4F6RC

Tubulin:stathmin-like domain complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
64
Chain Sequence
NKATSGQSWEVILKPPSFPSLEEIQKKLEAAEERRKAHFAAMLERLQEKDKHAEEVRKNKELKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 20
structure length 64
sequence length 79
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.580 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4f6rC01
3N2KE 3N2GE 5JVDE 4O4JE 5LYJE 4ZOLE 5CA1E 3RYHE 5J2UE 4O4IE 5EZYE 5LOVE 4X1IE 5CA0E 5J2TE 4TV8E 1SA0E 4F6RC 5C8YE 5BMVE 5GONE 4IHJE 4YJ2E 4O2AE 3HKEE 4TV9E 4I55E 4I50E 3E22E 4I4TE 4X20E 5LA6E 4O2BE 5LXTE 3HKDE 3RYCE 4YJ3E 3HKCE 3RYIE 5JQGE 4O4LE 4X1KE 3HKBE 4X1YE 5IYZE 3RYFE 4WBNE 4ZI7E 4EB6E 4ZHQE 4IIJE 5JH7E 4TUYE 5KX5E 3UT5E 5CB4E 5LP6E 5FNVE 4O4HE
chains in the Genus database with same CATH superfamily
1JNZA 1IAPA 2HH7A 2W67A 1HX8A 3KVBA 2JIWA 3O4XE 4P1NA 4P0AA 1J5WA 1IBLT 1T72A 3CQCB 2J47A 4MLKA 4EEBA 4JYAT 4EYYR 3ESLA 1L0VA 2WB5A 2B1EA 4HFBA 5AQJB 1NAFA 2CCQA 1YKEB 1D0ZA 1HTJF 2BG9B 2ZM2A 4DV5T 1ZEEA 1MMDA 3LG7A 1OXZA 4EYUA 2QA7A 4XBFB 2JMHA 3AE9A 2IHR1 3LK42 5LXTE 1NWMX 2AE9A 2WZHA 3AE2A 3BQIA 5DQWA 2Q9QC 5L3DB 3TLTA 4UV9B 1QUUA 3GN5A 1W0AA 4KHPT 2E2AA 1OEDC 2K9AA 2OLTA 5HYAA 2RPAA 1NEKA 5JDHA 3O9XA 3UUBA 1FMWA 4ZI2C 4ISTA 2VKOA 4OX9T 3V5UA 4PFOA 2HPJA 4LF9T 2PBIA 5LYJE 2WY2A 4JLEA 4LF4T 4HKAA 3OVUA 3UFEA 4AISA 2KNDA 5HEUA 4IDPA 3UUNA 3C64A 4L9IA 3U78A 5AFUL 2I6HA 4PJMA 3SS1A 3RPUA 3IA3A 5DJQC 3LBXA 4A56A 4AQFA 1I94T 5HWXA 2UXBT 2Y48B 3AE7A 3B5MA 2XSAA 2LRKA 4IL4A 3VKHA 2UXDT 5AQHB 3RRWA 4OK0A 2XQAA 3SWHA 2CBIA 2VQFT 4YT0A 5LG4A 2H7VC 2V7JA 5ABFA 3TKLB 2XTLA 2V6YA 2CWYA 3JAFA 3ZEFB 3I0QA 1WLXA 2AXDS 4OHFA 3CK6A 4FJOA 2ZM6T 4LMLA 1FJGT 3AE3A 3CMLA 3P4PA 2D5UA 2QYWA 3QK6A 4PK6A 2H7OA 3AAEB 2OA5A 3JADA 4QXHB 4WW0A 4HTEA 3LFMA 4YTMA 5LJNA 5AQNB 1HNZT 5A1LA 2MAWA 4WBOA 5AQMB 4UV8B 1KFYA 3O1JA 2FJEA 3PUGA 3F57A 4MBQA 3RX6A 4UEMA 4DNDA 4AI6A 5ABFB 4X5TA 4TN7B 4U2ZA 3SRZA 4HFVA 5BMVE 4U33A 3BK9A 2N2NA 3C98B 2P9BA 1HG5A 4M1PA 4TWDA 1MNEA 3I9WA 1Y64B 4TZ4C 5HEHA 3NRYA 2WDQA 3ZMSB 3QOFA 1HX1B 2L3LA 4UELA 5LG3A 3E0ZA 4YTPA 4LFBT 1OEDB 1Z0PA 3LJCA 2LHRA 3TLVA 3VR9A 3J9X1 5C3JA 4B3TT 2V5DA 5FYMA 4CN1A 1JNRA 2BVMA 2SPCA 3RGLA 4A97A 2BKPA 2V1DB 3N5LA 4LF8T 4ILAA 3TLWA 3UT5E 3AE4A 2MPKA 2QGSA 2M6BA 2QVAA 2NW7A 2XAJB 3AEAA 3RIUA 1UK5A 5FNVE 2ACZA 2KXPB 5AQFB 1YKHB 3V5SA 4EZHA 3UU5A 1MMGA 5LHIB 1WFDA 4TWHA 4V1Av 5LMNT 1XZYA 3I1AA 4XAXB 5AQKB 3C4ZA 4ZS2A 4Z91A 1O3XA 2CBJA 4AQGA 2A9UA 2LKGA 5C8YE 1N34T 2LSGA 2BG9A 4IDQA 4CZZB 4CXYA 1R8IA 1ZKEA 5L3CB 2E8IA 5KDMC 2E5VA 5L4HA 3PV0F 1MIVA 2PG8A 3HKBE 3RC3A 1Y01A 2IIUA 2WMOA 2RP4A 3P4WA 4BAYB 3AEFA 4GKKT 4QXCB 2C5KT 4O8SA 1UX5A 3KV5A 3AE8A 1KNRA 4Q25A 2OV9A 3EHZA 4AIUA 1MIYA 5FMNA 1HNXT 5AQGB 4UVCB 5F8PA 5LBQB 3NWIA 3N2GE 4MHCA 2LEHA 2ZM8A 3CQGB 5H6RB 1D1BA 5E0OA 3S4UA 2JQHA 3PU8A 5M4YA 1XNRT 5JDFA 1FMVA 2C5IT 4I43B 2LSJA 3SFDA 4IL9A 3AAAB 4NXMT 1XDPA 3VRAA 2D2SA 3L39A 2CRBA 1YQ3A 4OFZA 3AA7B 3KINB 3ZLIA 5KMGP 3VU7H 2HHHT 2CLYC 5HXRA 5LCYA 2XAHB 4JBWF 2EHOC 4U72A 1DU2A 2LM9A 3AA1B 3MK7C 2KWHA 2FUPA 2ES0A 4E7SA 2V7MA 2EHOA 1FEWA 3RYCE 3RLFF 2V5CA 2FBWA 3MA9A 5H6QB 3ZN0B 5FVKA 5LGNB 1XNQT 5FKYA 2A72A 4IREA 3J7Yq 4AKIA 3EAMA 4MALA 3RF1A 1T98A 2BKOA 3O1HA 1G73A 3Q5DA 1D1CA 4KI0F 3CKDA 4U7YA 3CPZA 4IE7A 4U7IA 2K48A 1N33T 4FI5A 4JI4T 4H9QC 5FY7A 4P09A 4H9RC 1LKXA 2BS2A 4C91A 3PUYF 2YDRA 3AB3B 1H7CA 1OEDE 2FJAA 3F31A 3I0OA 2L8KA 4G63A 4B3RT 3D0TA 3LK3B 1ZP0A 3K3QC 3ONXA 2E9XB 1SA0E 3OYXA 3FB2A 4GYRA 4QH1A 2E9XC 3AEDA 4TV8E 3UU6A 4ERRA 4YFSA 3OBVE 5FXWA 5ABGA 4EAHA 4YHHT 5AQOB 4YJ3E 2YEVC 2X9YA 4O4LE 1VCTA 5IYZE 3RIUC 1UURA 1QSDA 4CI1B 2BBJA 3CX6B 1D0YA 4GYSA 5LHGB 4TUYE 2KSRA 3P4SA 2V6XA 4DMVA 4P0BA 3AVRA 3UU8A 2V26A 4Z8XA 3Q5EA 4X64T 2X0HA 5AQQB 3ABVA 4OYJA 1HR0T 5LMUT 5LNKA 3FZHB 3K3NA 2M67A 4CI3B 2DCFA 5EZYE 3AAIA 1I6ZA 3AXJA 2DI4A 2LRLA 3RHWA 4HWHA 4DR7T 1VRBA 3AE6A 5LOVE 4ADZA 1YW0A 3MZKB 4J2CA 2M6IA 3IEEA 4B3MT 3LDQB 3P50A 3UUMA 2W61A 4KHZF 4JI7T 2H3RA 2DWKA 1NENA 3M3ZB 2LKHA 2W66A 2XHEB 3NBXX 4I50E 4QWNB 4X20E 4O2BE 2Q9QB 3R84B 1UGOA 2W63A 4A98A 3NZQA 2BDEA 3RYIE 3ZMVB 2LHNA 4X66T 2V7IA 5HAXA 1KNPA 2YDQA 1X9BA 2CEAA 2NR4A 4HFIA 3OPCA 4HE8A 4NUUA 5JDGA 4DR2T 4LFCT 1WYCA 4IDZA 2NW8A 1HF8A 1XMOT 3H37A 2LLYA 2IUBA 2UXXB 4DR3T 4LFAT 5JRCB 5CB4E 4O4HE 2W62A 2PFVA 3N2KE 4DV1T 2YK0A 2WDRA 3OJAA 2XUEA 4IT4A 3KV4A 4K0UA 4JI2T 3FZMB 4EIWA 4JI1T 2XASB 1KEYA 2X9WA 3QUJA 3U3IA 4YSXA 2VWAA 1E7PA 4I0UA 4YXDA 3X1DA 4B6XA 3PUXF 4PK5A 4JI3T 2CLYB 2CXFA 3AEEA 2J4GA 4H9PC 3GN5B 4QXBB 2I0MA 2I59A 3AE1A 3EUHA 1N36T 3PUAA 4WYVA 4LF6T 5HEOA 3AA0B 4DR6T 2BZBA 2R6GF 3F2EA 2JQ9A 5JTGA 5L4EA 3UQ7A 4TNWA 2VQET 2N9DA 2PJQA 2MOZA 2LOSA 3KFWX 4PFPA 4YLHA 3RKGA 3UTKA 5HWYA 2EHOD 2GK9A 2Z6EA 1UUSA 4GK5E 5HXCA 2WDVA 3JC6D 1S35A 5TAOA 4IIJE 4DIDB 2UUCT 3N9MA 3WAJA 2XJ7A 2DNXA 1W9RA 3ZPOA 3RQWA 4DV0T 3I9YA 4ILCA 2C5JA 4TX5A 2YDSA 2X9XA 3LBXB 3NZPA 3PUQA 1EZ3A 2XY8B 3GA8A 4HWIB 4N78D 2JQQA 2LE8A 1IJ6A 4BJNA 4JI8T 2K3WA 3N9QA 2F4VT 3SFEA 5AQRB 2WU2A 4UVBB 4KP3C 4KMCA 3AE5A 4ZI3D 2UXNB 2XAGB 3LSVA 2UUBT 3FZFB 1BR2A 2V6YB 4G2AA 3HA4A 1M7KA 3HKEE 5LA6E 5HXHA 1AJ3A 1US7B 4DV4T 4UR9A 2N1GA 1J5ET 3ETUA 5JQGE 4GKJT 1FIOA 5EK3A 1W09A 3T1YT 4UVAB 4X1YE 5L3FB 4MFRA 5FXZA 1U4QA 5AQSB 2CE7A 2V7LA 3A7MA 4LMKA 4PK4A 5AQIB 5KX5E 5J1GA 5LJMA 5CJ5A 2ZMAA 2KMFA 1U5PA 3C4XA 4HFHA 2CA5A 4U31A 2CXLA 3KDSE 4IE6A 5JDLA 4ZZCA 3B13A 3DTOA 3QNUA 1SHZC 2DLRA 1YD8G 3CWZB 2ZM0A 4QH4A 3P4QA 2E9XD 2H89A 3MACA 1GQEA 2YOEA 1YXRA 2KZ7B 3MKDA 2DWGA 4WNKA 4WZXA 4AKRB 5HXEA 3PJAJ 2MTQA 2VKHA 3M65A 3CX7B 3LK2B 3SOLA 5J2TE 2E5LT 5IHYA 2V8SV 2X0LB 4C90A 4KBMB 5AQTB 5L2LA 5AQVB 2W00A 4X62T 4DBRA 4JI6T 2BBHA 3E22E 2MYSA 2LSYA 2VASA 4ANJA 1OEDA 1HCIA 1SUMB 2XZEA 2A2FX 3CX8B 3PUSA 5FVLA 4ZI3C 3DJBA 3RRCA 5JREA 2VL8A 2WCAA 2Q9QA 2DHRA 2XM2A 3HR0A 3KVAA 2ZLYA 3ZCIA 4JI0T 1X79A 1ZOYA 3ZSTA 2CXDA 4YTNA 4Z90A 2LSIA 3DP7A 4F8HA 5FY1A 5EK2A 3NRXA 4PAGA 5AQLB 3RH3A 4B3ST 2WQYA 3PUWF 5HCMA 4KX6A 3RI5A 2WU5A 4XZCA 4PJLA 5LP6E 2C0SA 4L0RA 3EABA 3BQLA 2LM2A 4GOUA 4HFCA 1T8BA 3P4RA 3FXEB 2WWUA 2X0YA 2LOPA 4H9SE 2FJDA 4HFEA 4PJNA 4ASKA 2K24A 1D0XA 4ZZBA 4PNIA 5ETWA 5HCJA 1WR0A 2CM0A 4F6RC 4CQIA 2VKDA 2BG9C 2QRXA 3CQXC 4HFDA 5GONE 3G06A 4IHJE 3PUVF 5JDMA 2YKSA 3ZMZB 2HN2A 3EI0A 5HXSA 2RA1A 5IWAT 3NVOA 4IE5A 2Y8DA 3JCFA 3H3MA 3ZCJA 1IZNB 5BR8T 4YSZA 4IGUA 2X51A 2CHOA 1S94A 4L5GA 3VR8A 4DV7T 4UXNB 2UUAT 5FP3A 3K1SA 4QKNA 4JUYA 2WM9A 3ZYKA 3UUXB 3EVYA 2WAUA 3TLUA 5ABEA 3ZC0A 3BQKA 3ETVA 2CPTA 4ILUA 4EGWA 4DUZT 1UCUA 2IC9A 2W2UA 3AECA 4IDOA 5JVDE 5FXVA 3UFGA 4YSYA 4O4JE 4AQFC 1MMAA 3C4WA 4DO0A 3ZN1B 3FXDB 1M62A 2NOXA 2VURA 4DV3T 4UF0A 4ZEYA 4NXNT 2XM1A 3FZKB 3ZT6A 3AVSA 3Q2MA 1HS7A 1KK7A 3RKOA 5KXJA 2JQKA 3KV9A 3O1IA 3ZJ2A 1VOMA 5LB7B 2IMLA 2EHOB 2VB6A 4ZS3A 5ADXL 3EDVA 3MXZA 3UU4A 1HFAA 2CMRA 2ODUA 4IE4A 4QX7B 4LMJA 3HKCE 1XDOA 2V7KA 4H9OC 5JDNA 4DR5T 4DUYT 5F5WA 4DVDA 4ZHQE 4CN4A 3L3PA 2NTYA 3ZSSA 3T8OA 4DMWA 2JJ9A 4AQYT 1J1JA 4UF0B 2ODVA 4CI2B 3OTOT 3IBPA 2H88A 4U2YA 2VKJA 3AA6B 2LJLA 2YINA 3B57A 4QH5A 5DABA 2BS4A 5FXXA 3ZKRA 3RYHE 2D9DA 5CA1E 2X9HA 4X65T 3N2OA 4ZI2D 2B76A 2YU1A 5CFBA 3WAKA 4HN9A 2NW9A 2UU9T 1YQ4A 1IBMT 1WR6A 5CA0E 3QB5A 2WMNA 2XAFB 2KT9A 3P8CD 3KV6A 2HPLA 5JRCA 3Q5WA 4O2AE 5JDQA 1OWAA 4I55E 5HEJA 4JV5T 3GWHA 4JI5T 3GMIA 3ZT5A 5DQVA 4IDNA 2UXCT 4U74A 4X1KE 3KBUA 2MBGA 4QHOA 5JR9A 3ZYLA 2WWVA 2XQ6A 3RIFA 3UU3A 2J62A 4JEHB 3L09A 4EB6E 4ZI7E 1Z8UA 2IC6A 1WRDA 2J1DG 2XAQB 1VCSA 2XQ8A 2XQ7A 2XQ3A 3A5XA 5FY0A 1E2AA 2G0UA 1MMNA 4AKHA 5LGUB 2Y6XA 1XWMA 3RQUA 5CGMA 2NWBA 4NUVA 2X68A 5EK4A 3R6NA 5AQUB 2XPKA 2W0GA 3H3AA 5J2UE 2BG9E 3ANWA 4NIQA 5L3GB 3K3OA 4HWDA 3RC8A 2XSBA 1LVFA 3C51A 1BR0A 4H9NC 3PU3A 1G8XA 4EXTA 1MNDA 4CN6A 5L3EB 2A3DA 1D1AA 4NPPA 4H63V 4AXPA 5JR9B 2CWOA 3ZYMA 4TV9E 5C2TA 3HL6A 3N9OA 4DV6T 1W0BA 3N9LA 5J0ZA 4DR4T 4CXWA 4EEDA 2YU2A 5FL0A 2DL1A 3MJXA 3OYZA 3RYFE 4WBNE 1BR1A 3FBLA 2JMKA 3ANWB 4OYKA 3T1HT 1LRZA 3W15B 1ZV4X 1IJ5A 3PDYA 4EV6A 2Q9QD 4AKGA 1WYBA 3NKZA 1V9DA 4DR1T 4YY3T 1LVKA 3CVRA 2D0UA 3N9PA 4UIGA 4H63H 4E7ZA 2WBLA 2IDOB 3C50A 4ZOLE 2L9QA 3Q5XA 2D0TA 1QLBA 4GK0E 5LBMA 4KUMB 3A8YC 3AEBA 3ZC1A 4ILBA 5ABHA 3ONJA 4X1IE 2ACXA 2PTFA 4HGAA 3EDUA 4BA9A 2BVLA 3N9NA 5JR9C 1B7TA 3VRBA 2E9XA 4HEAA 4I4TE 3IHRA 5AQPB 3ZMUB 2VL0A 4A5XA 2JRKA 1HG2A 3HKDE 3P7IA 5F3JA 4DV2T 2JPFA 2X67A 3JAEA 3WI3A 4TWFA 3ZT7A 1IBKT 1UX4A 2K5BB 3AEGA 4EZ4A 1CHUA 4CXXA 2BKNA 3HI2A 3PUZF 3UULA 2LSKA 1T7SA 5HEGA 3FHNA 5FL1A 4IE0A 2KWIB 4JEUB 3OKQA 4YHJA 4ZXLA 1SE7A 2XQYA 3PURA 1XMQT 1N32T 1MIWA 2WP9A 3Q9DA 3L8RA 2XQ9A 2HN1A 2X66A 4EOZB 3KBTA 2YN6A 5L47A 3FZLB 2LT3A 4O4IE 4HWCA 2WSSV 2BS3A 2NTXA 3E08A 2NP9A 4GIWA 1ZHCA 4PJJA 3IF8B 4QX8B 4BJMA 4COFA 2WS3A 2VVNA 5LGTB 1WCRA 2W4XA 3PTRB 2WZIA 2VVSA 2CHNA 3ZJ1A 1E1HB 2FJBA 4TNVA 4AKLA 4U3CA 3ZMTB 3JC6C 3CIRA 3UQ4A 4YJ2E 4ISSA 2KINB 4HWFA 3AXJB 4K0KT 3VHLA 1CUNA 2IW5B 2KLQA 3PJAA 3TLSA 4DBQA 5LHHB 1KF6A 3K8PC 3VKGA 3RIAA 5IUXA 2VK9A 4LF7T 1KNZA 2XQ5A 3QB5K 3FBZA 2XQ4A 5JH7E 1BR4A 4PW8A 5L3BB 4LF5T 3PE0A 1HNWT 3ONLC 3QC9A 2IAKA
chains in the Genus database with same CATH topology
1IAPA 2HH7A 1HX8A 3KVBA 3O4XE 4P0AA 3CQCB 4MLKA 4EYYR 3ESLA 2B1EA 1NAFA 2CCQA 1YKEB 1D0ZA 1HTJF 2ZM2A 1ZEEA 1MMDA 3LG7A 1OXZA 4EYUA 2QA7A 4XBFB 2JMHA 3LK42 5LXTE 4CXYA 1NWMX 3BQIA 5DQWA 5L3DB 2Q9QC 4UV9B 1QUUA 3GN5A 2K9AA 5HYAA 3O9XA 5JDHA 1FMWA 4ZI2C 4ISTA 2VKOA 3V5UA 4PFOA 2HPJA 2PBIA 5LYJE 4JLEA 4HKAA 3UFEA 2KNDA 3UUNA 3C64A 4L9IA 3U78A 5AFUL 4PJMA 3SS1A 3RPUA 5DJQC 3LBXA 4A56A 4AQFA 5HWXA 2Y48B 3VKHA 3RRWA 4OK0A 3SWHA 5LG4A 2H7VC 2V7JA 3TKLB 2XTLA 2CWYA 3ZEFB 3I0QA 1WLXA 4OHFA 4FJOA 3CMLA 2D5UA 3QK6A 4PK6A 4QXHB 2H7OA 3AAEB 2OA5A 4WW0A 5LJNA 4HTEA 3LFMA 5A1LA 4WBOA 4UV8B 3O1JA 4MBQA 4DNDA 3PUGA 3F57A 3RX6A 4UEMA 4AI6A 4TN7B 5BMVE 3SRZA 4HFVA 3BK9A 2N2NA 3C98B 2P9BA 1HG5A 4M1PA 4TZ4C 1MNEA 3I9WA 1Y64B 3RRCA 3ZMSB 3NRYA 2L3LA 4UELA 3E0ZA 1Z0PA 3LJCA 2LHRA 3J9X1 5FYMA 2BVMA 2SPCA 2V1DB 3N5LA 3UT5E 2QGSA 2NW7A 2XAJB 2KXPB 1YKHB 3V5SA 4EZHA 1MMGA 5LHIB 4V1Av 3I1AA 4XAXB 3C4ZA 4ZS2A 1O3XA 5C8YE 2LSGA 4CZZB 1ZKEA 5L3CB 2E8IA 5KDMC 3RC3A 1MIVA 2PG8A 3HKBE 2WMOA 2RP4A 4BAYB 4QXCB 2C5KT 4O8SA 1UX5A 3KV5A 1MIYA 5FMNA 4UVCB 5F8PA 5LBQB 3N2GE 4MHCA 2LEHA 2ZM8A 3CQGB 5H6RB 1D1BA 5E0OA 3S4UA 5M4YA 3PU8A 5JDFA 1FMVA 2C5IT 4I43B 2LSJA 3AAAB 2D2SA 4OFZA 5KMGP 3AA7B 3KINB 3ZLIA 3VU7H 2CLYC 5HXRA 5LCYA 2XAHB 2EHOC 4U72A 2LM9A 3AA1B 3MK7C 2KWHA 2ES0A 4E7SA 2V7MA 2EHOA 1FEWA 3RYCE 3MA9A 5H6QB 3ZN0B 5LGNB 2A72A 3J7Yq 4AKIA 4MALA 1T98A 3O1HA 1G73A 1D1CA 3CKDA 3CPZA 4IE7A 2K48A 4FI5A 4H9QC 5FY7A 4P09A 4H9RC 1LKXA 4C91A 3AB3B 1H7CA 4G63A 3F31A 3I0OA 2L8KA 3D0TA 3LK3B 3K3QC 3ONXA 3OYXA 2E9XB 1SA0E 4TV8E 3FB2A 4GYRA 4AXPA 2E9XC 4ERRA 4YFSA 3OBVE 5FXWA 4EAHA 4YJ3E 2YEVC 2X9YA 4O4LE 1QSDA 4CI1B 3CX6B 1D0YA 4GYSA 5LHGB 4TUYE 4DMVA 4P0BA 3AVRA 2V26A 4Z8XA 4OYJA 5LNKA 3K3NA 2M67A 4CI3B 2DCFA 5EZYE 3AAIA 2DI4A 5JRCA 1VRBA 5LOVE 4ADZA 1YW0A 3MZKB 4J2CA 3IEEA 3UUMA 2W61A 2H3RA 2IAKA 2DWKA 2XHEB 3NBXX 4I50E 4X20E 4QWNB 3R84B 4O2BE 2Q9QB 2W63A 3NZQA 2BDEA 3RYIE 3ZMVB 2LHNA 2V7IA 5HAXA 5IYZE 5JDGA 2CEAA 4HE8A 4NUUA 1WYCA 4IDZA 2NW8A 1HF8A 3H37A 2UXXB 5JRCB 5CB4E 4O4HE 2W62A 2PFVA 3N2KE 2YK0A 3OJAA 2XUEA 4K0UA 3KV4A 4EIWA 2XASB 2X9WA 3U3IA 3QUJA 2VWAA 4B6XA 4PK5A 2CLYB 2CXFA 4H9PC 4QXBB 3GN5B 2I59A 3EUHA 3PUAA 3AA0B 2BZBA 3F2EA 2N9DA 2PJQA 2MOZA 2LOSA 3KFWX 4PFPA 4YLHA 3UTKA 4AQGA 5HWYA 2EHOD 2GK9A 2Z6EA 4GK5E 5TAOA 5HXCA 3JC6D 1S35A 4IIJE 3N9MA 3WAJA 2DNXA 3ZPOA 3I9YA 4X1KE 2C5JA 4TX5A 3PUQA 2X9XA 3LBXB 3NZPA 5FNVE 1EZ3A 3GA8A 4N78D 2JQQA 2LE8A 1IJ6A 4BJNA 3N9QA 4UVBB 4KP3C 4KMCA 4ZI3D 2UXNB 2XAGB 1BR2A 4G2AA 3HA4A 3HKEE 5LA6E 5HXHA 1AJ3A 1US7B 2N1GA 3ETUA 5JQGE 1FIOA 5EK3A 4UVAB 4X1YE 5L3FB 4MFRA 5FXZA 1U4QA 2CE7A 2V7LA 4PK4A 5KX5E 5J1GA 5LJMA 2ZMAA 2KMFA 1U5PA 5JDLA 2CA5A 2CXLA 3KDSE 4IE6A 3B13A 3DTOA 1SHZC 2DLRA 1YD8G 3CWZB 2ZM0A 2E9XD 3MACA 3MKDA 4WNKA 2KZ7B 4AKRB 2DWGA 5HXEA 2MTQA 2VKHA 3M65A 3CX7B 3LK2B 3SOLA 5J2TE 5IHYA 2X0LB 4C90A 4KBMB 5L2LA 2W00A 4DBRA 3E22E 2MYSA 2LSYA 2VASA 4ANJA 1HCIA 3PUSA 3CX8B 2A2FX 4ZI3C 5JREA 3DJBA 2VL8A 2Q9QA 2DHRA 3HR0A 3KVAA 3ZCIA 2ZLYA 1X79A 2CXDA 2LSIA 3DP7A 5FY1A 5EK2A 3NRXA 4PAGA 3RH3A 5LP6E 4XZCA 4PJLA 2C0SA 4L0RA 3BQLA 4GOUA 4PJNA 4ASKA 3FXEB 2WWUA 4H9SE 2LOPA 2K24A 1D0XA 4PNIA 5ETWA 2CM0A 4F6RC 4CQIA 2VKDA 3CQXC 5GONE 4IHJE 5JDMA 3ZMZB 5HXSA 2RA1A 4IE5A 2Y8DA 3ZCJA 1IZNB 4IGUA 2X51A 1S94A 4L5GA 4UXNB 5FP3A 4QKNA 4JUYA 2WM9A 3ZYKA 3UUXB 3EVYA 2WAUA 3ZC0A 3BQKA 3ETVA 4ILUA 1UCUA 2IC9A 5JVDE 5FXVA 4O4JE 4AQFC 1MMAA 3C4WA 4DO0A 3ZN1B 3FXDB 2NOXA 4UF0A 3AVSA 3Q2MA 1HS7A 1KK7A 3RKOA 3O1IA 3KV9A 3ZJ2A 1VOMA 2VB6A 2EHOB 4ZS3A 5ADXL 3EDVA 3MXZA 1HFAA 2CMRA 2ODUA 4IE4A 4QX7B 3HKCE 2V7KA 4H9OC 5JDNA 4DVDA 4ZHQE 3L3PA 2NTYA 4DMWA 3T8OA 2JJ9A 4UF0B 2ODVA 4CI2B 3IBPA 2VKJA 3AA6B 2LJLA 2YINA 3B57A 5DABA 5FXXA 5CA1E 3RYHE 2X9HA 3N2OA 4ZI2D 2YU1A 3WAKA 4HN9A 2NW9A 1WR6A 5CA0E 2WMNA 2XAFB 2KT9A 3P8CD 3KV6A 2HPLA 3Q5WA 4O2AE 5JDQA 1OWAA 4I55E 3GWHA 3GMIA 5DQVA 4U74A 2MBGA 3KBUA 4QHOA 5JR9A 3ZYLA 4ZI7E 4JEHB 4EB6E 3L09A 2J1DG 2IC6A 1WRDA 2XAQB 3A5XA 5FY0A 4AKHA 2G0UA 1MMNA 5LGUB 2Y6XA 2NWBA 4NUVA 2X68A 5EK4A 3R6NA 2W0GA 3H3AA 5J2UE 5L3GB 3ANWA 3K3OA 3RC8A 1LVFA 3C51A 1BR0A 4H9NC 3PU3A 1G8XA 4EXTA 1MNDA 5L3EB 2A3DA 1D1AA 5JR9B 4H63V 2CWOA 3ZYMA 4TV9E 3HL6A 3N9OA 3N9LA 4CXWA 2YU2A 3MJXA 3OYZA 3RYFE 4WBNE 1BR1A 3FBLA 2JMKA 3ANWB 4OYKA 1LRZA 3W15B 1ZV4X 1IJ5A 3PDYA 4AKGA 2Q9QD 1WYBA 1V9DA 1LVKA 3CVRA 2D0UA 3N9PA 4UIGA 4H63H 4E7ZA 2WBLA 3C50A 4ZOLE 2L9QA 3Q5XA 2D0TA 3ZC1A 4GK0E 5LBMA 4KUMB 4X1IE 2ACXA 4HGAA 3EDUA 4BA9A 2BVLA 3N9NA 5JR9C 1B7TA 2E9XA 4HEAA 4I4TE 3IHRA 3ZMUB 2JRKA 1HG2A 3HKDE 3P7IA 5F3JA 2JPFA 2X67A 3WI3A 1UX4A 2K5BB 4EZ4A 4CXXA 3HI2A 3UULA 2LSKA 3FHNA 4IE0A 2KWIB 4JEUB 3OKQA 4YHJA 3PURA 2XQYA 1MIWA 3Q9DA 2X66A 4EOZB 3KBTA 2LT3A 4O4IE 2WSSV 4PJJA 2NTXA 3E08A 2NP9A 4GIWA 1ZHCA 4QX8B 3IF8B 4BJMA 5LGTB 3PTRB 3ZJ1A 1E1HB 4AKLA 3ZMTB 3JC6C 4YJ2E 4ISSA 2KINB 3VHLA 1CUNA 2IW5B 2KLQA 4DBQA 5LHHB 3K8PC 3VKGA 2VK9A 1KNZA 3FBZA 5JH7E 1BR4A 4PW8A 5L3BB 3PE0A 3QC9A 3C4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N2K E;  3N2G E;  5JVD E;  4O4J E;  5LYJ E;  4ZOL E;  5CA1 E;  3RYH E;  5J2U E;  4O4I E;  5EZY E;  5LOV E;  4X1I E;  5CA0 E;  5J2T E;  4TV8 E;  1SA0 E;  4F6R C;  5C8Y E;  5BMV E;  5GON E;  4IHJ E;  4YJ2 E;  4O2A E;  3HKE E;  4TV9 E;  4I55 E;  4I50 E;  3E22 E;  4I4T E;  4X20 E;  5LA6 E;  4O2B E;  5LXT E;  3HKD E;  3RYC E;  4YJ3 E;  3HKC E;  3RYI E;  5JQG E;  4O4L E;  4X1K E;  3HKB E;  4X1Y E;  5IYZ E;  3RYF E;  4WBN E;  4ZI7 E;  4EB6 E;  4ZHQ E;  4IIJ E;  5JH7 E;  4TUY E;  5KX5 E;  3UT5 E;  5CB4 E;  5LP6 E;  5FNV E;  4O4H E; 
#chains in the Genus database with same CATH topology
 1JNZ A;  1IAP A;  2HH7 A;  2W67 A;  1HX8 A;  3KVB A;  2JIW A;  3O4X E;  4P1N A;  4P0A A;  1J5W A;  1IBL T;  1T72 A;  3CQC B;  2J47 A;  4MLK A;  4EEB A;  4JYA T;  4EYY R;  3ESL A;  1L0V A;  2WB5 A;  2B1E A;  4HFB A;  5AQJ B;  1NAF A;  2CCQ A;  1YKE B;  1D0Z A;  1HTJ F;  2BG9 B;  2ZM2 A;  4DV5 T;  1ZEE A;  1MMD A;  3LG7 A;  1OXZ A;  4EYU A;  2QA7 A;  4XBF B;  2JMH A;  3AE9 A;  2IHR 1;  3LK4 2;  5LXT E;  1NWM X;  2AE9 A;  2WZH A;  3AE2 A;  3BQI A;  5DQW A;  2Q9Q C;  5L3D B;  3TLT A;  4UV9 B;  1QUU A;  3GN5 A;  1W0A A;  4KHP T;  2E2A A;  1OED C;  2K9A A;  2OLT A;  5HYA A;  2RPA A;  1NEK A;  5JDH A;  3O9X A;  3UUB A;  1FMW A;  4ZI2 C;  4IST A;  2VKO A;  4OX9 T;  3V5U A;  4PFO A;  2HPJ A;  4LF9 T;  2PBI A;  5LYJ E;  2WY2 A;  4JLE A;  4LF4 T;  4HKA A;  3OVU A;  3UFE A;  4AIS A;  2KND A;  5HEU A;  4IDP A;  3UUN A;  3C64 A;  4L9I A;  3U78 A;  5AFU L;  2I6H A;  4PJM A;  3SS1 A;  3RPU A;  3IA3 A;  5DJQ C;  3LBX A;  4A56 A;  4AQF A;  1I94 T;  5HWX A;  2UXB T;  2Y48 B;  3AE7 A;  3B5M A;  2XSA A;  2LRK A;  4IL4 A;  3VKH A;  2UXD T;  5AQH B;  3RRW A;  4OK0 A;  2XQA A;  3SWH A;  2CBI A;  2VQF T;  4YT0 A;  5LG4 A;  2H7V C;  2V7J A;  5ABF A;  3TKL B;  2XTL A;  2V6Y A;  2CWY A;  3JAF A;  3ZEF B;  3I0Q A;  1WLX A;  2AXD S;  4OHF A;  3CK6 A;  4FJO A;  2ZM6 T;  4LML A;  1FJG T;  3AE3 A;  3CML A;  3P4P A;  2D5U A;  2QYW A;  3QK6 A;  4PK6 A;  2H7O A;  3AAE B;  2OA5 A;  3JAD A;  4QXH B;  4WW0 A;  4HTE A;  3LFM A;  4YTM A;  5LJN A;  5AQN B;  1HNZ T;  5A1L A;  2MAW A;  4WBO A;  5AQM B;  4UV8 B;  1KFY A;  3O1J A;  2FJE A;  3PUG A;  3F57 A;  4MBQ A;  3RX6 A;  4UEM A;  4DND A;  4AI6 A;  5ABF B;  4X5T A;  4TN7 B;  4U2Z A;  3SRZ A;  4HFV A;  5BMV E;  4U33 A;  3BK9 A;  2N2N A;  3C98 B;  2P9B A;  1HG5 A;  4M1P A;  4TWD A;  1MNE A;  3I9W A;  1Y64 B;  4TZ4 C;  5HEH A;  3NRY A;  2WDQ A;  3ZMS B;  3QOF A;  1HX1 B;  2L3L A;  4UEL A;  5LG3 A;  3E0Z A;  4YTP A;  4LFB T;  1OED B;  1Z0P A;  3LJC A;  2LHR A;  3TLV A;  3VR9 A;  3J9X 1;  5C3J A;  4B3T T;  2V5D A;  5FYM A;  4CN1 A;  1JNR A;  2BVM A;  2SPC A;  3RGL A;  4A97 A;  2BKP A;  2V1D B;  3N5L A;  4LF8 T;  4ILA A;  3TLW A;  3UT5 E;  3AE4 A;  2MPK A;  2QGS A;  2M6B A;  2QVA A;  2NW7 A;  2XAJ B;  3AEA A;  3RIU A;  1UK5 A;  5FNV E;  2ACZ A;  2KXP B;  5AQF B;  1YKH B;  3V5S A;  4EZH A;  3UU5 A;  1MMG A;  5LHI B;  1WFD A;  4TWH A;  4V1A v;  5LMN T;  1XZY A;  3I1A A;  4XAX B;  5AQK B;  3C4Z A;  4ZS2 A;  4Z91 A;  1O3X A;  2CBJ A;  4AQG A;  2A9U A;  2LKG A;  5C8Y E;  1N34 T;  2LSG A;  2BG9 A;  4IDQ A;  4CZZ B;  4CXY A;  1R8I A;  1ZKE A;  5L3C B;  2E8I A;  5KDM C;  2E5V A;  5L4H A;  3PV0 F;  1MIV A;  2PG8 A;  3HKB E;  3RC3 A;  1Y01 A;  2IIU A;  2WMO A;  2RP4 A;  3P4W A;  4BAY B;  3AEF A;  4GKK T;  4QXC B;  2C5K T;  4O8S A;  1UX5 A;  3KV5 A;  3AE8 A;  1KNR A;  4Q25 A;  2OV9 A;  3EHZ A;  4AIU A;  1MIY A;  5FMN A;  1HNX T;  5AQG B;  4UVC B;  5F8P A;  5LBQ B;  3NWI A;  3N2G E;  4MHC A;  2LEH A;  2ZM8 A;  3CQG B;  5H6R B;  1D1B A;  5E0O A;  3S4U A;  2JQH A;  3PU8 A;  5M4Y A;  1XNR T;  5JDF A;  1FMV A;  2C5I T;  4I43 B;  2LSJ A;  3SFD A;  4IL9 A;  3AAA B;  4NXM T;  1XDP A;  3VRA A;  2D2S A;  3L39 A;  2CRB A;  1YQ3 A;  4OFZ A;  3AA7 B;  3KIN B;  3ZLI A;  5KMG P;  3VU7 H;  2HHH T;  2CLY C;  5HXR A;  5LCY A;  2XAH B;  4JBW F;  2EHO C;  4U72 A;  1DU2 A;  2LM9 A;  3AA1 B;  3MK7 C;  2KWH A;  2FUP A;  2ES0 A;  4E7S A;  2V7M A;  2EHO A;  1FEW A;  3RYC E;  3RLF F;  2V5C A;  2FBW A;  3MA9 A;  5H6Q B;  3ZN0 B;  5FVK A;  5LGN B;  1XNQ T;  5FKY A;  2A72 A;  4IRE A;  3J7Y q;  4AKI A;  3EAM A;  4MAL A;  3RF1 A;  1T98 A;  2BKO A;  3O1H A;  1G73 A;  3Q5D A;  1D1C A;  4KI0 F;  3CKD A;  4U7Y A;  3CPZ A;  4IE7 A;  4U7I A;  2K48 A;  1N33 T;  4FI5 A;  4JI4 T;  4H9Q C;  5FY7 A;  4P09 A;  4H9R C;  1LKX A;  2BS2 A;  4C91 A;  3PUY F;  2YDR A;  3AB3 B;  1H7C A;  1OED E;  2FJA A;  3F31 A;  3I0O A;  2L8K A;  4G63 A;  4B3R T;  3D0T A;  3LK3 B;  1ZP0 A;  3K3Q C;  3ONX A;  2E9X B;  1SA0 E;  3OYX A;  3FB2 A;  4GYR A;  4QH1 A;  2E9X C;  3AED A;  4TV8 E;  3UU6 A;  4ERR A;  4YFS A;  3OBV E;  5FXW A;  5ABG A;  4EAH A;  4YHH T;  5AQO B;  4YJ3 E;  2YEV C;  2X9Y A;  4O4L E;  1VCT A;  5IYZ E;  3RIU C;  1UUR A;  1QSD A;  4CI1 B;  2BBJ A;  3CX6 B;  1D0Y A;  4GYS A;  5LHG B;  4TUY E;  2KSR A;  3P4S A;  2V6X A;  4DMV A;  4P0B A;  3AVR A;  3UU8 A;  2V26 A;  4Z8X A;  3Q5E A;  4X64 T;  2X0H A;  5AQQ B;  3ABV A;  4OYJ A;  1HR0 T;  5LMU T;  5LNK A;  3FZH B;  3K3N A;  2M67 A;  4CI3 B;  2DCF A;  5EZY E;  3AAI A;  1I6Z A;  3AXJ A;  2DI4 A;  2LRL A;  3RHW A;  4HWH A;  4DR7 T;  1VRB A;  3AE6 A;  5LOV E;  4ADZ A;  1YW0 A;  3MZK B;  4J2C A;  2M6I A;  3IEE A;  4B3M T;  3LDQ B;  3P50 A;  3UUM A;  2W61 A;  4KHZ F;  4JI7 T;  2H3R A;  2DWK A;  1NEN A;  3M3Z B;  2LKH A;  2W66 A;  2XHE B;  3NBX X;  4I50 E;  4QWN B;  4X20 E;  4O2B E;  2Q9Q B;  3R84 B;  1UGO A;  2W63 A;  4A98 A;  3NZQ A;  2BDE A;  3RYI E;  3ZMV B;  2LHN A;  4X66 T;  2V7I A;  5HAX A;  1KNP A;  2YDQ A;  1X9B A;  2CEA A;  2NR4 A;  4HFI A;  3OPC A;  4HE8 A;  4NUU A;  5JDG A;  4DR2 T;  4LFC T;  1WYC A;  4IDZ A;  2NW8 A;  1HF8 A;  1XMO T;  3H37 A;  2LLY A;  2IUB A;  2UXX B;  4DR3 T;  4LFA T;  5JRC B;  5CB4 E;  4O4H E;  2W62 A;  2PFV A;  3N2K E;  4DV1 T;  2YK0 A;  2WDR A;  3OJA A;  2XUE A;  4IT4 A;  3KV4 A;  4K0U A;  4JI2 T;  3FZM B;  4EIW A;  4JI1 T;  2XAS B;  1KEY A;  2X9W A;  3QUJ A;  3U3I A;  4YSX A;  2VWA A;  1E7P A;  4I0U A;  4YXD A;  3X1D A;  4B6X A;  3PUX F;  4PK5 A;  4JI3 T;  2CLY B;  2CXF A;  3AEE A;  2J4G A;  4H9P C;  3GN5 B;  4QXB B;  2I0M A;  2I59 A;  3AE1 A;  3EUH A;  1N36 T;  3PUA A;  4WYV A;  4LF6 T;  5HEO A;  3AA0 B;  4DR6 T;  2BZB A;  2R6G F;  3F2E A;  2JQ9 A;  5JTG A;  5L4E A;  3UQ7 A;  4TNW A;  2VQE T;  2N9D A;  2PJQ A;  2MOZ A;  2LOS A;  3KFW X;  4PFP A;  4YLH A;  3RKG A;  3UTK A;  5HWY A;  2EHO D;  2GK9 A;  2Z6E A;  1UUS A;  4GK5 E;  5HXC A;  2WDV A;  3JC6 D;  1S35 A;  5TAO A;  4IIJ E;  4DID B;  2UUC T;  3N9M A;  3WAJ A;  2XJ7 A;  2DNX A;  1W9R A;  3ZPO A;  3RQW A;  4DV0 T;  3I9Y A;  4ILC A;  2C5J A;  4TX5 A;  2YDS A;  2X9X A;  3LBX B;  3NZP A;  3PUQ A;  1EZ3 A;  2XY8 B;  3GA8 A;  4HWI B;  4N78 D;  2JQQ A;  2LE8 A;  1IJ6 A;  4BJN A;  4JI8 T;  2K3W A;  3N9Q A;  2F4V T;  3SFE A;  5AQR B;  2WU2 A;  4UVB B;  4KP3 C;  4KMC A;  3AE5 A;  4ZI3 D;  2UXN B;  2XAG B;  3LSV A;  2UUB T;  3FZF B;  1BR2 A;  2V6Y B;  4G2A A;  3HA4 A;  1M7K A;  3HKE E;  5LA6 E;  5HXH A;  1AJ3 A;  1US7 B;  4DV4 T;  4UR9 A;  2N1G A;  1J5E T;  3ETU A;  5JQG E;  4GKJ T;  1FIO A;  5EK3 A;  1W09 A;  3T1Y T;  4UVA B;  4X1Y E;  5L3F B;  4MFR A;  5FXZ A;  1U4Q A;  5AQS B;  2CE7 A;  2V7L A;  3A7M A;  4LMK A;  4PK4 A;  5AQI B;  5KX5 E;  5J1G A;  5LJM A;  5CJ5 A;  2ZMA A;  2KMF A;  1U5P A;  3C4X A;  4HFH A;  2CA5 A;  4U31 A;  2CXL A;  3KDS E;  4IE6 A;  5JDL A;  4ZZC A;  3B13 A;  3DTO A;  3QNU A;  1SHZ C;  2DLR A;  1YD8 G;  3CWZ B;  2ZM0 A;  4QH4 A;  3P4Q A;  2E9X D;  2H89 A;  3MAC A;  1GQE A;  2YOE A;  1YXR A;  2KZ7 B;  3MKD A;  2DWG A;  4WNK A;  4WZX A;  4AKR B;  5HXE A;  3PJA J;  2MTQ A;  2VKH A;  3M65 A;  3CX7 B;  3LK2 B;  3SOL A;  5J2T E;  2E5L T;  5IHY A;  2V8S V;  2X0L B;  4C90 A;  4KBM B;  5AQT B;  5L2L A;  5AQV B;  2W00 A;  4X62 T;  4DBR A;  4JI6 T;  2BBH A;  3E22 E;  2MYS A;  2LSY A;  2VAS A;  4ANJ A;  1OED A;  1HCI A;  1SUM B;  2XZE A;  2A2F X;  3CX8 B;  3PUS A;  5FVL A;  4ZI3 C;  3DJB A;  3RRC A;  5JRE A;  2VL8 A;  2WCA A;  2Q9Q A;  2DHR A;  2XM2 A;  3HR0 A;  3KVA A;  2ZLY A;  3ZCI A;  4JI0 T;  1X79 A;  1ZOY A;  3ZST A;  2CXD A;  4YTN A;  4Z90 A;  2LSI A;  3DP7 A;  4F8H A;  5FY1 A;  5EK2 A;  3NRX A;  4PAG A;  5AQL B;  3RH3 A;  4B3S T;  2WQY A;  3PUW F;  5HCM A;  4KX6 A;  3RI5 A;  2WU5 A;  4XZC A;  4PJL A;  5LP6 E;  2C0S A;  4L0R A;  3EAB A;  3BQL A;  2LM2 A;  4GOU A;  4HFC A;  1T8B A;  3P4R A;  3FXE B;  2WWU A;  2X0Y A;  2LOP A;  4H9S E;  2FJD A;  4HFE A;  4PJN A;  4ASK A;  2K24 A;  1D0X A;  4ZZB A;  4PNI A;  5ETW A;  5HCJ A;  1WR0 A;  2CM0 A;  4F6R C;  4CQI A;  2VKD A;  2BG9 C;  2QRX A;  3CQX C;  4HFD A;  5GON E;  3G06 A;  4IHJ E;  3PUV F;  5JDM A;  2YKS A;  3ZMZ B;  2HN2 A;  3EI0 A;  5HXS A;  2RA1 A;  5IWA T;  3NVO A;  4IE5 A;  2Y8D A;  3JCF A;  3H3M A;  3ZCJ A;  1IZN B;  5BR8 T;  4YSZ A;  4IGU A;  2X51 A;  2CHO A;  1S94 A;  4L5G A;  3VR8 A;  4DV7 T;  4UXN B;  2UUA T;  5FP3 A;  3K1S A;  4QKN A;  4JUY A;  2WM9 A;  3ZYK A;  3UUX B;  3EVY A;  2WAU A;  3TLU A;  5ABE A;  3ZC0 A;  3BQK A;  3ETV A;  2CPT A;  4ILU A;  4EGW A;  4DUZ T;  1UCU A;  2IC9 A;  2W2U A;  3AEC A;  4IDO A;  5JVD E;  5FXV A;  3UFG A;  4YSY A;  4O4J E;  4AQF C;  1MMA A;  3C4W A;  4DO0 A;  3ZN1 B;  3FXD B;  1M62 A;  2NOX A;  2VUR A;  4DV3 T;  4UF0 A;  4ZEY A;  4NXN T;  2XM1 A;  3FZK B;  3ZT6 A;  3AVS A;  3Q2M A;  1HS7 A;  1KK7 A;  3RKO A;  5KXJ A;  2JQK A;  3KV9 A;  3O1I A;  3ZJ2 A;  1VOM A;  5LB7 B;  2IML A;  2EHO B;  2VB6 A;  4ZS3 A;  5ADX L;  3EDV A;  3MXZ A;  3UU4 A;  1HFA A;  2CMR A;  2ODU A;  4IE4 A;  4QX7 B;  4LMJ A;  3HKC E;  1XDO A;  2V7K A;  4H9O C;  5JDN A;  4DR5 T;  4DUY T;  5F5W A;  4DVD A;  4ZHQ E;  4CN4 A;  3L3P A;  2NTY A;  3ZSS A;  3T8O A;  4DMW A;  2JJ9 A;  4AQY T;  1J1J A;  4UF0 B;  2ODV A;  4CI2 B;  3OTO T;  3IBP A;  2H88 A;  4U2Y A;  2VKJ A;  3AA6 B;  2LJL A;  2YIN A;  3B57 A;  4QH5 A;  5DAB A;  2BS4 A;  5FXX A;  3ZKR A;  3RYH E;  2D9D A;  5CA1 E;  2X9H A;  4X65 T;  3N2O A;  4ZI2 D;  2B76 A;  2YU1 A;  5CFB A;  3WAK A;  4HN9 A;  2NW9 A;  2UU9 T;  1YQ4 A;  1IBM T;  1WR6 A;  5CA0 E;  3QB5 A;  2WMN A;  2XAF B;  2KT9 A;  3P8C D;  3KV6 A;  2HPL A;  5JRC A;  3Q5W A;  4O2A E;  5JDQ A;  1OWA A;  4I55 E;  5HEJ A;  4JV5 T;  3GWH A;  4JI5 T;  3GMI A;  3ZT5 A;  5DQV A;  4IDN A;  2UXC T;  4U74 A;  4X1K E;  3KBU A;  2MBG A;  4QHO A;  5JR9 A;  3ZYL A;  2WWV A;  2XQ6 A;  3RIF A;  3UU3 A;  2J62 A;  4JEH B;  3L09 A;  4EB6 E;  4ZI7 E;  1Z8U A;  2IC6 A;  1WRD A;  2J1D G;  2XAQ B;  1VCS A;  2XQ8 A;  2XQ7 A;  2XQ3 A;  3A5X A;  5FY0 A;  1E2A A;  2G0U A;  1MMN A;  4AKH A;  5LGU B;  2Y6X A;  1XWM A;  3RQU A;  5CGM A;  2NWB A;  4NUV A;  2X68 A;  5EK4 A;  3R6N A;  5AQU B;  2XPK A;  2W0G A;  3H3A A;  5J2U E;  2BG9 E;  3ANW A;  4NIQ A;  5L3G B;  3K3O A;  4HWD A;  3RC8 A;  2XSB A;  1LVF A;  3C51 A;  1BR0 A;  4H9N C;  3PU3 A;  1G8X A;  4EXT A;  1MND A;  4CN6 A;  5L3E B;  2A3D A;  1D1A A;  4NPP A;  4H63 V;  4AXP A;  5JR9 B;  2CWO A;  3ZYM A;  4TV9 E;  5C2T A;  3HL6 A;  3N9O A;  4DV6 T;  1W0B A;  3N9L A;  5J0Z A;  4DR4 T;  4CXW A;  4EED A;  2YU2 A;  5FL0 A;  2DL1 A;  3MJX A;  3OYZ A;  3RYF E;  4WBN E;  1BR1 A;  3FBL A;  2JMK A;  3ANW B;  4OYK A;  3T1H T;  1LRZ A;  3W15 B;  1ZV4 X;  1IJ5 A;  3PDY A;  4EV6 A;  2Q9Q D;  4AKG A;  1WYB A;  3NKZ A;  1V9D A;  4DR1 T;  4YY3 T;  1LVK A;  3CVR A;  2D0U A;  3N9P A;  4UIG A;  4H63 H;  4E7Z A;  2WBL A;  2IDO B;  3C50 A;  4ZOL E;  2L9Q A;  3Q5X A;  2D0T A;  1QLB A;  4GK0 E;  5LBM A;  4KUM B;  3A8Y C;  3AEB A;  3ZC1 A;  4ILB A;  5ABH A;  3ONJ A;  4X1I E;  2ACX A;  2PTF A;  4HGA A;  3EDU A;  4BA9 A;  2BVL A;  3N9N A;  5JR9 C;  1B7T A;  3VRB A;  2E9X A;  4HEA A;  4I4T E;  3IHR A;  5AQP B;  3ZMU B;  2VL0 A;  4A5X A;  2JRK A;  1HG2 A;  3HKD E;  3P7I A;  5F3J A;  4DV2 T;  2JPF A;  2X67 A;  3JAE A;  3WI3 A;  4TWF A;  3ZT7 A;  1IBK T;  1UX4 A;  2K5B B;  3AEG A;  4EZ4 A;  1CHU A;  4CXX A;  2BKN A;  3HI2 A;  3PUZ F;  3UUL A;  2LSK A;  1T7S A;  5HEG A;  3FHN A;  5FL1 A;  4IE0 A;  2KWI B;  4JEU B;  3OKQ A;  4YHJ A;  4ZXL A;  1SE7 A;  2XQY A;  3PUR A;  1XMQ T;  1N32 T;  1MIW A;  2WP9 A;  3Q9D A;  3L8R A;  2XQ9 A;  2HN1 A;  2X66 A;  4EOZ B;  3KBT A;  2YN6 A;  5L47 A;  3FZL B;  2LT3 A;  4O4I E;  4HWC A;  2WSS V;  2BS3 A;  2NTX A;  3E08 A;  2NP9 A;  4GIW A;  1ZHC A;  4PJJ A;  3IF8 B;  4QX8 B;  4BJM A;  4COF A;  2WS3 A;  2VVN A;  5LGT B;  1WCR A;  2W4X A;  3PTR B;  2WZI A;  2VVS A;  2CHN A;  3ZJ1 A;  1E1H B;  2FJB A;  4TNV A;  4AKL A;  4U3C A;  3ZMT B;  3JC6 C;  3CIR A;  3UQ4 A;  4YJ2 E;  4ISS A;  2KIN B;  4HWF A;  3AXJ B;  4K0K T;  3VHL A;  1CUN A;  2IW5 B;  2KLQ A;  3PJA A;  3TLS A;  4DBQ A;  5LHH B;  1KF6 A;  3K8P C;  3VKG A;  3RIA A;  5IUX A;  2VK9 A;  4LF7 T;  1KNZ A;  2XQ5 A;  3QB5 K;  3FBZ A;  2XQ4 A;  5JH7 E;  1BR4 A;  4PW8 A;  5L3B B;  4LF5 T;  3PE0 A;  1HNW T;  3ONL C;  3QC9 A;  2IAK A; 
#chains in the Genus database with same CATH homology
 1IAP A;  2HH7 A;  1HX8 A;  3KVB A;  3O4X E;  4P0A A;  3CQC B;  4MLK A;  4EYY R;  3ESL A;  2B1E A;  1NAF A;  2CCQ A;  1YKE B;  1D0Z A;  1HTJ F;  2ZM2 A;  1ZEE A;  1MMD A;  3LG7 A;  1OXZ A;  4EYU A;  2QA7 A;  4XBF B;  2JMH A;  3LK4 2;  5LXT E;  4CXY A;  1NWM X;  3BQI A;  5DQW A;  5L3D B;  2Q9Q C;  4UV9 B;  1QUU A;  3GN5 A;  2K9A A;  5HYA A;  3O9X A;  5JDH A;  1FMW A;  4ZI2 C;  4IST A;  2VKO A;  3V5U A;  4PFO A;  2HPJ A;  2PBI A;  5LYJ E;  4JLE A;  4HKA A;  3UFE A;  2KND A;  3UUN A;  3C64 A;  4L9I A;  3U78 A;  5AFU L;  4PJM A;  3SS1 A;  3RPU A;  5DJQ C;  3LBX A;  4A56 A;  4AQF A;  5HWX A;  2Y48 B;  3VKH A;  3RRW A;  4OK0 A;  3SWH A;  5LG4 A;  2H7V C;  2V7J A;  3TKL B;  2XTL A;  2CWY A;  3ZEF B;  3I0Q A;  1WLX A;  4OHF A;  4FJO A;  3CML A;  2D5U A;  3QK6 A;  4PK6 A;  4QXH B;  2H7O A;  3AAE B;  2OA5 A;  4WW0 A;  5LJN A;  4HTE A;  3LFM A;  5A1L A;  4WBO A;  4UV8 B;  3O1J A;  4MBQ A;  4DND A;  3PUG A;  3F57 A;  3RX6 A;  4UEM A;  4AI6 A;  4TN7 B;  5BMV E;  3SRZ A;  4HFV A;  3BK9 A;  2N2N A;  3C98 B;  2P9B A;  1HG5 A;  4M1P A;  4TZ4 C;  1MNE A;  3I9W A;  1Y64 B;  3RRC A;  3ZMS B;  3NRY A;  2L3L A;  4UEL A;  3E0Z A;  1Z0P A;  3LJC A;  2LHR A;  3J9X 1;  5FYM A;  2BVM A;  2SPC A;  2V1D B;  3N5L A;  3UT5 E;  2QGS A;  2NW7 A;  2XAJ B;  2KXP B;  1YKH B;  3V5S A;  4EZH A;  1MMG A;  5LHI B;  4V1A v;  3I1A A;  4XAX B;  3C4Z A;  4ZS2 A;  1O3X A;  5C8Y E;  2LSG A;  4CZZ B;  1ZKE A;  5L3C B;  2E8I A;  5KDM C;  3RC3 A;  1MIV A;  2PG8 A;  3HKB E;  2WMO A;  2RP4 A;  4BAY B;  4QXC B;  2C5K T;  4O8S A;  1UX5 A;  3KV5 A;  1MIY A;  5FMN A;  4UVC B;  5F8P A;  5LBQ B;  3N2G E;  4MHC A;  2LEH A;  2ZM8 A;  3CQG B;  5H6R B;  1D1B A;  5E0O A;  3S4U A;  5M4Y A;  3PU8 A;  5JDF A;  1FMV A;  2C5I T;  4I43 B;  2LSJ A;  3AAA B;  2D2S A;  4OFZ A;  5KMG P;  3AA7 B;  3KIN B;  3ZLI A;  3VU7 H;  2CLY C;  5HXR A;  5LCY A;  2XAH B;  2EHO C;  4U72 A;  2LM9 A;  3AA1 B;  3MK7 C;  2KWH A;  2ES0 A;  4E7S A;  2V7M A;  2EHO A;  1FEW A;  3RYC E;  3MA9 A;  5H6Q B;  3ZN0 B;  5LGN B;  2A72 A;  3J7Y q;  4AKI A;  4MAL A;  1T98 A;  3O1H A;  1G73 A;  1D1C A;  3CKD A;  3CPZ A;  4IE7 A;  2K48 A;  4FI5 A;  4H9Q C;  5FY7 A;  4P09 A;  4H9R C;  1LKX A;  4C91 A;  3AB3 B;  1H7C A;  4G63 A;  3F31 A;  3I0O A;  2L8K A;  3D0T A;  3LK3 B;  3K3Q C;  3ONX A;  3OYX A;  2E9X B;  1SA0 E;  4TV8 E;  3FB2 A;  4GYR A;  4AXP A;  2E9X C;  4ERR A;  4YFS A;  3OBV E;  5FXW A;  4EAH A;  4YJ3 E;  2YEV C;  2X9Y A;  4O4L E;  1QSD A;  4CI1 B;  3CX6 B;  1D0Y A;  4GYS A;  5LHG B;  4TUY E;  4DMV A;  4P0B A;  3AVR A;  2V26 A;  4Z8X A;  4OYJ A;  5LNK A;  3K3N A;  2M67 A;  4CI3 B;  2DCF A;  5EZY E;  3AAI A;  2DI4 A;  5JRC A;  1VRB A;  5LOV E;  4ADZ A;  1YW0 A;  3MZK B;  4J2C A;  3IEE A;  3UUM A;  2W61 A;  2H3R A;  2IAK A;  2DWK A;  2XHE B;  3NBX X;  4I50 E;  4X20 E;  4QWN B;  3R84 B;  4O2B E;  2Q9Q B;  2W63 A;  3NZQ A;  2BDE A;  3RYI E;  3ZMV B;  2LHN A;  2V7I A;  5HAX A;  5IYZ E;  5JDG A;  2CEA A;  4HE8 A;  4NUU A;  1WYC A;  4IDZ A;  2NW8 A;  1HF8 A;  3H37 A;  2UXX B;  5JRC B;  5CB4 E;  4O4H E;  2W62 A;  2PFV A;  3N2K E;  2YK0 A;  3OJA A;  2XUE A;  4K0U A;  3KV4 A;  4EIW A;  2XAS B;  2X9W A;  3U3I A;  3QUJ A;  2VWA A;  4B6X A;  4PK5 A;  2CLY B;  2CXF A;  4H9P C;  4QXB B;  3GN5 B;  2I59 A;  3EUH A;  3PUA A;  3AA0 B;  2BZB A;  3F2E A;  2N9D A;  2PJQ A;  2MOZ A;  2LOS A;  3KFW X;  4PFP A;  4YLH A;  3UTK A;  4AQG A;  5HWY A;  2EHO D;  2GK9 A;  2Z6E A;  4GK5 E;  5TAO A;  5HXC A;  3JC6 D;  1S35 A;  4IIJ E;  3N9M A;  3WAJ A;  2DNX A;  3ZPO A;  3I9Y A;  4X1K E;  2C5J A;  4TX5 A;  3PUQ A;  2X9X A;  3LBX B;  3NZP A;  5FNV E;  1EZ3 A;  3GA8 A;  4N78 D;  2JQQ A;  2LE8 A;  1IJ6 A;  4BJN A;  3N9Q A;  4UVB B;  4KP3 C;  4KMC A;  4ZI3 D;  2UXN B;  2XAG B;  1BR2 A;  4G2A A;  3HA4 A;  3HKE E;  5LA6 E;  5HXH A;  1AJ3 A;  1US7 B;  2N1G A;  3ETU A;  5JQG E;  1FIO A;  5EK3 A;  4UVA B;  4X1Y E;  5L3F B;  4MFR A;  5FXZ A;  1U4Q A;  2CE7 A;  2V7L A;  4PK4 A;  5KX5 E;  5J1G A;  5LJM A;  2ZMA A;  2KMF A;  1U5P A;  5JDL A;  2CA5 A;  2CXL A;  3KDS E;  4IE6 A;  3B13 A;  3DTO A;  1SHZ C;  2DLR A;  1YD8 G;  3CWZ B;  2ZM0 A;  2E9X D;  3MAC A;  3MKD A;  4WNK A;  2KZ7 B;  4AKR B;  2DWG A;  5HXE A;  2MTQ A;  2VKH A;  3M65 A;  3CX7 B;  3LK2 B;  3SOL A;  5J2T E;  5IHY A;  2X0L B;  4C90 A;  4KBM B;  5L2L A;  2W00 A;  4DBR A;  3E22 E;  2MYS A;  2LSY A;  2VAS A;  4ANJ A;  1HCI A;  3PUS A;  3CX8 B;  2A2F X;  4ZI3 C;  5JRE A;  3DJB A;  2VL8 A;  2Q9Q A;  2DHR A;  3HR0 A;  3KVA A;  3ZCI A;  2ZLY A;  1X79 A;  2CXD A;  2LSI A;  3DP7 A;  5FY1 A;  5EK2 A;  3NRX A;  4PAG A;  3RH3 A;  5LP6 E;  4XZC A;  4PJL A;  2C0S A;  4L0R A;  3BQL A;  4GOU A;  4PJN A;  4ASK A;  3FXE B;  2WWU A;  4H9S E;  2LOP A;  2K24 A;  1D0X A;  4PNI A;  5ETW A;  2CM0 A;  4F6R C;  4CQI A;  2VKD A;  3CQX C;  5GON E;  4IHJ E;  5JDM A;  3ZMZ B;  5HXS A;  2RA1 A;  4IE5 A;  2Y8D A;  3ZCJ A;  1IZN B;  4IGU A;  2X51 A;  1S94 A;  4L5G A;  4UXN B;  5FP3 A;  4QKN A;  4JUY A;  2WM9 A;  3ZYK A;  3UUX B;  3EVY A;  2WAU A;  3ZC0 A;  3BQK A;  3ETV A;  4ILU A;  1UCU A;  2IC9 A;  5JVD E;  5FXV A;  4O4J E;  4AQF C;  1MMA A;  3C4W A;  4DO0 A;  3ZN1 B;  3FXD B;  2NOX A;  4UF0 A;  3AVS A;  3Q2M A;  1HS7 A;  1KK7 A;  3RKO A;  3O1I A;  3KV9 A;  3ZJ2 A;  1VOM A;  2VB6 A;  2EHO B;  4ZS3 A;  5ADX L;  3EDV A;  3MXZ A;  1HFA A;  2CMR A;  2ODU A;  4IE4 A;  4QX7 B;  3HKC E;  2V7K A;  4H9O C;  5JDN A;  4DVD A;  4ZHQ E;  3L3P A;  2NTY A;  4DMW A;  3T8O A;  2JJ9 A;  4UF0 B;  2ODV A;  4CI2 B;  3IBP A;  2VKJ A;  3AA6 B;  2LJL A;  2YIN A;  3B57 A;  5DAB A;  5FXX A;  5CA1 E;  3RYH E;  2X9H A;  3N2O A;  4ZI2 D;  2YU1 A;  3WAK A;  4HN9 A;  2NW9 A;  1WR6 A;  5CA0 E;  2WMN A;  2XAF B;  2KT9 A;  3P8C D;  3KV6 A;  2HPL A;  3Q5W A;  4O2A E;  5JDQ A;  1OWA A;  4I55 E;  3GWH A;  3GMI A;  5DQV A;  4U74 A;  2MBG A;  3KBU A;  4QHO A;  5JR9 A;  3ZYL A;  4ZI7 E;  4JEH B;  4EB6 E;  3L09 A;  2J1D G;  2IC6 A;  1WRD A;  2XAQ B;  3A5X A;  5FY0 A;  4AKH A;  2G0U A;  1MMN A;  5LGU B;  2Y6X A;  2NWB A;  4NUV A;  2X68 A;  5EK4 A;  3R6N A;  2W0G A;  3H3A A;  5J2U E;  5L3G B;  3ANW A;  3K3O A;  3RC8 A;  1LVF A;  3C51 A;  1BR0 A;  4H9N C;  3PU3 A;  1G8X A;  4EXT A;  1MND A;  5L3E B;  2A3D A;  1D1A A;  5JR9 B;  4H63 V;  2CWO A;  3ZYM A;  4TV9 E;  3HL6 A;  3N9O A;  3N9L A;  4CXW A;  2YU2 A;  3MJX A;  3OYZ A;  3RYF E;  4WBN E;  1BR1 A;  3FBL A;  2JMK A;  3ANW B;  4OYK A;  1LRZ A;  3W15 B;  1ZV4 X;  1IJ5 A;  3PDY A;  4AKG A;  2Q9Q D;  1WYB A;  1V9D A;  1LVK A;  3CVR A;  2D0U A;  3N9P A;  4UIG A;  4H63 H;  4E7Z A;  2WBL A;  3C50 A;  4ZOL E;  2L9Q A;  3Q5X A;  2D0T A;  3ZC1 A;  4GK0 E;  5LBM A;  4KUM B;  4X1I E;  2ACX A;  4HGA A;  3EDU A;  4BA9 A;  2BVL A;  3N9N A;  5JR9 C;  1B7T A;  2E9X A;  4HEA A;  4I4T E;  3IHR A;  3ZMU B;  2JRK A;  1HG2 A;  3HKD E;  3P7I A;  5F3J A;  2JPF A;  2X67 A;  3WI3 A;  1UX4 A;  2K5B B;  4EZ4 A;  4CXX A;  3HI2 A;  3UUL A;  2LSK A;  3FHN A;  4IE0 A;  2KWI B;  4JEU B;  3OKQ A;  4YHJ A;  3PUR A;  2XQY A;  1MIW A;  3Q9D A;  2X66 A;  4EOZ B;  3KBT A;  2LT3 A;  4O4I E;  2WSS V;  4PJJ A;  2NTX A;  3E08 A;  2NP9 A;  4GIW A;  1ZHC A;  4QX8 B;  3IF8 B;  4BJM A;  5LGT B;  3PTR B;  3ZJ1 A;  1E1H B;  4AKL A;  3ZMT B;  3JC6 C;  4YJ2 E;  4ISS A;  2KIN B;  3VHL A;  1CUN A;  2IW5 B;  2KLQ A;  4DBQ A;  5LHH B;  3K8P C;  3VKG A;  2VK9 A;  1KNZ A;  3FBZ A;  5JH7 E;  1BR4 A;  4PW8 A;  5L3B B;  3PE0 A;  3QC9 A;  3C4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...