QA 4JI4T 2R3CA 1T8ZA 3VR8A 1BE3E 5LGNB 1YHQP 2FBWC 4DZOA 4U3FE 1WFDA 1PZQA 2FYNB 4JI8T 2WDQA 2LSGA 4IL6H 3WMM0 1XDOA 1HBWA 3AAAB 3BRVB 4QXCB 4AQFA 3ZN0B 3AEDA 1NTME 5L3DB 2L9QA 2CEAA 3QK6A 3MD0A 1M1KQ 2I6HA 3VKHA 1L2PA 4DT0A 1ZN5A 4DV2T 5KLVG 3PDYA 4EYUA 2YIUB 5AQQB 1N33T 2IAKA 4UVCB 4TUYE 4AIUA 5AVUB 1PGJA 2WT7B 4OYKA 1HGVA 3EQ2A 1BSHA 5C2TA 2XUEA 2NW8A 4DUZT 1NTMK 2NOXA 3H1KJ 3PUAA 2BEZF 1MMAA 1BCCD 1R8IA 2PG8A 2XU6A 2LE8A 1J5WA 2QJPC 2WQYC 3L72D 2E43A 1IZNB 1J5ET 2YEVC 3RYHE 1IJ6A 2IBZD 1RF1A 4F8HA 1WYCA 3D70A 2KSJA 2OYIA 2LHNA 2YKQA 2PTFA 2VB6A 2ZT9B 3L71D 5EK2A 5HXSA 3FWNA 2XY8B 1VQMP 4IFFA 3C4WA 4GYSA 2QSIA 2XSBA 3S1KA 2FYUD 5KXJA 1ZOYC 3K5BA 4EB6E 2Y0EA 4AQGA 4P0AA 2UUBT 5KAFH 3WU2E 2WWUA 4UV8B 2IC6A 5AW6B 1NWQA 1D0ZA 3IF4A 5JVDE 5LBQB 2QJKC 1OEDB 2IHR1 4O2BE 3ZT5A 1JY3P 1NU1D 2BG9C 4CQIA 2JWAA 3H37A 1T8BA 3G9RA 4XA4A 3FZKB 1LTBC 3N2OA 2H43A 4YXDC 2LT3A 3M0DC 3TNUB 5DABA 4IOIH 3CCMP 2YINA 2WU2A 3CWBJ 3AA7B 1FEWA 3NVOA 3TKLB 1NTKE 1IFPA 3P50A 5JRCA 3L75G 2A3DA 5JDNA 5AVRB 5HEJA 4P09A 1KTMA 1AVOA 3CMAP 3FXDA 4W7YA 5FY7A 3H1HG 2K88A 4HYTB 5JREA 4AI6A 1GL2A 1N2DC 3A5XA 1SQXK 3BQIA 4H9QC 2UWJE 3AEBC 1H7CA 2K3WA 1NENA 2P10A 3ZJ1A 1NTKK 4IL6X 1SFCA 4R4MA 3NXSA 2AEJA 4DO0A 2XAJB 1CZQA 3I56P 3CXHI 2K24A 2Q9QA 5CBOA 2IPPA 3HKBE 2VVNA 2XJ7A 1SQQJ 2D2CD 1EDLA 1MNDA 2XQ6A 3G71P 3L4FA 5L3EB 1BSNA 2KT9A 5ABFB 1FAVA 1W0BA 2E75D 5E79E 4BRYB 2L3LA 4HFBA 5F5WA 3TLWA 3C9IA 1OW6A 3LW5H 3KV4A 1KB9I 2N1TA 4RJTA 2WMMA 5APQA 3CCQP 2XM2A 2E74D 2LKHA 2IFNA 4JEUB 3CX5I 5DQWA 1RE4C 3H1KE 1S72P 2WT7A 4C7NB 1NKNA 1VQKP 1YJ9P 2W6JH 1KYOH 2M67A 1T3UA 2R32A 2KSRA 3F31A 1AQ5A 5JH7E 3CCVP 3NRXA 3AXJB 5AQHB 3WU2H 4UEMA 3PP5A 1VOMA 2CK3H 4KI0F 3F5HA 5CB4E 2IW5B 2IC9A 2O1KA 3H3MA 3V2PA 5AW1B 3RHWA 3T8OA 2E9XA 5HXEA 3JSVC 5AVYB 3PJAJ 4NXMT 2DWGA 3ETUA 2C0SA 2RP4A 4HFVA 2A06E 1BCCE 1LTTC 4LMLA 4WZXA 3L72E 3UU4A 3L74D 2CA5A 3L37A 1KORA 1YW0A 2IBZE 2UXXB 5KLIC 1LRZA 4YPCA 4H13B 1YIJP 4PV1B 3L71E 3L73D 4WY4A 3H1JD 2QM8A 1WRDA 5FXZA 2H7HA 3L09A 2VKDA 2QA7A 4GOEA 3IN6A 3T97A 4YTNA 2MYSA 4P0BA 2ES0A 1IFJA 2B87B 3HUSB 3CQCB 3RQUA 2W66A 3CMLA 2JMKA 3TNUA 1K73Q 2BBJA 5AW0B 4I50E 1ZV4X 3H1KG 1G8XA 1MMNA 2FYUK 3KZIH 3RL0C 1Z8UA 2FXOA 2B88A 2E76C 4OWFA 1GL2D 3CCSP 4DUYT 2IZ0A 2WQYA 4KMCA 3GW6A 3AEAC 2W00A 3RYFE 2QJYB 4CN6A 3BCCD 2GM4A 4DVDA 3QNUA 4RESB 2CWYA 4H44B 2WTYA 1NU1K 4CXWA 5AQGB 1EZVG 3JC6D 2H7VC 3O1HA 1NHLA 2Q9QD 3N9MA 3UU6A 3X1DA 2A06G 3J7Yq 2E5TA 4EEDA 1BCCG 2IYOA 3OAKA 3AE3A 2WDVA 3R84B 4UB8E 3L72G 3B4SA 1ZOYA 2OQQA 4Z90A 2POHA 1SS1A 1GZLA 2ACZA 4PD4D 3NBXX 3RH3A 2ZYGA 2WSFJ 1X22A 3RRCA 3H25A 5L4HA 1GMJA 2N1TD 3UULA 4UR9A 3EI0A 2PFVA 1VCSA 1KNZA 4HFCA 4IDNA 3CWBG 4D6TD 1LWUC 1X9VA 2WMNA 4WBNE 4TV8E 2JR8A 1NH4A 2ZM8A 1BR4A 3U1AA 2QGSA 2V7LA 1LVFA 2YN6A 4COFA 4C90A 2M3EA 2RH0A 2LOPA 2QIWA 3AXJA 3L3PA 1AFOA 2E9XD 1KILB 3PUQA 5J0ZA 2WSSV 2I8DA 5AQJB 2EHOA 4I43B 4M1PA 1USEA 2ZT9D 2XDJA 2H3RA 3N4XA 3ZYMA 1HFAA 2WPRA 3TGUJ 3U78A 1E5WA 5CBNA 3P32A 3PUYF 4UELA 4ZOLE 1JTHB 2IUBA 3EVYA 3H6PA 2CLYB 4H9RC 2DL1A 4HFDA 1SQQG 3ANWA 4BJMA 4ZI3D 3AE6C 2RKLA 1LNQA 4WY4D 5AQUB 3CPWO 2H8PD 1JO5A 1G2CB 3PURA 2J62A 1ZKEA 4KHZF 5AVSB 5C3JA 3I55P 4HGAA 3PLNA 1NAFA 3HE4B 3L74E 3SWKA 2WP9A 1BDCA 3SWYA 1FU1A 1VQ8P 3CMEP 3R2PA 5JR9C 1LT9C 2AXTE 2X9XA 2VVSA 2IZ1A 1AJYA 3L73E 1FJPA 1M56D 1QGKB 2JMHA 3H1JE 2NRGA 2V7IA 2CBJA 3CX8B 4IE6A 4NUVA 3HKCE 1YXRA 4UB8H 1BR2A 3A8YC 3CKDA 1Z56A 1QSDA 3V2NA 1YYCA 1FZCC 1M62A 2N9YB 4JYBA 2BS4A 2ZMAA 3GMIA 2G3AA 4TWDA 4X1IE 1URQB 2X51A 1LGHB 3T1HT 1IC2A 1KFMA 4I0UA 1S5LX 2FFDC 3VMZA 3WAJA 2LLYA 2Q3IA 5AW8B 3FX0A 5DJQC 3K8PC 3GLMA 4BJNA 1N73B 1H8AA 5CA0E 4JI3T 4EYYQ 5J2TE 2KYVA 3BCCE 1M57D 3Q5DA 3AECA 1D0YA 4OX9T 2IDBA 3SFDC 1UIXA 3AE5A 1USDA 1O3XA 3M0AA 5M1BA 3L74G 3QH9A 2NTYA 5LYJE 1GD2E 4I4TE 4IL9A 1JM0A 4LFCT 1OFCX 3PUGA 1SQBE 2MOZA 4EEBA 4EIJA 1W2BO 1QL1A 5FYMA 2K3RA 4GKKT 1MKMA 5AW9B 3HR0A 3UUMA 1YD8G 3LIDA 1N36T 3S9OA 4LF8T 2UUAT 5AW2B 2UXDT 1AQTA 3GF3A 2EHOD 3NWIA 4EGWA 2SPZA 2D2CC 2JPFA 3KFWX 3MXZA 1J1EB 4D6TE 2N1GA 4AQFC 4J2CA 1CSBA 3AEDC 3MKDA 3Q5WA 1S9KD 1NYHA 3BATA 2E75C 2BVMA 2MTQA 4R4LA 4X1YE 5HYAA 4JV5T 3RK2D 5DQVA 2VKOA 1JTHA 3HE5B 2AXTH 1LTJB 4YSXA 2LJLA 5BMVE 1BGYJ 3E7KA 2NR4A 3AEEA 4X62T 4MHCA 1FZGA 4HWDA 3A0BE 3VR9A 1NWMX 1FDOA 4YSZA 1L0ND 3PRJA 2M5AB 3EUHA 4JBZA 1RF1C 3HE4A 4X64T 1N34T 4X65T 2OYIC 3LK2B 4O9BA 1G1JA 3H1ID 5L4EA 3PUXF 3AA0B 3I1AA 1SQBG 3OPCA 3CCUP 1S3JA 1J1DB 1QUUA 4U7YA 5AQSB 3ZSSA 2C5KT 1VQ7P 2CXLA 1X79A 3M3ZB 2BCCJ 1BE3J 4YT0A 3AB3B 3VMXA 1FJKA 5HAXA 3TGUG 4U3FJ 1PFIA 2NP9A 3P4QA 3Q5XA 3O9XA 4ZKPA 4PFOA 4L75A 1NTMJ 4ZEYA 1E1HB 1N73A 5AQNB 2BKOA 4PD4H 4PAGA 2V7QH 2YDQA 3RKOA 3KBTA 3B5NB 1S4XA 4DCKA 1JNRA 3PJSK 5JQGE 4JYCA 1NTZK 2I0MA 4LGDE 5LGUB 2XQYA 5TAOA 1Q2NA 4F6RC 5LB7B 2W4XA 1GL2C 4ZXLA 2XQ7A 4QKNA 3R4YA 3C4XA 2XAFB 2O01N 1JNMA 3KV5A 3LW5J 2CXFA 3MIWA 3LBXB 3ZMZB 2WVRA 4JBWF 3RK3D 5LHGB 3JC6C 1P84I 2Q9QC 2JJLA 3USSA 4ASWA 5AQPB 3FXEA 4I2LC 4O4IE 3HI2A 2P58A 3HA4A 2E42A 4OGQB 2YO2A 2KNDA 2LEHA 2DHRA 2FYNC 2OTLP 3JAEA 1L4AB 2ZM2A 5CGMA 2WSEH 3A0BH 5M4YA 4IGUA 5AQIB 5HXHA 4P1NA 4KHXA 3AEFA 2X67A 2WAUA 1OX3A 3AE8A 2N1TC 2E2AA 2J59M 4IE5A 2KZIA 4MFRA 1EDJA 3CX6B 4PJLA 2LRKA 2YIUC 3SOLA 1SQVD 1M1JB 1NEKA 2WZIA 1SQXJ 3OBVE 1QLED 1PPJG 2D5UA 4ZI7E 4XZCA 2HODA 1S9KE 2YOEA 2HN1A 1WRGA 2H88A 1JOCA 1NTKJ 1KMIZ 5AVQB 2P67A 3L36A 3SFDA 3CC4P 4OFZA 2M5AA 2E9XC 1PGPA 3ZPOA 4G2AA 1JY3N 2UXNB 2ZT9C 4GOFA 3SSUA 5HCJA 3C50A 2Z4EA 2V8SV 3G4SP 1L0NE 1LTSC 2KLUA 4GOUA 2NTXA 1KEYA 4U3CA 5CA1E 1Q86Q 4QX7B 1ZRTD 4ZI3C 3H1IE 4KHPT 3MUDC 1JNZA 5DJUB 3W68A 4WY4C 4U74A 2KP8A 5AQMB 2XASB 2VQET 1G1IA 1L0NK 4A56A 2Q9IA 4ILCA 3SRZA 1L0LD 3B71A 1KZUB 1BGYG 1LKXA 1IBMT 3FBLA 4TX5A 3ONLC 4Z1MH 3PTZA 4WNKA 3FGAD 1UX4A 2VK9A 3AVSA 2ZM0A 3H1LD 5AW4B 2N9BA 1K05A 2Z5HA 3GHGB 2KZ7B 3I9WA 2KLQA 3EAMA 3ZT7A 2DNXA 1RHZB 4CI3B 5TJHA 1ZW0A 4YHHT 2RPAA 3LBXA 3MACA 3CPZA 4PNIA 5EK3A 3AE3C 2B1EA 1FMVA 4TNWA 2ZJSE 1H88A 4PK4A 1KYOE 2K9YA 1VQOP 3E0ZA 1KD1Q 1FZAA 3RRWA 2BCCG 1BCCJ 4KBMB 4WW0A 3UUNA 1BE3G 2RN0A 3L72J 1BDDA 2YNYA 1HGZA 3EFFK 1FC2C 4U3FG 1X9BA 3N2GE 5CJ5A 2V7JA 5FVLA 3K3OA 2WSCH 2OYHA 3AA1B 1PIXA 3RK3E 1QVFO 4GYRA 3KQGA 3PU8A 3C8VA 4HKAA 3L71J 1EDIA 1NTMG 3C4ZA 4IE0A 3CD6P 3LK3B 1OVVA 2FYUJ 1N7SA 1SQXE 1T3JA 1DEEG 2BZBA 5AVXB 5LJNA 1KNPA 3VHLA 4UV9B 3M65A 4BA9A 4H9OC 3MZKB 4HEAA 1NU1J 2PFXA 3RPUA 4EDFA 4I6MC 3G06A 2EHOC 2XHEB 2HPLA 1OVRA 3I0QA 2KK7A 1SQVE 4CPGA 3E1IA 1LTAC 2WPVB 2DI4A 4MLKA 3ZCIA 1IJ5A 5AQFB 2XQ5A 1PP9D 2KS1A 4LF4T 1MFZA 5LNKA 5APYA 4GKGA 3SFEA 5LHIB 3RK2C 2X9YA 3KZIE 1ZR2A 2FYZA 2HPCB 2QJPB 2WS3A 4YTPC 4ILAA 5AQLB 1SQVK 2H89A 4ISTA 4A5XA 3L39A 5L8RJ 3N9NA 4B3RT 1DX7A 3U1CA 2YXRB 4GT1A 2MKVA 3Q5RA 1VPCA 4X1KE 5LCYA 4JI1T 2UXCT 1MIWA 5GONE 3QUJA 5ABGA 2XZEA 3WUVA 1XMOT 1RF0A 3HUSC 4H9SE 3AA6B 4DR4T 3ZC0A 2R6GF 2HG5D 1FBMA 1SQXG 1OMIA 3F57A 2XNDH 4PFPA 5CFBA 1VQ4P 5IHYA 4LFBT 1EZVI 2QJKB 1HX1B 1NTKG 3CVRA 1S5LE 2PAJA 1JCDA 4YXWH 2C0WA 2K5BB 3B5MA 1L0LE 2DW3A 3Q5PA 2BG9B 3UUBA 2KMFA 2CPBA 2YU2A 1WMKA 2ZVNB 2Q3EA 3IBPA 2IBZI 2CMRA 3N2KE 3RYCE 3WAKA 4DMVA 5LG4A 1VCTA 1JEKA 1VF5D 2P1JA 5ADXL 2JIWA 2K9JB 2R44A 3IAOA 3C98B 2WB5A 1L0LK 5GTIH 1DH3A 3HD7B 1WCRA 3Q3DA 1CW5A 2FJAA 1RH5B 3AECC 5ETWA 4CI2B 3CCEP 2KZJA 3KV6A 2HHHT 2ZYAA 3MUDA 3P7KA 4IL4A 4HFHA 1OEDA 2KOGA 4Y28J 4L5GA 3AE5C 5HXRA 2QA4P 3O1JA 4QHOA 2R3SA 3ITKA 2FYUE 2XM1A 1GQEA 3LJCA 1PGQA 1N7SD 2OA5A 1HH0A 1MIYA 3RKGA 3L74J 3IF8B 4ZZBA 3T1YT 2FKWB 2OARA 5AW5B 2XZRA 5BU5A 1H0TB 2O1JA 4I7ZB 4H0LD 2XQ4A 3GA8A 3RK3C 1FMWA 2WY2A 1NU1E 3GG2A 1YITP 3L73J 2W62A 4IE7A 1XNRT 1NAYA 3H1JJ 4DV7T 5LA6E 2KXPB 3JC22 4V1Av 1MZ9A 5LBMA 3Q5SA 5FNVE 5CCHA 4YY3T 2V7MA 3HTKB 4NPFX 1VRBA 3CWZB 1VQ9P 3MGNA 1MMGA 1YQ3A 1GTWA 1OZHA 2XKMA 1SQPD 3EDUA 2GUVA 3RYIE 3L35A 3B13A 2CLYC 5HEUA 3P4RA 5EK4A 4DR2T 4C91A 2G0UA 5C39A 4QWNB 5JDFA 3AEEC 2HPCA 2FJDA 2IBZG 2Y48B 4GIFA 3L71G 1S5LH 5J2UE 1PP9E 3BCCJ 2W90A 2ODUA 4GK5E 5ABFA 3VTPC 4QMAA 2MJZA 2JO1A 2XQ8A 2FYUG 5KX5E 4BRYA 5KKZB 2KSEA 2LHRA 2JP3A 4DBQA 4DV4T 3PE0A 2JQQA 5JDGA 3ONXA 5KJ7A 1UURA 4ERRA 5CMZA 5KLIB 2V7QJ 3IEEA 3CCRP 4GODA 3E08A 4U7JA 4C7NA 1NU1G 1SQBJ 4DV5T 3JCUE 5FY1A 5FVKA 3V6IA 5J1GA 3BQKA 1QX8A 2O3JA 1HNWT 1JB0J 4HWCA 2X0YA 2MBGA 4UF0B 2C5IT 1KQLA 3C51A 1B7TA 3P4SA 1T7SA 3D71A 3AE7A 2LXCB 4D6TJ 2M6BA 3KVBA 3M06A 2ODVA 1GU5A 1N73C 3FHNA 4K35A 3RL0B 3G3ZA 3CCLP 1BR1A 2YO3A 3HD7A 1SVFA 5JDLA 4UB6E 4YTPA 2HYNA 5FXWA 4JI5T 5GTHE 4DR3T 1R5SA 4A98A 1CI6B 2WSEJ 4U33A 3TF5A 3NKZA 3RLFF 1WR0A 2LKMA 2NPSB 2FY8A 3IA3A 4EAHA 4ZHQE 1FS0E 2BDEA 2B87A 3QB5A 3HUSA 3OTOT 2E5YA 3U3IA 1H0TA 1NTZD 3ZMVB 3ZCJA 2RA1A 1OW8A 2H7OA 5AW3B 4WBOA 3EWKA 4ZS2A 1LJ2A 3VP8A 3RIUA 5CCHD 3FZHB 4EYYR 4JI6T 3OJAB 1GK6A 2D2SA 3HTKA 5L3CB 3AEFC 1IFIA 1LWUB 1OVUA 3AE8C 1OIPA 2V7KA 2IMLA 1RQUA 2BKNA 4CZZB 1PL5A 2ZFCA 2X0LB 1Q7YQ 4JUYA 2W67A 4N6JA 3P8MC 1R8EA 2CPSA 1QL2A 1ZEEA 2VL0A 3TLSA 5CCGA 1SQPE 1BR0A 2H88C 4BWNA 3KDSE 1H89A 4LF5T 4IE4A 3JCUH 2A45G 3LSVA 1IO4A 3LFMA 1UIIA 5AQTB 3VU7H 3OVUA 1A02F 1D1CA 5APUA 5KJ7D 1S35A 4WWIA 4PD4E 1NKZB 3MTUE 2B89A 4ZI2D 1SQPK 1MUUA 3L73G 5B66E 4B6XA 4OYJA 1YTZI 2VRSA 3H1JG 3VMAA 1J1DC 1CUNA 5BU8B 3JCFA 4GIWA 1HR0T 4GKJT 4L76A 2JWDA 1TU3F 1GW4A 1NO4A 4JPZB 1M7KA 1KILA 4UB6H 3C64A 3ZT6A 1XTGB 5GTHH 2A45H 3N9QA 4L74A 3PUSA 2QG4A 2ZXEB 3AE9A 3O4XE 4GDOA 1P84D 3V5UA 3HD7D 4X66T 2CE7A 3M9BA 1U57A 4I1LA 1N7LA 4H13D 1FZCB 4PV1D 2BS3A 5KLVD 3I0OA 2GK9A 2M6IA 2Y6XA 3BCCG 1FDIA 1DEBA 1NJIQ 3NFQA 2K48A 2FJEA 4DBRA 5K5GB 4K0UA 4EOTA 4OVNF 1G2CA 5ABEA 4PJMA 2WSCJ 1JMMA 1CI6A 3ZYLA 1KFYA 3CQXC 1M7LA 1JCCA 2NPSA 1T98A 2V6YB 3I9YA 3ZEFB 1JY2O 1OEDE 3UT5E 2Q6QA 3CQGB 2LSYA 3S4RA 4CI1B 1VF5C 3AE4A 2W83C 1AV1A 1W9RA 3AE2A 1RQVA 1YI2P 4QH4A 1I6ZA 1L0NJ 3CC2P 2Z5IA 2DLRA 4AKGA 4AKLA 4PK5A 3RC3A 1JY3O 2YKOA 4JI2T 4EIWA 1ZLLA 2VL8A 2OYHC 1SUMB 3OJAA 1Y01A 4DV0T 1FOSE 2GA1A 1NTZE 4D6TG 3H1IJ 1URQA 2V5DA 1FZBA 4H44D 3U59A 1D0XA 3BRTB 4PJJA 2C9LY 3KINB 3O6QB 1N7SC 4RO0A 3Q2MA 3CIRA 4L9IA 3ZJ2A 2OGUA 5CCGD 1M1JC 1DU2A 5B66H 2FJBA 5CJ0A 2L8KA 4H0LC 1UUSA 1ZP0A 3FWLA 2QE7H 4AISA 5AFUL 2OV9A 1YQ4A 3L75D 5APSA 2Y0CA 1AJ3A 2E75B 4QH1A 1W2EA 1DD4A 1HNZT 1T72A 3H1HD 3H3AA 2O01H 2PGDA 4PJNA 1HG5A 4XBFB 4HWIB 2E74B 4ILUA 1PV3A 4OH8B 3SFEC 3S4UA 4ANJA 1MMDA 2NW7A 5APVA 4IDQA 4K3AA 2VASA 1X0TA 4NPDA 5KDMC 1KILD 2H89C 3NRYA 3D6YA 1RF1B 1ZHCA 3ZYKA 2IIUA 2OYIB 4XFJA 2W8ZA 3O1IA 1NTZG 3UQ7A 1IAPA 3QWOC 5AVVB 1HUCA 1HF8A 4ZNCA 3BK9A 3NZPA 1RF0C 2W27A 1FJGT 1K8AQ 1A02J 4ASVA 3HE5A 4C46A 2V1DB 1LTJA 1D1AA 1Y47A 1S2EA 3E1RA 1XTCC 2JKVA 5ABHA 1JUNA 2C5JA 2WMOA 2NW9A 5LGTB 1W5CE 1K04A 1P84E 4G63A 2NPSD 5FP3A 2J4GA 4NXNT 2XSAA 1MFTA 2KLVA 2QVAA 5TISH 1SE7A 3SWFA 3L70D 1HG2A 1N32T 3A2AA 2V6YA 4YTMA 4Y99B 3UUXB 3G6EP 1SQVJ 5HWYA 4LF6T 5JRCB 3TDKA 4HFIA 2WWWA 3EHZA 2I59A 2HR3A 2Y0DA 2NZ2A 2VWAA 3KHUA 3RF1A 1ZXGA 3FXDB 2YU1A 2Y9YA 2OLTA 4H9PC 2YXQB 2K9AA 2FUPA 1GL2B 1U7MA 2OTKE 1KQGB 1URQD 4ADZA 5KLVK 5FMNA 1OEDC 2HH7A 4DV1T 4AYCA 1IFMA 2LOSA 2M0BA 1SFCB 3RGUA 2JQKA 1OWAA 1Q90D 2KIKA 2WM9A 4I55E 1KC8Q 3AAEB 2OTJP 2Q9QB 2UUCT 2W63A 3CXHD 1WYBA 1J1JA 3QB5K 2BBHA 4KX6A 4LF9T 5BVZA 1M90Q 1ZR4A 4LMKA 3LIEA 3JAFA 3B5NA 3FB2A 3ABVA 3RL0g 3H1KD 4KP3C 5JTGA 4IT4A 1KYOI 5CCHC 3BQLA 3GN5B 4PW8A 2ZLYA 2N1TB 3RQWA 1L0LJ 1KB9D 2XQ3A 1YQ3C 1K9MQ 4XAXB 3VRBA 3II6A 4NPEA 3QC9A 1WR6A 2XQ9A 3N9LA 4Z8XA 4NPPA 2D9DA 4O4HE 4DR7T 3PJAA 3CX5D 3PUWF 5AVTB 1GW3A 3L75E 1L0NG 1EZVD 4IDZA 3BVHA 1US7B 2A06D 5HEOA 3H1LJ 1XWMA 1VDFA 2XAQB 5HWXA 2IX7C 2Q1KA 3H1HE 3KYQA 1HWTC 3N9PA 3LK42 2VURA 3HKDE 2E9XB 3H1IG 4E7SA 2X9WA 3V2QA 4O4LE 1L4AA 3PH0A 2ZM6T 4FJOA 2J58A 1P84H 5BR8T 1S1CX 3TK1A 1GU4A 2KB7P 4AXPA 1JY2P 3RBZA 1KILE 5GTIE 3Q9DA 5KJ7C 5L3BB 2W6AA 2WZHA 3HRNA 3MK7C 3CWBD 1YKEB 4DMWA 4IIJE 4ZI2C 1M1JA 4WY4B 2LSJA 1S94A 1GK4A 5IYZE 3Q1MA 5LG3A 2KNCB 5KAIH 3RBXA 1YKHB 4L0RA 2IFMA 2R5DA 4C7RA 4QX8B 4YFSA 5APWA 3UTKA 3T97B 4DIDB 4IFMA 5LJMA 1MNEA 1IBLT 3B8EB 2CXDA 1Q81Q 3K3QC 3AE7C 5FXXA 1FE6A 2YDRA 1V9DA 1FZEA 2WZ7A 1SP4A 4EI2A 1EDKA 2RMZA 4WBAA 4TV9E 3HD7C 2C9NY 3L70E 1HNXT 1SQQD 4H13C 4PV1C 2AXCA 2LXBA 2NWBA 4HJGH 4HFEA 5LHHB 1ZV8A 3QOFA 4X5TA 2HLOA 1W0AA 4IREA 3UU8A 5JDMA 1RE3A 1KF6A 1PP9J 3MP7B 5F3JA 3ZLIA 1NOHA 1HF9A 2AEMA 2ZYDA 1ZRTE 4WB4A 1KK7A 2A72A 3B5ND 4DR1T 1RY3A 1X8YA 4I7ZC 4YJ2E 3K3NA 5CJ4A 2X0HA 3MA9A 2W0GA 3GF7A 3TLUA 1KN7A 2BEQD 4DV6T 1IFNA 3A0HE 2QM7A 1YJNP 2MAWA 3RIUC 3ZMSB 2V26A 3F89A 2JJ9A 3EDVA 4PJ0E 3CXHE 5AQVB 3H32B 2JQHA 1LP1B 3GHGA 3D0TA
chains in the Genus database with same CATH topology
3GN5A 2WITA 4JEHB 1J2JB 2CCQA 4TN7B 4U72A 1U5PA 1T2KD 1HTLC 1L4AD 5KTBA 5CCGC 2HPJA 2EHOB 2YKPA 1FOSF 2J1DG 3BASA 3ZMUB 3P8CD 1Z0PA 3LG7A 4CXXA 3M9QA 4UXNB 3N5LA 2DCFA 3VOPA 2A2FX 3RK2B 3VKGA 2KWHA 3ANWB 3I5CA 2XAGB 2LM9A 3RX6A 1D1BA 3KV9A 1EZ3A 3ZC1A 4HN9A 3HL6A 1LVKA 1KILC 3V4QA 4AKRB 2HFED 3AAIA 2BASA 4H63H 5HXCA 5A1LA 2BVLA 1U4QA 1EQ7A 3M9HA 5H6QB 3PTRB 1HS7A 3V2RA 2D0TA 3IHRA 4IFDK 2YK0A 4KUMB 3GWHA 1SFCD 3ESLA 5EZYE 4YJ3E 3WI3A 3A3YB 2NPSC 2I1KA 1GDTA 3PU3A 2L5GB 3P7IA 2X66A 2PP6A 3V5SA 1IJDB 3CX7B 2Q5UA 2LSKA 2XAHB 1IK9A 1SHZC 4BAYB 2VKHA 2WPSA 3TYYA 2KWIB 1SLQA 4UVBB 4E7ZA 3H32A 4AUWA 5AW7B 1SQQK 4TZ4C 4AKIA 1URQC 1YTZT 4ZKUA 4FI5A 1HJBA 2JEEA 3M0DA 2GUSA 2A45I 4XE5B 4NUUA 3CI9A 3RK3B 2CWOA 3EFGA 3VMYA 3E22E 4H9NC 1HTJF 5F8PA 2P9BA 2M8RA 1G73A 4O4JE 2PJQA 5JDHA 1N86A 1MV8A 1FIOA 1WT6A 3V4WA 1HX8A 2CM0A 2VKJA 3ZMTB 1UX5A 2FXMA 4AQRD 2ACXA 4X20E 3P8CE 1Y64B 3SS1A 3UIAA 1LTIC 2Y8DA 3CLQA 4LC1A 2E8IA 5FXVA 4QXBB 1J1EC 1FDMA 5L3GB 1FZFA 2X68A 1RE4A 4QXHB 3ZN1B 1X79B 1LTJC 3V5BA 4JLEA 2I1JA 2P2UA 5APXA 3NTNA 4N78D 4MBQA 4DNDA 1WLXA 1SA0E 2W6BA 4HTEA 3CL3D 2N2NA 3RC8A 3J9X1 3UFEA 1KFNA 5LOVE 5AVZB 5JR9B 4UF0A 1LT9B 5JDQA 4EZHA 3FXEB 4GK0E 3VP9A 3B5NC 2XTLA 4EXTA 3DJBA 3N9OA 4PK6A 1SQBK 3M91A 1LTGC 5FY0A 2FFDB 5LXTE 3TSIA 3R6NA 4YHJA 3N7NA 4YLHA 5C8YE 3A5TA 4W80A 4MALA 2WPQA 2KINB 2HODB 3KVAA 1HVVA 2YMYA 3KPEA 4ISSA 1T2KC 4EOZB 1L4AC 3A7OA 4HH2A 3OYZA 1LWUA 4CXYA 3OA7A 2XNXA 4LLHA 3F2EA 4M3LA 3NMDA 2WSFH 3O8ZA 5APTA 5AVWB 2M3BA 1UCUA 3KDPB 2X9HA 3ETVA 2DWKA 2P7JA 4OK0A 4Y99C 3AVRA 3DTOA 1IFDA 4O8SA 5H6RB 4N78E 2LSIA 2C0XA 3DP7A 2WBLA 2N9DA 1OXZA 3W15B 4ASKA 4EZ4A 3NZQA 2JRKA 2Q7CA 5JR9A 1SFCC 1RE3C 1LT9A 1MIVA 5L3FB 3IFMA 4N3YB 3B57A 5CHXA 3RL0D 3OYXA 2D0UA 2Z6EA 4UVAB 4HE8A 3VN0A 4JF7A 4OHFA 4ZS3A 1FZCA 5E0OA 2OYHB 4B86A 4W7ZA 3MJXA 4DOJA 4IHJE 3GHGC 2FFDA 5KMGP 3IR9A 1N7SB 2PBIA 3FBZA 2W61A 1JY2N 3HKEE 2SPCA 3KBUA 5L2LA 5LP6E 2R5BA 3OKQA 4H63V 3VYIA 4UIGA 4O2AE 3SWHA 1HCIA 4AKHA 2XV5A 1T8ZA 2R3CA 5LGNB 4DZOA 2LSGA 3WMM0 1HBWA 3AAAB 3BRVB 4QXCB 4AQFA 3ZN0B 5L3DB 2L9QA 2CEAA 3QK6A 3MD0A 3VKHA 1ZN5A 3PDYA 4EYUA 2IAKA 4UVCB 4TUYE 5AVUB 2WT7B 4OYKA 1HGVA 3EQ2A 2XUEA 2NW8A 1NTMK 2NOXA 3PUAA 1MMAA 2PG8A 2XU6A 2LE8A 2E43A 1IZNB 2YEVC 3RYHE 1IJ6A 1RF1A 1WYCA 2KSJA 2OYIA 2LHNA 2YKQA 2VB6A 5EK2A 5HXSA 4IFFA 3C4WA 4GYSA 4EB6E 4P0AA 4AQGA 2WWUA 4UV8B 2IC6A 5AW6B 1NWQA 1D0ZA 5JVDE 5LBQB 4O2BE 1JY3P 4CQIA 3H37A 4XA4A 1LTBC 3N2OA 2H43A 2LT3A 3M0DC 3TNUB 5DABA 2YINA 3AA7B 1FEWA 3TKLB 5JRCA 2A3DA 5JDNA 5AVRB 4P09A 4W7YA 5FY7A 4HYTB 4AI6A 5JREA 1GL2A 1N2DC 3A5XA 1SQXK 3BQIA 4H9QC 1H7CA 3ZJ1A 1NTKK 1SFCA 3NXSA 4DO0A 2XAJB 1CZQA 2K24A 2Q9QA 2IPPA 3HKBE 1MNDA 3L4FA 5L3EB 2KT9A 1FAVA 2L3LA 3C9IA 3LW5H 3KV4A 2N1TA 5APQA 2IFNA 4JEUB 5DQWA 1RE4C 2WT7A 4C7NB 1NKNA 2M67A 1T3UA 2R32A 3F31A 1AQ5A 5JH7E 3NRXA 4UEMA 5CB4E 3PP5A 1VOMA 2IW5B 2IC9A 2O1KA 3V2PA 5AW1B 3T8OA 2E9XA 5HXEA 5AVYB 2DWGA 3ETUA 2C0SA 2RP4A 4HFVA 1LTTC 2CA5A 3L37A 1YW0A 2UXXB 1LRZA 4WY4A 5FXZA 2QM8A 1WRDA 2H7HA 3L09A 2VKDA 2QA7A 3T97A 2MYSA 4P0BA 2ES0A 1IFJA 3HUSB 3CQCB 3CMLA 2JMKA 3TNUA 5AW0B 4I50E 1ZV4X 1G8XA 1MMNA 2FYUK 3RL0C 1GL2D 4KMCA 3RYFE 2W00A 2GM4A 4DVDA 4RESB 2CWYA 2WTYA 1NU1K 4CXWA 3JC6D 3O1HA 2H7VC 1NHLA 2Q9QD 3N9MA 3J7Yq 3OAKA 3R84B 2POHA 1GZLA 3NBXX 3RH3A 3RRCA 2N1TD 3UULA 2PFVA 1KNZA 1LWUC 1X9VA 2WMNA 4WBNE 4TV8E 1NH4A 2ZM8A 1BR4A 3U1AA 2QGSA 2V7LA 1LVFA 4C90A 2LOPA 3L3PA 1AFOA 2E9XD 1KILB 3PUQA 2WSSV 2EHOA 4I43B 4M1PA 2XDJA 2H3RA 3N4XA 3ZYMA 1HFAA 2WPRA 3U78A 1E5WA 3P32A 4UELA 4ZOLE 1JTHB 3EVYA 3H6PA 2CLYB 4H9RC 4BJMA 3ANWA 4ZI3D 4WY4D 2H8PD 1JO5A 1G2CB 3PURA 1ZKEA 5AVSB 4HGAA 1NAFA 3HE4B 3SWYA 1FU1A 3R2PA 5JR9C 1LT9C 2X9XA 1FJPA 2JMHA 2V7IA 3CX8B 4IE6A 4NUVA 3HKCE 1BR2A 3CKDA 1Z56A 1QSDA 3GMIA 3V2NA 1YYCA 1FZCC 2ZMAA 4JYBA 4X1IE 1URQB 2X51A 1LGHB 1IC2A 1KFMA 2FFDC 3VMZA 3WAJA 2Q3IA 5AW8B 5DJQC 3K8PC 4BJNA 1N73B 1H8AA 5CA0E 5J2TE 2KYVA 1D0YA 1O3XA 3M0AA 2NTYA 5LYJE 1GD2E 4I4TE 3PUGA 2MOZA 4EIJA 5FYMA 1QL1A 3HR0A 5AW9B 3UUMA 1YD8G 3LIDA 5AW2B 2EHOD 3KFWX 2JPFA 3MXZA 1J1EB 2N1GA 4AQFC 4J2CA 1CSBA 3MKDA 3Q5WA 1S9KD 3BATA 2BVMA 2MTQA 4X1YE 5HYAA 3RK2D 5DQVA 2VKOA 1JTHA 3HE5B 1LTJB 2LJLA 5BMVE 4MHCA 1FZGA 1NWMX 3EUHA 1RF1C 3HE4A 2OYIC 3LK2B 4O9BA 1G1JA 3AA0B 3I1AA 1J1DB 1QUUA 2C5KT 2CXLA 1X79A 3AB3B 3VMXA 1FJKA 5HAXA 1PFIA 2NP9A 3Q5XA 3O9XA 4ZKPA 4PFOA 1E1HB 1N73A 4PAGA 3RKOA 3KBTA 3B5NB 5JQGE 4JYCA 1NTZK 4LGDE 5LGUB 2XQYA 5TAOA 4F6RC 1GL2C 4QKNA 3C4XA 2XAFB 1JNMA 3KV5A 2CXFA 3MIWA 3LBXB 3ZMZB 5LHGB 3RK3D 3JC6C 2Q9QC 2JJLA 4I2LC 4O4IE 3HI2A 3HA4A 2E42A 2YO2A 2KNDA 2LEHA 2DHRA 1L4AB 2ZM2A 2WSEH 5M4YA 4IGUA 5HXHA 4KHXA 2X67A 2WAUA 2N1TC 2J59M 4IE5A 4MFRA 3CX6B 4PJLA 3SOLA 1M1JB 3OBVE 2D5UA 4ZI7E 4XZCA 2HODA 1S9KE 1WRGA 1JOCA 5AVQB 2P67A 3L36A 4OFZA 2E9XC 3ZPOA 4G2AA 1JY3N 2UXNB 3C50A 2Z4EA 1LTSC 4GOUA 2NTXA 5CA1E 4QX7B 4ZI3C 4WY4C 4U74A 2KP8A 2XASB 1G1IA 1L0NK 4A56A 2Q9IA 3SRZA 1KZUB 1LKXA 3FBLA 4TX5A 4WNKA 1UX4A 2VK9A 3AVSA 2ZM0A 5AW4B 2N9BA 2Z5HA 3GHGB 2KZ7B 3I9WA 2KLQA 2DNXA 4CI3B 3LBXA 3MACA 3CPZA 4PNIA 5EK3A 2B1EA 1FMVA 1H88A 4PK4A 3E0ZA 1FZAA 3RRWA 4KBMB 4WW0A 3UUNA 2YNYA 3N2GE 1HGZA 2V7JA 3K3OA 2WSCH 2OYHA 3AA1B 4GYRA 3KQGA 3PU8A 4HKAA 3C4ZA 4IE0A 3LK3B 1N7SA 1T3JA 2BZBA 5AVXB 5LJNA 3VHLA 4UV9B 3M65A 4BA9A 4H9OC 3MZKB 4HEAA 3RPUA 4I6MC 2EHOC 2XHEB 2HPLA 3I0QA 3E1IA 1LTAC 4MLKA 2DI4A 3ZCIA 1IJ5A 1MFZA 5LNKA 5APYA 4GKGA 5LHIB 3RK2C 2X9YA 1ZR2A 2FYZA 2HPCB 1SQVK 4ISTA 3N9NA 1DX7A 3U1CA 4GT1A 1VPCA 4X1KE 5LCYA 1MIWA 5GONE 3QUJA 1RF0A 3HUSC 4H9SE 3AA6B 3ZC0A 2HG5D 1FBMA 3F57A 4PFPA 5IHYA 3CVRA 2PAJA 1JCDA 2C0WA 2K5BB 2KMFA 2CPBA 2YU2A 3RYCE 3IBPA 2CMRA 3N2KE 4DMVA 5LG4A 3WAKA 2P1JA 5ADXL 3C98B 1L0LK 1DH3A 3HD7B 1CW5A 5ETWA 4CI2B 3KV6A 3MUDA 3P7KA 2KOGA 4L5GA 5HXRA 3O1JA 4QHOA 3LJCA 1N7SD 2OA5A 1HH0A 1MIYA 3IF8B 2FKWB 2OARA 5AW5B 2XZRA 5BU5A 2O1JA 3GA8A 3RK3C 1FMWA 2W62A 4IE7A 5LA6E 2KXPB 4V1Av 1MZ9A 5LBMA 5FNVE 5CCHA 2V7MA 3HTKB 1VRBA 3CWZB 3MGNA 1MMGA 1GTWA 2XKMA 3EDUA 2GUVA 3RYIE 3L35A 3B13A 2CLYC 5EK4A 4C91A 2G0UA 4QWNB 5JDFA 2HPCA 2Y48B 4GIFA 5J2UE 2ODUA 4GK5E 3VTPC 2MJZA 5KX5E 2LHRA 4DBQA 3PE0A 2JQQA 5JDGA 3ONXA 5KJ7A 4ERRA 5CMZA 3IEEA 3E08A 4C7NA 5FY1A 5J1GA 3BQKA 2MBGA 4UF0B 2C5IT 1KQLA 3C51A 1B7TA 3KVBA 3M06A 2ODVA 1GU5A 1N73C 3FHNA 3RL0B 3G3ZA 1BR1A 2YO3A 3HD7A 1SVFA 5JDLA 2HYNA 5FXWA 1CI6B 2LKMA 2NPSB 4EAHA 4ZHQE 2BDEA 3HUSA 3U3IA 3ZMVB 3ZCJA 2RA1A 2H7OA 5AW3B 4WBOA 4ZS2A 3VP8A 5CCHD 4EYYR 3OJAB 1GK6A 2D2SA 3HTKA 5L3CB 1IFIA 1LWUB 2V7KA 4CZZB 2ZFCA 2X0LB 4JUYA 4N6JA 3P8MC 2CPSA 1QL2A 1ZEEA 1BR0A 5CCGA 3KDSE 1H89A 4IE4A 2A45G 1IO4A 3LFMA 3VU7H 1A02F 1D1CA 5APUA 5KJ7D 1S35A 1NKZB 3MTUE 4ZI2D 1SQPK 1MUUA 4B6XA 4OYJA 1YTZI 2VRSA 1CUNA 4GIWA 1J1DC 5BU8B 1GW4A 1NO4A 1KILA 3C64A 1XTGB 2A45H 3N9QA 3PUSA 2ZXEB 3O4XE 3V5UA 3HD7D 2CE7A 3M9BA 4I1LA 1N7LA 1FZCB 3I0OA 2GK9A 2Y6XA 1DEBA 2K48A 3NFQA 4DBRA 4K0UA 4EOTA 1G2CA 4PJMA 1JMMA 1CI6A 3ZYLA 3CQXC 1M7LA 1JCCA 2NPSA 1T98A 3I9YA 3ZEFB 1JY2O 3UT5E 3CQGB 2LSYA 4CI1B 2Z5IA 2DLRA 4AKGA 4AKLA 4PK5A 3RC3A 1JY3O 2YKOA 4EIWA 1ZLLA 2VL8A 2OYHC 3OJAA 1FOSE 1URQA 1FZBA 3U59A 1D0XA 3BRTB 4PJJA 2C9LY 3KINB 1N7SC 3Q2MA 4L9IA 3ZJ2A 5CCGD 1M1JC 5CJ0A 2L8KA 5AFUL 5APSA 1AJ3A 1W2EA 3H3AA 2O01H 4PJNA 1HG5A 4XBFB 4ILUA 4OH8B 3S4UA 4ANJA 1MMDA 2NW7A 5APVA 5KDMC 2VASA 1KILD 3NRYA 1RF1B 1ZHCA 3ZYKA 2OYIB 3O1IA 1IAPA 5AVVB 1HUCA 1HF8A 3BK9A 3NZPA 1RF0C 2W27A 1A02J 3HE5A 4C46A 2V1DB 1LTJA 1D1AA 1XTCC 1JUNA 2C5JA 2WMOA 2NW9A 5LGTB 4G63A 2NPSD 5FP3A 2KLVA 3SWFA 1HG2A 3A2AA 4Y99B 3UUXB 5HWYA 5JRCB 2WWWA 2I59A 2VWAA 3FXDB 2YU1A 4H9PC 2K9AA 1GL2B 1URQD 4ADZA 5KLVK 5FMNA 2HH7A 4AYCA 1IFMA 2LOSA 1SFCB 1OWAA 2WM9A 4I55E 3AAEB 2Q9QB 2W63A 1WYBA 5BVZA 1ZR4A 3LIEA 3B5NA 3FB2A 4KP3C 5CCHC 3BQLA 3GN5B 4PW8A 2ZLYA 2N1TB 4XAXB 3II6A 3QC9A 1WR6A 4Z8XA 3N9LA 4O4HE 5AVTB 1GW3A 4IDZA 3BVHA 1US7B 2XAQB 1VDFA 5HWXA 2IX7C 3KYQA 1HWTC 3N9PA 3LK42 3HKDE 2E9XB 4E7SA 2X9WA 3V2QA 4O4LE 1L4AA 4FJOA 2J58A 3TK1A 1GU4A 2KB7P 4AXPA 1JY2P 3Q9DA 5KJ7C 5L3BB 2W6AA 3MK7C 3HRNA 1YKEB 4DMWA 4IIJE 4ZI2C 1M1JA 4WY4B 2LSJA 1S94A 1GK4A 5IYZE 4L0RA 1YKHB 2IFMA 2R5DA 4C7RA 4QX8B 4YFSA 5APWA 3UTKA 4IFMA 5LJMA 1MNEA 3B8EB 2CXDA 3K3QC 5FXXA 1V9DA 1FZEA 2WZ7A 1SP4A 4WBAA 4TV9E 3HD7C 2C9NY 2NWBA 5LHHB 1ZV8A 2HLOA 5JDMA 1RE3A 5F3JA 3ZLIA 1NOHA 4WB4A 1KK7A 2A72A 3B5ND 1RY3A 1X8YA 4YJ2E 3K3NA 5CJ4A 3MA9A 2W0GA 1IFNA 2QM7A 3ZMSB 2V26A 2JJ9A 3EDVA 3H32B 3GHGA 3D0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE4 A;  1S9K E;  3NXS A;  5AVT B;  2YO3 A;  2ZXE B;  3KDP B;  2WPS A;  4DZO A;  3TYY A;  5AVX B;  1CZQ A;  1SLQ A;  5AVQ B;  2P67 A;  3L36 A;  1J2J B;  2P7J A;  4AUW A;  5AW7 B;  1HBW A;  2IPP A;  4RES B;  1YYC A;  5AVV B;  2WTY A;  3M9B A;  4JYB A;  1HWT C;  5AW5 B;  1HUC A;  1CI6 B;  2XZR A;  1QUU A;  1HJB A;  2W27 A;  3M0D A;  3MD0 A;  3OAK A;  1U5P A;  1T2K D;  4I6M C;  4XE5 B;  3NFQ A;  1A02 J;  5AVZ B;  3HE5 A;  3VMZ A;  1FAV A;  4C46 A;  2Q3I A;  4EOT A;  5AW8 B;  3TK1 A;  1GU4 A;  1FOS F;  1GZL A;  1CI6 A;  3VMX A;  5AVU B;  2WT7 B;  1H8A A;  3VMY A;  1OXZ A;  1JUN A;  5AW3 B;  1MFZ A;  5APQ A;  2W6A A;  5APY A;  4GKG A;  3MGN A;  2Q7C A;  2KP8 A;  2XU6 A;  1GTW A;  3UUL A;  2E43 A;  1GK4 A;  3SWF A;  3I5C A;  2WT7 A;  4C7N B;  3A2A A;  1MV8 A;  2R5D A;  5APW A;  2R32 A;  1GK6 A;  3L35 A;  3HTK A;  4JYC A;  2Z5I A;  3V4W A;  3F31 A;  3M0A A;  3B8E B;  3M91 A;  4GT1 A;  3VN0 A;  2WWW A;  5AW1 B;  1GD2 E;  1FOS E;  5AVY B;  4AQR D;  4B86 A;  3V4Q A;  2ZFC A;  1SP4 A;  3UIA A;  2ODU A;  3P8M C;  2BAS A;  2C9L Y;  3VTP C;  3A5T A;  5AW6 B;  1NWQ A;  5AW4 B;  2N9B A;  5AW9 B;  4LC1 A;  2Z5H A;  4AYC A;  1JNM A;  3LID A;  3UUM A;  2WPQ A;  3LBX B;  3L37 A;  1H89 A;  3IR9 A;  2C9N Y;  2WPR A;  5AW2 B;  1U4Q A;  3PE0 A;  1OWA A;  3M9H A;  3P32 A;  2JJL A;  1IO4 A;  4I2L C;  1A02 F;  5APU A;  1CSB A;  5CMZ A;  1T2K C;  2SPC A;  2E42 A;  3LBX A;  2YO2 A;  2QM8 A;  1S35 A;  4C7N A;  1S9K D;  2H7H A;  3TNU B;  3A7O A;  5APS A;  3LIE A;  1H88 A;  1AJ3 A;  3FB2 A;  3T97 A;  1MUU A;  3V5B A;  3UUN A;  2R5B A;  3HE5 B;  2P2U A;  2VRS A;  4KHX A;  1CUN A;  1G2C B;  1X8Y A;  2YNY A;  3VYI A;  1KQL A;  5AVR B;  3A3Y B;  5AVS B;  3TNU A;  1NAF A;  3HE4 B;  5AW0 B;  4M3L A;  3NMD A;  1DH3 A;  3KQG A;  3O8Z A;  2QM7 A;  3M06 A;  4HYT B;  5APT A;  5AVW B;  5APX A;  1GU5 A;  2ODV A;  3NTN A;  1HCI A;  5APV A;  3EDV A;  2XV5 A;  3P7K A;  1WLX A;  2Q5U A;  2R3C A; 
#chains in the Genus database with same CATH topology
 1E7P A;  3GN5 A;  2QJY C;  3AEG A;  3A7M A;  3TLT A;  2WIT A;  4JEH B;  4LFA T;  1SQV G;  3ZKR A;  1J2J B;  4H44 C;  2CCQ A;  4L73 A;  3FZL B;  1HJ0 A;  4TWH A;  3UU3 A;  3H1L E;  3AE1 A;  5EFW B;  2J5U A;  4TN7 B;  4U72 A;  1U5P A;  4OGQ D;  1T2K D;  5H2F E;  1HTL C;  1KB9 E;  3L70 G;  1L4A D;  5KTB A;  5CCG C;  2HPJ A;  2EHO B;  2YKP A;  1FOS F;  1I94 T;  2J1D G;  3BAS A;  3ZMU B;  3CX5 E;  3P8C D;  1Z0P A;  3LG7 A;  2CHO A;  4CXX A;  1EZV E;  3M9Q A;  4UXN B;  3UFG A;  5KKZ C;  2DCF A;  3N5L A;  3VOP A;  1IBK T;  4A97 A;  2A2F X;  3RK2 B;  3VKG A;  2KWH A;  3ANW B;  3I5C A;  2XAG B;  3CK6 A;  2LM9 A;  3Q5E A;  4IDO A;  2FBW A;  3RX6 A;  1D1B A;  3KV9 A;  1EZ3 A;  3ZC1 A;  2XQA A;  1YJW P;  4HN9 A;  3HL6 A;  4IDP A;  4B3M T;  2KNC A;  2CPT A;  1LVK A;  5HEH A;  4TLF A;  1KIL C;  1L0L G;  3V4Q A;  4AKR B;  2HFE D;  3W67 A;  3AAI A;  4U31 A;  2BAS A;  4H63 H;  3CWB E;  2B9B A;  1JMB A;  5HXC A;  5A1L A;  3AE9 C;  2BVL A;  2FXP A;  3PHL A;  1U4Q A;  2G8Y A;  1EQ7 A;  3M9H A;  5H6Q B;  3H1L G;  3PTR B;  1HS7 A;  1PGO A;  1NVO A;  3V2R A;  2D0T A;  3IHR A;  4IFD K;  1U7J A;  2YK0 A;  4KUM B;  3A0H H;  3GWH A;  4B3S T;  1SFC D;  3ESL A;  5AQR B;  4CN1 A;  5E79 H;  1SQP J;  4PJ0 H;  3K1S A;  3CXH H;  5FL0 A;  1VQL P;  5EZY E;  3KXD A;  4YJ3 E;  3WI3 A;  3A3Y B;  2NPS C;  2I1K A;  1GDT A;  3PUV F;  2CBI A;  2AEF A;  3PU3 A;  2L5G B;  3P7I A;  1SQQ E;  2X66 A;  2PP6 A;  1KV4 A;  3V5S A;  4ZZC A;  1IJD B;  3CX7 B;  3AE4 C;  3CC7 P;  4LF7 T;  2Q5U A;  3AE2 C;  2LSK A;  2XAH B;  5HEG A;  1IK9 A;  2CRB A;  4ILB A;  1SQB D;  1SHZ C;  3P4P A;  4BAY B;  2VKH A;  2WPS A;  3TYY A;  2V4H A;  2KWI B;  1SLQ A;  5H2F H;  1KB9 H;  4UVB B;  2BG9 A;  4E7Z A;  3H32 A;  4AUW A;  3PV0 F;  1LP1 A;  5AW7 B;  1SQQ K;  4TZ4 C;  4AKI A;  1VQP P;  1URQ C;  1YTZ T;  3CX5 H;  4ZKU A;  4FI5 A;  1HJB A;  4YXD A;  1XNQ T;  2JEE A;  3M0D A;  3TGU D;  1NGM B;  2GUS A;  2A45 I;  4XE5 B;  2V6X A;  4NUU A;  2O01 J;  2IDO B;  4U7I A;  3CI9 A;  2K9J A;  3RK3 B;  1W09 A;  2CWO A;  3FZF B;  3EFG A;  4DR6 T;  3VMY A;  3E22 E;  4H9N C;  2E76 B;  1HTJ F;  1R5L A;  2HN2 A;  5F8P A;  1ZP0 C;  2P9B A;  2M8R A;  1DIP A;  1G73 A;  4O4J E;  2PJQ A;  1YQ4 C;  5JDH A;  1PP9 G;  4WYV A;  2B76 A;  4AQY T;  1N86 A;  3AEB A;  1MV8 A;  3Q2Y A;  1FIO A;  1WT6 A;  3V4W A;  1HX8 A;  2CM0 A;  2VKJ A;  1UK5 A;  3UQ4 A;  3ZMT B;  1UX5 A;  2AE9 A;  2FXM A;  4A7P A;  5FKY A;  4AQR D;  2ACX A;  4ZMD A;  3P8C E;  1XZY A;  4X20 E;  2YKS A;  1Y64 B;  3SS1 A;  3UIA A;  2JDI H;  1LTI C;  1ZME C;  1E2A A;  2Y8D A;  3CLQ A;  4LC1 A;  5FL1 A;  2WWV A;  2E8I A;  5FXV A;  1EXI A;  2PRR A;  4QXB B;  1J1E C;  3UU5 A;  1EXJ A;  1FDM A;  5L3G B;  4WVZ A;  3PUZ F;  4TT3 H;  1NTZ J;  2Y9Z A;  2XPK A;  1FZF A;  2X68 A;  1RE4 A;  2ZAE B;  5DJT B;  4KJM A;  1QLB A;  4QH5 A;  4QXH B;  3ZN1 B;  1X79 B;  1LTJ C;  3V5B A;  4JLE A;  2I1J A;  2P2U A;  4PD4 I;  2F4V T;  4RKU J;  4TNV A;  2VQF T;  4JI7 T;  1PPJ D;  3RIF A;  2IYP A;  5APX A;  1L0V A;  3NTN A;  2QRX A;  2LKG A;  4N78 D;  2AXD S;  4MBQ A;  4DND A;  1WLX A;  2L91 A;  4Z91 A;  1SA0 E;  1IK7 A;  3FZM B;  3LDQ B;  2W6B A;  4HTE A;  2LRL A;  3CL3 D;  2N2N A;  2LR2 A;  3RC8 A;  3J9X 1;  3UFE A;  1KFN A;  2E5V A;  5LOV E;  5AVZ B;  2QYW A;  2LM2 A;  5JR9 B;  4UF0 A;  4HWF A;  1Y8A A;  1LT9 B;  2WU5 A;  4Q25 A;  5JDQ A;  4EZH A;  1CHU A;  4JQ0 D;  1AA0 A;  3FXE B;  4GK0 E;  2QEX P;  2WDR A;  4HKZ H;  3VP9 A;  3B5N C;  2XTL A;  1M8O B;  4EXT A;  3ABV C;  4HWH A;  1BGY D;  3DJB A;  3N9O A;  2WCA A;  2JQ9 A;  3TGU E;  4PK6 A;  1SQP G;  3AEA A;  5B5E E;  1SQB K;  3M91 A;  1LTG C;  5FY0 A;  2FFD B;  5LXT E;  3TSI A;  1OW7 A;  3R6N A;  4YHJ A;  3N7N A;  4JYA T;  4YLH A;  5C8Y E;  2W2U A;  2E74 C;  2KUB A;  3A5T A;  1XMQ T;  4W80 A;  4MAL A;  1VQ5 P;  5KLV J;  2WPQ A;  2KIN B;  2OYO A;  3ZST A;  2HOD B;  1KQS O;  1E79 H;  3KVA A;  3EAB A;  5IWA T;  4U2Y A;  1HVV A;  2BS2 A;  2YMY A;  3KPE A;  4ISS A;  4OGQ C;  3GMA A;  1T2K C;  2BCC D;  2ZXX A;  1Q82 Q;  4EOZ B;  1BE3 D;  1L4A C;  5TIS E;  3A7O A;  4U3F D;  4LMJ A;  4HH2 A;  2ITA A;  3ONJ A;  2A9U A;  3OYZ A;  1KNR A;  1LWU A;  3RI5 A;  4CXY A;  3OA7 A;  2XNX A;  2UXB T;  1NTM D;  4LLH A;  3F2E A;  4M3L A;  3NMD A;  2WSF H;  3O8Z A;  5APT A;  5AVW B;  1D7M A;  2M3B A;  2D2C B;  2V5C A;  1EC5 A;  4NIQ A;  3VRA A;  4JI0 T;  1UCU A;  3KDP B;  2KI7 B;  2X9H A;  4DV3 T;  3ETV A;  2DWK A;  2P7J A;  2YMK A;  1N8R Q;  4OK0 A;  1VQ6 P;  4Y99 C;  3AVR A;  3DTO A;  4HB1 A;  1IFD A;  5AQK B;  1VQN P;  3AE6 A;  1PPJ E;  4O8S A;  3RGL A;  5H6R B;  4IL6 E;  4N78 E;  2LSI A;  1KQF B;  3JAD A;  2C0X A;  3DP7 A;  2WBL A;  4EV6 A;  3L75 J;  1KYO D;  2N9D A;  1OXZ A;  3W15 B;  4ASK A;  4EZ4 A;  3NZQ A;  2JRK A;  2WSS H;  3H1H J;  2CHN A;  5B5E H;  2Q7C A;  5JR9 A;  1SFC C;  4BXL A;  1DD3 A;  1RE3 C;  1LT9 A;  3MHV A;  1MIV A;  5LMN T;  5L3F B;  1VF5 B;  3P4W A;  2BG9 E;  3IFM A;  4N3Y B;  1T6A A;  5CHX A;  3RL0 D;  3B57 A;  3OYX A;  2UU9 T;  1QVG O;  2D0U A;  2E76 D;  4DR5 T;  2Z6E A;  4UVA B;  1UGO A;  4HE8 A;  1VL2 A;  3WUT A;  3VN0 A;  3WUU A;  4JF7 A;  4OHF A;  1SQX D;  4ZS3 A;  1FZC A;  4TWF A;  5E0O A;  2OYH B;  4B86 A;  4KT0 J;  4W7Z A;  3MJX A;  3C1L A;  4DOJ A;  1NTK D;  3RIA A;  4IHJ E;  1QEX A;  3GHG C;  3CCJ P;  1YBK A;  2FFD A;  2E5L T;  3AEG C;  1AVY A;  5KMG P;  3IR9 A;  1N7S B;  3D6Z A;  5LMU T;  1BGY E;  5KLV E;  2PBI A;  3FBZ A;  4B3T T;  5KAF E;  2J47 A;  4MN4 C;  2W61 A;  5L47 A;  1JY2 N;  1Y9B A;  3HKE E;  2SPC A;  3AE1 C;  4DJG A;  4H0L B;  4U2Z A;  1XDP A;  2BKP A;  2K37 A;  3MZW B;  3OW2 O;  3KBU A;  5L2L A;  4K0K T;  5KAI E;  5LP6 E;  3ZDM A;  5HCM A;  2R5B A;  2YDS A;  3OKQ A;  4H63 V;  3L70 J;  4YSY A;  3VYI A;  4UIG A;  2K1A A;  4O2A E;  5IUX A;  2KS1 B;  3SWH A;  3TLV A;  1LT1 A;  5AQO B;  2MPK A;  1HCI A;  3L8R A;  2ZVO B;  4AKH A;  4CN4 A;  2XV5 A;  2BCC E;  3O6Q A;  4JI4 T;  2R3C A;  1T8Z A;  3VR8 A;  1BE3 E;  5LGN B;  1YHQ P;  2FBW C;  4DZO A;  4U3F E;  1WFD A;  1PZQ A;  2FYN B;  4JI8 T;  2WDQ A;  2LSG A;  4IL6 H;  3WMM 0;  1XDO A;  1HBW A;  3AAA B;  3BRV B;  4QXC B;  4AQF A;  3ZN0 B;  3AED A;  1NTM E;  5L3D B;  2L9Q A;  2CEA A;  3QK6 A;  3MD0 A;  1M1K Q;  2I6H A;  3VKH A;  1L2P A;  4DT0 A;  1ZN5 A;  4DV2 T;  5KLV G;  3PDY A;  4EYU A;  2YIU B;  5AQQ B;  1N33 T;  2IAK A;  4UVC B;  4TUY E;  4AIU A;  5AVU B;  1PGJ A;  2WT7 B;  4OYK A;  1HGV A;  3EQ2 A;  1BSH A;  5C2T A;  2XUE A;  2NW8 A;  4DUZ T;  1NTM K;  2NOX A;  3H1K J;  3PUA A;  2BEZ F;  1MMA A;  1BCC D;  1R8I A;  2PG8 A;  2XU6 A;  2LE8 A;  1J5W A;  2QJP C;  2WQY C;  3L72 D;  2E43 A;  1IZN B;  1J5E T;  2YEV C;  3RYH E;  1IJ6 A;  2IBZ D;  1RF1 A;  4F8H A;  1WYC A;  3D70 A;  2KSJ A;  2OYI A;  2LHN A;  2YKQ A;  2PTF A;  2VB6 A;  2ZT9 B;  3L71 D;  5EK2 A;  5HXS A;  3FWN A;  2XY8 B;  1VQM P;  4IFF A;  3C4W A;  4GYS A;  2QSI A;  2XSB A;  3S1K A;  2FYU D;  5KXJ A;  1ZOY C;  3K5B A;  4EB6 E;  2Y0E A;  4AQG A;  4P0A A;  2UUB T;  5KAF H;  3WU2 E;  2WWU A;  4UV8 B;  2IC6 A;  5AW6 B;  1NWQ A;  1D0Z A;  3IF4 A;  5JVD E;  5LBQ B;  2QJK C;  1OED B;  2IHR 1;  4O2B E;  3ZT5 A;  1JY3 P;  1NU1 D;  2BG9 C;  4CQI A;  2JWA A;  3H37 A;  1T8B A;  3G9R A;  4XA4 A;  3FZK B;  1LTB C;  3N2O A;  2H43 A;  4YXD C;  2LT3 A;  3M0D C;  3TNU B;  5DAB A;  4IOI H;  3CCM P;  2YIN A;  2WU2 A;  3CWB J;  3AA7 B;  1FEW A;  3NVO A;  3TKL B;  1NTK E;  1IFP A;  3P50 A;  5JRC A;  3L75 G;  2A3D A;  5JDN A;  5AVR B;  5HEJ A;  4P09 A;  1KTM A;  1AVO A;  3CMA P;  3FXD A;  4W7Y A;  5FY7 A;  3H1H G;  2K88 A;  4HYT B;  5JRE A;  4AI6 A;  1GL2 A;  1N2D C;  3A5X A;  1SQX K;  3BQI A;  4H9Q C;  2UWJ E;  3AEB C;  1H7C A;  2K3W A;  1NEN A;  2P10 A;  3ZJ1 A;  1NTK K;  4IL6 X;  1SFC A;  4R4M A;  3NXS A;  2AEJ A;  4DO0 A;  2XAJ B;  1CZQ A;  3I56 P;  3CXH I;  2K24 A;  2Q9Q A;  5CBO A;  2IPP A;  3HKB E;  2VVN A;  2XJ7 A;  1SQQ J;  2D2C D;  1EDL A;  1MND A;  2XQ6 A;  3G71 P;  3L4F A;  5L3E B;  1BSN A;  2KT9 A;  5ABF B;  1FAV A;  1W0B A;  2E75 D;  5E79 E;  4BRY B;  2L3L A;  4HFB A;  5F5W A;  3TLW A;  3C9I A;  1OW6 A;  3LW5 H;  3KV4 A;  1KB9 I;  2N1T A;  4RJT A;  2WMM A;  5APQ A;  3CCQ P;  2XM2 A;  2E74 D;  2LKH A;  2IFN A;  4JEU B;  3CX5 I;  5DQW A;  1RE4 C;  3H1K E;  1S72 P;  2WT7 A;  4C7N B;  1NKN A;  1VQK P;  1YJ9 P;  2W6J H;  1KYO H;  2M67 A;  1T3U A;  2R32 A;  2KSR A;  3F31 A;  1AQ5 A;  5JH7 E;  3CCV P;  3NRX A;  3AXJ B;  5AQH B;  3WU2 H;  4UEM A;  3PP5 A;  1VOM A;  2CK3 H;  4KI0 F;  3F5H A;  5CB4 E;  2IW5 B;  2IC9 A;  2O1K A;  3H3M A;  3V2P A;  5AW1 B;  3RHW A;  3T8O A;  2E9X A;  5HXE A;  3JSV C;  5AVY B;  3PJA J;  4NXM T;  2DWG A;  3ETU A;  2C0S A;  2RP4 A;  4HFV A;  2A06 E;  1BCC E;  1LTT C;  4LML A;  4WZX A;  3L72 E;  3UU4 A;  3L74 D;  2CA5 A;  3L37 A;  1KOR A;  1YW0 A;  2IBZ E;  2UXX B;  5KLI C;  1LRZ A;  4YPC A;  4H13 B;  1YIJ P;  4PV1 B;  3L71 E;  3L73 D;  4WY4 A;  3H1J D;  2QM8 A;  1WRD A;  5FXZ A;  2H7H A;  3L09 A;  2VKD A;  2QA7 A;  4GOE A;  3IN6 A;  3T97 A;  4YTN A;  2MYS A;  4P0B A;  2ES0 A;  1IFJ A;  2B87 B;  3HUS B;  3CQC B;  3RQU A;  2W66 A;  3CML A;  2JMK A;  3TNU A;  1K73 Q;  2BBJ A;  5AW0 B;  4I50 E;  1ZV4 X;  3H1K G;  1G8X A;  1MMN A;  2FYU K;  3KZI H;  3RL0 C;  1Z8U A;  2FXO A;  2B88 A;  2E76 C;  4OWF A;  1GL2 D;  3CCS P;  4DUY T;  2IZ0 A;  2WQY A;  4KMC A;  3GW6 A;  3AEA C;  2W00 A;  3RYF E;  2QJY B;  4CN6 A;  3BCC D;  2GM4 A;  4DVD A;  3QNU A;  4RES B;  2CWY A;  4H44 B;  2WTY A;  1NU1 K;  4CXW A;  5AQG B;  1EZV G;  3JC6 D;  2H7V C;  3O1H A;  1NHL A;  2Q9Q D;  3N9M A;  3UU6 A;  3X1D A;  2A06 G;  3J7Y q;  2E5T A;  4EED A;  1BCC G;  2IYO A;  3OAK A;  3AE3 A;  2WDV A;  3R84 B;  4UB8 E;  3L72 G;  3B4S A;  1ZOY A;  2OQQ A;  4Z90 A;  2POH A;  1SS1 A;  1GZL A;  2ACZ A;  4PD4 D;  3NBX X;  3RH3 A;  2ZYG A;  2WSF J;  1X22 A;  3RRC A;  3H25 A;  5L4H A;  1GMJ A;  2N1T D;  3UUL A;  4UR9 A;  3EI0 A;  2PFV A;  1VCS A;  1KNZ A;  4HFC A;  4IDN A;  3CWB G;  4D6T D;  1LWU C;  1X9V A;  2WMN A;  4WBN E;  4TV8 E;  2JR8 A;  1NH4 A;  2ZM8 A;  1BR4 A;  3U1A A;  2QGS A;  2V7L A;  1LVF A;  2YN6 A;  4COF A;  4C90 A;  2M3E A;  2RH0 A;  2LOP A;  2QIW A;  3AXJ A;  3L3P A;  1AFO A;  2E9X D;  1KIL B;  3PUQ A;  5J0Z A;  2WSS V;  2I8D A;  5AQJ B;  2EHO A;  4I43 B;  4M1P A;  1USE A;  2ZT9 D;  2XDJ A;  2H3R A;  3N4X A;  3ZYM A;  1HFA A;  2WPR A;  3TGU J;  3U78 A;  1E5W A;  5CBN A;  3P32 A;  3PUY F;  4UEL A;  4ZOL E;  1JTH B;  2IUB A;  3EVY A;  3H6P A;  2CLY B;  4H9R C;  2DL1 A;  4HFD A;  1SQQ G;  3ANW A;  4BJM A;  4ZI3 D;  3AE6 C;  2RKL A;  1LNQ A;  4WY4 D;  5AQU B;  3CPW O;  2H8P D;  1JO5 A;  1G2C B;  3PUR A;  2J62 A;  1ZKE A;  4KHZ F;  5AVS B;  5C3J A;  3I55 P;  4HGA A;  3PLN A;  1NAF A;  3HE4 B;  3L74 E;  3SWK A;  2WP9 A;  1BDC A;  3SWY A;  1FU1 A;  1VQ8 P;  3CME P;  3R2P A;  5JR9 C;  1LT9 C;  2AXT E;  2X9X A;  2VVS A;  2IZ1 A;  1AJY A;  3L73 E;  1FJP A;  1M56 D;  1QGK B;  2JMH A;  3H1J E;  2NRG A;  2V7I A;  2CBJ A;  3CX8 B;  4IE6 A;  4NUV A;  3HKC E;  1YXR A;  4UB8 H;  1BR2 A;  3A8Y C;  3CKD A;  1Z56 A;  1QSD A;  3V2N A;  1YYC A;  1FZC C;  1M62 A;  2N9Y B;  4JYB A;  2BS4 A;  2ZMA A;  3GMI A;  2G3A A;  4TWD A;  4X1I E;  1URQ B;  2X51 A;  1LGH B;  3T1H T;  1IC2 A;  1KFM A;  4I0U A;  1S5L X;  2FFD C;  3VMZ A;  3WAJ A;  2LLY A;  2Q3I A;  5AW8 B;  3FX0 A;  5DJQ C;  3K8P C;  3GLM A;  4BJN A;  1N73 B;  1H8A A;  5CA0 E;  4JI3 T;  4EYY Q;  5J2T E;  2KYV A;  3BCC E;  1M57 D;  3Q5D A;  3AEC A;  1D0Y A;  4OX9 T;  2IDB A;  3SFD C;  1UIX A;  3AE5 A;  1USD A;  1O3X A;  3M0A A;  5M1B A;  3L74 G;  3QH9 A;  2NTY A;  5LYJ E;  1GD2 E;  4I4T E;  4IL9 A;  1JM0 A;  4LFC T;  1OFC X;  3PUG A;  1SQB E;  2MOZ A;  4EEB A;  4EIJ A;  1W2B O;  1QL1 A;  5FYM A;  2K3R A;  4GKK T;  1MKM A;  5AW9 B;  3HR0 A;  3UUM A;  1YD8 G;  3LID A;  1N36 T;  3S9O A;  4LF8 T;  2UUA T;  5AW2 B;  2UXD T;  1AQT A;  3GF3 A;  2EHO D;  3NWI A;  4EGW A;  2SPZ A;  2D2C C;  2JPF A;  3KFW X;  3MXZ A;  1J1E B;  4D6T E;  2N1G A;  4AQF C;  4J2C A;  1CSB A;  3AED C;  3MKD A;  3Q5W A;  1S9K D;  1NYH A;  3BAT A;  2E75 C;  2BVM A;  2MTQ A;  4R4L A;  4X1Y E;  5HYA A;  4JV5 T;  3RK2 D;  5DQV A;  2VKO A;  1JTH A;  3HE5 B;  2AXT H;  1LTJ B;  4YSX A;  2LJL A;  5BMV E;  1BGY J;  3E7K A;  2NR4 A;  3AEE A;  4X62 T;  4MHC A;  1FZG A;  4HWD A;  3A0B E;  3VR9 A;  1NWM X;  1FDO A;  4YSZ A;  1L0N D;  3PRJ A;  2M5A B;  3EUH A;  4JBZ A;  1RF1 C;  3HE4 A;  4X64 T;  1N34 T;  4X65 T;  2OYI C;  3LK2 B;  4O9B A;  1G1J A;  3H1I D;  5L4E A;  3PUX F;  3AA0 B;  3I1A A;  1SQB G;  3OPC A;  3CCU P;  1S3J A;  1J1D B;  1QUU A;  4U7Y A;  5AQS B;  3ZSS A;  2C5K T;  1VQ7 P;  2CXL A;  1X79 A;  3M3Z B;  2BCC J;  1BE3 J;  4YT0 A;  3AB3 B;  3VMX A;  1FJK A;  5HAX A;  3TGU G;  4U3F J;  1PFI A;  2NP9 A;  3P4Q A;  3Q5X A;  3O9X A;  4ZKP A;  4PFO A;  4L75 A;  1NTM J;  4ZEY A;  1E1H B;  1N73 A;  5AQN B;  2BKO A;  4PD4 H;  4PAG A;  2V7Q H;  2YDQ A;  3RKO A;  3KBT A;  3B5N B;  1S4X A;  4DCK A;  1JNR A;  3PJS K;  5JQG E;  4JYC A;  1NTZ K;  2I0M A;  4LGD E;  5LGU B;  2XQY A;  5TAO A;  1Q2N A;  4F6R C;  5LB7 B;  2W4X A;  1GL2 C;  4ZXL A;  2XQ7 A;  4QKN A;  3R4Y A;  3C4X A;  2XAF B;  2O01 N;  1JNM A;  3KV5 A;  3LW5 J;  2CXF A;  3MIW A;  3LBX B;  3ZMZ B;  2WVR A;  4JBW F;  3RK3 D;  5LHG B;  3JC6 C;  1P84 I;  2Q9Q C;  2JJL A;  3USS A;  4ASW A;  5AQP B;  3FXE A;  4I2L C;  4O4I E;  3HI2 A;  2P58 A;  3HA4 A;  2E42 A;  4OGQ B;  2YO2 A;  2KND A;  2LEH A;  2DHR A;  2FYN C;  2OTL P;  3JAE A;  1L4A B;  2ZM2 A;  5CGM A;  2WSE H;  3A0B H;  5M4Y A;  4IGU A;  5AQI B;  5HXH A;  4P1N A;  4KHX A;  3AEF A;  2X67 A;  2WAU A;  1OX3 A;  3AE8 A;  2N1T C;  2E2A A;  2J59 M;  4IE5 A;  2KZI A;  4MFR A;  1EDJ A;  3CX6 B;  4PJL A;  2LRK A;  2YIU C;  3SOL A;  1SQV D;  1M1J B;  1NEK A;  2WZI A;  1SQX J;  3OBV E;  1QLE D;  1PPJ G;  2D5U A;  4ZI7 E;  4XZC A;  2HOD A;  1S9K E;  2YOE A;  2HN1 A;  1WRG A;  2H88 A;  1JOC A;  1NTK J;  1KMI Z;  5AVQ B;  2P67 A;  3L36 A;  3SFD A;  3CC4 P;  4OFZ A;  2M5A A;  2E9X C;  1PGP A;  3ZPO A;  4G2A A;  1JY3 N;  2UXN B;  2ZT9 C;  4GOF A;  3SSU A;  5HCJ A;  3C50 A;  2Z4E A;  2V8S V;  3G4S P;  1L0N E;  1LTS C;  2KLU A;  4GOU A;  2NTX A;  1KEY A;  4U3C A;  5CA1 E;  1Q86 Q;  4QX7 B;  1ZRT D;  4ZI3 C;  3H1I E;  4KHP T;  3MUD C;  1JNZ A;  5DJU B;  3W68 A;  4WY4 C;  4U74 A;  2KP8 A;  5AQM B;  2XAS B;  2VQE T;  1G1I A;  1L0N K;  4A56 A;  2Q9I A;  4ILC A;  3SRZ A;  1L0L D;  3B71 A;  1KZU B;  1BGY G;  1LKX A;  1IBM T;  3FBL A;  4TX5 A;  3ONL C;  4Z1M H;  3PTZ A;  4WNK A;  3FGA D;  1UX4 A;  2VK9 A;  3AVS A;  2ZM0 A;  3H1L D;  5AW4 B;  2N9B A;  1K05 A;  2Z5H A;  3GHG B;  2KZ7 B;  3I9W A;  2KLQ A;  3EAM A;  3ZT7 A;  2DNX A;  1RHZ B;  4CI3 B;  5TJH A;  1ZW0 A;  4YHH T;  2RPA A;  3LBX A;  3MAC A;  3CPZ A;  4PNI A;  5EK3 A;  3AE3 C;  2B1E A;  1FMV A;  4TNW A;  2ZJS E;  1H88 A;  4PK4 A;  1KYO E;  2K9Y A;  1VQO P;  3E0Z A;  1KD1 Q;  1FZA A;  3RRW A;  2BCC G;  1BCC J;  4KBM B;  4WW0 A;  3UUN A;  1BE3 G;  2RN0 A;  3L72 J;  1BDD A;  2YNY A;  1HGZ A;  3EFF K;  1FC2 C;  4U3F G;  1X9B A;  3N2G E;  5CJ5 A;  2V7J A;  5FVL A;  3K3O A;  2WSC H;  2OYH A;  3AA1 B;  1PIX A;  3RK3 E;  1QVF O;  4GYR A;  3KQG A;  3PU8 A;  3C8V A;  4HKA A;  3L71 J;  1EDI A;  1NTM G;  3C4Z A;  4IE0 A;  3CD6 P;  3LK3 B;  1OVV A;  2FYU J;  1N7S A;  1SQX E;  1T3J A;  1DEE G;  2BZB A;  5AVX B;  5LJN A;  1KNP A;  3VHL A;  4UV9 B;  3M65 A;  4BA9 A;  4H9O C;  3MZK B;  4HEA A;  1NU1 J;  2PFX A;  3RPU A;  4EDF A;  4I6M C;  3G06 A;  2EHO C;  2XHE B;  2HPL A;  1OVR A;  3I0Q A;  2KK7 A;  1SQV E;  4CPG A;  3E1I A;  1LTA C;  2WPV B;  2DI4 A;  4MLK A;  3ZCI A;  1IJ5 A;  5AQF B;  2XQ5 A;  1PP9 D;  2KS1 A;  4LF4 T;  1MFZ A;  5LNK A;  5APY A;  4GKG A;  3SFE A;  5LHI B;  3RK2 C;  2X9Y A;  3KZI E;  1ZR2 A;  2FYZ A;  2HPC B;  2QJP B;  2WS3 A;  4YTP C;  4ILA A;  5AQL B;  1SQV K;  2H89 A;  4IST A;  4A5X A;  3L39 A;  5L8R J;  3N9N A;  4B3R T;  1DX7 A;  3U1C A;  2YXR B;  4GT1 A;  2MKV A;  3Q5R A;  1VPC A;  4X1K E;  5LCY A;  4JI1 T;  2UXC T;  1MIW A;  5GON E;  3QUJ A;  5ABG A;  2XZE A;  3WUV A;  1XMO T;  1RF0 A;  3HUS C;  4H9S E;  3AA6 B;  4DR4 T;  3ZC0 A;  2R6G F;  2HG5 D;  1FBM A;  1SQX G;  1OMI A;  3F57 A;  2XND H;  4PFP A;  5CFB A;  1VQ4 P;  5IHY A;  4LFB T;  1EZV I;  2QJK B;  1HX1 B;  1NTK G;  3CVR A;  1S5L E;  2PAJ A;  1JCD A;  4YXW H;  2C0W A;  2K5B B;  3B5M A;  1L0L E;  2DW3 A;  3Q5P A;  2BG9 B;  3UUB A;  2KMF A;  2CPB A;  2YU2 A;  1WMK A;  2ZVN B;  2Q3E A;  3IBP A;  2IBZ I;  2CMR A;  3N2K E;  3RYC E;  3WAK A;  4DMV A;  5LG4 A;  1VCT A;  1JEK A;  1VF5 D;  2P1J A;  5ADX L;  2JIW A;  2K9J B;  2R44 A;  3IAO A;  3C98 B;  2WB5 A;  1L0L K;  5GTI H;  1DH3 A;  3HD7 B;  1WCR A;  3Q3D A;  1CW5 A;  2FJA A;  1RH5 B;  3AEC C;  5ETW A;  4CI2 B;  3CCE P;  2KZJ A;  3KV6 A;  2HHH T;  2ZYA A;  3MUD A;  3P7K A;  4IL4 A;  4HFH A;  1OED A;  2KOG A;  4Y28 J;  4L5G A;  3AE5 C;  5HXR A;  2QA4 P;  3O1J A;  4QHO A;  2R3S A;  3ITK A;  2FYU E;  2XM1 A;  1GQE A;  3LJC A;  1PGQ A;  1N7S D;  2OA5 A;  1HH0 A;  1MIY A;  3RKG A;  3L74 J;  3IF8 B;  4ZZB A;  3T1Y T;  2FKW B;  2OAR A;  5AW5 B;  2XZR A;  5BU5 A;  1H0T B;  2O1J A;  4I7Z B;  4H0L D;  2XQ4 A;  3GA8 A;  3RK3 C;  1FMW A;  2WY2 A;  1NU1 E;  3GG2 A;  1YIT P;  3L73 J;  2W62 A;  4IE7 A;  1XNR T;  1NAY A;  3H1J J;  4DV7 T;  5LA6 E;  2KXP B;  3JC2 2;  4V1A v;  1MZ9 A;  5LBM A;  3Q5S A;  5FNV E;  5CCH A;  4YY3 T;  2V7M A;  3HTK B;  4NPF X;  1VRB A;  3CWZ B;  1VQ9 P;  3MGN A;  1MMG A;  1YQ3 A;  1GTW A;  1OZH A;  2XKM A;  1SQP D;  3EDU A;  2GUV A;  3RYI E;  3L35 A;  3B13 A;  2CLY C;  5HEU A;  3P4R A;  5EK4 A;  4DR2 T;  4C91 A;  2G0U A;  5C39 A;  4QWN B;  5JDF A;  3AEE C;  2HPC A;  2FJD A;  2IBZ G;  2Y48 B;  4GIF A;  3L71 G;  1S5L H;  5J2U E;  1PP9 E;  3BCC J;  2W90 A;  2ODU A;  4GK5 E;  5ABF A;  3VTP C;  4QMA A;  2MJZ A;  2JO1 A;  2XQ8 A;  2FYU G;  5KX5 E;  4BRY A;  5KKZ B;  2KSE A;  2LHR A;  2JP3 A;  4DBQ A;  4DV4 T;  3PE0 A;  2JQQ A;  5JDG A;  3ONX A;  5KJ7 A;  1UUR A;  4ERR A;  5CMZ A;  5KLI B;  2V7Q J;  3IEE A;  3CCR P;  4GOD A;  3E08 A;  4U7J A;  4C7N A;  1NU1 G;  1SQB J;  4DV5 T;  3JCU E;  5FY1 A;  5FVK A;  3V6I A;  5J1G A;  3BQK A;  1QX8 A;  2O3J A;  1HNW T;  1JB0 J;  4HWC A;  2X0Y A;  2MBG A;  4UF0 B;  2C5I T;  1KQL A;  3C51 A;  1B7T A;  3P4S A;  1T7S A;  3D71 A;  3AE7 A;  2LXC B;  4D6T J;  2M6B A;  3KVB A;  3M06 A;  2ODV A;  1GU5 A;  1N73 C;  3FHN A;  4K35 A;  3RL0 B;  3G3Z A;  3CCL P;  1BR1 A;  2YO3 A;  3HD7 A;  1SVF A;  5JDL A;  4UB6 E;  4YTP A;  2HYN A;  5FXW A;  4JI5 T;  5GTH E;  4DR3 T;  1R5S A;  4A98 A;  1CI6 B;  2WSE J;  4U33 A;  3TF5 A;  3NKZ A;  3RLF F;  1WR0 A;  2LKM A;  2NPS B;  2FY8 A;  3IA3 A;  4EAH A;  4ZHQ E;  1FS0 E;  2BDE A;  2B87 A;  3QB5 A;  3HUS A;  3OTO T;  2E5Y A;  3U3I A;  1H0T A;  1NTZ D;  3ZMV B;  3ZCJ A;  2RA1 A;  1OW8 A;  2H7O A;  5AW3 B;  4WBO A;  3EWK A;  4ZS2 A;  1LJ2 A;  3VP8 A;  3RIU A;  5CCH D;  3FZH B;  4EYY R;  4JI6 T;  3OJA B;  1GK6 A;  2D2S A;  3HTK A;  5L3C B;  3AEF C;  1IFI A;  1LWU B;  1OVU A;  3AE8 C;  1OIP A;  2V7K A;  2IML A;  1RQU A;  2BKN A;  4CZZ B;  1PL5 A;  2ZFC A;  2X0L B;  1Q7Y Q;  4JUY A;  2W67 A;  4N6J A;  3P8M C;  1R8E A;  2CPS A;  1QL2 A;  1ZEE A;  2VL0 A;  3TLS A;  5CCG A;  1SQP E;  1BR0 A;  2H88 C;  4BWN A;  3KDS E;  1H89 A;  4LF5 T;  4IE4 A;  3JCU H;  2A45 G;  3LSV A;  1IO4 A;  3LFM A;  1UII A;  5AQT B;  3VU7 H;  3OVU A;  1A02 F;  1D1C A;  5APU A;  5KJ7 D;  1S35 A;  4WWI A;  4PD4 E;  1NKZ B;  3MTU E;  2B89 A;  4ZI2 D;  1SQP K;  1MUU A;  3L73 G;  5B66 E;  4B6X A;  4OYJ A;  1YTZ I;  2VRS A;  3H1J G;  3VMA A;  1J1D C;  1CUN A;  5BU8 B;  3JCF A;  4GIW A;  1HR0 T;  4GKJ T;  4L76 A;  2JWD A;  1TU3 F;  1GW4 A;  1NO4 A;  4JPZ B;  1M7K A;  1KIL A;  4UB6 H;  3C64 A;  3ZT6 A;  1XTG B;  5GTH H;  2A45 H;  3N9Q A;  4L74 A;  3PUS A;  2QG4 A;  2ZXE B;  3AE9 A;  3O4X E;  4GDO A;  1P84 D;  3V5U A;  3HD7 D;  4X66 T;  2CE7 A;  3M9B A;  1U57 A;  4I1L A;  1N7L A;  4H13 D;  1FZC B;  4PV1 D;  2BS3 A;  5KLV D;  3I0O A;  2GK9 A;  2M6I A;  2Y6X A;  3BCC G;  1FDI A;  1DEB A;  1NJI Q;  3NFQ A;  2K48 A;  2FJE A;  4DBR A;  5K5G B;  4K0U A;  4EOT A;  4OVN F;  1G2C A;  5ABE A;  4PJM A;  2WSC J;  1JMM A;  1CI6 A;  3ZYL A;  1KFY A;  3CQX C;  1M7L A;  1JCC A;  2NPS A;  1T98 A;  2V6Y B;  3I9Y A;  3ZEF B;  1JY2 O;  1OED E;  3UT5 E;  2Q6Q A;  3CQG B;  2LSY A;  3S4R A;  4CI1 B;  1VF5 C;  3AE4 A;  2W83 C;  1AV1 A;  1W9R A;  3AE2 A;  1RQV A;  1YI2 P;  4QH4 A;  1I6Z A;  1L0N J;  3CC2 P;  2Z5I A;  2DLR A;  4AKG A;  4AKL A;  4PK5 A;  3RC3 A;  1JY3 O;  2YKO A;  4JI2 T;  4EIW A;  1ZLL A;  2VL8 A;  2OYH C;  1SUM B;  3OJA A;  1Y01 A;  4DV0 T;  1FOS E;  2GA1 A;  1NTZ E;  4D6T G;  3H1I J;  1URQ A;  2V5D A;  1FZB A;  4H44 D;  3U59 A;  1D0X A;  3BRT B;  4PJJ A;  2C9L Y;  3KIN B;  3O6Q B;  1N7S C;  4RO0 A;  3Q2M A;  3CIR A;  4L9I A;  3ZJ2 A;  2OGU A;  5CCG D;  1M1J C;  1DU2 A;  5B66 H;  2FJB A;  5CJ0 A;  2L8K A;  4H0L C;  1UUS A;  1ZP0 A;  3FWL A;  2QE7 H;  4AIS A;  5AFU L;  2OV9 A;  1YQ4 A;  3L75 D;  5APS A;  2Y0C A;  1AJ3 A;  2E75 B;  4QH1 A;  1W2E A;  1DD4 A;  1HNZ T;  1T72 A;  3H1H D;  3H3A A;  2O01 H;  2PGD A;  4PJN A;  1HG5 A;  4XBF B;  4HWI B;  2E74 B;  4ILU A;  1PV3 A;  4OH8 B;  3SFE C;  3S4U A;  4ANJ A;  1MMD A;  2NW7 A;  5APV A;  4IDQ A;  4K3A A;  2VAS A;  1X0T A;  4NPD A;  5KDM C;  1KIL D;  2H89 C;  3NRY A;  3D6Y A;  1RF1 B;  1ZHC A;  3ZYK A;  2IIU A;  2OYI B;  4XFJ A;  2W8Z A;  3O1I A;  1NTZ G;  3UQ7 A;  1IAP A;  3QWO C;  5AVV B;  1HUC A;  1HF8 A;  4ZNC A;  3BK9 A;  3NZP A;  1RF0 C;  2W27 A;  1FJG T;  1K8A Q;  1A02 J;  4ASV A;  3HE5 A;  4C46 A;  2V1D B;  1LTJ A;  1D1A A;  1Y47 A;  1S2E A;  3E1R A;  1XTC C;  2JKV A;  5ABH A;  1JUN A;  2C5J A;  2WMO A;  2NW9 A;  5LGT B;  1W5C E;  1K04 A;  1P84 E;  4G63 A;  2NPS D;  5FP3 A;  2J4G A;  4NXN T;  2XSA A;  1MFT A;  2KLV A;  2QVA A;  5TIS H;  1SE7 A;  3SWF A;  3L70 D;  1HG2 A;  1N32 T;  3A2A A;  2V6Y A;  4YTM A;  4Y99 B;  3UUX B;  3G6E P;  1SQV J;  5HWY A;  4LF6 T;  5JRC B;  3TDK A;  4HFI A;  2WWW A;  3EHZ A;  2I59 A;  2HR3 A;  2Y0D A;  2NZ2 A;  2VWA A;  3KHU A;  3RF1 A;  1ZXG A;  3FXD B;  2YU1 A;  2Y9Y A;  2OLT A;  4H9P C;  2YXQ B;  2K9A A;  2FUP A;  1GL2 B;  1U7M A;  2OTK E;  1KQG B;  1URQ D;  4ADZ A;  5KLV K;  5FMN A;  1OED C;  2HH7 A;  4DV1 T;  4AYC A;  1IFM A;  2LOS A;  2M0B A;  1SFC B;  3RGU A;  2JQK A;  1OWA A;  1Q90 D;  2KIK A;  2WM9 A;  4I55 E;  1KC8 Q;  3AAE B;  2OTJ P;  2Q9Q B;  2UUC T;  2W63 A;  3CXH D;  1WYB A;  1J1J A;  3QB5 K;  2BBH A;  4KX6 A;  4LF9 T;  5BVZ A;  1M90 Q;  1ZR4 A;  4LMK A;  3LIE A;  3JAF A;  3B5N A;  3FB2 A;  3ABV A;  3RL0 g;  3H1K D;  4KP3 C;  5JTG A;  4IT4 A;  1KYO I;  5CCH C;  3BQL A;  3GN5 B;  4PW8 A;  2ZLY A;  2N1T B;  3RQW A;  1L0L J;  1KB9 D;  2XQ3 A;  1YQ3 C;  1K9M Q;  4XAX B;  3VRB A;  3II6 A;  4NPE A;  3QC9 A;  1WR6 A;  2XQ9 A;  3N9L A;  4Z8X A;  4NPP A;  2D9D A;  4O4H E;  4DR7 T;  3PJA A;  3CX5 D;  3PUW F;  5AVT B;  1GW3 A;  3L75 E;  1L0N G;  1EZV D;  4IDZ A;  3BVH A;  1US7 B;  2A06 D;  5HEO A;  3H1L J;  1XWM A;  1VDF A;  2XAQ B;  5HWX A;  2IX7 C;  2Q1K A;  3H1H E;  3KYQ A;  1HWT C;  3N9P A;  3LK4 2;  2VUR A;  3HKD E;  2E9X B;  3H1I G;  4E7S A;  2X9W A;  3V2Q A;  4O4L E;  1L4A A;  3PH0 A;  2ZM6 T;  4FJO A;  2J58 A;  1P84 H;  5BR8 T;  1S1C X;  3TK1 A;  1GU4 A;  2KB7 P;  4AXP A;  1JY2 P;  3RBZ A;  1KIL E;  5GTI E;  3Q9D A;  5KJ7 C;  5L3B B;  2W6A A;  2WZH A;  3HRN A;  3MK7 C;  3CWB D;  1YKE B;  4DMW A;  4IIJ E;  4ZI2 C;  1M1J A;  4WY4 B;  2LSJ A;  1S94 A;  1GK4 A;  5IYZ E;  3Q1M A;  5LG3 A;  2KNC B;  5KAI H;  3RBX A;  1YKH B;  4L0R A;  2IFM A;  2R5D A;  4C7R A;  4QX8 B;  4YFS A;  5APW A;  3UTK A;  3T97 B;  4DID B;  4IFM A;  5LJM A;  1MNE A;  1IBL T;  3B8E B;  2CXD A;  1Q81 Q;  3K3Q C;  3AE7 C;  5FXX A;  1FE6 A;  2YDR A;  1V9D A;  1FZE A;  2WZ7 A;  1SP4 A;  4EI2 A;  1EDK A;  2RMZ A;  4WBA A;  4TV9 E;  3HD7 C;  2C9N Y;  3L70 E;  1HNX T;  1SQQ D;  4H13 C;  4PV1 C;  2AXC A;  2LXB A;  2NWB A;  4HJG H;  4HFE A;  5LHH B;  1ZV8 A;  3QOF A;  4X5T A;  2HLO A;  1W0A A;  4IRE A;  3UU8 A;  5JDM A;  1RE3 A;  1KF6 A;  1PP9 J;  3MP7 B;  5F3J A;  3ZLI A;  1NOH A;  1HF9 A;  2AEM A;  2ZYD A;  1ZRT E;  4WB4 A;  1KK7 A;  2A72 A;  3B5N D;  4DR1 T;  1RY3 A;  1X8Y A;  4I7Z C;  4YJ2 E;  3K3N A;  5CJ4 A;  2X0H A;  3MA9 A;  2W0G A;  3GF7 A;  3TLU A;  1KN7 A;  2BEQ D;  4DV6 T;  1IFN A;  3A0H E;  2QM7 A;  1YJN P;  2MAW A;  3RIU C;  3ZMS B;  2V26 A;  3F89 A;  2JJ9 A;  3EDV A;  4PJ0 E;  3CXH E;  5AQV B;  3H32 B;  2JQH A;  1LP1 B;  3GHG A;  3D0T A; 
#chains in the Genus database with same CATH homology
 3GN5 A;  2WIT A;  4JEH B;  1J2J B;  2CCQ A;  4TN7 B;  4U72 A;  1U5P A;  1T2K D;  1HTL C;  1L4A D;  5KTB A;  5CCG C;  2HPJ A;  2EHO B;  2YKP A;  1FOS F;  2J1D G;  3BAS A;  3ZMU B;  3P8C D;  1Z0P A;  3LG7 A;  4CXX A;  3M9Q A;  4UXN B;  3N5L A;  2DCF A;  3VOP A;  2A2F X;  3RK2 B;  3VKG A;  2KWH A;  3ANW B;  3I5C A;  2XAG B;  2LM9 A;  3RX6 A;  1D1B A;  3KV9 A;  1EZ3 A;  3ZC1 A;  4HN9 A;  3HL6 A;  1LVK A;  1KIL C;  3V4Q A;  4AKR B;  2HFE D;  3AAI A;  2BAS A;  4H63 H;  5HXC A;  5A1L A;  2BVL A;  1U4Q A;  1EQ7 A;  3M9H A;  5H6Q B;  3PTR B;  1HS7 A;  3V2R A;  2D0T A;  3IHR A;  4IFD K;  2YK0 A;  4KUM B;  3GWH A;  1SFC D;  3ESL A;  5EZY E;  4YJ3 E;  3WI3 A;  3A3Y B;  2NPS C;  2I1K A;  1GDT A;  3PU3 A;  2L5G B;  3P7I A;  2X66 A;  2PP6 A;  3V5S A;  1IJD B;  3CX7 B;  2Q5U A;  2LSK A;  2XAH B;  1IK9 A;  1SHZ C;  4BAY B;  2VKH A;  2WPS A;  3TYY A;  2KWI B;  1SLQ A;  4UVB B;  4E7Z A;  3H32 A;  4AUW A;  5AW7 B;  1SQQ K;  4TZ4 C;  4AKI A;  1URQ C;  1YTZ T;  4ZKU A;  4FI5 A;  1HJB A;  2JEE A;  3M0D A;  2GUS A;  2A45 I;  4XE5 B;  4NUU A;  3CI9 A;  3RK3 B;  2CWO A;  3EFG A;  3VMY A;  3E22 E;  4H9N C;  1HTJ F;  5F8P A;  2P9B A;  2M8R A;  1G73 A;  4O4J E;  2PJQ A;  5JDH A;  1N86 A;  1MV8 A;  1FIO A;  1WT6 A;  3V4W A;  1HX8 A;  2CM0 A;  2VKJ A;  3ZMT B;  1UX5 A;  2FXM A;  4AQR D;  2ACX A;  4X20 E;  3P8C E;  1Y64 B;  3SS1 A;  3UIA A;  1LTI C;  2Y8D A;  3CLQ A;  4LC1 A;  2E8I A;  5FXV A;  4QXB B;  1J1E C;  1FDM A;  5L3G B;  1FZF A;  2X68 A;  1RE4 A;  4QXH B;  3ZN1 B;  1X79 B;  1LTJ C;  3V5B A;  4JLE A;  2I1J A;  2P2U A;  5APX A;  3NTN A;  4N78 D;  4MBQ A;  4DND A;  1WLX A;  1SA0 E;  2W6B A;  4HTE A;  3CL3 D;  2N2N A;  3RC8 A;  3J9X 1;  3UFE A;  1KFN A;  5LOV E;  5AVZ B;  5JR9 B;  4UF0 A;  1LT9 B;  5JDQ A;  4EZH A;  3FXE B;  4GK0 E;  3VP9 A;  3B5N C;  2XTL A;  4EXT A;  3DJB A;  3N9O A;  4PK6 A;  1SQB K;  3M91 A;  1LTG C;  5FY0 A;  2FFD B;  5LXT E;  3TSI A;  3R6N A;  4YHJ A;  3N7N A;  4YLH A;  5C8Y E;  3A5T A;  4W80 A;  4MAL A;  2WPQ A;  2KIN B;  2HOD B;  3KVA A;  1HVV A;  2YMY A;  3KPE A;  4ISS A;  1T2K C;  4EOZ B;  1L4A C;  3A7O A;  4HH2 A;  3OYZ A;  1LWU A;  4CXY A;  3OA7 A;  2XNX A;  4LLH A;  3F2E A;  4M3L A;  3NMD A;  2WSF H;  3O8Z A;  5APT A;  5AVW B;  2M3B A;  1UCU A;  3KDP B;  2X9H A;  3ETV A;  2DWK A;  2P7J A;  4OK0 A;  4Y99 C;  3AVR A;  3DTO A;  1IFD A;  4O8S A;  5H6R B;  4N78 E;  2LSI A;  2C0X A;  3DP7 A;  2WBL A;  2N9D A;  1OXZ A;  3W15 B;  4ASK A;  4EZ4 A;  3NZQ A;  2JRK A;  2Q7C A;  5JR9 A;  1SFC C;  1RE3 C;  1LT9 A;  1MIV A;  5L3F B;  3IFM A;  4N3Y B;  3B57 A;  5CHX A;  3RL0 D;  3OYX A;  2D0U A;  2Z6E A;  4UVA B;  4HE8 A;  3VN0 A;  4JF7 A;  4OHF A;  4ZS3 A;  1FZC A;  5E0O A;  2OYH B;  4B86 A;  4W7Z A;  3MJX A;  4DOJ A;  4IHJ E;  3GHG C;  2FFD A;  5KMG P;  3IR9 A;  1N7S B;  2PBI A;  3FBZ A;  2W61 A;  1JY2 N;  3HKE E;  2SPC A;  3KBU A;  5L2L A;  5LP6 E;  2R5B A;  3OKQ A;  4H63 V;  3VYI A;  4UIG A;  4O2A E;  3SWH A;  1HCI A;  4AKH A;  2XV5 A;  1T8Z A;  2R3C A;  5LGN B;  4DZO A;  2LSG A;  3WMM 0;  1HBW A;  3AAA B;  3BRV B;  4QXC B;  4AQF A;  3ZN0 B;  5L3D B;  2L9Q A;  2CEA A;  3QK6 A;  3MD0 A;  3VKH A;  1ZN5 A;  3PDY A;  4EYU A;  2IAK A;  4UVC B;  4TUY E;  5AVU B;  2WT7 B;  4OYK A;  1HGV A;  3EQ2 A;  2XUE A;  2NW8 A;  1NTM K;  2NOX A;  3PUA A;  1MMA A;  2PG8 A;  2XU6 A;  2LE8 A;  2E43 A;  1IZN B;  2YEV C;  3RYH E;  1IJ6 A;  1RF1 A;  1WYC A;  2KSJ A;  2OYI A;  2LHN A;  2YKQ A;  2VB6 A;  5EK2 A;  5HXS A;  4IFF A;  3C4W A;  4GYS A;  4EB6 E;  4P0A A;  4AQG A;  2WWU A;  4UV8 B;  2IC6 A;  5AW6 B;  1NWQ A;  1D0Z A;  5JVD E;  5LBQ B;  4O2B E;  1JY3 P;  4CQI A;  3H37 A;  4XA4 A;  1LTB C;  3N2O A;  2H43 A;  2LT3 A;  3M0D C;  3TNU B;  5DAB A;  2YIN A;  3AA7 B;  1FEW A;  3TKL B;  5JRC A;  2A3D A;  5JDN A;  5AVR B;  4P09 A;  4W7Y A;  5FY7 A;  4HYT B;  4AI6 A;  5JRE A;  1GL2 A;  1N2D C;  3A5X A;  1SQX K;  3BQI A;  4H9Q C;  1H7C A;  3ZJ1 A;  1NTK K;  1SFC A;  3NXS A;  4DO0 A;  2XAJ B;  1CZQ A;  2K24 A;  2Q9Q A;  2IPP A;  3HKB E;  1MND A;  3L4F A;  5L3E B;  2KT9 A;  1FAV A;  2L3L A;  3C9I A;  3LW5 H;  3KV4 A;  2N1T A;  5APQ A;  2IFN A;  4JEU B;  5DQW A;  1RE4 C;  2WT7 A;  4C7N B;  1NKN A;  2M67 A;  1T3U A;  2R32 A;  3F31 A;  1AQ5 A;  5JH7 E;  3NRX A;  4UEM A;  5CB4 E;  3PP5 A;  1VOM A;  2IW5 B;  2IC9 A;  2O1K A;  3V2P A;  5AW1 B;  3T8O A;  2E9X A;  5HXE A;  5AVY B;  2DWG A;  3ETU A;  2C0S A;  2RP4 A;  4HFV A;  1LTT C;  2CA5 A;  3L37 A;  1YW0 A;  2UXX B;  1LRZ A;  4WY4 A;  5FXZ A;  2QM8 A;  1WRD A;  2H7H A;  3L09 A;  2VKD A;  2QA7 A;  3T97 A;  2MYS A;  4P0B A;  2ES0 A;  1IFJ A;  3HUS B;  3CQC B;  3CML A;  2JMK A;  3TNU A;  5AW0 B;  4I50 E;  1ZV4 X;  1G8X A;  1MMN A;  2FYU K;  3RL0 C;  1GL2 D;  4KMC A;  3RYF E;  2W00 A;  2GM4 A;  4DVD A;  4RES B;  2CWY A;  2WTY A;  1NU1 K;  4CXW A;  3JC6 D;  3O1H A;  2H7V C;  1NHL A;  2Q9Q D;  3N9M A;  3J7Y q;  3OAK A;  3R84 B;  2POH A;  1GZL A;  3NBX X;  3RH3 A;  3RRC A;  2N1T D;  3UUL A;  2PFV A;  1KNZ A;  1LWU C;  1X9V A;  2WMN A;  4WBN E;  4TV8 E;  1NH4 A;  2ZM8 A;  1BR4 A;  3U1A A;  2QGS A;  2V7L A;  1LVF A;  4C90 A;  2LOP A;  3L3P A;  1AFO A;  2E9X D;  1KIL B;  3PUQ A;  2WSS V;  2EHO A;  4I43 B;  4M1P A;  2XDJ A;  2H3R A;  3N4X A;  3ZYM A;  1HFA A;  2WPR A;  3U78 A;  1E5W A;  3P32 A;  4UEL A;  4ZOL E;  1JTH B;  3EVY A;  3H6P A;  2CLY B;  4H9R C;  4BJM A;  3ANW A;  4ZI3 D;  4WY4 D;  2H8P D;  1JO5 A;  1G2C B;  3PUR A;  1ZKE A;  5AVS B;  4HGA A;  1NAF A;  3HE4 B;  3SWY A;  1FU1 A;  3R2P A;  5JR9 C;  1LT9 C;  2X9X A;  1FJP A;  2JMH A;  2V7I A;  3CX8 B;  4IE6 A;  4NUV A;  3HKC E;  1BR2 A;  3CKD A;  1Z56 A;  1QSD A;  3GMI A;  3V2N A;  1YYC A;  1FZC C;  2ZMA A;  4JYB A;  4X1I E;  1URQ B;  2X51 A;  1LGH B;  1IC2 A;  1KFM A;  2FFD C;  3VMZ A;  3WAJ A;  2Q3I A;  5AW8 B;  5DJQ C;  3K8P C;  4BJN A;  1N73 B;  1H8A A;  5CA0 E;  5J2T E;  2KYV A;  1D0Y A;  1O3X A;  3M0A A;  2NTY A;  5LYJ E;  1GD2 E;  4I4T E;  3PUG A;  2MOZ A;  4EIJ A;  5FYM A;  1QL1 A;  3HR0 A;  5AW9 B;  3UUM A;  1YD8 G;  3LID A;  5AW2 B;  2EHO D;  3KFW X;  2JPF A;  3MXZ A;  1J1E B;  2N1G A;  4AQF C;  4J2C A;  1CSB A;  3MKD A;  3Q5W A;  1S9K D;  3BAT A;  2BVM A;  2MTQ A;  4X1Y E;  5HYA A;  3RK2 D;  5DQV A;  2VKO A;  1JTH A;  3HE5 B;  1LTJ B;  2LJL A;  5BMV E;  4MHC A;  1FZG A;  1NWM X;  3EUH A;  1RF1 C;  3HE4 A;  2OYI C;  3LK2 B;  4O9B A;  1G1J A;  3AA0 B;  3I1A A;  1J1D B;  1QUU A;  2C5K T;  2CXL A;  1X79 A;  3AB3 B;  3VMX A;  1FJK A;  5HAX A;  1PFI A;  2NP9 A;  3Q5X A;  3O9X A;  4ZKP A;  4PFO A;  1E1H B;  1N73 A;  4PAG A;  3RKO A;  3KBT A;  3B5N B;  5JQG E;  4JYC A;  1NTZ K;  4LGD E;  5LGU B;  2XQY A;  5TAO A;  4F6R C;  1GL2 C;  4QKN A;  3C4X A;  2XAF B;  1JNM A;  3KV5 A;  2CXF A;  3MIW A;  3LBX B;  3ZMZ B;  5LHG B;  3RK3 D;  3JC6 C;  2Q9Q C;  2JJL A;  4I2L C;  4O4I E;  3HI2 A;  3HA4 A;  2E42 A;  2YO2 A;  2KND A;  2LEH A;  2DHR A;  1L4A B;  2ZM2 A;  2WSE H;  5M4Y A;  4IGU A;  5HXH A;  4KHX A;  2X67 A;  2WAU A;  2N1T C;  2J59 M;  4IE5 A;  4MFR A;  3CX6 B;  4PJL A;  3SOL A;  1M1J B;  3OBV E;  2D5U A;  4ZI7 E;  4XZC A;  2HOD A;  1S9K E;  1WRG A;  1JOC A;  5AVQ B;  2P67 A;  3L36 A;  4OFZ A;  2E9X C;  3ZPO A;  4G2A A;  1JY3 N;  2UXN B;  3C50 A;  2Z4E A;  1LTS C;  4GOU A;  2NTX A;  5CA1 E;  4QX7 B;  4ZI3 C;  4WY4 C;  4U74 A;  2KP8 A;  2XAS B;  1G1I A;  1L0N K;  4A56 A;  2Q9I A;  3SRZ A;  1KZU B;  1LKX A;  3FBL A;  4TX5 A;  4WNK A;  1UX4 A;  2VK9 A;  3AVS A;  2ZM0 A;  5AW4 B;  2N9B A;  2Z5H A;  3GHG B;  2KZ7 B;  3I9W A;  2KLQ A;  2DNX A;  4CI3 B;  3LBX A;  3MAC A;  3CPZ A;  4PNI A;  5EK3 A;  2B1E A;  1FMV A;  1H88 A;  4PK4 A;  3E0Z A;  1FZA A;  3RRW A;  4KBM B;  4WW0 A;  3UUN A;  2YNY A;  3N2G E;  1HGZ A;  2V7J A;  3K3O A;  2WSC H;  2OYH A;  3AA1 B;  4GYR A;  3KQG A;  3PU8 A;  4HKA A;  3C4Z A;  4IE0 A;  3LK3 B;  1N7S A;  1T3J A;  2BZB A;  5AVX B;  5LJN A;  3VHL A;  4UV9 B;  3M65 A;  4BA9 A;  4H9O C;  3MZK B;  4HEA A;  3RPU A;  4I6M C;  2EHO C;  2XHE B;  2HPL A;  3I0Q A;  3E1I A;  1LTA C;  4MLK A;  2DI4 A;  3ZCI A;  1IJ5 A;  1MFZ A;  5LNK A;  5APY A;  4GKG A;  5LHI B;  3RK2 C;  2X9Y A;  1ZR2 A;  2FYZ A;  2HPC B;  1SQV K;  4IST A;  3N9N A;  1DX7 A;  3U1C A;  4GT1 A;  1VPC A;  4X1K E;  5LCY A;  1MIW A;  5GON E;  3QUJ A;  1RF0 A;  3HUS C;  4H9S E;  3AA6 B;  3ZC0 A;  2HG5 D;  1FBM A;  3F57 A;  4PFP A;  5IHY A;  3CVR A;  2PAJ A;  1JCD A;  2C0W A;  2K5B B;  2KMF A;  2CPB A;  2YU2 A;  3RYC E;  3IBP A;  2CMR A;  3N2K E;  4DMV A;  5LG4 A;  3WAK A;  2P1J A;  5ADX L;  3C98 B;  1L0L K;  1DH3 A;  3HD7 B;  1CW5 A;  5ETW A;  4CI2 B;  3KV6 A;  3MUD A;  3P7K A;  2KOG A;  4L5G A;  5HXR A;  3O1J A;  4QHO A;  3LJC A;  1N7S D;  2OA5 A;  1HH0 A;  1MIY A;  3IF8 B;  2FKW B;  2OAR A;  5AW5 B;  2XZR A;  5BU5 A;  2O1J A;  3GA8 A;  3RK3 C;  1FMW A;  2W62 A;  4IE7 A;  5LA6 E;  2KXP B;  4V1A v;  1MZ9 A;  5LBM A;  5FNV E;  5CCH A;  2V7M A;  3HTK B;  1VRB A;  3CWZ B;  3MGN A;  1MMG A;  1GTW A;  2XKM A;  3EDU A;  2GUV A;  3RYI E;  3L35 A;  3B13 A;  2CLY C;  5EK4 A;  4C91 A;  2G0U A;  4QWN B;  5JDF A;  2HPC A;  2Y48 B;  4GIF A;  5J2U E;  2ODU A;  4GK5 E;  3VTP C;  2MJZ A;  5KX5 E;  2LHR A;  4DBQ A;  3PE0 A;  2JQQ A;  5JDG A;  3ONX A;  5KJ7 A;  4ERR A;  5CMZ A;  3IEE A;  3E08 A;  4C7N A;  5FY1 A;  5J1G A;  3BQK A;  2MBG A;  4UF0 B;  2C5I T;  1KQL A;  3C51 A;  1B7T A;  3KVB A;  3M06 A;  2ODV A;  1GU5 A;  1N73 C;  3FHN A;  3RL0 B;  3G3Z A;  1BR1 A;  2YO3 A;  3HD7 A;  1SVF A;  5JDL A;  2HYN A;  5FXW A;  1CI6 B;  2LKM A;  2NPS B;  4EAH A;  4ZHQ E;  2BDE A;  3HUS A;  3U3I A;  3ZMV B;  3ZCJ A;  2RA1 A;  2H7O A;  5AW3 B;  4WBO A;  4ZS2 A;  3VP8 A;  5CCH D;  4EYY R;  3OJA B;  1GK6 A;  2D2S A;  3HTK A;  5L3C B;  1IFI A;  1LWU B;  2V7K A;  4CZZ B;  2ZFC A;  2X0L B;  4JUY A;  4N6J A;  3P8M C;  2CPS A;  1QL2 A;  1ZEE A;  1BR0 A;  5CCG A;  3KDS E;  1H89 A;  4IE4 A;  2A45 G;  1IO4 A;  3LFM A;  3VU7 H;  1A02 F;  1D1C A;  5APU A;  5KJ7 D;  1S35 A;  1NKZ B;  3MTU E;  4ZI2 D;  1SQP K;  1MUU A;  4B6X A;  4OYJ A;  1YTZ I;  2VRS A;  1CUN A;  4GIW A;  1J1D C;  5BU8 B;  1GW4 A;  1NO4 A;  1KIL A;  3C64 A;  1XTG B;  2A45 H;  3N9Q A;  3PUS A;  2ZXE B;  3O4X E;  3V5U A;  3HD7 D;  2CE7 A;  3M9B A;  4I1L A;  1N7L A;  1FZC B;  3I0O A;  2GK9 A;  2Y6X A;  1DEB A;  2K48 A;  3NFQ A;  4DBR A;  4K0U A;  4EOT A;  1G2C A;  4PJM A;  1JMM A;  1CI6 A;  3ZYL A;  3CQX C;  1M7L A;  1JCC A;  2NPS A;  1T98 A;  3I9Y A;  3ZEF B;  1JY2 O;  3UT5 E;  3CQG B;  2LSY A;  4CI1 B;  2Z5I A;  2DLR A;  4AKG A;  4AKL A;  4PK5 A;  3RC3 A;  1JY3 O;  2YKO A;  4EIW A;  1ZLL A;  2VL8 A;  2OYH C;  3OJA A;  1FOS E;  1URQ A;  1FZB A;  3U59 A;  1D0X A;  3BRT B;  4PJJ A;  2C9L Y;  3KIN B;  1N7S C;  3Q2M A;  4L9I A;  3ZJ2 A;  5CCG D;  1M1J C;  5CJ0 A;  2L8K A;  5AFU L;  5APS A;  1AJ3 A;  1W2E A;  3H3A A;  2O01 H;  4PJN A;  1HG5 A;  4XBF B;  4ILU A;  4OH8 B;  3S4U A;  4ANJ A;  1MMD A;  2NW7 A;  5APV A;  5KDM C;  2VAS A;  1KIL D;  3NRY A;  1RF1 B;  1ZHC A;  3ZYK A;  2OYI B;  3O1I A;  1IAP A;  5AVV B;  1HUC A;  1HF8 A;  3BK9 A;  3NZP A;  1RF0 C;  2W27 A;  1A02 J;  3HE5 A;  4C46 A;  2V1D B;  1LTJ A;  1D1A A;  1XTC C;  1JUN A;  2C5J A;  2WMO A;  2NW9 A;  5LGT B;  4G63 A;  2NPS D;  5FP3 A;  2KLV A;  3SWF A;  1HG2 A;  3A2A A;  4Y99 B;  3UUX B;  5HWY A;  5JRC B;  2WWW A;  2I59 A;  2VWA A;  3FXD B;  2YU1 A;  4H9P C;  2K9A A;  1GL2 B;  1URQ D;  4ADZ A;  5KLV K;  5FMN A;  2HH7 A;  4AYC A;  1IFM A;  2LOS A;  1SFC B;  1OWA A;  2WM9 A;  4I55 E;  3AAE B;  2Q9Q B;  2W63 A;  1WYB A;  5BVZ A;  1ZR4 A;  3LIE A;  3B5N A;  3FB2 A;  4KP3 C;  5CCH C;  3BQL A;  3GN5 B;  4PW8 A;  2ZLY A;  2N1T B;  4XAX B;  3II6 A;  3QC9 A;  1WR6 A;  4Z8X A;  3N9L A;  4O4H E;  5AVT B;  1GW3 A;  4IDZ A;  3BVH A;  1US7 B;  2XAQ B;  1VDF A;  5HWX A;  2IX7 C;  3KYQ A;  1HWT C;  3N9P A;  3LK4 2;  3HKD E;  2E9X B;  4E7S A;  2X9W A;  3V2Q A;  4O4L E;  1L4A A;  4FJO A;  2J58 A;  3TK1 A;  1GU4 A;  2KB7 P;  4AXP A;  1JY2 P;  3Q9D A;  5KJ7 C;  5L3B B;  2W6A A;  3MK7 C;  3HRN A;  1YKE B;  4DMW A;  4IIJ E;  4ZI2 C;  1M1J A;  4WY4 B;  2LSJ A;  1S94 A;  1GK4 A;  5IYZ E;  4L0R A;  1YKH B;  2IFM A;  2R5D A;  4C7R A;  4QX8 B;  4YFS A;  5APW A;  3UTK A;  4IFM A;  5LJM A;  1MNE A;  3B8E B;  2CXD A;  3K3Q C;  5FXX A;  1V9D A;  1FZE A;  2WZ7 A;  1SP4 A;  4WBA A;  4TV9 E;  3HD7 C;  2C9N Y;  2NWB A;  5LHH B;  1ZV8 A;  2HLO A;  5JDM A;  1RE3 A;  5F3J A;  3ZLI A;  1NOH A;  4WB4 A;  1KK7 A;  2A72 A;  3B5N D;  1RY3 A;  1X8Y A;  4YJ2 E;  3K3N A;  5CJ4 A;  3MA9 A;  2W0G A;  1IFN A;  2QM7 A;  3ZMS B;  2V26 A;  2JJ9 A;  3EDV A;  3H32 B;  3GHG A;  3D0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...