1IBKT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibkT00
3T1HT 5LMNT 4JI5T 4DV7T 4LF5T 2ZM6T 4OX9T 4LFBT 5IWAT 1IBLT 2UXCT 4JI4T 4NXNT 1I94T 4B3ST 4DV2T 4LF6T 4K0KT 1IBMT 2UUAT 4NXMT 4X66T 4DR6T 4DR4T 4DV3T 4AQYT 4DR3T 1XNQT 2UUCT 3OTOT 4DV5T 1XMQT 1HNWT 4DV6T 4X62T 2HHHT 1N33T 1J5ET 4JYAT 4DR7T 1IBKT 5BR8T 4DR2T 4YHHT 1XNRT 2UU9T 4JI6T 2UUBT 4LFCT 2F4VT 4YY3T 4B3MT 2E5LT 4JI3T 1N32T 2UXDT 4DR1T 4DR5T 4GKJT 1N36T 4LF7T 5LMUT 4JI2T 4DUYT 4JI1T 1HNXT 4DV0T 4LF9T 2UXBT 4KHPT 3T1YT 4X65T 4B3RT 4GKKT 1FJGT 2VQET 4X64T 1N34T 4DUZT 1XMOT 4LF8T 2VQFT 4DV4T 4LFAT 4JI7T 4JV5T 4LF4T 4B3TT 4JI0T 1HNZT 4JI8T 1HR0T 4DV1T
chains in the Genus database with same CATH superfamily
5LYJE 2XM2A 1Z0PA 3B13A 3N9PA 2L9QA 2IDOB 4PAGA 2CRBA 2ZLYA 5L3GB 3ETVA 3CK6A 5LBQB 3JC6C 4DV2T 2CMRA 3KBUA 1ZOYA 3PUWF 1HTJF 4TV8E 3EVYA 5F3JA 3CMLA 2WB5A 2HN2A 3EAMA 2XZEA 2HPLA 2QYWA 2X9YA 3F2EA 3AEBA 3EABA 2DNXA 4UR9A 4PFOA 5L3EB 2RPAA 4U74A 3WI3A 2XPKA 4TWDA 2BVMA 1Y64B 2XQ8A 1QLBA 4O2AE 1XZYA 4B3MT 3KVBA 5HXSA 3Q5DA 4PK4A 1HS7A 3O1JA 3RH3A 4H9PC 2XAJB 4IGUA 3HKBE 5JRCA 1T98A 2L8KA 4DV0T 3IF8B 3NVOA 3UT5E 5EK2A 5JDGA 5JDQA 3ZJ1A 1UUSA 5L3FB 2VL8A 2H3RA 2VASA 4B3TT 2XHEB 4GIWA 5JR9B 2JIWA 3NKZA 1KK7A 5JR9C 4KMCA 4LF6T 4COFA 3L09A 2N1GA 3RIFA 4DR4T 3RI5A 3QNUA 4HWHA 3NZPA 1GQEA 5JQGE 5H6QB 5IYZE 3MZKB 3ZC0A 3RYIE 2V5CA 3J9X1 2WQYA 1WYBA 2CHOA 3CKDA 2YK0A 4DBRA 2DCFA 5KMGP 2WBLA 4O4HE 4U7YA 5LB7B 4DR7T 3Q5WA 1T8BA 2KLQA 1FIOA 5LGUB 4IE7A 3KBTA 4YHHT 4PK6A 4QH1A 3AE9A 4DBQA 3AE7A 4WW0A 3T8OA 2DWKA 3PUAA 2UXBT 2CWYA 3VKGA 1X9BA 5JDMA 5FVKA 3A7MA 5L3DB 3P4RA 3AEFA 3E0ZA 4WYVA 5HCMA 1KNPA 5IHYA 3LK42 3K3NA 1ZEEA 4LF4T 4LMLA 3ETUA 5ABGA 3H3MA 4ZI3C 4NIQA 4X1YE 2UXCT 4JI4T 2WWVA 1D0XA 3AXJB 2UUAT 2J62A 2W66A 4EYUA 3QC9A 4V1Av 4YTNA 2YDRA 3RIUA 4CN1A 4ZEYA 5C2TA 5JREA 3SOLA 4LMJA 1ZP0A 2CWOA 1LVFA 2B1EA 3DTOA 1W09A 1VRBA 3ONXA 4U31A 3K3OA 1YKHB 2WAUA 2WCAA 4AKGA 3AE3A 4ZHQE 5JDHA 2D9DA 4IE6A 2BG9B 4DVDA 4H63V 3QUJA 3LG7A 2BG9C 4G2AA 5HXHA 4CXYA 4OK0A 4YY3T 4IDOA 4UV9B 4DR1T 2VVNA 2UXXB 1W9RA 3EUHA 4ZZCA 2V6YA 4A5XA 1WR6A 3KV6A 4MFRA 2SPCA 1G73A 2K3WA 2A3DA 2X0YA 4LF9T 2OA5A 1Z8UA 4LMKA 3AEAA 3PDYA 2VVSA 2LHRA 2P9BA 4QXBB 2M6BA 3L39A 2C0SA 4JI7T 2BKOA 2HPJA 4TWHA 2X68A 3NZQA 2BS2A 3MXZA 4UIGA 1IBLT 2CM0A 5AFUL 2Q9QB 4IT4A 4XZCA 3C98B 2Q9QC 2R6GF 3WAJA 4PNIA 4DR6T 2YU2A 3LJCA 5FXWA 2V26A 1HFAA 3GWHA 5JDLA 4X1KE 4ASKA 2H89A 4JUYA 5JTGA 4JBWF 1OWAA 3B5MA 1HNWT 5AQFB 2XAHB 1J5ET 4JYAT 1BR0A 4IL9A 2CBIA 2E9XB 2AE9A 4EXTA 2E9XC 2PJQA 3VRAA 4H9SE 4UVBB 2ODVA 2IC9A 4JI6T 3QK6A 3L8RA 2V8SV 3UU8A 4ZOLE 2XQ3A 3O9XA 4FI5A 4IREA 3U78A 2LSKA 1IJ6A 4AQFA 5AQLB 4KBMB 3ZN0B 2BS3A 2RP4A 3UUNA 4CI1B 4DMWA 3RKOA 2XTLA 4P0BA 2WWUA 4L0RA 5FMNA 4CXWA 4QXCB 4HWFA 4JI0T 3O4XE 5LA6E 5HWXA 3F57A 5HEUA 3UULA 3FXEB 4E7ZA 2A72A 4PW8A 4AKIA 3LBXA 2VWAA 3ZC1A 4UVCB 4TZ4C 4IDNA 3A8YC 5AQQB 2IAKA 4AQYT 4O2BE 3AECA 4CQIA 4HGAA 3RQWA 3MACA 4EEBA 2NR4A 2YOEA 2KMFA 4HN9A 3FXDB 2W61A 4EGWA 3ANWB 5LG4A 1KNZA 5JRCB 2IUBA 5IUXA 1Y01A 4KX6A 4AKRB 4UXNB 4MHCA 1IZNB 2GK9A 4DR5T 4QXHB 4GK5E 4CN4A 2AXDS 5AQRB 4A98A 3JAFA 2Y6XA 4LF7T 4JI1T 2ES0A 1D0YA 3AB3B 1YXRA 4DO0A 3X1DA 3IHRA 3TLVA 3ZJ2A 3EDUA 1KNRA 2K48A 2XJ7A 2ZMAA 3ZT5A 3GN5A 4JI5T 5AQIB 2JJ9A 5FKYA 5ETWA 3OBVE 4YFSA 1YQ3A 1VOMA 2CEAA 3KV9A 3K1SA 2K9AA 2H7OA 3N2KE 1FMVA 3EI0A 1J5WA 3C64A 2WY2A 4GOUA 3CQXC 3UUMA 2YU1A 3ZEFB 2K24A 4MLKA 3H3AA 2XY8B 1FEWA 3N9NA 1WLXA 4NUVA 2MAWA 3HKEE 1D0ZA 1XDPA 4JEUB 3ZYLA 4ZS3A 1UX5A 2FJBA 2D0TA 3RKGA 2XM1A 2XQ5A 4HKAA 1ZV4X 4U2YA 4H9OC 3PU3A 2CXFA 2YEVC 5KX5E 2XUEA 5J2TE 2CA5A 4I4TE 5J1GA 2YDQA 4O8SA 4YJ2E 4ANJA 2JQQA 1N36T 2C5JA 5AQNB 4B6XA 4HE8A 4KHPT 3T1YT 4B3RT 3MK7C 4GKKT 4YTPA 1NEKA 5ABFA 1UURA 4CI3B 2Y48B 3FZFB 4LF8T 2A2FX 4DV4T 4HWIB 3RIUC 4XBFB 5J0ZA 2VL0A 1SHZC 5CA1E 4TUYE 4DV7T 3E22E 1CHUA 3P8CD 3HKCE 2PTFA 4KP3C 4CI2B 2IIUA 3RGLA 4BA9A 3ZMVB 4IE5A 3QOFA 3RLFF 3Q2MA 1MMGA 2BBJA 4HFCA 4HFEA 3V5UA 3ZMUB 1M62A 3Q5EA 4F8HA 4YSZA 2UUCT 5AQHB 3BQLA 2XQAA 3CX6B 1QUUA 4HWCA 3ZSSA 2V6YB 4X62T 1J1JA 5FYMA 2BVLA 3JADA 5FY7A 5BR8T 5LXTE 4AKHA 2L3LA 4ISSA 3AA7B 4NPPA 4U33A 3OVUA 3CX7B 1T72A 5L2LA 2LE8A 3ESLA 1U4QA 1UK5A 2E5LT 3ZYKA 2RA1A 4YXDA 3I9WA 3AAAB 4JI2T 2LEHA 2C5KT 3BQKA 3TKLB 3SS1A 2LM9A 1IAPA 4Z91A 4EB6E 2CXDA 4CN6A 2YN6A 5DQVA 1UX4A 2KWHA 2I6HA 5FVLA 3CX8B 2K5BB 3AAEB 4M1PA 4CXXA 3RC8A 4YLHA 4WZXA 3TLWA 2PFVA 5HYAA 4MBQA 5LMNT 3I0OA 2YKSA 5AQKB 4H63H 4NXNT 5AQVB 3ZYMA 1B7TA 3VU7H 2D0UA 3LSVA 3NWIA 2JQ9A 2JQKA 2W4XA 1HG2A 1MMNA 5AQGB 3N2GE 2XQ4A 2W62A 1KEYA 3FBLA 2HN1A 4KI0F 1T7SA 2X51A 1FMWA 2QA7A 1NENA 3P4SA 4AQFC 3AVSA 2KZ7B 3MJXA 2E8IA 3HR0A 2I59A 1XNRT 4IE4A 2VKHA 2XASB 2W0GA 2CE7A 2B76A 2JMHA 2UXDT 4QHOA 4Q25A 3MA9A 4O4LE 4HEAA 3P50A 2EHOD 3GMIA 4QWNB 3LBXB 2ACZA 3BK9A 4TN7B 2X0LB 1G8XA 2XQ7A 2VQET 3PE0A 4X64T 4OFZA 5JH7E 4EEDA 2NTXA 3C4XA 4UELA 4DIDB 1OEDB 3IEEA 3OJAA 4YTMA 4LFAT 2MBGA 4JV5T 1OEDC 1L0VA 4DV1T 1D1CA 1W0AA 5AQJB 3T1HT 4ZI7E 1E1HB 4ILBA 5L4EA 2BDEA 2XQYA 5JR9A 2H88A 3AEGA 3B57A 2BBHA 3SFDA 5LHHB 4PJLA 2LOSA 3UFGA 4N78D 4KUMB 2KNDA 2DI4A 4HFIA 1XNQT 3RYCE 2LRLA 3ZN1B 4DV5T 2MOZA 3PV0F 3FZHB 1XMQT 2J4GA 5LG3A 2LRKA 4G63A 1WCRA 2YINA 3C4WA 3RF1A 5AQTB 5H6RB 4UF0A 5J2UE 3VR8A 2E5VA 2FBWA 4ZI2D 4AKLA 3AEEA 1KFYA 3CVRA 3P4PA 2WZHA 3PUVF 3AE1A 2J47A 1VCTA 2LSGA 4MALA 3EDVA 1AJ3A 4QX7B 4GYRA 2N2NA 3GA8A 1ZKEA 3NRYA 3P4QA 2ODUA 1X79A 3FZKB 4U7IA 2V7LA 5HEJA 4IDPA 3C50A 1BR4A 2EHOA 1QSDA 4J2CA 2VQFT 2Z6EA 4TX5A 3FBZA 4OYJA 5LOVE 1WR0A 2VKOA 4WNKA 2WDQA 1I94T 2ZM8A 4HFDA 4AXPA 2LKHA 2XAFB 2NOXA 5LGNB 3AXJA 1HX1B 2DL1A 5DABA 4YT0A 3N9MA 3RC3A 5DJQC 3H37A 1S94A 3J7Yq 5JVDE 2I0MA 3OYXA 3O1IA 3R84B 2WSSV 5FY1A 2JRKA 4EZHA 3KV5A 2N9DA 3AAIA 4O4JE 5FXXA 5GONE 3KVAA 4ISTA 1LKXA 3C4ZA 5ABFB 2V7KA 3M3ZB 5EK3A 1HX8A 5JDFA 2UXNB 3Q5XA 3ZMTB 4JLEA 1XDOA 4DUYT 3ZCJA 3R6NA 4P1NA 3CPZA 1V9DA 4KHZF 2W2UA 2VB6A 3UUXB 5HWYA 3ZT7A 5HEGA 2IW5B 3JCFA 5LBMA 2M67A 3G06A 3D0TA 3PJAA 1SE7A 4IIJE 4A56A 3LK2B 4IE0A 3P4WA 3DJBA 4ZS2A 4LF5T 4L9IA 3RRCA 1US7B 4LFBT 1EZ3A 2CLYB 3DP7A 2BZBA 2CLYC 1MIWA 1LRZA 4C91A 2IHR1 4X66T 5A1LA 3TLUA 4OYKA 5C3JA 4ILAA 3SFEA 4I50E 4Z8XA 5HXRA 1WYCA 5JDNA 4PJNA 3FZLB 2MYSA 2V7IA 4QH5A 3UFEA 1S35A 3PUSA 3PUYF 3TLTA 2E9XA 5AQSB 4CZZB 3ZLIA 1SA0E 4I55E 3HA4A 5FL1A 1D1BA 4XAXB 2NWBA 2V7JA 3FHNA 4WBOA 1BR2A 4WBNE 4DNDA 2C5IT 5LP6E 3F31A 2V5DA 5FXZA 3QB5A 5ADXL 3FB2A 4EV6A 1YD8G 3PJAJ 4Z90A 2LM2A 2CXLA 3VKHA 2Y8DA 5HCJA 4AQGA 2KINB 3A5XA 4AIUA 1JNZA 2HH7A 2G0UA 2VURA 4AISA 2W00A 4L5GA 2LOPA 3L3PA 3HKDE 2BKNA 5ABEA 2BS4A 4GYSA 2KSRA 3AVRA 4NXMT 5HEHA 2W67A 3IA3A 3ZSTA 4X1IE 2D2SA 3JC6D 1DU2A 1WFDA 2MTQA 2X9WA 3OTOT 5L4HA 1BR1A 3PUQA 3QB5K 3PURA 3AA6B 4DV6T 4IDZA 2HHHT 3ZKRA 3ZT6A 2J1DG 3ANWA 2LSIA 1R8IA 4IDQA 2CCQA 4TNWA 3RRWA 5HXEA 3N5LA 2UU9T 3AE4A 2JQHA 3KDSE 3ZPOA 3VRBA 3K8PC 3UUBA 4GKJT 3VR9A 4E7SA 3O1HA 4TV9E 4HWDA 3P7IA 1NWMX 2OLTA 4EIWA 4X65T 4ZXLA 2V7MA 4P0AA 1N34T 4GK0E 1XMOT 2JMKA 1OXZA 4EAHA 2NW7A 1H7CA 2IMLA 5L3BB 2KWIB 5AQOB 4TWFA 5CGMA 4UVAB 2WS3A 3FZMB 4K0UA 1E2AA 1UGOA 3UU3A 5F5WA 2WDRA 2NW9A 5AQPB 3PUXF 3AE2A 4UF0B 2LSYA 2X67A 1YKEB 5CJ5A 3CQGB 4ZZBA 5KDMC 3NRXA 2PBIA 3K3QC 2WZIA 1MNEA 3M65A 5EK4A 3V5SA 5FNVE 5TAOA 3ABVA 4TNVA 3RYHE 4PJJA 2PG8A 3PTRB 3NBXX 2M6IA 3CWZB 2LJLA 5EZYE 2XSAA 4BAYB 3OPCA 2EHOB 1I6ZA 2F4VT 3AA1B 2EHOC 4BJMA 4H9NC 3I0QA 3AA0B 5L3CB 2FJDA 1HCIA 5AQMB 5L47A 1UCUA 2XSBA 5LJMA 3RYFE 2XQ6A 2DWGA 2JPFA 2WP9A 4EYYR 3IBPA 1WRDA 3PUZF 4UEMA 1XWMA 4A97A 3N9LA 3HI2A 4JI8T 2NP9A 3U3IA 4AI6A 2IC6A 4O4IE 2XAGB 4ERRA 4B3ST 3CIRA 4ZI3D 2OV9A 1MMDA 2ZM2A 1JNRA 5M4YA 2VKDA 4DV3T 2KT9A 4NUUA 5LNKA 4FJOA 4I0UA 3N2OA 2X9HA 3SRZA 3I9YA 1VCSA 2NTYA 4HFVA 4ZI2C 4EOZB 4IHJE 2QRXA 4H9QC 3RIAA 4DR2T 1U5PA 1CUNA 2UUBT 1M7KA 3RPUA 2KXPB 3AEDA 2DLRA 2XQ9A 5HXCA 2D5UA 2FJAA 3KFWX 3PU8A 3I1AA 2LKGA 3RX6A 2LT3A 1SUMB 2X9XA 3UQ4A 3KV4A 3BQIA 1FJGT 4JEHB 5CA0E 1E7PA 1KF6A 5CB4E 2CPTA 3S4UA 4U2ZA 2LLYA 4HTEA 3WAKA 4EZ4A 4OHFA 3GN5B 1HNZT 1LVKA 1MIVA 3ONJA 5HAXA 2ZM6T 4ILCA 5FY0A 5CFBA 3N9OA 3LDQB 3N9QA 4IL4A 1IBMT 3Q9DA 2H7VC 4H9RC 1MIYA 4DR3T 3LK3B 2Q9QD 2WMOA 3CQCB 5DQWA 3TLSA 3UTKA 3SWHA 3JAEA 1N33T 3E08A 4PFPA 4P09A 5LJNA 5C8YE 1NAFA 1IBKT 4F6RC 5LCYA 3AE6A 5E0OA 5BMVE 3UU4A 4DMVA 1HG5A 2E9XD 2FUPA 1N32T 3EHZA 2E2AA 3UQ7A 2WU5A 4YSYA 4PJMA 5LMUT 2X66A 1HF8A 4YHJA 4QX8B 4QH4A 4X20E 5FXVA 2X0HA 1D1AA 3KINB 2BG9A 3OYZA 4DUZT 2VK9A 2BKPA 1YW0A 2CHNA 2WDVA 5LHGB 2LSJA 1HR0T 1OEDA 2WMNA 3RQUA 4OX9T 1ZHCA 2LHNA 5FL0A 5IWAT 1YQ4A 2A9UA 4ADZA 4YJ3E 1IJ5A 4K0KT 2ACXA 4BJNA 5ABHA 1MNDA 5FP3A 5LHIB 2XAQB 2BG9E 2FJEA 1MMAA 3UU5A 2CBJA 4QKNA 2WU2A 3ZMZB 2ZM0A 2NW8A 3ZMSB 3AE5A 1OEDE 4X5TA 3MKDA 2QGSA 4HFHA 2Q9QA 3ZCIA 2QVAA 3LFMA 3UU6A 5AQUB 4I43B 2WM9A 2MPKA 3OKQA 3PUGA 3ONLC 3C51A 4ILUA 4LFCT 4U72A 2V1DB 4PK5A 3VHLA 4JI3T 3HL6A 3W15B 4YSXA 4U3CA 5LGTB 1W0BA 2DHRA 5HEOA 1HNXT 2YDSA 4C90A 2VKJA 4HFBA 3AE8A 1O3XA 4UV8B 2V6XA 3RHWA 5KXJA 2W63A 5F8PA
chains in the Genus database with same CATH topology
3T1HT 5LMNT 4JI5T 4DV7T 4LF5T 2ZM6T 4OX9T 4LFBT 5IWAT 1IBLT 2UXCT 4JI4T 4NXNT 1I94T 4B3ST 4DV2T 4LF6T 4K0KT 1IBMT 2UUAT 4NXMT 4X66T 4DR6T 4DR4T 4DV3T 4AQYT 4DR3T 1XNQT 2UUCT 3OTOT 4DV5T 1XMQT 1HNWT 4DV6T 4X62T 2HHHT 1N33T 1J5ET 4JYAT 4DR7T 1IBKT 5BR8T 4DR2T 4YHHT 1XNRT 2UU9T 4JI6T 2UUBT 4LFCT 2F4VT 4YY3T 4B3MT 2E5LT 4JI3T 1N32T 2UXDT 4DR1T 4DR5T 4GKJT 1N36T 4LF7T 5LMUT 4JI2T 4DUYT 4JI1T 1HNXT 4DV0T 4LF9T 2UXBT 4KHPT 3T1YT 4X65T 4B3RT 4GKKT 1FJGT 2VQET 4X64T 1N34T 4DUZT 1XMOT 4LF8T 2VQFT 4DV4T 4LFAT 4JI7T 4JV5T 4LF4T 4B3TT 4JI0T 1HNZT 4JI8T 1HR0T 4DV1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H T;  5LMN T;  4JI5 T;  4DV7 T;  4LF5 T;  2ZM6 T;  4OX9 T;  4LFB T;  5IWA T;  1IBL T;  2UXC T;  4JI4 T;  4NXN T;  1I94 T;  4B3S T;  4DV2 T;  4LF6 T;  4K0K T;  1IBM T;  2UUA T;  4NXM T;  4X66 T;  4DR6 T;  4DR4 T;  4DV3 T;  4AQY T;  4DR3 T;  1XNQ T;  2UUC T;  3OTO T;  4DV5 T;  1XMQ T;  1HNW T;  4DV6 T;  4X62 T;  2HHH T;  1N33 T;  1J5E T;  4JYA T;  4DR7 T;  1IBK T;  5BR8 T;  4DR2 T;  4YHH T;  1XNR T;  2UU9 T;  4JI6 T;  2UUB T;  4LFC T;  2F4V T;  4YY3 T;  4B3M T;  2E5L T;  4JI3 T;  1N32 T;  2UXD T;  4DR1 T;  4DR5 T;  4GKJ T;  1N36 T;  4LF7 T;  5LMU T;  4JI2 T;  4DUY T;  4JI1 T;  1HNX T;  4DV0 T;  4LF9 T;  2UXB T;  4KHP T;  3T1Y T;  4X65 T;  4B3R T;  4GKK T;  1FJG T;  2VQE T;  4X64 T;  1N34 T;  4DUZ T;  1XMO T;  4LF8 T;  2VQF T;  4DV4 T;  4LFA T;  4JI7 T;  4JV5 T;  4LF4 T;  4B3T T;  4JI0 T;  1HNZ T;  4JI8 T;  1HR0 T;  4DV1 T; 
#chains in the Genus database with same CATH topology
 5LYJ E;  2XM2 A;  1Z0P A;  3B13 A;  3N9P A;  2L9Q A;  2IDO B;  4PAG A;  2CRB A;  2ZLY A;  5L3G B;  3ETV A;  3CK6 A;  5LBQ B;  3JC6 C;  4DV2 T;  2CMR A;  3KBU A;  1ZOY A;  3PUW F;  1HTJ F;  4TV8 E;  3EVY A;  5F3J A;  3CML A;  2WB5 A;  2HN2 A;  3EAM A;  2XZE A;  2HPL A;  2QYW A;  2X9Y A;  3F2E A;  3AEB A;  3EAB A;  2DNX A;  4UR9 A;  4PFO A;  5L3E B;  2RPA A;  4U74 A;  3WI3 A;  2XPK A;  4TWD A;  2BVM A;  1Y64 B;  2XQ8 A;  1QLB A;  4O2A E;  1XZY A;  4B3M T;  3KVB A;  5HXS A;  3Q5D A;  4PK4 A;  1HS7 A;  3O1J A;  3RH3 A;  4H9P C;  2XAJ B;  4IGU A;  3HKB E;  5JRC A;  1T98 A;  2L8K A;  4DV0 T;  3IF8 B;  3NVO A;  3UT5 E;  5EK2 A;  5JDG A;  5JDQ A;  3ZJ1 A;  1UUS A;  5L3F B;  2VL8 A;  2H3R A;  2VAS A;  4B3T T;  2XHE B;  4GIW A;  5JR9 B;  2JIW A;  3NKZ A;  1KK7 A;  5JR9 C;  4KMC A;  4LF6 T;  4COF A;  3L09 A;  2N1G A;  3RIF A;  4DR4 T;  3RI5 A;  3QNU A;  4HWH A;  3NZP A;  1GQE A;  5JQG E;  5H6Q B;  5IYZ E;  3MZK B;  3ZC0 A;  3RYI E;  2V5C A;  3J9X 1;  2WQY A;  1WYB A;  2CHO A;  3CKD A;  2YK0 A;  4DBR A;  2DCF A;  5KMG P;  2WBL A;  4O4H E;  4U7Y A;  5LB7 B;  4DR7 T;  3Q5W A;  1T8B A;  2KLQ A;  1FIO A;  5LGU B;  4IE7 A;  3KBT A;  4YHH T;  4PK6 A;  4QH1 A;  3AE9 A;  4DBQ A;  3AE7 A;  4WW0 A;  3T8O A;  2DWK A;  3PUA A;  2UXB T;  2CWY A;  3VKG A;  1X9B A;  5JDM A;  5FVK A;  3A7M A;  5L3D B;  3P4R A;  3AEF A;  3E0Z A;  4WYV A;  5HCM A;  1KNP A;  5IHY A;  3LK4 2;  3K3N A;  1ZEE A;  4LF4 T;  4LML A;  3ETU A;  5ABG A;  3H3M A;  4ZI3 C;  4NIQ A;  4X1Y E;  2UXC T;  4JI4 T;  2WWV A;  1D0X A;  3AXJ B;  2UUA T;  2J62 A;  2W66 A;  4EYU A;  3QC9 A;  4V1A v;  4YTN A;  2YDR A;  3RIU A;  4CN1 A;  4ZEY A;  5C2T A;  5JRE A;  3SOL A;  4LMJ A;  1ZP0 A;  2CWO A;  1LVF A;  2B1E A;  3DTO A;  1W09 A;  1VRB A;  3ONX A;  4U31 A;  3K3O A;  1YKH B;  2WAU A;  2WCA A;  4AKG A;  3AE3 A;  4ZHQ E;  5JDH A;  2D9D A;  4IE6 A;  2BG9 B;  4DVD A;  4H63 V;  3QUJ A;  3LG7 A;  2BG9 C;  4G2A A;  5HXH A;  4CXY A;  4OK0 A;  4YY3 T;  4IDO A;  4UV9 B;  4DR1 T;  2VVN A;  2UXX B;  1W9R A;  3EUH A;  4ZZC A;  2V6Y A;  4A5X A;  1WR6 A;  3KV6 A;  4MFR A;  2SPC A;  1G73 A;  2K3W A;  2A3D A;  2X0Y A;  4LF9 T;  2OA5 A;  1Z8U A;  4LMK A;  3AEA A;  3PDY A;  2VVS A;  2LHR A;  2P9B A;  4QXB B;  2M6B A;  3L39 A;  2C0S A;  4JI7 T;  2BKO A;  2HPJ A;  4TWH A;  2X68 A;  3NZQ A;  2BS2 A;  3MXZ A;  4UIG A;  1IBL T;  2CM0 A;  5AFU L;  2Q9Q B;  4IT4 A;  4XZC A;  3C98 B;  2Q9Q C;  2R6G F;  3WAJ A;  4PNI A;  4DR6 T;  2YU2 A;  3LJC A;  5FXW A;  2V26 A;  1HFA A;  3GWH A;  5JDL A;  4X1K E;  4ASK A;  2H89 A;  4JUY A;  5JTG A;  4JBW F;  1OWA A;  3B5M A;  1HNW T;  5AQF B;  2XAH B;  1J5E T;  4JYA T;  1BR0 A;  4IL9 A;  2CBI A;  2E9X B;  2AE9 A;  4EXT A;  2E9X C;  2PJQ A;  3VRA A;  4H9S E;  4UVB B;  2ODV A;  2IC9 A;  4JI6 T;  3QK6 A;  3L8R A;  2V8S V;  3UU8 A;  4ZOL E;  2XQ3 A;  3O9X A;  4FI5 A;  4IRE A;  3U78 A;  2LSK A;  1IJ6 A;  4AQF A;  5AQL B;  4KBM B;  3ZN0 B;  2BS3 A;  2RP4 A;  3UUN A;  4CI1 B;  4DMW A;  3RKO A;  2XTL A;  4P0B A;  2WWU A;  4L0R A;  5FMN A;  4CXW A;  4QXC B;  4HWF A;  4JI0 T;  3O4X E;  5LA6 E;  5HWX A;  3F57 A;  5HEU A;  3UUL A;  3FXE B;  4E7Z A;  2A72 A;  4PW8 A;  4AKI A;  3LBX A;  2VWA A;  3ZC1 A;  4UVC B;  4TZ4 C;  4IDN A;  3A8Y C;  5AQQ B;  2IAK A;  4AQY T;  4O2B E;  3AEC A;  4CQI A;  4HGA A;  3RQW A;  3MAC A;  4EEB A;  2NR4 A;  2YOE A;  2KMF A;  4HN9 A;  3FXD B;  2W61 A;  4EGW A;  3ANW B;  5LG4 A;  1KNZ A;  5JRC B;  2IUB A;  5IUX A;  1Y01 A;  4KX6 A;  4AKR B;  4UXN B;  4MHC A;  1IZN B;  2GK9 A;  4DR5 T;  4QXH B;  4GK5 E;  4CN4 A;  2AXD S;  5AQR B;  4A98 A;  3JAF A;  2Y6X A;  4LF7 T;  4JI1 T;  2ES0 A;  1D0Y A;  3AB3 B;  1YXR A;  4DO0 A;  3X1D A;  3IHR A;  3TLV A;  3ZJ2 A;  3EDU A;  1KNR A;  2K48 A;  2XJ7 A;  2ZMA A;  3ZT5 A;  3GN5 A;  4JI5 T;  5AQI B;  2JJ9 A;  5FKY A;  5ETW A;  3OBV E;  4YFS A;  1YQ3 A;  1VOM A;  2CEA A;  3KV9 A;  3K1S A;  2K9A A;  2H7O A;  3N2K E;  1FMV A;  3EI0 A;  1J5W A;  3C64 A;  2WY2 A;  4GOU A;  3CQX C;  3UUM A;  2YU1 A;  3ZEF B;  2K24 A;  4MLK A;  3H3A A;  2XY8 B;  1FEW A;  3N9N A;  1WLX A;  4NUV A;  2MAW A;  3HKE E;  1D0Z A;  1XDP A;  4JEU B;  3ZYL A;  4ZS3 A;  1UX5 A;  2FJB A;  2D0T A;  3RKG A;  2XM1 A;  2XQ5 A;  4HKA A;  1ZV4 X;  4U2Y A;  4H9O C;  3PU3 A;  2CXF A;  2YEV C;  5KX5 E;  2XUE A;  5J2T E;  2CA5 A;  4I4T E;  5J1G A;  2YDQ A;  4O8S A;  4YJ2 E;  4ANJ A;  2JQQ A;  1N36 T;  2C5J A;  5AQN B;  4B6X A;  4HE8 A;  4KHP T;  3T1Y T;  4B3R T;  3MK7 C;  4GKK T;  4YTP A;  1NEK A;  5ABF A;  1UUR A;  4CI3 B;  2Y48 B;  3FZF B;  4LF8 T;  2A2F X;  4DV4 T;  4HWI B;  3RIU C;  4XBF B;  5J0Z A;  2VL0 A;  1SHZ C;  5CA1 E;  4TUY E;  4DV7 T;  3E22 E;  1CHU A;  3P8C D;  3HKC E;  2PTF A;  4KP3 C;  4CI2 B;  2IIU A;  3RGL A;  4BA9 A;  3ZMV B;  4IE5 A;  3QOF A;  3RLF F;  3Q2M A;  1MMG A;  2BBJ A;  4HFC A;  4HFE A;  3V5U A;  3ZMU B;  1M62 A;  3Q5E A;  4F8H A;  4YSZ A;  2UUC T;  5AQH B;  3BQL A;  2XQA A;  3CX6 B;  1QUU A;  4HWC A;  3ZSS A;  2V6Y B;  4X62 T;  1J1J A;  5FYM A;  2BVL A;  3JAD A;  5FY7 A;  5BR8 T;  5LXT E;  4AKH A;  2L3L A;  4ISS A;  3AA7 B;  4NPP A;  4U33 A;  3OVU A;  3CX7 B;  1T72 A;  5L2L A;  2LE8 A;  3ESL A;  1U4Q A;  1UK5 A;  2E5L T;  3ZYK A;  2RA1 A;  4YXD A;  3I9W A;  3AAA B;  4JI2 T;  2LEH A;  2C5K T;  3BQK A;  3TKL B;  3SS1 A;  2LM9 A;  1IAP A;  4Z91 A;  4EB6 E;  2CXD A;  4CN6 A;  2YN6 A;  5DQV A;  1UX4 A;  2KWH A;  2I6H A;  5FVL A;  3CX8 B;  2K5B B;  3AAE B;  4M1P A;  4CXX A;  3RC8 A;  4YLH A;  4WZX A;  3TLW A;  2PFV A;  5HYA A;  4MBQ A;  5LMN T;  3I0O A;  2YKS A;  5AQK B;  4H63 H;  4NXN T;  5AQV B;  3ZYM A;  1B7T A;  3VU7 H;  2D0U A;  3LSV A;  3NWI A;  2JQ9 A;  2JQK A;  2W4X A;  1HG2 A;  1MMN A;  5AQG B;  3N2G E;  2XQ4 A;  2W62 A;  1KEY A;  3FBL A;  2HN1 A;  4KI0 F;  1T7S A;  2X51 A;  1FMW A;  2QA7 A;  1NEN A;  3P4S A;  4AQF C;  3AVS A;  2KZ7 B;  3MJX A;  2E8I A;  3HR0 A;  2I59 A;  1XNR T;  4IE4 A;  2VKH A;  2XAS B;  2W0G A;  2CE7 A;  2B76 A;  2JMH A;  2UXD T;  4QHO A;  4Q25 A;  3MA9 A;  4O4L E;  4HEA A;  3P50 A;  2EHO D;  3GMI A;  4QWN B;  3LBX B;  2ACZ A;  3BK9 A;  4TN7 B;  2X0L B;  1G8X A;  2XQ7 A;  2VQE T;  3PE0 A;  4X64 T;  4OFZ A;  5JH7 E;  4EED A;  2NTX A;  3C4X A;  4UEL A;  4DID B;  1OED B;  3IEE A;  3OJA A;  4YTM A;  4LFA T;  2MBG A;  4JV5 T;  1OED C;  1L0V A;  4DV1 T;  1D1C A;  1W0A A;  5AQJ B;  3T1H T;  4ZI7 E;  1E1H B;  4ILB A;  5L4E A;  2BDE A;  2XQY A;  5JR9 A;  2H88 A;  3AEG A;  3B57 A;  2BBH A;  3SFD A;  5LHH B;  4PJL A;  2LOS A;  3UFG A;  4N78 D;  4KUM B;  2KND A;  2DI4 A;  4HFI A;  1XNQ T;  3RYC E;  2LRL A;  3ZN1 B;  4DV5 T;  2MOZ A;  3PV0 F;  3FZH B;  1XMQ T;  2J4G A;  5LG3 A;  2LRK A;  4G63 A;  1WCR A;  2YIN A;  3C4W A;  3RF1 A;  5AQT B;  5H6R B;  4UF0 A;  5J2U E;  3VR8 A;  2E5V A;  2FBW A;  4ZI2 D;  4AKL A;  3AEE A;  1KFY A;  3CVR A;  3P4P A;  2WZH A;  3PUV F;  3AE1 A;  2J47 A;  1VCT A;  2LSG A;  4MAL A;  3EDV A;  1AJ3 A;  4QX7 B;  4GYR A;  2N2N A;  3GA8 A;  1ZKE A;  3NRY A;  3P4Q A;  2ODU A;  1X79 A;  3FZK B;  4U7I A;  2V7L A;  5HEJ A;  4IDP A;  3C50 A;  1BR4 A;  2EHO A;  1QSD A;  4J2C A;  2VQF T;  2Z6E A;  4TX5 A;  3FBZ A;  4OYJ A;  5LOV E;  1WR0 A;  2VKO A;  4WNK A;  2WDQ A;  1I94 T;  2ZM8 A;  4HFD A;  4AXP A;  2LKH A;  2XAF B;  2NOX A;  5LGN B;  3AXJ A;  1HX1 B;  2DL1 A;  5DAB A;  4YT0 A;  3N9M A;  3RC3 A;  5DJQ C;  3H37 A;  1S94 A;  3J7Y q;  5JVD E;  2I0M A;  3OYX A;  3O1I A;  3R84 B;  2WSS V;  5FY1 A;  2JRK A;  4EZH A;  3KV5 A;  2N9D A;  3AAI A;  4O4J E;  5FXX A;  5GON E;  3KVA A;  4IST A;  1LKX A;  3C4Z A;  5ABF B;  2V7K A;  3M3Z B;  5EK3 A;  1HX8 A;  5JDF A;  2UXN B;  3Q5X A;  3ZMT B;  4JLE A;  1XDO A;  4DUY T;  3ZCJ A;  3R6N A;  4P1N A;  3CPZ A;  1V9D A;  4KHZ F;  2W2U A;  2VB6 A;  3UUX B;  5HWY A;  3ZT7 A;  5HEG A;  2IW5 B;  3JCF A;  5LBM A;  2M67 A;  3G06 A;  3D0T A;  3PJA A;  1SE7 A;  4IIJ E;  4A56 A;  3LK2 B;  4IE0 A;  3P4W A;  3DJB A;  4ZS2 A;  4LF5 T;  4L9I A;  3RRC A;  1US7 B;  4LFB T;  1EZ3 A;  2CLY B;  3DP7 A;  2BZB A;  2CLY C;  1MIW A;  1LRZ A;  4C91 A;  2IHR 1;  4X66 T;  5A1L A;  3TLU A;  4OYK A;  5C3J A;  4ILA A;  3SFE A;  4I50 E;  4Z8X A;  5HXR A;  1WYC A;  5JDN A;  4PJN A;  3FZL B;  2MYS A;  2V7I A;  4QH5 A;  3UFE A;  1S35 A;  3PUS A;  3PUY F;  3TLT A;  2E9X A;  5AQS B;  4CZZ B;  3ZLI A;  1SA0 E;  4I55 E;  3HA4 A;  5FL1 A;  1D1B A;  4XAX B;  2NWB A;  2V7J A;  3FHN A;  4WBO A;  1BR2 A;  4WBN E;  4DND A;  2C5I T;  5LP6 E;  3F31 A;  2V5D A;  5FXZ A;  3QB5 A;  5ADX L;  3FB2 A;  4EV6 A;  1YD8 G;  3PJA J;  4Z90 A;  2LM2 A;  2CXL A;  3VKH A;  2Y8D A;  5HCJ A;  4AQG A;  2KIN B;  3A5X A;  4AIU A;  1JNZ A;  2HH7 A;  2G0U A;  2VUR A;  4AIS A;  2W00 A;  4L5G A;  2LOP A;  3L3P A;  3HKD E;  2BKN A;  5ABE A;  2BS4 A;  4GYS A;  2KSR A;  3AVR A;  4NXM T;  5HEH A;  2W67 A;  3IA3 A;  3ZST A;  4X1I E;  2D2S A;  3JC6 D;  1DU2 A;  1WFD A;  2MTQ A;  2X9W A;  3OTO T;  5L4H A;  1BR1 A;  3PUQ A;  3QB5 K;  3PUR A;  3AA6 B;  4DV6 T;  4IDZ A;  2HHH T;  3ZKR A;  3ZT6 A;  2J1D G;  3ANW A;  2LSI A;  1R8I A;  4IDQ A;  2CCQ A;  4TNW A;  3RRW A;  5HXE A;  3N5L A;  2UU9 T;  3AE4 A;  2JQH A;  3KDS E;  3ZPO A;  3VRB A;  3K8P C;  3UUB A;  4GKJ T;  3VR9 A;  4E7S A;  3O1H A;  4TV9 E;  4HWD A;  3P7I A;  1NWM X;  2OLT A;  4EIW A;  4X65 T;  4ZXL A;  2V7M A;  4P0A A;  1N34 T;  4GK0 E;  1XMO T;  2JMK A;  1OXZ A;  4EAH A;  2NW7 A;  1H7C A;  2IML A;  5L3B B;  2KWI B;  5AQO B;  4TWF A;  5CGM A;  4UVA B;  2WS3 A;  3FZM B;  4K0U A;  1E2A A;  1UGO A;  3UU3 A;  5F5W A;  2WDR A;  2NW9 A;  5AQP B;  3PUX F;  3AE2 A;  4UF0 B;  2LSY A;  2X67 A;  1YKE B;  5CJ5 A;  3CQG B;  4ZZB A;  5KDM C;  3NRX A;  2PBI A;  3K3Q C;  2WZI A;  1MNE A;  3M65 A;  5EK4 A;  3V5S A;  5FNV E;  5TAO A;  3ABV A;  4TNV A;  3RYH E;  4PJJ A;  2PG8 A;  3PTR B;  3NBX X;  2M6I A;  3CWZ B;  2LJL A;  5EZY E;  2XSA A;  4BAY B;  3OPC A;  2EHO B;  1I6Z A;  2F4V T;  3AA1 B;  2EHO C;  4BJM A;  4H9N C;  3I0Q A;  3AA0 B;  5L3C B;  2FJD A;  1HCI A;  5AQM B;  5L47 A;  1UCU A;  2XSB A;  5LJM A;  3RYF E;  2XQ6 A;  2DWG A;  2JPF A;  2WP9 A;  4EYY R;  3IBP A;  1WRD A;  3PUZ F;  4UEM A;  1XWM A;  4A97 A;  3N9L A;  3HI2 A;  4JI8 T;  2NP9 A;  3U3I A;  4AI6 A;  2IC6 A;  4O4I E;  2XAG B;  4ERR A;  4B3S T;  3CIR A;  4ZI3 D;  2OV9 A;  1MMD A;  2ZM2 A;  1JNR A;  5M4Y A;  2VKD A;  4DV3 T;  2KT9 A;  4NUU A;  5LNK A;  4FJO A;  4I0U A;  3N2O A;  2X9H A;  3SRZ A;  3I9Y A;  1VCS A;  2NTY A;  4HFV A;  4ZI2 C;  4EOZ B;  4IHJ E;  2QRX A;  4H9Q C;  3RIA A;  4DR2 T;  1U5P A;  1CUN A;  2UUB T;  1M7K A;  3RPU A;  2KXP B;  3AED A;  2DLR A;  2XQ9 A;  5HXC A;  2D5U A;  2FJA A;  3KFW X;  3PU8 A;  3I1A A;  2LKG A;  3RX6 A;  2LT3 A;  1SUM B;  2X9X A;  3UQ4 A;  3KV4 A;  3BQI A;  1FJG T;  4JEH B;  5CA0 E;  1E7P A;  1KF6 A;  5CB4 E;  2CPT A;  3S4U A;  4U2Z A;  2LLY A;  4HTE A;  3WAK A;  4EZ4 A;  4OHF A;  3GN5 B;  1HNZ T;  1LVK A;  1MIV A;  3ONJ A;  5HAX A;  2ZM6 T;  4ILC A;  5FY0 A;  5CFB A;  3N9O A;  3LDQ B;  3N9Q A;  4IL4 A;  1IBM T;  3Q9D A;  2H7V C;  4H9R C;  1MIY A;  4DR3 T;  3LK3 B;  2Q9Q D;  2WMO A;  3CQC B;  5DQW A;  3TLS A;  3UTK A;  3SWH A;  3JAE A;  1N33 T;  3E08 A;  4PFP A;  4P09 A;  5LJN A;  5C8Y E;  1NAF A;  1IBK T;  4F6R C;  5LCY A;  3AE6 A;  5E0O A;  5BMV E;  3UU4 A;  4DMV A;  1HG5 A;  2E9X D;  2FUP A;  1N32 T;  3EHZ A;  2E2A A;  3UQ7 A;  2WU5 A;  4YSY A;  4PJM A;  5LMU T;  2X66 A;  1HF8 A;  4YHJ A;  4QX8 B;  4QH4 A;  4X20 E;  5FXV A;  2X0H A;  1D1A A;  3KIN B;  2BG9 A;  3OYZ A;  4DUZ T;  2VK9 A;  2BKP A;  1YW0 A;  2CHN A;  2WDV A;  5LHG B;  2LSJ A;  1HR0 T;  1OED A;  2WMN A;  3RQU A;  4OX9 T;  1ZHC A;  2LHN A;  5FL0 A;  5IWA T;  1YQ4 A;  2A9U A;  4ADZ A;  4YJ3 E;  1IJ5 A;  4K0K T;  2ACX A;  4BJN A;  5ABH A;  1MND A;  5FP3 A;  5LHI B;  2XAQ B;  2BG9 E;  2FJE A;  1MMA A;  3UU5 A;  2CBJ A;  4QKN A;  2WU2 A;  3ZMZ B;  2ZM0 A;  2NW8 A;  3ZMS B;  3AE5 A;  1OED E;  4X5T A;  3MKD A;  2QGS A;  4HFH A;  2Q9Q A;  3ZCI A;  2QVA A;  3LFM A;  3UU6 A;  5AQU B;  4I43 B;  2WM9 A;  2MPK A;  3OKQ A;  3PUG A;  3ONL C;  3C51 A;  4ILU A;  4LFC T;  4U72 A;  2V1D B;  4PK5 A;  3VHL A;  4JI3 T;  3HL6 A;  3W15 B;  4YSX A;  4U3C A;  5LGT B;  1W0B A;  2DHR A;  5HEO A;  1HNX T;  2YDS A;  4C90 A;  2VKJ A;  4HFB A;  3AE8 A;  1O3X A;  4UV8 B;  2V6X A;  3RHW A;  5KXJ A;  2W63 A;  5F8P A; 
#chains in the Genus database with same CATH homology
 3T1H T;  5LMN T;  4JI5 T;  4DV7 T;  4LF5 T;  2ZM6 T;  4OX9 T;  4LFB T;  5IWA T;  1IBL T;  2UXC T;  4JI4 T;  4NXN T;  1I94 T;  4B3S T;  4DV2 T;  4LF6 T;  4K0K T;  1IBM T;  2UUA T;  4NXM T;  4X66 T;  4DR6 T;  4DR4 T;  4DV3 T;  4AQY T;  4DR3 T;  1XNQ T;  2UUC T;  3OTO T;  4DV5 T;  1XMQ T;  1HNW T;  4DV6 T;  4X62 T;  2HHH T;  1N33 T;  1J5E T;  4JYA T;  4DR7 T;  1IBK T;  5BR8 T;  4DR2 T;  4YHH T;  1XNR T;  2UU9 T;  4JI6 T;  2UUB T;  4LFC T;  2F4V T;  4YY3 T;  4B3M T;  2E5L T;  4JI3 T;  1N32 T;  2UXD T;  4DR1 T;  4DR5 T;  4GKJ T;  1N36 T;  4LF7 T;  5LMU T;  4JI2 T;  4DUY T;  4JI1 T;  1HNX T;  4DV0 T;  4LF9 T;  2UXB T;  4KHP T;  3T1Y T;  4X65 T;  4B3R T;  4GKK T;  1FJG T;  2VQE T;  4X64 T;  1N34 T;  4DUZ T;  1XMO T;  4LF8 T;  2VQF T;  4DV4 T;  4LFA T;  4JI7 T;  4JV5 T;  4LF4 T;  4B3T T;  4JI0 T;  1HNZ T;  4JI8 T;  1HR0 T;  4DV1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...