2QRXA

Crystal structure of drosophila melanogaster translin protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
b'NFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM27569p
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qrxA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qrxA01
5DJUB 2KUBA 1LP1A 2LXBA 1ZW0A 1KEYA 1EC5A 5EFWB 2KZJA 1FC2C 1EDIA 1H0TB 3AXJA 3PH0A 3QB5A 4IOIH 2RKLA 2KS1B 3AXJB 1NVOA 1ZXGA 4CPGA 2B87A 2SPZA 2KZIA 2P58A 4BXLA 3RGUA 3S1KA 1JMBA 2B89A 1OVVA 2QVAA 4EYYQ 2Q1KA 3ZDMA 1H0TA 1OVRA 2K3RA 1X0TA 3MHVA 5C39A 5CBOA 2KI7B 2QRXA 5DJTB 3PJAA 3PJAJ 2KIKA 4ASVA 4NPEA 4NPDA 4KJMA 2JWDA 5CBNA 1U7MA 4ASWA 4K3AA 1BDCA 1S3JA 4K35A 4ZNCA 3QB5K 4GODA 1EDLA 1EDJA 2HR3A 4HKZH 2M5AA 4GOFA 4GOEA 4ZMDA 3FXEA 2WMMA 4JBZA 2M5AB 3MZWB 3QWOC 1LT1A 2B88A 1BDDA 2M0BA 4NPFX 2UWJE 1Q2NA 2R44A 1LP1B 1U7JA 2OTKE 2LR2A 1JM0A 1Y47A 3RIUA 4MN4C 3FXDA 1J1JA 3RIUC 2ZAEB 2LXCB 2I8DA 4HJGH 1OVUA 1EDKA 1DEEG 4WWIA 5K5GB 2B87B 4WYVA 1MFTA 1SS1A 4HB1A
chains in the Genus database with same CATH superfamily
3CWBJ 3TLSA 1CW5A 4JYCA 4HGAA 4IDQA 4DV7T 2WWWA 3AEBA 4PFPA 3BQIA 4YTPC 1EC5A 4IDZA 5LMNT 1IFDA 5TAOA 2Y8DA 4HN9A 1V9DA 5JDLA 3M91A 4K0UA 2HN2A 1EDIA 1FAVA 1M62A 4DZOA 2UUAT 2WMOA 3CCEP 3K5BA 3LJCA 5AVUB 5CB4E 5FKYA 2XDJA 3EWKA 1HNXT 4G63A 4O8SA 2BZBA 1P84I 1FIOA 1GMJA 3V2NA 2UXDT 3H1LJ 1SQBG 3VP8A 1JMBA 1QVGO 2NWBA 3RH3A 1BE3E 4TZ4C 1T8BA 4JI5T 3L37A 1OVVA 5AVXB 1L0VA 1WR0A 2YEVC 5C3JA 2BKPA 4HWDA 2QM7A 3K3QC 1SFCA 5AFUL 1VQ6P 3C9IA 1VCTA 2W8ZA 4UEMA 4WY4C 2XNDH 1HX1B 4DMVA 3HUSC 2R3CA 3SWYA 3VR9A 1USEA 1VQPP 4ILAA 2R6GF 1JY3O 3IFMA 1BSNA 2V6XA 2WB5A 5LNKA 5AQKB 4XFJA 1BE3G 3UTKA 2E74C 2QJKC 2QJYB 3PUVF 1EDLA 3S9OA 2XQ5A 4AKGA 3CVRA 1HCIA 3PURA 2BS4A 3WAJA 3V5BA 4NUUA 4H9PC 2W2UA 1NO4A 2W67A 4I4TE 3AE6A 2IDOB 5APXA 5L4EA 3V4QA 4U33A 2G0UA 3VRBA 3CXHE 3A0HH 2HODB 1AA0A 1EZVD 4C7RA 2Q3IA 1N73C 1HS7A 1WYCA 3LK2B 1JOCA 2OARA 3RIUA 5BVZA 1D1AA 2FBWC 3SFDC 1UIIA 4QX7B 5H6QB 4Y99B 4KX6A 4L75A 2YDRA 4DUYT 5L3GB 4TN7B 3O1HA 2I1KA 1WLXA 5JTGA 1YJWP 1KYOH 2XHEB 4WWIA 2E8IA 2YMKA 3E08A 4EOZB 1VQMP 3N9OA 4OWFA 1RE4A 2W27A 3B5ND 3JAEA 1SQVG 3CCUP 2BDEA 3CX5E 4IDOA 4IIJE 2E9XA 1KEYA 1KF6A 1JNZA 1QEXA 1Z56A 3GWHA 2E9XB 2CPBA 4CZZB 2YU1A 1S5LE 2ZYAA 4H44B 2CLYC 4KBMB 2KS1B 4GIWA 3AAIA 3AE7C 4YXWH 3AE3C 3HD7D 4IFFA 2ZYDA 3HR0A 5FNVE 2B87A 2SPZA 5LBQB 2WDQA 2H7OA 1LRZA 3KBTA 4PJMA 5JQGE 1CUNA 3H3MA 3CQGB 3FGAD 4A7PA 1N7LA 1X22A 4R4LA 2K9JB 1KMIZ 3H3AA 5B66E 4ZI7E 4EAHA 3L72G 4YXDC 2N1TC 1H0TA 1SQPK 4OGQD 1SHZC 2Y48B 3L74E 3K1SA 1AFOA 1YQ4A 3BCCD 2Q9QA 1KQSO 3P50A 1VL2A 3GHGA 1DIPA 3OYXA 3VRAA 3VKHA 3ONXA 4YPCA 4D6TG 3PJAJ 4I2LC 4DR5T 2NPSA 3W15B 4O9BA 5KTBA 2L91A 3WMM0 2FJDA 3EDUA 4KHZF 1N73B 2NPSB 3ABVA 1UURA 1ZOYC 3QUJA 1HR0T 2H8PD 3GMIA 2PFVA 1LGHB 3IF4A 3RC3A 3ZCIA 2LE8A 1GDTA 1ZRTD 3FBZA 4UB8E 3FZMB 3J7Yq 3K3OA 4HFHA 3P4QA 3L74G 3ZT6A 4ZMDA 2J47A 3PDYA 4U7YA 1KB9E 4IE5A 1BDDA 2DWGA 2WSEH 3H1JJ 2JJLA 2WT7A 3AB3B 1SQVD 3ZSSA 2A2FX 1SUMB 1KZUB 2WT7B 3VKGA 2OTKE 3CXHD 1JCDA 3N5LA 1YKHB 4L0RA 4C7NA 2Z4EA 1JY2P 3FXDA 5AQTB 1JY3N 2X0YA 3AVSA 2OA5A 4C7NB 1AVYA 4ADZA 5AW4B 2E76B 2D2CB 4L9IA 2WZ7A 1YQ3C 4JUYA 1IBLT 3ZN0B 4JI3T 2P1JA 2BG9C 3KV4A 1W09A 1SA0E 3H32A 4LMJA 1M1JC 2CXLA 1OEDC 4U3FJ 5LGNB 2CXFA 2ZVNB 1KILB 2N1TB 2KZJA 2VB6A 1PFIA 1D0YA 1KFMA 5APVA 3L72D 2XAFB 4QH4A 5LHHB 1RF1A 3AA6B 3L70J 3AA7B 3TYYA 3DP7A 2KOGA 4IE4A 3KBUA 2PFXA 3A0BH 1NVOA 5L3EB 1ZKEA 3EI0A 1T7SA 4IL6X 3CIRA 3CL3D 3D6YA 3T8OA 3RKGA 2UXCT 4D6TD 2WMNA 2LSYA 2OV9A 1RE3C 4YSZA 4EYUA 4I6MC 1L4AC 1QUUA 2Z5IA 1T3UA 2V7JA 2FXMA 3EQ2A 4U74A 3M9BA 1L0ND 5L3CB 2I6HA 1JEKA 4H63V 3UT5E 2W63A 1YYCA 1KILE 2A45H 5ABGA 3B8EB 5CBOA 1LTBC 3VHLA 4ISSA 3E22E 3L71D 4EI2A 2E5VA 1JNMA 3Q5RA 3L09A 2XQ6A 2WSCJ 5CA0E 5TISE 2XSAA 1X79B 1M8OB 2BCCJ 3TLTA 4B3RT 2H89C 4W7ZA 2BS3A 3CCLP 3HE4B 1BDCA 2ZFCA 2VRSA 1P84D 3LG7A 1OZHA 3N4XA 4DUZT 4N3YB 1IZNB 4HWFA 1KNZA 1TU3F 2VKOA 1EDJA 4RESB 3L39A 1GD2E 2I59A 2CXDA 3RC8A 3SRZA 2XNXA 4PAGA 1JUNA 3HE5B 3S4RA 2FYUG 3AE4A 2IFNA 1W2BO 3A2AA 3MZWB 3HTKB 3L75J 1OEDB 3CKDA 1NWQA 2O3JA 4HFIA 3ZC1A 4TT3H 4IE0A 3N9NA 3QOFA 4ERRA 1MMGA 4QXBB 4I50E 4X1YE 5HEJA 2Q9QD 3OYZA 4UVAB 2ZAEB 3H1IJ 2WWVA 3TLUA 3PU8A 1JMMA 4BRYA 5GTIH 3TGUE 1MNDA 3NTNA 3PHLA 2YIUB 4ZKUA 4XE5B 2JIWA 1MV8A 4X64T 1N34T 2XQYA 2NTXA 1Q86Q 1L4AB 4PNIA 3AE1C 1LTAC 4W7YA 5JDFA 4YFSA 4B86A 3O8ZA 2BVLA 1OW7A 5HWXA 2B1EA 2LHRA 4F8HA 1ZLLA 1LT9A 1EZ3A 5LGTB 2IHR1 3AA1B 2J62A 5FXVA 4PD4E 1LT9B 2IYOA 4HE8A 1GTWA 3TDKA 4ZI2C 1IK9A 1JO5A 2ZT9C 3A3YB 3N9PA 5TJHA 2JEEA 2L5GB 5J1GA 3TGUG 5KDMC 2FFDA 2AE9A 1W9RA 3KZIH 2FFDB 3ANWB 1CSBA 2Z6EA 3ONLC 2BBJA 2IMLA 1KFNA 3ZEFB 2WTYA 3CMLA 1S2EA 5HXSA 2K3RA 4U3CA 3ZMUB 1S1CX 1UX5A 2OTJP 3T1YT 3P4RA 2VQET 2QA7A 2PJQA 2OGUA 4NXNT 2NW8A 2EHOA 2FYUD 2VQFT 2X51A 1Z0PA 4HWCA 1NYHA 2PGDA 4NPDA 2LSIA 3AE9C 2DLRA 3OVUA 1LTJA 3UUBA 2J1DG 1LTJB 2JMHA 2R5BA 2J4GA 3Q5DA 2E42A 3A8YC 2LM2A 5JR9C 5KJ7A 3AEEC 1ZV4X 4J2CA 4ZS2A 4CI2B 1PGQA 1MMNA 4Y28J 3RK3D 5FL0A 4AUWA 2CRBA 3QWOC 2AEJA 3NZQA 4UR9A 2Q6QA 1J1EB 1UCUA 3V2QA 4DV1T 5JRCB 4JV5T 1YBKA 3NWIA 1CHUA 3L73E 5AW5B 1QLED 4LF4T 2WVRA 3ZMZB 1BCCE 2K9AA 3U3IA 4E7SA 2W62A 3ZSTA 4OX9T 4U7JA 1YHQP 2W61A 3OA7A 3AEGC 4LLHA 2WDRA 1XNQT 4LF9T 5DQWA 5JDHA 4IE7A 3A5TA 2BS2A 2D9DA 1WCRA 3RL0B 4ZZBA 4UB6H 3KXDA 5AVWB 5EFWB 2QJPB 5HAXA 4L5GA 4K0KT 4TV8E 3L73G 2ZM0A 1BCCG 2K9YA 2RMZA 2DNXA 1S5LX 2NRGA 4HFCA 1GQEA 3U1AA 4H13D 2L3LA 4IFDK 1LWUB 1J5WA 4WW0A 3JCUE 3GA8A 2WITA 2YO2A 3IN6A 3Q5PA 1S9KE 3MTUE 1N7SB 3M0DC 4JI2T 1NTZE 3B5NC 5CCGA 5FY0A 3L35A 4TNWA 1I94T 1SQQD 3KHUA 1GL2D 1HNZT 4YHHT 1E2AA 3SOLA 5JH7E 1EXIA 4IGUA 3P8CE 2W6JH 5KAIH 3NVOA 3TK1A 1OIPA 3CMEP 5HCMA 3GN5A 3UU4A 3E1IA 2A06D 3GN5B 4LFAT 2Q9IA 2ZLYA 2M6IA 3L8RA 1L0LE 3HD7C 4LGDE 1T2KD 5LBMA 3P8MC 4N78E 4FJOA 1R5LA 1IBMT 2OLTA 4ZNCA 4ZKPA 3GG2A 3AEFC 4RO0A 5IYZE 1NTZG 1G8XA 2JQQA 3H1HE 1GW4A 3RYHE 2E75D 5ABFA 5CA1E 1X9VA 2O1KA 3TNUB 3BCCJ 4OGQC 3MKDA 1L2PA 1LT1A 3AECC 4MALA 3UU8A 1NTME 2BEQD 3KV5A 4IT4A 4DR7T 5AW1B 2I0MA 5AQIB 3NMDA 4PJ0H 3M65A 2PP6A 1NU1D 3AEBC 5HEUA 3BASA 2CM0A 4X62T 3B4SA 2WSEJ 3B13A 2VKJA 1SQXG 2C0WA 2EHOD 1X9BA 4Z91A 2QM8A 1JTHA 3P4WA 2KLQA 2ZYGA 1R5SA 5LMUT 1ZP0A 2Y0CA 5K5GB 2CCQA 2WDVA 1K73Q 3CX5I 3A0HE 2ODUA 2MBGA 1U57A 1PGJA 3BK9A 4DOJA 2XUEA 4WNKA 5M4YA 1PGPA 3RHWA 2IPPA 2DHRA 2M3BA 5C8YE 5DQVA 3C1LA 2WWUA 2RA1A 2YK0A 3PP5A 3SFEA 3PH0A 3OW2O 1HVVA 2WBLA 2WSSV 2MJZA 2WQYC 2P58A 1KYOE 1URQD 2D5UA 3HD7B 1LKXA 3CD6P 1PP9J 1IJ6A 1BGYE 1NKZB 2CPTA 2IZ1A 3RF1A 2QVAA 4EYYQ 2A9UA 4GK0E 3RL0g 2W66A 3AEAA 2KNCA 3I0OA 2WM9A 3ZPOA 3KQGA 3L72J 1NTZD 3ZC0A 3V5UA 2KNCB 3UUXB 2JQHA 2PTFA 5L2LA 2MAWA 4PFOA 3CI9A 2E2AA 3AE2C 5L47A 1A02F 1M7LA 4WBOA 5HXHA 1SQVK 3I1AA 3O4XE 2NW7A 3AAEB 3OTOT 1NAYA 4QH5A 3CCRP 1NTKG 3EFGA 2KSEA 1FZBA 2BVMA 1K05A 4H63H 2Q3EA 2O1JA 1L0NJ 1KNRA 4IL6H 5F8PA 1K9MQ 3WUUA 3HKDE 1XDOA 1SQXD 1XTCC 2M5AA 2YNYA 4EGWA 3B71A 5CJ0A 1KB9I 2AXCA 5KLVE 2M5AB 4I55E 5LA6E 4LFCT 2QYWA 3RK2B 3L71J 3UUNA 4HYTB 1WR6A 2FJEA 1RE4C 5CCGD 2FXOA 1FJKA 1LVFA 1U4QA 1T3JA 1WRDA 1GK4A 2LJLA 2IC9A 2AEFA 2FYZA 4ZOLE 3UQ4A 1OXZA 3NFQA 2FXPA 4HWHA 4PJNA 2XPKA 2W00A 4I1LA 3AE8A 2L9QA 1YI2P 4MHCA 1T8ZA 2HODA 2XQ7A 4EZ4A 3F31A 3ZYLA 1HF9A 4DCKA 3FWNA 3VMXA 4GIFA 3UU5A 1FOSE 2V7IA 3MACA 3ZMVB 3FHNA 1L0NK 3MZKB 5A1LA 2DCFA 1FOSF 4P0BA 2XZEA 1VF5D 1SQPJ 2KSRA 4AISA 1ZXGA 4MFRA 2Q9QC 2ES0A 1G2CA 2OYIC 5KMGP 3JC6D 1H7CA 2WS3A 3WUVA 2POHA 1G2CB 3KDSE 2V1DB 5AQFB 1SQBD 2ACZA 1AQ5A 1VRBA 2A3DA 3JCFA 2WP9A 1ZR4A 1NTKD 3ETVA 3WU2H 4QXHB 2KS1A 5AQJB 4HFEA 1K04A 2MKVA 4WY4B 3CWBE 3LFMA 3HUSB 1Q82Q 3NKZA 2QRXA 5ABHA 1UX4A 4IFMA 5LP6E 3EHZA 4IHJE 4H9SE 3IR9A 3BQKA 3PRJA 3HKEE 4LF7T 2K9JA 5CBNA 1OW8A 4ILUA 1K8AQ 3WAKA 2E74B 2QJKB 4DV6T 1JB0J 5APYA 1BE3D 4JEHB 4CI3B 3H1LE 2IX7C 5AW6B 2KXPB 3VN0A 1DEBA 2XSBA 5AVVB 4Z90A 3FX0A 5LB7B 1KD1Q 3P4PA 1VQLP 1E79H 2FYNC 5EK4A 2K24A 2FYUJ 1PPJE 3P32A 1N73A 2N9BA 4X65T 5LXTE 2UWJE 5FP3A 2MTQA 5AQRB 3FZFB 3SFDA 1HJBA 3FWLA 1OFCX 5FMNA 4PW8A 1NWMX 2DWKA 3N7NA 2IW5B 1M57D 1WRGA 1M1KQ 1KC8Q 2JJ9A 3UUMA 4CN1A 3EAMA 5LGUB 4JI0T 1MNEA 3H1LG 1OMIA 4H0LC 2KP8A 1GU4A 2HYNA 4N6JA 5JREA 1WFDA 3CC4P 2LXBA 1MUUA 1ZW0A 1PPJG 3RK3C 4AYCA 5HEHA 1G1JA 4EV6A 5BMVE 4A5XA 2WU2A 1SFCD 3C4WA 2XV5A 1PIXA 5E79H 3AE7A 2CLYB 4PD4I 2UXNB 2VL8A 1G1IA 2V7KA 1WMKA 4IDNA 2YKPA 2HLOA 4COFA 4ZEYA 2QG4A 4DR1T 2FYUK 3L4FA 3EVYA 2H88C 1N33T 3CXHH 1VDFA 3D0TA 3U78A 3RBZA 5AQGB 4HH2A 3RIFA 3ZMTB 3CCVP 1U5PA 1IK7A 2YKSA 2OTLP 1KILA 1E1HB 2N1TA 4YXDA 4IL4A 5GTHH 4DR6T 2E5TA 3LDQB 3ZDMA 3A7MA 3IHRA 3CX5D 2KMFA 3MA9A 5B5EH 5LHGB 3WUTA 1X0TA 3AA0B 4P0AA 2K3WA 4JLEA 2HPCA 4FI5A 4AQFA 2HPCB 2ZJSE 3U1CA 4H9QC 5EK2A 3RYIE 3KDPB 3PJAA 2AXTE 2YXQB 3AE4C 2PG8A 3CX5H 5GONE 2VK9A 2IUBA 4DV5T 4H13C 3ZMSB 2CBIA 1S3JA 3I5CA 3QB5K 5KKZC 1VQ9P 2C9NY 3Q5WA 4O4HE 3PU3A 1W5CE 1SQQJ 5LHIB 3H1KJ 5HCJA 2X9YA 1XNRT 4H0LB 4LF5T 1GL2C 5APTA 1FZGA 2M3EA 3L74D 4JBZA 1QL1A 1X79A 2M0BA 4R4MA 3TF5A 2E9XD 2VKHA 3HE4A 3VMYA 1EXJA 5B66H 2IYPA 2JPFA 4CN6A 1LP1B 4OFZA 1VQNP 4LMKA 4H44D 1J1DC 2RN0A 1T2KC 4I7ZC 1YQ3A 2W4XA 5M1BA 4CXWA 1N2DC 2YOEA 2ZM2A 2GUVA 3GLMA 3HE5A 2E43A 1EDKA 2BG9A 1DEEG 1H88A 1CZQA 3LIDA 5AW3B 3HTKA 2BG9B 3U59A 1OEDA 4TUYE 4WYVA 3V5SA 1P84H 3ZJ1A 2E75C 2OYHC 1M1JB 2CPSA 4Z8XA 5FY1A 2WPVB 2J58A 4EEBA 4AKRB 4LF6T 2C0XA 3M0AA 1FJPA 1KB9D 3FZHB 1SQQK 3IAOA 3P4SA 5EK3A 4YHJA 2XAQB 5H2FE 4BWNA 1NU1J 1IFJA 3H1JE 2LEHA 3N9QA 4ZI3D 3RI5A 3V2PA 1FZCC 2V26A 4KUMB 3RQWA 2NPSD 1GZLA 1L4AA 1Y8AA 3E1RA 4H13B 2EHOC 2I1JA 1JY2O 3N2OA 2HH7A 3UQ7A 1USDA 5J2UE 4UB6E 2VVNA 3OBVE 2BG9E 4QMAA 4HFVA 3USSA 4TNVA 3N2KE 2LOSA 5FYMA 1OEDE 2KNDA 1MIWA 2IZ0A 2ITAA 4GK5E 2CHOA 4JYBA 2WSSH 3RIAA 4U3FE 2V6YB 3C51A 1PV3A 3CCJP 3IF8B 3LBXB 4CN4A 4CI1B 3H1JG 1KTMA 3GW6A 2H89A 3ANWA 4RKUJ 3L70E 5L4HA 1Q81Q 2O01J 1NENA 1U7MA 3KV9A 4TWFA 3MP7B 1EQ7A 1URQC 1MIYA 4JF7A 1NU1K 2E76D 3C8VA 4UF0A 2D2CD 3ITKA 3M9QA 2WPQA 3QH9A 3F5HA 4GKKT 4UF0B 2HR3A 3CPWO 1DX7A 2JMKA 3PV0F 2FUPA 4H9OC 2OYHB 4ISTA 4U3FG 5EZYE 3ZN1B 5CGMA 1KILD 2B88A 4DR3T 5DABA 1DD3A 3E7KA 1FDMA 5AW9B 2F4VT 4U2YA 4WB4A 2X9XA 2YN6A 3T97B 4M3LA 2QA4P 1HBWA 3LW5J 3MK7C 4AKIA 3MGNA 1R8EA 3H37A 1FZCB 2BCCE 5CJ5A 1ZV8A 1Y01A 3RKOA 4YTNA 5IWAT 5FXWA 2WCAA 3AE1A 2ZM6T 1SQXJ 1YITP 5CFBA 2FJAA 5TISH 3TKLB 3W68A 4O2BE 1HNWT 4TLFA 5L3BB 4I43B 3PUWF 4GKJT 3RGUA 1HH0A 1OWAA 2WSFH 5JRCA 1I6ZA 1SE7A 2X0HA 4PJ0E 3AE5C 5H6RB 5CCGC 1NTZK 1NJIQ 4O2AE 3L75E 4IOIH 5JDQA 4O4LE 2NTYA 3Q5SA 3CLQA 2ZT9B 4YT0A 2Y0DA 5CCHA 3CC2P 3Q2YA 2XM1A 3W67A 2BCCG 1KYOI 4ZZCA 3R6NA 3TGUD 2C5KT 2RPAA 3P7KA 4JQ0D 3I0QA 3H1IE 5AQHB 2GA1A 3B57A 4GYRA 2R32A 3G9RA 1DU2A 3ZLIA 1IAPA 3CCMP 1KN7A 1AVOA 3K3NA 5DJQC 5AQUB 3VP9A 1HWTC 1QX8A 3KVAA 1SQXK 5HXRA 4U7IA 1H89A 4IL9A 3L75G 3SWKA 1YTZI 3AE9A 1UGOA 4MBQA 3T1HT 5DJTB 1LWUA 4PD4D 4L76A 3HKCE 3LK3B 3ZT7A 4KJMA 4JBWF 5AQVB 4YLHA 2GM4A 2XU6A 1N7SA 3CC7P 4GOUA 5APWA 4ASWA 2IBZE 2HFED 1BR2A 1SQBJ 3JC6C 3H1IG 2D0TA 3ZKRA 5JR9A 2C5IT 1HX8A 1HTJF 2SPCA 1NTKJ 5JR9B 4UIGA 1VQOP 1JY2N 4KT0J 4HKZH 2KWHA 2JRKA 2B76A 3NZPA 2JP3A 3Q3DA 4GOFA 3ESLA 2QIWA 4EB6E 2MOZA 3FB2A 3ZJ2A 4I0UA 1HTLC 3HI2A 1ZP0C 2K5BB 3OAKA 4DVDA 3D70A 1JM0A 1AJYA 3MUDA 2ZVOB 1NEKA 3D6ZA 1RQVA 3B5MA 1BE3J 3AEGA 3AEDC 5CJ4A 2H43A 5FXXA 2Q7CA 3RRWA 1OVUA 3TNUA 1OW6A 2FY8A 3VMZA 1G73A 1E7PA 4PV1D 1LNQA 1MFTA 2YKOA 3D71A 2X67A 3BVHA 3I56P 4HB1A 1SQBK 2X9HA 4CXXA 1L0LG 1NTKK 4B3ST 5AW8B 3UFEA 1RF0A 1YXRA 2WAUA 2KLUA 3UULA 1D1CA 3V2RA 2XJ7A 4TV9E 1JY3P 2YMYA 4NXMT 3AEAC 3DJBA 3L73D 3FZKB 5KAFH 1BCCD 1MZ9A 3H1HG 4A98A 1CI6B 3BQLA 5F3JA 4KHXA 5HEGA 3M0DA 4KMCA 3B5NB 1XTGB 3QNUA 4DR4T 2Q1KA 5HXCA 3RGLA 1SQVJ 5BU5A 1NTMG 1WYBA 4QH1A 1OX3A 2XM2A 2HPJA 5KJ7D 3PTRB 1YJ9P 2J5UA 2MPKA 1Q7YQ 1SFCC 4QX8B 4ZXLA 3OPCA 1PZQA 1ZMEC 3GF3A 3HD7A 3RYFE 1EZVE 2KIKA 4H9NC 5E0OA 1XMOT 5HYAA 5AQLB 5APQA 3TSIA 2QSIA 3VR8A 4UELA 3AEFA 2LRLA 3UU3A 1WT6A 2QJYC 3JC22 1N8RQ 3WU2E 1S9KD 5CCHD 4KP3C 2A45I 2O01H 2XAGB 4OGQB 3JSVC 3AECA 4GOEA 1AJ3A 1YW0A 4UXNB 3RL0D 2JQ9A 3O6QB 3P8CD 4EDFA 2RP4A 4YSYA 1M7KA 1EZVG 3AE6C 5AVYB 4NPFX 3LK42 1LVKA 4D6TJ 3H6PA 2V4HA 2XQ9A 2IDBA 1VPCA 4Z1MH 4TWDA 5J2TE 4JPZB 1L0LD 1BGYG 3GMAA 4L74A 2J59M 1GK6A 1FU1A 4N78D 3HRNA 4HFBA 3RIUC 5AQQB 2YDQA 4Y99C 2ZXXA 3VU7H 3ONJA 3R4YA 2KLVA 1FZEA 1KV4A 3H1HD 4PK6A 3ZYMA 3LW5H 2IIUA 3F2EA 1N7SD 2LKMA 4DT0A 3L74J 3C4ZA 1Y9BA 3TLVA 1Q90D 2X66A 1J5ET 1HFAA 3VTPC 1QLBA 3I9WA 5ABEA 2KINB 4XA4A 3BCCE 2E9XC 1NTMD 3AXJA 4DBRA 1QL2A 1SFCB 2WQYA 4H44C 3AXJB 1R8IA 5JDMA 2KSJA 3PUQA 1Z8UA 1PL5A 1YIJP 3TLWA 4YTPA 1NGMB 5KLIC 3F89A 3M3ZB 3HL6A 5KLVG 1BR4A 4PK4A 1ZRTE 2BEZF 1RHZB 2MYSA 3RLFF 1VOMA 1OVRA 2XY8B 2CBJA 5E79E 1FS0E 4A56A 3N2GE 3M06A 3BCCG 1KQFB 3AE2A 2V7QJ 2LSKA 2CHNA 4WZXA 2QE7H 1VQKP 1SQVE 1YQ4C 1IFMA 5FL1A 4U31A 2X0LB 4B3TT 2PBIA 3G71P 4WVZA 3GHGC 5JVDE 4HKAA 4ZI3C 3G4SP 3S4UA 3CMAP 1KYOD 2NPSC 5GTHE 3IA3A 3M9HA 3G3ZA 2UU9T 4GODA 1UUSA 3ABVC 3QC9A 1BGYD 3CCSP 3C4XA 5B5EE 3CQCB 4WY4A 4LMLA 3PTZA 3HUSA 1PP9E 4ILCA 2LRKA 3A0BE 2YDSA 3UU6A 5L3DB 1IFPA 1HJ0A 2UUBT 4ASKA 3EFFK 3L72E 3E0ZA 2N9DA 3AAAB 2ZMAA 2R44A 4L73A 3V6IA 3C64A 1Y47A 4RJTA 4EEDA 5CHXA 3ZCJA 1ZHCA 2CMRA 2ZXEB 2V7MA 4D6TE 4KI0F 5JDNA 2E76C 3SSUA 2WZIA 2D2CC 1PP9G 3OJAA 3CWBG 4C91A 2B87B 3O1JA 5KLIB 3OJAB 2K88A 2QEXP 5DJUB 4PJLA 1L0NE 1FZAA 3CQXC 2K1AA 5KLVD 4H9RC 5KXJA 5FVKA 1KILC 2OYOA 2FBWA 5CMZA 3EUHA 4JEUB 1H0TB 5FY7A 3L71E 1JNRA 2WSFJ 1RF1C 2OYIA 3FBLA 5AQNB 4HFDA 2Q9QB 2X68A 2LT3A 4M1PA 2OYIB 2YINA 3GHGB 5AVSB 5AW2B 4AQFC 2PRRA 3A7OA 2A45G 4DV3T 2DL1A 1P84E 2JWAA 4UVBB 5FXZA 4V1Av 4E7ZA 2E5LT 2M6BA 3G6EP 1L0NG 1MIVA 4EYYR 1AV1A 2HHHT 3AE3A 3L3PA 2WU5A 3J9X1 3IEEA 4X20E 2W83C 4BA9A 3RK2D 5GTIE 3L71G 2XQAA 4HEAA 2Z5HA 5IUXA 4AIUA 5AQSB 2XQ8A 1E5WA 5APSA 1ZN5A 3PJSK 2XZRA 4EXTA 2JWDA 4IE6A 1IBKT 2KK7A 3EABA 3MJXA 3TGUJ 3Q5EA 5AVTB 2UUCT 1Y64B 5IHYA 4JYAT 1SQPE 4EOTA 5LYJE 4C46A 1YD8G 4K35A 2WZHA 3JADA 4MLKA 1NAFA 1FDOA 5FVLA 1T98A 1DH3A 1FMVA 4AQGA 2VASA 3FXDB 4Q25A 2C5JA 2O01N 4GT1A 1YTZT 2FYNB 1PP9D 4OK0A 3CWBD 2WY2A 4AKHA 1ZOYA 5HWYA 1N86A 3KZIE 3H32B 3UIAA 1N32T 1MMDA 1NKNA 2D2SA 1LJ2A 1FZFA 2UXXB 1X8YA 1SQPG 5ADXL 1HUCA 4DJGA 1DD4A 1RF1B 1S5LH 4QKNA 4YJ3E 1J1JA 1IJ5A 2X9WA 1N36T 5L8RJ 1D0XA 4EIWA 3PUZF 3Q5XA 1SP4A 3N9MA 2NOXA 1FE6A 3NXSA 2Y6XA 2YIUC 2W6AA 3H1LD 1US7B 5AVRB 2HG5D 1M56D 2LKGA 4TWHA 1SS1A 2YKQA 4W80A 4GYSA 4OH8B 2ZM8A 3RK3B 2KUBA 2W0GA 1LP1A 4QHOA 3O1IA 4G2AA 3SS1A 4DO0A 1PPJD 1H8AA 4WY4D 4DV2T 1FC2C 2WPRA 3PUYF 2NP9A 3QB5A 2FYUE 3KYQA 5AW0B 4X1KE 4B3MT 2H88A 1LT9C 2LLYA 3VYIA 3R84B 2P67A 2ODVA 2K48A 1M1JA 3S1KA 2E74D 2P9BA 4LFBT 2FFDC 5AW7B 2N1GA 2VKDA 4PV1C 4HWIB 2QGSA 2L8KA 2FKWB 2KWIB 3IBPA 3JAFA 3RK3E 4UB8H 2FJBA 3C98B 5C39A 2DI4A 2N9YB 2V5DA 3II6A 3L73J 3MIWA 2XAJB 2YXRB 2GUSA 1BCCJ 1RE3A 1KB9H 2H7HA 3F57A 4ASVA 4JI4T 2M67A 3A5XA 1RY3A 1IO4A 4OYJA 2V7QH 2LSGA 2IBZI 4JI8T 1LTIC 4P1NA 4DR2T 1KORA 1QGKB 5KKZB 5L3FB 2GK9A 4XAXB 2VVSA 3LIEA 1LTJC 1SQPD 2BKOA 3WI3A 4YY3T 1GL2A 3NRYA 2V6YA 5AQPB 3Q2MA 3LBXA 3PE0A 1XWMA 5HXEA 1LTTC 1GL2B 4BRYB 1KQLA 4AI6A 1LTSC 2LHNA 3LSVA 4P09A 5LJMA 3RBXA 5KJ7C 4O4JE 3CPZA 3BRTB 4ILBA 1J1EC 3KINB 2Y0EA 4OHFA 2HN1A 1Q2NA 1J1DB 1U7JA 4DV4T 1S72P 3V4WA 2XAHB 1VQ8P 4I7ZB 3CX7B 5AQOB 3ZYKA 2XASB 4BJMA 3H25A 1SVFA 3KV6A 2BASA 1MKMA 4HJGH 1NTZJ 3CX6B 3FZLB 3OKQA 1HGVA 2OYHA 2G8YA 5KAIE 2HPLA 2AXTH 2Y9ZA 4DIDB 5CCHC 2G3AA 2E75B 3UFGA 2W6BA 2JQKA 3BRVB 2N1TD 4KHPT 4PV1B 2W90A 1SQQE 4UVCB 1LTGC 3H1KE 3RYCE 3SWHA 3RL0C 3L70G 3T97A 2IC6A 3DTOA 1KFYA 2LM9A 2ACXA 3HA4A 2QJPC 1YKEB 5ETWA 1L0LJ 1FZCA 2P2UA 5BU8B 4JI6T 2A06E 2BKNA 1S94A 4NPPA 4QWNB 5JDGA 1VQ5P 4A97A 2VURA 4CPGA 3RRCA 4NUVA 2NW9A 2EHOB 4AQRD 4OYKA 3H1HJ 1LWUC 5HEOA 1UIXA 4YJ2E 3I9YA 2IFMA 1IJDB 3MXZA 4AQYT 3VOPA 1RQUA 3G06A 1SQQG 3CWZB 1N7SC 1BR0A 3H1KG 1S35A 4XZCA 1XMQT 4H0LD 3SWFA 2N2NA 4WBNE 1NTMJ 2PAJA 2UXBT 5LG3A 5KAFE 2A06G 1EZVI 1MMAA 3MD0A 3AVRA 4YSXA 3H1JD 3NBXX 4NPEA 1URQA 4JI1T 2Q5UA 3KFWX 1FDIA 1NU1E 2JDIH 4ZHQE 4BJNA 1URQB 3KVBA 1QVFO 1L0LK 4F6RC 1YJNP 5H2FH 1VQ4P 1XDPA 4IREA 4CXYA 3MUDC 1J2JB 3RX6A 1IFNA 2K37A 1KNPA 2KZ7B 4AXPA 3C50A 2CWYA 2KB7P 3BATA 2WMMA 3R2PA 3RPUA 2YO3A 4U3FD 1AQTA 1VF5C 2JR8A 1FBMA 1NU1G 3P7IA 4DMWA 2LR2A 4X5TA 3L70D 5AVZB 4GDOA 1JCCA 2CWOA 5AQMB 1NTMK 1S4XA 4U72A 5APUA 1BSHA 2V5CA 2LKHA 3AEEA 4ANJA 2V7LA 1RF0C 1GU5A 4PD4H 1BGYJ 5J0ZA 2XQ3A 3QK6A 3PUAA 1L4AD 2VL0A 5LOVE 4EZHA 1A02J 2CK3H 3HKBE 2M8RA 3VMAA 1T72A 4IDPA 3AE5A 1XZYA 2AXDS 1D1BA 2DW3A 1HGZA 2E5YA 3X1DA 3H1KD 1ZR2A 2H3RA 2IBZG 2BBHA 2KT9A 3PUXF 2RKLA 1FEWA 2P10A 4IL6E 2LSJA 2XQ4A 3SFEC 4OVNF 3KPEA 1KK7A 4NIQA 2KZIA 4BXLA 4PK5A 1UK5A 3CK6A 2BCCD 4DV0T 4YTMA 5C2TA 2KYVA 2RH0A 2WPSA 5F5WA 3ZT5A 2H7VC 1BR1A 3L36A 4U2ZA 2B89A 4JI7T 1T6AA 5LJNA 3PUSA 5KLVJ 4TX5A 2NR4A 1SQXE 4LC1A 2WSCH 2LOPA 3RQUA 4EIJA 4BAYB 2CA5A 3CCQP 2C0SA 3CX8B 3O9XA 4CQIA 3MHVA 1W0AA 2CEAA 1W2EA 4B6XA 3ETUA 2KI7B 3PLNA 1CI6A 5ABFB 1IC2A 1D0ZA 3L75D 2R3SA 1HG2A 3CXHI 1VF5B 2JKVA 2P7JA 1VCSA 4ZS3A 2V8SV 3B5NA 2IAKA 2B9BA 1RH5B 4K3AA 2CE7A 1PGOA 1MFZA 4AKLA 1HF8A 3K8PC 4WBAA 2A72A 4DBQA 3H1ID 4UV8B 3GF7A 2VWAA 4X1IE 1IFIA 3I55P 5KX5E 2NZ2A 2XTLA 4O4IE 4XBFB 5BR8T 1JTHB 1D7MA 2OQQA 3FXEA 4C90A 3Q1MA 4GKGA 2C9LY 2XKMA 3EDVA 2YU2A 1KQGB 2AEMA 3FXEB 2Y9YA 5LCYA 1NOHA 3RK2C 4UV9B 5KLVK 1W0BA 4PJJA 1O3XA 4ZI2D 5AVQB 3AEDA 4HTEA 2ZT9D 1QSDA 1M90Q 5LG4A 1SLQA 4MN4C 1HG5A 4LF8T 2D0UA 1GW3A 2IBZD 2JO1A 2LXCB 1FJGT 1NHLA 3NRXA 3N9LA 2I8DA 1ZEEA 3PUGA 3Q9DA 1SQBE 3O6QA 1NH4A 4QXCB 4X66T 3AE8C 4DNDA 1VQ7P 3JCUH 2R5DA 1NTKE 1FMWA 1B7TA
chains in the Genus database with same CATH topology
5DJUB 2KUBA 1LP1A 2LXBA 1ZW0A 1KEYA 1EC5A 5EFWB 2KZJA 1FC2C 1EDIA 1H0TB 3AXJA 3PH0A 3QB5A 4IOIH 2RKLA 2KS1B 3AXJB 1NVOA 1ZXGA 4CPGA 2B87A 2SPZA 2KZIA 2P58A 4BXLA 3RGUA 3S1KA 1JMBA 2B89A 1OVVA 2QVAA 4EYYQ 2Q1KA 3ZDMA 1H0TA 1OVRA 2K3RA 1X0TA 3MHVA 5C39A 5CBOA 2KI7B 2QRXA 5DJTB 3PJAA 3PJAJ 2KIKA 4ASVA 4NPEA 4NPDA 4KJMA 2JWDA 5CBNA 1U7MA 4ASWA 4K3AA 1BDCA 1S3JA 4K35A 4ZNCA 3QB5K 4GODA 1EDLA 1EDJA 2HR3A 4HKZH 2M5AA 4GOFA 4GOEA 4ZMDA 3FXEA 2WMMA 4JBZA 2M5AB 3MZWB 3QWOC 1LT1A 2B88A 1BDDA 2M0BA 4NPFX 2UWJE 1Q2NA 2R44A 1LP1B 1U7JA 2OTKE 2LR2A 1JM0A 1Y47A 3RIUA 4MN4C 3FXDA 1J1JA 3RIUC 2ZAEB 2LXCB 2I8DA 4HJGH 1OVUA 1EDKA 1DEEG 4WWIA 5K5GB 2B87B 4WYVA 1MFTA 1SS1A 4HB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJU B;  2KUB A;  1LP1 A;  2LXB A;  1ZW0 A;  1KEY A;  1EC5 A;  5EFW B;  2KZJ A;  1FC2 C;  1EDI A;  1H0T B;  3AXJ A;  3PH0 A;  3QB5 A;  4IOI H;  2RKL A;  2KS1 B;  3AXJ B;  1NVO A;  1ZXG A;  4CPG A;  2B87 A;  2SPZ A;  2KZI A;  2P58 A;  4BXL A;  3RGU A;  3S1K A;  1JMB A;  2B89 A;  1OVV A;  2QVA A;  4EYY Q;  2Q1K A;  3ZDM A;  1H0T A;  1OVR A;  2K3R A;  1X0T A;  3MHV A;  5C39 A;  5CBO A;  2KI7 B;  2QRX A;  5DJT B;  3PJA A;  3PJA J;  2KIK A;  4ASV A;  4NPE A;  4NPD A;  4KJM A;  2JWD A;  5CBN A;  1U7M A;  4ASW A;  4K3A A;  1BDC A;  1S3J A;  4K35 A;  4ZNC A;  3QB5 K;  4GOD A;  1EDL A;  1EDJ A;  2HR3 A;  4HKZ H;  2M5A A;  4GOF A;  4GOE A;  4ZMD A;  3FXE A;  2WMM A;  4JBZ A;  2M5A B;  3MZW B;  3QWO C;  1LT1 A;  2B88 A;  1BDD A;  2M0B A;  4NPF X;  2UWJ E;  1Q2N A;  2R44 A;  1LP1 B;  1U7J A;  2OTK E;  2LR2 A;  1JM0 A;  1Y47 A;  3RIU A;  4MN4 C;  3FXD A;  1J1J A;  3RIU C;  2ZAE B;  2LXC B;  2I8D A;  4HJG H;  1OVU A;  1EDK A;  1DEE G;  4WWI A;  5K5G B;  2B87 B;  4WYV A;  1MFT A;  1SS1 A;  4HB1 A; 
#chains in the Genus database with same CATH topology
 3CWB J;  3TLS A;  1CW5 A;  4JYC A;  4HGA A;  4IDQ A;  4DV7 T;  2WWW A;  3AEB A;  4PFP A;  3BQI A;  4YTP C;  1EC5 A;  4IDZ A;  5LMN T;  1IFD A;  5TAO A;  2Y8D A;  4HN9 A;  1V9D A;  5JDL A;  3M91 A;  4K0U A;  2HN2 A;  1EDI A;  1FAV A;  1M62 A;  4DZO A;  2UUA T;  2WMO A;  3CCE P;  3K5B A;  3LJC A;  5AVU B;  5CB4 E;  5FKY A;  2XDJ A;  3EWK A;  1HNX T;  4G63 A;  4O8S A;  2BZB A;  1P84 I;  1FIO A;  1GMJ A;  3V2N A;  2UXD T;  3H1L J;  1SQB G;  3VP8 A;  1JMB A;  1QVG O;  2NWB A;  3RH3 A;  1BE3 E;  4TZ4 C;  1T8B A;  4JI5 T;  3L37 A;  1OVV A;  5AVX B;  1L0V A;  1WR0 A;  2YEV C;  5C3J A;  2BKP A;  4HWD A;  2QM7 A;  3K3Q C;  1SFC A;  5AFU L;  1VQ6 P;  3C9I A;  1VCT A;  2W8Z A;  4UEM A;  4WY4 C;  2XND H;  1HX1 B;  4DMV A;  3HUS C;  2R3C A;  3SWY A;  3VR9 A;  1USE A;  1VQP P;  4ILA A;  2R6G F;  1JY3 O;  3IFM A;  1BSN A;  2V6X A;  2WB5 A;  5LNK A;  5AQK B;  4XFJ A;  1BE3 G;  3UTK A;  2E74 C;  2QJK C;  2QJY B;  3PUV F;  1EDL A;  3S9O A;  2XQ5 A;  4AKG A;  3CVR A;  1HCI A;  3PUR A;  2BS4 A;  3WAJ A;  3V5B A;  4NUU A;  4H9P C;  2W2U A;  1NO4 A;  2W67 A;  4I4T E;  3AE6 A;  2IDO B;  5APX A;  5L4E A;  3V4Q A;  4U33 A;  2G0U A;  3VRB A;  3CXH E;  3A0H H;  2HOD B;  1AA0 A;  1EZV D;  4C7R A;  2Q3I A;  1N73 C;  1HS7 A;  1WYC A;  3LK2 B;  1JOC A;  2OAR A;  3RIU A;  5BVZ A;  1D1A A;  2FBW C;  3SFD C;  1UII A;  4QX7 B;  5H6Q B;  4Y99 B;  4KX6 A;  4L75 A;  2YDR A;  4DUY T;  5L3G B;  4TN7 B;  3O1H A;  2I1K A;  1WLX A;  5JTG A;  1YJW P;  1KYO H;  2XHE B;  4WWI A;  2E8I A;  2YMK A;  3E08 A;  4EOZ B;  1VQM P;  3N9O A;  4OWF A;  1RE4 A;  2W27 A;  3B5N D;  3JAE A;  1SQV G;  3CCU P;  2BDE A;  3CX5 E;  4IDO A;  4IIJ E;  2E9X A;  1KEY A;  1KF6 A;  1JNZ A;  1QEX A;  1Z56 A;  3GWH A;  2E9X B;  2CPB A;  4CZZ B;  2YU1 A;  1S5L E;  2ZYA A;  4H44 B;  2CLY C;  4KBM B;  2KS1 B;  4GIW A;  3AAI A;  3AE7 C;  4YXW H;  3AE3 C;  3HD7 D;  4IFF A;  2ZYD A;  3HR0 A;  5FNV E;  2B87 A;  2SPZ A;  5LBQ B;  2WDQ A;  2H7O A;  1LRZ A;  3KBT A;  4PJM A;  5JQG E;  1CUN A;  3H3M A;  3CQG B;  3FGA D;  4A7P A;  1N7L A;  1X22 A;  4R4L A;  2K9J B;  1KMI Z;  3H3A A;  5B66 E;  4ZI7 E;  4EAH A;  3L72 G;  4YXD C;  2N1T C;  1H0T A;  1SQP K;  4OGQ D;  1SHZ C;  2Y48 B;  3L74 E;  3K1S A;  1AFO A;  1YQ4 A;  3BCC D;  2Q9Q A;  1KQS O;  3P50 A;  1VL2 A;  3GHG A;  1DIP A;  3OYX A;  3VRA A;  3VKH A;  3ONX A;  4YPC A;  4D6T G;  3PJA J;  4I2L C;  4DR5 T;  2NPS A;  3W15 B;  4O9B A;  5KTB A;  2L91 A;  3WMM 0;  2FJD A;  3EDU A;  4KHZ F;  1N73 B;  2NPS B;  3ABV A;  1UUR A;  1ZOY C;  3QUJ A;  1HR0 T;  2H8P D;  3GMI A;  2PFV A;  1LGH B;  3IF4 A;  3RC3 A;  3ZCI A;  2LE8 A;  1GDT A;  1ZRT D;  3FBZ A;  4UB8 E;  3FZM B;  3J7Y q;  3K3O A;  4HFH A;  3P4Q A;  3L74 G;  3ZT6 A;  4ZMD A;  2J47 A;  3PDY A;  4U7Y A;  1KB9 E;  4IE5 A;  1BDD A;  2DWG A;  2WSE H;  3H1J J;  2JJL A;  2WT7 A;  3AB3 B;  1SQV D;  3ZSS A;  2A2F X;  1SUM B;  1KZU B;  2WT7 B;  3VKG A;  2OTK E;  3CXH D;  1JCD A;  3N5L A;  1YKH B;  4L0R A;  4C7N A;  2Z4E A;  1JY2 P;  3FXD A;  5AQT B;  1JY3 N;  2X0Y A;  3AVS A;  2OA5 A;  4C7N B;  1AVY A;  4ADZ A;  5AW4 B;  2E76 B;  2D2C B;  4L9I A;  2WZ7 A;  1YQ3 C;  4JUY A;  1IBL T;  3ZN0 B;  4JI3 T;  2P1J A;  2BG9 C;  3KV4 A;  1W09 A;  1SA0 E;  3H32 A;  4LMJ A;  1M1J C;  2CXL A;  1OED C;  4U3F J;  5LGN B;  2CXF A;  2ZVN B;  1KIL B;  2N1T B;  2KZJ A;  2VB6 A;  1PFI A;  1D0Y A;  1KFM A;  5APV A;  3L72 D;  2XAF B;  4QH4 A;  5LHH B;  1RF1 A;  3AA6 B;  3L70 J;  3AA7 B;  3TYY A;  3DP7 A;  2KOG A;  4IE4 A;  3KBU A;  2PFX A;  3A0B H;  1NVO A;  5L3E B;  1ZKE A;  3EI0 A;  1T7S A;  4IL6 X;  3CIR A;  3CL3 D;  3D6Y A;  3T8O A;  3RKG A;  2UXC T;  4D6T D;  2WMN A;  2LSY A;  2OV9 A;  1RE3 C;  4YSZ A;  4EYU A;  4I6M C;  1L4A C;  1QUU A;  2Z5I A;  1T3U A;  2V7J A;  2FXM A;  3EQ2 A;  4U74 A;  3M9B A;  1L0N D;  5L3C B;  2I6H A;  1JEK A;  4H63 V;  3UT5 E;  2W63 A;  1YYC A;  1KIL E;  2A45 H;  5ABG A;  3B8E B;  5CBO A;  1LTB C;  3VHL A;  4ISS A;  3E22 E;  3L71 D;  4EI2 A;  2E5V A;  1JNM A;  3Q5R A;  3L09 A;  2XQ6 A;  2WSC J;  5CA0 E;  5TIS E;  2XSA A;  1X79 B;  1M8O B;  2BCC J;  3TLT A;  4B3R T;  2H89 C;  4W7Z A;  2BS3 A;  3CCL P;  3HE4 B;  1BDC A;  2ZFC A;  2VRS A;  1P84 D;  3LG7 A;  1OZH A;  3N4X A;  4DUZ T;  4N3Y B;  1IZN B;  4HWF A;  1KNZ A;  1TU3 F;  2VKO A;  1EDJ A;  4RES B;  3L39 A;  1GD2 E;  2I59 A;  2CXD A;  3RC8 A;  3SRZ A;  2XNX A;  4PAG A;  1JUN A;  3HE5 B;  3S4R A;  2FYU G;  3AE4 A;  2IFN A;  1W2B O;  3A2A A;  3MZW B;  3HTK B;  3L75 J;  1OED B;  3CKD A;  1NWQ A;  2O3J A;  4HFI A;  3ZC1 A;  4TT3 H;  4IE0 A;  3N9N A;  3QOF A;  4ERR A;  1MMG A;  4QXB B;  4I50 E;  4X1Y E;  5HEJ A;  2Q9Q D;  3OYZ A;  4UVA B;  2ZAE B;  3H1I J;  2WWV A;  3TLU A;  3PU8 A;  1JMM A;  4BRY A;  5GTI H;  3TGU E;  1MND A;  3NTN A;  3PHL A;  2YIU B;  4ZKU A;  4XE5 B;  2JIW A;  1MV8 A;  4X64 T;  1N34 T;  2XQY A;  2NTX A;  1Q86 Q;  1L4A B;  4PNI A;  3AE1 C;  1LTA C;  4W7Y A;  5JDF A;  4YFS A;  4B86 A;  3O8Z A;  2BVL A;  1OW7 A;  5HWX A;  2B1E A;  2LHR A;  4F8H A;  1ZLL A;  1LT9 A;  1EZ3 A;  5LGT B;  2IHR 1;  3AA1 B;  2J62 A;  5FXV A;  4PD4 E;  1LT9 B;  2IYO A;  4HE8 A;  1GTW A;  3TDK A;  4ZI2 C;  1IK9 A;  1JO5 A;  2ZT9 C;  3A3Y B;  3N9P A;  5TJH A;  2JEE A;  2L5G B;  5J1G A;  3TGU G;  5KDM C;  2FFD A;  2AE9 A;  1W9R A;  3KZI H;  2FFD B;  3ANW B;  1CSB A;  2Z6E A;  3ONL C;  2BBJ A;  2IML A;  1KFN A;  3ZEF B;  2WTY A;  3CML A;  1S2E A;  5HXS A;  2K3R A;  4U3C A;  3ZMU B;  1S1C X;  1UX5 A;  2OTJ P;  3T1Y T;  3P4R A;  2VQE T;  2QA7 A;  2PJQ A;  2OGU A;  4NXN T;  2NW8 A;  2EHO A;  2FYU D;  2VQF T;  2X51 A;  1Z0P A;  4HWC A;  1NYH A;  2PGD A;  4NPD A;  2LSI A;  3AE9 C;  2DLR A;  3OVU A;  1LTJ A;  3UUB A;  2J1D G;  1LTJ B;  2JMH A;  2R5B A;  2J4G A;  3Q5D A;  2E42 A;  3A8Y C;  2LM2 A;  5JR9 C;  5KJ7 A;  3AEE C;  1ZV4 X;  4J2C A;  4ZS2 A;  4CI2 B;  1PGQ A;  1MMN A;  4Y28 J;  3RK3 D;  5FL0 A;  4AUW A;  2CRB A;  3QWO C;  2AEJ A;  3NZQ A;  4UR9 A;  2Q6Q A;  1J1E B;  1UCU A;  3V2Q A;  4DV1 T;  5JRC B;  4JV5 T;  1YBK A;  3NWI A;  1CHU A;  3L73 E;  5AW5 B;  1QLE D;  4LF4 T;  2WVR A;  3ZMZ B;  1BCC E;  2K9A A;  3U3I A;  4E7S A;  2W62 A;  3ZST A;  4OX9 T;  4U7J A;  1YHQ P;  2W61 A;  3OA7 A;  3AEG C;  4LLH A;  2WDR A;  1XNQ T;  4LF9 T;  5DQW A;  5JDH A;  4IE7 A;  3A5T A;  2BS2 A;  2D9D A;  1WCR A;  3RL0 B;  4ZZB A;  4UB6 H;  3KXD A;  5AVW B;  5EFW B;  2QJP B;  5HAX A;  4L5G A;  4K0K T;  4TV8 E;  3L73 G;  2ZM0 A;  1BCC G;  2K9Y A;  2RMZ A;  2DNX A;  1S5L X;  2NRG A;  4HFC A;  1GQE A;  3U1A A;  4H13 D;  2L3L A;  4IFD K;  1LWU B;  1J5W A;  4WW0 A;  3JCU E;  3GA8 A;  2WIT A;  2YO2 A;  3IN6 A;  3Q5P A;  1S9K E;  3MTU E;  1N7S B;  3M0D C;  4JI2 T;  1NTZ E;  3B5N C;  5CCG A;  5FY0 A;  3L35 A;  4TNW A;  1I94 T;  1SQQ D;  3KHU A;  1GL2 D;  1HNZ T;  4YHH T;  1E2A A;  3SOL A;  5JH7 E;  1EXI A;  4IGU A;  3P8C E;  2W6J H;  5KAI H;  3NVO A;  3TK1 A;  1OIP A;  3CME P;  5HCM A;  3GN5 A;  3UU4 A;  3E1I A;  2A06 D;  3GN5 B;  4LFA T;  2Q9I A;  2ZLY A;  2M6I A;  3L8R A;  1L0L E;  3HD7 C;  4LGD E;  1T2K D;  5LBM A;  3P8M C;  4N78 E;  4FJO A;  1R5L A;  1IBM T;  2OLT A;  4ZNC A;  4ZKP A;  3GG2 A;  3AEF C;  4RO0 A;  5IYZ E;  1NTZ G;  1G8X A;  2JQQ A;  3H1H E;  1GW4 A;  3RYH E;  2E75 D;  5ABF A;  5CA1 E;  1X9V A;  2O1K A;  3TNU B;  3BCC J;  4OGQ C;  3MKD A;  1L2P A;  1LT1 A;  3AEC C;  4MAL A;  3UU8 A;  1NTM E;  2BEQ D;  3KV5 A;  4IT4 A;  4DR7 T;  5AW1 B;  2I0M A;  5AQI B;  3NMD A;  4PJ0 H;  3M65 A;  2PP6 A;  1NU1 D;  3AEB C;  5HEU A;  3BAS A;  2CM0 A;  4X62 T;  3B4S A;  2WSE J;  3B13 A;  2VKJ A;  1SQX G;  2C0W A;  2EHO D;  1X9B A;  4Z91 A;  2QM8 A;  1JTH A;  3P4W A;  2KLQ A;  2ZYG A;  1R5S A;  5LMU T;  1ZP0 A;  2Y0C A;  5K5G B;  2CCQ A;  2WDV A;  1K73 Q;  3CX5 I;  3A0H E;  2ODU A;  2MBG A;  1U57 A;  1PGJ A;  3BK9 A;  4DOJ A;  2XUE A;  4WNK A;  5M4Y A;  1PGP A;  3RHW A;  2IPP A;  2DHR A;  2M3B A;  5C8Y E;  5DQV A;  3C1L A;  2WWU A;  2RA1 A;  2YK0 A;  3PP5 A;  3SFE A;  3PH0 A;  3OW2 O;  1HVV A;  2WBL A;  2WSS V;  2MJZ A;  2WQY C;  2P58 A;  1KYO E;  1URQ D;  2D5U A;  3HD7 B;  1LKX A;  3CD6 P;  1PP9 J;  1IJ6 A;  1BGY E;  1NKZ B;  2CPT A;  2IZ1 A;  3RF1 A;  2QVA A;  4EYY Q;  2A9U A;  4GK0 E;  3RL0 g;  2W66 A;  3AEA A;  2KNC A;  3I0O A;  2WM9 A;  3ZPO A;  3KQG A;  3L72 J;  1NTZ D;  3ZC0 A;  3V5U A;  2KNC B;  3UUX B;  2JQH A;  2PTF A;  5L2L A;  2MAW A;  4PFO A;  3CI9 A;  2E2A A;  3AE2 C;  5L47 A;  1A02 F;  1M7L A;  4WBO A;  5HXH A;  1SQV K;  3I1A A;  3O4X E;  2NW7 A;  3AAE B;  3OTO T;  1NAY A;  4QH5 A;  3CCR P;  1NTK G;  3EFG A;  2KSE A;  1FZB A;  2BVM A;  1K05 A;  4H63 H;  2Q3E A;  2O1J A;  1L0N J;  1KNR A;  4IL6 H;  5F8P A;  1K9M Q;  3WUU A;  3HKD E;  1XDO A;  1SQX D;  1XTC C;  2M5A A;  2YNY A;  4EGW A;  3B71 A;  5CJ0 A;  1KB9 I;  2AXC A;  5KLV E;  2M5A B;  4I55 E;  5LA6 E;  4LFC T;  2QYW A;  3RK2 B;  3L71 J;  3UUN A;  4HYT B;  1WR6 A;  2FJE A;  1RE4 C;  5CCG D;  2FXO A;  1FJK A;  1LVF A;  1U4Q A;  1T3J A;  1WRD A;  1GK4 A;  2LJL A;  2IC9 A;  2AEF A;  2FYZ A;  4ZOL E;  3UQ4 A;  1OXZ A;  3NFQ A;  2FXP A;  4HWH A;  4PJN A;  2XPK A;  2W00 A;  4I1L A;  3AE8 A;  2L9Q A;  1YI2 P;  4MHC A;  1T8Z A;  2HOD A;  2XQ7 A;  4EZ4 A;  3F31 A;  3ZYL A;  1HF9 A;  4DCK A;  3FWN A;  3VMX A;  4GIF A;  3UU5 A;  1FOS E;  2V7I A;  3MAC A;  3ZMV B;  3FHN A;  1L0N K;  3MZK B;  5A1L A;  2DCF A;  1FOS F;  4P0B A;  2XZE A;  1VF5 D;  1SQP J;  2KSR A;  4AIS A;  1ZXG A;  4MFR A;  2Q9Q C;  2ES0 A;  1G2C A;  2OYI C;  5KMG P;  3JC6 D;  1H7C A;  2WS3 A;  3WUV A;  2POH A;  1G2C B;  3KDS E;  2V1D B;  5AQF B;  1SQB D;  2ACZ A;  1AQ5 A;  1VRB A;  2A3D A;  3JCF A;  2WP9 A;  1ZR4 A;  1NTK D;  3ETV A;  3WU2 H;  4QXH B;  2KS1 A;  5AQJ B;  4HFE A;  1K04 A;  2MKV A;  4WY4 B;  3CWB E;  3LFM A;  3HUS B;  1Q82 Q;  3NKZ A;  2QRX A;  5ABH A;  1UX4 A;  4IFM A;  5LP6 E;  3EHZ A;  4IHJ E;  4H9S E;  3IR9 A;  3BQK A;  3PRJ A;  3HKE E;  4LF7 T;  2K9J A;  5CBN A;  1OW8 A;  4ILU A;  1K8A Q;  3WAK A;  2E74 B;  2QJK B;  4DV6 T;  1JB0 J;  5APY A;  1BE3 D;  4JEH B;  4CI3 B;  3H1L E;  2IX7 C;  5AW6 B;  2KXP B;  3VN0 A;  1DEB A;  2XSB A;  5AVV B;  4Z90 A;  3FX0 A;  5LB7 B;  1KD1 Q;  3P4P A;  1VQL P;  1E79 H;  2FYN C;  5EK4 A;  2K24 A;  2FYU J;  1PPJ E;  3P32 A;  1N73 A;  2N9B A;  4X65 T;  5LXT E;  2UWJ E;  5FP3 A;  2MTQ A;  5AQR B;  3FZF B;  3SFD A;  1HJB A;  3FWL A;  1OFC X;  5FMN A;  4PW8 A;  1NWM X;  2DWK A;  3N7N A;  2IW5 B;  1M57 D;  1WRG A;  1M1K Q;  1KC8 Q;  2JJ9 A;  3UUM A;  4CN1 A;  3EAM A;  5LGU B;  4JI0 T;  1MNE A;  3H1L G;  1OMI A;  4H0L C;  2KP8 A;  1GU4 A;  2HYN A;  4N6J A;  5JRE A;  1WFD A;  3CC4 P;  2LXB A;  1MUU A;  1ZW0 A;  1PPJ G;  3RK3 C;  4AYC A;  5HEH A;  1G1J A;  4EV6 A;  5BMV E;  4A5X A;  2WU2 A;  1SFC D;  3C4W A;  2XV5 A;  1PIX A;  5E79 H;  3AE7 A;  2CLY B;  4PD4 I;  2UXN B;  2VL8 A;  1G1I A;  2V7K A;  1WMK A;  4IDN A;  2YKP A;  2HLO A;  4COF A;  4ZEY A;  2QG4 A;  4DR1 T;  2FYU K;  3L4F A;  3EVY A;  2H88 C;  1N33 T;  3CXH H;  1VDF A;  3D0T A;  3U78 A;  3RBZ A;  5AQG B;  4HH2 A;  3RIF A;  3ZMT B;  3CCV P;  1U5P A;  1IK7 A;  2YKS A;  2OTL P;  1KIL A;  1E1H B;  2N1T A;  4YXD A;  4IL4 A;  5GTH H;  4DR6 T;  2E5T A;  3LDQ B;  3ZDM A;  3A7M A;  3IHR A;  3CX5 D;  2KMF A;  3MA9 A;  5B5E H;  5LHG B;  3WUT A;  1X0T A;  3AA0 B;  4P0A A;  2K3W A;  4JLE A;  2HPC A;  4FI5 A;  4AQF A;  2HPC B;  2ZJS E;  3U1C A;  4H9Q C;  5EK2 A;  3RYI E;  3KDP B;  3PJA A;  2AXT E;  2YXQ B;  3AE4 C;  2PG8 A;  3CX5 H;  5GON E;  2VK9 A;  2IUB A;  4DV5 T;  4H13 C;  3ZMS B;  2CBI A;  1S3J A;  3I5C A;  3QB5 K;  5KKZ C;  1VQ9 P;  2C9N Y;  3Q5W A;  4O4H E;  3PU3 A;  1W5C E;  1SQQ J;  5LHI B;  3H1K J;  5HCJ A;  2X9Y A;  1XNR T;  4H0L B;  4LF5 T;  1GL2 C;  5APT A;  1FZG A;  2M3E A;  3L74 D;  4JBZ A;  1QL1 A;  1X79 A;  2M0B A;  4R4M A;  3TF5 A;  2E9X D;  2VKH A;  3HE4 A;  3VMY A;  1EXJ A;  5B66 H;  2IYP A;  2JPF A;  4CN6 A;  1LP1 B;  4OFZ A;  1VQN P;  4LMK A;  4H44 D;  1J1D C;  2RN0 A;  1T2K C;  4I7Z C;  1YQ3 A;  2W4X A;  5M1B A;  4CXW A;  1N2D C;  2YOE A;  2ZM2 A;  2GUV A;  3GLM A;  3HE5 A;  2E43 A;  1EDK A;  2BG9 A;  1DEE G;  1H88 A;  1CZQ A;  3LID A;  5AW3 B;  3HTK A;  2BG9 B;  3U59 A;  1OED A;  4TUY E;  4WYV A;  3V5S A;  1P84 H;  3ZJ1 A;  2E75 C;  2OYH C;  1M1J B;  2CPS A;  4Z8X A;  5FY1 A;  2WPV B;  2J58 A;  4EEB A;  4AKR B;  4LF6 T;  2C0X A;  3M0A A;  1FJP A;  1KB9 D;  3FZH B;  1SQQ K;  3IAO A;  3P4S A;  5EK3 A;  4YHJ A;  2XAQ B;  5H2F E;  4BWN A;  1NU1 J;  1IFJ A;  3H1J E;  2LEH A;  3N9Q A;  4ZI3 D;  3RI5 A;  3V2P A;  1FZC C;  2V26 A;  4KUM B;  3RQW A;  2NPS D;  1GZL A;  1L4A A;  1Y8A A;  3E1R A;  4H13 B;  2EHO C;  2I1J A;  1JY2 O;  3N2O A;  2HH7 A;  3UQ7 A;  1USD A;  5J2U E;  4UB6 E;  2VVN A;  3OBV E;  2BG9 E;  4QMA A;  4HFV A;  3USS A;  4TNV A;  3N2K E;  2LOS A;  5FYM A;  1OED E;  2KND A;  1MIW A;  2IZ0 A;  2ITA A;  4GK5 E;  2CHO A;  4JYB A;  2WSS H;  3RIA A;  4U3F E;  2V6Y B;  3C51 A;  1PV3 A;  3CCJ P;  3IF8 B;  3LBX B;  4CN4 A;  4CI1 B;  3H1J G;  1KTM A;  3GW6 A;  2H89 A;  3ANW A;  4RKU J;  3L70 E;  5L4H A;  1Q81 Q;  2O01 J;  1NEN A;  1U7M A;  3KV9 A;  4TWF A;  3MP7 B;  1EQ7 A;  1URQ C;  1MIY A;  4JF7 A;  1NU1 K;  2E76 D;  3C8V A;  4UF0 A;  2D2C D;  3ITK A;  3M9Q A;  2WPQ A;  3QH9 A;  3F5H A;  4GKK T;  4UF0 B;  2HR3 A;  3CPW O;  1DX7 A;  2JMK A;  3PV0 F;  2FUP A;  4H9O C;  2OYH B;  4IST A;  4U3F G;  5EZY E;  3ZN1 B;  5CGM A;  1KIL D;  2B88 A;  4DR3 T;  5DAB A;  1DD3 A;  3E7K A;  1FDM A;  5AW9 B;  2F4V T;  4U2Y A;  4WB4 A;  2X9X A;  2YN6 A;  3T97 B;  4M3L A;  2QA4 P;  1HBW A;  3LW5 J;  3MK7 C;  4AKI A;  3MGN A;  1R8E A;  3H37 A;  1FZC B;  2BCC E;  5CJ5 A;  1ZV8 A;  1Y01 A;  3RKO A;  4YTN A;  5IWA T;  5FXW A;  2WCA A;  3AE1 A;  2ZM6 T;  1SQX J;  1YIT P;  5CFB A;  2FJA A;  5TIS H;  3TKL B;  3W68 A;  4O2B E;  1HNW T;  4TLF A;  5L3B B;  4I43 B;  3PUW F;  4GKJ T;  3RGU A;  1HH0 A;  1OWA A;  2WSF H;  5JRC A;  1I6Z A;  1SE7 A;  2X0H A;  4PJ0 E;  3AE5 C;  5H6R B;  5CCG C;  1NTZ K;  1NJI Q;  4O2A E;  3L75 E;  4IOI H;  5JDQ A;  4O4L E;  2NTY A;  3Q5S A;  3CLQ A;  2ZT9 B;  4YT0 A;  2Y0D A;  5CCH A;  3CC2 P;  3Q2Y A;  2XM1 A;  3W67 A;  2BCC G;  1KYO I;  4ZZC A;  3R6N A;  3TGU D;  2C5K T;  2RPA A;  3P7K A;  4JQ0 D;  3I0Q A;  3H1I E;  5AQH B;  2GA1 A;  3B57 A;  4GYR A;  2R32 A;  3G9R A;  1DU2 A;  3ZLI A;  1IAP A;  3CCM P;  1KN7 A;  1AVO A;  3K3N A;  5DJQ C;  5AQU B;  3VP9 A;  1HWT C;  1QX8 A;  3KVA A;  1SQX K;  5HXR A;  4U7I A;  1H89 A;  4IL9 A;  3L75 G;  3SWK A;  1YTZ I;  3AE9 A;  1UGO A;  4MBQ A;  3T1H T;  5DJT B;  1LWU A;  4PD4 D;  4L76 A;  3HKC E;  3LK3 B;  3ZT7 A;  4KJM A;  4JBW F;  5AQV B;  4YLH A;  2GM4 A;  2XU6 A;  1N7S A;  3CC7 P;  4GOU A;  5APW A;  4ASW A;  2IBZ E;  2HFE D;  1BR2 A;  1SQB J;  3JC6 C;  3H1I G;  2D0T A;  3ZKR A;  5JR9 A;  2C5I T;  1HX8 A;  1HTJ F;  2SPC A;  1NTK J;  5JR9 B;  4UIG A;  1VQO P;  1JY2 N;  4KT0 J;  4HKZ H;  2KWH A;  2JRK A;  2B76 A;  3NZP A;  2JP3 A;  3Q3D A;  4GOF A;  3ESL A;  2QIW A;  4EB6 E;  2MOZ A;  3FB2 A;  3ZJ2 A;  4I0U A;  1HTL C;  3HI2 A;  1ZP0 C;  2K5B B;  3OAK A;  4DVD A;  3D70 A;  1JM0 A;  1AJY A;  3MUD A;  2ZVO B;  1NEK A;  3D6Z A;  1RQV A;  3B5M A;  1BE3 J;  3AEG A;  3AED C;  5CJ4 A;  2H43 A;  5FXX A;  2Q7C A;  3RRW A;  1OVU A;  3TNU A;  1OW6 A;  2FY8 A;  3VMZ A;  1G73 A;  1E7P A;  4PV1 D;  1LNQ A;  1MFT A;  2YKO A;  3D71 A;  2X67 A;  3BVH A;  3I56 P;  4HB1 A;  1SQB K;  2X9H A;  4CXX A;  1L0L G;  1NTK K;  4B3S T;  5AW8 B;  3UFE A;  1RF0 A;  1YXR A;  2WAU A;  2KLU A;  3UUL A;  1D1C A;  3V2R A;  2XJ7 A;  4TV9 E;  1JY3 P;  2YMY A;  4NXM T;  3AEA C;  3DJB A;  3L73 D;  3FZK B;  5KAF H;  1BCC D;  1MZ9 A;  3H1H G;  4A98 A;  1CI6 B;  3BQL A;  5F3J A;  4KHX A;  5HEG A;  3M0D A;  4KMC A;  3B5N B;  1XTG B;  3QNU A;  4DR4 T;  2Q1K A;  5HXC A;  3RGL A;  1SQV J;  5BU5 A;  1NTM G;  1WYB A;  4QH1 A;  1OX3 A;  2XM2 A;  2HPJ A;  5KJ7 D;  3PTR B;  1YJ9 P;  2J5U A;  2MPK A;  1Q7Y Q;  1SFC C;  4QX8 B;  4ZXL A;  3OPC A;  1PZQ A;  1ZME C;  3GF3 A;  3HD7 A;  3RYF E;  1EZV E;  2KIK A;  4H9N C;  5E0O A;  1XMO T;  5HYA A;  5AQL B;  5APQ A;  3TSI A;  2QSI A;  3VR8 A;  4UEL A;  3AEF A;  2LRL A;  3UU3 A;  1WT6 A;  2QJY C;  3JC2 2;  1N8R Q;  3WU2 E;  1S9K D;  5CCH D;  4KP3 C;  2A45 I;  2O01 H;  2XAG B;  4OGQ B;  3JSV C;  3AEC A;  4GOE A;  1AJ3 A;  1YW0 A;  4UXN B;  3RL0 D;  2JQ9 A;  3O6Q B;  3P8C D;  4EDF A;  2RP4 A;  4YSY A;  1M7K A;  1EZV G;  3AE6 C;  5AVY B;  4NPF X;  3LK4 2;  1LVK A;  4D6T J;  3H6P A;  2V4H A;  2XQ9 A;  2IDB A;  1VPC A;  4Z1M H;  4TWD A;  5J2T E;  4JPZ B;  1L0L D;  1BGY G;  3GMA A;  4L74 A;  2J59 M;  1GK6 A;  1FU1 A;  4N78 D;  3HRN A;  4HFB A;  3RIU C;  5AQQ B;  2YDQ A;  4Y99 C;  2ZXX A;  3VU7 H;  3ONJ A;  3R4Y A;  2KLV A;  1FZE A;  1KV4 A;  3H1H D;  4PK6 A;  3ZYM A;  3LW5 H;  2IIU A;  3F2E A;  1N7S D;  2LKM A;  4DT0 A;  3L74 J;  3C4Z A;  1Y9B A;  3TLV A;  1Q90 D;  2X66 A;  1J5E T;  1HFA A;  3VTP C;  1QLB A;  3I9W A;  5ABE A;  2KIN B;  4XA4 A;  3BCC E;  2E9X C;  1NTM D;  3AXJ A;  4DBR A;  1QL2 A;  1SFC B;  2WQY A;  4H44 C;  3AXJ B;  1R8I A;  5JDM A;  2KSJ A;  3PUQ A;  1Z8U A;  1PL5 A;  1YIJ P;  3TLW A;  4YTP A;  1NGM B;  5KLI C;  3F89 A;  3M3Z B;  3HL6 A;  5KLV G;  1BR4 A;  4PK4 A;  1ZRT E;  2BEZ F;  1RHZ B;  2MYS A;  3RLF F;  1VOM A;  1OVR A;  2XY8 B;  2CBJ A;  5E79 E;  1FS0 E;  4A56 A;  3N2G E;  3M06 A;  3BCC G;  1KQF B;  3AE2 A;  2V7Q J;  2LSK A;  2CHN A;  4WZX A;  2QE7 H;  1VQK P;  1SQV E;  1YQ4 C;  1IFM A;  5FL1 A;  4U31 A;  2X0L B;  4B3T T;  2PBI A;  3G71 P;  4WVZ A;  3GHG C;  5JVD E;  4HKA A;  4ZI3 C;  3G4S P;  3S4U A;  3CMA P;  1KYO D;  2NPS C;  5GTH E;  3IA3 A;  3M9H A;  3G3Z A;  2UU9 T;  4GOD A;  1UUS A;  3ABV C;  3QC9 A;  1BGY D;  3CCS P;  3C4X A;  5B5E E;  3CQC B;  4WY4 A;  4LML A;  3PTZ A;  3HUS A;  1PP9 E;  4ILC A;  2LRK A;  3A0B E;  2YDS A;  3UU6 A;  5L3D B;  1IFP A;  1HJ0 A;  2UUB T;  4ASK A;  3EFF K;  3L72 E;  3E0Z A;  2N9D A;  3AAA B;  2ZMA A;  2R44 A;  4L73 A;  3V6I A;  3C64 A;  1Y47 A;  4RJT A;  4EED A;  5CHX A;  3ZCJ A;  1ZHC A;  2CMR A;  2ZXE B;  2V7M A;  4D6T E;  4KI0 F;  5JDN A;  2E76 C;  3SSU A;  2WZI A;  2D2C C;  1PP9 G;  3OJA A;  3CWB G;  4C91 A;  2B87 B;  3O1J A;  5KLI B;  3OJA B;  2K88 A;  2QEX P;  5DJU B;  4PJL A;  1L0N E;  1FZA A;  3CQX C;  2K1A A;  5KLV D;  4H9R C;  5KXJ A;  5FVK A;  1KIL C;  2OYO A;  2FBW A;  5CMZ A;  3EUH A;  4JEU B;  1H0T B;  5FY7 A;  3L71 E;  1JNR A;  2WSF J;  1RF1 C;  2OYI A;  3FBL A;  5AQN B;  4HFD A;  2Q9Q B;  2X68 A;  2LT3 A;  4M1P A;  2OYI B;  2YIN A;  3GHG B;  5AVS B;  5AW2 B;  4AQF C;  2PRR A;  3A7O A;  2A45 G;  4DV3 T;  2DL1 A;  1P84 E;  2JWA A;  4UVB B;  5FXZ A;  4V1A v;  4E7Z A;  2E5L T;  2M6B A;  3G6E P;  1L0N G;  1MIV A;  4EYY R;  1AV1 A;  2HHH T;  3AE3 A;  3L3P A;  2WU5 A;  3J9X 1;  3IEE A;  4X20 E;  2W83 C;  4BA9 A;  3RK2 D;  5GTI E;  3L71 G;  2XQA A;  4HEA A;  2Z5H A;  5IUX A;  4AIU A;  5AQS B;  2XQ8 A;  1E5W A;  5APS A;  1ZN5 A;  3PJS K;  2XZR A;  4EXT A;  2JWD A;  4IE6 A;  1IBK T;  2KK7 A;  3EAB A;  3MJX A;  3TGU J;  3Q5E A;  5AVT B;  2UUC T;  1Y64 B;  5IHY A;  4JYA T;  1SQP E;  4EOT A;  5LYJ E;  4C46 A;  1YD8 G;  4K35 A;  2WZH A;  3JAD A;  4MLK A;  1NAF A;  1FDO A;  5FVL A;  1T98 A;  1DH3 A;  1FMV A;  4AQG A;  2VAS A;  3FXD B;  4Q25 A;  2C5J A;  2O01 N;  4GT1 A;  1YTZ T;  2FYN B;  1PP9 D;  4OK0 A;  3CWB D;  2WY2 A;  4AKH A;  1ZOY A;  5HWY A;  1N86 A;  3KZI E;  3H32 B;  3UIA A;  1N32 T;  1MMD A;  1NKN A;  2D2S A;  1LJ2 A;  1FZF A;  2UXX B;  1X8Y A;  1SQP G;  5ADX L;  1HUC A;  4DJG A;  1DD4 A;  1RF1 B;  1S5L H;  4QKN A;  4YJ3 E;  1J1J A;  1IJ5 A;  2X9W A;  1N36 T;  5L8R J;  1D0X A;  4EIW A;  3PUZ F;  3Q5X A;  1SP4 A;  3N9M A;  2NOX A;  1FE6 A;  3NXS A;  2Y6X A;  2YIU C;  2W6A A;  3H1L D;  1US7 B;  5AVR B;  2HG5 D;  1M56 D;  2LKG A;  4TWH A;  1SS1 A;  2YKQ A;  4W80 A;  4GYS A;  4OH8 B;  2ZM8 A;  3RK3 B;  2KUB A;  2W0G A;  1LP1 A;  4QHO A;  3O1I A;  4G2A A;  3SS1 A;  4DO0 A;  1PPJ D;  1H8A A;  4WY4 D;  4DV2 T;  1FC2 C;  2WPR A;  3PUY F;  2NP9 A;  3QB5 A;  2FYU E;  3KYQ A;  5AW0 B;  4X1K E;  4B3M T;  2H88 A;  1LT9 C;  2LLY A;  3VYI A;  3R84 B;  2P67 A;  2ODV A;  2K48 A;  1M1J A;  3S1K A;  2E74 D;  2P9B A;  4LFB T;  2FFD C;  5AW7 B;  2N1G A;  2VKD A;  4PV1 C;  4HWI B;  2QGS A;  2L8K A;  2FKW B;  2KWI B;  3IBP A;  3JAF A;  3RK3 E;  4UB8 H;  2FJB A;  3C98 B;  5C39 A;  2DI4 A;  2N9Y B;  2V5D A;  3II6 A;  3L73 J;  3MIW A;  2XAJ B;  2YXR B;  2GUS A;  1BCC J;  1RE3 A;  1KB9 H;  2H7H A;  3F57 A;  4ASV A;  4JI4 T;  2M67 A;  3A5X A;  1RY3 A;  1IO4 A;  4OYJ A;  2V7Q H;  2LSG A;  2IBZ I;  4JI8 T;  1LTI C;  4P1N A;  4DR2 T;  1KOR A;  1QGK B;  5KKZ B;  5L3F B;  2GK9 A;  4XAX B;  2VVS A;  3LIE A;  1LTJ C;  1SQP D;  2BKO A;  3WI3 A;  4YY3 T;  1GL2 A;  3NRY A;  2V6Y A;  5AQP B;  3Q2M A;  3LBX A;  3PE0 A;  1XWM A;  5HXE A;  1LTT C;  1GL2 B;  4BRY B;  1KQL A;  4AI6 A;  1LTS C;  2LHN A;  3LSV A;  4P09 A;  5LJM A;  3RBX A;  5KJ7 C;  4O4J E;  3CPZ A;  3BRT B;  4ILB A;  1J1E C;  3KIN B;  2Y0E A;  4OHF A;  2HN1 A;  1Q2N A;  1J1D B;  1U7J A;  4DV4 T;  1S72 P;  3V4W A;  2XAH B;  1VQ8 P;  4I7Z B;  3CX7 B;  5AQO B;  3ZYK A;  2XAS B;  4BJM A;  3H25 A;  1SVF A;  3KV6 A;  2BAS A;  1MKM A;  4HJG H;  1NTZ J;  3CX6 B;  3FZL B;  3OKQ A;  1HGV A;  2OYH A;  2G8Y A;  5KAI E;  2HPL A;  2AXT H;  2Y9Z A;  4DID B;  5CCH C;  2G3A A;  2E75 B;  3UFG A;  2W6B A;  2JQK A;  3BRV B;  2N1T D;  4KHP T;  4PV1 B;  2W90 A;  1SQQ E;  4UVC B;  1LTG C;  3H1K E;  3RYC E;  3SWH A;  3RL0 C;  3L70 G;  3T97 A;  2IC6 A;  3DTO A;  1KFY A;  2LM9 A;  2ACX A;  3HA4 A;  2QJP C;  1YKE B;  5ETW A;  1L0L J;  1FZC A;  2P2U A;  5BU8 B;  4JI6 T;  2A06 E;  2BKN A;  1S94 A;  4NPP A;  4QWN B;  5JDG A;  1VQ5 P;  4A97 A;  2VUR A;  4CPG A;  3RRC A;  4NUV A;  2NW9 A;  2EHO B;  4AQR D;  4OYK A;  3H1H J;  1LWU C;  5HEO A;  1UIX A;  4YJ2 E;  3I9Y A;  2IFM A;  1IJD B;  3MXZ A;  4AQY T;  3VOP A;  1RQU A;  3G06 A;  1SQQ G;  3CWZ B;  1N7S C;  1BR0 A;  3H1K G;  1S35 A;  4XZC A;  1XMQ T;  4H0L D;  3SWF A;  2N2N A;  4WBN E;  1NTM J;  2PAJ A;  2UXB T;  5LG3 A;  5KAF E;  2A06 G;  1EZV I;  1MMA A;  3MD0 A;  3AVR A;  4YSX A;  3H1J D;  3NBX X;  4NPE A;  1URQ A;  4JI1 T;  2Q5U A;  3KFW X;  1FDI A;  1NU1 E;  2JDI H;  4ZHQ E;  4BJN A;  1URQ B;  3KVB A;  1QVF O;  1L0L K;  4F6R C;  1YJN P;  5H2F H;  1VQ4 P;  1XDP A;  4IRE A;  4CXY A;  3MUD C;  1J2J B;  3RX6 A;  1IFN A;  2K37 A;  1KNP A;  2KZ7 B;  4AXP A;  3C50 A;  2CWY A;  2KB7 P;  3BAT A;  2WMM A;  3R2P A;  3RPU A;  2YO3 A;  4U3F D;  1AQT A;  1VF5 C;  2JR8 A;  1FBM A;  1NU1 G;  3P7I A;  4DMW A;  2LR2 A;  4X5T A;  3L70 D;  5AVZ B;  4GDO A;  1JCC A;  2CWO A;  5AQM B;  1NTM K;  1S4X A;  4U72 A;  5APU A;  1BSH A;  2V5C A;  2LKH A;  3AEE A;  4ANJ A;  2V7L A;  1RF0 C;  1GU5 A;  4PD4 H;  1BGY J;  5J0Z A;  2XQ3 A;  3QK6 A;  3PUA A;  1L4A D;  2VL0 A;  5LOV E;  4EZH A;  1A02 J;  2CK3 H;  3HKB E;  2M8R A;  3VMA A;  1T72 A;  4IDP A;  3AE5 A;  1XZY A;  2AXD S;  1D1B A;  2DW3 A;  1HGZ A;  2E5Y A;  3X1D A;  3H1K D;  1ZR2 A;  2H3R A;  2IBZ G;  2BBH A;  2KT9 A;  3PUX F;  2RKL A;  1FEW A;  2P10 A;  4IL6 E;  2LSJ A;  2XQ4 A;  3SFE C;  4OVN F;  3KPE A;  1KK7 A;  4NIQ A;  2KZI A;  4BXL A;  4PK5 A;  1UK5 A;  3CK6 A;  2BCC D;  4DV0 T;  4YTM A;  5C2T A;  2KYV A;  2RH0 A;  2WPS A;  5F5W A;  3ZT5 A;  2H7V C;  1BR1 A;  3L36 A;  4U2Z A;  2B89 A;  4JI7 T;  1T6A A;  5LJN A;  3PUS A;  5KLV J;  4TX5 A;  2NR4 A;  1SQX E;  4LC1 A;  2WSC H;  2LOP A;  3RQU A;  4EIJ A;  4BAY B;  2CA5 A;  3CCQ P;  2C0S A;  3CX8 B;  3O9X A;  4CQI A;  3MHV A;  1W0A A;  2CEA A;  1W2E A;  4B6X A;  3ETU A;  2KI7 B;  3PLN A;  1CI6 A;  5ABF B;  1IC2 A;  1D0Z A;  3L75 D;  2R3S A;  1HG2 A;  3CXH I;  1VF5 B;  2JKV A;  2P7J A;  1VCS A;  4ZS3 A;  2V8S V;  3B5N A;  2IAK A;  2B9B A;  1RH5 B;  4K3A A;  2CE7 A;  1PGO A;  1MFZ A;  4AKL A;  1HF8 A;  3K8P C;  4WBA A;  2A72 A;  4DBQ A;  3H1I D;  4UV8 B;  3GF7 A;  2VWA A;  4X1I E;  1IFI A;  3I55 P;  5KX5 E;  2NZ2 A;  2XTL A;  4O4I E;  4XBF B;  5BR8 T;  1JTH B;  1D7M A;  2OQQ A;  3FXE A;  4C90 A;  3Q1M A;  4GKG A;  2C9L Y;  2XKM A;  3EDV A;  2YU2 A;  1KQG B;  2AEM A;  3FXE B;  2Y9Y A;  5LCY A;  1NOH A;  3RK2 C;  4UV9 B;  5KLV K;  1W0B A;  4PJJ A;  1O3X A;  4ZI2 D;  5AVQ B;  3AED A;  4HTE A;  2ZT9 D;  1QSD A;  1M90 Q;  5LG4 A;  1SLQ A;  4MN4 C;  1HG5 A;  4LF8 T;  2D0U A;  1GW3 A;  2IBZ D;  2JO1 A;  2LXC B;  1FJG T;  1NHL A;  3NRX A;  3N9L A;  2I8D A;  1ZEE A;  3PUG A;  3Q9D A;  1SQB E;  3O6Q A;  1NH4 A;  4QXC B;  4X66 T;  3AE8 C;  4DND A;  1VQ7 P;  3JCU H;  2R5D A;  1NTK E;  1FMW A;  1B7T A; 
#chains in the Genus database with same CATH homology
 5DJU B;  2KUB A;  1LP1 A;  2LXB A;  1ZW0 A;  1KEY A;  1EC5 A;  5EFW B;  2KZJ A;  1FC2 C;  1EDI A;  1H0T B;  3AXJ A;  3PH0 A;  3QB5 A;  4IOI H;  2RKL A;  2KS1 B;  3AXJ B;  1NVO A;  1ZXG A;  4CPG A;  2B87 A;  2SPZ A;  2KZI A;  2P58 A;  4BXL A;  3RGU A;  3S1K A;  1JMB A;  2B89 A;  1OVV A;  2QVA A;  4EYY Q;  2Q1K A;  3ZDM A;  1H0T A;  1OVR A;  2K3R A;  1X0T A;  3MHV A;  5C39 A;  5CBO A;  2KI7 B;  2QRX A;  5DJT B;  3PJA A;  3PJA J;  2KIK A;  4ASV A;  4NPE A;  4NPD A;  4KJM A;  2JWD A;  5CBN A;  1U7M A;  4ASW A;  4K3A A;  1BDC A;  1S3J A;  4K35 A;  4ZNC A;  3QB5 K;  4GOD A;  1EDL A;  1EDJ A;  2HR3 A;  4HKZ H;  2M5A A;  4GOF A;  4GOE A;  4ZMD A;  3FXE A;  2WMM A;  4JBZ A;  2M5A B;  3MZW B;  3QWO C;  1LT1 A;  2B88 A;  1BDD A;  2M0B A;  4NPF X;  2UWJ E;  1Q2N A;  2R44 A;  1LP1 B;  1U7J A;  2OTK E;  2LR2 A;  1JM0 A;  1Y47 A;  3RIU A;  4MN4 C;  3FXD A;  1J1J A;  3RIU C;  2ZAE B;  2LXC B;  2I8D A;  4HJG H;  1OVU A;  1EDK A;  1DEE G;  4WWI A;  5K5G B;  2B87 B;  4WYV A;  1MFT A;  1SS1 A;  4HB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...