4F6RC

Tubulin:stathmin-like domain complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
64
Chain Sequence
NKATSGQSWEVILKPPSFPSLEEIQKKLEAAEERRKAHFAAMLERLQEKDKHAEEVRKNKELKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
total genus 20
structure length 64
sequence length 79
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.580 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4f6rC01
5KX5E 5LXTE 5CB4E 4IHJE 4TUYE 3RYFE 3UT5E 4YJ2E 4F6RC 3HKBE 4I55E 5EZYE 3HKDE 5FNVE 3HKCE 4O2BE 4WBNE 5LP6E 4TV9E 4EB6E 4X1YE 3HKEE 4O4HE 5GONE 5IYZE 3N2GE 4ZHQE 3RYHE 5JH7E 4I4TE 4TV8E 5CA1E 5JQGE 4YJ3E 5J2TE 4O4LE 3E22E 5C8YE 5JVDE 4ZOLE 4O2AE 4X1KE 1SA0E 4IIJE 5LYJE 4O4IE 3RYCE 4X20E 4X1IE 5LA6E 5LOVE 3N2KE 4ZI7E 5BMVE 5CA0E 4O4JE 5J2UE 3RYIE 4I50E
chains in the Genus database with same CATH superfamily
4BAYB 4P09A 3HR0A 5ABFA 3CK6A 2LLYA 5AQKB 3HKDE 4UELA 4NXNT 4DBQA 2MAWA 4H9QC 4DR4T 3PUGA 5ABHA 2A72A 1KFYA 4TNWA 3ZCJA 4P0AA 1D1BA 2MYSA 4B3MT 4DR7T 5HXRA 1WFDA 3O4XE 3N9PA 3J9X1 4UF0B 3AEBA 3JAFA 2H7OA 4EEBA 1IBLT 4YY3T 1B7TA 5AQVB 3EVYA 1ZP0A 2M67A 5L4EA 2CEAA 4KHPT 2CWOA 3HKCE 4WBNE 2LKGA 4AQFC 4YSXA 3AA0B 2HHHT 5C3JA 2JMKA 2AE9A 4PJLA 4PK4A 3FXDB 1HX1B 4CN1A 3PUVF 3JCFA 1BR1A 3RYFE 2YK0A 3ZC1A 4QH1A 3H37A 5EK3A 1IZNB 4XAXB 2DL1A 4JI5T 4EYUA 3PV0F 3I0QA 2FJBA 1WR6A 2MPKA 4HWHA 5FNVE 1WYCA 2XQ9A 2BG9E 4DNDA 3ZMTB 2LHRA 4HWDA 4MLKA 4X1KE 4UF0A 2W00A 3ZPOA 3LK2B 1H7CA 2V6YB 3G06A 4PJNA 2NW7A 2XAFB 4TNVA 3NZQA 4GOUA 3AE8A 4KUMB 3FZHB 2Q9QD 2X9YA 2CHNA 4H9PC 2CHOA 1VCTA 2BDEA 1MMAA 1HFAA 4H9NC 4DR2T 4A98A 4TZ4C 3ZCIA 4KMCA 1XWMA 4HWIB 2ACXA 3SFEA 4JI2T 1BR4A 1S94A 2X0HA 2OV9A 3TLVA 2V7MA 1UCUA 3K3QC 4IL4A 4AISA 2W66A 3ZSTA 4EXTA 5LA6E 4IE4A 3T1YT 2V8SV 4LF9T 4H9RC 3F57A 2QYWA 1FMWA 2BS2A 2E5LT 2HPJA 3MJXA 2ODVA 5JDLA 3RKGA 5CGMA 3DP7A 3AAIA 2OA5A 4I50E 2V6YA 2CA5A 4H9SE 4UXNB 2LEHA 3VRBA 4AXPA 3E22E 3RPUA 3J7Yq 5LMUT 4Z8XA 2XAJB 5FVKA 2KLQA 2LSGA 4EIWA 5HYAA 2XQ5A 3B5MA 5FXVA 1KF6A 1QUUA 3AEAA 3Q9DA 2UUAT 4TUYE 2H3RA 2DLRA 3AXJB 2BKPA 3PDYA 5L47A 2LSJA 2IDOB 3P8CD 1J5WA 4ZI2D 2XSBA 4AQFA 2ZMAA 3AE5A 5LG3A 2JPFA 1HF8A 2RP4A 4YFSA 4G63A 2UXBT 4U3CA 3SS1A 2WDVA 2V7JA 1MMDA 3MK7C 4WNKA 2L9QA 3ZYMA 3RQUA 3A8YC 3LSVA 2CRBA 2VKHA 5AQFB 4DVDA 3EHZA 2WB5A 4G2AA 1JNRA 3AA1B 2NR4A 5L3CB 2LOSA 4H9OC 2OLTA 3PU8A 3AAEB 5LCYA 4DMWA 1ZKEA 3H3MA 1CHUA 2LJLA 5ADXL 1HNXT 3UU4A 1YD8G 2FJDA 3AEDA 2YKSA 5JTGA 2I59A 5FY0A 2VK9A 2XUEA 4DUYT 3KV5A 4CN4A 3JAEA 4IGUA 1L0VA 3Q5DA 4LF8T 4J2CA 3AXJA 5FVLA 2D0UA 4F8HA 1E1HB 3CIRA 2N9DA 4CXWA 3AE7A 5IYZE 4EV6A 5HEOA 1WYBA 3ZMVB 3RIFA 3K3NA 4DR3T 1LKXA 4DV3T 5AQTB 2DCFA 2WZHA 5CJ5A 2Q9QB 3ESLA 2HN1A 2CCQA 2PJQA 3ANWB 1V9DA 4ZI2C 4DV5T 2JMHA 2WAUA 2XJ7A 1I6ZA 1M7KA 5LYJE 4LF5T 1D0YA 3NRYA 5FMNA 1YQ4A 2VQFT 2M6BA 2WDRA 4PNIA 2CXDA 3EABA 3LDQB 5AQSB 4IT4A 2YN6A 4JUYA 2UXDT 5L2LA 3U3IA 1WLXA 3PUWF 4EZ4A 1X9BA 1US7B 4XBFB 4U2ZA 3RIAA 4I0UA 2KSRA 3CX6B 4O2AE 4QH4A 3M3ZB 4B3TT 3KV4A 4CN6A 2UUCT 5CFBA 1MIWA 5JDGA 4LFAT 5HXCA 3WAKA 4TV8E 3GN5B 5C8YE 3OPCA 5HEUA 2K48A 2KXPB 4CQIA 5JR9B 3N5LA 5HCJA 3FB2A 2Q9QA 2QRXA 5LMNT 2XQ4A 3ANWA 2CXLA 5F3JA 3CX8B 3I0OA 4YT0A 2BS3A 3VHLA 4A56A 1OEDC 2KMFA 4DV6T 3RIUA 5AQIB 3SOLA 1UURA 2KNDA 3HI2A 3EDUA 4Q25A 5H6QB 4ZEYA 5FY7A 5FL0A 1KEYA 1W09A 5FKYA 1WR0A 4U74A 3MACA 3LJCA 2G0UA 1UX5A 3RC3A 3N9MA 2UXCT 3IEEA 2LRLA 2JJ9A 4C91A 3GA8A 3RGLA 3PUZF 3HA4A 3MZKB 5LB7B 3R84B 4HFDA 1R8IA 4OFZA 5HEJA 3GN5A 3BK9A 2XHEB 2FBWA 3N9OA 3E0ZA 3CPZA 4OHFA 1MIVA 1UK5A 5JR9A 4AIUA 4IE0A 2WWVA 5M4YA 3ZMUB 3AA7B 3RX6A 2CM0A 2HN2A 3M65A 3N9NA 1FEWA 2X0LB 4JEHB 3QK6A 2BG9B 3UUXB 4ISSA 3PURA 1D1AA 3FZFB 2AXDS 2B1EA 2FJEA 3IF8B 1T7SA 3AECA 2V7IA 1YKEB 4P0BA 3F2EA 4HFVA 3X1DA 1KNPA 3RLFF 4KBMB 2ZLYA 1W0BA 2CWYA 3CQCB 2H7VC 5GONE 4YSZA 2YEVC 5FL1A 4MBQA 2V6XA 2CBJA 2LSIA 3K3OA 5DJQC 3I1AA 3LK3B 3KVAA 2LKHA 4JI8T 4IREA 3UQ7A 4JBWF 3UUMA 4AQYT 1HG5A 2XAHB 3ZJ2A 4IE7A 2IAKA 4YLHA 2D9DA 4IL9A 3FXEB 4X64T 3SRZA 1HR0T 4HN9A 4AKLA 5KXJA 5AQLB 4A5XA 1NAFA 4GYRA 4U31A 3CQXC 3NKZA 3E08A 4QX7B 2NW9A 2BG9A 2YU1A 2CE7A 3WI3A 1XDPA 2Y6XA 3U78A 3KFWX 5H6RB 5AQGB 4C90A 4O4LE 2ES0A 1QSDA 3AE2A 5HEGA 3N2OA 2BBJA 4ISTA 4BJNA 4QH5A 4HTEA 4CI1B 1XMQT 2R6GF 5AFUL 2W4XA 1Z8UA 2JQHA 1UGOA 2FUPA 3UFGA 3CX7B 3AE9A 4UV8B 5JDNA 3RYHE 4PJJA 1N36T 3PUXF 4DV7T 3KBTA 4CI3B 5IHYA 2X9HA 5IWAT 2KZ7B 2E9XC 1OEDE 1HNWT 5LGNB 3N2KE 1MIYA 4YTMA 3AVSA 3C64A 1DU2A 4YJ2E 3L39A 5DABA 1N34T 4JI4T 3CVRA 4NUVA 3IA3A 5JVDE 1SUMB 3KV9A 3ZYLA 3RQWA 3VR8A 3QUJA 2ACZA 2Y8DA 2CBIA 2L8KA 3FZLB 2GK9A 5DQVA 4EEDA 3Q5WA 4ZXLA 3RC8A 1LVFA 1XDOA 2WQYA 3RH3A 3BQKA 3ONXA 2K3WA 1YW0A 2XY8B 1T8BA 3AE6A 4U7IA 1NENA 1KK7A 3NBXX 3AVRA 2VKDA 5AQQB 1D0XA 2NTXA 4PFPA 2MTQA 3UU8A 2SPCA 3Q2MA 4ILAA 2ZM2A 3Q5XA 4ZI3C 5L3GB 3VKHA 1YQ3A 2BKNA 1XNRT 4DBRA 2X0YA 3PUAA 4LMKA 5CB4E 3RKOA 1IAPA 3QB5A 4HEAA 4JI0T 2XQ3A 5C2TA 3AAAB 4NIQA 5AQJB 2WSSV 2CXFA 1IBMT 3HKBE 4ANJA 1SHZC 4JI7T 5F5WA 4QX8B 4PK6A 2JQKA 4COFA 2KT9A 2LE8A 3PJAA 4IHJE 2BKOA 3KBUA 5FXXA 1UUSA 2CLYC 2CPTA 2VVSA 2XSAA 2H89A 4QWNB 2KWIB 3ONLC 1HX8A 5KMGP 4AKGA 4IDNA 2HPLA 1N32T 2E2AA 4HKAA 3C51A 3UT5E 4DV0T 5FXZA 2BS4A 2XQ8A 3ZT5A 5LP6E 4DV4T 3EDVA 5JH7E 4HGAA 3O1IA 1MNDA 4LFCT 1VOMA 4ERRA 3UULA 2QVAA 1MMNA 2A9UA 4LMJA 3SWHA 4EAHA 2CMRA 3RHWA 2A3DA 4DV1T 1FJGT 3AE3A 4UVCB 4HFIA 2XZEA 3UU3A 3UQ4A 3PUYF 2WS3A 2JRKA 5LGUB 5LJNA 3P4RA 2XAGB 2VQET 4DR5T 5BR8T 2XPKA 4X65T 4L5GA 3AEGA 5F8PA 4JLEA 2BZBA 3CKDA 1T72A 5JDFA 4P1NA 2YOEA 2QGSA 2XQ6A 2V5CA 2WY2A 2VKJA 3QOFA 2X68A 5LG4A 1T98A 3UU6A 4MHCA 2UUBT 3AB3B 5LJMA 3OKQA 2IC9A 3ZC0A 2P9BA 1ZV4X 4K0KT 4GYSA 4JI6T 5EZYE 5HXHA 2C5IT 3AEEA 5JDQA 4HFHA 2IW5B 3LFMA 3HKEE 3P7IA 2VWAA 1GQEA 3IBPA 4E7ZA 4DUZT 3ABVA 3RYCE 3RF1A 3ZYKA 4JI3T 2VL8A 4GK0E 1G73A 5FP3A 3PUSA 4MFRA 2J4GA 2BVMA 3GMIA 2EHOD 3L09A 3TKLB 4HWCA 5IUXA 3F31A 2DHRA 5JDMA 1MNEA 3ZLIA 5L3BB 5LBMA 4TWHA 2PFVA 2Z6EA 1ZEEA 1S35A 2H88A 2VURA 1HCIA 4NUUA 4PJMA 1YXRA 4OK0A 3EAMA 4EYYR 2NP9A 5J0ZA 3UUBA 3N9LA 2DWGA 2K24A 2ODUA 4IE6A 3VKGA 1HNZT 2E8IA 4LMLA 2VB6A 3OBVE 3B13A 3ZMSB 1J1JA 4U2YA 3UU5A 4YHHT 5J1GA 2XASB 3T1HT 2LSKA 2IHR1 4JI1T 1BR2A 4U72A 3ETUA 4LFBT 3ZN0B 1X79A 4PFOA 2WWUA 3TLUA 5AQRB 3AA6B 4YXDA 4O4IE 3ZEFB 2RPAA 3OYXA 4L0RA 2XM1A 2UXNB 2YINA 4PAGA 1O3XA 2J1DG 4WBOA 2IIUA 3C50A 1M62A 3I9YA 2IC6A 4FJOA 4M1PA 5KDMC 4HFCA 2MOZA 4GKKT 1IJ5A 2EHOC 2I0MA 4ZI7E 2Y48B 3CMLA 1OEDB 2E9XD 2XM2A 4IDOA 1FMVA 4QKNA 4V1Av 5DQWA 4DR6T 5ABEA 1WRDA 3PUQA 4AKIA 2YDRA 3T8OA 3CWZB 2ZM6T 1OWAA 4YSYA 3ZT6A 4B3ST 4LF7T 4WZXA 4I55E 2PG8A 5EK4A 4JV5T 1HG2A 2LM2A 3AEFA 2YU2A 2VVNA 5J2UE 4ZZBA 4BJMA 2BBHA 4EZHA 4YHJA 4DR1T 4UVBB 3MA9A 4H63V 3UTKA 2IMLA 4ILUA 3P4WA 4ZI3D 2WU5A 4X20E 5FYMA 1D1CA 3NWIA 3B57A 1G8XA 5AQOB 2DNXA 3TLWA 1OEDA 4QXHB 3ZT7A 2I6HA 3W15B 3ZJ1A 4ILBA 1N33T 3P4QA 3DJBA 5LXTE 5JDHA 2EHOB 3D0TA 1Z0PA 4EB6E 4H63H 4GKJT 3C98B 2W63A 2W61A 1UX4A 3DTOA 3P50A 2E5VA 5FXWA 4E7SA 5AQHB 5JREA 4X62T 1KNRA 3RI5A 2A2FX 2LT3A 2X9XA 2JQ9A 3Q5EA 1QLBA 4UR9A 4YJ3E 1YKHB 4PW8A 3KVBA 5JRCB 2DWKA 2N1GA 2UXXB 1W9RA 4QHOA 5LOVE 1I94T 5LHGB 2WMNA 4JEUB 3A5XA 1D0ZA 2RA1A 4N78D 4ZZCA 1BR0A 2MBGA 3NRXA 2K9AA 4IIJE 3AE1A 4X1IE 5TAOA 2M6IA 3C4WA 4L9IA 3QC9A 4DV2T 1LVKA 1CUNA 5KX5E 3O9XA 3NVOA 4I43B 4Z90A 1Y01A 2EHOA 4CXYA 2NTYA 1XMOT 3QB5K 3GWHA 4EOZB 2PBIA 2V5DA 1E7PA 2WM9A 4UVAB 4ZS3A 3MKDA 3FZKB 4IDPA 3L8RA 4DO0A 3ZN1B 2C5KT 4U7YA 3ZSSA 4LF4T 4AKHA 4MALA 1OXZA 4YTNA 2J47A 2YDQA 3PU3A 4GK5E 2HH7A 4AKRB 4I4TE 1AJ3A 2DI4A 2LSYA 2WBLA 3BQLA 1IJ6A 4PK5A 4X66T 3HL6A 4JYAT 2NOXA 2WDQA 2E9XB 3FZMB 5BMVE 4OYKA 5JRCA 5ETWA 2WU2A 2W2UA 4LF6T 4TX5A 4FI5A 3I9WA 1U4QA 5AQPB 1KNZA 2YDSA 4AQGA 4ZOLE 5HWXA 3EUHA 2Q9QC 4Z91A 1FIOA 2X66A 3ZKRA 4WW0A 3VU7H 4F6RC 3ONJA 4O2BE 2K5BB 1ZOYA 3ZMZB 2ZM8A 2NW8A 1HTJF 3RIUC 5AQMB 3PTRB 3K8PC 3LK42 5EK2A 2XAQB 3K1SA 2WP9A 3JADA 1XNQT 2JQQA 3LBXB 4KI0F 3ETVA 3FBLA 4EGWA 1HS7A 4TV9E 3KDSE 2C5JA 2X67A 4X5TA 3PJAJ 2W67A 3QNUA 4TWDA 1U5PA 3KV6A 2E9XA 1MMGA 1NWMX 3VR9A 3RRCA 3TLTA 5AQUB 1SE7A 3FHNA 4OX9T 4GIWA 2L3LA 4QXCB 3AE4A 3CQGB 5JR9C 3R6NA 3V5SA 3RRWA 5LGTB 2X9WA 2V7LA 5L3EB 4UIGA 3V5UA 1Y64B 5HAXA 4ILCA 4CZZB 3LG7A 2WZIA 5L4HA 5A1LA 5CA1E 3TLSA 4ZS2A 2KINB 2BVLA 3UFEA 1LRZA 2X51A 1VRBA 4ASKA 3SFDA 4DIDB 4ZHQE 3LBXA 5LNKA 3FBZA 5AQNB 3BQIA 2VASA 2CLYB 1IBKT 4B6XA 4QXBB 3UUNA 2VL0A 5LBQB 2NWBA 4KP3C 3N9QA 4O4HE 3N2GE 2IUBA 1XZYA 1EZ3A 2C0SA 5L3DB 2WCAA 4NXMT 4UV9B 2LM9A 2WMOA 5ABGA 4TWFA 3RYIE 2N2NA 3JC6D 4HFBA 1VCSA 4O8SA 3O1HA 2XQAA 4B3RT 2V7KA 4HE8A 5E0OA 5HEHA 2D5UA 5L3FB 3IHRA 3O1JA 2BG9C 2XQYA 3WAJA 2ZM0A 4ADZA 2PTFA 2VKOA 4HWFA 2D0TA 2D2SA 1J5ET 4YTPA 2QA7A 5LHHB 3MXZA 5HXEA 2XQ7A 1SA0E 3PE0A 3OVUA 3L3PA 5ABFB 4K0UA 4U33A 1JNZA 5HXSA 4IDQA 3A7MA 2LHNA 4OYJA 5JQGE 5J2TE 1E2AA 3NZPA 1WCRA 2LOPA 3P4PA 4HFEA 5LHIB 3C4XA 4O4JE 3OYZA 3C4ZA 5FY1A 2XTLA 4XZCA 3P4SA 5HCMA 2V1DB 4CXXA 3H3AA 2F4VT 4NPPA 3OJAA 2LRKA 1NEKA 2W62A 1ZHCA 2JIWA 2KWHA 4TN7B 2V26A 4A97A 5HWYA 4KHZF 3OTOT 3EI0A 4AI6A 4X1YE 3S4UA 4IDZA 4CI2B 3VRAA 3JC6C 2FJAA 2J62A 4WYVA 2W0GA 3KINB 2UU9T 4UEMA 4KX6A 4DMVA 1W0AA 4IE5A 4BA9A 5CA0E 2B76A
chains in the Genus database with same CATH topology
2LE8A 4IHJE 4BAYB 4P09A 3HR0A 3KBUA 2A2FX 2LT3A 2X9XA 3HKDE 4UELA 5FXXA 1MIWA 5JDGA 5HXCA 2CLYC 4DBQA 3WAKA 4TV8E 3GN5B 4H9QC 1YKHB 4QWNB 4YJ3E 4PW8A 3KVBA 3PUGA 5C8YE 2KWIB 1HX8A 5KMGP 4AKGA 2A72A 5JRCB 2K48A 2DWKA 2N1GA 2UXXB 4QHOA 5LOVE 3ZCJA 2KXPB 4P0AA 1D1BA 2HPLA 2MYSA 5LHGB 4CQIA 2WMNA 5JR9B 4HKAA 4JEUB 5HXRA 3C51A 3UT5E 3N5LA 5FXZA 3A5XA 1D0ZA 2RA1A 3FB2A 2Q9QA 4N78D 5LP6E 3O4XE 1BR0A 2MBGA 3NRXA 3ANWA 3EDVA 2CXLA 3N9PA 3O1IA 4HGAA 3J9X1 4UF0B 5JH7E 5F3JA 3CX8B 1MNDA 3I0OA 2K9AA 3VHLA 4A56A 4IIJE 2KMFA 1VOMA 4X1IE 4ERRA 5TAOA 2H7OA 3C4WA 4L9IA 3QC9A 1LVKA 1B7TA 1CUNA 3UULA 3EVYA 5KX5E 1MMNA 3SWHA 3SOLA 3O9XA 2M67A 4EAHA 2CEAA 4I43B 2KNDA 2CMRA 3HI2A 3EDUA 2CWOA 2A3DA 3HKCE 4WBNE 2EHOA 5H6QB 4AQFC 4UVCB 4CXYA 2NTYA 5FY7A 3AA0B 2JMKA 3GWHA 4PJLA 4EOZB 4U74A 4PK4A 3FXDB 2PBIA 2WM9A 4UVAB 2JRKA 4ZS3A 3MKDA 3MACA 3LJCA 2G0UA 1UX5A 4DO0A 5LGUB 3ZN1B 5LJNA 2C5KT 2XAGB 3RC3A 3N9MA 1BR1A 4AKHA 4MALA 3RYFE 1OXZA 2YK0A 3IEEA 2JJ9A 4C91A 3GA8A 3PU3A 3HA4A 4GK5E 4L5GA 2HH7A 3ZC1A 5F8PA 4AKRB 4I4TE 1AJ3A 3MZKB 3H37A 2DI4A 2LSYA 2WBLA 3BQLA 1IZNB 1IJ6A 5EK3A 3R84B 4JLEA 4PK5A 2BZBA 3HL6A 4OFZA 3GN5A 3BK9A 2XHEB 3CKDA 4XAXB 2NOXA 2E9XB 3N9OA 5JDFA 5BMVE 3E0ZA 4OYKA 3CPZA 5JRCA 4EYUA 2QGSA 4OHFA 3I0QA 5ETWA 1WR6A 1MIVA 5JR9A 4IE0A 5FNVE 4TX5A 5M4YA 4FI5A 3ZMUB 2VKJA 3AA7B 3I9WA 1WYCA 3RX6A 2X68A 5LG4A 1U4QA 1T98A 4MHCA 1KNZA 2CM0A 4DNDA 3ZMTB 3AB3B 2LHRA 4AQGA 5LJMA 4ZOLE 4MLKA 4X1KE 3OKQA 4UF0A 2W00A 3ZPOA 5HWXA 3M65A 3EUHA 3LK2B 2IC9A 1H7CA 2P9BA 3N9NA 1FEWA 3ZC0A 2Q9QC 1FIOA 4PJNA 2X0LB 1ZV4X 2X66A 2NW7A 4JEHB 2XAFB 3QK6A 4WW0A 3VU7H 3UUXB 4ISSA 3PURA 4GYSA 3NZQA 1D1AA 4GOUA 4F6RC 2B1EA 5EZYE 4KUMB 3IF8B 5HXHA 2C5IT 2Q9QD 4O2BE 2K5BB 5JDQA 2V7IA 2IW5B 1YKEB 3HKEE 2X9YA 2VWAA 3LFMA 3P7IA 4P0BA 3ZMZB 2ZM8A 3F2EA 2NW8A 3IBPA 1HTJF 3PTRB 4E7ZA 4H9PC 4HFVA 3K8PC 2BDEA 3LK42 3RYCE 1MMAA 1HFAA 4H9NC 3ZYKA 5EK2A 2XAQB 4KBMB 2ZLYA 4TZ4C 3ZCIA 2VL8A 4GK0E 1G73A 3CQCB 2CWYA 4KMCA 5FP3A 3PUSA 2JQQA 4MFRA 3LBXB 2ACXA 2BVMA 3GMIA 3ETVA 2EHOD 3L09A 3TKLB 3FBLA 1HS7A 4TV9E 2H7VC 5GONE 3KDSE 2C5JA 2YEVC 2X67A 3F31A 1BR4A 1S94A 2DHRA 5JDMA 4MBQA 1MNEA 2V7MA 1UCUA 3K3QC 4EXTA 2LSIA 3ZLIA 3K3OA 5DJQC 3I1AA 3LK3B 5LA6E 3KVAA 4IE4A 1U5PA 5L3BB 3KV6A 5LBMA 2E9XA 2PFVA 1MMGA 3UUMA 1NWMX 4H9RC 3F57A 1HG5A 2XAHB 2Z6EA 1ZEEA 3RRCA 3ZJ2A 4IE7A 2IAKA 4YLHA 1FMWA 1S35A 3FHNA 2HPJA 3FXEB 4GIWA 3MJXA 2ODVA 3SRZA 4HN9A 4AKLA 1HCIA 2L3LA 4NUUA 4PJMA 5JDLA 4QXCB 3CQGB 1NAFA 4OK0A 5JR9C 3R6NA 4EYYR 3V5SA 4GYRA 3RRWA 5LGTB 3CQXC 2NP9A 2X9WA 2V7LA 3DP7A 3AAIA 2OA5A 4I50E 5L3EB 3E08A 4UIGA 3N9LA 2DWGA 2K24A 4QX7B 2ODUA 3V5UA 2NW9A 2CA5A 4H9SE 2YU1A 2CE7A 4IE6A 4UXNB 3WI3A 1Y64B 2Y6XA 2LEHA 5HAXA 3U78A 3VKGA 4CZZB 3LG7A 3KFWX 5A1LA 5CA1E 5H6RB 4C90A 4AXPA 4O4LE 3E22E 3RPUA 3J7Yq 4Z8XA 2XAJB 2ES0A 4ZS2A 2KLQA 2E8IA 1QSDA 2LSGA 4EIWA 2KINB 2BVLA 2VB6A 3OBVE 5HYAA 3B13A 3ZMSB 5FXVA 1QUUA 3UFEA 5J1GA 2XASB 3Q9DA 1LRZA 2LSKA 3N2OA 4TUYE 2X51A 1VRBA 4ISTA 4BJNA 1BR2A 4U72A 2H3RA 4ASKA 4HTEA 2DLRA 3ETUA 4CI1B 3ZN0B 1X79A 3LBXA 4ZHQE 5AFUL 3PDYA 4PFOA 5LNKA 2LSJA 2WWUA 3FBZA 3BQIA 3CX7B 3P8CD 3AA6B 2VASA 2CLYB 4UV8B 5JDNA 4ZI2D 4O4IE 4AQFA 3ZEFB 2ZMAA 4B6XA 3OYXA 4L0RA 4QXBB 3UUNA 3RYHE 2JPFA 1HF8A 2RP4A 4YFSA 4G63A 5LBQB 4PJJA 3SS1A 2V7JA 3KBTA 2UXNB 4CI3B 2YINA 4PAGA 5IHYA 2NWBA 1O3XA 2J1DG 4WBOA 4KP3C 1MMDA 2X9HA 3C50A 3N9QA 3MK7C 3I9YA 4O4HE 4WNKA 3N2GE 2L9QA 2IC6A 4FJOA 4M1PA 3ZYMA 1EZ3A 2KZ7B 2E9XC 5KDMC 2VKHA 2C0SA 5L3DB 2MOZA 4UV9B 2LM9A 2WMOA 4DVDA 5LGNB 1IJ5A 2EHOC 3N2KE 4ZI7E 3RYIE 2Y48B 2N2NA 3CMLA 3JC6D 4G2AA 2E9XD 3AA1B 1MIYA 5L3CB 3AVSA 1FMVA 4QKNA 4V1Av 3C64A 2LOSA 4YJ2E 4H9OC 5DQWA 4O8SA 3O1HA 5DABA 3PU8A 1WRDA 2V7KA 3AAEB 5LCYA 4DMWA 1ZKEA 3CVRA 4HE8A 5E0OA 4NUVA 2D5UA 3PUQA 3IHRA 5L3FB 3O1JA 2LJLA 5ADXL 5JVDE 4AKIA 3KV9A 3ZYLA 3QUJA 2Y8DA 1YD8G 3T8OA 2L8KA 2XQYA 3CWZB 3WAJA 2GK9A 1OWAA 5DQVA 2I59A 3Q5WA 3RC8A 1LVFA 5FY0A 3RH3A 3BQKA 3ONXA 2VK9A 2ZM0A 4I55E 2XUEA 2PG8A 4ADZA 1YW0A 3KV5A 2VKOA 5EK4A 2D0TA 2D2SA 4IGUA 2QA7A 5LHHB 3MXZA 5HXEA 1HG2A 4J2CA 1KK7A 2D0UA 3NBXX 2YU2A 1SA0E 3AVRA 2VKDA 1E1HB 1D0XA 2NTXA 4PFPA 2MTQA 3PE0A 5J2UE 2SPCA 3L3PA 4BJMA 4K0UA 2N9DA 5HXSA 4EZHA 4YHJA 3Q2MA 4CXWA 2ZM2A 3Q5XA 4ZI3C 5L3GB 3VKHA 2LHNA 5IYZE 4UVBB 3MA9A 4OYJA 4H63V 5JQGE 3UTKA 5J2TE 1WYBA 3ZMVB 3K3NA 3NZPA 4ILUA 1LKXA 4DBRA 4ZI3D 2LOPA 4X20E 5FYMA 1D1CA 5LHIB 3C4XA 2DCFA 4O4JE 3B57A 1G8XA 3PUAA 2DNXA 5CB4E 3OYZA 3RKOA 3C4ZA 2Q9QB 3ESLA 2CCQA 1IAPA 4HEAA 2PJQA 2XTLA 3ANWB 5FY1A 1V9DA 4QXHB 4ZI2C 4XZCA 2JMHA 2V1DB 2WAUA 3W15B 3AAAB 4CXXA 3ZJ1A 3H3AA 5LYJE 2WSSV 3OJAA 2CXFA 3DJBA 1D0YA 2W62A 1ZHCA 3NRYA 5FMNA 2KWHA 4TN7B 5LXTE 5JDHA 2V26A 4PNIA 2EHOB 3D0TA 3HKBE 5HWYA 2CXDA 4ANJA 1SHZC 1Z0PA 4AI6A 4JUYA 4EB6E 4X1YE 3S4UA 5L2LA 3U3IA 4H63H 1WLXA 4IDZA 3C98B 4CI2B 2W63A 4QX8B 4EZ4A 3JC6C 1US7B 4XBFB 2W0GA 1UX4A 2W61A 3DTOA 3CX6B 3KINB 4O2AE 4PK6A 4UEMA 5FXWA 4DMVA 4E7SA 4IE5A 2KT9A 4BA9A 5CA0E 5JREA 3KV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KX5 E;  5LXT E;  5CB4 E;  4IHJ E;  4TUY E;  3RYF E;  3UT5 E;  4YJ2 E;  4F6R C;  3HKB E;  4I55 E;  5EZY E;  3HKD E;  5FNV E;  3HKC E;  4O2B E;  4WBN E;  5LP6 E;  4TV9 E;  4EB6 E;  4X1Y E;  3HKE E;  4O4H E;  5GON E;  5IYZ E;  3N2G E;  4ZHQ E;  3RYH E;  5JH7 E;  4I4T E;  4TV8 E;  5CA1 E;  5JQG E;  4YJ3 E;  5J2T E;  4O4L E;  3E22 E;  5C8Y E;  5JVD E;  4ZOL E;  4O2A E;  4X1K E;  1SA0 E;  4IIJ E;  5LYJ E;  4O4I E;  3RYC E;  4X20 E;  4X1I E;  5LA6 E;  5LOV E;  3N2K E;  4ZI7 E;  5BMV E;  5CA0 E;  4O4J E;  5J2U E;  3RYI E;  4I50 E; 
#chains in the Genus database with same CATH topology
 4BAY B;  4P09 A;  3HR0 A;  5ABF A;  3CK6 A;  2LLY A;  5AQK B;  3HKD E;  4UEL A;  4NXN T;  4DBQ A;  2MAW A;  4H9Q C;  4DR4 T;  3PUG A;  5ABH A;  2A72 A;  1KFY A;  4TNW A;  3ZCJ A;  4P0A A;  1D1B A;  2MYS A;  4B3M T;  4DR7 T;  5HXR A;  1WFD A;  3O4X E;  3N9P A;  3J9X 1;  4UF0 B;  3AEB A;  3JAF A;  2H7O A;  4EEB A;  1IBL T;  4YY3 T;  1B7T A;  5AQV B;  3EVY A;  1ZP0 A;  2M67 A;  5L4E A;  2CEA A;  4KHP T;  2CWO A;  3HKC E;  4WBN E;  2LKG A;  4AQF C;  4YSX A;  3AA0 B;  2HHH T;  5C3J A;  2JMK A;  2AE9 A;  4PJL A;  4PK4 A;  3FXD B;  1HX1 B;  4CN1 A;  3PUV F;  3JCF A;  1BR1 A;  3RYF E;  2YK0 A;  3ZC1 A;  4QH1 A;  3H37 A;  5EK3 A;  1IZN B;  4XAX B;  2DL1 A;  4JI5 T;  4EYU A;  3PV0 F;  3I0Q A;  2FJB A;  1WR6 A;  2MPK A;  4HWH A;  5FNV E;  1WYC A;  2XQ9 A;  2BG9 E;  4DND A;  3ZMT B;  2LHR A;  4HWD A;  4MLK A;  4X1K E;  4UF0 A;  2W00 A;  3ZPO A;  3LK2 B;  1H7C A;  2V6Y B;  3G06 A;  4PJN A;  2NW7 A;  2XAF B;  4TNV A;  3NZQ A;  4GOU A;  3AE8 A;  4KUM B;  3FZH B;  2Q9Q D;  2X9Y A;  2CHN A;  4H9P C;  2CHO A;  1VCT A;  2BDE A;  1MMA A;  1HFA A;  4H9N C;  4DR2 T;  4A98 A;  4TZ4 C;  3ZCI A;  4KMC A;  1XWM A;  4HWI B;  2ACX A;  3SFE A;  4JI2 T;  1BR4 A;  1S94 A;  2X0H A;  2OV9 A;  3TLV A;  2V7M A;  1UCU A;  3K3Q C;  4IL4 A;  4AIS A;  2W66 A;  3ZST A;  4EXT A;  5LA6 E;  4IE4 A;  3T1Y T;  2V8S V;  4LF9 T;  4H9R C;  3F57 A;  2QYW A;  1FMW A;  2BS2 A;  2E5L T;  2HPJ A;  3MJX A;  2ODV A;  5JDL A;  3RKG A;  5CGM A;  3DP7 A;  3AAI A;  2OA5 A;  4I50 E;  2V6Y A;  2CA5 A;  4H9S E;  4UXN B;  2LEH A;  3VRB A;  4AXP A;  3E22 E;  3RPU A;  3J7Y q;  5LMU T;  4Z8X A;  2XAJ B;  5FVK A;  2KLQ A;  2LSG A;  4EIW A;  5HYA A;  2XQ5 A;  3B5M A;  5FXV A;  1KF6 A;  1QUU A;  3AEA A;  3Q9D A;  2UUA T;  4TUY E;  2H3R A;  2DLR A;  3AXJ B;  2BKP A;  3PDY A;  5L47 A;  2LSJ A;  2IDO B;  3P8C D;  1J5W A;  4ZI2 D;  2XSB A;  4AQF A;  2ZMA A;  3AE5 A;  5LG3 A;  2JPF A;  1HF8 A;  2RP4 A;  4YFS A;  4G63 A;  2UXB T;  4U3C A;  3SS1 A;  2WDV A;  2V7J A;  1MMD A;  3MK7 C;  4WNK A;  2L9Q A;  3ZYM A;  3RQU A;  3A8Y C;  3LSV A;  2CRB A;  2VKH A;  5AQF B;  4DVD A;  3EHZ A;  2WB5 A;  4G2A A;  1JNR A;  3AA1 B;  2NR4 A;  5L3C B;  2LOS A;  4H9O C;  2OLT A;  3PU8 A;  3AAE B;  5LCY A;  4DMW A;  1ZKE A;  3H3M A;  1CHU A;  2LJL A;  5ADX L;  1HNX T;  3UU4 A;  1YD8 G;  2FJD A;  3AED A;  2YKS A;  5JTG A;  2I59 A;  5FY0 A;  2VK9 A;  2XUE A;  4DUY T;  3KV5 A;  4CN4 A;  3JAE A;  4IGU A;  1L0V A;  3Q5D A;  4LF8 T;  4J2C A;  3AXJ A;  5FVL A;  2D0U A;  4F8H A;  1E1H B;  3CIR A;  2N9D A;  4CXW A;  3AE7 A;  5IYZ E;  4EV6 A;  5HEO A;  1WYB A;  3ZMV B;  3RIF A;  3K3N A;  4DR3 T;  1LKX A;  4DV3 T;  5AQT B;  2DCF A;  2WZH A;  5CJ5 A;  2Q9Q B;  3ESL A;  2HN1 A;  2CCQ A;  2PJQ A;  3ANW B;  1V9D A;  4ZI2 C;  4DV5 T;  2JMH A;  2WAU A;  2XJ7 A;  1I6Z A;  1M7K A;  5LYJ E;  4LF5 T;  1D0Y A;  3NRY A;  5FMN A;  1YQ4 A;  2VQF T;  2M6B A;  2WDR A;  4PNI A;  2CXD A;  3EAB A;  3LDQ B;  5AQS B;  4IT4 A;  2YN6 A;  4JUY A;  2UXD T;  5L2L A;  3U3I A;  1WLX A;  3PUW F;  4EZ4 A;  1X9B A;  1US7 B;  4XBF B;  4U2Z A;  3RIA A;  4I0U A;  2KSR A;  3CX6 B;  4O2A E;  4QH4 A;  3M3Z B;  4B3T T;  3KV4 A;  4CN6 A;  2UUC T;  5CFB A;  1MIW A;  5JDG A;  4LFA T;  5HXC A;  3WAK A;  4TV8 E;  3GN5 B;  5C8Y E;  3OPC A;  5HEU A;  2K48 A;  2KXP B;  4CQI A;  5JR9 B;  3N5L A;  5HCJ A;  3FB2 A;  2Q9Q A;  2QRX A;  5LMN T;  2XQ4 A;  3ANW A;  2CXL A;  5F3J A;  3CX8 B;  3I0O A;  4YT0 A;  2BS3 A;  3VHL A;  4A56 A;  1OED C;  2KMF A;  4DV6 T;  3RIU A;  5AQI B;  3SOL A;  1UUR A;  2KND A;  3HI2 A;  3EDU A;  4Q25 A;  5H6Q B;  4ZEY A;  5FY7 A;  5FL0 A;  1KEY A;  1W09 A;  5FKY A;  1WR0 A;  4U74 A;  3MAC A;  3LJC A;  2G0U A;  1UX5 A;  3RC3 A;  3N9M A;  2UXC T;  3IEE A;  2LRL A;  2JJ9 A;  4C91 A;  3GA8 A;  3RGL A;  3PUZ F;  3HA4 A;  3MZK B;  5LB7 B;  3R84 B;  4HFD A;  1R8I A;  4OFZ A;  5HEJ A;  3GN5 A;  3BK9 A;  2XHE B;  2FBW A;  3N9O A;  3E0Z A;  3CPZ A;  4OHF A;  1MIV A;  1UK5 A;  5JR9 A;  4AIU A;  4IE0 A;  2WWV A;  5M4Y A;  3ZMU B;  3AA7 B;  3RX6 A;  2CM0 A;  2HN2 A;  3M65 A;  3N9N A;  1FEW A;  2X0L B;  4JEH B;  3QK6 A;  2BG9 B;  3UUX B;  4ISS A;  3PUR A;  1D1A A;  3FZF B;  2AXD S;  2B1E A;  2FJE A;  3IF8 B;  1T7S A;  3AEC A;  2V7I A;  1YKE B;  4P0B A;  3F2E A;  4HFV A;  3X1D A;  1KNP A;  3RLF F;  4KBM B;  2ZLY A;  1W0B A;  2CWY A;  3CQC B;  2H7V C;  5GON E;  4YSZ A;  2YEV C;  5FL1 A;  4MBQ A;  2V6X A;  2CBJ A;  2LSI A;  3K3O A;  5DJQ C;  3I1A A;  3LK3 B;  3KVA A;  2LKH A;  4JI8 T;  4IRE A;  3UQ7 A;  4JBW F;  3UUM A;  4AQY T;  1HG5 A;  2XAH B;  3ZJ2 A;  4IE7 A;  2IAK A;  4YLH A;  2D9D A;  4IL9 A;  3FXE B;  4X64 T;  3SRZ A;  1HR0 T;  4HN9 A;  4AKL A;  5KXJ A;  5AQL B;  4A5X A;  1NAF A;  4GYR A;  4U31 A;  3CQX C;  3NKZ A;  3E08 A;  4QX7 B;  2NW9 A;  2BG9 A;  2YU1 A;  2CE7 A;  3WI3 A;  1XDP A;  2Y6X A;  3U78 A;  3KFW X;  5H6R B;  5AQG B;  4C90 A;  4O4L E;  2ES0 A;  1QSD A;  3AE2 A;  5HEG A;  3N2O A;  2BBJ A;  4IST A;  4BJN A;  4QH5 A;  4HTE A;  4CI1 B;  1XMQ T;  2R6G F;  5AFU L;  2W4X A;  1Z8U A;  2JQH A;  1UGO A;  2FUP A;  3UFG A;  3CX7 B;  3AE9 A;  4UV8 B;  5JDN A;  3RYH E;  4PJJ A;  1N36 T;  3PUX F;  4DV7 T;  3KBT A;  4CI3 B;  5IHY A;  2X9H A;  5IWA T;  2KZ7 B;  2E9X C;  1OED E;  1HNW T;  5LGN B;  3N2K E;  1MIY A;  4YTM A;  3AVS A;  3C64 A;  1DU2 A;  4YJ2 E;  3L39 A;  5DAB A;  1N34 T;  4JI4 T;  3CVR A;  4NUV A;  3IA3 A;  5JVD E;  1SUM B;  3KV9 A;  3ZYL A;  3RQW A;  3VR8 A;  3QUJ A;  2ACZ A;  2Y8D A;  2CBI A;  2L8K A;  3FZL B;  2GK9 A;  5DQV A;  4EED A;  3Q5W A;  4ZXL A;  3RC8 A;  1LVF A;  1XDO A;  2WQY A;  3RH3 A;  3BQK A;  3ONX A;  2K3W A;  1YW0 A;  2XY8 B;  1T8B A;  3AE6 A;  4U7I A;  1NEN A;  1KK7 A;  3NBX X;  3AVR A;  2VKD A;  5AQQ B;  1D0X A;  2NTX A;  4PFP A;  2MTQ A;  3UU8 A;  2SPC A;  3Q2M A;  4ILA A;  2ZM2 A;  3Q5X A;  4ZI3 C;  5L3G B;  3VKH A;  1YQ3 A;  2BKN A;  1XNR T;  4DBR A;  2X0Y A;  3PUA A;  4LMK A;  5CB4 E;  3RKO A;  1IAP A;  3QB5 A;  4HEA A;  4JI0 T;  2XQ3 A;  5C2T A;  3AAA B;  4NIQ A;  5AQJ B;  2WSS V;  2CXF A;  1IBM T;  3HKB E;  4ANJ A;  1SHZ C;  4JI7 T;  5F5W A;  4QX8 B;  4PK6 A;  2JQK A;  4COF A;  2KT9 A;  2LE8 A;  3PJA A;  4IHJ E;  2BKO A;  3KBU A;  5FXX A;  1UUS A;  2CLY C;  2CPT A;  2VVS A;  2XSA A;  2H89 A;  4QWN B;  2KWI B;  3ONL C;  1HX8 A;  5KMG P;  4AKG A;  4IDN A;  2HPL A;  1N32 T;  2E2A A;  4HKA A;  3C51 A;  3UT5 E;  4DV0 T;  5FXZ A;  2BS4 A;  2XQ8 A;  3ZT5 A;  5LP6 E;  4DV4 T;  3EDV A;  5JH7 E;  4HGA A;  3O1I A;  1MND A;  4LFC T;  1VOM A;  4ERR A;  3UUL A;  2QVA A;  1MMN A;  2A9U A;  4LMJ A;  3SWH A;  4EAH A;  2CMR A;  3RHW A;  2A3D A;  4DV1 T;  1FJG T;  3AE3 A;  4UVC B;  4HFI A;  2XZE A;  3UU3 A;  3UQ4 A;  3PUY F;  2WS3 A;  2JRK A;  5LGU B;  5LJN A;  3P4R A;  2XAG B;  2VQE T;  4DR5 T;  5BR8 T;  2XPK A;  4X65 T;  4L5G A;  3AEG A;  5F8P A;  4JLE A;  2BZB A;  3CKD A;  1T72 A;  5JDF A;  4P1N A;  2YOE A;  2QGS A;  2XQ6 A;  2V5C A;  2WY2 A;  2VKJ A;  3QOF A;  2X68 A;  5LG4 A;  1T98 A;  3UU6 A;  4MHC A;  2UUB T;  3AB3 B;  5LJM A;  3OKQ A;  2IC9 A;  3ZC0 A;  2P9B A;  1ZV4 X;  4K0K T;  4GYS A;  4JI6 T;  5EZY E;  5HXH A;  2C5I T;  3AEE A;  5JDQ A;  4HFH A;  2IW5 B;  3LFM A;  3HKE E;  3P7I A;  2VWA A;  1GQE A;  3IBP A;  4E7Z A;  4DUZ T;  3ABV A;  3RYC E;  3RF1 A;  3ZYK A;  4JI3 T;  2VL8 A;  4GK0 E;  1G73 A;  5FP3 A;  3PUS A;  4MFR A;  2J4G A;  2BVM A;  3GMI A;  2EHO D;  3L09 A;  3TKL B;  4HWC A;  5IUX A;  3F31 A;  2DHR A;  5JDM A;  1MNE A;  3ZLI A;  5L3B B;  5LBM A;  4TWH A;  2PFV A;  2Z6E A;  1ZEE A;  1S35 A;  2H88 A;  2VUR A;  1HCI A;  4NUU A;  4PJM A;  1YXR A;  4OK0 A;  3EAM A;  4EYY R;  2NP9 A;  5J0Z A;  3UUB A;  3N9L A;  2DWG A;  2K24 A;  2ODU A;  4IE6 A;  3VKG A;  1HNZ T;  2E8I A;  4LML A;  2VB6 A;  3OBV E;  3B13 A;  3ZMS B;  1J1J A;  4U2Y A;  3UU5 A;  4YHH T;  5J1G A;  2XAS B;  3T1H T;  2LSK A;  2IHR 1;  4JI1 T;  1BR2 A;  4U72 A;  3ETU A;  4LFB T;  3ZN0 B;  1X79 A;  4PFO A;  2WWU A;  3TLU A;  5AQR B;  3AA6 B;  4YXD A;  4O4I E;  3ZEF B;  2RPA A;  3OYX A;  4L0R A;  2XM1 A;  2UXN B;  2YIN A;  4PAG A;  1O3X A;  2J1D G;  4WBO A;  2IIU A;  3C50 A;  1M62 A;  3I9Y A;  2IC6 A;  4FJO A;  4M1P A;  5KDM C;  4HFC A;  2MOZ A;  4GKK T;  1IJ5 A;  2EHO C;  2I0M A;  4ZI7 E;  2Y48 B;  3CML A;  1OED B;  2E9X D;  2XM2 A;  4IDO A;  1FMV A;  4QKN A;  4V1A v;  5DQW A;  4DR6 T;  5ABE A;  1WRD A;  3PUQ A;  4AKI A;  2YDR A;  3T8O A;  3CWZ B;  2ZM6 T;  1OWA A;  4YSY A;  3ZT6 A;  4B3S T;  4LF7 T;  4WZX A;  4I55 E;  2PG8 A;  5EK4 A;  4JV5 T;  1HG2 A;  2LM2 A;  3AEF A;  2YU2 A;  2VVN A;  5J2U E;  4ZZB A;  4BJM A;  2BBH A;  4EZH A;  4YHJ A;  4DR1 T;  4UVB B;  3MA9 A;  4H63 V;  3UTK A;  2IML A;  4ILU A;  3P4W A;  4ZI3 D;  2WU5 A;  4X20 E;  5FYM A;  1D1C A;  3NWI A;  3B57 A;  1G8X A;  5AQO B;  2DNX A;  3TLW A;  1OED A;  4QXH B;  3ZT7 A;  2I6H A;  3W15 B;  3ZJ1 A;  4ILB A;  1N33 T;  3P4Q A;  3DJB A;  5LXT E;  5JDH A;  2EHO B;  3D0T A;  1Z0P A;  4EB6 E;  4H63 H;  4GKJ T;  3C98 B;  2W63 A;  2W61 A;  1UX4 A;  3DTO A;  3P50 A;  2E5V A;  5FXW A;  4E7S A;  5AQH B;  5JRE A;  4X62 T;  1KNR A;  3RI5 A;  2A2F X;  2LT3 A;  2X9X A;  2JQ9 A;  3Q5E A;  1QLB A;  4UR9 A;  4YJ3 E;  1YKH B;  4PW8 A;  3KVB A;  5JRC B;  2DWK A;  2N1G A;  2UXX B;  1W9R A;  4QHO A;  5LOV E;  1I94 T;  5LHG B;  2WMN A;  4JEU B;  3A5X A;  1D0Z A;  2RA1 A;  4N78 D;  4ZZC A;  1BR0 A;  2MBG A;  3NRX A;  2K9A A;  4IIJ E;  3AE1 A;  4X1I E;  5TAO A;  2M6I A;  3C4W A;  4L9I A;  3QC9 A;  4DV2 T;  1LVK A;  1CUN A;  5KX5 E;  3O9X A;  3NVO A;  4I43 B;  4Z90 A;  1Y01 A;  2EHO A;  4CXY A;  2NTY A;  1XMO T;  3QB5 K;  3GWH A;  4EOZ B;  2PBI A;  2V5D A;  1E7P A;  2WM9 A;  4UVA B;  4ZS3 A;  3MKD A;  3FZK B;  4IDP A;  3L8R A;  4DO0 A;  3ZN1 B;  2C5K T;  4U7Y A;  3ZSS A;  4LF4 T;  4AKH A;  4MAL A;  1OXZ A;  4YTN A;  2J47 A;  2YDQ A;  3PU3 A;  4GK5 E;  2HH7 A;  4AKR B;  4I4T E;  1AJ3 A;  2DI4 A;  2LSY A;  2WBL A;  3BQL A;  1IJ6 A;  4PK5 A;  4X66 T;  3HL6 A;  4JYA T;  2NOX A;  2WDQ A;  2E9X B;  3FZM B;  5BMV E;  4OYK A;  5JRC A;  5ETW A;  2WU2 A;  2W2U A;  4LF6 T;  4TX5 A;  4FI5 A;  3I9W A;  1U4Q A;  5AQP B;  1KNZ A;  2YDS A;  4AQG A;  4ZOL E;  5HWX A;  3EUH A;  2Q9Q C;  4Z91 A;  1FIO A;  2X66 A;  3ZKR A;  4WW0 A;  3VU7 H;  4F6R C;  3ONJ A;  4O2B E;  2K5B B;  1ZOY A;  3ZMZ B;  2ZM8 A;  2NW8 A;  1HTJ F;  3RIU C;  5AQM B;  3PTR B;  3K8P C;  3LK4 2;  5EK2 A;  2XAQ B;  3K1S A;  2WP9 A;  3JAD A;  1XNQ T;  2JQQ A;  3LBX B;  4KI0 F;  3ETV A;  3FBL A;  4EGW A;  1HS7 A;  4TV9 E;  3KDS E;  2C5J A;  2X67 A;  4X5T A;  3PJA J;  2W67 A;  3QNU A;  4TWD A;  1U5P A;  3KV6 A;  2E9X A;  1MMG A;  1NWM X;  3VR9 A;  3RRC A;  3TLT A;  5AQU B;  1SE7 A;  3FHN A;  4OX9 T;  4GIW A;  2L3L A;  4QXC B;  3AE4 A;  3CQG B;  5JR9 C;  3R6N A;  3V5S A;  3RRW A;  5LGT B;  2X9W A;  2V7L A;  5L3E B;  4UIG A;  3V5U A;  1Y64 B;  5HAX A;  4ILC A;  4CZZ B;  3LG7 A;  2WZI A;  5L4H A;  5A1L A;  5CA1 E;  3TLS A;  4ZS2 A;  2KIN B;  2BVL A;  3UFE A;  1LRZ A;  2X51 A;  1VRB A;  4ASK A;  3SFD A;  4DID B;  4ZHQ E;  3LBX A;  5LNK A;  3FBZ A;  5AQN B;  3BQI A;  2VAS A;  2CLY B;  1IBK T;  4B6X A;  4QXB B;  3UUN A;  2VL0 A;  5LBQ B;  2NWB A;  4KP3 C;  3N9Q A;  4O4H E;  3N2G E;  2IUB A;  1XZY A;  1EZ3 A;  2C0S A;  5L3D B;  2WCA A;  4NXM T;  4UV9 B;  2LM9 A;  2WMO A;  5ABG A;  4TWF A;  3RYI E;  2N2N A;  3JC6 D;  4HFB A;  1VCS A;  4O8S A;  3O1H A;  2XQA A;  4B3R T;  2V7K A;  4HE8 A;  5E0O A;  5HEH A;  2D5U A;  5L3F B;  3IHR A;  3O1J A;  2BG9 C;  2XQY A;  3WAJ A;  2ZM0 A;  4ADZ A;  2PTF A;  2VKO A;  4HWF A;  2D0T A;  2D2S A;  1J5E T;  4YTP A;  2QA7 A;  5LHH B;  3MXZ A;  5HXE A;  2XQ7 A;  1SA0 E;  3PE0 A;  3OVU A;  3L3P A;  5ABF B;  4K0U A;  4U33 A;  1JNZ A;  5HXS A;  4IDQ A;  3A7M A;  2LHN A;  4OYJ A;  5JQG E;  5J2T E;  1E2A A;  3NZP A;  1WCR A;  2LOP A;  3P4P A;  4HFE A;  5LHI B;  3C4X A;  4O4J E;  3OYZ A;  3C4Z A;  5FY1 A;  2XTL A;  4XZC A;  3P4S A;  5HCM A;  2V1D B;  4CXX A;  3H3A A;  2F4V T;  4NPP A;  3OJA A;  2LRK A;  1NEK A;  2W62 A;  1ZHC A;  2JIW A;  2KWH A;  4TN7 B;  2V26 A;  4A97 A;  5HWY A;  4KHZ F;  3OTO T;  3EI0 A;  4AI6 A;  4X1Y E;  3S4U A;  4IDZ A;  4CI2 B;  3VRA A;  3JC6 C;  2FJA A;  2J62 A;  4WYV A;  2W0G A;  3KIN B;  2UU9 T;  4UEM A;  4KX6 A;  4DMV A;  1W0A A;  4IE5 A;  4BA9 A;  5CA0 E;  2B76 A; 
#chains in the Genus database with same CATH homology
 2LE8 A;  4IHJ E;  4BAY B;  4P09 A;  3HR0 A;  3KBU A;  2A2F X;  2LT3 A;  2X9X A;  3HKD E;  4UEL A;  5FXX A;  1MIW A;  5JDG A;  5HXC A;  2CLY C;  4DBQ A;  3WAK A;  4TV8 E;  3GN5 B;  4H9Q C;  1YKH B;  4QWN B;  4YJ3 E;  4PW8 A;  3KVB A;  3PUG A;  5C8Y E;  2KWI B;  1HX8 A;  5KMG P;  4AKG A;  2A72 A;  5JRC B;  2K48 A;  2DWK A;  2N1G A;  2UXX B;  4QHO A;  5LOV E;  3ZCJ A;  2KXP B;  4P0A A;  1D1B A;  2HPL A;  2MYS A;  5LHG B;  4CQI A;  2WMN A;  5JR9 B;  4HKA A;  4JEU B;  5HXR A;  3C51 A;  3UT5 E;  3N5L A;  5FXZ A;  3A5X A;  1D0Z A;  2RA1 A;  3FB2 A;  2Q9Q A;  4N78 D;  5LP6 E;  3O4X E;  1BR0 A;  2MBG A;  3NRX A;  3ANW A;  3EDV A;  2CXL A;  3N9P A;  3O1I A;  4HGA A;  3J9X 1;  4UF0 B;  5JH7 E;  5F3J A;  3CX8 B;  1MND A;  3I0O A;  2K9A A;  3VHL A;  4A56 A;  4IIJ E;  2KMF A;  1VOM A;  4X1I E;  4ERR A;  5TAO A;  2H7O A;  3C4W A;  4L9I A;  3QC9 A;  1LVK A;  1B7T A;  1CUN A;  3UUL A;  3EVY A;  5KX5 E;  1MMN A;  3SWH A;  3SOL A;  3O9X A;  2M67 A;  4EAH A;  2CEA A;  4I43 B;  2KND A;  2CMR A;  3HI2 A;  3EDU A;  2CWO A;  2A3D A;  3HKC E;  4WBN E;  2EHO A;  5H6Q B;  4AQF C;  4UVC B;  4CXY A;  2NTY A;  5FY7 A;  3AA0 B;  2JMK A;  3GWH A;  4PJL A;  4EOZ B;  4U74 A;  4PK4 A;  3FXD B;  2PBI A;  2WM9 A;  4UVA B;  2JRK A;  4ZS3 A;  3MKD A;  3MAC A;  3LJC A;  2G0U A;  1UX5 A;  4DO0 A;  5LGU B;  3ZN1 B;  5LJN A;  2C5K T;  2XAG B;  3RC3 A;  3N9M A;  1BR1 A;  4AKH A;  4MAL A;  3RYF E;  1OXZ A;  2YK0 A;  3IEE A;  2JJ9 A;  4C91 A;  3GA8 A;  3PU3 A;  3HA4 A;  4GK5 E;  4L5G A;  2HH7 A;  3ZC1 A;  5F8P A;  4AKR B;  4I4T E;  1AJ3 A;  3MZK B;  3H37 A;  2DI4 A;  2LSY A;  2WBL A;  3BQL A;  1IZN B;  1IJ6 A;  5EK3 A;  3R84 B;  4JLE A;  4PK5 A;  2BZB A;  3HL6 A;  4OFZ A;  3GN5 A;  3BK9 A;  2XHE B;  3CKD A;  4XAX B;  2NOX A;  2E9X B;  3N9O A;  5JDF A;  5BMV E;  3E0Z A;  4OYK A;  3CPZ A;  5JRC A;  4EYU A;  2QGS A;  4OHF A;  3I0Q A;  5ETW A;  1WR6 A;  1MIV A;  5JR9 A;  4IE0 A;  5FNV E;  4TX5 A;  5M4Y A;  4FI5 A;  3ZMU B;  2VKJ A;  3AA7 B;  3I9W A;  1WYC A;  3RX6 A;  2X68 A;  5LG4 A;  1U4Q A;  1T98 A;  4MHC A;  1KNZ A;  2CM0 A;  4DND A;  3ZMT B;  3AB3 B;  2LHR A;  4AQG A;  5LJM A;  4ZOL E;  4MLK A;  4X1K E;  3OKQ A;  4UF0 A;  2W00 A;  3ZPO A;  5HWX A;  3M65 A;  3EUH A;  3LK2 B;  2IC9 A;  1H7C A;  2P9B A;  3N9N A;  1FEW A;  3ZC0 A;  2Q9Q C;  1FIO A;  4PJN A;  2X0L B;  1ZV4 X;  2X66 A;  2NW7 A;  4JEH B;  2XAF B;  3QK6 A;  4WW0 A;  3VU7 H;  3UUX B;  4ISS A;  3PUR A;  4GYS A;  3NZQ A;  1D1A A;  4GOU A;  4F6R C;  2B1E A;  5EZY E;  4KUM B;  3IF8 B;  5HXH A;  2C5I T;  2Q9Q D;  4O2B E;  2K5B B;  5JDQ A;  2V7I A;  2IW5 B;  1YKE B;  3HKE E;  2X9Y A;  2VWA A;  3LFM A;  3P7I A;  4P0B A;  3ZMZ B;  2ZM8 A;  3F2E A;  2NW8 A;  3IBP A;  1HTJ F;  3PTR B;  4E7Z A;  4H9P C;  4HFV A;  3K8P C;  2BDE A;  3LK4 2;  3RYC E;  1MMA A;  1HFA A;  4H9N C;  3ZYK A;  5EK2 A;  2XAQ B;  4KBM B;  2ZLY A;  4TZ4 C;  3ZCI A;  2VL8 A;  4GK0 E;  1G73 A;  3CQC B;  2CWY A;  4KMC A;  5FP3 A;  3PUS A;  2JQQ A;  4MFR A;  3LBX B;  2ACX A;  2BVM A;  3GMI A;  3ETV A;  2EHO D;  3L09 A;  3TKL B;  3FBL A;  1HS7 A;  4TV9 E;  2H7V C;  5GON E;  3KDS E;  2C5J A;  2YEV C;  2X67 A;  3F31 A;  1BR4 A;  1S94 A;  2DHR A;  5JDM A;  4MBQ A;  1MNE A;  2V7M A;  1UCU A;  3K3Q C;  4EXT A;  2LSI A;  3ZLI A;  3K3O A;  5DJQ C;  3I1A A;  3LK3 B;  5LA6 E;  3KVA A;  4IE4 A;  1U5P A;  5L3B B;  3KV6 A;  5LBM A;  2E9X A;  2PFV A;  1MMG A;  3UUM A;  1NWM X;  4H9R C;  3F57 A;  1HG5 A;  2XAH B;  2Z6E A;  1ZEE A;  3RRC A;  3ZJ2 A;  4IE7 A;  2IAK A;  4YLH A;  1FMW A;  1S35 A;  3FHN A;  2HPJ A;  3FXE B;  4GIW A;  3MJX A;  2ODV A;  3SRZ A;  4HN9 A;  4AKL A;  1HCI A;  2L3L A;  4NUU A;  4PJM A;  5JDL A;  4QXC B;  3CQG B;  1NAF A;  4OK0 A;  5JR9 C;  3R6N A;  4EYY R;  3V5S A;  4GYR A;  3RRW A;  5LGT B;  3CQX C;  2NP9 A;  2X9W A;  2V7L A;  3DP7 A;  3AAI A;  2OA5 A;  4I50 E;  5L3E B;  3E08 A;  4UIG A;  3N9L A;  2DWG A;  2K24 A;  4QX7 B;  2ODU A;  3V5U A;  2NW9 A;  2CA5 A;  4H9S E;  2YU1 A;  2CE7 A;  4IE6 A;  4UXN B;  3WI3 A;  1Y64 B;  2Y6X A;  2LEH A;  5HAX A;  3U78 A;  3VKG A;  4CZZ B;  3LG7 A;  3KFW X;  5A1L A;  5CA1 E;  5H6R B;  4C90 A;  4AXP A;  4O4L E;  3E22 E;  3RPU A;  3J7Y q;  4Z8X A;  2XAJ B;  2ES0 A;  4ZS2 A;  2KLQ A;  2E8I A;  1QSD A;  2LSG A;  4EIW A;  2KIN B;  2BVL A;  2VB6 A;  3OBV E;  5HYA A;  3B13 A;  3ZMS B;  5FXV A;  1QUU A;  3UFE A;  5J1G A;  2XAS B;  3Q9D A;  1LRZ A;  2LSK A;  3N2O A;  4TUY E;  2X51 A;  1VRB A;  4IST A;  4BJN A;  1BR2 A;  4U72 A;  2H3R A;  4ASK A;  4HTE A;  2DLR A;  3ETU A;  4CI1 B;  3ZN0 B;  1X79 A;  3LBX A;  4ZHQ E;  5AFU L;  3PDY A;  4PFO A;  5LNK A;  2LSJ A;  2WWU A;  3FBZ A;  3BQI A;  3CX7 B;  3P8C D;  3AA6 B;  2VAS A;  2CLY B;  4UV8 B;  5JDN A;  4ZI2 D;  4O4I E;  4AQF A;  3ZEF B;  2ZMA A;  4B6X A;  3OYX A;  4L0R A;  4QXB B;  3UUN A;  3RYH E;  2JPF A;  1HF8 A;  2RP4 A;  4YFS A;  4G63 A;  5LBQ B;  4PJJ A;  3SS1 A;  2V7J A;  3KBT A;  2UXN B;  4CI3 B;  2YIN A;  4PAG A;  5IHY A;  2NWB A;  1O3X A;  2J1D G;  4WBO A;  4KP3 C;  1MMD A;  2X9H A;  3C50 A;  3N9Q A;  3MK7 C;  3I9Y A;  4O4H E;  4WNK A;  3N2G E;  2L9Q A;  2IC6 A;  4FJO A;  4M1P A;  3ZYM A;  1EZ3 A;  2KZ7 B;  2E9X C;  5KDM C;  2VKH A;  2C0S A;  5L3D B;  2MOZ A;  4UV9 B;  2LM9 A;  2WMO A;  4DVD A;  5LGN B;  1IJ5 A;  2EHO C;  3N2K E;  4ZI7 E;  3RYI E;  2Y48 B;  2N2N A;  3CML A;  3JC6 D;  4G2A A;  2E9X D;  3AA1 B;  1MIY A;  5L3C B;  3AVS A;  1FMV A;  4QKN A;  4V1A v;  3C64 A;  2LOS A;  4YJ2 E;  4H9O C;  5DQW A;  4O8S A;  3O1H A;  5DAB A;  3PU8 A;  1WRD A;  2V7K A;  3AAE B;  5LCY A;  4DMW A;  1ZKE A;  3CVR A;  4HE8 A;  5E0O A;  4NUV A;  2D5U A;  3PUQ A;  3IHR A;  5L3F B;  3O1J A;  2LJL A;  5ADX L;  5JVD E;  4AKI A;  3KV9 A;  3ZYL A;  3QUJ A;  2Y8D A;  1YD8 G;  3T8O A;  2L8K A;  2XQY A;  3CWZ B;  3WAJ A;  2GK9 A;  1OWA A;  5DQV A;  2I59 A;  3Q5W A;  3RC8 A;  1LVF A;  5FY0 A;  3RH3 A;  3BQK A;  3ONX A;  2VK9 A;  2ZM0 A;  4I55 E;  2XUE A;  2PG8 A;  4ADZ A;  1YW0 A;  3KV5 A;  2VKO A;  5EK4 A;  2D0T A;  2D2S A;  4IGU A;  2QA7 A;  5LHH B;  3MXZ A;  5HXE A;  1HG2 A;  4J2C A;  1KK7 A;  2D0U A;  3NBX X;  2YU2 A;  1SA0 E;  3AVR A;  2VKD A;  1E1H B;  1D0X A;  2NTX A;  4PFP A;  2MTQ A;  3PE0 A;  5J2U E;  2SPC A;  3L3P A;  4BJM A;  4K0U A;  2N9D A;  5HXS A;  4EZH A;  4YHJ A;  3Q2M A;  4CXW A;  2ZM2 A;  3Q5X A;  4ZI3 C;  5L3G B;  3VKH A;  2LHN A;  5IYZ E;  4UVB B;  3MA9 A;  4OYJ A;  4H63 V;  5JQG E;  3UTK A;  5J2T E;  1WYB A;  3ZMV B;  3K3N A;  3NZP A;  4ILU A;  1LKX A;  4DBR A;  4ZI3 D;  2LOP A;  4X20 E;  5FYM A;  1D1C A;  5LHI B;  3C4X A;  2DCF A;  4O4J E;  3B57 A;  1G8X A;  3PUA A;  2DNX A;  5CB4 E;  3OYZ A;  3RKO A;  3C4Z A;  2Q9Q B;  3ESL A;  2CCQ A;  1IAP A;  4HEA A;  2PJQ A;  2XTL A;  3ANW B;  5FY1 A;  1V9D A;  4QXH B;  4ZI2 C;  4XZC A;  2JMH A;  2V1D B;  2WAU A;  3W15 B;  3AAA B;  4CXX A;  3ZJ1 A;  3H3A A;  5LYJ E;  2WSS V;  3OJA A;  2CXF A;  3DJB A;  1D0Y A;  2W62 A;  1ZHC A;  3NRY A;  5FMN A;  2KWH A;  4TN7 B;  5LXT E;  5JDH A;  2V26 A;  4PNI A;  2EHO B;  3D0T A;  3HKB E;  5HWY A;  2CXD A;  4ANJ A;  1SHZ C;  1Z0P A;  4AI6 A;  4JUY A;  4EB6 E;  4X1Y E;  3S4U A;  5L2L A;  3U3I A;  4H63 H;  1WLX A;  4IDZ A;  3C98 B;  4CI2 B;  2W63 A;  4QX8 B;  4EZ4 A;  3JC6 C;  1US7 B;  4XBF B;  2W0G A;  1UX4 A;  2W61 A;  3DTO A;  3CX6 B;  3KIN B;  4O2A E;  4PK6 A;  4UEM A;  5FXW A;  4DMV A;  4E7S A;  4IE5 A;  2KT9 A;  4BA9 A;  5CA0 E;  5JRE A;  3KV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...