2QRXA

Crystal structure of drosophila melanogaster translin protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
NFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM27569p
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qrxA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qrxA01
4GOEA 4K3AA 1DEEG 2KI7B 2K3RA 4WYVA 1Y47A 4WWIA 4IOIH 3FXEA 1FC2C 1NVOA 2R44A 1H0TA 4ZNCA 1U7JA 2JWDA 3PJAJ 5C39A 3S1KA 4CPGA 3RIUA 2SPZA 3AXJB 4HJGH 2I8DA 4BXLA 1JM0A 2LR2A 3MZWB 1EDIA 3PJAA 3QB5A 2LXBA 3QB5K 2M0BA 2OTKE 5EFWB 1LP1B 1ZW0A 2KUBA 3AXJA 3QWOC 4GODA 4GOFA 1EC5A 1LT1A 4HKZH 1MFTA 2WMMA 5DJUB 1LP1A 2QVAA 1X0TA 4NPDA 2Q1KA 5CBOA 2B89A 2KZJA 3RGUA 1JMBA 2KZIA 1OVRA 4HB1A 3RIUC 1BDDA 1Q2NA 2KIKA 2P58A 3MHVA 4KJMA 2M5AB 3PH0A 2B87B 3FXDA 2KS1B 3ZDMA 1SS1A 1J1JA 2RKLA 4JBZA 4EYYQ 2M5AA 1S3JA 2B87A 1BDCA 4ASVA 1EDJA 1ZXGA 2HR3A 4NPEA 2LXCB 4K35A 1OVUA 5DJTB 2ZAEB 1EDLA 4ZMDA 2QRXA 2UWJE 5K5GB 2B88A 4MN4C 1EDKA 1KEYA 1OVVA 1H0TB 4NPFX 4ASWA 5CBNA 1U7MA
chains in the Genus database with same CATH superfamily
3X1DA 4ZI2C 1FMVA 3L71G 4V1Av 4XZCA 4COFA 4FJOA 1GW3A 3CK6A 1QVGO 4DMVA 1Z0PA 1D0ZA 1KQSO 1MIVA 1N33T 4WWIA 4CQIA 3H1LE 1SQXJ 1VOMA 4NUVA 1KYOE 2P1JA 3OKQA 4D6TE 3CMEP 5AQNB 4AKIA 2AXCA 3CWBG 2WZIA 4AKGA 1URQC 2XJ7A 4NIQA 1VQ6P 2CM0A 4CPGA 1D7MA 2E5YA 2WU2A 2R32A 2E9XB 3RF1A 4IL6E 2H89C 2ACZA 3GA8A 3QC9A 4IHJE 2KWIB 4B3RT 2WT7A 2PG8A 1KYOD 2LKHA 3U1AA 4OHFA 3NXSA 3AECC 3GHGC 4QXBB 1BE3J 2RH0A 3A3YB 3H1IE 3N9NA 5C2TA 2O1KA 1N7SD 5HEOA 4HFCA 5AVSB 4OK0A 5LHGB 1JEKA 4LFBT 4DIDB 3UFGA 2FYUJ 1NEKA 2W2UA 1HJ0A 2CEAA 2E8IA 3CPZA 2K88A 3L70G 2Q1KA 1VQ5P 2RN0A 3H1ID 3FXDB 2QJKC 2Q5UA 2V7MA 2MJZA 4F6RC 4JLEA 5AW3B 4EXTA 1KB9E 5AVUB 3S4UA 4H44C 3G3ZA 1SFCB 2ODVA 5LA6E 1LRZA 3RL0D 3P8MC 1YQ3A 2N1TB 1J1JA 4DV6T 1ZR2A 1L4AC 2CCQA 2X0YA 4DR7T 3PV0F 4IT4A 4ISTA 1PPJG 1OMIA 1OEDB 2XSBA 1JY2O 2HHHT 1SQBD 1ZV8A 4HTEA 1S9KD 1RE3C 2BKPA 5FY1A 3I5CA 1HFAA 2WTYA 1YKEB 4OH8B 3PUSA 5AW0B 5L3FB 2Q9QC 5AVXB 1HF8A 2XQ5A 3CL3D 3PJSK 2W6BA 1BR1A 4LFCT 2AEFA 3W68A 3BCCJ 3AAAB 3BRVB 4AYCA 2VWAA 4ZZBA 1K8AQ 5KAFH 3ZLIA 2K9JB 2NZ2A 3CCQP 3AE3A 2M3BA 3S1KA 3IR9A 3NVOA 3RIUA 2E9XD 2XAJB 4U33A 2FJAA 3JAEA 2H88A 2DCFA 5HCMA 5HXRA 3HL6A 5AFUL 2CLYC 1KV4A 1VDFA 3AEAA 3B13A 1ZOYC 3PRJA 1T3JA 1A02J 2NOXA 4ZOLE 1N7SA 3H1HJ 3ZJ1A 4X20E 1ZR4A 1ZRTE 2NTXA 1XMOT 3KPEA 1XNQT 1NENA 3HKBE 2VKDA 2HFED 1IFJA 2WCAA 2LJLA 3M3ZB 1HTJF 3WAKA 3U1CA 4P0BA 4TV8E 4BAYB 1LTBC 2GM4A 3PTZA 4JPZB 1M7LA 1IO4A 3BQLA 2JPFA 3ZKRA 4H63H 5JR9A 2YIUC 2JIWA 2M8RA 1ZRTD 4EAHA 5CFBA 2BG9A 3JC6C 2UU9T 3A0BH 3IFMA 2J4GA 3G06A 4WVZA 1MMAA 2W62A 2E76C 3ZCIA 1HVVA 1LT9C 2F4VT 2OYIC 3VYIA 1BCCJ 2JQHA 1M1JC 1NAFA 2YKOA 4DOJA 2OYHA 2IIUA 4P1NA 1BR0A 2HH7A 4IDPA 3L75D 1NTME 5LJNA 4EEDA 3OA7A 4H0LD 1OEDE 3CQXC 1XTGB 3TGUD 3DP7A 3LBXB 4DNDA 2A06D 1R8IA 4W7YA 1PP9J 5LG4A 2IHR1 2I6HA 1KYOI 1NTKK 1YITP 4QX7B 4OWFA 3AEDA 3M9BA 2WDRA 3KBUA 1SS1A 2HYNA 3AA1B 4UELA 1FDIA 1YTZI 2K9YA 3SFEC 1FJPA 3R4YA 4YHJA 3RYHE 2XZRA 4H9SE 4ZKUA 2WM9A 1RY3A 1D0YA 4OFZA 4GK0E 1SP4A 4IFDK 4L73A 3RKOA 1AV1A 5GTHH 3N5LA 5HXHA 4KHPT 4ASWA 4B3TT 1GW4A 2BS3A 1PIXA 3SWKA 5LBMA 3P7KA 3MGNA 2W67A 2DL1A 3HD7B 1LTJC 3L72J 3AA7B 2N9YB 3RK2D 5J2UE 1E1HB 4G2AA 2MOZA 1KILD 4YPCA 3IAOA 3PE0A 5LB7B 1S5LE 3JCUH 2LM2A 2XV5A 2C5IT 3L74E 2KSRA 3HE5B 1VL2A 3U3IA 2WPQA 1N8RQ 2M3EA 2QYWA 2V1DB 2CMRA 5GONE 4CI3B 3MIWA 4BXLA 1X79B 1GL2C 1J1EB 1NU1E 4X66T 4P0AA 1KB9I 2HODA 1NYHA 1SQVD 5H2FH 3QB5K 2M67A 3P4QA 3L71E 4WY4A 3LIEA 3M06A 1M57D 3QWOC 1FOSF 3C4XA 4IGUA 3AE5C 3UUBA 3BATA 4I1LA 1EC5A 4EIWA 5CJ4A 3S4RA 2AXTH 5ABFA 1T6AA 2QA7A 4L9IA 4U3CA 5APVA 3CWBE 3IBPA 3A5TA 2ZVOB 1VPCA 4DV1T 3CXHD 1HTLC 2QJPC 4U7IA 3ZT5A 2V7JA 3L71D 5F5WA 4QMAA 2V5DA 2R3SA 5AQPB 3PLNA 3H1KG 3BCCD 5JVDE 4AQFA 1GD2E 2E75C 1SA0E 1RF0A 4JI2T 1IFIA 5LCYA 1M7KA 2PBIA 2GUSA 3EDUA 1IFDA 4ZI3D 1BGYJ 1AQ5A 1S94A 4DBRA 1LTGC 1K05A 2KS1B 5AVYB 4GYSA 1U57A 3CCLP 5AQMB 2FYZA 5LP6E 1JNZA 4JBZA 5JDNA 2M5AA 1RF1B 3L70E 1LVKA 1ZXGA 3B4SA 3NBXX 3SS1A 4NPEA 3ITKA 1VF5D 1FDMA 3OPCA 1QLBA 1FZBA 1HS7A 1MUUA 2BKOA 1HG5A 3H32B 2LT3A 1K73Q 1KEYA 4NXMT 4I2LC 3L70D 2LOSA 4LF4T 1KILA 4ZI7E 2XZEA 2SPCA 1XTCC 2CHNA 4DCKA 3H1LG 2XM2A 4AQGA 2LLYA 3FXEA 1FC2C 1NVOA 4Y28J 2WDVA 1P84E 2E74D 4E7ZA 5KLVJ 4BA9A 1LVFA 2P67A 2P2UA 5C39A 3M0DA 4WNKA 4GKJT 1YYCA 2JQKA 2VB6A 4YJ3E 5C3JA 1MZ9A 3LK3B 3RYCE 5JTGA 5EK2A 4CZZB 1VQPP 5HEUA 1PP9D 1SFCC 4PD4E 3Q3DA 1RH5B 1O3XA 1AA0A 3NWIA 1P84D 2QJKB 4YSYA 2WSSH 2IMLA 2QA4P 3TLSA 1PPJD 2IUBA 4X1IE 4PJJA 2KUBA 5E79E 3V4QA 4PJ0H 3T97A 1OEDC 4GODA 4UVCB 5AW9B 1LT1A 3LFMA 4Y99C 2OGUA 2Y9ZA 1WRDA 2K5BB 2QG4A 3AVSA 4HFHA 3AE2C 3VMXA 4UEMA 3P4SA 4UF0A 1LP1A 3VRBA 3MZKB 3RIFA 2XQ4A 4JI1T 3VKHA 1LWUA 2HPCB 4KBMB 5HEHA 5BU8B 3SRZA 2Y0EA 4DUZT 3ZMVB 4CN6A 1SQQK 4IFFA 3CX7B 3NMDA 4A97A 1YXRA 4HWDA 1E5WA 4EGWA 2Q9QB 2ZM2A 2A45H 1Z8UA 4ZI2D 2WWUA 4RO0A 2XY8B 1Q7YQ 4MBQA 1HGVA 4X65T 4C7NB 1FZFA 2C5KT 2WWWA 2E43A 3IF8B 3ZYLA 1WRGA 5KLIB 4EYUA 1OWAA 3RI5A 2OA5A 2HLOA 4JUYA 1VQ8P 3P4PA 1UX4A 1E79H 1HH0A 1URQD 4QXHB 4JI5T 4JI7T 2WU5A 1VQ9P 5M4YA 1UURA 2B88A 3PUZF 5APSA 2ZT9B 1LTSC 2WWVA 4OVNF 3VMZA 2Y8DA 4RJTA 3AEBA 1NTMK 1H0TB 3CCEP 1GU4A 3LK42 3A5XA 3EQ2A 1XMQT 2KOGA 5CCGC 1LKXA 4YSZA 5DQVA 1ZV4X 1LTAC 4BRYB 2C5JA 1PGQA 2WPVB 4EZHA 4MHCA 3AEFC 2XHEB 2FBWA 3Q5EA 4IE7A 2UUCT 1KFNA 2IYOA 3RC3A 3RRCA 3CX5H 2FJEA 2YIUB 3B5ND 4CN4A 1KQFB 2IDOB 1SQQG 4XFJA 2G8YA 4IIJE 2E76B 4W80A 1LT9B 1SVFA 3H1IJ 2OYIB 1FS0E 1L0NG 4U2YA 4AKLA 5DABA 3BQIA 5AW8B 3N9LA 1HGZA 5GTIH 2ZM8A 3UU8A 2M6BA 4F8HA 2XDJA 5FP3A 2K24A 4H44D 4LC1A 1SQPE 4JQ0D 2XUEA 1KF6A 3QNUA 3CVRA 2DI4A 4DBQA 1VQ7P 3SFDA 3GF7A 3QK6A 1L4AD 2KNCB 5HXSA 3NRYA 4GK5E 4EDFA 3ANWB 2LSYA 4IDOA 4U7JA 1QSDA 1W09A 3WAJA 1NTMG 3HD7C 3FB2A 1NU1K 3JADA 5CMZA 2I59A 3OW2O 1SQBJ 2EHOD 4A5XA 4K0UA 4EYYR 4CI2B 3MHVA 3MA9A 1P84I 2OLTA 4I4TE 3ETVA 3N2KE 5FY7A 2V4HA 1URQA 5LYJE 1MKMA 2O3JA 1MNDA 2XM1A 1LTJB 4EYYQ 2ZYAA 3F57A 2LKMA 4H13D 5B5EH 1NTKD 3SWFA 5LGUB 2XQ3A 2JQ9A 4PD4I 1FMWA 4K35A 2NW8A 3PUWF 2LSKA 4U31A 3VR9A 3ABVC 4YTPC 1CZQA 2IFMA 5APUA 4ZMDA 3AA0B 3P32A 3GHGA 3AECA 5AQJB 4AQYT 3EHZA 1NWQA 2ZMAA 2ZXXA 3V2QA 2FYUG 2CPTA 1GL2B 4YHHT 1MIWA 5CBNA 2BDEA 2ZXEB 3P8CD 3H1KD 1AVOA 2J62A 3DTOA 4WYVA 4DVDA 3B5NA 1HCIA 4IOIH 2FFDC 3C50A 2QGSA 2IC6A 2O01N 3BK9A 3H6PA 4N78D 3MXZA 3L74G 3BQKA 2V6XA 3CMLA 3KYQA 1KN7A 3AE1A 3JC6D 4X62T 4Q25A 2QJPB 5M1BA 1T2KC 2Z4EA 2NPSC 3MZWB 1QGKB 3PUXF 4LF8T 1NTZE 2E75B 2OYOA 4IFMA 3KZIH 1RF1C 3L75J 3R6NA 1IK7A 4YSXA 1L4AA 5KAFE 3TGUJ 3QOFA 3ZN0B 5AVTB 2AXDS 3CWZB 1GMJA 3U78A 3Q2YA 3LSVA 4H9RC 4OX9T 4NPPA 3O8ZA 2KINB 2W66A 1PGPA 3CPWO 2ZM0A 3AE4A 5LXTE 4JI0T 2EHOA 3E08A 1KTMA 2BS4A 4TN7B 3H1LD 4D6TD 2BBHA 1ZP0C 1HBWA 5EZYE 2QSIA 1YJ9P 1Y9BA 3MUDA 4A98A 3T1HT 4N3YB 4AKHA 4OYKA 3CC2P 2VKHA 1S2EA 3FWNA 1L2PA 5AQTB 4ZS2A 4JI4T 3E7KA 1K9MQ 1SUMB 2A45G 3KDSE 2D2CB 1M56D 4WZXA 3L36A 2XTLA 3HUSC 2WSFJ 5AQKB 5JRCB 5AQGB 1PL5A 3M0AA 1D0XA 2IDBA 3A0BE 1R5SA 3ZMSB 2KLVA 2B87A 4ASVA 4LF7T 2XQ9A 5CA0E 3Q2MA 5ETWA 2V7LA 4H63V 3OJAB 2DWGA 4X1KE 4FI5A 3HI2A 4PV1C 4JV5T 1KC8Q 1FBMA 4P09A 2BCCG 3KVAA 1RQVA 1GL2D 3H3AA 1H89A 3VP8A 1JY2P 4HH2A 5BVZA 2ACXA 3GN5B 4MLKA 4YJ2E 2FUPA 2G3AA 4TLFA 2CHOA 2PRRA 2R5BA 1SQVJ 2BS2A 1G1JA 4IDQA 3C98B 1KB9D 2Z5IA 3OTOT 3IF4A 3G4SP 2LOPA 4Y99B 4QH5A 2Q3IA 2X9HA 3M9HA 1M1JA 1NU1J 1S4XA 3AB3B 3EUHA 3SWHA 4IDZA 4HJGH 4PFOA 4YXDC 5CJ5A 1IBLT 5AVQB 3L71J 1DEBA 3GW6A 3IEEA 4OGQB 3HE4B 5JDFA 3S9OA 3QB5A 4O2AE 2FXMA 2ZYDA 4JYAT 2ITAA 1YI2P 3NRXA 3VN0A 4GIWA 4DMWA 5EK4A 5KLIC 4PK4A 5L3GB 3ZN1B 2XNDH 5J0ZA 3CC7P 3J9X1 1IK9A 2P9BA 4YXWH 2POHA 1XNRT 2WPSA 2ZT9C 3KBTA 4DV7T 1D1AA 4GYRA 3C4ZA 1RE4C 1SQQE 3I0OA 1GZLA 4IL9A 1KYOH 5DQWA 5ABHA 5H6QB 2CPSA 1L0NE 5H2FE 1NAYA 4IL6X 1HG2A 1GK4A 3PUAA 3OYXA 2LM9A 3UUXB 2KIKA 3MKDA 3C8VA 3A2AA 1Q81Q 4QHOA 1AQTA 3H1JG 3CMAP 2AXTE 1SQQD 1Q86Q 2Y0DA 1N73B 3RBZA 1FZCA 1SQPK 3L70J 4ZXLA 3O4XE 3TLUA 4EOZB 2V6YB 1VCTA 4AKRB 5FKYA 1S3JA 1EDJA 3RX6A 3AE7C 4U74A 4KI0F 1VCSA 4C90A 4DR6T 1YQ3C 1EZVG 1JY3P 2QIWA 2ZAEB 5L8RJ 1SQXE 4TV9E 1SFCD 4A56A 1EDKA 2FYNB 5FYMA 1VQOP 4YT0A 2WSCJ 2K9AA 1G2CB 2Y0CA 3TNUA 3NKZA 1FJKA 2N1TD 4I7ZC 1Y64B 4A7PA 5FL0A 1JY3O 3D6ZA 4U72A 2WSEH 5CCHC 2G0UA 1NTMD 4QH1A 5L2LA 2WBLA 1IFNA 2W00A 2JWDA 1BE3E 3LK2B 1KMIZ 2P7JA 3V2PA 1KQGB 2W83C 4XAXB 1IZNB 2KMFA 1JM0A 3FWLA 1J5WA 3LW5J 2FYUE 3AE3C 1Y01A 4UVBB 5L4EA 2CWYA 2LXBA 1PV3A 2MYSA 5TJHA 1VRBA 2E9XA 3UU3A 4TZ4C 2VASA 1YBKA 3HKCE 2VVSA 3ZMZB 1SQPG 4DZOA 1ZN5A 3TSIA 3O1IA 1PZQA 3AEAC 3KV5A 3HRNA 1S72P 4PAGA 2PTFA 5IHYA 1N7SC 2LEHA 2CA5A 2JEEA 3K3NA 1IBKT 2Z5HA 1Y8AA 4L75A 1J5ET 1EQ7A 2YN6A 4YTMA 2NRGA 4IREA 3V5UA 2B89A 2KZJA 3RGUA 2KLQA 1S1CX 5AVRB 4N6JA 2JKVA 3KHUA 5APXA 2C0WA 3T1YT 3VR8A 1WYCA 3L74D 2JQQA 4PJ0E 3O6QB 3FZMB 1NTZK 5C8YE 3FXDA 4U7YA 2WQYC 3AE8A 3D0TA 1NU1D 3KV9A 3L73G 1JY2N 2OYHC 2WSSV 4X64T 1HNWT 4IDNA 1JTHB 5CCGD 4KUMB 2XAFB 1J2JB 4L0RA 2IC9A 4GT1A 3EABA 1XDOA 3N9MA 1SFCA 2FFDB 3M91A 2O01J 2WS3A 4J2CA 2R3CA 5L3EB 3MACA 3AAIA 2XQ7A 5DJTB 5TISH 2N1TA 2VL8A 3HKEE 3CWBD 5FXWA 5B66H 4ASKA 5LMUT 2YU1A 1HUCA 3JAFA 4DV5T 3UIAA 3EFGA 1OVVA 1Z56A 3AVRA 1OEDA 2LSIA 2NPSB 1X9BA 1XZYA 5L3DB 5HXEA 1NJIQ 4JF7A 1SHZC 4JYCA 1FAVA 1DEEG 5KJ7D 3O1JA 1YD8G 1B7TA 2W6AA 2ZM6T 2CBJA 3H1HE 3LDQB 1QEXA 2N9DA 4LLHA 2LKGA 3ZEFB 3CD6P 5FVLA 3KV6A 4Z8XA 3LIDA 3CC4P 4BJNA 5LJMA 1FDOA 1FIOA 2PAJA 5L4HA 2SPZA 3AXJB 2DWKA 3MK7C 2X67A 2BCCE 1SLQA 2D2CC 3HTKB 2K9JA 4EV6A 4EB6E 4U3FG 1HJBA 3C4WA 1NTZG 2WSFH 5JDQA 1CI6B 1OX3A 1L0LK 1FZAA 3PJAA 3HD7D 3E1RA 1WR0A 4JEHB 5BR8T 4HWIB 3L8RA 1N32T 4QX8B 4BJMA 2VQET 4AI6A 5AQLB 3TYYA 4NUUA 2KWHA 2PJQA 2BCCD 1KFYA 3UFEA 1DD3A 2XQ6A 2OTLP 1U4QA 3CX5E 4DR4T 3HUSB 3RYFE 2DLRA 4WY4C 3NTNA 1SE7A 4HWFA 3AEGA 2CK3H 1USEA 1OZHA 3KXDA 1H8AA 1IBMT 4DV0T 4K0KT 3PUYF 3C9IA 4EEBA 4M1PA 1S5LX 4B3MT 3CX6B 1NTKJ 2V7QJ 2XASB 3K3OA 4HKAA 4KP3C 3PUGA 2KP8A 4DV4T 1LGHB 3G71P 2V6YA 5GTIE 1Q82Q 1KORA 3MP7B 1JY3N 3R2PA 4PV1B 5CCGA 2P58A 4GDOA 1QLED 4PD4D 1DX7A 2KT9A 4TNVA 5F8PA 2WZHA 4AQFC 3U59A 3CXHH 1JUNA 1RF0C 3AEEA 3CCUP 2ODUA 3GMIA 3H1KJ 2YK0A 4JEUB 4JI3T 4ERRA 4OGQC 3LBXA 2K3WA 2B76A 4ISSA 2Q3EA 1OW8A 2YDRA 3E22E 5FNVE 1W9RA 3JCFA 5HXCA 5H6RB 2ZYGA 4WBAA 2V7IA 1NKNA 4HWHA 3ZSSA 5DJQC 2HG5D 1L0LG 5K5GB 4ZHQE 1L0NK 3SOLA 5KJ7A 1T2KD 3HKDE 3TLVA 1WYBA 2NPSD 1D1CA 3H1JE 4M3LA 2ES0A 1CHUA 2MTQA 2BBJA 2QM8A 2CBIA 1HX1B 1AVYA 1YQ4C 3G9RA 1N36T 2X9WA 3C51A 1Y47A 3VOPA 2E5VA 5B5EE 2C0SA 1U7JA 2WT7B 2MKVA 5BU5A 1UGOA 1QVFO 1LJ2A 1KILC 2L5GB 1VQMP 3H1JD 2IYPA 3HD7A 2I1JA 1EZVE 1X8YA 5KDMC 2FY8A 5KKZC 2XU6A 2J58A 1MNEA 1SQXK 2LR2A 1N73C 2L8KA 3H1LJ 3CQCB 2D0TA 4D6TJ 5FMNA 3CI9A 3Q9DA 3HE5A 3WUVA 2IFNA 1EZVD 3VMAA 4IE6A 4B86A 1X79A 1LNQA 4GOFA 2UUAT 3AE6A 2OARA 3CQGB 2J5UA 2W6JH 2D5UA 4ANJA 3ABVA 3GF3A 1CSBA 2LE8A 2FYNC 2WSCH 1BGYE 4IE0A 3OVUA 4I55E 4IE5A 1T8BA 4WBNE 5LGNB 2JR8A 2UXBT 2A45I 2FYUK 4AXPA 1KNPA 1JTHA 1LTTC 2YMYA 2JDIH 4DR3T 1UIXA 2A72A 1LWUC 4L76A 4UB6H 3A7MA 4ZI3C 1M62A 2E5TA 3MJXA 4I7ZB 1E2AA 4XA4A 3PU8A 3AE9A 1KNZA 4JYBA 2V7KA 5APQA 1JCDA 1T7SA 2A9UA 3UUMA 3UQ7A 5CHXA 1MMGA 4HFVA 3LW5H 2LHRA 4YTNA 3N9QA 1SQPD 5LHHB 5AW4B 1WFDA 2KS1A 1N2DC 4XBFB 1SQXG 2KSJA 3N4XA 1EDLA 1VF5C 5AW1B 3PTRB 3I55P 4YLHA 2UUBT 5IWAT 3RLFF 1RF1A 2FXPA 1X22A 2Q9QD 3D70A 3TLWA 3L73E 2Y48B 5J2TE 1H7CA 4GIFA 3TK1A 3EAMA 5ABGA 1FEWA 3ESLA 3H32A 4ILAA 3CX5I 2H89A 3PP5A 3AEBC 3V5SA 2JMHA 1BE3G 3PUQA 1JB0J 2VVNA 4HFEA 1N7SB 2XPKA 2AEMA 5BMVE 1NO4A 2ZT9D 4AIUA 2WZ7A 1YHQP 2JRKA 1LTIC 3MTUE 2DW3A 2NP9A 2QJYC 4WBOA 1XDPA 3BASA 1FZGA 3WU2H 4TWHA 3UQ4A 3UTKA 2X68A 3OAKA 3EVYA 4LF9T 2FBWC 1G8XA 2PP6A 2X66A 2L3LA 1YJNP 2M0BA 1T8ZA 4HWCA 1W0AA 2IBZE 5JR9B 3EDVA 3M9QA 3Q5XA 1IAPA 2JWAA 2BG9B 2O01H 3D6YA 2PFVA 5ADXL 1FE6A 4HKZH 2YNYA 4AUWA 3LG7A 2I0MA 3UU4A 2OYHB 1SQQJ 3A8YC 3RL0B 1YKHB 1J1DC 2J47A 2NWBA 2E76D 1L0NJ 4L5GA 3A7OA 2W4XA 3ZT7A 2E5LT 1XWMA 4U3FE 3DJBA 4WW0A 4IL4A 2KZIA 2YKQA 3NZQA 1QL2A 2VL0A 3V6IA 3SFDC 2YXQB 1BSHA 5KTBA 4EOTA 2HPCA 3C64A 5AQVB 4C46A 4IE4A 5KX5E 4U3FD 1RE3A 1NTZD 5HWYA 3ZDMA 2GUVA 5CCHD 1QL1A 3KDPB 1EZVI 1BDCA 1NTMJ 2CWOA 3D71A 3TF5A 2Q9QA 4YXDA 3BCCG 4ZZCA 1T98A 2ZLYA 1KNRA 1RQUA 1VQLP 4C7NA 1YTZT 3K3QC 5JREA 3JSVC 4TT3H 2KSEA 4PNIA 5HEGA 3V4WA 3FZHB 4NPFX 1DH3A 3A0HH 2V26A 2NR4A 1Q90D 5LHIB 4K3AA 1VQNP 3K5BA 2WAUA 3H1HG 4O4IE 3N2OA 4DUYT 2V7QH 1ZOYA 2QE7H 2R44A 1H0TA 3PDYA 3UU5A 1RHZB 1IJDB 1RE4A 4DO0A 3PJAJ 4UB8H 2HODB 4O8SA 2BG9E 5E0OA 3CCSP 2R5DA 3WUTA 1W0BA 2BVLA 3BVHA 1I94T 2V5CA 4WY4B 1L0LE 4HFDA 4BRYA 3B5NC 3PUVF 3Q1MA 4PW8A 1NHLA 3RRWA 1BR2A 2UXNB 4HGAA 3V2RA 3CLQA 5AQIB 2H3RA 5ABFB 5L47A 3AE1C 1BCCG 2Q9IA 2LSGA 5AQRB 3L74J 4ZEYA 1L0LD 4KHZF 1HWTC 5L3CB 3QH9A 4H0LB 4RKUJ 1LT9A 2OYIA 1WLXA 3AE7A 4GOUA 4LFAT 1SQBE 1HNXT 1FU1A 1S9KE 1VQ4P 2QVAA 3KFWX 4LMKA 5GTHE 1PP9G 1N7LA 3RK3C 3NZPA 1KQLA 4HE8A 4DV2T 4UV9B 3UU6A 4NPDA 3CCRP 5FXZA 5L3BB 3USSA 2UXDT 2E75D 5KAIH 5AW5B 2YO3A 1CUNA 1BDDA 1KD1Q 5IYZE 5KXJA 1ZEEA 2KNCA 4PK6A 3CWBJ 3SFEA 2UXXB 3K8PC 3AE4C 2KNDA 5CCHA 2EHOC 2M5AB 1L0VA 3ANWA 1IJ5A 1UIIA 4O4HE 1EZ3A 3F5HA 3JCUE 3PU3A 3ZMUB 2XQAA 1OW6A 4O9BA 3MUDC 3N9PA 2WPRA 5JDMA 4QWNB 4I43B 4TUYE 3KV4A 3ZYKA 2B1EA 4H13C 3RK2B 2LXCB 3L72G 2C9NY 1WR6A 4Z91A 1KILB 2XQ8A 2PGDA 2WY2A 1LTJA 1NH4A 2JP3A 4IL6H 4GKGA 3ZPOA 2IBZI 2D2CD 1DIPA 2E2AA 5KKZB 3FX0A 3FXEB 1IFPA 3L4FA 2YMKA 2L91A 4H9OC 1U7MA 2K1AA 1UUSA 2X9YA 1L0ND 2D9DA 4HYTB 4YY3T 3HA4A 2N9BA 4ILBA 1G1IA 2YKSA 3FZLB 5HYAA 3II6A 1GL2A 2VK9A 5AQFB 2HN2A 1FOSE 2BCCJ 2YKPA 3SSUA 3L75E 5TISE 4WY4D 4DR5T 3ZJ2A 5B66E 3H25A 3TGUE 1WCRA 3T97B 3AE5A 2A06E 2QEXP 3TDKA 3RYIE 5KLVK 2WQYA 3N9OA 1VQKP 2YEVC 1JOCA 2OTKE 4I50E 5APTA 4UF0B 1LP1B 2FJBA 1IFMA 5HAXA 1SQXD 4TWDA 1HF9A 1KB9H 4I6MC 3F31A 4H9QC 3ETUA 1LWUB 2XQYA 2ZFCA 3FBZA 4R4MA 2WMMA 3L37A 3UUNA 5LBQB 2CXLA 4O2BE 5AQQB 1AJ3A 3RKGA 1BGYG 1W2BO 3ZCJA 4QXCB 3UULA 2VKOA 4CXYA 2YDSA 4OGQD 1IJ6A 2AE9A 3E0ZA 4R4LA 3Q5PA 3ONJA 5TAOA 4LF5T 1I6ZA 1GQEA 5EK3A 3H3MA 3RH3A 2OV9A 4HB1A 3RIUC 1BE3D 2I1KA 2H88C 2IZ1A 1VF5B 1PFIA 4X5TA 1WT6A 3K1SA 1KILE 4UVAB 4AISA 3NFQA 5JDHA 4ZKPA 2RP4A 2FYUD 3ZMTB 3ONLC 1BR4A 2VURA 3I1AA 3H37A 4QKNA 1PGJA 1HR0T 4UXNB 4GKKT 2RKLA 1EXIA 2MBGA 4B6XA 4TWFA 3Q5SA 4LMLA 5CJ0A 4PFPA 3ONXA 4TNWA 4CI1B 1K04A 1SQVE 1M90Q 5JR9C 2A2FX 2E74B 1FZCC 1EXJA 4G63A 5JRCA 5APWA 2BG9C 5KLVG 3PURA 2QRXA 3H1JJ 4JBWF 1ZKEA 2GA1A 4KHXA 5AVWB 2DHRA 2QJYB 2FXOA 1M1KQ 2WMOA 2CPBA 3VKGA 2CE7A 4KT0J 3RL0C 1TU3F 3VTPC 4HN9A 2CRBA 2YU2A 3OJAA 2W8ZA 3CXHE 2KI7B 1FZEA 2K3RA 3Q5WA 4I0UA 2FJDA 2UXCT 1NTKG 2Y9YA 3P4RA 3GN5A 3BCCE 1BSNA 3OBVE 3AEDC 2IX7C 2FKWB 5FVKA 1R5LA 1ZMEC 2NTYA 2OQQA 2W0GA 2LRKA 4UV8B 2YDQA 1J1DB 3FBLA 2WP9A 2XAGB 4U2ZA 2BZBA 4CXWA 3E1IA 1W2EA 2I8DA 1QUUA 3B71A 3VHLA 1EDIA 2IBZG 1WMKA 4C7RA 3AE2A 3AA6B 1GTWA 2AEJA 5LNKA 1ZW0A 3RQWA 1JO5A 1ZHCA 3PHLA 5AQUB 1HX8A 3HE4A 5AVVB 4CN1A 2Q7CA 1U5PA 2J1DG 3VP9A 4H9NC 4W7ZA 3CIRA 2D2SA 1OIPA 3OYZA 2E9XC 1S35A 1X0TA 3F89A 3N2GE 3TKLB 2KYVA 2GK9A 1X9VA 1KK7A 3H1HD 3VRAA 1JMBA 1SQPJ 2MPKA 1OVRA 5LOVE 3VMYA 1V9DA 5HWXA 3V2NA 2RA1A 1URQB 1YQ4A 2A3DA 2XKMA 5HEJA 1BCCE 4OYJA 2H7VC 3ZSTA 3CCVP 4KX6A 2QM7A 3WMM0 3V5BA 5FXVA 2JJLA 2YXRB 1JCCA 4JI6T 1IC2A 2X51A 3RGLA 1SQBK 4DJGA 3RIAA 1PP9E 3GHGB 5JDLA 1OFCX 3IN6A 3N7NA 1AFOA 1T3UA 2N2NA 3FGAD 4UIGA 4D6TG 1HNZT 1BCCD 2WDQA 3AE8C 3I9WA 5FL1A 1N73A 1FJGT 1PPJE 1S5LH 1OVUA 1NWMX 2VQFT 3CX5D 3L73J 1AJYA 4H0LC 2YO2A 3B5NB 5A1LA 3RPUA 4C91A 2Q6QA 2VRSA 3FHNA 4UB6E 1USDA 3AEFA 4PJLA 1MMNA 2Y6XA 4ADZA 3L39A 3W67A 4GOEA 4HFBA 2N1TC 3I56P 3H1IG 5AW2B 2B9BA 2Z6EA 1ZLLA 1OW7A 2YOEA 3M65A 1MFZA 3GLMA 1G2CA 1YIJP 5IUXA 1MV8A 2BASA 2K37A 4RESB 4H44B 3L72E 3ZC0A 3G6EP 3VU7H 3P50A 4QH4A 2H8PD 3RL0g 3R84B 3RK3B 3C1LA 2WB5A 4CXXA 1L4AB 2H43A 1A02F 1MIYA 3ZT6A 3JC22 1NKZB 3L72D 1N34T 4HEAA 5ABEA 2CXDA 5HCJA 2P10A 3RK2C 1N86A 5LG3A 4E7SA 4NXNT 2EHOB 1SQBG 3CKDA 1MFTA 2W90A 2VKJA 3CCMP 4H9PC 4DR2T 4U3FJ 3KQGA 4EZ4A 1NTZJ 1R8EA 2W61A 4O4JE 2IZ0A 3WU2E 4H13B 3M0DC 2BVMA 1D1BA 5J1GA 4DV3T 5CGMA 3GMAA 2IPPA 3AEGC 4DR1T 3WUUA 3CXHI 4KJMA 3EFFK 3FZKB 2B87B 2XNXA 2CLYB 1OXZA 1JNMA 1PGOA 2DNXA 2E42A 5AVZB 2J59M 3LJCA 2KLUA 4ILCA 3ZC1A 4YTPA 5CA1E 1UX5A 3RBXA 2OTJP 2BEZF 1E7PA 3B5MA 3O6QA 2O1JA 4LGDE 3O1HA 2NW9A 1DU2A 3EWKA 1GU5A 3I0QA 1P84H 5KMGP 4ZS3A 5AQOB 2HR3A 2X0HA 4PK5A 3J7Yq 1NOHA 3O9XA 4BWNA 4PV1D 3KZIE 3QUJA 4PJNA 4X1YE 3AEEC 2H7HA 3GWHA 2XAQB 1BGYD 1KZUB 4PD4H 2FFDA 1G73A 3SWYA 1DD4A 1JNRA 4DT0A 2JJ9A 2ZJSE 4XE5B 3RK3E 4B3ST 1M1JB 5E79H 3P7IA 5AQSB 5KJ7C 3P4WA 4Z90A 3GG2A 5JQGE 3RC8A 3EI0A 3TLTA 1CW5A 2NPSA 4ZNCA 1L0LJ 1GK6A 2MAWA 3L75G 3Q5RA 3W15B 2JO1A 1MMDA 1W5CE 4WB4A 1T72A 2D0UA 3TGUG 2A06G 3RK3D 1SQVK 5KLVE 4LMJA 2BKNA 3IA3A 3B57A 4EI2A 3L35A 5AW6B 1UK5A 2LSJA 2WSEJ 5AW7B 4KMCA 3I9YA 3A0HE 2C9LY 5FXXA 2ZVNB 2W63A 3KINB 4HFIA 4UR9A 1M8OB 5JH7E 1JMMA 5EFWB 3UT5E 2L9QA 3AXJA 2KXPB 1QX8A 3HTKA 1NTKE 5KLVD 2C0XA 2WMNA 1CI6A 2E74C 1ZP0A 5DJUB 3CCJP 3L3PA 2XAHB 2WVRA 4UB8E 3L73D 3CX8B 3ZYMA 2JMKA 3BRTB 2KZ7B 4ILUA 1J1EC 5CBOA 3AAEB 2M6IA 2BEQD 3AE6C 1US7B 2KB7P 4L74A 3P8CE 4EIJA 3T8OA 3FZFB 3H1KE 3B8EB 3HUSA 1FZCB 5APYA 3HR0A 2IAKA 1Q2NA 2V8SV 2R6GF 2HPJA 3MD0A 3RHWA 2WITA 4AQRD 2YINA 5LMNT 4O4LE 3PH0A 2HN1A 3IHRA 2HPLA 4TX5A 4N78E 3WI3A 5AQHB 2RPAA 2XSAA 2IBZD 2LHNA 2KK7A 4JI8T 2X9XA 1YW0A 1GDTA 4Z1MH 1SQVG 4MFRA 4YFSA 2IW5B 3TNUB 5CB4E 3KVBA 5KAIE 2K48A 3F2EA 1H88A 3AE9C 5JDGA 2NW7A 1NGMB 3Q5DA 4LF6T 2UWJE 2LRLA 4PJMA 2H7OA 3RQUA 4MN4C 1YJWP 3L09A 2CXFA 2RMZA 1NU1G 2W27A 5F3JA 4MALA 2N1GA 5FY0A 1UCUA 2PFXA 2X0LB 5LGTB 1KFMA
chains in the Genus database with same CATH topology
4GOEA 4K3AA 1DEEG 2KI7B 2K3RA 4WYVA 1Y47A 4WWIA 4IOIH 3FXEA 1FC2C 1NVOA 2R44A 1H0TA 4ZNCA 1U7JA 2JWDA 3PJAJ 5C39A 3S1KA 4CPGA 3RIUA 2SPZA 3AXJB 4HJGH 2I8DA 4BXLA 1JM0A 2LR2A 3MZWB 1EDIA 3PJAA 3QB5A 2LXBA 3QB5K 2M0BA 2OTKE 5EFWB 1LP1B 1ZW0A 2KUBA 3AXJA 3QWOC 4GODA 4GOFA 1EC5A 1LT1A 4HKZH 1MFTA 2WMMA 5DJUB 1LP1A 2QVAA 1X0TA 4NPDA 2Q1KA 5CBOA 2B89A 2KZJA 3RGUA 1JMBA 2KZIA 1OVRA 4HB1A 3RIUC 1BDDA 1Q2NA 2KIKA 2P58A 3MHVA 4KJMA 2M5AB 3PH0A 2B87B 3FXDA 2KS1B 3ZDMA 1SS1A 1J1JA 2RKLA 4JBZA 4EYYQ 2M5AA 1S3JA 2B87A 1BDCA 4ASVA 1EDJA 1ZXGA 2HR3A 4NPEA 2LXCB 4K35A 1OVUA 5DJTB 2ZAEB 1EDLA 4ZMDA 2QRXA 2UWJE 5K5GB 2B88A 4MN4C 1EDKA 1KEYA 1OVVA 1H0TB 4NPFX 4ASWA 5CBNA 1U7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOE A;  4K3A A;  1DEE G;  2KI7 B;  2K3R A;  4WYV A;  1Y47 A;  4WWI A;  4IOI H;  3FXE A;  1FC2 C;  1NVO A;  2R44 A;  1H0T A;  4ZNC A;  1U7J A;  2JWD A;  3PJA J;  5C39 A;  3S1K A;  4CPG A;  3RIU A;  2SPZ A;  3AXJ B;  4HJG H;  2I8D A;  4BXL A;  1JM0 A;  2LR2 A;  3MZW B;  1EDI A;  3PJA A;  3QB5 A;  2LXB A;  3QB5 K;  2M0B A;  2OTK E;  5EFW B;  1LP1 B;  1ZW0 A;  2KUB A;  3AXJ A;  3QWO C;  4GOD A;  4GOF A;  1EC5 A;  1LT1 A;  4HKZ H;  1MFT A;  2WMM A;  5DJU B;  1LP1 A;  2QVA A;  1X0T A;  4NPD A;  2Q1K A;  5CBO A;  2B89 A;  2KZJ A;  3RGU A;  1JMB A;  2KZI A;  1OVR A;  4HB1 A;  3RIU C;  1BDD A;  1Q2N A;  2KIK A;  2P58 A;  3MHV A;  4KJM A;  2M5A B;  3PH0 A;  2B87 B;  3FXD A;  2KS1 B;  3ZDM A;  1SS1 A;  1J1J A;  2RKL A;  4JBZ A;  4EYY Q;  2M5A A;  1S3J A;  2B87 A;  1BDC A;  4ASV A;  1EDJ A;  1ZXG A;  2HR3 A;  4NPE A;  2LXC B;  4K35 A;  1OVU A;  5DJT B;  2ZAE B;  1EDL A;  4ZMD A;  2QRX A;  2UWJ E;  5K5G B;  2B88 A;  4MN4 C;  1EDK A;  1KEY A;  1OVV A;  1H0T B;  4NPF X;  4ASW A;  5CBN A;  1U7M A; 
#chains in the Genus database with same CATH topology
 3X1D A;  4ZI2 C;  1FMV A;  3L71 G;  4V1A v;  4XZC A;  4COF A;  4FJO A;  1GW3 A;  3CK6 A;  1QVG O;  4DMV A;  1Z0P A;  1D0Z A;  1KQS O;  1MIV A;  1N33 T;  4WWI A;  4CQI A;  3H1L E;  1SQX J;  1VOM A;  4NUV A;  1KYO E;  2P1J A;  3OKQ A;  4D6T E;  3CME P;  5AQN B;  4AKI A;  2AXC A;  3CWB G;  2WZI A;  4AKG A;  1URQ C;  2XJ7 A;  4NIQ A;  1VQ6 P;  2CM0 A;  4CPG A;  1D7M A;  2E5Y A;  2WU2 A;  2R32 A;  2E9X B;  3RF1 A;  4IL6 E;  2H89 C;  2ACZ A;  3GA8 A;  3QC9 A;  4IHJ E;  2KWI B;  4B3R T;  2WT7 A;  2PG8 A;  1KYO D;  2LKH A;  3U1A A;  4OHF A;  3NXS A;  3AEC C;  3GHG C;  4QXB B;  1BE3 J;  2RH0 A;  3A3Y B;  3H1I E;  3N9N A;  5C2T A;  2O1K A;  1N7S D;  5HEO A;  4HFC A;  5AVS B;  4OK0 A;  5LHG B;  1JEK A;  4LFB T;  4DID B;  3UFG A;  2FYU J;  1NEK A;  2W2U A;  1HJ0 A;  2CEA A;  2E8I A;  3CPZ A;  2K88 A;  3L70 G;  2Q1K A;  1VQ5 P;  2RN0 A;  3H1I D;  3FXD B;  2QJK C;  2Q5U A;  2V7M A;  2MJZ A;  4F6R C;  4JLE A;  5AW3 B;  4EXT A;  1KB9 E;  5AVU B;  3S4U A;  4H44 C;  3G3Z A;  1SFC B;  2ODV A;  5LA6 E;  1LRZ A;  3RL0 D;  3P8M C;  1YQ3 A;  2N1T B;  1J1J A;  4DV6 T;  1ZR2 A;  1L4A C;  2CCQ A;  2X0Y A;  4DR7 T;  3PV0 F;  4IT4 A;  4IST A;  1PPJ G;  1OMI A;  1OED B;  2XSB A;  1JY2 O;  2HHH T;  1SQB D;  1ZV8 A;  4HTE A;  1S9K D;  1RE3 C;  2BKP A;  5FY1 A;  3I5C A;  1HFA A;  2WTY A;  1YKE B;  4OH8 B;  3PUS A;  5AW0 B;  5L3F B;  2Q9Q C;  5AVX B;  1HF8 A;  2XQ5 A;  3CL3 D;  3PJS K;  2W6B A;  1BR1 A;  4LFC T;  2AEF A;  3W68 A;  3BCC J;  3AAA B;  3BRV B;  4AYC A;  2VWA A;  4ZZB A;  1K8A Q;  5KAF H;  3ZLI A;  2K9J B;  2NZ2 A;  3CCQ P;  3AE3 A;  2M3B A;  3S1K A;  3IR9 A;  3NVO A;  3RIU A;  2E9X D;  2XAJ B;  4U33 A;  2FJA A;  3JAE A;  2H88 A;  2DCF A;  5HCM A;  5HXR A;  3HL6 A;  5AFU L;  2CLY C;  1KV4 A;  1VDF A;  3AEA A;  3B13 A;  1ZOY C;  3PRJ A;  1T3J A;  1A02 J;  2NOX A;  4ZOL E;  1N7S A;  3H1H J;  3ZJ1 A;  4X20 E;  1ZR4 A;  1ZRT E;  2NTX A;  1XMO T;  3KPE A;  1XNQ T;  1NEN A;  3HKB E;  2VKD A;  2HFE D;  1IFJ A;  2WCA A;  2LJL A;  3M3Z B;  1HTJ F;  3WAK A;  3U1C A;  4P0B A;  4TV8 E;  4BAY B;  1LTB C;  2GM4 A;  3PTZ A;  4JPZ B;  1M7L A;  1IO4 A;  3BQL A;  2JPF A;  3ZKR A;  4H63 H;  5JR9 A;  2YIU C;  2JIW A;  2M8R A;  1ZRT D;  4EAH A;  5CFB A;  2BG9 A;  3JC6 C;  2UU9 T;  3A0B H;  3IFM A;  2J4G A;  3G06 A;  4WVZ A;  1MMA A;  2W62 A;  2E76 C;  3ZCI A;  1HVV A;  1LT9 C;  2F4V T;  2OYI C;  3VYI A;  1BCC J;  2JQH A;  1M1J C;  1NAF A;  2YKO A;  4DOJ A;  2OYH A;  2IIU A;  4P1N A;  1BR0 A;  2HH7 A;  4IDP A;  3L75 D;  1NTM E;  5LJN A;  4EED A;  3OA7 A;  4H0L D;  1OED E;  3CQX C;  1XTG B;  3TGU D;  3DP7 A;  3LBX B;  4DND A;  2A06 D;  1R8I A;  4W7Y A;  1PP9 J;  5LG4 A;  2IHR 1;  2I6H A;  1KYO I;  1NTK K;  1YIT P;  4QX7 B;  4OWF A;  3AED A;  3M9B A;  2WDR A;  3KBU A;  1SS1 A;  2HYN A;  3AA1 B;  4UEL A;  1FDI A;  1YTZ I;  2K9Y A;  3SFE C;  1FJP A;  3R4Y A;  4YHJ A;  3RYH E;  2XZR A;  4H9S E;  4ZKU A;  2WM9 A;  1RY3 A;  1D0Y A;  4OFZ A;  4GK0 E;  1SP4 A;  4IFD K;  4L73 A;  3RKO A;  1AV1 A;  5GTH H;  3N5L A;  5HXH A;  4KHP T;  4ASW A;  4B3T T;  1GW4 A;  2BS3 A;  1PIX A;  3SWK A;  5LBM A;  3P7K A;  3MGN A;  2W67 A;  2DL1 A;  3HD7 B;  1LTJ C;  3L72 J;  3AA7 B;  2N9Y B;  3RK2 D;  5J2U E;  1E1H B;  4G2A A;  2MOZ A;  1KIL D;  4YPC A;  3IAO A;  3PE0 A;  5LB7 B;  1S5L E;  3JCU H;  2LM2 A;  2XV5 A;  2C5I T;  3L74 E;  2KSR A;  3HE5 B;  1VL2 A;  3U3I A;  2WPQ A;  1N8R Q;  2M3E A;  2QYW A;  2V1D B;  2CMR A;  5GON E;  4CI3 B;  3MIW A;  4BXL A;  1X79 B;  1GL2 C;  1J1E B;  1NU1 E;  4X66 T;  4P0A A;  1KB9 I;  2HOD A;  1NYH A;  1SQV D;  5H2F H;  3QB5 K;  2M67 A;  3P4Q A;  3L71 E;  4WY4 A;  3LIE A;  3M06 A;  1M57 D;  3QWO C;  1FOS F;  3C4X A;  4IGU A;  3AE5 C;  3UUB A;  3BAT A;  4I1L A;  1EC5 A;  4EIW A;  5CJ4 A;  3S4R A;  2AXT H;  5ABF A;  1T6A A;  2QA7 A;  4L9I A;  4U3C A;  5APV A;  3CWB E;  3IBP A;  3A5T A;  2ZVO B;  1VPC A;  4DV1 T;  3CXH D;  1HTL C;  2QJP C;  4U7I A;  3ZT5 A;  2V7J A;  3L71 D;  5F5W A;  4QMA A;  2V5D A;  2R3S A;  5AQP B;  3PLN A;  3H1K G;  3BCC D;  5JVD E;  4AQF A;  1GD2 E;  2E75 C;  1SA0 E;  1RF0 A;  4JI2 T;  1IFI A;  5LCY A;  1M7K A;  2PBI A;  2GUS A;  3EDU A;  1IFD A;  4ZI3 D;  1BGY J;  1AQ5 A;  1S94 A;  4DBR A;  1LTG C;  1K05 A;  2KS1 B;  5AVY B;  4GYS A;  1U57 A;  3CCL P;  5AQM B;  2FYZ A;  5LP6 E;  1JNZ A;  4JBZ A;  5JDN A;  2M5A A;  1RF1 B;  3L70 E;  1LVK A;  1ZXG A;  3B4S A;  3NBX X;  3SS1 A;  4NPE A;  3ITK A;  1VF5 D;  1FDM A;  3OPC A;  1QLB A;  1FZB A;  1HS7 A;  1MUU A;  2BKO A;  1HG5 A;  3H32 B;  2LT3 A;  1K73 Q;  1KEY A;  4NXM T;  4I2L C;  3L70 D;  2LOS A;  4LF4 T;  1KIL A;  4ZI7 E;  2XZE A;  2SPC A;  1XTC C;  2CHN A;  4DCK A;  3H1L G;  2XM2 A;  4AQG A;  2LLY A;  3FXE A;  1FC2 C;  1NVO A;  4Y28 J;  2WDV A;  1P84 E;  2E74 D;  4E7Z A;  5KLV J;  4BA9 A;  1LVF A;  2P67 A;  2P2U A;  5C39 A;  3M0D A;  4WNK A;  4GKJ T;  1YYC A;  2JQK A;  2VB6 A;  4YJ3 E;  5C3J A;  1MZ9 A;  3LK3 B;  3RYC E;  5JTG A;  5EK2 A;  4CZZ B;  1VQP P;  5HEU A;  1PP9 D;  1SFC C;  4PD4 E;  3Q3D A;  1RH5 B;  1O3X A;  1AA0 A;  3NWI A;  1P84 D;  2QJK B;  4YSY A;  2WSS H;  2IML A;  2QA4 P;  3TLS A;  1PPJ D;  2IUB A;  4X1I E;  4PJJ A;  2KUB A;  5E79 E;  3V4Q A;  4PJ0 H;  3T97 A;  1OED C;  4GOD A;  4UVC B;  5AW9 B;  1LT1 A;  3LFM A;  4Y99 C;  2OGU A;  2Y9Z A;  1WRD A;  2K5B B;  2QG4 A;  3AVS A;  4HFH A;  3AE2 C;  3VMX A;  4UEM A;  3P4S A;  4UF0 A;  1LP1 A;  3VRB A;  3MZK B;  3RIF A;  2XQ4 A;  4JI1 T;  3VKH A;  1LWU A;  2HPC B;  4KBM B;  5HEH A;  5BU8 B;  3SRZ A;  2Y0E A;  4DUZ T;  3ZMV B;  4CN6 A;  1SQQ K;  4IFF A;  3CX7 B;  3NMD A;  4A97 A;  1YXR A;  4HWD A;  1E5W A;  4EGW A;  2Q9Q B;  2ZM2 A;  2A45 H;  1Z8U A;  4ZI2 D;  2WWU A;  4RO0 A;  2XY8 B;  1Q7Y Q;  4MBQ A;  1HGV A;  4X65 T;  4C7N B;  1FZF A;  2C5K T;  2WWW A;  2E43 A;  3IF8 B;  3ZYL A;  1WRG A;  5KLI B;  4EYU A;  1OWA A;  3RI5 A;  2OA5 A;  2HLO A;  4JUY A;  1VQ8 P;  3P4P A;  1UX4 A;  1E79 H;  1HH0 A;  1URQ D;  4QXH B;  4JI5 T;  4JI7 T;  2WU5 A;  1VQ9 P;  5M4Y A;  1UUR A;  2B88 A;  3PUZ F;  5APS A;  2ZT9 B;  1LTS C;  2WWV A;  4OVN F;  3VMZ A;  2Y8D A;  4RJT A;  3AEB A;  1NTM K;  1H0T B;  3CCE P;  1GU4 A;  3LK4 2;  3A5X A;  3EQ2 A;  1XMQ T;  2KOG A;  5CCG C;  1LKX A;  4YSZ A;  5DQV A;  1ZV4 X;  1LTA C;  4BRY B;  2C5J A;  1PGQ A;  2WPV B;  4EZH A;  4MHC A;  3AEF C;  2XHE B;  2FBW A;  3Q5E A;  4IE7 A;  2UUC T;  1KFN A;  2IYO A;  3RC3 A;  3RRC A;  3CX5 H;  2FJE A;  2YIU B;  3B5N D;  4CN4 A;  1KQF B;  2IDO B;  1SQQ G;  4XFJ A;  2G8Y A;  4IIJ E;  2E76 B;  4W80 A;  1LT9 B;  1SVF A;  3H1I J;  2OYI B;  1FS0 E;  1L0N G;  4U2Y A;  4AKL A;  5DAB A;  3BQI A;  5AW8 B;  3N9L A;  1HGZ A;  5GTI H;  2ZM8 A;  3UU8 A;  2M6B A;  4F8H A;  2XDJ A;  5FP3 A;  2K24 A;  4H44 D;  4LC1 A;  1SQP E;  4JQ0 D;  2XUE A;  1KF6 A;  3QNU A;  3CVR A;  2DI4 A;  4DBQ A;  1VQ7 P;  3SFD A;  3GF7 A;  3QK6 A;  1L4A D;  2KNC B;  5HXS A;  3NRY A;  4GK5 E;  4EDF A;  3ANW B;  2LSY A;  4IDO A;  4U7J A;  1QSD A;  1W09 A;  3WAJ A;  1NTM G;  3HD7 C;  3FB2 A;  1NU1 K;  3JAD A;  5CMZ A;  2I59 A;  3OW2 O;  1SQB J;  2EHO D;  4A5X A;  4K0U A;  4EYY R;  4CI2 B;  3MHV A;  3MA9 A;  1P84 I;  2OLT A;  4I4T E;  3ETV A;  3N2K E;  5FY7 A;  2V4H A;  1URQ A;  5LYJ E;  1MKM A;  2O3J A;  1MND A;  2XM1 A;  1LTJ B;  4EYY Q;  2ZYA A;  3F57 A;  2LKM A;  4H13 D;  5B5E H;  1NTK D;  3SWF A;  5LGU B;  2XQ3 A;  2JQ9 A;  4PD4 I;  1FMW A;  4K35 A;  2NW8 A;  3PUW F;  2LSK A;  4U31 A;  3VR9 A;  3ABV C;  4YTP C;  1CZQ A;  2IFM A;  5APU A;  4ZMD A;  3AA0 B;  3P32 A;  3GHG A;  3AEC A;  5AQJ B;  4AQY T;  3EHZ A;  1NWQ A;  2ZMA A;  2ZXX A;  3V2Q A;  2FYU G;  2CPT A;  1GL2 B;  4YHH T;  1MIW A;  5CBN A;  2BDE A;  2ZXE B;  3P8C D;  3H1K D;  1AVO A;  2J62 A;  3DTO A;  4WYV A;  4DVD A;  3B5N A;  1HCI A;  4IOI H;  2FFD C;  3C50 A;  2QGS A;  2IC6 A;  2O01 N;  3BK9 A;  3H6P A;  4N78 D;  3MXZ A;  3L74 G;  3BQK A;  2V6X A;  3CML A;  3KYQ A;  1KN7 A;  3AE1 A;  3JC6 D;  4X62 T;  4Q25 A;  2QJP B;  5M1B A;  1T2K C;  2Z4E A;  2NPS C;  3MZW B;  1QGK B;  3PUX F;  4LF8 T;  1NTZ E;  2E75 B;  2OYO A;  4IFM A;  3KZI H;  1RF1 C;  3L75 J;  3R6N A;  1IK7 A;  4YSX A;  1L4A A;  5KAF E;  3TGU J;  3QOF A;  3ZN0 B;  5AVT B;  2AXD S;  3CWZ B;  1GMJ A;  3U78 A;  3Q2Y A;  3LSV A;  4H9R C;  4OX9 T;  4NPP A;  3O8Z A;  2KIN B;  2W66 A;  1PGP A;  3CPW O;  2ZM0 A;  3AE4 A;  5LXT E;  4JI0 T;  2EHO A;  3E08 A;  1KTM A;  2BS4 A;  4TN7 B;  3H1L D;  4D6T D;  2BBH A;  1ZP0 C;  1HBW A;  5EZY E;  2QSI A;  1YJ9 P;  1Y9B A;  3MUD A;  4A98 A;  3T1H T;  4N3Y B;  4AKH A;  4OYK A;  3CC2 P;  2VKH A;  1S2E A;  3FWN A;  1L2P A;  5AQT B;  4ZS2 A;  4JI4 T;  3E7K A;  1K9M Q;  1SUM B;  2A45 G;  3KDS E;  2D2C B;  1M56 D;  4WZX A;  3L36 A;  2XTL A;  3HUS C;  2WSF J;  5AQK B;  5JRC B;  5AQG B;  1PL5 A;  3M0A A;  1D0X A;  2IDB A;  3A0B E;  1R5S A;  3ZMS B;  2KLV A;  2B87 A;  4ASV A;  4LF7 T;  2XQ9 A;  5CA0 E;  3Q2M A;  5ETW A;  2V7L A;  4H63 V;  3OJA B;  2DWG A;  4X1K E;  4FI5 A;  3HI2 A;  4PV1 C;  4JV5 T;  1KC8 Q;  1FBM A;  4P09 A;  2BCC G;  3KVA A;  1RQV A;  1GL2 D;  3H3A A;  1H89 A;  3VP8 A;  1JY2 P;  4HH2 A;  5BVZ A;  2ACX A;  3GN5 B;  4MLK A;  4YJ2 E;  2FUP A;  2G3A A;  4TLF A;  2CHO A;  2PRR A;  2R5B A;  1SQV J;  2BS2 A;  1G1J A;  4IDQ A;  3C98 B;  1KB9 D;  2Z5I A;  3OTO T;  3IF4 A;  3G4S P;  2LOP A;  4Y99 B;  4QH5 A;  2Q3I A;  2X9H A;  3M9H A;  1M1J A;  1NU1 J;  1S4X A;  3AB3 B;  3EUH A;  3SWH A;  4IDZ A;  4HJG H;  4PFO A;  4YXD C;  5CJ5 A;  1IBL T;  5AVQ B;  3L71 J;  1DEB A;  3GW6 A;  3IEE A;  4OGQ B;  3HE4 B;  5JDF A;  3S9O A;  3QB5 A;  4O2A E;  2FXM A;  2ZYD A;  4JYA T;  2ITA A;  1YI2 P;  3NRX A;  3VN0 A;  4GIW A;  4DMW A;  5EK4 A;  5KLI C;  4PK4 A;  5L3G B;  3ZN1 B;  2XND H;  5J0Z A;  3CC7 P;  3J9X 1;  1IK9 A;  2P9B A;  4YXW H;  2POH A;  1XNR T;  2WPS A;  2ZT9 C;  3KBT A;  4DV7 T;  1D1A A;  4GYR A;  3C4Z A;  1RE4 C;  1SQQ E;  3I0O A;  1GZL A;  4IL9 A;  1KYO H;  5DQW A;  5ABH A;  5H6Q B;  2CPS A;  1L0N E;  5H2F E;  1NAY A;  4IL6 X;  1HG2 A;  1GK4 A;  3PUA A;  3OYX A;  2LM9 A;  3UUX B;  2KIK A;  3MKD A;  3C8V A;  3A2A A;  1Q81 Q;  4QHO A;  1AQT A;  3H1J G;  3CMA P;  2AXT E;  1SQQ D;  1Q86 Q;  2Y0D A;  1N73 B;  3RBZ A;  1FZC A;  1SQP K;  3L70 J;  4ZXL A;  3O4X E;  3TLU A;  4EOZ B;  2V6Y B;  1VCT A;  4AKR B;  5FKY A;  1S3J A;  1EDJ A;  3RX6 A;  3AE7 C;  4U74 A;  4KI0 F;  1VCS A;  4C90 A;  4DR6 T;  1YQ3 C;  1EZV G;  1JY3 P;  2QIW A;  2ZAE B;  5L8R J;  1SQX E;  4TV9 E;  1SFC D;  4A56 A;  1EDK A;  2FYN B;  5FYM A;  1VQO P;  4YT0 A;  2WSC J;  2K9A A;  1G2C B;  2Y0C A;  3TNU A;  3NKZ A;  1FJK A;  2N1T D;  4I7Z C;  1Y64 B;  4A7P A;  5FL0 A;  1JY3 O;  3D6Z A;  4U72 A;  2WSE H;  5CCH C;  2G0U A;  1NTM D;  4QH1 A;  5L2L A;  2WBL A;  1IFN A;  2W00 A;  2JWD A;  1BE3 E;  3LK2 B;  1KMI Z;  2P7J A;  3V2P A;  1KQG B;  2W83 C;  4XAX B;  1IZN B;  2KMF A;  1JM0 A;  3FWL A;  1J5W A;  3LW5 J;  2FYU E;  3AE3 C;  1Y01 A;  4UVB B;  5L4E A;  2CWY A;  2LXB A;  1PV3 A;  2MYS A;  5TJH A;  1VRB A;  2E9X A;  3UU3 A;  4TZ4 C;  2VAS A;  1YBK A;  3HKC E;  2VVS A;  3ZMZ B;  1SQP G;  4DZO A;  1ZN5 A;  3TSI A;  3O1I A;  1PZQ A;  3AEA C;  3KV5 A;  3HRN A;  1S72 P;  4PAG A;  2PTF A;  5IHY A;  1N7S C;  2LEH A;  2CA5 A;  2JEE A;  3K3N A;  1IBK T;  2Z5H A;  1Y8A A;  4L75 A;  1J5E T;  1EQ7 A;  2YN6 A;  4YTM A;  2NRG A;  4IRE A;  3V5U A;  2B89 A;  2KZJ A;  3RGU A;  2KLQ A;  1S1C X;  5AVR B;  4N6J A;  2JKV A;  3KHU A;  5APX A;  2C0W A;  3T1Y T;  3VR8 A;  1WYC A;  3L74 D;  2JQQ A;  4PJ0 E;  3O6Q B;  3FZM B;  1NTZ K;  5C8Y E;  3FXD A;  4U7Y A;  2WQY C;  3AE8 A;  3D0T A;  1NU1 D;  3KV9 A;  3L73 G;  1JY2 N;  2OYH C;  2WSS V;  4X64 T;  1HNW T;  4IDN A;  1JTH B;  5CCG D;  4KUM B;  2XAF B;  1J2J B;  4L0R A;  2IC9 A;  4GT1 A;  3EAB A;  1XDO A;  3N9M A;  1SFC A;  2FFD B;  3M91 A;  2O01 J;  2WS3 A;  4J2C A;  2R3C A;  5L3E B;  3MAC A;  3AAI A;  2XQ7 A;  5DJT B;  5TIS H;  2N1T A;  2VL8 A;  3HKE E;  3CWB D;  5FXW A;  5B66 H;  4ASK A;  5LMU T;  2YU1 A;  1HUC A;  3JAF A;  4DV5 T;  3UIA A;  3EFG A;  1OVV A;  1Z56 A;  3AVR A;  1OED A;  2LSI A;  2NPS B;  1X9B A;  1XZY A;  5L3D B;  5HXE A;  1NJI Q;  4JF7 A;  1SHZ C;  4JYC A;  1FAV A;  1DEE G;  5KJ7 D;  3O1J A;  1YD8 G;  1B7T A;  2W6A A;  2ZM6 T;  2CBJ A;  3H1H E;  3LDQ B;  1QEX A;  2N9D A;  4LLH A;  2LKG A;  3ZEF B;  3CD6 P;  5FVL A;  3KV6 A;  4Z8X A;  3LID A;  3CC4 P;  4BJN A;  5LJM A;  1FDO A;  1FIO A;  2PAJ A;  5L4H A;  2SPZ A;  3AXJ B;  2DWK A;  3MK7 C;  2X67 A;  2BCC E;  1SLQ A;  2D2C C;  3HTK B;  2K9J A;  4EV6 A;  4EB6 E;  4U3F G;  1HJB A;  3C4W A;  1NTZ G;  2WSF H;  5JDQ A;  1CI6 B;  1OX3 A;  1L0L K;  1FZA A;  3PJA A;  3HD7 D;  3E1R A;  1WR0 A;  4JEH B;  5BR8 T;  4HWI B;  3L8R A;  1N32 T;  4QX8 B;  4BJM A;  2VQE T;  4AI6 A;  5AQL B;  3TYY A;  4NUU A;  2KWH A;  2PJQ A;  2BCC D;  1KFY A;  3UFE A;  1DD3 A;  2XQ6 A;  2OTL P;  1U4Q A;  3CX5 E;  4DR4 T;  3HUS B;  3RYF E;  2DLR A;  4WY4 C;  3NTN A;  1SE7 A;  4HWF A;  3AEG A;  2CK3 H;  1USE A;  1OZH A;  3KXD A;  1H8A A;  1IBM T;  4DV0 T;  4K0K T;  3PUY F;  3C9I A;  4EEB A;  4M1P A;  1S5L X;  4B3M T;  3CX6 B;  1NTK J;  2V7Q J;  2XAS B;  3K3O A;  4HKA A;  4KP3 C;  3PUG A;  2KP8 A;  4DV4 T;  1LGH B;  3G71 P;  2V6Y A;  5GTI E;  1Q82 Q;  1KOR A;  3MP7 B;  1JY3 N;  3R2P A;  4PV1 B;  5CCG A;  2P58 A;  4GDO A;  1QLE D;  4PD4 D;  1DX7 A;  2KT9 A;  4TNV A;  5F8P A;  2WZH A;  4AQF C;  3U59 A;  3CXH H;  1JUN A;  1RF0 C;  3AEE A;  3CCU P;  2ODU A;  3GMI A;  3H1K J;  2YK0 A;  4JEU B;  4JI3 T;  4ERR A;  4OGQ C;  3LBX A;  2K3W A;  2B76 A;  4ISS A;  2Q3E A;  1OW8 A;  2YDR A;  3E22 E;  5FNV E;  1W9R A;  3JCF A;  5HXC A;  5H6R B;  2ZYG A;  4WBA A;  2V7I A;  1NKN A;  4HWH A;  3ZSS A;  5DJQ C;  2HG5 D;  1L0L G;  5K5G B;  4ZHQ E;  1L0N K;  3SOL A;  5KJ7 A;  1T2K D;  3HKD E;  3TLV A;  1WYB A;  2NPS D;  1D1C A;  3H1J E;  4M3L A;  2ES0 A;  1CHU A;  2MTQ A;  2BBJ A;  2QM8 A;  2CBI A;  1HX1 B;  1AVY A;  1YQ4 C;  3G9R A;  1N36 T;  2X9W A;  3C51 A;  1Y47 A;  3VOP A;  2E5V A;  5B5E E;  2C0S A;  1U7J A;  2WT7 B;  2MKV A;  5BU5 A;  1UGO A;  1QVF O;  1LJ2 A;  1KIL C;  2L5G B;  1VQM P;  3H1J D;  2IYP A;  3HD7 A;  2I1J A;  1EZV E;  1X8Y A;  5KDM C;  2FY8 A;  5KKZ C;  2XU6 A;  2J58 A;  1MNE A;  1SQX K;  2LR2 A;  1N73 C;  2L8K A;  3H1L J;  3CQC B;  2D0T A;  4D6T J;  5FMN A;  3CI9 A;  3Q9D A;  3HE5 A;  3WUV A;  2IFN A;  1EZV D;  3VMA A;  4IE6 A;  4B86 A;  1X79 A;  1LNQ A;  4GOF A;  2UUA T;  3AE6 A;  2OAR A;  3CQG B;  2J5U A;  2W6J H;  2D5U A;  4ANJ A;  3ABV A;  3GF3 A;  1CSB A;  2LE8 A;  2FYN C;  2WSC H;  1BGY E;  4IE0 A;  3OVU A;  4I55 E;  4IE5 A;  1T8B A;  4WBN E;  5LGN B;  2JR8 A;  2UXB T;  2A45 I;  2FYU K;  4AXP A;  1KNP A;  1JTH A;  1LTT C;  2YMY A;  2JDI H;  4DR3 T;  1UIX A;  2A72 A;  1LWU C;  4L76 A;  4UB6 H;  3A7M A;  4ZI3 C;  1M62 A;  2E5T A;  3MJX A;  4I7Z B;  1E2A A;  4XA4 A;  3PU8 A;  3AE9 A;  1KNZ A;  4JYB A;  2V7K A;  5APQ A;  1JCD A;  1T7S A;  2A9U A;  3UUM A;  3UQ7 A;  5CHX A;  1MMG A;  4HFV A;  3LW5 H;  2LHR A;  4YTN A;  3N9Q A;  1SQP D;  5LHH B;  5AW4 B;  1WFD A;  2KS1 A;  1N2D C;  4XBF B;  1SQX G;  2KSJ A;  3N4X A;  1EDL A;  1VF5 C;  5AW1 B;  3PTR B;  3I55 P;  4YLH A;  2UUB T;  5IWA T;  3RLF F;  1RF1 A;  2FXP A;  1X22 A;  2Q9Q D;  3D70 A;  3TLW A;  3L73 E;  2Y48 B;  5J2T E;  1H7C A;  4GIF A;  3TK1 A;  3EAM A;  5ABG A;  1FEW A;  3ESL A;  3H32 A;  4ILA A;  3CX5 I;  2H89 A;  3PP5 A;  3AEB C;  3V5S A;  2JMH A;  1BE3 G;  3PUQ A;  1JB0 J;  2VVN A;  4HFE A;  1N7S B;  2XPK A;  2AEM A;  5BMV E;  1NO4 A;  2ZT9 D;  4AIU A;  2WZ7 A;  1YHQ P;  2JRK A;  1LTI C;  3MTU E;  2DW3 A;  2NP9 A;  2QJY C;  4WBO A;  1XDP A;  3BAS A;  1FZG A;  3WU2 H;  4TWH A;  3UQ4 A;  3UTK A;  2X68 A;  3OAK A;  3EVY A;  4LF9 T;  2FBW C;  1G8X A;  2PP6 A;  2X66 A;  2L3L A;  1YJN P;  2M0B A;  1T8Z A;  4HWC A;  1W0A A;  2IBZ E;  5JR9 B;  3EDV A;  3M9Q A;  3Q5X A;  1IAP A;  2JWA A;  2BG9 B;  2O01 H;  3D6Y A;  2PFV A;  5ADX L;  1FE6 A;  4HKZ H;  2YNY A;  4AUW A;  3LG7 A;  2I0M A;  3UU4 A;  2OYH B;  1SQQ J;  3A8Y C;  3RL0 B;  1YKH B;  1J1D C;  2J47 A;  2NWB A;  2E76 D;  1L0N J;  4L5G A;  3A7O A;  2W4X A;  3ZT7 A;  2E5L T;  1XWM A;  4U3F E;  3DJB A;  4WW0 A;  4IL4 A;  2KZI A;  2YKQ A;  3NZQ A;  1QL2 A;  2VL0 A;  3V6I A;  3SFD C;  2YXQ B;  1BSH A;  5KTB A;  4EOT A;  2HPC A;  3C64 A;  5AQV B;  4C46 A;  4IE4 A;  5KX5 E;  4U3F D;  1RE3 A;  1NTZ D;  5HWY A;  3ZDM A;  2GUV A;  5CCH D;  1QL1 A;  3KDP B;  1EZV I;  1BDC A;  1NTM J;  2CWO A;  3D71 A;  3TF5 A;  2Q9Q A;  4YXD A;  3BCC G;  4ZZC A;  1T98 A;  2ZLY A;  1KNR A;  1RQU A;  1VQL P;  4C7N A;  1YTZ T;  3K3Q C;  5JRE A;  3JSV C;  4TT3 H;  2KSE A;  4PNI A;  5HEG A;  3V4W A;  3FZH B;  4NPF X;  1DH3 A;  3A0H H;  2V26 A;  2NR4 A;  1Q90 D;  5LHI B;  4K3A A;  1VQN P;  3K5B A;  2WAU A;  3H1H G;  4O4I E;  3N2O A;  4DUY T;  2V7Q H;  1ZOY A;  2QE7 H;  2R44 A;  1H0T A;  3PDY A;  3UU5 A;  1RHZ B;  1IJD B;  1RE4 A;  4DO0 A;  3PJA J;  4UB8 H;  2HOD B;  4O8S A;  2BG9 E;  5E0O A;  3CCS P;  2R5D A;  3WUT A;  1W0B A;  2BVL A;  3BVH A;  1I94 T;  2V5C A;  4WY4 B;  1L0L E;  4HFD A;  4BRY A;  3B5N C;  3PUV F;  3Q1M A;  4PW8 A;  1NHL A;  3RRW A;  1BR2 A;  2UXN B;  4HGA A;  3V2R A;  3CLQ A;  5AQI B;  2H3R A;  5ABF B;  5L47 A;  3AE1 C;  1BCC G;  2Q9I A;  2LSG A;  5AQR B;  3L74 J;  4ZEY A;  1L0L D;  4KHZ F;  1HWT C;  5L3C B;  3QH9 A;  4H0L B;  4RKU J;  1LT9 A;  2OYI A;  1WLX A;  3AE7 A;  4GOU A;  4LFA T;  1SQB E;  1HNX T;  1FU1 A;  1S9K E;  1VQ4 P;  2QVA A;  3KFW X;  4LMK A;  5GTH E;  1PP9 G;  1N7L A;  3RK3 C;  3NZP A;  1KQL A;  4HE8 A;  4DV2 T;  4UV9 B;  3UU6 A;  4NPD A;  3CCR P;  5FXZ A;  5L3B B;  3USS A;  2UXD T;  2E75 D;  5KAI H;  5AW5 B;  2YO3 A;  1CUN A;  1BDD A;  1KD1 Q;  5IYZ E;  5KXJ A;  1ZEE A;  2KNC A;  4PK6 A;  3CWB J;  3SFE A;  2UXX B;  3K8P C;  3AE4 C;  2KND A;  5CCH A;  2EHO C;  2M5A B;  1L0V A;  3ANW A;  1IJ5 A;  1UII A;  4O4H E;  1EZ3 A;  3F5H A;  3JCU E;  3PU3 A;  3ZMU B;  2XQA A;  1OW6 A;  4O9B A;  3MUD C;  3N9P A;  2WPR A;  5JDM A;  4QWN B;  4I43 B;  4TUY E;  3KV4 A;  3ZYK A;  2B1E A;  4H13 C;  3RK2 B;  2LXC B;  3L72 G;  2C9N Y;  1WR6 A;  4Z91 A;  1KIL B;  2XQ8 A;  2PGD A;  2WY2 A;  1LTJ A;  1NH4 A;  2JP3 A;  4IL6 H;  4GKG A;  3ZPO A;  2IBZ I;  2D2C D;  1DIP A;  2E2A A;  5KKZ B;  3FX0 A;  3FXE B;  1IFP A;  3L4F A;  2YMK A;  2L91 A;  4H9O C;  1U7M A;  2K1A A;  1UUS A;  2X9Y A;  1L0N D;  2D9D A;  4HYT B;  4YY3 T;  3HA4 A;  2N9B A;  4ILB A;  1G1I A;  2YKS A;  3FZL B;  5HYA A;  3II6 A;  1GL2 A;  2VK9 A;  5AQF B;  2HN2 A;  1FOS E;  2BCC J;  2YKP A;  3SSU A;  3L75 E;  5TIS E;  4WY4 D;  4DR5 T;  3ZJ2 A;  5B66 E;  3H25 A;  3TGU E;  1WCR A;  3T97 B;  3AE5 A;  2A06 E;  2QEX P;  3TDK A;  3RYI E;  5KLV K;  2WQY A;  3N9O A;  1VQK P;  2YEV C;  1JOC A;  2OTK E;  4I50 E;  5APT A;  4UF0 B;  1LP1 B;  2FJB A;  1IFM A;  5HAX A;  1SQX D;  4TWD A;  1HF9 A;  1KB9 H;  4I6M C;  3F31 A;  4H9Q C;  3ETU A;  1LWU B;  2XQY A;  2ZFC A;  3FBZ A;  4R4M A;  2WMM A;  3L37 A;  3UUN A;  5LBQ B;  2CXL A;  4O2B E;  5AQQ B;  1AJ3 A;  3RKG A;  1BGY G;  1W2B O;  3ZCJ A;  4QXC B;  3UUL A;  2VKO A;  4CXY A;  2YDS A;  4OGQ D;  1IJ6 A;  2AE9 A;  3E0Z A;  4R4L A;  3Q5P A;  3ONJ A;  5TAO A;  4LF5 T;  1I6Z A;  1GQE A;  5EK3 A;  3H3M A;  3RH3 A;  2OV9 A;  4HB1 A;  3RIU C;  1BE3 D;  2I1K A;  2H88 C;  2IZ1 A;  1VF5 B;  1PFI A;  4X5T A;  1WT6 A;  3K1S A;  1KIL E;  4UVA B;  4AIS A;  3NFQ A;  5JDH A;  4ZKP A;  2RP4 A;  2FYU D;  3ZMT B;  3ONL C;  1BR4 A;  2VUR A;  3I1A A;  3H37 A;  4QKN A;  1PGJ A;  1HR0 T;  4UXN B;  4GKK T;  2RKL A;  1EXI A;  2MBG A;  4B6X A;  4TWF A;  3Q5S A;  4LML A;  5CJ0 A;  4PFP A;  3ONX A;  4TNW A;  4CI1 B;  1K04 A;  1SQV E;  1M90 Q;  5JR9 C;  2A2F X;  2E74 B;  1FZC C;  1EXJ A;  4G63 A;  5JRC A;  5APW A;  2BG9 C;  5KLV G;  3PUR A;  2QRX A;  3H1J J;  4JBW F;  1ZKE A;  2GA1 A;  4KHX A;  5AVW B;  2DHR A;  2QJY B;  2FXO A;  1M1K Q;  2WMO A;  2CPB A;  3VKG A;  2CE7 A;  4KT0 J;  3RL0 C;  1TU3 F;  3VTP C;  4HN9 A;  2CRB A;  2YU2 A;  3OJA A;  2W8Z A;  3CXH E;  2KI7 B;  1FZE A;  2K3R A;  3Q5W A;  4I0U A;  2FJD A;  2UXC T;  1NTK G;  2Y9Y A;  3P4R A;  3GN5 A;  3BCC E;  1BSN A;  3OBV E;  3AED C;  2IX7 C;  2FKW B;  5FVK A;  1R5L A;  1ZME C;  2NTY A;  2OQQ A;  2W0G A;  2LRK A;  4UV8 B;  2YDQ A;  1J1D B;  3FBL A;  2WP9 A;  2XAG B;  4U2Z A;  2BZB A;  4CXW A;  3E1I A;  1W2E A;  2I8D A;  1QUU A;  3B71 A;  3VHL A;  1EDI A;  2IBZ G;  1WMK A;  4C7R A;  3AE2 A;  3AA6 B;  1GTW A;  2AEJ A;  5LNK A;  1ZW0 A;  3RQW A;  1JO5 A;  1ZHC A;  3PHL A;  5AQU B;  1HX8 A;  3HE4 A;  5AVV B;  4CN1 A;  2Q7C A;  1U5P A;  2J1D G;  3VP9 A;  4H9N C;  4W7Z A;  3CIR A;  2D2S A;  1OIP A;  3OYZ A;  2E9X C;  1S35 A;  1X0T A;  3F89 A;  3N2G E;  3TKL B;  2KYV A;  2GK9 A;  1X9V A;  1KK7 A;  3H1H D;  3VRA A;  1JMB A;  1SQP J;  2MPK A;  1OVR A;  5LOV E;  3VMY A;  1V9D A;  5HWX A;  3V2N A;  2RA1 A;  1URQ B;  1YQ4 A;  2A3D A;  2XKM A;  5HEJ A;  1BCC E;  4OYJ A;  2H7V C;  3ZST A;  3CCV P;  4KX6 A;  2QM7 A;  3WMM 0;  3V5B A;  5FXV A;  2JJL A;  2YXR B;  1JCC A;  4JI6 T;  1IC2 A;  2X51 A;  3RGL A;  1SQB K;  4DJG A;  3RIA A;  1PP9 E;  3GHG B;  5JDL A;  1OFC X;  3IN6 A;  3N7N A;  1AFO A;  1T3U A;  2N2N A;  3FGA D;  4UIG A;  4D6T G;  1HNZ T;  1BCC D;  2WDQ A;  3AE8 C;  3I9W A;  5FL1 A;  1N73 A;  1FJG T;  1PPJ E;  1S5L H;  1OVU A;  1NWM X;  2VQF T;  3CX5 D;  3L73 J;  1AJY A;  4H0L C;  2YO2 A;  3B5N B;  5A1L A;  3RPU A;  4C91 A;  2Q6Q A;  2VRS A;  3FHN A;  4UB6 E;  1USD A;  3AEF A;  4PJL A;  1MMN A;  2Y6X A;  4ADZ A;  3L39 A;  3W67 A;  4GOE A;  4HFB A;  2N1T C;  3I56 P;  3H1I G;  5AW2 B;  2B9B A;  2Z6E A;  1ZLL A;  1OW7 A;  2YOE A;  3M65 A;  1MFZ A;  3GLM A;  1G2C A;  1YIJ P;  5IUX A;  1MV8 A;  2BAS A;  2K37 A;  4RES B;  4H44 B;  3L72 E;  3ZC0 A;  3G6E P;  3VU7 H;  3P50 A;  4QH4 A;  2H8P D;  3RL0 g;  3R84 B;  3RK3 B;  3C1L A;  2WB5 A;  4CXX A;  1L4A B;  2H43 A;  1A02 F;  1MIY A;  3ZT6 A;  3JC2 2;  1NKZ B;  3L72 D;  1N34 T;  4HEA A;  5ABE A;  2CXD A;  5HCJ A;  2P10 A;  3RK2 C;  1N86 A;  5LG3 A;  4E7S A;  4NXN T;  2EHO B;  1SQB G;  3CKD A;  1MFT A;  2W90 A;  2VKJ A;  3CCM P;  4H9P C;  4DR2 T;  4U3F J;  3KQG A;  4EZ4 A;  1NTZ J;  1R8E A;  2W61 A;  4O4J E;  2IZ0 A;  3WU2 E;  4H13 B;  3M0D C;  2BVM A;  1D1B A;  5J1G A;  4DV3 T;  5CGM A;  3GMA A;  2IPP A;  3AEG C;  4DR1 T;  3WUU A;  3CXH I;  4KJM A;  3EFF K;  3FZK B;  2B87 B;  2XNX A;  2CLY B;  1OXZ A;  1JNM A;  1PGO A;  2DNX A;  2E42 A;  5AVZ B;  2J59 M;  3LJC A;  2KLU A;  4ILC A;  3ZC1 A;  4YTP A;  5CA1 E;  1UX5 A;  3RBX A;  2OTJ P;  2BEZ F;  1E7P A;  3B5M A;  3O6Q A;  2O1J A;  4LGD E;  3O1H A;  2NW9 A;  1DU2 A;  3EWK A;  1GU5 A;  3I0Q A;  1P84 H;  5KMG P;  4ZS3 A;  5AQO B;  2HR3 A;  2X0H A;  4PK5 A;  3J7Y q;  1NOH A;  3O9X A;  4BWN A;  4PV1 D;  3KZI E;  3QUJ A;  4PJN A;  4X1Y E;  3AEE C;  2H7H A;  3GWH A;  2XAQ B;  1BGY D;  1KZU B;  4PD4 H;  2FFD A;  1G73 A;  3SWY A;  1DD4 A;  1JNR A;  4DT0 A;  2JJ9 A;  2ZJS E;  4XE5 B;  3RK3 E;  4B3S T;  1M1J B;  5E79 H;  3P7I A;  5AQS B;  5KJ7 C;  3P4W A;  4Z90 A;  3GG2 A;  5JQG E;  3RC8 A;  3EI0 A;  3TLT A;  1CW5 A;  2NPS A;  4ZNC A;  1L0L J;  1GK6 A;  2MAW A;  3L75 G;  3Q5R A;  3W15 B;  2JO1 A;  1MMD A;  1W5C E;  4WB4 A;  1T72 A;  2D0U A;  3TGU G;  2A06 G;  3RK3 D;  1SQV K;  5KLV E;  4LMJ A;  2BKN A;  3IA3 A;  3B57 A;  4EI2 A;  3L35 A;  5AW6 B;  1UK5 A;  2LSJ A;  2WSE J;  5AW7 B;  4KMC A;  3I9Y A;  3A0H E;  2C9L Y;  5FXX A;  2ZVN B;  2W63 A;  3KIN B;  4HFI A;  4UR9 A;  1M8O B;  5JH7 E;  1JMM A;  5EFW B;  3UT5 E;  2L9Q A;  3AXJ A;  2KXP B;  1QX8 A;  3HTK A;  1NTK E;  5KLV D;  2C0X A;  2WMN A;  1CI6 A;  2E74 C;  1ZP0 A;  5DJU B;  3CCJ P;  3L3P A;  2XAH B;  2WVR A;  4UB8 E;  3L73 D;  3CX8 B;  3ZYM A;  2JMK A;  3BRT B;  2KZ7 B;  4ILU A;  1J1E C;  5CBO A;  3AAE B;  2M6I A;  2BEQ D;  3AE6 C;  1US7 B;  2KB7 P;  4L74 A;  3P8C E;  4EIJ A;  3T8O A;  3FZF B;  3H1K E;  3B8E B;  3HUS A;  1FZC B;  5APY A;  3HR0 A;  2IAK A;  1Q2N A;  2V8S V;  2R6G F;  2HPJ A;  3MD0 A;  3RHW A;  2WIT A;  4AQR D;  2YIN A;  5LMN T;  4O4L E;  3PH0 A;  2HN1 A;  3IHR A;  2HPL A;  4TX5 A;  4N78 E;  3WI3 A;  5AQH B;  2RPA A;  2XSA A;  2IBZ D;  2LHN A;  2KK7 A;  4JI8 T;  2X9X A;  1YW0 A;  1GDT A;  4Z1M H;  1SQV G;  4MFR A;  4YFS A;  2IW5 B;  3TNU B;  5CB4 E;  3KVB A;  5KAI E;  2K48 A;  3F2E A;  1H88 A;  3AE9 C;  5JDG A;  2NW7 A;  1NGM B;  3Q5D A;  4LF6 T;  2UWJ E;  2LRL A;  4PJM A;  2H7O A;  3RQU A;  4MN4 C;  1YJW P;  3L09 A;  2CXF A;  2RMZ A;  1NU1 G;  2W27 A;  5F3J A;  4MAL A;  2N1G A;  5FY0 A;  1UCU A;  2PFX A;  2X0L B;  5LGT B;  1KFM A; 
#chains in the Genus database with same CATH homology
 4GOE A;  4K3A A;  1DEE G;  2KI7 B;  2K3R A;  4WYV A;  1Y47 A;  4WWI A;  4IOI H;  3FXE A;  1FC2 C;  1NVO A;  2R44 A;  1H0T A;  4ZNC A;  1U7J A;  2JWD A;  3PJA J;  5C39 A;  3S1K A;  4CPG A;  3RIU A;  2SPZ A;  3AXJ B;  4HJG H;  2I8D A;  4BXL A;  1JM0 A;  2LR2 A;  3MZW B;  1EDI A;  3PJA A;  3QB5 A;  2LXB A;  3QB5 K;  2M0B A;  2OTK E;  5EFW B;  1LP1 B;  1ZW0 A;  2KUB A;  3AXJ A;  3QWO C;  4GOD A;  4GOF A;  1EC5 A;  1LT1 A;  4HKZ H;  1MFT A;  2WMM A;  5DJU B;  1LP1 A;  2QVA A;  1X0T A;  4NPD A;  2Q1K A;  5CBO A;  2B89 A;  2KZJ A;  3RGU A;  1JMB A;  2KZI A;  1OVR A;  4HB1 A;  3RIU C;  1BDD A;  1Q2N A;  2KIK A;  2P58 A;  3MHV A;  4KJM A;  2M5A B;  3PH0 A;  2B87 B;  3FXD A;  2KS1 B;  3ZDM A;  1SS1 A;  1J1J A;  2RKL A;  4JBZ A;  4EYY Q;  2M5A A;  1S3J A;  2B87 A;  1BDC A;  4ASV A;  1EDJ A;  1ZXG A;  2HR3 A;  4NPE A;  2LXC B;  4K35 A;  1OVU A;  5DJT B;  2ZAE B;  1EDL A;  4ZMD A;  2QRX A;  2UWJ E;  5K5G B;  2B88 A;  4MN4 C;  1EDK A;  1KEY A;  1OVV A;  1H0T B;  4NPF X;  4ASW A;  5CBN A;  1U7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...