1OWAA

Solution structural studies on human erythrocyte alpha spectrin n terminal tetramerization domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, erythrocyte
publication title Solution structural studies on human erythrocyte alpha-spectrin tetramerization site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 53
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1owaA01
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1owaA02
5AVQB 3LIEA 4KHXA 3M0AA 5AVXB 5AW4B 4B86A 3SWFA 1GD2E 3TYYA 1KQLA 3M06A 2XZRA 1H8AA 3P8MC 1A02J 4C7NB 1CZQA 4HYTB 4C7NA 4DZOA 2P7JA 5APXA 3T97A 5APSA 3VMYA 1X8YA 2N9BA 3UULA 3NMDA 5AVYB 4C46A 2QM8A 1FAVA 1J2JB 4I6MC 3L35A 3P7KA 5AVVB 3A5TA 1JUNA 4AUWA 3FB2A 1G2CB 5AVZB 3V5BA 2WTYA 1YYCA 5AW0B 3LIDA 3KDPB 1NWQA 1SP4A 2Z5HA 5APTA 5AW2B 3VN0A 1FOSE 2WWWA 3UUMA 3HE4A 3MD0A 5AVRB 1MUUA 2Q5UA 2ZXEB 5APWA 3VYIA 1AJ3A 3M9HA 2WT7B 5AW1B 2WT7A 4JYCA 2SPCA 1NAFA 4RESB 2YO3A 2C9LY 5AVTB 2Q7CA 1MFZA 2R32A 1FOSF 1WLXA 4GT1A 5AVSB 1GK6A 1T2KD 1HBWA 3LBXB 4JYBA 5AW7B 1GTWA 3LBXA 2XV5A 3A2AA 2ODUA 3V4WA 4I2LC 2YO2A 5AW8B 3VTPC 2E42A 1S35A 1CUNA 3P32A 3UIAA 2QM7A 3NFQA 5APQA 1A02F 3M91A 2JJLA 1MV8A 1JNMA 1IO4A 1HJBA 3F31A 4XE5B 2P2UA 2C9NY 2R5BA 1HCIA 2WPSA 2WPQA 1OWAA 1CI6B 1CI6A 2W27A 5APVA 2ODVA 3TNUB 5AVUB 3TNUA 3B8EB 2E43A 1QUUA 1S9KE 3V4QA 1T2KC 3A3YB 1GK4A 2IPPA 1GU5A 2H7HA 2VRSA 2R3CA 5CMZA 3KQGA 3L37A 3IR9A 3VMZA 4EOTA 1H89A 5AW3B 1GU4A 3I5CA 4AYCA 2BASA 5AW9B 3MGNA 3O8ZA 2W6AA 5AW5B 4LC1A 1S9KD 5AVWB 1HWTC 3UUNA 3VMXA 1H88A 3M0DA 3OAKA 5AW6B 1HUCA 1OXZA 2R5DA 2WPRA 1DH3A 2P67A 3L36A 1GZLA 4M3LA 4AQRD 5APUA 2Q3IA 2Z5IA 1U5PA 2KP8A 1U4QA 1SLQA 5APYA 3EDVA 2YNYA 3NTNA 3NXSA 3TK1A 3A7OA 2ZFCA 3HTKA 1CSBA 2XU6A 3PE0A 3HE5B 3HE4B 3M9BA 3HE5A 4GKGA
chains in the Genus database with same CATH superfamily
1NTZG 2B87B 1N86A 1USDA 4H9NC 2M8RA 3VKHA 2JMKA 1GW3A 2P7JA 3T97A 5APSA 1W9RA 4AXPA 3F5HA 2MPKA 5JQGE 1PGPA 5FVLA 5LGUB 4N3YB 2CWYA 2Q6QA 3CWBE 4DIDB 3MUDC 5CCGD 4CXXA 2DI4A 2VWAA 2VL0A 3LIDA 2VB6A 4UF0A 4QMAA 3JSVC 4I4TE 3IN6A 3D71A 4IFDK 3N2KE 3L74J 3ZMUB 4QKNA 5AVRB 4OGQC 2KSJA 1HX1B 1EDIA 4NPPA 2PTFA 3TGUJ 4RESB 5KLVK 5CGMA 2VURA 4WZXA 3N9NA 5LHGB 5AVTB 2W6JH 1IFIA 2ZXXA 3FBZA 2QYWA 5JDFA 2OGUA 3PUSA 5LYJE 1IBKT 2QJKC 3OA7A 4W80A 4JI3T 3L74D 3GWHA 4IE0A 1KC8Q 2Q9IA 1IO4A 3QB5A 4WYVA 5FXXA 5LP6E 2NPSC 3GG2A 3AAAB 1MMGA 1L4AD 2OYIB 2XHEB 4A5XA 3TGUD 1PGJA 2ZM6T 1ZR2A 2X68A 3UFEA 3EQ2A 1KILB 3MKDA 3TNUB 5AVUB 3ZEFB 1FZBA 3IA3A 5CBOA 4O4HE 1GU5A 4ZI7E 2W4XA 3ZJ1A 3B5NB 3PUGA 3E1IA 3RF1A 3KQGA 3HTKB 4ILBA 1R5LA 2WDQA 3NWIA 1VF5B 4PD4D 4U74A 1IK7A 1AFOA 1UIIA 3ZYMA 2W6AA 2WP9A 4P0AA 1KNZA 1JOCA 2KZIA 2Y48B 3BQKA 2QA7A 1NTKE 1WRDA 5DJTB 2KLQA 1FMWA 5APUA 2Y8DA 3CK6A 3V5UA 1SLQA 2LXCB 3RK2D 1ZMEC 2Q9QA 2JQHA 2C0XA 4IIJE 3ZJ2A 1JMBA 4L75A 5FYMA 2HODA 3AE3C 2GA1A 4LF8T 5E0OA 2UU9T 1T3JA 2WPVB 1KEYA 3HE5A 1K04A 5KAIE 3G4SP 2FJEA 2E8IA 2FUPA 3HRNA 2J4GA 3F2EA 4DBRA 4UB6H 1URQC 3V2QA 1KB9I 5KLIC 4EI2A 4XAXB 1Z8UA 3HI2A 4EEBA 3D0TA 3EI0A 3H1LJ 1RE4C 5KTBA 2HLOA 2O3JA 1R8EA 1NJIQ 2CM0A 1ZOYC 5CA1E 1PFIA 5L8RJ 5AW0B 4DR4T 3VN0A 5KLVJ 4LF5T 1W0BA 4ILCA 1PL5A 2PRRA 1LT9C 4Z90A 1PIXA 2WT7A 3NRYA 3VMAA 1M56D 3H1LD 2PG8A 2YN6A 1XZYA 1UURA 4DR1T 1O3XA 3N2OA 2V7QH 1DIPA 1KF6A 1B7TA 2LSGA 3LBXB 5LG4A 1JY3N 4HFDA 2KSRA 4TLFA 1NU1J 3MHVA 2CMRA 3ZKRA 1ZHCA 3AEFA 4WBAA 4GOEA 5KLVD 3KINB 3AEDA 1UUSA 1FJGT 3S1KA 1FZAA 4R4MA 2PFVA 3UU3A 2JJLA 2Q1KA 3L75E 3Q5EA 3P8CE 2F4VT 1D1BA 1SFCC 1ZEEA 1LNQA 4ILAA 2OTJP 3UUXB 4EZ4A 1SQPK 3Q1MA 1WFDA 3LK42 3OKQA 1L0NE 1LT1A 2H89A 3MIWA 2IYOA 3H1KJ 4H63H 2OYHC 2E5TA 4Z91A 1QUUA 4HJGH 4JBZA 1NU1D 3KZIE 3RL0B 3L09A 1XMOT 3VR8A 4TV9E 1VQPP 2R3CA 2YOEA 2R6GF 5CMZA 5E79H 3V5SA 5GTHH 3PHLA 3KDSE 2YDQA 2QA4P 4EOTA 3N9MA 3AAEB 3PJAA 4A98A 4U3CA 1KB9H 4O8SA 3P4RA 5FL1A 4DV3T 3VMXA 3H1KD 1S1CX 5AW6B 3SWYA 2E9XB 5LXTE 2V5CA 3CMAP 1RF1A 3L72G 5FXWA 3RL0D 4H9PC 1OX3A 3MUDA 1U5PA 2XQ9A 5K5GB 5C3JA 5HEGA 2YIUB 4ERRA 1BCCJ 4DV5T 1VOMA 2X0HA 3VKGA 4DR3T 5LGTB 4Z8XA 5FXVA 1YTZT 5AVXB 3SWFA 3BRVB 3VP9A 5HXEA 4Y99B 3M06A 4NPEA 1YTZI 4V1Av 4HYTB 2UXXB 2J59M 1FJKA 5IYZE 1JB0J 3FHNA 3WU2H 4ZS3A 1N7LA 2HG5D 4C46A 3DTOA 4IOIH 1US7B 1JY2N 4WY4B 2LSIA 4DR5T 1QLED 2E5LT 1BCCD 2QEXP 2RN0A 5LOVE 1WR0A 5AVZB 3V5BA 1L0LG 2XQ7A 3CPWO 2BKPA 3C64A 2CLYC 3AE9A 3CX7B 4ZI2C 4HWCA 1WCRA 2RA1A 2NPSA 2IDOB 3O6QA 2RP4A 1AJ3A 3HA4A 1VCSA 5JR9C 5GONE 1EZVE 2WS3A 2E5VA 1XNQT 2ZT9C 2OTLP 1ZP0C 2K9JA 3H32B 4AI6A 3HD7C 2KZJA 4DCKA 1IJ5A 2LXBA 2KNCB 4EYYQ 2YMKA 3PUVF 3P32A 1SQPG 3CX8B 3R6NA 5HXHA 2IBZE 4YTNA 1SQBJ 4C91A 3L70G 3KBTA 5H6RB 3ABVC 1M7KA 1S5LH 1GL2A 2QRXA 3E22E 5EK4A 1BR2A 5AQUB 3V4QA 2X9YA 3ANWA 2W62A 2E2AA 3CC4P 1NENA 4HWFA 4I0UA 4A97A 1DD4A 4D6TJ 1HS7A 1XTGB 3U1AA 1EZ3A 4P09A 4RO0A 4HFHA 1VQOP 1LP1B 4LC1A 2BKOA 2OYIC 2AEFA 3KV4A 2VASA 2BS2A 1R8IA 1PPJD 4ZS2A 2BCCE 2D2CD 2XTLA 3CCRP 5CCHD 1RE4A 1DEBA 4AQRD 3Q5SA 1ZOYA 1YQ3C 2XNXA 1PP9G 4BRYB 2FXPA 3B5NC 4D6TD 4R4LA 4HKZH 2XDJA 2LSYA 3EHZA 1LTJB 3ZN0B 2K9YA 1VF5C 3AE8C 1N7SD 4JI7T 3RGUA 5L4EA 4GKGA 1JNRA 5JDGA 2KMFA 5AVQB 3LIEA 4U2YA 2IDBA 5M4YA 3CX5D 1FE6A 4C7NB 1SQXK 5LNKA 2CRBA 2JWAA 3ITKA 2N9BA 2QGSA 4KP3C 4X1KE 1NTME 1LRZA 2C0WA 2HPLA 3V2PA 1QSDA 3IFMA 2N1GA 4PK4A 1NWQA 5LB7B 1FMVA 3K8PC 5LGNB 1J1DB 3PUWF 2XZEA 2FFDB 2ZXEB 3FWNA 3QWOC 1SFCA 3CVRA 4U7YA 1QLBA 1D0YA 4TWFA 5LBMA 3G6EP 1MFZA 4WVZA 1VQ8P 3H1IJ 1BGYJ 3O1HA 4HWIB 2XV5A 3A0HH 3V6IA 3A2AA 3RK3B 2LHNA 2E75B 2D2SA 4UV8B 1HR0T 2QM7A 3Q3DA 1NVOA 3MJXA 2PAJA 2DWKA 3L71E 1M1JC 2BKNA 2LM2A 2AE9A 3SFDC 3H3AA 1GMJA 1NTKJ 4CXYA 5L3DB 2P2UA 2OLTA 2WPQA 3H1ID 1BGYD 5AQSB 2W2UA 2W90A 2E43A 1T98A 1S9KE 3ZYLA 1VQ5P 1ZV8A 2KS1A 3EFFK 3RK3D 4H44D 1JCDA 3LW5H 1ZLLA 2BZBA 1GU4A 4OGQD 1TU3F 1NTKD 3AE4C 3C4WA 4YT0A 4YY3T 4NPFX 3MGNA 3L73G 2PGDA 1HWTC 1T8BA 4AISA 5ABHA 4LMLA 4JI8T 1KYOE 2WPRA 2WSFJ 4EV6A 3I9WA 1KTMA 5TISH 1AVYA 5KJ7D 3SFEC 2LSKA 3ONLC 2WZIA 5APYA 1QGKB 1HNZT 3MK7C 2Q3EA 3P4WA 3NTNA 2UUAT 3SWKA 2XKMA 1JTHA 1SQXG 1Y01A 1T6AA 3ZN1B 2XU6A 1Z0PA 2D0TA 2NPSD 2M0BA 1KB9E 5DQVA 3RC8A 2NTXA 2QJPB 2ZVNB 2RMZA 1IFMA 2PP6A 3K3NA 2E9XC 2LEHA 5JR9A 2V7MA 3SRZA 1OMIA 4HFIA 2PJQA 2IC9A 2P1JA 1D0XA 1ZP0A 1JY2O 3HD7A 1UX4A 1J5WA 2YIUC 1IFNA 4EZHA 2UXBT 2IFNA 2YINA 3HKBE 1ZV4X 1FZEA 2XM2A 1L0NJ 4F8HA 2AXTE 3M9HA 2W6BA 3KVAA 2CA5A 2CCQA 2SPCA 1NAFA 2YO3A 3ZMVB 2YXQB 5H2FH 5JRCB 4X62T 3SSUA 4U31A 2YDRA 5AVSB 1GK6A 3RC3A 2Z4EA 4I1LA 4DV7T 3P8CD 2ODUA 4JF7A 2Q9QC 2A06G 1JY3P 5JTGA 1QEXA 1CUNA 1L0ND 3UIAA 1ZRTE 4ASWA 4G63A 5DJQC 3WAKA 2KYVA 2RKLA 2E74B 1G8XA 2XPKA 3AXJB 3OPCA 2OYIA 1URQD 4CXWA 4N78D 1YHQP 2SPZA 3ZLIA 1CI6B 3PJSK 3ZPOA 5HWXA 3TNUA 1IBMT 2E76D 4OYKA 1T2KC 1YQ3A 4ZMDA 1FIOA 5LBQB 1BE3G 2A06D 3L72E 4GODA 3B5NA 2CXLA 2YDSA 4AQFA 1H89A 1VQ9P 1LVKA 1KFYA 4YLHA 1HFAA 5F5WA 4IDNA 2MYSA 5A1LA 3L3PA 4O4IE 3RHWA 4X64T 1J1EB 2PBIA 3UT5E 1H88A 4B3MT 3B5MA 2R5DA 1BSHA 2VKHA 5FP3A 3WMM0 3L36A 3RYIE 1ZN5A 1MIWA 3JC6C 4QH5A 2FJAA 4MBQA 3PTRB 3RYCE 4O9BA 2W00A 1MFTA 1L0LE 4KX6A 2K24A 2DLRA 3H1HJ 4CN6A 3QOFA 2YEVC 1GD2E 4BJNA 2AEJA 1SQQE 2J5UA 2FYUE 3P8MC 1RQVA 1Y9BA 3FXDB 5FXZA 2OARA 2H89C 2FYNC 5JDHA 2AXCA 3BQLA 1FAVA 4I6MC 3NBXX 5AVVB 1JMMA 3IF8B 1QL1A 3BCCE 3QUJA 4ISTA 4ZKPA 4UXNB 2YMYA 3H1HD 2JQ9A 4IDOA 5HEJA 2W61A 5J0ZA 1Q2NA 2BG9C 1MKMA 1I94T 1LTBC 3MD0A 3SFDA 3FZHB 1LWUB 2UUCT 2P9BA 1EDJA 2XNDH 3ONXA 4F6RC 1HTLC 1HBWA 1RF1C 1IFDA 1GTWA 3LBXA 3Q5RA 5L3CB 3KYQA 1PV3A 2EHOC 1KMIZ 3V4WA 4YXWH 1DEEG 2WDVA 3BATA 2CPTA 2KI7B 3OYXA 1DX7A 1LKXA 1A02F 4YXDC 1FZCB 1LVFA 1J1DC 3AE4A 1HG2A 3HKEE 2BCCJ 3RPUA 3L74G 2FFDC 3AA0B 2V4HA 1L4AB 3H1JE 2C9NY 2LJLA 5J2TE 3TGUG 2V1DB 4IL6H 1FJPA 1VCTA 4PD4I 1WYCA 5HEOA 3SFEA 4H13D 4JV5T 2LKMA 3CQXC 3VMZA 3LFMA 4DV4T 2BCCD 3AE9C 2LKHA 1ZW0A 1NU1K 3B57A 2CXFA 1YQ4C 2H43A 2O1JA 1NTMJ 2BG9E 2E9XA 5AQIB 1HUCA 4ZKUA 2ZT9D 3BASA 3HD7D 4UIGA 2NTYA 2V7JA 5CFBA 3GN5B 4XA4A 1RQUA 2KLVA 5KAFH 1U4QA 3RK2B 3O1IA 2X9WA 4OH8B 3TSIA 4A7PA 4JEUB 3PURA 5AQGB 3HE4B 2DHRA 4U3FE 1MNDA 5HAXA 3PUZF 1YKHB 2H8PD 1NTMD 2XZRA 2YK0A 1YJWP 1SQVJ 4PJMA 1GL2C 4HB1A 5APXA 4LLHA 4PFOA 4EOZB 1KFNA 2A3DA 2NRGA 4WY4A 3K3OA 5BMVE 3FB2A 5KKZB 5IUXA 1SE7A 5DABA 3M3ZB 3L71J 1MNEA 2WTYA 4CN4A 3A8YC 5FL0A 1IBLT 1Y8AA 3N9PA 2HHHT 4L5GA 2WWWA 2HPCB 3UUMA 2QJPC 3C8VA 2WDRA 1U57A 1XMQT 3P4SA 3Q5XA 2JJ9A 1SQVD 3S9OA 4PD4H 1LTTC 2JMHA 2C9LY 4O2AE 2L9QA 2N1TD 4H0LD 3H1LG 5JDLA 4B3ST 3L71D 3H32A 2XQ6A 3ZC1A 3RYHE 3W15B 1OVVA 1KORA 3CCEP 3AEEC 2XAJB 5KLVG 2VKJA 1JNMA 2V5DA 3PV0F 4PV1D 2KNDA 3H6PA 4HKAA 4PK5A 1QX8A 2WMMA 5BR8T 5L2LA 1HCIA 3L73E 1Q82Q 2WAUA 5L47A 5APVA 2ZMAA 3LDQB 1DD3A 3P50A 5AQPB 2KINB 1Q81Q 5JDNA 1XDOA 3UU8A 4UVBB 1S94A 1SS1A 2ES0A 2PFXA 3RBZA 1NU1G 2V8SV 3F57A 1X22A 4ZXLA 5HEHA 1KQGB 1PGOA 1Q86Q 4AKGA 1KYOD 1T3UA 4PJ0H 5FNVE 3IAOA 3O8ZA 2HPJA 2XQ8A 2E74C 1LP1A 1NKNA 2NZ2A 2NP9A 1OXZA 3H1KG 1M7LA 2N2NA 4BA9A 3NVOA 2XQYA 4HE8A 4M3LA 1GZLA 1SQBK 1UCUA 1DU2A 4X5TA 2Q3IA 1OW8A 2CWOA 4BRYA 4DT0A 1JCCA 5GTIH 2YKQA 4UB8E 4QWNB 2BBHA 5FY1A 4UF0B 4WBOA 3NXSA 1LTJA 1MIYA 2ZFCA 3ZCIA 3KPEA 4IDQA 3K3QC 2P58A 2BG9A 4UVCB 2JDIH 4YFSA 1J1EC 2VKOA 1XNRT 2L91A 2K9AA 4CQIA 2BBJA 4K35A 5JREA 1CZQA 4C7NA 1D1CA 5AQMB 4EGWA 2WM9A 4TUYE 4Q25A 1IFJA 3T1YT 2ZJSE 1X9VA 1RHZB 1EQ7A 4CI3B 3AEBC 4YHHT 5AQNB 1NHLA 2XQAA 2QIWA 2ZYAA 2EHOA 2CHOA 1YJ9P 1BCCG 1SP4A 2Z5HA 1D7MA 2K88A 4YXDA 4YSZA 5L3FB 3JCUE 1MUUA 3LJCA 4IDZA 2FFDA 1N73B 3BVHA 2V6YB 2C5IT 4O2BE 1XDPA 1S5LX 2Q7CA 1MMDA 3CQCB 2UXDT 2I0MA 1ZRTD 5AW7B 5C39A 3MA9A 2IX7C 4EB6E 3CC2P 2J1DG 3CXHD 5AW8B 1OEDB 3RX6A 4EXTA 5C8YE 4LMKA 4B3RT 2JRKA 3FX0A 4MFRA 1BDDA 3M91A 3QK6A 4B6XA 1E2AA 1D0ZA 4JLEA 1G1JA 2W8ZA 1LWUC 1YQ4A 2CBIA 2QE7H 5B66H 1I6ZA 1LTSC 2M5AB 2H3RA 3O9XA 3WUTA 3A3YB 1P84D 4JQ0D 5AQLB 5AQJB 4X1IE 4H9OC 3RGLA 1RE3C 3ESLA 1YW0A 4ISSA 4JUYA 5ABEA 3N9LA 1SQQJ 5AW3B 2FYUJ 2B89A 4AYCA 4ZNCA 1FZCC 4X65T 4OVNF 3N5LA 3CXHH 4WBNE 1SQBG 3R2PA 3IHRA 4H9RC 4IT4A 3OAKA 3AAIA 1NGMB 3AVSA 2D2CB 3BCCJ 2MJZA 3Q2YA 2RPAA 1PPJG 2GUSA 2WITA 1YKEB 1NTKK 5KDMC 2C0SA 2Q9QD 1UIXA 2WY2A 2DW3A 5FVKA 3Q2MA 3PRJA 1SQQD 2FYUD 3CX5I 4D6TG 1N7SB 2ACXA 3OJAA 5LHHB 1P84H 1SQBD 3FGAD 2DCFA 2WWVA 5ABGA 5BVZA 1KQLA 4NXMT 1H8AA 4EYYR 1KK7A 3BCCD 1E79H 1NTZE 3M0DC 3AE5A 1YITP 3CWBJ 1KILC 4TWHA 4X20E 2GK9A 1KQFB 1R5SA 2CK3H 1G2CB 3P4PA 3ZCJA 2FXOA 1HJ0A 4U33A 3PU8A 4JYAT 3AEEA 2MBGA 3SOLA 2Y0DA 4AQFC 5KMGP 1YD8G 3H1JJ 1VQMP 4TNVA 3FXEB 5DQWA 4U72A 5APWA 3CWBD 5AW1B 3X1DA 2DL1A 3L74E 4GOUA 3JADA 3WAJA 3MZKB 1QL2A 2QSIA 5JRCA 5CA0E 3F89A 3TGUE 1SVFA 2L8KA 1W5CE 5LA6E 4PJJA 1RF0C 5B5EH 1HF9A 2FKWB 2J47A 3PLNA 2YXRB 3VTPC 3H1JD 1H0TA 4WW0A 2WU2A 3MXZA 3PJAJ 3A0BH 3N7NA 1CW5A 3AXJA 4H9QC 2R44A 4E7SA 1JO5A 3EVYA 2LRKA 2G3AA 4UB6E 5KX5E 2VVSA 2A45H 1CI6A 4JPZB 1L0NK 2KOGA 3H1IG 1BGYG 1AV1A 4AKHA 3CX5H 1LTGC 3U3IA 4U3FJ 5KXJA 1KILE 2KWIB 4H44B 1HNWT 4LFCT 1NAYA 1E1HB 5CHXA 2XY8B 5HCJA 5AW9B 4OGQB 1BR1A 1K05A 5F8PA 1NTKG 3B71A 3A5XA 4I55E 2N9DA 2ZYDA 4LFBT 2B1EA 2JEEA 5HCMA 1DH3A 3AE7C 4NUVA 2R3SA 3Q9DA 3AEBA 4U3FD 4XBFB 3HL6A 2JP3A 5HWYA 3EDVA 2YNYA 2HH7A 3HUSB 2JQKA 3TK1A 2FBWC 3CC7P 1MMAA 3KV6A 2OV9A 1U7JA 5FY7A 3R84B 3D70A 2NPSB 1M62A 3O6QB 5BU5A 3BRTB 3G3ZA 4QH1A 3FXDA 3G71P 3ZC0A 2WSCJ 3TF5A 1W2BO 3UULA 2I1JA 4K0UA 2K9JB 3I56P 3P7KA 3W68A 1KNPA 4EIJA 2XAHB 2C5JA 2V26A 1NYHA 3NZQA 3RL0C 3H1LE 3H3MA 5E79E 2JPFA 4KBMB 5GTHE 3CCQP 1YYCA 5JDMA 3QH9A 5F3JA 3AEGC 3CMLA 3ZT6A 5L3BB 3V2NA 2B87A 5KLVE 1LWUA 5H6QB 3J7Yq 1T72A 1IZNB 2BVLA 1MIVA 3PUQA 2R32A 3RQWA 4GT1A 4GIFA 3CD6P 3I0QA 4JYBA 3H37A 3E1RA 3SS1A 2I1KA 3GF7A 4DV0T 3AECC 1RE3A 1FZGA 5IWAT 3L75J 3RKGA 5AFUL 2X67A 1NU1E 3CIRA 4KUMB 2NR4A 1FZCA 1L0NG 5KAIH 3C50A 3ZMSB 1L4AA 1GL2D 1URQB 4Y99C 5LJNA 3U78A 3WU2E 1KN7A 2XAFB 3NKZA 3ZMTB 2OYOA 1VQ4P 1FDOA 2E76B 4WY4C 2D5UA 2KZ7B 3L75D 2ZLYA 3HKDE 1GW4A 4PJNA 1GDTA 2WSFH 1N32T 1OEDC 3LG7A 2WSEJ 3CL3D 3O4XE 4TZ4C 1HNXT 2KLUA 2XAGB 1LT9B 1Q7YQ 2ZYGA 3Q5PA 2DWGA 2Y6XA 3UUNA 4ADZA 3M0DA 3CQGB 1OW6A 1KILA 3VRAA 4A56A 4ASVA 3GN5A 2KT9A 4NIQA 1LJ2A 2Y0CA 1Y64B 4CN1A 1FEWA 4TN7B 1HF8A 4TV8E 3HTKA 1KV4A 2KSEA 4PW8A 5EZYE 1IFPA 5EFWB 1YXRA 4AKRB 4KHXA 2ITAA 3BK9A 4COFA 3LSVA 1S5LE 3T1HT 4DV2T 3FZLB 2OYHB 3RIAA 2W63A 2D2CC 2WCAA 3NMDA 1FDMA 1J2JB 4IREA 3PH0A 3KZIH 1K8AQ 1RF0A 1WMKA 2IUBA 4ZZBA 1NTMK 3W67A 4TWDA 4JI1T 2ACZA 2FXMA 4DMVA 3N9OA 4BWNA 1NOHA 3ZT7A 1N7SC 2K5BB 3H1HG 4ZHQE 1SFCD 1OZHA 2HPCA 5L3EB 1WRGA 3VYIA 1OEDE 4K0KT 1J1JA 2WSEH 3Q5WA 2QVAA 2IW5B 4QX7B 4JYCA 4IHJE 5HXSA 1HH0A 2HN2A 2YKSA 2BS3A 2X9HA 3PP5A 4PFPA 4UV9B 4IL6X 2GUVA 4HTEA 1USEA 2X66A 1SQVK 2YO2A 3VU7H 1JY2P 2E42A 3VP8A 1LTJC 2LM9A 3UQ4A 2NW7A 4CI2B 3G9RA 4O4JE 3UFGA 5AQQB 2JO1A 1EZVD 1HJBA 1SQPE 2WZHA 4IE5A 4IDPA 4JI2T 2XUEA 4AIUA 3EFGA 4J2CA 5L3GB 1OWAA 2P10A 4U7JA 3L70E 3RI5A 3AE7A 2YU1A 4E7ZA 3IEEA 4GIWA 5LHIB 1LTIC 1PPJE 3TDKA 1M90Q 4H13B 2IBZD 5EK3A 3I0OA 4YJ2E 5LG3A 2UXCT 1S3JA 4X66T 4Y28J 2FBWA 1AQTA 2LHRA 3A0BE 2WSSV 1NTZJ 4HEAA 1K9MQ 4QX8B 4D6TE 2BCCG 3PDYA 5JR9B 4YPCA 3UU6A 1SA0E 2ZT9B 2K1AA 3CX5E 3A0HE 1RY3A 3HD7B 1KZUB 3CWZB 2O1KA 2Z5IA 4IGUA 2HYNA 3RK3C 1VL2A 2MOZA 1PP9E 4H44C 3P7IA 1NTZD 2V7LA 4ZI2D 2E75C 2D0UA 4AKIA 2H88C 3AEGA 1FZFA 2UWJE 1FU1A 3PUYF 2UUBT 1A02J 4EYUA 3C1LA 4LF6T 4N6JA 1YI2P 3GMAA 4GKJT 1FDIA 1UK5A 1NTMG 2VK9A 2XSBA 3IF4A 2UXNB 1E5WA 4PK6A 3JAEA 3KFWX 5KJ7C 2M6IA 1HVVA 2MAWA 5ABFB 3AECA 1EC5A 1X79B 2XQ3A 3HUSC 3KDPB 4CPGA 3QNUA 5IHYA 2XQ4A 5CJ5A 4XFJA 1AQ5A 3CLQA 3PUAA 2Q5UA 2B76A 2IAKA 4MHCA 3RRCA 4HWDA 1N73A 2V6YA 1J5ET 1SQVG 1FOSF 1YIJP 3JAFA 2IZ0A 5TISE 2N1TB 4H0LB 2HR3A 1G1IA 1KQSO 2Y9ZA 3H1IE 2IC6A 1BGYE 4I2LC 3L71G 1OEDA 3GHGB 5APQA 4C90A 4YSYA 2LT3A 3UUBA 1JNZA 1L2PA 4MALA 3RRWA 3RK3E 4GK5E 2V7QJ 4PV1B 3I9YA 2WPSA 1IC2A 2H7OA 1KILD 3AE5C 2HN1A 4HGAA 2L5GB 3VRBA 3U59A 3OYZA 1EDLA 2M5AA 3QB5K 3SWHA 3RYFE 4B3TT 1NWMX 3RKOA 1YJNP 3E08A 3B5ND 1KYOI 3T8OA 1H7CA 2G0UA 2WVRA 3L37A 1VF5D 2A2FX 2CHNA 4ZOLE 3AE6C 1KNRA 4DV6T 2KNCA 2JQQA 4L0RA 3I5CA 3UTKA 5CJ4A 3N4XA 3CI9A 1AVOA 4RJTA 1S9KD 3FZMB 2KB7P 1Y47A 4KMCA 2YKOA 1N2DC 4EDFA 4W7ZA 5H2FE 3ZSTA 3GLMA 3VHLA 5CCHA 1Q90D 2E76C 2BEZF 1D1AA 2WU5A 3RIUA 2NW9A 4JEHB 3AB3B 3TKLB 1L0VA 4HN9A 4YTPC 1M1JB 4IE6A 1N7SA 3S4RA 1L0LK 4B86A 5AW4B 1SQXE 3KV5A 3LK2B 3C4ZA 2POHA 1VRBA 4L76A 3CCVP 3EUHA 1FS0E 1PZQA 3CKDA 3BQIA 3T97B 2K3RA 1SQQK 2FYUK 2Y9YA 4U7IA 2QM8A 2L3LA 3A5TA 2H7VC 5J1GA 3S4UA 3FWLA 1RH5B 3KVBA 1KB9D 1G2CA 2WB5A 3NRXA 2NW8A 1WR6A 2VKDA 1SUMB 3TLSA 3WUVA 2LKGA 4YTMA 4ZI3C 5APTA 3RH3A 3TLVA 3MACA 3FXEA 3AEAC 5HYAA 2BS4A 5L4HA 4I7ZB 2I6HA 3EABA 2LE8A 4G2AA 4YJ3E 1EDKA 1HGZA 1S72P 3CXHI 1WLXA 1KYOH 2ZM0A 2Z6EA 4GK0E 4KHZF 4N78E 1EXJA 2D9DA 3I1AA 3VOPA 3TLTA 2KK7A 2WQYC 2LOPA 3AA1B 2X0LB 1MV8A 2A06E 2YU2A 2ZM8A 4LF9T 4DR2T 3B4SA 3CX6B 1P84I 1JM0A 1M57D 1BSNA 2IHR1 2ODVA 5LMNT 1N34T 1OIPA 3B8EB 3L72J 2IIUA 4JI4T 3JC22 2I8DA 3N2GE 3GA8A 4UELA 3ETVA 5CCGC 3MTUE 1BE3E 4HFVA 5BU8B 3RLFF 3PU3A 2H88A 4I50E 4NUUA 3EWKA 3PTZA 2O01J 3UU5A 2AXTH 5AW5B 2X0YA 5FMNA 2HFED 1W09A 2QJYB 2E9XD 2IZ1A 3H25A 2CEAA 3AA7B 4DOJA 3L72D 3FZFB 1VPCA 4OHFA 4MN4C 1G73A 2P67A 3AE1C 1MZ9A 2WSSH 4DV1T 3GMIA 2M3EA 5KJ7A 1W0AA 2GM4A 2Q9QB 1L0LJ 4H13C 4QXBB 3CCJP 2HODB 3L4FA 2W66A 4L74A 4AQYT 2OTKE 3HUSA 2NOXA 4KHPT 3ZT5A 1FBMA 4IL4A 3RQUA 1NEKA 1SQQG 3HE5B 3PE0A 2FYUG 4TNWA 4W7YA 2XM1A 2FYZA 3H1HE 1L4AC 2JR8A 4DR7T 1HG5A 5ETWA 2ZVOB 4IL6E 3VMYA 4CI1B 3BCCG 5JDQA 4WY4D 3M9QA 2OQQA 3L35A 2XASB 4IFFA 3ZMZB 1IJDB 1L0LD 1U7MA 4YSXA 2A45I 2VQET 1N36T 4DO0A 2WWUA 1N33T 2MKVA 2Y0EA 1SQPJ 4FI5A 5AW2B 4L73A 2A72A 3OVUA 3C4XA 3L70J 2A45G 1EXIA 2WT7B 3A7MA 3ZDMA 3WUUA 2DNXA 3OW2O 2QG4A 3B13A 5JVDE 2O01H 4IFMA 3CWBG 2BVMA 1T2KD 2E5YA 5KAFE 3KHUA 1SQPD 2FY8A 2LOSA 4KT0J 3RK2C 3AE3A 3AE6A 5C2TA 5AQHB 1IJ6A 3NFQA 3L70D 3H1JG 1YBKA 2B88A 4BXLA 2W67A 4XE5B 5AQTB 1URQA 3PUXF 2FYNB 3M65A 4OWFA 3AE2C 2XQ5A 1PP9J 2N1TC 4H0LC 1WT6A 2XJ7A 4L9IA 1GK4A 3JC6D 5KKZC 2VRSA 2ZM2A 3ONJA 5AQOB 4DVDA 4ILUA 4TX5A 4JI5T 3GHGC 3IR9A 2M67A 4QHOA 2BG9B 4YTPA 1WYBA 4WB4A 4P1NA 5ADXL 2VL8A 3HR0A 1LT9A 4TT3H 2CE7A 4PV1C 1KD1Q 4GDOA 4PD4E 3MZWB 1PP9D 4YHJA 1RF1B 3DP7A 5LCYA 2WMNA 3LW5J 5TAOA 2CPSA 3UU4A 3CCSP 2EHOB 1JEKA 5TJHA 2AEMA 4U3FG 4LMJA 4RKUJ 4MLKA 4GOFA 5HXRA 3J9X1 4GYSA 4I43B 3FBLA 5M1BA 3AEAA 3M0AA 3KV9A 4KI0F 3II6A 2KUBA 2X51A 3EDUA 1OW7A 3L39A 4DZOA 3I55P 2OYHA 1X8YA 4BJMA 3FZKB 2W0GA 3O1JA 3CCMP 3AA6B 1SQVE 4ZZCA 1JUNA 4AUWA 4OK0A 1ZXGA 2EHOD 4H9SE 1JY3O 1OVUA 4DJGA 1UGOA 2WQYA 2QJKB 4O4LE 5LJMA 4PJ0E 1FOSE 3USSA 3TLUA 5J2UE 1XTCC 3D6ZA 3CMEP 4IE7A 1V9DA 1AA0A 1FC2C 5AQKB 4K3AA 1X0TA 5GTIE 1IK9A 4DUZT 3V2RA 4AKLA 5CCGA 2E75D 5CBNA 1S35A 4LFAT 3OBVE 4GYRA 3AVRA 2XAQB 1XWMA 1BR0A 1ZR4A 4M1PA 3L73J 4OX9T 1QVGO 4I7ZC 4PNIA 2R5BA 1GL2B 5AQVB 1VQLP 4ASKA 1NH4A 3ZSSA 2W27A 5CB4E 1M1KQ 2XSAA 2V7KA 1QVFO 4HH2A 3AE1A 3ANWB 2VVNA 5FY0A 3HKCE 1HGVA 2IPPA 2H7HA 2IFMA 1N8RQ 1SQXJ 4ANJA 3L75G 3OJAB 3L73D 4UVAB 1OVRA 4IE4A 4UEMA 2RH0A 3E7KA 2V6XA 3GF3A 1K73Q 2O01N 4PJLA 2C5KT 2N9YB 1N73C 5KLIB 4JI6T 2ZAEB 4DMWA 1HX8A 4JBWF 5HXCA 1S2EA 3KXDA 1VQNP 3OTOT 1T8ZA 1UX5A 3N9QA 5HEUA 4NPDA 3NZPA 5AQFB 3H1KE 1SQXD 4LGDE 2WSCH 2KIKA 2YKPA 1KFMA 2A9UA 3Q5DA 3A7OA 3ETUA 1GQEA 1CSBA 3QC9A 1S4XA 4ZEYA 3RL0g 3M9BA 4HFBA 3RIFA 2CPBA 1LGHB 2JKVA 5EK2A 4NXNT 3K1SA 4QH4A 1MMNA 2FJBA 3TYYA 3KBUA 3ABVA 3IBPA 2KWHA 2G8YA 2QJYC 5B66E 2B9BA 2FJDA 5DJUB 4DUYT 1NTZK 4KJMA 5AVYB 4DR6T 1HTJF 3TLWA 2V7IA 1M8OB 4FJOA 3CCLP 1CHUA 5ABFA 1X79A 5AQRB 4LF7T 1H0TB 1NKZB 2M3BA 4UR9A 1PGQA 4DBQA 1LTAC 3LK3B 4BAYB 1BCCE 1IAPA 3HE4A 3JCFA 1SFCB 3CXHE 4HWHA 3R4YA 4XZCA 1Z56A 4GKKT 2WMOA 3C51A 4DNDA 4Z1MH 4CZZB 2MTQA 3C98B 2I59A 2CXDA 1T7SA 4QXHB 3AE2A 5CCHC 2N1TA 4HFEA 1BE3J 5CJ0A 1SHZC 3G06A 4OFZA 2K37A 1EZVI 2J58A 3GW6A 4UB8H 2NWBA 4H63V 5FKYA 2K3WA 3U1CA 4PAGA 3RIUC 3AE8A 3DJBA 3D6YA 3GHGA 1P84E 1OFCX 2LLYA 2IMLA 3CPZA 2E74D 2OA5A 3EAMA 3F31A 2JIWA 5JH7E 3RBXA 4LF4T 1EZVG 4WWIA 1NO4A 3K5BA 1VDFA 2IBZI 3P4QA 3MP7B 3VR9A 1BE3D 2J62A 3WI3A 4AQGA 4OYJA 2KS1B 4C7RA 1X9BA 4X1YE 2CBJA 3L8RA 4IL9A 3AEFC 2M6BA 2BDEA 4ZI3D 2K48A 3AEDC 2VQFT 3C9IA 4U2ZA 4EEDA 2IBZG 2W83C 2BASA 2JWDA 4QXCB 2LRLA 3JCUH 1VQKP 4HFCA 3CCUP 1BR4A 5AVWB 1VQ7P 4EAHA 1VQ6P 1SQBE 2LR2A 5LMUT 2IYPA 1BDCA 4P0BA 2BEQD 3E0ZA 5B5EE 4JI0T 1E7PA 2KP8A 3ZYKA 1W2EA 2X9XA 3UQ7A 2WZ7A 4EIWA 2WBLA 1JTHB 1ZKEA 2CLYB 4WNKA 2KXPB 1AJYA 2AXDS 1M1JA 2LSJA
chains in the Genus database with same CATH topology
1N86A 4H9NC 2M8RA 3VKHA 2JMKA 1GW3A 2P7JA 3T97A 5APSA 4AXPA 5JQGE 5LGUB 4N3YB 2CWYA 5CCGD 4CXXA 2DI4A 2VWAA 2VB6A 3LIDA 4UF0A 4I4TE 4IFDK 3N2KE 3ZMUB 4QKNA 5AVRB 2KSJA 4RESB 5KLVK 3N9NA 5LHGB 5AVTB 1IFIA 3FBZA 5JDFA 3PUSA 5LYJE 3OA7A 4W80A 3GWHA 4IE0A 2Q9IA 1IO4A 5FXXA 5LP6E 2NPSC 3AAAB 1MMGA 1L4AD 2OYIB 2XHEB 1ZR2A 2X68A 3UFEA 3EQ2A 1KILB 3MKDA 3TNUB 5AVUB 3ZEFB 1FZBA 4O4HE 1GU5A 4ZI7E 3ZJ1A 3B5NB 3PUGA 3E1IA 3KQGA 3HTKB 4U74A 1AFOA 3ZYMA 2W6AA 4P0AA 1KNZA 1JOCA 2Y48B 3BQKA 2QA7A 1WRDA 2KLQA 1FMWA 5APUA 2Y8DA 3V5UA 1SLQA 3RK2D 2Q9QA 4IIJE 2C0XA 3ZJ2A 5FYMA 2HODA 5E0OA 1T3JA 3HE5A 2E8IA 3HRNA 3F2EA 4DBRA 1URQC 3V2QA 4XAXB 3HI2A 3D0TA 5KTBA 1RE4C 2HLOA 2CM0A 5CA1E 1PFIA 5AW0B 3VN0A 1LT9C 2WT7A 3NRYA 2PG8A 1O3XA 3N2OA 1B7TA 2LSGA 3LBXB 5LG4A 1JY3N 2CMRA 1ZHCA 4WBAA 3KINB 1FZAA 2PFVA 2JJLA 3P8CE 1D1BA 1SFCC 1ZEEA 3UUXB 4EZ4A 1SQPK 3LK42 3OKQA 3MIWA 4H63H 2OYHC 1QUUA 3RL0B 3L09A 4TV9E 2R3CA 5CMZA 3V5SA 3KDSE 4EOTA 3N9MA 3AAEB 4O8SA 3VMXA 5AW6B 2E9XB 3SWYA 5LXTE 1RF1A 5FXWA 3RL0D 4H9PC 3MUDA 1U5PA 4ERRA 1VOMA 3VKGA 5LGTB 4Z8XA 5FXVA 1YTZT 5AVXB 3SWFA 3BRVB 3VP9A 5HXEA 4Y99B 3M06A 1YTZI 4V1Av 4HYTB 2UXXB 2J59M 1FJKA 5IYZE 3FHNA 4ZS3A 1N7LA 2HG5D 4C46A 3DTOA 1US7B 1JY2N 4WY4B 2LSIA 5LOVE 5AVZB 3V5BA 3C64A 2CLYC 3CX7B 4ZI2C 2RA1A 2NPSA 1AJ3A 2RP4A 3HA4A 5JR9C 5GONE 3H32B 4AI6A 3HD7C 1IJ5A 3P32A 3CX8B 3R6NA 5HXHA 4C91A 3KBTA 5H6RB 1GL2A 3E22E 5EK4A 1BR2A 3V4QA 2X9YA 3ANWA 2W62A 1HS7A 1XTGB 3U1AA 1EZ3A 4P09A 4LC1A 2OYIC 3KV4A 2VASA 4ZS2A 2XTLA 5CCHD 1RE4A 1DEBA 4AQRD 2XNXA 3B5NC 2LSYA 2XDJA 1LTJB 3ZN0B 1N7SD 4GKGA 5JDGA 2KMFA 5AVQB 3LIEA 5M4YA 4C7NB 1SQXK 5LNKA 2N9BA 2QGSA 4KP3C 4X1KE 1LRZA 2C0WA 2HPLA 3V2PA 1QSDA 3IFMA 2N1GA 4PK4A 1NWQA 1FMVA 3K8PC 5LGNB 1J1DB 2FFDB 2ZXEB 1SFCA 3CVRA 1D0YA 5LBMA 1MFZA 3O1HA 2XV5A 3A2AA 3RK3B 2LHNA 2D2SA 4UV8B 2QM7A 3MJXA 2PAJA 2DWKA 1M1JC 3H3AA 4CXYA 5L3DB 2P2UA 2WPQA 2E43A 1T98A 1S9KE 3ZYLA 1ZV8A 3RK3D 1JCDA 3LW5H 1ZLLA 2BZBA 1GU4A 3C4WA 3MGNA 1HWTC 2WPRA 3I9WA 5KJ7D 2LSKA 5APYA 3MK7C 3NTNA 2XKMA 1JTHA 3ZN1B 2XU6A 1Z0PA 2D0TA 2NPSD 5DQVA 3RC8A 2NTXA 1IFMA 2PP6A 3K3NA 2E9XC 2LEHA 5JR9A 2V7MA 3SRZA 2PJQA 2IC9A 2P1JA 1D0XA 1JY2O 3HD7A 1UX4A 1IFNA 4EZHA 2IFNA 2YINA 3HKBE 1ZV4X 1FZEA 3M9HA 2W6BA 3KVAA 2CA5A 2CCQA 2SPCA 1NAFA 2YO3A 3ZMVB 5JRCB 5AVSB 1GK6A 3RC3A 2Z4EA 4I1LA 3P8CD 2ODUA 4JF7A 2Q9QC 1JY3P 1CUNA 3UIAA 4G63A 5DJQC 3WAKA 2KYVA 1G8XA 2OYIA 1URQD 4CXWA 4N78D 3ZLIA 1CI6B 3ZPOA 5HWXA 3TNUA 4OYKA 1T2KC 1FIOA 5LBQB 3B5NA 2CXLA 4AQFA 1H89A 1LVKA 4YLHA 1HFAA 2MYSA 5A1LA 3L3PA 4O4IE 1J1EB 2PBIA 3UT5E 1H88A 2R5DA 2VKHA 5FP3A 3WMM0 3L36A 3RYIE 1ZN5A 1MIWA 3JC6C 4MBQA 3PTRB 3RYCE 4O9BA 2W00A 2K24A 2DLRA 2YEVC 1GD2E 4BJNA 3P8MC 3FXDB 5FXZA 2OARA 5JDHA 3BQLA 1FAVA 4I6MC 3NBXX 5AVVB 1JMMA 3IF8B 1QL1A 3QUJA 4ISTA 4ZKPA 4UXNB 2YMYA 2W61A 1LTBC 3MD0A 1LWUB 2P9BA 3ONXA 4F6RC 1HTLC 1HBWA 1RF1C 1IFDA 1GTWA 3LBXA 5L3CB 3KYQA 2EHOC 3V4WA 3BATA 3OYXA 1DX7A 1LKXA 1A02F 1FZCB 1LVFA 1J1DC 3HKEE 1HG2A 3RPUA 3AA0B 2FFDC 1L4AB 2C9NY 2LJLA 5J2TE 2V1DB 1FJPA 1WYCA 2LKMA 3CQXC 3VMZA 3LFMA 1NU1K 3B57A 2CXFA 2H43A 2O1JA 2E9XA 1HUCA 4ZKUA 3BASA 3HD7D 4UIGA 2NTYA 2V7JA 3GN5B 4XA4A 2KLVA 1U4QA 3RK2B 3O1IA 2X9WA 4OH8B 3TSIA 4JEUB 3PURA 3HE4B 2DHRA 1MNDA 5HAXA 1YKHB 2H8PD 2XZRA 2YK0A 4PJMA 1GL2C 5APXA 4LLHA 4PFOA 4EOZB 1KFNA 2A3DA 4WY4A 3K3OA 5BMVE 3FB2A 5DABA 1MNEA 2WTYA 3N9PA 4L5GA 2WWWA 2HPCB 3UUMA 3Q5XA 2JJ9A 1LTTC 2JMHA 2C9LY 4O2AE 2L9QA 2N1TD 5JDLA 3H32A 3ZC1A 3RYHE 3W15B 2XAJB 2VKJA 1JNMA 2KNDA 3H6PA 4HKAA 4PK5A 5L2LA 1HCIA 2WAUA 5APVA 2ZMAA 2KINB 5JDNA 4UVBB 1S94A 2ES0A 3F57A 4AKGA 1T3UA 5FNVE 3O8ZA 2HPJA 1NKNA 2NP9A 1OXZA 1M7LA 2N2NA 4BA9A 2XQYA 4HE8A 4M3LA 1GZLA 1SQBK 1UCUA 2Q3IA 2CWOA 1JCCA 2YKQA 4QWNB 5FY1A 4UF0B 4WBOA 3NXSA 1LTJA 1MIYA 2ZFCA 3ZCIA 3KPEA 3K3QC 4UVCB 4YFSA 1J1EC 2VKOA 2K9AA 4CQIA 5JREA 1CZQA 4C7NA 1D1CA 2WM9A 4TUYE 1IFJA 1X9VA 1EQ7A 4CI3B 1NHLA 2EHOA 1SP4A 2Z5HA 5L3FB 1MUUA 3LJCA 4IDZA 2FFDA 1N73B 3BVHA 2C5IT 4O2BE 2Q7CA 1MMDA 3CQCB 5AW7B 3MA9A 2IX7C 4EB6E 2J1DG 5AW8B 5C8YE 3RX6A 4EXTA 2JRKA 4MFRA 3M91A 3QK6A 4B6XA 1D0ZA 4JLEA 1G1JA 1LWUC 1LTSC 2H3RA 3O9XA 3A3YB 4X1IE 4H9OC 1RE3C 3ESLA 1YW0A 4ISSA 4JUYA 3N9LA 5AW3B 4AYCA 1FZCC 3N5LA 4WBNE 3R2PA 3IHRA 4H9RC 3OAKA 3AAIA 3AVSA 2MJZA 2GUSA 2WITA 1YKEB 1NTKK 5KDMC 2C0SA 2Q9QD 3Q2MA 1N7SB 3OJAA 2ACXA 5LHHB 2DCFA 5BVZA 1KQLA 1H8AA 4EYYR 1KK7A 3M0DC 1KILC 4X20E 2GK9A 1G2CB 3ZCJA 3PU8A 2MBGA 3SOLA 4AQFC 5KMGP 1YD8G 3FXEB 5DQWA 4U72A 5APWA 5AW1B 4GOUA 3WAJA 3MZKB 1QL2A 5JRCA 5CA0E 1SVFA 2L8KA 5LA6E 4PJJA 1RF0C 2FKWB 3VTPC 4WW0A 3MXZA 3N7NA 1CW5A 4H9QC 4E7SA 1JO5A 3EVYA 5KX5E 2A45H 1CI6A 1L0NK 2KOGA 4AKHA 1LTGC 3U3IA 2KWIB 1E1HB 5CHXA 5AW9B 1BR1A 5F8PA 3A5XA 4I55E 2N9DA 2B1EA 2JEEA 1DH3A 4NUVA 3Q9DA 4XBFB 3HL6A 5HWYA 3EDVA 2YNYA 2HH7A 3HUSB 3TK1A 1MMAA 3KV6A 5FY7A 3R84B 2NPSB 5BU5A 3BRTB 3G3ZA 3ZC0A 3UULA 2I1JA 4K0UA 3P7KA 4EIJA 2XAHB 2C5JA 2V26A 3NZQA 3RL0C 2JPFA 4KBMB 1YYCA 5JDMA 5F3JA 3CMLA 5L3BB 3V2NA 1LWUA 5H6QB 3J7Yq 1IZNB 2BVLA 1MIVA 3PUQA 2R32A 4GT1A 4GIFA 3I0QA 4JYBA 3H37A 3SS1A 2I1KA 1RE3A 1FZGA 5AFUL 2X67A 4KUMB 1FZCA 3C50A 3ZMSB 1L4AA 1GL2D 1URQB 4Y99C 5LJNA 3U78A 2XAFB 3ZMTB 4WY4C 2D5UA 2KZ7B 2ZLYA 3HKDE 1GW4A 4PJNA 1GDTA 2WSFH 3LG7A 3CL3D 3O4XE 4TZ4C 2XAGB 1LT9B 3UUNA 2DWGA 2Y6XA 4ADZA 3M0DA 3CQGB 1KILA 4A56A 3GN5A 2KT9A 1Y64B 1FEWA 4TN7B 1HF8A 4TV8E 3HTKA 4PW8A 5EZYE 4AKRB 4KHXA 3BK9A 2OYHB 2W63A 3NMDA 1FDMA 1J2JB 1RF0A 1NTMK 2FXMA 4DMVA 3N9OA 1NOHA 1N7SC 2K5BB 4ZHQE 1SFCD 2HPCA 5L3EB 1WRGA 3VYIA 2IW5B 2WSEH 3Q5WA 4QX7B 4JYCA 4IHJE 5HXSA 1HH0A 2X9HA 3PP5A 4PFPA 4UV9B 2GUVA 4HTEA 2X66A 1SQVK 2YO2A 3VU7H 1JY2P 2E42A 3VP8A 1LTJC 2LM9A 2NW7A 4CI2B 4O4JE 1HJBA 4IE5A 2XUEA 3EFGA 4J2CA 5L3GB 1OWAA 2YU1A 4E7ZA 3IEEA 4GIWA 5LHIB 1LTIC 5EK3A 3I0OA 4YJ2E 2LHRA 2WSSV 4HEAA 4QX8B 3PDYA 5JR9B 1SA0E 1RY3A 3HD7B 1KZUB 3CWZB 2O1KA 2Z5IA 4IGUA 2HYNA 3RK3C 2MOZA 3P7IA 2V7LA 4ZI2D 2D0UA 4AKIA 1FZFA 1FU1A 1A02J 4EYUA 4N6JA 2VK9A 2UXNB 1E5WA 4PK6A 3KFWX 5KJ7C 1HVVA 1X79B 3HUSC 3KDPB 5IHYA 3PUAA 3CLQA 1AQ5A 2Q5UA 2IAKA 4MHCA 3RRCA 1N73A 1FOSF 2N1TB 1G1IA 2IC6A 4I2LC 3GHGB 5APQA 4C90A 2LT3A 4MALA 3RRWA 4GK5E 3I9YA 2WPSA 1IC2A 2H7OA 1KILD 4HGAA 2L5GB 3U59A 3OYZA 3SWHA 3RYFE 1NWMX 3RKOA 3E08A 3B5ND 3T8OA 1H7CA 2G0UA 3L37A 2A2FX 4ZOLE 2JQQA 4L0RA 3I5CA 3UTKA 5CJ4A 3N4XA 3CI9A 1S9KD 2KB7P 4KMCA 2YKOA 1N2DC 4W7ZA 3VHLA 5CCHA 1D1AA 2NW9A 4JEHB 3AB3B 3TKLB 4HN9A 4IE6A 1M1JB 1N7SA 1L0LK 4B86A 5AW4B 3LK2B 3KV5A 3C4ZA 2POHA 1VRBA 3EUHA 3CKDA 3BQIA 1SQQK 2FYUK 2QM8A 2L3LA 3A5TA 2H7VC 5J1GA 3S4UA 3KVBA 1G2CA 3NRXA 2NW8A 1WR6A 2VKDA 4ZI3C 5APTA 3RH3A 3MACA 5HYAA 2LE8A 4G2AA 4YJ3E 1HGZA 1WLXA 2ZM0A 2Z6EA 4GK0E 4N78E 3I1AA 3VOPA 2LOPA 3AA1B 2X0LB 1MV8A 2YU2A 2ZM8A 3CX6B 2ODVA 3B8EB 3N2GE 3GA8A 4UELA 3ETVA 5CCGC 3MTUE 4HFVA 5BU8B 3PU3A 4I50E 4NUUA 5AW5B 5FMNA 2HFED 2E9XD 2CEAA 3AA7B 4DOJA 1VPCA 4OHFA 1G73A 2P67A 1MZ9A 3GMIA 5KJ7A 2GM4A 2Q9QB 4QXBB 2HODB 3L4FA 3HUSA 2NOXA 1FBMA 3PE0A 3HE5B 4W7YA 2FYZA 1L4AC 1HG5A 5ETWA 3VMYA 4CI1B 5JDQA 4WY4D 3M9QA 3L35A 2XASB 4IFFA 3ZMZB 1IJDB 2A45I 4DO0A 2WWUA 4FI5A 5AW2B 2A72A 3C4XA 2A45G 2WT7B 2DNXA 3B13A 5JVDE 2O01H 4IFMA 2BVMA 1T2KD 2LOSA 3RK2C 1IJ6A 3NFQA 4XE5B 1URQA 3M65A 2N1TC 1WT6A 4L9IA 1GK4A 3JC6D 2VRSA 2ZM2A 4DVDA 4ILUA 4TX5A 3GHGC 3IR9A 2M67A 4QHOA 1WYBA 4WB4A 5ADXL 2VL8A 3HR0A 1LT9A 2CE7A 4YHJA 1RF1B 3DP7A 5LCYA 2WMNA 5TAOA 2CPSA 2EHOB 4MLKA 5HXRA 3J9X1 4GYSA 4I43B 3FBLA 3M0AA 3KV9A 3II6A 2X51A 3EDUA 4DZOA 2OYHA 1X8YA 4BJMA 2W0GA 3O1JA 3AA6B 1JUNA 4AUWA 4OK0A 2EHOD 4H9SE 1JY3O 4O4LE 5LJMA 1FOSE 5J2UE 1XTCC 4IE7A 1V9DA 1IK9A 3V2RA 4AKLA 5CCGA 1S35A 3OBVE 4GYRA 3AVRA 2XAQB 1BR0A 1ZR4A 4M1PA 4PNIA 2R5BA 1GL2B 4ASKA 1NH4A 2W27A 5CB4E 2V7KA 4HH2A 3ANWB 5FY0A 3HKCE 1HGVA 2IPPA 2H7HA 2IFMA 4ANJA 3OJAB 4UVAB 4IE4A 4UEMA 4PJLA 2C5KT 1N73C 4DMWA 1HX8A 5HXCA 1T8ZA 1UX5A 3N9QA 3NZPA 4LGDE 2WSCH 2YKPA 1KFMA 3A7OA 3ETUA 1CSBA 3QC9A 3M9BA 2CPBA 1LGHB 5EK2A 1MMNA 3TYYA 3KBUA 3IBPA 2KWHA 1NTZK 5AVYB 1HTJF 2V7IA 4FJOA 1X79A 1NKZB 2M3BA 4DBQA 1LTAC 3LK3B 4BAYB 1IAPA 3HE4A 1SFCB 4XZCA 1Z56A 2WMOA 3C51A 4DNDA 4CZZB 2MTQA 3C98B 2I59A 2CXDA 4QXHB 2N1TA 5CCHC 1SHZC 5CJ0A 4OFZA 2NWBA 2J58A 4H63V 4PAGA 3U1CA 3DJBA 3GHGA 3CPZA 2OA5A 3F31A 5JH7E 1NO4A 1VDFA 4AQGA 3WI3A 4OYJA 4C7RA 4X1YE 2BDEA 4ZI3D 2K48A 3C9IA 2BASA 4QXCB 1BR4A 5AVWB 4EAHA 4P0BA 3E0ZA 2KP8A 3ZYKA 1W2EA 2X9XA 2WZ7A 4EIWA 2WBLA 1JTHB 1ZKEA 2CLYB 4WNKA 2KXPB 1M1JA 2LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVQ B;  3LIE A;  4KHX A;  3M0A A;  5AVX B;  5AW4 B;  4B86 A;  3SWF A;  1GD2 E;  3TYY A;  1KQL A;  3M06 A;  2XZR A;  1H8A A;  3P8M C;  1A02 J;  4C7N B;  1CZQ A;  4HYT B;  4C7N A;  4DZO A;  2P7J A;  5APX A;  3T97 A;  5APS A;  3VMY A;  1X8Y A;  2N9B A;  3UUL A;  3NMD A;  5AVY B;  4C46 A;  2QM8 A;  1FAV A;  1J2J B;  4I6M C;  3L35 A;  3P7K A;  5AVV B;  3A5T A;  1JUN A;  4AUW A;  3FB2 A;  1G2C B;  5AVZ B;  3V5B A;  2WTY A;  1YYC A;  5AW0 B;  3LID A;  3KDP B;  1NWQ A;  1SP4 A;  2Z5H A;  5APT A;  5AW2 B;  3VN0 A;  1FOS E;  2WWW A;  3UUM A;  3HE4 A;  3MD0 A;  5AVR B;  1MUU A;  2Q5U A;  2ZXE B;  5APW A;  3VYI A;  1AJ3 A;  3M9H A;  2WT7 B;  5AW1 B;  2WT7 A;  4JYC A;  2SPC A;  1NAF A;  4RES B;  2YO3 A;  2C9L Y;  5AVT B;  2Q7C A;  1MFZ A;  2R32 A;  1FOS F;  1WLX A;  4GT1 A;  5AVS B;  1GK6 A;  1T2K D;  1HBW A;  3LBX B;  4JYB A;  5AW7 B;  1GTW A;  3LBX A;  2XV5 A;  3A2A A;  2ODU A;  3V4W A;  4I2L C;  2YO2 A;  5AW8 B;  3VTP C;  2E42 A;  1S35 A;  1CUN A;  3P32 A;  3UIA A;  2QM7 A;  3NFQ A;  5APQ A;  1A02 F;  3M91 A;  2JJL A;  1MV8 A;  1JNM A;  1IO4 A;  1HJB A;  3F31 A;  4XE5 B;  2P2U A;  2C9N Y;  2R5B A;  1HCI A;  2WPS A;  2WPQ A;  1OWA A;  1CI6 B;  1CI6 A;  2W27 A;  5APV A;  2ODV A;  3TNU B;  5AVU B;  3TNU A;  3B8E B;  2E43 A;  1QUU A;  1S9K E;  3V4Q A;  1T2K C;  3A3Y B;  1GK4 A;  2IPP A;  1GU5 A;  2H7H A;  2VRS A;  2R3C A;  5CMZ A;  3KQG A;  3L37 A;  3IR9 A;  3VMZ A;  4EOT A;  1H89 A;  5AW3 B;  1GU4 A;  3I5C A;  4AYC A;  2BAS A;  5AW9 B;  3MGN A;  3O8Z A;  2W6A A;  5AW5 B;  4LC1 A;  1S9K D;  5AVW B;  1HWT C;  3UUN A;  3VMX A;  1H88 A;  3M0D A;  3OAK A;  5AW6 B;  1HUC A;  1OXZ A;  2R5D A;  2WPR A;  1DH3 A;  2P67 A;  3L36 A;  1GZL A;  4M3L A;  4AQR D;  5APU A;  2Q3I A;  2Z5I A;  1U5P A;  2KP8 A;  1U4Q A;  1SLQ A;  5APY A;  3EDV A;  2YNY A;  3NTN A;  3NXS A;  3TK1 A;  3A7O A;  2ZFC A;  3HTK A;  1CSB A;  2XU6 A;  3PE0 A;  3HE5 B;  3HE4 B;  3M9B A;  3HE5 A;  4GKG A; 
#chains in the Genus database with same CATH topology
 1NTZ G;  2B87 B;  1N86 A;  1USD A;  4H9N C;  2M8R A;  3VKH A;  2JMK A;  1GW3 A;  2P7J A;  3T97 A;  5APS A;  1W9R A;  4AXP A;  3F5H A;  2MPK A;  5JQG E;  1PGP A;  5FVL A;  5LGU B;  4N3Y B;  2CWY A;  2Q6Q A;  3CWB E;  4DID B;  3MUD C;  5CCG D;  4CXX A;  2DI4 A;  2VWA A;  2VL0 A;  3LID A;  2VB6 A;  4UF0 A;  4QMA A;  3JSV C;  4I4T E;  3IN6 A;  3D71 A;  4IFD K;  3N2K E;  3L74 J;  3ZMU B;  4QKN A;  5AVR B;  4OGQ C;  2KSJ A;  1HX1 B;  1EDI A;  4NPP A;  2PTF A;  3TGU J;  4RES B;  5KLV K;  5CGM A;  2VUR A;  4WZX A;  3N9N A;  5LHG B;  5AVT B;  2W6J H;  1IFI A;  2ZXX A;  3FBZ A;  2QYW A;  5JDF A;  2OGU A;  3PUS A;  5LYJ E;  1IBK T;  2QJK C;  3OA7 A;  4W80 A;  4JI3 T;  3L74 D;  3GWH A;  4IE0 A;  1KC8 Q;  2Q9I A;  1IO4 A;  3QB5 A;  4WYV A;  5FXX A;  5LP6 E;  2NPS C;  3GG2 A;  3AAA B;  1MMG A;  1L4A D;  2OYI B;  2XHE B;  4A5X A;  3TGU D;  1PGJ A;  2ZM6 T;  1ZR2 A;  2X68 A;  3UFE A;  3EQ2 A;  1KIL B;  3MKD A;  3TNU B;  5AVU B;  3ZEF B;  1FZB A;  3IA3 A;  5CBO A;  4O4H E;  1GU5 A;  4ZI7 E;  2W4X A;  3ZJ1 A;  3B5N B;  3PUG A;  3E1I A;  3RF1 A;  3KQG A;  3HTK B;  4ILB A;  1R5L A;  2WDQ A;  3NWI A;  1VF5 B;  4PD4 D;  4U74 A;  1IK7 A;  1AFO A;  1UII A;  3ZYM A;  2W6A A;  2WP9 A;  4P0A A;  1KNZ A;  1JOC A;  2KZI A;  2Y48 B;  3BQK A;  2QA7 A;  1NTK E;  1WRD A;  5DJT B;  2KLQ A;  1FMW A;  5APU A;  2Y8D A;  3CK6 A;  3V5U A;  1SLQ A;  2LXC B;  3RK2 D;  1ZME C;  2Q9Q A;  2JQH A;  2C0X A;  4IIJ E;  3ZJ2 A;  1JMB A;  4L75 A;  5FYM A;  2HOD A;  3AE3 C;  2GA1 A;  4LF8 T;  5E0O A;  2UU9 T;  1T3J A;  2WPV B;  1KEY A;  3HE5 A;  1K04 A;  5KAI E;  3G4S P;  2FJE A;  2E8I A;  2FUP A;  3HRN A;  2J4G A;  3F2E A;  4DBR A;  4UB6 H;  1URQ C;  3V2Q A;  1KB9 I;  5KLI C;  4EI2 A;  4XAX B;  1Z8U A;  3HI2 A;  4EEB A;  3D0T A;  3EI0 A;  3H1L J;  1RE4 C;  5KTB A;  2HLO A;  2O3J A;  1R8E A;  1NJI Q;  2CM0 A;  1ZOY C;  5CA1 E;  1PFI A;  5L8R J;  5AW0 B;  4DR4 T;  3VN0 A;  5KLV J;  4LF5 T;  1W0B A;  4ILC A;  1PL5 A;  2PRR A;  1LT9 C;  4Z90 A;  1PIX A;  2WT7 A;  3NRY A;  3VMA A;  1M56 D;  3H1L D;  2PG8 A;  2YN6 A;  1XZY A;  1UUR A;  4DR1 T;  1O3X A;  3N2O A;  2V7Q H;  1DIP A;  1KF6 A;  1B7T A;  2LSG A;  3LBX B;  5LG4 A;  1JY3 N;  4HFD A;  2KSR A;  4TLF A;  1NU1 J;  3MHV A;  2CMR A;  3ZKR A;  1ZHC A;  3AEF A;  4WBA A;  4GOE A;  5KLV D;  3KIN B;  3AED A;  1UUS A;  1FJG T;  3S1K A;  1FZA A;  4R4M A;  2PFV A;  3UU3 A;  2JJL A;  2Q1K A;  3L75 E;  3Q5E A;  3P8C E;  2F4V T;  1D1B A;  1SFC C;  1ZEE A;  1LNQ A;  4ILA A;  2OTJ P;  3UUX B;  4EZ4 A;  1SQP K;  3Q1M A;  1WFD A;  3LK4 2;  3OKQ A;  1L0N E;  1LT1 A;  2H89 A;  3MIW A;  2IYO A;  3H1K J;  4H63 H;  2OYH C;  2E5T A;  4Z91 A;  1QUU A;  4HJG H;  4JBZ A;  1NU1 D;  3KZI E;  3RL0 B;  3L09 A;  1XMO T;  3VR8 A;  4TV9 E;  1VQP P;  2R3C A;  2YOE A;  2R6G F;  5CMZ A;  5E79 H;  3V5S A;  5GTH H;  3PHL A;  3KDS E;  2YDQ A;  2QA4 P;  4EOT A;  3N9M A;  3AAE B;  3PJA A;  4A98 A;  4U3C A;  1KB9 H;  4O8S A;  3P4R A;  5FL1 A;  4DV3 T;  3VMX A;  3H1K D;  1S1C X;  5AW6 B;  3SWY A;  2E9X B;  5LXT E;  2V5C A;  3CMA P;  1RF1 A;  3L72 G;  5FXW A;  3RL0 D;  4H9P C;  1OX3 A;  3MUD A;  1U5P A;  2XQ9 A;  5K5G B;  5C3J A;  5HEG A;  2YIU B;  4ERR A;  1BCC J;  4DV5 T;  1VOM A;  2X0H A;  3VKG A;  4DR3 T;  5LGT B;  4Z8X A;  5FXV A;  1YTZ T;  5AVX B;  3SWF A;  3BRV B;  3VP9 A;  5HXE A;  4Y99 B;  3M06 A;  4NPE A;  1YTZ I;  4V1A v;  4HYT B;  2UXX B;  2J59 M;  1FJK A;  5IYZ E;  1JB0 J;  3FHN A;  3WU2 H;  4ZS3 A;  1N7L A;  2HG5 D;  4C46 A;  3DTO A;  4IOI H;  1US7 B;  1JY2 N;  4WY4 B;  2LSI A;  4DR5 T;  1QLE D;  2E5L T;  1BCC D;  2QEX P;  2RN0 A;  5LOV E;  1WR0 A;  5AVZ B;  3V5B A;  1L0L G;  2XQ7 A;  3CPW O;  2BKP A;  3C64 A;  2CLY C;  3AE9 A;  3CX7 B;  4ZI2 C;  4HWC A;  1WCR A;  2RA1 A;  2NPS A;  2IDO B;  3O6Q A;  2RP4 A;  1AJ3 A;  3HA4 A;  1VCS A;  5JR9 C;  5GON E;  1EZV E;  2WS3 A;  2E5V A;  1XNQ T;  2ZT9 C;  2OTL P;  1ZP0 C;  2K9J A;  3H32 B;  4AI6 A;  3HD7 C;  2KZJ A;  4DCK A;  1IJ5 A;  2LXB A;  2KNC B;  4EYY Q;  2YMK A;  3PUV F;  3P32 A;  1SQP G;  3CX8 B;  3R6N A;  5HXH A;  2IBZ E;  4YTN A;  1SQB J;  4C91 A;  3L70 G;  3KBT A;  5H6R B;  3ABV C;  1M7K A;  1S5L H;  1GL2 A;  2QRX A;  3E22 E;  5EK4 A;  1BR2 A;  5AQU B;  3V4Q A;  2X9Y A;  3ANW A;  2W62 A;  2E2A A;  3CC4 P;  1NEN A;  4HWF A;  4I0U A;  4A97 A;  1DD4 A;  4D6T J;  1HS7 A;  1XTG B;  3U1A A;  1EZ3 A;  4P09 A;  4RO0 A;  4HFH A;  1VQO P;  1LP1 B;  4LC1 A;  2BKO A;  2OYI C;  2AEF A;  3KV4 A;  2VAS A;  2BS2 A;  1R8I A;  1PPJ D;  4ZS2 A;  2BCC E;  2D2C D;  2XTL A;  3CCR P;  5CCH D;  1RE4 A;  1DEB A;  4AQR D;  3Q5S A;  1ZOY A;  1YQ3 C;  2XNX A;  1PP9 G;  4BRY B;  2FXP A;  3B5N C;  4D6T D;  4R4L A;  4HKZ H;  2XDJ A;  2LSY A;  3EHZ A;  1LTJ B;  3ZN0 B;  2K9Y A;  1VF5 C;  3AE8 C;  1N7S D;  4JI7 T;  3RGU A;  5L4E A;  4GKG A;  1JNR A;  5JDG A;  2KMF A;  5AVQ B;  3LIE A;  4U2Y A;  2IDB A;  5M4Y A;  3CX5 D;  1FE6 A;  4C7N B;  1SQX K;  5LNK A;  2CRB A;  2JWA A;  3ITK A;  2N9B A;  2QGS A;  4KP3 C;  4X1K E;  1NTM E;  1LRZ A;  2C0W A;  2HPL A;  3V2P A;  1QSD A;  3IFM A;  2N1G A;  4PK4 A;  1NWQ A;  5LB7 B;  1FMV A;  3K8P C;  5LGN B;  1J1D B;  3PUW F;  2XZE A;  2FFD B;  2ZXE B;  3FWN A;  3QWO C;  1SFC A;  3CVR A;  4U7Y A;  1QLB A;  1D0Y A;  4TWF A;  5LBM A;  3G6E P;  1MFZ A;  4WVZ A;  1VQ8 P;  3H1I J;  1BGY J;  3O1H A;  4HWI B;  2XV5 A;  3A0H H;  3V6I A;  3A2A A;  3RK3 B;  2LHN A;  2E75 B;  2D2S A;  4UV8 B;  1HR0 T;  2QM7 A;  3Q3D A;  1NVO A;  3MJX A;  2PAJ A;  2DWK A;  3L71 E;  1M1J C;  2BKN A;  2LM2 A;  2AE9 A;  3SFD C;  3H3A A;  1GMJ A;  1NTK J;  4CXY A;  5L3D B;  2P2U A;  2OLT A;  2WPQ A;  3H1I D;  1BGY D;  5AQS B;  2W2U A;  2W90 A;  2E43 A;  1T98 A;  1S9K E;  3ZYL A;  1VQ5 P;  1ZV8 A;  2KS1 A;  3EFF K;  3RK3 D;  4H44 D;  1JCD A;  3LW5 H;  1ZLL A;  2BZB A;  1GU4 A;  4OGQ D;  1TU3 F;  1NTK D;  3AE4 C;  3C4W A;  4YT0 A;  4YY3 T;  4NPF X;  3MGN A;  3L73 G;  2PGD A;  1HWT C;  1T8B A;  4AIS A;  5ABH A;  4LML A;  4JI8 T;  1KYO E;  2WPR A;  2WSF J;  4EV6 A;  3I9W A;  1KTM A;  5TIS H;  1AVY A;  5KJ7 D;  3SFE C;  2LSK A;  3ONL C;  2WZI A;  5APY A;  1QGK B;  1HNZ T;  3MK7 C;  2Q3E A;  3P4W A;  3NTN A;  2UUA T;  3SWK A;  2XKM A;  1JTH A;  1SQX G;  1Y01 A;  1T6A A;  3ZN1 B;  2XU6 A;  1Z0P A;  2D0T A;  2NPS D;  2M0B A;  1KB9 E;  5DQV A;  3RC8 A;  2NTX A;  2QJP B;  2ZVN B;  2RMZ A;  1IFM A;  2PP6 A;  3K3N A;  2E9X C;  2LEH A;  5JR9 A;  2V7M A;  3SRZ A;  1OMI A;  4HFI A;  2PJQ A;  2IC9 A;  2P1J A;  1D0X A;  1ZP0 A;  1JY2 O;  3HD7 A;  1UX4 A;  1J5W A;  2YIU C;  1IFN A;  4EZH A;  2UXB T;  2IFN A;  2YIN A;  3HKB E;  1ZV4 X;  1FZE A;  2XM2 A;  1L0N J;  4F8H A;  2AXT E;  3M9H A;  2W6B A;  3KVA A;  2CA5 A;  2CCQ A;  2SPC A;  1NAF A;  2YO3 A;  3ZMV B;  2YXQ B;  5H2F H;  5JRC B;  4X62 T;  3SSU A;  4U31 A;  2YDR A;  5AVS B;  1GK6 A;  3RC3 A;  2Z4E A;  4I1L A;  4DV7 T;  3P8C D;  2ODU A;  4JF7 A;  2Q9Q C;  2A06 G;  1JY3 P;  5JTG A;  1QEX A;  1CUN A;  1L0N D;  3UIA A;  1ZRT E;  4ASW A;  4G63 A;  5DJQ C;  3WAK A;  2KYV A;  2RKL A;  2E74 B;  1G8X A;  2XPK A;  3AXJ B;  3OPC A;  2OYI A;  1URQ D;  4CXW A;  4N78 D;  1YHQ P;  2SPZ A;  3ZLI A;  1CI6 B;  3PJS K;  3ZPO A;  5HWX A;  3TNU A;  1IBM T;  2E76 D;  4OYK A;  1T2K C;  1YQ3 A;  4ZMD A;  1FIO A;  5LBQ B;  1BE3 G;  2A06 D;  3L72 E;  4GOD A;  3B5N A;  2CXL A;  2YDS A;  4AQF A;  1H89 A;  1VQ9 P;  1LVK A;  1KFY A;  4YLH A;  1HFA A;  5F5W A;  4IDN A;  2MYS A;  5A1L A;  3L3P A;  4O4I E;  3RHW A;  4X64 T;  1J1E B;  2PBI A;  3UT5 E;  1H88 A;  4B3M T;  3B5M A;  2R5D A;  1BSH A;  2VKH A;  5FP3 A;  3WMM 0;  3L36 A;  3RYI E;  1ZN5 A;  1MIW A;  3JC6 C;  4QH5 A;  2FJA A;  4MBQ A;  3PTR B;  3RYC E;  4O9B A;  2W00 A;  1MFT A;  1L0L E;  4KX6 A;  2K24 A;  2DLR A;  3H1H J;  4CN6 A;  3QOF A;  2YEV C;  1GD2 E;  4BJN A;  2AEJ A;  1SQQ E;  2J5U A;  2FYU E;  3P8M C;  1RQV A;  1Y9B A;  3FXD B;  5FXZ A;  2OAR A;  2H89 C;  2FYN C;  5JDH A;  2AXC A;  3BQL A;  1FAV A;  4I6M C;  3NBX X;  5AVV B;  1JMM A;  3IF8 B;  1QL1 A;  3BCC E;  3QUJ A;  4IST A;  4ZKP A;  4UXN B;  2YMY A;  3H1H D;  2JQ9 A;  4IDO A;  5HEJ A;  2W61 A;  5J0Z A;  1Q2N A;  2BG9 C;  1MKM A;  1I94 T;  1LTB C;  3MD0 A;  3SFD A;  3FZH B;  1LWU B;  2UUC T;  2P9B A;  1EDJ A;  2XND H;  3ONX A;  4F6R C;  1HTL C;  1HBW A;  1RF1 C;  1IFD A;  1GTW A;  3LBX A;  3Q5R A;  5L3C B;  3KYQ A;  1PV3 A;  2EHO C;  1KMI Z;  3V4W A;  4YXW H;  1DEE G;  2WDV A;  3BAT A;  2CPT A;  2KI7 B;  3OYX A;  1DX7 A;  1LKX A;  1A02 F;  4YXD C;  1FZC B;  1LVF A;  1J1D C;  3AE4 A;  1HG2 A;  3HKE E;  2BCC J;  3RPU A;  3L74 G;  2FFD C;  3AA0 B;  2V4H A;  1L4A B;  3H1J E;  2C9N Y;  2LJL A;  5J2T E;  3TGU G;  2V1D B;  4IL6 H;  1FJP A;  1VCT A;  4PD4 I;  1WYC A;  5HEO A;  3SFE A;  4H13 D;  4JV5 T;  2LKM A;  3CQX C;  3VMZ A;  3LFM A;  4DV4 T;  2BCC D;  3AE9 C;  2LKH A;  1ZW0 A;  1NU1 K;  3B57 A;  2CXF A;  1YQ4 C;  2H43 A;  2O1J A;  1NTM J;  2BG9 E;  2E9X A;  5AQI B;  1HUC A;  4ZKU A;  2ZT9 D;  3BAS A;  3HD7 D;  4UIG A;  2NTY A;  2V7J A;  5CFB A;  3GN5 B;  4XA4 A;  1RQU A;  2KLV A;  5KAF H;  1U4Q A;  3RK2 B;  3O1I A;  2X9W A;  4OH8 B;  3TSI A;  4A7P A;  4JEU B;  3PUR A;  5AQG B;  3HE4 B;  2DHR A;  4U3F E;  1MND A;  5HAX A;  3PUZ F;  1YKH B;  2H8P D;  1NTM D;  2XZR A;  2YK0 A;  1YJW P;  1SQV J;  4PJM A;  1GL2 C;  4HB1 A;  5APX A;  4LLH A;  4PFO A;  4EOZ B;  1KFN A;  2A3D A;  2NRG A;  4WY4 A;  3K3O A;  5BMV E;  3FB2 A;  5KKZ B;  5IUX A;  1SE7 A;  5DAB A;  3M3Z B;  3L71 J;  1MNE A;  2WTY A;  4CN4 A;  3A8Y C;  5FL0 A;  1IBL T;  1Y8A A;  3N9P A;  2HHH T;  4L5G A;  2WWW A;  2HPC B;  3UUM A;  2QJP C;  3C8V A;  2WDR A;  1U57 A;  1XMQ T;  3P4S A;  3Q5X A;  2JJ9 A;  1SQV D;  3S9O A;  4PD4 H;  1LTT C;  2JMH A;  2C9L Y;  4O2A E;  2L9Q A;  2N1T D;  4H0L D;  3H1L G;  5JDL A;  4B3S T;  3L71 D;  3H32 A;  2XQ6 A;  3ZC1 A;  3RYH E;  3W15 B;  1OVV A;  1KOR A;  3CCE P;  3AEE C;  2XAJ B;  5KLV G;  2VKJ A;  1JNM A;  2V5D A;  3PV0 F;  4PV1 D;  2KND A;  3H6P A;  4HKA A;  4PK5 A;  1QX8 A;  2WMM A;  5BR8 T;  5L2L A;  1HCI A;  3L73 E;  1Q82 Q;  2WAU A;  5L47 A;  5APV A;  2ZMA A;  3LDQ B;  1DD3 A;  3P50 A;  5AQP B;  2KIN B;  1Q81 Q;  5JDN A;  1XDO A;  3UU8 A;  4UVB B;  1S94 A;  1SS1 A;  2ES0 A;  2PFX A;  3RBZ A;  1NU1 G;  2V8S V;  3F57 A;  1X22 A;  4ZXL A;  5HEH A;  1KQG B;  1PGO A;  1Q86 Q;  4AKG A;  1KYO D;  1T3U A;  4PJ0 H;  5FNV E;  3IAO A;  3O8Z A;  2HPJ A;  2XQ8 A;  2E74 C;  1LP1 A;  1NKN A;  2NZ2 A;  2NP9 A;  1OXZ A;  3H1K G;  1M7L A;  2N2N A;  4BA9 A;  3NVO A;  2XQY A;  4HE8 A;  4M3L A;  1GZL A;  1SQB K;  1UCU A;  1DU2 A;  4X5T A;  2Q3I A;  1OW8 A;  2CWO A;  4BRY A;  4DT0 A;  1JCC A;  5GTI H;  2YKQ A;  4UB8 E;  4QWN B;  2BBH A;  5FY1 A;  4UF0 B;  4WBO A;  3NXS A;  1LTJ A;  1MIY A;  2ZFC A;  3ZCI A;  3KPE A;  4IDQ A;  3K3Q C;  2P58 A;  2BG9 A;  4UVC B;  2JDI H;  4YFS A;  1J1E C;  2VKO A;  1XNR T;  2L91 A;  2K9A A;  4CQI A;  2BBJ A;  4K35 A;  5JRE A;  1CZQ A;  4C7N A;  1D1C A;  5AQM B;  4EGW A;  2WM9 A;  4TUY E;  4Q25 A;  1IFJ A;  3T1Y T;  2ZJS E;  1X9V A;  1RHZ B;  1EQ7 A;  4CI3 B;  3AEB C;  4YHH T;  5AQN B;  1NHL A;  2XQA A;  2QIW A;  2ZYA A;  2EHO A;  2CHO A;  1YJ9 P;  1BCC G;  1SP4 A;  2Z5H A;  1D7M A;  2K88 A;  4YXD A;  4YSZ A;  5L3F B;  3JCU E;  1MUU A;  3LJC A;  4IDZ A;  2FFD A;  1N73 B;  3BVH A;  2V6Y B;  2C5I T;  4O2B E;  1XDP A;  1S5L X;  2Q7C A;  1MMD A;  3CQC B;  2UXD T;  2I0M A;  1ZRT D;  5AW7 B;  5C39 A;  3MA9 A;  2IX7 C;  4EB6 E;  3CC2 P;  2J1D G;  3CXH D;  5AW8 B;  1OED B;  3RX6 A;  4EXT A;  5C8Y E;  4LMK A;  4B3R T;  2JRK A;  3FX0 A;  4MFR A;  1BDD A;  3M91 A;  3QK6 A;  4B6X A;  1E2A A;  1D0Z A;  4JLE A;  1G1J A;  2W8Z A;  1LWU C;  1YQ4 A;  2CBI A;  2QE7 H;  5B66 H;  1I6Z A;  1LTS C;  2M5A B;  2H3R A;  3O9X A;  3WUT A;  3A3Y B;  1P84 D;  4JQ0 D;  5AQL B;  5AQJ B;  4X1I E;  4H9O C;  3RGL A;  1RE3 C;  3ESL A;  1YW0 A;  4ISS A;  4JUY A;  5ABE A;  3N9L A;  1SQQ J;  5AW3 B;  2FYU J;  2B89 A;  4AYC A;  4ZNC A;  1FZC C;  4X65 T;  4OVN F;  3N5L A;  3CXH H;  4WBN E;  1SQB G;  3R2P A;  3IHR A;  4H9R C;  4IT4 A;  3OAK A;  3AAI A;  1NGM B;  3AVS A;  2D2C B;  3BCC J;  2MJZ A;  3Q2Y A;  2RPA A;  1PPJ G;  2GUS A;  2WIT A;  1YKE B;  1NTK K;  5KDM C;  2C0S A;  2Q9Q D;  1UIX A;  2WY2 A;  2DW3 A;  5FVK A;  3Q2M A;  3PRJ A;  1SQQ D;  2FYU D;  3CX5 I;  4D6T G;  1N7S B;  2ACX A;  3OJA A;  5LHH B;  1P84 H;  1SQB D;  3FGA D;  2DCF A;  2WWV A;  5ABG A;  5BVZ A;  1KQL A;  4NXM T;  1H8A A;  4EYY R;  1KK7 A;  3BCC D;  1E79 H;  1NTZ E;  3M0D C;  3AE5 A;  1YIT P;  3CWB J;  1KIL C;  4TWH A;  4X20 E;  2GK9 A;  1KQF B;  1R5S A;  2CK3 H;  1G2C B;  3P4P A;  3ZCJ A;  2FXO A;  1HJ0 A;  4U33 A;  3PU8 A;  4JYA T;  3AEE A;  2MBG A;  3SOL A;  2Y0D A;  4AQF C;  5KMG P;  1YD8 G;  3H1J J;  1VQM P;  4TNV A;  3FXE B;  5DQW A;  4U72 A;  5APW A;  3CWB D;  5AW1 B;  3X1D A;  2DL1 A;  3L74 E;  4GOU A;  3JAD A;  3WAJ A;  3MZK B;  1QL2 A;  2QSI A;  5JRC A;  5CA0 E;  3F89 A;  3TGU E;  1SVF A;  2L8K A;  1W5C E;  5LA6 E;  4PJJ A;  1RF0 C;  5B5E H;  1HF9 A;  2FKW B;  2J47 A;  3PLN A;  2YXR B;  3VTP C;  3H1J D;  1H0T A;  4WW0 A;  2WU2 A;  3MXZ A;  3PJA J;  3A0B H;  3N7N A;  1CW5 A;  3AXJ A;  4H9Q C;  2R44 A;  4E7S A;  1JO5 A;  3EVY A;  2LRK A;  2G3A A;  4UB6 E;  5KX5 E;  2VVS A;  2A45 H;  1CI6 A;  4JPZ B;  1L0N K;  2KOG A;  3H1I G;  1BGY G;  1AV1 A;  4AKH A;  3CX5 H;  1LTG C;  3U3I A;  4U3F J;  5KXJ A;  1KIL E;  2KWI B;  4H44 B;  1HNW T;  4LFC T;  1NAY A;  1E1H B;  5CHX A;  2XY8 B;  5HCJ A;  5AW9 B;  4OGQ B;  1BR1 A;  1K05 A;  5F8P A;  1NTK G;  3B71 A;  3A5X A;  4I55 E;  2N9D A;  2ZYD A;  4LFB T;  2B1E A;  2JEE A;  5HCM A;  1DH3 A;  3AE7 C;  4NUV A;  2R3S A;  3Q9D A;  3AEB A;  4U3F D;  4XBF B;  3HL6 A;  2JP3 A;  5HWY A;  3EDV A;  2YNY A;  2HH7 A;  3HUS B;  2JQK A;  3TK1 A;  2FBW C;  3CC7 P;  1MMA A;  3KV6 A;  2OV9 A;  1U7J A;  5FY7 A;  3R84 B;  3D70 A;  2NPS B;  1M62 A;  3O6Q B;  5BU5 A;  3BRT B;  3G3Z A;  4QH1 A;  3FXD A;  3G71 P;  3ZC0 A;  2WSC J;  3TF5 A;  1W2B O;  3UUL A;  2I1J A;  4K0U A;  2K9J B;  3I56 P;  3P7K A;  3W68 A;  1KNP A;  4EIJ A;  2XAH B;  2C5J A;  2V26 A;  1NYH A;  3NZQ A;  3RL0 C;  3H1L E;  3H3M A;  5E79 E;  2JPF A;  4KBM B;  5GTH E;  3CCQ P;  1YYC A;  5JDM A;  3QH9 A;  5F3J A;  3AEG C;  3CML A;  3ZT6 A;  5L3B B;  3V2N A;  2B87 A;  5KLV E;  1LWU A;  5H6Q B;  3J7Y q;  1T72 A;  1IZN B;  2BVL A;  1MIV A;  3PUQ A;  2R32 A;  3RQW A;  4GT1 A;  4GIF A;  3CD6 P;  3I0Q A;  4JYB A;  3H37 A;  3E1R A;  3SS1 A;  2I1K A;  3GF7 A;  4DV0 T;  3AEC C;  1RE3 A;  1FZG A;  5IWA T;  3L75 J;  3RKG A;  5AFU L;  2X67 A;  1NU1 E;  3CIR A;  4KUM B;  2NR4 A;  1FZC A;  1L0N G;  5KAI H;  3C50 A;  3ZMS B;  1L4A A;  1GL2 D;  1URQ B;  4Y99 C;  5LJN A;  3U78 A;  3WU2 E;  1KN7 A;  2XAF B;  3NKZ A;  3ZMT B;  2OYO A;  1VQ4 P;  1FDO A;  2E76 B;  4WY4 C;  2D5U A;  2KZ7 B;  3L75 D;  2ZLY A;  3HKD E;  1GW4 A;  4PJN A;  1GDT A;  2WSF H;  1N32 T;  1OED C;  3LG7 A;  2WSE J;  3CL3 D;  3O4X E;  4TZ4 C;  1HNX T;  2KLU A;  2XAG B;  1LT9 B;  1Q7Y Q;  2ZYG A;  3Q5P A;  2DWG A;  2Y6X A;  3UUN A;  4ADZ A;  3M0D A;  3CQG B;  1OW6 A;  1KIL A;  3VRA A;  4A56 A;  4ASV A;  3GN5 A;  2KT9 A;  4NIQ A;  1LJ2 A;  2Y0C A;  1Y64 B;  4CN1 A;  1FEW A;  4TN7 B;  1HF8 A;  4TV8 E;  3HTK A;  1KV4 A;  2KSE A;  4PW8 A;  5EZY E;  1IFP A;  5EFW B;  1YXR A;  4AKR B;  4KHX A;  2ITA A;  3BK9 A;  4COF A;  3LSV A;  1S5L E;  3T1H T;  4DV2 T;  3FZL B;  2OYH B;  3RIA A;  2W63 A;  2D2C C;  2WCA A;  3NMD A;  1FDM A;  1J2J B;  4IRE A;  3PH0 A;  3KZI H;  1K8A Q;  1RF0 A;  1WMK A;  2IUB A;  4ZZB A;  1NTM K;  3W67 A;  4TWD A;  4JI1 T;  2ACZ A;  2FXM A;  4DMV A;  3N9O A;  4BWN A;  1NOH A;  3ZT7 A;  1N7S C;  2K5B B;  3H1H G;  4ZHQ E;  1SFC D;  1OZH A;  2HPC A;  5L3E B;  1WRG A;  3VYI A;  1OED E;  4K0K T;  1J1J A;  2WSE H;  3Q5W A;  2QVA A;  2IW5 B;  4QX7 B;  4JYC A;  4IHJ E;  5HXS A;  1HH0 A;  2HN2 A;  2YKS A;  2BS3 A;  2X9H A;  3PP5 A;  4PFP A;  4UV9 B;  4IL6 X;  2GUV A;  4HTE A;  1USE A;  2X66 A;  1SQV K;  2YO2 A;  3VU7 H;  1JY2 P;  2E42 A;  3VP8 A;  1LTJ C;  2LM9 A;  3UQ4 A;  2NW7 A;  4CI2 B;  3G9R A;  4O4J E;  3UFG A;  5AQQ B;  2JO1 A;  1EZV D;  1HJB A;  1SQP E;  2WZH A;  4IE5 A;  4IDP A;  4JI2 T;  2XUE A;  4AIU A;  3EFG A;  4J2C A;  5L3G B;  1OWA A;  2P10 A;  4U7J A;  3L70 E;  3RI5 A;  3AE7 A;  2YU1 A;  4E7Z A;  3IEE A;  4GIW A;  5LHI B;  1LTI C;  1PPJ E;  3TDK A;  1M90 Q;  4H13 B;  2IBZ D;  5EK3 A;  3I0O A;  4YJ2 E;  5LG3 A;  2UXC T;  1S3J A;  4X66 T;  4Y28 J;  2FBW A;  1AQT A;  2LHR A;  3A0B E;  2WSS V;  1NTZ J;  4HEA A;  1K9M Q;  4QX8 B;  4D6T E;  2BCC G;  3PDY A;  5JR9 B;  4YPC A;  3UU6 A;  1SA0 E;  2ZT9 B;  2K1A A;  3CX5 E;  3A0H E;  1RY3 A;  3HD7 B;  1KZU B;  3CWZ B;  2O1K A;  2Z5I A;  4IGU A;  2HYN A;  3RK3 C;  1VL2 A;  2MOZ A;  1PP9 E;  4H44 C;  3P7I A;  1NTZ D;  2V7L A;  4ZI2 D;  2E75 C;  2D0U A;  4AKI A;  2H88 C;  3AEG A;  1FZF A;  2UWJ E;  1FU1 A;  3PUY F;  2UUB T;  1A02 J;  4EYU A;  3C1L A;  4LF6 T;  4N6J A;  1YI2 P;  3GMA A;  4GKJ T;  1FDI A;  1UK5 A;  1NTM G;  2VK9 A;  2XSB A;  3IF4 A;  2UXN B;  1E5W A;  4PK6 A;  3JAE A;  3KFW X;  5KJ7 C;  2M6I A;  1HVV A;  2MAW A;  5ABF B;  3AEC A;  1EC5 A;  1X79 B;  2XQ3 A;  3HUS C;  3KDP B;  4CPG A;  3QNU A;  5IHY A;  2XQ4 A;  5CJ5 A;  4XFJ A;  1AQ5 A;  3CLQ A;  3PUA A;  2Q5U A;  2B76 A;  2IAK A;  4MHC A;  3RRC A;  4HWD A;  1N73 A;  2V6Y A;  1J5E T;  1SQV G;  1FOS F;  1YIJ P;  3JAF A;  2IZ0 A;  5TIS E;  2N1T B;  4H0L B;  2HR3 A;  1G1I A;  1KQS O;  2Y9Z A;  3H1I E;  2IC6 A;  1BGY E;  4I2L C;  3L71 G;  1OED A;  3GHG B;  5APQ A;  4C90 A;  4YSY A;  2LT3 A;  3UUB A;  1JNZ A;  1L2P A;  4MAL A;  3RRW A;  3RK3 E;  4GK5 E;  2V7Q J;  4PV1 B;  3I9Y A;  2WPS A;  1IC2 A;  2H7O A;  1KIL D;  3AE5 C;  2HN1 A;  4HGA A;  2L5G B;  3VRB A;  3U59 A;  3OYZ A;  1EDL A;  2M5A A;  3QB5 K;  3SWH A;  3RYF E;  4B3T T;  1NWM X;  3RKO A;  1YJN P;  3E08 A;  3B5N D;  1KYO I;  3T8O A;  1H7C A;  2G0U A;  2WVR A;  3L37 A;  1VF5 D;  2A2F X;  2CHN A;  4ZOL E;  3AE6 C;  1KNR A;  4DV6 T;  2KNC A;  2JQQ A;  4L0R A;  3I5C A;  3UTK A;  5CJ4 A;  3N4X A;  3CI9 A;  1AVO A;  4RJT A;  1S9K D;  3FZM B;  2KB7 P;  1Y47 A;  4KMC A;  2YKO A;  1N2D C;  4EDF A;  4W7Z A;  5H2F E;  3ZST A;  3GLM A;  3VHL A;  5CCH A;  1Q90 D;  2E76 C;  2BEZ F;  1D1A A;  2WU5 A;  3RIU A;  2NW9 A;  4JEH B;  3AB3 B;  3TKL B;  1L0V A;  4HN9 A;  4YTP C;  1M1J B;  4IE6 A;  1N7S A;  3S4R A;  1L0L K;  4B86 A;  5AW4 B;  1SQX E;  3KV5 A;  3LK2 B;  3C4Z A;  2POH A;  1VRB A;  4L76 A;  3CCV P;  3EUH A;  1FS0 E;  1PZQ A;  3CKD A;  3BQI A;  3T97 B;  2K3R A;  1SQQ K;  2FYU K;  2Y9Y A;  4U7I A;  2QM8 A;  2L3L A;  3A5T A;  2H7V C;  5J1G A;  3S4U A;  3FWL A;  1RH5 B;  3KVB A;  1KB9 D;  1G2C A;  2WB5 A;  3NRX A;  2NW8 A;  1WR6 A;  2VKD A;  1SUM B;  3TLS A;  3WUV A;  2LKG A;  4YTM A;  4ZI3 C;  5APT A;  3RH3 A;  3TLV A;  3MAC A;  3FXE A;  3AEA C;  5HYA A;  2BS4 A;  5L4H A;  4I7Z B;  2I6H A;  3EAB A;  2LE8 A;  4G2A A;  4YJ3 E;  1EDK A;  1HGZ A;  1S72 P;  3CXH I;  1WLX A;  1KYO H;  2ZM0 A;  2Z6E A;  4GK0 E;  4KHZ F;  4N78 E;  1EXJ A;  2D9D A;  3I1A A;  3VOP A;  3TLT A;  2KK7 A;  2WQY C;  2LOP A;  3AA1 B;  2X0L B;  1MV8 A;  2A06 E;  2YU2 A;  2ZM8 A;  4LF9 T;  4DR2 T;  3B4S A;  3CX6 B;  1P84 I;  1JM0 A;  1M57 D;  1BSN A;  2IHR 1;  2ODV A;  5LMN T;  1N34 T;  1OIP A;  3B8E B;  3L72 J;  2IIU A;  4JI4 T;  3JC2 2;  2I8D A;  3N2G E;  3GA8 A;  4UEL A;  3ETV A;  5CCG C;  3MTU E;  1BE3 E;  4HFV A;  5BU8 B;  3RLF F;  3PU3 A;  2H88 A;  4I50 E;  4NUU A;  3EWK A;  3PTZ A;  2O01 J;  3UU5 A;  2AXT H;  5AW5 B;  2X0Y A;  5FMN A;  2HFE D;  1W09 A;  2QJY B;  2E9X D;  2IZ1 A;  3H25 A;  2CEA A;  3AA7 B;  4DOJ A;  3L72 D;  3FZF B;  1VPC A;  4OHF A;  4MN4 C;  1G73 A;  2P67 A;  3AE1 C;  1MZ9 A;  2WSS H;  4DV1 T;  3GMI A;  2M3E A;  5KJ7 A;  1W0A A;  2GM4 A;  2Q9Q B;  1L0L J;  4H13 C;  4QXB B;  3CCJ P;  2HOD B;  3L4F A;  2W66 A;  4L74 A;  4AQY T;  2OTK E;  3HUS A;  2NOX A;  4KHP T;  3ZT5 A;  1FBM A;  4IL4 A;  3RQU A;  1NEK A;  1SQQ G;  3HE5 B;  3PE0 A;  2FYU G;  4TNW A;  4W7Y A;  2XM1 A;  2FYZ A;  3H1H E;  1L4A C;  2JR8 A;  4DR7 T;  1HG5 A;  5ETW A;  2ZVO B;  4IL6 E;  3VMY A;  4CI1 B;  3BCC G;  5JDQ A;  4WY4 D;  3M9Q A;  2OQQ A;  3L35 A;  2XAS B;  4IFF A;  3ZMZ B;  1IJD B;  1L0L D;  1U7M A;  4YSX A;  2A45 I;  2VQE T;  1N36 T;  4DO0 A;  2WWU A;  1N33 T;  2MKV A;  2Y0E A;  1SQP J;  4FI5 A;  5AW2 B;  4L73 A;  2A72 A;  3OVU A;  3C4X A;  3L70 J;  2A45 G;  1EXI A;  2WT7 B;  3A7M A;  3ZDM A;  3WUU A;  2DNX A;  3OW2 O;  2QG4 A;  3B13 A;  5JVD E;  2O01 H;  4IFM A;  3CWB G;  2BVM A;  1T2K D;  2E5Y A;  5KAF E;  3KHU A;  1SQP D;  2FY8 A;  2LOS A;  4KT0 J;  3RK2 C;  3AE3 A;  3AE6 A;  5C2T A;  5AQH B;  1IJ6 A;  3NFQ A;  3L70 D;  3H1J G;  1YBK A;  2B88 A;  4BXL A;  2W67 A;  4XE5 B;  5AQT B;  1URQ A;  3PUX F;  2FYN B;  3M65 A;  4OWF A;  3AE2 C;  2XQ5 A;  1PP9 J;  2N1T C;  4H0L C;  1WT6 A;  2XJ7 A;  4L9I A;  1GK4 A;  3JC6 D;  5KKZ C;  2VRS A;  2ZM2 A;  3ONJ A;  5AQO B;  4DVD A;  4ILU A;  4TX5 A;  4JI5 T;  3GHG C;  3IR9 A;  2M67 A;  4QHO A;  2BG9 B;  4YTP A;  1WYB A;  4WB4 A;  4P1N A;  5ADX L;  2VL8 A;  3HR0 A;  1LT9 A;  4TT3 H;  2CE7 A;  4PV1 C;  1KD1 Q;  4GDO A;  4PD4 E;  3MZW B;  1PP9 D;  4YHJ A;  1RF1 B;  3DP7 A;  5LCY A;  2WMN A;  3LW5 J;  5TAO A;  2CPS A;  3UU4 A;  3CCS P;  2EHO B;  1JEK A;  5TJH A;  2AEM A;  4U3F G;  4LMJ A;  4RKU J;  4MLK A;  4GOF A;  5HXR A;  3J9X 1;  4GYS A;  4I43 B;  3FBL A;  5M1B A;  3AEA A;  3M0A A;  3KV9 A;  4KI0 F;  3II6 A;  2KUB A;  2X51 A;  3EDU A;  1OW7 A;  3L39 A;  4DZO A;  3I55 P;  2OYH A;  1X8Y A;  4BJM A;  3FZK B;  2W0G A;  3O1J A;  3CCM P;  3AA6 B;  1SQV E;  4ZZC A;  1JUN A;  4AUW A;  4OK0 A;  1ZXG A;  2EHO D;  4H9S E;  1JY3 O;  1OVU A;  4DJG A;  1UGO A;  2WQY A;  2QJK B;  4O4L E;  5LJM A;  4PJ0 E;  1FOS E;  3USS A;  3TLU A;  5J2U E;  1XTC C;  3D6Z A;  3CME P;  4IE7 A;  1V9D A;  1AA0 A;  1FC2 C;  5AQK B;  4K3A A;  1X0T A;  5GTI E;  1IK9 A;  4DUZ T;  3V2R A;  4AKL A;  5CCG A;  2E75 D;  5CBN A;  1S35 A;  4LFA T;  3OBV E;  4GYR A;  3AVR A;  2XAQ B;  1XWM A;  1BR0 A;  1ZR4 A;  4M1P A;  3L73 J;  4OX9 T;  1QVG O;  4I7Z C;  4PNI A;  2R5B A;  1GL2 B;  5AQV B;  1VQL P;  4ASK A;  1NH4 A;  3ZSS A;  2W27 A;  5CB4 E;  1M1K Q;  2XSA A;  2V7K A;  1QVF O;  4HH2 A;  3AE1 A;  3ANW B;  2VVN A;  5FY0 A;  3HKC E;  1HGV A;  2IPP A;  2H7H A;  2IFM A;  1N8R Q;  1SQX J;  4ANJ A;  3L75 G;  3OJA B;  3L73 D;  4UVA B;  1OVR A;  4IE4 A;  4UEM A;  2RH0 A;  3E7K A;  2V6X A;  3GF3 A;  1K73 Q;  2O01 N;  4PJL A;  2C5K T;  2N9Y B;  1N73 C;  5KLI B;  4JI6 T;  2ZAE B;  4DMW A;  1HX8 A;  4JBW F;  5HXC A;  1S2E A;  3KXD A;  1VQN P;  3OTO T;  1T8Z A;  1UX5 A;  3N9Q A;  5HEU A;  4NPD A;  3NZP A;  5AQF B;  3H1K E;  1SQX D;  4LGD E;  2WSC H;  2KIK A;  2YKP A;  1KFM A;  2A9U A;  3Q5D A;  3A7O A;  3ETU A;  1GQE A;  1CSB A;  3QC9 A;  1S4X A;  4ZEY A;  3RL0 g;  3M9B A;  4HFB A;  3RIF A;  2CPB A;  1LGH B;  2JKV A;  5EK2 A;  4NXN T;  3K1S A;  4QH4 A;  1MMN A;  2FJB A;  3TYY A;  3KBU A;  3ABV A;  3IBP A;  2KWH A;  2G8Y A;  2QJY C;  5B66 E;  2B9B A;  2FJD A;  5DJU B;  4DUY T;  1NTZ K;  4KJM A;  5AVY B;  4DR6 T;  1HTJ F;  3TLW A;  2V7I A;  1M8O B;  4FJO A;  3CCL P;  1CHU A;  5ABF A;  1X79 A;  5AQR B;  4LF7 T;  1H0T B;  1NKZ B;  2M3B A;  4UR9 A;  1PGQ A;  4DBQ A;  1LTA C;  3LK3 B;  4BAY B;  1BCC E;  1IAP A;  3HE4 A;  3JCF A;  1SFC B;  3CXH E;  4HWH A;  3R4Y A;  4XZC A;  1Z56 A;  4GKK T;  2WMO A;  3C51 A;  4DND A;  4Z1M H;  4CZZ B;  2MTQ A;  3C98 B;  2I59 A;  2CXD A;  1T7S A;  4QXH B;  3AE2 A;  5CCH C;  2N1T A;  4HFE A;  1BE3 J;  5CJ0 A;  1SHZ C;  3G06 A;  4OFZ A;  2K37 A;  1EZV I;  2J58 A;  3GW6 A;  4UB8 H;  2NWB A;  4H63 V;  5FKY A;  2K3W A;  3U1C A;  4PAG A;  3RIU C;  3AE8 A;  3DJB A;  3D6Y A;  3GHG A;  1P84 E;  1OFC X;  2LLY A;  2IML A;  3CPZ A;  2E74 D;  2OA5 A;  3EAM A;  3F31 A;  2JIW A;  5JH7 E;  3RBX A;  4LF4 T;  1EZV G;  4WWI A;  1NO4 A;  3K5B A;  1VDF A;  2IBZ I;  3P4Q A;  3MP7 B;  3VR9 A;  1BE3 D;  2J62 A;  3WI3 A;  4AQG A;  4OYJ A;  2KS1 B;  4C7R A;  1X9B A;  4X1Y E;  2CBJ A;  3L8R A;  4IL9 A;  3AEF C;  2M6B A;  2BDE A;  4ZI3 D;  2K48 A;  3AED C;  2VQF T;  3C9I A;  4U2Z A;  4EED A;  2IBZ G;  2W83 C;  2BAS A;  2JWD A;  4QXC B;  2LRL A;  3JCU H;  1VQK P;  4HFC A;  3CCU P;  1BR4 A;  5AVW B;  1VQ7 P;  4EAH A;  1VQ6 P;  1SQB E;  2LR2 A;  5LMU T;  2IYP A;  1BDC A;  4P0B A;  2BEQ D;  3E0Z A;  5B5E E;  4JI0 T;  1E7P A;  2KP8 A;  3ZYK A;  1W2E A;  2X9X A;  3UQ7 A;  2WZ7 A;  4EIW A;  2WBL A;  1JTH B;  1ZKE A;  2CLY B;  4WNK A;  2KXP B;  1AJY A;  2AXD S;  1M1J A;  2LSJ A; 
#chains in the Genus database with same CATH homology
 1N86 A;  4H9N C;  2M8R A;  3VKH A;  2JMK A;  1GW3 A;  2P7J A;  3T97 A;  5APS A;  4AXP A;  5JQG E;  5LGU B;  4N3Y B;  2CWY A;  5CCG D;  4CXX A;  2DI4 A;  2VWA A;  2VB6 A;  3LID A;  4UF0 A;  4I4T E;  4IFD K;  3N2K E;  3ZMU B;  4QKN A;  5AVR B;  2KSJ A;  4RES B;  5KLV K;  3N9N A;  5LHG B;  5AVT B;  1IFI A;  3FBZ A;  5JDF A;  3PUS A;  5LYJ E;  3OA7 A;  4W80 A;  3GWH A;  4IE0 A;  2Q9I A;  1IO4 A;  5FXX A;  5LP6 E;  2NPS C;  3AAA B;  1MMG A;  1L4A D;  2OYI B;  2XHE B;  1ZR2 A;  2X68 A;  3UFE A;  3EQ2 A;  1KIL B;  3MKD A;  3TNU B;  5AVU B;  3ZEF B;  1FZB A;  4O4H E;  1GU5 A;  4ZI7 E;  3ZJ1 A;  3B5N B;  3PUG A;  3E1I A;  3KQG A;  3HTK B;  4U74 A;  1AFO A;  3ZYM A;  2W6A A;  4P0A A;  1KNZ A;  1JOC A;  2Y48 B;  3BQK A;  2QA7 A;  1WRD A;  2KLQ A;  1FMW A;  5APU A;  2Y8D A;  3V5U A;  1SLQ A;  3RK2 D;  2Q9Q A;  4IIJ E;  2C0X A;  3ZJ2 A;  5FYM A;  2HOD A;  5E0O A;  1T3J A;  3HE5 A;  2E8I A;  3HRN A;  3F2E A;  4DBR A;  1URQ C;  3V2Q A;  4XAX B;  3HI2 A;  3D0T A;  5KTB A;  1RE4 C;  2HLO A;  2CM0 A;  5CA1 E;  1PFI A;  5AW0 B;  3VN0 A;  1LT9 C;  2WT7 A;  3NRY A;  2PG8 A;  1O3X A;  3N2O A;  1B7T A;  2LSG A;  3LBX B;  5LG4 A;  1JY3 N;  2CMR A;  1ZHC A;  4WBA A;  3KIN B;  1FZA A;  2PFV A;  2JJL A;  3P8C E;  1D1B A;  1SFC C;  1ZEE A;  3UUX B;  4EZ4 A;  1SQP K;  3LK4 2;  3OKQ A;  3MIW A;  4H63 H;  2OYH C;  1QUU A;  3RL0 B;  3L09 A;  4TV9 E;  2R3C A;  5CMZ A;  3V5S A;  3KDS E;  4EOT A;  3N9M A;  3AAE B;  4O8S A;  3VMX A;  5AW6 B;  2E9X B;  3SWY A;  5LXT E;  1RF1 A;  5FXW A;  3RL0 D;  4H9P C;  3MUD A;  1U5P A;  4ERR A;  1VOM A;  3VKG A;  5LGT B;  4Z8X A;  5FXV A;  1YTZ T;  5AVX B;  3SWF A;  3BRV B;  3VP9 A;  5HXE A;  4Y99 B;  3M06 A;  1YTZ I;  4V1A v;  4HYT B;  2UXX B;  2J59 M;  1FJK A;  5IYZ E;  3FHN A;  4ZS3 A;  1N7L A;  2HG5 D;  4C46 A;  3DTO A;  1US7 B;  1JY2 N;  4WY4 B;  2LSI A;  5LOV E;  5AVZ B;  3V5B A;  3C64 A;  2CLY C;  3CX7 B;  4ZI2 C;  2RA1 A;  2NPS A;  1AJ3 A;  2RP4 A;  3HA4 A;  5JR9 C;  5GON E;  3H32 B;  4AI6 A;  3HD7 C;  1IJ5 A;  3P32 A;  3CX8 B;  3R6N A;  5HXH A;  4C91 A;  3KBT A;  5H6R B;  1GL2 A;  3E22 E;  5EK4 A;  1BR2 A;  3V4Q A;  2X9Y A;  3ANW A;  2W62 A;  1HS7 A;  1XTG B;  3U1A A;  1EZ3 A;  4P09 A;  4LC1 A;  2OYI C;  3KV4 A;  2VAS A;  4ZS2 A;  2XTL A;  5CCH D;  1RE4 A;  1DEB A;  4AQR D;  2XNX A;  3B5N C;  2LSY A;  2XDJ A;  1LTJ B;  3ZN0 B;  1N7S D;  4GKG A;  5JDG A;  2KMF A;  5AVQ B;  3LIE A;  5M4Y A;  4C7N B;  1SQX K;  5LNK A;  2N9B A;  2QGS A;  4KP3 C;  4X1K E;  1LRZ A;  2C0W A;  2HPL A;  3V2P A;  1QSD A;  3IFM A;  2N1G A;  4PK4 A;  1NWQ A;  1FMV A;  3K8P C;  5LGN B;  1J1D B;  2FFD B;  2ZXE B;  1SFC A;  3CVR A;  1D0Y A;  5LBM A;  1MFZ A;  3O1H A;  2XV5 A;  3A2A A;  3RK3 B;  2LHN A;  2D2S A;  4UV8 B;  2QM7 A;  3MJX A;  2PAJ A;  2DWK A;  1M1J C;  3H3A A;  4CXY A;  5L3D B;  2P2U A;  2WPQ A;  2E43 A;  1T98 A;  1S9K E;  3ZYL A;  1ZV8 A;  3RK3 D;  1JCD A;  3LW5 H;  1ZLL A;  2BZB A;  1GU4 A;  3C4W A;  3MGN A;  1HWT C;  2WPR A;  3I9W A;  5KJ7 D;  2LSK A;  5APY A;  3MK7 C;  3NTN A;  2XKM A;  1JTH A;  3ZN1 B;  2XU6 A;  1Z0P A;  2D0T A;  2NPS D;  5DQV A;  3RC8 A;  2NTX A;  1IFM A;  2PP6 A;  3K3N A;  2E9X C;  2LEH A;  5JR9 A;  2V7M A;  3SRZ A;  2PJQ A;  2IC9 A;  2P1J A;  1D0X A;  1JY2 O;  3HD7 A;  1UX4 A;  1IFN A;  4EZH A;  2IFN A;  2YIN A;  3HKB E;  1ZV4 X;  1FZE A;  3M9H A;  2W6B A;  3KVA A;  2CA5 A;  2CCQ A;  2SPC A;  1NAF A;  2YO3 A;  3ZMV B;  5JRC B;  5AVS B;  1GK6 A;  3RC3 A;  2Z4E A;  4I1L A;  3P8C D;  2ODU A;  4JF7 A;  2Q9Q C;  1JY3 P;  1CUN A;  3UIA A;  4G63 A;  5DJQ C;  3WAK A;  2KYV A;  1G8X A;  2OYI A;  1URQ D;  4CXW A;  4N78 D;  3ZLI A;  1CI6 B;  3ZPO A;  5HWX A;  3TNU A;  4OYK A;  1T2K C;  1FIO A;  5LBQ B;  3B5N A;  2CXL A;  4AQF A;  1H89 A;  1LVK A;  4YLH A;  1HFA A;  2MYS A;  5A1L A;  3L3P A;  4O4I E;  1J1E B;  2PBI A;  3UT5 E;  1H88 A;  2R5D A;  2VKH A;  5FP3 A;  3WMM 0;  3L36 A;  3RYI E;  1ZN5 A;  1MIW A;  3JC6 C;  4MBQ A;  3PTR B;  3RYC E;  4O9B A;  2W00 A;  2K24 A;  2DLR A;  2YEV C;  1GD2 E;  4BJN A;  3P8M C;  3FXD B;  5FXZ A;  2OAR A;  5JDH A;  3BQL A;  1FAV A;  4I6M C;  3NBX X;  5AVV B;  1JMM A;  3IF8 B;  1QL1 A;  3QUJ A;  4IST A;  4ZKP A;  4UXN B;  2YMY A;  2W61 A;  1LTB C;  3MD0 A;  1LWU B;  2P9B A;  3ONX A;  4F6R C;  1HTL C;  1HBW A;  1RF1 C;  1IFD A;  1GTW A;  3LBX A;  5L3C B;  3KYQ A;  2EHO C;  3V4W A;  3BAT A;  3OYX A;  1DX7 A;  1LKX A;  1A02 F;  1FZC B;  1LVF A;  1J1D C;  3HKE E;  1HG2 A;  3RPU A;  3AA0 B;  2FFD C;  1L4A B;  2C9N Y;  2LJL A;  5J2T E;  2V1D B;  1FJP A;  1WYC A;  2LKM A;  3CQX C;  3VMZ A;  3LFM A;  1NU1 K;  3B57 A;  2CXF A;  2H43 A;  2O1J A;  2E9X A;  1HUC A;  4ZKU A;  3BAS A;  3HD7 D;  4UIG A;  2NTY A;  2V7J A;  3GN5 B;  4XA4 A;  2KLV A;  1U4Q A;  3RK2 B;  3O1I A;  2X9W A;  4OH8 B;  3TSI A;  4JEU B;  3PUR A;  3HE4 B;  2DHR A;  1MND A;  5HAX A;  1YKH B;  2H8P D;  2XZR A;  2YK0 A;  4PJM A;  1GL2 C;  5APX A;  4LLH A;  4PFO A;  4EOZ B;  1KFN A;  2A3D A;  4WY4 A;  3K3O A;  5BMV E;  3FB2 A;  5DAB A;  1MNE A;  2WTY A;  3N9P A;  4L5G A;  2WWW A;  2HPC B;  3UUM A;  3Q5X A;  2JJ9 A;  1LTT C;  2JMH A;  2C9L Y;  4O2A E;  2L9Q A;  2N1T D;  5JDL A;  3H32 A;  3ZC1 A;  3RYH E;  3W15 B;  2XAJ B;  2VKJ A;  1JNM A;  2KND A;  3H6P A;  4HKA A;  4PK5 A;  5L2L A;  1HCI A;  2WAU A;  5APV A;  2ZMA A;  2KIN B;  5JDN A;  4UVB B;  1S94 A;  2ES0 A;  3F57 A;  4AKG A;  1T3U A;  5FNV E;  3O8Z A;  2HPJ A;  1NKN A;  2NP9 A;  1OXZ A;  1M7L A;  2N2N A;  4BA9 A;  2XQY A;  4HE8 A;  4M3L A;  1GZL A;  1SQB K;  1UCU A;  2Q3I A;  2CWO A;  1JCC A;  2YKQ A;  4QWN B;  5FY1 A;  4UF0 B;  4WBO A;  3NXS A;  1LTJ A;  1MIY A;  2ZFC A;  3ZCI A;  3KPE A;  3K3Q C;  4UVC B;  4YFS A;  1J1E C;  2VKO A;  2K9A A;  4CQI A;  5JRE A;  1CZQ A;  4C7N A;  1D1C A;  2WM9 A;  4TUY E;  1IFJ A;  1X9V A;  1EQ7 A;  4CI3 B;  1NHL A;  2EHO A;  1SP4 A;  2Z5H A;  5L3F B;  1MUU A;  3LJC A;  4IDZ A;  2FFD A;  1N73 B;  3BVH A;  2C5I T;  4O2B E;  2Q7C A;  1MMD A;  3CQC B;  5AW7 B;  3MA9 A;  2IX7 C;  4EB6 E;  2J1D G;  5AW8 B;  5C8Y E;  3RX6 A;  4EXT A;  2JRK A;  4MFR A;  3M91 A;  3QK6 A;  4B6X A;  1D0Z A;  4JLE A;  1G1J A;  1LWU C;  1LTS C;  2H3R A;  3O9X A;  3A3Y B;  4X1I E;  4H9O C;  1RE3 C;  3ESL A;  1YW0 A;  4ISS A;  4JUY A;  3N9L A;  5AW3 B;  4AYC A;  1FZC C;  3N5L A;  4WBN E;  3R2P A;  3IHR A;  4H9R C;  3OAK A;  3AAI A;  3AVS A;  2MJZ A;  2GUS A;  2WIT A;  1YKE B;  1NTK K;  5KDM C;  2C0S A;  2Q9Q D;  3Q2M A;  1N7S B;  3OJA A;  2ACX A;  5LHH B;  2DCF A;  5BVZ A;  1KQL A;  1H8A A;  4EYY R;  1KK7 A;  3M0D C;  1KIL C;  4X20 E;  2GK9 A;  1G2C B;  3ZCJ A;  3PU8 A;  2MBG A;  3SOL A;  4AQF C;  5KMG P;  1YD8 G;  3FXE B;  5DQW A;  4U72 A;  5APW A;  5AW1 B;  4GOU A;  3WAJ A;  3MZK B;  1QL2 A;  5JRC A;  5CA0 E;  1SVF A;  2L8K A;  5LA6 E;  4PJJ A;  1RF0 C;  2FKW B;  3VTP C;  4WW0 A;  3MXZ A;  3N7N A;  1CW5 A;  4H9Q C;  4E7S A;  1JO5 A;  3EVY A;  5KX5 E;  2A45 H;  1CI6 A;  1L0N K;  2KOG A;  4AKH A;  1LTG C;  3U3I A;  2KWI B;  1E1H B;  5CHX A;  5AW9 B;  1BR1 A;  5F8P A;  3A5X A;  4I55 E;  2N9D A;  2B1E A;  2JEE A;  1DH3 A;  4NUV A;  3Q9D A;  4XBF B;  3HL6 A;  5HWY A;  3EDV A;  2YNY A;  2HH7 A;  3HUS B;  3TK1 A;  1MMA A;  3KV6 A;  5FY7 A;  3R84 B;  2NPS B;  5BU5 A;  3BRT B;  3G3Z A;  3ZC0 A;  3UUL A;  2I1J A;  4K0U A;  3P7K A;  4EIJ A;  2XAH B;  2C5J A;  2V26 A;  3NZQ A;  3RL0 C;  2JPF A;  4KBM B;  1YYC A;  5JDM A;  5F3J A;  3CML A;  5L3B B;  3V2N A;  1LWU A;  5H6Q B;  3J7Y q;  1IZN B;  2BVL A;  1MIV A;  3PUQ A;  2R32 A;  4GT1 A;  4GIF A;  3I0Q A;  4JYB A;  3H37 A;  3SS1 A;  2I1K A;  1RE3 A;  1FZG A;  5AFU L;  2X67 A;  4KUM B;  1FZC A;  3C50 A;  3ZMS B;  1L4A A;  1GL2 D;  1URQ B;  4Y99 C;  5LJN A;  3U78 A;  2XAF B;  3ZMT B;  4WY4 C;  2D5U A;  2KZ7 B;  2ZLY A;  3HKD E;  1GW4 A;  4PJN A;  1GDT A;  2WSF H;  3LG7 A;  3CL3 D;  3O4X E;  4TZ4 C;  2XAG B;  1LT9 B;  3UUN A;  2DWG A;  2Y6X A;  4ADZ A;  3M0D A;  3CQG B;  1KIL A;  4A56 A;  3GN5 A;  2KT9 A;  1Y64 B;  1FEW A;  4TN7 B;  1HF8 A;  4TV8 E;  3HTK A;  4PW8 A;  5EZY E;  4AKR B;  4KHX A;  3BK9 A;  2OYH B;  2W63 A;  3NMD A;  1FDM A;  1J2J B;  1RF0 A;  1NTM K;  2FXM A;  4DMV A;  3N9O A;  1NOH A;  1N7S C;  2K5B B;  4ZHQ E;  1SFC D;  2HPC A;  5L3E B;  1WRG A;  3VYI A;  2IW5 B;  2WSE H;  3Q5W A;  4QX7 B;  4JYC A;  4IHJ E;  5HXS A;  1HH0 A;  2X9H A;  3PP5 A;  4PFP A;  4UV9 B;  2GUV A;  4HTE A;  2X66 A;  1SQV K;  2YO2 A;  3VU7 H;  1JY2 P;  2E42 A;  3VP8 A;  1LTJ C;  2LM9 A;  2NW7 A;  4CI2 B;  4O4J E;  1HJB A;  4IE5 A;  2XUE A;  3EFG A;  4J2C A;  5L3G B;  1OWA A;  2YU1 A;  4E7Z A;  3IEE A;  4GIW A;  5LHI B;  1LTI C;  5EK3 A;  3I0O A;  4YJ2 E;  2LHR A;  2WSS V;  4HEA A;  4QX8 B;  3PDY A;  5JR9 B;  1SA0 E;  1RY3 A;  3HD7 B;  1KZU B;  3CWZ B;  2O1K A;  2Z5I A;  4IGU A;  2HYN A;  3RK3 C;  2MOZ A;  3P7I A;  2V7L A;  4ZI2 D;  2D0U A;  4AKI A;  1FZF A;  1FU1 A;  1A02 J;  4EYU A;  4N6J A;  2VK9 A;  2UXN B;  1E5W A;  4PK6 A;  3KFW X;  5KJ7 C;  1HVV A;  1X79 B;  3HUS C;  3KDP B;  5IHY A;  3PUA A;  3CLQ A;  1AQ5 A;  2Q5U A;  2IAK A;  4MHC A;  3RRC A;  1N73 A;  1FOS F;  2N1T B;  1G1I A;  2IC6 A;  4I2L C;  3GHG B;  5APQ A;  4C90 A;  2LT3 A;  4MAL A;  3RRW A;  4GK5 E;  3I9Y A;  2WPS A;  1IC2 A;  2H7O A;  1KIL D;  4HGA A;  2L5G B;  3U59 A;  3OYZ A;  3SWH A;  3RYF E;  1NWM X;  3RKO A;  3E08 A;  3B5N D;  3T8O A;  1H7C A;  2G0U A;  3L37 A;  2A2F X;  4ZOL E;  2JQQ A;  4L0R A;  3I5C A;  3UTK A;  5CJ4 A;  3N4X A;  3CI9 A;  1S9K D;  2KB7 P;  4KMC A;  2YKO A;  1N2D C;  4W7Z A;  3VHL A;  5CCH A;  1D1A A;  2NW9 A;  4JEH B;  3AB3 B;  3TKL B;  4HN9 A;  4IE6 A;  1M1J B;  1N7S A;  1L0L K;  4B86 A;  5AW4 B;  3LK2 B;  3KV5 A;  3C4Z A;  2POH A;  1VRB A;  3EUH A;  3CKD A;  3BQI A;  1SQQ K;  2FYU K;  2QM8 A;  2L3L A;  3A5T A;  2H7V C;  5J1G A;  3S4U A;  3KVB A;  1G2C A;  3NRX A;  2NW8 A;  1WR6 A;  2VKD A;  4ZI3 C;  5APT A;  3RH3 A;  3MAC A;  5HYA A;  2LE8 A;  4G2A A;  4YJ3 E;  1HGZ A;  1WLX A;  2ZM0 A;  2Z6E A;  4GK0 E;  4N78 E;  3I1A A;  3VOP A;  2LOP A;  3AA1 B;  2X0L B;  1MV8 A;  2YU2 A;  2ZM8 A;  3CX6 B;  2ODV A;  3B8E B;  3N2G E;  3GA8 A;  4UEL A;  3ETV A;  5CCG C;  3MTU E;  4HFV A;  5BU8 B;  3PU3 A;  4I50 E;  4NUU A;  5AW5 B;  5FMN A;  2HFE D;  2E9X D;  2CEA A;  3AA7 B;  4DOJ A;  1VPC A;  4OHF A;  1G73 A;  2P67 A;  1MZ9 A;  3GMI A;  5KJ7 A;  2GM4 A;  2Q9Q B;  4QXB B;  2HOD B;  3L4F A;  3HUS A;  2NOX A;  1FBM A;  3PE0 A;  3HE5 B;  4W7Y A;  2FYZ A;  1L4A C;  1HG5 A;  5ETW A;  3VMY A;  4CI1 B;  5JDQ A;  4WY4 D;  3M9Q A;  3L35 A;  2XAS B;  4IFF A;  3ZMZ B;  1IJD B;  2A45 I;  4DO0 A;  2WWU A;  4FI5 A;  5AW2 B;  2A72 A;  3C4X A;  2A45 G;  2WT7 B;  2DNX A;  3B13 A;  5JVD E;  2O01 H;  4IFM A;  2BVM A;  1T2K D;  2LOS A;  3RK2 C;  1IJ6 A;  3NFQ A;  4XE5 B;  1URQ A;  3M65 A;  2N1T C;  1WT6 A;  4L9I A;  1GK4 A;  3JC6 D;  2VRS A;  2ZM2 A;  4DVD A;  4ILU A;  4TX5 A;  3GHG C;  3IR9 A;  2M67 A;  4QHO A;  1WYB A;  4WB4 A;  5ADX L;  2VL8 A;  3HR0 A;  1LT9 A;  2CE7 A;  4YHJ A;  1RF1 B;  3DP7 A;  5LCY A;  2WMN A;  5TAO A;  2CPS A;  2EHO B;  4MLK A;  5HXR A;  3J9X 1;  4GYS A;  4I43 B;  3FBL A;  3M0A A;  3KV9 A;  3II6 A;  2X51 A;  3EDU A;  4DZO A;  2OYH A;  1X8Y A;  4BJM A;  2W0G A;  3O1J A;  3AA6 B;  1JUN A;  4AUW A;  4OK0 A;  2EHO D;  4H9S E;  1JY3 O;  4O4L E;  5LJM A;  1FOS E;  5J2U E;  1XTC C;  4IE7 A;  1V9D A;  1IK9 A;  3V2R A;  4AKL A;  5CCG A;  1S35 A;  3OBV E;  4GYR A;  3AVR A;  2XAQ B;  1BR0 A;  1ZR4 A;  4M1P A;  4PNI A;  2R5B A;  1GL2 B;  4ASK A;  1NH4 A;  2W27 A;  5CB4 E;  2V7K A;  4HH2 A;  3ANW B;  5FY0 A;  3HKC E;  1HGV A;  2IPP A;  2H7H A;  2IFM A;  4ANJ A;  3OJA B;  4UVA B;  4IE4 A;  4UEM A;  4PJL A;  2C5K T;  1N73 C;  4DMW A;  1HX8 A;  5HXC A;  1T8Z A;  1UX5 A;  3N9Q A;  3NZP A;  4LGD E;  2WSC H;  2YKP A;  1KFM A;  3A7O A;  3ETU A;  1CSB A;  3QC9 A;  3M9B A;  2CPB A;  1LGH B;  5EK2 A;  1MMN A;  3TYY A;  3KBU A;  3IBP A;  2KWH A;  1NTZ K;  5AVY B;  1HTJ F;  2V7I A;  4FJO A;  1X79 A;  1NKZ B;  2M3B A;  4DBQ A;  1LTA C;  3LK3 B;  4BAY B;  1IAP A;  3HE4 A;  1SFC B;  4XZC A;  1Z56 A;  2WMO A;  3C51 A;  4DND A;  4CZZ B;  2MTQ A;  3C98 B;  2I59 A;  2CXD A;  4QXH B;  2N1T A;  5CCH C;  1SHZ C;  5CJ0 A;  4OFZ A;  2NWB A;  2J58 A;  4H63 V;  4PAG A;  3U1C A;  3DJB A;  3GHG A;  3CPZ A;  2OA5 A;  3F31 A;  5JH7 E;  1NO4 A;  1VDF A;  4AQG A;  3WI3 A;  4OYJ A;  4C7R A;  4X1Y E;  2BDE A;  4ZI3 D;  2K48 A;  3C9I A;  2BAS A;  4QXC B;  1BR4 A;  5AVW B;  4EAH A;  4P0B A;  3E0Z A;  2KP8 A;  3ZYK A;  1W2E A;  2X9X A;  2WZ7 A;  4EIW A;  2WBL A;  1JTH B;  1ZKE A;  2CLY B;  4WNK A;  2KXP B;  1M1J A;  2LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...