2QRXA

Crystal structure of drosophila melanogaster translin protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
NFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM27569p
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qrxA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qrxA01
5CBNA 2I8DA 3RGUA 3QB5K 2KI7B 5K5GB 2ZAEB 2KIKA 3PJAJ 3RIUA 3FXDA 5DJTB 4WYVA 2B87B 2KZIA 2P58A 1LP1B 4ASWA 2WMMA 1X0TA 4HKZH 1BDDA 2KS1B 1OVVA 4K3AA 4EYYQ 4K35A 4BXLA 2HR3A 4KJMA 5DJUB 5C39A 2KUBA 1H0TA 2K3RA 1H0TB 3QWOC 1S3JA 1EC5A 1ZXGA 2JWDA 3AXJA 2RKLA 2LXBA 3PH0A 3AXJB 2KZJA 4NPEA 4HJGH 1OVUA 3RIUC 2LXCB 1Q2NA 4GOFA 1EDKA 1SS1A 3MZWB 3FXEA 2UWJE 4IOIH 4ZMDA 1JMBA 1EDLA 4ASVA 1KEYA 1DEEG 2QRXA 4GOEA 4ZNCA 1BDCA 2M0BA 4NPDA 3QB5A 1U7JA 3MHVA 1JM0A 4NPFX 1OVRA 4HB1A 5CBOA 1U7MA 2QVAA 4JBZA 1J1JA 1LT1A 2LR2A 1MFTA 1EDJA 1FC2C 4WWIA 5EFWB 3ZDMA 1EDIA 2SPZA 2B88A 4GODA 3PJAA 1NVOA 2B87A 2M5AA 1ZW0A 1LP1A 2M5AB 2Q1KA 4CPGA 3S1KA 2OTKE 4MN4C 2R44A 1Y47A 2B89A
chains in the Genus database with same CATH superfamily
5A1LA 2I8DA 1WYCA 2WSSV 2WTYA 3HD7D 2V7IA 2YXQB 1FE6A 2AXCA 5KAFE 3AVRA 3I9WA 4EV6A 3SFEA 1N73C 1KB9E 2YMKA 1YQ3C 5J1GA 2A06D 2FXMA 3VTPC 3CCUP 3LIEA 2BDEA 4Y99B 3D6ZA 4A7PA 4YPCA 3ZMTB 3RK2B 1SFCB 4QXCB 3IHRA 1OVVA 4XBFB 2OYHB 2E75B 4YHJA 3F57A 3GHGC 2LKHA 5B66H 3RYCE 3CCEP 4OYJA 2QYWA 4EYUA 3GN5B 1L0LG 5C2TA 5L8RJ 3FHNA 2KNCB 5FKYA 2K88A 3A5XA 1M1JB 4YSZA 3V2PA 3MKDA 3RIUC 4LF6T 3PV0F 1HWTC 3H1KD 4GYSA 2VURA 4EB6E 2WSCJ 2LKMA 3HE5A 4H44D 1D0XA 4IE6A 2EHOA 5LNKA 2QG4A 1P84D 1HG5A 2HPCB 5DJQC 4PJLA 1LTBC 1MMDA 3CLQA 1Q86Q 2L91A 1OW8A 4R4LA 1U7JA 1ZMEC 2XV5A 1VQ6P 4DMWA 4J2CA 4B86A 5LMNT 5L4HA 5KTBA 3AE9C 4L0RA 4PK6A 2K5BB 1I6ZA 4H63V 3E22E 2N1TB 2FJAA 1GL2A 4JV5T 2NR4A 1NKZB 2WMNA 2HH7A 5KXJA 2MJZA 2QM8A 1ZV4X 2CBJA 2EHOD 1QLED 1PV3A 1RF1A 4JYAT 4RJTA 4DUZT 4Z8XA 1KQGB 3L74E 3TK1A 3E08A 5AW1B 5KAIE 3G4SP 5ABHA 3AA0B 2IFMA 3R4YA 4U7JA 1VQ9P 1L0LJ 3TYYA 2NRGA 1WYBA 2UXCT 1YI2P 4H13C 3V6IA 2F4VT 3VKGA 2YO3A 1GL2D 2IYOA 2OTJP 2WMOA 3AE6A 4UR9A 5AQIB 2C0XA 2LSGA 3AE8C 1ZN5A 1BGYG 4LC1A 3FZHB 4P0BA 3Q5EA 2YU2A 2RPAA 3VHLA 3ZMUB 1AJ3A 4ILCA 3HR0A 1PFIA 3PUGA 4UF0B 3PUXF 3C4ZA 2IZ1A 2H7HA 2BCCE 1SQBK 4FI5A 5KAIH 4XAXB 4EYYQ 2G0UA 4K35A 3VU7H 4H0LC 3EDUA 4JUYA 3N9LA 1NAYA 1NHLA 3OAKA 3L75D 3ABVC 2LSKA 2NTYA 3IF8B 1UCUA 4N78E 3SWFA 3P7IA 1NTKD 2W83C 3TNUB 5APTA 1FDMA 5LGTB 2Q9QB 3QK6A 2ZMAA 1WT6A 1FZCA 1T3JA 4EIJA 3IN6A 2E5YA 1L4AB 2L3LA 1YQ4C 2I0MA 4BA9A 1OXZA 2YOEA 3WAKA 3L37A 4OGQC 2IBZI 5TISE 3ZC1A 3ZJ1A 1G2CA 4JPZB 2V5DA 3RK2C 3KZIE 4LFAT 2OGUA 2LHNA 3GG2A 1PGJA 1N7SC 3B5NB 5APVA 1PPJD 4TWHA 2VL8A 4DNDA 4ZHQE 3K3NA 3KV6A 2CLYB 1S35A 1SQVD 1K8AQ 2DLRA 4LF8T 5JRCB 3ZN1B 1KYOI 4CN6A 1S9KE 2KSJA 1S5LH 4U3CA 4XZCA 4PV1C 1BGYJ 5CJ0A 2VQET 3ESLA 3AE4A 2WPVB 1M1JC 1FC2C 2QJYC 1WR0A 3HD7B 4C7NB 1Y01A 4GODA 4ZOLE 2R3CA 1HJ0A 5TISH 2XAQB 3ONLC 4F8HA 2C5KT 3T97A 5AW3B 2K9AA 3IFMA 1MFZA 4DUYT 3FWNA 2KOGA 3WMM0 3UQ7A 2FYUK 2X51A 4X66T 1L2PA 2YKPA 3L74J 2WVRA 2QJKB 1A02J 2VVSA 4JI6T 2XQ7A 1LRZA 1N7LA 4MLKA 1E1HB 4U7IA 3OJAB 3C51A 2JQQA 1KB9I 3G71P 2Y0EA 2JR8A 4PD4D 5AQUB 4CXYA 3NBXX 1VF5D 1SQQK 5JDQA 2FXOA 2RA1A 1VL2A 4TV8E 3IBPA 2E8IA 3TGUG 3I1AA 1QL1A 5AW5B 1ZRTD 2A9UA 2AEMA 1RF0A 3HI2A 3WUUA 3UFEA 4EOZB 1X9BA 2QA4P 3AEBC 4H44B 3BVHA 2WAUA 1T2KC 4IE4A 1EZVE 2VQFT 3CC7P 4AKRB 1HJBA 3AEGA 2SPCA 2X9YA 2BCCJ 3LG7A 2ZM0A 2KYVA 5J0ZA 2BG9E 3BATA 3H1KG 1GDTA 4H9RC 1XMOT 5C8YE 3AE3A 3F2EA 2B76A 1B7TA 3Q1MA 2DHRA 2M8RA 1MUUA 4HJGH 4ZKPA 5HXSA 1AV1A 2BG9B 4PFPA 2JJ9A 5CCHA 3HE5B 1BR0A 1FZEA 2D2CB 3MZWB 1S1CX 2EHOB 3FXEA 2JKVA 4ZMDA 1EDLA 3RK3C 2IHR1 3SFDA 5J2UE 3AE9A 1IO4A 1HR0T 4Z90A 4B3TT 4NPDA 2CCQA 3N9NA 4KBMB 1KNRA 3ZJ2A 3L72D 3B5MA 2CMRA 2IW5B 2QGSA 3MP7B 3U1CA 3H6PA 3FZMB 1OEDC 2BKNA 2WPSA 1GD2E 2V6YB 4GK5E 2WDQA 2ZT9B 4UIGA 2NP9A 4AXPA 1VPCA 3LK3B 2FYZA 3RL0D 3E7KA 1GL2B 2NOXA 2X9WA 2X9HA 3RYHE 2HPLA 1LTJA 5GTHH 3JSVC 2A72A 4AKGA 3L73D 1LT9B 5CCHD 3ANWA 1NVOA 1VQKP 1OX3A 1ZW0A 2CE7A 2MAWA 2BVMA 2WWUA 2XUEA 3NWIA 3AA6B 3CC4P 1USEA 4LF9T 1BR4A 3VMAA 3CMAP 3J7Yq 4TZ4C 3B5NC 1KK7A 2CLYC 3L36A 1TU3F 4X20E 5BU5A 3I56P 1JY3P 2HG5D 4DR5T 5CBNA 1FBMA 1Q81Q 2ZVOB 1YBKA 2Q6QA 1RE3A 3PUWF 1XDOA 2X9XA 4GKGA 3HUSC 1HNXT 3AE5C 5DJTB 1SQXG 4AKHA 3HD7C 3C4XA 2P58A 3L71G 1AQTA 3Q2YA 5KLVD 5CA0E 5FY1A 4H13D 1VRBA 5FMNA 1QSDA 2NW9A 1BSNA 3G6EP 2FBWC 1AA0A 4ZKUA 4E7ZA 5LHIB 3L8RA 1NO4A 5AVZB 3JADA 1VQLP 1NGMB 1XDPA 3N9OA 3JAFA 1VQNP 1DU2A 1NH4A 3A7OA 2G8YA 1WCRA 5L3BB 4LMKA 3CCSP 2J4GA 3C8VA 4U31A 4B6XA 3VR8A 2E76D 4I1LA 1D1BA 3H1LE 4CQIA 1FZCB 4PW8A 5LHGB 4CI3B 4GDOA 1L0NK 3NZPA 5DQWA 3SFEC 3LBXB 3MXZA 3CX8B 1CSBA 2W63A 1NTKK 1N7SA 1AJYA 4UVAB 4IE0A 2ES0A 2XAFB 1SQPE 2CPSA 1G2CB 1KILE 3Q9DA 5LJNA 1VQPP 5GONE 2NW7A 1FJGT 5J2TE 2ZYAA 1KEYA 5JR9C 2P7JA 3R6NA 2BS3A 3P32A 4BWNA 4QH5A 3O1IA 3S9OA 4U72A 3AB3B 3MACA 4AISA 4ADZA 4JI1T 4HB1A 4U3FG 3BCCG 2JDIH 5AQRB 3R84B 1L0LD 1JY2P 1KILB 3CK6A 2K1AA 4DR1T 3HKBE 4UXNB 3CWBE 1NTMG 2XQYA 1US7B 5LB7B 1N7SD 1SQXJ 3E1IA 3PUYF 5EFWB 4EAHA 1SQVK 3KINB 2E9XB 4CI1B 1FOSE 4YSYA 4U74A 5JDNA 3PJAA 3VP8A 4U2YA 1T72A 4TT3H 1W9RA 4UV8B 2V26A 1IBLT 3GMIA 2WWVA 3OA7A 2EHOC 3KVAA 5JH7E 3T97B 4GK0E 1WR6A 4O4IE 3CMLA 2WT7A 3W15B 2OARA 3L70G 3H1JG 3D0TA 2ZFCA 1XTCC 2VWAA 3O4XE 4IHJE 4LLHA 1N73B 3CMEP 5CA1E 3U59A 3LSVA 1P84I 3PUAA 3FXDA 4PJ0E 2D5UA 1S2EA 3HTKA 1WFDA 2L8KA 2GK9A 3FB2A 3AEBA 5FXWA 1R5SA 2DWGA 1RF1C 2XQ9A 2Z4EA 3P4RA 3M0AA 2DW3A 2XDJA 5ABFB 2BEQD 1M62A 2BBJA 3MUDA 5CFBA 2CXLA 4BXLA 3T1HT 3RHWA 5L4EA 4H9OC 2X0LB 1LGHB 4YXDA 4DT0A 4U3FJ 1ZEEA 3BCCJ 2P9BA 3K1SA 2HYNA 3AE6C 3H25A 4QKNA 4KHPT 3DTOA 3P4WA 2QJPC 3RQWA 2N9DA 5KLIB 3D70A 2J1DG 2Y9ZA 2V7KA 4QXBB 2WBLA 2I1JA 1BGYD 1NKNA 1M90Q 1FZBA 3TSIA 3VMYA 2QSIA 2NPSC 5LMUT 3H1LJ 4O8SA 3GF7A 4DR6T 2XHEB 3AE7A 2JMKA 4AI6A 1S72P 5FY7A 4ERRA 5LCYA 3LFMA 4D6TE 1MNEA 3NTNA 2PG8A 3AE2A 3CWZB 4HH2A 2XAJB 4PNIA 2A45I 5AFUL 2VKOA 1PP9E 3RK3D 1FZCC 1DIPA 2BZBA 1HX1B 2LE8A 3C1LA 4RKUJ 1JTHA 1NWMX 2WZ7A 2IBZE 1LWUA 3I0QA 3ANWB 5FVLA 3EQ2A 4DV4T 2B87A 2LRLA 3G06A 4DR4T 5JDLA 2I1KA 3CWBJ 2IC9A 2CM0A 5IHYA 4H13B 4C91A 5LGUB 2WWWA 4MALA 5JQGE 5JREA 3R2PA 2ZXEB 1FZFA 2R44A 3Q5XA 1FU1A 1UX4A 3N2GE 2YKQA 3PE0A 2GUSA 3NMDA 3H3AA 4EEBA 3VN0A 2UUAT 1FZAA 4NIQA 4ZS3A 3W67A 1AVYA 1T6AA 1S94A 2E5VA 4EZ4A 2E74C 1M8OB 2ZAEB 5L3FB 2FBWA 3H1IE 2WZHA 1CI6A 4X62T 2E42A 2E76B 2LEHA 1N34T 2H8PD 4ANJA 1HG2A 1BSHA 1LP1B 3PU3A 3VOPA 4ISTA 4WNKA 3ZT6A 2KS1A 4H0LB 1IJ5A 1NTZG 4YFSA 1VF5C 4N78D 4N3YB 1W5CE 2M3EA 1DH3A 1KYOH 2MTQA 2X68A 5KLVK 2IDOB 3CX7B 4WBOA 4JYCA 1Y9BA 3EWKA 1KQSO 3QOFA 3FBZA 2M6IA 1S3JA 3TLSA 2H89A 2YDQA 4ILUA 1HS7A 1OIPA 2JWDA 3CC2P 3AXJA 2KMFA 4IL4A 2LXBA 4JQ0D 4OGQB 3T1YT 2KZJA 1FOSF 3NVOA 1R8EA 2WDRA 5AVQB 1I94T 3Q5WA 3KBUA 1AVOA 3CCJP 5JR9A 3KHUA 4AUWA 1N7SB 2QE7H 1E7PA 5LOVE 1NU1K 5KX5E 1URQC 2JPFA 3SWKA 1RF0C 2CPBA 4JEHB 4OFZA 3O9XA 3TGUD 2C5IT 5ADXL 1GTWA 1T8ZA 4PV1B 4PD4I 5KAFH 1QL2A 2I6HA 2VB6A 3AEGC 4IL6X 1KB9H 2X67A 2QJYB 2CEAA 3CX5E 2O3JA 4IDPA 2LR2A 3AE3C 5KLIC 1MFTA 1MV8A 2LSJA 2UXBT 1EDJA 4IL6E 4CXXA 3P4PA 1IK9A 3VRAA 1HNZT 4A56A 1JCCA 4I6MC 4TUYE 1IAPA 1K05A 3LK42 3RL0C 2HHHT 2R32A 3OPCA 4TWFA 1L0LK 4U33A 1NTZJ 2Q1KA 2XTLA 4ZEYA 4K0KT 3S1KA 5CCHC 1SQBE 1LTAC 4EYYR 1E2AA 2M3BA 1YJWP 4QX7B 2UXDT 3SFDC 3O1HA 1QUUA 4W7YA 2WT7B 2Y9YA 4ZZCA 1Y47A 4M1PA 4LMLA 1DD3A 4I7ZC 1JMMA 1G73A 1S4XA 4KX6A 3ZKRA 1NOHA 3MIWA 2BVLA 1QGKB 5H2FE 1N86A 4ZXLA 1YJ9P 1HX8A 4WYVA 1BCCE 1LVFA 1LTJC 3AEEA 3HTKB 2IDBA 4ASWA 2MPKA 1EZVD 3A2AA 1YIJP 3PUQA 3PLNA 2OYIC 1JNRA 3RIAA 3JCFA 4JI2T 2IPPA 2WSSH 4UB8E 4NUVA 1H7CA 3V5SA 1T98A 3UUBA 4CN4A 1PGQA 4DMVA 5LJMA 1ZLLA 2R5DA 1H0TA 2FYNC 2PJQA 1YYCA 3QWOC 3EDVA 1Q90D 1BE3E 1JB0J 1EC5A 1KV4A 2LRKA 1KN7A 2DCFA 5JTGA 5AQMB 3U78A 4F6RC 2YDRA 4IREA 2NPSA 1RE3C 1VQ5P 1RH5B 5M4YA 3JC22 2E76C 2HN2A 2LXCB 4UVBB 1J5WA 3RK3B 3ZCIA 5AVUB 1SQXD 1NAFA 2O01H 3Q5PA 3L71D 2N9BA 1WMKA 4IOIH 1JMBA 2ZM8A 3BK9A 3M06A 1DEEG 2LM2A 3L74G 1N32T 3S4RA 2QA7A 4EZHA 1OEDB 3KDSE 4PK5A 4ILBA 2FYUE 1FAVA 2LJLA 1VCTA 4DV5T 4X64T 5HXHA 3I0OA 1DEBA 3L39A 2K48A 3OYZA 3Q2MA 4QX8B 2NPSD 3LW5H 2K9JB 1G1IA 2VL0A 5AQHB 2XAHB 3H1HE 2XJ7A 4IDQA 1JY3N 3PTRB 3SOLA 1OFCX 3C64A 4QXHB 5TJHA 2BKOA 5HWXA 1IFIA 1LWUB 2BASA 3CQXC 4LF5T 1SQQE 1Z56A 1OW7A 3UUMA 4HYTB 2XY8B 4V1Av 1ZR2A 4H63H 1J2JB 4WB4A 1XWMA 2KXPB 1NENA 2WP9A 2BCCG 3HL6A 5AQQB 3SSUA 4OVNF 3RPUA 2A06E 1X9VA 4WVZA 3ZSTA 4MHCA 1GW3A 4YHHT 2K9YA 3M9BA 3CI9A 2CRBA 3HUSB 5KJ7A 3UUNA 1VQ4P 1SQBJ 1K73Q 2IAKA 1IC2A 4U3FD 4IFMA 4JLEA 2KSEA 3BCCD 2VK9A 1JNZA 1GMJA 1MMGA 1HGVA 3UIAA 2XQ5A 3P8CD 1CI6B 3BQLA 2RMZA 3KZIH 1NTMD 3CIRA 1GW4A 5APSA 4HFDA 4H9NC 2KS1B 2YNYA 4ZZBA 5AQVB 3W68A 2E74D 2YXRB 2WPRA 1NEKA 3UQ4A 4HWCA 1AQ5A 2OA5A 1BCCJ 2XM1A 3O8ZA 5KJ7D 4AQFA 2HR3A 2JIWA 3QH9A 5DJUB 1YKEB 4HWFA 1VQOP 3BQIA 4EEDA 1M57D 3L70D 2O01J 5FL0A 3H1JD 2Y48B 1P84E 1V9DA 3V4WA 1O3XA 4TX5A 2O1KA 3AXJB 4CXWA 2W62A 3I9YA 4TNWA 1URQA 4HFCA 5AVTB 1JY2N 1XZYA 5JR9B 1BE3J 4Z1MH 3LW5J 2VASA 2HPJA 1CZQA 1KC8Q 1YJNP 4AKLA 3MUDC 4ZNCA 2AE9A 3QB5A 5LG3A 3M0DA 3CD6P 3A7MA 4NPFX 1VQMP 3N9QA 4YXDC 2ZLYA 4QWNB 1JNMA 3CX5I 5H6QB 5AQTB 1P84H 3CKDA 3F5HA 4GOUA 1URQD 5CCGA 3K5BA 1KQFB 5HCMA 3IA3A 4O4HE 2FYUJ 2OV9A 3AAIA 2LT3A 4IDNA 1YW0A 3A0HE 2HODA 3U1AA 2W6AA 2UXNB 2R6GF 1MNDA 3L3PA 4I50E 2H43A 5HEOA 4OWFA 2UXXB 4HWDA 4YTMA 2CWOA 3AE7C 3H1HJ 3PUSA 4KHZF 3MA9A 2JRKA 2Z5HA 4ASKA 2JMHA 5AQSB 3KQGA 1SQQJ 4ZS2A 1UK5A 1OWAA 1EZVG 3AE2C 3CXHD 2ZJSE 2Y0CA 5M1BA 1RF1B 2W00A 2OYIA 3ZCJA 4YTPA 4O4JE 1MIWA 3SWYA 3PHLA 2YK0A 2KWIB 3RLFF 3PTZA 1L0NE 3HKDE 3L75E 3A0HH 1W2EA 5AVYB 3SS1A 1LWUC 2DL1A 1NTKE 5HWYA 4U7YA 3SRZA 3BRVB 3RI5A 2IC6A 1LVKA 4MFRA 4OX9T 2JP3A 3ONXA 3OKQA 4ZI3C 3DJBA 4DV6T 1UIXA 2QJPB 5FXVA 4XFJA 1Z8UA 4O2AE 2A45H 3VMZA 1SE7A 3X1DA 1H0TB 3M9HA 3AE1A 2MOZA 3UUXB 3UU8A 1VQ8P 3FZLB 2KK7A 3V2NA 5FL1A 1PPJE 2NPSB 1GQEA 2FUPA 3ZT5A 1OVUA 2L9QA 1SQVE 4KT0J 5E79E 2VKHA 4R4MA 5IYZE 3MTUE 1ZP0A 2ODUA 4JI8T 1EDKA 1SS1A 3WAJA 1WRDA 2UWJE 1KD1Q 3CCLP 1CW5A 4L9IA 4ASVA 3N9MA 4WW0A 4GOEA 1RHZB 4U2ZA 1IFJA 1NTZD 3RF1A 4DOJA 2M6BA 3K8PC 5LGNB 1YD8G 2H3RA 4W80A 2WS3A 4HKAA 4PJNA 1KFNA 1USDA 1EXIA 5C3JA 3QNUA 3KFWX 2GUVA 3UT5E 2H89C 4YSXA 2V6XA 4DJGA 4DIDB 3RIFA 1RE4C 4DR7T 1KYOD 1SP4A 3LDQB 4AQRD 5CGMA 4NUUA 5AW9B 4YLHA 3GF3A 4PD4E 4MN4C 2PBIA 1LJ2A 5AQOB 2V8SV 2E74B 1X22A 3A0BE 2KT9A 2V7JA 3ETVA 1XNQT 1PGOA 4HN9A 3GN5A 3ZC0A 2J5UA 5AW2B 5KKZC 2L5GB 1PGPA 2XNXA 3RGUA 5ABEA 1ZRTE 1G8XA 2KNCA 2FY8A 2W0GA 5HEUA 4YY3T 4DV0T 3E1RA 1VF5B 3H1LG 3L4FA 4DVDA 4KI0F 4JI4T 4HKZH 2MYSA 3A5TA 4IFFA 1FS0E 1MKMA 2ZXXA 4N6JA 3ZYMA 4L5GA 1KB9D 4PD4H 4W7ZA 2HPCA 1SQPG 1HNWT 2KNDA 1Q7YQ 1L0NJ 1NTMK 1R5LA 2XZEA 3A0BH 3HE4A 4PAGA 1BR2A 4YJ2E 4AKIA 2NZ2A 1JCDA 1NTKJ 4IDOA 2WU5A 1HFAA 1XNRT 4G63A 3RBZA 4LF4T 3FBLA 1D1AA 2BBHA 4DBQA 3H3MA 1X8YA 2N1TA 1FDOA 2C9NY 1GK4A 2FFDA 2PFXA 3A3YB 3H32A 5F3JA 3L72E 3Q5SA 1URQB 2FJEA 5TAOA 3CWBG 2XKMA 3AEEC 3PURA 1LTSC 2IX7C 1OMIA 4MBQA 1BR1A 3UU6A 2KSRA 3RX6A 5JVDE 2DWKA 2XQ8A 3AECA 2IYPA 3RRWA 4I43B 2M0BA 2ODVA 3GWHA 2AEFA 3L73E 1SQVJ 3PUVF 2V1DB 2XSBA 5LBMA 4GIWA 3CCMP 3GA8A 4QMAA 2QVAA 2N1TD 4JBWF 4PJ0H 1U5PA 5HXRA 1YITP 5LA6E 3RL0B 4NPPA 3CQCB 1IFNA 4B3RT 2J58A 4ILAA 2YKSA 3ZDMA 5GTIE 1IFMA 2AXDS 3FXEB 1SHZC 4TLFA 4XE5B 2Y6XA 3Q5DA 4WY4A 3A8YC 4OH8B 2YN6A 1SQPJ 4I7ZB 5AW0B 2LHRA 5AVRB 3PDYA 4ZI7E 3MK7C 3VP9A 1KNPA 3B8EB 4COFA 2B89A 2WITA 3L74D 5KLVE 5AQJB 2LSYA 3M9QA 3QB5K 2G3AA 1LTJB 2J59M 4HGAA 3WU2E 2Q9QA 3ZMVB 2YDSA 1IZNB 1CHUA 2V7MA 2OYIB 1ZKEA 1L4AA 1PIXA 4WBNE 3RGLA 3FZKB 4WY4D 1KNZA 3FX0A 1N33T 1Y8AA 2XAGB 2CPTA 5E0OA 2OTLP 1FDIA 1NU1E 1QEXA 2FJDA 2FYNB 4X1YE 1IBKT 2P10A 3ZN0B 4YTNA 2YEVC 5FNVE 2KUBA 2BCCD 4DV3T 2WQYA 2Q9QD 3C4WA 3N5LA 1U4QA 1HF8A 5KJ7C 4D6TG 5HEHA 3WU2H 1L4AD 3PH0A 3F89A 3G9RA 2KLUA 4ZI3D 2P67A 3I55P 3TLTA 3I5CA 4UVCB 1SLQA 2CHOA 1PP9G 3RC3A 2YIUC 1JUNA 2D0TA 3VYIA 3AAAB 4I55E 2FYUD 4PJMA 2Q3IA 2IBZG 1L0LE 1WLXA 1MIYA 3C50A 2ACXA 1NWQA 4OYKA 3N2KE 3NRYA 2HLOA 3MHVA 4HE8A 2Z6EA 3VKHA 3EFGA 4AQFC 2V7LA 2CBIA 1VOMA 1M7KA 4IFDK 1LT1A 3AEFC 3MD0A 5AQNB 1RE4A 2PAJA 3LK2B 1NTZK 3OJAA 2C9LY 4H9SE 3L73J 3CCVP 3HKCE 1D1CA 3JAEA 1S9KD 3H1IG 2WU2A 2H88A 4KHXA 3OVUA 4KUMB 2HN1A 2KINB 4O9BA 4EI2A 2E43A 4L76A 1KMIZ 2WY2A 5CJ4A 1HH0A 4UEMA 2Q9IA 5EK2A 4AIUA 1GU5A 1EZ3A 2P2UA 2W66A 5CB4E 1MMAA 3M0DC 2UU9T 2ACZA 1PL5A 5HCJA 3V2RA 1LTIC 1R8IA 2OLTA 4D6TJ 2ITAA 3S4UA 4ISSA 1KORA 4H9QC 2KIKA 3FWLA 5ETWA 4LGDE 4IDZA 5CCGC 2RP4A 4ZI2D 2KZIA 3PUZF 4I0UA 5KLVJ 1PP9J 3V5UA 1J1DC 2WMMA 3JCUE 1X0TA 2X0HA 3ZPOA 4B3MT 2WZIA 1KZUB 1ZR4A 2BG9A 3B71A 2O1JA 3LIDA 3GMAA 1LNQA 1IFPA 1IFDA 3UTKA 4LF7T 4KMCA 3ZMSB 4JI7T 3AAEB 4O4LE 3UULA 2HFED 2YMYA 1BGYE 3CX5H 3HE4B 2D2SA 1IK7A 1GU4A 1QVGO 2K3RA 5DABA 4IL6H 5AW8B 2W90A 3TLWA 1NU1J 2A2FX 3FXDB 3AA7B 2VKJA 2V6YA 1GK6A 4JI0T 4NPEA 2FFDB 1N36T 2Q5UA 4YTPC 3OW2O 3H32B 3H1IJ 4P09A 3JCUH 4PK4A 1LT9A 3KV9A 2AEJA 2D2CD 4HFEA 5FVKA 5B5EE 2N2NA 5AVVB 2J47A 3B13A 4TV9E 2XPKA 2QRXA 3RK3E 3KXDA 1BDCA 3CXHI 3FGAD 2LKGA 2XASB 5FYMA 1JM0A 1SQBG 2JQ9A 4L73A 3P7KA 5H2FH 3Q5RA 5AVSB 2MBGA 3M3ZB 4AQGA 3NXSA 3EABA 3ZMZB 4RO0A 2ZT9D 3N2OA 4HEAA 1OEDE 5LP6E 3AE1C 3AEAC 5APQA 2CXFA 3PP5A 3O6QA 2YU1A 3KYQA 1KF6A 4HWHA 4UB8H 3NKZA 4Y28J 5IWAT 5CMZA 4RESB 5AVWB 4GYRA 1ZOYC 1BCCG 3P8MC 1W09A 1ZP0C 5B5EH 1SUMB 2BS4A 2W67A 4WY4B 4AYCA 3LJCA 2ZYGA 4JYBA 4TWDA 2K24A 3UU3A 4FJOA 4HFIA 1S5LX 2K3WA 1L0ND 5LG4A 2LLYA 1LTTC 3OYXA 3BQKA 1JTHB 2H7VC 5L3GB 3PJAJ 4UELA 4L74A 1S5LE 1HTJF 2B87B 1BE3G 4Z91A 1RQVA 4CZZB 2C0SA 4DR3T 1H89A 3LBXA 2NWBA 3L09A 3L35A 1UUSA 3CCRP 4X5TA 3OBVE 5APUA 1FJKA 1D0ZA 4BJNA 5CHXA 4Y99C 5AW4B 2C0WA 3ZYKA 1SFCC 4M3LA 2CA5A 2OYHC 3UU5A 2E75C 5C39A 1L0VA 4LFBT 3ZLIA 1H8AA 3KDPB 5LYJE 2Y8DA 5IUXA 2W8ZA 1W0BA 2Y0DA 1J1EB 2WPQA 2D0UA 2FYUG 1HGZA 1KILA 1H88A 3N7NA 3TGUE 1YXRA 5BU8B 3RC8A 5H6RB 2MKVA 3GW6A 2E9XA 1HUCA 4C7RA 3KVBA 1JY3O 3D6YA 4GT1A 3H1HG 5APXA 1FIOA 3H1LD 2W27A 4HWIB 4JF7A 2X66A 3Q3DA 1MIVA 1EQ7A 1SQQG 3H1KE 2JEEA 2LOSA 1XMQT 3AEFA 3F31A 1OW6A 1ZHCA 1SQPD 2W2UA 5DQVA 3VR9A 2H7OA 2QEXP 4JBZA 1J1JA 2WSFH 1KILD 2DI4A 2XM2A 2A06G 1N73A 1FEWA 4BAYB 3EFFK 5JDGA 1X79A 1YQ3A 5FXZA 2FJBA 2N1TC 2E9XD 2V7QH 1EDIA 3CCQP 5HEGA 1OZHA 2FFDC 3JC6C 3K3OA 1NJIQ 3KV4A 2RH0A 2W4XA 2M5AA 4YJ3E 3UU4A 3CWBD 2Q7CA 3GHGA 3B57A 3AECC 3SWHA 5ABFA 2C5JA 2XU6A 1YTZT 5KKZB 4NXNT 2DNXA 2WB5A 1VQ7P 2A3DA 2XQAA 4K0UA 2Z5IA 1W0AA 2ZVNB 3AA1B 5HXCA 3CQGB 1KFYA 3V5BA 4IE5A 2LOPA 5K5GB 5L3CB 2PGDA 2GM4A 3N4XA 3RIUA 4P1NA 3QC9A 3EHZA 3TLVA 2QIWA 3KV5A 2WM9A 5GTHE 3BRTB 2E5LT 5ABGA 1UGOA 2IIUA 2XNDH 4K3AA 1HBWA 4GKJT 5FY0A 2D9DA 4DV2T 3NFQA 1A02F 1JY2O 1U57A 4WY4C 1MZ9A 2XQ6A 4O2BE 3MGNA 1EXJA 3CX6B 4QHOA 5CCGD 2JQKA 2LM9A 3EI0A 1G1JA 2WSEH 1SQXE 5L2LA 5EK3A 1KQLA 2B1EA 3L71E 3QUJA 5HAXA 3PU8A 2Q9QC 2B9BA 5BMVE 4G2AA 3RKGA 1L4AC 4GOFA 1SA0E 2YO2A 2O01N 2WSFJ 3U3IA 3RYIE 3TKLB 4B3ST 4NXMT 3TGUJ 1FJPA 2V7QJ 1YKHB 4TN7B 3AEAA 2PRRA 3BASA 3USSA 4GIFA 5AVXB 5AQLB 1RQUA 5CBOA 4DO0A 2PP6A 1Z0PA 1RY3A 5CJ5A 3AE8A 5L3DB 3NRXA 4EOTA 3KBTA 1J1EC 2WQYC 2IMLA 5JDMA 4DV7T 2NW8A 4BRYA 3H1KJ 4I4TE 4A97A 4JI5T 1ZOYA 2A45G 3ETUA 4DV1T 3O6QB 4D6TD 2SPZA 1SVFA 2B88A 1FMVA 2CXDA 4A98A 1MMNA 3CVRA 3EAMA 1M1KQ 1LP1A 4OHFA 5LBQB 3AEDC 1L0NG 3EUHA 1PP9D 3L75G 5AQPB 3C98B 4U3FE 1JEKA 3BCCE 1SQXK 2V5CA 3ABVA 5HXEA 1NTKG 4IE7A 3M65A 2IBZD 1VDFA 4X1IE 3P8CE 1LTGC 2IFNA 1W2BO 1NTME 4WBAA 2CK3H 4TNVA 1KTMA 1XTGB 2KI7B 5AW6B 3D71A 1YQ4A 2QJKC 5E79H 3WUVA 1N8RQ 4X65T 1FMWA 2VRSA 4YT0A 1NU1D 5BR8T 3ITKA 4EGWA 2UUBT 4H0LD 1SFCA 2WSEJ 1KFMA 3CL3D 1NYHA 5FXXA 5KMGP 1PPJG 3HA4A 3L70E 2OYHA 1QVFO 2H88C 3H1JE 2XQ4A 4ZI2C 3G3ZA 4X1KE 3II6A 2GA1A 3H1ID 1SQVG 4Q25A 5HYAA 3OTOT 3KPEA 5F8PA 5AQKB 5L47A 3ZT7A 4CI2B 4KJMA 4IL9A 1E79H 4H44C 2ZM2A 4YXWH 3PRJA 2JWAA 2KB7P 4C90A 2RN0A 1M1JA 2RKLA 4OGQD 4C46A 2YIUB 2PFVA 1WRGA 1IJDB 3RK2D 1SFCD 2POHA 3ZSSA 1Q2NA 4L75A 3P50A 2E75D 3GLMA 3L71J 5FP3A 1Q82Q 1DX7A 3L75J 4XA4A 4DZOA 2BG9C 1UIIA 2LSIA 2KZ7B 5AQGB 1N2DC 5HEJA 1D0YA 2D2CC 4IGUA 4PV1D 3DP7A 5EK4A 1YTZI 3PJSK 3K3QC 1OVRA 3ZEFB 3WUTA 2CHNA 4E7SA 5LXTE 3TLUA 2AXTE 3IF4A 2QM7A 3IEEA 3WI3A 4DBRA 2N1GA 2W6BA 1X79B 2E5TA 2ZYDA 1HF9A 2ZT9C 1SQPK 1ZV8A 4UB6E 1E5WA 1GL2C 5EZYE 2UUCT 1M7LA 2M5AB 1LT9C 2XQ3A 1K9MQ 4HFVA 4CPGA 3CX5D 2WCAA 4P0AA 4WZXA 2BEZF 3CXHE 3H37A 2N9YB 4I2LC 4GKKT 3GHGB 2OTKE 5AW7B 2R5BA 3O1JA 5F5WA 1EZVI 3JC6D 4LFCT 2AXTH 1FZGA 2V4HA 2M67A 2E2AA 1SQBD 4HTEA 5LHHB 2OQQA 4UV9B 3M91A 3RL0g 1J1DB 1IJ6A 3N9PA 2HODB 4IIJE 4OK0A 4UF0A 1NTMJ 1VCSA 4UB6H 3RH3A 3MJXA 1BDDA 3E0ZA 1T2KD 3ZYLA 5L3EB 1D7MA 3IR9A 3RQUA 2JO1A 3CXHH 2XSAA 3RKOA 4QH1A 1HCIA 3L72G 2CWYA 3P4SA 3CPWO 1QX8A 4H9PC 4KP3C 3AVSA 4LMJA 1BCCD 2P1JA 1AFOA 1T3UA 4DCKA 2X0YA 3TNUA 1OEDA 3FZFB 1T7SA 2VKDA 3RYFE 1CUNA 3L70J 3H1JJ 3L73G 1ZXGA 1IBMT 2JQHA 5APWA 5GTIH 2W6JH 2J62A 3ONJA 4EIWA 2Q3EA 1HTLC 1NTZE 2FXPA 4QH4A 5KDMC 1K04A 4EDFA 3B4SA 2K9JA 2JJLA 5APYA 5JDFA 1JOCA 2KWHA 2BKPA 4HFBA 3T8OA 1BE3D 4BJMA 3J9X1 2K37A 2KLQA 2IUBA 3B5NA 1YHQP 2YINA 5BVZA 5JDHA 5JRCA 3UFGA 4JI3T 4PJJA 3NZQA 2NTXA 1M56D 4AQYT 1HVVA 2WSCH 2IZ0A 3TF5A 1U7MA 2BS2A 2KLVA 1T8BA 4JEUB 1KYOE 1LKXA 1DD4A 1JO5A 1Y64B 3HUSA 1PZQA 3CPZA 3AE5A 5KLVG 2XZRA 3HD7A 4C7NA 4BRYB 2YKOA 1GZLA 4WWIA 3EVYA 1J5ET 1KILC 3AEDA 3IAOA 3C9IA 4HFHA 4EXTA 2OYOA 3V4QA 3MZKB 3VRBA 2R3SA 3RBXA 4PFOA 3B5ND 2VVNA 3P4QA 1QLBA 4CN1A 3AE4C 5AQFB 2E9XC 2PTFA 3V2QA 1UURA 3L72J 4IT4A 4A5XA 3HKEE 1UX5A 3H1HD 2WDVA 5B66E 2W61A 2ZM6T 4DR2T 3HRNA 2I59A 2FKWB 3RRCA 2KP8A 3TDKA 3VMXA 1NU1G 1SQQD
chains in the Genus database with same CATH topology
5CBNA 2I8DA 3RGUA 3QB5K 2KI7B 5K5GB 2ZAEB 2KIKA 3PJAJ 3RIUA 3FXDA 5DJTB 4WYVA 2B87B 2KZIA 2P58A 1LP1B 4ASWA 2WMMA 1X0TA 4HKZH 1BDDA 2KS1B 1OVVA 4K3AA 4EYYQ 4K35A 4BXLA 2HR3A 4KJMA 5DJUB 5C39A 2KUBA 1H0TA 2K3RA 1H0TB 3QWOC 1S3JA 1EC5A 1ZXGA 2JWDA 3AXJA 2RKLA 2LXBA 3PH0A 3AXJB 2KZJA 4NPEA 4HJGH 1OVUA 3RIUC 2LXCB 1Q2NA 4GOFA 1EDKA 1SS1A 3MZWB 3FXEA 2UWJE 4IOIH 4ZMDA 1JMBA 1EDLA 4ASVA 1KEYA 1DEEG 2QRXA 4GOEA 4ZNCA 1BDCA 2M0BA 4NPDA 3QB5A 1U7JA 3MHVA 1JM0A 4NPFX 1OVRA 4HB1A 5CBOA 1U7MA 2QVAA 4JBZA 1J1JA 1LT1A 2LR2A 1MFTA 1EDJA 1FC2C 4WWIA 5EFWB 3ZDMA 1EDIA 2SPZA 2B88A 4GODA 3PJAA 1NVOA 2B87A 2M5AA 1ZW0A 1LP1A 2M5AB 2Q1KA 4CPGA 3S1KA 2OTKE 4MN4C 2R44A 1Y47A 2B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBN A;  2I8D A;  3RGU A;  3QB5 K;  2KI7 B;  5K5G B;  2ZAE B;  2KIK A;  3PJA J;  3RIU A;  3FXD A;  5DJT B;  4WYV A;  2B87 B;  2KZI A;  2P58 A;  1LP1 B;  4ASW A;  2WMM A;  1X0T A;  4HKZ H;  1BDD A;  2KS1 B;  1OVV A;  4K3A A;  4EYY Q;  4K35 A;  4BXL A;  2HR3 A;  4KJM A;  5DJU B;  5C39 A;  2KUB A;  1H0T A;  2K3R A;  1H0T B;  3QWO C;  1S3J A;  1EC5 A;  1ZXG A;  2JWD A;  3AXJ A;  2RKL A;  2LXB A;  3PH0 A;  3AXJ B;  2KZJ A;  4NPE A;  4HJG H;  1OVU A;  3RIU C;  2LXC B;  1Q2N A;  4GOF A;  1EDK A;  1SS1 A;  3MZW B;  3FXE A;  2UWJ E;  4IOI H;  4ZMD A;  1JMB A;  1EDL A;  4ASV A;  1KEY A;  1DEE G;  2QRX A;  4GOE A;  4ZNC A;  1BDC A;  2M0B A;  4NPD A;  3QB5 A;  1U7J A;  3MHV A;  1JM0 A;  4NPF X;  1OVR A;  4HB1 A;  5CBO A;  1U7M A;  2QVA A;  4JBZ A;  1J1J A;  1LT1 A;  2LR2 A;  1MFT A;  1EDJ A;  1FC2 C;  4WWI A;  5EFW B;  3ZDM A;  1EDI A;  2SPZ A;  2B88 A;  4GOD A;  3PJA A;  1NVO A;  2B87 A;  2M5A A;  1ZW0 A;  1LP1 A;  2M5A B;  2Q1K A;  4CPG A;  3S1K A;  2OTK E;  4MN4 C;  2R44 A;  1Y47 A;  2B89 A; 
#chains in the Genus database with same CATH topology
 5A1L A;  2I8D A;  1WYC A;  2WSS V;  2WTY A;  3HD7 D;  2V7I A;  2YXQ B;  1FE6 A;  2AXC A;  5KAF E;  3AVR A;  3I9W A;  4EV6 A;  3SFE A;  1N73 C;  1KB9 E;  2YMK A;  1YQ3 C;  5J1G A;  2A06 D;  2FXM A;  3VTP C;  3CCU P;  3LIE A;  2BDE A;  4Y99 B;  3D6Z A;  4A7P A;  4YPC A;  3ZMT B;  3RK2 B;  1SFC B;  4QXC B;  3IHR A;  1OVV A;  4XBF B;  2OYH B;  2E75 B;  4YHJ A;  3F57 A;  3GHG C;  2LKH A;  5B66 H;  3RYC E;  3CCE P;  4OYJ A;  2QYW A;  4EYU A;  3GN5 B;  1L0L G;  5C2T A;  5L8R J;  3FHN A;  2KNC B;  5FKY A;  2K88 A;  3A5X A;  1M1J B;  4YSZ A;  3V2P A;  3MKD A;  3RIU C;  4LF6 T;  3PV0 F;  1HWT C;  3H1K D;  4GYS A;  2VUR A;  4EB6 E;  2WSC J;  2LKM A;  3HE5 A;  4H44 D;  1D0X A;  4IE6 A;  2EHO A;  5LNK A;  2QG4 A;  1P84 D;  1HG5 A;  2HPC B;  5DJQ C;  4PJL A;  1LTB C;  1MMD A;  3CLQ A;  1Q86 Q;  2L91 A;  1OW8 A;  4R4L A;  1U7J A;  1ZME C;  2XV5 A;  1VQ6 P;  4DMW A;  4J2C A;  4B86 A;  5LMN T;  5L4H A;  5KTB A;  3AE9 C;  4L0R A;  4PK6 A;  2K5B B;  1I6Z A;  4H63 V;  3E22 E;  2N1T B;  2FJA A;  1GL2 A;  4JV5 T;  2NR4 A;  1NKZ B;  2WMN A;  2HH7 A;  5KXJ A;  2MJZ A;  2QM8 A;  1ZV4 X;  2CBJ A;  2EHO D;  1QLE D;  1PV3 A;  1RF1 A;  4JYA T;  4RJT A;  4DUZ T;  4Z8X A;  1KQG B;  3L74 E;  3TK1 A;  3E08 A;  5AW1 B;  5KAI E;  3G4S P;  5ABH A;  3AA0 B;  2IFM A;  3R4Y A;  4U7J A;  1VQ9 P;  1L0L J;  3TYY A;  2NRG A;  1WYB A;  2UXC T;  1YI2 P;  4H13 C;  3V6I A;  2F4V T;  3VKG A;  2YO3 A;  1GL2 D;  2IYO A;  2OTJ P;  2WMO A;  3AE6 A;  4UR9 A;  5AQI B;  2C0X A;  2LSG A;  3AE8 C;  1ZN5 A;  1BGY G;  4LC1 A;  3FZH B;  4P0B A;  3Q5E A;  2YU2 A;  2RPA A;  3VHL A;  3ZMU B;  1AJ3 A;  4ILC A;  3HR0 A;  1PFI A;  3PUG A;  4UF0 B;  3PUX F;  3C4Z A;  2IZ1 A;  2H7H A;  2BCC E;  1SQB K;  4FI5 A;  5KAI H;  4XAX B;  4EYY Q;  2G0U A;  4K35 A;  3VU7 H;  4H0L C;  3EDU A;  4JUY A;  3N9L A;  1NAY A;  1NHL A;  3OAK A;  3L75 D;  3ABV C;  2LSK A;  2NTY A;  3IF8 B;  1UCU A;  4N78 E;  3SWF A;  3P7I A;  1NTK D;  2W83 C;  3TNU B;  5APT A;  1FDM A;  5LGT B;  2Q9Q B;  3QK6 A;  2ZMA A;  1WT6 A;  1FZC A;  1T3J A;  4EIJ A;  3IN6 A;  2E5Y A;  1L4A B;  2L3L A;  1YQ4 C;  2I0M A;  4BA9 A;  1OXZ A;  2YOE A;  3WAK A;  3L37 A;  4OGQ C;  2IBZ I;  5TIS E;  3ZC1 A;  3ZJ1 A;  1G2C A;  4JPZ B;  2V5D A;  3RK2 C;  3KZI E;  4LFA T;  2OGU A;  2LHN A;  3GG2 A;  1PGJ A;  1N7S C;  3B5N B;  5APV A;  1PPJ D;  4TWH A;  2VL8 A;  4DND A;  4ZHQ E;  3K3N A;  3KV6 A;  2CLY B;  1S35 A;  1SQV D;  1K8A Q;  2DLR A;  4LF8 T;  5JRC B;  3ZN1 B;  1KYO I;  4CN6 A;  1S9K E;  2KSJ A;  1S5L H;  4U3C A;  4XZC A;  4PV1 C;  1BGY J;  5CJ0 A;  2VQE T;  3ESL A;  3AE4 A;  2WPV B;  1M1J C;  1FC2 C;  2QJY C;  1WR0 A;  3HD7 B;  4C7N B;  1Y01 A;  4GOD A;  4ZOL E;  2R3C A;  1HJ0 A;  5TIS H;  2XAQ B;  3ONL C;  4F8H A;  2C5K T;  3T97 A;  5AW3 B;  2K9A A;  3IFM A;  1MFZ A;  4DUY T;  3FWN A;  2KOG A;  3WMM 0;  3UQ7 A;  2FYU K;  2X51 A;  4X66 T;  1L2P A;  2YKP A;  3L74 J;  2WVR A;  2QJK B;  1A02 J;  2VVS A;  4JI6 T;  2XQ7 A;  1LRZ A;  1N7L A;  4MLK A;  1E1H B;  4U7I A;  3OJA B;  3C51 A;  2JQQ A;  1KB9 I;  3G71 P;  2Y0E A;  2JR8 A;  4PD4 D;  5AQU B;  4CXY A;  3NBX X;  1VF5 D;  1SQQ K;  5JDQ A;  2FXO A;  2RA1 A;  1VL2 A;  4TV8 E;  3IBP A;  2E8I A;  3TGU G;  3I1A A;  1QL1 A;  5AW5 B;  1ZRT D;  2A9U A;  2AEM A;  1RF0 A;  3HI2 A;  3WUU A;  3UFE A;  4EOZ B;  1X9B A;  2QA4 P;  3AEB C;  4H44 B;  3BVH A;  2WAU A;  1T2K C;  4IE4 A;  1EZV E;  2VQF T;  3CC7 P;  4AKR B;  1HJB A;  3AEG A;  2SPC A;  2X9Y A;  2BCC J;  3LG7 A;  2ZM0 A;  2KYV A;  5J0Z A;  2BG9 E;  3BAT A;  3H1K G;  1GDT A;  4H9R C;  1XMO T;  5C8Y E;  3AE3 A;  3F2E A;  2B76 A;  1B7T A;  3Q1M A;  2DHR A;  2M8R A;  1MUU A;  4HJG H;  4ZKP A;  5HXS A;  1AV1 A;  2BG9 B;  4PFP A;  2JJ9 A;  5CCH A;  3HE5 B;  1BR0 A;  1FZE A;  2D2C B;  3MZW B;  1S1C X;  2EHO B;  3FXE A;  2JKV A;  4ZMD A;  1EDL A;  3RK3 C;  2IHR 1;  3SFD A;  5J2U E;  3AE9 A;  1IO4 A;  1HR0 T;  4Z90 A;  4B3T T;  4NPD A;  2CCQ A;  3N9N A;  4KBM B;  1KNR A;  3ZJ2 A;  3L72 D;  3B5M A;  2CMR A;  2IW5 B;  2QGS A;  3MP7 B;  3U1C A;  3H6P A;  3FZM B;  1OED C;  2BKN A;  2WPS A;  1GD2 E;  2V6Y B;  4GK5 E;  2WDQ A;  2ZT9 B;  4UIG A;  2NP9 A;  4AXP A;  1VPC A;  3LK3 B;  2FYZ A;  3RL0 D;  3E7K A;  1GL2 B;  2NOX A;  2X9W A;  2X9H A;  3RYH E;  2HPL A;  1LTJ A;  5GTH H;  3JSV C;  2A72 A;  4AKG A;  3L73 D;  1LT9 B;  5CCH D;  3ANW A;  1NVO A;  1VQK P;  1OX3 A;  1ZW0 A;  2CE7 A;  2MAW A;  2BVM A;  2WWU A;  2XUE A;  3NWI A;  3AA6 B;  3CC4 P;  1USE A;  4LF9 T;  1BR4 A;  3VMA A;  3CMA P;  3J7Y q;  4TZ4 C;  3B5N C;  1KK7 A;  2CLY C;  3L36 A;  1TU3 F;  4X20 E;  5BU5 A;  3I56 P;  1JY3 P;  2HG5 D;  4DR5 T;  5CBN A;  1FBM A;  1Q81 Q;  2ZVO B;  1YBK A;  2Q6Q A;  1RE3 A;  3PUW F;  1XDO A;  2X9X A;  4GKG A;  3HUS C;  1HNX T;  3AE5 C;  5DJT B;  1SQX G;  4AKH A;  3HD7 C;  3C4X A;  2P58 A;  3L71 G;  1AQT A;  3Q2Y A;  5KLV D;  5CA0 E;  5FY1 A;  4H13 D;  1VRB A;  5FMN A;  1QSD A;  2NW9 A;  1BSN A;  3G6E P;  2FBW C;  1AA0 A;  4ZKU A;  4E7Z A;  5LHI B;  3L8R A;  1NO4 A;  5AVZ B;  3JAD A;  1VQL P;  1NGM B;  1XDP A;  3N9O A;  3JAF A;  1VQN P;  1DU2 A;  1NH4 A;  3A7O A;  2G8Y A;  1WCR A;  5L3B B;  4LMK A;  3CCS P;  2J4G A;  3C8V A;  4U31 A;  4B6X A;  3VR8 A;  2E76 D;  4I1L A;  1D1B A;  3H1L E;  4CQI A;  1FZC B;  4PW8 A;  5LHG B;  4CI3 B;  4GDO A;  1L0N K;  3NZP A;  5DQW A;  3SFE C;  3LBX B;  3MXZ A;  3CX8 B;  1CSB A;  2W63 A;  1NTK K;  1N7S A;  1AJY A;  4UVA B;  4IE0 A;  2ES0 A;  2XAF B;  1SQP E;  2CPS A;  1G2C B;  1KIL E;  3Q9D A;  5LJN A;  1VQP P;  5GON E;  2NW7 A;  1FJG T;  5J2T E;  2ZYA A;  1KEY A;  5JR9 C;  2P7J A;  3R6N A;  2BS3 A;  3P32 A;  4BWN A;  4QH5 A;  3O1I A;  3S9O A;  4U72 A;  3AB3 B;  3MAC A;  4AIS A;  4ADZ A;  4JI1 T;  4HB1 A;  4U3F G;  3BCC G;  2JDI H;  5AQR B;  3R84 B;  1L0L D;  1JY2 P;  1KIL B;  3CK6 A;  2K1A A;  4DR1 T;  3HKB E;  4UXN B;  3CWB E;  1NTM G;  2XQY A;  1US7 B;  5LB7 B;  1N7S D;  1SQX J;  3E1I A;  3PUY F;  5EFW B;  4EAH A;  1SQV K;  3KIN B;  2E9X B;  4CI1 B;  1FOS E;  4YSY A;  4U74 A;  5JDN A;  3PJA A;  3VP8 A;  4U2Y A;  1T72 A;  4TT3 H;  1W9R A;  4UV8 B;  2V26 A;  1IBL T;  3GMI A;  2WWV A;  3OA7 A;  2EHO C;  3KVA A;  5JH7 E;  3T97 B;  4GK0 E;  1WR6 A;  4O4I E;  3CML A;  2WT7 A;  3W15 B;  2OAR A;  3L70 G;  3H1J G;  3D0T A;  2ZFC A;  1XTC C;  2VWA A;  3O4X E;  4IHJ E;  4LLH A;  1N73 B;  3CME P;  5CA1 E;  3U59 A;  3LSV A;  1P84 I;  3PUA A;  3FXD A;  4PJ0 E;  2D5U A;  1S2E A;  3HTK A;  1WFD A;  2L8K A;  2GK9 A;  3FB2 A;  3AEB A;  5FXW A;  1R5S A;  2DWG A;  1RF1 C;  2XQ9 A;  2Z4E A;  3P4R A;  3M0A A;  2DW3 A;  2XDJ A;  5ABF B;  2BEQ D;  1M62 A;  2BBJ A;  3MUD A;  5CFB A;  2CXL A;  4BXL A;  3T1H T;  3RHW A;  5L4E A;  4H9O C;  2X0L B;  1LGH B;  4YXD A;  4DT0 A;  4U3F J;  1ZEE A;  3BCC J;  2P9B A;  3K1S A;  2HYN A;  3AE6 C;  3H25 A;  4QKN A;  4KHP T;  3DTO A;  3P4W A;  2QJP C;  3RQW A;  2N9D A;  5KLI B;  3D70 A;  2J1D G;  2Y9Z A;  2V7K A;  4QXB B;  2WBL A;  2I1J A;  1BGY D;  1NKN A;  1M90 Q;  1FZB A;  3TSI A;  3VMY A;  2QSI A;  2NPS C;  5LMU T;  3H1L J;  4O8S A;  3GF7 A;  4DR6 T;  2XHE B;  3AE7 A;  2JMK A;  4AI6 A;  1S72 P;  5FY7 A;  4ERR A;  5LCY A;  3LFM A;  4D6T E;  1MNE A;  3NTN A;  2PG8 A;  3AE2 A;  3CWZ B;  4HH2 A;  2XAJ B;  4PNI A;  2A45 I;  5AFU L;  2VKO A;  1PP9 E;  3RK3 D;  1FZC C;  1DIP A;  2BZB A;  1HX1 B;  2LE8 A;  3C1L A;  4RKU J;  1JTH A;  1NWM X;  2WZ7 A;  2IBZ E;  1LWU A;  3I0Q A;  3ANW B;  5FVL A;  3EQ2 A;  4DV4 T;  2B87 A;  2LRL A;  3G06 A;  4DR4 T;  5JDL A;  2I1K A;  3CWB J;  2IC9 A;  2CM0 A;  5IHY A;  4H13 B;  4C91 A;  5LGU B;  2WWW A;  4MAL A;  5JQG E;  5JRE A;  3R2P A;  2ZXE B;  1FZF A;  2R44 A;  3Q5X A;  1FU1 A;  1UX4 A;  3N2G E;  2YKQ A;  3PE0 A;  2GUS A;  3NMD A;  3H3A A;  4EEB A;  3VN0 A;  2UUA T;  1FZA A;  4NIQ A;  4ZS3 A;  3W67 A;  1AVY A;  1T6A A;  1S94 A;  2E5V A;  4EZ4 A;  2E74 C;  1M8O B;  2ZAE B;  5L3F B;  2FBW A;  3H1I E;  2WZH A;  1CI6 A;  4X62 T;  2E42 A;  2E76 B;  2LEH A;  1N34 T;  2H8P D;  4ANJ A;  1HG2 A;  1BSH A;  1LP1 B;  3PU3 A;  3VOP A;  4IST A;  4WNK A;  3ZT6 A;  2KS1 A;  4H0L B;  1IJ5 A;  1NTZ G;  4YFS A;  1VF5 C;  4N78 D;  4N3Y B;  1W5C E;  2M3E A;  1DH3 A;  1KYO H;  2MTQ A;  2X68 A;  5KLV K;  2IDO B;  3CX7 B;  4WBO A;  4JYC A;  1Y9B A;  3EWK A;  1KQS O;  3QOF A;  3FBZ A;  2M6I A;  1S3J A;  3TLS A;  2H89 A;  2YDQ A;  4ILU A;  1HS7 A;  1OIP A;  2JWD A;  3CC2 P;  3AXJ A;  2KMF A;  4IL4 A;  2LXB A;  4JQ0 D;  4OGQ B;  3T1Y T;  2KZJ A;  1FOS F;  3NVO A;  1R8E A;  2WDR A;  5AVQ B;  1I94 T;  3Q5W A;  3KBU A;  1AVO A;  3CCJ P;  5JR9 A;  3KHU A;  4AUW A;  1N7S B;  2QE7 H;  1E7P A;  5LOV E;  1NU1 K;  5KX5 E;  1URQ C;  2JPF A;  3SWK A;  1RF0 C;  2CPB A;  4JEH B;  4OFZ A;  3O9X A;  3TGU D;  2C5I T;  5ADX L;  1GTW A;  1T8Z A;  4PV1 B;  4PD4 I;  5KAF H;  1QL2 A;  2I6H A;  2VB6 A;  3AEG C;  4IL6 X;  1KB9 H;  2X67 A;  2QJY B;  2CEA A;  3CX5 E;  2O3J A;  4IDP A;  2LR2 A;  3AE3 C;  5KLI C;  1MFT A;  1MV8 A;  2LSJ A;  2UXB T;  1EDJ A;  4IL6 E;  4CXX A;  3P4P A;  1IK9 A;  3VRA A;  1HNZ T;  4A56 A;  1JCC A;  4I6M C;  4TUY E;  1IAP A;  1K05 A;  3LK4 2;  3RL0 C;  2HHH T;  2R32 A;  3OPC A;  4TWF A;  1L0L K;  4U33 A;  1NTZ J;  2Q1K A;  2XTL A;  4ZEY A;  4K0K T;  3S1K A;  5CCH C;  1SQB E;  1LTA C;  4EYY R;  1E2A A;  2M3B A;  1YJW P;  4QX7 B;  2UXD T;  3SFD C;  3O1H A;  1QUU A;  4W7Y A;  2WT7 B;  2Y9Y A;  4ZZC A;  1Y47 A;  4M1P A;  4LML A;  1DD3 A;  4I7Z C;  1JMM A;  1G73 A;  1S4X A;  4KX6 A;  3ZKR A;  1NOH A;  3MIW A;  2BVL A;  1QGK B;  5H2F E;  1N86 A;  4ZXL A;  1YJ9 P;  1HX8 A;  4WYV A;  1BCC E;  1LVF A;  1LTJ C;  3AEE A;  3HTK B;  2IDB A;  4ASW A;  2MPK A;  1EZV D;  3A2A A;  1YIJ P;  3PUQ A;  3PLN A;  2OYI C;  1JNR A;  3RIA A;  3JCF A;  4JI2 T;  2IPP A;  2WSS H;  4UB8 E;  4NUV A;  1H7C A;  3V5S A;  1T98 A;  3UUB A;  4CN4 A;  1PGQ A;  4DMV A;  5LJM A;  1ZLL A;  2R5D A;  1H0T A;  2FYN C;  2PJQ A;  1YYC A;  3QWO C;  3EDV A;  1Q90 D;  1BE3 E;  1JB0 J;  1EC5 A;  1KV4 A;  2LRK A;  1KN7 A;  2DCF A;  5JTG A;  5AQM B;  3U78 A;  4F6R C;  2YDR A;  4IRE A;  2NPS A;  1RE3 C;  1VQ5 P;  1RH5 B;  5M4Y A;  3JC2 2;  2E76 C;  2HN2 A;  2LXC B;  4UVB B;  1J5W A;  3RK3 B;  3ZCI A;  5AVU B;  1SQX D;  1NAF A;  2O01 H;  3Q5P A;  3L71 D;  2N9B A;  1WMK A;  4IOI H;  1JMB A;  2ZM8 A;  3BK9 A;  3M06 A;  1DEE G;  2LM2 A;  3L74 G;  1N32 T;  3S4R A;  2QA7 A;  4EZH A;  1OED B;  3KDS E;  4PK5 A;  4ILB A;  2FYU E;  1FAV A;  2LJL A;  1VCT A;  4DV5 T;  4X64 T;  5HXH A;  3I0O A;  1DEB A;  3L39 A;  2K48 A;  3OYZ A;  3Q2M A;  4QX8 B;  2NPS D;  3LW5 H;  2K9J B;  1G1I A;  2VL0 A;  5AQH B;  2XAH B;  3H1H E;  2XJ7 A;  4IDQ A;  1JY3 N;  3PTR B;  3SOL A;  1OFC X;  3C64 A;  4QXH B;  5TJH A;  2BKO A;  5HWX A;  1IFI A;  1LWU B;  2BAS A;  3CQX C;  4LF5 T;  1SQQ E;  1Z56 A;  1OW7 A;  3UUM A;  4HYT B;  2XY8 B;  4V1A v;  1ZR2 A;  4H63 H;  1J2J B;  4WB4 A;  1XWM A;  2KXP B;  1NEN A;  2WP9 A;  2BCC G;  3HL6 A;  5AQQ B;  3SSU A;  4OVN F;  3RPU A;  2A06 E;  1X9V A;  4WVZ A;  3ZST A;  4MHC A;  1GW3 A;  4YHH T;  2K9Y A;  3M9B A;  3CI9 A;  2CRB A;  3HUS B;  5KJ7 A;  3UUN A;  1VQ4 P;  1SQB J;  1K73 Q;  2IAK A;  1IC2 A;  4U3F D;  4IFM A;  4JLE A;  2KSE A;  3BCC D;  2VK9 A;  1JNZ A;  1GMJ A;  1MMG A;  1HGV A;  3UIA A;  2XQ5 A;  3P8C D;  1CI6 B;  3BQL A;  2RMZ A;  3KZI H;  1NTM D;  3CIR A;  1GW4 A;  5APS A;  4HFD A;  4H9N C;  2KS1 B;  2YNY A;  4ZZB A;  5AQV B;  3W68 A;  2E74 D;  2YXR B;  2WPR A;  1NEK A;  3UQ4 A;  4HWC A;  1AQ5 A;  2OA5 A;  1BCC J;  2XM1 A;  3O8Z A;  5KJ7 D;  4AQF A;  2HR3 A;  2JIW A;  3QH9 A;  5DJU B;  1YKE B;  4HWF A;  1VQO P;  3BQI A;  4EED A;  1M57 D;  3L70 D;  2O01 J;  5FL0 A;  3H1J D;  2Y48 B;  1P84 E;  1V9D A;  3V4W A;  1O3X A;  4TX5 A;  2O1K A;  3AXJ B;  4CXW A;  2W62 A;  3I9Y A;  4TNW A;  1URQ A;  4HFC A;  5AVT B;  1JY2 N;  1XZY A;  5JR9 B;  1BE3 J;  4Z1M H;  3LW5 J;  2VAS A;  2HPJ A;  1CZQ A;  1KC8 Q;  1YJN P;  4AKL A;  3MUD C;  4ZNC A;  2AE9 A;  3QB5 A;  5LG3 A;  3M0D A;  3CD6 P;  3A7M A;  4NPF X;  1VQM P;  3N9Q A;  4YXD C;  2ZLY A;  4QWN B;  1JNM A;  3CX5 I;  5H6Q B;  5AQT B;  1P84 H;  3CKD A;  3F5H A;  4GOU A;  1URQ D;  5CCG A;  3K5B A;  1KQF B;  5HCM A;  3IA3 A;  4O4H E;  2FYU J;  2OV9 A;  3AAI A;  2LT3 A;  4IDN A;  1YW0 A;  3A0H E;  2HOD A;  3U1A A;  2W6A A;  2UXN B;  2R6G F;  1MND A;  3L3P A;  4I50 E;  2H43 A;  5HEO A;  4OWF A;  2UXX B;  4HWD A;  4YTM A;  2CWO A;  3AE7 C;  3H1H J;  3PUS A;  4KHZ F;  3MA9 A;  2JRK A;  2Z5H A;  4ASK A;  2JMH A;  5AQS B;  3KQG A;  1SQQ J;  4ZS2 A;  1UK5 A;  1OWA A;  1EZV G;  3AE2 C;  3CXH D;  2ZJS E;  2Y0C A;  5M1B A;  1RF1 B;  2W00 A;  2OYI A;  3ZCJ A;  4YTP A;  4O4J E;  1MIW A;  3SWY A;  3PHL A;  2YK0 A;  2KWI B;  3RLF F;  3PTZ A;  1L0N E;  3HKD E;  3L75 E;  3A0H H;  1W2E A;  5AVY B;  3SS1 A;  1LWU C;  2DL1 A;  1NTK E;  5HWY A;  4U7Y A;  3SRZ A;  3BRV B;  3RI5 A;  2IC6 A;  1LVK A;  4MFR A;  4OX9 T;  2JP3 A;  3ONX A;  3OKQ A;  4ZI3 C;  3DJB A;  4DV6 T;  1UIX A;  2QJP B;  5FXV A;  4XFJ A;  1Z8U A;  4O2A E;  2A45 H;  3VMZ A;  1SE7 A;  3X1D A;  1H0T B;  3M9H A;  3AE1 A;  2MOZ A;  3UUX B;  3UU8 A;  1VQ8 P;  3FZL B;  2KK7 A;  3V2N A;  5FL1 A;  1PPJ E;  2NPS B;  1GQE A;  2FUP A;  3ZT5 A;  1OVU A;  2L9Q A;  1SQV E;  4KT0 J;  5E79 E;  2VKH A;  4R4M A;  5IYZ E;  3MTU E;  1ZP0 A;  2ODU A;  4JI8 T;  1EDK A;  1SS1 A;  3WAJ A;  1WRD A;  2UWJ E;  1KD1 Q;  3CCL P;  1CW5 A;  4L9I A;  4ASV A;  3N9M A;  4WW0 A;  4GOE A;  1RHZ B;  4U2Z A;  1IFJ A;  1NTZ D;  3RF1 A;  4DOJ A;  2M6B A;  3K8P C;  5LGN B;  1YD8 G;  2H3R A;  4W80 A;  2WS3 A;  4HKA A;  4PJN A;  1KFN A;  1USD A;  1EXI A;  5C3J A;  3QNU A;  3KFW X;  2GUV A;  3UT5 E;  2H89 C;  4YSX A;  2V6X A;  4DJG A;  4DID B;  3RIF A;  1RE4 C;  4DR7 T;  1KYO D;  1SP4 A;  3LDQ B;  4AQR D;  5CGM A;  4NUU A;  5AW9 B;  4YLH A;  3GF3 A;  4PD4 E;  4MN4 C;  2PBI A;  1LJ2 A;  5AQO B;  2V8S V;  2E74 B;  1X22 A;  3A0B E;  2KT9 A;  2V7J A;  3ETV A;  1XNQ T;  1PGO A;  4HN9 A;  3GN5 A;  3ZC0 A;  2J5U A;  5AW2 B;  5KKZ C;  2L5G B;  1PGP A;  2XNX A;  3RGU A;  5ABE A;  1ZRT E;  1G8X A;  2KNC A;  2FY8 A;  2W0G A;  5HEU A;  4YY3 T;  4DV0 T;  3E1R A;  1VF5 B;  3H1L G;  3L4F A;  4DVD A;  4KI0 F;  4JI4 T;  4HKZ H;  2MYS A;  3A5T A;  4IFF A;  1FS0 E;  1MKM A;  2ZXX A;  4N6J A;  3ZYM A;  4L5G A;  1KB9 D;  4PD4 H;  4W7Z A;  2HPC A;  1SQP G;  1HNW T;  2KND A;  1Q7Y Q;  1L0N J;  1NTM K;  1R5L A;  2XZE A;  3A0B H;  3HE4 A;  4PAG A;  1BR2 A;  4YJ2 E;  4AKI A;  2NZ2 A;  1JCD A;  1NTK J;  4IDO A;  2WU5 A;  1HFA A;  1XNR T;  4G63 A;  3RBZ A;  4LF4 T;  3FBL A;  1D1A A;  2BBH A;  4DBQ A;  3H3M A;  1X8Y A;  2N1T A;  1FDO A;  2C9N Y;  1GK4 A;  2FFD A;  2PFX A;  3A3Y B;  3H32 A;  5F3J A;  3L72 E;  3Q5S A;  1URQ B;  2FJE A;  5TAO A;  3CWB G;  2XKM A;  3AEE C;  3PUR A;  1LTS C;  2IX7 C;  1OMI A;  4MBQ A;  1BR1 A;  3UU6 A;  2KSR A;  3RX6 A;  5JVD E;  2DWK A;  2XQ8 A;  3AEC A;  2IYP A;  3RRW A;  4I43 B;  2M0B A;  2ODV A;  3GWH A;  2AEF A;  3L73 E;  1SQV J;  3PUV F;  2V1D B;  2XSB A;  5LBM A;  4GIW A;  3CCM P;  3GA8 A;  4QMA A;  2QVA A;  2N1T D;  4JBW F;  4PJ0 H;  1U5P A;  5HXR A;  1YIT P;  5LA6 E;  3RL0 B;  4NPP A;  3CQC B;  1IFN A;  4B3R T;  2J58 A;  4ILA A;  2YKS A;  3ZDM A;  5GTI E;  1IFM A;  2AXD S;  3FXE B;  1SHZ C;  4TLF A;  4XE5 B;  2Y6X A;  3Q5D A;  4WY4 A;  3A8Y C;  4OH8 B;  2YN6 A;  1SQP J;  4I7Z B;  5AW0 B;  2LHR A;  5AVR B;  3PDY A;  4ZI7 E;  3MK7 C;  3VP9 A;  1KNP A;  3B8E B;  4COF A;  2B89 A;  2WIT A;  3L74 D;  5KLV E;  5AQJ B;  2LSY A;  3M9Q A;  3QB5 K;  2G3A A;  1LTJ B;  2J59 M;  4HGA A;  3WU2 E;  2Q9Q A;  3ZMV B;  2YDS A;  1IZN B;  1CHU A;  2V7M A;  2OYI B;  1ZKE A;  1L4A A;  1PIX A;  4WBN E;  3RGL A;  3FZK B;  4WY4 D;  1KNZ A;  3FX0 A;  1N33 T;  1Y8A A;  2XAG B;  2CPT A;  5E0O A;  2OTL P;  1FDI A;  1NU1 E;  1QEX A;  2FJD A;  2FYN B;  4X1Y E;  1IBK T;  2P10 A;  3ZN0 B;  4YTN A;  2YEV C;  5FNV E;  2KUB A;  2BCC D;  4DV3 T;  2WQY A;  2Q9Q D;  3C4W A;  3N5L A;  1U4Q A;  1HF8 A;  5KJ7 C;  4D6T G;  5HEH A;  3WU2 H;  1L4A D;  3PH0 A;  3F89 A;  3G9R A;  2KLU A;  4ZI3 D;  2P67 A;  3I55 P;  3TLT A;  3I5C A;  4UVC B;  1SLQ A;  2CHO A;  1PP9 G;  3RC3 A;  2YIU C;  1JUN A;  2D0T A;  3VYI A;  3AAA B;  4I55 E;  2FYU D;  4PJM A;  2Q3I A;  2IBZ G;  1L0L E;  1WLX A;  1MIY A;  3C50 A;  2ACX A;  1NWQ A;  4OYK A;  3N2K E;  3NRY A;  2HLO A;  3MHV A;  4HE8 A;  2Z6E A;  3VKH A;  3EFG A;  4AQF C;  2V7L A;  2CBI A;  1VOM A;  1M7K A;  4IFD K;  1LT1 A;  3AEF C;  3MD0 A;  5AQN B;  1RE4 A;  2PAJ A;  3LK2 B;  1NTZ K;  3OJA A;  2C9L Y;  4H9S E;  3L73 J;  3CCV P;  3HKC E;  1D1C A;  3JAE A;  1S9K D;  3H1I G;  2WU2 A;  2H88 A;  4KHX A;  3OVU A;  4KUM B;  2HN1 A;  2KIN B;  4O9B A;  4EI2 A;  2E43 A;  4L76 A;  1KMI Z;  2WY2 A;  5CJ4 A;  1HH0 A;  4UEM A;  2Q9I A;  5EK2 A;  4AIU A;  1GU5 A;  1EZ3 A;  2P2U A;  2W66 A;  5CB4 E;  1MMA A;  3M0D C;  2UU9 T;  2ACZ A;  1PL5 A;  5HCJ A;  3V2R A;  1LTI C;  1R8I A;  2OLT A;  4D6T J;  2ITA A;  3S4U A;  4ISS A;  1KOR A;  4H9Q C;  2KIK A;  3FWL A;  5ETW A;  4LGD E;  4IDZ A;  5CCG C;  2RP4 A;  4ZI2 D;  2KZI A;  3PUZ F;  4I0U A;  5KLV J;  1PP9 J;  3V5U A;  1J1D C;  2WMM A;  3JCU E;  1X0T A;  2X0H A;  3ZPO A;  4B3M T;  2WZI A;  1KZU B;  1ZR4 A;  2BG9 A;  3B71 A;  2O1J A;  3LID A;  3GMA A;  1LNQ A;  1IFP A;  1IFD A;  3UTK A;  4LF7 T;  4KMC A;  3ZMS B;  4JI7 T;  3AAE B;  4O4L E;  3UUL A;  2HFE D;  2YMY A;  1BGY E;  3CX5 H;  3HE4 B;  2D2S A;  1IK7 A;  1GU4 A;  1QVG O;  2K3R A;  5DAB A;  4IL6 H;  5AW8 B;  2W90 A;  3TLW A;  1NU1 J;  2A2F X;  3FXD B;  3AA7 B;  2VKJ A;  2V6Y A;  1GK6 A;  4JI0 T;  4NPE A;  2FFD B;  1N36 T;  2Q5U A;  4YTP C;  3OW2 O;  3H32 B;  3H1I J;  4P09 A;  3JCU H;  4PK4 A;  1LT9 A;  3KV9 A;  2AEJ A;  2D2C D;  4HFE A;  5FVK A;  5B5E E;  2N2N A;  5AVV B;  2J47 A;  3B13 A;  4TV9 E;  2XPK A;  2QRX A;  3RK3 E;  3KXD A;  1BDC A;  3CXH I;  3FGA D;  2LKG A;  2XAS B;  5FYM A;  1JM0 A;  1SQB G;  2JQ9 A;  4L73 A;  3P7K A;  5H2F H;  3Q5R A;  5AVS B;  2MBG A;  3M3Z B;  4AQG A;  3NXS A;  3EAB A;  3ZMZ B;  4RO0 A;  2ZT9 D;  3N2O A;  4HEA A;  1OED E;  5LP6 E;  3AE1 C;  3AEA C;  5APQ A;  2CXF A;  3PP5 A;  3O6Q A;  2YU1 A;  3KYQ A;  1KF6 A;  4HWH A;  4UB8 H;  3NKZ A;  4Y28 J;  5IWA T;  5CMZ A;  4RES B;  5AVW B;  4GYR A;  1ZOY C;  1BCC G;  3P8M C;  1W09 A;  1ZP0 C;  5B5E H;  1SUM B;  2BS4 A;  2W67 A;  4WY4 B;  4AYC A;  3LJC A;  2ZYG A;  4JYB A;  4TWD A;  2K24 A;  3UU3 A;  4FJO A;  4HFI A;  1S5L X;  2K3W A;  1L0N D;  5LG4 A;  2LLY A;  1LTT C;  3OYX A;  3BQK A;  1JTH B;  2H7V C;  5L3G B;  3PJA J;  4UEL A;  4L74 A;  1S5L E;  1HTJ F;  2B87 B;  1BE3 G;  4Z91 A;  1RQV A;  4CZZ B;  2C0S A;  4DR3 T;  1H89 A;  3LBX A;  2NWB A;  3L09 A;  3L35 A;  1UUS A;  3CCR P;  4X5T A;  3OBV E;  5APU A;  1FJK A;  1D0Z A;  4BJN A;  5CHX A;  4Y99 C;  5AW4 B;  2C0W A;  3ZYK A;  1SFC C;  4M3L A;  2CA5 A;  2OYH C;  3UU5 A;  2E75 C;  5C39 A;  1L0V A;  4LFB T;  3ZLI A;  1H8A A;  3KDP B;  5LYJ E;  2Y8D A;  5IUX A;  2W8Z A;  1W0B A;  2Y0D A;  1J1E B;  2WPQ A;  2D0U A;  2FYU G;  1HGZ A;  1KIL A;  1H88 A;  3N7N A;  3TGU E;  1YXR A;  5BU8 B;  3RC8 A;  5H6R B;  2MKV A;  3GW6 A;  2E9X A;  1HUC A;  4C7R A;  3KVB A;  1JY3 O;  3D6Y A;  4GT1 A;  3H1H G;  5APX A;  1FIO A;  3H1L D;  2W27 A;  4HWI B;  4JF7 A;  2X66 A;  3Q3D A;  1MIV A;  1EQ7 A;  1SQQ G;  3H1K E;  2JEE A;  2LOS A;  1XMQ T;  3AEF A;  3F31 A;  1OW6 A;  1ZHC A;  1SQP D;  2W2U A;  5DQV A;  3VR9 A;  2H7O A;  2QEX P;  4JBZ A;  1J1J A;  2WSF H;  1KIL D;  2DI4 A;  2XM2 A;  2A06 G;  1N73 A;  1FEW A;  4BAY B;  3EFF K;  5JDG A;  1X79 A;  1YQ3 A;  5FXZ A;  2FJB A;  2N1T C;  2E9X D;  2V7Q H;  1EDI A;  3CCQ P;  5HEG A;  1OZH A;  2FFD C;  3JC6 C;  3K3O A;  1NJI Q;  3KV4 A;  2RH0 A;  2W4X A;  2M5A A;  4YJ3 E;  3UU4 A;  3CWB D;  2Q7C A;  3GHG A;  3B57 A;  3AEC C;  3SWH A;  5ABF A;  2C5J A;  2XU6 A;  1YTZ T;  5KKZ B;  4NXN T;  2DNX A;  2WB5 A;  1VQ7 P;  2A3D A;  2XQA A;  4K0U A;  2Z5I A;  1W0A A;  2ZVN B;  3AA1 B;  5HXC A;  3CQG B;  1KFY A;  3V5B A;  4IE5 A;  2LOP A;  5K5G B;  5L3C B;  2PGD A;  2GM4 A;  3N4X A;  3RIU A;  4P1N A;  3QC9 A;  3EHZ A;  3TLV A;  2QIW A;  3KV5 A;  2WM9 A;  5GTH E;  3BRT B;  2E5L T;  5ABG A;  1UGO A;  2IIU A;  2XND H;  4K3A A;  1HBW A;  4GKJ T;  5FY0 A;  2D9D A;  4DV2 T;  3NFQ A;  1A02 F;  1JY2 O;  1U57 A;  4WY4 C;  1MZ9 A;  2XQ6 A;  4O2B E;  3MGN A;  1EXJ A;  3CX6 B;  4QHO A;  5CCG D;  2JQK A;  2LM9 A;  3EI0 A;  1G1J A;  2WSE H;  1SQX E;  5L2L A;  5EK3 A;  1KQL A;  2B1E A;  3L71 E;  3QUJ A;  5HAX A;  3PU8 A;  2Q9Q C;  2B9B A;  5BMV E;  4G2A A;  3RKG A;  1L4A C;  4GOF A;  1SA0 E;  2YO2 A;  2O01 N;  2WSF J;  3U3I A;  3RYI E;  3TKL B;  4B3S T;  4NXM T;  3TGU J;  1FJP A;  2V7Q J;  1YKH B;  4TN7 B;  3AEA A;  2PRR A;  3BAS A;  3USS A;  4GIF A;  5AVX B;  5AQL B;  1RQU A;  5CBO A;  4DO0 A;  2PP6 A;  1Z0P A;  1RY3 A;  5CJ5 A;  3AE8 A;  5L3D B;  3NRX A;  4EOT A;  3KBT A;  1J1E C;  2WQY C;  2IML A;  5JDM A;  4DV7 T;  2NW8 A;  4BRY A;  3H1K J;  4I4T E;  4A97 A;  4JI5 T;  1ZOY A;  2A45 G;  3ETU A;  4DV1 T;  3O6Q B;  4D6T D;  2SPZ A;  1SVF A;  2B88 A;  1FMV A;  2CXD A;  4A98 A;  1MMN A;  3CVR A;  3EAM A;  1M1K Q;  1LP1 A;  4OHF A;  5LBQ B;  3AED C;  1L0N G;  3EUH A;  1PP9 D;  3L75 G;  5AQP B;  3C98 B;  4U3F E;  1JEK A;  3BCC E;  1SQX K;  2V5C A;  3ABV A;  5HXE A;  1NTK G;  4IE7 A;  3M65 A;  2IBZ D;  1VDF A;  4X1I E;  3P8C E;  1LTG C;  2IFN A;  1W2B O;  1NTM E;  4WBA A;  2CK3 H;  4TNV A;  1KTM A;  1XTG B;  2KI7 B;  5AW6 B;  3D71 A;  1YQ4 A;  2QJK C;  5E79 H;  3WUV A;  1N8R Q;  4X65 T;  1FMW A;  2VRS A;  4YT0 A;  1NU1 D;  5BR8 T;  3ITK A;  4EGW A;  2UUB T;  4H0L D;  1SFC A;  2WSE J;  1KFM A;  3CL3 D;  1NYH A;  5FXX A;  5KMG P;  1PPJ G;  3HA4 A;  3L70 E;  2OYH A;  1QVF O;  2H88 C;  3H1J E;  2XQ4 A;  4ZI2 C;  3G3Z A;  4X1K E;  3II6 A;  2GA1 A;  3H1I D;  1SQV G;  4Q25 A;  5HYA A;  3OTO T;  3KPE A;  5F8P A;  5AQK B;  5L47 A;  3ZT7 A;  4CI2 B;  4KJM A;  4IL9 A;  1E79 H;  4H44 C;  2ZM2 A;  4YXW H;  3PRJ A;  2JWA A;  2KB7 P;  4C90 A;  2RN0 A;  1M1J A;  2RKL A;  4OGQ D;  4C46 A;  2YIU B;  2PFV A;  1WRG A;  1IJD B;  3RK2 D;  1SFC D;  2POH A;  3ZSS A;  1Q2N A;  4L75 A;  3P50 A;  2E75 D;  3GLM A;  3L71 J;  5FP3 A;  1Q82 Q;  1DX7 A;  3L75 J;  4XA4 A;  4DZO A;  2BG9 C;  1UII A;  2LSI A;  2KZ7 B;  5AQG B;  1N2D C;  5HEJ A;  1D0Y A;  2D2C C;  4IGU A;  4PV1 D;  3DP7 A;  5EK4 A;  1YTZ I;  3PJS K;  3K3Q C;  1OVR A;  3ZEF B;  3WUT A;  2CHN A;  4E7S A;  5LXT E;  3TLU A;  2AXT E;  3IF4 A;  2QM7 A;  3IEE A;  3WI3 A;  4DBR A;  2N1G A;  2W6B A;  1X79 B;  2E5T A;  2ZYD A;  1HF9 A;  2ZT9 C;  1SQP K;  1ZV8 A;  4UB6 E;  1E5W A;  1GL2 C;  5EZY E;  2UUC T;  1M7L A;  2M5A B;  1LT9 C;  2XQ3 A;  1K9M Q;  4HFV A;  4CPG A;  3CX5 D;  2WCA A;  4P0A A;  4WZX A;  2BEZ F;  3CXH E;  3H37 A;  2N9Y B;  4I2L C;  4GKK T;  3GHG B;  2OTK E;  5AW7 B;  2R5B A;  3O1J A;  5F5W A;  1EZV I;  3JC6 D;  4LFC T;  2AXT H;  1FZG A;  2V4H A;  2M67 A;  2E2A A;  1SQB D;  4HTE A;  5LHH B;  2OQQ A;  4UV9 B;  3M91 A;  3RL0 g;  1J1D B;  1IJ6 A;  3N9P A;  2HOD B;  4IIJ E;  4OK0 A;  4UF0 A;  1NTM J;  1VCS A;  4UB6 H;  3RH3 A;  3MJX A;  1BDD A;  3E0Z A;  1T2K D;  3ZYL A;  5L3E B;  1D7M A;  3IR9 A;  3RQU A;  2JO1 A;  3CXH H;  2XSA A;  3RKO A;  4QH1 A;  1HCI A;  3L72 G;  2CWY A;  3P4S A;  3CPW O;  1QX8 A;  4H9P C;  4KP3 C;  3AVS A;  4LMJ A;  1BCC D;  2P1J A;  1AFO A;  1T3U A;  4DCK A;  2X0Y A;  3TNU A;  1OED A;  3FZF B;  1T7S A;  2VKD A;  3RYF E;  1CUN A;  3L70 J;  3H1J J;  3L73 G;  1ZXG A;  1IBM T;  2JQH A;  5APW A;  5GTI H;  2W6J H;  2J62 A;  3ONJ A;  4EIW A;  2Q3E A;  1HTL C;  1NTZ E;  2FXP A;  4QH4 A;  5KDM C;  1K04 A;  4EDF A;  3B4S A;  2K9J A;  2JJL A;  5APY A;  5JDF A;  1JOC A;  2KWH A;  2BKP A;  4HFB A;  3T8O A;  1BE3 D;  4BJM A;  3J9X 1;  2K37 A;  2KLQ A;  2IUB A;  3B5N A;  1YHQ P;  2YIN A;  5BVZ A;  5JDH A;  5JRC A;  3UFG A;  4JI3 T;  4PJJ A;  3NZQ A;  2NTX A;  1M56 D;  4AQY T;  1HVV A;  2WSC H;  2IZ0 A;  3TF5 A;  1U7M A;  2BS2 A;  2KLV A;  1T8B A;  4JEU B;  1KYO E;  1LKX A;  1DD4 A;  1JO5 A;  1Y64 B;  3HUS A;  1PZQ A;  3CPZ A;  3AE5 A;  5KLV G;  2XZR A;  3HD7 A;  4C7N A;  4BRY B;  2YKO A;  1GZL A;  4WWI A;  3EVY A;  1J5E T;  1KIL C;  3AED A;  3IAO A;  3C9I A;  4HFH A;  4EXT A;  2OYO A;  3V4Q A;  3MZK B;  3VRB A;  2R3S A;  3RBX A;  4PFO A;  3B5N D;  2VVN A;  3P4Q A;  1QLB A;  4CN1 A;  3AE4 C;  5AQF B;  2E9X C;  2PTF A;  3V2Q A;  1UUR A;  3L72 J;  4IT4 A;  4A5X A;  3HKE E;  1UX5 A;  3H1H D;  2WDV A;  5B66 E;  2W61 A;  2ZM6 T;  4DR2 T;  3HRN A;  2I59 A;  2FKW B;  3RRC A;  2KP8 A;  3TDK A;  3VMX A;  1NU1 G;  1SQQ D; 
#chains in the Genus database with same CATH homology
 5CBN A;  2I8D A;  3RGU A;  3QB5 K;  2KI7 B;  5K5G B;  2ZAE B;  2KIK A;  3PJA J;  3RIU A;  3FXD A;  5DJT B;  4WYV A;  2B87 B;  2KZI A;  2P58 A;  1LP1 B;  4ASW A;  2WMM A;  1X0T A;  4HKZ H;  1BDD A;  2KS1 B;  1OVV A;  4K3A A;  4EYY Q;  4K35 A;  4BXL A;  2HR3 A;  4KJM A;  5DJU B;  5C39 A;  2KUB A;  1H0T A;  2K3R A;  1H0T B;  3QWO C;  1S3J A;  1EC5 A;  1ZXG A;  2JWD A;  3AXJ A;  2RKL A;  2LXB A;  3PH0 A;  3AXJ B;  2KZJ A;  4NPE A;  4HJG H;  1OVU A;  3RIU C;  2LXC B;  1Q2N A;  4GOF A;  1EDK A;  1SS1 A;  3MZW B;  3FXE A;  2UWJ E;  4IOI H;  4ZMD A;  1JMB A;  1EDL A;  4ASV A;  1KEY A;  1DEE G;  2QRX A;  4GOE A;  4ZNC A;  1BDC A;  2M0B A;  4NPD A;  3QB5 A;  1U7J A;  3MHV A;  1JM0 A;  4NPF X;  1OVR A;  4HB1 A;  5CBO A;  1U7M A;  2QVA A;  4JBZ A;  1J1J A;  1LT1 A;  2LR2 A;  1MFT A;  1EDJ A;  1FC2 C;  4WWI A;  5EFW B;  3ZDM A;  1EDI A;  2SPZ A;  2B88 A;  4GOD A;  3PJA A;  1NVO A;  2B87 A;  2M5A A;  1ZW0 A;  1LP1 A;  2M5A B;  2Q1K A;  4CPG A;  3S1K A;  2OTK E;  4MN4 C;  2R44 A;  1Y47 A;  2B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...