4QXCB

Crystal structure of histone demethylase kdm2a-h3k36me2 with nog
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxcB00
4QX8B 4QX7B 4QXCB 4QWNB 4QXBB 4QXHB 4TN7B
chains in the Genus database with same CATH superfamily
4YJ2E 4DNDA 2UUCT 3L39A 3AE8A 4JI2T 3PUGA 2W0GA 2WMNA 2C0SA 3KVBA 3KV5A 2FJDA 2IC6A 2PBIA 3C64A 3P7IA 5HWXA 4ZS3A 3SFEA 3FZLB 4DV7T 2RA1A 3ONXA 4WYVA 5AQKB 2XHEB 3RIFA 4CN6A 3VRBA 4YSXA 2IIUA 4QXCB 5JTGA 1MMGA 5JRCA 2XQ6A 4UVAB 1HNXT 4G63A 2V7LA 5CJ5A 2LSIA 2V7JA 3F57A 3MJXA 4X64T 2IMLA 2J62A 3OBVE 4YLHA 2Q9QB 5L3FB 4AQYT 3I1AA 2CPTA 1YW0A 1E7PA 2GK9A 2LJLA 2IC9A 2MAWA 4DR2T 2V1DB 4I43B 2E8IA 2CLYB 2AXDS 5DQWA 5CB4E 1T72A 3CPZA 5LOVE 4JI3T 2H7VC 3I0OA 2BG9C 4I55E 4AKGA 4LMLA 3L3PA 1MNDA 1HCIA 2WU2A 3LBXB 4HWCA 5HEJA 1OEDB 2XQYA 4GIWA 1Z8UA 2XAJB 2CXFA 2D2SA 2EHOB 4TUYE 3ZMZB 3ZT6A 2E9XB 3AECA 5GONE 3W15B 1ZV4X 3C4XA 5L3DB 2QRXA 2WZIA 2F4VT 1JNZA 5HXCA 3PUAA 4JUYA 2YU1A 2DCFA 4O4HE 4OK0A 4TWFA 3R84B 2SPCA 3SWHA 4HFEA 4COFA 2BG9B 3AVRA 4UEMA 3RGLA 5F3JA 4A97A 3C51A 2LSGA 4U74A 2C5IT 5DQVA 4KHPT 3FB2A 2V26A 3L09A 4HFIA 5FP3A 3ZSTA 3TKLB 5JDLA 4N78D 1X79A 3RH3A 1W0BA 4EZHA 3JC6D 2BBJA 3JAFA 2Y6XA 3K8PC 1WR6A 4EAHA 5HXSA 2ZM0A 5JH7E 4ZI7E 4HWHA 2RPAA 2VQET 5FXVA 2WMOA 2CWYA 4O4LE 4X5TA 3MK7C 4IGUA 4UR9A 3PV0F 2CEAA 2M6BA 4GYRA 5L4EA 4JV5T 3IF8B 3FBZA 2WQYA 3N2GE 3NRXA 2VK9A 2WB5A 3RC8A 3SRZA 4CN1A 4YTPA 5HXEA 3Q5WA 1UGOA 3V5UA 5JDQA 3OVUA 2VWAA 1SE7A 2UXXB 3UU8A 2UXBT 1ZEEA 4O2AE 3U78A 3VR9A 4F6RC 5TAOA 3RQUA 4EEDA 2ZMAA 5EK4A 3ZJ1A 3P4SA 1HX8A 2V6YA 4CQIA 1NWMX 3CQXC 2NTYA 3TLWA 3NBXX 1FMVA 3RIUA 2V6YB 2BKPA 2XQ7A 2RP4A 4TNVA 3N9NA 2CE7A 3RYFE 2D0UA 4CI3B 1BR1A 5AQOB 3ZJ2A 5JRCB 2LOPA 4TV9E 4J2CA 5IWAT 2CMRA 2XQ5A 2KWHA 3ESLA 1UX4A 3IA3A 5LGUB 5HXHA 2A72A 3UUNA 1ZP0A 4YSYA 2LM2A 2WDRA 3Q2MA 2QYWA 3RRCA 4AKLA 5ABFA 2X9HA 2XTLA 4XAXB 2VURA 2LLYA 4UF0B 1HG5A 4IHJE 4AQFC 4YXDA 4DV5T 2ACZA 4YFSA 1FJGT 5EZYE 2E5VA 4GYSA 5KDMC 1OXZA 4BA9A 3WAJA 4B3ST 4JBWF 2H89A 2KINB 4BAYB 1WRDA 3PUYF 3N9OA 4NUUA 2DHRA 2IAKA 4X65T 3PUSA 2EHOD 4DV6T 1IZNB 2HHHT 1S35A 4DR6T 2DWGA 3B13A 1LKXA 4PFPA 4KX6A 1M62A 2BS3A 2KNDA 2LRKA 4L5GA 4Q25A 2XAGB 3N2KE 4QWNB 1T8BA 3N9QA 4CXYA 4AQGA 2A9UA 1N33T 3UU6A 1CUNA 1YQ3A 3D0TA 3DJBA 5LP6E 1HNZT 1S94A 2L9QA 2V5CA 2W00A 4LF8T 5F8PA 4AIUA 5FVLA 3R6NA 5LXTE 4TV8E 1I6ZA 4MALA 2N9DA 2XQ3A 3AE2A 3QC9A 4NUVA 5HXRA 3WAKA 4ASKA 4B3TT 2XAHB 4DR4T 4FI5A 4E7ZA 2M67A 4DR7T 4AKHA 1LVFA 4G2AA 1WYCA 3O1JA 3RKGA 2W61A 3ANWA 3MA9A 3IEEA 3HR0A 3LDQB 5J0ZA 3RI5A 4ADZA 1HR0T 4UXNB 2LOSA 3E08A 3KBUA 3EI0A 3AB3B 1U4QA 4LF5T 2X9YA 4PFOA 2JRKA 2YKSA 4QH5A 5HEOA 3UQ7A 3I0QA 4ISSA 2BS2A 3Q5EA 2WS3A 1IJ5A 2XQ4A 2DL1A 3ZPOA 2V7MA 1IBLT 3AEGA 3CVRA 4EEBA 2FJEA 4ZI3D 2VKDA 3AEFA 2UUBT 4LF4T 4LMKA 2FJBA 3U3IA 2WSSV 2XQAA 3JADA 5FKYA 4YT0A 5JDHA 1E2AA 1BR4A 3N9MA 4LMJA 4JI1T 2V6XA 2CXDA 3V5SA 2MYSA 2V5DA 2CM0A 2XASB 2KWIB 4A98A 1MIVA 2NTXA 3O1IA 1SHZC 3PJAA 4Z91A 3I9YA 4F8HA 3GN5B 4HE8A 5JVDE 4WBNE 4YSZA 4IDNA 3AXJA 1LVKA 5LA6E 1ZKEA 4O8SA 2R6GF 5CA0E 4UIGA 2J4GA 5FXZA 3L8RA 2WP9A 3RYCE 3ZCIA 3CMLA 3AE5A 3FBLA 5AQVB 4DMVA 4ANJA 2Q9QC 2K3WA 3GMIA 3ZYMA 1IBKT 3CKDA 3LFMA 5ABEA 3ZMSB 1D0XA 4QHOA 2LEHA 2YU2A 4IL9A 4HFBA 3AA1B 1O3XA 3LJCA 3KV6A 1HS7A 4IE5A 3FXEB 2CHNA 2CXLA 4X1KE 2XUEA 3ZN1B 3H3MA 4ILCA 3RIAA 4OX9T 5KX5E 3AEDA 2VQFT 3AXJB 3RHWA 2QA7A 1VRBA 2W4XA 3RRWA 2EHOC 4QKNA 5FY7A 4CN4A 5FXXA 4M1PA 4C90A 5JR9C 3A8YC 4YY3T 3QK6A 4I0UA 4NPPA 5F5WA 3ONJA 3AE3A 3NRYA 4FJOA 3LK42 2IW5B 2LKHA 3G06A 5ABGA 1V9DA 2D0TA 2MBGA 3ZT7A 3K3QC 1XDPA 3RYIE 3ZMUB 4DBRA 2WY2A 4O4JE 5FVKA 1YXRA 4HTEA 4ZS2A 2ODVA 2LRLA 3CX6B 2M6IA 2WDQA 3LBXA 5JDFA 2CLYC 1I94T 3EAMA 3PUQA 5DABA 2YDQA 4EZ4A 1IBMT 1HNWT 1FIOA 3ZC1A 3SFDA 3UU5A 1WCRA 3P4QA 4HFVA 4HFCA 2FBWA 3RQWA 5JR9A 5IHYA 2DI4A 4QXBB 1D0YA 2WDVA 3UQ4A 3O1HA 1KEYA 2WZHA 1FEWA 2YN6A 3DTOA 4KHZF 4X62T 2XAFB 4JI5T 2E9XC 3QOFA 3KDSE 4IDPA 4BJMA 3O9XA 3RLFF 2BDEA 1L0VA 5EK2A 4P1NA 4DO0A 4DUZT 3GWHA 3UUBA 5AQJB 2E5LT 2N1GA 1X9BA 3BK9A 2WBLA 1WFDA 3N9LA 4QXHB 3RF1A 2PTFA 3AE9A 3AEEA 3P4RA 3ZSSA 3M65A 1BR2A 1FMWA 2VL8A 2ES0A 2NW9A 4AI6A 3EUHA 1YD8G 2C5JA 2ZM2A 1M7KA 4MFRA 4IE7A 5H6QB 5AQHB 1LRZA 4DV4T 1IJ6A 1ZHCA 2UUAT 5AQFB 2KLQA 3KV9A 4X1IE 2XY8B 3P4PA 3AEAA 4HFDA 2VVNA 3AA7B 4HN9A 4YHJA 4JEHB 4DV3T 3T1HT 4QH1A 2C5KT 3E22E 3BQLA 3ONLC 4DR1T 3LG7A 3I9WA 2FUPA 5HEHA 5L2LA 1UX5A 4ZEYA 4E7SA 5AQLB 1B7TA 3CQGB 5LJMA 4DR5T 2ACXA 3JC6C 2JQKA 3FHNA 4AKRB 3BQIA 4ZOLE 4IT4A 3LK2B 2L8KA 2L3LA 2XSBA 3AA0B 2UU9T 3PE0A 3UULA 3CWZB 2BZBA 4PK4A 4NXNT 3ZEFB 1MNEA 1NENA 4HGAA 4LF7T 5ABHA 3RIUC 1WYBA 4DMWA 1OEDA 1XMOT 1N32T 4K0UA 2VASA 2X51A 3AAEB 1HFAA 3AE4A 4QH4A 5HYAA 5JR9B 5LNKA 2ZM6T 2HPLA 1KNZA 4IIJE 3HKCE 5JDMA 4H9SE 3AAAB 4B3MT 2W67A 4KUMB 4L0RA 5LMNT 1YQ4A 3X1DA 4C91A 2XJ7A 3LSVA 4I4TE 1G73A 4TX5A 2CA5A 1QLBA 5FY1A 4H9PC 5IYZE 4JYAT 3C4ZA 3AAIA 3TLSA 1JNRA 1MMNA 2J47A 3QB5K 2WWUA 2JMHA 2LHNA 4PJLA 2NOXA 4IDOA 4AISA 5LGTB 1NAFA 2NP9A 3A5XA 4IE0A 4O4IE 4Z8XA 1XNQT 2X67A 3RKOA 1HTJF 5LBQB 3NWIA 3NVOA 3PU3A 2Q9QD 5JDGA 2LSYA 5L47A 2OA5A 4WBOA 3SOLA 2H7OA 1H7CA 2XPKA 2BS4A 3UUXB 1NEKA 5FY0A 3ZMTB 1WR0A 2X9XA 3TLUA 2K9AA 3FZFB 2KXPB 3IBPA 3WI3A 5BMVE 4UV9B 3J7Yq 4X1YE 4DUYT 4LFBT 2H88A 2LE8A 3J9X1 4GOUA 2LSJA 2ODUA 3ZLIA 4PAGA 3UFGA 4I50E 4P09A 2KZ7B 5H6RB 3AVSA 3EVYA 2QGSA 3PUZF 4V1Av 3RPUA 3KBTA 3CK6A 4JEUB 5AQNB 4IE6A 1T98A 3CX7B 4IDQA 2HPJA 1KF6A 3H37A 3Q5XA 4HWDA 2LSKA 4U72A 5E0OA 5FXWA 3RYHE 1UCUA 4JLEA 4LFAT 2YEVC 2EHOA 2UXNB 3QNUA 3KINB 3PDYA 4NIQA 4TZ4C 4PJJA 4L9IA 3UU4A 5ABFB 2JMKA 5LCYA 1XWMA 4GKKT 4UVBB 2CBIA 2E2AA 2JQQA 5LBMA 5LHGB 1VCSA 3M3ZB 3Q9DA 2LHRA 3EDVA 2JQHA 1UUSA 3KVAA 3RC3A 4LFCT 4TN7B 2H3RA 4EOZB 3VR8A 3H3AA 1W0AA 2DNXA 2V8SV 1MMDA 2XZEA 5ADXL 3PUVF 3FXDB 3SS1A 4U3CA 4MLKA 2MPKA 3O4XE 2ZLYA 4HEAA 4NXMT 3B5MA 2D9DA 1MMAA 1U5PA 4OFZA 4EYUA 5EK3A 1IAPA 1YKHB 2IDOB 2D5UA 3PURA 4UVCB 2CRBA 3B57A 5AQRB 5J1GA 4EXTA 4QX7B 3IHRA 4JI6T 1XZYA 2CCQA 2UXCT 2B76A 2K5BB 2WCAA 2MTQA 3OKQA 3RX6A 4B6XA 2KMFA 5LHHB 4JI7T 1DU2A 3ZYKA 3K1SA 3AE7A 1Y64B 4KI0F 1ZOYA 5BR8T 1N36T 3Q5DA 3K3OA 4CZZB 2A3DA 3P50A 2B1EA 2CHOA 2V7IA 3N9PA 2JPFA 4PJMA 5AQPB 3ZYLA 3HI2A 3EABA 3F31A 5DJQC 1N34T 3OJAA 1UK5A 3T8OA 2VL0A 1VCTA 2BBHA 2WWVA 4ZXLA 3MACA 2CWOA 2MOZA 3ETUA 4QX8B 4X20E 1YKEB 2NW8A 4GK5E 4OYKA 2JJ9A 3HL6A 1KNPA 2YK0A 5HWYA 4H9QC 1J1JA 2WU5A 1CHUA 3HKDE 4WW0A 4HFHA 1US7B 3AEBA 3UFEA 1KNRA 5AQMB 4UELA 5L3CB 2OLTA 5L3EB 4ILUA 3VKHA 5FL0A 2E9XA 4DV0T 2PFVA 2YDSA 2OV9A 2CBJA 2BG9E 2QVAA 2I6HA 3CQCB 4OHFA 5AQQB 4DIDB 4EV6A 5CA1E 4P0AA 2XQ9A 4LF6T 5JDNA 1OEDC 4CXWA 4X66T 1WLXA 5A1LA 1OWAA 2BG9A 4AXPA 2Y48B 1EZ3A 4U7YA 3EHZA 4WZXA 2VB6A 4H9NC 3TLVA 3UT5E 5L3GB 3VKGA 2XAQB 4YTMA 3S4UA 3HA4A 1D1AA 3MXZA 3UUMA 3BQKA 3OYXA 4UF0A 4LF9T 5JREA 4CI1B 2W62A 4PNIA 1D1CA 4GKJT 5LG3A 5FNVE 2X66A 4ZI2D 2X0YA 2WAUA 4PK5A 4H9OC 2K24A 4U2ZA 4IREA 3PUXF 4HKAA 4HWIB 4CI2B 5LMUT 3KV4A 1R8IA 3HKBE 4EB6E 3T1YT 4YTNA 3FZHB 4TNWA 5HEUA 4ZHQE 3HKEE 3OPCA 4IDZA 4AQFA 3FZKB 4BJNA 5LHIB 1D0ZA 4YHHT 4U31A 3P8CD 2JIWA 5JQGE 1XDOA 2BKNA 5AQTB 5HCJA 5CGMA 4AKIA 5AQSB 3JAEA 4ERRA 4EGWA 2AE9A 2DLRA 2I59A 2I0MA 2LKGA 2NW7A 3C4WA 1OEDE 3ZKRA 3PTRB 2BVLA 5J2TE 2HH7A 5AQGB 5C2TA 2E9XD 2X68A 5LG4A 3ZC0A 3TLTA 1KFYA 3EDUA 4U33A 3JCFA 2NR4A 2KT9A 2X0HA 3C50A 4ZI3C 4A56A 5FMNA 4PK6A 3AA6B 3MZKB 1AJ3A 5HAXA 5CFBA 4U2YA 1KK7A 1UURA 2IUBA 3F2EA 4ILAA 2BKOA 4PW8A 4XZCA 2W2UA 5ETWA 2P9BA 4JI4T 3GN5A 5M4YA 5LB7B 2A2FX 1Y01A 1HF8A 4H63V 1G8XA 2VKOA 4H9RC 2PG8A 5L3BB 3OYZA 4TWHA 1BR0A 2BVMA 4TWDA 4YJ3E 3CIRA 3NZQA 5AQIB 4ZZCA 2YOEA 5FYMA 5J2UE 2VKJA 2W66A 3UU3A 4DR3T 2DWKA 2N2NA 4P0BA 2Y8DA 5AFUL 3A7MA 3N2OA 3OTOT 4JI0T 4DV1T 1HG2A 3GA8A 4KMCA 1QUUA 3ZMVB 3ETVA 5LGNB 2VVSA 2IHR1 5HCMA 1MIWA 1XNRT 1D1BA 3MKDA 2V7KA 4IL4A 1W09A 3CX8B 3E0ZA 3UTKA 5KMGP 5LYJE 3C98B 3ZCJA 4EYYR 4JI8T 2HN2A 1SUMB 1J5ET 2WM9A 4ZZBA 1E1HB 5C8YE 2JQ9A 1T7SA 4CXXA 3VRAA 1GQEA 3AE1A 3KFWX 1VOMA 2XSAA 1SA0E 3FZMB 2XM2A 3QUJA 2LM9A 3PU8A 3P4WA 3NKZA 4UV8B 5AQUB 2X0LB 1W9RA 2G0UA 5KXJA 2K48A 2NWBA 2XM1A 2YINA 3K3NA 1J5WA 3LK3B 2YDRA 4PJNA 3VU7H 5IUXA 4DV2T 5C3JA 3ANWB 4EIWA 2Q9QA 4H63H 4Z90A 4MHCA 3VHLA 2UXDT 4KBMB 4ZI2C 2FJAA 4OYJA 2XQ8A 4KP3C 4A5XA 2J1DG 3DP7A 3ZT5A 2VKHA 3AE6A 3NZPA 4ILBA 5L4HA 4K0KT 2W63A 3QB5A 5FL1A 2PJQA 1MIYA 4GK0E 1QSDA 3N5LA 4DBQA 4IE4A 2Z6EA 1XMQT 4O2BE 1Z0PA 4MBQA 2ZM8A 3ABVA 5HEGA 4B3RT 2KSRA 4XBFB 4WNKA 1HX1B 3PJAJ 3PUWF 4DVDA 4HWFA 4ISTA 2LT3A 5LJNA 3ZN0B 2X9WA 2HN1A 4U7IA
chains in the Genus database with same CATH topology
4YJ2E 4DNDA 3PUGA 2W0GA 2WMNA 2C0SA 3KVBA 3KV5A 2IC6A 3C64A 2PBIA 3P7IA 5HWXA 4ZS3A 2RA1A 3ONXA 2XHEB 4QXCB 1MMGA 5JRCA 4UVAB 4G63A 2V7LA 2LSIA 2V7JA 3F57A 3MJXA 4YLHA 3OBVE 2Q9QB 5L3FB 3I1AA 1YW0A 2GK9A 2LJLA 2IC9A 2V1DB 4I43B 2E8IA 2CLYB 5CB4E 5DQWA 3CPZA 5LOVE 2H7VC 3I0OA 4I55E 4AKGA 3L3PA 1MNDA 1HCIA 3LBXB 2XQYA 4GIWA 2XAJB 2CXFA 2D2SA 2EHOB 4TUYE 3ZMZB 2E9XB 3W15B 5GONE 1ZV4X 3C4XA 5L3DB 5HXCA 3PUAA 4JUYA 2YU1A 2DCFA 4O4HE 4OK0A 3R84B 3SWHA 2SPCA 3AVRA 4UEMA 3C51A 2LSGA 4U74A 2C5IT 5DQVA 3FB2A 2V26A 3L09A 5FP3A 5JDLA 3TKLB 4N78D 1X79A 3RH3A 4EZHA 3JC6D 2Y6XA 3K8PC 1WR6A 4EAHA 5HXSA 2ZM0A 5JH7E 4ZI7E 5FXVA 2WMOA 2CWYA 4O4LE 3MK7C 4IGUA 2CEAA 4GYRA 3IF8B 3FBZA 3N2GE 3NRXA 2VK9A 3RC8A 3SRZA 5HXEA 3Q5WA 3V5UA 5JDQA 2VWAA 2UXXB 1ZEEA 4O2AE 3U78A 4F6RC 5TAOA 2ZMAA 5EK4A 3ZJ1A 1HX8A 4CQIA 1NWMX 3CQXC 2NTYA 3NBXX 1FMVA 2RP4A 3RYFE 3N9NA 2CE7A 4CI3B 2D0UA 5JRCB 1BR1A 3ZJ2A 2LOPA 4TV9E 4J2CA 2CMRA 2KWHA 3ESLA 1UX4A 5LGUB 5HXHA 2A72A 3UUNA 3RRCA 3Q2MA 4AKLA 2X9HA 2XTLA 4XAXB 4UF0B 1HG5A 4IHJE 4AQFC 4YFSA 5EZYE 4GYSA 5KDMC 1OXZA 4BA9A 3WAJA 2KINB 4BAYB 1WRDA 3N9OA 4NUUA 2DHRA 2IAKA 3PUSA 2EHOD 1IZNB 1S35A 2DWGA 3B13A 1LKXA 4PFPA 5J2TE 2KNDA 4L5GA 4QWNB 4CXYA 2XAGB 3N2KE 3N9QA 4AQGA 1CUNA 3D0TA 3DJBA 5LP6E 1S94A 2L9QA 2W00A 5F8PA 3R6NA 5LXTE 4TV8E 4MALA 2N9DA 4ASKA 3QC9A 4NUVA 5HXRA 3WAKA 2XAHB 4FI5A 4E7ZA 2M67A 4AKHA 1LVFA 4G2AA 1WYCA 3O1JA 2W61A 3ANWA 3MA9A 3IEEA 3HR0A 4ADZA 4UXNB 2LOSA 3E08A 3KBUA 3AB3B 1U4QA 2X9YA 4PFOA 2JRKA 3I0QA 4ISSA 1IJ5A 3ZPOA 2V7MA 3CVRA 4ZI3D 2VKDA 3U3IA 2WSSV 5JDHA 3N9MA 1BR4A 2CXDA 3V5SA 2MYSA 2CM0A 2XASB 2KWIB 1MIVA 2NTXA 3O1IA 1SHZC 4CI1B 3I9YA 3GN5B 4HE8A 5JVDE 4WBNE 5CA0E 1LVKA 5LA6E 1ZKEA 4O8SA 4UIGA 5FXZA 3ZCIA 3CMLA 4DMVA 3FBLA 4ANJA 2Q9QC 3GMIA 3ZYMA 3CKDA 3LFMA 3ZMSB 1D0XA 4QHOA 2LEHA 2YU2A 3AA1B 1O3XA 3LJCA 3KV6A 1HS7A 4IE5A 3FXEB 3ZN1B 2CXLA 4X1KE 2XUEA 5KX5E 2QA7A 1VRBA 3RRWA 2EHOC 4QKNA 5FY7A 5FXXA 4M1PA 4C90A 5JR9C 3QK6A 3NRYA 4FJOA 3LK42 2IW5B 2MBGA 1V9DA 2D0TA 3K3QC 3RYIE 3ZMUB 4DBRA 4O4JE 4HTEA 4ZS2A 2ODVA 3CX6B 5JDFA 3LBXA 2CLYC 3PUQA 5DABA 4EZ4A 1FIOA 3ZC1A 4HFVA 5JR9A 5IHYA 2DI4A 4QXBB 1D0YA 3O1HA 1FEWA 3DTOA 3O9XA 2XAFB 2E9XC 3KDSE 4BJMA 2BDEA 5EK2A 4DO0A 3GWHA 2N1GA 3BK9A 2WBLA 4QXHB 3N9LA 3M65A 1BR2A 1FMWA 2VL8A 2ES0A 2NW9A 3EUHA 1YD8G 2C5JA 2ZM2A 4MFRA 5H6QB 4IE7A 1LRZA 1IJ6A 1ZHCA 2KLQA 3KV9A 4X1IE 4YHJA 4HN9A 5F3JA 3AA7B 4JEHB 2C5KT 3E22E 3BQLA 3LG7A 3I9WA 5L2LA 1UX5A 4E7SA 1B7TA 3CQGB 5LJMA 2ACXA 3JC6C 3FHNA 4AKRB 3BQIA 4ZOLE 3LK2B 2L8KA 2L3LA 3AA0B 3PE0A 3UULA 3CWZB 2BZBA 4PK4A 3ZEFB 1MNEA 4HGAA 1WYBA 4DMWA 4K0UA 2VASA 2X51A 3AAEB 1HFAA 5HYAA 5LNKA 5JR9B 1KNZA 2HPLA 4IIJE 3HKCE 5JDMA 4H9SE 3AAAB 4KUMB 4L0RA 4C91A 4I4TE 1G73A 4TX5A 2CA5A 5FY1A 5IYZE 4H9PC 3C4ZA 3AAIA 1MMNA 2WWUA 2JMHA 2LHNA 4PJLA 2NOXA 5LGTB 5LYJE 1NAFA 2NP9A 3A5XA 4IE0A 4O4IE 4Z8XA 2X67A 3RKOA 1HTJF 5LBQB 3PU3A 5JDGA 2Q9QD 2LSYA 2OA5A 4WBOA 3SOLA 2H7OA 1H7CA 3UUXB 3ZMTB 5FY0A 2X9XA 2K9AA 2KXPB 3IBPA 3WI3A 5BMVE 4UV9B 3J7Yq 4X1YE 2LE8A 3J9X1 4GOUA 2LSJA 2ODUA 3ZLIA 4PAGA 4I50E 4P09A 2KZ7B 5H6RB 3AVSA 3EVYA 2QGSA 3RPUA 4V1Av 3KBTA 4JEUB 4IE6A 1T98A 3CX7B 2HPJA 3H37A 3RYHE 3Q5XA 5FXWA 2LSKA 4U72A 5E0OA 1UCUA 4JLEA 2YEVC 2EHOA 2UXNB 3KINB 3PDYA 4TZ4C 4PJJA 4L9IA 2JMKA 5LCYA 4UVBB 2JQQA 5LHGB 5LBMA 3Q9DA 2LHRA 3EDVA 3RC3A 4TN7B 2H3RA 4EOZB 3H3AA 2DNXA 1MMDA 5ADXL 3FXDB 3SS1A 4MLKA 3O4XE 2ZLYA 4HEAA 1MMAA 1U5PA 4OFZA 4EYUA 5EK3A 1YKHB 1IAPA 4UVCB 2D5UA 3PURA 5J1GA 3B57A 3UFEA 4EXTA 4QX7B 3IHRA 2CCQA 2K5BB 2MTQA 3OKQA 3RX6A 4B6XA 2KMFA 5LHHB 3ZYKA 1Y64B 3K3OA 4CZZB 2A3DA 2B1EA 2V7IA 4PJMA 3N9PA 2JPFA 3ZYLA 3HI2A 3F31A 5DJQC 3OJAA 3T8OA 3MACA 2CWOA 2MOZA 3ETUA 4QX8B 4X20E 1YKEB 2NW8A 4GK5E 4OYKA 2JJ9A 3HL6A 2YK0A 5HWYA 4H9QC 4WW0A 3HKDE 1US7B 5L3CB 4UELA 5L3EB 4ILUA 3VKHA 2E9XA 2PFVA 4OHFA 3CQCB 4AI6A 4P0AA 5CA1E 5JDNA 4CXWA 1WLXA 5A1LA 1OWAA 4AXPA 2Y48B 1EZ3A 3UT5E 2VB6A 4H9NC 5L3GB 3VKGA 2XAQB 3S4UA 3HA4A 1D1AA 3MXZA 3UUMA 3BQKA 3OYXA 4UF0A 5JREA 2W62A 4PNIA 1D1CA 5FNVE 2X66A 4ZI2D 2WAUA 4PK5A 4H9OC 2K24A 4CI2B 4HKAA 3KV4A 4EB6E 3HKBE 4ZHQE 3HKEE 5LHIB 4IDZA 4AQFA 4BJNA 1D0ZA 3P8CD 5JQGE 4AKIA 4ERRA 2DLRA 2I59A 2NW7A 3C4WA 3PTRB 2BVLA 2HH7A 2E9XD 2X68A 5LG4A 3ZC0A 3EDUA 3C50A 2KT9A 4A56A 4ZI3C 5FMNA 4PK6A 3AA6B 3MZKB 1AJ3A 5HAXA 1KK7A 3RYCE 3F2EA 4XZCA 4PW8A 5ETWA 2P9BA 3GN5A 5M4YA 2A2FX 1HF8A 4H63V 1G8XA 2VKOA 4H9RC 2PG8A 5L3BB 3OYZA 1BR0A 2BVMA 4YJ3E 3NZQA 5J2UE 5FYMA 2VKJA 2DWKA 2N2NA 4P0BA 2Y8DA 5AFUL 3N2OA 1HG2A 3GA8A 4KMCA 1QUUA 3ZMVB 3ETVA 5LGNB 1MIWA 1D1BA 3MKDA 2V7KA 3CX8B 3E0ZA 3UTKA 5KMGP 3C98B 3ZCJA 4EYYR 2WM9A 1E1HB 5C8YE 4CXXA 3KFWX 1VOMA 1SA0E 3QUJA 2LM9A 3PU8A 4UV8B 2X0LB 2G0UA 2K48A 2NWBA 2YINA 3K3NA 3LK3B 3VU7H 4PJNA 3ANWB 4EIWA 2Q9QA 4H63H 4MHCA 3VHLA 4KBMB 4ZI2C 4OYJA 4KP3C 2J1DG 3DP7A 2VKHA 3NZPA 2W63A 2PJQA 1MIYA 4GK0E 1QSDA 3N5LA 4DBQA 4IE4A 2Z6EA 4O2BE 1Z0PA 4MBQA 2ZM8A 4XBFB 4WNKA 4DVDA 4ISTA 2LT3A 5LJNA 3ZN0B 2X9WA 3KVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX8 B;  4QX7 B;  4QXC B;  4QWN B;  4QXB B;  4QXH B;  4TN7 B; 
#chains in the Genus database with same CATH topology
 4YJ2 E;  4DND A;  2UUC T;  3L39 A;  3AE8 A;  4JI2 T;  3PUG A;  2W0G A;  2WMN A;  2C0S A;  3KVB A;  3KV5 A;  2FJD A;  2IC6 A;  2PBI A;  3C64 A;  3P7I A;  5HWX A;  4ZS3 A;  3SFE A;  3FZL B;  4DV7 T;  2RA1 A;  3ONX A;  4WYV A;  5AQK B;  2XHE B;  3RIF A;  4CN6 A;  3VRB A;  4YSX A;  2IIU A;  4QXC B;  5JTG A;  1MMG A;  5JRC A;  2XQ6 A;  4UVA B;  1HNX T;  4G63 A;  2V7L A;  5CJ5 A;  2LSI A;  2V7J A;  3F57 A;  3MJX A;  4X64 T;  2IML A;  2J62 A;  3OBV E;  4YLH A;  2Q9Q B;  5L3F B;  4AQY T;  3I1A A;  2CPT A;  1YW0 A;  1E7P A;  2GK9 A;  2LJL A;  2IC9 A;  2MAW A;  4DR2 T;  2V1D B;  4I43 B;  2E8I A;  2CLY B;  2AXD S;  5DQW A;  5CB4 E;  1T72 A;  3CPZ A;  5LOV E;  4JI3 T;  2H7V C;  3I0O A;  2BG9 C;  4I55 E;  4AKG A;  4LML A;  3L3P A;  1MND A;  1HCI A;  2WU2 A;  3LBX B;  4HWC A;  5HEJ A;  1OED B;  2XQY A;  4GIW A;  1Z8U A;  2XAJ B;  2CXF A;  2D2S A;  2EHO B;  4TUY E;  3ZMZ B;  3ZT6 A;  2E9X B;  3AEC A;  5GON E;  3W15 B;  1ZV4 X;  3C4X A;  5L3D B;  2QRX A;  2WZI A;  2F4V T;  1JNZ A;  5HXC A;  3PUA A;  4JUY A;  2YU1 A;  2DCF A;  4O4H E;  4OK0 A;  4TWF A;  3R84 B;  2SPC A;  3SWH A;  4HFE A;  4COF A;  2BG9 B;  3AVR A;  4UEM A;  3RGL A;  5F3J A;  4A97 A;  3C51 A;  2LSG A;  4U74 A;  2C5I T;  5DQV A;  4KHP T;  3FB2 A;  2V26 A;  3L09 A;  4HFI A;  5FP3 A;  3ZST A;  3TKL B;  5JDL A;  4N78 D;  1X79 A;  3RH3 A;  1W0B A;  4EZH A;  3JC6 D;  2BBJ A;  3JAF A;  2Y6X A;  3K8P C;  1WR6 A;  4EAH A;  5HXS A;  2ZM0 A;  5JH7 E;  4ZI7 E;  4HWH A;  2RPA A;  2VQE T;  5FXV A;  2WMO A;  2CWY A;  4O4L E;  4X5T A;  3MK7 C;  4IGU A;  4UR9 A;  3PV0 F;  2CEA A;  2M6B A;  4GYR A;  5L4E A;  4JV5 T;  3IF8 B;  3FBZ A;  2WQY A;  3N2G E;  3NRX A;  2VK9 A;  2WB5 A;  3RC8 A;  3SRZ A;  4CN1 A;  4YTP A;  5HXE A;  3Q5W A;  1UGO A;  3V5U A;  5JDQ A;  3OVU A;  2VWA A;  1SE7 A;  2UXX B;  3UU8 A;  2UXB T;  1ZEE A;  4O2A E;  3U78 A;  3VR9 A;  4F6R C;  5TAO A;  3RQU A;  4EED A;  2ZMA A;  5EK4 A;  3ZJ1 A;  3P4S A;  1HX8 A;  2V6Y A;  4CQI A;  1NWM X;  3CQX C;  2NTY A;  3TLW A;  3NBX X;  1FMV A;  3RIU A;  2V6Y B;  2BKP A;  2XQ7 A;  2RP4 A;  4TNV A;  3N9N A;  2CE7 A;  3RYF E;  2D0U A;  4CI3 B;  1BR1 A;  5AQO B;  3ZJ2 A;  5JRC B;  2LOP A;  4TV9 E;  4J2C A;  5IWA T;  2CMR A;  2XQ5 A;  2KWH A;  3ESL A;  1UX4 A;  3IA3 A;  5LGU B;  5HXH A;  2A72 A;  3UUN A;  1ZP0 A;  4YSY A;  2LM2 A;  2WDR A;  3Q2M A;  2QYW A;  3RRC A;  4AKL A;  5ABF A;  2X9H A;  2XTL A;  4XAX B;  2VUR A;  2LLY A;  4UF0 B;  1HG5 A;  4IHJ E;  4AQF C;  4YXD A;  4DV5 T;  2ACZ A;  4YFS A;  1FJG T;  5EZY E;  2E5V A;  4GYS A;  5KDM C;  1OXZ A;  4BA9 A;  3WAJ A;  4B3S T;  4JBW F;  2H89 A;  2KIN B;  4BAY B;  1WRD A;  3PUY F;  3N9O A;  4NUU A;  2DHR A;  2IAK A;  4X65 T;  3PUS A;  2EHO D;  4DV6 T;  1IZN B;  2HHH T;  1S35 A;  4DR6 T;  2DWG A;  3B13 A;  1LKX A;  4PFP A;  4KX6 A;  1M62 A;  2BS3 A;  2KND A;  2LRK A;  4L5G A;  4Q25 A;  2XAG B;  3N2K E;  4QWN B;  1T8B A;  3N9Q A;  4CXY A;  4AQG A;  2A9U A;  1N33 T;  3UU6 A;  1CUN A;  1YQ3 A;  3D0T A;  3DJB A;  5LP6 E;  1HNZ T;  1S94 A;  2L9Q A;  2V5C A;  2W00 A;  4LF8 T;  5F8P A;  4AIU A;  5FVL A;  3R6N A;  5LXT E;  4TV8 E;  1I6Z A;  4MAL A;  2N9D A;  2XQ3 A;  3AE2 A;  3QC9 A;  4NUV A;  5HXR A;  3WAK A;  4ASK A;  4B3T T;  2XAH B;  4DR4 T;  4FI5 A;  4E7Z A;  2M67 A;  4DR7 T;  4AKH A;  1LVF A;  4G2A A;  1WYC A;  3O1J A;  3RKG A;  2W61 A;  3ANW A;  3MA9 A;  3IEE A;  3HR0 A;  3LDQ B;  5J0Z A;  3RI5 A;  4ADZ A;  1HR0 T;  4UXN B;  2LOS A;  3E08 A;  3KBU A;  3EI0 A;  3AB3 B;  1U4Q A;  4LF5 T;  2X9Y A;  4PFO A;  2JRK A;  2YKS A;  4QH5 A;  5HEO A;  3UQ7 A;  3I0Q A;  4ISS A;  2BS2 A;  3Q5E A;  2WS3 A;  1IJ5 A;  2XQ4 A;  2DL1 A;  3ZPO A;  2V7M A;  1IBL T;  3AEG A;  3CVR A;  4EEB A;  2FJE A;  4ZI3 D;  2VKD A;  3AEF A;  2UUB T;  4LF4 T;  4LMK A;  2FJB A;  3U3I A;  2WSS V;  2XQA A;  3JAD A;  5FKY A;  4YT0 A;  5JDH A;  1E2A A;  1BR4 A;  3N9M A;  4LMJ A;  4JI1 T;  2V6X A;  2CXD A;  3V5S A;  2MYS A;  2V5D A;  2CM0 A;  2XAS B;  2KWI B;  4A98 A;  1MIV A;  2NTX A;  3O1I A;  1SHZ C;  3PJA A;  4Z91 A;  3I9Y A;  4F8H A;  3GN5 B;  4HE8 A;  5JVD E;  4WBN E;  4YSZ A;  4IDN A;  3AXJ A;  1LVK A;  5LA6 E;  1ZKE A;  4O8S A;  2R6G F;  5CA0 E;  4UIG A;  2J4G A;  5FXZ A;  3L8R A;  2WP9 A;  3RYC E;  3ZCI A;  3CML A;  3AE5 A;  3FBL A;  5AQV B;  4DMV A;  4ANJ A;  2Q9Q C;  2K3W A;  3GMI A;  3ZYM A;  1IBK T;  3CKD A;  3LFM A;  5ABE A;  3ZMS B;  1D0X A;  4QHO A;  2LEH A;  2YU2 A;  4IL9 A;  4HFB A;  3AA1 B;  1O3X A;  3LJC A;  3KV6 A;  1HS7 A;  4IE5 A;  3FXE B;  2CHN A;  2CXL A;  4X1K E;  2XUE A;  3ZN1 B;  3H3M A;  4ILC A;  3RIA A;  4OX9 T;  5KX5 E;  3AED A;  2VQF T;  3AXJ B;  3RHW A;  2QA7 A;  1VRB A;  2W4X A;  3RRW A;  2EHO C;  4QKN A;  5FY7 A;  4CN4 A;  5FXX A;  4M1P A;  4C90 A;  5JR9 C;  3A8Y C;  4YY3 T;  3QK6 A;  4I0U A;  4NPP A;  5F5W A;  3ONJ A;  3AE3 A;  3NRY A;  4FJO A;  3LK4 2;  2IW5 B;  2LKH A;  3G06 A;  5ABG A;  1V9D A;  2D0T A;  2MBG A;  3ZT7 A;  3K3Q C;  1XDP A;  3RYI E;  3ZMU B;  4DBR A;  2WY2 A;  4O4J E;  5FVK A;  1YXR A;  4HTE A;  4ZS2 A;  2ODV A;  2LRL A;  3CX6 B;  2M6I A;  2WDQ A;  3LBX A;  5JDF A;  2CLY C;  1I94 T;  3EAM A;  3PUQ A;  5DAB A;  2YDQ A;  4EZ4 A;  1IBM T;  1HNW T;  1FIO A;  3ZC1 A;  3SFD A;  3UU5 A;  1WCR A;  3P4Q A;  4HFV A;  4HFC A;  2FBW A;  3RQW A;  5JR9 A;  5IHY A;  2DI4 A;  4QXB B;  1D0Y A;  2WDV A;  3UQ4 A;  3O1H A;  1KEY A;  2WZH A;  1FEW A;  2YN6 A;  3DTO A;  4KHZ F;  4X62 T;  2XAF B;  4JI5 T;  2E9X C;  3QOF A;  3KDS E;  4IDP A;  4BJM A;  3O9X A;  3RLF F;  2BDE A;  1L0V A;  5EK2 A;  4P1N A;  4DO0 A;  4DUZ T;  3GWH A;  3UUB A;  5AQJ B;  2E5L T;  2N1G A;  1X9B A;  3BK9 A;  2WBL A;  1WFD A;  3N9L A;  4QXH B;  3RF1 A;  2PTF A;  3AE9 A;  3AEE A;  3P4R A;  3ZSS A;  3M65 A;  1BR2 A;  1FMW A;  2VL8 A;  2ES0 A;  2NW9 A;  4AI6 A;  3EUH A;  1YD8 G;  2C5J A;  2ZM2 A;  1M7K A;  4MFR A;  4IE7 A;  5H6Q B;  5AQH B;  1LRZ A;  4DV4 T;  1IJ6 A;  1ZHC A;  2UUA T;  5AQF B;  2KLQ A;  3KV9 A;  4X1I E;  2XY8 B;  3P4P A;  3AEA A;  4HFD A;  2VVN A;  3AA7 B;  4HN9 A;  4YHJ A;  4JEH B;  4DV3 T;  3T1H T;  4QH1 A;  2C5K T;  3E22 E;  3BQL A;  3ONL C;  4DR1 T;  3LG7 A;  3I9W A;  2FUP A;  5HEH A;  5L2L A;  1UX5 A;  4ZEY A;  4E7S A;  5AQL B;  1B7T A;  3CQG B;  5LJM A;  4DR5 T;  2ACX A;  3JC6 C;  2JQK A;  3FHN A;  4AKR B;  3BQI A;  4ZOL E;  4IT4 A;  3LK2 B;  2L8K A;  2L3L A;  2XSB A;  3AA0 B;  2UU9 T;  3PE0 A;  3UUL A;  3CWZ B;  2BZB A;  4PK4 A;  4NXN T;  3ZEF B;  1MNE A;  1NEN A;  4HGA A;  4LF7 T;  5ABH A;  3RIU C;  1WYB A;  4DMW A;  1OED A;  1XMO T;  1N32 T;  4K0U A;  2VAS A;  2X51 A;  3AAE B;  1HFA A;  3AE4 A;  4QH4 A;  5HYA A;  5JR9 B;  5LNK A;  2ZM6 T;  2HPL A;  1KNZ A;  4IIJ E;  3HKC E;  5JDM A;  4H9S E;  3AAA B;  4B3M T;  2W67 A;  4KUM B;  4L0R A;  5LMN T;  1YQ4 A;  3X1D A;  4C91 A;  2XJ7 A;  3LSV A;  4I4T E;  1G73 A;  4TX5 A;  2CA5 A;  1QLB A;  5FY1 A;  4H9P C;  5IYZ E;  4JYA T;  3C4Z A;  3AAI A;  3TLS A;  1JNR A;  1MMN A;  2J47 A;  3QB5 K;  2WWU A;  2JMH A;  2LHN A;  4PJL A;  2NOX A;  4IDO A;  4AIS A;  5LGT B;  1NAF A;  2NP9 A;  3A5X A;  4IE0 A;  4O4I E;  4Z8X A;  1XNQ T;  2X67 A;  3RKO A;  1HTJ F;  5LBQ B;  3NWI A;  3NVO A;  3PU3 A;  2Q9Q D;  5JDG A;  2LSY A;  5L47 A;  2OA5 A;  4WBO A;  3SOL A;  2H7O A;  1H7C A;  2XPK A;  2BS4 A;  3UUX B;  1NEK A;  5FY0 A;  3ZMT B;  1WR0 A;  2X9X A;  3TLU A;  2K9A A;  3FZF B;  2KXP B;  3IBP A;  3WI3 A;  5BMV E;  4UV9 B;  3J7Y q;  4X1Y E;  4DUY T;  4LFB T;  2H88 A;  2LE8 A;  3J9X 1;  4GOU A;  2LSJ A;  2ODU A;  3ZLI A;  4PAG A;  3UFG A;  4I50 E;  4P09 A;  2KZ7 B;  5H6R B;  3AVS A;  3EVY A;  2QGS A;  3PUZ F;  4V1A v;  3RPU A;  3KBT A;  3CK6 A;  4JEU B;  5AQN B;  4IE6 A;  1T98 A;  3CX7 B;  4IDQ A;  2HPJ A;  1KF6 A;  3H37 A;  3Q5X A;  4HWD A;  2LSK A;  4U72 A;  5E0O A;  5FXW A;  3RYH E;  1UCU A;  4JLE A;  4LFA T;  2YEV C;  2EHO A;  2UXN B;  3QNU A;  3KIN B;  3PDY A;  4NIQ A;  4TZ4 C;  4PJJ A;  4L9I A;  3UU4 A;  5ABF B;  2JMK A;  5LCY A;  1XWM A;  4GKK T;  4UVB B;  2CBI A;  2E2A A;  2JQQ A;  5LBM A;  5LHG B;  1VCS A;  3M3Z B;  3Q9D A;  2LHR A;  3EDV A;  2JQH A;  1UUS A;  3KVA A;  3RC3 A;  4LFC T;  4TN7 B;  2H3R A;  4EOZ B;  3VR8 A;  3H3A A;  1W0A A;  2DNX A;  2V8S V;  1MMD A;  2XZE A;  5ADX L;  3PUV F;  3FXD B;  3SS1 A;  4U3C A;  4MLK A;  2MPK A;  3O4X E;  2ZLY A;  4HEA A;  4NXM T;  3B5M A;  2D9D A;  1MMA A;  1U5P A;  4OFZ A;  4EYU A;  5EK3 A;  1IAP A;  1YKH B;  2IDO B;  2D5U A;  3PUR A;  4UVC B;  2CRB A;  3B57 A;  5AQR B;  5J1G A;  4EXT A;  4QX7 B;  3IHR A;  4JI6 T;  1XZY A;  2CCQ A;  2UXC T;  2B76 A;  2K5B B;  2WCA A;  2MTQ A;  3OKQ A;  3RX6 A;  4B6X A;  2KMF A;  5LHH B;  4JI7 T;  1DU2 A;  3ZYK A;  3K1S A;  3AE7 A;  1Y64 B;  4KI0 F;  1ZOY A;  5BR8 T;  1N36 T;  3Q5D A;  3K3O A;  4CZZ B;  2A3D A;  3P50 A;  2B1E A;  2CHO A;  2V7I A;  3N9P A;  2JPF A;  4PJM A;  5AQP B;  3ZYL A;  3HI2 A;  3EAB A;  3F31 A;  5DJQ C;  1N34 T;  3OJA A;  1UK5 A;  3T8O A;  2VL0 A;  1VCT A;  2BBH A;  2WWV A;  4ZXL A;  3MAC A;  2CWO A;  2MOZ A;  3ETU A;  4QX8 B;  4X20 E;  1YKE B;  2NW8 A;  4GK5 E;  4OYK A;  2JJ9 A;  3HL6 A;  1KNP A;  2YK0 A;  5HWY A;  4H9Q C;  1J1J A;  2WU5 A;  1CHU A;  3HKD E;  4WW0 A;  4HFH A;  1US7 B;  3AEB A;  3UFE A;  1KNR A;  5AQM B;  4UEL A;  5L3C B;  2OLT A;  5L3E B;  4ILU A;  3VKH A;  5FL0 A;  2E9X A;  4DV0 T;  2PFV A;  2YDS A;  2OV9 A;  2CBJ A;  2BG9 E;  2QVA A;  2I6H A;  3CQC B;  4OHF A;  5AQQ B;  4DID B;  4EV6 A;  5CA1 E;  4P0A A;  2XQ9 A;  4LF6 T;  5JDN A;  1OED C;  4CXW A;  4X66 T;  1WLX A;  5A1L A;  1OWA A;  2BG9 A;  4AXP A;  2Y48 B;  1EZ3 A;  4U7Y A;  3EHZ A;  4WZX A;  2VB6 A;  4H9N C;  3TLV A;  3UT5 E;  5L3G B;  3VKG A;  2XAQ B;  4YTM A;  3S4U A;  3HA4 A;  1D1A A;  3MXZ A;  3UUM A;  3BQK A;  3OYX A;  4UF0 A;  4LF9 T;  5JRE A;  4CI1 B;  2W62 A;  4PNI A;  1D1C A;  4GKJ T;  5LG3 A;  5FNV E;  2X66 A;  4ZI2 D;  2X0Y A;  2WAU A;  4PK5 A;  4H9O C;  2K24 A;  4U2Z A;  4IRE A;  3PUX F;  4HKA A;  4HWI B;  4CI2 B;  5LMU T;  3KV4 A;  1R8I A;  3HKB E;  4EB6 E;  3T1Y T;  4YTN A;  3FZH B;  4TNW A;  5HEU A;  4ZHQ E;  3HKE E;  3OPC A;  4IDZ A;  4AQF A;  3FZK B;  4BJN A;  5LHI B;  1D0Z A;  4YHH T;  4U31 A;  3P8C D;  2JIW A;  5JQG E;  1XDO A;  2BKN A;  5AQT B;  5HCJ A;  5CGM A;  4AKI A;  5AQS B;  3JAE A;  4ERR A;  4EGW A;  2AE9 A;  2DLR A;  2I59 A;  2I0M A;  2LKG A;  2NW7 A;  3C4W A;  1OED E;  3ZKR A;  3PTR B;  2BVL A;  5J2T E;  2HH7 A;  5AQG B;  5C2T A;  2E9X D;  2X68 A;  5LG4 A;  3ZC0 A;  3TLT A;  1KFY A;  3EDU A;  4U33 A;  3JCF A;  2NR4 A;  2KT9 A;  2X0H A;  3C50 A;  4ZI3 C;  4A56 A;  5FMN A;  4PK6 A;  3AA6 B;  3MZK B;  1AJ3 A;  5HAX A;  5CFB A;  4U2Y A;  1KK7 A;  1UUR A;  2IUB A;  3F2E A;  4ILA A;  2BKO A;  4PW8 A;  4XZC A;  2W2U A;  5ETW A;  2P9B A;  4JI4 T;  3GN5 A;  5M4Y A;  5LB7 B;  2A2F X;  1Y01 A;  1HF8 A;  4H63 V;  1G8X A;  2VKO A;  4H9R C;  2PG8 A;  5L3B B;  3OYZ A;  4TWH A;  1BR0 A;  2BVM A;  4TWD A;  4YJ3 E;  3CIR A;  3NZQ A;  5AQI B;  4ZZC A;  2YOE A;  5FYM A;  5J2U E;  2VKJ A;  2W66 A;  3UU3 A;  4DR3 T;  2DWK A;  2N2N A;  4P0B A;  2Y8D A;  5AFU L;  3A7M A;  3N2O A;  3OTO T;  4JI0 T;  4DV1 T;  1HG2 A;  3GA8 A;  4KMC A;  1QUU A;  3ZMV B;  3ETV A;  5LGN B;  2VVS A;  2IHR 1;  5HCM A;  1MIW A;  1XNR T;  1D1B A;  3MKD A;  2V7K A;  4IL4 A;  1W09 A;  3CX8 B;  3E0Z A;  3UTK A;  5KMG P;  5LYJ E;  3C98 B;  3ZCJ A;  4EYY R;  4JI8 T;  2HN2 A;  1SUM B;  1J5E T;  2WM9 A;  4ZZB A;  1E1H B;  5C8Y E;  2JQ9 A;  1T7S A;  4CXX A;  3VRA A;  1GQE A;  3AE1 A;  3KFW X;  1VOM A;  2XSA A;  1SA0 E;  3FZM B;  2XM2 A;  3QUJ A;  2LM9 A;  3PU8 A;  3P4W A;  3NKZ A;  4UV8 B;  5AQU B;  2X0L B;  1W9R A;  2G0U A;  5KXJ A;  2K48 A;  2NWB A;  2XM1 A;  2YIN A;  3K3N A;  1J5W A;  3LK3 B;  2YDR A;  4PJN A;  3VU7 H;  5IUX A;  4DV2 T;  5C3J A;  3ANW B;  4EIW A;  2Q9Q A;  4H63 H;  4Z90 A;  4MHC A;  3VHL A;  2UXD T;  4KBM B;  4ZI2 C;  2FJA A;  4OYJ A;  2XQ8 A;  4KP3 C;  4A5X A;  2J1D G;  3DP7 A;  3ZT5 A;  2VKH A;  3AE6 A;  3NZP A;  4ILB A;  5L4H A;  4K0K T;  2W63 A;  3QB5 A;  5FL1 A;  2PJQ A;  1MIY A;  4GK0 E;  1QSD A;  3N5L A;  4DBQ A;  4IE4 A;  2Z6E A;  1XMQ T;  4O2B E;  1Z0P A;  4MBQ A;  2ZM8 A;  3ABV A;  5HEG A;  4B3R T;  2KSR A;  4XBF B;  4WNK A;  1HX1 B;  3PJA J;  3PUW F;  4DVD A;  4HWF A;  4IST A;  2LT3 A;  5LJN A;  3ZN0 B;  2X9W A;  2HN1 A;  4U7I A; 
#chains in the Genus database with same CATH homology
 4YJ2 E;  4DND A;  3PUG A;  2W0G A;  2WMN A;  2C0S A;  3KVB A;  3KV5 A;  2IC6 A;  3C64 A;  2PBI A;  3P7I A;  5HWX A;  4ZS3 A;  2RA1 A;  3ONX A;  2XHE B;  4QXC B;  1MMG A;  5JRC A;  4UVA B;  4G63 A;  2V7L A;  2LSI A;  2V7J A;  3F57 A;  3MJX A;  4YLH A;  3OBV E;  2Q9Q B;  5L3F B;  3I1A A;  1YW0 A;  2GK9 A;  2LJL A;  2IC9 A;  2V1D B;  4I43 B;  2E8I A;  2CLY B;  5CB4 E;  5DQW A;  3CPZ A;  5LOV E;  2H7V C;  3I0O A;  4I55 E;  4AKG A;  3L3P A;  1MND A;  1HCI A;  3LBX B;  2XQY A;  4GIW A;  2XAJ B;  2CXF A;  2D2S A;  2EHO B;  4TUY E;  3ZMZ B;  2E9X B;  3W15 B;  5GON E;  1ZV4 X;  3C4X A;  5L3D B;  5HXC A;  3PUA A;  4JUY A;  2YU1 A;  2DCF A;  4O4H E;  4OK0 A;  3R84 B;  3SWH A;  2SPC A;  3AVR A;  4UEM A;  3C51 A;  2LSG A;  4U74 A;  2C5I T;  5DQV A;  3FB2 A;  2V26 A;  3L09 A;  5FP3 A;  5JDL A;  3TKL B;  4N78 D;  1X79 A;  3RH3 A;  4EZH A;  3JC6 D;  2Y6X A;  3K8P C;  1WR6 A;  4EAH A;  5HXS A;  2ZM0 A;  5JH7 E;  4ZI7 E;  5FXV A;  2WMO A;  2CWY A;  4O4L E;  3MK7 C;  4IGU A;  2CEA A;  4GYR A;  3IF8 B;  3FBZ A;  3N2G E;  3NRX A;  2VK9 A;  3RC8 A;  3SRZ A;  5HXE A;  3Q5W A;  3V5U A;  5JDQ A;  2VWA A;  2UXX B;  1ZEE A;  4O2A E;  3U78 A;  4F6R C;  5TAO A;  2ZMA A;  5EK4 A;  3ZJ1 A;  1HX8 A;  4CQI A;  1NWM X;  3CQX C;  2NTY A;  3NBX X;  1FMV A;  2RP4 A;  3RYF E;  3N9N A;  2CE7 A;  4CI3 B;  2D0U A;  5JRC B;  1BR1 A;  3ZJ2 A;  2LOP A;  4TV9 E;  4J2C A;  2CMR A;  2KWH A;  3ESL A;  1UX4 A;  5LGU B;  5HXH A;  2A72 A;  3UUN A;  3RRC A;  3Q2M A;  4AKL A;  2X9H A;  2XTL A;  4XAX B;  4UF0 B;  1HG5 A;  4IHJ E;  4AQF C;  4YFS A;  5EZY E;  4GYS A;  5KDM C;  1OXZ A;  4BA9 A;  3WAJ A;  2KIN B;  4BAY B;  1WRD A;  3N9O A;  4NUU A;  2DHR A;  2IAK A;  3PUS A;  2EHO D;  1IZN B;  1S35 A;  2DWG A;  3B13 A;  1LKX A;  4PFP A;  5J2T E;  2KND A;  4L5G A;  4QWN B;  4CXY A;  2XAG B;  3N2K E;  3N9Q A;  4AQG A;  1CUN A;  3D0T A;  3DJB A;  5LP6 E;  1S94 A;  2L9Q A;  2W00 A;  5F8P A;  3R6N A;  5LXT E;  4TV8 E;  4MAL A;  2N9D A;  4ASK A;  3QC9 A;  4NUV A;  5HXR A;  3WAK A;  2XAH B;  4FI5 A;  4E7Z A;  2M67 A;  4AKH A;  1LVF A;  4G2A A;  1WYC A;  3O1J A;  2W61 A;  3ANW A;  3MA9 A;  3IEE A;  3HR0 A;  4ADZ A;  4UXN B;  2LOS A;  3E08 A;  3KBU A;  3AB3 B;  1U4Q A;  2X9Y A;  4PFO A;  2JRK A;  3I0Q A;  4ISS A;  1IJ5 A;  3ZPO A;  2V7M A;  3CVR A;  4ZI3 D;  2VKD A;  3U3I A;  2WSS V;  5JDH A;  3N9M A;  1BR4 A;  2CXD A;  3V5S A;  2MYS A;  2CM0 A;  2XAS B;  2KWI B;  1MIV A;  2NTX A;  3O1I A;  1SHZ C;  4CI1 B;  3I9Y A;  3GN5 B;  4HE8 A;  5JVD E;  4WBN E;  5CA0 E;  1LVK A;  5LA6 E;  1ZKE A;  4O8S A;  4UIG A;  5FXZ A;  3ZCI A;  3CML A;  4DMV A;  3FBL A;  4ANJ A;  2Q9Q C;  3GMI A;  3ZYM A;  3CKD A;  3LFM A;  3ZMS B;  1D0X A;  4QHO A;  2LEH A;  2YU2 A;  3AA1 B;  1O3X A;  3LJC A;  3KV6 A;  1HS7 A;  4IE5 A;  3FXE B;  3ZN1 B;  2CXL A;  4X1K E;  2XUE A;  5KX5 E;  2QA7 A;  1VRB A;  3RRW A;  2EHO C;  4QKN A;  5FY7 A;  5FXX A;  4M1P A;  4C90 A;  5JR9 C;  3QK6 A;  3NRY A;  4FJO A;  3LK4 2;  2IW5 B;  2MBG A;  1V9D A;  2D0T A;  3K3Q C;  3RYI E;  3ZMU B;  4DBR A;  4O4J E;  4HTE A;  4ZS2 A;  2ODV A;  3CX6 B;  5JDF A;  3LBX A;  2CLY C;  3PUQ A;  5DAB A;  4EZ4 A;  1FIO A;  3ZC1 A;  4HFV A;  5JR9 A;  5IHY A;  2DI4 A;  4QXB B;  1D0Y A;  3O1H A;  1FEW A;  3DTO A;  3O9X A;  2XAF B;  2E9X C;  3KDS E;  4BJM A;  2BDE A;  5EK2 A;  4DO0 A;  3GWH A;  2N1G A;  3BK9 A;  2WBL A;  4QXH B;  3N9L A;  3M65 A;  1BR2 A;  1FMW A;  2VL8 A;  2ES0 A;  2NW9 A;  3EUH A;  1YD8 G;  2C5J A;  2ZM2 A;  4MFR A;  5H6Q B;  4IE7 A;  1LRZ A;  1IJ6 A;  1ZHC A;  2KLQ A;  3KV9 A;  4X1I E;  4YHJ A;  4HN9 A;  5F3J A;  3AA7 B;  4JEH B;  2C5K T;  3E22 E;  3BQL A;  3LG7 A;  3I9W A;  5L2L A;  1UX5 A;  4E7S A;  1B7T A;  3CQG B;  5LJM A;  2ACX A;  3JC6 C;  3FHN A;  4AKR B;  3BQI A;  4ZOL E;  3LK2 B;  2L8K A;  2L3L A;  3AA0 B;  3PE0 A;  3UUL A;  3CWZ B;  2BZB A;  4PK4 A;  3ZEF B;  1MNE A;  4HGA A;  1WYB A;  4DMW A;  4K0U A;  2VAS A;  2X51 A;  3AAE B;  1HFA A;  5HYA A;  5LNK A;  5JR9 B;  1KNZ A;  2HPL A;  4IIJ E;  3HKC E;  5JDM A;  4H9S E;  3AAA B;  4KUM B;  4L0R A;  4C91 A;  4I4T E;  1G73 A;  4TX5 A;  2CA5 A;  5FY1 A;  5IYZ E;  4H9P C;  3C4Z A;  3AAI A;  1MMN A;  2WWU A;  2JMH A;  2LHN A;  4PJL A;  2NOX A;  5LGT B;  5LYJ E;  1NAF A;  2NP9 A;  3A5X A;  4IE0 A;  4O4I E;  4Z8X A;  2X67 A;  3RKO A;  1HTJ F;  5LBQ B;  3PU3 A;  5JDG A;  2Q9Q D;  2LSY A;  2OA5 A;  4WBO A;  3SOL A;  2H7O A;  1H7C A;  3UUX B;  3ZMT B;  5FY0 A;  2X9X A;  2K9A A;  2KXP B;  3IBP A;  3WI3 A;  5BMV E;  4UV9 B;  3J7Y q;  4X1Y E;  2LE8 A;  3J9X 1;  4GOU A;  2LSJ A;  2ODU A;  3ZLI A;  4PAG A;  4I50 E;  4P09 A;  2KZ7 B;  5H6R B;  3AVS A;  3EVY A;  2QGS A;  3RPU A;  4V1A v;  3KBT A;  4JEU B;  4IE6 A;  1T98 A;  3CX7 B;  2HPJ A;  3H37 A;  3RYH E;  3Q5X A;  5FXW A;  2LSK A;  4U72 A;  5E0O A;  1UCU A;  4JLE A;  2YEV C;  2EHO A;  2UXN B;  3KIN B;  3PDY A;  4TZ4 C;  4PJJ A;  4L9I A;  2JMK A;  5LCY A;  4UVB B;  2JQQ A;  5LHG B;  5LBM A;  3Q9D A;  2LHR A;  3EDV A;  3RC3 A;  4TN7 B;  2H3R A;  4EOZ B;  3H3A A;  2DNX A;  1MMD A;  5ADX L;  3FXD B;  3SS1 A;  4MLK A;  3O4X E;  2ZLY A;  4HEA A;  1MMA A;  1U5P A;  4OFZ A;  4EYU A;  5EK3 A;  1YKH B;  1IAP A;  4UVC B;  2D5U A;  3PUR A;  5J1G A;  3B57 A;  3UFE A;  4EXT A;  4QX7 B;  3IHR A;  2CCQ A;  2K5B B;  2MTQ A;  3OKQ A;  3RX6 A;  4B6X A;  2KMF A;  5LHH B;  3ZYK A;  1Y64 B;  3K3O A;  4CZZ B;  2A3D A;  2B1E A;  2V7I A;  4PJM A;  3N9P A;  2JPF A;  3ZYL A;  3HI2 A;  3F31 A;  5DJQ C;  3OJA A;  3T8O A;  3MAC A;  2CWO A;  2MOZ A;  3ETU A;  4QX8 B;  4X20 E;  1YKE B;  2NW8 A;  4GK5 E;  4OYK A;  2JJ9 A;  3HL6 A;  2YK0 A;  5HWY A;  4H9Q C;  4WW0 A;  3HKD E;  1US7 B;  5L3C B;  4UEL A;  5L3E B;  4ILU A;  3VKH A;  2E9X A;  2PFV A;  4OHF A;  3CQC B;  4AI6 A;  4P0A A;  5CA1 E;  5JDN A;  4CXW A;  1WLX A;  5A1L A;  1OWA A;  4AXP A;  2Y48 B;  1EZ3 A;  3UT5 E;  2VB6 A;  4H9N C;  5L3G B;  3VKG A;  2XAQ B;  3S4U A;  3HA4 A;  1D1A A;  3MXZ A;  3UUM A;  3BQK A;  3OYX A;  4UF0 A;  5JRE A;  2W62 A;  4PNI A;  1D1C A;  5FNV E;  2X66 A;  4ZI2 D;  2WAU A;  4PK5 A;  4H9O C;  2K24 A;  4CI2 B;  4HKA A;  3KV4 A;  4EB6 E;  3HKB E;  4ZHQ E;  3HKE E;  5LHI B;  4IDZ A;  4AQF A;  4BJN A;  1D0Z A;  3P8C D;  5JQG E;  4AKI A;  4ERR A;  2DLR A;  2I59 A;  2NW7 A;  3C4W A;  3PTR B;  2BVL A;  2HH7 A;  2E9X D;  2X68 A;  5LG4 A;  3ZC0 A;  3EDU A;  3C50 A;  2KT9 A;  4A56 A;  4ZI3 C;  5FMN A;  4PK6 A;  3AA6 B;  3MZK B;  1AJ3 A;  5HAX A;  1KK7 A;  3RYC E;  3F2E A;  4XZC A;  4PW8 A;  5ETW A;  2P9B A;  3GN5 A;  5M4Y A;  2A2F X;  1HF8 A;  4H63 V;  1G8X A;  2VKO A;  4H9R C;  2PG8 A;  5L3B B;  3OYZ A;  1BR0 A;  2BVM A;  4YJ3 E;  3NZQ A;  5J2U E;  5FYM A;  2VKJ A;  2DWK A;  2N2N A;  4P0B A;  2Y8D A;  5AFU L;  3N2O A;  1HG2 A;  3GA8 A;  4KMC A;  1QUU A;  3ZMV B;  3ETV A;  5LGN B;  1MIW A;  1D1B A;  3MKD A;  2V7K A;  3CX8 B;  3E0Z A;  3UTK A;  5KMG P;  3C98 B;  3ZCJ A;  4EYY R;  2WM9 A;  1E1H B;  5C8Y E;  4CXX A;  3KFW X;  1VOM A;  1SA0 E;  3QUJ A;  2LM9 A;  3PU8 A;  4UV8 B;  2X0L B;  2G0U A;  2K48 A;  2NWB A;  2YIN A;  3K3N A;  3LK3 B;  3VU7 H;  4PJN A;  3ANW B;  4EIW A;  2Q9Q A;  4H63 H;  4MHC A;  3VHL A;  4KBM B;  4ZI2 C;  4OYJ A;  4KP3 C;  2J1D G;  3DP7 A;  2VKH A;  3NZP A;  2W63 A;  2PJQ A;  1MIY A;  4GK0 E;  1QSD A;  3N5L A;  4DBQ A;  4IE4 A;  2Z6E A;  4O2B E;  1Z0P A;  4MBQ A;  2ZM8 A;  4XBF B;  4WNK A;  4DVD A;  4IST A;  2LT3 A;  5LJN A;  3ZN0 B;  2X9W A;  3KVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...