4QXCB

Crystal structure of histone demethylase kdm2a-h3k36me2 with nog
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 17
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxcB00
4QWNB 4QXHB 4QXCB 4QX8B 4QXBB 4TN7B 4QX7B
chains in the Genus database with same CATH superfamily
5IUXA 2IMLA 4DV2T 2OA5A 1J1JA 4HFBA 3K3OA 3I9WA 2XY8B 5KDMC 2X51A 5HXHA 4YHHT 4IDNA 2Q9QA 5LNKA 2LSJA 3KVBA 3FXDB 5F8PA 4ASKA 4ILBA 1SHZC 2FUPA 4EYYR 5KX5E 1BR2A 5LG3A 2XAQB 1OWAA 5M4YA 3FXEB 5AQHB 5AQKB 2K48A 4COFA 3LFMA 1XDOA 1WFDA 3OPCA 3PUQA 3Q5DA 2Q9QD 4CXWA 1D1CA 2A3DA 4I4TE 5AQRB 3P7IA 5L3EB 3KBUA 3EABA 1T98A 4YJ2E 2N1GA 2XJ7A 4IDZA 3TLUA 3PUGA 2W62A 2LOSA 4Z91A 2H89A 4DV6T 2XTLA 3I0QA 4X62T 2CEAA 1MMNA 5J2UE 3SFEA 5ADXL 3UU3A 1KNRA 4TX5A 2ACZA 4HFVA 4ZEYA 2JQKA 3CMLA 2H88A 2LSIA 3QB5A 2XQ4A 4IREA 3JCFA 5AQJB 5AQNB 3AAEB 4PFOA 3M65A 3LK3B 4YTMA 2C5JA 5H6RB 2XAHB 4HTEA 4AQFA 1HX8A 4YXDA 2YINA 2DNXA 3AEDA 4OYKA 4X1YE 2CWOA 1E2AA 2VVNA 2BVMA 4I55E 3AE6A 1N33T 2CLYB 2UU9T 5FKYA 4XZCA 3E22E 2YDSA 3AA0B 4UR9A 1Y64B 2WM9A 4OK0A 3ZC0A 3BK9A 1T7SA 3KINB 2CCQA 5A1LA 4CI2B 3ETVA 5KMGP 4ZXLA 2MAWA 5TAOA 5FY7A 1FMVA 2C5KT 2XPKA 2DHRA 4KMCA 2LLYA 3PUXF 4HFDA 3R6NA 3RYHE 4X1IE 3C50A 2V7KA 1HNZT 4UEMA 2D5UA 2HHHT 1IAPA 2WP9A 1OEDC 1I6ZA 4H9PC 3FHNA 5AQPB 4U33A 3VKGA 2V8SV 3N9PA 4AKGA 2BG9A 4HWDA 3C4WA 4ILAA 2ODVA 5FP3A 2DWGA 2G0UA 2YK0A 4O8SA 2YEVC 2X9HA 5J1GA 3AXJB 4DV3T 3OTOT 4I43B 2WU5A 2V6YA 4IE5A 5FL0A 3X1DA 3A5XA 1XNRT 2XSBA 4HFEA 2IW5B 1MIVA 3Q9DA 1NEKA 3PUVF 3AVRA 2QRXA 2V26A 4G2AA 3M3ZB 1NENA 1I94T 3VRAA 2XM1A 4B3TT 3DP7A 3UU6A 1US7B 4ZS3A 3QNUA 3ZPOA 2V5DA 3RH3A 4IGUA 2A2FX 2BKPA 2VQET 3VR8A 4QH5A 1KK7A 4KHZF 4A56A 2E9XB 4AKIA 4OYJA 4AQFC 3HA4A 4PK6A 5LP6E 5LA6E 4KI0F 2KNDA 2V1DB 3OVUA 3N2KE 4AQGA 4BA9A 5AQOB 1QUUA 2CRBA 3GWHA 5FXXA 3ZCJA 2BS4A 4HFHA 1ZEEA 4IE7A 1N36T 1Y01A 3P50A 4TWFA 2EHOB 4L9IA 3UQ4A 3QOFA 3W15B 3FBZA 2LKHA 2ZMAA 3RX6A 2BDEA 1WYBA 4QKNA 5LXTE 2WDVA 4QWNB 3HKBE 3N5LA 1HF8A 4JEUB 5DJQC 2HN2A 2AXDS 3LG7A 1XWMA 1UCUA 2J1DG 5EK2A 3KFWX 4L0RA 5FXWA 2JQQA 3CPZA 3SRZA 4EAHA 4YTPA 4TWHA 2W0GA 1E1HB 4GKJT 4ILCA 3AE5A 4QH1A 5AQLB 1W9RA 4PK4A 5JVDE 3AA7B 3F57A 1IJ6A 3CK6A 4H9QC 1MNEA 2JIWA 5JQGE 3N9MA 2KMFA 4LF7T 1CHUA 3RF1A 4DR7T 5HWXA 2YKSA 3UU5A 3N9LA 2VKJA 3C98B 1FIOA 3ZN0B 3LBXB 2LSYA 4K0KT 3ESLA 2PBIA 3UFEA 5JR9B 3PUSA 2XQ7A 2IHR1 2X9WA 3A7MA 4O2AE 1U5PA 4MFRA 4JI8T 2OLTA 2YDRA 5AFUL 4UF0A 3SFDA 3R84B 3UUNA 2XQAA 5JTGA 4DV5T 1XMOT 3ZYMA 3RPUA 3TLSA 3BQKA 3PUZF 3RC8A 1EZ3A 3RQUA 4BJMA 1LVFA 3ZYKA 2N2NA 2VKHA 4TNWA 3UUMA 5ABHA 1MMGA 4EIWA 4U72A 3ZSSA 2ZM8A 3FZHB 3H37A 4ZS2A 1X9BA 4UV8B 4EB6E 4HKAA 2UXDT 5LMNT 2A72A 4WBOA 3T8OA 2XHEB 2YU1A 2QVAA 4G63A 2WWUA 4YHJA 3AEBA 1N32T 2W67A 2LHRA 4AQYT 2XQYA 1KEYA 3CX6B 3RGLA 4DR2T 2DI4A 2LEHA 4QX8B 2LJLA 3ZYLA 4AKHA 2BG9E 4HFIA 5LG4A 3CQCB 2K5BB 4GYRA 4U31A 2KINB 1T72A 5HEUA 5FVLA 1IBMT 5JRCB 3H3MA 3MJXA 3KV4A 5JREA 3FZFB 4M1PA 2MBGA 4LF6T 3JC6C 3UUBA 2H7OA 3AE4A 2WSSV 3HI2A 2JPFA 2H3RA 2CA5A 4YSYA 3MA9A 3FBLA 3PDYA 2LRKA 1J5ET 4U3CA 3NRYA 1ZV4X 4QHOA 4EV6A 3A8YC 2LSKA 2WCAA 2X0HA 5IYZE 5CJ5A 1OEDA 5C8YE 2LKGA 5BR8T 5F5WA 4DR1T 2W00A 3E0ZA 2Y48B 2JMKA 1S94A 2JQ9A 2E9XA 2WY2A 2ZM6T 4A97A 2AE9A 5FL1A 4Q25A 2FJAA 4H63V 4C90A 2BKOA 1DU2A 5JDMA 3C51A 2XQ8A 4TV8E 5HEHA 4AIUA 5L3GB 1ZHCA 3RC3A 3P4WA 3GA8A 5HEJA 3VU7H 2XM2A 4PJMA 4LMKA 5L3BB 3F31A 5L3FB 2E9XD 1WCRA 3AEEA 3ZMUB 2V7JA 4JI0T 2LSGA 2NWBA 3FZMB 3AE8A 4NUVA 4WYVA 1R8IA 2I6HA 2CE7A 2UUCT 1WR6A 3QB5K 3Q5XA 5CA1E 4YSXA 2E5VA 4DV1T 2VWAA 1U4QA 4DV7T 1YKEB 4GKKT 1KF6A 4ZI3C 4PAGA 2NP9A 2WDQA 4QX7B 1VCSA 5ABFB 2KT9A 2V5CA 4LF8T 2NOXA 3VHLA 1D0ZA 3NWIA 3SWHA 1YXRA 4GYSA 4EXTA 2CMRA 3C4XA 3KDSE 3TLWA 2V6XA 4DMWA 4UV9B 4WBNE 2KSRA 4GOUA 2IC6A 2XQ9A 3N2GE 5HXSA 4AKLA 5LYJE 4A98A 5IHYA 3LBXA 5E0OA 4DV0T 3OYZA 1JNRA 1HCIA 5FYMA 3CKDA 2J47A 4X1KE 1YD8G 4ILUA 3EDUA 2VKDA 2NW7A 2DCFA 3NRXA 4DBRA 3KV5A 5AQGB 1MMDA 1HG5A 3AEAA 3ZMTB 2JQHA 4QXHB 4PJLA 2M67A 2UXCT 2E9XC 3O4XE 1L0VA 5JDQA 4J2CA 4HGAA 3ANWA 4DIDB 4OX9T 2WU2A 2XAGB 4HWFA 5HXEA 3WAJA 4X64T 3VKHA 4U2YA 2YN6A 3NZQA 4DR4T 4DR5T 4EEDA 4IL4A 3N9OA 5L4HA 3MKDA 5AQQB 3SS1A 2XUEA 2ZLYA 1ZOYA 5JH7E 2Q9QB 2W2UA 3AAAB 5EK4A 2EHOC 3HL6A 4I0UA 3AE9A 1IBLT 3QC9A 3B13A 1J5WA 5L47A 3ZT6A 4HE8A 4WNKA 2E5LT 5HXCA 2IAKA 3UUXB 4EZHA 3AE1A 5JDGA 2FJDA 2CM0A 1Z8UA 2QGSA 4TV9E 5EZYE 3Q2MA 1S35A 3ZMZB 4UELA 4ZHQE 2KXPB 4HWCA 4X20E 3DJBA 4HFCA 4WZXA 4B3MT 3I0OA 1NAFA 5LCYA 2X0LB 4YFSA 2UUBT 3ZMSB 1UX4A 2XQ6A 5EK3A 4AKRB 1NWMX 2X68A 4LFBT 3UQ7A 2W4XA 2KWIB 5JRCA 3I1AA 4PFPA 4H9SE 2V7MA 4JV5T 5JDFA 3B5MA 5LB7B 3QUJA 2XSAA 3SOLA 3ONJA 5JR9C 2BS3A 4ZI2C 5AQMB 3NBXX 1UGOA 4LMLA 4KP3C 3N9QA 2KLQA 4MLKA 4YJ3E 4XBFB 1OEDE 2B76A 3UU8A 4KX6A 1N34T 4AXPA 4H9RC 5JDLA 5J0ZA 1HG2A 1YW0A 3ETUA 4IDQA 4UVAB 5HEGA 2NW9A 2CXLA 5LHIB 4ERRA 5AQIB 3LK42 2IDOB 5F3JA 1HFAA 5AQVB 2XAJB 3CIRA 3HR0A 3JAEA 2MPKA 1UK5A 2LM2A 4U2ZA 3PUAA 2F4VT 2CHOA 3HKDE 4P0BA 2LM9A 5KXJA 4HN9A 3IEEA 2MTQA 4JBWF 3TLTA 3TKLB 4KBMB 3ABVA 2JMHA 4ZI7E 2E8IA 2D9DA 1BR1A 2K24A 2X9XA 1XDPA 5FXZA 5H6QB 2WMNA 3PJAA 4H63H 3OYXA 4U7YA 3CVRA 4UVBB 1YQ4A 2XZEA 3G06A 4ZZBA 3JC6D 5ETWA 5LHGB 4DO0A 4DR3T 3OKQA 4JEHB 3RYFE 2BG9B 1FJGT 3FZKB 4LMJA 2ZM0A 2KWHA 4PJNA 2M6BA 4P09A 4Z8XA 3RLFF 4OHFA 4DUYT 4CXYA 5FVKA 4PNIA 3BQIA 2XASB 2CXFA 3I9YA 1MMAA 5LGTB 3HKEE 5LGNB 2VQFT 3PU3A 1W0AA 4FI5A 3GN5B 2CHNA 2Z6EA 4JI5T 2XQ3A 2XQ5A 3V5SA 3RKGA 2MYSA 2JJ9A 1CUNA 4WW0A 2ZM2A 3K3NA 4NXNT 1M62A 3PTRB 4O4IE 2V7LA 3O1IA 3U3IA 3GMIA 3KV6A 2VL0A 2L9QA 3RYCE 2VK9A 2PFVA 1HX1B 4TN7B 5AQUB 3RQWA 2R6GF 3AE3A 5LHHB 3P4QA 2NTXA 4QH4A 1FMWA 5L3CB 3T1YT 2VASA 1LKXA 3PE0A 4MHCA 3CQGB 3RRCA 3UTKA 3IBPA 3N2OA 2J4GA 4I50E 5HCMA 5GONE 2FBWA 4JI2T 3EHZA 4DR6T 1D0YA 4IE0A 3AXJA 3MACA 3AECA 3L3PA 4ZI3D 2WAUA 5LBQB 2WWVA 3P4PA 4IE6A 1BR4A 3L39A 3C64A 4GIWA 1IJ5A 2ES0A 3PURA 3P8CD 1UX5A 5CGMA 1X79A 1WRDA 4U74A 5AQFB 3O1HA 3NVOA 5BMVE 3O9XA 5FXVA 4UIGA 3LDQB 5LOVE 4X66T 2Y8DA 2KZ7B 4NUUA 1UUSA 1SUMB 5HWYA 5CFBA 5HXRA 2NR4A 4JI4T 4EEBA 4X65T 1G73A 1WLXA 3MK7C 2WZHA 4ISTA 3U78A 3TLVA 3IF8B 3BQLA 4PJJA 4TNVA 5DABA 2CLYC 2I0MA 2MOZA 4LF9T 2BS2A 3HKCE 4CN4A 2D2SA 1VRBA 3KVAA 3RRWA 4NXMT 2WZIA 3AEFA 4Z90A 4YT0A 1Z0PA 4AI6A 4IL9A 2RA1A 3ZJ2A 4DUZT 3EDVA 2X0YA 1MNDA 2HH7A 2CPTA 1XZYA 4UF0B 4TUYE 2ODUA 2UXXB 4F8HA 2EHOA 3F2EA 3K3QC 4JI3T 3L8RA 1GQEA 3RYIE 4KHPT 4IDOA 1LRZA 3ZT7A 1SE7A 3FZLB 4BAYB 1KNPA 2Y6XA 4ZZCA 3LSVA 5FY1A 1T8BA 5C2TA 2CWYA 3N9NA 2EHOD 4PW8A 5JDHA 1IZNB 4EZ4A 1HR0T 1WYCA 1QLBA 4BJNA 1W0BA 2QA7A 5DQWA 5HEOA 3J7Yq 5FY0A 4GK5E 5FNVE 2LOPA 4B3ST 1YKHB 3EVYA 2CXDA 1KFYA 2QYWA 4PK5A 1BR0A 5JR9A 2OV9A 1V9DA 3CQXC 4JUYA 3AEGA 2I59A 5LJMA 4IDPA 2WB5A 2A9UA 3CX7B 3VRBA 1B7TA 4A5XA 1G8XA 2YDQA 4V1Av 2Q9QC 2DL1A 3B57A 2WQYA 2H7VC 2RP4A 3C4ZA 3ZSTA 1H7CA 4P0AA 4ZI2D 3WI3A 2LE8A 2P9BA 2UXBT 3UU4A 3JADA 3MXZA 1ZKEA 3Q5WA 2CBIA 4B3RT 2N9DA 1W09A 2BBJA 3EUHA 4IT4A 3K8PC 2LT3A 5ABEA 4JI6T 5JDNA 3AAIA 3IHRA 4ZOLE 2D0UA 4H9OC 2VURA 4HEAA 3LK2B 2WS3A 3ZCIA 4UVCB 3Q5EA 3PV0F 4CN1A 2DLRA 4L5GA 1HNXT 4FJOA 4O4JE 4X5TA 3KV9A 2B1EA 4TWDA 4IE4A 5C3JA 2W63A 3OBVE 3PU8A 3GN5A 2W61A 4NPPA 2K9AA 2PG8A 1OEDB 3ZMVB 1FEWA 4LF4T 4YSZA 3ZC1A 3IA3A 2VL8A 4IIJE 2VB6A 4C91A 3ZKRA 3OJAA 2L8KA 4U7IA 2IUBA 2E2AA 3AE2A 3RI5A 2C5IT 1SA0E 2BKNA 4NIQA 4HWHA 3EAMA 3ONLC 2NW8A 3RIFA 2DWKA 4HWIB 3RIUA 2UXNB 2CBJA 2ACXA 5ABGA 3DTOA 3O1JA 2WMOA 4ISSA 2J62A 2X67A 4K0UA 1IBKT 2HPJA 5CA0E 1XMQT 4MBQA 2RPAA 3MZKB 5L4EA 3WAKA 2IIUA 1AJ3A 2HPLA 2VVSA 1XNQT 4CQIA 2W66A 4DBQA 4O4LE 3S4UA 5LMUT 4O2BE 1ZP0A 4IHJE 3P4RA 5L3DB 3J9X1 1JNZA 4CI3B 2WDRA 2PTFA 4YLHA 1MIYA 2LHNA 4P1NA 3ZJ1A 4EOZB 2BG9C 3PUWF 4MALA 3UULA 3FB2A 3L09A 3NKZA 4TZ4C 4N78D 2YU2A 4JI7T 1LVKA 4DVDA 1KNZA 2FJBA 3AA1B 3H3AA 5AQTB 4AISA 3AE7A 4JLEA 2V7IA 2VKOA 4JYAT 3ZT5A 2BBHA 4OFZA 4CN6A 2IC9A 5LJNA 4ADZA 3ZN1B 4XAXB 4CI1B 4JI1T 4UXNB 4LF5T 5HAXA 4LFCT 5DQVA 4EYUA 1O3XA 4CXXA 5AQSB 2XAFB 5CB4E 2X66A 3VR9A 2GK9A 2BVLA 2PJQA 3ANWB 1M7KA 3K1SA 1D0XA 1HNWT 5HYAA 2V6YB 4EGWA 3AB3B 4YTNA 1HTJF 1MIWA 4B6XA 2JRKA 3ZLIA 3UFGA 5FMNA 3T1HT 2HN1A 5ABFA 4LFAT 3RHWA 2UUAT 4KUMB 3RKOA 4YY3T 3QK6A 4CZZB 3RIUC 4H9NC 1VOMA 3NZPA 3PUYF 2BZBA 1WR0A 3ONXA 3RIAA 5HCJA 1D1BA 3AVSA 2WBLA 3AA6B 4ANJA 2SPCA 3EI0A 1HS7A 3P4SA 4E7SA 4O4HE 4DMVA 3CWZB 5LGUB 1VCTA 3KBTA 3CX8B 2M6IA 4DV4T 2NTYA 2K3WA 3D0TA 1QSDA 2FJEA 2L3LA 2LRLA 2X9YA 5J2TE 1UURA 4E7ZA 4F6RC 2YOEA 3PJAJ 1D1AA 3JAFA 5IWAT 4QXBB 3V5UA 4GK0E 2C0SA 4DNDA 2D0TA 3E08A 1YQ3A 5L2LA 1OXZA 4QXCB 3UT5E 5LBMA 1E7PA 3LJCA 3ZEFB
chains in the Genus database with same CATH topology
3UUXB 4EZHA 5JDGA 2CM0A 2OA5A 2QGSA 1WYCA 4TV9E 5AFUL 4UF0A 4BJNA 5EZYE 3R84B 2QA7A 3UUNA 3Q2MA 5DQWA 1S35A 3J7Yq 3ZMZB 3K3OA 4UELA 5FY0A 3I9WA 3ZYMA 4ZHQE 2KXPB 4GK5E 5FNVE 2LOPA 3RPUA 1YKHB 4X20E 3DJBA 3I0OA 1NAFA 3BQKA 3EVYA 5KDMC 2CXDA 2X51A 5LCYA 5HXHA 2X0LB 4PK5A 1BR0A 3RC8A 1EZ3A 4YFSA 4BJMA 1LVFA 5JR9A 3ZMSB 5LNKA 2Q9QA 1UX4A 5EK3A 4AKRB 1NWMX 1V9DA 2LSJA 3KVBA 2X68A 2N2NA 3CQXC 3ZYKA 3FXDB 5F8PA 2VKHA 4JUYA 2I59A 4ASKA 5LJMA 2KWIB 5JRCA 1SHZC 3UUMA 3I1AA 4PFPA 3CX7B 1MMGA 4EYYR 1B7TA 4H9SE 5KX5E 1BR2A 2V7MA 2XAQB 5JDFA 1OWAA 5M4YA 1G8XA 3QUJA 4EIWA 3FXEB 3SOLA 4U72A 2K48A 5JR9C 2ZM8A 4V1Av 2Q9QC 4ZI2C 3B57A 3H37A 2H7VC 3NBXX 3LFMA 4ZS2A 2RP4A 4KP3C 3N9QA 3PUQA 3C4ZA 2Q9QD 1H7CA 4CXWA 4P0AA 4UV8B 4ZI2D 2KLQA 3WI3A 4HKAA 1D1CA 4EB6E 2LE8A 2P9BA 4MLKA 2A3DA 4YJ3E 2A72A 4WBOA 4I4TE 4XBFB 3P7IA 5L3EB 3MXZA 1ZKEA 3KBUA 3T8OA 3Q5WA 2XHEB 2YU1A 4G63A 2WWUA 2N9DA 4YHJA 3EUHA 4AXPA 1T98A 4H9RC 4YJ2E 5JDLA 2LHRA 1HG2A 2N1GA 4IDZA 1YW0A 3K8PC 2XQYA 3PUGA 3CX6B 2W62A 3ETUA 2LOSA 2LT3A 2XTLA 2DI4A 3I0QA 2LEHA 4UVAB 2NW9A 5JDNA 3AAIA 4QX8B 2CXLA 2CEAA 3IHRA 4ZOLE 2D0UA 1MMNA 5LHIB 5J2UE 4H9OC 4ERRA 5ADXL 2LJLA 3LK42 4HEAA 3LK2B 4TX5A 3ZYLA 1HFAA 5F3JA 2XAJB 4AKHA 3HR0A 4HFVA 3ZCIA 4UVCB 3CMLA 5LG4A 3PUAA 2DLRA 3CQCB 4L5GA 2LSIA 2K5BB 4FJOA 4GYRA 4O4JE 3HKDE 3KV9A 4P0BA 2KINB 2B1EA 2LM9A 4HN9A 4IE4A 3IEEA 3AAEB 4PFOA 2W63A 3OBVE 3M65A 2MTQA 3LK3B 3PU8A 2C5JA 5H6RB 2XAHB 3TKLB 5JRCB 4KBMB 3GN5A 2W61A 4HTEA 2JMHA 3MJXA 4AQFA 1HX8A 4ZI7E 2E8IA 2DNXA 2YINA 2K9AA 4EZ4A 2PG8A 4OYKA 1BR1A 4X1YE 2CWOA 2BVMA 3KV4A 4I55E 2K24A 5JREA 2X9XA 3ZMVB 1FEWA 4M1PA 2MBGA 5FXZA 2CLYB 3JC6C 5H6QB 2WMNA 3ZC1A 2H7OA 4XZCA 2WSSV 3E22E 2VL8A 3OYXA 4H63H 4IIJE 3HI2A 3CVRA 2JPFA 4UVBB 2VB6A 4C91A 3AA0B 3JC6D 2H3RA 5ETWA 5LHGB 3OJAA 1Y64B 2L8KA 2WM9A 2CA5A 4DO0A 4OK0A 3ZC0A 3BK9A 3MA9A 3OKQA 4JEHB 2C5IT 3FBLA 3PDYA 1SA0E 3KINB 3RYFE 2CCQA 2NW8A 5A1LA 4CI2B 3ETVA 5KMGP 2ZM0A 3NRYA 1ZV4X 2KWHA 4QHOA 4PJNA 5FY7A 1FMVA 2LSKA 5TAOA 2C5KT 2DWKA 4P09A 4Z8XA 5IYZE 4OHFA 4CXYA 4PNIA 2DHRA 3BQIA 4KMCA 5C8YE 2UXNB 2ACXA 2XASB 2CXFA 3R6NA 3RYHE 4X1IE 3DTOA 3C50A 3O1JA 2WMOA 1MMAA 3I9YA 5LGTB 2V7KA 2W00A 3E0ZA 4ISSA 4UEMA 2Y48B 2JMKA 1S94A 2D5UA 3HKEE 2X67A 4K0UA 5LGNB 1IAPA 2E9XA 2HPJA 5CA0E 3PU3A 4H63V 4MBQA 3MZKB 4FI5A 4C90A 4H9PC 3GN5B 3FHNA 3WAKA 2Z6EA 1AJ3A 3V5SA 3VKGA 2HPLA 5JDMA 3C51A 3N9PA 4TV8E 4CQIA 5L3GB 4AKGA 1ZHCA 2MYSA 2JJ9A 3RC3A 4DBQA 3C4WA 1CUNA 3GA8A 2ZM2A 4WW0A 3VU7H 2ODVA 5FP3A 4O4LE 3K3NA 3S4UA 2DWGA 2G0UA 2YK0A 4O8SA 4O2BE 2YEVC 4PJMA 5HXCA 2X9HA 4IHJE 5J1GA 5L3BB 3PTRB 3F31A 5L3DB 4O4IE 3J9X1 5L3FB 4CI3B 2V7LA 3O1IA 3U3IA 2E9XD 3GMIA 4YLHA 3ZMUB 1MIYA 4I43B 2LHNA 2V7JA 3KV6A 2L9QA 3RYCE 4IE5A 3ZJ1A 4EOZB 2VK9A 2LSGA 2NWBA 2PFVA 4NUVA 4MALA 3UULA 3A5XA 4TN7B 2IW5B 3FB2A 1MIVA 3L09A 3Q9DA 2CE7A 5LHHB 4TZ4C 3AVRA 2NTXA 4N78D 2YU2A 1FMWA 2V26A 4G2AA 5L3CB 1WR6A 1LVKA 2VASA 4DVDA 1LKXA 3PE0A 3Q5XA 3CQGB 4MHCA 3RRCA 1KNZA 3DP7A 3UTKA 3IBPA 1US7B 3N2OA 4I50E 5CA1E 4ZS3A 5GONE 2VWAA 3AA1B 3ZPOA 3H3AA 1U4QA 1YKEB 3RH3A 4JLEA 2V7IA 4IGUA 2A2FX 2VKOA 1D0YA 4ZI3C 4OFZA 4PAGA 2NP9A 4IE0A 1KK7A 2IC9A 3MACA 4A56A 5LJNA 2E9XB 3L3PA 4QX7B 4AKIA 4ADZA 4ZI3D 2WAUA 4OYJA 5LBQB 4AQFC 3ZN1B 2KT9A 4XAXB 4CI1B 2NOXA 4IE6A 3HA4A 3VHLA 1BR4A 4PK6A 1D0ZA 5LP6E 3C64A 3SWHA 4GYSA 4GIWA 4EXTA 4UXNB 2CMRA 3C4XA 5LA6E 3KDSE 1IJ5A 5HAXA 2KNDA 5DQVA 2ES0A 4EYUA 2V1DB 3PURA 4DMWA 3P8CD 1O3XA 4UV9B 4CXXA 4WBNE 2XAFB 3N2KE 4AQGA 1UX5A 5CB4E 2X66A 4BA9A 4GOUA 2IC6A 1X79A 3N2GE 5HXSA 4AKLA 2GK9A 2BVLA 2PJQA 1QUUA 5LYJE 1WRDA 5IHYA 3LBXA 4U74A 3ANWB 5E0OA 3O1HA 3OYZA 3GWHA 5FXXA 3ZCJA 1D0XA 5HYAA 3AB3B 5BMVE 3O9XA 5FXVA 1HCIA 4UIGA 1ZEEA 4IE7A 1HTJF 5FYMA 5LOVE 2Y8DA 2KZ7B 3CKDA 4NUUA 1MIWA 4B6XA 2JRKA 3ZLIA 4X1KE 1YD8G 2EHOB 5HWYA 4L9IA 5FMNA 4ILUA 3EDUA 2VKDA 5HXRA 2NW7A 2DCFA 3NRXA 3W15B 3FBZA 4DBRA 2ZMAA 4KUMB 2BDEA 3RKOA 3RX6A 1WYBA 3QK6A 4CZZB 3KV5A 4QKNA 5LXTE 4H9NC 1MMDA 1G73A 1VOMA 3NZPA 4QWNB 1WLXA 3MK7C 4ISTA 3HKBE 3U78A 1HG5A 3N5LA 2BZBA 3IF8B 1HF8A 3BQLA 4PJJA 4JEUB 5DJQC 3ZMTB 5DABA 3LG7A 3ONXA 4QXHB 2CLYC 1UCUA 2J1DG 5EK2A 2MOZA 4PJLA 1D1BA 3KFWX 4L0RA 2M67A 3AVSA 2E9XC 3HKCE 3O4XE 5FXWA 5JDQA 2WBLA 3AA6B 2JQQA 2D2SA 2SPCA 3CPZA 4ANJA 1VRBA 3KVAA 3SRZA 3RRWA 4EAHA 4J2CA 1HS7A 4HGAA 3ANWA 4E7SA 4O4HE 2W0GA 1E1HB 4DMVA 3CWZB 1Z0PA 2XAGB 5LGUB 4AI6A 3KBTA 4PK4A 2RA1A 5JVDE 3CX8B 3AA7B 3ZJ2A 5HXEA 3F57A 3EDVA 1MNDA 1IJ6A 2HH7A 3WAJA 4H9QC 2NTYA 4UF0B 1MNEA 3D0TA 4TUYE 5JQGE 3N9MA 3VKHA 2ODUA 2UXXB 1QSDA 2EHOA 2KMFA 3F2EA 3NZQA 2L3LA 3K3QC 2X9YA 5J2TE 4E7ZA 5HWXA 3N9OA 4F6RC 3MKDA 1D1AA 3RYIE 3N9LA 3SS1A 2XUEA 2VKJA 3C98B 1FIOA 1LRZA 3ZN0B 4QXBB 3V5UA 3LBXB 2ZLYA 2LSYA 4GK0E 2C0SA 3ESLA 4DNDA 2PBIA 5JH7E 2D0TA 3E08A 3UFEA 5JR9B 5L2LA 2Q9QB 4BAYB 3AAAB 3PUSA 1OXZA 5EK4A 2EHOC 2Y6XA 3HL6A 4QXCB 3QC9A 3UT5E 3B13A 2X9WA 5FY1A 2CWYA 4O2AE 5LBMA 3N9NA 3LJCA 2EHOD 4HE8A 4PW8A 4WNKA 5JDHA 1U5PA 1IZNB 2IAKA 3ZEFB 4MFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWN B;  4QXH B;  4QXC B;  4QX8 B;  4QXB B;  4TN7 B;  4QX7 B; 
#chains in the Genus database with same CATH topology
 5IUX A;  2IML A;  4DV2 T;  2OA5 A;  1J1J A;  4HFB A;  3K3O A;  3I9W A;  2XY8 B;  5KDM C;  2X51 A;  5HXH A;  4YHH T;  4IDN A;  2Q9Q A;  5LNK A;  2LSJ A;  3KVB A;  3FXD B;  5F8P A;  4ASK A;  4ILB A;  1SHZ C;  2FUP A;  4EYY R;  5KX5 E;  1BR2 A;  5LG3 A;  2XAQ B;  1OWA A;  5M4Y A;  3FXE B;  5AQH B;  5AQK B;  2K48 A;  4COF A;  3LFM A;  1XDO A;  1WFD A;  3OPC A;  3PUQ A;  3Q5D A;  2Q9Q D;  4CXW A;  1D1C A;  2A3D A;  4I4T E;  5AQR B;  3P7I A;  5L3E B;  3KBU A;  3EAB A;  1T98 A;  4YJ2 E;  2N1G A;  2XJ7 A;  4IDZ A;  3TLU A;  3PUG A;  2W62 A;  2LOS A;  4Z91 A;  2H89 A;  4DV6 T;  2XTL A;  3I0Q A;  4X62 T;  2CEA A;  1MMN A;  5J2U E;  3SFE A;  5ADX L;  3UU3 A;  1KNR A;  4TX5 A;  2ACZ A;  4HFV A;  4ZEY A;  2JQK A;  3CML A;  2H88 A;  2LSI A;  3QB5 A;  2XQ4 A;  4IRE A;  3JCF A;  5AQJ B;  5AQN B;  3AAE B;  4PFO A;  3M65 A;  3LK3 B;  4YTM A;  2C5J A;  5H6R B;  2XAH B;  4HTE A;  4AQF A;  1HX8 A;  4YXD A;  2YIN A;  2DNX A;  3AED A;  4OYK A;  4X1Y E;  2CWO A;  1E2A A;  2VVN A;  2BVM A;  4I55 E;  3AE6 A;  1N33 T;  2CLY B;  2UU9 T;  5FKY A;  4XZC A;  3E22 E;  2YDS A;  3AA0 B;  4UR9 A;  1Y64 B;  2WM9 A;  4OK0 A;  3ZC0 A;  3BK9 A;  1T7S A;  3KIN B;  2CCQ A;  5A1L A;  4CI2 B;  3ETV A;  5KMG P;  4ZXL A;  2MAW A;  5TAO A;  5FY7 A;  1FMV A;  2C5K T;  2XPK A;  2DHR A;  4KMC A;  2LLY A;  3PUX F;  4HFD A;  3R6N A;  3RYH E;  4X1I E;  3C50 A;  2V7K A;  1HNZ T;  4UEM A;  2D5U A;  2HHH T;  1IAP A;  2WP9 A;  1OED C;  1I6Z A;  4H9P C;  3FHN A;  5AQP B;  4U33 A;  3VKG A;  2V8S V;  3N9P A;  4AKG A;  2BG9 A;  4HWD A;  3C4W A;  4ILA A;  2ODV A;  5FP3 A;  2DWG A;  2G0U A;  2YK0 A;  4O8S A;  2YEV C;  2X9H A;  5J1G A;  3AXJ B;  4DV3 T;  3OTO T;  4I43 B;  2WU5 A;  2V6Y A;  4IE5 A;  5FL0 A;  3X1D A;  3A5X A;  1XNR T;  2XSB A;  4HFE A;  2IW5 B;  1MIV A;  3Q9D A;  1NEK A;  3PUV F;  3AVR A;  2QRX A;  2V26 A;  4G2A A;  3M3Z B;  1NEN A;  1I94 T;  3VRA A;  2XM1 A;  4B3T T;  3DP7 A;  3UU6 A;  1US7 B;  4ZS3 A;  3QNU A;  3ZPO A;  2V5D A;  3RH3 A;  4IGU A;  2A2F X;  2BKP A;  2VQE T;  3VR8 A;  4QH5 A;  1KK7 A;  4KHZ F;  4A56 A;  2E9X B;  4AKI A;  4OYJ A;  4AQF C;  3HA4 A;  4PK6 A;  5LP6 E;  5LA6 E;  4KI0 F;  2KND A;  2V1D B;  3OVU A;  3N2K E;  4AQG A;  4BA9 A;  5AQO B;  1QUU A;  2CRB A;  3GWH A;  5FXX A;  3ZCJ A;  2BS4 A;  4HFH A;  1ZEE A;  4IE7 A;  1N36 T;  1Y01 A;  3P50 A;  4TWF A;  2EHO B;  4L9I A;  3UQ4 A;  3QOF A;  3W15 B;  3FBZ A;  2LKH A;  2ZMA A;  3RX6 A;  2BDE A;  1WYB A;  4QKN A;  5LXT E;  2WDV A;  4QWN B;  3HKB E;  3N5L A;  1HF8 A;  4JEU B;  5DJQ C;  2HN2 A;  2AXD S;  3LG7 A;  1XWM A;  1UCU A;  2J1D G;  5EK2 A;  3KFW X;  4L0R A;  5FXW A;  2JQQ A;  3CPZ A;  3SRZ A;  4EAH A;  4YTP A;  4TWH A;  2W0G A;  1E1H B;  4GKJ T;  4ILC A;  3AE5 A;  4QH1 A;  5AQL B;  1W9R A;  4PK4 A;  5JVD E;  3AA7 B;  3F57 A;  1IJ6 A;  3CK6 A;  4H9Q C;  1MNE A;  2JIW A;  5JQG E;  3N9M A;  2KMF A;  4LF7 T;  1CHU A;  3RF1 A;  4DR7 T;  5HWX A;  2YKS A;  3UU5 A;  3N9L A;  2VKJ A;  3C98 B;  1FIO A;  3ZN0 B;  3LBX B;  2LSY A;  4K0K T;  3ESL A;  2PBI A;  3UFE A;  5JR9 B;  3PUS A;  2XQ7 A;  2IHR 1;  2X9W A;  3A7M A;  4O2A E;  1U5P A;  4MFR A;  4JI8 T;  2OLT A;  2YDR A;  5AFU L;  4UF0 A;  3SFD A;  3R84 B;  3UUN A;  2XQA A;  5JTG A;  4DV5 T;  1XMO T;  3ZYM A;  3RPU A;  3TLS A;  3BQK A;  3PUZ F;  3RC8 A;  1EZ3 A;  3RQU A;  4BJM A;  1LVF A;  3ZYK A;  2N2N A;  2VKH A;  4TNW A;  3UUM A;  5ABH A;  1MMG A;  4EIW A;  4U72 A;  3ZSS A;  2ZM8 A;  3FZH B;  3H37 A;  4ZS2 A;  1X9B A;  4UV8 B;  4EB6 E;  4HKA A;  2UXD T;  5LMN T;  2A72 A;  4WBO A;  3T8O A;  2XHE B;  2YU1 A;  2QVA A;  4G63 A;  2WWU A;  4YHJ A;  3AEB A;  1N32 T;  2W67 A;  2LHR A;  4AQY T;  2XQY A;  1KEY A;  3CX6 B;  3RGL A;  4DR2 T;  2DI4 A;  2LEH A;  4QX8 B;  2LJL A;  3ZYL A;  4AKH A;  2BG9 E;  4HFI A;  5LG4 A;  3CQC B;  2K5B B;  4GYR A;  4U31 A;  2KIN B;  1T72 A;  5HEU A;  5FVL A;  1IBM T;  5JRC B;  3H3M A;  3MJX A;  3KV4 A;  5JRE A;  3FZF B;  4M1P A;  2MBG A;  4LF6 T;  3JC6 C;  3UUB A;  2H7O A;  3AE4 A;  2WSS V;  3HI2 A;  2JPF A;  2H3R A;  2CA5 A;  4YSY A;  3MA9 A;  3FBL A;  3PDY A;  2LRK A;  1J5E T;  4U3C A;  3NRY A;  1ZV4 X;  4QHO A;  4EV6 A;  3A8Y C;  2LSK A;  2WCA A;  2X0H A;  5IYZ E;  5CJ5 A;  1OED A;  5C8Y E;  2LKG A;  5BR8 T;  5F5W A;  4DR1 T;  2W00 A;  3E0Z A;  2Y48 B;  2JMK A;  1S94 A;  2JQ9 A;  2E9X A;  2WY2 A;  2ZM6 T;  4A97 A;  2AE9 A;  5FL1 A;  4Q25 A;  2FJA A;  4H63 V;  4C90 A;  2BKO A;  1DU2 A;  5JDM A;  3C51 A;  2XQ8 A;  4TV8 E;  5HEH A;  4AIU A;  5L3G B;  1ZHC A;  3RC3 A;  3P4W A;  3GA8 A;  5HEJ A;  3VU7 H;  2XM2 A;  4PJM A;  4LMK A;  5L3B B;  3F31 A;  5L3F B;  2E9X D;  1WCR A;  3AEE A;  3ZMU B;  2V7J A;  4JI0 T;  2LSG A;  2NWB A;  3FZM B;  3AE8 A;  4NUV A;  4WYV A;  1R8I A;  2I6H A;  2CE7 A;  2UUC T;  1WR6 A;  3QB5 K;  3Q5X A;  5CA1 E;  4YSX A;  2E5V A;  4DV1 T;  2VWA A;  1U4Q A;  4DV7 T;  1YKE B;  4GKK T;  1KF6 A;  4ZI3 C;  4PAG A;  2NP9 A;  2WDQ A;  4QX7 B;  1VCS A;  5ABF B;  2KT9 A;  2V5C A;  4LF8 T;  2NOX A;  3VHL A;  1D0Z A;  3NWI A;  3SWH A;  1YXR A;  4GYS A;  4EXT A;  2CMR A;  3C4X A;  3KDS E;  3TLW A;  2V6X A;  4DMW A;  4UV9 B;  4WBN E;  2KSR A;  4GOU A;  2IC6 A;  2XQ9 A;  3N2G E;  5HXS A;  4AKL A;  5LYJ E;  4A98 A;  5IHY A;  3LBX A;  5E0O A;  4DV0 T;  3OYZ A;  1JNR A;  1HCI A;  5FYM A;  3CKD A;  2J47 A;  4X1K E;  1YD8 G;  4ILU A;  3EDU A;  2VKD A;  2NW7 A;  2DCF A;  3NRX A;  4DBR A;  3KV5 A;  5AQG B;  1MMD A;  1HG5 A;  3AEA A;  3ZMT B;  2JQH A;  4QXH B;  4PJL A;  2M67 A;  2UXC T;  2E9X C;  3O4X E;  1L0V A;  5JDQ A;  4J2C A;  4HGA A;  3ANW A;  4DID B;  4OX9 T;  2WU2 A;  2XAG B;  4HWF A;  5HXE A;  3WAJ A;  4X64 T;  3VKH A;  4U2Y A;  2YN6 A;  3NZQ A;  4DR4 T;  4DR5 T;  4EED A;  4IL4 A;  3N9O A;  5L4H A;  3MKD A;  5AQQ B;  3SS1 A;  2XUE A;  2ZLY A;  1ZOY A;  5JH7 E;  2Q9Q B;  2W2U A;  3AAA B;  5EK4 A;  2EHO C;  3HL6 A;  4I0U A;  3AE9 A;  1IBL T;  3QC9 A;  3B13 A;  1J5W A;  5L47 A;  3ZT6 A;  4HE8 A;  4WNK A;  2E5L T;  5HXC A;  2IAK A;  3UUX B;  4EZH A;  3AE1 A;  5JDG A;  2FJD A;  2CM0 A;  1Z8U A;  2QGS A;  4TV9 E;  5EZY E;  3Q2M A;  1S35 A;  3ZMZ B;  4UEL A;  4ZHQ E;  2KXP B;  4HWC A;  4X20 E;  3DJB A;  4HFC A;  4WZX A;  4B3M T;  3I0O A;  1NAF A;  5LCY A;  2X0L B;  4YFS A;  2UUB T;  3ZMS B;  1UX4 A;  2XQ6 A;  5EK3 A;  4AKR B;  1NWM X;  2X68 A;  4LFB T;  3UQ7 A;  2W4X A;  2KWI B;  5JRC A;  3I1A A;  4PFP A;  4H9S E;  2V7M A;  4JV5 T;  5JDF A;  3B5M A;  5LB7 B;  3QUJ A;  2XSA A;  3SOL A;  3ONJ A;  5JR9 C;  2BS3 A;  4ZI2 C;  5AQM B;  3NBX X;  1UGO A;  4LML A;  4KP3 C;  3N9Q A;  2KLQ A;  4MLK A;  4YJ3 E;  4XBF B;  1OED E;  2B76 A;  3UU8 A;  4KX6 A;  1N34 T;  4AXP A;  4H9R C;  5JDL A;  5J0Z A;  1HG2 A;  1YW0 A;  3ETU A;  4IDQ A;  4UVA B;  5HEG A;  2NW9 A;  2CXL A;  5LHI B;  4ERR A;  5AQI B;  3LK4 2;  2IDO B;  5F3J A;  1HFA A;  5AQV B;  2XAJ B;  3CIR A;  3HR0 A;  3JAE A;  2MPK A;  1UK5 A;  2LM2 A;  4U2Z A;  3PUA A;  2F4V T;  2CHO A;  3HKD E;  4P0B A;  2LM9 A;  5KXJ A;  4HN9 A;  3IEE A;  2MTQ A;  4JBW F;  3TLT A;  3TKL B;  4KBM B;  3ABV A;  2JMH A;  4ZI7 E;  2E8I A;  2D9D A;  1BR1 A;  2K24 A;  2X9X A;  1XDP A;  5FXZ A;  5H6Q B;  2WMN A;  3PJA A;  4H63 H;  3OYX A;  4U7Y A;  3CVR A;  4UVB B;  1YQ4 A;  2XZE A;  3G06 A;  4ZZB A;  3JC6 D;  5ETW A;  5LHG B;  4DO0 A;  4DR3 T;  3OKQ A;  4JEH B;  3RYF E;  2BG9 B;  1FJG T;  3FZK B;  4LMJ A;  2ZM0 A;  2KWH A;  4PJN A;  2M6B A;  4P09 A;  4Z8X A;  3RLF F;  4OHF A;  4DUY T;  4CXY A;  5FVK A;  4PNI A;  3BQI A;  2XAS B;  2CXF A;  3I9Y A;  1MMA A;  5LGT B;  3HKE E;  5LGN B;  2VQF T;  3PU3 A;  1W0A A;  4FI5 A;  3GN5 B;  2CHN A;  2Z6E A;  4JI5 T;  2XQ3 A;  2XQ5 A;  3V5S A;  3RKG A;  2MYS A;  2JJ9 A;  1CUN A;  4WW0 A;  2ZM2 A;  3K3N A;  4NXN T;  1M62 A;  3PTR B;  4O4I E;  2V7L A;  3O1I A;  3U3I A;  3GMI A;  3KV6 A;  2VL0 A;  2L9Q A;  3RYC E;  2VK9 A;  2PFV A;  1HX1 B;  4TN7 B;  5AQU B;  3RQW A;  2R6G F;  3AE3 A;  5LHH B;  3P4Q A;  2NTX A;  4QH4 A;  1FMW A;  5L3C B;  3T1Y T;  2VAS A;  1LKX A;  3PE0 A;  4MHC A;  3CQG B;  3RRC A;  3UTK A;  3IBP A;  3N2O A;  2J4G A;  4I50 E;  5HCM A;  5GON E;  2FBW A;  4JI2 T;  3EHZ A;  4DR6 T;  1D0Y A;  4IE0 A;  3AXJ A;  3MAC A;  3AEC A;  3L3P A;  4ZI3 D;  2WAU A;  5LBQ B;  2WWV A;  3P4P A;  4IE6 A;  1BR4 A;  3L39 A;  3C64 A;  4GIW A;  1IJ5 A;  2ES0 A;  3PUR A;  3P8C D;  1UX5 A;  5CGM A;  1X79 A;  1WRD A;  4U74 A;  5AQF B;  3O1H A;  3NVO A;  5BMV E;  3O9X A;  5FXV A;  4UIG A;  3LDQ B;  5LOV E;  4X66 T;  2Y8D A;  2KZ7 B;  4NUU A;  1UUS A;  1SUM B;  5HWY A;  5CFB A;  5HXR A;  2NR4 A;  4JI4 T;  4EEB A;  4X65 T;  1G73 A;  1WLX A;  3MK7 C;  2WZH A;  4IST A;  3U78 A;  3TLV A;  3IF8 B;  3BQL A;  4PJJ A;  4TNV A;  5DAB A;  2CLY C;  2I0M A;  2MOZ A;  4LF9 T;  2BS2 A;  3HKC E;  4CN4 A;  2D2S A;  1VRB A;  3KVA A;  3RRW A;  4NXM T;  2WZI A;  3AEF A;  4Z90 A;  4YT0 A;  1Z0P A;  4AI6 A;  4IL9 A;  2RA1 A;  3ZJ2 A;  4DUZ T;  3EDV A;  2X0Y A;  1MND A;  2HH7 A;  2CPT A;  1XZY A;  4UF0 B;  4TUY E;  2ODU A;  2UXX B;  4F8H A;  2EHO A;  3F2E A;  3K3Q C;  4JI3 T;  3L8R A;  1GQE A;  3RYI E;  4KHP T;  4IDO A;  1LRZ A;  3ZT7 A;  1SE7 A;  3FZL B;  4BAY B;  1KNP A;  2Y6X A;  4ZZC A;  3LSV A;  5FY1 A;  1T8B A;  5C2T A;  2CWY A;  3N9N A;  2EHO D;  4PW8 A;  5JDH A;  1IZN B;  4EZ4 A;  1HR0 T;  1WYC A;  1QLB A;  4BJN A;  1W0B A;  2QA7 A;  5DQW A;  5HEO A;  3J7Y q;  5FY0 A;  4GK5 E;  5FNV E;  2LOP A;  4B3S T;  1YKH B;  3EVY A;  2CXD A;  1KFY A;  2QYW A;  4PK5 A;  1BR0 A;  5JR9 A;  2OV9 A;  1V9D A;  3CQX C;  4JUY A;  3AEG A;  2I59 A;  5LJM A;  4IDP A;  2WB5 A;  2A9U A;  3CX7 B;  3VRB A;  1B7T A;  4A5X A;  1G8X A;  2YDQ A;  4V1A v;  2Q9Q C;  2DL1 A;  3B57 A;  2WQY A;  2H7V C;  2RP4 A;  3C4Z A;  3ZST A;  1H7C A;  4P0A A;  4ZI2 D;  3WI3 A;  2LE8 A;  2P9B A;  2UXB T;  3UU4 A;  3JAD A;  3MXZ A;  1ZKE A;  3Q5W A;  2CBI A;  4B3R T;  2N9D A;  1W09 A;  2BBJ A;  3EUH A;  4IT4 A;  3K8P C;  2LT3 A;  5ABE A;  4JI6 T;  5JDN A;  3AAI A;  3IHR A;  4ZOL E;  2D0U A;  4H9O C;  2VUR A;  4HEA A;  3LK2 B;  2WS3 A;  3ZCI A;  4UVC B;  3Q5E A;  3PV0 F;  4CN1 A;  2DLR A;  4L5G A;  1HNX T;  4FJO A;  4O4J E;  4X5T A;  3KV9 A;  2B1E A;  4TWD A;  4IE4 A;  5C3J A;  2W63 A;  3OBV E;  3PU8 A;  3GN5 A;  2W61 A;  4NPP A;  2K9A A;  2PG8 A;  1OED B;  3ZMV B;  1FEW A;  4LF4 T;  4YSZ A;  3ZC1 A;  3IA3 A;  2VL8 A;  4IIJ E;  2VB6 A;  4C91 A;  3ZKR A;  3OJA A;  2L8K A;  4U7I A;  2IUB A;  2E2A A;  3AE2 A;  3RI5 A;  2C5I T;  1SA0 E;  2BKN A;  4NIQ A;  4HWH A;  3EAM A;  3ONL C;  2NW8 A;  3RIF A;  2DWK A;  4HWI B;  3RIU A;  2UXN B;  2CBJ A;  2ACX A;  5ABG A;  3DTO A;  3O1J A;  2WMO A;  4ISS A;  2J62 A;  2X67 A;  4K0U A;  1IBK T;  2HPJ A;  5CA0 E;  1XMQ T;  4MBQ A;  2RPA A;  3MZK B;  5L4E A;  3WAK A;  2IIU A;  1AJ3 A;  2HPL A;  2VVS A;  1XNQ T;  4CQI A;  2W66 A;  4DBQ A;  4O4L E;  3S4U A;  5LMU T;  4O2B E;  1ZP0 A;  4IHJ E;  3P4R A;  5L3D B;  3J9X 1;  1JNZ A;  4CI3 B;  2WDR A;  2PTF A;  4YLH A;  1MIY A;  2LHN A;  4P1N A;  3ZJ1 A;  4EOZ B;  2BG9 C;  3PUW F;  4MAL A;  3UUL A;  3FB2 A;  3L09 A;  3NKZ A;  4TZ4 C;  4N78 D;  2YU2 A;  4JI7 T;  1LVK A;  4DVD A;  1KNZ A;  2FJB A;  3AA1 B;  3H3A A;  5AQT B;  4AIS A;  3AE7 A;  4JLE A;  2V7I A;  2VKO A;  4JYA T;  3ZT5 A;  2BBH A;  4OFZ A;  4CN6 A;  2IC9 A;  5LJN A;  4ADZ A;  3ZN1 B;  4XAX B;  4CI1 B;  4JI1 T;  4UXN B;  4LF5 T;  5HAX A;  4LFC T;  5DQV A;  4EYU A;  1O3X A;  4CXX A;  5AQS B;  2XAF B;  5CB4 E;  2X66 A;  3VR9 A;  2GK9 A;  2BVL A;  2PJQ A;  3ANW B;  1M7K A;  3K1S A;  1D0X A;  1HNW T;  5HYA A;  2V6Y B;  4EGW A;  3AB3 B;  4YTN A;  1HTJ F;  1MIW A;  4B6X A;  2JRK A;  3ZLI A;  3UFG A;  5FMN A;  3T1H T;  2HN1 A;  5ABF A;  4LFA T;  3RHW A;  2UUA T;  4KUM B;  3RKO A;  4YY3 T;  3QK6 A;  4CZZ B;  3RIU C;  4H9N C;  1VOM A;  3NZP A;  3PUY F;  2BZB A;  1WR0 A;  3ONX A;  3RIA A;  5HCJ A;  1D1B A;  3AVS A;  2WBL A;  3AA6 B;  4ANJ A;  2SPC A;  3EI0 A;  1HS7 A;  3P4S A;  4E7S A;  4O4H E;  4DMV A;  3CWZ B;  5LGU B;  1VCT A;  3KBT A;  3CX8 B;  2M6I A;  4DV4 T;  2NTY A;  2K3W A;  3D0T A;  1QSD A;  2FJE A;  2L3L A;  2LRL A;  2X9Y A;  5J2T E;  1UUR A;  4E7Z A;  4F6R C;  2YOE A;  3PJA J;  1D1A A;  3JAF A;  5IWA T;  4QXB B;  3V5U A;  4GK0 E;  2C0S A;  4DND A;  2D0T A;  3E08 A;  1YQ3 A;  5L2L A;  1OXZ A;  4QXC B;  3UT5 E;  5LBM A;  1E7P A;  3LJC A;  3ZEF B; 
#chains in the Genus database with same CATH homology
 3UUX B;  4EZH A;  5JDG A;  2CM0 A;  2OA5 A;  2QGS A;  1WYC A;  4TV9 E;  5AFU L;  4UF0 A;  4BJN A;  5EZY E;  3R84 B;  2QA7 A;  3UUN A;  3Q2M A;  5DQW A;  1S35 A;  3J7Y q;  3ZMZ B;  3K3O A;  4UEL A;  5FY0 A;  3I9W A;  3ZYM A;  4ZHQ E;  2KXP B;  4GK5 E;  5FNV E;  2LOP A;  3RPU A;  1YKH B;  4X20 E;  3DJB A;  3I0O A;  1NAF A;  3BQK A;  3EVY A;  5KDM C;  2CXD A;  2X51 A;  5LCY A;  5HXH A;  2X0L B;  4PK5 A;  1BR0 A;  3RC8 A;  1EZ3 A;  4YFS A;  4BJM A;  1LVF A;  5JR9 A;  3ZMS B;  5LNK A;  2Q9Q A;  1UX4 A;  5EK3 A;  4AKR B;  1NWM X;  1V9D A;  2LSJ A;  3KVB A;  2X68 A;  2N2N A;  3CQX C;  3ZYK A;  3FXD B;  5F8P A;  2VKH A;  4JUY A;  2I59 A;  4ASK A;  5LJM A;  2KWI B;  5JRC A;  1SHZ C;  3UUM A;  3I1A A;  4PFP A;  3CX7 B;  1MMG A;  4EYY R;  1B7T A;  4H9S E;  5KX5 E;  1BR2 A;  2V7M A;  2XAQ B;  5JDF A;  1OWA A;  5M4Y A;  1G8X A;  3QUJ A;  4EIW A;  3FXE B;  3SOL A;  4U72 A;  2K48 A;  5JR9 C;  2ZM8 A;  4V1A v;  2Q9Q C;  4ZI2 C;  3B57 A;  3H37 A;  2H7V C;  3NBX X;  3LFM A;  4ZS2 A;  2RP4 A;  4KP3 C;  3N9Q A;  3PUQ A;  3C4Z A;  2Q9Q D;  1H7C A;  4CXW A;  4P0A A;  4UV8 B;  4ZI2 D;  2KLQ A;  3WI3 A;  4HKA A;  1D1C A;  4EB6 E;  2LE8 A;  2P9B A;  4MLK A;  2A3D A;  4YJ3 E;  2A72 A;  4WBO A;  4I4T E;  4XBF B;  3P7I A;  5L3E B;  3MXZ A;  1ZKE A;  3KBU A;  3T8O A;  3Q5W A;  2XHE B;  2YU1 A;  4G63 A;  2WWU A;  2N9D A;  4YHJ A;  3EUH A;  4AXP A;  1T98 A;  4H9R C;  4YJ2 E;  5JDL A;  2LHR A;  1HG2 A;  2N1G A;  4IDZ A;  1YW0 A;  3K8P C;  2XQY A;  3PUG A;  3CX6 B;  2W62 A;  3ETU A;  2LOS A;  2LT3 A;  2XTL A;  2DI4 A;  3I0Q A;  2LEH A;  4UVA B;  2NW9 A;  5JDN A;  3AAI A;  4QX8 B;  2CXL A;  2CEA A;  3IHR A;  4ZOL E;  2D0U A;  1MMN A;  5LHI B;  5J2U E;  4H9O C;  4ERR A;  5ADX L;  2LJL A;  3LK4 2;  4HEA A;  3LK2 B;  4TX5 A;  3ZYL A;  1HFA A;  5F3J A;  2XAJ B;  4AKH A;  3HR0 A;  4HFV A;  3ZCI A;  4UVC B;  3CML A;  5LG4 A;  3PUA A;  2DLR A;  3CQC B;  4L5G A;  2LSI A;  2K5B B;  4FJO A;  4GYR A;  4O4J E;  3HKD E;  3KV9 A;  4P0B A;  2KIN B;  2B1E A;  2LM9 A;  4HN9 A;  4IE4 A;  3IEE A;  3AAE B;  4PFO A;  2W63 A;  3OBV E;  3M65 A;  2MTQ A;  3LK3 B;  3PU8 A;  2C5J A;  5H6R B;  2XAH B;  3TKL B;  5JRC B;  4KBM B;  3GN5 A;  2W61 A;  4HTE A;  2JMH A;  3MJX A;  4AQF A;  1HX8 A;  4ZI7 E;  2E8I A;  2DNX A;  2YIN A;  2K9A A;  4EZ4 A;  2PG8 A;  4OYK A;  1BR1 A;  4X1Y E;  2CWO A;  2BVM A;  3KV4 A;  4I55 E;  2K24 A;  5JRE A;  2X9X A;  3ZMV B;  1FEW A;  4M1P A;  2MBG A;  5FXZ A;  2CLY B;  3JC6 C;  5H6Q B;  2WMN A;  3ZC1 A;  2H7O A;  4XZC A;  2WSS V;  3E22 E;  2VL8 A;  3OYX A;  4H63 H;  4IIJ E;  3HI2 A;  3CVR A;  2JPF A;  4UVB B;  2VB6 A;  4C91 A;  3AA0 B;  3JC6 D;  2H3R A;  5ETW A;  5LHG B;  3OJA A;  1Y64 B;  2L8K A;  2WM9 A;  2CA5 A;  4DO0 A;  4OK0 A;  3ZC0 A;  3BK9 A;  3MA9 A;  3OKQ A;  4JEH B;  2C5I T;  3FBL A;  3PDY A;  1SA0 E;  3KIN B;  3RYF E;  2CCQ A;  2NW8 A;  5A1L A;  4CI2 B;  3ETV A;  5KMG P;  2ZM0 A;  3NRY A;  1ZV4 X;  2KWH A;  4QHO A;  4PJN A;  5FY7 A;  1FMV A;  2LSK A;  5TAO A;  2C5K T;  2DWK A;  4P09 A;  4Z8X A;  5IYZ E;  4OHF A;  4CXY A;  4PNI A;  2DHR A;  3BQI A;  4KMC A;  5C8Y E;  2UXN B;  2ACX A;  2XAS B;  2CXF A;  3R6N A;  3RYH E;  4X1I E;  3DTO A;  3C50 A;  3O1J A;  2WMO A;  1MMA A;  3I9Y A;  5LGT B;  2V7K A;  2W00 A;  3E0Z A;  4ISS A;  4UEM A;  2Y48 B;  2JMK A;  1S94 A;  2D5U A;  3HKE E;  2X67 A;  4K0U A;  5LGN B;  1IAP A;  2E9X A;  2HPJ A;  5CA0 E;  3PU3 A;  4H63 V;  4MBQ A;  3MZK B;  4FI5 A;  4C90 A;  4H9P C;  3GN5 B;  3FHN A;  3WAK A;  2Z6E A;  1AJ3 A;  3V5S A;  3VKG A;  2HPL A;  5JDM A;  3C51 A;  3N9P A;  4TV8 E;  4CQI A;  5L3G B;  4AKG A;  1ZHC A;  2MYS A;  2JJ9 A;  3RC3 A;  4DBQ A;  3C4W A;  1CUN A;  3GA8 A;  2ZM2 A;  4WW0 A;  3VU7 H;  2ODV A;  5FP3 A;  4O4L E;  3K3N A;  3S4U A;  2DWG A;  2G0U A;  2YK0 A;  4O8S A;  4O2B E;  2YEV C;  4PJM A;  5HXC A;  2X9H A;  4IHJ E;  5J1G A;  5L3B B;  3PTR B;  3F31 A;  5L3D B;  4O4I E;  3J9X 1;  5L3F B;  4CI3 B;  2V7L A;  3O1I A;  3U3I A;  2E9X D;  3GMI A;  4YLH A;  3ZMU B;  1MIY A;  4I43 B;  2LHN A;  2V7J A;  3KV6 A;  2L9Q A;  3RYC E;  4IE5 A;  3ZJ1 A;  4EOZ B;  2VK9 A;  2LSG A;  2NWB A;  2PFV A;  4NUV A;  4MAL A;  3UUL A;  3A5X A;  4TN7 B;  2IW5 B;  3FB2 A;  1MIV A;  3L09 A;  3Q9D A;  2CE7 A;  5LHH B;  4TZ4 C;  3AVR A;  2NTX A;  4N78 D;  2YU2 A;  1FMW A;  2V26 A;  4G2A A;  5L3C B;  1WR6 A;  1LVK A;  2VAS A;  4DVD A;  1LKX A;  3PE0 A;  3Q5X A;  3CQG B;  4MHC A;  3RRC A;  1KNZ A;  3DP7 A;  3UTK A;  3IBP A;  1US7 B;  3N2O A;  4I50 E;  5CA1 E;  4ZS3 A;  5GON E;  2VWA A;  3AA1 B;  3ZPO A;  3H3A A;  1U4Q A;  1YKE B;  3RH3 A;  4JLE A;  2V7I A;  4IGU A;  2A2F X;  2VKO A;  1D0Y A;  4ZI3 C;  4OFZ A;  4PAG A;  2NP9 A;  4IE0 A;  1KK7 A;  2IC9 A;  3MAC A;  4A56 A;  5LJN A;  2E9X B;  3L3P A;  4QX7 B;  4AKI A;  4ADZ A;  4ZI3 D;  2WAU A;  4OYJ A;  5LBQ B;  4AQF C;  3ZN1 B;  2KT9 A;  4XAX B;  4CI1 B;  2NOX A;  4IE6 A;  3HA4 A;  3VHL A;  1BR4 A;  4PK6 A;  1D0Z A;  5LP6 E;  3C64 A;  3SWH A;  4GYS A;  4GIW A;  4EXT A;  4UXN B;  2CMR A;  3C4X A;  5LA6 E;  3KDS E;  1IJ5 A;  5HAX A;  2KND A;  5DQV A;  2ES0 A;  4EYU A;  2V1D B;  3PUR A;  4DMW A;  3P8C D;  1O3X A;  4UV9 B;  4CXX A;  4WBN E;  2XAF B;  3N2K E;  4AQG A;  1UX5 A;  5CB4 E;  2X66 A;  4BA9 A;  4GOU A;  2IC6 A;  1X79 A;  3N2G E;  5HXS A;  4AKL A;  2GK9 A;  2BVL A;  2PJQ A;  1QUU A;  5LYJ E;  1WRD A;  5IHY A;  3LBX A;  4U74 A;  3ANW B;  5E0O A;  3O1H A;  3OYZ A;  3GWH A;  5FXX A;  3ZCJ A;  1D0X A;  5HYA A;  3AB3 B;  5BMV E;  3O9X A;  5FXV A;  1HCI A;  4UIG A;  1ZEE A;  4IE7 A;  1HTJ F;  5FYM A;  5LOV E;  2Y8D A;  2KZ7 B;  3CKD A;  4NUU A;  1MIW A;  4B6X A;  2JRK A;  3ZLI A;  4X1K E;  1YD8 G;  2EHO B;  5HWY A;  4L9I A;  5FMN A;  4ILU A;  3EDU A;  2VKD A;  5HXR A;  2NW7 A;  2DCF A;  3NRX A;  3W15 B;  3FBZ A;  4DBR A;  2ZMA A;  4KUM B;  2BDE A;  3RKO A;  3RX6 A;  1WYB A;  3QK6 A;  4CZZ B;  3KV5 A;  4QKN A;  5LXT E;  4H9N C;  1MMD A;  1G73 A;  1VOM A;  3NZP A;  4QWN B;  1WLX A;  3MK7 C;  4IST A;  3HKB E;  3U78 A;  1HG5 A;  3N5L A;  2BZB A;  3IF8 B;  1HF8 A;  3BQL A;  4PJJ A;  4JEU B;  5DJQ C;  3ZMT B;  5DAB A;  3LG7 A;  3ONX A;  4QXH B;  2CLY C;  1UCU A;  2J1D G;  5EK2 A;  2MOZ A;  4PJL A;  1D1B A;  3KFW X;  4L0R A;  2M67 A;  3AVS A;  2E9X C;  3HKC E;  3O4X E;  5FXW A;  5JDQ A;  2WBL A;  3AA6 B;  2JQQ A;  2D2S A;  2SPC A;  3CPZ A;  4ANJ A;  1VRB A;  3KVA A;  3SRZ A;  3RRW A;  4EAH A;  4J2C A;  1HS7 A;  4HGA A;  3ANW A;  4E7S A;  4O4H E;  2W0G A;  1E1H B;  4DMV A;  3CWZ B;  1Z0P A;  2XAG B;  5LGU B;  4AI6 A;  3KBT A;  4PK4 A;  2RA1 A;  5JVD E;  3CX8 B;  3AA7 B;  3ZJ2 A;  5HXE A;  3F57 A;  3EDV A;  1MND A;  1IJ6 A;  2HH7 A;  3WAJ A;  4H9Q C;  2NTY A;  4UF0 B;  1MNE A;  3D0T A;  4TUY E;  5JQG E;  3N9M A;  3VKH A;  2ODU A;  2UXX B;  1QSD A;  2EHO A;  2KMF A;  3F2E A;  3NZQ A;  2L3L A;  3K3Q C;  2X9Y A;  5J2T E;  4E7Z A;  5HWX A;  3N9O A;  4F6R C;  3MKD A;  1D1A A;  3RYI E;  3N9L A;  3SS1 A;  2XUE A;  2VKJ A;  3C98 B;  1FIO A;  1LRZ A;  3ZN0 B;  4QXB B;  3V5U A;  3LBX B;  2ZLY A;  2LSY A;  4GK0 E;  2C0S A;  3ESL A;  4DND A;  2PBI A;  5JH7 E;  2D0T A;  3E08 A;  3UFE A;  5JR9 B;  5L2L A;  2Q9Q B;  4BAY B;  3AAA B;  3PUS A;  1OXZ A;  5EK4 A;  2EHO C;  2Y6X A;  3HL6 A;  4QXC B;  3QC9 A;  3UT5 E;  3B13 A;  2X9W A;  5FY1 A;  2CWY A;  4O2A E;  5LBM A;  3N9N A;  3LJC A;  2EHO D;  4HE8 A;  4PW8 A;  4WNK A;  5JDH A;  1U5P A;  1IZN B;  2IAK A;  3ZEF B;  4MFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...