4QXCB

Crystal structure of histone demethylase kdm2a-h3k36me2 with nog
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxcB00
4QXHB 4TN7B 4QXCB 4QXBB 4QWNB 4QX8B 4QX7B
chains in the Genus database with same CATH superfamily
3AB3B 5AQRB 4O4IE 3NRYA 3PUZF 4QWNB 2VKDA 4FJOA 2ZLYA 4PW8A 5TAOA 2E9XC 3EUHA 3AE7A 2JQKA 1S94A 2LM2A 1KF6A 4O4HE 1MMAA 3Q5XA 2ZM2A 3QNUA 1ZOYA 3VU7H 5J1GA 3L3PA 2W2UA 1OEDB 2B76A 4IE0A 3RYCE 3NWIA 4TZ4C 3HKDE 3P4RA 2V8SV 2NWBA 1MNDA 4EOZB 3AXJB 3C98B 4K0UA 2XQ8A 3VR9A 2NR4A 4LMLA 2M6BA 3CKDA 2Y48B 4EZ4A 5J2UE 3GN5B 3N2KE 2DI4A 3ZT6A 2CLYC 5IYZE 3HKCE 1X79A 2CEAA 4HWIB 3N9QA 2KT9A 3L8RA 2IIUA 2LSIA 2FBWA 1IBKT 5LHGB 4X64T 4GYRA 2VL0A 2D2SA 3EDVA 3EHZA 2XAHB 4EEDA 2CBIA 2BBJA 4NXMT 2WDQA 1D1CA 1L0VA 3NZPA 1Y01A 3FZMB 3O1JA 3RPUA 4CI1B 5HCJA 3NVOA 5ABFB 1EZ3A 2UXCT 2DWKA 3HKEE 3HKBE 3CQGB 2XAFB 2E9XB 2ES0A 2ODVA 4BJNA 3P4SA 4F6RC 1IJ6A 5FNVE 1FMVA 3ZEFB 2W4XA 3RF1A 4OK0A 4IDNA 2H7OA 2V5DA 4PFOA 3MK7C 3KVAA 3NZQA 3Q9DA 2I6HA 4ZI2D 2V7LA 4EZHA 5DQWA 3RQUA 3ZMVB 3ZCJA 3VKHA 5IUXA 3Q5WA 1FIOA 4U2ZA 4B3RT 1BR1A 4EXTA 4YJ2E 4EEBA 5AFUL 3EVYA 5AQQB 2LEHA 1VOMA 2XZEA 2X9WA 2BVMA 2CLYB 4P0BA 3ZSTA 3GA8A 3RYFE 2W67A 3MKDA 5EZYE 3QB5A 1T72A 2XM1A 5AQVB 2LSJA 2VKOA 3PUXF 2QGSA 4ANJA 5JREA 5L2LA 4HKAA 4HWCA 4PFPA 4GYSA 3RIUC 4YSYA 5IHYA 2BKNA 3N9MA 2RA1A 4KMCA 1XZYA 4DUYT 1WFDA 3L39A 1US7B 2WWVA 3LBXA 3E08A 4IE7A 3ZMTB 1BR2A 4GKJT 3ZSSA 5J2TE 4MALA 2H7VC 1FMWA 1LVFA 4OX9T 2WS3A 1W09A 2KMFA 2CM0A 4DUZT 2KSRA 5LNKA 5HYAA 2ACXA 1IBMT 4QH4A 2NTXA 2WWUA 4NXNT 2WSSV 3RRCA 3KV9A 4PNIA 1XMQT 4PK5A 2A2FX 3LG7A 3K1SA 2UXBT 3P4PA 4AQGA 5CA1E 1LVKA 4H63V 3C4WA 3ZC0A 3B5MA 2E2AA 3P8CD 3W15B 3RKGA 2WB5A 2X0YA 4DV3T 1VCTA 2NW7A 4DMVA 2HN2A 5ABFA 4JI2T 5DQVA 1KNZA 4OHFA 3DP7A 4TWHA 3C4XA 2HPLA 3UUXB 2OA5A 4UIGA 3P4WA 4ZI3C 3SFEA 3CWZB 1W0AA 3TLUA 2MPKA 2Y8DA 3ANWB 2W66A 4UEMA 5AQGB 3EABA 3IEEA 2Q9QD 3PUWF 5L4HA 4LF6T 5EK4A 3K3QC 1XWMA 1LKXA 3K3NA 2KLQA 3ONXA 1ZP0A 4JI3T 4HGAA 3VKGA 2HH7A 4X20E 4L0RA 4QXCB 3RLFF 3UFGA 4MLKA 2G0UA 2CWOA 5LG3A 2BDEA 5LYJE 3PURA 4QKNA 5LGTB 4IDQA 1YQ4A 4IHJE 5AQNB 2WY2A 3NBXX 3M65A 2QVAA 4O4LE 3SOLA 3Q5DA 3CQCB 2C0SA 2I0MA 5LOVE 3T1YT 1UX5A 5FL0A 3FXEB 2JRKA 4IT4A 3PTRB 3PUSA 5BR8T 2LT3A 3I0OA 3A7MA 1KFYA 5ABEA 3F2EA 4HFBA 2NW9A 4FI5A 1ZV4X 4ZS2A 3AEAA 2MYSA 5HAXA 5JR9B 3ZPOA 2C5IT 4JEHB 2JIWA 4WYVA 3OKQA 1JNRA 3ZKRA 2ZMAA 5C3JA 4IL9A 4X65T 2D9DA 3G06A 3AVSA 3ETVA 4IL4A 1Y64B 1VCSA 5LBMA 1XDPA 2XY8B 4HEAA 1GQEA 1J5WA 2D0TA 4ZOLE 4LF4T 3EAMA 4LFAT 2X67A 1MIWA 3MACA 2MOZA 5HWYA 3CPZA 3FZHB 5CGMA 4TNVA 2VVNA 4ZZCA 5HEJA 5AQLB 1IAPA 2CXDA 4I50E 1N32T 2PJQA 4GKKT 2X0LB 4TNWA 4E7SA 2LHNA 3AE1A 2KINB 2BS4A 2W61A 3PV0F 3RYHE 2OV9A 3C51A 4HE8A 4LF9T 4PJLA 3AA6B 2MTQA 5FXWA 1CHUA 3UU8A 2WZHA 2HN1A 4ISSA 4DV0T 4PJNA 1XDOA 4IDPA 3TLSA 4H9SE 4G63A 2YDSA 2DLRA 3RKOA 3EDUA 3QB5K 3LJCA 4AKLA 3WAJA 3WAKA 2N9DA 4C90A 1SE7A 2VURA 3ANWA 2X68A 2ACZA 4DMWA 4DR4T 1NENA 2LE8A 4I43B 4I4TE 3R84B 4UELA 3KV4A 1WYCA 1ZKEA 2XJ7A 2XUEA 4LF8T 3ZYLA 2VKJA 3BQIA 2V6YA 4DV7T 1U4QA 4CN4A 3AEEA 3LBXB 4DVDA 3AA7B 3N9NA 5LMNT 4ILAA 3AVRA 4KX6A 1M7KA 3X1DA 2IW5B 3Q2MA 2W62A 4DR3T 3DJBA 3JAFA 2FUPA 4U3CA 5LBQB 4CQIA 5FMNA 1OEDE 2E5VA 5AQFB 2FJBA 1J5ET 1HG2A 2V7JA 3N9PA 1FJGT 1MIYA 4H63H 5L3BB 3T8OA 2IDOB 4XZCA 1T7SA 5JR9A 5J0ZA 4YHJA 1YKHB 3LK42 4GIWA 3VR8A 3U78A 2XM2A 4ZXLA 3SS1A 2IMLA 4CI2B 5HCMA 1BR4A 4AXPA 1HTJF 3FB2A 2Q9QA 4LMJA 3TLWA 1E1HB 3ZN0B 2ZM6T 2BG9A 1OWAA 2UUCT 4IREA 4DR2T 2NP9A 3C50A 2LOSA 2SPCA 2WU5A 3JADA 2BKPA 2A9UA 4LFBT 2WP9A 2X66A 5AQHB 3ZMZB 3UULA 3CQXC 2KZ7B 2W0GA 4EYYR 1N33T 5LGUB 5CA0E 4ZI2C 4YHHT 1MMNA 2H88A 2KXPB 4UVBB 3KBUA 5C2TA 3PU8A 1J1JA 1SHZC 2WM9A 4ZS3A 3AE9A 5LCYA 3F57A 1WYBA 3CIRA 3U3IA 3MA9A 4X62T 4ZZBA 4JBWF 5KX5E 4HFEA 4B6XA 2VKHA 3HA4A 2H3RA 3QK6A 3K8PC 4PJMA 4AISA 5FY0A 5ETWA 2AXDS 3T1HT 1YQ3A 4TWDA 2XSAA 2XASB 3OTOT 3CX6B 5JTGA 5HEGA 3HI2A 4ERRA 2XQ7A 4DV5T 4YT0A 2V7MA 2DHRA 3UU6A 4H9OC 3A8YC 1N34T 1W9RA 2LRKA 4X66T 1QLBA 3MJXA 2XTLA 5F3JA 4QX7B 3ZMSB 2WZIA 5L3GB 2CRBA 4COFA 3VRBA 3O1HA 2DCFA 3AE4A 2XQ3A 2FJEA 4WBOA 2UXNB 5HEUA 3NRXA 5JVDE 2J1DG 4GK0E 3BQLA 4A5XA 2XAGB 3UU5A 2IC9A 3PJAJ 4P1NA 2LM9A 4U33A 4XBFB 3NKZA 2CXLA 3DTOA 3BK9A 2LOPA 2WMNA 4PJJA 4X1KE 3KFWX 4HN9A 3KV6A 3C64A 3AECA 3B57A 3RC3A 3UT5E 4H9NC 5L47A 3I1AA 4DBQA 1IBLT 4HFVA 5L3EB 2CBJA 2VVSA 2JMKA 3OYXA 5LMUT 4EB6E 2VQET 2YINA 4IGUA 2YDQA 5JH7E 1UK5A 2D5UA 3OBVE 4WNKA 4U72A 1HF8A 3PUQA 3RH3A 1VRBA 5JR9C 4EV6A 1HX1B 2WQYA 2K5BB 4ASKA 2YN6A 4HWDA 5C8YE 5LHHB 1HNXT 2CHOA 1G73A 2L3LA 4AIUA 2Q9QC 4YFSA 1YW0A 1SUMB 1UCUA 4DV4T 4JI4T 2BG9C 3QOFA 1XNRT 2QA7A 2EHOD 4HFCA 1T98A 4HTEA 3AEDA 4LF5T 2J4GA 1BR0A 1Z0PA 3AA1B 2IAKA 1HG5A 2CMRA 4TN7B 5ABGA 3ZT7A 4B3TT 2V26A 2V6XA 3AE8A 4IE5A 4KHPT 2V6YB 5FXVA 4IE6A 5AQKB 5DJQC 5LJMA 2L8KA 2JMHA 3VHLA 5L3DB 3CVRA 4CN1A 3ZC1A 4QX8B 3ZN1B 4HFIA 2ZM0A 1UX4A 5AQTB 2X51A 5E0OA 5AQJB 2KNDA 4JV5T 2F4VT 2PTFA 3A5XA 4WZXA 3N9OA 2X9HA 2DL1A 5FY7A 4CZZB 4DR7T 4J2CA 4TV8E 4HWHA 5FVLA 4YJ3E 2VK9A 4JI5T 4JI1T 4IE4A 3E22E 3AAIA 1UURA 1KNRA 2E8IA 2WAUA 3R6NA 4AQYT 5CB4E 1D0XA 1YXRA 4TUYE 3F31A 2UXDT 3AE5A 3P50A 2Q9QB 2EHOB 4U2YA 3JAEA 4XAXB 1H7CA 4JLEA 3VRAA 2XQAA 1M62A 2BG9B 4QXBB 1WRDA 3AEBA 1X9BA 4KBMB 1QSDA 3V5UA 2V1DB 4ISTA 4DR5T 4PAGA 5JDHA 4AQFA 2Y6XA 4JI6T 4IIJE 2E5LT 2W00A 4IDZA 4UR9A 1HCIA 3I9WA 3MZKB 2CXFA 3FHNA 4AKIA 2YDRA 3QUJA 3UFEA 4AI6A 3UUMA 4U31A 5H6QB 5AQMB 4UXNB 3OPCA 4QHOA 5JQGE 3D0TA 2D0UA 2V5CA 5A1LA 3ZT5A 1R8IA 2LHRA 3HL6A 3CX7B 4BA9A 3AAAB 3GWHA 3P7IA 1JNZA 5LGNB 1D1AA 4B3ST 1AJ3A 2VL8A 3AE3A 4MBQA 4JI0T 2LKHA 5LB7B 4OYKA 2WMOA 2HPJA 3PDYA 4V1Av 2KWIB 3PUAA 3ONLC 1NWMX 5HXEA 4MHCA 2R6GF 4O2BE 1QUUA 3P4QA 3ZCIA 2E9XD 4YY3T 1S35A 2P9BA 2JQQA 3RQWA 3IHRA 4ZEYA 5LJNA 3RHWA 1WLXA 4YSXA 2B1EA 3MXZA 4A97A 5KMGP 3N2OA 2CCQA 3FBLA 5CJ5A 4AKRB 2LLYA 5EK2A 4UF0B 4DV6T 4HFHA 5KDMC 4C91A 1O3XA 2ZM8A 4NIQA 2FJAA 3ZYMA 4JI7T 4M1PA 1I94T 5FXXA 1UUSA 4ZHQE 2QRXA 4WBNE 2J47A 2YU1A 4YTNA 3FZKB 2I59A 2WCAA 1MMDA 5L3CB 2H89A 2X9XA 5FKYA 4X1IE 3TKLB 2X0HA 3H3AA 2VASA 4X1YE 2JQHA 5GONE 5JRCB 2EHOA 4H9QC 2K3WA 5CFBA 4CN6A 5AQIB 4L5GA 2XQ6A 4LF7T 1D0YA 2LSKA 5LHIB 2CHNA 2X9YA 3ESLA 4P09A 4Z91A 3O4XE 3UU3A 2N2NA 2YU2A 2DNXA 4H9PC 5LXTE 4B3MT 2C5KT 3LK2B 4ILUA 2K24A 5JDFA 3CX8B 3Q5EA 1B7TA 2K9AA 4P0AA 1ZHCA 3J7Yq 2QYWA 3ETUA 1HNZT 2FJDA 3WI3A 2PG8A 2XHEB 2YOEA 3BQKA 3JCFA 2ODUA 4QH1A 4AQFC 4OFZA 5EK3A 1HNWT 3H37A 2BS2A 2XAJB 3S4UA 3AA0B 4TX5A 4JUYA 4CI3B 5L4EA 4GK5E 1SA0E 4CXXA 1T8BA 1KNPA 4O8SA 5F5WA 4JI8T 4KHZF 3H3MA 4YSZA 4YTPA 4GOUA 2WDRA 4BAYB 2XQ5A 3ZYKA 1XNQT 4MFRA 3PUYF 3JC6C 2WDVA 4NUUA 3GMIA 3OVUA 5DABA 4QXHB 3JC6D 4E7ZA 5L3FB 3RYIE 1DU2A 5HEHA 5F8PA 1D0ZA 2RP4A 4I55E 2VWAA 4EYUA 1Z8UA 4A56A 2PBIA 2IHR1 4OYJA 5JDGA 3V5SA 1HX8A 3UUNA 3K3OA 1OEDA 5AQOB 2WBLA 2DWGA 4K0KT 3TLVA 4DR6T 5LP6E 2CPTA 3AXJA 3TLTA 2LKGA 4UF0A 3I9YA 2K48A 2KWHA 4ILBA 3O9XA 3OJAA 3OYZA 3GN5A 4UV8B 2XQ9A 4U7YA 1MNEA 5AQUB 3KV5A 2V7KA 3KBTA 3CMLA 4PK6A 3QC9A 1U5PA 3LDQB 5LG4A 4L9IA 3UUBA 2LRLA 4BJMA 5KXJA 2UU9T 4I0UA 4PK4A 5M4YA 4O2AE 1I6ZA 4KUMB 4CXWA 2IUBA 2C5JA 4LFCT 5JRCA 3RIFA 4YLHA 4KI0F 5FY1A 5HXCA 5LA6E 2CWYA 2LSYA 1OXZA 2YEVC 4EAHA 4YTMA 4NUVA 1UGOA 5JDMA 2BBHA 3RX6A 1WCRA 1FEWA 3ZMUB 2IC6A 3PU3A 5AQSB 4UVCB 2JJ9A 4TV9E 4U7IA 5FXZA 1D1BA 2YKSA 5HXHA 1HR0T 2EHOC 3IF8B 2WU2A 1MMGA 1E7PA 1E2AA 2LJLA 5FP3A 4DO0A 1YD8G 2E9XA 3N2GE 1KEYA 4CXYA 1XMOT 1HFAA 1V9DA 3PUGA 2L9QA 3CK6A 3AE2A 5FL1A 4ZI7E 1ZEEA 4AKGA 2M6IA 3AEGA 1WR6A 3SRZA 4ZI3D 3FBZA 3C4ZA 3O1IA 2PFVA 5HEOA 3J9X1 3LK3B 2LSGA 3AAEB 4HWFA 4QH5A 2UUAT 2XQ4A 3N5LA 4DIDB 2CE7A 4EIWA 3ZJ1A 3KINB 5HXSA 3E0ZA 5JDNA 3EI0A 3UQ7A 1N36T 4NPPA 4F8HA 3ABVA 2XPKA 2XAQB 3N9LA 2Z6EA 4JEUB 5FYMA 3LFMA 1WR0A 2BVLA 4X5TA 3SWHA 1YKEB 4UV9B 3PJAA 5AQPB 5FVKA 3ZJ2A 3FXDB 4IDOA 2OLTA 1LRZA 4H9RC 4ADZA 3RIAA 2XQYA 4WW0A 3RI5A 4DV2T 3RGLA 3M3ZB 2JPFA 3ONJA 2AE9A 2MAWA 5H6RB 2BKOA 1IJ5A 3LSVA 1KK7A 2M67A 2VQFT 4DV1T 4DBRA 3ZLIA 4A98A 3KDSE 4TWFA 2J62A 3PE0A 3I0QA 3UTKA 4O4JE 2GK9A 2UXXB 4N78D 4ILCA 2NTYA 4DR1T 1HS7A 2HHHT 4JYAT 1OEDC 3UU4A 3RRWA 1MIVA 2XSBA 3L09A 4Z8XA 3FZLB 2NOXA 3AE6A 4Q25A 2A72A 4EGWA 2JQ9A 3FZFB 2BG9E 1G8XA 1CUNA 1W0BA 4U74A 2N1GA 5JDLA 1NEKA 2RPAA 2NW8A 4AKHA 4LMKA 3B13A 3RC8A 2YK0A 1NAFA 5IWAT 2BS3A 2A3DA 2VB6A 4DNDA 3HR0A 3IBPA 5HXRA 4YXDA 2MBGA 2BZBA 1IZNB 4G2AA 3AEFA 4UVAB 4Z90A 2V7IA 2W63A 3UQ4A 4KP3C 5BMVE 2UUBT 3IA3A 3SFDA 3PUVF 3RIUA 5JDQA 3KVBA 5HWXA 5ABHA 5ADXL 2CA5A 4HFDA
chains in the Genus database with same CATH topology
3J7Yq 3PTRB 3PUSA 3AB3B 4O4IE 3ETUA 2LT3A 3NRYA 2JMKA 3I0OA 3OYXA 4QWNB 4EB6E 2VKDA 2YINA 3F2EA 2NW9A 4IGUA 4FJOA 2ZLYA 4FI5A 4PW8A 3WI3A 5JH7E 5TAOA 1ZV4X 2D5UA 3OBVE 2E9XC 2PG8A 2XHEB 3BQKA 3EUHA 4ZS2A 1S94A 4WNKA 2ODUA 4U72A 4AQFC 4OFZA 5EK3A 2MYSA 5HAXA 5JR9B 3ZPOA 2C5IT 4O4HE 3H37A 4JEHB 1HF8A 1MMAA 2XAJB 3Q5XA 3PUQA 3RH3A 1VRBA 2ZM2A 3OKQA 3S4UA 3AA0B 4TX5A 4JUYA 3VU7H 2ZMAA 5J1GA 3L3PA 4CI3B 5JR9C 3RYCE 4IE0A 4TZ4C 4GK5E 1SA0E 3HKDE 3AVSA 3ETVA 4CXXA 2NWBA 4O8SA 1MNDA 4EOZB 1Y64B 2K5BB 3C98B 4K0UA 5LBMA 4ASKA 5C8YE 4GOUA 5LHHB 4BAYB 4HEAA 2D0TA 1G73A 4ZOLE 3ZYKA 2L3LA 4MFRA 3CKDA 2X67A 3JC6C 2Y48B 1MIWA 2Q9QC 3MACA 2MOZA 4NUUA 4YFSA 1YW0A 4EZ4A 5HWYA 5J2UE 3GN5B 1UCUA 3CPZA 3GMIA 3N2KE 2DI4A 5DABA 2CLYC 5IYZE 4QXHB 3JC6D 2QA7A 4E7ZA 1IAPA 2EHOD 5L3FB 3HKCE 1X79A 2CXDA 4I50E 3RYIE 2CEAA 1T98A 2PJQA 3N9QA 5F8PA 4HTEA 2KT9A 2X0LB 4E7SA 2LHNA 1D0ZA 2RP4A 4I55E 2LSIA 2KINB 2VWAA 1BR0A 1Z0PA 2W61A 3RYHE 3AA1B 3C51A 4HE8A 4EYUA 2IAKA 4PJLA 4A56A 2PBIA 3AA6B 4OYJA 5LHGB 1HG5A 2CMRA 4TN7B 1HX8A 2MTQA 3V5SA 5JDGA 3UUNA 4GYRA 5FXWA 3K3OA 4ISSA 2D2SA 2WBLA 2DWGA 3EDVA 4PJNA 2XAHB 2V26A 4IE5A 5LP6E 5FXVA 4IE6A 4H9SE 4G63A 4UF0A 3I9YA 5DJQC 5LJMA 2L8KA 1D1CA 2JMHA 3VHLA 2DLRA 5L3DB 3CVRA 2K48A 3NZPA 4QX8B 3ZC1A 3ZN1B 3RKOA 3EDUA 2KWHA 2ZM0A 3O1JA 3O9XA 3RPUA 3OJAA 4CI1B 1UX4A 3LJCA 3OYZA 1EZ3A 3GN5A 4UV8B 2DWKA 4AKLA 3WAJA 3WAKA 1MNEA 2N9DA 3HKEE 3HKBE 2X51A 5E0OA 4C90A 3ANWA 2KNDA 3KV5A 2V7KA 2XAFB 3CQGB 3KBTA 3CMLA 4PK6A 3QC9A 2X68A 2E9XB 4DMWA 1U5PA 3A5XA 5LG4A 2ES0A 2X9HA 3N9OA 2LE8A 4L9IA 4I43B 2ODVA 4I4TE 3R84B 4BJNA 4UELA 5FY7A 4CZZB 4BJMA 4F6RC 1IJ6A 4J2CA 5FNVE 1FMVA 4TV8E 3KV4A 4PK4A 5M4YA 4O2AE 4KUMB 4YJ3E 4CXWA 2C5JA 3ZEFB 1WYCA 2VK9A 5JRCA 1ZKEA 4IE4A 3E22E 4OK0A 3AAIA 2XUEA 2H7OA 4YLHA 4PFOA 5FY1A 3MK7C 3KVAA 2E8IA 3NZQA 2WAUA 3Q9DA 3R6NA 3ZYLA 5HXCA 2VKJA 4ZI2D 2V7LA 5LA6E 2CWYA 3BQIA 2LSYA 5DQWA 4EZHA 3ZMVB 1OXZA 2YEVC 3ZCJA 4EAHA 3VKHA 1U4QA 5CB4E 1D0XA 4NUVA 4TUYE 3LBXB 3Q5WA 1FIOA 4DVDA 3F31A 3AA7B 3N9NA 5JDMA 1BR1A 3AVRA 3RX6A 4EXTA 4YJ2E 5AFUL 3EVYA 1FEWA 3ZMUB 2IC6A 2IW5B 2Q9QB 2LEHA 2EHOB 3PU3A 2W62A 3Q2MA 2JJ9A 4TV9E 4UVCB 5FXZA 4XAXB 3DJBA 1VOMA 1D1BA 1H7CA 4JLEA 2X9WA 5HXHA 2BVMA 4QXBB 5LBQB 1WRDA 2CLYB 4P0BA 4CQIA 2EHOC 5FMNA 3IF8B 1MMGA 3GA8A 3RYFE 5FP3A 2LJLA 4KBMB 4DO0A 1YD8G 1QSDA 3MKDA 5EZYE 3V5UA 2E9XA 2V1DB 3N2GE 4ISTA 1HG2A 2V7JA 2LSJA 4CXYA 3N9PA 1HFAA 4PAGA 5JDHA 2VKOA 1V9DA 4AQFA 2Y6XA 1MIYA 4H63H 5L3BB 3PUGA 3T8OA 2L9QA 2QGSA 4ANJA 4IIJE 4ZI7E 4XZCA 5L2LA 4HKAA 5JREA 4PFPA 4GYSA 1ZEEA 2W00A 4AKGA 4IDZA 5JR9A 1WR6A 1HCIA 3I9WA 4YHJA 3SRZA 5IHYA 4ZI3D 1YKHB 3FBZA 3LK42 3N9MA 2RA1A 3C4ZA 3O1IA 2PFVA 4GIWA 3J9X1 4KMCA 3LK3B 3MZKB 2LSGA 3AAEB 3U78A 2CXFA 3FHNA 4AKIA 1US7B 3SS1A 3LBXA 3E08A 3QUJA 4CI2B 3UFEA 4AI6A 1BR4A 3N5LA 4IE7A 4AXPA 3UUMA 2CE7A 3ZMTB 1BR2A 4EIWA 1HTJF 5H6QB 3ZJ1A 4UXNB 4P0AA 3KINB 5HXSA 5J2TE 4MALA 3FB2A 2Q9QA 4QHOA 2H7VC 3E0ZA 5JDNA 5JQGE 3D0TA 1E1HB 2D0UA 1FMWA 1LVFA 3ZN0B 5A1LA 2LHRA 1OWAA 2XAQB 3HL6A 2KMFA 2CM0A 2NP9A 3N9LA 2Z6EA 3C50A 4JEUB 5LNKA 5FYMA 3LFMA 2LOSA 2SPCA 5HYAA 2ACXA 3CX7B 4BA9A 2BVLA 3SWHA 1YKEB 2NTXA 2WWUA 3AAAB 4UV9B 2WSSV 2X66A 3ZMZB 3UULA 3GWHA 3P7IA 3RRCA 3KV9A 3ZJ2A 4PNIA 3CQXC 3FXDB 4PK5A 2KZ7B 5LGNB 2W0GA 4EYYR 2A2FX 1D1AA 1LRZA 4H9RC 4ADZA 1AJ3A 5LGUB 2VL8A 5CA0E 3LG7A 4MBQA 4ZI2C 1MMNA 2KXPB 4UVBB 2XQYA 3KBUA 4WW0A 3PU8A 1SHZC 4OYKA 2WM9A 4ZS3A 2WMOA 4AQGA 5LCYA 3F57A 1LVKA 5CA1E 1WYBA 2JPFA 4H63V 2HPJA 3PDYA 4V1Av 3U3IA 2KWIB 3C4WA 3MA9A 3ZC0A 3PUAA 3P8CD 5KX5E 1NWMX 3W15B 4B6XA 2VKHA 5HXEA 5H6RB 3HA4A 2H3RA 3QK6A 3K8PC 1IJ5A 4MHCA 4PJMA 1KK7A 2M67A 5FY0A 4O2BE 5ETWA 1QUUA 4DBRA 3ZLIA 3ZCIA 3KDSE 2E9XD 3PE0A 3I0QA 3UTKA 2NW7A 4O4JE 4DMVA 2GK9A 1S35A 2UXXB 2P9BA 4N78D 2JQQA 2XASB 3IHRA 2NTYA 3CX6B 1HS7A 5LJNA 5DQVA 1WLXA 1KNZA 3HI2A 2B1EA 4OHFA 3DP7A 3MXZA 4ERRA 5KMGP 3N2OA 2CCQA 3C4XA 3RRWA 3FBLA 2HPLA 4AKRB 5EK2A 1MIVA 4UF0B 2V7MA 3L09A 4Z8XA 2DHRA 2NOXA 3UUXB 4H9OC 2OA5A 4UIGA 5KDMC 4C91A 2A72A 4ZI3C 1O3XA 2ZM8A 3MJXA 2XTLA 3ZYMA 5F3JA 3CWZB 4QX7B 3ZMSB 4M1PA 5FXXA 4ZHQE 1G8XA 1CUNA 4U74A 5L3GB 4WBNE 2N1GA 2Y8DA 3ANWB 4UEMA 5JDLA 3IEEA 2Q9QD 3O1HA 2YU1A 2DCFA 5EK4A 2I59A 2NW8A 1MMDA 4AKHA 5L3CB 3K3QC 2X9XA 3B13A 4WBOA 4X1IE 3TKLB 1LKXA 2UXNB 3K3NA 2KLQA 3H3AA 3NRXA 3RC8A 5JVDE 3ONXA 2VASA 4HGAA 3VKGA 2HH7A 2YK0A 2J1DG 1NAFA 4X20E 4L0RA 4QXCB 4X1YE 4GK0E 5GONE 3BQLA 2A3DA 2VB6A 4DNDA 2XAGB 4MLKA 2G0UA 3HR0A 3IBPA 2IC9A 5HXRA 5JRCB 2LM9A 2EHOA 2CWOA 4H9QC 4XBFB 2CXLA 2BDEA 3DTOA 3BK9A 5LYJE 3PURA 2MBGA 4QKNA 2BZBA 1IZNB 4G2AA 2LOPA 4L5GA 5LGTB 2WMNA 4PJJA 4X1KE 4UVAB 3KFWX 4HN9A 2V7IA 2W63A 4IHJE 1D0YA 2LSKA 5LHIB 3NBXX 4KP3C 5BMVE 2X9YA 3M65A 3ESLA 3KV6A 4P09A 3C64A 4O4LE 3B57A 3RC3A 3O4XE 2N2NA 3SOLA 3UT5E 2YU2A 2DNXA 4H9PC 5JDQA 5LXTE 3KVBA 5HWXA 4H9NC 2C5KT 3I1AA 3CQCB 3LK2B 2C0SA 5LOVE 4ILUA 4DBQA 2K24A 4HFVA 5JDFA 5L3EB 1UX5A 3CX8B 5ADXL 3FXEB 2CA5A 2JRKA 1B7TA 2K9AA 1ZHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXH B;  4TN7 B;  4QXC B;  4QXB B;  4QWN B;  4QX8 B;  4QX7 B; 
#chains in the Genus database with same CATH topology
 3AB3 B;  5AQR B;  4O4I E;  3NRY A;  3PUZ F;  4QWN B;  2VKD A;  4FJO A;  2ZLY A;  4PW8 A;  5TAO A;  2E9X C;  3EUH A;  3AE7 A;  2JQK A;  1S94 A;  2LM2 A;  1KF6 A;  4O4H E;  1MMA A;  3Q5X A;  2ZM2 A;  3QNU A;  1ZOY A;  3VU7 H;  5J1G A;  3L3P A;  2W2U A;  1OED B;  2B76 A;  4IE0 A;  3RYC E;  3NWI A;  4TZ4 C;  3HKD E;  3P4R A;  2V8S V;  2NWB A;  1MND A;  4EOZ B;  3AXJ B;  3C98 B;  4K0U A;  2XQ8 A;  3VR9 A;  2NR4 A;  4LML A;  2M6B A;  3CKD A;  2Y48 B;  4EZ4 A;  5J2U E;  3GN5 B;  3N2K E;  2DI4 A;  3ZT6 A;  2CLY C;  5IYZ E;  3HKC E;  1X79 A;  2CEA A;  4HWI B;  3N9Q A;  2KT9 A;  3L8R A;  2IIU A;  2LSI A;  2FBW A;  1IBK T;  5LHG B;  4X64 T;  4GYR A;  2VL0 A;  2D2S A;  3EDV A;  3EHZ A;  2XAH B;  4EED A;  2CBI A;  2BBJ A;  4NXM T;  2WDQ A;  1D1C A;  1L0V A;  3NZP A;  1Y01 A;  3FZM B;  3O1J A;  3RPU A;  4CI1 B;  5HCJ A;  3NVO A;  5ABF B;  1EZ3 A;  2UXC T;  2DWK A;  3HKE E;  3HKB E;  3CQG B;  2XAF B;  2E9X B;  2ES0 A;  2ODV A;  4BJN A;  3P4S A;  4F6R C;  1IJ6 A;  5FNV E;  1FMV A;  3ZEF B;  2W4X A;  3RF1 A;  4OK0 A;  4IDN A;  2H7O A;  2V5D A;  4PFO A;  3MK7 C;  3KVA A;  3NZQ A;  3Q9D A;  2I6H A;  4ZI2 D;  2V7L A;  4EZH A;  5DQW A;  3RQU A;  3ZMV B;  3ZCJ A;  3VKH A;  5IUX A;  3Q5W A;  1FIO A;  4U2Z A;  4B3R T;  1BR1 A;  4EXT A;  4YJ2 E;  4EEB A;  5AFU L;  3EVY A;  5AQQ B;  2LEH A;  1VOM A;  2XZE A;  2X9W A;  2BVM A;  2CLY B;  4P0B A;  3ZST A;  3GA8 A;  3RYF E;  2W67 A;  3MKD A;  5EZY E;  3QB5 A;  1T72 A;  2XM1 A;  5AQV B;  2LSJ A;  2VKO A;  3PUX F;  2QGS A;  4ANJ A;  5JRE A;  5L2L A;  4HKA A;  4HWC A;  4PFP A;  4GYS A;  3RIU C;  4YSY A;  5IHY A;  2BKN A;  3N9M A;  2RA1 A;  4KMC A;  1XZY A;  4DUY T;  1WFD A;  3L39 A;  1US7 B;  2WWV A;  3LBX A;  3E08 A;  4IE7 A;  3ZMT B;  1BR2 A;  4GKJ T;  3ZSS A;  5J2T E;  4MAL A;  2H7V C;  1FMW A;  1LVF A;  4OX9 T;  2WS3 A;  1W09 A;  2KMF A;  2CM0 A;  4DUZ T;  2KSR A;  5LNK A;  5HYA A;  2ACX A;  1IBM T;  4QH4 A;  2NTX A;  2WWU A;  4NXN T;  2WSS V;  3RRC A;  3KV9 A;  4PNI A;  1XMQ T;  4PK5 A;  2A2F X;  3LG7 A;  3K1S A;  2UXB T;  3P4P A;  4AQG A;  5CA1 E;  1LVK A;  4H63 V;  3C4W A;  3ZC0 A;  3B5M A;  2E2A A;  3P8C D;  3W15 B;  3RKG A;  2WB5 A;  2X0Y A;  4DV3 T;  1VCT A;  2NW7 A;  4DMV A;  2HN2 A;  5ABF A;  4JI2 T;  5DQV A;  1KNZ A;  4OHF A;  3DP7 A;  4TWH A;  3C4X A;  2HPL A;  3UUX B;  2OA5 A;  4UIG A;  3P4W A;  4ZI3 C;  3SFE A;  3CWZ B;  1W0A A;  3TLU A;  2MPK A;  2Y8D A;  3ANW B;  2W66 A;  4UEM A;  5AQG B;  3EAB A;  3IEE A;  2Q9Q D;  3PUW F;  5L4H A;  4LF6 T;  5EK4 A;  3K3Q C;  1XWM A;  1LKX A;  3K3N A;  2KLQ A;  3ONX A;  1ZP0 A;  4JI3 T;  4HGA A;  3VKG A;  2HH7 A;  4X20 E;  4L0R A;  4QXC B;  3RLF F;  3UFG A;  4MLK A;  2G0U A;  2CWO A;  5LG3 A;  2BDE A;  5LYJ E;  3PUR A;  4QKN A;  5LGT B;  4IDQ A;  1YQ4 A;  4IHJ E;  5AQN B;  2WY2 A;  3NBX X;  3M65 A;  2QVA A;  4O4L E;  3SOL A;  3Q5D A;  3CQC B;  2C0S A;  2I0M A;  5LOV E;  3T1Y T;  1UX5 A;  5FL0 A;  3FXE B;  2JRK A;  4IT4 A;  3PTR B;  3PUS A;  5BR8 T;  2LT3 A;  3I0O A;  3A7M A;  1KFY A;  5ABE A;  3F2E A;  4HFB A;  2NW9 A;  4FI5 A;  1ZV4 X;  4ZS2 A;  3AEA A;  2MYS A;  5HAX A;  5JR9 B;  3ZPO A;  2C5I T;  4JEH B;  2JIW A;  4WYV A;  3OKQ A;  1JNR A;  3ZKR A;  2ZMA A;  5C3J A;  4IL9 A;  4X65 T;  2D9D A;  3G06 A;  3AVS A;  3ETV A;  4IL4 A;  1Y64 B;  1VCS A;  5LBM A;  1XDP A;  2XY8 B;  4HEA A;  1GQE A;  1J5W A;  2D0T A;  4ZOL E;  4LF4 T;  3EAM A;  4LFA T;  2X67 A;  1MIW A;  3MAC A;  2MOZ A;  5HWY A;  3CPZ A;  3FZH B;  5CGM A;  4TNV A;  2VVN A;  4ZZC A;  5HEJ A;  5AQL B;  1IAP A;  2CXD A;  4I50 E;  1N32 T;  2PJQ A;  4GKK T;  2X0L B;  4TNW A;  4E7S A;  2LHN A;  3AE1 A;  2KIN B;  2BS4 A;  2W61 A;  3PV0 F;  3RYH E;  2OV9 A;  3C51 A;  4HE8 A;  4LF9 T;  4PJL A;  3AA6 B;  2MTQ A;  5FXW A;  1CHU A;  3UU8 A;  2WZH A;  2HN1 A;  4ISS A;  4DV0 T;  4PJN A;  1XDO A;  4IDP A;  3TLS A;  4H9S E;  4G63 A;  2YDS A;  2DLR A;  3RKO A;  3EDU A;  3QB5 K;  3LJC A;  4AKL A;  3WAJ A;  3WAK A;  2N9D A;  4C90 A;  1SE7 A;  2VUR A;  3ANW A;  2X68 A;  2ACZ A;  4DMW A;  4DR4 T;  1NEN A;  2LE8 A;  4I43 B;  4I4T E;  3R84 B;  4UEL A;  3KV4 A;  1WYC A;  1ZKE A;  2XJ7 A;  2XUE A;  4LF8 T;  3ZYL A;  2VKJ A;  3BQI A;  2V6Y A;  4DV7 T;  1U4Q A;  4CN4 A;  3AEE A;  3LBX B;  4DVD A;  3AA7 B;  3N9N A;  5LMN T;  4ILA A;  3AVR A;  4KX6 A;  1M7K A;  3X1D A;  2IW5 B;  3Q2M A;  2W62 A;  4DR3 T;  3DJB A;  3JAF A;  2FUP A;  4U3C A;  5LBQ B;  4CQI A;  5FMN A;  1OED E;  2E5V A;  5AQF B;  2FJB A;  1J5E T;  1HG2 A;  2V7J A;  3N9P A;  1FJG T;  1MIY A;  4H63 H;  5L3B B;  3T8O A;  2IDO B;  4XZC A;  1T7S A;  5JR9 A;  5J0Z A;  4YHJ A;  1YKH B;  3LK4 2;  4GIW A;  3VR8 A;  3U78 A;  2XM2 A;  4ZXL A;  3SS1 A;  2IML A;  4CI2 B;  5HCM A;  1BR4 A;  4AXP A;  1HTJ F;  3FB2 A;  2Q9Q A;  4LMJ A;  3TLW A;  1E1H B;  3ZN0 B;  2ZM6 T;  2BG9 A;  1OWA A;  2UUC T;  4IRE A;  4DR2 T;  2NP9 A;  3C50 A;  2LOS A;  2SPC A;  2WU5 A;  3JAD A;  2BKP A;  2A9U A;  4LFB T;  2WP9 A;  2X66 A;  5AQH B;  3ZMZ B;  3UUL A;  3CQX C;  2KZ7 B;  2W0G A;  4EYY R;  1N33 T;  5LGU B;  5CA0 E;  4ZI2 C;  4YHH T;  1MMN A;  2H88 A;  2KXP B;  4UVB B;  3KBU A;  5C2T A;  3PU8 A;  1J1J A;  1SHZ C;  2WM9 A;  4ZS3 A;  3AE9 A;  5LCY A;  3F57 A;  1WYB A;  3CIR A;  3U3I A;  3MA9 A;  4X62 T;  4ZZB A;  4JBW F;  5KX5 E;  4HFE A;  4B6X A;  2VKH A;  3HA4 A;  2H3R A;  3QK6 A;  3K8P C;  4PJM A;  4AIS A;  5FY0 A;  5ETW A;  2AXD S;  3T1H T;  1YQ3 A;  4TWD A;  2XSA A;  2XAS B;  3OTO T;  3CX6 B;  5JTG A;  5HEG A;  3HI2 A;  4ERR A;  2XQ7 A;  4DV5 T;  4YT0 A;  2V7M A;  2DHR A;  3UU6 A;  4H9O C;  3A8Y C;  1N34 T;  1W9R A;  2LRK A;  4X66 T;  1QLB A;  3MJX A;  2XTL A;  5F3J A;  4QX7 B;  3ZMS B;  2WZI A;  5L3G B;  2CRB A;  4COF A;  3VRB A;  3O1H A;  2DCF A;  3AE4 A;  2XQ3 A;  2FJE A;  4WBO A;  2UXN B;  5HEU A;  3NRX A;  5JVD E;  2J1D G;  4GK0 E;  3BQL A;  4A5X A;  2XAG B;  3UU5 A;  2IC9 A;  3PJA J;  4P1N A;  2LM9 A;  4U33 A;  4XBF B;  3NKZ A;  2CXL A;  3DTO A;  3BK9 A;  2LOP A;  2WMN A;  4PJJ A;  4X1K E;  3KFW X;  4HN9 A;  3KV6 A;  3C64 A;  3AEC A;  3B57 A;  3RC3 A;  3UT5 E;  4H9N C;  5L47 A;  3I1A A;  4DBQ A;  1IBL T;  4HFV A;  5L3E B;  2CBJ A;  2VVS A;  2JMK A;  3OYX A;  5LMU T;  4EB6 E;  2VQE T;  2YIN A;  4IGU A;  2YDQ A;  5JH7 E;  1UK5 A;  2D5U A;  3OBV E;  4WNK A;  4U72 A;  1HF8 A;  3PUQ A;  3RH3 A;  1VRB A;  5JR9 C;  4EV6 A;  1HX1 B;  2WQY A;  2K5B B;  4ASK A;  2YN6 A;  4HWD A;  5C8Y E;  5LHH B;  1HNX T;  2CHO A;  1G73 A;  2L3L A;  4AIU A;  2Q9Q C;  4YFS A;  1YW0 A;  1SUM B;  1UCU A;  4DV4 T;  4JI4 T;  2BG9 C;  3QOF A;  1XNR T;  2QA7 A;  2EHO D;  4HFC A;  1T98 A;  4HTE A;  3AED A;  4LF5 T;  2J4G A;  1BR0 A;  1Z0P A;  3AA1 B;  2IAK A;  1HG5 A;  2CMR A;  4TN7 B;  5ABG A;  3ZT7 A;  4B3T T;  2V26 A;  2V6X A;  3AE8 A;  4IE5 A;  4KHP T;  2V6Y B;  5FXV A;  4IE6 A;  5AQK B;  5DJQ C;  5LJM A;  2L8K A;  2JMH A;  3VHL A;  5L3D B;  3CVR A;  4CN1 A;  3ZC1 A;  4QX8 B;  3ZN1 B;  4HFI A;  2ZM0 A;  1UX4 A;  5AQT B;  2X51 A;  5E0O A;  5AQJ B;  2KND A;  4JV5 T;  2F4V T;  2PTF A;  3A5X A;  4WZX A;  3N9O A;  2X9H A;  2DL1 A;  5FY7 A;  4CZZ B;  4DR7 T;  4J2C A;  4TV8 E;  4HWH A;  5FVL A;  4YJ3 E;  2VK9 A;  4JI5 T;  4JI1 T;  4IE4 A;  3E22 E;  3AAI A;  1UUR A;  1KNR A;  2E8I A;  2WAU A;  3R6N A;  4AQY T;  5CB4 E;  1D0X A;  1YXR A;  4TUY E;  3F31 A;  2UXD T;  3AE5 A;  3P50 A;  2Q9Q B;  2EHO B;  4U2Y A;  3JAE A;  4XAX B;  1H7C A;  4JLE A;  3VRA A;  2XQA A;  1M62 A;  2BG9 B;  4QXB B;  1WRD A;  3AEB A;  1X9B A;  4KBM B;  1QSD A;  3V5U A;  2V1D B;  4IST A;  4DR5 T;  4PAG A;  5JDH A;  4AQF A;  2Y6X A;  4JI6 T;  4IIJ E;  2E5L T;  2W00 A;  4IDZ A;  4UR9 A;  1HCI A;  3I9W A;  3MZK B;  2CXF A;  3FHN A;  4AKI A;  2YDR A;  3QUJ A;  3UFE A;  4AI6 A;  3UUM A;  4U31 A;  5H6Q B;  5AQM B;  4UXN B;  3OPC A;  4QHO A;  5JQG E;  3D0T A;  2D0U A;  2V5C A;  5A1L A;  3ZT5 A;  1R8I A;  2LHR A;  3HL6 A;  3CX7 B;  4BA9 A;  3AAA B;  3GWH A;  3P7I A;  1JNZ A;  5LGN B;  1D1A A;  4B3S T;  1AJ3 A;  2VL8 A;  3AE3 A;  4MBQ A;  4JI0 T;  2LKH A;  5LB7 B;  4OYK A;  2WMO A;  2HPJ A;  3PDY A;  4V1A v;  2KWI B;  3PUA A;  3ONL C;  1NWM X;  5HXE A;  4MHC A;  2R6G F;  4O2B E;  1QUU A;  3P4Q A;  3ZCI A;  2E9X D;  4YY3 T;  1S35 A;  2P9B A;  2JQQ A;  3RQW A;  3IHR A;  4ZEY A;  5LJN A;  3RHW A;  1WLX A;  4YSX A;  2B1E A;  3MXZ A;  4A97 A;  5KMG P;  3N2O A;  2CCQ A;  3FBL A;  5CJ5 A;  4AKR B;  2LLY A;  5EK2 A;  4UF0 B;  4DV6 T;  4HFH A;  5KDM C;  4C91 A;  1O3X A;  2ZM8 A;  4NIQ A;  2FJA A;  3ZYM A;  4JI7 T;  4M1P A;  1I94 T;  5FXX A;  1UUS A;  4ZHQ E;  2QRX A;  4WBN E;  2J47 A;  2YU1 A;  4YTN A;  3FZK B;  2I59 A;  2WCA A;  1MMD A;  5L3C B;  2H89 A;  2X9X A;  5FKY A;  4X1I E;  3TKL B;  2X0H A;  3H3A A;  2VAS A;  4X1Y E;  2JQH A;  5GON E;  5JRC B;  2EHO A;  4H9Q C;  2K3W A;  5CFB A;  4CN6 A;  5AQI B;  4L5G A;  2XQ6 A;  4LF7 T;  1D0Y A;  2LSK A;  5LHI B;  2CHN A;  2X9Y A;  3ESL A;  4P09 A;  4Z91 A;  3O4X E;  3UU3 A;  2N2N A;  2YU2 A;  2DNX A;  4H9P C;  5LXT E;  4B3M T;  2C5K T;  3LK2 B;  4ILU A;  2K24 A;  5JDF A;  3CX8 B;  3Q5E A;  1B7T A;  2K9A A;  4P0A A;  1ZHC A;  3J7Y q;  2QYW A;  3ETU A;  1HNZ T;  2FJD A;  3WI3 A;  2PG8 A;  2XHE B;  2YOE A;  3BQK A;  3JCF A;  2ODU A;  4QH1 A;  4AQF C;  4OFZ A;  5EK3 A;  1HNW T;  3H37 A;  2BS2 A;  2XAJ B;  3S4U A;  3AA0 B;  4TX5 A;  4JUY A;  4CI3 B;  5L4E A;  4GK5 E;  1SA0 E;  4CXX A;  1T8B A;  1KNP A;  4O8S A;  5F5W A;  4JI8 T;  4KHZ F;  3H3M A;  4YSZ A;  4YTP A;  4GOU A;  2WDR A;  4BAY B;  2XQ5 A;  3ZYK A;  1XNQ T;  4MFR A;  3PUY F;  3JC6 C;  2WDV A;  4NUU A;  3GMI A;  3OVU A;  5DAB A;  4QXH B;  3JC6 D;  4E7Z A;  5L3F B;  3RYI E;  1DU2 A;  5HEH A;  5F8P A;  1D0Z A;  2RP4 A;  4I55 E;  2VWA A;  4EYU A;  1Z8U A;  4A56 A;  2PBI A;  2IHR 1;  4OYJ A;  5JDG A;  3V5S A;  1HX8 A;  3UUN A;  3K3O A;  1OED A;  5AQO B;  2WBL A;  2DWG A;  4K0K T;  3TLV A;  4DR6 T;  5LP6 E;  2CPT A;  3AXJ A;  3TLT A;  2LKG A;  4UF0 A;  3I9Y A;  2K48 A;  2KWH A;  4ILB A;  3O9X A;  3OJA A;  3OYZ A;  3GN5 A;  4UV8 B;  2XQ9 A;  4U7Y A;  1MNE A;  5AQU B;  3KV5 A;  2V7K A;  3KBT A;  3CML A;  4PK6 A;  3QC9 A;  1U5P A;  3LDQ B;  5LG4 A;  4L9I A;  3UUB A;  2LRL A;  4BJM A;  5KXJ A;  2UU9 T;  4I0U A;  4PK4 A;  5M4Y A;  4O2A E;  1I6Z A;  4KUM B;  4CXW A;  2IUB A;  2C5J A;  4LFC T;  5JRC A;  3RIF A;  4YLH A;  4KI0 F;  5FY1 A;  5HXC A;  5LA6 E;  2CWY A;  2LSY A;  1OXZ A;  2YEV C;  4EAH A;  4YTM A;  4NUV A;  1UGO A;  5JDM A;  2BBH A;  3RX6 A;  1WCR A;  1FEW A;  3ZMU B;  2IC6 A;  3PU3 A;  5AQS B;  4UVC B;  2JJ9 A;  4TV9 E;  4U7I A;  5FXZ A;  1D1B A;  2YKS A;  5HXH A;  1HR0 T;  2EHO C;  3IF8 B;  2WU2 A;  1MMG A;  1E7P A;  1E2A A;  2LJL A;  5FP3 A;  4DO0 A;  1YD8 G;  2E9X A;  3N2G E;  1KEY A;  4CXY A;  1XMO T;  1HFA A;  1V9D A;  3PUG A;  2L9Q A;  3CK6 A;  3AE2 A;  5FL1 A;  4ZI7 E;  1ZEE A;  4AKG A;  2M6I A;  3AEG A;  1WR6 A;  3SRZ A;  4ZI3 D;  3FBZ A;  3C4Z A;  3O1I A;  2PFV A;  5HEO A;  3J9X 1;  3LK3 B;  2LSG A;  3AAE B;  4HWF A;  4QH5 A;  2UUA T;  2XQ4 A;  3N5L A;  4DID B;  2CE7 A;  4EIW A;  3ZJ1 A;  3KIN B;  5HXS A;  3E0Z A;  5JDN A;  3EI0 A;  3UQ7 A;  1N36 T;  4NPP A;  4F8H A;  3ABV A;  2XPK A;  2XAQ B;  3N9L A;  2Z6E A;  4JEU B;  5FYM A;  3LFM A;  1WR0 A;  2BVL A;  4X5T A;  3SWH A;  1YKE B;  4UV9 B;  3PJA A;  5AQP B;  5FVK A;  3ZJ2 A;  3FXD B;  4IDO A;  2OLT A;  1LRZ A;  4H9R C;  4ADZ A;  3RIA A;  2XQY A;  4WW0 A;  3RI5 A;  4DV2 T;  3RGL A;  3M3Z B;  2JPF A;  3ONJ A;  2AE9 A;  2MAW A;  5H6R B;  2BKO A;  1IJ5 A;  3LSV A;  1KK7 A;  2M67 A;  2VQF T;  4DV1 T;  4DBR A;  3ZLI A;  4A98 A;  3KDS E;  4TWF A;  2J62 A;  3PE0 A;  3I0Q A;  3UTK A;  4O4J E;  2GK9 A;  2UXX B;  4N78 D;  4ILC A;  2NTY A;  4DR1 T;  1HS7 A;  2HHH T;  4JYA T;  1OED C;  3UU4 A;  3RRW A;  1MIV A;  2XSB A;  3L09 A;  4Z8X A;  3FZL B;  2NOX A;  3AE6 A;  4Q25 A;  2A72 A;  4EGW A;  2JQ9 A;  3FZF B;  2BG9 E;  1G8X A;  1CUN A;  1W0B A;  4U74 A;  2N1G A;  5JDL A;  1NEK A;  2RPA A;  2NW8 A;  4AKH A;  4LMK A;  3B13 A;  3RC8 A;  2YK0 A;  1NAF A;  5IWA T;  2BS3 A;  2A3D A;  2VB6 A;  4DND A;  3HR0 A;  3IBP A;  5HXR A;  4YXD A;  2MBG A;  2BZB A;  1IZN B;  4G2A A;  3AEF A;  4UVA B;  4Z90 A;  2V7I A;  2W63 A;  3UQ4 A;  4KP3 C;  5BMV E;  2UUB T;  3IA3 A;  3SFD A;  3PUV F;  3RIU A;  5JDQ A;  3KVB A;  5HWX A;  5ABH A;  5ADX L;  2CA5 A;  4HFD A; 
#chains in the Genus database with same CATH homology
 3J7Y q;  3PTR B;  3PUS A;  3AB3 B;  4O4I E;  3ETU A;  2LT3 A;  3NRY A;  2JMK A;  3I0O A;  3OYX A;  4QWN B;  4EB6 E;  2VKD A;  2YIN A;  3F2E A;  2NW9 A;  4IGU A;  4FJO A;  2ZLY A;  4FI5 A;  4PW8 A;  3WI3 A;  5JH7 E;  5TAO A;  1ZV4 X;  2D5U A;  3OBV E;  2E9X C;  2PG8 A;  2XHE B;  3BQK A;  3EUH A;  4ZS2 A;  1S94 A;  4WNK A;  2ODU A;  4U72 A;  4AQF C;  4OFZ A;  5EK3 A;  2MYS A;  5HAX A;  5JR9 B;  3ZPO A;  2C5I T;  4O4H E;  3H37 A;  4JEH B;  1HF8 A;  1MMA A;  2XAJ B;  3Q5X A;  3PUQ A;  3RH3 A;  1VRB A;  2ZM2 A;  3OKQ A;  3S4U A;  3AA0 B;  4TX5 A;  4JUY A;  3VU7 H;  2ZMA A;  5J1G A;  3L3P A;  4CI3 B;  5JR9 C;  3RYC E;  4IE0 A;  4TZ4 C;  4GK5 E;  1SA0 E;  3HKD E;  3AVS A;  3ETV A;  4CXX A;  2NWB A;  4O8S A;  1MND A;  4EOZ B;  1Y64 B;  2K5B B;  3C98 B;  4K0U A;  5LBM A;  4ASK A;  5C8Y E;  4GOU A;  5LHH B;  4BAY B;  4HEA A;  2D0T A;  1G73 A;  4ZOL E;  3ZYK A;  2L3L A;  4MFR A;  3CKD A;  2X67 A;  3JC6 C;  2Y48 B;  1MIW A;  2Q9Q C;  3MAC A;  2MOZ A;  4NUU A;  4YFS A;  1YW0 A;  4EZ4 A;  5HWY A;  5J2U E;  3GN5 B;  1UCU A;  3CPZ A;  3GMI A;  3N2K E;  2DI4 A;  5DAB A;  2CLY C;  5IYZ E;  4QXH B;  3JC6 D;  2QA7 A;  4E7Z A;  1IAP A;  2EHO D;  5L3F B;  3HKC E;  1X79 A;  2CXD A;  4I50 E;  3RYI E;  2CEA A;  1T98 A;  2PJQ A;  3N9Q A;  5F8P A;  4HTE A;  2KT9 A;  2X0L B;  4E7S A;  2LHN A;  1D0Z A;  2RP4 A;  4I55 E;  2LSI A;  2KIN B;  2VWA A;  1BR0 A;  1Z0P A;  2W61 A;  3RYH E;  3AA1 B;  3C51 A;  4HE8 A;  4EYU A;  2IAK A;  4PJL A;  4A56 A;  2PBI A;  3AA6 B;  4OYJ A;  5LHG B;  1HG5 A;  2CMR A;  4TN7 B;  1HX8 A;  2MTQ A;  3V5S A;  5JDG A;  3UUN A;  4GYR A;  5FXW A;  3K3O A;  4ISS A;  2D2S A;  2WBL A;  2DWG A;  3EDV A;  4PJN A;  2XAH B;  2V26 A;  4IE5 A;  5LP6 E;  5FXV A;  4IE6 A;  4H9S E;  4G63 A;  4UF0 A;  3I9Y A;  5DJQ C;  5LJM A;  2L8K A;  1D1C A;  2JMH A;  3VHL A;  2DLR A;  5L3D B;  3CVR A;  2K48 A;  3NZP A;  4QX8 B;  3ZC1 A;  3ZN1 B;  3RKO A;  3EDU A;  2KWH A;  2ZM0 A;  3O1J A;  3O9X A;  3RPU A;  3OJA A;  4CI1 B;  1UX4 A;  3LJC A;  3OYZ A;  1EZ3 A;  3GN5 A;  4UV8 B;  2DWK A;  4AKL A;  3WAJ A;  3WAK A;  1MNE A;  2N9D A;  3HKE E;  3HKB E;  2X51 A;  5E0O A;  4C90 A;  3ANW A;  2KND A;  3KV5 A;  2V7K A;  2XAF B;  3CQG B;  3KBT A;  3CML A;  4PK6 A;  3QC9 A;  2X68 A;  2E9X B;  4DMW A;  1U5P A;  3A5X A;  5LG4 A;  2ES0 A;  2X9H A;  3N9O A;  2LE8 A;  4L9I A;  4I43 B;  2ODV A;  4I4T E;  3R84 B;  4BJN A;  4UEL A;  5FY7 A;  4CZZ B;  4BJM A;  4F6R C;  1IJ6 A;  4J2C A;  5FNV E;  1FMV A;  4TV8 E;  3KV4 A;  4PK4 A;  5M4Y A;  4O2A E;  4KUM B;  4YJ3 E;  4CXW A;  2C5J A;  3ZEF B;  1WYC A;  2VK9 A;  5JRC A;  1ZKE A;  4IE4 A;  3E22 E;  4OK0 A;  3AAI A;  2XUE A;  2H7O A;  4YLH A;  4PFO A;  5FY1 A;  3MK7 C;  3KVA A;  2E8I A;  3NZQ A;  2WAU A;  3Q9D A;  3R6N A;  3ZYL A;  5HXC A;  2VKJ A;  4ZI2 D;  2V7L A;  5LA6 E;  2CWY A;  3BQI A;  2LSY A;  5DQW A;  4EZH A;  3ZMV B;  1OXZ A;  2YEV C;  3ZCJ A;  4EAH A;  3VKH A;  1U4Q A;  5CB4 E;  1D0X A;  4NUV A;  4TUY E;  3LBX B;  3Q5W A;  1FIO A;  4DVD A;  3F31 A;  3AA7 B;  3N9N A;  5JDM A;  1BR1 A;  3AVR A;  3RX6 A;  4EXT A;  4YJ2 E;  5AFU L;  3EVY A;  1FEW A;  3ZMU B;  2IC6 A;  2IW5 B;  2Q9Q B;  2LEH A;  2EHO B;  3PU3 A;  2W62 A;  3Q2M A;  2JJ9 A;  4TV9 E;  4UVC B;  5FXZ A;  4XAX B;  3DJB A;  1VOM A;  1D1B A;  1H7C A;  4JLE A;  2X9W A;  5HXH A;  2BVM A;  4QXB B;  5LBQ B;  1WRD A;  2CLY B;  4P0B A;  4CQI A;  2EHO C;  5FMN A;  3IF8 B;  1MMG A;  3GA8 A;  3RYF E;  5FP3 A;  2LJL A;  4KBM B;  4DO0 A;  1YD8 G;  1QSD A;  3MKD A;  5EZY E;  3V5U A;  2E9X A;  2V1D B;  3N2G E;  4IST A;  1HG2 A;  2V7J A;  2LSJ A;  4CXY A;  3N9P A;  1HFA A;  4PAG A;  5JDH A;  2VKO A;  1V9D A;  4AQF A;  2Y6X A;  1MIY A;  4H63 H;  5L3B B;  3PUG A;  3T8O A;  2L9Q A;  2QGS A;  4ANJ A;  4IIJ E;  4ZI7 E;  4XZC A;  5L2L A;  4HKA A;  5JRE A;  4PFP A;  4GYS A;  1ZEE A;  2W00 A;  4AKG A;  4IDZ A;  5JR9 A;  1WR6 A;  1HCI A;  3I9W A;  4YHJ A;  3SRZ A;  5IHY A;  4ZI3 D;  1YKH B;  3FBZ A;  3LK4 2;  3N9M A;  2RA1 A;  3C4Z A;  3O1I A;  2PFV A;  4GIW A;  3J9X 1;  4KMC A;  3LK3 B;  3MZK B;  2LSG A;  3AAE B;  3U78 A;  2CXF A;  3FHN A;  4AKI A;  1US7 B;  3SS1 A;  3LBX A;  3E08 A;  3QUJ A;  4CI2 B;  3UFE A;  4AI6 A;  1BR4 A;  3N5L A;  4IE7 A;  4AXP A;  3UUM A;  2CE7 A;  3ZMT B;  1BR2 A;  4EIW A;  1HTJ F;  5H6Q B;  3ZJ1 A;  4UXN B;  4P0A A;  3KIN B;  5HXS A;  5J2T E;  4MAL A;  3FB2 A;  2Q9Q A;  4QHO A;  2H7V C;  3E0Z A;  5JDN A;  5JQG E;  3D0T A;  1E1H B;  2D0U A;  1FMW A;  1LVF A;  3ZN0 B;  5A1L A;  2LHR A;  1OWA A;  2XAQ B;  3HL6 A;  2KMF A;  2CM0 A;  2NP9 A;  3N9L A;  2Z6E A;  3C50 A;  4JEU B;  5LNK A;  5FYM A;  3LFM A;  2LOS A;  2SPC A;  5HYA A;  2ACX A;  3CX7 B;  4BA9 A;  2BVL A;  3SWH A;  1YKE B;  2NTX A;  2WWU A;  3AAA B;  4UV9 B;  2WSS V;  2X66 A;  3ZMZ B;  3UUL A;  3GWH A;  3P7I A;  3RRC A;  3KV9 A;  3ZJ2 A;  4PNI A;  3CQX C;  3FXD B;  4PK5 A;  2KZ7 B;  5LGN B;  2W0G A;  4EYY R;  2A2F X;  1D1A A;  1LRZ A;  4H9R C;  4ADZ A;  1AJ3 A;  5LGU B;  2VL8 A;  5CA0 E;  3LG7 A;  4MBQ A;  4ZI2 C;  1MMN A;  2KXP B;  4UVB B;  2XQY A;  3KBU A;  4WW0 A;  3PU8 A;  1SHZ C;  4OYK A;  2WM9 A;  4ZS3 A;  2WMO A;  4AQG A;  5LCY A;  3F57 A;  1LVK A;  5CA1 E;  1WYB A;  2JPF A;  4H63 V;  2HPJ A;  3PDY A;  4V1A v;  3U3I A;  2KWI B;  3C4W A;  3MA9 A;  3ZC0 A;  3PUA A;  3P8C D;  5KX5 E;  1NWM X;  3W15 B;  4B6X A;  2VKH A;  5HXE A;  5H6R B;  3HA4 A;  2H3R A;  3QK6 A;  3K8P C;  1IJ5 A;  4MHC A;  4PJM A;  1KK7 A;  2M67 A;  5FY0 A;  4O2B E;  5ETW A;  1QUU A;  4DBR A;  3ZLI A;  3ZCI A;  3KDS E;  2E9X D;  3PE0 A;  3I0Q A;  3UTK A;  2NW7 A;  4O4J E;  4DMV A;  2GK9 A;  1S35 A;  2UXX B;  2P9B A;  4N78 D;  2JQQ A;  2XAS B;  3IHR A;  2NTY A;  3CX6 B;  1HS7 A;  5LJN A;  5DQV A;  1WLX A;  1KNZ A;  3HI2 A;  2B1E A;  4OHF A;  3DP7 A;  3MXZ A;  4ERR A;  5KMG P;  3N2O A;  2CCQ A;  3C4X A;  3RRW A;  3FBL A;  2HPL A;  4AKR B;  5EK2 A;  1MIV A;  4UF0 B;  2V7M A;  3L09 A;  4Z8X A;  2DHR A;  2NOX A;  3UUX B;  4H9O C;  2OA5 A;  4UIG A;  5KDM C;  4C91 A;  2A72 A;  4ZI3 C;  1O3X A;  2ZM8 A;  3MJX A;  2XTL A;  3ZYM A;  5F3J A;  3CWZ B;  4QX7 B;  3ZMS B;  4M1P A;  5FXX A;  4ZHQ E;  1G8X A;  1CUN A;  4U74 A;  5L3G B;  4WBN E;  2N1G A;  2Y8D A;  3ANW B;  4UEM A;  5JDL A;  3IEE A;  2Q9Q D;  3O1H A;  2YU1 A;  2DCF A;  5EK4 A;  2I59 A;  2NW8 A;  1MMD A;  4AKH A;  5L3C B;  3K3Q C;  2X9X A;  3B13 A;  4WBO A;  4X1I E;  3TKL B;  1LKX A;  2UXN B;  3K3N A;  2KLQ A;  3H3A A;  3NRX A;  3RC8 A;  5JVD E;  3ONX A;  2VAS A;  4HGA A;  3VKG A;  2HH7 A;  2YK0 A;  2J1D G;  1NAF A;  4X20 E;  4L0R A;  4QXC B;  4X1Y E;  4GK0 E;  5GON E;  3BQL A;  2A3D A;  2VB6 A;  4DND A;  2XAG B;  4MLK A;  2G0U A;  3HR0 A;  3IBP A;  2IC9 A;  5HXR A;  5JRC B;  2LM9 A;  2EHO A;  2CWO A;  4H9Q C;  4XBF B;  2CXL A;  2BDE A;  3DTO A;  3BK9 A;  5LYJ E;  3PUR A;  2MBG A;  4QKN A;  2BZB A;  1IZN B;  4G2A A;  2LOP A;  4L5G A;  5LGT B;  2WMN A;  4PJJ A;  4X1K E;  4UVA B;  3KFW X;  4HN9 A;  2V7I A;  2W63 A;  4IHJ E;  1D0Y A;  2LSK A;  5LHI B;  3NBX X;  4KP3 C;  5BMV E;  2X9Y A;  3M65 A;  3ESL A;  3KV6 A;  4P09 A;  3C64 A;  4O4L E;  3B57 A;  3RC3 A;  3O4X E;  2N2N A;  3SOL A;  3UT5 E;  2YU2 A;  2DNX A;  4H9P C;  5JDQ A;  5LXT E;  3KVB A;  5HWX A;  4H9N C;  2C5K T;  3I1A A;  3CQC B;  3LK2 B;  2C0S A;  5LOV E;  4ILU A;  4DBQ A;  2K24 A;  4HFV A;  5JDF A;  5L3E B;  1UX5 A;  3CX8 B;  5ADX L;  3FXE B;  2CA5 A;  2JRK A;  1B7T A;  2K9A A;  1ZHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...