4LF4T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf4T00
4DR3T 1IBLT 3OTOT 1IBKT 4DV4T 1HNXT 1N34T 5LMUT 2F4VT 4DV6T 4LF9T 4X62T 4K0KT 1J5ET 5IWAT 4DR7T 1HNZT 1IBMT 4DV0T 4JI5T 4DR1T 4B3ST 1FJGT 3T1YT 4B3RT 4LFCT 4JI4T 4DV1T 4JI3T 1N36T 4LFAT 4X65T 4OX9T 4DV7T 4DR4T 4X64T 2VQFT 2ZM6T 2UXBT 5BR8T 4LF7T 4KHPT 2UUBT 4DUYT 4GKJT 4JI0T 4DUZT 4AQYT 3T1HT 5LMNT 2UUCT 4GKKT 4DR5T 4LFBT 2UXCT 1HR0T 2VQET 1XMOT 4LF4T 1XNQT 4JI8T 4JI6T 4DR6T 1N33T 2E5LT 4DV2T 4NXNT 2HHHT 1N32T 4JYAT 4DR2T 4JI1T 4B3TT 4DV3T 2UU9T 4LF5T 1HNWT 2UUAT 4JV5T 2UXDT 1XMQT 4JI2T 4JI7T 1XNRT 4LF6T 4DV5T 4X66T 1I94T 4NXMT 4YY3T 4YHHT 4LF8T 4B3MT
chains in the Genus database with same CATH superfamily
2HN1A 3M65A 3AE1A 4YSZA 4DBRA 3K1SA 1HF8A 3UU8A 2WWUA 3A8YC 4NIQA 3O9XA 2VKHA 1HNZT 2CE7A 5AQKB 2FBWA 4Z8XA 5FKYA 4B6XA 2P9BA 3UFEA 4LFCT 4JI4T 4HGAA 2K48A 2XSAA 3AEEA 4XZCA 4PK4A 4AKHA 2V7MA 2ZM0A 4DMVA 2CBJA 4X20E 3FB2A 2UUCT 3U3IA 5FVLA 2K5BB 2JQHA 4MALA 4KHZF 2X9YA 1IJ5A 4TN7B 1G8XA 3AE7A 4IREA 2AXDS 2EHOA 2YK0A 3LBXA 3VR9A 5JRCA 4PJJA 4PJMA 4IDOA 4H9OC 3PUWF 2WS3A 4QKNA 2JJ9A 4MHCA 5LHHB 4PJNA 4CQIA 4YTMA 2X51A 2YINA 3IHRA 4TWFA 3UTKA 2LT3A 2KZ7B 4JLEA 4PJLA 4H9RC 4TNVA 1HG2A 2NP9A 1ZP0A 2WB5A 4KI0F 3K3NA 5LMUT 5L3DB 4UVAB 3ZMUB 4X62T 1EZ3A 4HN9A 2EHOC 3AEBA 2X9HA 3RH3A 4EIWA 3ZLIA 2VVNA 2W67A 4HE8A 1MMGA 2WU2A 2W62A 4DIDB 3CPZA 5AQGB 4U31A 3EABA 3Q5XA 5ADXL 2FUPA 2PBIA 3B13A 2B76A 2XM1A 2I0MA 1VCTA 5M4YA 3JAFA 1UURA 5CA1E 4GKKT 4JEHB 2LE8A 2UXCT 2R6GF 4ILBA 5FY0A 2XUEA 4EV6A 5IUXA 5LYJE 2BDEA 4GK5E 5LHGB 3E0ZA 3P4WA 2X0HA 2D5UA 3CIRA 1UX4A 4ZS3A 1D0ZA 2CXDA 3ZN1B 2N2NA 2VVSA 3N9QA 1T8BA 4ZEYA 3PUXF 2UUAT 5L47A 3FZFB 2YDRA 4PFPA 2JIWA 3UUXB 1S94A 3CX7B 3IBPA 3EUHA 4YHHT 4ISTA 4EGWA 4U7YA 3PDYA 3DJBA 3OYXA 2CMRA 4U74A 2XAQB 2J4GA 4HWIB 1UK5A 3RRCA 4XBFB 2CCQA 1E1HB 4F8HA 1FMVA 4IE7A 4HTEA 4EZHA 1Z0PA 5BMVE 1YXRA 5H6RB 3C50A 4AKIA 2YDQA 4ZI2C 2Q9QC 5FNVE 4YHJA 3PURA 4YJ2E 3ZSSA 5L3BB 3T1HT 3TLVA 1IJ6A 4AISA 3RYIE 5ABFB 5FXZA 1SA0E 2X68A 4YTPA 5LCYA 4JI8T 3AEGA 1MNDA 3JCFA 2LJLA 2XQAA 2NW9A 4JI1T 1NENA 3AEFA 2FJBA 2WQYA 3IA3A 4CN4A 2BBHA 2E5VA 2RP4A 2JMHA 4JI7T 5KX5E 4G2AA 4JBWF 1X9BA 2X9WA 4TV8E 5E0OA 2XM2A 3ZT5A 3FZKB 4G63A 3N9LA 4YJ3E 4TZ4C 4QHOA 5ETWA 4O4HE 4P0BA 1MMAA 4HFIA 2XAJB 2PTFA 2W00A 1US7B 2A72A 3OVUA 3J9X1 5JDMA 2XQ8A 4OK0A 4YSYA 3VRBA 4MFRA 4ADZA 4JI5T 4DR1T 2OA5A 2MPKA 4L9IA 1OWAA 4PNIA 2MTQA 5L3CB 3HR0A 4DBQA 1KF6A 5AQJB 2M6BA 2BVMA 4DVDA 3AECA 4WZXA 4UIGA 3PUGA 2A9UA 5HEGA 2HPJA 2YOEA 3EAMA 2QA7A 2ACXA 4IGUA 5HEOA 1ZOYA 5HWYA 4ILAA 1LVFA 3FBZA 3DTOA 4UELA 4AXPA 3UU5A 3RC3A 2N1GA 3KV6A 2DNXA 3KBUA 5L3EB 2DI4A 3P8CD 5LG3A 3M3ZB 2LHNA 2YKSA 3GN5A 3IF8B 1GQEA 3UULA 4XAXB 3UQ7A 3TLTA 3NKZA 2G0UA 2GK9A 2XAFB 2HH7A 3H3MA 2M6IA 4IIJE 1MMNA 4B3MT 2IHR1 3UFGA 3F31A 3P4PA 4QH4A 2JRKA 4O4IE 3I9WA 4DNDA 2XQ4A 1M7KA 2YEVC 1D1CA 3UUMA 4NPPA 5IWAT 3DP7A 3VHLA 1OEDE 5ABGA 3PUSA 4LFAT 4O2BE 5TAOA 2NW7A 3NRXA 2IW5B 4IE0A 2LKGA 3AE8A 3AVSA 2QYWA 2WMOA 5C2TA 5J2UE 2UUBT 4DUZT 4AQYT 3EHZA 1J1JA 4YXDA 4LFBT 4UR9A 4AQGA 3QK6A 1XMOT 3ZYLA 3IEEA 3MACA 3N9OA 3NZPA 4QX7B 4JI6T 4UF0A 5F5WA 3EDVA 3UQ4A 2E9XB 2V7KA 3SS1A 5J0ZA 5J2TE 1MIWA 1HX8A 3JC6C 4AQFA 1OEDA 2H7OA 3EI0A 1XMQT 2ODUA 1BR2A 4ZHQE 2Y8DA 2NW8A 3QOFA 4IDZA 1W0AA 3RQUA 3ETVA 2V6YA 4Z90A 2VKOA 2FJEA 4UV9B 3I0OA 3N9PA 1WLXA 4K0KT 2N9DA 5A1LA 4DR7T 4KUMB 2W63A 3LDQB 3LK2B 2ZMAA 3K3QC 3OYZA 1KNZA 2CLYC 3I9YA 2FJAA 3JADA 3PU8A 5FMNA 2CBIA 4OHFA 5EK3A 4UVCB 4YT0A 4DR4T 3AAEB 4MLKA 1YKEB 3P50A 4QXCB 2JPFA 3FBLA 2ZM6T 2UXBT 3RC8A 3NRYA 1HG5A 2M67A 1WYCA 4PW8A 5HXSA 4U2ZA 4JI0T 2JMKA 2XY8B 5LMNT 3QNUA 4QWNB 2VQET 1G73A 3V5SA 4TX5A 2PFVA 3ZJ2A 3AAAB 3KVAA 4ZS2A 3Q5WA 3QC9A 5HYAA 2BG9A 2VB6A 4A5XA 3KFWX 2D9DA 3HKCE 1ZKEA 2PJQA 4NUVA 4ZOLE 4AKGA 3ONLC 3ZPOA 3KV4A 2ACZA 3KBTA 2H3RA 3LSVA 1HNXT 4CI1B 5JREA 4KBMB 1YW0A 3AA0B 2Z6EA 3MKDA 2VK9A 4CZZB 1R8IA 4WNKA 2V6XA 2BG9C 2KWHA 5DABA 1T72A 4L0RA 4ASKA 3FHNA 4CXXA 3B57A 1N36T 2XZEA 3H3AA 3ANWB 5AQNB 4X1KE 4PK6A 3PUVF 3N2GE 3HL6A 3TLUA 3AE4A 5BR8T 2MOZA 5HCMA 5JH7E 2XTLA 2KINB 1D1BA 2I59A 3H37A 3AVRA 1WYBA 4ZI3D 5EZYE 4TWDA 3KVBA 3NBXX 5LA6E 2XHEB 5GONE 4DV2T 2XQ6A 4U7IA 4HFHA 4H9NC 2NWBA 2VURA 2KMFA 2ZLYA 5AQOB 4DV3T 3AE5A 2KXPB 2DWKA 1LRZA 1HNWT 3ABVA 1Y64B 1KFYA 1LVKA 2Y48B 5JDFA 2UXDT 4WBNE 1LKXA 2DWGA 2V7LA 4LMJA 5FXXA 3L3PA 5HEJA 4BAYB 3L39A 5L2LA 3O4XE 1WRDA 4Q25A 4EAHA 2IAKA 4EEBA 4AKRB 3ESLA 5H6QB 4KMCA 5LJNA 2WDRA 1OEDB 2HPLA 3HI2A 1ZEEA 1XDPA 4IDPA 5JQGE 1HX1B 4UVBB 4HWDA 3AXJB 2X0YA 3RYHE 4ZI7E 5F3JA 1X79A 4B3ST 2V6YB 1FJGT 3J7Yq 2Q9QA 4IL9A 4JEUB 5CFBA 4DV7T 5KMGP 4OYKA 3S4UA 2WU5A 3AB3B 3VR8A 2LLYA 4LF7T 3CK6A 1NWMX 4ZZCA 4U2YA 4C91A 3PUQA 1KEYA 2WZHA 2KT9A 3SWHA 1XNQT 3LK3B 3BK9A 3TLSA 3CKDA 3CX8B 2MBGA 3ZYKA 1L0VA 4IDNA 2HN2A 2L9QA 4IE5A 3VU7H 3MK7C 1T7SA 3ZCJA 2FJDA 5LG4A 2VL8A 2WM9A 4P0AA 1T98A 5JR9A 4DV5T 4ISSA 4KP3C 5HCJA 3PE0A 2LM2A 3RYCE 1D0XA 5AQLB 3AE2A 2CXLA 3L8RA 4IT4A 2XQ5A 3W15B 3ZSTA 4DV4T 1IBKT 4TWHA 4QH1A 4NUUA 2XAHB 4QXHB 1MIVA 5JDNA 4EYYR 2XJ7A 4ILCA 2L8KA 3PUAA 1SUMB 4DO0A 5FP3A 4ERRA 3TLWA 3V5UA 2EHOB 3LBXB 3WAKA 3BQIA 5ABHA 5JRCB 3R6NA 5HWXA 4JI3T 1HCIA 4DMWA 5JR9C 4A56A 3O1HA 2J1DG 3CQCB 2W66A 5L4HA 4ANJA 5HEUA 5FL1A 5FXWA 3O1IA 1WCRA 1I6ZA 3RI5A 1W0BA 2X0LB 3MJXA 1KNRA 5C3JA 1HR0T 4IL4A 2LHRA 3RLFF 5AQTB 1N33T 2E5LT 4H63H 5FY7A 3RIAA 3LK42 4GOUA 3HKEE 4HEAA 3FZMB 1XDOA 2XQ7A 2BKOA 3AA6B 3RKGA 2V26A 1HFAA 2LOPA 3QB5K 2YDSA 5LP6E 4X66T 2LSYA 5FYMA 2J62A 1QLBA 4LF8T 2H89A 4FI5A 2WBLA 3ZYMA 2XQ3A 3GMIA 3MZKB 2BVLA 3E22E 4X1YE 3PJAA 2BKNA 3K8PC 2K24A 2ODVA 3SFDA 4E7SA 5FY1A 4ZI3C 2YU1A 4IDQA 4CXWA 2YU2A 4OX9T 3WAJA 4M1PA 3ONJA 4X64T 2BZBA 2VQFT 3PV0F 5L3FB 3C4ZA 3GA8A 4QX8B 3UU6A 5C8YE 1W9RA 2WSSV 1ZV4X 3P4RA 2H7VC 1WR0A 4A97A 3EDUA 3RIUA 5IYZE 3MXZA 3K3OA 4LMLA 4NXNT 2RPAA 3ZKRA 5JDLA 1B7TA 3JAEA 4B3TT 2CWOA 5AQQB 4GK0E 2IDOB 5LGUB 4JI2T 4O2AE 2V7IA 3SOLA 2X9XA 3A7MA 3RQWA 1MNEA 2E2AA 3VKGA 5AQUB 2C5KT 4WW0A 2WY2A 1NEKA 3ZN0B 3CX6B 4BJNA 4WBOA 3RIUC 4EB6E 3PJAJ 3T8OA 2ZM2A 2QGSA 4GYSA 4J2CA 1WR6A 1OXZA 2YN6A 1IZNB 1QUUA 3G06A 3PTRB 4ILUA 4EZ4A 5JDQA 2WZIA 4TUYE 3D0TA 4GIWA 3EVYA 4P1NA 4PAGA 1UCUA 2BG9E 4ZI2D 3AAIA 3OJAA 3OKQA 2MYSA 3X1DA 3GWHA 3Q5EA 2XAGB 2CA5A 2QVAA 3UU3A 2MAWA 2HHHT 1CUNA 4DR2T 2BKPA 3MA9A 2AE9A 5FXVA 5AQVB 2K3WA 1V9DA 1XWMA 2LSKA 4JV5T 5J1GA 1XNRT 2E9XD 4UEMA 4LMKA 5JVDE 4YY3T 3ETUA 5HXCA 4HFVA 3OTOT 5ABFA 2CRBA 3WI3A 2F4VT 4BJMA 4YLHA 2W2UA 5LGTB 5LGNB 3NZQA 3RGLA 1BR1A 4ZXLA 3PU3A 2CHNA 3ONXA 4H63V 5CGMA 1HS7A 4I0UA 5CA0E 2XPKA 4B3RT 3L09A 1FIOA 4DV1T 3C64A 3RHWA 2IMLA 1VCSA 3N9MA 1J5WA 3GN5B 2DCFA 2NR4A 3HA4A 4HFDA 2B1EA 3I1AA 4L5GA 4QH5A 3KV5A 4KHPT 5L4EA 2WAUA 1W09A 3ZT7A 5LB7B 4HFCA 4OFZA 5AQPB 1KK7A 3F2EA 5CJ5A 3KDSE 4I50E 5DJQC 3RRWA 3CQXC 1MIYA 4CN6A 4IE6A 2WDVA 3CWZB 5F8PA 2JQKA 1U4QA 2LOSA 1Y01A 4EYUA 5IHYA 3RPUA 2CEAA 5LOVE 4EXTA 1E7PA 3ZT6A 2VKDA 1WFDA 1IAPA 1UUSA 5EK4A 5AQFB 1N34T 1UGOA 3O1JA 5LBMA 5CB4E 3LFMA 3TKLB 2OLTA 3UT5E 3SRZA 3KV9A 3C51A 2C5IT 3N9NA 4UF0B 3I0QA 4Z91A 3F57A 5JDHA 4K0UA 4TV9E 4AKLA 3N2OA 2BS2A 1VOMA 1VRBA 3CQGB 4YSXA 2CLYB 3FXDB 2CM0A 3RIFA 2UXXB 4DUYT 3AEDA 1BR0A 1CHUA 2XQYA 3HKDE 1SE7A 3N2KE 2X66A 1Z8UA 4ZZBA 3KINB 3AE6A 4LF4T 1D0YA 2KLQA 1FEWA 3UUBA 5KXJA 2CPTA 4BA9A 2DHRA 1AJ3A 5AQMB 2VKJA 4O8SA 1YD8G 3JC6D 2WWVA 2BS3A 4E7ZA 4LF6T 4O4LE 3VKHA 4HWHA 3E08A 1O3XA 5EK2A 1KNPA 1FMWA 4H9QC 2V5DA 4JUYA 3ZMSB 1YQ3A 4F6RC 2VASA 5HXEA 4HWFA 4CXYA 1J5ET 5AQRB 3ZJ1A 4H9PC 2WMNA 1JNRA 2E9XA 3P7IA 2V5CA 3AEAA 2V7JA 5DQWA 5HEHA 1UX5A 2BG9B 3UU4A 2IUBA 3AA7B 5KDMC 2CWYA 5FL0A 3OBVE 1SHZC 2SPCA 4TNWA 3CVRA 2XASB 2LKHA 1H7CA 3NWIA 2A3DA 4IHJE 1YQ4A 4AIUA 5AFUL 4FJOA 1ZHCA 4CI2B 3LG7A 3A5XA 4HWCA 2E9XC 1NAFA 2PG8A 5JDGA 5JTGA 4U33A 4U3CA 3AE3A 2QRXA 2JQQA 4PFOA 2H88A 3RF1A 5LXTE 4HKAA 4LF5T 4EOZB 4P09A 3FZHB 5DQVA 5LHIB 2NOXA 3OPCA 3ZEFB 3SFEA 2LSGA 3B5MA 3FXEB 1YKHB 3P4QA 3ZMTB 2VL0A 2UXNB 1M62A 4DR3T 3ZMZB 3BQLA 1U5PA 4GYRA 2W0GA 4UV8B 3C4WA 2IC6A 2CXFA 1E2AA 3BQKA 3C4XA 4LF9T 2K9AA 3QB5A 4I43B 2ES0A 5LJMA 2IC9A 2LSIA 3PUYF 4YTNA 1IBMT 3AE9A 4DV0T 2BS4A 4CN1A 3T1YT 1DU2A 2JQ9A 2XSBA 5HXHA 4HFBA 4X5TA 4IE4A 4UXNB 4YFSA 3RYFE 1S35A 3Q9DA 2KWIB 2EHOD 3NVOA 5LBQB 4GKJT 3ZMVB 3U78A 4DR5T 2LM9A 3RX6A 3FZLB 5ABEA 2D0TA 3R84B 3HKBE 3VRAA 2V8SV 3AA1B 5LNKA 2LRLA 2DLRA 2NTYA 3C98B 2UU9T 4HFEA 3RKOA 4I4TE 2V1DB 3ANWA 2C0SA 2Q9QB 2BBJA 1BR4A 5HAXA 2W61A 2IIUA 2D2SA 1JNZA 2KNDA 1I94T 3Q5DA 4EEDA 2LRKA 5L3GB 2OV9A 4OYJA 1IBLT 5AQSB 3QUJA 1XZYA 4QXBB 4DV6T 2I6HA 4A98A 2X67A 3ZC0A 5HXRA 4WYVA 4PK5A 4O4JE 4X1IE 2E8IA 2NTXA 1HTJF 2LEHA 3LJCA 2C5JA 2J47A 3ZCIA 2W4XA 4U72A 4H9SE 4X65T 4N78D 1D1AA 2DL1A 4I55E 4COFA 2RA1A 5JR9B 4KX6A 2LSJA 3PUZF 5AQHB 2VWAA 4C90A 2L3LA 2D0UA 3P4SA 3N5LA 4AI6A 4DR6T 5AQIB 3UUNA 3AXJA 1QSDA 2A2FX 2XQ9A 4JYAT 1N32T 2Q9QD 5FVKA 1MMDA 3ZC1A 2Y6XA 4V1Av 2WP9A 2WCAA 2KSRA 3CMLA 4MBQA 2WDQA 3Q2MA 2CHOA 4NXMT 4AQFC 1OEDC 2ZM8A 4CI3B
chains in the Genus database with same CATH topology
4DR3T 1IBLT 3OTOT 1IBKT 4DV4T 1HNXT 1N34T 5LMUT 2F4VT 4DV6T 4LF9T 4X62T 4K0KT 1J5ET 5IWAT 4DR7T 1HNZT 1IBMT 4DV0T 4JI5T 4DR1T 4B3ST 1FJGT 3T1YT 4B3RT 4LFCT 4JI4T 4DV1T 4JI3T 1N36T 4LFAT 4X65T 4OX9T 4DV7T 4DR4T 4X64T 2VQFT 2ZM6T 2UXBT 5BR8T 4LF7T 4KHPT 2UUBT 4DUYT 4GKJT 4JI0T 4DUZT 4AQYT 3T1HT 5LMNT 2UUCT 4GKKT 4DR5T 4LFBT 2UXCT 1HR0T 2VQET 1XMOT 4LF4T 1XNQT 4JI8T 4JI6T 4DR6T 1N33T 2E5LT 4DV2T 4NXNT 2HHHT 1N32T 4JYAT 4DR2T 4JI1T 4B3TT 4DV3T 2UU9T 4LF5T 1HNWT 2UUAT 4JV5T 2UXDT 1XMQT 4JI2T 4JI7T 1XNRT 4LF6T 4DV5T 4X66T 1I94T 4NXMT 4YY3T 4YHHT 4LF8T 4B3MT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 T;  1IBL T;  3OTO T;  1IBK T;  4DV4 T;  1HNX T;  1N34 T;  5LMU T;  2F4V T;  4DV6 T;  4LF9 T;  4X62 T;  4K0K T;  1J5E T;  5IWA T;  4DR7 T;  1HNZ T;  1IBM T;  4DV0 T;  4JI5 T;  4DR1 T;  4B3S T;  1FJG T;  3T1Y T;  4B3R T;  4LFC T;  4JI4 T;  4DV1 T;  4JI3 T;  1N36 T;  4LFA T;  4X65 T;  4OX9 T;  4DV7 T;  4DR4 T;  4X64 T;  2VQF T;  2ZM6 T;  2UXB T;  5BR8 T;  4LF7 T;  4KHP T;  2UUB T;  4DUY T;  4GKJ T;  4JI0 T;  4DUZ T;  4AQY T;  3T1H T;  5LMN T;  2UUC T;  4GKK T;  4DR5 T;  4LFB T;  2UXC T;  1HR0 T;  2VQE T;  1XMO T;  4LF4 T;  1XNQ T;  4JI8 T;  4JI6 T;  4DR6 T;  1N33 T;  2E5L T;  4DV2 T;  4NXN T;  2HHH T;  1N32 T;  4JYA T;  4DR2 T;  4JI1 T;  4B3T T;  4DV3 T;  2UU9 T;  4LF5 T;  1HNW T;  2UUA T;  4JV5 T;  2UXD T;  1XMQ T;  4JI2 T;  4JI7 T;  1XNR T;  4LF6 T;  4DV5 T;  4X66 T;  1I94 T;  4NXM T;  4YY3 T;  4YHH T;  4LF8 T;  4B3M T; 
#chains in the Genus database with same CATH topology
 2HN1 A;  3M65 A;  3AE1 A;  4YSZ A;  4DBR A;  3K1S A;  1HF8 A;  3UU8 A;  2WWU A;  3A8Y C;  4NIQ A;  3O9X A;  2VKH A;  1HNZ T;  2CE7 A;  5AQK B;  2FBW A;  4Z8X A;  5FKY A;  4B6X A;  2P9B A;  3UFE A;  4LFC T;  4JI4 T;  4HGA A;  2K48 A;  2XSA A;  3AEE A;  4XZC A;  4PK4 A;  4AKH A;  2V7M A;  2ZM0 A;  4DMV A;  2CBJ A;  4X20 E;  3FB2 A;  2UUC T;  3U3I A;  5FVL A;  2K5B B;  2JQH A;  4MAL A;  4KHZ F;  2X9Y A;  1IJ5 A;  4TN7 B;  1G8X A;  3AE7 A;  4IRE A;  2AXD S;  2EHO A;  2YK0 A;  3LBX A;  3VR9 A;  5JRC A;  4PJJ A;  4PJM A;  4IDO A;  4H9O C;  3PUW F;  2WS3 A;  4QKN A;  2JJ9 A;  4MHC A;  5LHH B;  4PJN A;  4CQI A;  4YTM A;  2X51 A;  2YIN A;  3IHR A;  4TWF A;  3UTK A;  2LT3 A;  2KZ7 B;  4JLE A;  4PJL A;  4H9R C;  4TNV A;  1HG2 A;  2NP9 A;  1ZP0 A;  2WB5 A;  4KI0 F;  3K3N A;  5LMU T;  5L3D B;  4UVA B;  3ZMU B;  4X62 T;  1EZ3 A;  4HN9 A;  2EHO C;  3AEB A;  2X9H A;  3RH3 A;  4EIW A;  3ZLI A;  2VVN A;  2W67 A;  4HE8 A;  1MMG A;  2WU2 A;  2W62 A;  4DID B;  3CPZ A;  5AQG B;  4U31 A;  3EAB A;  3Q5X A;  5ADX L;  2FUP A;  2PBI A;  3B13 A;  2B76 A;  2XM1 A;  2I0M A;  1VCT A;  5M4Y A;  3JAF A;  1UUR A;  5CA1 E;  4GKK T;  4JEH B;  2LE8 A;  2UXC T;  2R6G F;  4ILB A;  5FY0 A;  2XUE A;  4EV6 A;  5IUX A;  5LYJ E;  2BDE A;  4GK5 E;  5LHG B;  3E0Z A;  3P4W A;  2X0H A;  2D5U A;  3CIR A;  1UX4 A;  4ZS3 A;  1D0Z A;  2CXD A;  3ZN1 B;  2N2N A;  2VVS A;  3N9Q A;  1T8B A;  4ZEY A;  3PUX F;  2UUA T;  5L47 A;  3FZF B;  2YDR A;  4PFP A;  2JIW A;  3UUX B;  1S94 A;  3CX7 B;  3IBP A;  3EUH A;  4YHH T;  4IST A;  4EGW A;  4U7Y A;  3PDY A;  3DJB A;  3OYX A;  2CMR A;  4U74 A;  2XAQ B;  2J4G A;  4HWI B;  1UK5 A;  3RRC A;  4XBF B;  2CCQ A;  1E1H B;  4F8H A;  1FMV A;  4IE7 A;  4HTE A;  4EZH A;  1Z0P A;  5BMV E;  1YXR A;  5H6R B;  3C50 A;  4AKI A;  2YDQ A;  4ZI2 C;  2Q9Q C;  5FNV E;  4YHJ A;  3PUR A;  4YJ2 E;  3ZSS A;  5L3B B;  3T1H T;  3TLV A;  1IJ6 A;  4AIS A;  3RYI E;  5ABF B;  5FXZ A;  1SA0 E;  2X68 A;  4YTP A;  5LCY A;  4JI8 T;  3AEG A;  1MND A;  3JCF A;  2LJL A;  2XQA A;  2NW9 A;  4JI1 T;  1NEN A;  3AEF A;  2FJB A;  2WQY A;  3IA3 A;  4CN4 A;  2BBH A;  2E5V A;  2RP4 A;  2JMH A;  4JI7 T;  5KX5 E;  4G2A A;  4JBW F;  1X9B A;  2X9W A;  4TV8 E;  5E0O A;  2XM2 A;  3ZT5 A;  3FZK B;  4G63 A;  3N9L A;  4YJ3 E;  4TZ4 C;  4QHO A;  5ETW A;  4O4H E;  4P0B A;  1MMA A;  4HFI A;  2XAJ B;  2PTF A;  2W00 A;  1US7 B;  2A72 A;  3OVU A;  3J9X 1;  5JDM A;  2XQ8 A;  4OK0 A;  4YSY A;  3VRB A;  4MFR A;  4ADZ A;  4JI5 T;  4DR1 T;  2OA5 A;  2MPK A;  4L9I A;  1OWA A;  4PNI A;  2MTQ A;  5L3C B;  3HR0 A;  4DBQ A;  1KF6 A;  5AQJ B;  2M6B A;  2BVM A;  4DVD A;  3AEC A;  4WZX A;  4UIG A;  3PUG A;  2A9U A;  5HEG A;  2HPJ A;  2YOE A;  3EAM A;  2QA7 A;  2ACX A;  4IGU A;  5HEO A;  1ZOY A;  5HWY A;  4ILA A;  1LVF A;  3FBZ A;  3DTO A;  4UEL A;  4AXP A;  3UU5 A;  3RC3 A;  2N1G A;  3KV6 A;  2DNX A;  3KBU A;  5L3E B;  2DI4 A;  3P8C D;  5LG3 A;  3M3Z B;  2LHN A;  2YKS A;  3GN5 A;  3IF8 B;  1GQE A;  3UUL A;  4XAX B;  3UQ7 A;  3TLT A;  3NKZ A;  2G0U A;  2GK9 A;  2XAF B;  2HH7 A;  3H3M A;  2M6I A;  4IIJ E;  1MMN A;  4B3M T;  2IHR 1;  3UFG A;  3F31 A;  3P4P A;  4QH4 A;  2JRK A;  4O4I E;  3I9W A;  4DND A;  2XQ4 A;  1M7K A;  2YEV C;  1D1C A;  3UUM A;  4NPP A;  5IWA T;  3DP7 A;  3VHL A;  1OED E;  5ABG A;  3PUS A;  4LFA T;  4O2B E;  5TAO A;  2NW7 A;  3NRX A;  2IW5 B;  4IE0 A;  2LKG A;  3AE8 A;  3AVS A;  2QYW A;  2WMO A;  5C2T A;  5J2U E;  2UUB T;  4DUZ T;  4AQY T;  3EHZ A;  1J1J A;  4YXD A;  4LFB T;  4UR9 A;  4AQG A;  3QK6 A;  1XMO T;  3ZYL A;  3IEE A;  3MAC A;  3N9O A;  3NZP A;  4QX7 B;  4JI6 T;  4UF0 A;  5F5W A;  3EDV A;  3UQ4 A;  2E9X B;  2V7K A;  3SS1 A;  5J0Z A;  5J2T E;  1MIW A;  1HX8 A;  3JC6 C;  4AQF A;  1OED A;  2H7O A;  3EI0 A;  1XMQ T;  2ODU A;  1BR2 A;  4ZHQ E;  2Y8D A;  2NW8 A;  3QOF A;  4IDZ A;  1W0A A;  3RQU A;  3ETV A;  2V6Y A;  4Z90 A;  2VKO A;  2FJE A;  4UV9 B;  3I0O A;  3N9P A;  1WLX A;  4K0K T;  2N9D A;  5A1L A;  4DR7 T;  4KUM B;  2W63 A;  3LDQ B;  3LK2 B;  2ZMA A;  3K3Q C;  3OYZ A;  1KNZ A;  2CLY C;  3I9Y A;  2FJA A;  3JAD A;  3PU8 A;  5FMN A;  2CBI A;  4OHF A;  5EK3 A;  4UVC B;  4YT0 A;  4DR4 T;  3AAE B;  4MLK A;  1YKE B;  3P50 A;  4QXC B;  2JPF A;  3FBL A;  2ZM6 T;  2UXB T;  3RC8 A;  3NRY A;  1HG5 A;  2M67 A;  1WYC A;  4PW8 A;  5HXS A;  4U2Z A;  4JI0 T;  2JMK A;  2XY8 B;  5LMN T;  3QNU A;  4QWN B;  2VQE T;  1G73 A;  3V5S A;  4TX5 A;  2PFV A;  3ZJ2 A;  3AAA B;  3KVA A;  4ZS2 A;  3Q5W A;  3QC9 A;  5HYA A;  2BG9 A;  2VB6 A;  4A5X A;  3KFW X;  2D9D A;  3HKC E;  1ZKE A;  2PJQ A;  4NUV A;  4ZOL E;  4AKG A;  3ONL C;  3ZPO A;  3KV4 A;  2ACZ A;  3KBT A;  2H3R A;  3LSV A;  1HNX T;  4CI1 B;  5JRE A;  4KBM B;  1YW0 A;  3AA0 B;  2Z6E A;  3MKD A;  2VK9 A;  4CZZ B;  1R8I A;  4WNK A;  2V6X A;  2BG9 C;  2KWH A;  5DAB A;  1T72 A;  4L0R A;  4ASK A;  3FHN A;  4CXX A;  3B57 A;  1N36 T;  2XZE A;  3H3A A;  3ANW B;  5AQN B;  4X1K E;  4PK6 A;  3PUV F;  3N2G E;  3HL6 A;  3TLU A;  3AE4 A;  5BR8 T;  2MOZ A;  5HCM A;  5JH7 E;  2XTL A;  2KIN B;  1D1B A;  2I59 A;  3H37 A;  3AVR A;  1WYB A;  4ZI3 D;  5EZY E;  4TWD A;  3KVB A;  3NBX X;  5LA6 E;  2XHE B;  5GON E;  4DV2 T;  2XQ6 A;  4U7I A;  4HFH A;  4H9N C;  2NWB A;  2VUR A;  2KMF A;  2ZLY A;  5AQO B;  4DV3 T;  3AE5 A;  2KXP B;  2DWK A;  1LRZ A;  1HNW T;  3ABV A;  1Y64 B;  1KFY A;  1LVK A;  2Y48 B;  5JDF A;  2UXD T;  4WBN E;  1LKX A;  2DWG A;  2V7L A;  4LMJ A;  5FXX A;  3L3P A;  5HEJ A;  4BAY B;  3L39 A;  5L2L A;  3O4X E;  1WRD A;  4Q25 A;  4EAH A;  2IAK A;  4EEB A;  4AKR B;  3ESL A;  5H6Q B;  4KMC A;  5LJN A;  2WDR A;  1OED B;  2HPL A;  3HI2 A;  1ZEE A;  1XDP A;  4IDP A;  5JQG E;  1HX1 B;  4UVB B;  4HWD A;  3AXJ B;  2X0Y A;  3RYH E;  4ZI7 E;  5F3J A;  1X79 A;  4B3S T;  2V6Y B;  1FJG T;  3J7Y q;  2Q9Q A;  4IL9 A;  4JEU B;  5CFB A;  4DV7 T;  5KMG P;  4OYK A;  3S4U A;  2WU5 A;  3AB3 B;  3VR8 A;  2LLY A;  4LF7 T;  3CK6 A;  1NWM X;  4ZZC A;  4U2Y A;  4C91 A;  3PUQ A;  1KEY A;  2WZH A;  2KT9 A;  3SWH A;  1XNQ T;  3LK3 B;  3BK9 A;  3TLS A;  3CKD A;  3CX8 B;  2MBG A;  3ZYK A;  1L0V A;  4IDN A;  2HN2 A;  2L9Q A;  4IE5 A;  3VU7 H;  3MK7 C;  1T7S A;  3ZCJ A;  2FJD A;  5LG4 A;  2VL8 A;  2WM9 A;  4P0A A;  1T98 A;  5JR9 A;  4DV5 T;  4ISS A;  4KP3 C;  5HCJ A;  3PE0 A;  2LM2 A;  3RYC E;  1D0X A;  5AQL B;  3AE2 A;  2CXL A;  3L8R A;  4IT4 A;  2XQ5 A;  3W15 B;  3ZST A;  4DV4 T;  1IBK T;  4TWH A;  4QH1 A;  4NUU A;  2XAH B;  4QXH B;  1MIV A;  5JDN A;  4EYY R;  2XJ7 A;  4ILC A;  2L8K A;  3PUA A;  1SUM B;  4DO0 A;  5FP3 A;  4ERR A;  3TLW A;  3V5U A;  2EHO B;  3LBX B;  3WAK A;  3BQI A;  5ABH A;  5JRC B;  3R6N A;  5HWX A;  4JI3 T;  1HCI A;  4DMW A;  5JR9 C;  4A56 A;  3O1H A;  2J1D G;  3CQC B;  2W66 A;  5L4H A;  4ANJ A;  5HEU A;  5FL1 A;  5FXW A;  3O1I A;  1WCR A;  1I6Z A;  3RI5 A;  1W0B A;  2X0L B;  3MJX A;  1KNR A;  5C3J A;  1HR0 T;  4IL4 A;  2LHR A;  3RLF F;  5AQT B;  1N33 T;  2E5L T;  4H63 H;  5FY7 A;  3RIA A;  3LK4 2;  4GOU A;  3HKE E;  4HEA A;  3FZM B;  1XDO A;  2XQ7 A;  2BKO A;  3AA6 B;  3RKG A;  2V26 A;  1HFA A;  2LOP A;  3QB5 K;  2YDS A;  5LP6 E;  4X66 T;  2LSY A;  5FYM A;  2J62 A;  1QLB A;  4LF8 T;  2H89 A;  4FI5 A;  2WBL A;  3ZYM A;  2XQ3 A;  3GMI A;  3MZK B;  2BVL A;  3E22 E;  4X1Y E;  3PJA A;  2BKN A;  3K8P C;  2K24 A;  2ODV A;  3SFD A;  4E7S A;  5FY1 A;  4ZI3 C;  2YU1 A;  4IDQ A;  4CXW A;  2YU2 A;  4OX9 T;  3WAJ A;  4M1P A;  3ONJ A;  4X64 T;  2BZB A;  2VQF T;  3PV0 F;  5L3F B;  3C4Z A;  3GA8 A;  4QX8 B;  3UU6 A;  5C8Y E;  1W9R A;  2WSS V;  1ZV4 X;  3P4R A;  2H7V C;  1WR0 A;  4A97 A;  3EDU A;  3RIU A;  5IYZ E;  3MXZ A;  3K3O A;  4LML A;  4NXN T;  2RPA A;  3ZKR A;  5JDL A;  1B7T A;  3JAE A;  4B3T T;  2CWO A;  5AQQ B;  4GK0 E;  2IDO B;  5LGU B;  4JI2 T;  4O2A E;  2V7I A;  3SOL A;  2X9X A;  3A7M A;  3RQW A;  1MNE A;  2E2A A;  3VKG A;  5AQU B;  2C5K T;  4WW0 A;  2WY2 A;  1NEK A;  3ZN0 B;  3CX6 B;  4BJN A;  4WBO A;  3RIU C;  4EB6 E;  3PJA J;  3T8O A;  2ZM2 A;  2QGS A;  4GYS A;  4J2C A;  1WR6 A;  1OXZ A;  2YN6 A;  1IZN B;  1QUU A;  3G06 A;  3PTR B;  4ILU A;  4EZ4 A;  5JDQ A;  2WZI A;  4TUY E;  3D0T A;  4GIW A;  3EVY A;  4P1N A;  4PAG A;  1UCU A;  2BG9 E;  4ZI2 D;  3AAI A;  3OJA A;  3OKQ A;  2MYS A;  3X1D A;  3GWH A;  3Q5E A;  2XAG B;  2CA5 A;  2QVA A;  3UU3 A;  2MAW A;  2HHH T;  1CUN A;  4DR2 T;  2BKP A;  3MA9 A;  2AE9 A;  5FXV A;  5AQV B;  2K3W A;  1V9D A;  1XWM A;  2LSK A;  4JV5 T;  5J1G A;  1XNR T;  2E9X D;  4UEM A;  4LMK A;  5JVD E;  4YY3 T;  3ETU A;  5HXC A;  4HFV A;  3OTO T;  5ABF A;  2CRB A;  3WI3 A;  2F4V T;  4BJM A;  4YLH A;  2W2U A;  5LGT B;  5LGN B;  3NZQ A;  3RGL A;  1BR1 A;  4ZXL A;  3PU3 A;  2CHN A;  3ONX A;  4H63 V;  5CGM A;  1HS7 A;  4I0U A;  5CA0 E;  2XPK A;  4B3R T;  3L09 A;  1FIO A;  4DV1 T;  3C64 A;  3RHW A;  2IML A;  1VCS A;  3N9M A;  1J5W A;  3GN5 B;  2DCF A;  2NR4 A;  3HA4 A;  4HFD A;  2B1E A;  3I1A A;  4L5G A;  4QH5 A;  3KV5 A;  4KHP T;  5L4E A;  2WAU A;  1W09 A;  3ZT7 A;  5LB7 B;  4HFC A;  4OFZ A;  5AQP B;  1KK7 A;  3F2E A;  5CJ5 A;  3KDS E;  4I50 E;  5DJQ C;  3RRW A;  3CQX C;  1MIY A;  4CN6 A;  4IE6 A;  2WDV A;  3CWZ B;  5F8P A;  2JQK A;  1U4Q A;  2LOS A;  1Y01 A;  4EYU A;  5IHY A;  3RPU A;  2CEA A;  5LOV E;  4EXT A;  1E7P A;  3ZT6 A;  2VKD A;  1WFD A;  1IAP A;  1UUS A;  5EK4 A;  5AQF B;  1N34 T;  1UGO A;  3O1J A;  5LBM A;  5CB4 E;  3LFM A;  3TKL B;  2OLT A;  3UT5 E;  3SRZ A;  3KV9 A;  3C51 A;  2C5I T;  3N9N A;  4UF0 B;  3I0Q A;  4Z91 A;  3F57 A;  5JDH A;  4K0U A;  4TV9 E;  4AKL A;  3N2O A;  2BS2 A;  1VOM A;  1VRB A;  3CQG B;  4YSX A;  2CLY B;  3FXD B;  2CM0 A;  3RIF A;  2UXX B;  4DUY T;  3AED A;  1BR0 A;  1CHU A;  2XQY A;  3HKD E;  1SE7 A;  3N2K E;  2X66 A;  1Z8U A;  4ZZB A;  3KIN B;  3AE6 A;  4LF4 T;  1D0Y A;  2KLQ A;  1FEW A;  3UUB A;  5KXJ A;  2CPT A;  4BA9 A;  2DHR A;  1AJ3 A;  5AQM B;  2VKJ A;  4O8S A;  1YD8 G;  3JC6 D;  2WWV A;  2BS3 A;  4E7Z A;  4LF6 T;  4O4L E;  3VKH A;  4HWH A;  3E08 A;  1O3X A;  5EK2 A;  1KNP A;  1FMW A;  4H9Q C;  2V5D A;  4JUY A;  3ZMS B;  1YQ3 A;  4F6R C;  2VAS A;  5HXE A;  4HWF A;  4CXY A;  1J5E T;  5AQR B;  3ZJ1 A;  4H9P C;  2WMN A;  1JNR A;  2E9X A;  3P7I A;  2V5C A;  3AEA A;  2V7J A;  5DQW A;  5HEH A;  1UX5 A;  2BG9 B;  3UU4 A;  2IUB A;  3AA7 B;  5KDM C;  2CWY A;  5FL0 A;  3OBV E;  1SHZ C;  2SPC A;  4TNW A;  3CVR A;  2XAS B;  2LKH A;  1H7C A;  3NWI A;  2A3D A;  4IHJ E;  1YQ4 A;  4AIU A;  5AFU L;  4FJO A;  1ZHC A;  4CI2 B;  3LG7 A;  3A5X A;  4HWC A;  2E9X C;  1NAF A;  2PG8 A;  5JDG A;  5JTG A;  4U33 A;  4U3C A;  3AE3 A;  2QRX A;  2JQQ A;  4PFO A;  2H88 A;  3RF1 A;  5LXT E;  4HKA A;  4LF5 T;  4EOZ B;  4P09 A;  3FZH B;  5DQV A;  5LHI B;  2NOX A;  3OPC A;  3ZEF B;  3SFE A;  2LSG A;  3B5M A;  3FXE B;  1YKH B;  3P4Q A;  3ZMT B;  2VL0 A;  2UXN B;  1M62 A;  4DR3 T;  3ZMZ B;  3BQL A;  1U5P A;  4GYR A;  2W0G A;  4UV8 B;  3C4W A;  2IC6 A;  2CXF A;  1E2A A;  3BQK A;  3C4X A;  4LF9 T;  2K9A A;  3QB5 A;  4I43 B;  2ES0 A;  5LJM A;  2IC9 A;  2LSI A;  3PUY F;  4YTN A;  1IBM T;  3AE9 A;  4DV0 T;  2BS4 A;  4CN1 A;  3T1Y T;  1DU2 A;  2JQ9 A;  2XSB A;  5HXH A;  4HFB A;  4X5T A;  4IE4 A;  4UXN B;  4YFS A;  3RYF E;  1S35 A;  3Q9D A;  2KWI B;  2EHO D;  3NVO A;  5LBQ B;  4GKJ T;  3ZMV B;  3U78 A;  4DR5 T;  2LM9 A;  3RX6 A;  3FZL B;  5ABE A;  2D0T A;  3R84 B;  3HKB E;  3VRA A;  2V8S V;  3AA1 B;  5LNK A;  2LRL A;  2DLR A;  2NTY A;  3C98 B;  2UU9 T;  4HFE A;  3RKO A;  4I4T E;  2V1D B;  3ANW A;  2C0S A;  2Q9Q B;  2BBJ A;  1BR4 A;  5HAX A;  2W61 A;  2IIU A;  2D2S A;  1JNZ A;  2KND A;  1I94 T;  3Q5D A;  4EED A;  2LRK A;  5L3G B;  2OV9 A;  4OYJ A;  1IBL T;  5AQS B;  3QUJ A;  1XZY A;  4QXB B;  4DV6 T;  2I6H A;  4A98 A;  2X67 A;  3ZC0 A;  5HXR A;  4WYV A;  4PK5 A;  4O4J E;  4X1I E;  2E8I A;  2NTX A;  1HTJ F;  2LEH A;  3LJC A;  2C5J A;  2J47 A;  3ZCI A;  2W4X A;  4U72 A;  4H9S E;  4X65 T;  4N78 D;  1D1A A;  2DL1 A;  4I55 E;  4COF A;  2RA1 A;  5JR9 B;  4KX6 A;  2LSJ A;  3PUZ F;  5AQH B;  2VWA A;  4C90 A;  2L3L A;  2D0U A;  3P4S A;  3N5L A;  4AI6 A;  4DR6 T;  5AQI B;  3UUN A;  3AXJ A;  1QSD A;  2A2F X;  2XQ9 A;  4JYA T;  1N32 T;  2Q9Q D;  5FVK A;  1MMD A;  3ZC1 A;  2Y6X A;  4V1A v;  2WP9 A;  2WCA A;  2KSR A;  3CML A;  4MBQ A;  2WDQ A;  3Q2M A;  2CHO A;  4NXM T;  4AQF C;  1OED C;  2ZM8 A;  4CI3 B; 
#chains in the Genus database with same CATH homology
 4DR3 T;  1IBL T;  3OTO T;  1IBK T;  4DV4 T;  1HNX T;  1N34 T;  5LMU T;  2F4V T;  4DV6 T;  4LF9 T;  4X62 T;  4K0K T;  1J5E T;  5IWA T;  4DR7 T;  1HNZ T;  1IBM T;  4DV0 T;  4JI5 T;  4DR1 T;  4B3S T;  1FJG T;  3T1Y T;  4B3R T;  4LFC T;  4JI4 T;  4DV1 T;  4JI3 T;  1N36 T;  4LFA T;  4X65 T;  4OX9 T;  4DV7 T;  4DR4 T;  4X64 T;  2VQF T;  2ZM6 T;  2UXB T;  5BR8 T;  4LF7 T;  4KHP T;  2UUB T;  4DUY T;  4GKJ T;  4JI0 T;  4DUZ T;  4AQY T;  3T1H T;  5LMN T;  2UUC T;  4GKK T;  4DR5 T;  4LFB T;  2UXC T;  1HR0 T;  2VQE T;  1XMO T;  4LF4 T;  1XNQ T;  4JI8 T;  4JI6 T;  4DR6 T;  1N33 T;  2E5L T;  4DV2 T;  4NXN T;  2HHH T;  1N32 T;  4JYA T;  4DR2 T;  4JI1 T;  4B3T T;  4DV3 T;  2UU9 T;  4LF5 T;  1HNW T;  2UUA T;  4JV5 T;  2UXD T;  1XMQ T;  4JI2 T;  4JI7 T;  1XNR T;  4LF6 T;  4DV5 T;  4X66 T;  1I94 T;  4NXM T;  4YY3 T;  4YHH T;  4LF8 T;  4B3M T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...