4F6RC

Tubulin:stathmin-like domain complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
64
Chain Sequence
NKATSGQSWEVILKPPSFPSLEEIQKKLEAAEERRKAHFAAMLERLQEKDKHAEEVRKNKELKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
source organism Artificial gene
total genus 20
structure length 64
sequence length 79
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.580 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4f6rC01
4I55E 4O4JE 3RYCE 4TUYE 4X20E 4ZHQE 3E22E 3RYIE 4WBNE 4ZI7E 4TV9E 5CA1E 5J2UE 4I50E 5J2TE 4O4HE 3RYHE 5JH7E 5LP6E 4F6RC 4O2AE 5IYZE 5KX5E 4X1IE 5CB4E 3N2GE 5FNVE 5LXTE 4I4TE 3HKDE 4O4LE 3N2KE 4O4IE 3RYFE 5JVDE 3HKEE 3HKBE 4X1YE 3UT5E 5JQGE 3HKCE 4X1KE 5EZYE 5LYJE 4IIJE 5CA0E 5LOVE 4EB6E 4ZOLE 5LA6E 5BMVE 4O2BE 5GONE 5C8YE 1SA0E 4YJ3E 4TV8E 4IHJE 4YJ2E
chains in the Genus database with same CATH superfamily
3NKZA 4H9OC 5AQQB 4ZZBA 1CUNA 2H89A 3NRXA 2V7JA 4X5TA 2K48A 1V9DA 3RPUA 1U4QA 2VVSA 1WR6A 3P50A 3H3MA 5AQIB 4C90A 1ZEEA 4ZI2D 3FBLA 2V7LA 2V26A 4OHFA 4UV8B 1FJGT 4H9SE 4DVDA 2VKDA 3EABA 2BVMA 4BA9A 4TN7B 4ERRA 5DQVA 5JDQA 4YTMA 4HFHA 4DUZT 3WAKA 2Y48B 3N9QA 3FZKB 3BK9A 2JMHA 3ZN0B 4JI4T 3UUMA 4TV9E 3R6NA 5LHHB 4NUUA 4F6RC 1JNRA 5FKYA 1MIWA 3AA0B 5ETWA 4U7IA 3HKDE 2K3WA 3AXJB 2BS2A 3UU8A 1DU2A 4U2YA 4HWIB 1U5PA 2LJLA 3P4QA 4PK6A 4A97A 3Q9DA 3ZSTA 2VQET 1J5WA 3N9PA 5LGNB 1XZYA 2UXXB 3FZLB 1D0XA 4PJLA 2W0GA 5F8PA 2XUEA 4DMVA 2EHOD 2X9XA 4EEBA 3TLVA 3BQLA 1WYCA 2V6XA 1FMWA 4CI3B 2HPJA 3UQ4A 3FZMB 3AXJA 4ZS2A 2BS4A 3PUVF 5JTGA 5CJ5A 4HFCA 3ZCJA 3A7MA 5FNVE 1UX5A 4NUVA 4UF0A 3RF1A 3CX8B 2MTQA 4JLEA 3F2EA 4H9NC 3I0QA 2DCFA 5AQKB 4DIDB 4QHOA 3P4PA 1HX1B 5HWXA 2LEHA 1BR2A 4E7SA 1MNEA 3KV4A 1T98A 3AAAB 4AKIA 4L0RA 5ABGA 5L3CB 2BBHA 5F3JA 3MZKB 4JEHB 2FJAA 4I55E 3UQ7A 1Z0PA 5AQPB 4HWCA 4YSXA 2WDVA 5IYZE 3O9XA 2UUBT 4JI0T 4UVAB 5CB4E 5E0OA 5LHIB 1YW0A 5AQTB 4TWDA 4H9QC 2IHR1 2JJ9A 5AQFB 1KK7A 4TZ4C 2N2NA 4YY3T 5M4YA 5JDMA 5TAOA 3QK6A 2QVAA 2KT9A 2XAQB 3MXZA 4GIWA 3ZYKA 5HXEA 1T72A 2ZM2A 2I59A 2A9UA 2J1DG 3LK3B 3MA9A 4DV2T 4Q25A 4O2BE 4OYJA 3LSVA 5JDNA 4YXDA 3AE9A 5AQGB 2W67A 2KINB 4JI2T 3HI2A 3RRCA 5LMUT 1MIYA 5L3FB 3PE0A 5HXHA 1FEWA 2ACZA 1VCTA 4O8SA 3V5UA 3E08A 5AQOB 3K3QC 3KFWX 3O1HA 1OEDA 3N9OA 3ZEFB 1ZOYA 3UU5A 4B3TT 2YU2A 2IC6A 3C4WA 5EK2A 4NXNT 1WFDA 1IJ5A 4MBQA 1LKXA 4IHJE 5FVKA 4CN4A 2X0YA 3NZQA 2N1GA 2E9XC 4O4HE 5DABA 3FXEB 2BVLA 4EAHA 5FXXA 1KNPA 2LRLA 5AQNB 4KHZF 5GONE 5AQHB 3VKGA 3PUQA 5FXWA 2XQYA 5CA1E 4I50E 3VRBA 4HWDA 3KBUA 3C64A 4CZZB 4LF4T 3O1IA 1I94T 5FL0A 2XQ6A 4IGUA 4U72A 4CN1A 2J4GA 2E9XB 4LF5T 4TUYE 4TNWA 2FBWA 3A8YC 2V7IA 4AKLA 3MACA 2H3RA 3KVAA 4YT0A 5LGUB 2XJ7A 3R84B 3P7IA 5JDFA 3EAMA 2HPLA 2AXDS 1IBKT 3MKDA 3CQGB 3E22E 3VRAA 4LFAT 2XASB 3I1AA 5ABFB 3JADA 1E2AA 3OYZA 3IEEA 4PK5A 3M65A 5JQGE 2CBIA 5L47A 5BR8T 3IF8B 3C51A 2LOSA 3AEGA 3TKLB 2E9XA 1MNDA 3Q5EA 5LMNT 4TX5A 4X64T 2V7KA 3LK2B 3JC6C 4QKNA 5JVDE 2CLYC 4U3CA 4DBQA 2J47A 3OJAA 3F31A 4EXTA 3EUHA 4WZXA 3L8RA 4I0UA 4TWFA 2G0UA 4KI0F 3K1SA 5ABFA 1N33T 2BG9A 3OYXA 4QXBB 4L9IA 2N9DA 1D0ZA 1X9BA 4IL9A 3V5SA 3AE4A 5L3DB 1WR0A 4F8HA 3ANWB 2FJDA 5J0ZA 1XNRT 4LF9T 2CLYB 3LG7A 2WMOA 2K5BB 3KINB 5AFUL 4LF8T 3JAEA 4NPPA 4ZZCA 1HNZT 2WWUA 2Q9QC 1FIOA 3SFDA 3CX6B 3ZC0A 2L8KA 4ZI7E 5J2TE 4QX7B 2E9XD 2X67A 1MMAA 5LJMA 2NW9A 5LB7B 4ILAA 2JIWA 2XQ9A 3RI5A 2WAUA 4CN6A 3EHZA 3PUAA 4DUYT 3QUJA 4WYVA 5LJNA 4CXWA 2P9BA 2DNXA 3TLSA 1IAPA 1ZP0A 5FMNA 2Q9QB 4IE4A 4IDOA 3CVRA 3ZJ2A 2K24A 2XSBA 4B3ST 3ZT5A 1HFAA 2A3DA 3RKOA 4P0AA 3ZJ1A 1FMVA 1IBLT 3KV9A 2DLRA 3LJCA 5HXCA 3AE2A 5HXRA 3K3OA 2MAWA 4PJNA 3X1DA 2MPKA 4V1Av 3NVOA 5L3EB 2LSGA 2XTLA 5JR9C 3K3NA 5HXSA 4JI3T 2IAKA 4K0UA 4YLHA 5KX5E 3C4XA 4AIUA 3NZPA 1W09A 2VKOA 3S4UA 2R6GF 2E8IA 3GN5B 4GKKT 4Z90A 3P8CD 1WLXA 4UR9A 2Q9QA 5HEUA 2C5JA 3IBPA 1MIVA 3JC6D 3UT5E 2CWYA 2YEVC 4OYKA 4X66T 5JR9B 4EOZB 3UFGA 4ANJA 3PUWF 1T8BA 4U7YA 2JQ9A 2XPKA 3VHLA 2YDRA 2LM2A 2LRKA 2GK9A 4OK0A 4P0BA 1HR0T 2Y8DA 1D0YA 2XSAA 5AQLB 5EZYE 5FYMA 3SOLA 2V5CA 5HEGA 3CQCB 4TV8E 4E7ZA 2I6HA 3QOFA 5LG3A 3GN5A 4AXPA 4DBRA 1Y01A 4KHPT 4ILCA 4U74A 1IBMT 3VKHA 5LP6E 4QH4A 4UF0B 4KBMB 2DHRA 1QUUA 3C98B 3FB2A 2RP4A 4U31A 2D2SA 2LSJA 1VRBA 1N36T 2WMNA 2PTFA 3N9NA 4G63A 2X9HA 1H7CA 3CQXC 5JR9A 1VCSA 1AJ3A 4GKJT 1UK5A 4UIGA 4MFRA 2RA1A 2AE9A 3ONJA 2UXCT 3N9MA 4UVBB 2YDSA 3L3PA 3B5MA 4GOUA 5FXVA 1HTJF 3ZPOA 2CHNA 4A5XA 3EVYA 1SUMB 3AEFA 2Z6EA 4DV6T 4U2ZA 4UV9B 4DR3T 5A1LA 3SS1A 3ETUA 5HCJA 2B1EA 2VWAA 2A72A 5CFBA 4HGAA 1OEDC 4QXHB 2LSKA 1N34T 4JV5T 2D9DA 2W62A 4LFCT 4ILBA 4IDNA 4I4TE 4HFVA 4ZI3D 5HAXA 2X9WA 4P09A 3CPZA 3AE1A 2F4VT 2MYSA 3KDSE 2M6BA 2M6IA 2YN6A 4O4LE 2HN2A 3AVSA 3I0OA 3NRYA 1OEDB 1LRZA 2J62A 1MMNA 3ZYMA 3RQWA 1J5ET 4LF7T 2NTYA 3LBXB 4UELA 2X51A 5IHYA 2KNDA 2BDEA 2IUBA 3U78A 1W0BA 4HFIA 2V8SV 3C50A 2WZHA 3D0TA 4G2AA 3P4WA 2VQFT 4X1IE 2VKJA 5DQWA 3BQIA 3FZFB 2HHHT 3PJAA 3PUSA 4Z91A 4ZOLE 4HEAA 4BAYB 2ACXA 3FBZA 3AE5A 4AKHA 1HNWT 2RPAA 4B6XA 3LBXA 4MALA 2XQAA 3W15B 2X9YA 1S94A 1XMOT 4EZHA 4DR7T 3RYFE 3JAFA 3RIUC 2YK0A 4WW0A 1KNZA 1IJ6A 1KNRA 3QB5A 3LFMA 4IE5A 2C0SA 3SRZA 4P1NA 1US7B 5C2TA 5KXJA 3Q5XA 1Y64B 4B3RT 4DR4T 5LYJE 1SA0E 2IC9A 4LFBT 2W2UA 1BR4A 2LHRA 4ZXLA 3PUXF 4OFZA 3ZMZB 4O2AE 3AEDA 3CKDA 3UU4A 2NW7A 3GMIA 3N2KE 2BG9C 3BQKA 3HL6A 2WM9A 4UEMA 1L0VA 3G06A 3ABVA 2YU1A 2UUCT 4COFA 5J2UE 4ISSA 4EEDA 3VR9A 1XWMA 1CHUA 3P4SA 3IA3A 2PG8A 3KV5A 2LT3A 3RQUA 1X79A 4PJMA 5C3JA 1O3XA 2WDRA 4DR2T 4AI6A 5L3BB 1T7SA 3ZMTB 3UFEA 5LBMA 1IZNB 2WCAA 3AE8A 2BBJA 3O1JA 4NIQA 3N9LA 2W00A 2NR4A 4LF6T 2BG9B 2BKPA 3AAIA 3AEBA 2KWIB 3HKEE 3RIUA 4HTEA 4UXNB 3PURA 5HEOA 1S35A 4YTPA 4ZS3A 2E2AA 3KBTA 2VVNA 2W61A 3AVRA 1HG2A 2C5KT 2M67A 3SWHA 4QXCB 2VASA 2SPCA 4ZEYA 5CGMA 2E5LT 3UU3A 5BMVE 2X0LB 5LGTB 4HFEA 4AQFA 1XDPA 3F57A 1ZV4X 2ZM8A 2VB6A 2XQ8A 3I9YA 2CEAA 3HKBE 3Q2MA 2YINA 4PW8A 5L4EA 3SFEA 2V5DA 4YFSA 2NOXA 4PAGA 3L39A 1BR1A 2WU2A 1HS7A 1SHZC 3OPCA 5FY0A 4BJMA 1M7KA 5L2LA 1LVFA 1W9RA 2MBGA 3CX7B 3TLWA 2LOPA 2JRKA 1UURA 2CE7A 3FXDB 2WB5A 4FI5A 2HN1A 2DL1A 4PFOA 4IL4A 1KF6A 1JNZA 2WBLA 5LA6E 2WQYA 3K8PC 3ZT7A 2EHOC 4ADZA 5LBQB 4AKRB 2VK9A 5JDHA 4QH5A 4ILUA 1HCIA 3AA6B 3ZT6A 4HFDA 1ZKEA 4AQGA 3B57A 4IDZA 4K0KT 4CXYA 4IREA 2HH7A 3NBXX 5AQUB 1WRDA 3OKQA 1G73A 5DJQC 4AQYT 3LK42 2V6YA 5FXZA 1D1AA 5LCYA 1Z8UA 3AA1B 5EK4A 4GK5E 4EYUA 2YOEA 3KVBA 3ZYLA 5C8YE 5L3GB 4NXMT 3RGLA 3J9X1 5HWYA 4YSYA 4JI5T 2CHOA 4YHHT 2ES0A 3EDUA 2XAFB 5LG4A 1WCRA 5H6QB 5JRCA 5LHGB 4PNIA 3N2OA 2Y6XA 1UX4A 3L09A 5F5WA 1KFYA 1KEYA 1OEDE 3OBVE 1E7PA 3RH3A 3MK7C 4DNDA 3M3ZB 5FL1A 3MJXA 5AQSB 3U3IA 1HF8A 4PK4A 2CMRA 2D0UA 1NWMX 4AKGA 2FUPA 5EK3A 3N5LA 4KP3C 2W66A 1SE7A 5HCMA 4WBNE 2EHOA 3AE6A 3UUXB 2YDQA 5ABHA 5JH7E 2KSRA 2X66A 4MLKA 3ESLA 4YTNA 4DV1T 5HYAA 3T1HT 3Q5DA 2LLYA 4JI7T 4EB6E 2IDOB 2LM9A 4X65T 3RKGA 4KX6A 3UU6A 2W63A 3Q5WA 1WYBA 2L9QA 3RX6A 3PU3A 3B13A 2D5UA 2PJQA 4DV4T 4X20E 2XY8B 3UUNA 3RYIE 2Q9QD 2DI4A 3TLTA 2UU9T 3ZLIA 3EDVA 3FZHB 4IT4A 4OX9T 4DR6T 2CPTA 2D0TA 3QNUA 2JPFA 2CWOA 3EI0A 2KLQA 3AAEB 2XZEA 2W4XA 2XAJB 2KXPB 2LHNA 3N2GE 2CM0A 1QSDA 4LMJA 4MHCA 4ASKA 5AQRB 1YXRA 2BKOA 2WS3A 3VR8A 3DTOA 5FVLA 4FJOA 2XAHB 1NEKA 2WWVA 5LNKA 2OV9A 3DP7A 5ABEA 3HR0A 2VL0A 4EGWA 3ZMUB 3AECA 2YKSA 2JQQA 3RLFF 2QGSA 1M62A 4M1PA 5L4HA 2NP9A 2QYWA 3J7Yq 2BG9E 3NWIA 4ZHQE 3H37A 2UXNB 2XQ7A 4L5GA 4DV5T 2DWGA 2VL8A 4IE7A 4QWNB 4IE0A 3RC3A 2ZM6T 4IIJE 4PJJA 5LOVE 4WBOA 3AA7B 4TNVA 3FHNA 3PJAJ 3WI3A 2VKHA 5FP3A 4JI8T 4XAXB 2V1DB 4HKAA 3KV6A 4IDPA 3PUGA 1N32T 4O4IE 2UXDT 3UULA 4C91A 4QX8B 2QRXA 4DV7T 1MMGA 4YJ2E 2CRBA 2C5IT 1J1JA 3RYCE 2E5VA 3C4ZA 3AEAA 3P4RA 2IIUA 1OXZA 5JDGA 2DWKA 2IMLA 4IDQA 2PBIA 3PV0F 3VU7H 1YQ4A 2XM1A 1YKEB 3HKCE 1HNXT 4H63H 4CQIA 2LE8A 2IW5B 2XM2A 4HE8A 4EYYR 3WAJA 4I43B 3HA4A 4JYAT 5J1GA 5KMGP 3ZSSA 4X1KE 3TLUA 2OLTA 3T8OA 2I0MA 4LMKA 4AQFC 4O4JE 2FJEA 4HWHA 4GYRA 3UUBA 4B3MT 3H3AA 2ZLYA 4EIWA 4CI1B 2H88A 4EZ4A 4GK0E 4DV3T 1EZ3A 3PTRB 3GWHA 1I6ZA 5HEJA 1VOMA 4QH1A 1HG5A 2QA7A 1YD8G 2L3LA 3ZCIA 5IWAT 3CMLA 4X62T 1QLBA 3ZMSB 4A56A 3RHWA 2B76A 2WDQA 3O4XE 4IE6A 3E0ZA 3PUZF 5CA0E 2XQ4A 4WNKA 4BJNA 1E1HB 4HFBA 1HX8A 4H9RC 4CI2B 2ZM0A 5AQMB 2JQKA 2KWHA 3RYHE 5FY1A 2CA5A 3PU8A 1XDOA 5LXTE 4YSZA 5HEHA 2WP9A 4HWFA 3RIAA 2LKGA 3A5XA 2KZ7B 3AE3A 4LMLA 1XMQT 2BKNA 4N78D 2OA5A 2NTXA 5AQJB 4XBFB 4JEUB 2NW8A 3AB3B 4X1YE 2MOZA 3ONXA 4ZI2C 5KDMC 2VURA 2UUAT 4JBWF 2X68A 3ZMVB 4DR5T 1UGOA 3OTOT 3RRWA 3T1YT 2H7OA 3AE7A 1UUSA 3PUYF 4TWHA 3ONLC 3QC9A 2ZMAA 1R8IA 3ZN1B 2JQHA 5JREA 1XNQT 4Z8XA 4A98A 3RC8A 2ODUA 3CIRA 4JI1T 4UVCB 2PFVA 3RIFA 5FY7A 3PDYA 4KUMB 2WU5A 4HN9A 3ZKRA 3LDQB 1NAFA 3UTKA 4EV6A 4JUYA 4DMWA 1OWAA 2H7VC 1ZHCA 2LKHA 4JI6T 3CK6A 2V6YB 1D1CA 2KMFA 2V7MA 2WZIA 3JCFA 2LSYA 1NENA 4H9PC 3DJBA 2A2FX 1D1BA 2K9AA 4H63V 5ADXL 5AQVB 2FJBA 2CXFA 3AEEA 5H6RB 1GQEA 5JRCB 1BR0A 4U33A 4GYSA 1YQ3A 2UXBT 4PFPA 4AISA 1MMDA 1G8XA 2LSIA 3QB5K 4YJ3E 3ZC1A 2CBJA 1LVKA 5JDLA 3IHRA 2XAGB 2XQ5A 1W0AA 3ANWA 4XZCA 2CCQA 2CXDA 4YHJA 2CXLA 2XHEB 2XQ3A 3GA8A 1UCUA 2JMKA 2EHOB 3CWZB 3I9WA 3OVUA 2BS3A 1YKHB 4KMCA 4DV0T 4ISTA 2NWBA 2WSSV 2X0HA 1B7TA 5IUXA 4DO0A 4ZI3C 2ODVA 4DR1T 4CXXA 2BZBA 2WY2A 3ETVA 4J2CA
chains in the Genus database with same CATH topology
4IE5A 2C0SA 4H9OC 3OJAA 3SRZA 3F31A 4EXTA 3EUHA 1CUNA 1US7B 2XAHB 2G0UA 3NRXA 5LNKA 2V7JA 2K48A 3DP7A 1V9DA 3Q5XA 3RPUA 1U4QA 1Y64B 1WR6A 3OYXA 4QXBB 5LYJE 4L9IA 2N9DA 4C90A 3HR0A 1ZEEA 1D0ZA 1SA0E 2IC9A 4ZI2D 3FBLA 2V7LA 3V5SA 2V26A 4OHFA 4UV8B 3ZMUB 4H9SE 1BR4A 4DVDA 5L3DB 2JQQA 2LHRA 2QGSA 4OFZA 3ZMZB 2VKDA 4O2AE 3CKDA 3ANWB 2BVMA 4BA9A 4TN7B 4ERRA 4M1PA 5DQVA 5JDQA 2NW7A 3GMIA 2CLYB 3LG7A 2WMOA 3N2KE 3BQKA 2K5BB 3KINB 5AFUL 3HL6A 3WAKA 2NP9A 2WM9A 3J7Yq 2Y48B 2WWUA 3N9QA 4UEMA 2Q9QC 3BK9A 1FIOA 2JMHA 3CX6B 3ZC0A 2L8KA 3ZN0B 3UUMA 4ZHQE 2YU1A 3H37A 2UXNB 4TV9E 3R6NA 4ZI7E 4ISSA 5J2UE 5LHHB 5J2TE 4QX7B 4NUUA 4F6RC 4L5GA 2DWGA 1MIWA 2E9XD 3AA0B 2X67A 5ETWA 2VL8A 1MMAA 2PG8A 3KV5A 4IE7A 3HKDE 4QWNB 2LT3A 2NW9A 5LJMA 1X79A 4IE0A 4PJMA 3RC3A 4IIJE 4PJJA 5LOVE 1O3XA 2WAUA 4WBOA 4AI6A 3AA7B 5L3BB 3ZMTB 3UFEA 3PUAA 5LBMA 1IZNB 3FHNA 3WI3A 2VKHA 3O1JA 3QUJA 5FP3A 1U5PA 2LJLA 3N9LA 4XAXB 2W00A 4PK6A 2V1DB 4HKAA 5LJNA 3Q9DA 3KV6A 3AAIA 3PUGA 4CXWA 2P9BA 3N9PA 2DNXA 4O4IE 5LGNB 1IAPA 2KWIB 3UULA 3HKEE 4C91A 2UXXB 4HTEA 4QX8B 5FMNA 4UXNB 3PURA 2Q9QB 1D0XA 1S35A 1MMGA 4PJLA 4IE4A 2W0GA 4ZS3A 4YJ2E 3CVRA 5F8PA 3KBTA 2C5IT 3ZJ2A 3RYCE 2K24A 3C4ZA 2W61A 3AVRA 1HG2A 2C5KT 2XUEA 4DMVA 2M67A 2EHOD 1HFAA 1OXZA 2A3DA 2X9XA 3RKOA 3SWHA 4QXCB 3ZJ1A 5JDGA 1FMVA 4P0AA 2DWKA 3KV9A 2PBIA 2VASA 2DLRA 3BQLA 3LJCA 5HXCA 1WYCA 2SPCA 3VU7H 5HXRA 3K3OA 1YKEB 1FMWA 3HKCE 4CI3B 2HPJA 4PJNA 5BMVE 4H63H 4CQIA 2X0LB 4V1Av 5LGTB 2LE8A 2IW5B 4HE8A 5L3EB 4EYYR 4AQFA 2LSGA 2XTLA 3WAJA 4I43B 5JR9C 3F57A 3K3NA 1ZV4X 4ZS2A 5HXSA 2ZM8A 3HA4A 2VB6A 2IAKA 4K0UA 4YLHA 5KX5E 3C4XA 5J1GA 3NZPA 3ZCJA 2VKOA 3I9YA 5FNVE 3S4UA 2CEAA 1UX5A 4NUVA 5KMGP 3HKBE 3Q2MA 4UF0A 4X1KE 3CX8B 2MTQA 4JLEA 2E8IA 3GN5B 3T8OA 2YINA 4PW8A 3P8CD 1WLXA 3F2EA 4H9NC 4YFSA 3I0QA 4AQFC 2NOXA 2Q9QA 2DCFA 4O4JE 4PAGA 4QHOA 4GYRA 5HWXA 2LEHA 3H3AA 2ZLYA 1BR2A 2C5JA 4EIWA 1BR1A 1HS7A 4E7SA 1MNEA 3IBPA 1MIVA 4CI1B 1SHZC 3JC6D 3KV4A 3UT5E 4EZ4A 2CWYA 1T98A 3AAAB 4AKIA 5FY0A 4BJMA 2YEVC 4GK0E 4L0RA 4OYKA 1EZ3A 5L3CB 5F3JA 3MZKB 4JEHB 3PTRB 3GWHA 5JR9B 5L2LA 1LVFA 2MBGA 4EOZB 4ANJA 3CX7B 4I55E 1Z0PA 2LOPA 1VOMA 1HG5A 2JRKA 2QA7A 1YD8G 2L3LA 3ZCIA 5IYZE 2CE7A 3O9XA 3VHLA 3CMLA 3FXDB 4UVAB 4FI5A 5CB4E 2GK9A 4OK0A 4P0BA 4PFOA 5E0OA 3ZMSB 5LHIB 1YW0A 2Y8DA 4A56A 1D0YA 4H9QC 3O4XE 2JJ9A 4IE6A 2WBLA 3E0ZA 5EZYE 5FYMA 5CA0E 4WNKA 4BJNA 5LA6E 1KK7A 4TZ4C 3SOLA 2N2NA 1E1HB 3CQCB 4TV8E 1HX8A 5M4YA 3K8PC 4H9RC 4E7ZA 5JDMA 4CI2B 5TAOA 3GN5A 4AXPA 3QK6A 2ZM0A 4DBRA 2EHOC 2KT9A 2XAQB 3MXZA 4ADZA 4U74A 5LBQB 4GIWA 2KWHA 3RYHE 2VK9A 3ZYKA 4AKRB 5HXEA 5LP6E 3VKHA 5JDHA 2ZM2A 2I59A 5FY1A 2CA5A 3PU8A 4ILUA 4UF0B 4KBMB 2DHRA 1QUUA 2J1DG 3C98B 5LXTE 3LK3B 1HCIA 3AA6B 3FB2A 3MA9A 2RP4A 1ZKEA 4AQGA 3B57A 2D2SA 4IDZA 4O2BE 4CXYA 4OYJA 2LSJA 5JDNA 1VRBA 3A5XA 2WMNA 2HH7A 2KZ7B 3NBXX 2KINB 3N9NA 4G63A 1WRDA 4N78D 3HI2A 3RRCA 2X9HA 3OKQA 1H7CA 1G73A 3CQXC 5DJQC 2OA5A 1MIYA 5JR9A 2NTXA 3LK42 1AJ3A 4XBFB 5FXZA 4JEUB 1D1AA 5L3FB 4UIGA 5LCYA 3PE0A 2NW8A 5HXHA 1FEWA 3AB3B 3AA1B 4MFRA 2RA1A 4X1YE 2MOZA 5EK4A 4O8SA 4GK5E 3V5UA 4EYUA 3ONXA 4ZI2C 5KDMC 3E08A 3N9MA 3K3QC 3KVBA 4UVBB 3ZYLA 3ZMVB 2X68A 5C8YE 5L3GB 3KFWX 3O1HA 3N9OA 3L3PA 3J9X1 3RRWA 3ZEFB 4GOUA 5HWYA 2H7OA 5FXVA 1HTJF 3ZPOA 2ES0A 3EDUA 3EVYA 2XAFB 2Z6EA 5LG4A 2YU2A 5H6QB 2IC6A 4UV9B 3C4WA 2ZMAA 3QC9A 3ZN1B 5EK2A 5JRCA 5A1LA 3SS1A 3ETUA 1IJ5A 5LHGB 2B1EA 2VWAA 4PNIA 5JREA 3N2OA 2A72A 4Z8XA 2Y6XA 4MBQA 1UX4A 3L09A 3RC8A 4HGAA 1LKXA 4IHJE 4QXHB 2ODUA 2LSKA 3OBVE 4UVCB 2PFVA 3NZQA 3RH3A 3MK7C 2N1GA 5FY7A 2E9XC 3PDYA 2W62A 4O4HE 4KUMB 4DNDA 5DABA 3FXEB 2BVLA 3MJXA 4HN9A 3U3IA 4EAHA 1HF8A 4PK4A 2CMRA 2D0UA 4I4TE 1NAFA 5FXXA 3UTKA 1NWMX 4JUYA 4DMWA 4AKGA 1OWAA 5EK3A 2H7VC 4HFVA 1ZHCA 4ZI3D 3N5LA 4KP3C 5GONE 5HAXA 2X9WA 4P09A 3CPZA 3VKGA 3PUQA 5FXWA 2MYSA 1D1CA 2EHOA 2KMFA 2XQYA 3KDSE 2V7MA 3UUXB 4WBNE 5CA1E 4I50E 5JH7E 2X66A 2LSYA 4MLKA 3ESLA 3KBUA 3C64A 4H9PC 4CZZB 4O4LE 3O1IA 5HYAA 3AVSA 2A2FX 3DJBA 3I0OA 3NRYA 1LRZA 1D1BA 4EB6E 2K9AA 4IGUA 1MMNA 3ZYMA 4U72A 4H63V 2LM9A 5ADXL 2NTYA 3LBXB 2E9XB 2CXFA 4TUYE 4UELA 2X51A 5IHYA 2V7IA 5H6RB 4AKLA 5JRCB 3MACA 2H3RA 2KNDA 2W63A 1BR0A 4GYSA 3Q5WA 2BDEA 3KVAA 1WYBA 4PFPA 3U78A 2L9QA 3RX6A 3PU3A 5LGUB 1MMDA 1G8XA 3R84B 2LSIA 3P7IA 3C50A 3B13A 2D5UA 2PJQA 5JDFA 3D0TA 4YJ3E 4G2AA 4X20E 3ZC1A 2HPLA 1LVKA 3MKDA 3UUNA 5JDLA 3CQGB 3IHRA 3E22E 3RYIE 2Q9QD 2XAGB 2XASB 3I1AA 2DI4A 3ZLIA 4X1IE 2VKJA 5DQWA 3BQIA 3OYZA 3ANWA 4XZCA 3IEEA 4PK5A 3EDVA 2CCQA 3M65A 5JQGE 2CXDA 3PUSA 4YHJA 2CXLA 4ZOLE 2XHEB 4HEAA 4BAYB 2D0TA 3GA8A 2JPFA 2ACXA 3IF8B 2CWOA 3C51A 3FBZA 1UCUA 2JMKA 2EHOB 3CWZB 3I9WA 2LOSA 4AKHA 3TKLB 2KLQA 4B6XA 3LBXA 3AAEB 4MALA 3W15B 1YKHB 2XAJB 4KMCA 4ISTA 2X9YA 2E9XA 2NWBA 2WSSV 1MNDA 1S94A 2KXPB 4TX5A 4EZHA 2LHNA 2V7KA 3LK2B 1B7TA 3JC6C 3N2GE 2CM0A 1QSDA 3RYFE 4DO0A 4QKNA 4ZI3C 5JVDE 2YK0A 4MHCA 4ASKA 4WW0A 2ODVA 1KNZA 1IJ6A 2CLYC 4CXXA 2BZBA 4DBQA 3ETVA 3DTOA 4FJOA 4J2CA 3LFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I55 E;  4O4J E;  3RYC E;  4TUY E;  4X20 E;  4ZHQ E;  3E22 E;  3RYI E;  4WBN E;  4ZI7 E;  4TV9 E;  5CA1 E;  5J2U E;  4I50 E;  5J2T E;  4O4H E;  3RYH E;  5JH7 E;  5LP6 E;  4F6R C;  4O2A E;  5IYZ E;  5KX5 E;  4X1I E;  5CB4 E;  3N2G E;  5FNV E;  5LXT E;  4I4T E;  3HKD E;  4O4L E;  3N2K E;  4O4I E;  3RYF E;  5JVD E;  3HKE E;  3HKB E;  4X1Y E;  3UT5 E;  5JQG E;  3HKC E;  4X1K E;  5EZY E;  5LYJ E;  4IIJ E;  5CA0 E;  5LOV E;  4EB6 E;  4ZOL E;  5LA6 E;  5BMV E;  4O2B E;  5GON E;  5C8Y E;  1SA0 E;  4YJ3 E;  4TV8 E;  4IHJ E;  4YJ2 E; 
#chains in the Genus database with same CATH topology
 3NKZ A;  4H9O C;  5AQQ B;  4ZZB A;  1CUN A;  2H89 A;  3NRX A;  2V7J A;  4X5T A;  2K48 A;  1V9D A;  3RPU A;  1U4Q A;  2VVS A;  1WR6 A;  3P50 A;  3H3M A;  5AQI B;  4C90 A;  1ZEE A;  4ZI2 D;  3FBL A;  2V7L A;  2V26 A;  4OHF A;  4UV8 B;  1FJG T;  4H9S E;  4DVD A;  2VKD A;  3EAB A;  2BVM A;  4BA9 A;  4TN7 B;  4ERR A;  5DQV A;  5JDQ A;  4YTM A;  4HFH A;  4DUZ T;  3WAK A;  2Y48 B;  3N9Q A;  3FZK B;  3BK9 A;  2JMH A;  3ZN0 B;  4JI4 T;  3UUM A;  4TV9 E;  3R6N A;  5LHH B;  4NUU A;  4F6R C;  1JNR A;  5FKY A;  1MIW A;  3AA0 B;  5ETW A;  4U7I A;  3HKD E;  2K3W A;  3AXJ B;  2BS2 A;  3UU8 A;  1DU2 A;  4U2Y A;  4HWI B;  1U5P A;  2LJL A;  3P4Q A;  4PK6 A;  4A97 A;  3Q9D A;  3ZST A;  2VQE T;  1J5W A;  3N9P A;  5LGN B;  1XZY A;  2UXX B;  3FZL B;  1D0X A;  4PJL A;  2W0G A;  5F8P A;  2XUE A;  4DMV A;  2EHO D;  2X9X A;  4EEB A;  3TLV A;  3BQL A;  1WYC A;  2V6X A;  1FMW A;  4CI3 B;  2HPJ A;  3UQ4 A;  3FZM B;  3AXJ A;  4ZS2 A;  2BS4 A;  3PUV F;  5JTG A;  5CJ5 A;  4HFC A;  3ZCJ A;  3A7M A;  5FNV E;  1UX5 A;  4NUV A;  4UF0 A;  3RF1 A;  3CX8 B;  2MTQ A;  4JLE A;  3F2E A;  4H9N C;  3I0Q A;  2DCF A;  5AQK B;  4DID B;  4QHO A;  3P4P A;  1HX1 B;  5HWX A;  2LEH A;  1BR2 A;  4E7S A;  1MNE A;  3KV4 A;  1T98 A;  3AAA B;  4AKI A;  4L0R A;  5ABG A;  5L3C B;  2BBH A;  5F3J A;  3MZK B;  4JEH B;  2FJA A;  4I55 E;  3UQ7 A;  1Z0P A;  5AQP B;  4HWC A;  4YSX A;  2WDV A;  5IYZ E;  3O9X A;  2UUB T;  4JI0 T;  4UVA B;  5CB4 E;  5E0O A;  5LHI B;  1YW0 A;  5AQT B;  4TWD A;  4H9Q C;  2IHR 1;  2JJ9 A;  5AQF B;  1KK7 A;  4TZ4 C;  2N2N A;  4YY3 T;  5M4Y A;  5JDM A;  5TAO A;  3QK6 A;  2QVA A;  2KT9 A;  2XAQ B;  3MXZ A;  4GIW A;  3ZYK A;  5HXE A;  1T72 A;  2ZM2 A;  2I59 A;  2A9U A;  2J1D G;  3LK3 B;  3MA9 A;  4DV2 T;  4Q25 A;  4O2B E;  4OYJ A;  3LSV A;  5JDN A;  4YXD A;  3AE9 A;  5AQG B;  2W67 A;  2KIN B;  4JI2 T;  3HI2 A;  3RRC A;  5LMU T;  1MIY A;  5L3F B;  3PE0 A;  5HXH A;  1FEW A;  2ACZ A;  1VCT A;  4O8S A;  3V5U A;  3E08 A;  5AQO B;  3K3Q C;  3KFW X;  3O1H A;  1OED A;  3N9O A;  3ZEF B;  1ZOY A;  3UU5 A;  4B3T T;  2YU2 A;  2IC6 A;  3C4W A;  5EK2 A;  4NXN T;  1WFD A;  1IJ5 A;  4MBQ A;  1LKX A;  4IHJ E;  5FVK A;  4CN4 A;  2X0Y A;  3NZQ A;  2N1G A;  2E9X C;  4O4H E;  5DAB A;  3FXE B;  2BVL A;  4EAH A;  5FXX A;  1KNP A;  2LRL A;  5AQN B;  4KHZ F;  5GON E;  5AQH B;  3VKG A;  3PUQ A;  5FXW A;  2XQY A;  5CA1 E;  4I50 E;  3VRB A;  4HWD A;  3KBU A;  3C64 A;  4CZZ B;  4LF4 T;  3O1I A;  1I94 T;  5FL0 A;  2XQ6 A;  4IGU A;  4U72 A;  4CN1 A;  2J4G A;  2E9X B;  4LF5 T;  4TUY E;  4TNW A;  2FBW A;  3A8Y C;  2V7I A;  4AKL A;  3MAC A;  2H3R A;  3KVA A;  4YT0 A;  5LGU B;  2XJ7 A;  3R84 B;  3P7I A;  5JDF A;  3EAM A;  2HPL A;  2AXD S;  1IBK T;  3MKD A;  3CQG B;  3E22 E;  3VRA A;  4LFA T;  2XAS B;  3I1A A;  5ABF B;  3JAD A;  1E2A A;  3OYZ A;  3IEE A;  4PK5 A;  3M65 A;  5JQG E;  2CBI A;  5L47 A;  5BR8 T;  3IF8 B;  3C51 A;  2LOS A;  3AEG A;  3TKL B;  2E9X A;  1MND A;  3Q5E A;  5LMN T;  4TX5 A;  4X64 T;  2V7K A;  3LK2 B;  3JC6 C;  4QKN A;  5JVD E;  2CLY C;  4U3C A;  4DBQ A;  2J47 A;  3OJA A;  3F31 A;  4EXT A;  3EUH A;  4WZX A;  3L8R A;  4I0U A;  4TWF A;  2G0U A;  4KI0 F;  3K1S A;  5ABF A;  1N33 T;  2BG9 A;  3OYX A;  4QXB B;  4L9I A;  2N9D A;  1D0Z A;  1X9B A;  4IL9 A;  3V5S A;  3AE4 A;  5L3D B;  1WR0 A;  4F8H A;  3ANW B;  2FJD A;  5J0Z A;  1XNR T;  4LF9 T;  2CLY B;  3LG7 A;  2WMO A;  2K5B B;  3KIN B;  5AFU L;  4LF8 T;  3JAE A;  4NPP A;  4ZZC A;  1HNZ T;  2WWU A;  2Q9Q C;  1FIO A;  3SFD A;  3CX6 B;  3ZC0 A;  2L8K A;  4ZI7 E;  5J2T E;  4QX7 B;  2E9X D;  2X67 A;  1MMA A;  5LJM A;  2NW9 A;  5LB7 B;  4ILA A;  2JIW A;  2XQ9 A;  3RI5 A;  2WAU A;  4CN6 A;  3EHZ A;  3PUA A;  4DUY T;  3QUJ A;  4WYV A;  5LJN A;  4CXW A;  2P9B A;  2DNX A;  3TLS A;  1IAP A;  1ZP0 A;  5FMN A;  2Q9Q B;  4IE4 A;  4IDO A;  3CVR A;  3ZJ2 A;  2K24 A;  2XSB A;  4B3S T;  3ZT5 A;  1HFA A;  2A3D A;  3RKO A;  4P0A A;  3ZJ1 A;  1FMV A;  1IBL T;  3KV9 A;  2DLR A;  3LJC A;  5HXC A;  3AE2 A;  5HXR A;  3K3O A;  2MAW A;  4PJN A;  3X1D A;  2MPK A;  4V1A v;  3NVO A;  5L3E B;  2LSG A;  2XTL A;  5JR9 C;  3K3N A;  5HXS A;  4JI3 T;  2IAK A;  4K0U A;  4YLH A;  5KX5 E;  3C4X A;  4AIU A;  3NZP A;  1W09 A;  2VKO A;  3S4U A;  2R6G F;  2E8I A;  3GN5 B;  4GKK T;  4Z90 A;  3P8C D;  1WLX A;  4UR9 A;  2Q9Q A;  5HEU A;  2C5J A;  3IBP A;  1MIV A;  3JC6 D;  3UT5 E;  2CWY A;  2YEV C;  4OYK A;  4X66 T;  5JR9 B;  4EOZ B;  3UFG A;  4ANJ A;  3PUW F;  1T8B A;  4U7Y A;  2JQ9 A;  2XPK A;  3VHL A;  2YDR A;  2LM2 A;  2LRK A;  2GK9 A;  4OK0 A;  4P0B A;  1HR0 T;  2Y8D A;  1D0Y A;  2XSA A;  5AQL B;  5EZY E;  5FYM A;  3SOL A;  2V5C A;  5HEG A;  3CQC B;  4TV8 E;  4E7Z A;  2I6H A;  3QOF A;  5LG3 A;  3GN5 A;  4AXP A;  4DBR A;  1Y01 A;  4KHP T;  4ILC A;  4U74 A;  1IBM T;  3VKH A;  5LP6 E;  4QH4 A;  4UF0 B;  4KBM B;  2DHR A;  1QUU A;  3C98 B;  3FB2 A;  2RP4 A;  4U31 A;  2D2S A;  2LSJ A;  1VRB A;  1N36 T;  2WMN A;  2PTF A;  3N9N A;  4G63 A;  2X9H A;  1H7C A;  3CQX C;  5JR9 A;  1VCS A;  1AJ3 A;  4GKJ T;  1UK5 A;  4UIG A;  4MFR A;  2RA1 A;  2AE9 A;  3ONJ A;  2UXC T;  3N9M A;  4UVB B;  2YDS A;  3L3P A;  3B5M A;  4GOU A;  5FXV A;  1HTJ F;  3ZPO A;  2CHN A;  4A5X A;  3EVY A;  1SUM B;  3AEF A;  2Z6E A;  4DV6 T;  4U2Z A;  4UV9 B;  4DR3 T;  5A1L A;  3SS1 A;  3ETU A;  5HCJ A;  2B1E A;  2VWA A;  2A72 A;  5CFB A;  4HGA A;  1OED C;  4QXH B;  2LSK A;  1N34 T;  4JV5 T;  2D9D A;  2W62 A;  4LFC T;  4ILB A;  4IDN A;  4I4T E;  4HFV A;  4ZI3 D;  5HAX A;  2X9W A;  4P09 A;  3CPZ A;  3AE1 A;  2F4V T;  2MYS A;  3KDS E;  2M6B A;  2M6I A;  2YN6 A;  4O4L E;  2HN2 A;  3AVS A;  3I0O A;  3NRY A;  1OED B;  1LRZ A;  2J62 A;  1MMN A;  3ZYM A;  3RQW A;  1J5E T;  4LF7 T;  2NTY A;  3LBX B;  4UEL A;  2X51 A;  5IHY A;  2KND A;  2BDE A;  2IUB A;  3U78 A;  1W0B A;  4HFI A;  2V8S V;  3C50 A;  2WZH A;  3D0T A;  4G2A A;  3P4W A;  2VQF T;  4X1I E;  2VKJ A;  5DQW A;  3BQI A;  3FZF B;  2HHH T;  3PJA A;  3PUS A;  4Z91 A;  4ZOL E;  4HEA A;  4BAY B;  2ACX A;  3FBZ A;  3AE5 A;  4AKH A;  1HNW T;  2RPA A;  4B6X A;  3LBX A;  4MAL A;  2XQA A;  3W15 B;  2X9Y A;  1S94 A;  1XMO T;  4EZH A;  4DR7 T;  3RYF E;  3JAF A;  3RIU C;  2YK0 A;  4WW0 A;  1KNZ A;  1IJ6 A;  1KNR A;  3QB5 A;  3LFM A;  4IE5 A;  2C0S A;  3SRZ A;  4P1N A;  1US7 B;  5C2T A;  5KXJ A;  3Q5X A;  1Y64 B;  4B3R T;  4DR4 T;  5LYJ E;  1SA0 E;  2IC9 A;  4LFB T;  2W2U A;  1BR4 A;  2LHR A;  4ZXL A;  3PUX F;  4OFZ A;  3ZMZ B;  4O2A E;  3AED A;  3CKD A;  3UU4 A;  2NW7 A;  3GMI A;  3N2K E;  2BG9 C;  3BQK A;  3HL6 A;  2WM9 A;  4UEM A;  1L0V A;  3G06 A;  3ABV A;  2YU1 A;  2UUC T;  4COF A;  5J2U E;  4ISS A;  4EED A;  3VR9 A;  1XWM A;  1CHU A;  3P4S A;  3IA3 A;  2PG8 A;  3KV5 A;  2LT3 A;  3RQU A;  1X79 A;  4PJM A;  5C3J A;  1O3X A;  2WDR A;  4DR2 T;  4AI6 A;  5L3B B;  1T7S A;  3ZMT B;  3UFE A;  5LBM A;  1IZN B;  2WCA A;  3AE8 A;  2BBJ A;  3O1J A;  4NIQ A;  3N9L A;  2W00 A;  2NR4 A;  4LF6 T;  2BG9 B;  2BKP A;  3AAI A;  3AEB A;  2KWI B;  3HKE E;  3RIU A;  4HTE A;  4UXN B;  3PUR A;  5HEO A;  1S35 A;  4YTP A;  4ZS3 A;  2E2A A;  3KBT A;  2VVN A;  2W61 A;  3AVR A;  1HG2 A;  2C5K T;  2M67 A;  3SWH A;  4QXC B;  2VAS A;  2SPC A;  4ZEY A;  5CGM A;  2E5L T;  3UU3 A;  5BMV E;  2X0L B;  5LGT B;  4HFE A;  4AQF A;  1XDP A;  3F57 A;  1ZV4 X;  2ZM8 A;  2VB6 A;  2XQ8 A;  3I9Y A;  2CEA A;  3HKB E;  3Q2M A;  2YIN A;  4PW8 A;  5L4E A;  3SFE A;  2V5D A;  4YFS A;  2NOX A;  4PAG A;  3L39 A;  1BR1 A;  2WU2 A;  1HS7 A;  1SHZ C;  3OPC A;  5FY0 A;  4BJM A;  1M7K A;  5L2L A;  1LVF A;  1W9R A;  2MBG A;  3CX7 B;  3TLW A;  2LOP A;  2JRK A;  1UUR A;  2CE7 A;  3FXD B;  2WB5 A;  4FI5 A;  2HN1 A;  2DL1 A;  4PFO A;  4IL4 A;  1KF6 A;  1JNZ A;  2WBL A;  5LA6 E;  2WQY A;  3K8P C;  3ZT7 A;  2EHO C;  4ADZ A;  5LBQ B;  4AKR B;  2VK9 A;  5JDH A;  4QH5 A;  4ILU A;  1HCI A;  3AA6 B;  3ZT6 A;  4HFD A;  1ZKE A;  4AQG A;  3B57 A;  4IDZ A;  4K0K T;  4CXY A;  4IRE A;  2HH7 A;  3NBX X;  5AQU B;  1WRD A;  3OKQ A;  1G73 A;  5DJQ C;  4AQY T;  3LK4 2;  2V6Y A;  5FXZ A;  1D1A A;  5LCY A;  1Z8U A;  3AA1 B;  5EK4 A;  4GK5 E;  4EYU A;  2YOE A;  3KVB A;  3ZYL A;  5C8Y E;  5L3G B;  4NXM T;  3RGL A;  3J9X 1;  5HWY A;  4YSY A;  4JI5 T;  2CHO A;  4YHH T;  2ES0 A;  3EDU A;  2XAF B;  5LG4 A;  1WCR A;  5H6Q B;  5JRC A;  5LHG B;  4PNI A;  3N2O A;  2Y6X A;  1UX4 A;  3L09 A;  5F5W A;  1KFY A;  1KEY A;  1OED E;  3OBV E;  1E7P A;  3RH3 A;  3MK7 C;  4DND A;  3M3Z B;  5FL1 A;  3MJX A;  5AQS B;  3U3I A;  1HF8 A;  4PK4 A;  2CMR A;  2D0U A;  1NWM X;  4AKG A;  2FUP A;  5EK3 A;  3N5L A;  4KP3 C;  2W66 A;  1SE7 A;  5HCM A;  4WBN E;  2EHO A;  3AE6 A;  3UUX B;  2YDQ A;  5ABH A;  5JH7 E;  2KSR A;  2X66 A;  4MLK A;  3ESL A;  4YTN A;  4DV1 T;  5HYA A;  3T1H T;  3Q5D A;  2LLY A;  4JI7 T;  4EB6 E;  2IDO B;  2LM9 A;  4X65 T;  3RKG A;  4KX6 A;  3UU6 A;  2W63 A;  3Q5W A;  1WYB A;  2L9Q A;  3RX6 A;  3PU3 A;  3B13 A;  2D5U A;  2PJQ A;  4DV4 T;  4X20 E;  2XY8 B;  3UUN A;  3RYI E;  2Q9Q D;  2DI4 A;  3TLT A;  2UU9 T;  3ZLI A;  3EDV A;  3FZH B;  4IT4 A;  4OX9 T;  4DR6 T;  2CPT A;  2D0T A;  3QNU A;  2JPF A;  2CWO A;  3EI0 A;  2KLQ A;  3AAE B;  2XZE A;  2W4X A;  2XAJ B;  2KXP B;  2LHN A;  3N2G E;  2CM0 A;  1QSD A;  4LMJ A;  4MHC A;  4ASK A;  5AQR B;  1YXR A;  2BKO A;  2WS3 A;  3VR8 A;  3DTO A;  5FVL A;  4FJO A;  2XAH B;  1NEK A;  2WWV A;  5LNK A;  2OV9 A;  3DP7 A;  5ABE A;  3HR0 A;  2VL0 A;  4EGW A;  3ZMU B;  3AEC A;  2YKS A;  2JQQ A;  3RLF F;  2QGS A;  1M62 A;  4M1P A;  5L4H A;  2NP9 A;  2QYW A;  3J7Y q;  2BG9 E;  3NWI A;  4ZHQ E;  3H37 A;  2UXN B;  2XQ7 A;  4L5G A;  4DV5 T;  2DWG A;  2VL8 A;  4IE7 A;  4QWN B;  4IE0 A;  3RC3 A;  2ZM6 T;  4IIJ E;  4PJJ A;  5LOV E;  4WBO A;  3AA7 B;  4TNV A;  3FHN A;  3PJA J;  3WI3 A;  2VKH A;  5FP3 A;  4JI8 T;  4XAX B;  2V1D B;  4HKA A;  3KV6 A;  4IDP A;  3PUG A;  1N32 T;  4O4I E;  2UXD T;  3UUL A;  4C91 A;  4QX8 B;  2QRX A;  4DV7 T;  1MMG A;  4YJ2 E;  2CRB A;  2C5I T;  1J1J A;  3RYC E;  2E5V A;  3C4Z A;  3AEA A;  3P4R A;  2IIU A;  1OXZ A;  5JDG A;  2DWK A;  2IML A;  4IDQ A;  2PBI A;  3PV0 F;  3VU7 H;  1YQ4 A;  2XM1 A;  1YKE B;  3HKC E;  1HNX T;  4H63 H;  4CQI A;  2LE8 A;  2IW5 B;  2XM2 A;  4HE8 A;  4EYY R;  3WAJ A;  4I43 B;  3HA4 A;  4JYA T;  5J1G A;  5KMG P;  3ZSS A;  4X1K E;  3TLU A;  2OLT A;  3T8O A;  2I0M A;  4LMK A;  4AQF C;  4O4J E;  2FJE A;  4HWH A;  4GYR A;  3UUB A;  4B3M T;  3H3A A;  2ZLY A;  4EIW A;  4CI1 B;  2H88 A;  4EZ4 A;  4GK0 E;  4DV3 T;  1EZ3 A;  3PTR B;  3GWH A;  1I6Z A;  5HEJ A;  1VOM A;  4QH1 A;  1HG5 A;  2QA7 A;  1YD8 G;  2L3L A;  3ZCI A;  5IWA T;  3CML A;  4X62 T;  1QLB A;  3ZMS B;  4A56 A;  3RHW A;  2B76 A;  2WDQ A;  3O4X E;  4IE6 A;  3E0Z A;  3PUZ F;  5CA0 E;  2XQ4 A;  4WNK A;  4BJN A;  1E1H B;  4HFB A;  1HX8 A;  4H9R C;  4CI2 B;  2ZM0 A;  5AQM B;  2JQK A;  2KWH A;  3RYH E;  5FY1 A;  2CA5 A;  3PU8 A;  1XDO A;  5LXT E;  4YSZ A;  5HEH A;  2WP9 A;  4HWF A;  3RIA A;  2LKG A;  3A5X A;  2KZ7 B;  3AE3 A;  4LML A;  1XMQ T;  2BKN A;  4N78 D;  2OA5 A;  2NTX A;  5AQJ B;  4XBF B;  4JEU B;  2NW8 A;  3AB3 B;  4X1Y E;  2MOZ A;  3ONX A;  4ZI2 C;  5KDM C;  2VUR A;  2UUA T;  4JBW F;  2X68 A;  3ZMV B;  4DR5 T;  1UGO A;  3OTO T;  3RRW A;  3T1Y T;  2H7O A;  3AE7 A;  1UUS A;  3PUY F;  4TWH A;  3ONL C;  3QC9 A;  2ZMA A;  1R8I A;  3ZN1 B;  2JQH A;  5JRE A;  1XNQ T;  4Z8X A;  4A98 A;  3RC8 A;  2ODU A;  3CIR A;  4JI1 T;  4UVC B;  2PFV A;  3RIF A;  5FY7 A;  3PDY A;  4KUM B;  2WU5 A;  4HN9 A;  3ZKR A;  3LDQ B;  1NAF A;  3UTK A;  4EV6 A;  4JUY A;  4DMW A;  1OWA A;  2H7V C;  1ZHC A;  2LKH A;  4JI6 T;  3CK6 A;  2V6Y B;  1D1C A;  2KMF A;  2V7M A;  2WZI A;  3JCF A;  2LSY A;  1NEN A;  4H9P C;  3DJB A;  2A2F X;  1D1B A;  2K9A A;  4H63 V;  5ADX L;  5AQV B;  2FJB A;  2CXF A;  3AEE A;  5H6R B;  1GQE A;  5JRC B;  1BR0 A;  4U33 A;  4GYS A;  1YQ3 A;  2UXB T;  4PFP A;  4AIS A;  1MMD A;  1G8X A;  2LSI A;  3QB5 K;  4YJ3 E;  3ZC1 A;  2CBJ A;  1LVK A;  5JDL A;  3IHR A;  2XAG B;  2XQ5 A;  1W0A A;  3ANW A;  4XZC A;  2CCQ A;  2CXD A;  4YHJ A;  2CXL A;  2XHE B;  2XQ3 A;  3GA8 A;  1UCU A;  2JMK A;  2EHO B;  3CWZ B;  3I9W A;  3OVU A;  2BS3 A;  1YKH B;  4KMC A;  4DV0 T;  4IST A;  2NWB A;  2WSS V;  2X0H A;  1B7T A;  5IUX A;  4DO0 A;  4ZI3 C;  2ODV A;  4DR1 T;  4CXX A;  2BZB A;  2WY2 A;  3ETV A;  4J2C A; 
#chains in the Genus database with same CATH homology
 4IE5 A;  2C0S A;  4H9O C;  3OJA A;  3SRZ A;  3F31 A;  4EXT A;  3EUH A;  1CUN A;  1US7 B;  2XAH B;  2G0U A;  3NRX A;  5LNK A;  2V7J A;  2K48 A;  3DP7 A;  1V9D A;  3Q5X A;  3RPU A;  1U4Q A;  1Y64 B;  1WR6 A;  3OYX A;  4QXB B;  5LYJ E;  4L9I A;  2N9D A;  4C90 A;  3HR0 A;  1ZEE A;  1D0Z A;  1SA0 E;  2IC9 A;  4ZI2 D;  3FBL A;  2V7L A;  3V5S A;  2V26 A;  4OHF A;  4UV8 B;  3ZMU B;  4H9S E;  1BR4 A;  4DVD A;  5L3D B;  2JQQ A;  2LHR A;  2QGS A;  4OFZ A;  3ZMZ B;  2VKD A;  4O2A E;  3CKD A;  3ANW B;  2BVM A;  4BA9 A;  4TN7 B;  4ERR A;  4M1P A;  5DQV A;  5JDQ A;  2NW7 A;  3GMI A;  2CLY B;  3LG7 A;  2WMO A;  3N2K E;  3BQK A;  2K5B B;  3KIN B;  5AFU L;  3HL6 A;  3WAK A;  2NP9 A;  2WM9 A;  3J7Y q;  2Y48 B;  2WWU A;  3N9Q A;  4UEM A;  2Q9Q C;  3BK9 A;  1FIO A;  2JMH A;  3CX6 B;  3ZC0 A;  2L8K A;  3ZN0 B;  3UUM A;  4ZHQ E;  2YU1 A;  3H37 A;  2UXN B;  4TV9 E;  3R6N A;  4ZI7 E;  4ISS A;  5J2U E;  5LHH B;  5J2T E;  4QX7 B;  4NUU A;  4F6R C;  4L5G A;  2DWG A;  1MIW A;  2E9X D;  3AA0 B;  2X67 A;  5ETW A;  2VL8 A;  1MMA A;  2PG8 A;  3KV5 A;  4IE7 A;  3HKD E;  4QWN B;  2LT3 A;  2NW9 A;  5LJM A;  1X79 A;  4IE0 A;  4PJM A;  3RC3 A;  4IIJ E;  4PJJ A;  5LOV E;  1O3X A;  2WAU A;  4WBO A;  4AI6 A;  3AA7 B;  5L3B B;  3ZMT B;  3UFE A;  3PUA A;  5LBM A;  1IZN B;  3FHN A;  3WI3 A;  2VKH A;  3O1J A;  3QUJ A;  5FP3 A;  1U5P A;  2LJL A;  3N9L A;  4XAX B;  2W00 A;  4PK6 A;  2V1D B;  4HKA A;  5LJN A;  3Q9D A;  3KV6 A;  3AAI A;  3PUG A;  4CXW A;  2P9B A;  3N9P A;  2DNX A;  4O4I E;  5LGN B;  1IAP A;  2KWI B;  3UUL A;  3HKE E;  4C91 A;  2UXX B;  4HTE A;  4QX8 B;  5FMN A;  4UXN B;  3PUR A;  2Q9Q B;  1D0X A;  1S35 A;  1MMG A;  4PJL A;  4IE4 A;  2W0G A;  4ZS3 A;  4YJ2 E;  3CVR A;  5F8P A;  3KBT A;  2C5I T;  3ZJ2 A;  3RYC E;  2K24 A;  3C4Z A;  2W61 A;  3AVR A;  1HG2 A;  2C5K T;  2XUE A;  4DMV A;  2M67 A;  2EHO D;  1HFA A;  1OXZ A;  2A3D A;  2X9X A;  3RKO A;  3SWH A;  4QXC B;  3ZJ1 A;  5JDG A;  1FMV A;  4P0A A;  2DWK A;  3KV9 A;  2PBI A;  2VAS A;  2DLR A;  3BQL A;  3LJC A;  5HXC A;  1WYC A;  2SPC A;  3VU7 H;  5HXR A;  3K3O A;  1YKE B;  1FMW A;  3HKC E;  4CI3 B;  2HPJ A;  4PJN A;  5BMV E;  4H63 H;  4CQI A;  2X0L B;  4V1A v;  5LGT B;  2LE8 A;  2IW5 B;  4HE8 A;  5L3E B;  4EYY R;  4AQF A;  2LSG A;  2XTL A;  3WAJ A;  4I43 B;  5JR9 C;  3F57 A;  3K3N A;  1ZV4 X;  4ZS2 A;  5HXS A;  2ZM8 A;  3HA4 A;  2VB6 A;  2IAK A;  4K0U A;  4YLH A;  5KX5 E;  3C4X A;  5J1G A;  3NZP A;  3ZCJ A;  2VKO A;  3I9Y A;  5FNV E;  3S4U A;  2CEA A;  1UX5 A;  4NUV A;  5KMG P;  3HKB E;  3Q2M A;  4UF0 A;  4X1K E;  3CX8 B;  2MTQ A;  4JLE A;  2E8I A;  3GN5 B;  3T8O A;  2YIN A;  4PW8 A;  3P8C D;  1WLX A;  3F2E A;  4H9N C;  4YFS A;  3I0Q A;  4AQF C;  2NOX A;  2Q9Q A;  2DCF A;  4O4J E;  4PAG A;  4QHO A;  4GYR A;  5HWX A;  2LEH A;  3H3A A;  2ZLY A;  1BR2 A;  2C5J A;  4EIW A;  1BR1 A;  1HS7 A;  4E7S A;  1MNE A;  3IBP A;  1MIV A;  4CI1 B;  1SHZ C;  3JC6 D;  3KV4 A;  3UT5 E;  4EZ4 A;  2CWY A;  1T98 A;  3AAA B;  4AKI A;  5FY0 A;  4BJM A;  2YEV C;  4GK0 E;  4L0R A;  4OYK A;  1EZ3 A;  5L3C B;  5F3J A;  3MZK B;  4JEH B;  3PTR B;  3GWH A;  5JR9 B;  5L2L A;  1LVF A;  2MBG A;  4EOZ B;  4ANJ A;  3CX7 B;  4I55 E;  1Z0P A;  2LOP A;  1VOM A;  1HG5 A;  2JRK A;  2QA7 A;  1YD8 G;  2L3L A;  3ZCI A;  5IYZ E;  2CE7 A;  3O9X A;  3VHL A;  3CML A;  3FXD B;  4UVA B;  4FI5 A;  5CB4 E;  2GK9 A;  4OK0 A;  4P0B A;  4PFO A;  5E0O A;  3ZMS B;  5LHI B;  1YW0 A;  2Y8D A;  4A56 A;  1D0Y A;  4H9Q C;  3O4X E;  2JJ9 A;  4IE6 A;  2WBL A;  3E0Z A;  5EZY E;  5FYM A;  5CA0 E;  4WNK A;  4BJN A;  5LA6 E;  1KK7 A;  4TZ4 C;  3SOL A;  2N2N A;  1E1H B;  3CQC B;  4TV8 E;  1HX8 A;  5M4Y A;  3K8P C;  4H9R C;  4E7Z A;  5JDM A;  4CI2 B;  5TAO A;  3GN5 A;  4AXP A;  3QK6 A;  2ZM0 A;  4DBR A;  2EHO C;  2KT9 A;  2XAQ B;  3MXZ A;  4ADZ A;  4U74 A;  5LBQ B;  4GIW A;  2KWH A;  3RYH E;  2VK9 A;  3ZYK A;  4AKR B;  5HXE A;  5LP6 E;  3VKH A;  5JDH A;  2ZM2 A;  2I59 A;  5FY1 A;  2CA5 A;  3PU8 A;  4ILU A;  4UF0 B;  4KBM B;  2DHR A;  1QUU A;  2J1D G;  3C98 B;  5LXT E;  3LK3 B;  1HCI A;  3AA6 B;  3FB2 A;  3MA9 A;  2RP4 A;  1ZKE A;  4AQG A;  3B57 A;  2D2S A;  4IDZ A;  4O2B E;  4CXY A;  4OYJ A;  2LSJ A;  5JDN A;  1VRB A;  3A5X A;  2WMN A;  2HH7 A;  2KZ7 B;  3NBX X;  2KIN B;  3N9N A;  4G63 A;  1WRD A;  4N78 D;  3HI2 A;  3RRC A;  2X9H A;  3OKQ A;  1H7C A;  1G73 A;  3CQX C;  5DJQ C;  2OA5 A;  1MIY A;  5JR9 A;  2NTX A;  3LK4 2;  1AJ3 A;  4XBF B;  5FXZ A;  4JEU B;  1D1A A;  5L3F B;  4UIG A;  5LCY A;  3PE0 A;  2NW8 A;  5HXH A;  1FEW A;  3AB3 B;  3AA1 B;  4MFR A;  2RA1 A;  4X1Y E;  2MOZ A;  5EK4 A;  4O8S A;  4GK5 E;  3V5U A;  4EYU A;  3ONX A;  4ZI2 C;  5KDM C;  3E08 A;  3N9M A;  3K3Q C;  3KVB A;  4UVB B;  3ZYL A;  3ZMV B;  2X68 A;  5C8Y E;  5L3G B;  3KFW X;  3O1H A;  3N9O A;  3L3P A;  3J9X 1;  3RRW A;  3ZEF B;  4GOU A;  5HWY A;  2H7O A;  5FXV A;  1HTJ F;  3ZPO A;  2ES0 A;  3EDU A;  3EVY A;  2XAF B;  2Z6E A;  5LG4 A;  2YU2 A;  5H6Q B;  2IC6 A;  4UV9 B;  3C4W A;  2ZMA A;  3QC9 A;  3ZN1 B;  5EK2 A;  5JRC A;  5A1L A;  3SS1 A;  3ETU A;  1IJ5 A;  5LHG B;  2B1E A;  2VWA A;  4PNI A;  5JRE A;  3N2O A;  2A72 A;  4Z8X A;  2Y6X A;  4MBQ A;  1UX4 A;  3L09 A;  3RC8 A;  4HGA A;  1LKX A;  4IHJ E;  4QXH B;  2ODU A;  2LSK A;  3OBV E;  4UVC B;  2PFV A;  3NZQ A;  3RH3 A;  3MK7 C;  2N1G A;  5FY7 A;  2E9X C;  3PDY A;  2W62 A;  4O4H E;  4KUM B;  4DND A;  5DAB A;  3FXE B;  2BVL A;  3MJX A;  4HN9 A;  3U3I A;  4EAH A;  1HF8 A;  4PK4 A;  2CMR A;  2D0U A;  4I4T E;  1NAF A;  5FXX A;  3UTK A;  1NWM X;  4JUY A;  4DMW A;  4AKG A;  1OWA A;  5EK3 A;  2H7V C;  4HFV A;  1ZHC A;  4ZI3 D;  3N5L A;  4KP3 C;  5GON E;  5HAX A;  2X9W A;  4P09 A;  3CPZ A;  3VKG A;  3PUQ A;  5FXW A;  2MYS A;  1D1C A;  2EHO A;  2KMF A;  2XQY A;  3KDS E;  2V7M A;  3UUX B;  4WBN E;  5CA1 E;  4I50 E;  5JH7 E;  2X66 A;  2LSY A;  4MLK A;  3ESL A;  3KBU A;  3C64 A;  4H9P C;  4CZZ B;  4O4L E;  3O1I A;  5HYA A;  3AVS A;  2A2F X;  3DJB A;  3I0O A;  3NRY A;  1LRZ A;  1D1B A;  4EB6 E;  2K9A A;  4IGU A;  1MMN A;  3ZYM A;  4U72 A;  4H63 V;  2LM9 A;  5ADX L;  2NTY A;  3LBX B;  2E9X B;  2CXF A;  4TUY E;  4UEL A;  2X51 A;  5IHY A;  2V7I A;  5H6R B;  4AKL A;  5JRC B;  3MAC A;  2H3R A;  2KND A;  2W63 A;  1BR0 A;  4GYS A;  3Q5W A;  2BDE A;  3KVA A;  1WYB A;  4PFP A;  3U78 A;  2L9Q A;  3RX6 A;  3PU3 A;  5LGU B;  1MMD A;  1G8X A;  3R84 B;  2LSI A;  3P7I A;  3C50 A;  3B13 A;  2D5U A;  2PJQ A;  5JDF A;  3D0T A;  4YJ3 E;  4G2A A;  4X20 E;  3ZC1 A;  2HPL A;  1LVK A;  3MKD A;  3UUN A;  5JDL A;  3CQG B;  3IHR A;  3E22 E;  3RYI E;  2Q9Q D;  2XAG B;  2XAS B;  3I1A A;  2DI4 A;  3ZLI A;  4X1I E;  2VKJ A;  5DQW A;  3BQI A;  3OYZ A;  3ANW A;  4XZC A;  3IEE A;  4PK5 A;  3EDV A;  2CCQ A;  3M65 A;  5JQG E;  2CXD A;  3PUS A;  4YHJ A;  2CXL A;  4ZOL E;  2XHE B;  4HEA A;  4BAY B;  2D0T A;  3GA8 A;  2JPF A;  2ACX A;  3IF8 B;  2CWO A;  3C51 A;  3FBZ A;  1UCU A;  2JMK A;  2EHO B;  3CWZ B;  3I9W A;  2LOS A;  4AKH A;  3TKL B;  2KLQ A;  4B6X A;  3LBX A;  3AAE B;  4MAL A;  3W15 B;  1YKH B;  2XAJ B;  4KMC A;  4IST A;  2X9Y A;  2E9X A;  2NWB A;  2WSS V;  1MND A;  1S94 A;  2KXP B;  4TX5 A;  4EZH A;  2LHN A;  2V7K A;  3LK2 B;  1B7T A;  3JC6 C;  3N2G E;  2CM0 A;  1QSD A;  3RYF E;  4DO0 A;  4QKN A;  4ZI3 C;  5JVD E;  2YK0 A;  4MHC A;  4ASK A;  4WW0 A;  2ODV A;  1KNZ A;  1IJ6 A;  2CLY C;  4CXX A;  2BZB A;  4DBQ A;  3ETV A;  3DTO A;  4FJO A;  4J2C A;  3LFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...