4F6RC

Tubulin:stathmin-like domain complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
64
Chain Sequence
b'NKATSGQSWEVILKPPSFPSLEEIQKKLEAAEERRKAHFAAMLERLQEKDKHAEEVRKNKELKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
molecule tags Cell cycle
source organism Artificial gene
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
total genus 20
structure length 64
sequence length 79
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.580 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4f6rC01
5CA0E 4I50E 5EZYE 4O2BE 4IHJE 4ZHQE 3RYCE 4TV9E 5LXTE 4O4HE 4X20E 5GONE 3RYIE 4X1IE 5FNVE 5LP6E 4TV8E 3UT5E 4ZOLE 4O4IE 5J2UE 4O4LE 4I4TE 4TUYE 3HKDE 3HKCE 4O4JE 5LOVE 4F6RC 5C8YE 5CB4E 5JVDE 3HKEE 4I55E 5BMVE 4EB6E 3RYHE 5KX5E 3N2GE 4YJ2E 1SA0E 4X1KE 3HKBE 4YJ3E 5LA6E 4WBNE 3N2KE 4O2AE 5J2TE 4X1YE 5IYZE 5JH7E 3E22E 3RYFE 5LYJE 4ZI7E 4IIJE 5JQGE 5CA1E
chains in the Genus database with same CATH superfamily
4HFIA 4NXMT 4I50E 4ZHQE 5ABFB 4ZI3C 3EDVA 2E9XC 4LMJA 5HWYA 4KBMB 2XM1A 3UFGA 4YSZA 3RYIE 2CBIA 1JNRA 4YY3T 3B57A 4B3ST 2ZLYA 2N2NA 4JI6T 3RI5A 4BJNA 4QH5A 4U74A 2K9AA 4ZXLA 1OEDA 5LHHB 4DR4T 4DMWA 1N32T 2DLRA 4GYSA 5C8YE 3V5SA 3RIUC 3AE4A 4L5GA 2XAQB 5CB4E 1Z0PA 2D2SA 2V7LA 5HEOA 2D5UA 2DWGA 1D1AA 1N33T 4YHJA 2C5KT 2H7OA 2X9WA 4X65T 1N34T 1CUNA 2NP9A 1S35A 2V7KA 4Z90A 1U4QA 4CZZB 2DNXA 1MMNA 2FBWA 2HN1A 5H6RB 1WYBA 4CXWA 2LHRA 5L3FB 5JR9A 1ZKEA 4G63A 2N9DA 2L8KA 1DU2A 5EZYE 1WR6A 2LKHA 4X62T 2BKNA 5JTGA 4AKLA 2LSJA 2QGSA 2LSIA 3I9YA 3ONLC 1Y64B 2CRBA 2CHNA 2V8SV 4G2AA 3RKGA 4CXYA 1J5WA 3IEEA 3ZSSA 2Q9QB 4NUUA 3JAEA 3SFDA 5J1GA 1HR0T 1HNZT 3C4WA 2IDOB 4ANJA 1NENA 2M6BA 4OHFA 5LOVE 4P1NA 2YU2A 2E5LT 5AQRB 2UUCT 2C0SA 5BMVE 2CPTA 3AA1B 5C3JA 2XSBA 3WAJA 5LB7B 2NW7A 2DWKA 2WMNA 4JEUB 4CN6A 2XASB 1KF6A 2WDVA 1XWMA 3C51A 3OBVE 5J2TE 2QA7A 4UF0A 4DV7T 4YXDA 4XAXB 2X66A 1L0VA 3VRAA 2WAUA 2B76A 3UUXB 2V6YB 4NXNT 2LM2A 3F57A 3FB2A 3PURA 5FVKA 2WSSV 5HEHA 4ASKA 1LVFA 3OTOT 4HFBA 2ODUA 2KINB 2FJBA 4DR5T 4JI2T 4O2BE 4YTNA 3ZJ2A 1NAFA 2DI4A 4COFA 4LFCT 2WZHA 1LVKA 2UU9T 1V9DA 2IC9A 1HTJF 3AXJA 3KV5A 2IC6A 3LSVA 5AQOB 5HXCA 3UULA 2YDQA 4DMVA 4E7ZA 2CA5A 3LK2B 4IE6A 1IJ5A 3AE5A 3UT5E 1HG5A 1LKXA 3KINB 3KBUA 3RF1A 3HKDE 4LF9T 2WB5A 4JI5T 4AKIA 3OPCA 3CX8B 2MBGA 4I55E 4IDQA 1E2AA 2CM0A 2X0HA 3FZLB 4HFDA 3K3QC 4YT0A 2K24A 2FJAA 2ZM0A 5AQTB 5EK2A 5IHYA 4YHHT 3ZMSB 4HFVA 5AQVB 2KT9A 3JADA 4NIQA 2J1DG 2VB6A 4KP3C 5AQFB 4HWDA 2ZMAA 3P4WA 4U7IA 5EK4A 5ADXL 3CK6A 5LMUT 4LF4T 3MA9A 5JRCA 2GK9A 5AQHB 5FXXA 4CN1A 3BQKA 1IBMT 4JI0T 5LMNT 4P0AA 4WBOA 5DABA 2UXCT 3N9NA 3AE8A 4J2CA 4PW8A 3FHNA 5AQMB 3UUBA 1EZ3A 1MMAA 4TV8E 3P8CD 2XQ8A 3GMIA 4QKNA 3TLUA 3OJAA 4HWIB 2HH7A 3LJCA 4HKAA 1UCUA 2ODVA 3IA3A 2NW9A 3SWHA 4UXNB 4EGWA 2BG9A 4I43B 4UVBB 5JDHA 4WZXA 2KWIB 2ACXA 4U7YA 4Z91A 4M1PA 3WAKA 1SA0E 2XTLA 1IBKT 3N9LA 4JI1T 1ZOYA 1ZHCA 4DNDA 4WNKA 3PUAA 4WW0A 1YKEB 4Z8XA 5HXRA 2HN2A 3KV4A 4QWNB 2XM2A 5H6QB 2HPLA 1FMVA 1IJ6A 3A8YC 4QXHB 4U33A 3UTKA 2SPCA 1VCTA 2W63A 3C50A 2Y6XA 5LGNB 2XAGB 2X51A 1XMQT 4PAGA 1YQ3A 1IAPA 4AI6A 1WCRA 2JMKA 4PJLA 2HPJA 2VWAA 5F3JA 4DUYT 4B3TT 2PBIA 2LRLA 4LMLA 5FY1A 2WWUA 5HWXA 3OYZA 2JJ9A 2H3RA 2XAFB 4PJMA 3CX7B 3AAEB 5ABGA 4HWFA 1D0XA 2NOXA 3AVRA 2YK0A 2KSRA 3NVOA 4IDPA 4UV8B 5AQGB 2IIUA 3AEEA 5C2TA 4AQFA 4YJ2E 4HE8A 4EYYR 1MMDA 4JI7T 2ES0A 3NZQA 4HGAA 3PUWF 2V5DA 3PUQA 3RIAA 3FBLA 1UUSA 2Q9QC 2XY8B 5FL1A 2BVMA 1KNPA 2BS4A 3E0ZA 2YDRA 2WM9A 2W00A 3KFWX 3H37A 3OYXA 2C5JA 3N2OA 3NRXA 3P50A 4IE5A 4QHOA 4TNWA 3O1IA 3AB3B 2X9HA 4U2ZA 3T8OA 2VKOA 1ZV4X 2WY2A 1H7CA 1HNWT 5HYAA 4TV9E 3IBPA 1HX8A 1D0ZA 3ZN0B 1T8BA 5GONE 3ZMUB 3L8RA 3I9WA 2IAKA 2W0GA 4JYAT 2NWBA 3QB5A 1SE7A 3AE6A 3PJAA 2V7MA 1O3XA 2V7IA 3ZMZB 5BR8T 4LF5T 3JC6C 5J2UE 1KNZA 2CWOA 3R6NA 4ILCA 5CFBA 3FZFB 2X67A 3AEDA 3F2EA 3KBTA 3FZKB 4CI3B 2CEAA 2Q9QD 4PK6A 5KDMC 2BZBA 3HL6A 2XPKA 4HWHA 3I0QA 5AQQB 5FY7A 5LJNA 4O8SA 4DV5T 2N1GA 4IT4A 5DQWA 2P9BA 2XUEA 1Z8UA 2WZIA 2XQ5A 4UIGA 2UXNB 5E0OA 3SRZA 3UFEA 3UUNA 3W15B 2W67A 4AQYT 3EABA 2C5IT 1MIVA 1MMGA 1WFDA 3RYFE 5L3CB 2W61A 2BDEA 5TAOA 4DR3T 2WWVA 4U31A 5JR9B 2E9XB 2LSGA 3AECA 5FYMA 4C91A 3EAMA 4PFOA 2E2AA 4GKJT 1BR0A 3AE1A 2ZM6T 1HCIA 4B6XA 2Y8DA 3JC6D 4A97A 1SUMB 3OVUA 4ZI2D 3ZSTA 1KNRA 2I6HA 1M62A 3O4XE 3QB5K 4GIWA 3ZYMA 3ZT5A 3OKQA 4JUYA 4TWFA 4QX8B 3D0TA 2JMHA 1UX5A 4ZOLE 4CXXA 1HX1B 1UX4A 3PV0F 4LF7T 4JBWF 1KK7A 3U78A 1U5PA 3IF8B 1HG2A 3AEGA 3RRWA 1CHUA 3RKOA 4YJ3E 2IW5B 4AKHA 1YQ4A 5LA6E 2G0UA 3K8PC 3GA8A 3QNUA 4QXBB 5AQJB 5HEGA 4O2AE 4B3MT 4ERRA 3GN5A 3I1AA 4JI4T 1MIYA 2X9XA 3VR9A 3ANWA 5LYJE 2UXBT 2ZM8A 2CHOA 4AIUA 3H3AA 3PUZF 2BG9E 3LDQB 5IUXA 3VKGA 1ZP0A 4DIDB 3LBXB 4I0UA 2YEVC 4IGUA 4YLHA 5FXWA 4ILBA 1IBLT 1N36T 1XMOT 2WDRA 3B13A 4A56A 2CE7A 2E9XD 4DV2T 3AE9A 2LJLA 5FXVA 2R6GF 2M6IA 1OEDE 3O1HA 1QLBA 2ACZA 1JNZA 4UV9B 3RQWA 2XQAA 4IREA 3ZEFB 5JDNA 5LHIB 5JVDE 3HKEE 2XAHB 2I0MA 2EHOB 1XNRT 2IMLA 3FZMB 3TLSA 3HR0A 3KV9A 3BK9A 4MALA 3HKBE 4MFRA 3UU4A 4EV6A 2BKPA 4YFSA 4DV3T 3BQIA 3ZJ1A 4UR9A 3DP7A 3LK42 4IDZA 4MBQA 1UK5A 2XHEB 4IE7A 4MHCA 4DV6T 2YINA 1X9BA 4MLKA 2LT3A 3HI2A 2V6YA 3N9MA 3RPUA 3L3PA 4FJOA 2A3DA 4OFZA 3PU3A 3SS1A 4O4HE 2CXDA 1HNXT 3GN5B 3PTRB 3ZKRA 2UUAT 2BG9B 3NZPA 4A98A 5LP6E 2Z6EA 2UXDT 1T7SA 1E1HB 2MYSA 1I94T 1LRZA 2MOZA 1Y01A 3LG7A 3P4RA 4OK0A 4ZS3A 4O4IE 2KMFA 4H63H 3ZYLA 4DBQA 4DR7T 5LBMA 1WR0A 3PJAJ 4I4TE 1W0AA 3QUJA 2MTQA 2XQ6A 3N9OA 4U3CA 4BAYB 5KXJA 3E08A 1SHZC 2A72A 4KI0F 1KEYA 5AQPB 5KX5E 1YXRA 2JQHA 2Q9QA 3CQXC 4Q25A 4PJNA 1J1JA 3KVAA 4HN9A 2V5CA 2CWYA 3WI3A 2JIWA 3ZPOA 2L3LA 4AQFC 2RPAA 5HXHA 4ZI7E 1I6ZA 1YKHB 2J4GA 2VKJA 4HEAA 3LFMA 1FIOA 2VURA 4UELA 5EK3A 5FVLA 3TLVA 2XQ4A 4CN4A 2WQYA 2VL0A 4ILAA 3L09A 4EEBA 3KDSE 2LRKA 5A1LA 3N9QA 2JQKA 3ANWB 3C64A 4PNIA 1ZEEA 2QRXA 3ZC1A 3PUVF 3X1DA 5HCMA 5CA1E 2JPFA 2WU5A 2CBJA 2X0LB 3AA0B 2NTYA 3RRCA 3CPZA 2D9DA 3DTOA 3AA6B 2M67A 3B5MA 1VRBA 2YU1A 3LK3B 1XNQT 4HFCA 3CWZB 4OYJA 4TNVA 4JI3T 4H9NC 3U3IA 4AKGA 2VKDA 2XQ7A 4O4LE 2XJ7A 1XDOA 3HKCE 4L0RA 4ZZBA 4L9IA 4ZZCA 2VVSA 2Y48B 2V6XA 3A5XA 4H63V 5L47A 4DV1T 5HCJA 2A9UA 2CMRA 2WDQA 3EVYA 3K3OA 4YTPA 2HHHT 2H7VC 3JCFA 2KLQA 5LCYA 1BR2A 3UU6A 4X1YE 4H9RC 5CA0E 1UGOA 1HFAA 1T98A 2V1DB 1OWAA 2BG9C 3AE3A 3ESLA 5AQUB 5FKYA 2CLYC 2BKOA 4NPPA 5LBQB 3ZMVB 2J62A 2VL8A 3KV6A 3UU8A 4X64T 2KZ7B 3KVBA 3AE7A 3T1HT 2RP4A 4GYRA 5L3EB 1KFYA 4GKKT 2AE9A 3C4XA 3IHRA 5L4HA 3ZLIA 5L3BB 2W66A 3MACA 4ZEYA 4GK0E 3RH3A 4EEDA 4ZI3D 5L4EA 3FZHB 2F4VT 1HS7A 5JRCB 3EUHA 2MPKA 5LNKA 1NWMX 2LEHA 3UU5A 2XQYA 2L9QA 3J7Yq 3VKHA 2X68A 1GQEA 1B7TA 3G06A 4F8HA 3M3ZB 3AE2A 4LF6T 5IYZE 3JAFA 2OA5A 3CVRA 3MJXA 4ILUA 5J0ZA 4WYVA 3P7IA 2K48A 2LM9A 3EI0A 3NKZA 1WYCA 2B1EA 2KXPB 3ZT6A 4YSXA 4AISA 1W0BA 3VU7H 2XAJB 3Q9DA 4YTMA 1G8XA 3AEAA 4AQGA 4DUZT 3CMLA 4EAHA 4X1IE 3RHWA 4KHPT 3FXDB 3UQ4A 3FBZA 5F5WA 3RQUA 5JDMA 4OYKA 5FMNA 3HA4A 4IE4A 2FJDA 3VR8A 4DO0A 2UXXB 4UEMA 5ABFA 5HEJA 5LJMA 5AQIB 4TUYE 2KNDA 4EOZB 3ABVA 2LHNA 4KHZF 3TKLB 4EZ4A 2K5BB 3ZCIA 3ETVA 5AFUL 3CIRA 2JRKA 3Q5EA 1VOMA 3VRBA 4A5XA 4DBRA 3BQLA 4JEHB 4ZS2A 3N2KE 5HEUA 5HXSA 5JDQA 4P0BA 5L3DB 4DV4T 4UVAB 4LF8T 2EHOD 3R84B 1XZYA 2YOEA 1QUUA 4BA9A 3CKDA 2X9YA 5JQGE 1UURA 3P4SA 3P4PA 2V7JA 2D0UA 5LG4A 2IUBA 4ISSA 5JDLA 4AKRB 5AQSB 2OLTA 4P09A 3RYCE 1BR1A 5LXTE 4IE0A 3RX6A 4TWHA 5ETWA 3AAAB 2FUPA 4LMKA 2JQQA 2D0TA 2PTFA 5LG3A 1MNEA 2W2UA 1D1CA 4CI2B 2LKGA 4H9OC 1OXZA 2K3WA 2NR4A 2WMOA 3QOFA 3RLFF 2E8IA 4QX7B 2NW8A 2XZEA 3CX6B 3DJBA 5JR9C 2CLYB 2XSAA 4H9PC 3MXZA 5FXZA 3RYHE 2MAWA 1D0YA 4PJJA 2VQET 3S4UA 3TLTA 1G73A 2WS3A 5KMGP 3MK7C 2LOSA 2XQ3A 4KUMB 5HAXA 3PUYF 4E7SA 4EZHA 2XQ9A 4K0UA 4HFEA 4AXPA 1IZNB 3F31A 4FI5A 4C90A 2VKHA 2WU2A 3I0OA 3ETUA 3FXEB 2LE8A 2DHRA 4H9SE 3RIUA 4EIWA 4ZI2C 2YN6A 3AEBA 3MZKB 4HFHA 1OEDC 2A2FX 2DL1A 4QH1A 4TWDA 4HWCA 4UF0B 4NUVA 5AQNB 4YSYA 2VQFT 1FMWA 2BS2A 3RC3A 2VASA 2LSYA 3PUXF 4X20E 5LHGB 5M4YA 3AVSA 3Q2MA 2BVLA 3CQGB 2AXDS 2E9XA 3EHZA 4QXCB 4TX5A 1E7PA 2W62A 1HF8A 2W4XA 3O9XA 3PUSA 4O4JE 3ZMTB 2YKSA 3ZYKA 5F8PA 3UU3A 3N2GE 2DCFA 4X1KE 3UUMA 3QK6A 4DVDA 2ZM2A 3QC9A 4QH4A 4BJMA 3RGLA 5L3GB 1FEWA 4PFPA 4EXTA 5ABEA 2QYWA 5CJ5A 3EDUA 2QVAA 3AA7B 5JREA 3PE0A 1WRDA 3K3NA 2VK9A 1W09A 1AJ3A 2BBHA 4PK4A 3Q5WA 2BBJA 1YW0A 2PJQA 1NEKA 1OEDB 3MKDA 3N5LA 2RA1A 3NWIA 5FP3A 4OX9T 3K1SA 5FNVE 2X0YA 3Q5XA 1J5ET 2BS3A 3UQ7A 1W9RA 5AQLB 3NBXX 3RIFA 3AAIA 4PK5A 2KWHA 3NRYA 4F6RC 2E5VA 2IHR1 5IWAT 3L39A 4JLEA 2EHOC 1FJGT 4IDNA 4UVCB 1VCSA 3PDYA 3SOLA 5LGTB 4X66T 2WP9A 3M65A 4LFAT 1MIWA 4HTEA 4H9QC 2LLYA 5FL0A 3ZT7A 2VVNA 4GK5E 4N78D 3J9X1 3CQCB 5DJQC 5JH7E 3C98B 1BR4A 4B3RT 3Q5DA 1US7B 3E22E 1WLXA 3P4QA 4TN7B 4XZCA 3GWHA 3ZCJA 2EHOA 2WBLA 1M7KA 4IIJE 1R8IA 5AQKB 3PUGA 3SFEA 4IHJE 2CXLA 2JQ9A 4DR1T 3PU8A 2CXFA 5JDGA 3VHLA 2LSKA 3N9PA 3T1YT 3ZC0A 4V1Av 3ONXA 4DV0T 3V5UA 5JDFA 5ABHA 4ADZA 1D1BA 2J47A 4JI8T 3ZN1B 4TZ4C 4IL4A 3O1JA 3RC8A 4X5TA 2I59A 2PG8A 3ONJA 4XBFB 4U72A 1YD8G 2H88A 4CI1B 1QSDA 5HXEA 1MNDA 4EYUA 2LOPA 5L2LA 4U2YA 2WCAA 4EB6E 3TLWA 4LFBT 3AXJB 1X79A 4KMCA 4DR2T 4IL9A 4JV5T 1T72A 4ISTA 2H89A 5DQVA 4CQIA 5LGUB 2YDSA 2NTXA 5CGMA 4WBNE 3H3MA 3LBXA 2CCQA 2UUBT 4K0KT 3AEFA 2V26A 1S94A 4KX6A 1XDPA 2FJEA 5FY0A 4IDOA 4DR6T 2PFVA 3C4ZA 4GOUA 3A7MA 2OV9A
chains in the Genus database with same CATH topology
4I50E 4ZHQE 4ZI3C 3EDVA 2E9XC 5HWYA 4KBMB 3RYIE 3B57A 2ZLYA 2N2NA 4BJNA 4U74A 5LHHB 2K9AA 4DMWA 2DLRA 4GYSA 5C8YE 3V5SA 4L5GA 2XAQB 5CB4E 1Z0PA 2D2SA 2V7LA 2D5UA 2DWGA 1D1AA 4YHJA 2C5KT 2H7OA 2X9WA 1CUNA 2NP9A 1S35A 2V7KA 1U4QA 4CZZB 2DNXA 1MMNA 5H6RB 1WYBA 4CXWA 2LHRA 5L3FB 5JR9A 1ZKEA 4G63A 2N9DA 2L8KA 5EZYE 1WR6A 4AKLA 2LSJA 2LSIA 2QGSA 3I9YA 4G2AA 1Y64B 4CXYA 3IEEA 2Q9QB 4NUUA 5J1GA 3C4WA 4ANJA 4OHFA 5LOVE 2YU2A 2C0SA 5BMVE 3AA1B 2NW7A 2DWKA 2WMNA 4JEUB 2XASB 3OBVE 5J2TE 3C51A 2QA7A 4UF0A 4XAXB 2X66A 2WAUA 3UUXB 3FB2A 3F57A 3PURA 4ASKA 2WSSV 1LVFA 2ODUA 2KINB 4O2BE 3ZJ2A 1NAFA 2DI4A 1LVKA 1V9DA 2IC9A 1HTJF 3KV5A 2IC6A 3UULA 4DMVA 5HXCA 4E7ZA 2CA5A 3LK2B 4IE6A 1IJ5A 3UT5E 1HG5A 1LKXA 3KINB 3KBUA 3HKDE 4AKIA 3CX8B 2MBGA 4I55E 2CM0A 3K3QC 2K24A 2ZM0A 5EK2A 5IHYA 3ZMSB 4HFVA 2KT9A 2J1DG 2VB6A 4KP3C 2ZMAA 5EK4A 5ADXL 5JRCA 3MA9A 2GK9A 5FXXA 3BQKA 4P0AA 4WBOA 5DABA 3N9NA 4J2CA 4PW8A 3FHNA 1EZ3A 1MMAA 4TV8E 3P8CD 3GMIA 4QKNA 3OJAA 2HH7A 3LJCA 4HKAA 1UCUA 2ODVA 2NW9A 3SWHA 4UXNB 4I43B 4UVBB 5JDHA 2KWIB 2ACXA 3WAKA 4M1PA 1SA0E 2XTLA 3N9LA 4DNDA 1ZHCA 4WNKA 3PUAA 4WW0A 1YKEB 4Z8XA 5HXRA 3KV4A 4QWNB 5H6QB 2HPLA 1FMVA 1IJ6A 4QXHB 3UTKA 2SPCA 2W63A 3C50A 2Y6XA 5LGNB 2XAGB 2X51A 4PAGA 1IAPA 2JMKA 4PJLA 2HPJA 2VWAA 5F3JA 2PBIA 2WWUA 5HWXA 3OYZA 2JJ9A 2H3RA 2XAFB 4PJMA 3CX7B 3AAEB 1D0XA 2NOXA 3AVRA 2YK0A 4UV8B 4AQFA 4YJ2E 4HE8A 4EYYR 1MMDA 2ES0A 3NZQA 4HGAA 3PUQA 3FBLA 2Q9QC 2BVMA 3E0ZA 3KFWX 2WM9A 2W00A 3H37A 3OYXA 2C5JA 3N2OA 3NRXA 4IE5A 4QHOA 3O1IA 3AB3B 2X9HA 3T8OA 2VKOA 1ZV4X 1H7CA 5HYAA 4TV9E 3IBPA 1HX8A 1D0ZA 3ZN0B 3ZMUB 5GONE 3I9WA 2IAKA 2W0GA 2NWBA 2V7MA 1O3XA 2V7IA 3ZMZB 3JC6C 5J2UE 1KNZA 2CWOA 3R6NA 3KBTA 2X67A 4CI3B 3F2EA 5KDMC 3O9XA 2CEAA 2Q9QD 4PK6A 2BZBA 3HL6A 3VKHA 5LJNA 3I0QA 5FY7A 4O8SA 2N1GA 5DQWA 2P9BA 2XUEA 3SRZA 4UIGA 3UFEA 2UXNB 5E0OA 3UUNA 3W15B 2C5IT 1MIVA 1MMGA 3RYFE 5L3CB 2W61A 2BDEA 5TAOA 5JR9B 2E9XB 2LSGA 5FYMA 4C91A 4PFOA 1BR0A 1HCIA 4B6XA 2Y8DA 3JC6D 4ZI2D 4GIWA 3O4XE 3ZYMA 3OKQA 4JUYA 4QX8B 3D0TA 2JMHA 1UX5A 4ZOLE 4CXXA 1UX4A 1KK7A 3U78A 1U5PA 3IF8B 1HG2A 3RRWA 3RKOA 4YJ3E 2IW5B 4AKHA 5LA6E 2G0UA 3K8PC 3GA8A 4QXBB 4O2AE 4ERRA 3GN5A 3I1AA 1MIYA 2X9XA 3ANWA 5LYJE 2ZM8A 3H3AA 3VKGA 3LBXB 4IGUA 2YEVC 4YLHA 5FXWA 4A56A 3B13A 2CE7A 2E9XD 2LJLA 5FXVA 3O1HA 4UV9B 3ZEFB 5JDNA 3WAJA 5LHIB 5JVDE 3HKEE 2XAHB 2EHOB 3HR0A 3KV9A 3BK9A 4MALA 3HKBE 4MFRA 4YFSA 3BQIA 3ZJ1A 3DP7A 3LK42 4IDZA 4MBQA 4IE7A 2XHEB 4MHCA 2YINA 4MLKA 2LT3A 3HI2A 3N9MA 3RPUA 3L3PA 4FJOA 2A3DA 4OFZA 3PU3A 3SS1A 4O4HE 2CXDA 3GN5B 3PTRB 3NZPA 5LP6E 2Z6EA 1E1HB 2MYSA 1LRZA 2MOZA 4ZS3A 3LG7A 4OK0A 4DBQA 4O4IE 2KMFA 4H63H 3ZYLA 5LBMA 4BAYB 4I4TE 3QUJA 2MTQA 3N9OA 3E08A 1SHZC 2A72A 5KX5E 2Q9QA 3CQXC 4PJNA 3KVAA 4HN9A 2CWYA 3WI3A 3ZPOA 2L3LA 4AQFC 5HXHA 4ZI7E 1YKHB 2VKJA 5EK3A 4HEAA 3LFMA 1FIOA 4UELA 5CA1E 4AI6A 5CA0E 3L09A 3KDSE 5A1LA 3N9QA 3ANWB 4PNIA 3C64A 1ZEEA 3ZC1A 2JPFA 2X0LB 3AA0B 2NTYA 3RRCA 3CPZA 3DTOA 3AA6B 2M67A 3LK3B 1VRBA 2YU1A 3CWZB 4OYJA 4H9NC 3U3IA 4AKGA 2VKDA 4O4LE 3HKCE 4L0RA 4L9IA 2Y48B 3A5XA 4H63V 2CMRA 3EVYA 3K3OA 2H7VC 2KLQA 5LCYA 1BR2A 4X1YE 4H9RC 1HFAA 1T98A 2V1DB 1OWAA 3ESLA 5LBQB 2CLYC 3ZMVB 2VL8A 3KV6A 3ZC0A 2KZ7B 3KVBA 2RP4A 4GYRA 5L3EB 3C4XA 3IHRA 3ZLIA 5L3BB 3MACA 4GK0E 3RH3A 4ZI3D 1HS7A 5JRCB 3EUHA 5LNKA 1NWMX 2LEHA 2XQYA 2L9QA 3J7Yq 2X68A 1B7TA 5IYZE 2OA5A 3CVRA 3MJXA 4ILUA 3P7IA 2K48A 2LM9A 1WYCA 2B1EA 2KXPB 3VU7H 2XAJB 3Q9DA 1G8XA 4AQGA 3CMLA 4EAHA 4X1IE 3FXDB 3FBZA 5JDMA 4OYKA 5FMNA 3HA4A 4IE4A 4DO0A 5LJMA 2UXXB 4UEMA 4TUYE 2KNDA 4EOZB 2LHNA 3TKLB 4EZ4A 2K5BB 3ZCIA 3ETVA 5AFUL 2JRKA 1VOMA 4DBRA 3BQLA 4JEHB 4ZS2A 3N2KE 5HXSA 5JDQA 4P0BA 5L3DB 4UVAB 2EHOD 3R84B 1QUUA 4BA9A 3CKDA 2X9YA 5JQGE 2V7JA 2D0UA 5LG4A 4ISSA 5JDLA 4AKRB 4P09A 3RYCE 1BR1A 5LXTE 4IE0A 3RX6A 5ETWA 3AAAB 2JQQA 2D0TA 1MNEA 1D1CA 4CI2B 4H9OC 1OXZA 2WMOA 2E8IA 4QX7B 2NW8A 3CX6B 3DJBA 5JR9C 2CLYB 4H9PC 5FXZA 3MXZA 3RYHE 1D0YA 4PJJA 3S4UA 1G73A 5KMGP 3MK7C 2LOSA 5HAXA 4KUMB 4E7SA 4EZHA 4K0UA 4AXPA 1IZNB 3F31A 4FI5A 4C90A 2VKHA 3I0OA 3ETUA 3FXEB 2LE8A 2DHRA 4H9SE 4EIWA 4ZI2C 3MZKB 2A2FX 4UF0B 4NUVA 1FMWA 3RC3A 2VASA 2LSYA 4X20E 5LHGB 5M4YA 3AVSA 3Q2MA 2BVLA 3CQGB 2E9XA 4QXCB 4TX5A 2W62A 1HF8A 3PUSA 4O4JE 3ZMTB 3ZYKA 5F8PA 3N2GE 2DCFA 4X1KE 3UUMA 3QK6A 4DVDA 2ZM2A 3QC9A 4BJMA 5L3GB 1FEWA 4PFPA 4EXTA 3EDUA 3AA7B 5JREA 3PE0A 1WRDA 3K3NA 2VK9A 1AJ3A 4PK4A 3Q5WA 1YW0A 2PJQA 3MKDA 3N5LA 2RA1A 5FP3A 5FNVE 3Q5XA 3NBXX 3AAIA 4PK5A 2KWHA 3NRYA 4F6RC 4JLEA 2EHOC 4UVCB 3PDYA 3SOLA 5LGTB 3M65A 1MIWA 4HTEA 4H9QC 4GK5E 4N78D 3J9X1 3CQCB 5DJQC 5JH7E 3C98B 1BR4A 4XZCA 1US7B 3E22E 1WLXA 4TN7B 3ZCJA 3GWHA 2EHOA 2WBLA 4IIJE 3PUGA 4IHJE 2CXLA 3PU8A 2CXFA 5JDGA 3VHLA 2LSKA 3N9PA 4V1Av 3ONXA 3V5UA 5JDFA 4ADZA 1D1BA 3ZN1B 4TZ4C 3O1JA 3RC8A 4XBFB 2I59A 2PG8A 4U72A 1YD8G 4CI1B 1QSDA 5HXEA 1MNDA 4EYUA 2LOPA 5L2LA 4EB6E 1X79A 4KMCA 4ISTA 5DQVA 5LGUB 4CQIA 2NTXA 4WBNE 3LBXA 2CCQA 2V26A 1S94A 5FY0A 2PFVA 3C4ZA 4GOUA 5FY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CA0 E;  4I50 E;  5EZY E;  4O2B E;  4IHJ E;  4ZHQ E;  3RYC E;  4TV9 E;  5LXT E;  4O4H E;  4X20 E;  5GON E;  3RYI E;  4X1I E;  5FNV E;  5LP6 E;  4TV8 E;  3UT5 E;  4ZOL E;  4O4I E;  5J2U E;  4O4L E;  4I4T E;  4TUY E;  3HKD E;  3HKC E;  4O4J E;  5LOV E;  4F6R C;  5C8Y E;  5CB4 E;  5JVD E;  3HKE E;  4I55 E;  5BMV E;  4EB6 E;  3RYH E;  5KX5 E;  3N2G E;  4YJ2 E;  1SA0 E;  4X1K E;  3HKB E;  4YJ3 E;  5LA6 E;  4WBN E;  3N2K E;  4O2A E;  5J2T E;  4X1Y E;  5IYZ E;  5JH7 E;  3E22 E;  3RYF E;  5LYJ E;  4ZI7 E;  4IIJ E;  5JQG E;  5CA1 E; 
#chains in the Genus database with same CATH topology
 4HFI A;  4NXM T;  4I50 E;  4ZHQ E;  5ABF B;  4ZI3 C;  3EDV A;  2E9X C;  4LMJ A;  5HWY A;  4KBM B;  2XM1 A;  3UFG A;  4YSZ A;  3RYI E;  2CBI A;  1JNR A;  4YY3 T;  3B57 A;  4B3S T;  2ZLY A;  2N2N A;  4JI6 T;  3RI5 A;  4BJN A;  4QH5 A;  4U74 A;  2K9A A;  4ZXL A;  1OED A;  5LHH B;  4DR4 T;  4DMW A;  1N32 T;  2DLR A;  4GYS A;  5C8Y E;  3V5S A;  3RIU C;  3AE4 A;  4L5G A;  2XAQ B;  5CB4 E;  1Z0P A;  2D2S A;  2V7L A;  5HEO A;  2D5U A;  2DWG A;  1D1A A;  1N33 T;  4YHJ A;  2C5K T;  2H7O A;  2X9W A;  4X65 T;  1N34 T;  1CUN A;  2NP9 A;  1S35 A;  2V7K A;  4Z90 A;  1U4Q A;  4CZZ B;  2DNX A;  1MMN A;  2FBW A;  2HN1 A;  5H6R B;  1WYB A;  4CXW A;  2LHR A;  5L3F B;  5JR9 A;  1ZKE A;  4G63 A;  2N9D A;  2L8K A;  1DU2 A;  5EZY E;  1WR6 A;  2LKH A;  4X62 T;  2BKN A;  5JTG A;  4AKL A;  2LSJ A;  2QGS A;  2LSI A;  3I9Y A;  3ONL C;  1Y64 B;  2CRB A;  2CHN A;  2V8S V;  4G2A A;  3RKG A;  4CXY A;  1J5W A;  3IEE A;  3ZSS A;  2Q9Q B;  4NUU A;  3JAE A;  3SFD A;  5J1G A;  1HR0 T;  1HNZ T;  3C4W A;  2IDO B;  4ANJ A;  1NEN A;  2M6B A;  4OHF A;  5LOV E;  4P1N A;  2YU2 A;  2E5L T;  5AQR B;  2UUC T;  2C0S A;  5BMV E;  2CPT A;  3AA1 B;  5C3J A;  2XSB A;  3WAJ A;  5LB7 B;  2NW7 A;  2DWK A;  2WMN A;  4JEU B;  4CN6 A;  2XAS B;  1KF6 A;  2WDV A;  1XWM A;  3C51 A;  3OBV E;  5J2T E;  2QA7 A;  4UF0 A;  4DV7 T;  4YXD A;  4XAX B;  2X66 A;  1L0V A;  3VRA A;  2WAU A;  2B76 A;  3UUX B;  2V6Y B;  4NXN T;  2LM2 A;  3F57 A;  3FB2 A;  3PUR A;  5FVK A;  2WSS V;  5HEH A;  4ASK A;  1LVF A;  3OTO T;  4HFB A;  2ODU A;  2KIN B;  2FJB A;  4DR5 T;  4JI2 T;  4O2B E;  4YTN A;  3ZJ2 A;  1NAF A;  2DI4 A;  4COF A;  4LFC T;  2WZH A;  1LVK A;  2UU9 T;  1V9D A;  2IC9 A;  1HTJ F;  3AXJ A;  3KV5 A;  2IC6 A;  3LSV A;  5AQO B;  5HXC A;  3UUL A;  2YDQ A;  4DMV A;  4E7Z A;  2CA5 A;  3LK2 B;  4IE6 A;  1IJ5 A;  3AE5 A;  3UT5 E;  1HG5 A;  1LKX A;  3KIN B;  3KBU A;  3RF1 A;  3HKD E;  4LF9 T;  2WB5 A;  4JI5 T;  4AKI A;  3OPC A;  3CX8 B;  2MBG A;  4I55 E;  4IDQ A;  1E2A A;  2CM0 A;  2X0H A;  3FZL B;  4HFD A;  3K3Q C;  4YT0 A;  2K24 A;  2FJA A;  2ZM0 A;  5AQT B;  5EK2 A;  5IHY A;  4YHH T;  3ZMS B;  4HFV A;  5AQV B;  2KT9 A;  3JAD A;  4NIQ A;  2J1D G;  2VB6 A;  4KP3 C;  5AQF B;  4HWD A;  2ZMA A;  3P4W A;  4U7I A;  5EK4 A;  5ADX L;  3CK6 A;  5LMU T;  4LF4 T;  3MA9 A;  5JRC A;  2GK9 A;  5AQH B;  5FXX A;  4CN1 A;  3BQK A;  1IBM T;  4JI0 T;  5LMN T;  4P0A A;  4WBO A;  5DAB A;  2UXC T;  3N9N A;  3AE8 A;  4J2C A;  4PW8 A;  3FHN A;  5AQM B;  3UUB A;  1EZ3 A;  1MMA A;  4TV8 E;  3P8C D;  2XQ8 A;  3GMI A;  4QKN A;  3TLU A;  3OJA A;  4HWI B;  2HH7 A;  3LJC A;  4HKA A;  1UCU A;  2ODV A;  3IA3 A;  2NW9 A;  3SWH A;  4UXN B;  4EGW A;  2BG9 A;  4I43 B;  4UVB B;  5JDH A;  4WZX A;  2KWI B;  2ACX A;  4U7Y A;  4Z91 A;  4M1P A;  3WAK A;  1SA0 E;  2XTL A;  1IBK T;  3N9L A;  4JI1 T;  1ZOY A;  1ZHC A;  4DND A;  4WNK A;  3PUA A;  4WW0 A;  1YKE B;  4Z8X A;  5HXR A;  2HN2 A;  3KV4 A;  4QWN B;  2XM2 A;  5H6Q B;  2HPL A;  1FMV A;  1IJ6 A;  3A8Y C;  4QXH B;  4U33 A;  3UTK A;  2SPC A;  1VCT A;  2W63 A;  3C50 A;  2Y6X A;  5LGN B;  2XAG B;  2X51 A;  1XMQ T;  4PAG A;  1YQ3 A;  1IAP A;  4AI6 A;  1WCR A;  2JMK A;  4PJL A;  2HPJ A;  2VWA A;  5F3J A;  4DUY T;  4B3T T;  2PBI A;  2LRL A;  4LML A;  5FY1 A;  2WWU A;  5HWX A;  3OYZ A;  2JJ9 A;  2H3R A;  2XAF B;  4PJM A;  3CX7 B;  3AAE B;  5ABG A;  4HWF A;  1D0X A;  2NOX A;  3AVR A;  2YK0 A;  2KSR A;  3NVO A;  4IDP A;  4UV8 B;  5AQG B;  2IIU A;  3AEE A;  5C2T A;  4AQF A;  4YJ2 E;  4HE8 A;  4EYY R;  1MMD A;  4JI7 T;  2ES0 A;  3NZQ A;  4HGA A;  3PUW F;  2V5D A;  3PUQ A;  3RIA A;  3FBL A;  1UUS A;  2Q9Q C;  2XY8 B;  5FL1 A;  2BVM A;  1KNP A;  2BS4 A;  3E0Z A;  2YDR A;  2WM9 A;  2W00 A;  3KFW X;  3H37 A;  3OYX A;  2C5J A;  3N2O A;  3NRX A;  3P50 A;  4IE5 A;  4QHO A;  4TNW A;  3O1I A;  3AB3 B;  2X9H A;  4U2Z A;  3T8O A;  2VKO A;  1ZV4 X;  2WY2 A;  1H7C A;  1HNW T;  5HYA A;  4TV9 E;  3IBP A;  1HX8 A;  1D0Z A;  3ZN0 B;  1T8B A;  5GON E;  3ZMU B;  3L8R A;  3I9W A;  2IAK A;  2W0G A;  4JYA T;  2NWB A;  3QB5 A;  1SE7 A;  3AE6 A;  3PJA A;  2V7M A;  1O3X A;  2V7I A;  3ZMZ B;  5BR8 T;  4LF5 T;  3JC6 C;  5J2U E;  1KNZ A;  2CWO A;  3R6N A;  4ILC A;  5CFB A;  3FZF B;  2X67 A;  3AED A;  3F2E A;  3KBT A;  3FZK B;  4CI3 B;  2CEA A;  2Q9Q D;  4PK6 A;  5KDM C;  2BZB A;  3HL6 A;  2XPK A;  4HWH A;  3I0Q A;  5AQQ B;  5FY7 A;  5LJN A;  4O8S A;  4DV5 T;  2N1G A;  4IT4 A;  5DQW A;  2P9B A;  2XUE A;  1Z8U A;  2WZI A;  2XQ5 A;  4UIG A;  2UXN B;  5E0O A;  3SRZ A;  3UFE A;  3UUN A;  3W15 B;  2W67 A;  4AQY T;  3EAB A;  2C5I T;  1MIV A;  1MMG A;  1WFD A;  3RYF E;  5L3C B;  2W61 A;  2BDE A;  5TAO A;  4DR3 T;  2WWV A;  4U31 A;  5JR9 B;  2E9X B;  2LSG A;  3AEC A;  5FYM A;  4C91 A;  3EAM A;  4PFO A;  2E2A A;  4GKJ T;  1BR0 A;  3AE1 A;  2ZM6 T;  1HCI A;  4B6X A;  2Y8D A;  3JC6 D;  4A97 A;  1SUM B;  3OVU A;  4ZI2 D;  3ZST A;  1KNR A;  2I6H A;  1M62 A;  3O4X E;  3QB5 K;  4GIW A;  3ZYM A;  3ZT5 A;  3OKQ A;  4JUY A;  4TWF A;  4QX8 B;  3D0T A;  2JMH A;  1UX5 A;  4ZOL E;  4CXX A;  1HX1 B;  1UX4 A;  3PV0 F;  4LF7 T;  4JBW F;  1KK7 A;  3U78 A;  1U5P A;  3IF8 B;  1HG2 A;  3AEG A;  3RRW A;  1CHU A;  3RKO A;  4YJ3 E;  2IW5 B;  4AKH A;  1YQ4 A;  5LA6 E;  2G0U A;  3K8P C;  3GA8 A;  3QNU A;  4QXB B;  5AQJ B;  5HEG A;  4O2A E;  4B3M T;  4ERR A;  3GN5 A;  3I1A A;  4JI4 T;  1MIY A;  2X9X A;  3VR9 A;  3ANW A;  5LYJ E;  2UXB T;  2ZM8 A;  2CHO A;  4AIU A;  3H3A A;  3PUZ F;  2BG9 E;  3LDQ B;  5IUX A;  3VKG A;  1ZP0 A;  4DID B;  3LBX B;  4I0U A;  2YEV C;  4IGU A;  4YLH A;  5FXW A;  4ILB A;  1IBL T;  1N36 T;  1XMO T;  2WDR A;  3B13 A;  4A56 A;  2CE7 A;  2E9X D;  4DV2 T;  3AE9 A;  2LJL A;  5FXV A;  2R6G F;  2M6I A;  1OED E;  3O1H A;  1QLB A;  2ACZ A;  1JNZ A;  4UV9 B;  3RQW A;  2XQA A;  4IRE A;  3ZEF B;  5JDN A;  5LHI B;  5JVD E;  3HKE E;  2XAH B;  2I0M A;  2EHO B;  1XNR T;  2IML A;  3FZM B;  3TLS A;  3HR0 A;  3KV9 A;  3BK9 A;  4MAL A;  3HKB E;  4MFR A;  3UU4 A;  4EV6 A;  2BKP A;  4YFS A;  4DV3 T;  3BQI A;  3ZJ1 A;  4UR9 A;  3DP7 A;  3LK4 2;  4IDZ A;  4MBQ A;  1UK5 A;  2XHE B;  4IE7 A;  4MHC A;  4DV6 T;  2YIN A;  1X9B A;  4MLK A;  2LT3 A;  3HI2 A;  2V6Y A;  3N9M A;  3RPU A;  3L3P A;  4FJO A;  2A3D A;  4OFZ A;  3PU3 A;  3SS1 A;  4O4H E;  2CXD A;  1HNX T;  3GN5 B;  3PTR B;  3ZKR A;  2UUA T;  2BG9 B;  3NZP A;  4A98 A;  5LP6 E;  2Z6E A;  2UXD T;  1T7S A;  1E1H B;  2MYS A;  1I94 T;  1LRZ A;  2MOZ A;  1Y01 A;  3LG7 A;  3P4R A;  4OK0 A;  4ZS3 A;  4O4I E;  2KMF A;  4H63 H;  3ZYL A;  4DBQ A;  4DR7 T;  5LBM A;  1WR0 A;  3PJA J;  4I4T E;  1W0A A;  3QUJ A;  2MTQ A;  2XQ6 A;  3N9O A;  4U3C A;  4BAY B;  5KXJ A;  3E08 A;  1SHZ C;  2A72 A;  4KI0 F;  1KEY A;  5AQP B;  5KX5 E;  1YXR A;  2JQH A;  2Q9Q A;  3CQX C;  4Q25 A;  4PJN A;  1J1J A;  3KVA A;  4HN9 A;  2V5C A;  2CWY A;  3WI3 A;  2JIW A;  3ZPO A;  2L3L A;  4AQF C;  2RPA A;  5HXH A;  4ZI7 E;  1I6Z A;  1YKH B;  2J4G A;  2VKJ A;  4HEA A;  3LFM A;  1FIO A;  2VUR A;  4UEL A;  5EK3 A;  5FVL A;  3TLV A;  2XQ4 A;  4CN4 A;  2WQY A;  2VL0 A;  4ILA A;  3L09 A;  4EEB A;  3KDS E;  2LRK A;  5A1L A;  3N9Q A;  2JQK A;  3ANW B;  3C64 A;  4PNI A;  1ZEE A;  2QRX A;  3ZC1 A;  3PUV F;  3X1D A;  5HCM A;  5CA1 E;  2JPF A;  2WU5 A;  2CBJ A;  2X0L B;  3AA0 B;  2NTY A;  3RRC A;  3CPZ A;  2D9D A;  3DTO A;  3AA6 B;  2M67 A;  3B5M A;  1VRB A;  2YU1 A;  3LK3 B;  1XNQ T;  4HFC A;  3CWZ B;  4OYJ A;  4TNV A;  4JI3 T;  4H9N C;  3U3I A;  4AKG A;  2VKD A;  2XQ7 A;  4O4L E;  2XJ7 A;  1XDO A;  3HKC E;  4L0R A;  4ZZB A;  4L9I A;  4ZZC A;  2VVS A;  2Y48 B;  2V6X A;  3A5X A;  4H63 V;  5L47 A;  4DV1 T;  5HCJ A;  2A9U A;  2CMR A;  2WDQ A;  3EVY A;  3K3O A;  4YTP A;  2HHH T;  2H7V C;  3JCF A;  2KLQ A;  5LCY A;  1BR2 A;  3UU6 A;  4X1Y E;  4H9R C;  5CA0 E;  1UGO A;  1HFA A;  1T98 A;  2V1D B;  1OWA A;  2BG9 C;  3AE3 A;  3ESL A;  5AQU B;  5FKY A;  2CLY C;  2BKO A;  4NPP A;  5LBQ B;  3ZMV B;  2J62 A;  2VL8 A;  3KV6 A;  3UU8 A;  4X64 T;  2KZ7 B;  3KVB A;  3AE7 A;  3T1H T;  2RP4 A;  4GYR A;  5L3E B;  1KFY A;  4GKK T;  2AE9 A;  3C4X A;  3IHR A;  5L4H A;  3ZLI A;  5L3B B;  2W66 A;  3MAC A;  4ZEY A;  4GK0 E;  3RH3 A;  4EED A;  4ZI3 D;  5L4E A;  3FZH B;  2F4V T;  1HS7 A;  5JRC B;  3EUH A;  2MPK A;  5LNK A;  1NWM X;  2LEH A;  3UU5 A;  2XQY A;  2L9Q A;  3J7Y q;  3VKH A;  2X68 A;  1GQE A;  1B7T A;  3G06 A;  4F8H A;  3M3Z B;  3AE2 A;  4LF6 T;  5IYZ E;  3JAF A;  2OA5 A;  3CVR A;  3MJX A;  4ILU A;  5J0Z A;  4WYV A;  3P7I A;  2K48 A;  2LM9 A;  3EI0 A;  3NKZ A;  1WYC A;  2B1E A;  2KXP B;  3ZT6 A;  4YSX A;  4AIS A;  1W0B A;  3VU7 H;  2XAJ B;  3Q9D A;  4YTM A;  1G8X A;  3AEA A;  4AQG A;  4DUZ T;  3CML A;  4EAH A;  4X1I E;  3RHW A;  4KHP T;  3FXD B;  3UQ4 A;  3FBZ A;  5F5W A;  3RQU A;  5JDM A;  4OYK A;  5FMN A;  3HA4 A;  4IE4 A;  2FJD A;  3VR8 A;  4DO0 A;  2UXX B;  4UEM A;  5ABF A;  5HEJ A;  5LJM A;  5AQI B;  4TUY E;  2KND A;  4EOZ B;  3ABV A;  2LHN A;  4KHZ F;  3TKL B;  4EZ4 A;  2K5B B;  3ZCI A;  3ETV A;  5AFU L;  3CIR A;  2JRK A;  3Q5E A;  1VOM A;  3VRB A;  4A5X A;  4DBR A;  3BQL A;  4JEH B;  4ZS2 A;  3N2K E;  5HEU A;  5HXS A;  5JDQ A;  4P0B A;  5L3D B;  4DV4 T;  4UVA B;  4LF8 T;  2EHO D;  3R84 B;  1XZY A;  2YOE A;  1QUU A;  4BA9 A;  3CKD A;  2X9Y A;  5JQG E;  1UUR A;  3P4S A;  3P4P A;  2V7J A;  2D0U A;  5LG4 A;  2IUB A;  4ISS A;  5JDL A;  4AKR B;  5AQS B;  2OLT A;  4P09 A;  3RYC E;  1BR1 A;  5LXT E;  4IE0 A;  3RX6 A;  4TWH A;  5ETW A;  3AAA B;  2FUP A;  4LMK A;  2JQQ A;  2D0T A;  2PTF A;  5LG3 A;  1MNE A;  2W2U A;  1D1C A;  4CI2 B;  2LKG A;  4H9O C;  1OXZ A;  2K3W A;  2NR4 A;  2WMO A;  3QOF A;  3RLF F;  2E8I A;  4QX7 B;  2NW8 A;  2XZE A;  3CX6 B;  3DJB A;  5JR9 C;  2CLY B;  2XSA A;  4H9P C;  3MXZ A;  5FXZ A;  3RYH E;  2MAW A;  1D0Y A;  4PJJ A;  2VQE T;  3S4U A;  3TLT A;  1G73 A;  2WS3 A;  5KMG P;  3MK7 C;  2LOS A;  2XQ3 A;  4KUM B;  5HAX A;  3PUY F;  4E7S A;  4EZH A;  2XQ9 A;  4K0U A;  4HFE A;  4AXP A;  1IZN B;  3F31 A;  4FI5 A;  4C90 A;  2VKH A;  2WU2 A;  3I0O A;  3ETU A;  3FXE B;  2LE8 A;  2DHR A;  4H9S E;  3RIU A;  4EIW A;  4ZI2 C;  2YN6 A;  3AEB A;  3MZK B;  4HFH A;  1OED C;  2A2F X;  2DL1 A;  4QH1 A;  4TWD A;  4HWC A;  4UF0 B;  4NUV A;  5AQN B;  4YSY A;  2VQF T;  1FMW A;  2BS2 A;  3RC3 A;  2VAS A;  2LSY A;  3PUX F;  4X20 E;  5LHG B;  5M4Y A;  3AVS A;  3Q2M A;  2BVL A;  3CQG B;  2AXD S;  2E9X A;  3EHZ A;  4QXC B;  4TX5 A;  1E7P A;  2W62 A;  1HF8 A;  2W4X A;  3O9X A;  3PUS A;  4O4J E;  3ZMT B;  2YKS A;  3ZYK A;  5F8P A;  3UU3 A;  3N2G E;  2DCF A;  4X1K E;  3UUM A;  3QK6 A;  4DVD A;  2ZM2 A;  3QC9 A;  4QH4 A;  4BJM A;  3RGL A;  5L3G B;  1FEW A;  4PFP A;  4EXT A;  5ABE A;  2QYW A;  5CJ5 A;  3EDU A;  2QVA A;  3AA7 B;  5JRE A;  3PE0 A;  1WRD A;  3K3N A;  2VK9 A;  1W09 A;  1AJ3 A;  2BBH A;  4PK4 A;  3Q5W A;  2BBJ A;  1YW0 A;  2PJQ A;  1NEK A;  1OED B;  3MKD A;  3N5L A;  2RA1 A;  3NWI A;  5FP3 A;  4OX9 T;  3K1S A;  5FNV E;  2X0Y A;  3Q5X A;  1J5E T;  2BS3 A;  3UQ7 A;  1W9R A;  5AQL B;  3NBX X;  3RIF A;  3AAI A;  4PK5 A;  2KWH A;  3NRY A;  4F6R C;  2E5V A;  2IHR 1;  5IWA T;  3L39 A;  4JLE A;  2EHO C;  1FJG T;  4IDN A;  4UVC B;  1VCS A;  3PDY A;  3SOL A;  5LGT B;  4X66 T;  2WP9 A;  3M65 A;  4LFA T;  1MIW A;  4HTE A;  4H9Q C;  2LLY A;  5FL0 A;  3ZT7 A;  2VVN A;  4GK5 E;  4N78 D;  3J9X 1;  3CQC B;  5DJQ C;  5JH7 E;  3C98 B;  1BR4 A;  4B3R T;  3Q5D A;  1US7 B;  3E22 E;  1WLX A;  3P4Q A;  4TN7 B;  4XZC A;  3GWH A;  3ZCJ A;  2EHO A;  2WBL A;  1M7K A;  4IIJ E;  1R8I A;  5AQK B;  3PUG A;  3SFE A;  4IHJ E;  2CXL A;  2JQ9 A;  4DR1 T;  3PU8 A;  2CXF A;  5JDG A;  3VHL A;  2LSK A;  3N9P A;  3T1Y T;  3ZC0 A;  4V1A v;  3ONX A;  4DV0 T;  3V5U A;  5JDF A;  5ABH A;  4ADZ A;  1D1B A;  2J47 A;  4JI8 T;  3ZN1 B;  4TZ4 C;  4IL4 A;  3O1J A;  3RC8 A;  4X5T A;  2I59 A;  2PG8 A;  3ONJ A;  4XBF B;  4U72 A;  1YD8 G;  2H88 A;  4CI1 B;  1QSD A;  5HXE A;  1MND A;  4EYU A;  2LOP A;  5L2L A;  4U2Y A;  2WCA A;  4EB6 E;  3TLW A;  4LFB T;  3AXJ B;  1X79 A;  4KMC A;  4DR2 T;  4IL9 A;  4JV5 T;  1T72 A;  4IST A;  2H89 A;  5DQV A;  4CQI A;  5LGU B;  2YDS A;  2NTX A;  5CGM A;  4WBN E;  3H3M A;  3LBX A;  2CCQ A;  2UUB T;  4K0K T;  3AEF A;  2V26 A;  1S94 A;  4KX6 A;  1XDP A;  2FJE A;  5FY0 A;  4IDO A;  4DR6 T;  2PFV A;  3C4Z A;  4GOU A;  3A7M A;  2OV9 A; 
#chains in the Genus database with same CATH homology
 4I50 E;  4ZHQ E;  4ZI3 C;  3EDV A;  2E9X C;  5HWY A;  4KBM B;  3RYI E;  3B57 A;  2ZLY A;  2N2N A;  4BJN A;  4U74 A;  5LHH B;  2K9A A;  4DMW A;  2DLR A;  4GYS A;  5C8Y E;  3V5S A;  4L5G A;  2XAQ B;  5CB4 E;  1Z0P A;  2D2S A;  2V7L A;  2D5U A;  2DWG A;  1D1A A;  4YHJ A;  2C5K T;  2H7O A;  2X9W A;  1CUN A;  2NP9 A;  1S35 A;  2V7K A;  1U4Q A;  4CZZ B;  2DNX A;  1MMN A;  5H6R B;  1WYB A;  4CXW A;  2LHR A;  5L3F B;  5JR9 A;  1ZKE A;  4G63 A;  2N9D A;  2L8K A;  5EZY E;  1WR6 A;  4AKL A;  2LSJ A;  2LSI A;  2QGS A;  3I9Y A;  4G2A A;  1Y64 B;  4CXY A;  3IEE A;  2Q9Q B;  4NUU A;  5J1G A;  3C4W A;  4ANJ A;  4OHF A;  5LOV E;  2YU2 A;  2C0S A;  5BMV E;  3AA1 B;  2NW7 A;  2DWK A;  2WMN A;  4JEU B;  2XAS B;  3OBV E;  5J2T E;  3C51 A;  2QA7 A;  4UF0 A;  4XAX B;  2X66 A;  2WAU A;  3UUX B;  3FB2 A;  3F57 A;  3PUR A;  4ASK A;  2WSS V;  1LVF A;  2ODU A;  2KIN B;  4O2B E;  3ZJ2 A;  1NAF A;  2DI4 A;  1LVK A;  1V9D A;  2IC9 A;  1HTJ F;  3KV5 A;  2IC6 A;  3UUL A;  4DMV A;  5HXC A;  4E7Z A;  2CA5 A;  3LK2 B;  4IE6 A;  1IJ5 A;  3UT5 E;  1HG5 A;  1LKX A;  3KIN B;  3KBU A;  3HKD E;  4AKI A;  3CX8 B;  2MBG A;  4I55 E;  2CM0 A;  3K3Q C;  2K24 A;  2ZM0 A;  5EK2 A;  5IHY A;  3ZMS B;  4HFV A;  2KT9 A;  2J1D G;  2VB6 A;  4KP3 C;  2ZMA A;  5EK4 A;  5ADX L;  5JRC A;  3MA9 A;  2GK9 A;  5FXX A;  3BQK A;  4P0A A;  4WBO A;  5DAB A;  3N9N A;  4J2C A;  4PW8 A;  3FHN A;  1EZ3 A;  1MMA A;  4TV8 E;  3P8C D;  3GMI A;  4QKN A;  3OJA A;  2HH7 A;  3LJC A;  4HKA A;  1UCU A;  2ODV A;  2NW9 A;  3SWH A;  4UXN B;  4I43 B;  4UVB B;  5JDH A;  2KWI B;  2ACX A;  3WAK A;  4M1P A;  1SA0 E;  2XTL A;  3N9L A;  4DND A;  1ZHC A;  4WNK A;  3PUA A;  4WW0 A;  1YKE B;  4Z8X A;  5HXR A;  3KV4 A;  4QWN B;  5H6Q B;  2HPL A;  1FMV A;  1IJ6 A;  4QXH B;  3UTK A;  2SPC A;  2W63 A;  3C50 A;  2Y6X A;  5LGN B;  2XAG B;  2X51 A;  4PAG A;  1IAP A;  2JMK A;  4PJL A;  2HPJ A;  2VWA A;  5F3J A;  2PBI A;  2WWU A;  5HWX A;  3OYZ A;  2JJ9 A;  2H3R A;  2XAF B;  4PJM A;  3CX7 B;  3AAE B;  1D0X A;  2NOX A;  3AVR A;  2YK0 A;  4UV8 B;  4AQF A;  4YJ2 E;  4HE8 A;  4EYY R;  1MMD A;  2ES0 A;  3NZQ A;  4HGA A;  3PUQ A;  3FBL A;  2Q9Q C;  2BVM A;  3E0Z A;  3KFW X;  2WM9 A;  2W00 A;  3H37 A;  3OYX A;  2C5J A;  3N2O A;  3NRX A;  4IE5 A;  4QHO A;  3O1I A;  3AB3 B;  2X9H A;  3T8O A;  2VKO A;  1ZV4 X;  1H7C A;  5HYA A;  4TV9 E;  3IBP A;  1HX8 A;  1D0Z A;  3ZN0 B;  3ZMU B;  5GON E;  3I9W A;  2IAK A;  2W0G A;  2NWB A;  2V7M A;  1O3X A;  2V7I A;  3ZMZ B;  3JC6 C;  5J2U E;  1KNZ A;  2CWO A;  3R6N A;  3KBT A;  2X67 A;  4CI3 B;  3F2E A;  5KDM C;  3O9X A;  2CEA A;  2Q9Q D;  4PK6 A;  2BZB A;  3HL6 A;  3VKH A;  5LJN A;  3I0Q A;  5FY7 A;  4O8S A;  2N1G A;  5DQW A;  2P9B A;  2XUE A;  3SRZ A;  4UIG A;  3UFE A;  2UXN B;  5E0O A;  3UUN A;  3W15 B;  2C5I T;  1MIV A;  1MMG A;  3RYF E;  5L3C B;  2W61 A;  2BDE A;  5TAO A;  5JR9 B;  2E9X B;  2LSG A;  5FYM A;  4C91 A;  4PFO A;  1BR0 A;  1HCI A;  4B6X A;  2Y8D A;  3JC6 D;  4ZI2 D;  4GIW A;  3O4X E;  3ZYM A;  3OKQ A;  4JUY A;  4QX8 B;  3D0T A;  2JMH A;  1UX5 A;  4ZOL E;  4CXX A;  1UX4 A;  1KK7 A;  3U78 A;  1U5P A;  3IF8 B;  1HG2 A;  3RRW A;  3RKO A;  4YJ3 E;  2IW5 B;  4AKH A;  5LA6 E;  2G0U A;  3K8P C;  3GA8 A;  4QXB B;  4O2A E;  4ERR A;  3GN5 A;  3I1A A;  1MIY A;  2X9X A;  3ANW A;  5LYJ E;  2ZM8 A;  3H3A A;  3VKG A;  3LBX B;  4IGU A;  2YEV C;  4YLH A;  5FXW A;  4A56 A;  3B13 A;  2CE7 A;  2E9X D;  2LJL A;  5FXV A;  3O1H A;  4UV9 B;  3ZEF B;  5JDN A;  3WAJ A;  5LHI B;  5JVD E;  3HKE E;  2XAH B;  2EHO B;  3HR0 A;  3KV9 A;  3BK9 A;  4MAL A;  3HKB E;  4MFR A;  4YFS A;  3BQI A;  3ZJ1 A;  3DP7 A;  3LK4 2;  4IDZ A;  4MBQ A;  4IE7 A;  2XHE B;  4MHC A;  2YIN A;  4MLK A;  2LT3 A;  3HI2 A;  3N9M A;  3RPU A;  3L3P A;  4FJO A;  2A3D A;  4OFZ A;  3PU3 A;  3SS1 A;  4O4H E;  2CXD A;  3GN5 B;  3PTR B;  3NZP A;  5LP6 E;  2Z6E A;  1E1H B;  2MYS A;  1LRZ A;  2MOZ A;  4ZS3 A;  3LG7 A;  4OK0 A;  4DBQ A;  4O4I E;  2KMF A;  4H63 H;  3ZYL A;  5LBM A;  4BAY B;  4I4T E;  3QUJ A;  2MTQ A;  3N9O A;  3E08 A;  1SHZ C;  2A72 A;  5KX5 E;  2Q9Q A;  3CQX C;  4PJN A;  3KVA A;  4HN9 A;  2CWY A;  3WI3 A;  3ZPO A;  2L3L A;  4AQF C;  5HXH A;  4ZI7 E;  1YKH B;  2VKJ A;  5EK3 A;  4HEA A;  3LFM A;  1FIO A;  4UEL A;  5CA1 E;  4AI6 A;  5CA0 E;  3L09 A;  3KDS E;  5A1L A;  3N9Q A;  3ANW B;  4PNI A;  3C64 A;  1ZEE A;  3ZC1 A;  2JPF A;  2X0L B;  3AA0 B;  2NTY A;  3RRC A;  3CPZ A;  3DTO A;  3AA6 B;  2M67 A;  3LK3 B;  1VRB A;  2YU1 A;  3CWZ B;  4OYJ A;  4H9N C;  3U3I A;  4AKG A;  2VKD A;  4O4L E;  3HKC E;  4L0R A;  4L9I A;  2Y48 B;  3A5X A;  4H63 V;  2CMR A;  3EVY A;  3K3O A;  2H7V C;  2KLQ A;  5LCY A;  1BR2 A;  4X1Y E;  4H9R C;  1HFA A;  1T98 A;  2V1D B;  1OWA A;  3ESL A;  5LBQ B;  2CLY C;  3ZMV B;  2VL8 A;  3KV6 A;  3ZC0 A;  2KZ7 B;  3KVB A;  2RP4 A;  4GYR A;  5L3E B;  3C4X A;  3IHR A;  3ZLI A;  5L3B B;  3MAC A;  4GK0 E;  3RH3 A;  4ZI3 D;  1HS7 A;  5JRC B;  3EUH A;  5LNK A;  1NWM X;  2LEH A;  2XQY A;  2L9Q A;  3J7Y q;  2X68 A;  1B7T A;  5IYZ E;  2OA5 A;  3CVR A;  3MJX A;  4ILU A;  3P7I A;  2K48 A;  2LM9 A;  1WYC A;  2B1E A;  2KXP B;  3VU7 H;  2XAJ B;  3Q9D A;  1G8X A;  4AQG A;  3CML A;  4EAH A;  4X1I E;  3FXD B;  3FBZ A;  5JDM A;  4OYK A;  5FMN A;  3HA4 A;  4IE4 A;  4DO0 A;  5LJM A;  2UXX B;  4UEM A;  4TUY E;  2KND A;  4EOZ B;  2LHN A;  3TKL B;  4EZ4 A;  2K5B B;  3ZCI A;  3ETV A;  5AFU L;  2JRK A;  1VOM A;  4DBR A;  3BQL A;  4JEH B;  4ZS2 A;  3N2K E;  5HXS A;  5JDQ A;  4P0B A;  5L3D B;  4UVA B;  2EHO D;  3R84 B;  1QUU A;  4BA9 A;  3CKD A;  2X9Y A;  5JQG E;  2V7J A;  2D0U A;  5LG4 A;  4ISS A;  5JDL A;  4AKR B;  4P09 A;  3RYC E;  1BR1 A;  5LXT E;  4IE0 A;  3RX6 A;  5ETW A;  3AAA B;  2JQQ A;  2D0T A;  1MNE A;  1D1C A;  4CI2 B;  4H9O C;  1OXZ A;  2WMO A;  2E8I A;  4QX7 B;  2NW8 A;  3CX6 B;  3DJB A;  5JR9 C;  2CLY B;  4H9P C;  5FXZ A;  3MXZ A;  3RYH E;  1D0Y A;  4PJJ A;  3S4U A;  1G73 A;  5KMG P;  3MK7 C;  2LOS A;  5HAX A;  4KUM B;  4E7S A;  4EZH A;  4K0U A;  4AXP A;  1IZN B;  3F31 A;  4FI5 A;  4C90 A;  2VKH A;  3I0O A;  3ETU A;  3FXE B;  2LE8 A;  2DHR A;  4H9S E;  4EIW A;  4ZI2 C;  3MZK B;  2A2F X;  4UF0 B;  4NUV A;  1FMW A;  3RC3 A;  2VAS A;  2LSY A;  4X20 E;  5LHG B;  5M4Y A;  3AVS A;  3Q2M A;  2BVL A;  3CQG B;  2E9X A;  4QXC B;  4TX5 A;  2W62 A;  1HF8 A;  3PUS A;  4O4J E;  3ZMT B;  3ZYK A;  5F8P A;  3N2G E;  2DCF A;  4X1K E;  3UUM A;  3QK6 A;  4DVD A;  2ZM2 A;  3QC9 A;  4BJM A;  5L3G B;  1FEW A;  4PFP A;  4EXT A;  3EDU A;  3AA7 B;  5JRE A;  3PE0 A;  1WRD A;  3K3N A;  2VK9 A;  1AJ3 A;  4PK4 A;  3Q5W A;  1YW0 A;  2PJQ A;  3MKD A;  3N5L A;  2RA1 A;  5FP3 A;  5FNV E;  3Q5X A;  3NBX X;  3AAI A;  4PK5 A;  2KWH A;  3NRY A;  4F6R C;  4JLE A;  2EHO C;  4UVC B;  3PDY A;  3SOL A;  5LGT B;  3M65 A;  1MIW A;  4HTE A;  4H9Q C;  4GK5 E;  4N78 D;  3J9X 1;  3CQC B;  5DJQ C;  5JH7 E;  3C98 B;  1BR4 A;  4XZC A;  1US7 B;  3E22 E;  1WLX A;  4TN7 B;  3ZCJ A;  3GWH A;  2EHO A;  2WBL A;  4IIJ E;  3PUG A;  4IHJ E;  2CXL A;  3PU8 A;  2CXF A;  5JDG A;  3VHL A;  2LSK A;  3N9P A;  4V1A v;  3ONX A;  3V5U A;  5JDF A;  4ADZ A;  1D1B A;  3ZN1 B;  4TZ4 C;  3O1J A;  3RC8 A;  4XBF B;  2I59 A;  2PG8 A;  4U72 A;  1YD8 G;  4CI1 B;  1QSD A;  5HXE A;  1MND A;  4EYU A;  2LOP A;  5L2L A;  4EB6 E;  1X79 A;  4KMC A;  4IST A;  5DQV A;  5LGU B;  4CQI A;  2NTX A;  4WBN E;  3LBX A;  2CCQ A;  2V26 A;  1S94 A;  5FY0 A;  2PFV A;  3C4Z A;  4GOU A;  5FY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...