2QRXA

Crystal structure of drosophila melanogaster translin protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
NFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords GM27569p
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qrxA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qrxA01
3FXDA 1X0TA 5EFWB 4CPGA 3PJAJ 1Q2NA 1LT1A 1NVOA 1OVVA 1U7MA 1BDCA 2WMMA 1H0TA 2K3RA 4KJMA 2KIKA 2M0BA 2R44A 3PJAA 4HJGH 5DJUB 4EYYQ 1U7JA 1LP1A 3QB5A 2LXBA 4IOIH 4HKZH 1MFTA 2I8DA 2QVAA 4ZNCA 2SPZA 3MZWB 2B87B 3QWOC 2M5AA 2LR2A 2QRXA 3AXJB 1EDLA 1EDIA 1Y47A 1J1JA 2KZIA 4GOEA 2JWDA 2OTKE 4HB1A 1EDJA 4MN4C 5K5GB 5CBOA 1DEEG 4GODA 3QB5K 3ZDMA 2UWJE 4GOFA 2HR3A 1ZXGA 4NPDA 2Q1KA 1JM0A 4WWIA 5DJTB 1EDKA 3FXEA 4BXLA 4WYVA 5CBNA 2M5AB 4K35A 3RGUA 2KZJA 4JBZA 2KI7B 1SS1A 1H0TB 2KS1B 4K3AA 3AXJA 2P58A 1OVUA 2B87A 4ASVA 3S1KA 5C39A 1BDDA 3PH0A 1LP1B 4NPEA 1KEYA 2KUBA 1JMBA 2LXCB 4NPFX 1FC2C 1S3JA 4ZMDA 1ZW0A 3MHVA 3RIUA 2B89A 4ASWA 2RKLA 3RIUC 1EC5A 2ZAEB 1OVRA 2B88A
chains in the Genus database with same CATH superfamily
3ITKA 4G63A 5J1GA 2E9XA 2E5LT 3G71P 2LT3A 2KNCA 2YMKA 4HWDA 1J1EB 4AQRD 3N5LA 1IJ5A 2R32A 3EFFK 1G73A 2YK0A 4MHCA 1KNPA 2CPSA 2VKHA 3FZMB 3H6PA 5AVRB 5AW5B 4AIUA 2C5IT 2IYOA 4QWNB 1L4AC 3Q5SA 3UULA 3ZT5A 3QH9A 1M7LA 1S94A 4ASKA 2AEMA 3HE5B 5CJ4A 1NO4A 1W2EA 2HN2A 3H1KD 3B5NB 1J5WA 3Q9DA 3PU8A 2Q9QA 2BS3A 3AA1B 3O8ZA 2IYPA 1RF0C 1JB0J 3FWLA 4L73A 4K0UA 4UB6H 2PAJA 2M6IA 3GN5B 4U2YA 2KS1A 5CJ5A 5BU8B 5KLVD 3N9QA 2N2NA 4HGAA 2M6BA 2X9YA 1T72A 5TJHA 3O1HA 1L4AB 1MMNA 1AA0A 2E76C 1GU5A 3GF7A 3VYIA 1OIPA 4IL6X 5DJQC 4DV6T 3C9IA 2ZM8A 5KLVK 1DEEG 2FBWA 1H89A 1XZYA 3MUDA 4AKRB 4YTPC 3E1IA 1T2KD 1EZVE 1AVYA 3UU4A 4HEAA 3SFDC 3KPEA 4O2AE 1T98A 4CI3B 3ZKRA 1BR0A 5L3EB 3RX6A 2BKPA 2AEJA 2WPSA 3H1HD 4COFA 4UF0A 4WYVA 2YOEA 1GU4A 5FYMA 1YQ3A 2IFNA 2QYWA 1X9BA 5AW2B 2NPSC 2DLRA 1ZHCA 4UELA 4JUYA 2KOGA 3CCEP 4JI5T 2JEEA 1QGKB 4I6MC 1OEDB 3AXJA 3A0BE 3CX8B 1FOSF 1GL2C 2K3WA 2OARA 3S4UA 3LG7A 3OJAB 5C39A 3P4RA 3II6A 4HTEA 3H1IG 1KEYA 3PURA 1MV8A 4WY4A 2E76B 1CI6B 5APUA 4D6TE 3CXHD 2WZ7A 3FZHB 3V2PA 1WR6A 4ASWA 3EQ2A 1VQ6P 4GIFA 4KHZF 2PFVA 4LMJA 2XAJB 1S2EA 1W5CE 1Q2NA 2WDVA 1OW8A 1RQVA 1MIWA 4KUMB 3OVUA 4UB8E 1NTKE 3FXDB 4G2AA 1EXJA 3Q5XA 4IL6H 2H88C 2R44A 3CXHH 5L2LA 3FHNA 1IFPA 3L73J 1D1AA 2JP3A 2O01J 1QLED 2QG4A 2RMZA 3CQCB 5H6RB 3VP9A 3RK3D 4EIWA 2DCFA 1BCCJ 2CWOA 4U3FG 3LIEA 5TISE 3QB5A 3Q5DA 2PGDA 4TWFA 4LFBT 3RI5A 1HTJF 3CMLA 2X67A 2SPZA 2XY8B 2ZT9D 4LF6T 2L9QA 2WITA 4JI2T 1I6ZA 4JYCA 4JI4T 1LJ2A 1BCCD 4DBQA 4UVAB 1IK9A 5AQPB 2K48A 3N9MA 4HH2A 5KAFE 4GOEA 5M4YA 2XNXA 3OAKA 2FYUK 3WI3A 1FJGT 4Z8XA 2D2CD 4KHPT 2KYVA 1KYOE 2X0YA 2Q5UA 1AV1A 1BE3J 1RE3A 2E75B 3WUVA 1NTZJ 5LOVE 4AKHA 4QXHB 3ZT6A 5KLIC 3P32A 2RH0A 1H7CA 2HPLA 4JI3T 3VOPA 1M8OB 1W2BO 1JY2O 2Q9QC 2NTXA 3AVSA 3KHUA 2AXTH 4JPZB 1XMOT 3B57A 4GKKT 4B86A 3AEDC 1J1DB 2VWAA 1S35A 3V5SA 5DQVA 3M91A 1HBWA 3EHZA 1SQVK 5KAIH 3JCFA 3MA9A 5JDNA 5LHIB 1EQ7A 2WSEJ 3L8RA 1M56D 4H9QC 5JDMA 4U7YA 1G2CB 3HUSC 4MLKA 5JRCA 4HFEA 1BR4A 4TZ4C 3OPCA 5CCHD 5C3JA 4ZS3A 2BEQD 2CPBA 3SFEC 1KORA 2H43A 4XE5B 4PV1B 2CHNA 4UV8B 3B5NA 5C8YE 2WAUA 4P0BA 4NPPA 3AA0B 3TK1A 3CX5E 5CGMA 3GW6A 3L72J 3CQXC 4ZI3D 1UX5A 5AQRB 2H7VC 3U59A 1OEDC 1SQXJ 5GTIE 1N86A 2CXFA 4JEHB 1J5ET 1R5SA 3AEFC 2VVSA 3RRCA 3CCQP 3CCVP 1I94T 3L70D 2OLTA 3V5UA 3WMM0 2VKJA 3H32A 4ZZCA 2C9NY 5KLVJ 4F8HA 2LRLA 3EAMA 2X68A 4CN6A 3J9X1 3OJAA 5L4HA 2BS4A 2CBJA 5L8RJ 5AQJB 1X22A 4IFDK 2CA5A 3L75J 2BEZF 2XKMA 4LFCT 2L3LA 1NTKK 1JY2P 2KLUA 3M9QA 3PLNA 3AE5A 2QRXA 1N7SD 2IBZG 1SUMB 5J2UE 1BE3G 1YQ4C 3A0BH 4D6TD 4V1Av 4NXMT 3M0AA 4BRYB 3CCLP 3EWKA 1L0NK 2V7QH 2E74D 4X65T 1FZEA 2UWJE 3LFMA 1ZKEA 1KILC 2P2UA 1HJ0A 1BE3D 2ZT9B 3V6IA 2MOZA 3EUHA 3LK3B 3FX0A 3R6NA 3VR8A 1ZRTE 2JQQA 1Q86Q 5M1BA 1S5LH 1KQGB 5CBNA 3AE4C 4X1KE 4EOTA 5L3CB 3L71J 1R8EA 1VQPP 1ZP0A 3P4SA 3R4YA 5B66H 3AECA 1SS1A 3S9OA 1KILE 2WSEH 1LWUC 3HUSA 3JCUH 2MYSA 4GYSA 3U3IA 3TKLB 3H1IE 1Q90D 3I5CA 3QC9A 4I50E 5J2TE 4OGQB 4EZHA 1FZAA 3AEDA 1HR0T 2Q9QB 1DD4A 2YXQB 1PGJA 2LSJA 1VL2A 3HE5A 4JV5T 1S3JA 4DBRA 4DCKA 2N1TA 4H13D 2Z5HA 2CRBA 5AQIB 2YO3A 3B5NC 4LLHA 4EGWA 4ADZA 3JCUE 3OTOT 2UXNB 2ZAEB 1OVRA 1D0YA 3H1KE 1JTHA 2XUEA 1HUCA 1N73C 3PDYA 2K3RA 2CE7A 3SRZA 1JY2N 4L9IA 2WWVA 4O4JE 2A45I 4AQYT 3RBXA 2ES0A 3HL6A 2KXPB 4GKJT 3H1LG 4GOUA 3CCRP 5JDHA 2FYUJ 4DR7T 1RF0A 2LM9A 3PUQA 4QX7B 3NMDA 3L74D 2POHA 3RK3E 3PUVF 1S5LX 4IE0A 1JEKA 4DV3T 5FY7A 2P10A 2VK9A 4OYKA 4BA9A 1KYOI 2VKDA 3VMYA 5IHYA 2OQQA 1QEXA 5LGNB 3MZWB 1OX3A 5AVYB 2XHEB 1PP9G 1WR0A 5LHGB 2V6YB 3AE6A 1EDLA 2BBJA 1PFIA 1YTZT 4PJJA 1J1JA 1D7MA 1SQXD 1YD8G 3BQKA 1FAVA 1PP9J 3V5BA 2V5CA 5LG3A 1N7SC 3ZYLA 3L35A 5LXTE 1SE7A 3L70G 2GK9A 2MTQA 2X66A 1KILA 3C64A 3HTKB 4YFSA 2IFMA 2QGSA 1PGOA 1GZLA 2JR8A 2W2UA 3RL0D 1SHZC 2D0UA 1JM0A 4U3FJ 3IF4A 4W7YA 2Y9ZA 1ZR2A 5CCGA 2PFXA 2XQAA 4KT0J 2YMYA 1YXRA 1W0AA 5APTA 3ONJA 1IO4A 2KZJA 3BCCJ 2KSRA 3AE7A 3RLFF 2E74B 1S9KE 3BVHA 4KHXA 2H88A 2N9BA 3L36A 2LKHA 4OWFA 2QEXP 3KDSE 4IE6A 4O4IE 4X20E 1PZQA 4GIWA 3K5BA 3AE3C 5APXA 2A45H 1NTMG 1IBKT 2QE7H 3M0DA 1WYBA 1FU1A 3NVOA 3U1CA 1MMDA 3RK2D 3EDUA 5HEOA 1AQTA 2PJQA 1EC5A 1FDOA 2XAHB 4H13C 2VB6A 1P84D 1XNRT 2ZYAA 3CQGB 2FYUD 5EFWB 1CUNA 2CEAA 5BMVE 2K24A 1VQ5P 3PJAJ 2IBZI 2QJPB 5BR8T 3VMXA 5ADXL 2K9AA 1NVOA 2JMKA 4EIJA 2Q6QA 4HFCA 5HXHA 3TGUJ 4QH1A 2WPQA 4DO0A 3KV9A 3G6EP 5FY1A 2RN0A 2QM7A 4PV1C 1KTMA 3NBXX 1VQ7P 2WQYC 4U33A 4TX5A 3QUJA 4LF5T 1PV3A 1XDOA 3KZIH 3HKDE 4YSYA 5EK4A 1BGYG 2N1TC 3SSUA 4LF9T 4C7RA 5CCHC 3OA7A 1SQPK 1YW0A 5AW8B 1DU2A 5FL0A 3ANWB 5HXRA 3L75E 2CCQA 1Y8AA 3HKEE 2LJLA 2A06D 5HXSA 4EYUA 1J1DC 1YIJP 3B5MA 1SQQJ 3QWOC 4CXXA 3UIAA 4L5GA 4O4HE 2RPAA 2OYHC 1IFIA 3HA4A 4YJ2E 3L73D 1FS0E 4H44C 3MK7C 2KP8A 1PPJD 4IL9A 4EXTA 2Z4EA 3H1HG 2A06G 3HD7B 4XAXB 4IDOA 2NOXA 4HWFA 2M67A 2E5YA 2XZRA 3DTOA 2UXCT 5TISH 3HRNA 1BE3E 2YDRA 1KV4A 5APVA 4TUYE 1N7LA 1E2AA 3H1IJ 4NPDA 3L70E 1UGOA 2JMHA 3ONXA 3EI0A 4PW8A 2P9BA 3QOFA 2QJPC 3CX6B 2EHOC 1U57A 3HTKA 3CMEP 1VQ9P 2GA1A 2YKSA 4DR1T 3SWYA 2J62A 2XASB 2YDQA 3P4QA 3RH3A 1JY3O 1M1KQ 3BQLA 1L0NJ 1QX8A 3NRYA 1NTZK 1NWQA 4CXWA 2V6YA 1T3UA 1CHUA 2LOPA 4ISTA 5KJ7A 2XAQB 2AEFA 3E08A 5KKZB 3EVYA 2LXCB 4N78E 3WAJA 4H44B 5LYJE 4ILCA 4YTNA 4HKAA 1ZW0A 5JVDE 3C51A 2V6XA 1SQBE 2Z5IA 1KQLA 3C4ZA 5APSA 1YYCA 5DABA 3PE0A 3HD7A 2I6HA 4WY4B 1FZCC 2W0GA 3P7IA 5AQKB 5HAXA 3VR9A 1T6AA 4EV6A 1BCCG 4FJOA 3HKCE 5CA0E 3N9NA 1N8RQ 2HLOA 2QJYC 3CPWO 1U7MA 2LM2A 5GTHE 2WMMA 3RYCE 3H1LE 1SLQA 2A72A 5LJNA 3LW5J 2EHOD 2XQ7A 4H9NC 2NR4A 2NZ2A 1FE6A 3X1DA 2SPCA 1NTKG 1DIPA 1KFMA 2PP6A 1EZ3A 4UV9B 1FZBA 5KLVG 4X5TA 5FY0A 3K3NA 5DQWA 3LIDA 4ZI2D 1QL1A 4HFVA 4HKZH 3D0TA 2N1TD 3PV0F 1MFTA 5CFBA 3MTUE 3H1JJ 4A97A 5AW3B 3SWFA 1RQUA 3P8CD 5HEHA 3C8VA 3HE4A 3RIAA 5ABGA 3TDKA 1M57D 2ZYDA 2Q7CA 3AA7B 2FYUE 5L47A 2VQET 5IYZE 2E76D 1L0ND 2M3EA 2BG9A 5EK3A 3AEFA 3N7NA 5HYAA 1KB9I 2MAWA 1D0ZA 5B66E 3F57A 5L4EA 3O9XA 2BS2A 4YSZA 3PP5A 2B9BA 1HGVA 1YI2P 1T8BA 3TLSA 3Q5PA 4A98A 3CCMP 2MKVA 3OYXA 2Q9QD 4EEDA 3PUGA 1CSBA 2W67A 1L0VA 2Q3EA 4ILUA 4MALA 2WWWA 3BCCE 3PJSK 1HG2A 2IC6A 2YNYA 1S72P 1YQ3C 3UFGA 1VF5B 3H1JD 2FXMA 1VRBA 4FI5A 2ZXEB 1IK7A 3KBTA 3IHRA 1NJIQ 3MZKB 1KB9H 3GWHA 2K37A 5AVWB 2XPKA 2W8ZA 4H44D 3I56P 2W63A 2OA5A 2KSJA 1W9RA 1US7B 2BKOA 2FXOA 5E0OA 5AQTB 4JI1T 4N3YB 1J2JB 3V4WA 4DT0A 5FXVA 4IIJE 1FBMA 4C7NB 3CI9A 4ANJA 2NW7A 3PHLA 2YIUC 4YHJA 4TV9E 5FXWA 2WSCH 1M1JB 5FP3A 4ZEYA 1BGYJ 3FZKB 1N73A 2WSFJ 3S4RA 2KWIB 3A5XA 3UU3A 4JYAT 1T7SA 2DHRA 3AE1A 2WPVB 3B4SA 3DP7A 3P4PA 4TNWA 3AE6C 3ETVA 5HEGA 2M0BA 4JEUB 1YJ9P 4ILBA 1XTCC 2WT7B 4HWIB 2FYNC 3H1KG 2KMFA 1JY3N 5E79E 1BSHA 1GK4A 2L8KA 1IBLT 3F89A 1SQBK 2V26A 1UCUA 3L73E 4TT3H 2C5KT 2R5DA 1NOHA 5E79H 1RF1B 1SFCD 5JDQA 1RE4C 1UURA 2UUCT 3L39A 1HNWT 4NIQA 1NU1K 1HX1B 1R8IA 1MIVA 1MMAA 2F4VT 5AW6B 1JO5A 2X0HA 2FY8A 1O3XA 4LFAT 2XJ7A 2FFDA 4LMLA 2Q9IA 4W7ZA 1HF9A 2I59A 4BJNA 4TV8E 3UUBA 5KMGP 5ABHA 1NU1J 5AVQB 2ZLYA 4MN4C 2ZMAA 3L70J 5CBOA 3PU3A 3VMZA 1L0LD 5HEUA 3A0HE 3H1HJ 5HXCA 1FJKA 1YBKA 3CC7P 1VQMP 3NTNA 4PK6A 1GK6A 4MBQA 1WRGA 5AW0B 2A3DA 3RGLA 3UUXB 2JJLA 1BCCE 1HCIA 3ZSSA 5APWA 3SWKA 2G3AA 2X51A 2BZBA 2AXCA 2XDJA 4X1YE 4JI6T 2LLYA 3PUWF 5TAOA 2O01H 3H3MA 4O9BA 3FZFB 1KZUB 1LTAC 2LOSA 4GYRA 1UK5A 3O4XE 1LTIC 1RF1A 1UX4A 1FDIA 2JIWA 1OEDE 2WQYA 1BSNA 5AQSB 3L75G 1KC8Q 2H8PD 3RIUA 2WT7A 2FFDC 3UQ7A 3BRTB 1YQ4A 1KNZA 4WW0A 4R4LA 4B3TT 2Y9YA 3RL0B 3AEAC 1NH4A 5FNVE 3F31A 5JH7E 3CC2P 2MPKA 2WWUA 2AXTE 1NTKJ 2WSCJ 2DW3A 5KKZC 1LT1A 1M1JA 2XQ5A 3ZMUB 2FJEA 2QJKB 2HFED 3ZCJA 2E9XC 3AB3B 2XU6A 4DV4T 3AE2C 3RYFE 5APQA 2N1GA 4HJGH 4WB4A 3I55P 1KD1Q 1VQKP 3IA3A 5EK2A 3RF1A 3JC6C 2HPCA 1OFCX 1D1BA 1SQXE 2M8RA 2LXBA 1FZFA 4PJMA 4OGQC 4EB6E 1QL2A 4XA4A 3GLMA 2E5TA 1LT9B 2WM9A 5KJ7D 4ERRA 2W66A 3RBZA 4H9RC 2N9DA 2NTYA 1VQOP 2P1JA 4GKGA 2IZ1A 1BGYE 2W6BA 1HFAA 2LR2A 3QNUA 2UUAT 1QVGO 3RL0C 1OEDA 3AXJB 3IN6A 3JADA 3H3AA 3AAAB 4KI0F 1S1CX 4H0LC 4DR3T 1L0NG 1LTJB 3FBZA 1EDJA 2EHOA 1PPJE 1V9DA 1E79H 5FMNA 2GUSA 3AE9A 2HR3A 5JRCB 4CN1A 1G8XA 4I0UA 3B8EB 2XZEA 1FMVA 1DEBA 3Q1MA 1Q7YQ 5KXJA 5AW7B 4DJGA 2QJYB 5AVXB 1FOSE 3HE4B 2VURA 5LB7B 3KBUA 3RYIE 4X1IE 4OH8B 3BATA 2BCCD 4D6TJ 3HI2A 3HKBE 4EOZB 4YXDC 4WY4D 1YHQP 5HWYA 1Q81Q 5FXXA 5LBMA 3D6ZA 5KAFH 3NKZA 3K8PC 3P7KA 3E1RA 3PUSA 4L74A 2DWKA 1X8YA 2HG5D 3B71A 1SFCC 5IWAT 5B5EH 2OYIB 2XM2A 3ABVC 2ZFCA 2YKQA 1XWMA 3A8YC 3KINB 4ZMDA 3ZMTB 4RESB 1Y01A 3G4SP 3AEBA 3KQGA 2I1JA 2EHOB 4LF7T 1MIYA 4GK0E 2FYNB 3RIUC 2YU2A 1L0LE 1MUUA 3H1ID 1IFNA 3TLUA 3I0QA 4PK5A 3WU2E 4H9PC 4UEMA 2MBGA 4O8SA 3ZPOA 3UT5E 4ISSA 3CD6P 2A45G 2Q3IA 4U31A 4IHJE 4D6TG 3HR0A 4JYBA 3VKHA 4IE7A 3M9BA 3ZSTA 5B5EE 5L3GB 4XBFB 1QLBA 3A5TA 2W83C 2HPCB 1M7KA 4NXNT 4WBNE 1LP1A 1WT6A 2D2SA 3LDQB 3MACA 5AQLB 1KILB 1NENA 2ITAA 2I8DA 3MD0A 2CK3H 4JI7T 1P84I 4ZNCA 2N9YB 1VQ4P 3D6YA 2JKVA 4WY4C 1FZCB 1JMMA 4UB6E 1NTME 5JREA 2M3BA 1KNRA 3AE7C 1MZ9A 1SQBJ 3H25A 2JJ9A 1AJYA 1LTTC 2XQ6A 3KFWX 3CMAP 2ACXA 5ABFB 2NW8A 4HB1A 3T1YT 4Y99B 3H1JE 4OYJA 3ZDMA 5F5WA 4C90A 4Y28J 4WNKA 2IDBA 1L0LG 5CCGC 1ZV4X 2A9UA 2QA4P 2YINA 1WLXA 3DJBA 5DJTB 4YXDA 4DUZT 4ZI7E 2C0XA 3ESLA 2IZ0A 2M5AB 2WS3A 2KINB 4M3LA 2KNDA 4DV0T 4YT0A 2P7JA 4ZI3C 4PJ0E 4R4MA 5JTGA 1Z0PA 5AQVB 5AVVB 3CPZA 2WDQA 4IFMA 2XTLA 3NZQA 4UF0B 1OVUA 2FKWB 1SFCA 2Y0DA 4TLFA 4HE8A 3W67A 2H89C 3T97B 4OX9T 4TWDA 3GHGC 3TNUB 3BCCD 2OTJP 4ZOLE 3KDPB 3LBXA 4OHFA 5IUXA 5BVZA 4PD4D 1ZLLA 4IL6E 2VL8A 1X79A 1KILD 3FZLB 3I9WA 4HYTB 1Y9BA 1CW5A 1IJDB 4EEBA 4L76A 1WYCA 2DL1A 4DV2T 3K3OA 3L72G 2FFDB 4I7ZB 1QVFO 1SQVE 3KXDA 4JF7A 1K73Q 4OFZA 2ZVNB 3RK3C 2ZJSE 2DWGA 4U2ZA 3ZN1B 1OVVA 1KFYA 2MJZA 2KZ7B 4IDZA 2HH7A 3AEGA 2PBIA 3GN5A 3AAIA 4AYCA 1VCSA 2BCCE 4PK4A 4XZCA 2WZHA 4YY3T 3CIRA 1YKEB 2IX7C 3P8MC 3CWBG 1YJWP 1LT9C 1NTZG 5AVZB 3CK6A 1OZHA 4DVDA 1DH3A 4I43B 2E75C 3VKGA 3TGUG 2C0WA 4X64T 1UIXA 2KLQA 2VASA 1OMIA 1S5LE 1LGHB 2V7MA 2B87B 4C46A 4C91A 2G0UA 4NUUA 1BR1A 5LNKA 2V5DA 3TLWA 4QHOA 4DV5T 2E9XB 1VQ8P 1OWAA 4PFOA 2R6GF 4YHHT 2OYOA 1UIIA 1PGPA 3BQIA 2W62A 5AQOB 3FGAD 1RHZB 1BGYD 1HH0A 5HEJA 3CCJP 3EDVA 1LTBC 1L4AD 2JO1A 1ZMEC 2A2FX 2ACZA 4TWHA 2R3SA 1TU3F 1N36T 1ZN5A 3ZMSB 4YTPA 1NWMX 5HCJA 2O01N 5AQQB 4TN7B 3OBVE 3C1LA 2IC9A 1NAFA 1W09A 1JY3P 4OK0A 5APYA 2ZVOB 1NHLA 4Z90A 3UFEA 4EI2A 4J2CA 3CWBJ 4IE5A 3S1KA 3VN0A 4U7IA 1SQXK 4I2LC 5L3BB 3NRXA 4H0LB 3T8OA 5AW1B 4NPFX 1USDA 3BASA 3HD7C 3VMAA 4AQFC 4L0RA 1G2CA 2B89A 2E5VA 1FDMA 2B88A 3NZPA 2XQ9A 2BG9E 4IDPA 2KSEA 3AE8A 1JTHB 3Q2MA 3VHLA 2PRRA 3GHGB 2NPSD 3F5HA 4YJ3E 5H2FE 4PD4I 2I0MA 3H1HE 1T3JA 2RA1A 3RK3B 1H0TA 1GL2B 3RHWA 3GF3A 4LGDE 3W68A 3CKDA 2QIWA 1AVOA 5LG4A 2N1TB 3LJCA 4M1PA 3CXHI 3U1AA 2OV9A 1VCTA 2WSSH 4EYYQ 3ETUA 1VF5C 2IW5B 1SQQK 3LBXB 4OGQD 1YJNP 4DR5T 2C0SA 1SFCB 2WTYA 3CCUP 2H7HA 4U3CA 2QSIA 1SVFA 3UU8A 2CXLA 1ZV8A 2Z6EA 4Y99C 5LJMA 5HWXA 2K1AA 1J1EC 3AEEC 4CI1B 5GTHH 2M5AA 3A3YB 2D2CB 2QM8A 2BBHA 3N2OA 3UQ4A 4JI0T 2IDOB 3PUZF 2FXPA 3AEAA 2OTKE 5JR9C 4AUWA 3IR9A 2VQFT 3JC6D 4BJMA 1NU1D 4ZKPA 5AQUB 4X62T 1SP4A 1LKXA 2L91A 1LTGC 2ZM6T 2R5BA 4EDFA 5KAIE 2HODB 2ODUA 1L0LJ 1LNQA 3K1SA 4KBMB 1URQD 4DUYT 3ZJ1A 4GT1A 2W6JH 3Q5RA 2LE8A 3AE9C 5KTBA 3AA6B 1LTJA 3N4XA 1GL2D 4ZXLA 1X9VA 3Q3DA 2V7KA 1GQEA 3D71A 1UUSA 3VRBA 4UVBB 3KZIE 3PRJA 2V7IA 2VKOA 2BKNA 1CZQA 2XM1A 1LP1B 1AQ5A 2AXDS 4KMCA 3V4QA 4CI2B 4AQFA 3H1KJ 4QX8B 3ZC1A 1H88A 3AE8C 3H32B 4H13B 4TNVA 3CCSP 2FYZA 5CCHA 4N78D 1VPCA 5GTIH 1PL5A 3CC4P 3V2QA 4IGUA 2LHRA 3U78A 1HG5A 1PGQA 3IBPA 4DMWA 1X0TA 3IF8B 3RC8A 3N9OA 3G3ZA 4ZKUA 3EABA 1SQPJ 1WRDA 2VRSA 4PFPA 3AEBC 5CB4E 1EZVI 2K5BB 2ODVA 3ZYMA 4O2BE 1H8AA 2KIKA 2CLYC 3N9LA 2WZIA 4LMKA 3VRAA 2A06E 5AQNB 1IC2A 5CCGD 4BAYB 2WU5A 2HODA 3KYQA 1RE4A 2XQ8A 3M9HA 4KP3C 2FBWC 2UXXB 1FEWA 1VOMA 3M0DC 2V8SV 2D9DA 3TGUE 4DR4T 2WPRA 1HS7A 4ZS2A 2OYIC 4B3RT 3FB2A 5AVSB 2LSGA 2O3JA 2G8YA 1HJBA 1SQQD 1LRZA 1IFDA 2XQ4A 2XV5A 5LCYA 2QVAA 3JC22 4UIGA 1G1IA 1KF6A 5KX5E 2J4GA 1KYOD 4UB8H 3KV6A 3L71D 3K3QC 1N7SB 3V2RA 2X9WA 2WSFH 4DMVA 3SFEA 4A7PA 1Y47A 4AXPA 1SQVD 3RL0g 3FWNA 2UXDT 3MUDC 5BU5A 5LGTB 2Y6XA 1SQQE 2WBLA 4B3MT 5ETWA 3JSVC 3I1AA 3L71G 3PUYF 5GONE 5AQGB 4DZOA 4DR2T 2DNXA 5JR9B 3MP7B 2CHOA 1IFJA 1KN7A 3LK42 2B1EA 2PG8A 4I1LA 2C9LY 2WDRA 1B7TA 3L3PA 2LSKA 4LC1A 5AQHB 1WFDA 1JCCA 1ZOYC 3T1HT 3H1JG 1GL2A 1LT9A 1H0TB 1K9MQ 3A2AA 2ZM2A 4K3AA 5J0ZA 2VL0A 2OTLP 2Y0CA 3GHGA 5AFUL 2ZT9C 3AEGC 2IIUA 1BDDA 3PH0A 2W6AA 2FJDA 4A5XA 4A56A 1RF1C 2E2AA 1HNXT 2LEHA 3CWBD 3ZT7A 4KX6A 1SQXG 2I1KA 3V2NA 3CXHE 1HNZT 4HWHA 1IZNB 3M65A 2XNDH 3ONLC 2BDEA 4L75A 3FXDA 1MNEA 3KVAA 3RKGA 1LTSC 5CHXA 2L5GB 1WCRA 5LMNT 3CWZB 3UUMA 3O1JA 4Q25A 5FXZA 1KK7A 2JQ9A 2UUBT 3ZN0B 4KJMA 2NP9A 4WVZA 3ZCIA 1XTGB 2KT9A 4HWCA 2YIUB 5L3DB 3AVRA 4CXYA 4CN4A 4DV1T 3OW2O 1CI6A 2JRKA 1ZOYA 3L74E 1PP9D 2FYUG 2WMOA 1URQC 2V4HA 1U7JA 3VP8A 2BASA 4IOIH 3CVRA 2W90A 4I7ZC 3N2KE 2YKPA 4X66T 1EZVD 4N6JA 3CX7B 1W0BA 1M1JC 4YSXA 3L4FA 4DNDA 4CZZB 4QH5A 4HFHA 3L74J 1N2DC 5KLIB 2IPPA 3HD7D 5LGUB 1OW6A 1N33T 2ZXXA 5K5GB 5LP6E 1RE3C 4HFBA 2YEVC 3LW5H 4GODA 3G06A 3P8CE 1U5PA 2CXDA 1JNZA 4AQGA 1ZXGA 3GA8A 1XNQT 1FJPA 4AKGA 2YXRB 3L72E 2E75D 1L0NE 1NKZB 3CLQA 1M62A 1GW3A 1PIXA 5CMZA 2D5UA 1HVVA 2JQKA 4GDOA 2K88A 4K35A 2OGUA 5L3FB 3VTPC 3B13A 3RGUA 2KWHA 4XFJA 2X0LB 4ZHQE 1AJ3A 3NFQA 4AISA 3ABVA 2KS1B 2H3RA 3ZC0A 4IE4A 3L37A 2P58A 3AE3A 1N7SA 3RYHE 1SQPG 4NPEA 1SQPE 4IREA 2Y48B 3W15B 1IBMT 1NU1G 2KK7A 3L73G 5AVTB 3TYYA 3GMAA 5AVUB 1KQFB 3RQUA 4PNIA 4U72A 4YPCA 2RKLA 2CBIA 1HTLC 2CMRA 3I0OA 5AQMB 5H6QB 1JNRA 4E7ZA 3T97A 4U3FE 1MMGA 1SQQG 4CPGA 3O1IA 2V7JA 2KNCB 4UXNB 4U74A 3RQWA 3TGUD 4HN9A 1QSDA 4PD4E 1U4QA 5AQFB 2J5UA 2R3CA 2J47A 1NKNA 1SQBD 1DD3A 5HCMA 5JDFA 2XSAA 1KMIZ 1PP9E 1URQA 2LSYA 4U7JA 2XAGB 5DJUB 1RH5B 1LTJC 2DI4A 5ABEA 3O6QB 2BVLA 1XDPA 1MKMA 3RIFA 5CJ0A 2GUVA 1JUNA 4LF8T 3CWBE 2O1JA 1JOCA 4IFFA 2AE9A 1NU1E 2WCAA 2OYHA 2W61A 2BCCG 1MNDA 2W00A 2FJAA 2NPSB 5HXEA 3RC3A 3ZYKA 1EDIA 3AAEB 3UU5A 2X9HA 4JLEA 1KB9D 3A7OA 3MIWA 2LSIA 1SA0E 2B76A 4W80A 3JAEA 3MXZA 2KZIA 1GD2E 1ZR4A 3KVBA 1IAPA 2YU1A 4WBAA 1JNMA 1L2PA 4EAHA 4P1NA 3H37A 1BR2A 1OW7A 1R5LA 1FMWA 1HGZA 2E74C 3AECC 3WUUA 4P0AA 4JQ0D 2Q1KA 1NTMD 4WWIA 4EYYR 1N34T 4CQIA 2BG9B 1HWTC 3TF5A 1SQPD 1NAYA 3WAKA 3IEEA 3UU6A 1IJ6A 2WP9A 1GW4A 1K04A 4H9OC 2NW9A 2KI7B 4HFIA 5LBQB 3WU2H 2C5JA 1NEKA 1NTZE 3D70A 3M06A 1HF8A 3WUTA 3LK2B 5FKYA 3AE4A 3NWIA 4YXWH 3RK2C 4AI6A 2UXBT 1LWUB 1E1HB 5JR9A 1VQLP 2HHHT 2K9JB 2PTFA 1IFMA 3ANWA 3Q2YA 1P84E 5KLVE 2Y8DA 2OYIA 3BK9A 3OKQA 3PUXF 3ZMZB 2O1KA 1YITP 5FVKA 2CWYA 1FIOA 2E9XD 3SS1A 2WB5A 3PTZA 2HYNA 3USSA 1E7PA 5EZYE 3RK2B 1S4XA 3ZEFB 4LF4T 3UUNA 3PJAA 4Z91A 4ILAA 2IAKA 4RKUJ 2X9XA 4H63V 3AE2A 1ZEEA 4ZZBA 4PJLA 5AW9B 1KQSO 2CPTA 2HPJA 1HX8A 4AKIA 2YDSA 1Z56A 2JQHA 3H1LJ 2IBZD 2IMLA 2YN6A 5FVLA 3Q5WA 4EZ4A 2V1DB 2XSBA 4DOJA 2J58A 3C4XA 3QK6A 3E7KA 3H1LD 2BG9C 1USEA 1YTZI 2H89A 4K0KT 2JPFA 2FJBA 2D0TA 3C4WA 5F8PA 1FZGA 2W4XA 1DX7A 4IL4A 3KV5A 2V7QJ 2J59M 2J1DG 1YKHB 2OYHB 2LKGA 2QA7A 3I9YA 4E7SA 3IAOA 2H7OA 4RO0A 2HN1A 2WU2A 2JWDA 3TLVA 4P09A 1NTKD 4UVCB 3QB5K 2WY2A 4PV1D 4IT4A 3JAFA 3R84B 1Q82Q 3O6QA 1EDKA 5LHHB 1P84H 5H2FH 1URQB 4BXLA 2W27A 4I55E 4AKLA 1Y64B 2XQ3A 5KDMC 3MGNA 3L75D 4JBZA 2Y0EA 2IHR1 4H63H 1PPJG 2E43A 1D1CA 1A02F 2WSSV 4DV7T 4DIDB 2KB7P 3ZLIA 4IDNA 3L74G 4B3ST 2B87A 4ASVA 2XAFB 5C2TA 3TSIA 1G1JA 1JMBA 3CX5I 4IDQA 3N2GE 1VDFA 2GM4A 5JDGA 4QH4A 1FC2C 2E42A 3L09A 4BWNA 3EFGA 1GTWA 3MHVA 4O4LE 1GDTA 1VQNP 4HFDA 1XMQT 4Z1MH 4U3FD 5JDLA 1NTMJ 1L0LK 3RKOA 4OVNF 3MKDA 1L4AA 4QXBB 5FL1A 2CLYB 3M3ZB 3Q5EA 3SOLA 4JI8T 3LSVA 3AEEA 3L72D 2JDIH 3OYZA 5LA6E 2V7LA 1BDCA 3AE5C 3RRWA 5A1LA 1EXIA 4WBOA 3N9PA 3A0HH 4QKNA 4F6RC 2K9YA 2RP4A 3L71E 3RPUA 2K9JA 1K05A 2VVNA 1NYHA 3F2EA 3KV4A 2YKOA 1A02J 1LWUA 1OXZA 1SQVG 4QXCB 4WZXA 3GMIA 1K8AQ 1X79B 2LRKA 2WMNA 4NUVA 3R2PA 1VF5D 1T8ZA 1E5WA 3SWHA 2ZM0A 3TNUA 4YTMA 3IFMA 5AW4B 2JWAA 4DR6T 2CM0A 5F3JA 3NXSA 1LVFA 3P4WA 3BRVB 3CX5H 1NGMB 4H0LD 3E22E 1ZRTD 2IUBA 3C98B 4MFRA 4B6XA 1GMJA 3HUSB 3P50A 2BCCJ 1M90Q 1D0XA 3CL3D 3FBLA 3G9RA 3BCCG 3C50A 4QMAA 1EZVG 4PJ0H 1T2KC 4PAGA 4GK5E 4GOFA 1ZP0C 1S9KD 3AE1C 2FUPA 1NTZD 2E8IA 1QUUA 3B5ND 1RY3A 1JCDA 1KFNA 3UTKA 2P67A 1N32T 2LHNA 1SQVJ 2XQYA 2UU9T 2NRGA 3FXEA 5JQGE 2NPSA 5CA1E 4BRYA 2LKMA 1NTMK 5ABFA 3SFDA 2YO2A 2QJKC 5KJ7C 3J7Yq 1SQBG 3E0ZA 1N73B 1MFZA 2WVRA 2BVMA 1WMKA 3FXEB 3ZMVB 4UR9A 4RJTA 3MJXA 3VU7H 1FZCA 3CX5D 1Z8UA 2IBZE 5LMUT 2KUBA 4H9SE 1KYOH 4C7NA 4YLHA 1KB9E 4ZI2C 1AFOA 4PJNA 2ZYGA 4PD4H 3GG2A 2NWBA 3TLTA 3A7MA 1LVKA 2KLVA 3PTRB 4I4TE 3ZJ2A 3PUAA 4JBWF 2D2CC
chains in the Genus database with same CATH topology
3FXDA 1X0TA 5EFWB 4CPGA 3PJAJ 1Q2NA 1LT1A 1NVOA 1OVVA 1U7MA 1BDCA 2WMMA 1H0TA 2K3RA 4KJMA 2KIKA 2M0BA 2R44A 3PJAA 4HJGH 5DJUB 4EYYQ 1U7JA 1LP1A 3QB5A 2LXBA 4IOIH 4HKZH 1MFTA 2I8DA 2QVAA 4ZNCA 2SPZA 3MZWB 2B87B 3QWOC 2M5AA 2LR2A 2QRXA 3AXJB 1EDLA 1EDIA 1Y47A 1J1JA 2KZIA 4GOEA 2JWDA 2OTKE 4HB1A 1EDJA 4MN4C 5K5GB 5CBOA 1DEEG 4GODA 3QB5K 3ZDMA 2UWJE 4GOFA 2HR3A 1ZXGA 4NPDA 2Q1KA 1JM0A 4WWIA 5DJTB 1EDKA 3FXEA 4BXLA 4WYVA 5CBNA 2M5AB 4K35A 3RGUA 2KZJA 4JBZA 2KI7B 1SS1A 1H0TB 2KS1B 4K3AA 3AXJA 2P58A 1OVUA 2B87A 4ASVA 3S1KA 5C39A 1BDDA 3PH0A 1LP1B 4NPEA 1KEYA 2KUBA 1JMBA 2LXCB 4NPFX 1FC2C 1S3JA 4ZMDA 1ZW0A 3MHVA 3RIUA 2B89A 4ASWA 2RKLA 3RIUC 1EC5A 2ZAEB 1OVRA 2B88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXD A;  1X0T A;  5EFW B;  4CPG A;  3PJA J;  1Q2N A;  1LT1 A;  1NVO A;  1OVV A;  1U7M A;  1BDC A;  2WMM A;  1H0T A;  2K3R A;  4KJM A;  2KIK A;  2M0B A;  2R44 A;  3PJA A;  4HJG H;  5DJU B;  4EYY Q;  1U7J A;  1LP1 A;  3QB5 A;  2LXB A;  4IOI H;  4HKZ H;  1MFT A;  2I8D A;  2QVA A;  4ZNC A;  2SPZ A;  3MZW B;  2B87 B;  3QWO C;  2M5A A;  2LR2 A;  2QRX A;  3AXJ B;  1EDL A;  1EDI A;  1Y47 A;  1J1J A;  2KZI A;  4GOE A;  2JWD A;  2OTK E;  4HB1 A;  1EDJ A;  4MN4 C;  5K5G B;  5CBO A;  1DEE G;  4GOD A;  3QB5 K;  3ZDM A;  2UWJ E;  4GOF A;  2HR3 A;  1ZXG A;  4NPD A;  2Q1K A;  1JM0 A;  4WWI A;  5DJT B;  1EDK A;  3FXE A;  4BXL A;  4WYV A;  5CBN A;  2M5A B;  4K35 A;  3RGU A;  2KZJ A;  4JBZ A;  2KI7 B;  1SS1 A;  1H0T B;  2KS1 B;  4K3A A;  3AXJ A;  2P58 A;  1OVU A;  2B87 A;  4ASV A;  3S1K A;  5C39 A;  1BDD A;  3PH0 A;  1LP1 B;  4NPE A;  1KEY A;  2KUB A;  1JMB A;  2LXC B;  4NPF X;  1FC2 C;  1S3J A;  4ZMD A;  1ZW0 A;  3MHV A;  3RIU A;  2B89 A;  4ASW A;  2RKL A;  3RIU C;  1EC5 A;  2ZAE B;  1OVR A;  2B88 A; 
#chains in the Genus database with same CATH topology
 3ITK A;  4G63 A;  5J1G A;  2E9X A;  2E5L T;  3G71 P;  2LT3 A;  2KNC A;  2YMK A;  4HWD A;  1J1E B;  4AQR D;  3N5L A;  1IJ5 A;  2R32 A;  3EFF K;  1G73 A;  2YK0 A;  4MHC A;  1KNP A;  2CPS A;  2VKH A;  3FZM B;  3H6P A;  5AVR B;  5AW5 B;  4AIU A;  2C5I T;  2IYO A;  4QWN B;  1L4A C;  3Q5S A;  3UUL A;  3ZT5 A;  3QH9 A;  1M7L A;  1S94 A;  4ASK A;  2AEM A;  3HE5 B;  5CJ4 A;  1NO4 A;  1W2E A;  2HN2 A;  3H1K D;  3B5N B;  1J5W A;  3Q9D A;  3PU8 A;  2Q9Q A;  2BS3 A;  3AA1 B;  3O8Z A;  2IYP A;  1RF0 C;  1JB0 J;  3FWL A;  4L73 A;  4K0U A;  4UB6 H;  2PAJ A;  2M6I A;  3GN5 B;  4U2Y A;  2KS1 A;  5CJ5 A;  5BU8 B;  5KLV D;  3N9Q A;  2N2N A;  4HGA A;  2M6B A;  2X9Y A;  1T72 A;  5TJH A;  3O1H A;  1L4A B;  1MMN A;  1AA0 A;  2E76 C;  1GU5 A;  3GF7 A;  3VYI A;  1OIP A;  4IL6 X;  5DJQ C;  4DV6 T;  3C9I A;  2ZM8 A;  5KLV K;  1DEE G;  2FBW A;  1H89 A;  1XZY A;  3MUD A;  4AKR B;  4YTP C;  3E1I A;  1T2K D;  1EZV E;  1AVY A;  3UU4 A;  4HEA A;  3SFD C;  3KPE A;  4O2A E;  1T98 A;  4CI3 B;  3ZKR A;  1BR0 A;  5L3E B;  3RX6 A;  2BKP A;  2AEJ A;  2WPS A;  3H1H D;  4COF A;  4UF0 A;  4WYV A;  2YOE A;  1GU4 A;  5FYM A;  1YQ3 A;  2IFN A;  2QYW A;  1X9B A;  5AW2 B;  2NPS C;  2DLR A;  1ZHC A;  4UEL A;  4JUY A;  2KOG A;  3CCE P;  4JI5 T;  2JEE A;  1QGK B;  4I6M C;  1OED B;  3AXJ A;  3A0B E;  3CX8 B;  1FOS F;  1GL2 C;  2K3W A;  2OAR A;  3S4U A;  3LG7 A;  3OJA B;  5C39 A;  3P4R A;  3II6 A;  4HTE A;  3H1I G;  1KEY A;  3PUR A;  1MV8 A;  4WY4 A;  2E76 B;  1CI6 B;  5APU A;  4D6T E;  3CXH D;  2WZ7 A;  3FZH B;  3V2P A;  1WR6 A;  4ASW A;  3EQ2 A;  1VQ6 P;  4GIF A;  4KHZ F;  2PFV A;  4LMJ A;  2XAJ B;  1S2E A;  1W5C E;  1Q2N A;  2WDV A;  1OW8 A;  1RQV A;  1MIW A;  4KUM B;  3OVU A;  4UB8 E;  1NTK E;  3FXD B;  4G2A A;  1EXJ A;  3Q5X A;  4IL6 H;  2H88 C;  2R44 A;  3CXH H;  5L2L A;  3FHN A;  1IFP A;  3L73 J;  1D1A A;  2JP3 A;  2O01 J;  1QLE D;  2QG4 A;  2RMZ A;  3CQC B;  5H6R B;  3VP9 A;  3RK3 D;  4EIW A;  2DCF A;  1BCC J;  2CWO A;  4U3F G;  3LIE A;  5TIS E;  3QB5 A;  3Q5D A;  2PGD A;  4TWF A;  4LFB T;  3RI5 A;  1HTJ F;  3CML A;  2X67 A;  2SPZ A;  2XY8 B;  2ZT9 D;  4LF6 T;  2L9Q A;  2WIT A;  4JI2 T;  1I6Z A;  4JYC A;  4JI4 T;  1LJ2 A;  1BCC D;  4DBQ A;  4UVA B;  1IK9 A;  5AQP B;  2K48 A;  3N9M A;  4HH2 A;  5KAF E;  4GOE A;  5M4Y A;  2XNX A;  3OAK A;  2FYU K;  3WI3 A;  1FJG T;  4Z8X A;  2D2C D;  4KHP T;  2KYV A;  1KYO E;  2X0Y A;  2Q5U A;  1AV1 A;  1BE3 J;  1RE3 A;  2E75 B;  3WUV A;  1NTZ J;  5LOV E;  4AKH A;  4QXH B;  3ZT6 A;  5KLI C;  3P32 A;  2RH0 A;  1H7C A;  2HPL A;  4JI3 T;  3VOP A;  1M8O B;  1W2B O;  1JY2 O;  2Q9Q C;  2NTX A;  3AVS A;  3KHU A;  2AXT H;  4JPZ B;  1XMO T;  3B57 A;  4GKK T;  4B86 A;  3AED C;  1J1D B;  2VWA A;  1S35 A;  3V5S A;  5DQV A;  3M91 A;  1HBW A;  3EHZ A;  1SQV K;  5KAI H;  3JCF A;  3MA9 A;  5JDN A;  5LHI B;  1EQ7 A;  2WSE J;  3L8R A;  1M56 D;  4H9Q C;  5JDM A;  4U7Y A;  1G2C B;  3HUS C;  4MLK A;  5JRC A;  4HFE A;  1BR4 A;  4TZ4 C;  3OPC A;  5CCH D;  5C3J A;  4ZS3 A;  2BEQ D;  2CPB A;  3SFE C;  1KOR A;  2H43 A;  4XE5 B;  4PV1 B;  2CHN A;  4UV8 B;  3B5N A;  5C8Y E;  2WAU A;  4P0B A;  4NPP A;  3AA0 B;  3TK1 A;  3CX5 E;  5CGM A;  3GW6 A;  3L72 J;  3CQX C;  4ZI3 D;  1UX5 A;  5AQR B;  2H7V C;  3U59 A;  1OED C;  1SQX J;  5GTI E;  1N86 A;  2CXF A;  4JEH B;  1J5E T;  1R5S A;  3AEF C;  2VVS A;  3RRC A;  3CCQ P;  3CCV P;  1I94 T;  3L70 D;  2OLT A;  3V5U A;  3WMM 0;  2VKJ A;  3H32 A;  4ZZC A;  2C9N Y;  5KLV J;  4F8H A;  2LRL A;  3EAM A;  2X68 A;  4CN6 A;  3J9X 1;  3OJA A;  5L4H A;  2BS4 A;  2CBJ A;  5L8R J;  5AQJ B;  1X22 A;  4IFD K;  2CA5 A;  3L75 J;  2BEZ F;  2XKM A;  4LFC T;  2L3L A;  1NTK K;  1JY2 P;  2KLU A;  3M9Q A;  3PLN A;  3AE5 A;  2QRX A;  1N7S D;  2IBZ G;  1SUM B;  5J2U E;  1BE3 G;  1YQ4 C;  3A0B H;  4D6T D;  4V1A v;  4NXM T;  3M0A A;  4BRY B;  3CCL P;  3EWK A;  1L0N K;  2V7Q H;  2E74 D;  4X65 T;  1FZE A;  2UWJ E;  3LFM A;  1ZKE A;  1KIL C;  2P2U A;  1HJ0 A;  1BE3 D;  2ZT9 B;  3V6I A;  2MOZ A;  3EUH A;  3LK3 B;  3FX0 A;  3R6N A;  3VR8 A;  1ZRT E;  2JQQ A;  1Q86 Q;  5M1B A;  1S5L H;  1KQG B;  5CBN A;  3AE4 C;  4X1K E;  4EOT A;  5L3C B;  3L71 J;  1R8E A;  1VQP P;  1ZP0 A;  3P4S A;  3R4Y A;  5B66 H;  3AEC A;  1SS1 A;  3S9O A;  1KIL E;  2WSE H;  1LWU C;  3HUS A;  3JCU H;  2MYS A;  4GYS A;  3U3I A;  3TKL B;  3H1I E;  1Q90 D;  3I5C A;  3QC9 A;  4I50 E;  5J2T E;  4OGQ B;  4EZH A;  1FZA A;  3AED A;  1HR0 T;  2Q9Q B;  1DD4 A;  2YXQ B;  1PGJ A;  2LSJ A;  1VL2 A;  3HE5 A;  4JV5 T;  1S3J A;  4DBR A;  4DCK A;  2N1T A;  4H13 D;  2Z5H A;  2CRB A;  5AQI B;  2YO3 A;  3B5N C;  4LLH A;  4EGW A;  4ADZ A;  3JCU E;  3OTO T;  2UXN B;  2ZAE B;  1OVR A;  1D0Y A;  3H1K E;  1JTH A;  2XUE A;  1HUC A;  1N73 C;  3PDY A;  2K3R A;  2CE7 A;  3SRZ A;  1JY2 N;  4L9I A;  2WWV A;  4O4J E;  2A45 I;  4AQY T;  3RBX A;  2ES0 A;  3HL6 A;  2KXP B;  4GKJ T;  3H1L G;  4GOU A;  3CCR P;  5JDH A;  2FYU J;  4DR7 T;  1RF0 A;  2LM9 A;  3PUQ A;  4QX7 B;  3NMD A;  3L74 D;  2POH A;  3RK3 E;  3PUV F;  1S5L X;  4IE0 A;  1JEK A;  4DV3 T;  5FY7 A;  2P10 A;  2VK9 A;  4OYK A;  4BA9 A;  1KYO I;  2VKD A;  3VMY A;  5IHY A;  2OQQ A;  1QEX A;  5LGN B;  3MZW B;  1OX3 A;  5AVY B;  2XHE B;  1PP9 G;  1WR0 A;  5LHG B;  2V6Y B;  3AE6 A;  1EDL A;  2BBJ A;  1PFI A;  1YTZ T;  4PJJ A;  1J1J A;  1D7M A;  1SQX D;  1YD8 G;  3BQK A;  1FAV A;  1PP9 J;  3V5B A;  2V5C A;  5LG3 A;  1N7S C;  3ZYL A;  3L35 A;  5LXT E;  1SE7 A;  3L70 G;  2GK9 A;  2MTQ A;  2X66 A;  1KIL A;  3C64 A;  3HTK B;  4YFS A;  2IFM A;  2QGS A;  1PGO A;  1GZL A;  2JR8 A;  2W2U A;  3RL0 D;  1SHZ C;  2D0U A;  1JM0 A;  4U3F J;  3IF4 A;  4W7Y A;  2Y9Z A;  1ZR2 A;  5CCG A;  2PFX A;  2XQA A;  4KT0 J;  2YMY A;  1YXR A;  1W0A A;  5APT A;  3ONJ A;  1IO4 A;  2KZJ A;  3BCC J;  2KSR A;  3AE7 A;  3RLF F;  2E74 B;  1S9K E;  3BVH A;  4KHX A;  2H88 A;  2N9B A;  3L36 A;  2LKH A;  4OWF A;  2QEX P;  3KDS E;  4IE6 A;  4O4I E;  4X20 E;  1PZQ A;  4GIW A;  3K5B A;  3AE3 C;  5APX A;  2A45 H;  1NTM G;  1IBK T;  2QE7 H;  3M0D A;  1WYB A;  1FU1 A;  3NVO A;  3U1C A;  1MMD A;  3RK2 D;  3EDU A;  5HEO A;  1AQT A;  2PJQ A;  1EC5 A;  1FDO A;  2XAH B;  4H13 C;  2VB6 A;  1P84 D;  1XNR T;  2ZYA A;  3CQG B;  2FYU D;  5EFW B;  1CUN A;  2CEA A;  5BMV E;  2K24 A;  1VQ5 P;  3PJA J;  2IBZ I;  2QJP B;  5BR8 T;  3VMX A;  5ADX L;  2K9A A;  1NVO A;  2JMK A;  4EIJ A;  2Q6Q A;  4HFC A;  5HXH A;  3TGU J;  4QH1 A;  2WPQ A;  4DO0 A;  3KV9 A;  3G6E P;  5FY1 A;  2RN0 A;  2QM7 A;  4PV1 C;  1KTM A;  3NBX X;  1VQ7 P;  2WQY C;  4U33 A;  4TX5 A;  3QUJ A;  4LF5 T;  1PV3 A;  1XDO A;  3KZI H;  3HKD E;  4YSY A;  5EK4 A;  1BGY G;  2N1T C;  3SSU A;  4LF9 T;  4C7R A;  5CCH C;  3OA7 A;  1SQP K;  1YW0 A;  5AW8 B;  1DU2 A;  5FL0 A;  3ANW B;  5HXR A;  3L75 E;  2CCQ A;  1Y8A A;  3HKE E;  2LJL A;  2A06 D;  5HXS A;  4EYU A;  1J1D C;  1YIJ P;  3B5M A;  1SQQ J;  3QWO C;  4CXX A;  3UIA A;  4L5G A;  4O4H E;  2RPA A;  2OYH C;  1IFI A;  3HA4 A;  4YJ2 E;  3L73 D;  1FS0 E;  4H44 C;  3MK7 C;  2KP8 A;  1PPJ D;  4IL9 A;  4EXT A;  2Z4E A;  3H1H G;  2A06 G;  3HD7 B;  4XAX B;  4IDO A;  2NOX A;  4HWF A;  2M67 A;  2E5Y A;  2XZR A;  3DTO A;  2UXC T;  5TIS H;  3HRN A;  1BE3 E;  2YDR A;  1KV4 A;  5APV A;  4TUY E;  1N7L A;  1E2A A;  3H1I J;  4NPD A;  3L70 E;  1UGO A;  2JMH A;  3ONX A;  3EI0 A;  4PW8 A;  2P9B A;  3QOF A;  2QJP C;  3CX6 B;  2EHO C;  1U57 A;  3HTK A;  3CME P;  1VQ9 P;  2GA1 A;  2YKS A;  4DR1 T;  3SWY A;  2J62 A;  2XAS B;  2YDQ A;  3P4Q A;  3RH3 A;  1JY3 O;  1M1K Q;  3BQL A;  1L0N J;  1QX8 A;  3NRY A;  1NTZ K;  1NWQ A;  4CXW A;  2V6Y A;  1T3U A;  1CHU A;  2LOP A;  4IST A;  5KJ7 A;  2XAQ B;  2AEF A;  3E08 A;  5KKZ B;  3EVY A;  2LXC B;  4N78 E;  3WAJ A;  4H44 B;  5LYJ E;  4ILC A;  4YTN A;  4HKA A;  1ZW0 A;  5JVD E;  3C51 A;  2V6X A;  1SQB E;  2Z5I A;  1KQL A;  3C4Z A;  5APS A;  1YYC A;  5DAB A;  3PE0 A;  3HD7 A;  2I6H A;  4WY4 B;  1FZC C;  2W0G A;  3P7I A;  5AQK B;  5HAX A;  3VR9 A;  1T6A A;  4EV6 A;  1BCC G;  4FJO A;  3HKC E;  5CA0 E;  3N9N A;  1N8R Q;  2HLO A;  2QJY C;  3CPW O;  1U7M A;  2LM2 A;  5GTH E;  2WMM A;  3RYC E;  3H1L E;  1SLQ A;  2A72 A;  5LJN A;  3LW5 J;  2EHO D;  2XQ7 A;  4H9N C;  2NR4 A;  2NZ2 A;  1FE6 A;  3X1D A;  2SPC A;  1NTK G;  1DIP A;  1KFM A;  2PP6 A;  1EZ3 A;  4UV9 B;  1FZB A;  5KLV G;  4X5T A;  5FY0 A;  3K3N A;  5DQW A;  3LID A;  4ZI2 D;  1QL1 A;  4HFV A;  4HKZ H;  3D0T A;  2N1T D;  3PV0 F;  1MFT A;  5CFB A;  3MTU E;  3H1J J;  4A97 A;  5AW3 B;  3SWF A;  1RQU A;  3P8C D;  5HEH A;  3C8V A;  3HE4 A;  3RIA A;  5ABG A;  3TDK A;  1M57 D;  2ZYD A;  2Q7C A;  3AA7 B;  2FYU E;  5L47 A;  2VQE T;  5IYZ E;  2E76 D;  1L0N D;  2M3E A;  2BG9 A;  5EK3 A;  3AEF A;  3N7N A;  5HYA A;  1KB9 I;  2MAW A;  1D0Z A;  5B66 E;  3F57 A;  5L4E A;  3O9X A;  2BS2 A;  4YSZ A;  3PP5 A;  2B9B A;  1HGV A;  1YI2 P;  1T8B A;  3TLS A;  3Q5P A;  4A98 A;  3CCM P;  2MKV A;  3OYX A;  2Q9Q D;  4EED A;  3PUG A;  1CSB A;  2W67 A;  1L0V A;  2Q3E A;  4ILU A;  4MAL A;  2WWW A;  3BCC E;  3PJS K;  1HG2 A;  2IC6 A;  2YNY A;  1S72 P;  1YQ3 C;  3UFG A;  1VF5 B;  3H1J D;  2FXM A;  1VRB A;  4FI5 A;  2ZXE B;  1IK7 A;  3KBT A;  3IHR A;  1NJI Q;  3MZK B;  1KB9 H;  3GWH A;  2K37 A;  5AVW B;  2XPK A;  2W8Z A;  4H44 D;  3I56 P;  2W63 A;  2OA5 A;  2KSJ A;  1W9R A;  1US7 B;  2BKO A;  2FXO A;  5E0O A;  5AQT B;  4JI1 T;  4N3Y B;  1J2J B;  3V4W A;  4DT0 A;  5FXV A;  4IIJ E;  1FBM A;  4C7N B;  3CI9 A;  4ANJ A;  2NW7 A;  3PHL A;  2YIU C;  4YHJ A;  4TV9 E;  5FXW A;  2WSC H;  1M1J B;  5FP3 A;  4ZEY A;  1BGY J;  3FZK B;  1N73 A;  2WSF J;  3S4R A;  2KWI B;  3A5X A;  3UU3 A;  4JYA T;  1T7S A;  2DHR A;  3AE1 A;  2WPV B;  3B4S A;  3DP7 A;  3P4P A;  4TNW A;  3AE6 C;  3ETV A;  5HEG A;  2M0B A;  4JEU B;  1YJ9 P;  4ILB A;  1XTC C;  2WT7 B;  4HWI B;  2FYN C;  3H1K G;  2KMF A;  1JY3 N;  5E79 E;  1BSH A;  1GK4 A;  2L8K A;  1IBL T;  3F89 A;  1SQB K;  2V26 A;  1UCU A;  3L73 E;  4TT3 H;  2C5K T;  2R5D A;  1NOH A;  5E79 H;  1RF1 B;  1SFC D;  5JDQ A;  1RE4 C;  1UUR A;  2UUC T;  3L39 A;  1HNW T;  4NIQ A;  1NU1 K;  1HX1 B;  1R8I A;  1MIV A;  1MMA A;  2F4V T;  5AW6 B;  1JO5 A;  2X0H A;  2FY8 A;  1O3X A;  4LFA T;  2XJ7 A;  2FFD A;  4LML A;  2Q9I A;  4W7Z A;  1HF9 A;  2I59 A;  4BJN A;  4TV8 E;  3UUB A;  5KMG P;  5ABH A;  1NU1 J;  5AVQ B;  2ZLY A;  4MN4 C;  2ZMA A;  3L70 J;  5CBO A;  3PU3 A;  3VMZ A;  1L0L D;  5HEU A;  3A0H E;  3H1H J;  5HXC A;  1FJK A;  1YBK A;  3CC7 P;  1VQM P;  3NTN A;  4PK6 A;  1GK6 A;  4MBQ A;  1WRG A;  5AW0 B;  2A3D A;  3RGL A;  3UUX B;  2JJL A;  1BCC E;  1HCI A;  3ZSS A;  5APW A;  3SWK A;  2G3A A;  2X51 A;  2BZB A;  2AXC A;  2XDJ A;  4X1Y E;  4JI6 T;  2LLY A;  3PUW F;  5TAO A;  2O01 H;  3H3M A;  4O9B A;  3FZF B;  1KZU B;  1LTA C;  2LOS A;  4GYR A;  1UK5 A;  3O4X E;  1LTI C;  1RF1 A;  1UX4 A;  1FDI A;  2JIW A;  1OED E;  2WQY A;  1BSN A;  5AQS B;  3L75 G;  1KC8 Q;  2H8P D;  3RIU A;  2WT7 A;  2FFD C;  3UQ7 A;  3BRT B;  1YQ4 A;  1KNZ A;  4WW0 A;  4R4L A;  4B3T T;  2Y9Y A;  3RL0 B;  3AEA C;  1NH4 A;  5FNV E;  3F31 A;  5JH7 E;  3CC2 P;  2MPK A;  2WWU A;  2AXT E;  1NTK J;  2WSC J;  2DW3 A;  5KKZ C;  1LT1 A;  1M1J A;  2XQ5 A;  3ZMU B;  2FJE A;  2QJK B;  2HFE D;  3ZCJ A;  2E9X C;  3AB3 B;  2XU6 A;  4DV4 T;  3AE2 C;  3RYF E;  5APQ A;  2N1G A;  4HJG H;  4WB4 A;  3I55 P;  1KD1 Q;  1VQK P;  3IA3 A;  5EK2 A;  3RF1 A;  3JC6 C;  2HPC A;  1OFC X;  1D1B A;  1SQX E;  2M8R A;  2LXB A;  1FZF A;  4PJM A;  4OGQ C;  4EB6 E;  1QL2 A;  4XA4 A;  3GLM A;  2E5T A;  1LT9 B;  2WM9 A;  5KJ7 D;  4ERR A;  2W66 A;  3RBZ A;  4H9R C;  2N9D A;  2NTY A;  1VQO P;  2P1J A;  4GKG A;  2IZ1 A;  1BGY E;  2W6B A;  1HFA A;  2LR2 A;  3QNU A;  2UUA T;  1QVG O;  3RL0 C;  1OED A;  3AXJ B;  3IN6 A;  3JAD A;  3H3A A;  3AAA B;  4KI0 F;  1S1C X;  4H0L C;  4DR3 T;  1L0N G;  1LTJ B;  3FBZ A;  1EDJ A;  2EHO A;  1PPJ E;  1V9D A;  1E79 H;  5FMN A;  2GUS A;  3AE9 A;  2HR3 A;  5JRC B;  4CN1 A;  1G8X A;  4I0U A;  3B8E B;  2XZE A;  1FMV A;  1DEB A;  3Q1M A;  1Q7Y Q;  5KXJ A;  5AW7 B;  4DJG A;  2QJY B;  5AVX B;  1FOS E;  3HE4 B;  2VUR A;  5LB7 B;  3KBU A;  3RYI E;  4X1I E;  4OH8 B;  3BAT A;  2BCC D;  4D6T J;  3HI2 A;  3HKB E;  4EOZ B;  4YXD C;  4WY4 D;  1YHQ P;  5HWY A;  1Q81 Q;  5FXX A;  5LBM A;  3D6Z A;  5KAF H;  3NKZ A;  3K8P C;  3P7K A;  3E1R A;  3PUS A;  4L74 A;  2DWK A;  1X8Y A;  2HG5 D;  3B71 A;  1SFC C;  5IWA T;  5B5E H;  2OYI B;  2XM2 A;  3ABV C;  2ZFC A;  2YKQ A;  1XWM A;  3A8Y C;  3KIN B;  4ZMD A;  3ZMT B;  4RES B;  1Y01 A;  3G4S P;  3AEB A;  3KQG A;  2I1J A;  2EHO B;  4LF7 T;  1MIY A;  4GK0 E;  2FYN B;  3RIU C;  2YU2 A;  1L0L E;  1MUU A;  3H1I D;  1IFN A;  3TLU A;  3I0Q A;  4PK5 A;  3WU2 E;  4H9P C;  4UEM A;  2MBG A;  4O8S A;  3ZPO A;  3UT5 E;  4ISS A;  3CD6 P;  2A45 G;  2Q3I A;  4U31 A;  4IHJ E;  4D6T G;  3HR0 A;  4JYB A;  3VKH A;  4IE7 A;  3M9B A;  3ZST A;  5B5E E;  5L3G B;  4XBF B;  1QLB A;  3A5T A;  2W83 C;  2HPC B;  1M7K A;  4NXN T;  4WBN E;  1LP1 A;  1WT6 A;  2D2S A;  3LDQ B;  3MAC A;  5AQL B;  1KIL B;  1NEN A;  2ITA A;  2I8D A;  3MD0 A;  2CK3 H;  4JI7 T;  1P84 I;  4ZNC A;  2N9Y B;  1VQ4 P;  3D6Y A;  2JKV A;  4WY4 C;  1FZC B;  1JMM A;  4UB6 E;  1NTM E;  5JRE A;  2M3B A;  1KNR A;  3AE7 C;  1MZ9 A;  1SQB J;  3H25 A;  2JJ9 A;  1AJY A;  1LTT C;  2XQ6 A;  3KFW X;  3CMA P;  2ACX A;  5ABF B;  2NW8 A;  4HB1 A;  3T1Y T;  4Y99 B;  3H1J E;  4OYJ A;  3ZDM A;  5F5W A;  4C90 A;  4Y28 J;  4WNK A;  2IDB A;  1L0L G;  5CCG C;  1ZV4 X;  2A9U A;  2QA4 P;  2YIN A;  1WLX A;  3DJB A;  5DJT B;  4YXD A;  4DUZ T;  4ZI7 E;  2C0X A;  3ESL A;  2IZ0 A;  2M5A B;  2WS3 A;  2KIN B;  4M3L A;  2KND A;  4DV0 T;  4YT0 A;  2P7J A;  4ZI3 C;  4PJ0 E;  4R4M A;  5JTG A;  1Z0P A;  5AQV B;  5AVV B;  3CPZ A;  2WDQ A;  4IFM A;  2XTL A;  3NZQ A;  4UF0 B;  1OVU A;  2FKW B;  1SFC A;  2Y0D A;  4TLF A;  4HE8 A;  3W67 A;  2H89 C;  3T97 B;  4OX9 T;  4TWD A;  3GHG C;  3TNU B;  3BCC D;  2OTJ P;  4ZOL E;  3KDP B;  3LBX A;  4OHF A;  5IUX A;  5BVZ A;  4PD4 D;  1ZLL A;  4IL6 E;  2VL8 A;  1X79 A;  1KIL D;  3FZL B;  3I9W A;  4HYT B;  1Y9B A;  1CW5 A;  1IJD B;  4EEB A;  4L76 A;  1WYC A;  2DL1 A;  4DV2 T;  3K3O A;  3L72 G;  2FFD B;  4I7Z B;  1QVF O;  1SQV E;  3KXD A;  4JF7 A;  1K73 Q;  4OFZ A;  2ZVN B;  3RK3 C;  2ZJS E;  2DWG A;  4U2Z A;  3ZN1 B;  1OVV A;  1KFY A;  2MJZ A;  2KZ7 B;  4IDZ A;  2HH7 A;  3AEG A;  2PBI A;  3GN5 A;  3AAI A;  4AYC A;  1VCS A;  2BCC E;  4PK4 A;  4XZC A;  2WZH A;  4YY3 T;  3CIR A;  1YKE B;  2IX7 C;  3P8M C;  3CWB G;  1YJW P;  1LT9 C;  1NTZ G;  5AVZ B;  3CK6 A;  1OZH A;  4DVD A;  1DH3 A;  4I43 B;  2E75 C;  3VKG A;  3TGU G;  2C0W A;  4X64 T;  1UIX A;  2KLQ A;  2VAS A;  1OMI A;  1S5L E;  1LGH B;  2V7M A;  2B87 B;  4C46 A;  4C91 A;  2G0U A;  4NUU A;  1BR1 A;  5LNK A;  2V5D A;  3TLW A;  4QHO A;  4DV5 T;  2E9X B;  1VQ8 P;  1OWA A;  4PFO A;  2R6G F;  4YHH T;  2OYO A;  1UII A;  1PGP A;  3BQI A;  2W62 A;  5AQO B;  3FGA D;  1RHZ B;  1BGY D;  1HH0 A;  5HEJ A;  3CCJ P;  3EDV A;  1LTB C;  1L4A D;  2JO1 A;  1ZME C;  2A2F X;  2ACZ A;  4TWH A;  2R3S A;  1TU3 F;  1N36 T;  1ZN5 A;  3ZMS B;  4YTP A;  1NWM X;  5HCJ A;  2O01 N;  5AQQ B;  4TN7 B;  3OBV E;  3C1L A;  2IC9 A;  1NAF A;  1W09 A;  1JY3 P;  4OK0 A;  5APY A;  2ZVO B;  1NHL A;  4Z90 A;  3UFE A;  4EI2 A;  4J2C A;  3CWB J;  4IE5 A;  3S1K A;  3VN0 A;  4U7I A;  1SQX K;  4I2L C;  5L3B B;  3NRX A;  4H0L B;  3T8O A;  5AW1 B;  4NPF X;  1USD A;  3BAS A;  3HD7 C;  3VMA A;  4AQF C;  4L0R A;  1G2C A;  2B89 A;  2E5V A;  1FDM A;  2B88 A;  3NZP A;  2XQ9 A;  2BG9 E;  4IDP A;  2KSE A;  3AE8 A;  1JTH B;  3Q2M A;  3VHL A;  2PRR A;  3GHG B;  2NPS D;  3F5H A;  4YJ3 E;  5H2F E;  4PD4 I;  2I0M A;  3H1H E;  1T3J A;  2RA1 A;  3RK3 B;  1H0T A;  1GL2 B;  3RHW A;  3GF3 A;  4LGD E;  3W68 A;  3CKD A;  2QIW A;  1AVO A;  5LG4 A;  2N1T B;  3LJC A;  4M1P A;  3CXH I;  3U1A A;  2OV9 A;  1VCT A;  2WSS H;  4EYY Q;  3ETU A;  1VF5 C;  2IW5 B;  1SQQ K;  3LBX B;  4OGQ D;  1YJN P;  4DR5 T;  2C0S A;  1SFC B;  2WTY A;  3CCU P;  2H7H A;  4U3C A;  2QSI A;  1SVF A;  3UU8 A;  2CXL A;  1ZV8 A;  2Z6E A;  4Y99 C;  5LJM A;  5HWX A;  2K1A A;  1J1E C;  3AEE C;  4CI1 B;  5GTH H;  2M5A A;  3A3Y B;  2D2C B;  2QM8 A;  2BBH A;  3N2O A;  3UQ4 A;  4JI0 T;  2IDO B;  3PUZ F;  2FXP A;  3AEA A;  2OTK E;  5JR9 C;  4AUW A;  3IR9 A;  2VQF T;  3JC6 D;  4BJM A;  1NU1 D;  4ZKP A;  5AQU B;  4X62 T;  1SP4 A;  1LKX A;  2L91 A;  1LTG C;  2ZM6 T;  2R5B A;  4EDF A;  5KAI E;  2HOD B;  2ODU A;  1L0L J;  1LNQ A;  3K1S A;  4KBM B;  1URQ D;  4DUY T;  3ZJ1 A;  4GT1 A;  2W6J H;  3Q5R A;  2LE8 A;  3AE9 C;  5KTB A;  3AA6 B;  1LTJ A;  3N4X A;  1GL2 D;  4ZXL A;  1X9V A;  3Q3D A;  2V7K A;  1GQE A;  3D71 A;  1UUS A;  3VRB A;  4UVB B;  3KZI E;  3PRJ A;  2V7I A;  2VKO A;  2BKN A;  1CZQ A;  2XM1 A;  1LP1 B;  1AQ5 A;  2AXD S;  4KMC A;  3V4Q A;  4CI2 B;  4AQF A;  3H1K J;  4QX8 B;  3ZC1 A;  1H88 A;  3AE8 C;  3H32 B;  4H13 B;  4TNV A;  3CCS P;  2FYZ A;  5CCH A;  4N78 D;  1VPC A;  5GTI H;  1PL5 A;  3CC4 P;  3V2Q A;  4IGU A;  2LHR A;  3U78 A;  1HG5 A;  1PGQ A;  3IBP A;  4DMW A;  1X0T A;  3IF8 B;  3RC8 A;  3N9O A;  3G3Z A;  4ZKU A;  3EAB A;  1SQP J;  1WRD A;  2VRS A;  4PFP A;  3AEB C;  5CB4 E;  1EZV I;  2K5B B;  2ODV A;  3ZYM A;  4O2B E;  1H8A A;  2KIK A;  2CLY C;  3N9L A;  2WZI A;  4LMK A;  3VRA A;  2A06 E;  5AQN B;  1IC2 A;  5CCG D;  4BAY B;  2WU5 A;  2HOD A;  3KYQ A;  1RE4 A;  2XQ8 A;  3M9H A;  4KP3 C;  2FBW C;  2UXX B;  1FEW A;  1VOM A;  3M0D C;  2V8S V;  2D9D A;  3TGU E;  4DR4 T;  2WPR A;  1HS7 A;  4ZS2 A;  2OYI C;  4B3R T;  3FB2 A;  5AVS B;  2LSG A;  2O3J A;  2G8Y A;  1HJB A;  1SQQ D;  1LRZ A;  1IFD A;  2XQ4 A;  2XV5 A;  5LCY A;  2QVA A;  3JC2 2;  4UIG A;  1G1I A;  1KF6 A;  5KX5 E;  2J4G A;  1KYO D;  4UB8 H;  3KV6 A;  3L71 D;  3K3Q C;  1N7S B;  3V2R A;  2X9W A;  2WSF H;  4DMV A;  3SFE A;  4A7P A;  1Y47 A;  4AXP A;  1SQV D;  3RL0 g;  3FWN A;  2UXD T;  3MUD C;  5BU5 A;  5LGT B;  2Y6X A;  1SQQ E;  2WBL A;  4B3M T;  5ETW A;  3JSV C;  3I1A A;  3L71 G;  3PUY F;  5GON E;  5AQG B;  4DZO A;  4DR2 T;  2DNX A;  5JR9 B;  3MP7 B;  2CHO A;  1IFJ A;  1KN7 A;  3LK4 2;  2B1E A;  2PG8 A;  4I1L A;  2C9L Y;  2WDR A;  1B7T A;  3L3P A;  2LSK A;  4LC1 A;  5AQH B;  1WFD A;  1JCC A;  1ZOY C;  3T1H T;  3H1J G;  1GL2 A;  1LT9 A;  1H0T B;  1K9M Q;  3A2A A;  2ZM2 A;  4K3A A;  5J0Z A;  2VL0 A;  2OTL P;  2Y0C A;  3GHG A;  5AFU L;  2ZT9 C;  3AEG C;  2IIU A;  1BDD A;  3PH0 A;  2W6A A;  2FJD A;  4A5X A;  4A56 A;  1RF1 C;  2E2A A;  1HNX T;  2LEH A;  3CWB D;  3ZT7 A;  4KX6 A;  1SQX G;  2I1K A;  3V2N A;  3CXH E;  1HNZ T;  4HWH A;  1IZN B;  3M65 A;  2XND H;  3ONL C;  2BDE A;  4L75 A;  3FXD A;  1MNE A;  3KVA A;  3RKG A;  1LTS C;  5CHX A;  2L5G B;  1WCR A;  5LMN T;  3CWZ B;  3UUM A;  3O1J A;  4Q25 A;  5FXZ A;  1KK7 A;  2JQ9 A;  2UUB T;  3ZN0 B;  4KJM A;  2NP9 A;  4WVZ A;  3ZCI A;  1XTG B;  2KT9 A;  4HWC A;  2YIU B;  5L3D B;  3AVR A;  4CXY A;  4CN4 A;  4DV1 T;  3OW2 O;  1CI6 A;  2JRK A;  1ZOY A;  3L74 E;  1PP9 D;  2FYU G;  2WMO A;  1URQ C;  2V4H A;  1U7J A;  3VP8 A;  2BAS A;  4IOI H;  3CVR A;  2W90 A;  4I7Z C;  3N2K E;  2YKP A;  4X66 T;  1EZV D;  4N6J A;  3CX7 B;  1W0B A;  1M1J C;  4YSX A;  3L4F A;  4DND A;  4CZZ B;  4QH5 A;  4HFH A;  3L74 J;  1N2D C;  5KLI B;  2IPP A;  3HD7 D;  5LGU B;  1OW6 A;  1N33 T;  2ZXX A;  5K5G B;  5LP6 E;  1RE3 C;  4HFB A;  2YEV C;  3LW5 H;  4GOD A;  3G06 A;  3P8C E;  1U5P A;  2CXD A;  1JNZ A;  4AQG A;  1ZXG A;  3GA8 A;  1XNQ T;  1FJP A;  4AKG A;  2YXR B;  3L72 E;  2E75 D;  1L0N E;  1NKZ B;  3CLQ A;  1M62 A;  1GW3 A;  1PIX A;  5CMZ A;  2D5U A;  1HVV A;  2JQK A;  4GDO A;  2K88 A;  4K35 A;  2OGU A;  5L3F B;  3VTP C;  3B13 A;  3RGU A;  2KWH A;  4XFJ A;  2X0L B;  4ZHQ E;  1AJ3 A;  3NFQ A;  4AIS A;  3ABV A;  2KS1 B;  2H3R A;  3ZC0 A;  4IE4 A;  3L37 A;  2P58 A;  3AE3 A;  1N7S A;  3RYH E;  1SQP G;  4NPE A;  1SQP E;  4IRE A;  2Y48 B;  3W15 B;  1IBM T;  1NU1 G;  2KK7 A;  3L73 G;  5AVT B;  3TYY A;  3GMA A;  5AVU B;  1KQF B;  3RQU A;  4PNI A;  4U72 A;  4YPC A;  2RKL A;  2CBI A;  1HTL C;  2CMR A;  3I0O A;  5AQM B;  5H6Q B;  1JNR A;  4E7Z A;  3T97 A;  4U3F E;  1MMG A;  1SQQ G;  4CPG A;  3O1I A;  2V7J A;  2KNC B;  4UXN B;  4U74 A;  3RQW A;  3TGU D;  4HN9 A;  1QSD A;  4PD4 E;  1U4Q A;  5AQF B;  2J5U A;  2R3C A;  2J47 A;  1NKN A;  1SQB D;  1DD3 A;  5HCM A;  5JDF A;  2XSA A;  1KMI Z;  1PP9 E;  1URQ A;  2LSY A;  4U7J A;  2XAG B;  5DJU B;  1RH5 B;  1LTJ C;  2DI4 A;  5ABE A;  3O6Q B;  2BVL A;  1XDP A;  1MKM A;  3RIF A;  5CJ0 A;  2GUV A;  1JUN A;  4LF8 T;  3CWB E;  2O1J A;  1JOC A;  4IFF A;  2AE9 A;  1NU1 E;  2WCA A;  2OYH A;  2W61 A;  2BCC G;  1MND A;  2W00 A;  2FJA A;  2NPS B;  5HXE A;  3RC3 A;  3ZYK A;  1EDI A;  3AAE B;  3UU5 A;  2X9H A;  4JLE A;  1KB9 D;  3A7O A;  3MIW A;  2LSI A;  1SA0 E;  2B76 A;  4W80 A;  3JAE A;  3MXZ A;  2KZI A;  1GD2 E;  1ZR4 A;  3KVB A;  1IAP A;  2YU1 A;  4WBA A;  1JNM A;  1L2P A;  4EAH A;  4P1N A;  3H37 A;  1BR2 A;  1OW7 A;  1R5L A;  1FMW A;  1HGZ A;  2E74 C;  3AEC C;  3WUU A;  4P0A A;  4JQ0 D;  2Q1K A;  1NTM D;  4WWI A;  4EYY R;  1N34 T;  4CQI A;  2BG9 B;  1HWT C;  3TF5 A;  1SQP D;  1NAY A;  3WAK A;  3IEE A;  3UU6 A;  1IJ6 A;  2WP9 A;  1GW4 A;  1K04 A;  4H9O C;  2NW9 A;  2KI7 B;  4HFI A;  5LBQ B;  3WU2 H;  2C5J A;  1NEK A;  1NTZ E;  3D70 A;  3M06 A;  1HF8 A;  3WUT A;  3LK2 B;  5FKY A;  3AE4 A;  3NWI A;  4YXW H;  3RK2 C;  4AI6 A;  2UXB T;  1LWU B;  1E1H B;  5JR9 A;  1VQL P;  2HHH T;  2K9J B;  2PTF A;  1IFM A;  3ANW A;  3Q2Y A;  1P84 E;  5KLV E;  2Y8D A;  2OYI A;  3BK9 A;  3OKQ A;  3PUX F;  3ZMZ B;  2O1K A;  1YIT P;  5FVK A;  2CWY A;  1FIO A;  2E9X D;  3SS1 A;  2WB5 A;  3PTZ A;  2HYN A;  3USS A;  1E7P A;  5EZY E;  3RK2 B;  1S4X A;  3ZEF B;  4LF4 T;  3UUN A;  3PJA A;  4Z91 A;  4ILA A;  2IAK A;  4RKU J;  2X9X A;  4H63 V;  3AE2 A;  1ZEE A;  4ZZB A;  4PJL A;  5AW9 B;  1KQS O;  2CPT A;  2HPJ A;  1HX8 A;  4AKI A;  2YDS A;  1Z56 A;  2JQH A;  3H1L J;  2IBZ D;  2IML A;  2YN6 A;  5FVL A;  3Q5W A;  4EZ4 A;  2V1D B;  2XSB A;  4DOJ A;  2J58 A;  3C4X A;  3QK6 A;  3E7K A;  3H1L D;  2BG9 C;  1USE A;  1YTZ I;  2H89 A;  4K0K T;  2JPF A;  2FJB A;  2D0T A;  3C4W A;  5F8P A;  1FZG A;  2W4X A;  1DX7 A;  4IL4 A;  3KV5 A;  2V7Q J;  2J59 M;  2J1D G;  1YKH B;  2OYH B;  2LKG A;  2QA7 A;  3I9Y A;  4E7S A;  3IAO A;  2H7O A;  4RO0 A;  2HN1 A;  2WU2 A;  2JWD A;  3TLV A;  4P09 A;  1NTK D;  4UVC B;  3QB5 K;  2WY2 A;  4PV1 D;  4IT4 A;  3JAF A;  3R84 B;  1Q82 Q;  3O6Q A;  1EDK A;  5LHH B;  1P84 H;  5H2F H;  1URQ B;  4BXL A;  2W27 A;  4I55 E;  4AKL A;  1Y64 B;  2XQ3 A;  5KDM C;  3MGN A;  3L75 D;  4JBZ A;  2Y0E A;  2IHR 1;  4H63 H;  1PPJ G;  2E43 A;  1D1C A;  1A02 F;  2WSS V;  4DV7 T;  4DID B;  2KB7 P;  3ZLI A;  4IDN A;  3L74 G;  4B3S T;  2B87 A;  4ASV A;  2XAF B;  5C2T A;  3TSI A;  1G1J A;  1JMB A;  3CX5 I;  4IDQ A;  3N2G E;  1VDF A;  2GM4 A;  5JDG A;  4QH4 A;  1FC2 C;  2E42 A;  3L09 A;  4BWN A;  3EFG A;  1GTW A;  3MHV A;  4O4L E;  1GDT A;  1VQN P;  4HFD A;  1XMQ T;  4Z1M H;  4U3F D;  5JDL A;  1NTM J;  1L0L K;  3RKO A;  4OVN F;  3MKD A;  1L4A A;  4QXB B;  5FL1 A;  2CLY B;  3M3Z B;  3Q5E A;  3SOL A;  4JI8 T;  3LSV A;  3AEE A;  3L72 D;  2JDI H;  3OYZ A;  5LA6 E;  2V7L A;  1BDC A;  3AE5 C;  3RRW A;  5A1L A;  1EXI A;  4WBO A;  3N9P A;  3A0H H;  4QKN A;  4F6R C;  2K9Y A;  2RP4 A;  3L71 E;  3RPU A;  2K9J A;  1K05 A;  2VVN A;  1NYH A;  3F2E A;  3KV4 A;  2YKO A;  1A02 J;  1LWU A;  1OXZ A;  1SQV G;  4QXC B;  4WZX A;  3GMI A;  1K8A Q;  1X79 B;  2LRK A;  2WMN A;  4NUV A;  3R2P A;  1VF5 D;  1T8Z A;  1E5W A;  3SWH A;  2ZM0 A;  3TNU A;  4YTM A;  3IFM A;  5AW4 B;  2JWA A;  4DR6 T;  2CM0 A;  5F3J A;  3NXS A;  1LVF A;  3P4W A;  3BRV B;  3CX5 H;  1NGM B;  4H0L D;  3E22 E;  1ZRT D;  2IUB A;  3C98 B;  4MFR A;  4B6X A;  1GMJ A;  3HUS B;  3P50 A;  2BCC J;  1M90 Q;  1D0X A;  3CL3 D;  3FBL A;  3G9R A;  3BCC G;  3C50 A;  4QMA A;  1EZV G;  4PJ0 H;  1T2K C;  4PAG A;  4GK5 E;  4GOF A;  1ZP0 C;  1S9K D;  3AE1 C;  2FUP A;  1NTZ D;  2E8I A;  1QUU A;  3B5N D;  1RY3 A;  1JCD A;  1KFN A;  3UTK A;  2P67 A;  1N32 T;  2LHN A;  1SQV J;  2XQY A;  2UU9 T;  2NRG A;  3FXE A;  5JQG E;  2NPS A;  5CA1 E;  4BRY A;  2LKM A;  1NTM K;  5ABF A;  3SFD A;  2YO2 A;  2QJK C;  5KJ7 C;  3J7Y q;  1SQB G;  3E0Z A;  1N73 B;  1MFZ A;  2WVR A;  2BVM A;  1WMK A;  3FXE B;  3ZMV B;  4UR9 A;  4RJT A;  3MJX A;  3VU7 H;  1FZC A;  3CX5 D;  1Z8U A;  2IBZ E;  5LMU T;  2KUB A;  4H9S E;  1KYO H;  4C7N A;  4YLH A;  1KB9 E;  4ZI2 C;  1AFO A;  4PJN A;  2ZYG A;  4PD4 H;  3GG2 A;  2NWB A;  3TLT A;  3A7M A;  1LVK A;  2KLV A;  3PTR B;  4I4T E;  3ZJ2 A;  3PUA A;  4JBW F;  2D2C C; 
#chains in the Genus database with same CATH homology
 3FXD A;  1X0T A;  5EFW B;  4CPG A;  3PJA J;  1Q2N A;  1LT1 A;  1NVO A;  1OVV A;  1U7M A;  1BDC A;  2WMM A;  1H0T A;  2K3R A;  4KJM A;  2KIK A;  2M0B A;  2R44 A;  3PJA A;  4HJG H;  5DJU B;  4EYY Q;  1U7J A;  1LP1 A;  3QB5 A;  2LXB A;  4IOI H;  4HKZ H;  1MFT A;  2I8D A;  2QVA A;  4ZNC A;  2SPZ A;  3MZW B;  2B87 B;  3QWO C;  2M5A A;  2LR2 A;  2QRX A;  3AXJ B;  1EDL A;  1EDI A;  1Y47 A;  1J1J A;  2KZI A;  4GOE A;  2JWD A;  2OTK E;  4HB1 A;  1EDJ A;  4MN4 C;  5K5G B;  5CBO A;  1DEE G;  4GOD A;  3QB5 K;  3ZDM A;  2UWJ E;  4GOF A;  2HR3 A;  1ZXG A;  4NPD A;  2Q1K A;  1JM0 A;  4WWI A;  5DJT B;  1EDK A;  3FXE A;  4BXL A;  4WYV A;  5CBN A;  2M5A B;  4K35 A;  3RGU A;  2KZJ A;  4JBZ A;  2KI7 B;  1SS1 A;  1H0T B;  2KS1 B;  4K3A A;  3AXJ A;  2P58 A;  1OVU A;  2B87 A;  4ASV A;  3S1K A;  5C39 A;  1BDD A;  3PH0 A;  1LP1 B;  4NPE A;  1KEY A;  2KUB A;  1JMB A;  2LXC B;  4NPF X;  1FC2 C;  1S3J A;  4ZMD A;  1ZW0 A;  3MHV A;  3RIU A;  2B89 A;  4ASW A;  2RKL A;  3RIU C;  1EC5 A;  2ZAE B;  1OVR A;  2B88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...