2QRXA

Crystal structure of drosophila melanogaster translin protein
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
NFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERSLNISHFIGDLNTGFRLLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GM27569p
publication title Crystal structures of Drosophila mutant translin and characterization of translin variants reveal the structural plasticity of translin proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2qrxA02
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 2qrxA01
2B89A 1JM0A 2SPZA 3QB5K 2QRXA 4GOEA 4IOIH 1EDLA 3PJAJ 2UWJE 1EDJA 3MHVA 3RIUA 5CBOA 3MZWB 3S1KA 2HR3A 1ZXGA 1S3JA 2B87B 2JWDA 1OVUA 4JBZA 1J1JA 3FXEA 2KS1B 1BDCA 2P58A 4WWIA 2LR2A 4K3AA 2LXBA 4NPDA 3QWOC 1EDKA 2I8DA 2ZAEB 4ZMDA 2K3RA 3FXDA 2RKLA 3ZDMA 3RIUC 4EYYQ 4HKZH 4WYVA 3AXJA 1OVRA 4ZNCA 1FC2C 1EC5A 1JMBA 4NPEA 5C39A 2KZIA 1H0TB 2M5AB 1Y47A 1LP1B 2KIKA 4HJGH 4NPFX 4K35A 4GOFA 2B87A 2OTKE 1EDIA 3PJAA 5DJUB 2KZJA 4KJMA 2B88A 2Q1KA 1SS1A 2QVAA 1U7MA 5K5GB 1LT1A 5DJTB 1U7JA 1H0TA 1KEYA 2WMMA 1MFTA 4BXLA 1X0TA 4GODA 4ASWA 1OVVA 1ZW0A 4CPGA 3RGUA 1BDDA 2KI7B 3QB5A 1NVOA 4HB1A 2LXCB 2R44A 2M0BA 1Q2NA 2M5AA 1DEEG 4ASVA 1LP1A 4MN4C 3PH0A 3AXJB 5CBNA 2KUBA 5EFWB
chains in the Genus database with same CATH superfamily
5LG3A 1T7SA 3AE8A 5J2UE 2BG9A 1WRGA 3SWKA 2V6YA 2FBWC 3MGNA 3Q5SA 4WW0A 1VOMA 2D2CD 2OGUA 2PFVA 2KZ7B 4Z91A 2CEAA 3G9RA 1GTWA 3AE3C 3T1YT 1Y64B 5KLVK 3S1KA 1SQPK 3TGUJ 3A8YC 4TNVA 4EXTA 1YKHB 2E76B 3K3QC 2A45G 1NEKA 1LVKA 4LMLA 4DV7T 4TUYE 3UU8A 4YHHT 1Q86Q 1YQ3C 3HD7C 4ILBA 2CPBA 2I8DA 3CX5E 1ZP0A 4TLFA 2F4VT 5C2TA 1BGYD 5KXJA 2QSIA 1ZRTE 1M90Q 4PJNA 1WT6A 2BCCG 2HODA 4DOJA 3F57A 2K1AA 3A5XA 4C7NA 4HFCA 4JI3T 3RLFF 3WU2E 5H2FH 1SFCC 4B3TT 2O01H 2V7JA 1S5LH 2WPVB 4JI7T 1SP4A 4TX5A 1VQNP 4I6MC 1T8BA 5AQHB 5KKZC 5KLVD 3RI5A 3ZCIA 1EZVG 1SHZC 2FXMA 3E7KA 4BA9A 3ONLC 2ZYAA 3Q2YA 4DV4T 4YPCA 2V26A 2LSYA 1QL2A 1YW0A 1H0TA 3VOPA 4H9NC 1M1JC 2WVRA 5KTBA 2HYNA 3M0DA 4EIJA 3L3PA 2E2AA 3P50A 4YSXA 1DD4A 3ONJA 4QXBB 2LM2A 3MUDC 1NTMK 3IR9A 3T8OA 1YJNP 3V5BA 3RYIE 3BRTB 2Q9QC 2NP9A 2WDQA 4MALA 3RL0C 3EUHA 2LOSA 3H1JJ 4AISA 1SA0E 3W15B 5F3JA 3ABVC 3E1IA 2ZLYA 1UIIA 2A9UA 4EYUA 2K9AA 3PDYA 1D0XA 2R3CA 3AXJB 3EDUA 3I5CA 4PK5A 1KN7A 3SFEC 5TJHA 2OYHB 4U3CA 3CWBG 3RPUA 2YK0A 3NVOA 3EFFK 3I0OA 3UQ4A 1OX3A 1HTJF 4OK0A 1MUUA 1L4AB 2V7IA 3ZN0B 4CQIA 4OYKA 5LMNT 3LFMA 3PUWF 3MHVA 4AQFC 4TWFA 4U7IA 2PFXA 4PD4I 1VQPP 1KQSO 4AQGA 5HWXA 1I94T 2NPSC 4XA4A 4XZCA 4ILAA 2WSFH 1JNMA 3FXDB 3RYHE 1SQQJ 4PJ0E 1NTMD 4DBQA 1NU1J 2YNYA 4KHXA 1FZCB 2X0YA 2N1TA 1E1HB 4I55E 3AE8C 2BG9C 2FJBA 2WCAA 4ILUA 5HEHA 2QEXP 3LJCA 3EWKA 4GYSA 2K3RA 1GW3A 2Y0DA 1IJDB 1RY3A 3AE2A 1T3JA 4P09A 2CPSA 2HG5D 3TK1A 1YIJP 3CX6B 2XQ8A 5LHHB 2K9JA 3CXHI 1KZUB 4PD4D 1MMNA 1ZLLA 3ZYKA 1CZQA 3RK3E 2O3JA 2B1EA 1ZN5A 2A45I 2D0UA 3KXDA 3CCLP 3GA8A 5H6RB 4JYAT 3L75J 4OGQB 2J58A 4G2AA 1WCRA 3LK3B 3ZT5A 2YINA 1ZP0C 3WUVA 1R8EA 1OXZA 3L09A 2OTKE 4C91A 1K05A 3VR8A 4H13B 2E75C 2WMNA 2JEEA 4WBAA 5AQLB 5F5WA 4AIUA 2UUAT 3CXHD 3RC8A 2HN2A 3L73E 3BATA 3CCMP 1L0VA 3H25A 3Q2MA 4IE0A 2ZM6T 4DV3T 2Q9IA 3QK6A 2XTLA 2IYOA 4EIWA 4Y99B 1HWTC 4U2YA 4DR6T 1N7LA 2UXDT 1EZVI 2V5CA 3OA7A 1FZFA 5AQVB 5KDMC 5H2FE 1M8OB 2V5DA 2UXBT 4UB6H 1S5LE 2R5DA 3GMIA 3M0DC 4DR4T 3X1DA 2AXCA 3VHLA 2KYVA 3H1IJ 2MBGA 3AA7B 4X5TA 3TLWA 3ZMSB 5C39A 5KLIB 2BVLA 2A06E 5APTA 1NTZE 2AEJA 2BKNA 1U5PA 2KSRA 1CSBA 2KNCB 1HFAA 1HS7A 3L74J 2A2FX 3L71E 3DP7A 4AKRB 1EZVD 2N9BA 3UFGA 2V4HA 2JMHA 5AW0B 5JDFA 2L5GB 1JO5A 1ZXGA 1S3JA 1R8IA 2D2SA 4WY4D 2OYHA 3PE0A 3UU3A 1T3UA 3CX5I 4IE7A 3ZCJA 3SSUA 2LEHA 4QX7B 2MKVA 3PUVF 2BG9E 2BKOA 3IHRA 2WSSV 3B5ND 3QWOC 3P8CE 1VQKP 4DV1T 2NTYA 2ZAEB 2BZBA 3TKLB 1Y01A 3GW6A 1DU2A 3FXDA 3Q9DA 5IWAT 4UR9A 4JEHB 5LNKA 4H9QC 3FWNA 4PJLA 5AQRB 1FZCA 3UIAA 3JAEA 2OYIB 2FJDA 2PJQA 3CX5D 1M62A 4M1PA 2JJ9A 3JC6C 1L2PA 3TNUB 4FJOA 4KP3C 1ZRTD 3U1AA 1SUMB 2X9XA 3C50A 2N1TC 2KIKA 4LF6T 3ZPOA 4K35A 3H3MA 1KK7A 3H3AA 2L9QA 4H44D 4L0RA 2J1DG 2E76C 4KI0F 5DJUB 1W0AA 2KS1A 1URQD 4B3MT 2A06G 1NTZG 1YYCA 4HWCA 5KAFH 4GYRA 3L71G 3RK2D 1CUNA 5HXRA 1HBWA 5E79H 3KYQA 4BXLA 3K3NA 1XDPA 2LKGA 5J0ZA 3P8MC 1HG2A 3NRYA 3WMM0 2XAGB 4TV9E 2KNDA 4GT1A 3QB5A 1UGOA 1XNRT 2IHR1 4YHJA 3GLMA 3AEFA 4ILCA 3EFGA 2YMKA 3UU6A 1HJ0A 2XU6A 4PV1C 1Q2NA 3H1HG 3AE7A 2W62A 5HYAA 3PUAA 3R4YA 4ZI3D 5AFUL 1D0YA 3O1JA 3RIFA 2IDBA 4DJGA 1W5CE 2RMZA 4F8HA 2LT3A 4AUWA 1NTKJ 1MZ9A 2GM4A 3O4XE 1KFNA 3TLUA 4JYCA 1M7LA 5AQUB 2JDIH 2GUSA 2C5JA 4IL4A 3JCUH 2YKQA 2WWWA 3P4QA 5AW1B 2FYUK 2XDJA 3H1LE 3AE4A 1RHZB 3L8RA 4LF5T 2LR2A 3OVUA 2C0WA 4X20E 2FXPA 4NPDA 1D7MA 4CXWA 1N36T 4X66T 4GK5E 1K04A 2J62A 5JR9A 4E7SA 2QM8A 1AA0A 1HR0T 1FDIA 2XNDH 5AQSB 2YKSA 4AQRD 5FYMA 1QSDA 3HD7D 3ZDMA 1NENA 1FOSE 1J1DB 5FP3A 3JAFA 2OYHC 3ZMZB 3ZEFB 1KILB 2XUEA 1DD3A 2N1GA 1QL1A 4WBOA 3EI0A 3VMXA 1IFNA 1SFCD 4W7YA 3OKQA 1LTJB 2VKOA 1URQA 2I1KA 4KX6A 2OYIA 3HA4A 2Q5UA 2QE7H 2I1JA 3U1CA 3BQLA 3RK3D 5CCGA 2MOZA 1FOSF 1FMVA 3AE6A 4UXNB 3TNUA 1FZCC 3KFWX 5AW2B 2E9XB 5KLVJ 3RQUA 1L0LK 4DR2T 3Q1MA 5CCHC 1SQPJ 1XTGB 2FUPA 1H8AA 1CW5A 2VKDA 2FJEA 2FKWB 2XQYA 4YTMA 5LB7B 2FXOA 1JCCA 3DJBA 4ZEYA 1LTGC 2IIUA 3M06A 4UVBB 4UB8H 2XY8B 4YJ3E 4BAYB 3H1LG 3MP7B 3L73D 4PJJA 4LGDE 3V2QA 2MYSA 1MMAA 5LJMA 2R44A 2Z4EA 3V2PA 2Q9QD 2WAUA 1DX7A 3RL0D 3PTRB 3SS1A 3WI3A 4WB4A 2NR4A 3O6QB 5AW8B 3C4XA 4OGQC 1YITP 3OPCA 1OIPA 3CC2P 3M9QA 1AVOA 1OW7A 2UUBT 4AXPA 1YD8G 3HE5B 2WSCJ 2CHOA 4H13C 2YKOA 5TAOA 1R5SA 2VASA 2FBWA 4I2LC 1N8RQ 1KQGB 2W90A 2UWJE 5B66H 1G73A 4L73A 3ZJ1A 1HCIA 3IAOA 5AQTB 2Y8DA 3AEFC 2I6HA 5KAFE 2A06D 3CCQP 2JP3A 4JBZA 4TN7B 1NTZD 1X9VA 5E79E 3OTOT 2XPKA 1RF0C 3AE7C 2HPCA 2JMKA 2LE8A 3L71D 5EZYE 2NPSD 1YXRA 2WM9A 5HEJA 4QH4A 4U2ZA 3L72E 1FIOA 1FJKA 5IUXA 1HX8A 4JI1T 2AXTH 5APUA 4O4JE 5AQPB 1PL5A 1Z56A 3RQWA 1GU5A 1KD1Q 3CC7P 2YXRB 1FJGT 1OEDB 3O9XA 1KC8Q 4QH1A 4DR5T 4EYYQ 1SQVK 4WYVA 1QLED 3A2AA 3NRXA 5KLIC 4I50E 3V2NA 3P8CD 1BSHA 1SFCA 4IDZA 5LCYA 3AE4C 2KP8A 2K3WA 1Q90D 4TWDA 2UU9T 1U4QA 3N2OA 3DTOA 5APSA 3G4SP 1S9KE 3RRWA 4NPFX 2OQQA 3UU4A 2XM1A 3BVHA 5L3EB 1EDIA 2C0XA 2E5VA 3ZC1A 4JLEA 3JCUE 2ZVOB 3B5MA 2E5TA 3LK2B 1JCDA 1PGJA 1Z0PA 2DWGA 1LT1A 1LTJA 2WSEJ 2K37A 2LLYA 3FZKB 1MIVA 4R4LA 5L2LA 2W27A 1HVVA 4JI6T 1JY3O 4B3RT 2Y6XA 5AVZB 5JQGE 2PAJA 2LRKA 4N78E 3U3IA 2ZJSE 1SQXE 2JKVA 3P4SA 2RP4A 4EYYR 2Q9QA 3PJSK 2WSSH 2OYIC 2DWKA 4F6RC 4ADZA 3RYFE 4H0LB 4KT0J 3VP9A 3TLVA 4JI4T 5CCGC 3SFDA 3AE6C 4LFBT 3L72G 2M0BA 4PW8A 1WMKA 3P4PA 1PGPA 2HHHT 4X1YE 4ISTA 4DR3T 4MFRA 2M5AA 3NBXX 1IFPA 5AVVB 3RKGA 2YU2A 5HEGA 3ZMUB 3ONXA 4HFIA 4QXHB 2UXXB 3M91A 2IPPA 2BCCJ 3GHGB 3C9IA 4XAXB 3Q5PA 1X22A 4V1Av 1L0NE 3MTUE 2Q3EA 1T72A 3PUQA 4DO0A 2NZ2A 2C0SA 1M1KQ 1KYOH 2VL8A 4IFDK 1BCCJ 2W6BA 2M8RA 2H88A 2WB5A 2B87B 2Y0CA 1W2EA 3F5HA 4X1IE 1LTAC 3F31A 1GK6A 1JTHB 3KDSE 5JDHA 3FX0A 4HYTB 5FY0A 3SWYA 5JREA 2KWHA 4UB8E 4HE8A 5L3DB 3BQKA 3S9OA 5H6QB 3TDKA 3KVBA 4RO0A 4KHZF 2D2CB 1R5LA 1VQMP 3MZKB 3H1LD 4GIWA 4BJMA 4AI6A 1N7SB 2BKPA 3Q5RA 3P32A 1BE3E 1JOCA 1WR0A 2WDVA 3LBXA 1E5WA 1SQXG 5J1GA 1FC2C 1U57A 4FI5A 1DEBA 4D6TJ 5AQFB 3ZT6A 4A7PA 5HXEA 5B66E 3JC6D 1A02J 2V7KA 1RF1B 4RESB 3N9QA 5JDQA 1WR6A 1VL2A 2KOGA 2N1TD 4KJMA 4QMAA 1UCUA 3M3ZB 5JRCB 1S72P 3CX7B 2BEZF 2W61A 3AAEB 3CWBJ 2E76D 1L0NG 4HWIB 1KEYA 1PV3A 1NYHA 2AXTE 2CHNA 2ZXXA 1T98A 3CIRA 2CM0A 2CRBA 2QA7A 4UF0B 4ANJA 5L4HA 1BR0A 2C9LY 1J5WA 1CHUA 1HJBA 3RGUA 2KINB 1J1DC 2M3BA 3UQ7A 3MACA 3CVRA 4CN6A 5DQWA 4JQ0D 2M6BA 4EV6A 3NTNA 3CCEP 4DV5T 3CMAP 4ZS3A 2ZM0A 5FXVA 1LTJC 2XQ5A 2EHOB 2R32A 1USEA 4C7RA 5AQKB 2CK3H 1W0BA 2A72A 2B89A 4PV1D 1BE3G 3EHZA 2HPJA 3FGAD 3PV0F 1PGOA 3UULA 2W66A 1N33T 5DABA 1CI6B 4L74A 2XM2A 2KK7A 3VR9A 5C8YE 1EDJA 3KDPB 3SFDC 2YKPA 2JQKA 2DI4A 4Z1MH 1SE7A 3GHGA 1IFMA 2ACXA 1K73Q 3AA6B 3OJAA 4P1NA 2WQYA 2IAKA 2P58A 2L91A 3G6EP 3FZMB 4H9RC 4EOZB 2C5IT 2ZM2A 2XAQB 2W8ZA 4MLKA 1EDKA 4KHPT 3H1JE 4IL6X 2E8IA 3HR0A 3KBTA 3C8VA 2V7MA 1JTHA 5AVWB 3AECA 4EEDA 4EB6E 5AQJB 4CI1B 5ABHA 4LC1A 3VU7H 3OW2O 1JY2N 2H88C 3E08A 1N73B 4N3YB 3L72D 4LF4T 1GMJA 2DW3A 1KV4A 3Q5DA 2XAJB 4H9SE 4U3FJ 2ZT9D 4UELA 2IYPA 3B8EB 3HI2A 2SPCA 5LA6E 4ASKA 1N7SA 1SQXK 2WDRA 4HJGH 2KLVA 2Q7CA 2QGSA 2NWBA 4ERRA 3Q5WA 2WTYA 1SQQE 5FL1A 4CZZB 1NU1E 2GUVA 3JCFA 1JUNA 3KHUA 4DV0T 1JMMA 1S9KD 1KNZA 1HH0A 2HLOA 1XMQT 3RBZA 2FFDB 2LKHA 3CQGB 4ISSA 2FYUJ 3HRNA 1EXJA 4QWNB 1RF1A 1KNPA 2X9WA 1VQLP 1OEDC 4ASWA 2NRGA 3PU8A 5HAXA 4I7ZB 1UX5A 5JRCA 4QXCB 2O1JA 3UU5A 4IL9A 3W68A 3Q5XA 3GF3A 3LG7A 4IDQA 1QVGO 1GQEA 4Z90A 4YFSA 3UTKA 4B86A 5LOVE 4N78D 3CQXC 5LP6E 3H1JG 2ZFCA 4JUYA 1OFCX 2R3SA 1SQXD 3L75E 3VRAA 1YI2P 4HFBA 1YKEB 1LJ2A 4OGQD 3FXEB 5CJ4A 2SPZA 5JDMA 1XTCC 2N9DA 3PJAJ 3KQGA 4H13D 2EHOA 4I4TE 4EGWA 5FXXA 3UUBA 1N32T 3I1AA 2RN0A 2WY2A 3QC9A 1YTZI 1GU4A 2YDQA 5FKYA 1J1EB 2ZYDA 3NMDA 2O01J 5LBQB 1BDCA 1L0ND 3H6PA 4WWIA 3A0HH 1L0LJ 2W4XA 1SQQG 1NHLA 2E74C 4H0LC 3MJXA 3KINB 1NU1G 2QJYB 2NW8A 1SLQA 1G1JA 4TT3H 4EDFA 5HXHA 2Y9ZA 2G8YA 2RKLA 1FZAA 2YOEA 4CN4A 4WY4B 2W67A 4A5XA 3AXJA 4IFMA 5TISH 4DV2T 2CMRA 1QEXA 2WITA 3H1IE 3VMYA 3IA3A 3IF8B 2QG4A 3ZSSA 2AEFA 3GHGC 2GA1A 2KSEA 2VVNA 4BRYB 1VQ8P 3NKZA 1OW6A 2M3EA 2WQYC 3HKEE 2O1KA 1L4AA 2ZMAA 3B57A 4WZXA 2JO1A 3BASA 3L74E 4IDNA 5DQVA 1PP9J 3JSVC 3VRBA 1LP1B 3AVSA 2WS3A 1BE3D 5LHIB 4QKNA 2WMOA 3L73G 1AFOA 1OMIA 4C46A 3L75G 5JDNA 3AECC 2KZJA 3H1HJ 4YLHA 1EXIA 5M4YA 1NH4A 1K9MQ 4LF8T 1KFYA 4OH8B 2K5BB 1UK5A 5CMZA 1GW4A 3EAMA 4DR7T 5CCHA 3D6YA 2D2CC 3T97B 3B71A 2MAWA 1GL2B 3AEEA 1X0TA 4ZXLA 3RIAA 2H7HA 1N7SC 2UXNB 1S2EA 4O4LE 2W63A 1YTZT 2NW9A 5LXTE 2CWOA 3B4SA 1UURA 2UUCT 2FFDA 3SWFA 3H1KE 1SVFA 2WSFJ 2PBIA 3S4UA 3AEBA 4HFHA 1SQVJ 4ASVA 1MMDA 4IE5A 2WPQA 4W7ZA 5CCGD 4U31A 4XBFB 4UVCB 2B9BA 3PLNA 1RF1C 1AJYA 5AVUB 1GK4A 3H1IG 1H7CA 5HEUA 5C3JA 2IFMA 3N4XA 2Z6EA 2IBZE 3QOFA 1IO4A 3AE5C 1OZHA 3ZSTA 1Z8UA 2YEVC 1FE6A 3FXEA 2VKJA 5KMGP 2O01N 1RF0A 2OV9A 1KNRA 4KUMB 2CPTA 2HH7A 1B7TA 3R84B 2JIWA 4R4MA 2W6JH 3LSVA 5BU5A 2LSIA 2WZIA 5AQMB 1HNXT 3LDQB 5L8RJ 3OYXA 2LHNA 2ZVNB 1RQUA 2EHOC 3NWIA 1VCTA 4Q25A 5GTHH 4JF7A 4L76A 2GK9A 4QH5A 1J2JB 1OVRA 2CLYB 5KAIH 5ABFB 3H1JD 2KNCA 3H1LJ 2QJKB 2KZIA 1QGKB 1NTKE 3H1KG 1G8XA 1VQ7P 2BBJA 1RE4A 3BCCE 2HN1A 2WU5A 5HEOA 2X0LB 1US7B 5FMNA 4BRYA 1XMOT 4DCKA 1USDA 4UB6E 2XASB 3TSIA 1EZ3A 3G71P 1NOHA 2WSEH 5DJTB 2L3LA 4UV8B 1RH5B 3A0HE 1D1AA 1HNZT 2LRLA 5AVSB 1MV8A 1KYOD 4K0KT 2V8SV 1BGYJ 1L4AC 2IBZG 1NWQA 5DJQC 3GWHA 1SQQD 3CI9A 2FYZA 1NU1D 4U33A 2YDRA 3RK3B 1JB0J 2XQ9A 5TISE 5KKZB 1DIPA 1XNQT 4UIGA 3T97A 5CB4E 2ITAA 2XHEB 4OVNF 2LSKA 2XZEA 3USSA 3UFEA 3NZQA 1ZMEC 3IFMA 3N9NA 4JI8T 3I56P 2JQQA 5CBNA 2XSBA 4HWFA 1M1JB 5EFWB 3AEEC 1AVYA 5AVRB 3ETVA 3R6NA 1NTZK 3N2KE 2K24A 1FU1A 2OTJP 3LIDA 4IL6H 3N9MA 1ZV8A 3L75D 3RIUA 4YXDC 1IFIA 2FFDC 1SQPE 1NTKG 2ODUA 5EK2A 3CKDA 1X79B 1J1JA 2J4GA 3N5LA 3AEBC 3KBUA 5LG4A 3CMLA 3BCCG 5AQOB 4I7ZC 1KQLA 1PPJE 2Z5HA 3S4RA 4L75A 3TF5A 2XQ4A 3QNUA 3PRJA 4DUZT 3HE4B 4UV9B 5LYJE 4IGUA 2XQ3A 2OTLP 5CJ5A 3PUSA 1YHQP 3AE1C 3H32B 3A7MA 3ANWB 4GKKT 4H63V 3C4ZA 2IFNA 3A7OA 1G2CB 3GG2A 5LGNB 1JMBA 4NPEA 4Y99C 3FB2A 1SQBE 1YJ9P 2NW7A 1HGZA 1LGHB 3L72J 1ZOYA 3H1ID 3RF1A 4JI2T 1NTMJ 3IN6A 1J1EC 2BG9B 3AEDA 4HKAA 1WRDA 2V6YB 2C5KT 3RHWA 1LTSC 5APQA 1LTBC 1ZR2A 1O3XA 4H9OC 3L74D 3AB3B 3ZKRA 1YQ4A 4X65T 3J7Yq 3RBXA 4AKHA 4X64T 2QJYC 2X51A 2LKMA 1M7KA 2J59M 4CN1A 4DR1T 1ZKEA 3AEAA 4GKJT 2MJZA 4HH2A 1SQPG 2I59A 4CPGA 1KB9H 4ZKPA 4GOUA 1VF5B 4DBRA 4WY4C 2KI7B 4I43B 5GTHE 1RE4C 3E0ZA 5HCJA 3W67A 3QUJA 3KV4A 1KILA 1PPJG 3FBZA 4HB1A 4Y28J 3R2PA 4NXNT 5A1LA 3O1IA 5KAIE 1BR2A 2PP6A 2CXLA 2HODB 2IZ0A 1OW8A 4ZHQE 4C7NB 3ZLIA 3PH0A 2E75D 1N86A 3G06A 1QX8A 2KUBA 4DVDA 3MKDA 2IBZI 1FEWA 2X9YA 1IFJA 3ZJ2A 3JADA 4YT0A 1KMIZ 1GD2E 3H1KD 3MK7C 3GMAA 4PNIA 2E9XA 2H8PD 3L36A 5CBOA 1SQBG 3CK6A 3OBVE 1GL2C 1ZR4A 3FZLB 1MNDA 5CJ0A 1LWUB 3L70E 5KJ7A 3UUNA 1AQ5A 2IBZD 2V7QJ 4OWFA 4BWNA 1VQ5P 2AE9A 2FYNB 2WZ7A 2IMLA 4YTPA 3CCRP 1X79A 5GTIH 2E74D 3O6QA 4H0LD 5AQQB 4TZ4C 3J9X1 3RIUC 5AW7B 3K3OA 2Y48B 3HE5A 1V9DA 4TNWA 4P0AA 4ZI2C 1VRBA 4A98A 4OHFA 3HE4A 3BRVB 5HCMA 1MIYA 1NJIQ 5JDLA 3EDVA 5BR8T 2QYWA 2X0HA 3P7IA 3K8PC 2LSJA 1FDOA 3H32A 2G3AA 4IL6E 3ANWA 5APXA 1BCCE 4GOFA 1LT9B 4DMWA 4YY3T 2BS4A 1H88A 1G2CA 4A56A 2AXDS 1VQ6P 4HFDA 1FZBA 4A97A 1NTKD 3LW5J 3C64A 1LTTC 5AW6B 3CL3D 2LJLA 4ZI7E 4PK4A 2JWAA 3O8ZA 2K88A 3KVAA 3BCCD 2VURA 1FMWA 4P0BA 1UIXA 1XWMA 5BVZA 1BR4A 1ZHCA 3EABA 5AW9B 1OEDA 3I55P 1HNWT 1N34T 2BDEA 1ZOYC 4YJ2E 2N1TB 3L70G 2CLYC 2FJAA 1N7SD 1KF6A 3AEDC 3TGUE 4W80A 4I0UA 5IYZE 1S4XA 4CXXA 5JVDE 3QH9A 2QJKC 4D6TE 1VCSA 4DNDA 1YQ4C 1IBMT 3RH3A 2BVMA 3GN5B 4MN4C 4CI2B 2K9JB 3M0AA 3HKBE 3AEAC 1WYBA 3BQIA 3CCSP 3VKGA 1M56D 4BJNA 3P4RA 4PAGA 2H3RA 2QRXA 4GOEA 1EDLA 2DCFA 3B13A 1MMGA 1KILC 4ZZCA 3CWBE 1M57D 2HR3A 2JWDA 3NFQA 4G63A 2IC6A 4IT4A 2L8KA 1BCCG 5HXSA 3KV5A 4IDPA 4H9PC 1A02F 2Y0EA 1SQBK 1KB9E 3GF7A 4PV1B 3RK3C 3RX6A 3RRCA 3D71A 5LMUT 4O4HE 3T1HT 1SQPD 3CPZA 4PFOA 3PP5A 3TLSA 3AE9A 2E9XC 1MNEA 1LWUA 3E1RA 1K8AQ 2WT7B 1IAPA 2CA5A 4CXYA 1PPJD 2AEMA 2V1DB 3MIWA 1JY2O 4EZ4A 5AVQB 4JV5T 4ZNCA 1LTIC 3CCJP 4JBWF 2EHOD 2BS2A 1IK9A 4ZZBA 3CCUP 5KJ7C 3PUZF 4DUYT 2BASA 4LMJA 3TGUG 3ZMVB 1S94A 3KPEA 4O4IE 5FY7A 4XFJA 4D6TG 4YTPC 2B87A 2R6GF 3C51A 2IZ1A 2LOPA 3L39A 4J2CA 3KV9A 3PHLA 3EVYA 5L3GB 3RYCE 2VQFT 2QVAA 3VMAA 3WAJA 1SQBD 1HUCA 5AQIB 3Q5EA 2VVSA 2ZT9B 2HPLA 2XAHB 3A3YB 3PUGA 1LT9A 4GODA 4JYBA 3D0TA 3RGLA 4RKUJ 3NXSA 1S35A 4MHCA 5GTIE 1T2KC 4GDOA 1FJPA 1AV1A 1LKXA 1BDDA 1VPCA 1L4AD 1KYOE 1AJ3A 2M6IA 1AQTA 4Z8XA 4U3FE 1WYCA 1QVFO 2XQ6A 3II6A 3N9OA 2KLQA 3CCVP 4XE5B 4JI0T 3FWLA 3I9YA 4H63H 2D9DA 2J47A 4UVAB 4DMVA 1FZEA 1KILE 3QB5K 5CCHD 3CD6P 4KMCA 5EK3A 3N2GE 5BMVE 1L0NK 4IOIH 1P84H 3GN5A 3O1HA 3AE5A 3VYIA 4NUUA 4PFPA 3CLQA 1LNQA 3ZYMA 1W9RA 1E7PA 3UUMA 1I6ZA 2FYUE 4UF0A 3Q3DA 1E2AA 1IZNB 2KS1B 1VF5C 4LF9T 5LJNA 2P2UA 2D5UA 2X68A 4K3AA 1JNRA 3L73J 2OA5A 3IEEA 3JC22 1MFZA 3EQ2A 2LXBA 2YIUB 4N6JA 2XV5A 4HWDA 3M9BA 2WPSA 3PUYF 1QLBA 1PFIA 4IREA 1NKZB 1ZV4X 4O8SA 3ZN1B 1NAFA 1XZYA 5CA0E 1UUSA 3L70D 4NUVA 4PK6A 1Q82Q 2DNXA 3A5TA 1WLXA 2DL1A 2QJPB 3F89A 5M1BA 3FHNA 4LF7T 1FS0E 4UEMA 1CI6A 1VQOP 1PZQA 1W2BO 1N2DC 2WT7A 1Y47A 4U3FG 3MXZA 2RH0A 4AQYT 4LLHA 4RJTA 3PUXF 5ADXL 2LSGA 1NTZJ 2E5LT 2KT9A 3AE9C 5LGUB 2VL0A 2BCCD 1LWUC 2E5YA 2ES0A 5ABGA 3L71J 2Q1KA 3A0BH 4DT0A 2RPAA 2PTFA 1FBMA 1U7MA 4HWHA 4U74A 1L0LE 1BCCD 2FYNC 5LGTB 5CHXA 3B5NB 2P10A 3N9LA 2UXCT 4IIJE 2YO3A 1PIXA 3PU3A 2FYUG 3ESLA 1N73A 1HX1B 1JNZA 3RL0g 2Q3IA 3V5UA 5JR9B 2WBLA 2WZHA 3ITKA 2N9YB 4AKGA 4B6XA 1DEEG 1PP9E 1OEDE 2VWAA 1JY3P 1HG5A 1T8ZA 5HWYA 1LT9C 2XQAA 1RE3A 5AW3B 1HF9A 4WNKA 3TGUD 5CGMA 1VQ4P 5B5EH 2E42A 5CA1E 4TV8E 3H1HE 2A3DA 3HKCE 1NO4A 4D6TD 3ZC0A 1S1CX 4YXWH 2V6XA 4OYJA 4H44B 2CBJA 3ZYLA 2JQHA 3U78A 1URQB 3AEGA 4YXDA 3VTPC 1KB9I 2WWVA 4QX8B 5FVLA 2H7OA 1OVUA 3NZPA 4L5GA 5KX5E 1Y8AA 3H1KJ 3V6IA 1T6AA 1UX4A 2DLRA 5APYA 3RK2B 3K1SA 2V7LA 1J5ET 1D1CA 1GL2D 3PTZA 1G1IA 2WSCH 2JR8A 3I0QA 3VKHA 1HTLC 3CWBD 4TWHA 4LFAT 3LK42 4U72A 1KTMA 3VN0A 1FZGA 3AA0B 3AE2C 1L0LG 3TLTA 1KQFB 2CWYA 3AAAB 3AE1A 3HUSB 1SQVE 3L74G 1KB9D 1Q7YQ 2G0UA 1JEKA 2MPKA 1TU3F 4L9IA 3WAKA 2R5BA 5AW5B 2W6AA 2XKMA 3FZFB 2M67A 4ZI2D 4YSYA 3HTKB 1P84E 2IX7C 1GZLA 3CPWO 4X1KE 1IFDA 1PP9G 3L35A 3H37A 1SQQK 2YXQB 1SS1A 4OX9T 5ETWA 1NU1K 1D0ZA 1IC2A 2NTXA 2YMYA 1S5LX 1NAYA 2NOXA 1KYOI 2CCQA 3MA9A 4LFCT 4K0UA 2HPCB 1YBKA 4PD4H 1Y9BA 3V5SA 4WY4A 2VRSA 4KBMB 1VQ9P 3I9WA 5AW4B 3HD7B 1NVOA 2LXCB 3BCCJ 1IBLT 5HXCA 1DH3A 5L3BB 1PGQA 2P7JA 2WP9A 3B5NA 3ZT7A 2IDOB 1FAVA 2KSJA 4DV6T 5AVYB 1LP1A 3IF4A 2LM9A 5LBMA 3U59A 4HFEA 4NIQA 4NPPA 2W00A 4EEBA 4I1LA 3KV6A 1SFCB 2H89A 1SQVG 1D1BA 3AAIA 1JM0A 2IC9A 1MIWA 3CXHH 2Q6QA 4U3FD 2H7VC 2KXPB 4O2BE 3RC3A 5ABEA 4EOTA 1N73C 3A0BE 1X9BA 3D6ZA 5FL0A 4PJMA 2YDSA 2ZT9C 2A45H 2BS3A 3MZWB 3OYZA 5L3FB 1GL2A 2QIWA 1BGYE 4GIFA 2ACZA 5AQGB 1KILD 4IFFA 4WVZA 5FY1A 2JRKA 2XQ7A 1RQVA 2V7QH 4GKGA 1RE3C 1X8YA 2QA4P 2VB6A 1W09A 2VK9A 4JPZB 2C9NY 2ZM8A 2B76A 2BEQD 2P1JA 2FYUD 4YTNA 4IDOA 5E0OA 2ODVA 3AEGC 1JY2P 2X66A 3L4FA 2Q9QB 5KLVE 5AVTB 4QHOA 1HGVA 3RL0B 3KZIH 2WWUA 3BK9A 3CX8B 5AVXB 3FBLA 2E9XD 2I0MA 2JPFA 1E79H 3L37A 1EC5A 4HGAA 3SOLA 2W0GA 5B5EE 3C98B 3G3ZA 4IHJE 2YO2A 3CMEP 2M5AB 2RA1A 4EAHA 1H89A 2KLUA 3HUSA 3AVRA 5KJ7D 4MBQA 3SWHA 1YJWP 2N2NA 2H43A 1IK7A 3IBPA 5FVKA 5JDGA 1FDMA 2P9BA 2B88A 1ZEEA 4U7YA 4OFZA 5APVA 3LW5H 3CWZB 5K5GB 2XNXA 2YIUC 2VQET 2X67A 2BBHA 3HTKA 3OAKA 2WMMA 3WUTA 1IBKT 2NPSB 1OWAA 5FXWA 4ZKUA 1KFMA 2W2UA 4AYCA 1LRZA 1ZW0A 1SQBJ 1BGYG 4GK0E 2XSAA 3UT5E 1L0LD 3CX5H 2QM7A 3AE3A 5FXZA 2QJPC 3CC4P 5ABFA 1T2KD 1BR1A 1XDOA 1IJ5A 1GDTA 2WU2A 4EI2A 5LHGB 2E43A 3WU2H 3C4WA 1WFDA 3LBXB 2OYOA 2WPRA 4AKIA 3HL6A 1YQ3A 3HD7A 5KLVG 1NTME 4DZOA 2JQ9A 2YN6A 2OLTA 3ZMTB 5L3CB 2KMFA 1PP9D 3CQCB 2HFED 4X62T 4COFA 4ZS2A 5APWA 3B5NC 2ZXEB 3MD0A 1NWMX 3E22E 2E75B 3H1HD 2JJLA 3V4QA 1Q81Q 2K9YA 4PD4E 2XAFB 3F2EA 4DIDB 1NGMB 2H89C 2LHRA 5JR9C 3RKOA 2PGDA 1VF5D 2CXDA 4ZMDA 5JH7E 3C1LA 3N7NA 1SQXJ 1BSNA 2CE7A 4ZOLE 3AA1B 4M3LA 4HKZH 2XZRA 2D0TA 3ETUA 1M1JA 2X9HA 2KWIB 4EZHA 2J5UA 1P84I 3FZHB 4IE4A 2YU1A 2XJ7A 3TYYA 3M65A 3D70A 1QUUA 2OARA 3K5BA 4HEAA 2FY8A 2K48A 3P4WA 5EK4A 2IUBA 3L70J 3CXHE 4H44C 3MUDA 1NTKK 1H0TB 1URQC 4U7JA 1SQVD 5L4EA 4NXMT 2E74B 4C90A 3PJAA 4CI3B 5GONE 2POHA 1VDFA 3RK2C 4JI5T 1L0NJ 3ABVA 3V2RA 3VMZA 1NTMG 5IHYA 4B3ST 1U7JA 1EQ7A 1IJ6A 5FNVE 3WUUA 1P84D 2CBIA 2VKHA 3HKDE 2ZYGA 5JTGA 1MFTA 2BCCE 1KORA 5F8PA 1JY3N 4PJ0H 1LVFA 4IE6A 3SFEA 3UUXB 2PG8A 2KB7P 3OJAB 3M9HA 3N9PA 2DHRA 1OVVA 1NKNA 3PURA 5AQNB 4E7ZA 4HTEA 3HUSC 4JEUB 5L47A 5BU8B 3LIEA 4YSZA 2Z5IA 3KZIE 4O9BA 2PRRA 4AQFA 1MKMA 2P67A 4WBNE 4ZI3C 1HF8A 2NPSA 3VP8A 2CXFA 4LMKA 2IW5B 1EZVE 2W83C 4AKLA 5J2TE 2MTQA 1BE3J 3V4WA 3P7KA 4HN9A 5CFBA 2Y9YA 4HFVA 3SRZA 4O2AE
chains in the Genus database with same CATH topology
2B89A 1JM0A 2SPZA 3QB5K 2QRXA 4GOEA 4IOIH 1EDLA 3PJAJ 2UWJE 1EDJA 3MHVA 3RIUA 5CBOA 3MZWB 3S1KA 2HR3A 1ZXGA 1S3JA 2B87B 2JWDA 1OVUA 4JBZA 1J1JA 3FXEA 2KS1B 1BDCA 2P58A 4WWIA 2LR2A 4K3AA 2LXBA 4NPDA 3QWOC 1EDKA 2I8DA 2ZAEB 4ZMDA 2K3RA 3FXDA 2RKLA 3ZDMA 3RIUC 4EYYQ 4HKZH 4WYVA 3AXJA 1OVRA 4ZNCA 1FC2C 1EC5A 1JMBA 4NPEA 5C39A 2KZIA 1H0TB 2M5AB 1Y47A 1LP1B 2KIKA 4HJGH 4NPFX 4K35A 4GOFA 2B87A 2OTKE 1EDIA 3PJAA 5DJUB 2KZJA 4KJMA 2B88A 2Q1KA 1SS1A 2QVAA 1U7MA 5K5GB 1LT1A 5DJTB 1U7JA 1H0TA 1KEYA 2WMMA 1MFTA 4BXLA 1X0TA 4GODA 4ASWA 1OVVA 1ZW0A 4CPGA 3RGUA 1BDDA 2KI7B 3QB5A 1NVOA 4HB1A 2LXCB 2R44A 2M0BA 1Q2NA 2M5AA 1DEEG 4ASVA 1LP1A 4MN4C 3PH0A 3AXJB 5CBNA 2KUBA 5EFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B89 A;  1JM0 A;  2SPZ A;  3QB5 K;  2QRX A;  4GOE A;  4IOI H;  1EDL A;  3PJA J;  2UWJ E;  1EDJ A;  3MHV A;  3RIU A;  5CBO A;  3MZW B;  3S1K A;  2HR3 A;  1ZXG A;  1S3J A;  2B87 B;  2JWD A;  1OVU A;  4JBZ A;  1J1J A;  3FXE A;  2KS1 B;  1BDC A;  2P58 A;  4WWI A;  2LR2 A;  4K3A A;  2LXB A;  4NPD A;  3QWO C;  1EDK A;  2I8D A;  2ZAE B;  4ZMD A;  2K3R A;  3FXD A;  2RKL A;  3ZDM A;  3RIU C;  4EYY Q;  4HKZ H;  4WYV A;  3AXJ A;  1OVR A;  4ZNC A;  1FC2 C;  1EC5 A;  1JMB A;  4NPE A;  5C39 A;  2KZI A;  1H0T B;  2M5A B;  1Y47 A;  1LP1 B;  2KIK A;  4HJG H;  4NPF X;  4K35 A;  4GOF A;  2B87 A;  2OTK E;  1EDI A;  3PJA A;  5DJU B;  2KZJ A;  4KJM A;  2B88 A;  2Q1K A;  1SS1 A;  2QVA A;  1U7M A;  5K5G B;  1LT1 A;  5DJT B;  1U7J A;  1H0T A;  1KEY A;  2WMM A;  1MFT A;  4BXL A;  1X0T A;  4GOD A;  4ASW A;  1OVV A;  1ZW0 A;  4CPG A;  3RGU A;  1BDD A;  2KI7 B;  3QB5 A;  1NVO A;  4HB1 A;  2LXC B;  2R44 A;  2M0B A;  1Q2N A;  2M5A A;  1DEE G;  4ASV A;  1LP1 A;  4MN4 C;  3PH0 A;  3AXJ B;  5CBN A;  2KUB A;  5EFW B; 
#chains in the Genus database with same CATH topology
 5LG3 A;  1T7S A;  3AE8 A;  5J2U E;  2BG9 A;  1WRG A;  3SWK A;  2V6Y A;  2FBW C;  3MGN A;  3Q5S A;  4WW0 A;  1VOM A;  2D2C D;  2OGU A;  2PFV A;  2KZ7 B;  4Z91 A;  2CEA A;  3G9R A;  1GTW A;  3AE3 C;  3T1Y T;  1Y64 B;  5KLV K;  3S1K A;  1SQP K;  3TGU J;  3A8Y C;  4TNV A;  4EXT A;  1YKH B;  2E76 B;  3K3Q C;  2A45 G;  1NEK A;  1LVK A;  4LML A;  4DV7 T;  4TUY E;  3UU8 A;  4YHH T;  1Q86 Q;  1YQ3 C;  3HD7 C;  4ILB A;  2CPB A;  2I8D A;  3CX5 E;  1ZP0 A;  4TLF A;  2F4V T;  5C2T A;  1BGY D;  5KXJ A;  2QSI A;  1ZRT E;  1M90 Q;  4PJN A;  1WT6 A;  2BCC G;  2HOD A;  4DOJ A;  3F57 A;  2K1A A;  3A5X A;  4C7N A;  4HFC A;  4JI3 T;  3RLF F;  3WU2 E;  5H2F H;  1SFC C;  4B3T T;  2O01 H;  2V7J A;  1S5L H;  2WPV B;  4JI7 T;  1SP4 A;  4TX5 A;  1VQN P;  4I6M C;  1T8B A;  5AQH B;  5KKZ C;  5KLV D;  3RI5 A;  3ZCI A;  1EZV G;  1SHZ C;  2FXM A;  3E7K A;  4BA9 A;  3ONL C;  2ZYA A;  3Q2Y A;  4DV4 T;  4YPC A;  2V26 A;  2LSY A;  1QL2 A;  1YW0 A;  1H0T A;  3VOP A;  4H9N C;  1M1J C;  2WVR A;  5KTB A;  2HYN A;  3M0D A;  4EIJ A;  3L3P A;  2E2A A;  3P50 A;  4YSX A;  1DD4 A;  3ONJ A;  4QXB B;  2LM2 A;  3MUD C;  1NTM K;  3IR9 A;  3T8O A;  1YJN P;  3V5B A;  3RYI E;  3BRT B;  2Q9Q C;  2NP9 A;  2WDQ A;  4MAL A;  3RL0 C;  3EUH A;  2LOS A;  3H1J J;  4AIS A;  1SA0 E;  3W15 B;  5F3J A;  3ABV C;  3E1I A;  2ZLY A;  1UII A;  2A9U A;  4EYU A;  2K9A A;  3PDY A;  1D0X A;  2R3C A;  3AXJ B;  3EDU A;  3I5C A;  4PK5 A;  1KN7 A;  3SFE C;  5TJH A;  2OYH B;  4U3C A;  3CWB G;  3RPU A;  2YK0 A;  3NVO A;  3EFF K;  3I0O A;  3UQ4 A;  1OX3 A;  1HTJ F;  4OK0 A;  1MUU A;  1L4A B;  2V7I A;  3ZN0 B;  4CQI A;  4OYK A;  5LMN T;  3LFM A;  3PUW F;  3MHV A;  4AQF C;  4TWF A;  4U7I A;  2PFX A;  4PD4 I;  1VQP P;  1KQS O;  4AQG A;  5HWX A;  1I94 T;  2NPS C;  4XA4 A;  4XZC A;  4ILA A;  2WSF H;  1JNM A;  3FXD B;  3RYH E;  1SQQ J;  4PJ0 E;  1NTM D;  4DBQ A;  1NU1 J;  2YNY A;  4KHX A;  1FZC B;  2X0Y A;  2N1T A;  1E1H B;  4I55 E;  3AE8 C;  2BG9 C;  2FJB A;  2WCA A;  4ILU A;  5HEH A;  2QEX P;  3LJC A;  3EWK A;  4GYS A;  2K3R A;  1GW3 A;  2Y0D A;  1IJD B;  1RY3 A;  3AE2 A;  1T3J A;  4P09 A;  2CPS A;  2HG5 D;  3TK1 A;  1YIJ P;  3CX6 B;  2XQ8 A;  5LHH B;  2K9J A;  3CXH I;  1KZU B;  4PD4 D;  1MMN A;  1ZLL A;  3ZYK A;  1CZQ A;  3RK3 E;  2O3J A;  2B1E A;  1ZN5 A;  2A45 I;  2D0U A;  3KXD A;  3CCL P;  3GA8 A;  5H6R B;  4JYA T;  3L75 J;  4OGQ B;  2J58 A;  4G2A A;  1WCR A;  3LK3 B;  3ZT5 A;  2YIN A;  1ZP0 C;  3WUV A;  1R8E A;  1OXZ A;  3L09 A;  2OTK E;  4C91 A;  1K05 A;  3VR8 A;  4H13 B;  2E75 C;  2WMN A;  2JEE A;  4WBA A;  5AQL B;  5F5W A;  4AIU A;  2UUA T;  3CXH D;  3RC8 A;  2HN2 A;  3L73 E;  3BAT A;  3CCM P;  1L0V A;  3H25 A;  3Q2M A;  4IE0 A;  2ZM6 T;  4DV3 T;  2Q9I A;  3QK6 A;  2XTL A;  2IYO A;  4EIW A;  4Y99 B;  1HWT C;  4U2Y A;  4DR6 T;  1N7L A;  2UXD T;  1EZV I;  2V5C A;  3OA7 A;  1FZF A;  5AQV B;  5KDM C;  5H2F E;  1M8O B;  2V5D A;  2UXB T;  4UB6 H;  1S5L E;  2R5D A;  3GMI A;  3M0D C;  4DR4 T;  3X1D A;  2AXC A;  3VHL A;  2KYV A;  3H1I J;  2MBG A;  3AA7 B;  4X5T A;  3TLW A;  3ZMS B;  5C39 A;  5KLI B;  2BVL A;  2A06 E;  5APT A;  1NTZ E;  2AEJ A;  2BKN A;  1U5P A;  2KSR A;  1CSB A;  2KNC B;  1HFA A;  1HS7 A;  3L74 J;  2A2F X;  3L71 E;  3DP7 A;  4AKR B;  1EZV D;  2N9B A;  3UFG A;  2V4H A;  2JMH A;  5AW0 B;  5JDF A;  2L5G B;  1JO5 A;  1ZXG A;  1S3J A;  1R8I A;  2D2S A;  4WY4 D;  2OYH A;  3PE0 A;  3UU3 A;  1T3U A;  3CX5 I;  4IE7 A;  3ZCJ A;  3SSU A;  2LEH A;  4QX7 B;  2MKV A;  3PUV F;  2BG9 E;  2BKO A;  3IHR A;  2WSS V;  3B5N D;  3QWO C;  3P8C E;  1VQK P;  4DV1 T;  2NTY A;  2ZAE B;  2BZB A;  3TKL B;  1Y01 A;  3GW6 A;  1DU2 A;  3FXD A;  3Q9D A;  5IWA T;  4UR9 A;  4JEH B;  5LNK A;  4H9Q C;  3FWN A;  4PJL A;  5AQR B;  1FZC A;  3UIA A;  3JAE A;  2OYI B;  2FJD A;  2PJQ A;  3CX5 D;  1M62 A;  4M1P A;  2JJ9 A;  3JC6 C;  1L2P A;  3TNU B;  4FJO A;  4KP3 C;  1ZRT D;  3U1A A;  1SUM B;  2X9X A;  3C50 A;  2N1T C;  2KIK A;  4LF6 T;  3ZPO A;  4K35 A;  3H3M A;  1KK7 A;  3H3A A;  2L9Q A;  4H44 D;  4L0R A;  2J1D G;  2E76 C;  4KI0 F;  5DJU B;  1W0A A;  2KS1 A;  1URQ D;  4B3M T;  2A06 G;  1NTZ G;  1YYC A;  4HWC A;  5KAF H;  4GYR A;  3L71 G;  3RK2 D;  1CUN A;  5HXR A;  1HBW A;  5E79 H;  3KYQ A;  4BXL A;  3K3N A;  1XDP A;  2LKG A;  5J0Z A;  3P8M C;  1HG2 A;  3NRY A;  3WMM 0;  2XAG B;  4TV9 E;  2KND A;  4GT1 A;  3QB5 A;  1UGO A;  1XNR T;  2IHR 1;  4YHJ A;  3GLM A;  3AEF A;  4ILC A;  3EFG A;  2YMK A;  3UU6 A;  1HJ0 A;  2XU6 A;  4PV1 C;  1Q2N A;  3H1H G;  3AE7 A;  2W62 A;  5HYA A;  3PUA A;  3R4Y A;  4ZI3 D;  5AFU L;  1D0Y A;  3O1J A;  3RIF A;  2IDB A;  4DJG A;  1W5C E;  2RMZ A;  4F8H A;  2LT3 A;  4AUW A;  1NTK J;  1MZ9 A;  2GM4 A;  3O4X E;  1KFN A;  3TLU A;  4JYC A;  1M7L A;  5AQU B;  2JDI H;  2GUS A;  2C5J A;  4IL4 A;  3JCU H;  2YKQ A;  2WWW A;  3P4Q A;  5AW1 B;  2FYU K;  2XDJ A;  3H1L E;  3AE4 A;  1RHZ B;  3L8R A;  4LF5 T;  2LR2 A;  3OVU A;  2C0W A;  4X20 E;  2FXP A;  4NPD A;  1D7M A;  4CXW A;  1N36 T;  4X66 T;  4GK5 E;  1K04 A;  2J62 A;  5JR9 A;  4E7S A;  2QM8 A;  1AA0 A;  1HR0 T;  1FDI A;  2XND H;  5AQS B;  2YKS A;  4AQR D;  5FYM A;  1QSD A;  3HD7 D;  3ZDM A;  1NEN A;  1FOS E;  1J1D B;  5FP3 A;  3JAF A;  2OYH C;  3ZMZ B;  3ZEF B;  1KIL B;  2XUE A;  1DD3 A;  2N1G A;  1QL1 A;  4WBO A;  3EI0 A;  3VMX A;  1IFN A;  1SFC D;  4W7Y A;  3OKQ A;  1LTJ B;  2VKO A;  1URQ A;  2I1K A;  4KX6 A;  2OYI A;  3HA4 A;  2Q5U A;  2QE7 H;  2I1J A;  3U1C A;  3BQL A;  3RK3 D;  5CCG A;  2MOZ A;  1FOS F;  1FMV A;  3AE6 A;  4UXN B;  3TNU A;  1FZC C;  3KFW X;  5AW2 B;  2E9X B;  5KLV J;  3RQU A;  1L0L K;  4DR2 T;  3Q1M A;  5CCH C;  1SQP J;  1XTG B;  2FUP A;  1H8A A;  1CW5 A;  2VKD A;  2FJE A;  2FKW B;  2XQY A;  4YTM A;  5LB7 B;  2FXO A;  1JCC A;  3DJB A;  4ZEY A;  1LTG C;  2IIU A;  3M06 A;  4UVB B;  4UB8 H;  2XY8 B;  4YJ3 E;  4BAY B;  3H1L G;  3MP7 B;  3L73 D;  4PJJ A;  4LGD E;  3V2Q A;  2MYS A;  1MMA A;  5LJM A;  2R44 A;  2Z4E A;  3V2P A;  2Q9Q D;  2WAU A;  1DX7 A;  3RL0 D;  3PTR B;  3SS1 A;  3WI3 A;  4WB4 A;  2NR4 A;  3O6Q B;  5AW8 B;  3C4X A;  4OGQ C;  1YIT P;  3OPC A;  1OIP A;  3CC2 P;  3M9Q A;  1AVO A;  1OW7 A;  2UUB T;  4AXP A;  1YD8 G;  3HE5 B;  2WSC J;  2CHO A;  4H13 C;  2YKO A;  5TAO A;  1R5S A;  2VAS A;  2FBW A;  4I2L C;  1N8R Q;  1KQG B;  2W90 A;  2UWJ E;  5B66 H;  1G73 A;  4L73 A;  3ZJ1 A;  1HCI A;  3IAO A;  5AQT B;  2Y8D A;  3AEF C;  2I6H A;  5KAF E;  2A06 D;  3CCQ P;  2JP3 A;  4JBZ A;  4TN7 B;  1NTZ D;  1X9V A;  5E79 E;  3OTO T;  2XPK A;  1RF0 C;  3AE7 C;  2HPC A;  2JMK A;  2LE8 A;  3L71 D;  5EZY E;  2NPS D;  1YXR A;  2WM9 A;  5HEJ A;  4QH4 A;  4U2Z A;  3L72 E;  1FIO A;  1FJK A;  5IUX A;  1HX8 A;  4JI1 T;  2AXT H;  5APU A;  4O4J E;  5AQP B;  1PL5 A;  1Z56 A;  3RQW A;  1GU5 A;  1KD1 Q;  3CC7 P;  2YXR B;  1FJG T;  1OED B;  3O9X A;  1KC8 Q;  4QH1 A;  4DR5 T;  4EYY Q;  1SQV K;  4WYV A;  1QLE D;  3A2A A;  3NRX A;  5KLI C;  4I50 E;  3V2N A;  3P8C D;  1BSH A;  1SFC A;  4IDZ A;  5LCY A;  3AE4 C;  2KP8 A;  2K3W A;  1Q90 D;  4TWD A;  2UU9 T;  1U4Q A;  3N2O A;  3DTO A;  5APS A;  3G4S P;  1S9K E;  3RRW A;  4NPF X;  2OQQ A;  3UU4 A;  2XM1 A;  3BVH A;  5L3E B;  1EDI A;  2C0X A;  2E5V A;  3ZC1 A;  4JLE A;  3JCU E;  2ZVO B;  3B5M A;  2E5T A;  3LK2 B;  1JCD A;  1PGJ A;  1Z0P A;  2DWG A;  1LT1 A;  1LTJ A;  2WSE J;  2K37 A;  2LLY A;  3FZK B;  1MIV A;  4R4L A;  5L2L A;  2W27 A;  1HVV A;  4JI6 T;  1JY3 O;  4B3R T;  2Y6X A;  5AVZ B;  5JQG E;  2PAJ A;  2LRK A;  4N78 E;  3U3I A;  2ZJS E;  1SQX E;  2JKV A;  3P4S A;  2RP4 A;  4EYY R;  2Q9Q A;  3PJS K;  2WSS H;  2OYI C;  2DWK A;  4F6R C;  4ADZ A;  3RYF E;  4H0L B;  4KT0 J;  3VP9 A;  3TLV A;  4JI4 T;  5CCG C;  3SFD A;  3AE6 C;  4LFB T;  3L72 G;  2M0B A;  4PW8 A;  1WMK A;  3P4P A;  1PGP A;  2HHH T;  4X1Y E;  4IST A;  4DR3 T;  4MFR A;  2M5A A;  3NBX X;  1IFP A;  5AVV B;  3RKG A;  2YU2 A;  5HEG A;  3ZMU B;  3ONX A;  4HFI A;  4QXH B;  2UXX B;  3M91 A;  2IPP A;  2BCC J;  3GHG B;  3C9I A;  4XAX B;  3Q5P A;  1X22 A;  4V1A v;  1L0N E;  3MTU E;  2Q3E A;  1T72 A;  3PUQ A;  4DO0 A;  2NZ2 A;  2C0S A;  1M1K Q;  1KYO H;  2VL8 A;  4IFD K;  1BCC J;  2W6B A;  2M8R A;  2H88 A;  2WB5 A;  2B87 B;  2Y0C A;  1W2E A;  3F5H A;  4X1I E;  1LTA C;  3F31 A;  1GK6 A;  1JTH B;  3KDS E;  5JDH A;  3FX0 A;  4HYT B;  5FY0 A;  3SWY A;  5JRE A;  2KWH A;  4UB8 E;  4HE8 A;  5L3D B;  3BQK A;  3S9O A;  5H6Q B;  3TDK A;  3KVB A;  4RO0 A;  4KHZ F;  2D2C B;  1R5L A;  1VQM P;  3MZK B;  3H1L D;  4GIW A;  4BJM A;  4AI6 A;  1N7S B;  2BKP A;  3Q5R A;  3P32 A;  1BE3 E;  1JOC A;  1WR0 A;  2WDV A;  3LBX A;  1E5W A;  1SQX G;  5J1G A;  1FC2 C;  1U57 A;  4FI5 A;  1DEB A;  4D6T J;  5AQF B;  3ZT6 A;  4A7P A;  5HXE A;  5B66 E;  3JC6 D;  1A02 J;  2V7K A;  1RF1 B;  4RES B;  3N9Q A;  5JDQ A;  1WR6 A;  1VL2 A;  2KOG A;  2N1T D;  4KJM A;  4QMA A;  1UCU A;  3M3Z B;  5JRC B;  1S72 P;  3CX7 B;  2BEZ F;  2W61 A;  3AAE B;  3CWB J;  2E76 D;  1L0N G;  4HWI B;  1KEY A;  1PV3 A;  1NYH A;  2AXT E;  2CHN A;  2ZXX A;  1T98 A;  3CIR A;  2CM0 A;  2CRB A;  2QA7 A;  4UF0 B;  4ANJ A;  5L4H A;  1BR0 A;  2C9L Y;  1J5W A;  1CHU A;  1HJB A;  3RGU A;  2KIN B;  1J1D C;  2M3B A;  3UQ7 A;  3MAC A;  3CVR A;  4CN6 A;  5DQW A;  4JQ0 D;  2M6B A;  4EV6 A;  3NTN A;  3CCE P;  4DV5 T;  3CMA P;  4ZS3 A;  2ZM0 A;  5FXV A;  1LTJ C;  2XQ5 A;  2EHO B;  2R32 A;  1USE A;  4C7R A;  5AQK B;  2CK3 H;  1W0B A;  2A72 A;  2B89 A;  4PV1 D;  1BE3 G;  3EHZ A;  2HPJ A;  3FGA D;  3PV0 F;  1PGO A;  3UUL A;  2W66 A;  1N33 T;  5DAB A;  1CI6 B;  4L74 A;  2XM2 A;  2KK7 A;  3VR9 A;  5C8Y E;  1EDJ A;  3KDP B;  3SFD C;  2YKP A;  2JQK A;  2DI4 A;  4Z1M H;  1SE7 A;  3GHG A;  1IFM A;  2ACX A;  1K73 Q;  3AA6 B;  3OJA A;  4P1N A;  2WQY A;  2IAK A;  2P58 A;  2L91 A;  3G6E P;  3FZM B;  4H9R C;  4EOZ B;  2C5I T;  2ZM2 A;  2XAQ B;  2W8Z A;  4MLK A;  1EDK A;  4KHP T;  3H1J E;  4IL6 X;  2E8I A;  3HR0 A;  3KBT A;  3C8V A;  2V7M A;  1JTH A;  5AVW B;  3AEC A;  4EED A;  4EB6 E;  5AQJ B;  4CI1 B;  5ABH A;  4LC1 A;  3VU7 H;  3OW2 O;  1JY2 N;  2H88 C;  3E08 A;  1N73 B;  4N3Y B;  3L72 D;  4LF4 T;  1GMJ A;  2DW3 A;  1KV4 A;  3Q5D A;  2XAJ B;  4H9S E;  4U3F J;  2ZT9 D;  4UEL A;  2IYP A;  3B8E B;  3HI2 A;  2SPC A;  5LA6 E;  4ASK A;  1N7S A;  1SQX K;  2WDR A;  4HJG H;  2KLV A;  2Q7C A;  2QGS A;  2NWB A;  4ERR A;  3Q5W A;  2WTY A;  1SQQ E;  5FL1 A;  4CZZ B;  1NU1 E;  2GUV A;  3JCF A;  1JUN A;  3KHU A;  4DV0 T;  1JMM A;  1S9K D;  1KNZ A;  1HH0 A;  2HLO A;  1XMQ T;  3RBZ A;  2FFD B;  2LKH A;  3CQG B;  4ISS A;  2FYU J;  3HRN A;  1EXJ A;  4QWN B;  1RF1 A;  1KNP A;  2X9W A;  1VQL P;  1OED C;  4ASW A;  2NRG A;  3PU8 A;  5HAX A;  4I7Z B;  1UX5 A;  5JRC A;  4QXC B;  2O1J A;  3UU5 A;  4IL9 A;  3W68 A;  3Q5X A;  3GF3 A;  3LG7 A;  4IDQ A;  1QVG O;  1GQE A;  4Z90 A;  4YFS A;  3UTK A;  4B86 A;  5LOV E;  4N78 D;  3CQX C;  5LP6 E;  3H1J G;  2ZFC A;  4JUY A;  1OFC X;  2R3S A;  1SQX D;  3L75 E;  3VRA A;  1YI2 P;  4HFB A;  1YKE B;  1LJ2 A;  4OGQ D;  3FXE B;  5CJ4 A;  2SPZ A;  5JDM A;  1XTC C;  2N9D A;  3PJA J;  3KQG A;  4H13 D;  2EHO A;  4I4T E;  4EGW A;  5FXX A;  3UUB A;  1N32 T;  3I1A A;  2RN0 A;  2WY2 A;  3QC9 A;  1YTZ I;  1GU4 A;  2YDQ A;  5FKY A;  1J1E B;  2ZYD A;  3NMD A;  2O01 J;  5LBQ B;  1BDC A;  1L0N D;  3H6P A;  4WWI A;  3A0H H;  1L0L J;  2W4X A;  1SQQ G;  1NHL A;  2E74 C;  4H0L C;  3MJX A;  3KIN B;  1NU1 G;  2QJY B;  2NW8 A;  1SLQ A;  1G1J A;  4TT3 H;  4EDF A;  5HXH A;  2Y9Z A;  2G8Y A;  2RKL A;  1FZA A;  2YOE A;  4CN4 A;  4WY4 B;  2W67 A;  4A5X A;  3AXJ A;  4IFM A;  5TIS H;  4DV2 T;  2CMR A;  1QEX A;  2WIT A;  3H1I E;  3VMY A;  3IA3 A;  3IF8 B;  2QG4 A;  3ZSS A;  2AEF A;  3GHG C;  2GA1 A;  2KSE A;  2VVN A;  4BRY B;  1VQ8 P;  3NKZ A;  1OW6 A;  2M3E A;  2WQY C;  3HKE E;  2O1K A;  1L4A A;  2ZMA A;  3B57 A;  4WZX A;  2JO1 A;  3BAS A;  3L74 E;  4IDN A;  5DQV A;  1PP9 J;  3JSV C;  3VRB A;  1LP1 B;  3AVS A;  2WS3 A;  1BE3 D;  5LHI B;  4QKN A;  2WMO A;  3L73 G;  1AFO A;  1OMI A;  4C46 A;  3L75 G;  5JDN A;  3AEC C;  2KZJ A;  3H1H J;  4YLH A;  1EXI A;  5M4Y A;  1NH4 A;  1K9M Q;  4LF8 T;  1KFY A;  4OH8 B;  2K5B B;  1UK5 A;  5CMZ A;  1GW4 A;  3EAM A;  4DR7 T;  5CCH A;  3D6Y A;  2D2C C;  3T97 B;  3B71 A;  2MAW A;  1GL2 B;  3AEE A;  1X0T A;  4ZXL A;  3RIA A;  2H7H A;  1N7S C;  2UXN B;  1S2E A;  4O4L E;  2W63 A;  1YTZ T;  2NW9 A;  5LXT E;  2CWO A;  3B4S A;  1UUR A;  2UUC T;  2FFD A;  3SWF A;  3H1K E;  1SVF A;  2WSF J;  2PBI A;  3S4U A;  3AEB A;  4HFH A;  1SQV J;  4ASV A;  1MMD A;  4IE5 A;  2WPQ A;  4W7Z A;  5CCG D;  4U31 A;  4XBF B;  4UVC B;  2B9B A;  3PLN A;  1RF1 C;  1AJY A;  5AVU B;  1GK4 A;  3H1I G;  1H7C A;  5HEU A;  5C3J A;  2IFM A;  3N4X A;  2Z6E A;  2IBZ E;  3QOF A;  1IO4 A;  3AE5 C;  1OZH A;  3ZST A;  1Z8U A;  2YEV C;  1FE6 A;  3FXE A;  2VKJ A;  5KMG P;  2O01 N;  1RF0 A;  2OV9 A;  1KNR A;  4KUM B;  2CPT A;  2HH7 A;  1B7T A;  3R84 B;  2JIW A;  4R4M A;  2W6J H;  3LSV A;  5BU5 A;  2LSI A;  2WZI A;  5AQM B;  1HNX T;  3LDQ B;  5L8R J;  3OYX A;  2LHN A;  2ZVN B;  1RQU A;  2EHO C;  3NWI A;  1VCT A;  4Q25 A;  5GTH H;  4JF7 A;  4L76 A;  2GK9 A;  4QH5 A;  1J2J B;  1OVR A;  2CLY B;  5KAI H;  5ABF B;  3H1J D;  2KNC A;  3H1L J;  2QJK B;  2KZI A;  1QGK B;  1NTK E;  3H1K G;  1G8X A;  1VQ7 P;  2BBJ A;  1RE4 A;  3BCC E;  2HN1 A;  2WU5 A;  5HEO A;  2X0L B;  1US7 B;  5FMN A;  4BRY A;  1XMO T;  4DCK A;  1USD A;  4UB6 E;  2XAS B;  3TSI A;  1EZ3 A;  3G71 P;  1NOH A;  2WSE H;  5DJT B;  2L3L A;  4UV8 B;  1RH5 B;  3A0H E;  1D1A A;  1HNZ T;  2LRL A;  5AVS B;  1MV8 A;  1KYO D;  4K0K T;  2V8S V;  1BGY J;  1L4A C;  2IBZ G;  1NWQ A;  5DJQ C;  3GWH A;  1SQQ D;  3CI9 A;  2FYZ A;  1NU1 D;  4U33 A;  2YDR A;  3RK3 B;  1JB0 J;  2XQ9 A;  5TIS E;  5KKZ B;  1DIP A;  1XNQ T;  4UIG A;  3T97 A;  5CB4 E;  2ITA A;  2XHE B;  4OVN F;  2LSK A;  2XZE A;  3USS A;  3UFE A;  3NZQ A;  1ZME C;  3IFM A;  3N9N A;  4JI8 T;  3I56 P;  2JQQ A;  5CBN A;  2XSB A;  4HWF A;  1M1J B;  5EFW B;  3AEE C;  1AVY A;  5AVR B;  3ETV A;  3R6N A;  1NTZ K;  3N2K E;  2K24 A;  1FU1 A;  2OTJ P;  3LID A;  4IL6 H;  3N9M A;  1ZV8 A;  3L75 D;  3RIU A;  4YXD C;  1IFI A;  2FFD C;  1SQP E;  1NTK G;  2ODU A;  5EK2 A;  3CKD A;  1X79 B;  1J1J A;  2J4G A;  3N5L A;  3AEB C;  3KBU A;  5LG4 A;  3CML A;  3BCC G;  5AQO B;  4I7Z C;  1KQL A;  1PPJ E;  2Z5H A;  3S4R A;  4L75 A;  3TF5 A;  2XQ4 A;  3QNU A;  3PRJ A;  4DUZ T;  3HE4 B;  4UV9 B;  5LYJ E;  4IGU A;  2XQ3 A;  2OTL P;  5CJ5 A;  3PUS A;  1YHQ P;  3AE1 C;  3H32 B;  3A7M A;  3ANW B;  4GKK T;  4H63 V;  3C4Z A;  2IFN A;  3A7O A;  1G2C B;  3GG2 A;  5LGN B;  1JMB A;  4NPE A;  4Y99 C;  3FB2 A;  1SQB E;  1YJ9 P;  2NW7 A;  1HGZ A;  1LGH B;  3L72 J;  1ZOY A;  3H1I D;  3RF1 A;  4JI2 T;  1NTM J;  3IN6 A;  1J1E C;  2BG9 B;  3AED A;  4HKA A;  1WRD A;  2V6Y B;  2C5K T;  3RHW A;  1LTS C;  5APQ A;  1LTB C;  1ZR2 A;  1O3X A;  4H9O C;  3L74 D;  3AB3 B;  3ZKR A;  1YQ4 A;  4X65 T;  3J7Y q;  3RBX A;  4AKH A;  4X64 T;  2QJY C;  2X51 A;  2LKM A;  1M7K A;  2J59 M;  4CN1 A;  4DR1 T;  1ZKE A;  3AEA A;  4GKJ T;  2MJZ A;  4HH2 A;  1SQP G;  2I59 A;  4CPG A;  1KB9 H;  4ZKP A;  4GOU A;  1VF5 B;  4DBR A;  4WY4 C;  2KI7 B;  4I43 B;  5GTH E;  1RE4 C;  3E0Z A;  5HCJ A;  3W67 A;  3QUJ A;  3KV4 A;  1KIL A;  1PPJ G;  3FBZ A;  4HB1 A;  4Y28 J;  3R2P A;  4NXN T;  5A1L A;  3O1I A;  5KAI E;  1BR2 A;  2PP6 A;  2CXL A;  2HOD B;  2IZ0 A;  1OW8 A;  4ZHQ E;  4C7N B;  3ZLI A;  3PH0 A;  2E75 D;  1N86 A;  3G06 A;  1QX8 A;  2KUB A;  4DVD A;  3MKD A;  2IBZ I;  1FEW A;  2X9Y A;  1IFJ A;  3ZJ2 A;  3JAD A;  4YT0 A;  1KMI Z;  1GD2 E;  3H1K D;  3MK7 C;  3GMA A;  4PNI A;  2E9X A;  2H8P D;  3L36 A;  5CBO A;  1SQB G;  3CK6 A;  3OBV E;  1GL2 C;  1ZR4 A;  3FZL B;  1MND A;  5CJ0 A;  1LWU B;  3L70 E;  5KJ7 A;  3UUN A;  1AQ5 A;  2IBZ D;  2V7Q J;  4OWF A;  4BWN A;  1VQ5 P;  2AE9 A;  2FYN B;  2WZ7 A;  2IML A;  4YTP A;  3CCR P;  1X79 A;  5GTI H;  2E74 D;  3O6Q A;  4H0L D;  5AQQ B;  4TZ4 C;  3J9X 1;  3RIU C;  5AW7 B;  3K3O A;  2Y48 B;  3HE5 A;  1V9D A;  4TNW A;  4P0A A;  4ZI2 C;  1VRB A;  4A98 A;  4OHF A;  3HE4 A;  3BRV B;  5HCM A;  1MIY A;  1NJI Q;  5JDL A;  3EDV A;  5BR8 T;  2QYW A;  2X0H A;  3P7I A;  3K8P C;  2LSJ A;  1FDO A;  3H32 A;  2G3A A;  4IL6 E;  3ANW A;  5APX A;  1BCC E;  4GOF A;  1LT9 B;  4DMW A;  4YY3 T;  2BS4 A;  1H88 A;  1G2C A;  4A56 A;  2AXD S;  1VQ6 P;  4HFD A;  1FZB A;  4A97 A;  1NTK D;  3LW5 J;  3C64 A;  1LTT C;  5AW6 B;  3CL3 D;  2LJL A;  4ZI7 E;  4PK4 A;  2JWA A;  3O8Z A;  2K88 A;  3KVA A;  3BCC D;  2VUR A;  1FMW A;  4P0B A;  1UIX A;  1XWM A;  5BVZ A;  1BR4 A;  1ZHC A;  3EAB A;  5AW9 B;  1OED A;  3I55 P;  1HNW T;  1N34 T;  2BDE A;  1ZOY C;  4YJ2 E;  2N1T B;  3L70 G;  2CLY C;  2FJA A;  1N7S D;  1KF6 A;  3AED C;  3TGU E;  4W80 A;  4I0U A;  5IYZ E;  1S4X A;  4CXX A;  5JVD E;  3QH9 A;  2QJK C;  4D6T E;  1VCS A;  4DND A;  1YQ4 C;  1IBM T;  3RH3 A;  2BVM A;  3GN5 B;  4MN4 C;  4CI2 B;  2K9J B;  3M0A A;  3HKB E;  3AEA C;  1WYB A;  3BQI A;  3CCS P;  3VKG A;  1M56 D;  4BJN A;  3P4R A;  4PAG A;  2H3R A;  2QRX A;  4GOE A;  1EDL A;  2DCF A;  3B13 A;  1MMG A;  1KIL C;  4ZZC A;  3CWB E;  1M57 D;  2HR3 A;  2JWD A;  3NFQ A;  4G63 A;  2IC6 A;  4IT4 A;  2L8K A;  1BCC G;  5HXS A;  3KV5 A;  4IDP A;  4H9P C;  1A02 F;  2Y0E A;  1SQB K;  1KB9 E;  3GF7 A;  4PV1 B;  3RK3 C;  3RX6 A;  3RRC A;  3D71 A;  5LMU T;  4O4H E;  3T1H T;  1SQP D;  3CPZ A;  4PFO A;  3PP5 A;  3TLS A;  3AE9 A;  2E9X C;  1MNE A;  1LWU A;  3E1R A;  1K8A Q;  2WT7 B;  1IAP A;  2CA5 A;  4CXY A;  1PPJ D;  2AEM A;  2V1D B;  3MIW A;  1JY2 O;  4EZ4 A;  5AVQ B;  4JV5 T;  4ZNC A;  1LTI C;  3CCJ P;  4JBW F;  2EHO D;  2BS2 A;  1IK9 A;  4ZZB A;  3CCU P;  5KJ7 C;  3PUZ F;  4DUY T;  2BAS A;  4LMJ A;  3TGU G;  3ZMV B;  1S94 A;  3KPE A;  4O4I E;  5FY7 A;  4XFJ A;  4D6T G;  4YTP C;  2B87 A;  2R6G F;  3C51 A;  2IZ1 A;  2LOP A;  3L39 A;  4J2C A;  3KV9 A;  3PHL A;  3EVY A;  5L3G B;  3RYC E;  2VQF T;  2QVA A;  3VMA A;  3WAJ A;  1SQB D;  1HUC A;  5AQI B;  3Q5E A;  2VVS A;  2ZT9 B;  2HPL A;  2XAH B;  3A3Y B;  3PUG A;  1LT9 A;  4GOD A;  4JYB A;  3D0T A;  3RGL A;  4RKU J;  3NXS A;  1S35 A;  4MHC A;  5GTI E;  1T2K C;  4GDO A;  1FJP A;  1AV1 A;  1LKX A;  1BDD A;  1VPC A;  1L4A D;  1KYO E;  1AJ3 A;  2M6I A;  1AQT A;  4Z8X A;  4U3F E;  1WYC A;  1QVF O;  2XQ6 A;  3II6 A;  3N9O A;  2KLQ A;  3CCV P;  4XE5 B;  4JI0 T;  3FWL A;  3I9Y A;  4H63 H;  2D9D A;  2J47 A;  4UVA B;  4DMV A;  1FZE A;  1KIL E;  3QB5 K;  5CCH D;  3CD6 P;  4KMC A;  5EK3 A;  3N2G E;  5BMV E;  1L0N K;  4IOI H;  1P84 H;  3GN5 A;  3O1H A;  3AE5 A;  3VYI A;  4NUU A;  4PFP A;  3CLQ A;  1LNQ A;  3ZYM A;  1W9R A;  1E7P A;  3UUM A;  1I6Z A;  2FYU E;  4UF0 A;  3Q3D A;  1E2A A;  1IZN B;  2KS1 B;  1VF5 C;  4LF9 T;  5LJN A;  2P2U A;  2D5U A;  2X68 A;  4K3A A;  1JNR A;  3L73 J;  2OA5 A;  3IEE A;  3JC2 2;  1MFZ A;  3EQ2 A;  2LXB A;  2YIU B;  4N6J A;  2XV5 A;  4HWD A;  3M9B A;  2WPS A;  3PUY F;  1QLB A;  1PFI A;  4IRE A;  1NKZ B;  1ZV4 X;  4O8S A;  3ZN1 B;  1NAF A;  1XZY A;  5CA0 E;  1UUS A;  3L70 D;  4NUV A;  4PK6 A;  1Q82 Q;  2DNX A;  3A5T A;  1WLX A;  2DL1 A;  2QJP B;  3F89 A;  5M1B A;  3FHN A;  4LF7 T;  1FS0 E;  4UEM A;  1CI6 A;  1VQO P;  1PZQ A;  1W2B O;  1N2D C;  2WT7 A;  1Y47 A;  4U3F G;  3MXZ A;  2RH0 A;  4AQY T;  4LLH A;  4RJT A;  3PUX F;  5ADX L;  2LSG A;  1NTZ J;  2E5L T;  2KT9 A;  3AE9 C;  5LGU B;  2VL0 A;  2BCC D;  1LWU C;  2E5Y A;  2ES0 A;  5ABG A;  3L71 J;  2Q1K A;  3A0B H;  4DT0 A;  2RPA A;  2PTF A;  1FBM A;  1U7M A;  4HWH A;  4U74 A;  1L0L E;  1BCC D;  2FYN C;  5LGT B;  5CHX A;  3B5N B;  2P10 A;  3N9L A;  2UXC T;  4IIJ E;  2YO3 A;  1PIX A;  3PU3 A;  2FYU G;  3ESL A;  1N73 A;  1HX1 B;  1JNZ A;  3RL0 g;  2Q3I A;  3V5U A;  5JR9 B;  2WBL A;  2WZH A;  3ITK A;  2N9Y B;  4AKG A;  4B6X A;  1DEE G;  1PP9 E;  1OED E;  2VWA A;  1JY3 P;  1HG5 A;  1T8Z A;  5HWY A;  1LT9 C;  2XQA A;  1RE3 A;  5AW3 B;  1HF9 A;  4WNK A;  3TGU D;  5CGM A;  1VQ4 P;  5B5E H;  2E42 A;  5CA1 E;  4TV8 E;  3H1H E;  2A3D A;  3HKC E;  1NO4 A;  4D6T D;  3ZC0 A;  1S1C X;  4YXW H;  2V6X A;  4OYJ A;  4H44 B;  2CBJ A;  3ZYL A;  2JQH A;  3U78 A;  1URQ B;  3AEG A;  4YXD A;  3VTP C;  1KB9 I;  2WWV A;  4QX8 B;  5FVL A;  2H7O A;  1OVU A;  3NZP A;  4L5G A;  5KX5 E;  1Y8A A;  3H1K J;  3V6I A;  1T6A A;  1UX4 A;  2DLR A;  5APY A;  3RK2 B;  3K1S A;  2V7L A;  1J5E T;  1D1C A;  1GL2 D;  3PTZ A;  1G1I A;  2WSC H;  2JR8 A;  3I0Q A;  3VKH A;  1HTL C;  3CWB D;  4TWH A;  4LFA T;  3LK4 2;  4U72 A;  1KTM A;  3VN0 A;  1FZG A;  3AA0 B;  3AE2 C;  1L0L G;  3TLT A;  1KQF B;  2CWY A;  3AAA B;  3AE1 A;  3HUS B;  1SQV E;  3L74 G;  1KB9 D;  1Q7Y Q;  2G0U A;  1JEK A;  2MPK A;  1TU3 F;  4L9I A;  3WAK A;  2R5B A;  5AW5 B;  2W6A A;  2XKM A;  3FZF B;  2M67 A;  4ZI2 D;  4YSY A;  3HTK B;  1P84 E;  2IX7 C;  1GZL A;  3CPW O;  4X1K E;  1IFD A;  1PP9 G;  3L35 A;  3H37 A;  1SQQ K;  2YXQ B;  1SS1 A;  4OX9 T;  5ETW A;  1NU1 K;  1D0Z A;  1IC2 A;  2NTX A;  2YMY A;  1S5L X;  1NAY A;  2NOX A;  1KYO I;  2CCQ A;  3MA9 A;  4LFC T;  4K0U A;  2HPC B;  1YBK A;  4PD4 H;  1Y9B A;  3V5S A;  4WY4 A;  2VRS A;  4KBM B;  1VQ9 P;  3I9W A;  5AW4 B;  3HD7 B;  1NVO A;  2LXC B;  3BCC J;  1IBL T;  5HXC A;  1DH3 A;  5L3B B;  1PGQ A;  2P7J A;  2WP9 A;  3B5N A;  3ZT7 A;  2IDO B;  1FAV A;  2KSJ A;  4DV6 T;  5AVY B;  1LP1 A;  3IF4 A;  2LM9 A;  5LBM A;  3U59 A;  4HFE A;  4NIQ A;  4NPP A;  2W00 A;  4EEB A;  4I1L A;  3KV6 A;  1SFC B;  2H89 A;  1SQV G;  1D1B A;  3AAI A;  1JM0 A;  2IC9 A;  1MIW A;  3CXH H;  2Q6Q A;  4U3F D;  2H7V C;  2KXP B;  4O2B E;  3RC3 A;  5ABE A;  4EOT A;  1N73 C;  3A0B E;  1X9B A;  3D6Z A;  5FL0 A;  4PJM A;  2YDS A;  2ZT9 C;  2A45 H;  2BS3 A;  3MZW B;  3OYZ A;  5L3F B;  1GL2 A;  2QIW A;  1BGY E;  4GIF A;  2ACZ A;  5AQG B;  1KIL D;  4IFF A;  4WVZ A;  5FY1 A;  2JRK A;  2XQ7 A;  1RQV A;  2V7Q H;  4GKG A;  1RE3 C;  1X8Y A;  2QA4 P;  2VB6 A;  1W09 A;  2VK9 A;  4JPZ B;  2C9N Y;  2ZM8 A;  2B76 A;  2BEQ D;  2P1J A;  2FYU D;  4YTN A;  4IDO A;  5E0O A;  2ODV A;  3AEG C;  1JY2 P;  2X66 A;  3L4F A;  2Q9Q B;  5KLV E;  5AVT B;  4QHO A;  1HGV A;  3RL0 B;  3KZI H;  2WWU A;  3BK9 A;  3CX8 B;  5AVX B;  3FBL A;  2E9X D;  2I0M A;  2JPF A;  1E79 H;  3L37 A;  1EC5 A;  4HGA A;  3SOL A;  2W0G A;  5B5E E;  3C98 B;  3G3Z A;  4IHJ E;  2YO2 A;  3CME P;  2M5A B;  2RA1 A;  4EAH A;  1H89 A;  2KLU A;  3HUS A;  3AVR A;  5KJ7 D;  4MBQ A;  3SWH A;  1YJW P;  2N2N A;  2H43 A;  1IK7 A;  3IBP A;  5FVK A;  5JDG A;  1FDM A;  2P9B A;  2B88 A;  1ZEE A;  4U7Y A;  4OFZ A;  5APV A;  3LW5 H;  3CWZ B;  5K5G B;  2XNX A;  2YIU C;  2VQE T;  2X67 A;  2BBH A;  3HTK A;  3OAK A;  2WMM A;  3WUT A;  1IBK T;  2NPS B;  1OWA A;  5FXW A;  4ZKU A;  1KFM A;  2W2U A;  4AYC A;  1LRZ A;  1ZW0 A;  1SQB J;  1BGY G;  4GK0 E;  2XSA A;  3UT5 E;  1L0L D;  3CX5 H;  2QM7 A;  3AE3 A;  5FXZ A;  2QJP C;  3CC4 P;  5ABF A;  1T2K D;  1BR1 A;  1XDO A;  1IJ5 A;  1GDT A;  2WU2 A;  4EI2 A;  5LHG B;  2E43 A;  3WU2 H;  3C4W A;  1WFD A;  3LBX B;  2OYO A;  2WPR A;  4AKI A;  3HL6 A;  1YQ3 A;  3HD7 A;  5KLV G;  1NTM E;  4DZO A;  2JQ9 A;  2YN6 A;  2OLT A;  3ZMT B;  5L3C B;  2KMF A;  1PP9 D;  3CQC B;  2HFE D;  4X62 T;  4COF A;  4ZS2 A;  5APW A;  3B5N C;  2ZXE B;  3MD0 A;  1NWM X;  3E22 E;  2E75 B;  3H1H D;  2JJL A;  3V4Q A;  1Q81 Q;  2K9Y A;  4PD4 E;  2XAF B;  3F2E A;  4DID B;  1NGM B;  2H89 C;  2LHR A;  5JR9 C;  3RKO A;  2PGD A;  1VF5 D;  2CXD A;  4ZMD A;  5JH7 E;  3C1L A;  3N7N A;  1SQX J;  1BSN A;  2CE7 A;  4ZOL E;  3AA1 B;  4M3L A;  4HKZ H;  2XZR A;  2D0T A;  3ETU A;  1M1J A;  2X9H A;  2KWI B;  4EZH A;  2J5U A;  1P84 I;  3FZH B;  4IE4 A;  2YU1 A;  2XJ7 A;  3TYY A;  3M65 A;  3D70 A;  1QUU A;  2OAR A;  3K5B A;  4HEA A;  2FY8 A;  2K48 A;  3P4W A;  5EK4 A;  2IUB A;  3L70 J;  3CXH E;  4H44 C;  3MUD A;  1NTK K;  1H0T B;  1URQ C;  4U7J A;  1SQV D;  5L4E A;  4NXM T;  2E74 B;  4C90 A;  3PJA A;  4CI3 B;  5GON E;  2POH A;  1VDF A;  3RK2 C;  4JI5 T;  1L0N J;  3ABV A;  3V2R A;  3VMZ A;  1NTM G;  5IHY A;  4B3S T;  1U7J A;  1EQ7 A;  1IJ6 A;  5FNV E;  3WUU A;  1P84 D;  2CBI A;  2VKH A;  3HKD E;  2ZYG A;  5JTG A;  1MFT A;  2BCC E;  1KOR A;  5F8P A;  1JY3 N;  4PJ0 H;  1LVF A;  4IE6 A;  3SFE A;  3UUX B;  2PG8 A;  2KB7 P;  3OJA B;  3M9H A;  3N9P A;  2DHR A;  1OVV A;  1NKN A;  3PUR A;  5AQN B;  4E7Z A;  4HTE A;  3HUS C;  4JEU B;  5L47 A;  5BU8 B;  3LIE A;  4YSZ A;  2Z5I A;  3KZI E;  4O9B A;  2PRR A;  4AQF A;  1MKM A;  2P67 A;  4WBN E;  4ZI3 C;  1HF8 A;  2NPS A;  3VP8 A;  2CXF A;  4LMK A;  2IW5 B;  1EZV E;  2W83 C;  4AKL A;  5J2T E;  2MTQ A;  1BE3 J;  3V4W A;  3P7K A;  4HN9 A;  5CFB A;  2Y9Y A;  4HFV A;  3SRZ A;  4O2A E; 
#chains in the Genus database with same CATH homology
 2B89 A;  1JM0 A;  2SPZ A;  3QB5 K;  2QRX A;  4GOE A;  4IOI H;  1EDL A;  3PJA J;  2UWJ E;  1EDJ A;  3MHV A;  3RIU A;  5CBO A;  3MZW B;  3S1K A;  2HR3 A;  1ZXG A;  1S3J A;  2B87 B;  2JWD A;  1OVU A;  4JBZ A;  1J1J A;  3FXE A;  2KS1 B;  1BDC A;  2P58 A;  4WWI A;  2LR2 A;  4K3A A;  2LXB A;  4NPD A;  3QWO C;  1EDK A;  2I8D A;  2ZAE B;  4ZMD A;  2K3R A;  3FXD A;  2RKL A;  3ZDM A;  3RIU C;  4EYY Q;  4HKZ H;  4WYV A;  3AXJ A;  1OVR A;  4ZNC A;  1FC2 C;  1EC5 A;  1JMB A;  4NPE A;  5C39 A;  2KZI A;  1H0T B;  2M5A B;  1Y47 A;  1LP1 B;  2KIK A;  4HJG H;  4NPF X;  4K35 A;  4GOF A;  2B87 A;  2OTK E;  1EDI A;  3PJA A;  5DJU B;  2KZJ A;  4KJM A;  2B88 A;  2Q1K A;  1SS1 A;  2QVA A;  1U7M A;  5K5G B;  1LT1 A;  5DJT B;  1U7J A;  1H0T A;  1KEY A;  2WMM A;  1MFT A;  4BXL A;  1X0T A;  4GOD A;  4ASW A;  1OVV A;  1ZW0 A;  4CPG A;  3RGU A;  1BDD A;  2KI7 B;  3QB5 A;  1NVO A;  4HB1 A;  2LXC B;  2R44 A;  2M0B A;  1Q2N A;  2M5A A;  1DEE G;  4ASV A;  1LP1 A;  4MN4 C;  3PH0 A;  3AXJ B;  5CBN A;  2KUB A;  5EFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...