2QRXA

Crystal structure of drosophila melanogaster translin protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
NFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords GM27569p
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qrxA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qrxA01
1OVUA 2JWDA 1X0TA 1LT1A 4CPGA 5CBNA 4ZNCA 3AXJA 1H0TA 4K3AA 3PJAJ 2KUBA 2ZAEB 4EYYQ 2R44A 3S1KA 4BXLA 4IOIH 1S3JA 4NPFX 2B88A 2KIKA 2B89A 3FXDA 3RGUA 2M5AB 2K3RA 1ZXGA 1EDLA 1JMBA 2KS1B 2WMMA 2KZJA 3RIUC 2I8DA 4ASVA 4WWIA 1EDJA 4HB1A 2SPZA 4ZMDA 2LXCB 3RIUA 2B87A 4KJMA 2RKLA 1NVOA 4NPDA 3MZWB 1EC5A 3MHVA 2QVAA 5K5GB 1DEEG 4HJGH 3FXEA 5CBOA 3PJAA 1EDKA 2HR3A 1OVVA 4NPEA 5DJTB 1FC2C 3QB5K 1LP1B 1KEYA 1Y47A 1OVRA 1SS1A 2M5AA 1EDIA 1J1JA 1Q2NA 4GOFA 3AXJB 1MFTA 1JM0A 4JBZA 2QRXA 3QWOC 5C39A 2OTKE 5DJUB 4GOEA 2Q1KA 2LXBA 1LP1A 1ZW0A 2B87B 2M0BA 2KZIA 4MN4C 1H0TB 1BDDA 5EFWB 2UWJE 2KI7B 4HKZH 2P58A 1U7JA 4ASWA 1U7MA 3ZDMA 1BDCA 4K35A 3QB5A 2LR2A 4GODA 4WYVA 3PH0A
chains in the Genus database with same CATH superfamily
1SQQK 1CHUA 2V7KA 3RL0B 4KHPT 3RK3B 1OEDB 5IYZE 4JQ0D 2XSAA 4CPGA 4NPPA 1NYHA 2XJ7A 2R5DA 5CCGD 2UXNB 1M57D 2EHOC 1OW6A 3B5NA 3GHGC 1M7KA 4PJ0H 2I0MA 2VB6A 3QC9A 4DR6T 5EK4A 2X9WA 3N9OA 1T2KD 4ZI2C 2WWVA 3LIDA 1QEXA 2KIKA 4DNDA 1OEDA 5KAIE 2JR8A 5AW9B 2CLYB 4QMAA 2D2SA 3T8OA 2D2CD 2ZXXA 3KBUA 3R84B 2XKMA 2E76D 3PTRB 5JQGE 3D6YA 1L4AB 5HXHA 1GK4A 1N7SB 2I1JA 4DIDB 2HPCB 4NUUA 3OYZA 2V7QJ 1FZEA 1NGMB 4WB4A 2FBWC 2PFVA 4QXBB 5JDGA 3JC6D 1NHLA 2QA7A 4WNKA 3V5SA 3FZFB 2NRGA 1R8IA 3K3QC 1Z56A 3IBPA 5KTBA 1HGZA 4YXDA 2YMKA 2V6XA 3I55P 3G3ZA 4YJ2E 3BK9A 3W67A 3S9OA 2E2AA 1KYOI 1IJ5A 2Q7CA 1K8AQ 2XQ9A 4JBZA 3CXHI 5AW4B 2D2CB 2N9YB 4OK0A 1S35A 4AKLA 1L2PA 2K3WA 2Q9IA 4DCKA 1NWQA 5EK2A 2Y0EA 1JMMA 3HD7C 2WY2A 1CI6A 2YU2A 4X20E 4YSYA 1QL1A 4C91A 4EZHA 5L2LA 1FJKA 1JNZA 3MA9A 5FL0A 1RF1A 2M0BA 1H0TB 1HNXT 2G0UA 3GF3A 2LEHA 2N1TC 4ZZBA 2GA1A 5AQJB 4YSZA 4DV4T 4BA9A 5FY1A 3H1IJ 5BU5A 2RA1A 2KLQA 3HE5A 2N9DA 4H9RC 4PJ0E 2AXCA 3N2OA 4JBWF 2VL8A 4DJGA 1USDA 4WW0A 2KK7A 4TLFA 3EDVA 2MKVA 1JUNA 3L74D 4U72A 1UX4A 2E8IA 1PGQA 3H1LD 4C7NB 2B89A 2FXOA 4KUMB 4BAYB 5KKZB 3AE4C 3PP5A 1CUNA 4B6XA 1VQMP 5AQHB 3NWIA 4DMVA 1NU1E 3L35A 4UVBB 4AIUA 2KS1B 1AVOA 1L0LD 2DWKA 3TNUA 2V8SV 2KT9A 1XNQT 1LWUC 1BR1A 1LT9B 4YJ3E 3VRBA 4JPZB 2E9XD 1L4AA 1VDFA 2Z5HA 1W0AA 2EHOB 4E7SA 2ZM6T 2X0YA 1FZAA 1Y01A 3G6EP 1SQBK 2WSCH 1HF9A 3MHVA 1L0NE 1HG5A 3AEGA 4GOUA 5CCGA 3AEAC 5DQWA 4IL6H 3PUGA 4GK5E 2MAWA 1RHZB 1GW4A 4HE8A 1VQPP 2YKQA 3BQIA 2CA5A 2M67A 2KINB 1IBLT 4G2AA 3H1JG 1DD4A 4IFDK 4C7RA 2D5UA 1LTIC 1LP1B 4H13C 4M1PA 5ABFB 3HKEE 3I9YA 1VQNP 1LT9C 1OVRA 4Z8XA 5CA1E 3SFDC 4X5TA 2IAKA 3K3NA 1J1JA 2XV5A 2BG9A 3RQUA 3PLNA 3CMAP 3J7Yq 2V7IA 1HS7A 3MP7B 1KQLA 1Q86Q 1MZ9A 1T8ZA 3L4FA 4TWDA 1NAYA 3ZT6A 2FYUG 2XQ5A 1HNZT 2IDBA 2KZIA 3VR9A 1SP4A 5L3BB 1NO4A 3BATA 3N4XA 2PBIA 1IBMT 1I6ZA 1YQ3C 5FVKA 3BRVB 1LTSC 4IIJE 3HA4A 5J0ZA 3VHLA 1RQUA 3VMXA 2Q9QB 5FP3A 4WYVA 3B4SA 2D2CC 4GIFA 2XAHB 2PG8A 3FX0A 1YTZI 4PV1B 4DUYT 1N36T 2Z4EA 3OJAB 4EYYQ 3KINB 5FNVE 2R44A 1EZVD 1S9KD 3CD6P 5LCYA 3S4RA 3AE2A 5C3JA 3L72G 1XTCC 3RK3E 1FE6A 1KTMA 3I56P 1YBKA 2FYUJ 3KV4A 3WI3A 3L73D 1MMNA 4PD4E 1BSHA 3M3ZB 4JEUB 3GMIA 2CBIA 2O3JA 1LKXA 3AE3A 3B5ND 3BCCE 1AV1A 1JMBA 1S72P 2HPJA 2VL0A 3HE4B 2WMOA 1E7PA 1RE3C 3RBXA 2R5BA 1QVFO 2XDJA 2KMFA 2Q9QC 1WYBA 1FOSE 2YOEA 3VR8A 2OTJP 4DMWA 2MJZA 4H44B 3KDSE 2IYOA 1X79A 1JTHB 5JR9B 3NZQA 3N9MA 2W6AA 1EZVI 1HWTC 5FMNA 4PV1D 5ETWA 1JY2P 1M1KQ 4H9NC 4BRYB 1KF6A 4EEDA 1N73B 2YIUC 5HWYA 5LG4A 4A7PA 3L8RA 2N1TD 4OVNF 1NENA 5HEJA 1H7CA 1RE4A 3QB5K 2YNYA 3RL0D 1KZUB 3L37A 2O01J 5F8PA 3RC8A 1FDMA 4CN6A 2W0GA 2QJYB 2WPRA 3ANWA 3RYFE 2VWAA 4NIQA 3B5NB 1SQQE 3HKCE 2ZT9B 1W9RA 1M90Q 1K73Q 1GTWA 2JWAA 3M91A 4H44C 2NTXA 1L0NK 4HTEA 5L3GB 3AE9A 3KXDA 1PP9D 3KPEA 2YXQB 3RYHE 1LP1A 1JOCA 3F2EA 2N1TA 3ZJ1A 1Q82Q 3EWKA 3IFMA 4LMJA 1L0LG 1GL2C 2C5KT 2JPFA 3KFWX 1ZOYA 2LE8A 5CCHD 1WR6A 2KNCA 3L75E 2IFMA 1N7LA 3SWFA 4AYCA 3SFDA 1GZLA 1L4AD 3LW5H 3ZSTA 1URQD 4DR2T 4CXXA 4IDNA 1T6AA 2KXPB 3CXHH 3FGAD 3O6QA 3HRNA 3CWZB 3PUSA 1LT1A 2Z6EA 1H88A 4AISA 4K3AA 2YU1A 3OJAA 1YW0A 3RRCA 2KNCB 4J2CA 3B13A 2V6YB 3UQ4A 2UXBT 5LBMA 1P84H 3IAOA 3RH3A 3RYCE 3DP7A 5IWAT 2H7OA 1KFYA 4TNVA 3C4WA 3O1HA 1V9DA 3OBVE 2MTQA 4E7ZA 3T1HT 1HR0T 2VKDA 4WY4B 1PPJD 3AA7B 5AQSB 2ITAA 1MNEA 4H9SE 3NBXX 5HXSA 4JYAT 3H3MA 2JO1A 3GG2A 2IZ1A 5AVSB 2P9BA 4DV0T 3NRXA 2J47A 5HEUA 5LJNA 5FXWA 4ZI7E 1UUSA 3ZT5A 4BJMA 4AI6A 2WMNA 1SQPK 1N34T 2GUVA 4XZCA 4UF0A 2BG9C 1KNPA 1S5LE 1RF1B 3V5BA 4QXHB 3CWBD 1ZOYC 1MUUA 1SQBE 2E76C 3OA7A 1WLXA 4TV8E 3P4SA 5KAIH 2W00A 5ABGA 2B76A 1EXJA 1D1AA 2DNXA 2JQHA 2XQ6A 3NTNA 4CXWA 4EZ4A 4COFA 2CPTA 2QJPB 1LVFA 3USSA 3H37A 5JDFA 1HJ0A 3JAEA 4U2ZA 3N7NA 3OKQA 1X9BA 3HR0A 1RE3A 1OVVA 5LHGB 1KQSO 4ZOLE 1WFDA 2OGUA 4IE5A 3RC3A 4L75A 3ZJ2A 3N5LA 3K3OA 1UIIA 2R3CA 2JKVA 5LG3A 3IEEA 3CX6B 3IF8B 2O1JA 5F5WA 5C39A 4GOEA 2JRKA 3L74J 1E79H 2AE9A 1E2AA 3BQLA 4UR9A 3GHGB 3UU8A 2PP6A 2E74B 3PU8A 3BASA 5EK3A 4CXYA 4UVAB 4JI3T 4HFCA 4JI7T 4UXNB 2XQ4A 2CHOA 3QOFA 3AEDC 2FFDC 5CCHC 2LR2A 5AQOB 5L3CB 5GTIE 3L36A 5CFBA 2CE7A 2WB5A 3BCCG 3O6QB 1DIPA 2W63A 2P10A 3B5MA 3ONLC 3ABVC 4ZZCA 2KSJA 3M9QA 1R5SA 2POHA 3AXJA 5L8RJ 4B86A 5J2TE 1HNWT 2BBJA 2C5JA 2C0XA 4DR7T 5KLVK 2J4GA 1X9VA 1SQVK 2CK3H 4H0LB 2BVMA 2WPVB 4CN1A 2XAGB 4LF7T 4UB6E 1KNZA 2VKHA 3Q5XA 4XE5B 2C0WA 4EDFA 3TSIA 1VQ8P 2YK0A 5ABFA 2WQYC 3F5HA 1FOSF 1KORA 3BVHA 1SQPJ 3CL3D 3P32A 4M3LA 2FFDB 3RGLA 2L3LA 3LFMA 3SS1A 2Z5IA 1KILE 4I7ZB 1PZQA 3EABA 4FI5A 2IYPA 2W62A 1Q7YQ 4HWIB 3V4QA 1URQB 3P8CD 2ZVOB 4HFEA 4PFPA 5AVVB 1VQ6P 2WSEJ 3D6ZA 3AEBA 3NRYA 3ZC0A 4HWCA 3C4ZA 4TZ4C 1JCCA 2QVAA 3FWNA 3V2PA 5KLVJ 2ODVA 2PGDA 1S5LH 4EIJA 2UU9T 2I59A 1YI2P 2WBLA 1PL5A 1LTAC 1IFJA 3I5CA 5DJQC 2UUBT 4YT0A 2L8KA 4NPEA 4LMKA 4OGQB 1KK7A 2W67A 4U33A 1SQPG 1WCRA 3O4XE 4TWHA 1RF0C 1N7SC 4L73A 1LNQA 3CX5D 4IFFA 3GMAA 1KC8Q 3CWBG 2R3SA 4JF7A 5AW5B 2CRBA 2XSBA 3KYQA 4AQGA 1UX5A 3WUVA 2X66A 4HYTB 3WMM0 3EFGA 3PUXF 2AXDS 4EIWA 3AE7C 1PGJA 1M1JC 5KJ7D 4JI2T 2B87B 3L71D 3AE5A 2OLTA 2JJ9A 5AQFB 2OYHB 1XNRT 2UWJE 4DR4T 5APTA 4H9OC 4LGDE 2QJYC 2DCFA 3CCEP 3P8MC 1MKMA 4G63A 2IBZG 4R4MA 4ASWA 1U7MA 3FWLA 3AVSA 3FZMB 3ZYLA 2JQQA 5AVWB 5CMZA 3L70D 3NVOA 1SFCB 2WU5A 2FYNB 2KB7P 2A45G 4OGQD 2M3EA 3CCVP 1FZCA 5JDNA 2FXPA 3CX5I 4IFMA 2BZBA 3Q5DA 4KMCA 2VRSA 4KHXA 3CWBJ 2YN6A 4HFBA 1N73A 5JTGA 2NW7A 2PTFA 3G4SP 2BVLA 2W83C 3SWYA 3R2PA 1PIXA 2KWHA 2B88A 1KILA 4IL6E 3PURA 2WT7A 3NKZA 4DR3T 3RGUA 4GKJT 2OYIB 4LMLA 2H3RA 2XQ8A 4ZI3D 2Q3EA 1LTBC 4GYSA 3L71J 2F4VT 3A3YB 2LM9A 2N1GA 1WRGA 3UTKA 4ILUA 4DT0A 3VOPA 3M65A 1W2BO 5FKYA 3FHNA 3H32A 2B9BA 2KP8A 4P0AA 4ZS2A 2WZHA 3MZWB 1HBWA 1KB9I 1FBMA 1T3UA 1Y64B 2HPCA 4XA4A 1MMAA 3OTOT 3T97B 1DEEG 4HJGH 4IDPA 5CBOA 2WCAA 1ZEEA 3I1AA 1EDKA 1UCUA 2WQYA 2SPCA 4EI2A 2L91A 3UU3A 2NPSD 1NTKK 3ZCIA 1YKHB 2V7MA 5KLVG 3L74E 1QVGO 2JMHA 5AQRB 5EZYE 1SQBG 2BCCD 3L71G 3AE8C 1S2EA 4JI4T 2IPPA 4DBQA 2JEEA 4EB6E 2LKHA 5KAFH 1KILC 3F89A 4LC1A 1HG2A 3HKBE 3P4WA 5JDMA 1OEDC 2LOSA 1VQKP 2EHOD 4F6RC 4D6TJ 2QEXP 2ZYDA 1FS0E 2IZ0A 2W6JH 3AE9C 2R6GF 3AEDA 2MOZA 1SE7A 3L71E 3VN0A 3LW5J 2XQYA 4JEHB 1HF8A 4O4HE 3NMDA 4IDZA 1UGOA 3UT5E 2ACZA 3PUAA 3RQWA 3RYIE 3LIEA 2LKMA 1BE3J 4LF4T 4TV9E 1DD3A 1R8EA 3JCUH 3ZLIA 1D0ZA 4C90A 3CX5E 3H1KE 2NPSB 4ILBA 2BASA 1JY2N 3F31A 3W68A 1IFNA 2FJEA 2ZLYA 1H0TA 3I9WA 1E1HB 2YDQA 4YTPC 3AE3C 4QX8B 5HXRA 2P67A 2XASB 1NTZJ 1XTGB 3EAMA 2OYHC 2I1KA 4ISSA 4W7ZA 3AB3B 2WWUA 2AXTH 1ZP0C 4U2YA 1JY2O 1HJBA 2P2UA 4IT4A 2BDEA 2IIUA 1N73C 3UUNA 2WMMA 2KZJA 1XMOT 3ZPOA 4FJOA 1K04A 4WWIA 1HTJF 2LT3A 1SQVE 5APSA 1WRDA 2YKPA 5FY7A 4HB1A 1VRBA 2LHNA 2AXTE 5DABA 2C5IT 2EHOA 3RIUA 2JDIH 1YYCA 1FZFA 2W4XA 1MV8A 3VKGA 1HH0A 4IREA 3CI9A 2PFXA 3ABVA 1XDPA 3OVUA 3RHWA 2KNDA 4LFBT 5L47A 2W27A 3H32B 4O4JE 3AE5C 2HN1A 2CBJA 1JCDA 2DLRA 2IBZI 1NTKG 3H1KJ 5DJTB 4EEBA 5APYA 2K37A 2D9DA 1TU3F 2OV9A 3FB2A 3L09A 3T97A 4YXDC 4AXPA 4I7ZC 1EDIA 1KN7A 4IL9A 4A5XA 2J59M 3IA3A 5H6RB 5HEHA 1UK5A 3LBXA 1ZV8A 3P7KA 2WSSH 4AQRD 2K88A 2FKWB 1WT6A 1W5CE 5FL1A 5IHYA 4PJLA 4PD4I 4JV5T 2YINA 2XU6A 3SOLA 1SQVD 1YIJP 4ZXLA 4EV6A 5KLIB 5EFWB 3U78A 1G1JA 5JDLA 4UB8E 3KBTA 3BCCD 4P0BA 1SQVJ 3CCLP 5L4EA 1BDCA 2H7VC 4CI1B 2E9XA 1NTKJ 2H43A 1DX7A 2QM7A 3P4RA 1QSDA 2VURA 1NU1D 3PH0A 4OH8B 3RK2D 5LHHB 2AEFA 2O01N 4H63H 5LA6E 3U1CA 5BMVE 3ETUA 2J58A 5CBNA 3H1LE 4JI6T 2WZIA 3P4QA 1EZVE 3M0DC 4D6TD 1S9KE 1KFMA 2IHR1 3B71A 1WMKA 2KUBA 3AE6A 2FY8A 5AQTB 2WVRA 4AKIA 1PV3A 3KV6A 2LSJA 5GTHH 3CCMP 2UUAT 2WP9A 5AW0B 3HE5B 2MYSA 3AAEB 3EI0A 3UQ7A 3GA8A 4JUYA 4O9BA 5JVDE 2Y48B 2QM8A 1BR4A 4UIGA 1NAFA 3RIFA 4PK4A 2QGSA 1LGHB 1YHQP 2KLVA 4ADZA 4JI1T 2RH0A 4NXMT 4PK5A 2CXLA 3E1IA 2D0TA 4U74A 2XTLA 2IX7C 4WBAA 4DV7T 1AVYA 1LVKA 3A7OA 4IHJE 2HLOA 2B87A 4Z1MH 3O9XA 2RKLA 1ZMEC 3RK2B 1T98A 4AKRB 2A72A 1HGVA 1BGYG 1VL2A 1VQ9P 3TKLB 3AEEA 3D70A 1DEBA 4U7JA 4TUYE 4CQIA 2CPSA 2V7QH 3I0OA 4EGWA 1J1DC 1KB9D 1SQXK 2XQAA 3A0BE 3QNUA 2HR3A 2LOPA 2WSSV 3S4UA 3HL6A 2XHEB 1MMGA 3RK3D 4Y28J 3ZYMA 4AKGA 4RJTA 1Q2NA 1USEA 4QXCB 4HH2A 1QX8A 3P50A 5AVTB 3MIWA 1FEWA 5DJUB 4A98A 5CCGC 2VK9A 4Y99C 2C9LY 2ZVNB 3L75D 2X9YA 1G8XA 3UFEA 4DV3T 3LDQB 2XAJB 1IC2A 2YO2A 4N6JA 3VP9A 3B57A 1LTJC 4I2LC 2KI7B 1JNMA 1PP9E 3LBXB 2XZRA 3R6NA 1VOMA 1IFIA 3MZKB 2HH7A 3ZDMA 1EXIA 1T72A 4OGQC 3TDKA 2E9XB 3QB5A 3A0HH 3OYXA 3ESLA 3RF1A 1OXZA 3AE1C 2ZM0A 4TX5A 3U1AA 1YQ3A 1JB0J 4GKKT 4UELA 2CPBA 5FVLA 3H6PA 4HFHA 4GDOA 1YJNP 2QYWA 4Z90A 1YITP 4OX9T 3V2RA 4HEAA 1AJYA 4O8SA 5KMGP 1K05A 1KB9E 2ZT9D 1YKEB 3V5UA 3WU2E 3OAKA 3N2KE 4YLHA 3WUTA 4YHHT 1W2EA 4HWHA 4JYCA 1PP9G 1IFMA 5AVUB 4MHCA 4DO0A 1OIPA 4EXTA 3H3AA 4ZKUA 3FXDA 3G9RA 1OWAA 2ZYAA 4QX7B 3II6A 2QIWA 3Q1MA 4PJJA 1EDLA 4MFRA 1BCCG 1YQ4A 3H1IE 4ZI3C 1IJ6A 1KYOE 1AJ3A 2FYUE 4YPCA 4XBFB 3M0DA 1FZGA 4ZMDA 2ZFCA 4OWFA 2YDSA 2LLYA 1K9MQ 3DJBA 4LF5T 1LTJB 3A2AA 4O4IE 2LJLA 5ABEA 1EC5A 4X1IE 3UU6A 2KS1A 1SHZC 2KSRA 3RI5A 3C9IA 4U3FE 2OYOA 2NW8A 4Y99B 1PP9J 4AKHA 3RRWA 1NTMD 3IF4A 3LK3B 2ES0A 3PJAA 4A97A 2WSFH 1VCSA 1J5ET 3OPCA 1BGYJ 1HCIA 3D0TA 3TGUG 3E7KA 2NPSC 1E5WA 3UU5A 2YXRB 4JI5T 3AEFC 2I6HA 5HWXA 3M9BA 4ZEYA 3CQXC 2WSEH 5LBQB 1MNDA 2J62A 3EQ2A 4WBOA 3JAFA 2E76B 2PJQA 4LF6T 1KYOD 1EZVG 3AE6C 2W90A 3L73J 5LJMA 1SQQJ 2LRLA 4DVDA 1RH5B 2JQ9A 2J1DG 3BQKA 3CC7P 3CX7B 5AW8B 1CW5A 3AE2C 2WWWA 2HG5D 4GODA 4HGAA 3FZHB 1YTZT 3DTOA 2XUEA 4OYJA 2B1EA 3QUJA 5CJ0A 4A56A 1ZV4X 3PUZF 3AECA 2FJAA 5BVZA 2ACXA 1U57A 2L9QA 3KV5A 3N9PA 4U3FJ 2ZXEB 4PD4H 5M1BA 4TNWA 2X0LB 2DL1A 2Q5UA 4BXLA 1JEKA 5LHIB 3Q2MA 2KYVA 1NU1K 2K1AA 2RMZA 4XFJA 3L73G 4I1LA 1FIOA 1SQQG 4IL6X 4L74A 3KV9A 1VQOP 3GF7A 3K5BA 3HUSA 3CK6A 1A02F 3L72D 2RN0A 3UUXB 2K3RA 2XQ3A 5KAFE 2K9JA 1FMWA 1N8RQ 3VMAA 3GN5A 2X9XA 4EOTA 4P1NA 3ETVA 4H13D 4JI0T 1N32T 1JY3P 3O1IA 3A8YC 3KVBA 4U7IA 3RL0g 1FMVA 5LGUB 4UB8H 1IZNB 3U59A 4KHZF 1SFCD 5JDHA 3L73E 3VYIA 3RKOA 5C2TA 2V1DB 1VQ5P 3GN5B 1IFPA 2XY8B 2DW3A 2OQQA 1OZHA 2QJKC 3E08A 5AQMB 3UULA 3CPWO 1G2CB 1D0XA 5M4YA 1X79B 1BR2A 1D1BA 1QGKB 2MBGA 2Q6QA 1ZN5A 4JYBA 5KLVD 1PGPA 4DV1T 3M06A 2JJLA 3PUWF 3A5XA 1SQXE 1KV4A 1MFZA 3AA1B 1HX8A 5L4HA 3VRAA 4GKGA 4YHJA 1SQBD 2BCCG 2WTYA 4IE7A 3L72J 4UF0B 2LXBA 4ZS3A 4DV6T 3IN6A 5APQA 3V4WA 4QKNA 2A06D 1NWMX 3MTUE 1IBKT 2XM2A 2A45I 1BDDA 1NU1J 4UB6H 2IC6A 2X0HA 4B3TT 1N2DC 5HYAA 3L70G 1FJPA 1FAVA 1GD2E 1PPJE 3H1JJ 4K35A 3I0QA 5GONE 2WM9A 4HN9A 2LKGA 1Q81Q 1KNRA 2W66A 3CCQP 3PUVF 4CN4A 4F8HA 1SFCA 2VASA 3JCFA 3H1IG 1R5LA 3R4YA 5J2UE 2XAQB 3ZYKA 2JQKA 1G1IA 3JADA 5B5EE 4TN7B 3CCJP 4DBRA 5AW1B 4IOIH 1P84D 4RO0A 3MUDC 2X67A 4U3CA 4ANJA 2O1KA 2JIWA 2N1TB 1IAPA 1LTGC 2NR4A 3CMLA 3SFEA 3VKHA 2IC9A 1KILB 1SVFA 1N7SA 4U3FG 4JLEA 4YTPA 2M5AB 2WSFJ 4LF9T 1NU1G 3KHUA 3HD7B 2H89A 3L75J 3L70J 3RL0C 1YXRA 2I8DA 4O2BE 2A06G 3GW6A 4ZKPA 2H7HA 3P7IA 3AECC 1EQ7A 2BKOA 3MK7C 1NJIQ 5LB7B 5H2FE 3QH9A 2HODB 3CLQA 4UVCB 4QH5A 3A0HE 1G73A 3PTZA 4DZOA 2Q3IA 2DWGA 3ONXA 4LFCT 2NTYA 3KDPB 1X22A 1U4QA 1GL2D 2A2FX 2PAJA 2GUSA 3H1JE 2HODA 3IR9A 3NXSA 5KLIC 2HYNA 1YD8G 1FDOA 5TAOA 1L4AC 1T7SA 2C0SA 3UFGA 2N2NA 2UUCT 4K0KT 3AVRA 3UUMA 3SWHA 1QLBA 3EHZA 5AW2B 2V5CA 4NUVA 5BU8B 4PW8A 3W15B 2Q1KA 1S1CX 1OEDE 1ZR2A 2GK9A 3NFQA 2RPAA 3MGNA 2K48A 5AQIB 2Y9YA 2BS2A 3UIAA 3O1JA 5CJ4A 3BCCJ 4O2AE 4H0LC 2BCCJ 4ASKA 1X8YA 1XDOA 3Q5PA 3TF5A 2FJDA 1SUMB 2FBWA 5HEGA 2X68A 1JO5A 1OW7A 1LT9A 1YJ9P 3HUSC 3FBZA 3T1YT 1OMIA 5AVQB 5CA0E 4X65T 1SLQA 1KQGB 3E0ZA 1J2JB 5B5EH 1KD1Q 2JWDA 2VKOA 4ISTA 2H88A 2MPKA 3C64A 1U5PA 2BKPA 5AQNB 1LJ2A 3PJAJ 4MBQA 3TNUB 3L39A 4HFIA 3H1HE 2IUBA 3AEFA 1GDTA 4CI2B 3B5NC 3GHGA 3AEAA 1M56D 2E43A 4DOJA 1FZCB 4N78D 2VQFT 1L0LJ 1NOHA 4Z91A 4KBMB 2KWIB 2V26A 2YEVC 4B3ST 4EYYR 3VMYA 5AW7B 3AA0B 2YIUB 3IHRA 3LG7A 3RIUC 1QUUA 4L76A 3RK2C 4NXNT 1J5WA 3HTKB 4GIWA 2DHRA 3G06A 1WYCA 2CEAA 2LXCB 5L3FB 5LMNT 2WDQA 4GK0E 2CWOA 3L75G 2AEJA 5AVZB 4EAHA 2L5GB 3MD0A 4LFAT 2BCCE 5K5GB 1SQXJ 5AVXB 4IE6A 4N78E 1ZR4A 3A7MA 3TGUD 3ZC1A 3PJSK 4HWDA 3P4PA 2W2UA 1VQ4P 3OW2O 1PGOA 2BBHA 1H8AA 1KEYA 5APWA 4IE4A 4PJNA 2VKJA 3AE7A 3JSVC 1SQPE 2E75C 1PPJG 3ZCJA 1AFOA 3TLWA 2WITA 5AQQB 3KZIE 3QWOC 3ZKRA 2OTKE 1D0YA 2ZMAA 5LNKA 4U3FD 3PRJA 1VCTA 3WU2H 1IJDB 1J1DB 1M7LA 4X66T 1L0LE 2HN2A 1OX3A 1QLED 2J5UA 2WPSA 4MN4C 1DH3A 1BCCD 3MUDA 2DI4A 1GQEA 2GM4A 1RY3A 1SQXG 4L5GA 2BEQD 1O3XA 1JNRA 5CJ5A 3K8PC 4Q25A 1Z8UA 4H13B 4PAGA 4WZXA 5FXZA 1QL2A 5KXJA 4N3YB 1RF1C 3C8VA 4UEMA 3F57A 3AAAB 1GK6A 4U31A 4YY3T 3CCRP 4W7YA 2NOXA 5AQKB 1NH4A 2UXXB 4ZNCA 2QJPC 3UUBA 5GTHE 2LSGA 3H1LG 1EZ3A 3SFEC 4JI8T 2K5BB 2CXDA 3L70E 5AW6B 5LP6E 3L74G 3JC6C 1S3JA 3Q5EA 2ZM2A 2QA4P 4NPFX 1NTZK 2VVSA 3EDUA 3VP8A 1JTHA 2XQ7A 3RBZA 5JR9A 2BKNA 2E74D 5AVYB 1P84I 4L9IA 4KX6A 5AQVB 1FJGT 3GLMA 4H9QC 4B3RT 3U3IA 2E5LT 1G2CA 2IBZD 3ZN0B 2WDRA 3MJXA 1ZLLA 4KP3C 5E0OA 1BR0A 2HFED 4X64T 1ZKEA 1LWUA 2OYIA 2G8YA 2HHHT 1IK7A 4NPDA 2D0UA 3PU3A 5AQGB 3CXHD 3ZN1B 1SFCC 2R32A 4PD4D 2XZEA 4LF8T 4BWNA 2WS3A 5KJ7C 5AVRB 2OTLP 3FXEA 1BSNA 5L3DB 2FXMA 4H0LD 5AQPB 3ZMZB 3MXZA 4DUZT 2KLUA 3CIRA 2K24A 4EOZB 1SQPD 1AQ5A 4I0UA 5CGMA 2RP4A 3Q9DA 2OARA 1NTKD 3PUQA 2OA5A 4X1KE 1Y8AA 3AXJB 3LK42 1JM0A 1A02J 4U7YA 2LSYA 3FXEB 3Q5WA 3NZPA 4YSXA 4DV2T 3FBLA 1NKNA 2Q9QA 1KYOH 1MMDA 1KILD 2V4HA 2YKOA 5HEOA 2FUPA 2NW9A 3CQGB 2ZYGA 5FY0A 5AW3B 4TT3H 1OW8A 3KQGA 1LTTC 4LLHA 4I4TE 4X62T 4AQFA 2KSEA 5LGTB 2VVNA 2H88C 1S4XA 1M62A 3CC2P 1SQQD 5KX5E 3PDYA 1KFNA 3EFFK 3H1HJ 5HCJA 1NTZG 2IMLA 1X0TA 5CHXA 2BS3A 2XNDH 2E5YA 1BE3D 2FYZA 3N2GE 3HI2A 4IGUA 3ZMUB 5KLVE 3V6IA 2CMRA 3H1HD 4W80A 5CCHA 2FFDA 1GL2B 1NTKE 2W6BA 2X9HA 2N9BA 3MKDA 2E5TA 4DV5T 1J1EB 2G3AA 3HKDE 1UIXA 4I55E 2CLYC 4D6TE 1XZYA 3H1LJ 1T2KC 4ZI2D 4XAXB 4HFDA 5AQUB 3D71A 4PNIA 1SQBJ 4UV9B 3CCUP 2WU2A 5CB4E 3RPUA 2E74C 4MLKA 1ZHCA 4PJMA 1CI6B 3H1HG 1OFCX 5E79H 4KJMA 4P09A 3J9X1 2FYUD 1RQVA 4WVZA 5C8YE 1NTZD 1NTMG 3E1RA 2JMKA 3L3PA 2LM2A 4BJNA 5TISE 3M0AA 4B3MT 2V7LA 5GTIH 4TWFA 3FZKB 2CHNA 2LSIA 4GYRA 1Y9BA 2A45H 4ILAA 2V7JA 3SRZA 3CC4P 1FC2C 5LGNB 3JC22 1HTLC 5JREA 4YTNA 3TGUE 3H1JD 2M5AA 1ZP0A 1MFTA 1WR0A 2QSIA 2H8PD 3CWBE 3HD7A 3E22E 5HXEA 2YMYA 4I50E 5APVA 4MALA 1IFDA 2UXDT 4L0RA 2M6IA 2KZ7B 4ZHQE 3TK1A 2BG9E 5HXCA 4RKUJ 5KDMC 2CCQA 1XMQT 1IO4A 1NTMJ 5H6QB 2W61A 1UURA 3HD7D 2QE7H 1KQFB 3Q5RA 5FYMA 1PFIA 3CPZA 4UV8B 4V1Av 5J1GA 1J1EC 1HFAA 1N33T 4QH1A 3HTKA 4HKZH 4C7NA 1VF5D 4ILCA 3A5TA 2WAUA 1FDIA 2XAFB 3PHLA 3V2QA 2M6BA 3C50A 2FYUK 3LJCA 3UU4A 3CMEP 1OVUA 2QJKB 5APUA 4WY4A 2WT7B 2Y0CA 3N9QA 1JY3O 2BG9B 1W09A 1GMJA 3RLFF 3CVRA 3EUHA 1AA0A 3TLSA 4K0UA 2NZ2A 2QG4A 3CX5H 3AE4A 3CX8B 3AA6B 2YDRA 1B7TA 4AQFC 3AEEC 2LRKA 3Q2YA 1VQLP 5KJ7A 4AQYT 1I94T 2NP9A 2AEMA 5F3JA 4GT1A 3PUYF 5LXTE 3WAKA 3H1KD 5AQLB 2E5VA 2O01H 1BE3G 4QH4A 5JDQA 2OYIC 2PRRA 3AEBC 3K1SA 5FXVA 3AEGC 4ERRA 1VQ7P 1YQ4C 1W0BA 4IL4A 2FJBA 4HFVA 4CZZB 2IBZE 1LRZA 1NVOA 2E9XC 3G71P 2JP3A 1S94A 2IW5B 4AUWA 4WBNE 1NKZB 1D1CA 2V5DA 5JRCB 4IDQA 1KB9H 1ZRTE 1VPCA 3CCSP 2XNXA 1BE3E 1L0VA 4IE0A 4WY4C 1ZRTD 3EVYA 1LTJA 4KI0F 5DQVA 3GWHA 1SQXD 2E75D 1T3JA 4C46A 1HVVA 1IK9A 4YTMA 1Y47A 2IDOB 2WDVA 1FU1A 1SS1A 3TLTA 3TLVA 2XPKA 4GOFA 5JR9C 4O4LE 1BGYD 2QRXA 4OFZA 5LMUT 2NPSA 3C98B 5A1LA 1NTZE 4DR1T 4RESB 1RE4C 3V2NA 2Y0DA 2E42A 3C51A 4KT0J 1ZW0A 1GU4A 3AE1A 1D7MA 1XWMA 3C1LA 5B66E 3RIAA 3HE4A 3CQCB 2Y9ZA 5L3EB 3X1DA 3FZLB 4IDOA 3WUUA 4BRYA 3SSUA 1N86A 2FYNC 4QHOA 1U7JA 3PE0A 4H63V 4D6TG 2K9AA 3AE8A 3KZIH 5KKZC 3H1KG 3RKGA 1VF5C 1N7SD 4HKAA 2E75B 1KMIZ 2M3BA 5FXXA 3ONJA 3ITKA 5IUXA 3KVAA 4QWNB 2CWYA 2ZAEB 2LSKA 3Q5SA 3RX6A 1M1JB 2Y8DA 2XM1A 1T8BA 3ZMTB 3S1KA 1L0LK 2Y6XA 5HCMA 1RF0A 4HWFA 2YKSA 3CKDA 1BCCJ 2ZT9C 5AFUL 2BS4A 2C9NY 1SA0E 3VMZA 2P1JA 5JH7E 4DR5T 1L0NG 1NEKA 3B8EB 1ZXGA 5APXA 1MIWA 4R4LA 1M1JA 1DU2A 3ZSSA 1SQVG 3M9HA 3RK3C 4ASVA 3LSVA 1EDJA 1VF5B 4EYUA 1US7B 2A06E 1FZBA 2SPZA 1URQA 3ZT7A 2Q9QD 4PFOA 2WZ7A 5TJHA 3N9LA 4PV1C 4CI3B 3MACA 3HUSB 5ADXL 5ABHA 4I43B 1AQTA 2LHRA 2K9JB 2A3DA 4OHFA 3C4XA 3TGUJ 1FZCC 5JRCA 1Q90D 3BRTB 2V6YA 1CZQA 2ODUA 2P7JA 1M8OB 3FXDB 5HAXA 2VQET 4YXWH 3VTPC 3LK2B 2NWBA 1HUCA 1L0NJ 2ZJSE 3ZMVB 1YJWP 1P84E 1MIVA 4WY4D 2IFNA 3VU7H 1MIYA 3PV0F 5LYJE 2HPLA 3QK6A 2KOGA 1JY3N 5BR8T 4YFSA 1L0ND 1NTME 3ZMSB 2UXCT 2WPQA 3H25A 4X1YE 3A0BH 2ZM8A 2WSCJ 2X51A 2M8RA 1GL2A 2CXFA 1BCCE 3CXHE 4PK6A 1S5LX 3O8ZA 4H44D 1HX1B 2W8ZA 3JCUE 3SWKA 4H9PC 4OYKA 2H89C 2A9UA 3N9NA 1LWUB 2OYHA 3ZEFB 3Q3DA 5LOVE 3P8CE 5E79E 1NTMK 1Z0PA 3WAJA 3TLUA 3AAIA 1CSBA 2YO3A 1URQC 2K9YA 5H2FH 2P58A 3L72E 5B66H 1H89A 2BEZF 2CM0A 1GU5A 3H1ID 1BGYE 4I6MC 5TISH 3TYYA 1GW3A 3ANWB
chains in the Genus database with same CATH topology
1OVUA 2JWDA 1X0TA 1LT1A 4CPGA 5CBNA 4ZNCA 3AXJA 1H0TA 4K3AA 3PJAJ 2KUBA 2ZAEB 4EYYQ 2R44A 3S1KA 4BXLA 4IOIH 1S3JA 4NPFX 2B88A 2KIKA 2B89A 3FXDA 3RGUA 2M5AB 2K3RA 1ZXGA 1EDLA 1JMBA 2KS1B 2WMMA 2KZJA 3RIUC 2I8DA 4ASVA 4WWIA 1EDJA 4HB1A 2SPZA 4ZMDA 2LXCB 3RIUA 2B87A 4KJMA 2RKLA 1NVOA 4NPDA 3MZWB 1EC5A 3MHVA 2QVAA 5K5GB 1DEEG 4HJGH 3FXEA 5CBOA 3PJAA 1EDKA 2HR3A 1OVVA 4NPEA 5DJTB 1FC2C 3QB5K 1LP1B 1KEYA 1Y47A 1OVRA 1SS1A 2M5AA 1EDIA 1J1JA 1Q2NA 4GOFA 3AXJB 1MFTA 1JM0A 4JBZA 2QRXA 3QWOC 5C39A 2OTKE 5DJUB 4GOEA 2Q1KA 2LXBA 1LP1A 1ZW0A 2B87B 2M0BA 2KZIA 4MN4C 1H0TB 1BDDA 5EFWB 2UWJE 2KI7B 4HKZH 2P58A 1U7JA 4ASWA 1U7MA 3ZDMA 1BDCA 4K35A 3QB5A 2LR2A 4GODA 4WYVA 3PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVU A;  2JWD A;  1X0T A;  1LT1 A;  4CPG A;  5CBN A;  4ZNC A;  3AXJ A;  1H0T A;  4K3A A;  3PJA J;  2KUB A;  2ZAE B;  4EYY Q;  2R44 A;  3S1K A;  4BXL A;  4IOI H;  1S3J A;  4NPF X;  2B88 A;  2KIK A;  2B89 A;  3FXD A;  3RGU A;  2M5A B;  2K3R A;  1ZXG A;  1EDL A;  1JMB A;  2KS1 B;  2WMM A;  2KZJ A;  3RIU C;  2I8D A;  4ASV A;  4WWI A;  1EDJ A;  4HB1 A;  2SPZ A;  4ZMD A;  2LXC B;  3RIU A;  2B87 A;  4KJM A;  2RKL A;  1NVO A;  4NPD A;  3MZW B;  1EC5 A;  3MHV A;  2QVA A;  5K5G B;  1DEE G;  4HJG H;  3FXE A;  5CBO A;  3PJA A;  1EDK A;  2HR3 A;  1OVV A;  4NPE A;  5DJT B;  1FC2 C;  3QB5 K;  1LP1 B;  1KEY A;  1Y47 A;  1OVR A;  1SS1 A;  2M5A A;  1EDI A;  1J1J A;  1Q2N A;  4GOF A;  3AXJ B;  1MFT A;  1JM0 A;  4JBZ A;  2QRX A;  3QWO C;  5C39 A;  2OTK E;  5DJU B;  4GOE A;  2Q1K A;  2LXB A;  1LP1 A;  1ZW0 A;  2B87 B;  2M0B A;  2KZI A;  4MN4 C;  1H0T B;  1BDD A;  5EFW B;  2UWJ E;  2KI7 B;  4HKZ H;  2P58 A;  1U7J A;  4ASW A;  1U7M A;  3ZDM A;  1BDC A;  4K35 A;  3QB5 A;  2LR2 A;  4GOD A;  4WYV A;  3PH0 A; 
#chains in the Genus database with same CATH topology
 1SQQ K;  1CHU A;  2V7K A;  3RL0 B;  4KHP T;  3RK3 B;  1OED B;  5IYZ E;  4JQ0 D;  2XSA A;  4CPG A;  4NPP A;  1NYH A;  2XJ7 A;  2R5D A;  5CCG D;  2UXN B;  1M57 D;  2EHO C;  1OW6 A;  3B5N A;  3GHG C;  1M7K A;  4PJ0 H;  2I0M A;  2VB6 A;  3QC9 A;  4DR6 T;  5EK4 A;  2X9W A;  3N9O A;  1T2K D;  4ZI2 C;  2WWV A;  3LID A;  1QEX A;  2KIK A;  4DND A;  1OED A;  5KAI E;  2JR8 A;  5AW9 B;  2CLY B;  4QMA A;  2D2S A;  3T8O A;  2D2C D;  2ZXX A;  3KBU A;  3R84 B;  2XKM A;  2E76 D;  3PTR B;  5JQG E;  3D6Y A;  1L4A B;  5HXH A;  1GK4 A;  1N7S B;  2I1J A;  4DID B;  2HPC B;  4NUU A;  3OYZ A;  2V7Q J;  1FZE A;  1NGM B;  4WB4 A;  2FBW C;  2PFV A;  4QXB B;  5JDG A;  3JC6 D;  1NHL A;  2QA7 A;  4WNK A;  3V5S A;  3FZF B;  2NRG A;  1R8I A;  3K3Q C;  1Z56 A;  3IBP A;  5KTB A;  1HGZ A;  4YXD A;  2YMK A;  2V6X A;  3I55 P;  3G3Z A;  4YJ2 E;  3BK9 A;  3W67 A;  3S9O A;  2E2A A;  1KYO I;  1IJ5 A;  2Q7C A;  1K8A Q;  2XQ9 A;  4JBZ A;  3CXH I;  5AW4 B;  2D2C B;  2N9Y B;  4OK0 A;  1S35 A;  4AKL A;  1L2P A;  2K3W A;  2Q9I A;  4DCK A;  1NWQ A;  5EK2 A;  2Y0E A;  1JMM A;  3HD7 C;  2WY2 A;  1CI6 A;  2YU2 A;  4X20 E;  4YSY A;  1QL1 A;  4C91 A;  4EZH A;  5L2L A;  1FJK A;  1JNZ A;  3MA9 A;  5FL0 A;  1RF1 A;  2M0B A;  1H0T B;  1HNX T;  2G0U A;  3GF3 A;  2LEH A;  2N1T C;  4ZZB A;  2GA1 A;  5AQJ B;  4YSZ A;  4DV4 T;  4BA9 A;  5FY1 A;  3H1I J;  5BU5 A;  2RA1 A;  2KLQ A;  3HE5 A;  2N9D A;  4H9R C;  4PJ0 E;  2AXC A;  3N2O A;  4JBW F;  2VL8 A;  4DJG A;  1USD A;  4WW0 A;  2KK7 A;  4TLF A;  3EDV A;  2MKV A;  1JUN A;  3L74 D;  4U72 A;  1UX4 A;  2E8I A;  1PGQ A;  3H1L D;  4C7N B;  2B89 A;  2FXO A;  4KUM B;  4BAY B;  5KKZ B;  3AE4 C;  3PP5 A;  1CUN A;  4B6X A;  1VQM P;  5AQH B;  3NWI A;  4DMV A;  1NU1 E;  3L35 A;  4UVB B;  4AIU A;  2KS1 B;  1AVO A;  1L0L D;  2DWK A;  3TNU A;  2V8S V;  2KT9 A;  1XNQ T;  1LWU C;  1BR1 A;  1LT9 B;  4YJ3 E;  3VRB A;  4JPZ B;  2E9X D;  1L4A A;  1VDF A;  2Z5H A;  1W0A A;  2EHO B;  4E7S A;  2ZM6 T;  2X0Y A;  1FZA A;  1Y01 A;  3G6E P;  1SQB K;  2WSC H;  1HF9 A;  3MHV A;  1L0N E;  1HG5 A;  3AEG A;  4GOU A;  5CCG A;  3AEA C;  5DQW A;  4IL6 H;  3PUG A;  4GK5 E;  2MAW A;  1RHZ B;  1GW4 A;  4HE8 A;  1VQP P;  2YKQ A;  3BQI A;  2CA5 A;  2M67 A;  2KIN B;  1IBL T;  4G2A A;  3H1J G;  1DD4 A;  4IFD K;  4C7R A;  2D5U A;  1LTI C;  1LP1 B;  4H13 C;  4M1P A;  5ABF B;  3HKE E;  3I9Y A;  1VQN P;  1LT9 C;  1OVR A;  4Z8X A;  5CA1 E;  3SFD C;  4X5T A;  2IAK A;  3K3N A;  1J1J A;  2XV5 A;  2BG9 A;  3RQU A;  3PLN A;  3CMA P;  3J7Y q;  2V7I A;  1HS7 A;  3MP7 B;  1KQL A;  1Q86 Q;  1MZ9 A;  1T8Z A;  3L4F A;  4TWD A;  1NAY A;  3ZT6 A;  2FYU G;  2XQ5 A;  1HNZ T;  2IDB A;  2KZI A;  3VR9 A;  1SP4 A;  5L3B B;  1NO4 A;  3BAT A;  3N4X A;  2PBI A;  1IBM T;  1I6Z A;  1YQ3 C;  5FVK A;  3BRV B;  1LTS C;  4IIJ E;  3HA4 A;  5J0Z A;  3VHL A;  1RQU A;  3VMX A;  2Q9Q B;  5FP3 A;  4WYV A;  3B4S A;  2D2C C;  4GIF A;  2XAH B;  2PG8 A;  3FX0 A;  1YTZ I;  4PV1 B;  4DUY T;  1N36 T;  2Z4E A;  3OJA B;  4EYY Q;  3KIN B;  5FNV E;  2R44 A;  1EZV D;  1S9K D;  3CD6 P;  5LCY A;  3S4R A;  3AE2 A;  5C3J A;  3L72 G;  1XTC C;  3RK3 E;  1FE6 A;  1KTM A;  3I56 P;  1YBK A;  2FYU J;  3KV4 A;  3WI3 A;  3L73 D;  1MMN A;  4PD4 E;  1BSH A;  3M3Z B;  4JEU B;  3GMI A;  2CBI A;  2O3J A;  1LKX A;  3AE3 A;  3B5N D;  3BCC E;  1AV1 A;  1JMB A;  1S72 P;  2HPJ A;  2VL0 A;  3HE4 B;  2WMO A;  1E7P A;  1RE3 C;  3RBX A;  2R5B A;  1QVF O;  2XDJ A;  2KMF A;  2Q9Q C;  1WYB A;  1FOS E;  2YOE A;  3VR8 A;  2OTJ P;  4DMW A;  2MJZ A;  4H44 B;  3KDS E;  2IYO A;  1X79 A;  1JTH B;  5JR9 B;  3NZQ A;  3N9M A;  2W6A A;  1EZV I;  1HWT C;  5FMN A;  4PV1 D;  5ETW A;  1JY2 P;  1M1K Q;  4H9N C;  4BRY B;  1KF6 A;  4EED A;  1N73 B;  2YIU C;  5HWY A;  5LG4 A;  4A7P A;  3L8R A;  2N1T D;  4OVN F;  1NEN A;  5HEJ A;  1H7C A;  1RE4 A;  3QB5 K;  2YNY A;  3RL0 D;  1KZU B;  3L37 A;  2O01 J;  5F8P A;  3RC8 A;  1FDM A;  4CN6 A;  2W0G A;  2QJY B;  2WPR A;  3ANW A;  3RYF E;  2VWA A;  4NIQ A;  3B5N B;  1SQQ E;  3HKC E;  2ZT9 B;  1W9R A;  1M90 Q;  1K73 Q;  1GTW A;  2JWA A;  3M91 A;  4H44 C;  2NTX A;  1L0N K;  4HTE A;  5L3G B;  3AE9 A;  3KXD A;  1PP9 D;  3KPE A;  2YXQ B;  3RYH E;  1LP1 A;  1JOC A;  3F2E A;  2N1T A;  3ZJ1 A;  1Q82 Q;  3EWK A;  3IFM A;  4LMJ A;  1L0L G;  1GL2 C;  2C5K T;  2JPF A;  3KFW X;  1ZOY A;  2LE8 A;  5CCH D;  1WR6 A;  2KNC A;  3L75 E;  2IFM A;  1N7L A;  3SWF A;  4AYC A;  3SFD A;  1GZL A;  1L4A D;  3LW5 H;  3ZST A;  1URQ D;  4DR2 T;  4CXX A;  4IDN A;  1T6A A;  2KXP B;  3CXH H;  3FGA D;  3O6Q A;  3HRN A;  3CWZ B;  3PUS A;  1LT1 A;  2Z6E A;  1H88 A;  4AIS A;  4K3A A;  2YU1 A;  3OJA A;  1YW0 A;  3RRC A;  2KNC B;  4J2C A;  3B13 A;  2V6Y B;  3UQ4 A;  2UXB T;  5LBM A;  1P84 H;  3IAO A;  3RH3 A;  3RYC E;  3DP7 A;  5IWA T;  2H7O A;  1KFY A;  4TNV A;  3C4W A;  3O1H A;  1V9D A;  3OBV E;  2MTQ A;  4E7Z A;  3T1H T;  1HR0 T;  2VKD A;  4WY4 B;  1PPJ D;  3AA7 B;  5AQS B;  2ITA A;  1MNE A;  4H9S E;  3NBX X;  5HXS A;  4JYA T;  3H3M A;  2JO1 A;  3GG2 A;  2IZ1 A;  5AVS B;  2P9B A;  4DV0 T;  3NRX A;  2J47 A;  5HEU A;  5LJN A;  5FXW A;  4ZI7 E;  1UUS A;  3ZT5 A;  4BJM A;  4AI6 A;  2WMN A;  1SQP K;  1N34 T;  2GUV A;  4XZC A;  4UF0 A;  2BG9 C;  1KNP A;  1S5L E;  1RF1 B;  3V5B A;  4QXH B;  3CWB D;  1ZOY C;  1MUU A;  1SQB E;  2E76 C;  3OA7 A;  1WLX A;  4TV8 E;  3P4S A;  5KAI H;  2W00 A;  5ABG A;  2B76 A;  1EXJ A;  1D1A A;  2DNX A;  2JQH A;  2XQ6 A;  3NTN A;  4CXW A;  4EZ4 A;  4COF A;  2CPT A;  2QJP B;  1LVF A;  3USS A;  3H37 A;  5JDF A;  1HJ0 A;  3JAE A;  4U2Z A;  3N7N A;  3OKQ A;  1X9B A;  3HR0 A;  1RE3 A;  1OVV A;  5LHG B;  1KQS O;  4ZOL E;  1WFD A;  2OGU A;  4IE5 A;  3RC3 A;  4L75 A;  3ZJ2 A;  3N5L A;  3K3O A;  1UII A;  2R3C A;  2JKV A;  5LG3 A;  3IEE A;  3CX6 B;  3IF8 B;  2O1J A;  5F5W A;  5C39 A;  4GOE A;  2JRK A;  3L74 J;  1E79 H;  2AE9 A;  1E2A A;  3BQL A;  4UR9 A;  3GHG B;  3UU8 A;  2PP6 A;  2E74 B;  3PU8 A;  3BAS A;  5EK3 A;  4CXY A;  4UVA B;  4JI3 T;  4HFC A;  4JI7 T;  4UXN B;  2XQ4 A;  2CHO A;  3QOF A;  3AED C;  2FFD C;  5CCH C;  2LR2 A;  5AQO B;  5L3C B;  5GTI E;  3L36 A;  5CFB A;  2CE7 A;  2WB5 A;  3BCC G;  3O6Q B;  1DIP A;  2W63 A;  2P10 A;  3B5M A;  3ONL C;  3ABV C;  4ZZC A;  2KSJ A;  3M9Q A;  1R5S A;  2POH A;  3AXJ A;  5L8R J;  4B86 A;  5J2T E;  1HNW T;  2BBJ A;  2C5J A;  2C0X A;  4DR7 T;  5KLV K;  2J4G A;  1X9V A;  1SQV K;  2CK3 H;  4H0L B;  2BVM A;  2WPV B;  4CN1 A;  2XAG B;  4LF7 T;  4UB6 E;  1KNZ A;  2VKH A;  3Q5X A;  4XE5 B;  2C0W A;  4EDF A;  3TSI A;  1VQ8 P;  2YK0 A;  5ABF A;  2WQY C;  3F5H A;  1FOS F;  1KOR A;  3BVH A;  1SQP J;  3CL3 D;  3P32 A;  4M3L A;  2FFD B;  3RGL A;  2L3L A;  3LFM A;  3SS1 A;  2Z5I A;  1KIL E;  4I7Z B;  1PZQ A;  3EAB A;  4FI5 A;  2IYP A;  2W62 A;  1Q7Y Q;  4HWI B;  3V4Q A;  1URQ B;  3P8C D;  2ZVO B;  4HFE A;  4PFP A;  5AVV B;  1VQ6 P;  2WSE J;  3D6Z A;  3AEB A;  3NRY A;  3ZC0 A;  4HWC A;  3C4Z A;  4TZ4 C;  1JCC A;  2QVA A;  3FWN A;  3V2P A;  5KLV J;  2ODV A;  2PGD A;  1S5L H;  4EIJ A;  2UU9 T;  2I59 A;  1YI2 P;  2WBL A;  1PL5 A;  1LTA C;  1IFJ A;  3I5C A;  5DJQ C;  2UUB T;  4YT0 A;  2L8K A;  4NPE A;  4LMK A;  4OGQ B;  1KK7 A;  2W67 A;  4U33 A;  1SQP G;  1WCR A;  3O4X E;  4TWH A;  1RF0 C;  1N7S C;  4L73 A;  1LNQ A;  3CX5 D;  4IFF A;  3GMA A;  1KC8 Q;  3CWB G;  2R3S A;  4JF7 A;  5AW5 B;  2CRB A;  2XSB A;  3KYQ A;  4AQG A;  1UX5 A;  3WUV A;  2X66 A;  4HYT B;  3WMM 0;  3EFG A;  3PUX F;  2AXD S;  4EIW A;  3AE7 C;  1PGJ A;  1M1J C;  5KJ7 D;  4JI2 T;  2B87 B;  3L71 D;  3AE5 A;  2OLT A;  2JJ9 A;  5AQF B;  2OYH B;  1XNR T;  2UWJ E;  4DR4 T;  5APT A;  4H9O C;  4LGD E;  2QJY C;  2DCF A;  3CCE P;  3P8M C;  1MKM A;  4G63 A;  2IBZ G;  4R4M A;  4ASW A;  1U7M A;  3FWL A;  3AVS A;  3FZM B;  3ZYL A;  2JQQ A;  5AVW B;  5CMZ A;  3L70 D;  3NVO A;  1SFC B;  2WU5 A;  2FYN B;  2KB7 P;  2A45 G;  4OGQ D;  2M3E A;  3CCV P;  1FZC A;  5JDN A;  2FXP A;  3CX5 I;  4IFM A;  2BZB A;  3Q5D A;  4KMC A;  2VRS A;  4KHX A;  3CWB J;  2YN6 A;  4HFB A;  1N73 A;  5JTG A;  2NW7 A;  2PTF A;  3G4S P;  2BVL A;  2W83 C;  3SWY A;  3R2P A;  1PIX A;  2KWH A;  2B88 A;  1KIL A;  4IL6 E;  3PUR A;  2WT7 A;  3NKZ A;  4DR3 T;  3RGU A;  4GKJ T;  2OYI B;  4LML A;  2H3R A;  2XQ8 A;  4ZI3 D;  2Q3E A;  1LTB C;  4GYS A;  3L71 J;  2F4V T;  3A3Y B;  2LM9 A;  2N1G A;  1WRG A;  3UTK A;  4ILU A;  4DT0 A;  3VOP A;  3M65 A;  1W2B O;  5FKY A;  3FHN A;  3H32 A;  2B9B A;  2KP8 A;  4P0A A;  4ZS2 A;  2WZH A;  3MZW B;  1HBW A;  1KB9 I;  1FBM A;  1T3U A;  1Y64 B;  2HPC A;  4XA4 A;  1MMA A;  3OTO T;  3T97 B;  1DEE G;  4HJG H;  4IDP A;  5CBO A;  2WCA A;  1ZEE A;  3I1A A;  1EDK A;  1UCU A;  2WQY A;  2SPC A;  4EI2 A;  2L91 A;  3UU3 A;  2NPS D;  1NTK K;  3ZCI A;  1YKH B;  2V7M A;  5KLV G;  3L74 E;  1QVG O;  2JMH A;  5AQR B;  5EZY E;  1SQB G;  2BCC D;  3L71 G;  3AE8 C;  1S2E A;  4JI4 T;  2IPP A;  4DBQ A;  2JEE A;  4EB6 E;  2LKH A;  5KAF H;  1KIL C;  3F89 A;  4LC1 A;  1HG2 A;  3HKB E;  3P4W A;  5JDM A;  1OED C;  2LOS A;  1VQK P;  2EHO D;  4F6R C;  4D6T J;  2QEX P;  2ZYD A;  1FS0 E;  2IZ0 A;  2W6J H;  3AE9 C;  2R6G F;  3AED A;  2MOZ A;  1SE7 A;  3L71 E;  3VN0 A;  3LW5 J;  2XQY A;  4JEH B;  1HF8 A;  4O4H E;  3NMD A;  4IDZ A;  1UGO A;  3UT5 E;  2ACZ A;  3PUA A;  3RQW A;  3RYI E;  3LIE A;  2LKM A;  1BE3 J;  4LF4 T;  4TV9 E;  1DD3 A;  1R8E A;  3JCU H;  3ZLI A;  1D0Z A;  4C90 A;  3CX5 E;  3H1K E;  2NPS B;  4ILB A;  2BAS A;  1JY2 N;  3F31 A;  3W68 A;  1IFN A;  2FJE A;  2ZLY A;  1H0T A;  3I9W A;  1E1H B;  2YDQ A;  4YTP C;  3AE3 C;  4QX8 B;  5HXR A;  2P67 A;  2XAS B;  1NTZ J;  1XTG B;  3EAM A;  2OYH C;  2I1K A;  4ISS A;  4W7Z A;  3AB3 B;  2WWU A;  2AXT H;  1ZP0 C;  4U2Y A;  1JY2 O;  1HJB A;  2P2U A;  4IT4 A;  2BDE A;  2IIU A;  1N73 C;  3UUN A;  2WMM A;  2KZJ A;  1XMO T;  3ZPO A;  4FJO A;  1K04 A;  4WWI A;  1HTJ F;  2LT3 A;  1SQV E;  5APS A;  1WRD A;  2YKP A;  5FY7 A;  4HB1 A;  1VRB A;  2LHN A;  2AXT E;  5DAB A;  2C5I T;  2EHO A;  3RIU A;  2JDI H;  1YYC A;  1FZF A;  2W4X A;  1MV8 A;  3VKG A;  1HH0 A;  4IRE A;  3CI9 A;  2PFX A;  3ABV A;  1XDP A;  3OVU A;  3RHW A;  2KND A;  4LFB T;  5L47 A;  2W27 A;  3H32 B;  4O4J E;  3AE5 C;  2HN1 A;  2CBJ A;  1JCD A;  2DLR A;  2IBZ I;  1NTK G;  3H1K J;  5DJT B;  4EEB A;  5APY A;  2K37 A;  2D9D A;  1TU3 F;  2OV9 A;  3FB2 A;  3L09 A;  3T97 A;  4YXD C;  4AXP A;  4I7Z C;  1EDI A;  1KN7 A;  4IL9 A;  4A5X A;  2J59 M;  3IA3 A;  5H6R B;  5HEH A;  1UK5 A;  3LBX A;  1ZV8 A;  3P7K A;  2WSS H;  4AQR D;  2K88 A;  2FKW B;  1WT6 A;  1W5C E;  5FL1 A;  5IHY A;  4PJL A;  4PD4 I;  4JV5 T;  2YIN A;  2XU6 A;  3SOL A;  1SQV D;  1YIJ P;  4ZXL A;  4EV6 A;  5KLI B;  5EFW B;  3U78 A;  1G1J A;  5JDL A;  4UB8 E;  3KBT A;  3BCC D;  4P0B A;  1SQV J;  3CCL P;  5L4E A;  1BDC A;  2H7V C;  4CI1 B;  2E9X A;  1NTK J;  2H43 A;  1DX7 A;  2QM7 A;  3P4R A;  1QSD A;  2VUR A;  1NU1 D;  3PH0 A;  4OH8 B;  3RK2 D;  5LHH B;  2AEF A;  2O01 N;  4H63 H;  5LA6 E;  3U1C A;  5BMV E;  3ETU A;  2J58 A;  5CBN A;  3H1L E;  4JI6 T;  2WZI A;  3P4Q A;  1EZV E;  3M0D C;  4D6T D;  1S9K E;  1KFM A;  2IHR 1;  3B71 A;  1WMK A;  2KUB A;  3AE6 A;  2FY8 A;  5AQT B;  2WVR A;  4AKI A;  1PV3 A;  3KV6 A;  2LSJ A;  5GTH H;  3CCM P;  2UUA T;  2WP9 A;  5AW0 B;  3HE5 B;  2MYS A;  3AAE B;  3EI0 A;  3UQ7 A;  3GA8 A;  4JUY A;  4O9B A;  5JVD E;  2Y48 B;  2QM8 A;  1BR4 A;  4UIG A;  1NAF A;  3RIF A;  4PK4 A;  2QGS A;  1LGH B;  1YHQ P;  2KLV A;  4ADZ A;  4JI1 T;  2RH0 A;  4NXM T;  4PK5 A;  2CXL A;  3E1I A;  2D0T A;  4U74 A;  2XTL A;  2IX7 C;  4WBA A;  4DV7 T;  1AVY A;  1LVK A;  3A7O A;  4IHJ E;  2HLO A;  2B87 A;  4Z1M H;  3O9X A;  2RKL A;  1ZME C;  3RK2 B;  1T98 A;  4AKR B;  2A72 A;  1HGV A;  1BGY G;  1VL2 A;  1VQ9 P;  3TKL B;  3AEE A;  3D70 A;  1DEB A;  4U7J A;  4TUY E;  4CQI A;  2CPS A;  2V7Q H;  3I0O A;  4EGW A;  1J1D C;  1KB9 D;  1SQX K;  2XQA A;  3A0B E;  3QNU A;  2HR3 A;  2LOP A;  2WSS V;  3S4U A;  3HL6 A;  2XHE B;  1MMG A;  3RK3 D;  4Y28 J;  3ZYM A;  4AKG A;  4RJT A;  1Q2N A;  1USE A;  4QXC B;  4HH2 A;  1QX8 A;  3P50 A;  5AVT B;  3MIW A;  1FEW A;  5DJU B;  4A98 A;  5CCG C;  2VK9 A;  4Y99 C;  2C9L Y;  2ZVN B;  3L75 D;  2X9Y A;  1G8X A;  3UFE A;  4DV3 T;  3LDQ B;  2XAJ B;  1IC2 A;  2YO2 A;  4N6J A;  3VP9 A;  3B57 A;  1LTJ C;  4I2L C;  2KI7 B;  1JNM A;  1PP9 E;  3LBX B;  2XZR A;  3R6N A;  1VOM A;  1IFI A;  3MZK B;  2HH7 A;  3ZDM A;  1EXI A;  1T72 A;  4OGQ C;  3TDK A;  2E9X B;  3QB5 A;  3A0H H;  3OYX A;  3ESL A;  3RF1 A;  1OXZ A;  3AE1 C;  2ZM0 A;  4TX5 A;  3U1A A;  1YQ3 A;  1JB0 J;  4GKK T;  4UEL A;  2CPB A;  5FVL A;  3H6P A;  4HFH A;  4GDO A;  1YJN P;  2QYW A;  4Z90 A;  1YIT P;  4OX9 T;  3V2R A;  4HEA A;  1AJY A;  4O8S A;  5KMG P;  1K05 A;  1KB9 E;  2ZT9 D;  1YKE B;  3V5U A;  3WU2 E;  3OAK A;  3N2K E;  4YLH A;  3WUT A;  4YHH T;  1W2E A;  4HWH A;  4JYC A;  1PP9 G;  1IFM A;  5AVU B;  4MHC A;  4DO0 A;  1OIP A;  4EXT A;  3H3A A;  4ZKU A;  3FXD A;  3G9R A;  1OWA A;  2ZYA A;  4QX7 B;  3II6 A;  2QIW A;  3Q1M A;  4PJJ A;  1EDL A;  4MFR A;  1BCC G;  1YQ4 A;  3H1I E;  4ZI3 C;  1IJ6 A;  1KYO E;  1AJ3 A;  2FYU E;  4YPC A;  4XBF B;  3M0D A;  1FZG A;  4ZMD A;  2ZFC A;  4OWF A;  2YDS A;  2LLY A;  1K9M Q;  3DJB A;  4LF5 T;  1LTJ B;  3A2A A;  4O4I E;  2LJL A;  5ABE A;  1EC5 A;  4X1I E;  3UU6 A;  2KS1 A;  1SHZ C;  2KSR A;  3RI5 A;  3C9I A;  4U3F E;  2OYO A;  2NW8 A;  4Y99 B;  1PP9 J;  4AKH A;  3RRW A;  1NTM D;  3IF4 A;  3LK3 B;  2ES0 A;  3PJA A;  4A97 A;  2WSF H;  1VCS A;  1J5E T;  3OPC A;  1BGY J;  1HCI A;  3D0T A;  3TGU G;  3E7K A;  2NPS C;  1E5W A;  3UU5 A;  2YXR B;  4JI5 T;  3AEF C;  2I6H A;  5HWX A;  3M9B A;  4ZEY A;  3CQX C;  2WSE H;  5LBQ B;  1MND A;  2J62 A;  3EQ2 A;  4WBO A;  3JAF A;  2E76 B;  2PJQ A;  4LF6 T;  1KYO D;  1EZV G;  3AE6 C;  2W90 A;  3L73 J;  5LJM A;  1SQQ J;  2LRL A;  4DVD A;  1RH5 B;  2JQ9 A;  2J1D G;  3BQK A;  3CC7 P;  3CX7 B;  5AW8 B;  1CW5 A;  3AE2 C;  2WWW A;  2HG5 D;  4GOD A;  4HGA A;  3FZH B;  1YTZ T;  3DTO A;  2XUE A;  4OYJ A;  2B1E A;  3QUJ A;  5CJ0 A;  4A56 A;  1ZV4 X;  3PUZ F;  3AEC A;  2FJA A;  5BVZ A;  2ACX A;  1U57 A;  2L9Q A;  3KV5 A;  3N9P A;  4U3F J;  2ZXE B;  4PD4 H;  5M1B A;  4TNW A;  2X0L B;  2DL1 A;  2Q5U A;  4BXL A;  1JEK A;  5LHI B;  3Q2M A;  2KYV A;  1NU1 K;  2K1A A;  2RMZ A;  4XFJ A;  3L73 G;  4I1L A;  1FIO A;  1SQQ G;  4IL6 X;  4L74 A;  3KV9 A;  1VQO P;  3GF7 A;  3K5B A;  3HUS A;  3CK6 A;  1A02 F;  3L72 D;  2RN0 A;  3UUX B;  2K3R A;  2XQ3 A;  5KAF E;  2K9J A;  1FMW A;  1N8R Q;  3VMA A;  3GN5 A;  2X9X A;  4EOT A;  4P1N A;  3ETV A;  4H13 D;  4JI0 T;  1N32 T;  1JY3 P;  3O1I A;  3A8Y C;  3KVB A;  4U7I A;  3RL0 g;  1FMV A;  5LGU B;  4UB8 H;  1IZN B;  3U59 A;  4KHZ F;  1SFC D;  5JDH A;  3L73 E;  3VYI A;  3RKO A;  5C2T A;  2V1D B;  1VQ5 P;  3GN5 B;  1IFP A;  2XY8 B;  2DW3 A;  2OQQ A;  1OZH A;  2QJK C;  3E08 A;  5AQM B;  3UUL A;  3CPW O;  1G2C B;  1D0X A;  5M4Y A;  1X79 B;  1BR2 A;  1D1B A;  1QGK B;  2MBG A;  2Q6Q A;  1ZN5 A;  4JYB A;  5KLV D;  1PGP A;  4DV1 T;  3M06 A;  2JJL A;  3PUW F;  3A5X A;  1SQX E;  1KV4 A;  1MFZ A;  3AA1 B;  1HX8 A;  5L4H A;  3VRA A;  4GKG A;  4YHJ A;  1SQB D;  2BCC G;  2WTY A;  4IE7 A;  3L72 J;  4UF0 B;  2LXB A;  4ZS3 A;  4DV6 T;  3IN6 A;  5APQ A;  3V4W A;  4QKN A;  2A06 D;  1NWM X;  3MTU E;  1IBK T;  2XM2 A;  2A45 I;  1BDD A;  1NU1 J;  4UB6 H;  2IC6 A;  2X0H A;  4B3T T;  1N2D C;  5HYA A;  3L70 G;  1FJP A;  1FAV A;  1GD2 E;  1PPJ E;  3H1J J;  4K35 A;  3I0Q A;  5GON E;  2WM9 A;  4HN9 A;  2LKG A;  1Q81 Q;  1KNR A;  2W66 A;  3CCQ P;  3PUV F;  4CN4 A;  4F8H A;  1SFC A;  2VAS A;  3JCF A;  3H1I G;  1R5L A;  3R4Y A;  5J2U E;  2XAQ B;  3ZYK A;  2JQK A;  1G1I A;  3JAD A;  5B5E E;  4TN7 B;  3CCJ P;  4DBR A;  5AW1 B;  4IOI H;  1P84 D;  4RO0 A;  3MUD C;  2X67 A;  4U3C A;  4ANJ A;  2O1K A;  2JIW A;  2N1T B;  1IAP A;  1LTG C;  2NR4 A;  3CML A;  3SFE A;  3VKH A;  2IC9 A;  1KIL B;  1SVF A;  1N7S A;  4U3F G;  4JLE A;  4YTP A;  2M5A B;  2WSF J;  4LF9 T;  1NU1 G;  3KHU A;  3HD7 B;  2H89 A;  3L75 J;  3L70 J;  3RL0 C;  1YXR A;  2I8D A;  4O2B E;  2A06 G;  3GW6 A;  4ZKP A;  2H7H A;  3P7I A;  3AEC C;  1EQ7 A;  2BKO A;  3MK7 C;  1NJI Q;  5LB7 B;  5H2F E;  3QH9 A;  2HOD B;  3CLQ A;  4UVC B;  4QH5 A;  3A0H E;  1G73 A;  3PTZ A;  4DZO A;  2Q3I A;  2DWG A;  3ONX A;  4LFC T;  2NTY A;  3KDP B;  1X22 A;  1U4Q A;  1GL2 D;  2A2F X;  2PAJ A;  2GUS A;  3H1J E;  2HOD A;  3IR9 A;  3NXS A;  5KLI C;  2HYN A;  1YD8 G;  1FDO A;  5TAO A;  1L4A C;  1T7S A;  2C0S A;  3UFG A;  2N2N A;  2UUC T;  4K0K T;  3AVR A;  3UUM A;  3SWH A;  1QLB A;  3EHZ A;  5AW2 B;  2V5C A;  4NUV A;  5BU8 B;  4PW8 A;  3W15 B;  2Q1K A;  1S1C X;  1OED E;  1ZR2 A;  2GK9 A;  3NFQ A;  2RPA A;  3MGN A;  2K48 A;  5AQI B;  2Y9Y A;  2BS2 A;  3UIA A;  3O1J A;  5CJ4 A;  3BCC J;  4O2A E;  4H0L C;  2BCC J;  4ASK A;  1X8Y A;  1XDO A;  3Q5P A;  3TF5 A;  2FJD A;  1SUM B;  2FBW A;  5HEG A;  2X68 A;  1JO5 A;  1OW7 A;  1LT9 A;  1YJ9 P;  3HUS C;  3FBZ A;  3T1Y T;  1OMI A;  5AVQ B;  5CA0 E;  4X65 T;  1SLQ A;  1KQG B;  3E0Z A;  1J2J B;  5B5E H;  1KD1 Q;  2JWD A;  2VKO A;  4IST A;  2H88 A;  2MPK A;  3C64 A;  1U5P A;  2BKP A;  5AQN B;  1LJ2 A;  3PJA J;  4MBQ A;  3TNU B;  3L39 A;  4HFI A;  3H1H E;  2IUB A;  3AEF A;  1GDT A;  4CI2 B;  3B5N C;  3GHG A;  3AEA A;  1M56 D;  2E43 A;  4DOJ A;  1FZC B;  4N78 D;  2VQF T;  1L0L J;  1NOH A;  4Z91 A;  4KBM B;  2KWI B;  2V26 A;  2YEV C;  4B3S T;  4EYY R;  3VMY A;  5AW7 B;  3AA0 B;  2YIU B;  3IHR A;  3LG7 A;  3RIU C;  1QUU A;  4L76 A;  3RK2 C;  4NXN T;  1J5W A;  3HTK B;  4GIW A;  2DHR A;  3G06 A;  1WYC A;  2CEA A;  2LXC B;  5L3F B;  5LMN T;  2WDQ A;  4GK0 E;  2CWO A;  3L75 G;  2AEJ A;  5AVZ B;  4EAH A;  2L5G B;  3MD0 A;  4LFA T;  2BCC E;  5K5G B;  1SQX J;  5AVX B;  4IE6 A;  4N78 E;  1ZR4 A;  3A7M A;  3TGU D;  3ZC1 A;  3PJS K;  4HWD A;  3P4P A;  2W2U A;  1VQ4 P;  3OW2 O;  1PGO A;  2BBH A;  1H8A A;  1KEY A;  5APW A;  4IE4 A;  4PJN A;  2VKJ A;  3AE7 A;  3JSV C;  1SQP E;  2E75 C;  1PPJ G;  3ZCJ A;  1AFO A;  3TLW A;  2WIT A;  5AQQ B;  3KZI E;  3QWO C;  3ZKR A;  2OTK E;  1D0Y A;  2ZMA A;  5LNK A;  4U3F D;  3PRJ A;  1VCT A;  3WU2 H;  1IJD B;  1J1D B;  1M7L A;  4X66 T;  1L0L E;  2HN2 A;  1OX3 A;  1QLE D;  2J5U A;  2WPS A;  4MN4 C;  1DH3 A;  1BCC D;  3MUD A;  2DI4 A;  1GQE A;  2GM4 A;  1RY3 A;  1SQX G;  4L5G A;  2BEQ D;  1O3X A;  1JNR A;  5CJ5 A;  3K8P C;  4Q25 A;  1Z8U A;  4H13 B;  4PAG A;  4WZX A;  5FXZ A;  1QL2 A;  5KXJ A;  4N3Y B;  1RF1 C;  3C8V A;  4UEM A;  3F57 A;  3AAA B;  1GK6 A;  4U31 A;  4YY3 T;  3CCR P;  4W7Y A;  2NOX A;  5AQK B;  1NH4 A;  2UXX B;  4ZNC A;  2QJP C;  3UUB A;  5GTH E;  2LSG A;  3H1L G;  1EZ3 A;  3SFE C;  4JI8 T;  2K5B B;  2CXD A;  3L70 E;  5AW6 B;  5LP6 E;  3L74 G;  3JC6 C;  1S3J A;  3Q5E A;  2ZM2 A;  2QA4 P;  4NPF X;  1NTZ K;  2VVS A;  3EDU A;  3VP8 A;  1JTH A;  2XQ7 A;  3RBZ A;  5JR9 A;  2BKN A;  2E74 D;  5AVY B;  1P84 I;  4L9I A;  4KX6 A;  5AQV B;  1FJG T;  3GLM A;  4H9Q C;  4B3R T;  3U3I A;  2E5L T;  1G2C A;  2IBZ D;  3ZN0 B;  2WDR A;  3MJX A;  1ZLL A;  4KP3 C;  5E0O A;  1BR0 A;  2HFE D;  4X64 T;  1ZKE A;  1LWU A;  2OYI A;  2G8Y A;  2HHH T;  1IK7 A;  4NPD A;  2D0U A;  3PU3 A;  5AQG B;  3CXH D;  3ZN1 B;  1SFC C;  2R32 A;  4PD4 D;  2XZE A;  4LF8 T;  4BWN A;  2WS3 A;  5KJ7 C;  5AVR B;  2OTL P;  3FXE A;  1BSN A;  5L3D B;  2FXM A;  4H0L D;  5AQP B;  3ZMZ B;  3MXZ A;  4DUZ T;  2KLU A;  3CIR A;  2K24 A;  4EOZ B;  1SQP D;  1AQ5 A;  4I0U A;  5CGM A;  2RP4 A;  3Q9D A;  2OAR A;  1NTK D;  3PUQ A;  2OA5 A;  4X1K E;  1Y8A A;  3AXJ B;  3LK4 2;  1JM0 A;  1A02 J;  4U7Y A;  2LSY A;  3FXE B;  3Q5W A;  3NZP A;  4YSX A;  4DV2 T;  3FBL A;  1NKN A;  2Q9Q A;  1KYO H;  1MMD A;  1KIL D;  2V4H A;  2YKO A;  5HEO A;  2FUP A;  2NW9 A;  3CQG B;  2ZYG A;  5FY0 A;  5AW3 B;  4TT3 H;  1OW8 A;  3KQG A;  1LTT C;  4LLH A;  4I4T E;  4X62 T;  4AQF A;  2KSE A;  5LGT B;  2VVN A;  2H88 C;  1S4X A;  1M62 A;  3CC2 P;  1SQQ D;  5KX5 E;  3PDY A;  1KFN A;  3EFF K;  3H1H J;  5HCJ A;  1NTZ G;  2IML A;  1X0T A;  5CHX A;  2BS3 A;  2XND H;  2E5Y A;  1BE3 D;  2FYZ A;  3N2G E;  3HI2 A;  4IGU A;  3ZMU B;  5KLV E;  3V6I A;  2CMR A;  3H1H D;  4W80 A;  5CCH A;  2FFD A;  1GL2 B;  1NTK E;  2W6B A;  2X9H A;  2N9B A;  3MKD A;  2E5T A;  4DV5 T;  1J1E B;  2G3A A;  3HKD E;  1UIX A;  4I55 E;  2CLY C;  4D6T E;  1XZY A;  3H1L J;  1T2K C;  4ZI2 D;  4XAX B;  4HFD A;  5AQU B;  3D71 A;  4PNI A;  1SQB J;  4UV9 B;  3CCU P;  2WU2 A;  5CB4 E;  3RPU A;  2E74 C;  4MLK A;  1ZHC A;  4PJM A;  1CI6 B;  3H1H G;  1OFC X;  5E79 H;  4KJM A;  4P09 A;  3J9X 1;  2FYU D;  1RQV A;  4WVZ A;  5C8Y E;  1NTZ D;  1NTM G;  3E1R A;  2JMK A;  3L3P A;  2LM2 A;  4BJN A;  5TIS E;  3M0A A;  4B3M T;  2V7L A;  5GTI H;  4TWF A;  3FZK B;  2CHN A;  2LSI A;  4GYR A;  1Y9B A;  2A45 H;  4ILA A;  2V7J A;  3SRZ A;  3CC4 P;  1FC2 C;  5LGN B;  3JC2 2;  1HTL C;  5JRE A;  4YTN A;  3TGU E;  3H1J D;  2M5A A;  1ZP0 A;  1MFT A;  1WR0 A;  2QSI A;  2H8P D;  3CWB E;  3HD7 A;  3E22 E;  5HXE A;  2YMY A;  4I50 E;  5APV A;  4MAL A;  1IFD A;  2UXD T;  4L0R A;  2M6I A;  2KZ7 B;  4ZHQ E;  3TK1 A;  2BG9 E;  5HXC A;  4RKU J;  5KDM C;  2CCQ A;  1XMQ T;  1IO4 A;  1NTM J;  5H6Q B;  2W61 A;  1UUR A;  3HD7 D;  2QE7 H;  1KQF B;  3Q5R A;  5FYM A;  1PFI A;  3CPZ A;  4UV8 B;  4V1A v;  5J1G A;  1J1E C;  1HFA A;  1N33 T;  4QH1 A;  3HTK A;  4HKZ H;  4C7N A;  1VF5 D;  4ILC A;  3A5T A;  2WAU A;  1FDI A;  2XAF B;  3PHL A;  3V2Q A;  2M6B A;  3C50 A;  2FYU K;  3LJC A;  3UU4 A;  3CME P;  1OVU A;  2QJK B;  5APU A;  4WY4 A;  2WT7 B;  2Y0C A;  3N9Q A;  1JY3 O;  2BG9 B;  1W09 A;  1GMJ A;  3RLF F;  3CVR A;  3EUH A;  1AA0 A;  3TLS A;  4K0U A;  2NZ2 A;  2QG4 A;  3CX5 H;  3AE4 A;  3CX8 B;  3AA6 B;  2YDR A;  1B7T A;  4AQF C;  3AEE C;  2LRK A;  3Q2Y A;  1VQL P;  5KJ7 A;  4AQY T;  1I94 T;  2NP9 A;  2AEM A;  5F3J A;  4GT1 A;  3PUY F;  5LXT E;  3WAK A;  3H1K D;  5AQL B;  2E5V A;  2O01 H;  1BE3 G;  4QH4 A;  5JDQ A;  2OYI C;  2PRR A;  3AEB C;  3K1S A;  5FXV A;  3AEG C;  4ERR A;  1VQ7 P;  1YQ4 C;  1W0B A;  4IL4 A;  2FJB A;  4HFV A;  4CZZ B;  2IBZ E;  1LRZ A;  1NVO A;  2E9X C;  3G71 P;  2JP3 A;  1S94 A;  2IW5 B;  4AUW A;  4WBN E;  1NKZ B;  1D1C A;  2V5D A;  5JRC B;  4IDQ A;  1KB9 H;  1ZRT E;  1VPC A;  3CCS P;  2XNX A;  1BE3 E;  1L0V A;  4IE0 A;  4WY4 C;  1ZRT D;  3EVY A;  1LTJ A;  4KI0 F;  5DQV A;  3GWH A;  1SQX D;  2E75 D;  1T3J A;  4C46 A;  1HVV A;  1IK9 A;  4YTM A;  1Y47 A;  2IDO B;  2WDV A;  1FU1 A;  1SS1 A;  3TLT A;  3TLV A;  2XPK A;  4GOF A;  5JR9 C;  4O4L E;  1BGY D;  2QRX A;  4OFZ A;  5LMU T;  2NPS A;  3C98 B;  5A1L A;  1NTZ E;  4DR1 T;  4RES B;  1RE4 C;  3V2N A;  2Y0D A;  2E42 A;  3C51 A;  4KT0 J;  1ZW0 A;  1GU4 A;  3AE1 A;  1D7M A;  1XWM A;  3C1L A;  5B66 E;  3RIA A;  3HE4 A;  3CQC B;  2Y9Z A;  5L3E B;  3X1D A;  3FZL B;  4IDO A;  3WUU A;  4BRY A;  3SSU A;  1N86 A;  2FYN C;  4QHO A;  1U7J A;  3PE0 A;  4H63 V;  4D6T G;  2K9A A;  3AE8 A;  3KZI H;  5KKZ C;  3H1K G;  3RKG A;  1VF5 C;  1N7S D;  4HKA A;  2E75 B;  1KMI Z;  2M3B A;  5FXX A;  3ONJ A;  3ITK A;  5IUX A;  3KVA A;  4QWN B;  2CWY A;  2ZAE B;  2LSK A;  3Q5S A;  3RX6 A;  1M1J B;  2Y8D A;  2XM1 A;  1T8B A;  3ZMT B;  3S1K A;  1L0L K;  2Y6X A;  5HCM A;  1RF0 A;  4HWF A;  2YKS A;  3CKD A;  1BCC J;  2ZT9 C;  5AFU L;  2BS4 A;  2C9N Y;  1SA0 E;  3VMZ A;  2P1J A;  5JH7 E;  4DR5 T;  1L0N G;  1NEK A;  3B8E B;  1ZXG A;  5APX A;  1MIW A;  4R4L A;  1M1J A;  1DU2 A;  3ZSS A;  1SQV G;  3M9H A;  3RK3 C;  4ASV A;  3LSV A;  1EDJ A;  1VF5 B;  4EYU A;  1US7 B;  2A06 E;  1FZB A;  2SPZ A;  1URQ A;  3ZT7 A;  2Q9Q D;  4PFO A;  2WZ7 A;  5TJH A;  3N9L A;  4PV1 C;  4CI3 B;  3MAC A;  3HUS B;  5ADX L;  5ABH A;  4I43 B;  1AQT A;  2LHR A;  2K9J B;  2A3D A;  4OHF A;  3C4X A;  3TGU J;  1FZC C;  5JRC A;  1Q90 D;  3BRT B;  2V6Y A;  1CZQ A;  2ODU A;  2P7J A;  1M8O B;  3FXD B;  5HAX A;  2VQE T;  4YXW H;  3VTP C;  3LK2 B;  2NWB A;  1HUC A;  1L0N J;  2ZJS E;  3ZMV B;  1YJW P;  1P84 E;  1MIV A;  4WY4 D;  2IFN A;  3VU7 H;  1MIY A;  3PV0 F;  5LYJ E;  2HPL A;  3QK6 A;  2KOG A;  1JY3 N;  5BR8 T;  4YFS A;  1L0N D;  1NTM E;  3ZMS B;  2UXC T;  2WPQ A;  3H25 A;  4X1Y E;  3A0B H;  2ZM8 A;  2WSC J;  2X51 A;  2M8R A;  1GL2 A;  2CXF A;  1BCC E;  3CXH E;  4PK6 A;  1S5L X;  3O8Z A;  4H44 D;  1HX1 B;  2W8Z A;  3JCU E;  3SWK A;  4H9P C;  4OYK A;  2H89 C;  2A9U A;  3N9N A;  1LWU B;  2OYH A;  3ZEF B;  3Q3D A;  5LOV E;  3P8C E;  5E79 E;  1NTM K;  1Z0P A;  3WAJ A;  3TLU A;  3AAI A;  1CSB A;  2YO3 A;  1URQ C;  2K9Y A;  5H2F H;  2P58 A;  3L72 E;  5B66 H;  1H89 A;  2BEZ F;  2CM0 A;  1GU5 A;  3H1I D;  1BGY E;  4I6M C;  5TIS H;  3TYY A;  1GW3 A;  3ANW B; 
#chains in the Genus database with same CATH homology
 1OVU A;  2JWD A;  1X0T A;  1LT1 A;  4CPG A;  5CBN A;  4ZNC A;  3AXJ A;  1H0T A;  4K3A A;  3PJA J;  2KUB A;  2ZAE B;  4EYY Q;  2R44 A;  3S1K A;  4BXL A;  4IOI H;  1S3J A;  4NPF X;  2B88 A;  2KIK A;  2B89 A;  3FXD A;  3RGU A;  2M5A B;  2K3R A;  1ZXG A;  1EDL A;  1JMB A;  2KS1 B;  2WMM A;  2KZJ A;  3RIU C;  2I8D A;  4ASV A;  4WWI A;  1EDJ A;  4HB1 A;  2SPZ A;  4ZMD A;  2LXC B;  3RIU A;  2B87 A;  4KJM A;  2RKL A;  1NVO A;  4NPD A;  3MZW B;  1EC5 A;  3MHV A;  2QVA A;  5K5G B;  1DEE G;  4HJG H;  3FXE A;  5CBO A;  3PJA A;  1EDK A;  2HR3 A;  1OVV A;  4NPE A;  5DJT B;  1FC2 C;  3QB5 K;  1LP1 B;  1KEY A;  1Y47 A;  1OVR A;  1SS1 A;  2M5A A;  1EDI A;  1J1J A;  1Q2N A;  4GOF A;  3AXJ B;  1MFT A;  1JM0 A;  4JBZ A;  2QRX A;  3QWO C;  5C39 A;  2OTK E;  5DJU B;  4GOE A;  2Q1K A;  2LXB A;  1LP1 A;  1ZW0 A;  2B87 B;  2M0B A;  2KZI A;  4MN4 C;  1H0T B;  1BDD A;  5EFW B;  2UWJ E;  2KI7 B;  4HKZ H;  2P58 A;  1U7J A;  4ASW A;  1U7M A;  3ZDM A;  1BDC A;  4K35 A;  3QB5 A;  2LR2 A;  4GOD A;  4WYV A;  3PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...