4LF4T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf4T00
4JV5T 5IWAT 4X62T 1N33T 4KHPT 4NXNT 4DV2T 4DV5T 4LFBT 1XMOT 4DR5T 1IBKT 4DV6T 4JI2T 4DV1T 4LFCT 3OTOT 4DV3T 2VQET 4LF9T 4DV0T 3T1YT 4JI5T 2UUCT 4LF4T 1N36T 4YHHT 4OX9T 4GKKT 1FJGT 4AQYT 4LF5T 4B3ST 1HNWT 2UXBT 4DR4T 4DR2T 4DR6T 4NXMT 2E5LT 4X64T 1XNRT 4K0KT 1HNXT 4B3TT 4JI0T 2F4VT 1HR0T 4DUYT 5LMUT 4DR3T 4DV7T 2UU9T 4LF8T 5BR8T 4JI8T 4YY3T 1HNZT 4B3RT 4DUZT 5LMNT 1N32T 4JI4T 2UUAT 4DR1T 2ZM6T 1IBMT 4LF6T 4DR7T 4JI1T 4LFAT 1I94T 2UUBT 1IBLT 4LF7T 2UXCT 4DV4T 4JYAT 1XMQT 4GKJT 4JI6T 2UXDT 2HHHT 1N34T 2VQFT 1XNQT 3T1HT 4JI7T 4JI3T 4X66T 4B3MT 1J5ET 4X65T
chains in the Genus database with same CATH superfamily
3AE2A 4B6XA 4HWHA 1LRZA 5LGTB 2JQKA 2C5IT 2FJBA 2HN1A 4P0AA 3LJCA 3Q5DA 2ACZA 4JV5T 5IWAT 2CE7A 2HH7A 1SE7A 1MNEA 2XQ6A 4GYRA 2X9XA 5FL1A 1N33T 5LYJE 5FXXA 1HFAA 2VKJA 2K3WA 3ETVA 5AQQB 4LFBT 2Z6EA 4QXHB 1IBKT 4DV6T 1J5WA 4JI2T 4IE4A 5L3BB 2WCAA 4A98A 3EDVA 3KV6A 3ZYKA 4LFCT 2ODUA 3P4PA 3RYFE 3ZKRA 1VCTA 3U3IA 2XSAA 5JDFA 3ZJ1A 2WZHA 2VQET 2QYWA 4KX6A 2V7JA 3QB5A 4JI5T 4EEBA 4ZI2D 3E0ZA 3T1YT 2X9YA 4U2ZA 2RPAA 3HKCE 2YN6A 4HFEA 4YJ2E 5ABEA 5JREA 4ISTA 4DV5T 4LF4T 1MMDA 3MKDA 2V6YB 4X20E 3JCFA 2XM1A 2YU1A 3ANWA 2X67A 5LB7B 3WAJA 4CXXA 3OYZA 3PUXF 5AQLB 2UXBT 2PBIA 2XQ8A 3UFEA 4ZI2C 2YU2A 3AE4A 1UX4A 5JDQA 4DR4T 2WBLA 4NXMT 4GOUA 2Y8DA 2BG9A 4QX7B 2CEAA 3Q5XA 4K0KT 5E0OA 1ZKEA 4IE0A 3RYCE 4I50E 1D0YA 2BS2A 3IBPA 2CBIA 3NVOA 3P4QA 5LG4A 2X0YA 1OEDB 3Q9DA 2NW9A 4U72A 2W2UA 5AQUB 3RLFF 2F4VT 4KBMB 3LFMA 2KINB 1UX5A 4UVCB 3EVYA 3Q5EA 4XZCA 4EXTA 1HR0T 3JAEA 1ZOYA 2LSIA 2GK9A 3ZCJA 4AQFA 2MTQA 1KNPA 2VKHA 4ZI7E 5DQWA 5HWXA 4E7SA 3RYIE 4DVDA 3UUXB 2KZ7B 4DUYT 5FXZA 3G06A 2CRBA 2XM2A 4MALA 5LBQB 1QSDA 2YDRA 2KMFA 2H88A 2CLYB 2WSSV 3FXDB 3EI0A 3PE0A 4LF8T 5C2TA 4XAXB 4DV3T 4UR9A 2LLYA 1T7SA 4HEAA 3AEGA 5C3JA 5LHIB 3AB3B 4QH1A 2M67A 3AECA 5FY7A 3SFDA 3UQ7A 3VR8A 3O1IA 4TN7B 4LMLA 4DUZT 2YEVC 1N32T 1W09A 2FUPA 3M3ZB 2SPCA 1NENA 1ZV4X 2BDEA 2LOPA 3AE8A 3N9QA 4PFPA 3ZPOA 1KFYA 3BK9A 2IC6A 3NRXA 2XSBA 2BZBA 2NWBA 3AA6B 4DBQA 4AKHA 4IDOA 3PUSA 3E08A 2ZM6T 2E9XC 5AQOB 5HEOA 1IBMT 4PW8A 3UU5A 1ZHCA 3RRCA 4DR7T 2BKPA 3PTRB 4TWFA 2NTYA 2W62A 4YHJA 2MPKA 5HXCA 4LFAT 1BR0A 2XPKA 1WRDA 3ZJ2A 2ZMAA 2QVAA 2Q9QC 3IEEA 2JRKA 4P09A 4EIWA 3K8PC 4U7YA 4ZOLE 4LF7T 1BR2A 4PK6A 5L3EB 5HWYA 5LBMA 2V7LA 4YSXA 2K48A 3ZMZB 4UXNB 5AQSB 3EDUA 2MBGA 3ONJA 2N1GA 2LSKA 4ILCA 3GWHA 5AQHB 4U31A 4HFBA 4TZ4C 3NKZA 2V6YA 5AQNB 4YFSA 3UU4A 3VU7H 2FJEA 2V5CA 3HKBE 3ANWB 3E22E 3L8RA 3C64A 3NBXX 2CPTA 4IDQA 2K5BB 3EABA 2WP9A 4I0UA 2WQYA 5LXTE 2IMLA 4IDZA 4ZEYA 1N34T 2HHHT 1NAFA 3QK6A 4MHCA 3DJBA 4IGUA 2OV9A 2XQ3A 4HFHA 3KINB 4QHOA 5JTGA 5LGUB 1XNQT 2JIWA 3CX6B 4COFA 3BQLA 3ZN0B 4H9OC 4IT4A 5LOVE 2J62A 3ZEFB 4B3MT 5EK4A 5HXSA 5HXHA 3AEFA 3IHRA 3PUWF 5F5WA 3N5LA 4HFIA 2RA1A 4H9SE 3RH3A 4C90A 4H9QC 4E7ZA 3AAIA 5ETWA 2D5UA 5JDGA 1IZNB 2WWUA 2IW5B 4YXDA 2A2FX 4QXCB 3P4RA 3CKDA 3FZHB 2YDSA 3N2OA 4CI3B 5KMGP 4HTEA 4FJOA 5LCYA 5L47A 4O2BE 4NXNT 2X0HA 4O4LE 3ZYLA 4DV2T 2VWAA 1XMOT 5FVKA 4A5XA 5KDMC 2X9HA 2LHRA 3UUMA 2B76A 2PJQA 4DV1T 3NZPA 2BVLA 2JQHA 3AE7A 3MJXA 1LVKA 2JJ9A 2BKNA 1IJ5A 2W4XA 3UUBA 5FYMA 2VK9A 1HF8A 3VKHA 4KHZF 1OWAA 2VB6A 4JUYA 1HX8A 1W0BA 2X9WA 4GKKT 4JEUB 3KVAA 3C98B 5FY0A 4B3ST 3MA9A 5HXRA 5F3JA 1MIWA 2PFVA 2L8KA 3PUYF 5JDHA 3GMIA 4A97A 4WNKA 2WS3A 2XASB 4ZXLA 2B1EA 2KXPB 2XAFB 3FB2A 4TX5A 3QOFA 2UXNB 3F57A 3RIAA 4X64T 3RC8A 4TWDA 4WBNE 2C5KT 3OJAA 1YD8G 2CXLA 4CN1A 4HWFA 5JDMA 1E1HB 4ADZA 3N2KE 3RPUA 4U33A 5CFBA 4B3TT 2K24A 5L2LA 5L3FB 3FBLA 4UF0A 2EHOC 3AAEB 2M6IA 4CI1B 2I6HA 2P9BA 2WY2A 1U4QA 4X1IE 4ISSA 4UIGA 3O9XA 4AKGA 2V7IA 1CHUA 3CX8B 3K1SA 2MAWA 3LK42 3RC3A 5JDNA 3PU3A 4LMJA 4GKJT 2BVMA 4UV9B 4NIQA 3TLSA 5J2UE 2JQQA 5FMNA 3RF1A 4P1NA 5FXVA 4IIJE 2KLQA 2V7KA 2LM9A 3CQGB 2CMRA 3JAFA 2QRXA 4CQIA 2WMNA 2ZM0A 3HR0A 3I0OA 3KV5A 4NUUA 4JI8T 2NTXA 2J47A 1IJ6A 1FEWA 3RHWA 4DBRA 1HNZT 2UXCT 4B3RT 2WU2A 2Q9QB 4ZZCA 1V9DA 3AVRA 3O1JA 3K3NA 2V26A 1OXZA 1X79A 1XWMA 4P0BA 2W0GA 2UUAT 3AXJA 4DR1T 3ZMTB 3TLVA 4WZXA 5FVLA 4AQGA 3PUVF 3QB5K 3OKQA 2WDQA 3C50A 3R84B 3DP7A 3VR9A 3AE3A 4AISA 3KV9A 2WU5A 4JI1T 3UT5E 3EAMA 4F6RC 2FBWA 3AE6A 3KBUA 2UUBT 4J2CA 5AQFB 5HCJA 2JMKA 5JR9A 1UUSA 3LBXB 5HEHA 5C8YE 4K0UA 5DQVA 1D1AA 5F8PA 1IBLT 4ILUA 4HFCA 4PK4A 4BA9A 5J0ZA 2D0TA 2V7MA 2W63A 2L3LA 3CVRA 3MXZA 3OYXA 4UVAB 4YTMA 1DU2A 4IHJE 3ZSTA 2H3RA 1JNRA 4HE8A 4QH5A 2A72A 5FL0A 2XY8B 5CA0E 3ZYMA 1KNRA 2D0UA 1XMQT 2CHNA 5ABHA 2KSRA 3Q5WA 2NP9A 1S94A 4HKAA 4O8SA 5AQVB 5L3CB 2Y48B 4ZS3A 4LMKA 2NOXA 3PU8A 2W66A 4X1YE 1WLXA 4F8HA 2UXDT 1BR4A 3PJAA 3ETUA 5JQGE 3F2EA 3H37A 3PUAA 4H63H 4H9RC 3I9YA 5HEUA 3ZSSA 3FBZA 3HKEE 3T1HT 4JI7T 3JADA 3S4UA 4QH4A 4TV8E 5FXWA 4EOZB 1IAPA 4Z91A 3P4WA 4ILBA 3MK7C 1O3XA 4O4JE 4JLEA 1HG5A 4PJLA 4QXBB 3RX6A 3F31A 4G2AA 3RKOA 4EYYR 5AQIB 1VCSA 4I43B 2LJLA 2H89A 3AEAA 2XAQB 3P50A 4FI5A 3LSVA 1WFDA 3KBTA 4PAGA 2XQ4A 1WR6A 2ZM2A 2DWGA 2XQYA 2WDVA 3N9LA 1UURA 4H9NC 4IE7A 3C4ZA 5DABA 3X1DA 4ANJA 4X62T 4BJNA 4UELA 2X66A 5CJ5A 4OYJA 1L0VA 4DR5T 2E9XD 2W00A 3T8OA 1VRBA 2LSGA 2VVNA 5AQTB 4AKIA 2N9DA 4EZHA 3L09A 3AA1B 3SWHA 5A1LA 1ZEEA 2FJDA 2KWHA 2FJAA 2MYSA 2JQ9A 3CPZA 4PNIA 1MMGA 2Q9QA 2RP4A 1M62A 5FNVE 4EV6A 4LF9T 4WW0A 3N9PA 2UUCT 2EHOB 4HFVA 3A5XA 4CI2B 3LDQB 1Y64B 3FZMB 4YY3T 4YHHT 1N36T 4OX9T 1FJGT 4KP3C 2KWIB 4DO0A 4OYKA 2BG9C 4IREA 4U3CA 1Y01A 5HAXA 1WR0A 3KVBA 2WWVA 3UU3A 4DR2T 2R6GF 4HWCA 1HTJF 5AQKB 4AXPA 1OEDC 5L4HA 5L3DB 1XNRT 5J2TE 3SS1A 4IE6A 2CA5A 4AKRB 4PJMA 1HNXT 4YLHA 4Z90A 1WYBA 4DR6T 4AIUA 5LGNB 3L3PA 3RKGA 4TNWA 4YSYA 3D0TA 2LSJA 4X1KE 4EEDA 3VRBA 2LHNA 3RIUA 3J7Yq 2I59A 3GA8A 4HWIB 4O4HE 4V1Av 4YTNA 1XDPA 4CXWA 5LMUT 2V8SV 4DR3T 2UXXB 2VL0A 3UU8A 5L4EA 4DV7T 2V6XA 1YQ3A 4MBQA 4OFZA 3QUJA 3ONLC 3CMLA 2HN2A 4X5TA 5AQJB 3LG7A 3N9NA 2BBHA 1EZ3A 4O4IE 2NW8A 1UK5A 4QWNB 2LRLA 3H3AA 5JRCA 1WCRA 3PV0F 4IE5A 5EZYE 2E5VA 2M6BA 3ZT5A 3WI3A 5LJMA 3RIFA 3VKGA 1KF6A 5CGMA 3RGLA 2V5DA 5L3GB 1E7PA 3JC6C 2KNDA 4BAYB 3AA0B 3B5MA 2BBJA 4PK5A 1BR1A 2LSYA 1W9RA 2XUEA 4L0RA 2Y6XA 4LF6T 5LHGB 5HEGA 5FY1A 5IYZE 4YT0A 1XDOA 3ZC1A 5KXJA 2IHR1 2BS4A 2E8IA 2J4GA 2XQ5A 3UQ4A 3ZLIA 3DTOA 5IHYA 3ZT6A 1HX1B 2WM9A 4H9PC 3PUQA 3MACA 5KX5E 3FXEB 5BMVE 4CN6A 2IUBA 3HI2A 1UGOA 3GN5B 2VKOA 4IL9A 2V1DB 4AKLA 5AFUL 5HEJA 5AQMB 3PDYA 4IDNA 2N2NA 2IIUA 3K3QC 2DWKA 5TAOA 3AE5A 4GK0E 4HFDA 1YKEB 2CBJA 2ODVA 3UUNA 4JYAT 3LK3B 4HWDA 2HPJA 3N9MA 3SFEA 2XHEB 1YW0A 2EHOA 2HPLA 5HXEA 4DNDA 2IDOB 1H7CA 2W67A 3B57A 3TKLB 1B7TA 2LKGA 2LKHA 4GYSA 2H7OA 5JVDE 1CUNA 1FIOA 2DHRA 4ASKA 2VL8A 3FZKB 4ERRA 2YOEA 2WZIA 3ZC0A 2J1DG 2VURA 2X51A 2DLRA 3L39A 3W15B 4EAHA 3CQXC 5LNKA 1WYCA 5LP6E 3NWIA 4JI3T 2OA5A 3C4WA 3I0QA 4WYVA 3ZMSB 1J5ET 4AQFC 4WBOA 5AQRB 2XJ7A 3NZQA 2G0UA 3J9X1 4H63V 3ZT7A 4CZZB 5EK2A 2EHOD 2LRKA 2XQ7A 3AEBA 4DIDB 2X68A 4UVBB 1MMNA 4QX8B 4DMVA 4EGWA 1X9BA 5DJQC 1YKHB 2CHOA 5AQGB 1I6ZA 3ZN1B 4ZI3D 4KHPT 4ZI3C 3ZCIA 4OK0A 3ESLA 2K9AA 3V5SA 1YQ4A 2WMOA 3AE1A 2CLYC 3Q2MA 1LVFA 2YDQA 4G63A 1U5PA 4GK5E 4PFOA 3SOLA 1KNZA 1T98A 2ES0A 5IUXA 2ZM8A 4IDPA 3OTOT 2JPFA 3PUZF 4Q25A 5JR9C 2OLTA 2ZLYA 4IL4A 4JEHB 4PJNA 5ABFB 1SUMB 3KV4A 4DV0T 3FZLB 2L9QA 3HKDE 1QUUA 3OPCA 1YXRA 3CK6A 1NWMX 2E9XA 3KFWX 1ZP0A 2DNXA 4OHFA 5J1GA 5HYAA 2A9UA 4PJJA 4UF0B 5HCMA 2ACXA 2CXFA 4AQYT 2QGSA 2VASA 4LF5T 2CXDA 3RRWA 3ZMVB 1HNWT 2CWYA 1XZYA 1MIVA 5H6QB 1US7B 1R8IA 2WAUA 2DCFA 4I4TE 5FP3A 3IF8B 4C91A 5JRCB 2E5LT 3UTKA 4TWHA 3I9WA 2D2SA 3QNUA 2D9DA 3UFGA 4XBFB 4HN9A 4MLKA 1T72A 3K3OA 4ZS2A 3SRZA 1KEYA 2VVSA 4DMWA 4CXYA 3GN5A 4U74A 4TNVA 3V5UA 5GONE 1AJ3A 1HCIA 4JI0T 4EB6E 3CQCB 5ADXL 4EYUA 3CIRA 2YK0A 2AE9A 3U78A 3NRYA 4KI0F 4UEMA 5EK3A 2LEHA 1FMVA 4ZZBA 1D1BA 4O2AE 5CB4E 1T8BA 1HG2A 2W61A 4ILAA 5CA1E 4JBWF 1G73A 1MMAA 3I1AA 1D0ZA 3M65A 2YINA 4TV9E 2PG8A 5LHHB 2KT9A 5LJNA 1GQEA 1UCUA 2NR4A 4YJ3E 3BQIA 1W0AA 3RIUC 5LG3A 2UU9T 3B13A 3O4XE 1HS7A 3OBVE 3ABVA 3FHNA 3H3MA 4GIWA 4KUMB 3C4XA 4QKNA 4A56A 5FKYA 2LE8A 2XZEA 3FZFB 3O1HA 5JDLA 5BR8T 3BQKA 3A8YC 3AE9A 5ABGA 3RQUA 1D1CA 2A3DA 3A7MA 4EZ4A 5H6RB 2WB5A 4AI6A 2XQ9A 1FMWA 3N9OA 3OVUA 4KMCA 5AQPB 3TLTA 2CM0A 2E2AA 3LK2B 4U7IA 5LMNT 1Z0PA 4JI4T 2I0MA 2PTFA 3PURA 3AVSA 2XAJB 5JH7E 1Z8UA 1G8XA 2MOZA 3P7IA 2LM2A 3P8CD 3PJAJ 4YSZA 3TLWA 3AAAB 3AEDA 2DL1A 4NPPA 1MIYA 4YTPA 1NEKA 2IAKA 2WDRA 2Q9QD 3HA4A 3EUHA 3RYHE 2IC9A 1QLBA 3RQWA 2CWOA 2H7VC 2BG9B 4L5GA 1I94T 3JC6D 3WAKA 2LT3A 3HL6A 3KDSE 4HGAA 4Z8XA 4U2YA 1OEDA 4NUVA 3QC9A 4N78D 2AXDS 4BJMA 3AXJB 3N2GE 3AEEA 4ZHQE 5ABFA 3P4SA 1J1JA 2CCQA 3PUGA 1D0XA 3EHZA 1MNDA 4TUYE 4CN4A 5M4YA 4DV4T 3CWZB 1E2AA 2C5JA 2BKOA 2NW7A 1S35A 2E9XB 2XTLA 3TLUA 1OEDE 2JMHA 3R6NA 1SHZC 3VRAA 2YKSA 4JI6T 5JR9B 1VOMA 2VKDA 2C0SA 2X0LB 2LOSA 1SA0E 3LBXA 5LA6E 3IA3A 4MFRA 2VQFT 3UU6A 3MZKB 2XAHB 3VHLA 4UV8B 2DI4A 2XAGB 4M1PA 1M7KA 2XQAA 3CX7B 3RI5A 3ZMUB 4I55E 3UULA 4X66T 2BG9E 3ONXA 1LKXA 3C51A 4L9IA 2BS3A 4X65T 3AA7B 1JNZA 2QA7A 1KK7A
chains in the Genus database with same CATH topology
4JV5T 5IWAT 4X62T 1N33T 4KHPT 4NXNT 4DV2T 4DV5T 4LFBT 1XMOT 4DR5T 1IBKT 4DV6T 4JI2T 4DV1T 4LFCT 3OTOT 4DV3T 2VQET 4LF9T 4DV0T 3T1YT 4JI5T 2UUCT 4LF4T 1N36T 4YHHT 4OX9T 4GKKT 1FJGT 4AQYT 4LF5T 4B3ST 1HNWT 2UXBT 4DR4T 4DR2T 4DR6T 4NXMT 2E5LT 4X64T 1XNRT 4K0KT 1HNXT 4B3TT 4JI0T 2F4VT 1HR0T 4DUYT 5LMUT 4DR3T 4DV7T 2UU9T 4LF8T 5BR8T 4JI8T 4YY3T 1HNZT 4B3RT 4DUZT 5LMNT 1N32T 4JI4T 2UUAT 4DR1T 2ZM6T 1IBMT 4LF6T 4DR7T 4JI1T 4LFAT 1I94T 2UUBT 1IBLT 4LF7T 2UXCT 4DV4T 4JYAT 1XMQT 4GKJT 4JI6T 2UXDT 2HHHT 1N34T 2VQFT 1XNQT 3T1HT 4JI7T 4JI3T 4X66T 4B3MT 1J5ET 4X65T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 T;  5IWA T;  4X62 T;  1N33 T;  4KHP T;  4NXN T;  4DV2 T;  4DV5 T;  4LFB T;  1XMO T;  4DR5 T;  1IBK T;  4DV6 T;  4JI2 T;  4DV1 T;  4LFC T;  3OTO T;  4DV3 T;  2VQE T;  4LF9 T;  4DV0 T;  3T1Y T;  4JI5 T;  2UUC T;  4LF4 T;  1N36 T;  4YHH T;  4OX9 T;  4GKK T;  1FJG T;  4AQY T;  4LF5 T;  4B3S T;  1HNW T;  2UXB T;  4DR4 T;  4DR2 T;  4DR6 T;  4NXM T;  2E5L T;  4X64 T;  1XNR T;  4K0K T;  1HNX T;  4B3T T;  4JI0 T;  2F4V T;  1HR0 T;  4DUY T;  5LMU T;  4DR3 T;  4DV7 T;  2UU9 T;  4LF8 T;  5BR8 T;  4JI8 T;  4YY3 T;  1HNZ T;  4B3R T;  4DUZ T;  5LMN T;  1N32 T;  4JI4 T;  2UUA T;  4DR1 T;  2ZM6 T;  1IBM T;  4LF6 T;  4DR7 T;  4JI1 T;  4LFA T;  1I94 T;  2UUB T;  1IBL T;  4LF7 T;  2UXC T;  4DV4 T;  4JYA T;  1XMQ T;  4GKJ T;  4JI6 T;  2UXD T;  2HHH T;  1N34 T;  2VQF T;  1XNQ T;  3T1H T;  4JI7 T;  4JI3 T;  4X66 T;  4B3M T;  1J5E T;  4X65 T; 
#chains in the Genus database with same CATH topology
 3AE2 A;  4B6X A;  4HWH A;  1LRZ A;  5LGT B;  2JQK A;  2C5I T;  2FJB A;  2HN1 A;  4P0A A;  3LJC A;  3Q5D A;  2ACZ A;  4JV5 T;  5IWA T;  2CE7 A;  2HH7 A;  1SE7 A;  1MNE A;  2XQ6 A;  4GYR A;  2X9X A;  5FL1 A;  1N33 T;  5LYJ E;  5FXX A;  1HFA A;  2VKJ A;  2K3W A;  3ETV A;  5AQQ B;  4LFB T;  2Z6E A;  4QXH B;  1IBK T;  4DV6 T;  1J5W A;  4JI2 T;  4IE4 A;  5L3B B;  2WCA A;  4A98 A;  3EDV A;  3KV6 A;  3ZYK A;  4LFC T;  2ODU A;  3P4P A;  3RYF E;  3ZKR A;  1VCT A;  3U3I A;  2XSA A;  5JDF A;  3ZJ1 A;  2WZH A;  2VQE T;  2QYW A;  4KX6 A;  2V7J A;  3QB5 A;  4JI5 T;  4EEB A;  4ZI2 D;  3E0Z A;  3T1Y T;  2X9Y A;  4U2Z A;  2RPA A;  3HKC E;  2YN6 A;  4HFE A;  4YJ2 E;  5ABE A;  5JRE A;  4IST A;  4DV5 T;  4LF4 T;  1MMD A;  3MKD A;  2V6Y B;  4X20 E;  3JCF A;  2XM1 A;  2YU1 A;  3ANW A;  2X67 A;  5LB7 B;  3WAJ A;  4CXX A;  3OYZ A;  3PUX F;  5AQL B;  2UXB T;  2PBI A;  2XQ8 A;  3UFE A;  4ZI2 C;  2YU2 A;  3AE4 A;  1UX4 A;  5JDQ A;  4DR4 T;  2WBL A;  4NXM T;  4GOU A;  2Y8D A;  2BG9 A;  4QX7 B;  2CEA A;  3Q5X A;  4K0K T;  5E0O A;  1ZKE A;  4IE0 A;  3RYC E;  4I50 E;  1D0Y A;  2BS2 A;  3IBP A;  2CBI A;  3NVO A;  3P4Q A;  5LG4 A;  2X0Y A;  1OED B;  3Q9D A;  2NW9 A;  4U72 A;  2W2U A;  5AQU B;  3RLF F;  2F4V T;  4KBM B;  3LFM A;  2KIN B;  1UX5 A;  4UVC B;  3EVY A;  3Q5E A;  4XZC A;  4EXT A;  1HR0 T;  3JAE A;  1ZOY A;  2LSI A;  2GK9 A;  3ZCJ A;  4AQF A;  2MTQ A;  1KNP A;  2VKH A;  4ZI7 E;  5DQW A;  5HWX A;  4E7S A;  3RYI E;  4DVD A;  3UUX B;  2KZ7 B;  4DUY T;  5FXZ A;  3G06 A;  2CRB A;  2XM2 A;  4MAL A;  5LBQ B;  1QSD A;  2YDR A;  2KMF A;  2H88 A;  2CLY B;  2WSS V;  3FXD B;  3EI0 A;  3PE0 A;  4LF8 T;  5C2T A;  4XAX B;  4DV3 T;  4UR9 A;  2LLY A;  1T7S A;  4HEA A;  3AEG A;  5C3J A;  5LHI B;  3AB3 B;  4QH1 A;  2M67 A;  3AEC A;  5FY7 A;  3SFD A;  3UQ7 A;  3VR8 A;  3O1I A;  4TN7 B;  4LML A;  4DUZ T;  2YEV C;  1N32 T;  1W09 A;  2FUP A;  3M3Z B;  2SPC A;  1NEN A;  1ZV4 X;  2BDE A;  2LOP A;  3AE8 A;  3N9Q A;  4PFP A;  3ZPO A;  1KFY A;  3BK9 A;  2IC6 A;  3NRX A;  2XSB A;  2BZB A;  2NWB A;  3AA6 B;  4DBQ A;  4AKH A;  4IDO A;  3PUS A;  3E08 A;  2ZM6 T;  2E9X C;  5AQO B;  5HEO A;  1IBM T;  4PW8 A;  3UU5 A;  1ZHC A;  3RRC A;  4DR7 T;  2BKP A;  3PTR B;  4TWF A;  2NTY A;  2W62 A;  4YHJ A;  2MPK A;  5HXC A;  4LFA T;  1BR0 A;  2XPK A;  1WRD A;  3ZJ2 A;  2ZMA A;  2QVA A;  2Q9Q C;  3IEE A;  2JRK A;  4P09 A;  4EIW A;  3K8P C;  4U7Y A;  4ZOL E;  4LF7 T;  1BR2 A;  4PK6 A;  5L3E B;  5HWY A;  5LBM A;  2V7L A;  4YSX A;  2K48 A;  3ZMZ B;  4UXN B;  5AQS B;  3EDU A;  2MBG A;  3ONJ A;  2N1G A;  2LSK A;  4ILC A;  3GWH A;  5AQH B;  4U31 A;  4HFB A;  4TZ4 C;  3NKZ A;  2V6Y A;  5AQN B;  4YFS A;  3UU4 A;  3VU7 H;  2FJE A;  2V5C A;  3HKB E;  3ANW B;  3E22 E;  3L8R A;  3C64 A;  3NBX X;  2CPT A;  4IDQ A;  2K5B B;  3EAB A;  2WP9 A;  4I0U A;  2WQY A;  5LXT E;  2IML A;  4IDZ A;  4ZEY A;  1N34 T;  2HHH T;  1NAF A;  3QK6 A;  4MHC A;  3DJB A;  4IGU A;  2OV9 A;  2XQ3 A;  4HFH A;  3KIN B;  4QHO A;  5JTG A;  5LGU B;  1XNQ T;  2JIW A;  3CX6 B;  4COF A;  3BQL A;  3ZN0 B;  4H9O C;  4IT4 A;  5LOV E;  2J62 A;  3ZEF B;  4B3M T;  5EK4 A;  5HXS A;  5HXH A;  3AEF A;  3IHR A;  3PUW F;  5F5W A;  3N5L A;  4HFI A;  2RA1 A;  4H9S E;  3RH3 A;  4C90 A;  4H9Q C;  4E7Z A;  3AAI A;  5ETW A;  2D5U A;  5JDG A;  1IZN B;  2WWU A;  2IW5 B;  4YXD A;  2A2F X;  4QXC B;  3P4R A;  3CKD A;  3FZH B;  2YDS A;  3N2O A;  4CI3 B;  5KMG P;  4HTE A;  4FJO A;  5LCY A;  5L47 A;  4O2B E;  4NXN T;  2X0H A;  4O4L E;  3ZYL A;  4DV2 T;  2VWA A;  1XMO T;  5FVK A;  4A5X A;  5KDM C;  2X9H A;  2LHR A;  3UUM A;  2B76 A;  2PJQ A;  4DV1 T;  3NZP A;  2BVL A;  2JQH A;  3AE7 A;  3MJX A;  1LVK A;  2JJ9 A;  2BKN A;  1IJ5 A;  2W4X A;  3UUB A;  5FYM A;  2VK9 A;  1HF8 A;  3VKH A;  4KHZ F;  1OWA A;  2VB6 A;  4JUY A;  1HX8 A;  1W0B A;  2X9W A;  4GKK T;  4JEU B;  3KVA A;  3C98 B;  5FY0 A;  4B3S T;  3MA9 A;  5HXR A;  5F3J A;  1MIW A;  2PFV A;  2L8K A;  3PUY F;  5JDH A;  3GMI A;  4A97 A;  4WNK A;  2WS3 A;  2XAS B;  4ZXL A;  2B1E A;  2KXP B;  2XAF B;  3FB2 A;  4TX5 A;  3QOF A;  2UXN B;  3F57 A;  3RIA A;  4X64 T;  3RC8 A;  4TWD A;  4WBN E;  2C5K T;  3OJA A;  1YD8 G;  2CXL A;  4CN1 A;  4HWF A;  5JDM A;  1E1H B;  4ADZ A;  3N2K E;  3RPU A;  4U33 A;  5CFB A;  4B3T T;  2K24 A;  5L2L A;  5L3F B;  3FBL A;  4UF0 A;  2EHO C;  3AAE B;  2M6I A;  4CI1 B;  2I6H A;  2P9B A;  2WY2 A;  1U4Q A;  4X1I E;  4ISS A;  4UIG A;  3O9X A;  4AKG A;  2V7I A;  1CHU A;  3CX8 B;  3K1S A;  2MAW A;  3LK4 2;  3RC3 A;  5JDN A;  3PU3 A;  4LMJ A;  4GKJ T;  2BVM A;  4UV9 B;  4NIQ A;  3TLS A;  5J2U E;  2JQQ A;  5FMN A;  3RF1 A;  4P1N A;  5FXV A;  4IIJ E;  2KLQ A;  2V7K A;  2LM9 A;  3CQG B;  2CMR A;  3JAF A;  2QRX A;  4CQI A;  2WMN A;  2ZM0 A;  3HR0 A;  3I0O A;  3KV5 A;  4NUU A;  4JI8 T;  2NTX A;  2J47 A;  1IJ6 A;  1FEW A;  3RHW A;  4DBR A;  1HNZ T;  2UXC T;  4B3R T;  2WU2 A;  2Q9Q B;  4ZZC A;  1V9D A;  3AVR A;  3O1J A;  3K3N A;  2V26 A;  1OXZ A;  1X79 A;  1XWM A;  4P0B A;  2W0G A;  2UUA T;  3AXJ A;  4DR1 T;  3ZMT B;  3TLV A;  4WZX A;  5FVL A;  4AQG A;  3PUV F;  3QB5 K;  3OKQ A;  2WDQ A;  3C50 A;  3R84 B;  3DP7 A;  3VR9 A;  3AE3 A;  4AIS A;  3KV9 A;  2WU5 A;  4JI1 T;  3UT5 E;  3EAM A;  4F6R C;  2FBW A;  3AE6 A;  3KBU A;  2UUB T;  4J2C A;  5AQF B;  5HCJ A;  2JMK A;  5JR9 A;  1UUS A;  3LBX B;  5HEH A;  5C8Y E;  4K0U A;  5DQV A;  1D1A A;  5F8P A;  1IBL T;  4ILU A;  4HFC A;  4PK4 A;  4BA9 A;  5J0Z A;  2D0T A;  2V7M A;  2W63 A;  2L3L A;  3CVR A;  3MXZ A;  3OYX A;  4UVA B;  4YTM A;  1DU2 A;  4IHJ E;  3ZST A;  2H3R A;  1JNR A;  4HE8 A;  4QH5 A;  2A72 A;  5FL0 A;  2XY8 B;  5CA0 E;  3ZYM A;  1KNR A;  2D0U A;  1XMQ T;  2CHN A;  5ABH A;  2KSR A;  3Q5W A;  2NP9 A;  1S94 A;  4HKA A;  4O8S A;  5AQV B;  5L3C B;  2Y48 B;  4ZS3 A;  4LMK A;  2NOX A;  3PU8 A;  2W66 A;  4X1Y E;  1WLX A;  4F8H A;  2UXD T;  1BR4 A;  3PJA A;  3ETU A;  5JQG E;  3F2E A;  3H37 A;  3PUA A;  4H63 H;  4H9R C;  3I9Y A;  5HEU A;  3ZSS A;  3FBZ A;  3HKE E;  3T1H T;  4JI7 T;  3JAD A;  3S4U A;  4QH4 A;  4TV8 E;  5FXW A;  4EOZ B;  1IAP A;  4Z91 A;  3P4W A;  4ILB A;  3MK7 C;  1O3X A;  4O4J E;  4JLE A;  1HG5 A;  4PJL A;  4QXB B;  3RX6 A;  3F31 A;  4G2A A;  3RKO A;  4EYY R;  5AQI B;  1VCS A;  4I43 B;  2LJL A;  2H89 A;  3AEA A;  2XAQ B;  3P50 A;  4FI5 A;  3LSV A;  1WFD A;  3KBT A;  4PAG A;  2XQ4 A;  1WR6 A;  2ZM2 A;  2DWG A;  2XQY A;  2WDV A;  3N9L A;  1UUR A;  4H9N C;  4IE7 A;  3C4Z A;  5DAB A;  3X1D A;  4ANJ A;  4X62 T;  4BJN A;  4UEL A;  2X66 A;  5CJ5 A;  4OYJ A;  1L0V A;  4DR5 T;  2E9X D;  2W00 A;  3T8O A;  1VRB A;  2LSG A;  2VVN A;  5AQT B;  4AKI A;  2N9D A;  4EZH A;  3L09 A;  3AA1 B;  3SWH A;  5A1L A;  1ZEE A;  2FJD A;  2KWH A;  2FJA A;  2MYS A;  2JQ9 A;  3CPZ A;  4PNI A;  1MMG A;  2Q9Q A;  2RP4 A;  1M62 A;  5FNV E;  4EV6 A;  4LF9 T;  4WW0 A;  3N9P A;  2UUC T;  2EHO B;  4HFV A;  3A5X A;  4CI2 B;  3LDQ B;  1Y64 B;  3FZM B;  4YY3 T;  4YHH T;  1N36 T;  4OX9 T;  1FJG T;  4KP3 C;  2KWI B;  4DO0 A;  4OYK A;  2BG9 C;  4IRE A;  4U3C A;  1Y01 A;  5HAX A;  1WR0 A;  3KVB A;  2WWV A;  3UU3 A;  4DR2 T;  2R6G F;  4HWC A;  1HTJ F;  5AQK B;  4AXP A;  1OED C;  5L4H A;  5L3D B;  1XNR T;  5J2T E;  3SS1 A;  4IE6 A;  2CA5 A;  4AKR B;  4PJM A;  1HNX T;  4YLH A;  4Z90 A;  1WYB A;  4DR6 T;  4AIU A;  5LGN B;  3L3P A;  3RKG A;  4TNW A;  4YSY A;  3D0T A;  2LSJ A;  4X1K E;  4EED A;  3VRB A;  2LHN A;  3RIU A;  3J7Y q;  2I59 A;  3GA8 A;  4HWI B;  4O4H E;  4V1A v;  4YTN A;  1XDP A;  4CXW A;  5LMU T;  2V8S V;  4DR3 T;  2UXX B;  2VL0 A;  3UU8 A;  5L4E A;  4DV7 T;  2V6X A;  1YQ3 A;  4MBQ A;  4OFZ A;  3QUJ A;  3ONL C;  3CML A;  2HN2 A;  4X5T A;  5AQJ B;  3LG7 A;  3N9N A;  2BBH A;  1EZ3 A;  4O4I E;  2NW8 A;  1UK5 A;  4QWN B;  2LRL A;  3H3A A;  5JRC A;  1WCR A;  3PV0 F;  4IE5 A;  5EZY E;  2E5V A;  2M6B A;  3ZT5 A;  3WI3 A;  5LJM A;  3RIF A;  3VKG A;  1KF6 A;  5CGM A;  3RGL A;  2V5D A;  5L3G B;  1E7P A;  3JC6 C;  2KND A;  4BAY B;  3AA0 B;  3B5M A;  2BBJ A;  4PK5 A;  1BR1 A;  2LSY A;  1W9R A;  2XUE A;  4L0R A;  2Y6X A;  4LF6 T;  5LHG B;  5HEG A;  5FY1 A;  5IYZ E;  4YT0 A;  1XDO A;  3ZC1 A;  5KXJ A;  2IHR 1;  2BS4 A;  2E8I A;  2J4G A;  2XQ5 A;  3UQ4 A;  3ZLI A;  3DTO A;  5IHY A;  3ZT6 A;  1HX1 B;  2WM9 A;  4H9P C;  3PUQ A;  3MAC A;  5KX5 E;  3FXE B;  5BMV E;  4CN6 A;  2IUB A;  3HI2 A;  1UGO A;  3GN5 B;  2VKO A;  4IL9 A;  2V1D B;  4AKL A;  5AFU L;  5HEJ A;  5AQM B;  3PDY A;  4IDN A;  2N2N A;  2IIU A;  3K3Q C;  2DWK A;  5TAO A;  3AE5 A;  4GK0 E;  4HFD A;  1YKE B;  2CBJ A;  2ODV A;  3UUN A;  4JYA T;  3LK3 B;  4HWD A;  2HPJ A;  3N9M A;  3SFE A;  2XHE B;  1YW0 A;  2EHO A;  2HPL A;  5HXE A;  4DND A;  2IDO B;  1H7C A;  2W67 A;  3B57 A;  3TKL B;  1B7T A;  2LKG A;  2LKH A;  4GYS A;  2H7O A;  5JVD E;  1CUN A;  1FIO A;  2DHR A;  4ASK A;  2VL8 A;  3FZK B;  4ERR A;  2YOE A;  2WZI A;  3ZC0 A;  2J1D G;  2VUR A;  2X51 A;  2DLR A;  3L39 A;  3W15 B;  4EAH A;  3CQX C;  5LNK A;  1WYC A;  5LP6 E;  3NWI A;  4JI3 T;  2OA5 A;  3C4W A;  3I0Q A;  4WYV A;  3ZMS B;  1J5E T;  4AQF C;  4WBO A;  5AQR B;  2XJ7 A;  3NZQ A;  2G0U A;  3J9X 1;  4H63 V;  3ZT7 A;  4CZZ B;  5EK2 A;  2EHO D;  2LRK A;  2XQ7 A;  3AEB A;  4DID B;  2X68 A;  4UVB B;  1MMN A;  4QX8 B;  4DMV A;  4EGW A;  1X9B A;  5DJQ C;  1YKH B;  2CHO A;  5AQG B;  1I6Z A;  3ZN1 B;  4ZI3 D;  4KHP T;  4ZI3 C;  3ZCI A;  4OK0 A;  3ESL A;  2K9A A;  3V5S A;  1YQ4 A;  2WMO A;  3AE1 A;  2CLY C;  3Q2M A;  1LVF A;  2YDQ A;  4G63 A;  1U5P A;  4GK5 E;  4PFO A;  3SOL A;  1KNZ A;  1T98 A;  2ES0 A;  5IUX A;  2ZM8 A;  4IDP A;  3OTO T;  2JPF A;  3PUZ F;  4Q25 A;  5JR9 C;  2OLT A;  2ZLY A;  4IL4 A;  4JEH B;  4PJN A;  5ABF B;  1SUM B;  3KV4 A;  4DV0 T;  3FZL B;  2L9Q A;  3HKD E;  1QUU A;  3OPC A;  1YXR A;  3CK6 A;  1NWM X;  2E9X A;  3KFW X;  1ZP0 A;  2DNX A;  4OHF A;  5J1G A;  5HYA A;  2A9U A;  4PJJ A;  4UF0 B;  5HCM A;  2ACX A;  2CXF A;  4AQY T;  2QGS A;  2VAS A;  4LF5 T;  2CXD A;  3RRW A;  3ZMV B;  1HNW T;  2CWY A;  1XZY A;  1MIV A;  5H6Q B;  1US7 B;  1R8I A;  2WAU A;  2DCF A;  4I4T E;  5FP3 A;  3IF8 B;  4C91 A;  5JRC B;  2E5L T;  3UTK A;  4TWH A;  3I9W A;  2D2S A;  3QNU A;  2D9D A;  3UFG A;  4XBF B;  4HN9 A;  4MLK A;  1T72 A;  3K3O A;  4ZS2 A;  3SRZ A;  1KEY A;  2VVS A;  4DMW A;  4CXY A;  3GN5 A;  4U74 A;  4TNV A;  3V5U A;  5GON E;  1AJ3 A;  1HCI A;  4JI0 T;  4EB6 E;  3CQC B;  5ADX L;  4EYU A;  3CIR A;  2YK0 A;  2AE9 A;  3U78 A;  3NRY A;  4KI0 F;  4UEM A;  5EK3 A;  2LEH A;  1FMV A;  4ZZB A;  1D1B A;  4O2A E;  5CB4 E;  1T8B A;  1HG2 A;  2W61 A;  4ILA A;  5CA1 E;  4JBW F;  1G73 A;  1MMA A;  3I1A A;  1D0Z A;  3M65 A;  2YIN A;  4TV9 E;  2PG8 A;  5LHH B;  2KT9 A;  5LJN A;  1GQE A;  1UCU A;  2NR4 A;  4YJ3 E;  3BQI A;  1W0A A;  3RIU C;  5LG3 A;  2UU9 T;  3B13 A;  3O4X E;  1HS7 A;  3OBV E;  3ABV A;  3FHN A;  3H3M A;  4GIW A;  4KUM B;  3C4X A;  4QKN A;  4A56 A;  5FKY A;  2LE8 A;  2XZE A;  3FZF B;  3O1H A;  5JDL A;  5BR8 T;  3BQK A;  3A8Y C;  3AE9 A;  5ABG A;  3RQU A;  1D1C A;  2A3D A;  3A7M A;  4EZ4 A;  5H6R B;  2WB5 A;  4AI6 A;  2XQ9 A;  1FMW A;  3N9O A;  3OVU A;  4KMC A;  5AQP B;  3TLT A;  2CM0 A;  2E2A A;  3LK2 B;  4U7I A;  5LMN T;  1Z0P A;  4JI4 T;  2I0M A;  2PTF A;  3PUR A;  3AVS A;  2XAJ B;  5JH7 E;  1Z8U A;  1G8X A;  2MOZ A;  3P7I A;  2LM2 A;  3P8C D;  3PJA J;  4YSZ A;  3TLW A;  3AAA B;  3AED A;  2DL1 A;  4NPP A;  1MIY A;  4YTP A;  1NEK A;  2IAK A;  2WDR A;  2Q9Q D;  3HA4 A;  3EUH A;  3RYH E;  2IC9 A;  1QLB A;  3RQW A;  2CWO A;  2H7V C;  2BG9 B;  4L5G A;  1I94 T;  3JC6 D;  3WAK A;  2LT3 A;  3HL6 A;  3KDS E;  4HGA A;  4Z8X A;  4U2Y A;  1OED A;  4NUV A;  3QC9 A;  4N78 D;  2AXD S;  4BJM A;  3AXJ B;  3N2G E;  3AEE A;  4ZHQ E;  5ABF A;  3P4S A;  1J1J A;  2CCQ A;  3PUG A;  1D0X A;  3EHZ A;  1MND A;  4TUY E;  4CN4 A;  5M4Y A;  4DV4 T;  3CWZ B;  1E2A A;  2C5J A;  2BKO A;  2NW7 A;  1S35 A;  2E9X B;  2XTL A;  3TLU A;  1OED E;  2JMH A;  3R6N A;  1SHZ C;  3VRA A;  2YKS A;  4JI6 T;  5JR9 B;  1VOM A;  2VKD A;  2C0S A;  2X0L B;  2LOS A;  1SA0 E;  3LBX A;  5LA6 E;  3IA3 A;  4MFR A;  2VQF T;  3UU6 A;  3MZK B;  2XAH B;  3VHL A;  4UV8 B;  2DI4 A;  2XAG B;  4M1P A;  1M7K A;  2XQA A;  3CX7 B;  3RI5 A;  3ZMU B;  4I55 E;  3UUL A;  4X66 T;  2BG9 E;  3ONX A;  1LKX A;  3C51 A;  4L9I A;  2BS3 A;  4X65 T;  3AA7 B;  1JNZ A;  2QA7 A;  1KK7 A; 
#chains in the Genus database with same CATH homology
 4JV5 T;  5IWA T;  4X62 T;  1N33 T;  4KHP T;  4NXN T;  4DV2 T;  4DV5 T;  4LFB T;  1XMO T;  4DR5 T;  1IBK T;  4DV6 T;  4JI2 T;  4DV1 T;  4LFC T;  3OTO T;  4DV3 T;  2VQE T;  4LF9 T;  4DV0 T;  3T1Y T;  4JI5 T;  2UUC T;  4LF4 T;  1N36 T;  4YHH T;  4OX9 T;  4GKK T;  1FJG T;  4AQY T;  4LF5 T;  4B3S T;  1HNW T;  2UXB T;  4DR4 T;  4DR2 T;  4DR6 T;  4NXM T;  2E5L T;  4X64 T;  1XNR T;  4K0K T;  1HNX T;  4B3T T;  4JI0 T;  2F4V T;  1HR0 T;  4DUY T;  5LMU T;  4DR3 T;  4DV7 T;  2UU9 T;  4LF8 T;  5BR8 T;  4JI8 T;  4YY3 T;  1HNZ T;  4B3R T;  4DUZ T;  5LMN T;  1N32 T;  4JI4 T;  2UUA T;  4DR1 T;  2ZM6 T;  1IBM T;  4LF6 T;  4DR7 T;  4JI1 T;  4LFA T;  1I94 T;  2UUB T;  1IBL T;  4LF7 T;  2UXC T;  4DV4 T;  4JYA T;  1XMQ T;  4GKJ T;  4JI6 T;  2UXD T;  2HHH T;  1N34 T;  2VQF T;  1XNQ T;  3T1H T;  4JI7 T;  4JI3 T;  4X66 T;  4B3M T;  1J5E T;  4X65 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...