4F6RC

Tubulin:stathmin-like domain complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
64
Chain Sequence
NKATSGQSWEVILKPPSFPSLEEIQKKLEAAEERRKAHFAAMLERLQEKDKHAEEVRKNKELKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 20
structure length 64
sequence length 79
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.580 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4f6rC01
4O2AE 5CB4E 3HKDE 4O4JE 4O4HE 5LA6E 5LXTE 4O4IE 4X1KE 3HKEE 4TV8E 5GONE 5LP6E 4I50E 4X1YE 4TUYE 4X1IE 4IHJE 5KX5E 4O4LE 3N2KE 4O2BE 5JH7E 5JVDE 4X20E 5IYZE 5CA0E 4F6RC 5C8YE 4ZOLE 3RYCE 4EB6E 3HKBE 5BMVE 5EZYE 5JQGE 4I55E 5FNVE 4WBNE 5CA1E 3E22E 4TV9E 3RYHE 5J2UE 3HKCE 4YJ3E 3N2GE 4YJ2E 5LYJE 5J2TE 1SA0E 4I4TE 3UT5E 3RYFE 4ZHQE 5LOVE 4ZI7E 4IIJE 3RYIE
chains in the Genus database with same CATH superfamily
2KXPB 1N32T 3ESLA 4ERRA 4EV6A 4YLHA 4TV8E 3UUXB 2L8KA 3EAMA 4MBQA 2VKHA 1UX5A 5HEGA 4OX9T 3FZKB 5ABEA 4LF4T 4JI8T 5FVLA 3L8RA 4JLEA 5FL1A 4DV0T 1XNQT 1CHUA 4IL4A 4H9SE 5L3FB 2YEVC 4L5GA 5BMVE 3KINB 2QA7A 3PUQA 3VR8A 3KVBA 4HKAA 4JI4T 2VVNA 3CPZA 4NIQA 3A8YC 2LOPA 4OYKA 2C5IT 2FJAA 4U2ZA 4TNVA 2LSYA 2NOXA 4LMLA 3JCFA 3Q2MA 5AQLB 3ANWB 3JADA 4AISA 4YTNA 3RGLA 4FJOA 3HR0A 3GN5B 4YSZA 2M6IA 4ILCA 1KNRA 4DUZT 4HTEA 4EYUA 2EHOD 1T7SA 5FXVA 4JI6T 3O9XA 1HG5A 4JV5T 2X9WA 2XJ7A 4LFAT 5FXWA 3PUZF 1J5WA 5HXSA 3PUGA 4XBFB 4X66T 1UCUA 4AKIA 1WLXA 2ES0A 2CWYA 2XQ9A 3CQGB 3I9YA 4NPPA 3OJAA 2IIUA 3RX6A 2M67A 3ZT6A 4X1IE 4PJLA 3O1HA 2YU2A 2XPKA 2CEAA 5DJQC 3PUWF 2W62A 5IYZE 4IE0A 4ZI3C 2ZM8A 5LHGB 4Q25A 2PG8A 2VB6A 3AE2A 4B3TT 2KNDA 2VASA 2XQAA 3RRCA 1MIVA 1OEDE 2X9HA 1MNDA 2UXNB 3KDSE 3C51A 3P4QA 3UQ4A 2BVMA 1US7B 4OFZA 2XSAA 2DWKA 4DV5T 3UQ7A 3ZN1B 2E2AA 3N2GE 5JTGA 2Z6EA 5FL0A 2XY8B 5JR9B 3J7Yq 1HF8A 3IEEA 1E1HB 2CPTA 1WR0A 3MKDA 2LKGA 1IZNB 4U7IA 3L3PA 5L3GB 3RYIE 1Z0PA 4PNIA 3RIAA 4U3CA 3I0QA 3HKEE 2ZMAA 1NAFA 3KBTA 5HEOA 2LKHA 2XM1A 4UEMA 4JUYA 4JI7T 4U72A 4TX5A 3K1SA 4UVAB 2LHNA 3QOFA 4GIWA 3RIUC 4O4LE 3FBLA 3N2KE 3SRZA 3RH3A 2RA1A 5HAXA 4A98A 4CI3B 3D0TA 4YY3T 4IE7A 2LLYA 4V1Av 5LBQB 5AQFB 3X1DA 4UXNB 4QHOA 3T1YT 3KFWX 2BG9E 3AA1B 2YDSA 3VHLA 5ABFA 3ZMVB 4BJMA 2UXXB 4BA9A 2DNXA 4ILUA 3N9PA 3M3ZB 4H9PC 5AQSB 3SFEA 2HPJA 2NTXA 3N9MA 2E9XB 2R6GF 4YJ3E 4HEAA 5AQGB 2LM2A 3PJAA 4UF0A 5ETWA 3LBXA 4DR3T 1IBKT 5JRCA 2WB5A 4TWHA 5AQPB 3MZKB 4HWDA 4LF7T 2MTQA 5EK3A 3AB3B 1HNZT 3P4WA 4WBOA 4YT0A 1XDPA 2DL1A 2XAHB 5LA6E 2BG9B 4DR1T 3ZC0A 4AQYT 3UU6A 2CBIA 2BDEA 2NW9A 1FIOA 4OHFA 4K0UA 5L3BB 1IBMT 2XHEB 4LMJA 4UF0B 1OEDC 4IHJE 2V7KA 4YXDA 5JVDE 4HFEA 4E7ZA 3MA9A 4U74A 3P4PA 5FY0A 3K3NA 2JMHA 3HKBE 4ZXLA 3ZJ1A 5ABFB 1KNPA 1D0YA 2VURA 2H7VC 3EDUA 3KV9A 4IL9A 4DV4T 2E5LT 1MIWA 2D0TA 3C4WA 4ZS3A 4AKHA 1GQEA 4JBWF 5LGUB 3OKQA 5KXJA 5FXZA 4YJ2E 4ZZBA 4CQIA 5JDQA 2UUAT 5J2TE 2CRBA 4QXHB 3UT5E 2BS2A 2WZIA 3AAEB 3P7IA 5LG4A 3NZPA 2BBJA 2VQET 1T98A 2UUBT 2K24A 4X64T 3NZQA 3FZHB 4FI5A 2IDOB 5C2TA 4G2AA 1DU2A 3C98B 1W0BA 4J2CA 2KWIB 4PK6A 3E0ZA 3F31A 3T8OA 3ZN0B 1I94T 4JYAT 5F5WA 4QX8B 4DV7T 2ACZA 3WI3A 3K3QC 1S35A 1HNWT 4ANJA 3I1AA 3EVYA 3ETUA 3P4RA 4EIWA 4MHCA 4EOZB 2BBHA 4X20E 2WDRA 1YD8G 4PK5A 4AKLA 4UV8B 2NW7A 3MK7C 4PFPA 5FY7A 3AAAB 2LT3A 5HWYA 3H3MA 1HX1B 2G0UA 1V9DA 4L0RA 3ZCIA 3B57A 3ZMTB 1E7PA 2MOZA 2YKSA 4GKKT 1HR0T 3PUSA 3LFMA 1J5ET 1QUUA 3TLWA 5LGNB 3KVAA 3FXDB 3MJXA 3WAKA 5C3JA 2CWOA 4TZ4C 5ABHA 4EZHA 4KMCA 4YHJA 4BAYB 4YSXA 2EHOA 5AQQB 4H9OC 4AXPA 1KFYA 3N5LA 4HGAA 1WYBA 5JREA 3N9LA 2RPAA 4G63A 1D1AA 4I50E 1ZP0A 2CMRA 5JDGA 3LDQB 2E9XD 1BR0A 4ZZCA 3ONXA 5JDFA 3KV6A 1W0AA 4IE6A 2MAWA 4TWDA 4XAXB 4PJMA 2IAKA 2Q9QA 1XWMA 2EHOB 4TWFA 5EZYE 5FNVE 5HXHA 2CXDA 3A5XA 3LJCA 5J2UE 3FZMB 3HA4A 2AE9A 2PFVA 3UFGA 3LK3B 2QRXA 3EDVA 3EHZA 3FB2A 1NWMX 3N9QA 2XAJB 4U7YA 4PJNA 1OEDB 2DHRA 2V8SV 2W00A 3RPUA 3TLVA 4EXTA 4X5TA 3ZPOA 3U3IA 4YSYA 5J1GA 1NENA 5AQOB 1ZEEA 3JC6D 4IDQA 4DV1T 4O2AE 3RRWA 4AKGA 2PBIA 4O4JE 4O4IE 4X1KE 4LFBT 3Q5WA 5LP6E 3ZSSA 2FBWA 3VKHA 1IJ5A 4AI6A 4TUYE 5HEHA 2W67A 4ZI2D 2Y48B 2WU5A 3IHRA 5CGMA 4YHHT 2XTLA 2CHOA 2YN6A 4HWCA 3H37A 4EZ4A 1X9BA 3CK6A 2JMKA 3I0OA 2E9XC 3CQCB 2YDRA 3RYCE 2NWBA 3LK42 4EB6E 5C8YE 5M4YA 5L2LA 2F4VT 5DQVA 3OVUA 2W2UA 3FXEB 5FVKA 3UTKA 4N78D 3ABVA 3RQWA 2W4XA 5CA1E 2J1DG 3ONLC 4KX6A 3RC8A 5AQKB 3LSVA 3C50A 2NTYA 3ZYKA 4NUUA 5LBMA 1M7KA 4GK0E 3U78A 3TLUA 5KMGP 3ANWA 3CMLA 2CE7A 2CBJA 2HH7A 3L09A 5HXEA 5HEUA 4YTPA 4DR7T 1XDOA 3BQIA 2XQYA 1BR4A 4LF9T 3HKDE 3CX7B 4GYRA 4WYVA 3AEGA 3QNUA 1MMAA 2V5CA 2YK0A 1E2AA 1YKEB 3AVRA 1YXRA 3CX8B 3QK6A 1QSDA 2X0YA 1Z8UA 3AEAA 3VU7H 4PK4A 2A9UA 4CI1B 2JQHA 2UU9T 2VQFT 3AEDA 1YQ3A 4HFCA 5HXCA 1MIYA 5HCJA 3R6NA 2XAQB 2LRLA 4QXCB 4EAHA 3OYXA 1N36T 2CCQA 3LBXB 4I43B 2HPLA 2WMOA 2WSSV 4I4TE 2QGSA 2V1DB 3F2EA 1N34T 5HEJA 2AXDS 2CHNA 4A97A 2D5UA 1OXZA 2DWGA 5AFUL 1W09A 5CJ5A 2C5JA 2LSGA 1Y64B 2JRKA 3ZMUB 1IAPA 4UV9B 2OLTA 2XASB 4MALA 5JDNA 2WQYA 2XM2A 3PE0A 5L3DB 3ZYMA 5IWAT 3TLTA 2V6XA 2W63A 3ZSTA 2CM0A 3SWHA 1XZYA 4HWHA 5LGTB 3UU5A 1ZOYA 2OA5A 4EYYR 1MMDA 1T72A 4UVCB 2Q9QB 4EEDA 3VRAA 1IBLT 3AE1A 4YFSA 1T8BA 5LB7B 3UUMA 4GOUA 4P0AA 4TNWA 4CN6A 1UX4A 1ZHCA 1FMWA 1HTJF 2N2NA 3PUAA 3RIUA 3S4UA 4TN7B 3V5UA 3PUXF 5DABA 3AECA 4QKNA 4IDOA 2KT9A 3AXJB 3RQUA 4WW0A 3RYHE 5EK2A 2QYWA 3PV0F 2PTFA 2WWVA 5JRCB 1YW0A 2QVAA 2M6BA 3SFDA 4Z91A 2Y8DA 5EK4A 3RC3A 4K0KT 4DR4T 4H9RC 3Q5EA 3AE7A 2XQ5A 5HCMA 2VKJA 4O4HE 2XAGB 2JPFA 3BQLA 4OYJA 3AEFA 2UUCT 1BR1A 1UK5A 3O4XE 4IDPA 2HHHT 1U5PA 3ZC1A 4X1YE 5LJMA 4DV2T 3H3AA 2J62A 4U31A 2BG9C 2BKPA 3AA0B 3BK9A 3N9OA 3RKGA 5KDMC 2UXCT 3AAIA 4DR5T 3VKGA 2BG9A 3I9WA 2XQ8A 4QXBB 4A56A 4DIDB 2CA5A 2Q9QD 2KWHA 1VOMA 4KP3C 2YU1A 2L9QA 4DR2T 2CLYC 3OPCA 4JI3T 2E8IA 1OEDA 1I6ZA 1J1JA 4F8HA 1SE7A 5F3JA 1CUNA 1WFDA 2V5DA 4LFCT 5F8PA 1U4QA 3IF8B 3FHNA 4ZI2C 3GMIA 2WWUA 5AQMB 3FBZA 4QH4A 3AA6B 3NRXA 3ZKRA 1FEWA 4XZCA 2LEHA 2IMLA 3O1IA 1H7CA 3HL6A 4AKRB 2D0UA 4U33A 4KHZF 3WAJA 5FP3A 2LOSA 2E5VA 5LXTE 2DLRA 4P09A 3UULA 5FKYA 2FUPA 4GKJT 2LSJA 2H3RA 1SUMB 3IBPA 4JEUB 3QC9A 3A7MA 3EI0A 3PU8A 3AVSA 5ABGA 3G06A 2V26A 2ODVA 2WBLA 3IA3A 4P1NA 3NKZA 4ILBA 3KV4A 4LF5T 2VK9A 2DCFA 4QH1A 1XNRT 2X9XA 2LSKA 4WZXA 2Q9QC 5L47A 3GWHA 4X62T 3BQKA 2BVLA 4M1PA 3CQXC 4CZZB 4LMKA 5BR8T 3PURA 1HFAA 4HWIB 1W9RA 1XMQT 2ZM6T 1FMVA 3KBUA 4KBMB 3RIFA 3T1HT 2BKOA 4HFVA 2LRKA 4YTMA 4GYSA 2J47A 2X67A 4ISTA 5FY1A 2A3DA 5HYAA 4WNKA 2WP9A 3DTOA 5L3CB 2L3LA 3FZFB 1SHZC 5LCYA 4HN9A 5LHHB 3LK2B 1VRBA 4PFOA 5GONE 5JDMA 1B7TA 3LG7A 1KF6A 2WDQA 1ZV4X 3RHWA 4ADZA 1LRZA 1ZKEA 2H7OA 2E9XA 2XQ4A 4DBRA 2CXFA 2D2SA 3PUYF 3GA8A 3ZMZB 4NXNT 3B13A 2FJBA 2I0MA 1D1BA 4A5XA 2N9DA 4QWNB 4ZI3D 2K48A 3O1JA 4F6RC 2ZLYA 3JC6C 4H63V 4B3ST 2KSRA 4IE5A 5H6RB 5AQRB 2RP4A 2V6YB 1QLBA 3PU3A 3UFEA 1O3XA 4KUMB 3RI5A 4Z8XA 2WS3A 4H9NC 4IE4A 4CN4A 5LHIB 4B3MT 2K5BB 3Q5XA 5FXXA 3ZYLA 2JQKA 5LYJE 4X65T 2X51A 4NUVA 1LVFA 1HG2A 4IT4A 4ZEYA 1HNXT 1WYCA 2LSIA 3P8CD 4IREA 4EGWA 5J0ZA 5LOVE 5IUXA 4CI2B 2IHR1 3KV5A 2XQ6A 3NRYA 2FJDA 4OK0A 5AQHB 2GK9A 2IUBA 3P4SA 5AQJB 5LG3A 5JR9A 2BKNA 2XQ7A 4IDNA 5AQTB 2VVSA 2WAUA 3V5SA 1MMGA 1YKHB 2H89A 4DNDA 4LF6T 5ADXL 5CA0E 2A72A 3OTOT 4DV6T 3OYZA 1S94A 3EABA 1EZ3A 3PJAJ 1G8XA 2WMNA 3AE6A 4ZOLE 3K8PC 4PW8A 2BS4A 2DI4A 2WZHA 4DUYT 3L39A 4H9QC 2JIWA 4I55E 3ZEFB 4WBNE 5FYMA 4CXYA 2CLYB 2W66A 3CIRA 4Z90A 4GK5E 5JQGE 3RLFF 2IC9A 2W61A 3Q5DA 2X9YA 1SA0E 2JQ9A 2YINA 4HE8A 4H63H 3NBXX 4MFRA 2H88A 2V7LA 2UXDT 4ZHQE 2LM9A 2XZEA 1X79A 3ONJA 4ILAA 3ZT7A 1KNZA 5LMUT 3PUVF 5CB4E 4DVDA 4UIGA 2I6HA 2VKDA 2HN1A 4U2YA 3C64A 2BZBA 3C4XA 2WU2A 1L0VA 4DO0A 5L4EA 1XMOT 3AE8A 4JI1T 1KEYA 4JEHB 1YQ4A 3J9X1 3AE4A 4DMVA 2YOEA 4B6XA 4CN1A 5L3EB 1Y01A 2N1GA 4CXWA 2MPKA 2MYSA 5KX5E 2MBGA 3AXJA 2IC6A 1G73A 2CXLA 2EHOC 3RF1A 4JI2T 4JI5T 2V6YA 2D9DA 2KINB 5A1LA 5JR9C 2NP9A 3B5MA 3FZLB 4L9IA 4E7SA 4UR9A 3E22E 4TV9E 2PJQA 4I0UA 2XSBA 1KK7A 1BR2A 1WRDA 3CX6B 1UUSA 2JJ9A 1WR6A 2KZ7B 3EUHA 1LVKA 4HFIA 3ZCJA 4C90A 5JDHA 4QH5A 5JDLA 3K3OA 3ZMSB 1N33T 2X66A 3AE3A 4KHPT 2C5KT 2V7IA 3RYFE 2X0HA 2A2FX 3F57A 3DP7A 5L4HA 2NW8A 2Y6XA 4PAGA 1FJGT 3AEBA 2V7MA 2WDVA 3SOLA 3NVOA 3R84B 4HFBA 5AQUB 3DJBA 1D0ZA 1VCSA 2K9AA 1D0XA 2I59A 4HFDA 4O2BE 1HX8A 1UGOA 3AE5A 4IDZA 5HXRA 3PDYA 3MACA 5TAOA 3E08A 4DMWA 3UU3A 4DBQA 5CFBA 3ETVA 2NR4A 2SPCA 4AQFC 2VL8A 2WCAA 4AQGA 1OWAA 2IW5B 2UXBT 3HI2A 4AIUA 2ZM2A 1LKXA 4IGUA 1MNEA 2ODUA 3C4ZA 3GN5A 1WCRA 3Q9DA 4NXMT 1HS7A 4DR6T 4BJNA 3N9NA 3CWZB 3PTRB 3UU4A 4P0BA 2P9BA 2J4GA 4B3RT 1HCIA 3QUJA 4ZS2A 3UUNA 2ACXA 2VWAA 2B1EA 1M62A 1VCTA 2ZM0A 3CVRA 5AQNB 3UU8A 3VR9A 1R8IA 3ZJ2A 4ZI7E 4MLKA 4DV3T 4JI0T 3N2OA 3MXZA 3AA7B 1UURA 5AQVB 5LMNT 3ZT5A 5AQIB 2XAFB 3AEEA 3AE9A 4O8SA 5FMNA 3SS1A 4KI0F 5DQWA 4UVBB 3RKOA 1MMNA 2XQ3A 4HFHA 2YDQA 5JH7E 3JAEA 2W0GA 2V7JA 4QX7B 5IHYA 4COFA 2KMFA 2WY2A 4PJJA 5HWXA 1JNZA 2LHRA 1D1CA 2LE8A 3OBVE 3P50A 4LF8T 3TKLB 4ISSA 2B76A 3ZLIA 4HWFA 4CXXA 2OV9A 2VL0A 2JQQA 2WM9A 3NWIA 3QB5A 5LNKA 1AJ3A 2HN2A 2VKOA 5LJNA 3HKCE 1JNRA 1IJ6A 5H6QB 2X0LB 3JAFA 2C0SA 4UELA 3CKDA 2X68A 1NEKA 3M65A 3UUBA 2FJEA 2XUEA 2KLQA 5E0OA 4C91A 3VRBA 2LJLA 3W15B 3QB5K 2BS3A 3TLSA 2K3WA 4AQFA 4EEBA 4ASKA 4IIJE
chains in the Genus database with same CATH topology
2KXPB 3ESLA 4ERRA 4YLHA 4TV8E 3UUXB 2L8KA 4MBQA 2VKHA 1UX5A 4JLEA 5L3FB 4H9SE 2YEVC 4L5GA 5BMVE 3KINB 2QA7A 3PUQA 3KVBA 4HKAA 3CPZA 5JQGE 4OYKA 2LOPA 2C5IT 2LSYA 2NOXA 3Q2MA 3ANWB 4FJOA 3HR0A 3GN5B 4HTEA 4EYUA 2EHOD 5FXVA 3O9XA 1HG5A 2X9WA 5FXWA 4XBFB 5HXSA 3PUGA 1UCUA 4AKIA 1WLXA 2ES0A 2CWYA 3I9YA 3CQGB 3OJAA 3RX6A 2M67A 4X1IE 4PJLA 3O1HA 2YU2A 5DJQC 2CEAA 2W62A 5IYZE 4IE0A 4ZI3C 2ZM8A 5LHGB 2PG8A 2VB6A 2KNDA 2VASA 3RRCA 1MIVA 2X9HA 1MNDA 2UXNB 3KDSE 3C51A 2BVMA 1US7B 4OFZA 2DWKA 3ZN1B 3N2GE 2Z6EA 5JR9B 3J7Yq 1HF8A 3IEEA 1E1HB 3MKDA 1IZNB 3L3PA 5L3GB 3RYIE 1Z0PA 4PNIA 3I0QA 3HKEE 2ZMAA 1NAFA 3KBTA 4UEMA 4JUYA 4U72A 4TX5A 4UVAB 2LHNA 4GIWA 4O4LE 3FBLA 3N2KE 3SRZA 3RH3A 2RA1A 5HAXA 4CI3B 3D0TA 4IE7A 5LBQB 4V1Av 4UXNB 4QHOA 3KFWX 3AA1B 3VHLA 3ZMVB 4BJMA 2UXXB 4BA9A 2DNXA 4ILUA 3N9PA 4H9PC 2HPJA 2NTXA 3N9MA 2E9XB 4YJ3E 5ETWA 4HEAA 4UF0A 3LBXA 5JRCA 3MZKB 2MTQA 5EK3A 3AB3B 4WBOA 2XAHB 5LA6E 3ZC0A 2NW9A 2BDEA 1FIOA 4OHFA 4K0UA 5L3BB 2XHEB 4UF0B 4IHJE 2V7KA 5JVDE 4E7ZA 3MA9A 4U74A 5FY0A 3K3NA 2JMHA 3HKBE 3ZJ1A 5LG4A 1D0YA 2H7VC 3EDUA 3KV9A 4AKHA 1MIWA 2D0TA 3C4WA 4ZS3A 5LGUB 3OKQA 5FXZA 4YJ2E 4CQIA 5JDQA 5J2TE 4QXHB 3UT5E 3AAEB 3P7IA 3NZPA 1T98A 2K24A 3NZQA 4FI5A 4G2AA 3C98B 4J2CA 4PK6A 2KWIB 3T8OA 3E0ZA 3F31A 4P0AA 4QX8B 3WI3A 3K3QC 1S35A 4ANJA 3I1AA 3EVYA 3ETUA 4EIWA 4EOZB 4MHCA 4X20E 1YD8G 4PK5A 4AKLA 4UV8B 2NW7A 3MK7C 4PFPA 5FY7A 3AAAB 2LT3A 5HWYA 3ZMTB 2G0UA 4L0RA 1V9DA 3ZCIA 3B57A 2MOZA 3PUSA 3LFMA 1QUUA 5LGNB 3KVAA 3FXDB 3MJXA 3WAKA 2CWOA 4TZ4C 4EZHA 4KMCA 4YHJA 4BAYB 2EHOA 4AXPA 4H9OC 3N5LA 4HGAA 1WYBA 5JREA 3N9LA 4G63A 1D1AA 4I50E 2CMRA 5JDGA 2E9XD 1BR0A 3ONXA 5JDFA 3KV6A 4IE6A 4XAXB 4PJMA 2IAKA 2Q9QA 5EZYE 2EHOB 5HXHA 5FNVE 2CXDA 3A5XA 3LJCA 5J2UE 3HA4A 2PFVA 3LK3B 3EDVA 3FB2A 1NWMX 3N9QA 2XAJB 4EXTA 4PJNA 2DHRA 2W00A 3RPUA 3ZPOA 3U3IA 5J1GA 1ZEEA 3JC6D 4O2AE 3RRWA 4AKGA 2PBIA 4O4JE 4O4IE 4X1KE 3Q5WA 5LP6E 3VKHA 1IJ5A 4AI6A 4TUYE 4ZI2D 5JRCB 2Y48B 3IHRA 2XTLA 3H37A 4EZ4A 2JMKA 3I0OA 2E9XC 3CQCB 5C8YE 3RYCE 2NWBA 3LK42 4EB6E 5M4YA 5L2LA 5DQVA 3UTKA 3FXEB 4N78D 3RC8A 5CA1E 2J1DG 3C50A 2NTYA 3ZYKA 4NUUA 5LBMA 4GK0E 3U78A 5KMGP 3ANWA 3CMLA 2CE7A 3L09A 2HH7A 5HXEA 3BQIA 2XQYA 1BR4A 3HKDE 3CX7B 4GYRA 1MMAA 2YK0A 3CX8B 3AVRA 1YKEB 3QK6A 1QSDA 3VU7H 4PK4A 4CI1B 5HXCA 1MIYA 4EAHA 3R6NA 2XAQB 4QXCB 3OYXA 2CCQA 3LBXB 4I43B 2HPLA 2WMOA 2WSSV 4I4TE 2QGSA 2V1DB 3F2EA 2D5UA 1OXZA 2DWGA 5AFUL 2C5JA 2LSGA 1Y64B 2JRKA 3ZMUB 1IAPA 4UV9B 2XASB 4MALA 5JDNA 5L3DB 3PE0A 3ZYMA 2W63A 2CM0A 3SWHA 5LGTB 2OA5A 4EYYR 1MMDA 4UVCB 2Q9QB 4YFSA 3UUMA 4GOUA 1UX4A 1ZHCA 1FMWA 1HTJF 2N2NA 3PUAA 3S4UA 3ZN0B 4TN7B 3V5UA 5DABA 4QKNA 3RYHE 2KT9A 4WW0A 5EK2A 1YW0A 2Y8DA 5EK4A 3RC3A 4H9RC 2VKJA 4O4HE 2XAGB 2JPFA 3BQLA 4OYJA 1BR1A 3O4XE 1U5PA 3ZC1A 4X1YE 5LJMA 3H3AA 3BK9A 3AA0B 3N9OA 5KDMC 3VKGA 3AAIA 3I9WA 4QXBB 4A56A 2CA5A 2Q9QD 2KWHA 1VOMA 4KP3C 2YU1A 2L9QA 2CLYC 2E8IA 5F3JA 1CUNA 5F8PA 1U4QA 3IF8B 3FHNA 4ZI2C 3GMIA 2WWUA 3FBZA 3AA6B 3NRXA 1FEWA 4XZCA 2LEHA 3O1IA 1H7CA 3HL6A 4AKRB 2D0UA 3WAJA 5FP3A 2LOSA 5LXTE 2DLRA 4P09A 3UULA 2LSJA 2H3RA 3IBPA 4JEUB 3QC9A 3PU8A 3AVSA 2V26A 2ODVA 2WBLA 3KV4A 2VK9A 2DCFA 2X9XA 2LSKA 2Q9QC 3GWHA 3BQKA 2BVLA 4M1PA 3CQXC 4CZZB 3PURA 1HFAA 1FMVA 3KBUA 4KBMB 4HFVA 5FY1A 4GYSA 2X67A 4ISTA 5HYAA 2A3DA 4WNKA 3DTOA 5L3CB 2L3LA 5LCYA 1SHZC 4HN9A 5LHHB 3LK2B 1VRBA 4PFOA 5GONE 5JDMA 1B7TA 3LG7A 4AQFC 4DBRA 1ZV4X 4ADZA 1LRZA 1ZKEA 2H7OA 2E9XA 2CXFA 2D2SA 3GA8A 3ZMZB 3B13A 1D1BA 2N9DA 4QWNB 4ZI3D 2K48A 3O1JA 4F6RC 2ZLYA 3JC6C 4H63V 4IE5A 5H6RB 2RP4A 3PU3A 3UFEA 1O3XA 4KUMB 4Z8XA 4H9NC 4IE4A 5LHIB 2K5BB 3Q5XA 5FXXA 3ZYLA 5LYJE 2X51A 4NUVA 1LVFA 1HG2A 1WYCA 2LSIA 3P8CD 5LOVE 4CI2B 3KV5A 4OK0A 3NRYA 2GK9A 5JR9A 2WAUA 3V5SA 1MMGA 1YKHB 4DNDA 5ADXL 5CA0E 2A72A 3OYZA 1S94A 1EZ3A 4ZOLE 1G8XA 2WMNA 3K8PC 4PW8A 2DI4A 4H9QC 4I55E 4WBNE 3ZEFB 4CXYA 5FYMA 2CLYB 4GK5E 2IC9A 2W61A 2X9YA 1SA0E 2YINA 4HE8A 4H63H 3NBXX 4MFRA 2V7LA 4ZHQE 2LM9A 1X79A 1KNZA 5CB4E 4DVDA 4UIGA 2VKDA 4DO0A 3C64A 2BZBA 3C4XA 4JEHB 3J9X1 4DMVA 4B6XA 5L3EB 4CXWA 2N1GA 5KX5E 2MYSA 2MBGA 2IC6A 1G73A 2CXLA 2EHOC 2KINB 5A1LA 5JR9C 2NP9A 4L9IA 4E7SA 3E22E 4TV9E 2PJQA 1KK7A 1BR2A 1WRDA 3CX6B 2JJ9A 1WR6A 2KZ7B 3EUHA 1LVKA 3ZCJA 4C90A 5JDHA 5JDLA 3K3OA 3ZMSB 2X66A 2C5KT 2V7IA 3RYFE 2A2FX 3F57A 3DP7A 2NW8A 2Y6XA 4PAGA 3SOLA 2V7MA 3R84B 3DJBA 1D0ZA 2K9AA 1D0XA 2I59A 4O2BE 1HX8A 4IDZA 5HXRA 3PDYA 3MACA 5TAOA 3E08A 4DMWA 4DBQA 3ETVA 2SPCA 2VL8A 4AQGA 1OWAA 2IW5B 3HI2A 2ZM2A 1LKXA 4IGUA 1MNEA 2ODUA 3C4ZA 3GN5A 3Q9DA 1HS7A 4BJNA 3N9NA 3CWZB 3PTRB 4P0BA 2P9BA 1HCIA 3QUJA 4ZS2A 3UUNA 2ACXA 2VWAA 2B1EA 2ZM0A 3CVRA 4ZI7E 3ZJ2A 4MLKA 3N2OA 3MXZA 3AA7B 2XAFB 4O8SA 5FMNA 3SS1A 5DQWA 4UVBB 3RKOA 1MMNA 5JH7E 2W0GA 2V7JA 4QX7B 5IHYA 2KMFA 4PJJA 5HWXA 2LHRA 1D1CA 2LE8A 3OBVE 3ZLIA 3TKLB 4ISSA 4CXXA 2JQQA 2WM9A 5LNKA 1AJ3A 2VKOA 5LJNA 3HKCE 1IJ6A 5H6QB 2X0LB 4UELA 2C0SA 3CKDA 2X68A 3M65A 2XUEA 2KLQA 5E0OA 4C91A 2LJLA 3W15B 4AQFA 4ASKA 4IIJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2A E;  5CB4 E;  3HKD E;  4O4J E;  4O4H E;  5LA6 E;  5LXT E;  4O4I E;  4X1K E;  3HKE E;  4TV8 E;  5GON E;  5LP6 E;  4I50 E;  4X1Y E;  4TUY E;  4X1I E;  4IHJ E;  5KX5 E;  4O4L E;  3N2K E;  4O2B E;  5JH7 E;  5JVD E;  4X20 E;  5IYZ E;  5CA0 E;  4F6R C;  5C8Y E;  4ZOL E;  3RYC E;  4EB6 E;  3HKB E;  5BMV E;  5EZY E;  5JQG E;  4I55 E;  5FNV E;  4WBN E;  5CA1 E;  3E22 E;  4TV9 E;  3RYH E;  5J2U E;  3HKC E;  4YJ3 E;  3N2G E;  4YJ2 E;  5LYJ E;  5J2T E;  1SA0 E;  4I4T E;  3UT5 E;  3RYF E;  4ZHQ E;  5LOV E;  4ZI7 E;  4IIJ E;  3RYI E; 
#chains in the Genus database with same CATH topology
 2KXP B;  1N32 T;  3ESL A;  4ERR A;  4EV6 A;  4YLH A;  4TV8 E;  3UUX B;  2L8K A;  3EAM A;  4MBQ A;  2VKH A;  1UX5 A;  5HEG A;  4OX9 T;  3FZK B;  5ABE A;  4LF4 T;  4JI8 T;  5FVL A;  3L8R A;  4JLE A;  5FL1 A;  4DV0 T;  1XNQ T;  1CHU A;  4IL4 A;  4H9S E;  5L3F B;  2YEV C;  4L5G A;  5BMV E;  3KIN B;  2QA7 A;  3PUQ A;  3VR8 A;  3KVB A;  4HKA A;  4JI4 T;  2VVN A;  3CPZ A;  4NIQ A;  3A8Y C;  2LOP A;  4OYK A;  2C5I T;  2FJA A;  4U2Z A;  4TNV A;  2LSY A;  2NOX A;  4LML A;  3JCF A;  3Q2M A;  5AQL B;  3ANW B;  3JAD A;  4AIS A;  4YTN A;  3RGL A;  4FJO A;  3HR0 A;  3GN5 B;  4YSZ A;  2M6I A;  4ILC A;  1KNR A;  4DUZ T;  4HTE A;  4EYU A;  2EHO D;  1T7S A;  5FXV A;  4JI6 T;  3O9X A;  1HG5 A;  4JV5 T;  2X9W A;  2XJ7 A;  4LFA T;  5FXW A;  3PUZ F;  1J5W A;  5HXS A;  3PUG A;  4XBF B;  4X66 T;  1UCU A;  4AKI A;  1WLX A;  2ES0 A;  2CWY A;  2XQ9 A;  3CQG B;  3I9Y A;  4NPP A;  3OJA A;  2IIU A;  3RX6 A;  2M67 A;  3ZT6 A;  4X1I E;  4PJL A;  3O1H A;  2YU2 A;  2XPK A;  2CEA A;  5DJQ C;  3PUW F;  2W62 A;  5IYZ E;  4IE0 A;  4ZI3 C;  2ZM8 A;  5LHG B;  4Q25 A;  2PG8 A;  2VB6 A;  3AE2 A;  4B3T T;  2KND A;  2VAS A;  2XQA A;  3RRC A;  1MIV A;  1OED E;  2X9H A;  1MND A;  2UXN B;  3KDS E;  3C51 A;  3P4Q A;  3UQ4 A;  2BVM A;  1US7 B;  4OFZ A;  2XSA A;  2DWK A;  4DV5 T;  3UQ7 A;  3ZN1 B;  2E2A A;  3N2G E;  5JTG A;  2Z6E A;  5FL0 A;  2XY8 B;  5JR9 B;  3J7Y q;  1HF8 A;  3IEE A;  1E1H B;  2CPT A;  1WR0 A;  3MKD A;  2LKG A;  1IZN B;  4U7I A;  3L3P A;  5L3G B;  3RYI E;  1Z0P A;  4PNI A;  3RIA A;  4U3C A;  3I0Q A;  3HKE E;  2ZMA A;  1NAF A;  3KBT A;  5HEO A;  2LKH A;  2XM1 A;  4UEM A;  4JUY A;  4JI7 T;  4U72 A;  4TX5 A;  3K1S A;  4UVA B;  2LHN A;  3QOF A;  4GIW A;  3RIU C;  4O4L E;  3FBL A;  3N2K E;  3SRZ A;  3RH3 A;  2RA1 A;  5HAX A;  4A98 A;  4CI3 B;  3D0T A;  4YY3 T;  4IE7 A;  2LLY A;  4V1A v;  5LBQ B;  5AQF B;  3X1D A;  4UXN B;  4QHO A;  3T1Y T;  3KFW X;  2BG9 E;  3AA1 B;  2YDS A;  3VHL A;  5ABF A;  3ZMV B;  4BJM A;  2UXX B;  4BA9 A;  2DNX A;  4ILU A;  3N9P A;  3M3Z B;  4H9P C;  5AQS B;  3SFE A;  2HPJ A;  2NTX A;  3N9M A;  2E9X B;  2R6G F;  4YJ3 E;  4HEA A;  5AQG B;  2LM2 A;  3PJA A;  4UF0 A;  5ETW A;  3LBX A;  4DR3 T;  1IBK T;  5JRC A;  2WB5 A;  4TWH A;  5AQP B;  3MZK B;  4HWD A;  4LF7 T;  2MTQ A;  5EK3 A;  3AB3 B;  1HNZ T;  3P4W A;  4WBO A;  4YT0 A;  1XDP A;  2DL1 A;  2XAH B;  5LA6 E;  2BG9 B;  4DR1 T;  3ZC0 A;  4AQY T;  3UU6 A;  2CBI A;  2BDE A;  2NW9 A;  1FIO A;  4OHF A;  4K0U A;  5L3B B;  1IBM T;  2XHE B;  4LMJ A;  4UF0 B;  1OED C;  4IHJ E;  2V7K A;  4YXD A;  5JVD E;  4HFE A;  4E7Z A;  3MA9 A;  4U74 A;  3P4P A;  5FY0 A;  3K3N A;  2JMH A;  3HKB E;  4ZXL A;  3ZJ1 A;  5ABF B;  1KNP A;  1D0Y A;  2VUR A;  2H7V C;  3EDU A;  3KV9 A;  4IL9 A;  4DV4 T;  2E5L T;  1MIW A;  2D0T A;  3C4W A;  4ZS3 A;  4AKH A;  1GQE A;  4JBW F;  5LGU B;  3OKQ A;  5KXJ A;  5FXZ A;  4YJ2 E;  4ZZB A;  4CQI A;  5JDQ A;  2UUA T;  5J2T E;  2CRB A;  4QXH B;  3UT5 E;  2BS2 A;  2WZI A;  3AAE B;  3P7I A;  5LG4 A;  3NZP A;  2BBJ A;  2VQE T;  1T98 A;  2UUB T;  2K24 A;  4X64 T;  3NZQ A;  3FZH B;  4FI5 A;  2IDO B;  5C2T A;  4G2A A;  1DU2 A;  3C98 B;  1W0B A;  4J2C A;  2KWI B;  4PK6 A;  3E0Z A;  3F31 A;  3T8O A;  3ZN0 B;  1I94 T;  4JYA T;  5F5W A;  4QX8 B;  4DV7 T;  2ACZ A;  3WI3 A;  3K3Q C;  1S35 A;  1HNW T;  4ANJ A;  3I1A A;  3EVY A;  3ETU A;  3P4R A;  4EIW A;  4MHC A;  4EOZ B;  2BBH A;  4X20 E;  2WDR A;  1YD8 G;  4PK5 A;  4AKL A;  4UV8 B;  2NW7 A;  3MK7 C;  4PFP A;  5FY7 A;  3AAA B;  2LT3 A;  5HWY A;  3H3M A;  1HX1 B;  2G0U A;  1V9D A;  4L0R A;  3ZCI A;  3B57 A;  3ZMT B;  1E7P A;  2MOZ A;  2YKS A;  4GKK T;  1HR0 T;  3PUS A;  3LFM A;  1J5E T;  1QUU A;  3TLW A;  5LGN B;  3KVA A;  3FXD B;  3MJX A;  3WAK A;  5C3J A;  2CWO A;  4TZ4 C;  5ABH A;  4EZH A;  4KMC A;  4YHJ A;  4BAY B;  4YSX A;  2EHO A;  5AQQ B;  4H9O C;  4AXP A;  1KFY A;  3N5L A;  4HGA A;  1WYB A;  5JRE A;  3N9L A;  2RPA A;  4G63 A;  1D1A A;  4I50 E;  1ZP0 A;  2CMR A;  5JDG A;  3LDQ B;  2E9X D;  1BR0 A;  4ZZC A;  3ONX A;  5JDF A;  3KV6 A;  1W0A A;  4IE6 A;  2MAW A;  4TWD A;  4XAX B;  4PJM A;  2IAK A;  2Q9Q A;  1XWM A;  2EHO B;  4TWF A;  5EZY E;  5FNV E;  5HXH A;  2CXD A;  3A5X A;  3LJC A;  5J2U E;  3FZM B;  3HA4 A;  2AE9 A;  2PFV A;  3UFG A;  3LK3 B;  2QRX A;  3EDV A;  3EHZ A;  3FB2 A;  1NWM X;  3N9Q A;  2XAJ B;  4U7Y A;  4PJN A;  1OED B;  2DHR A;  2V8S V;  2W00 A;  3RPU A;  3TLV A;  4EXT A;  4X5T A;  3ZPO A;  3U3I A;  4YSY A;  5J1G A;  1NEN A;  5AQO B;  1ZEE A;  3JC6 D;  4IDQ A;  4DV1 T;  4O2A E;  3RRW A;  4AKG A;  2PBI A;  4O4J E;  4O4I E;  4X1K E;  4LFB T;  3Q5W A;  5LP6 E;  3ZSS A;  2FBW A;  3VKH A;  1IJ5 A;  4AI6 A;  4TUY E;  5HEH A;  2W67 A;  4ZI2 D;  2Y48 B;  2WU5 A;  3IHR A;  5CGM A;  4YHH T;  2XTL A;  2CHO A;  2YN6 A;  4HWC A;  3H37 A;  4EZ4 A;  1X9B A;  3CK6 A;  2JMK A;  3I0O A;  2E9X C;  3CQC B;  2YDR A;  3RYC E;  2NWB A;  3LK4 2;  4EB6 E;  5C8Y E;  5M4Y A;  5L2L A;  2F4V T;  5DQV A;  3OVU A;  2W2U A;  3FXE B;  5FVK A;  3UTK A;  4N78 D;  3ABV A;  3RQW A;  2W4X A;  5CA1 E;  2J1D G;  3ONL C;  4KX6 A;  3RC8 A;  5AQK B;  3LSV A;  3C50 A;  2NTY A;  3ZYK A;  4NUU A;  5LBM A;  1M7K A;  4GK0 E;  3U78 A;  3TLU A;  5KMG P;  3ANW A;  3CML A;  2CE7 A;  2CBJ A;  2HH7 A;  3L09 A;  5HXE A;  5HEU A;  4YTP A;  4DR7 T;  1XDO A;  3BQI A;  2XQY A;  1BR4 A;  4LF9 T;  3HKD E;  3CX7 B;  4GYR A;  4WYV A;  3AEG A;  3QNU A;  1MMA A;  2V5C A;  2YK0 A;  1E2A A;  1YKE B;  3AVR A;  1YXR A;  3CX8 B;  3QK6 A;  1QSD A;  2X0Y A;  1Z8U A;  3AEA A;  3VU7 H;  4PK4 A;  2A9U A;  4CI1 B;  2JQH A;  2UU9 T;  2VQF T;  3AED A;  1YQ3 A;  4HFC A;  5HXC A;  1MIY A;  5HCJ A;  3R6N A;  2XAQ B;  2LRL A;  4QXC B;  4EAH A;  3OYX A;  1N36 T;  2CCQ A;  3LBX B;  4I43 B;  2HPL A;  2WMO A;  2WSS V;  4I4T E;  2QGS A;  2V1D B;  3F2E A;  1N34 T;  5HEJ A;  2AXD S;  2CHN A;  4A97 A;  2D5U A;  1OXZ A;  2DWG A;  5AFU L;  1W09 A;  5CJ5 A;  2C5J A;  2LSG A;  1Y64 B;  2JRK A;  3ZMU B;  1IAP A;  4UV9 B;  2OLT A;  2XAS B;  4MAL A;  5JDN A;  2WQY A;  2XM2 A;  3PE0 A;  5L3D B;  3ZYM A;  5IWA T;  3TLT A;  2V6X A;  2W63 A;  3ZST A;  2CM0 A;  3SWH A;  1XZY A;  4HWH A;  5LGT B;  3UU5 A;  1ZOY A;  2OA5 A;  4EYY R;  1MMD A;  1T72 A;  4UVC B;  2Q9Q B;  4EED A;  3VRA A;  1IBL T;  3AE1 A;  4YFS A;  1T8B A;  5LB7 B;  3UUM A;  4GOU A;  4P0A A;  4TNW A;  4CN6 A;  1UX4 A;  1ZHC A;  1FMW A;  1HTJ F;  2N2N A;  3PUA A;  3RIU A;  3S4U A;  4TN7 B;  3V5U A;  3PUX F;  5DAB A;  3AEC A;  4QKN A;  4IDO A;  2KT9 A;  3AXJ B;  3RQU A;  4WW0 A;  3RYH E;  5EK2 A;  2QYW A;  3PV0 F;  2PTF A;  2WWV A;  5JRC B;  1YW0 A;  2QVA A;  2M6B A;  3SFD A;  4Z91 A;  2Y8D A;  5EK4 A;  3RC3 A;  4K0K T;  4DR4 T;  4H9R C;  3Q5E A;  3AE7 A;  2XQ5 A;  5HCM A;  2VKJ A;  4O4H E;  2XAG B;  2JPF A;  3BQL A;  4OYJ A;  3AEF A;  2UUC T;  1BR1 A;  1UK5 A;  3O4X E;  4IDP A;  2HHH T;  1U5P A;  3ZC1 A;  4X1Y E;  5LJM A;  4DV2 T;  3H3A A;  2J62 A;  4U31 A;  2BG9 C;  2BKP A;  3AA0 B;  3BK9 A;  3N9O A;  3RKG A;  5KDM C;  2UXC T;  3AAI A;  4DR5 T;  3VKG A;  2BG9 A;  3I9W A;  2XQ8 A;  4QXB B;  4A56 A;  4DID B;  2CA5 A;  2Q9Q D;  2KWH A;  1VOM A;  4KP3 C;  2YU1 A;  2L9Q A;  4DR2 T;  2CLY C;  3OPC A;  4JI3 T;  2E8I A;  1OED A;  1I6Z A;  1J1J A;  4F8H A;  1SE7 A;  5F3J A;  1CUN A;  1WFD A;  2V5D A;  4LFC T;  5F8P A;  1U4Q A;  3IF8 B;  3FHN A;  4ZI2 C;  3GMI A;  2WWU A;  5AQM B;  3FBZ A;  4QH4 A;  3AA6 B;  3NRX A;  3ZKR A;  1FEW A;  4XZC A;  2LEH A;  2IML A;  3O1I A;  1H7C A;  3HL6 A;  4AKR B;  2D0U A;  4U33 A;  4KHZ F;  3WAJ A;  5FP3 A;  2LOS A;  2E5V A;  5LXT E;  2DLR A;  4P09 A;  3UUL A;  5FKY A;  2FUP A;  4GKJ T;  2LSJ A;  2H3R A;  1SUM B;  3IBP A;  4JEU B;  3QC9 A;  3A7M A;  3EI0 A;  3PU8 A;  3AVS A;  5ABG A;  3G06 A;  2V26 A;  2ODV A;  2WBL A;  3IA3 A;  4P1N A;  3NKZ A;  4ILB A;  3KV4 A;  4LF5 T;  2VK9 A;  2DCF A;  4QH1 A;  1XNR T;  2X9X A;  2LSK A;  4WZX A;  2Q9Q C;  5L47 A;  3GWH A;  4X62 T;  3BQK A;  2BVL A;  4M1P A;  3CQX C;  4CZZ B;  4LMK A;  5BR8 T;  3PUR A;  1HFA A;  4HWI B;  1W9R A;  1XMQ T;  2ZM6 T;  1FMV A;  3KBU A;  4KBM B;  3RIF A;  3T1H T;  2BKO A;  4HFV A;  2LRK A;  4YTM A;  4GYS A;  2J47 A;  2X67 A;  4IST A;  5FY1 A;  2A3D A;  5HYA A;  4WNK A;  2WP9 A;  3DTO A;  5L3C B;  2L3L A;  3FZF B;  1SHZ C;  5LCY A;  4HN9 A;  5LHH B;  3LK2 B;  1VRB A;  4PFO A;  5GON E;  5JDM A;  1B7T A;  3LG7 A;  1KF6 A;  2WDQ A;  1ZV4 X;  3RHW A;  4ADZ A;  1LRZ A;  1ZKE A;  2H7O A;  2E9X A;  2XQ4 A;  4DBR A;  2CXF A;  2D2S A;  3PUY F;  3GA8 A;  3ZMZ B;  4NXN T;  3B13 A;  2FJB A;  2I0M A;  1D1B A;  4A5X A;  2N9D A;  4QWN B;  4ZI3 D;  2K48 A;  3O1J A;  4F6R C;  2ZLY A;  3JC6 C;  4H63 V;  4B3S T;  2KSR A;  4IE5 A;  5H6R B;  5AQR B;  2RP4 A;  2V6Y B;  1QLB A;  3PU3 A;  3UFE A;  1O3X A;  4KUM B;  3RI5 A;  4Z8X A;  2WS3 A;  4H9N C;  4IE4 A;  4CN4 A;  5LHI B;  4B3M T;  2K5B B;  3Q5X A;  5FXX A;  3ZYL A;  2JQK A;  5LYJ E;  4X65 T;  2X51 A;  4NUV A;  1LVF A;  1HG2 A;  4IT4 A;  4ZEY A;  1HNX T;  1WYC A;  2LSI A;  3P8C D;  4IRE A;  4EGW A;  5J0Z A;  5LOV E;  5IUX A;  4CI2 B;  2IHR 1;  3KV5 A;  2XQ6 A;  3NRY A;  2FJD A;  4OK0 A;  5AQH B;  2GK9 A;  2IUB A;  3P4S A;  5AQJ B;  5LG3 A;  5JR9 A;  2BKN A;  2XQ7 A;  4IDN A;  5AQT B;  2VVS A;  2WAU A;  3V5S A;  1MMG A;  1YKH B;  2H89 A;  4DND A;  4LF6 T;  5ADX L;  5CA0 E;  2A72 A;  3OTO T;  4DV6 T;  3OYZ A;  1S94 A;  3EAB A;  1EZ3 A;  3PJA J;  1G8X A;  2WMN A;  3AE6 A;  4ZOL E;  3K8P C;  4PW8 A;  2BS4 A;  2DI4 A;  2WZH A;  4DUY T;  3L39 A;  4H9Q C;  2JIW A;  4I55 E;  3ZEF B;  4WBN E;  5FYM A;  4CXY A;  2CLY B;  2W66 A;  3CIR A;  4Z90 A;  4GK5 E;  5JQG E;  3RLF F;  2IC9 A;  2W61 A;  3Q5D A;  2X9Y A;  1SA0 E;  2JQ9 A;  2YIN A;  4HE8 A;  4H63 H;  3NBX X;  4MFR A;  2H88 A;  2V7L A;  2UXD T;  4ZHQ E;  2LM9 A;  2XZE A;  1X79 A;  3ONJ A;  4ILA A;  3ZT7 A;  1KNZ A;  5LMU T;  3PUV F;  5CB4 E;  4DVD A;  4UIG A;  2I6H A;  2VKD A;  2HN1 A;  4U2Y A;  3C64 A;  2BZB A;  3C4X A;  2WU2 A;  1L0V A;  4DO0 A;  5L4E A;  1XMO T;  3AE8 A;  4JI1 T;  1KEY A;  4JEH B;  1YQ4 A;  3J9X 1;  3AE4 A;  4DMV A;  2YOE A;  4B6X A;  4CN1 A;  5L3E B;  1Y01 A;  2N1G A;  4CXW A;  2MPK A;  2MYS A;  5KX5 E;  2MBG A;  3AXJ A;  2IC6 A;  1G73 A;  2CXL A;  2EHO C;  3RF1 A;  4JI2 T;  4JI5 T;  2V6Y A;  2D9D A;  2KIN B;  5A1L A;  5JR9 C;  2NP9 A;  3B5M A;  3FZL B;  4L9I A;  4E7S A;  4UR9 A;  3E22 E;  4TV9 E;  2PJQ A;  4I0U A;  2XSB A;  1KK7 A;  1BR2 A;  1WRD A;  3CX6 B;  1UUS A;  2JJ9 A;  1WR6 A;  2KZ7 B;  3EUH A;  1LVK A;  4HFI A;  3ZCJ A;  4C90 A;  5JDH A;  4QH5 A;  5JDL A;  3K3O A;  3ZMS B;  1N33 T;  2X66 A;  3AE3 A;  4KHP T;  2C5K T;  2V7I A;  3RYF E;  2X0H A;  2A2F X;  3F57 A;  3DP7 A;  5L4H A;  2NW8 A;  2Y6X A;  4PAG A;  1FJG T;  3AEB A;  2V7M A;  2WDV A;  3SOL A;  3NVO A;  3R84 B;  4HFB A;  5AQU B;  3DJB A;  1D0Z A;  1VCS A;  2K9A A;  1D0X A;  2I59 A;  4HFD A;  4O2B E;  1HX8 A;  1UGO A;  3AE5 A;  4IDZ A;  5HXR A;  3PDY A;  3MAC A;  5TAO A;  3E08 A;  4DMW A;  3UU3 A;  4DBQ A;  5CFB A;  3ETV A;  2NR4 A;  2SPC A;  4AQF C;  2VL8 A;  2WCA A;  4AQG A;  1OWA A;  2IW5 B;  2UXB T;  3HI2 A;  4AIU A;  2ZM2 A;  1LKX A;  4IGU A;  1MNE A;  2ODU A;  3C4Z A;  3GN5 A;  1WCR A;  3Q9D A;  4NXM T;  1HS7 A;  4DR6 T;  4BJN A;  3N9N A;  3CWZ B;  3PTR B;  3UU4 A;  4P0B A;  2P9B A;  2J4G A;  4B3R T;  1HCI A;  3QUJ A;  4ZS2 A;  3UUN A;  2ACX A;  2VWA A;  2B1E A;  1M62 A;  1VCT A;  2ZM0 A;  3CVR A;  5AQN B;  3UU8 A;  3VR9 A;  1R8I A;  3ZJ2 A;  4ZI7 E;  4MLK A;  4DV3 T;  4JI0 T;  3N2O A;  3MXZ A;  3AA7 B;  1UUR A;  5AQV B;  5LMN T;  3ZT5 A;  5AQI B;  2XAF B;  3AEE A;  3AE9 A;  4O8S A;  5FMN A;  3SS1 A;  4KI0 F;  5DQW A;  4UVB B;  3RKO A;  1MMN A;  2XQ3 A;  4HFH A;  2YDQ A;  5JH7 E;  3JAE A;  2W0G A;  2V7J A;  4QX7 B;  5IHY A;  4COF A;  2KMF A;  2WY2 A;  4PJJ A;  5HWX A;  1JNZ A;  2LHR A;  1D1C A;  2LE8 A;  3OBV E;  3P50 A;  4LF8 T;  3TKL B;  4ISS A;  2B76 A;  3ZLI A;  4HWF A;  4CXX A;  2OV9 A;  2VL0 A;  2JQQ A;  2WM9 A;  3NWI A;  3QB5 A;  5LNK A;  1AJ3 A;  2HN2 A;  2VKO A;  5LJN A;  3HKC E;  1JNR A;  1IJ6 A;  5H6Q B;  2X0L B;  3JAF A;  2C0S A;  4UEL A;  3CKD A;  2X68 A;  1NEK A;  3M65 A;  3UUB A;  2FJE A;  2XUE A;  2KLQ A;  5E0O A;  4C91 A;  3VRB A;  2LJL A;  3W15 B;  3QB5 K;  2BS3 A;  3TLS A;  2K3W A;  4AQF A;  4EEB A;  4ASK A;  4IIJ E; 
#chains in the Genus database with same CATH homology
 2KXP B;  3ESL A;  4ERR A;  4YLH A;  4TV8 E;  3UUX B;  2L8K A;  4MBQ A;  2VKH A;  1UX5 A;  4JLE A;  5L3F B;  4H9S E;  2YEV C;  4L5G A;  5BMV E;  3KIN B;  2QA7 A;  3PUQ A;  3KVB A;  4HKA A;  3CPZ A;  5JQG E;  4OYK A;  2LOP A;  2C5I T;  2LSY A;  2NOX A;  3Q2M A;  3ANW B;  4FJO A;  3HR0 A;  3GN5 B;  4HTE A;  4EYU A;  2EHO D;  5FXV A;  3O9X A;  1HG5 A;  2X9W A;  5FXW A;  4XBF B;  5HXS A;  3PUG A;  1UCU A;  4AKI A;  1WLX A;  2ES0 A;  2CWY A;  3I9Y A;  3CQG B;  3OJA A;  3RX6 A;  2M67 A;  4X1I E;  4PJL A;  3O1H A;  2YU2 A;  5DJQ C;  2CEA A;  2W62 A;  5IYZ E;  4IE0 A;  4ZI3 C;  2ZM8 A;  5LHG B;  2PG8 A;  2VB6 A;  2KND A;  2VAS A;  3RRC A;  1MIV A;  2X9H A;  1MND A;  2UXN B;  3KDS E;  3C51 A;  2BVM A;  1US7 B;  4OFZ A;  2DWK A;  3ZN1 B;  3N2G E;  2Z6E A;  5JR9 B;  3J7Y q;  1HF8 A;  3IEE A;  1E1H B;  3MKD A;  1IZN B;  3L3P A;  5L3G B;  3RYI E;  1Z0P A;  4PNI A;  3I0Q A;  3HKE E;  2ZMA A;  1NAF A;  3KBT A;  4UEM A;  4JUY A;  4U72 A;  4TX5 A;  4UVA B;  2LHN A;  4GIW A;  4O4L E;  3FBL A;  3N2K E;  3SRZ A;  3RH3 A;  2RA1 A;  5HAX A;  4CI3 B;  3D0T A;  4IE7 A;  5LBQ B;  4V1A v;  4UXN B;  4QHO A;  3KFW X;  3AA1 B;  3VHL A;  3ZMV B;  4BJM A;  2UXX B;  4BA9 A;  2DNX A;  4ILU A;  3N9P A;  4H9P C;  2HPJ A;  2NTX A;  3N9M A;  2E9X B;  4YJ3 E;  5ETW A;  4HEA A;  4UF0 A;  3LBX A;  5JRC A;  3MZK B;  2MTQ A;  5EK3 A;  3AB3 B;  4WBO A;  2XAH B;  5LA6 E;  3ZC0 A;  2NW9 A;  2BDE A;  1FIO A;  4OHF A;  4K0U A;  5L3B B;  2XHE B;  4UF0 B;  4IHJ E;  2V7K A;  5JVD E;  4E7Z A;  3MA9 A;  4U74 A;  5FY0 A;  3K3N A;  2JMH A;  3HKB E;  3ZJ1 A;  5LG4 A;  1D0Y A;  2H7V C;  3EDU A;  3KV9 A;  4AKH A;  1MIW A;  2D0T A;  3C4W A;  4ZS3 A;  5LGU B;  3OKQ A;  5FXZ A;  4YJ2 E;  4CQI A;  5JDQ A;  5J2T E;  4QXH B;  3UT5 E;  3AAE B;  3P7I A;  3NZP A;  1T98 A;  2K24 A;  3NZQ A;  4FI5 A;  4G2A A;  3C98 B;  4J2C A;  4PK6 A;  2KWI B;  3T8O A;  3E0Z A;  3F31 A;  4P0A A;  4QX8 B;  3WI3 A;  3K3Q C;  1S35 A;  4ANJ A;  3I1A A;  3EVY A;  3ETU A;  4EIW A;  4EOZ B;  4MHC A;  4X20 E;  1YD8 G;  4PK5 A;  4AKL A;  4UV8 B;  2NW7 A;  3MK7 C;  4PFP A;  5FY7 A;  3AAA B;  2LT3 A;  5HWY A;  3ZMT B;  2G0U A;  4L0R A;  1V9D A;  3ZCI A;  3B57 A;  2MOZ A;  3PUS A;  3LFM A;  1QUU A;  5LGN B;  3KVA A;  3FXD B;  3MJX A;  3WAK A;  2CWO A;  4TZ4 C;  4EZH A;  4KMC A;  4YHJ A;  4BAY B;  2EHO A;  4AXP A;  4H9O C;  3N5L A;  4HGA A;  1WYB A;  5JRE A;  3N9L A;  4G63 A;  1D1A A;  4I50 E;  2CMR A;  5JDG A;  2E9X D;  1BR0 A;  3ONX A;  5JDF A;  3KV6 A;  4IE6 A;  4XAX B;  4PJM A;  2IAK A;  2Q9Q A;  5EZY E;  2EHO B;  5HXH A;  5FNV E;  2CXD A;  3A5X A;  3LJC A;  5J2U E;  3HA4 A;  2PFV A;  3LK3 B;  3EDV A;  3FB2 A;  1NWM X;  3N9Q A;  2XAJ B;  4EXT A;  4PJN A;  2DHR A;  2W00 A;  3RPU A;  3ZPO A;  3U3I A;  5J1G A;  1ZEE A;  3JC6 D;  4O2A E;  3RRW A;  4AKG A;  2PBI A;  4O4J E;  4O4I E;  4X1K E;  3Q5W A;  5LP6 E;  3VKH A;  1IJ5 A;  4AI6 A;  4TUY E;  4ZI2 D;  5JRC B;  2Y48 B;  3IHR A;  2XTL A;  3H37 A;  4EZ4 A;  2JMK A;  3I0O A;  2E9X C;  3CQC B;  5C8Y E;  3RYC E;  2NWB A;  3LK4 2;  4EB6 E;  5M4Y A;  5L2L A;  5DQV A;  3UTK A;  3FXE B;  4N78 D;  3RC8 A;  5CA1 E;  2J1D G;  3C50 A;  2NTY A;  3ZYK A;  4NUU A;  5LBM A;  4GK0 E;  3U78 A;  5KMG P;  3ANW A;  3CML A;  2CE7 A;  3L09 A;  2HH7 A;  5HXE A;  3BQI A;  2XQY A;  1BR4 A;  3HKD E;  3CX7 B;  4GYR A;  1MMA A;  2YK0 A;  3CX8 B;  3AVR A;  1YKE B;  3QK6 A;  1QSD A;  3VU7 H;  4PK4 A;  4CI1 B;  5HXC A;  1MIY A;  4EAH A;  3R6N A;  2XAQ B;  4QXC B;  3OYX A;  2CCQ A;  3LBX B;  4I43 B;  2HPL A;  2WMO A;  2WSS V;  4I4T E;  2QGS A;  2V1D B;  3F2E A;  2D5U A;  1OXZ A;  2DWG A;  5AFU L;  2C5J A;  2LSG A;  1Y64 B;  2JRK A;  3ZMU B;  1IAP A;  4UV9 B;  2XAS B;  4MAL A;  5JDN A;  5L3D B;  3PE0 A;  3ZYM A;  2W63 A;  2CM0 A;  3SWH A;  5LGT B;  2OA5 A;  4EYY R;  1MMD A;  4UVC B;  2Q9Q B;  4YFS A;  3UUM A;  4GOU A;  1UX4 A;  1ZHC A;  1FMW A;  1HTJ F;  2N2N A;  3PUA A;  3S4U A;  3ZN0 B;  4TN7 B;  3V5U A;  5DAB A;  4QKN A;  3RYH E;  2KT9 A;  4WW0 A;  5EK2 A;  1YW0 A;  2Y8D A;  5EK4 A;  3RC3 A;  4H9R C;  2VKJ A;  4O4H E;  2XAG B;  2JPF A;  3BQL A;  4OYJ A;  1BR1 A;  3O4X E;  1U5P A;  3ZC1 A;  4X1Y E;  5LJM A;  3H3A A;  3BK9 A;  3AA0 B;  3N9O A;  5KDM C;  3VKG A;  3AAI A;  3I9W A;  4QXB B;  4A56 A;  2CA5 A;  2Q9Q D;  2KWH A;  1VOM A;  4KP3 C;  2YU1 A;  2L9Q A;  2CLY C;  2E8I A;  5F3J A;  1CUN A;  5F8P A;  1U4Q A;  3IF8 B;  3FHN A;  4ZI2 C;  3GMI A;  2WWU A;  3FBZ A;  3AA6 B;  3NRX A;  1FEW A;  4XZC A;  2LEH A;  3O1I A;  1H7C A;  3HL6 A;  4AKR B;  2D0U A;  3WAJ A;  5FP3 A;  2LOS A;  5LXT E;  2DLR A;  4P09 A;  3UUL A;  2LSJ A;  2H3R A;  3IBP A;  4JEU B;  3QC9 A;  3PU8 A;  3AVS A;  2V26 A;  2ODV A;  2WBL A;  3KV4 A;  2VK9 A;  2DCF A;  2X9X A;  2LSK A;  2Q9Q C;  3GWH A;  3BQK A;  2BVL A;  4M1P A;  3CQX C;  4CZZ B;  3PUR A;  1HFA A;  1FMV A;  3KBU A;  4KBM B;  4HFV A;  5FY1 A;  4GYS A;  2X67 A;  4IST A;  5HYA A;  2A3D A;  4WNK A;  3DTO A;  5L3C B;  2L3L A;  5LCY A;  1SHZ C;  4HN9 A;  5LHH B;  3LK2 B;  1VRB A;  4PFO A;  5GON E;  5JDM A;  1B7T A;  3LG7 A;  4AQF C;  4DBR A;  1ZV4 X;  4ADZ A;  1LRZ A;  1ZKE A;  2H7O A;  2E9X A;  2CXF A;  2D2S A;  3GA8 A;  3ZMZ B;  3B13 A;  1D1B A;  2N9D A;  4QWN B;  4ZI3 D;  2K48 A;  3O1J A;  4F6R C;  2ZLY A;  3JC6 C;  4H63 V;  4IE5 A;  5H6R B;  2RP4 A;  3PU3 A;  3UFE A;  1O3X A;  4KUM B;  4Z8X A;  4H9N C;  4IE4 A;  5LHI B;  2K5B B;  3Q5X A;  5FXX A;  3ZYL A;  5LYJ E;  2X51 A;  4NUV A;  1LVF A;  1HG2 A;  1WYC A;  2LSI A;  3P8C D;  5LOV E;  4CI2 B;  3KV5 A;  4OK0 A;  3NRY A;  2GK9 A;  5JR9 A;  2WAU A;  3V5S A;  1MMG A;  1YKH B;  4DND A;  5ADX L;  5CA0 E;  2A72 A;  3OYZ A;  1S94 A;  1EZ3 A;  4ZOL E;  1G8X A;  2WMN A;  3K8P C;  4PW8 A;  2DI4 A;  4H9Q C;  4I55 E;  4WBN E;  3ZEF B;  4CXY A;  5FYM A;  2CLY B;  4GK5 E;  2IC9 A;  2W61 A;  2X9Y A;  1SA0 E;  2YIN A;  4HE8 A;  4H63 H;  3NBX X;  4MFR A;  2V7L A;  4ZHQ E;  2LM9 A;  1X79 A;  1KNZ A;  5CB4 E;  4DVD A;  4UIG A;  2VKD A;  4DO0 A;  3C64 A;  2BZB A;  3C4X A;  4JEH B;  3J9X 1;  4DMV A;  4B6X A;  5L3E B;  4CXW A;  2N1G A;  5KX5 E;  2MYS A;  2MBG A;  2IC6 A;  1G73 A;  2CXL A;  2EHO C;  2KIN B;  5A1L A;  5JR9 C;  2NP9 A;  4L9I A;  4E7S A;  3E22 E;  4TV9 E;  2PJQ A;  1KK7 A;  1BR2 A;  1WRD A;  3CX6 B;  2JJ9 A;  1WR6 A;  2KZ7 B;  3EUH A;  1LVK A;  3ZCJ A;  4C90 A;  5JDH A;  5JDL A;  3K3O A;  3ZMS B;  2X66 A;  2C5K T;  2V7I A;  3RYF E;  2A2F X;  3F57 A;  3DP7 A;  2NW8 A;  2Y6X A;  4PAG A;  3SOL A;  2V7M A;  3R84 B;  3DJB A;  1D0Z A;  2K9A A;  1D0X A;  2I59 A;  4O2B E;  1HX8 A;  4IDZ A;  5HXR A;  3PDY A;  3MAC A;  5TAO A;  3E08 A;  4DMW A;  4DBQ A;  3ETV A;  2SPC A;  2VL8 A;  4AQG A;  1OWA A;  2IW5 B;  3HI2 A;  2ZM2 A;  1LKX A;  4IGU A;  1MNE A;  2ODU A;  3C4Z A;  3GN5 A;  3Q9D A;  1HS7 A;  4BJN A;  3N9N A;  3CWZ B;  3PTR B;  4P0B A;  2P9B A;  1HCI A;  3QUJ A;  4ZS2 A;  3UUN A;  2ACX A;  2VWA A;  2B1E A;  2ZM0 A;  3CVR A;  4ZI7 E;  3ZJ2 A;  4MLK A;  3N2O A;  3MXZ A;  3AA7 B;  2XAF B;  4O8S A;  5FMN A;  3SS1 A;  5DQW A;  4UVB B;  3RKO A;  1MMN A;  5JH7 E;  2W0G A;  2V7J A;  4QX7 B;  5IHY A;  2KMF A;  4PJJ A;  5HWX A;  2LHR A;  1D1C A;  2LE8 A;  3OBV E;  3ZLI A;  3TKL B;  4ISS A;  4CXX A;  2JQQ A;  2WM9 A;  5LNK A;  1AJ3 A;  2VKO A;  5LJN A;  3HKC E;  1IJ6 A;  5H6Q B;  2X0L B;  4UEL A;  2C0S A;  3CKD A;  2X68 A;  3M65 A;  2XUE A;  2KLQ A;  5E0O A;  4C91 A;  2LJL A;  3W15 B;  4AQF A;  4ASK A;  4IIJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...