1IBKT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibkT00
4LF4T 5IWAT 4DV4T 4OX9T 4YHHT 3OTOT 4K0KT 2ZM6T 4JI8T 2UXCT 4DR4T 4X64T 2F4VT 4DR5T 4AQYT 5LMNT 5BR8T 1N34T 4LF7T 4DR1T 4DV6T 4NXNT 1I94T 4JI0T 4JI1T 4GKJT 4DV1T 4DR7T 4B3ST 4LF8T 2E5LT 1HR0T 4GKKT 4JI5T 4JI3T 2UUCT 4JYAT 2UUAT 1HNXT 4DV5T 4DV0T 1IBLT 1FJGT 1IBKT 1IBMT 1N32T 4LFAT 4JV5T 4DR3T 3T1HT 1XNRT 4X65T 4DUZT 4DUYT 2UUBT 4DV3T 4B3MT 2VQFT 1N33T 2HHHT 1XNQT 4LF6T 3T1YT 4LF9T 4X62T 4DR6T 4LFCT 4B3TT 1XMQT 4KHPT 4YY3T 4X66T 2UXDT 4B3RT 4DV2T 1HNZT 4NXMT 2UU9T 1J5ET 4JI7T 4JI6T 5LMUT 2VQET 2UXBT 4LFBT 4JI4T 1N36T 1XMOT 4JI2T 1HNWT 4LF5T 4DR2T 4DV7T
chains in the Genus database with same CATH superfamily
2YDQA 2C5KT 4CXXA 2W66A 3LK2B 3AA6B 3U78A 4ISSA 4MLKA 2XM1A 2BS2A 4AQFA 4C90A 2Y48B 2KMFA 2DLRA 2WDRA 4B3ST 4GKKT 2H7VC 4L0RA 1I6ZA 5C8YE 2NW8A 4JYAT 2B76A 4DV5T 3AVSA 1VRBA 4EEBA 3ZCIA 3TLSA 1IBLT 3L3PA 1IBKT 2NW9A 3EI0A 4H9RC 5FY0A 4MFRA 1D0XA 2KLQA 2I59A 1R8IA 3SFDA 2V5DA 2W61A 4ZI7E 4EXTA 4O2BE 4HWDA 5KX5E 2OLTA 4TWHA 4EOZB 4KHPT 2E9XB 2Q9QD 3K3OA 3V5SA 1KFYA 2IW5B 4AKGA 1KNZA 3ZC1A 2ZMAA 4ERRA 5IYZE 2VQET 2ACXA 5FL1A 2E8IA 2HPLA 4TX5A 4JI2T 4XBFB 1HNWT 5LHHB 4EIWA 2LRLA 5F8PA 2XY8B 3VRBA 3CQXC 2WDVA 4QH1A 3I0OA 2CXFA 2ACZA 5L3BB 2EHOB 4OHFA 3JC6D 1FMVA 4JI5T 1D1AA 3RIFA 4TWDA 5CA0E 2UXNB 3HR0A 2YDRA 2EHOC 1S94A 5CGMA 4U2YA 3I9YA 3UTKA 1E1HB 1M7KA 1MMGA 5EK3A 5HXHA 1QUUA 5IUXA 3TLWA 4HN9A 5TAOA 5EK4A 2VL8A 4PK6A 5AQQB 2ODVA 3VR9A 3HL6A 3M3ZB 1XMQT 4UV8B 1UX4A 4HFBA 1WCRA 3AA1B 1MMDA 2L8KA 3J7Yq 4HKAA 1T7SA 3EAMA 2XAFB 2XQ8A 4TV8E 1HX8A 1YQ3A 4UF0A 4CXWA 3P4QA 2DI4A 2HN1A 5AQGB 4O4JE 4AQGA 2XM2A 4PW8A 4PFPA 2XQ3A 5FP3A 4X1KE 4LF5T 1XZYA 2J4GA 4AKIA 5AQOB 3EVYA 3ZN0B 2VURA 3SOLA 4X64T 3JADA 3KDSE 3AA0B 5LNKA 2LSGA 2RPAA 3HA4A 2X9HA 4DV6T 1SE7A 1Z8UA 1WYCA 5LA6E 5ADXL 1HG2A 2RP4A 4HFEA 3NZQA 3CK6A 5LGUB 2R6GF 4ZZBA 3I9WA 5LGTB 4IDNA 3J9X1 4A5XA 3AECA 5LJNA 4G2AA 5AQMB 4DUYT 1D0YA 5JVDE 3PURA 4EGWA 2XQAA 3AE1A 3GA8A 2VB6A 3WI3A 2JMHA 4I43B 1JNRA 3NRXA 4LFCT 5HEHA 1OXZA 4B3TT 4WW0A 2LHRA 1WR0A 4UV9B 3NZPA 2WS3A 2V8SV 5LYJE 3P4PA 4U7YA 3UT5E 3HI2A 2LSKA 2NW7A 5ABHA 5JR9C 2YK0A 3IBPA 2YEVC 3ZC0A 4K0UA 2BS4A 5AQVB 5GONE 4IDPA 4DMWA 4DNDA 2CHNA 2J62A 2VKDA 3C64A 4AQFC 5IWAT 4P09A 3DJBA 2VKJA 2VVSA 3IHRA 4KHZF 3RGLA 3OVUA 1KK7A 4IDQA 2VK9A 3F31A 2KSRA 3FZHB 1L0VA 2YKSA 3PJAJ 3QK6A 3RPUA 2HH7A 4EZHA 2BZBA 2BG9B 3BK9A 3K8PC 3VKGA 1CUNA 2XQ6A 1YW0A 5HXEA 4AI6A 3V5UA 3CX7B 1YKEB 4ILBA 2CWOA 2JQHA 3CKDA 2VVNA 4JV5T 2WAUA 2V7JA 3UQ7A 1WR6A 4Z8XA 5AQIB 3NVOA 3I1AA 3S4UA 1YQ4A 2PBIA 4DR6T 3MKDA 1FMWA 4HFHA 3KBTA 3OJAA 5ABFA 2CBIA 2XAQB 2N2NA 2X67A 1KNPA 3RYIE 4NIQA 1N36T 4GK5E 4PK4A 3R84B 2EHOD 4PK5A 3FHNA 3HKCE 2MBGA 5JRCA 4LF4T 1YD8G 2W62A 5DQWA 4GK0E 2PTFA 4DV4T 1LRZA 4P0BA 4DR4T 1D1CA 2AE9A 4CXYA 3UU4A 1BR1A 3UQ4A 3AE3A 2WSSV 1ZV4X 2XQ9A 5LBQB 4AKRB 1MIYA 2DNXA 2V7LA 2WMOA 1I94T 3AEBA 3AEFA 4ANJA 5LG3A 2CEAA 2XQ7A 4JI3T 4PJMA 4OK0A 5LGNB 4TNWA 2D5UA 3RQWA 4ZS2A 2WZHA 5AQKB 3QC9A 1ZKEA 1LVFA 5J1GA 3CX6B 3AA7B 3TLTA 1N32T 2IC6A 4BAYB 4IIJE 1E2AA 1XNRT 5CA1E 3O1IA 3JCFA 4B3MT 2CWYA 2HHHT 2BKOA 1D0ZA 3FBZA 4LF6T 4LF9T 4XZCA 4B6XA 2CLYC 1MMNA 4Z90A 3P4SA 5IHYA 3OYZA 4ILCA 5AQRB 2K9AA 3ETUA 3LBXA 3UULA 5J2TE 1KNRA 3OKQA 1HNZT 3VHLA 2C5IT 4H9SE 4EAHA 2Y6XA 2JQKA 3ZMSB 2MPKA 2BBJA 5L4HA 2PFVA 2RA1A 2DWGA 2K24A 3ZLIA 4TNVA 3WAJA 1J5WA 2K5BB 4WBOA 4ZZCA 5JDNA 1US7B 1FEWA 1N34T 4H9OC 3HKEE 4EB6E 2E5LT 4YT0A 2UUCT 3KFWX 3SRZA 3PUAA 1UGOA 4HFIA 2XTLA 2N9DA 3FXEB 4AIUA 4EV6A 2CM0A 4HGAA 2D2SA 1HG5A 4DR3T 2BBHA 4YFSA 5HCMA 3QUJA 2VQFT 3CPZA 3RYFE 5J2UE 3A5XA 1ZEEA 1U5PA 2XHEB 3MACA 5JDGA 2HPJA 3CIRA 2CBJA 3KV9A 1UUSA 1W09A 5LCYA 2CXDA 2MYSA 3UUMA 5AQJB 2BG9A 1MMAA 2XSBA 1HTJF 1OEDA 4U74A 1NWMX 2BKNA 5HEJA 4DV7T 2P9BA 2XQ5A 1VCSA 3FZMB 2WU5A 3FZFB 2BKPA 3MZKB 4GYSA 4U3CA 5HXRA 3O4XE 2UXCT 2A2FX 2E9XC 2V7KA 4KMCA 1SA0E 3C50A 3MJXA 2XAGB 5HEGA 2X51A 3ZSTA 3ZYMA 1LKXA 2ZM8A 2FBWA 4ILUA 3AB3B 2E5VA 3CMLA 1OWAA 1D1BA 3AAAB 4HE8A 1H7CA 3Q5DA 4CN6A 2IUBA 2LSYA 3NWIA 5ABFB 4QXBB 4CI1B 2LSIA 4MALA 3RX6A 1IAPA 3B13A 4OFZA 2JPFA 3ZSSA 4ZEYA 5AQSB 3Q5EA 4EEDA 3UU5A 2WMNA 3EDVA 5JRCB 3MXZA 5LXTE 3AE6A 2X9WA 1WYBA 4U31A 2H89A 3PE0A 1XDOA 2G0UA 3ZT6A 4G63A 5HWXA 5L3EB 4X1YE 3KV6A 3M65A 4GYRA 2WB5A 1UURA 3E22E 4X20E 3RKGA 3FZKB 1VOMA 4YHJA 5JDMA 2VWAA 1BR4A 4DR2T 4DO0A 3MK7C 3AE7A 2LOPA 2NTXA 4PJJA 3N9PA 4QXCB 2X0HA 4KX6A 3L09A 3IA3A 4WYVA 2IC9A 1IJ5A 4LF7T 3PU8A 4JEHB 4JEUB 2DL1A 3UFEA 2BVMA 2BS3A 5KDMC 5BMVE 4QWNB 3WAKA 5LHGB 3LFMA 2H88A 4CI2B 2VKHA 4UVBB 1W0BA 2I6HA 3LBXB 2JJ9A 5L2LA 2WWUA 5JDQA 5LP6E 3N2KE 2WU2A 1SUMB 1S35A 4BA9A 4DV3T 3RIUA 4WBNE 2NOXA 5LBMA 2GK9A 5E0OA 2Z6EA 1T98A 5ABEA 3T1YT 2LKGA 2ODUA 2W67A 4IDOA 3VKHA 3ZT7A 4DBQA 3I0QA 4UELA 5LHIB 1WRDA 4H9QC 5JTGA 4COFA 3FXDB 4I50E 3LK3B 2A3DA 1W9RA 3IF8B 2HN2A 3N9OA 5C3JA 3SFEA 2LKHA 2KWHA 3P8CD 4MHCA 3PUSA 2WY2A 2XZEA 3KVBA 3MA9A 3ZYLA 4JI8T 2WP9A 2X9XA 1M62A 4O4LE 4YTNA 5H6QB 2K3WA 3RH3A 3Q9DA 4P0AA 5LG4A 2FUPA 4M1PA 4LF8T 3PUGA 3E08A 3OPCA 2WQYA 3AAIA 4Q25A 4E7ZA 2LE8A 4O4HE 5L3GB 4F8HA 4UEMA 1EZ3A 3P50A 4TUYE 4UVCB 3LK42 4JLEA 3ZKRA 3PUQA 1DU2A 3O1HA 4YJ2E 2CMRA 4QHOA 4QH5A 2ZM2A 1B7TA 3H3MA 3BQKA 1N33T 3O9XA 2D9DA 3FZLB 3RIAA 1OEDB 3N2OA 3A8YC 4NUUA 1QSDA 2E9XD 3D0TA 2JIWA 5DQVA 4B3RT 2BG9C 1KEYA 3Q5XA 1OEDC 4IGUA 5L4EA 3P7IA 3A7MA 4ZHQE 4OYJA 4MBQA 2JRKA 2WM9A 3SWHA 4DVDA 3O1JA 4U72A 2I0MA 2L3LA 4IL9A 3P4RA 2V7IA 1YKHB 5ABGA 4EYYR 3GMIA 4DIDB 3B57A 5KMGP 4PJNA 1X9BA 4DR1T 3VU7H 4HWIB 4DR7T 4YSZA 3AE4A 1V9DA 5ETWA 3K1SA 4IL4A 3EABA 2BDEA 3RF1A 2QGSA 4HFVA 4AXPA 3UU3A 4AKLA 2YDSA 1VCTA 5F3JA 4LFAT 2LT3A 1HFAA 4DUZT 3NRYA 3PU3A 4TWFA 4ZI2C 4FI5A 4OYKA 2W00A 3EDUA 5AFUL 4QXHB 3UUBA 2LEHA 4X62T 5H6RB 3KINB 3PUVF 4GOUA 4GIWA 3FBLA 1SHZC 3H3AA 4X66T 1HF8A 4PFOA 5HCJA 3ONLC 3N5LA 1HCIA 4JI6T 3PUYF 2C0SA 2BG9E 4QX7B 3AE2A 2XPKA 1OEDE 4IT4A 1Z0PA 4ZI3C 2M67A 3AEGA 4EZ4A 3L8RA 2X68A 2LSJA 3KV4A 4CN4A 4OX9T 5HXSA 3GWHA 2ZM6T 2V1DB 2SPCA 4X5TA 4AQYT 3ZN1B 1U4QA 2FJDA 3ZT5A 4YXDA 4P1NA 4ILAA 2WBLA 4DBRA 1HS7A 5FMNA 1JNZA 3C98B 5FYMA 3RKOA 1MNEA 3GN5A 3PDYA 3RIUC 1YXRA 2X9YA 3UUXB 2IHR1 4TZ4C 3RQUA 2XJ7A 4HTEA 2NR4A 2J47A 1ZHCA 3ZMUB 5A1LA 5JREA 5AQFB 1XWMA 5CFBA 4IE6A 2XQYA 2J1DG 4QKNA 3CX8B 5AQTB 5JR9A 4PNIA 2XUEA 2W2UA 3N9MA 3Q2MA 3LSVA 5HEOA 1NEKA 3N9QA 2XASB 2LOSA 4L5GA 2WDQA 4L9IA 1G73A 2H7OA 4K0KT 3ESLA 4V1Av 1E7PA 3ONXA 2D0TA 4N78D 5FVKA 2ZLYA 4AKHA 3P4WA 2PJQA 1W0AA 4NXNT 4JI0T 3ANWA 4DV1T 2YU1A 4PJLA 3QNUA 2DHRA 2Q9QA 4UVAB 3W15B 1UCUA 2JQ9A 1NAFA 3ZCJA 3BQLA 4X1IE 1HNXT 1X79A 1MIWA 5LB7B 3ZJ1A 1IBMT 3T1HT 4X65T 5LJMA 2XAJB 3TLVA 3QB5A 3EHZA 1MNDA 4QH4A 3ETVA 2IIUA 4JBWF 2JQQA 5HAXA 2PG8A 3HKBE 2LM2A 4CN1A 3G06A 5C2TA 4H63H 4ZS3A 3L39A 4U2ZA 2A72A 5LMUT 4CQIA 4JUYA 3VRAA 2XSAA 4H9NC 2BVLA 4YSXA 4ADZA 4TV9E 4EYUA 2W0GA 4ASKA 2N1GA 1T72A 2YINA 3SS1A 4ISTA 4PAGA 3OTOT 4H9PC 4ZI2D 3AXJB 3FB2A 4I4TE 5L3CB 2IAKA 5FXZA 1ZOYA 5FY1A 4WNKA 3LDQB 2WWVA 4LMLA 3ONJA 5CJ5A 3RLFF 5DJQC 1XDPA 4U33A 4CI3B 4I0UA 5EK2A 3AE5A 5JDFA 3KBUA 3CQGB 3C4ZA 4E7SA 2NP9A 2AXDS 4UR9A 3PUXF 2W63A 2UUBT 4QX8B 4ZI3D 3C4WA 1XNQT 3BQIA 3F57A 2UXXB 4UIGA 2QRXA 3C51A 2XQ4A 3DTOA 2MOZA 2YOEA 3QB5K 4ZOLE 3EUHA 4YY3T 4DV2T 5HYAA 3AVRA 3N9LA 4O8SA 3UU8A 3AAEB 4YSYA 1IZNB 3PV0F 2IDOB 2B1EA 2DWKA 4TN7B 4WZXA 2V6YB 4KUMB 3TKLB 2DCFA 5JH7E 1XMOT 1GQEA 3GN5B 2MTQA 2FJBA 2KNDA 2D0UA 5AQUB 5AQNB 2QVAA 3K3QC 4LMKA 4ZXLA 5FL0A 2FJEA 3OYXA 3ZMTB 3X1DA 2YN6A 2KZ7B 4FJOA 3U3IA 3ZMVB 4LMJA 5BR8T 2KWIB 2CXLA 4H63V 4JI1T 3UFGA 3RRWA 3PJAA 4YTMA 2KT9A 4KI0F 2M6BA 2M6IA 5CB4E 2LHNA 4IE0A 1CHUA 2CRBA 2CCQA 2CA5A 4HWHA 3CWZB 5JR9B 3H37A 3IEEA 1FJGT 3AEEA 2OA5A 5LOVE 5DABA 2L9QA 2CHOA 3RRCA 2QA7A 3AE9A 3PTRB 4HFCA 2NWBA 3RI5A 1WLXA 4J2CA 5FY7A 3TLUA 2QYWA 1O3XA 4Z91A 5FXXA 2VL0A 3RYHE 5HEUA 5L3FB 5AQHB 2Y8DA 4A97A 2CPTA 4NPPA 4IREA 3ZJ2A 3RC8A 4LFBT 3C4XA 3ANWB 2LLYA 3PUWF 2Q9QB 1QLBA 3AEDA 2LRKA 2C5JA 2WCAA 3ZYKA 4IE4A 4CZZB 2E2AA 3AE8A 3T8OA 2E9XA 2X66A 5JQGE 5FNVE 4KBMB 2WZIA 2XAHB 2Q9QC 2F4VT 5FXWA 3CVRA 4DR5T 4HWCA 5LMNT 2K48A 1NENA 3UU6A 1HX1B 3LG7A 4HWFA 1FIOA 2LM9A 4KP3C 4UXNB 4HFDA 4F6RC 4O2AE 5HWYA 1AJ3A 5HXCA 2CE7A 5J0ZA 5EZYE 3CQCB 1KF6A 4A98A 3RYCE 5KXJA 3E0ZA 3LJCA 4I55E 3N9NA 2EHOA 2VKOA 1BR2A 5L47A 3DP7A 1G8XA 1Y64B 3JC6C 3RC3A 2A9UA 1T8BA 2UXDT 3N2GE 3AXJA 2KINB 4NXMT 3VR8A 4O4IE 4BJMA 1Y01A 3PUZF 4C91A 1J1JA 2YU2A 2UXBT 3ZPOA 2IMLA 1UK5A 3RHWA 3UUNA 2V26A 3NKZA 2FJAA 4DMVA 5JDLA 2ES0A 2JMKA 4IHJE 3QOFA 4IE7A 4YHHT 5FKYA 3HKDE 2OV9A 2V6XA 3ZMZB 4IDZA 3Q5WA 4YLHA 3JAEA 5JDHA 4YJ3E 4YTPA 2NTYA 3R6NA 5FVLA 2CLYB 4A56A 4UF0B 3ZEFB 2V7MA 3NBXX 4GKJT 1ZP0A 1MIVA 1HR0T 3F2EA 1BR0A 1WFDA 2KXPB 5FXVA 2UUAT 2VASA 4DV0T 2X0YA 4XAXB 3OBVE 5M4YA 2V6YA 4HEAA 3ABVA 1LVKA 3KV5A 5F5WA 3AEAA 3JAFA 2H3RA 5L3DB 2LJLA 1UX5A 3KVAA 3K3NA 2V5CA 4U7IA 2W4XA 3B5MA 2ZM0A 2UU9T 1J5ET 4JI7T 5AQPB 4AISA 4IE5A 4JI4T 2X0LB 5AQLB 4BJNA 1IJ6A 4NUVA 2MAWA
chains in the Genus database with same CATH topology
4LF4T 5IWAT 4DV4T 4OX9T 4YHHT 3OTOT 4K0KT 2ZM6T 4JI8T 2UXCT 4DR4T 4X64T 2F4VT 4DR5T 4AQYT 5LMNT 5BR8T 1N34T 4LF7T 4DR1T 4DV6T 4NXNT 1I94T 4JI0T 4JI1T 4GKJT 4DV1T 4DR7T 4B3ST 4LF8T 2E5LT 1HR0T 4GKKT 4JI5T 4JI3T 2UUCT 4JYAT 2UUAT 1HNXT 4DV5T 4DV0T 1IBLT 1FJGT 1IBKT 1IBMT 1N32T 4LFAT 4JV5T 4DR3T 3T1HT 1XNRT 4X65T 4DUZT 4DUYT 2UUBT 4DV3T 4B3MT 2VQFT 1N33T 2HHHT 1XNQT 4LF6T 3T1YT 4LF9T 4X62T 4DR6T 4LFCT 4B3TT 1XMQT 4KHPT 4YY3T 4X66T 2UXDT 4B3RT 4DV2T 1HNZT 4NXMT 2UU9T 1J5ET 4JI7T 4JI6T 5LMUT 2VQET 2UXBT 4LFBT 4JI4T 1N36T 1XMOT 4JI2T 1HNWT 4LF5T 4DR2T 4DV7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 T;  5IWA T;  4DV4 T;  4OX9 T;  4YHH T;  3OTO T;  4K0K T;  2ZM6 T;  4JI8 T;  2UXC T;  4DR4 T;  4X64 T;  2F4V T;  4DR5 T;  4AQY T;  5LMN T;  5BR8 T;  1N34 T;  4LF7 T;  4DR1 T;  4DV6 T;  4NXN T;  1I94 T;  4JI0 T;  4JI1 T;  4GKJ T;  4DV1 T;  4DR7 T;  4B3S T;  4LF8 T;  2E5L T;  1HR0 T;  4GKK T;  4JI5 T;  4JI3 T;  2UUC T;  4JYA T;  2UUA T;  1HNX T;  4DV5 T;  4DV0 T;  1IBL T;  1FJG T;  1IBK T;  1IBM T;  1N32 T;  4LFA T;  4JV5 T;  4DR3 T;  3T1H T;  1XNR T;  4X65 T;  4DUZ T;  4DUY T;  2UUB T;  4DV3 T;  4B3M T;  2VQF T;  1N33 T;  2HHH T;  1XNQ T;  4LF6 T;  3T1Y T;  4LF9 T;  4X62 T;  4DR6 T;  4LFC T;  4B3T T;  1XMQ T;  4KHP T;  4YY3 T;  4X66 T;  2UXD T;  4B3R T;  4DV2 T;  1HNZ T;  4NXM T;  2UU9 T;  1J5E T;  4JI7 T;  4JI6 T;  5LMU T;  2VQE T;  2UXB T;  4LFB T;  4JI4 T;  1N36 T;  1XMO T;  4JI2 T;  1HNW T;  4LF5 T;  4DR2 T;  4DV7 T; 
#chains in the Genus database with same CATH topology
 2YDQ A;  2C5K T;  4CXX A;  2W66 A;  3LK2 B;  3AA6 B;  3U78 A;  4ISS A;  4MLK A;  2XM1 A;  2BS2 A;  4AQF A;  4C90 A;  2Y48 B;  2KMF A;  2DLR A;  2WDR A;  4B3S T;  4GKK T;  2H7V C;  4L0R A;  1I6Z A;  5C8Y E;  2NW8 A;  4JYA T;  2B76 A;  4DV5 T;  3AVS A;  1VRB A;  4EEB A;  3ZCI A;  3TLS A;  1IBL T;  3L3P A;  1IBK T;  2NW9 A;  3EI0 A;  4H9R C;  5FY0 A;  4MFR A;  1D0X A;  2KLQ A;  2I59 A;  1R8I A;  3SFD A;  2V5D A;  2W61 A;  4ZI7 E;  4EXT A;  4O2B E;  4HWD A;  5KX5 E;  2OLT A;  4TWH A;  4EOZ B;  4KHP T;  2E9X B;  2Q9Q D;  3K3O A;  3V5S A;  1KFY A;  2IW5 B;  4AKG A;  1KNZ A;  3ZC1 A;  2ZMA A;  4ERR A;  5IYZ E;  2VQE T;  2ACX A;  5FL1 A;  2E8I A;  2HPL A;  4TX5 A;  4JI2 T;  4XBF B;  1HNW T;  5LHH B;  4EIW A;  2LRL A;  5F8P A;  2XY8 B;  3VRB A;  3CQX C;  2WDV A;  4QH1 A;  3I0O A;  2CXF A;  2ACZ A;  5L3B B;  2EHO B;  4OHF A;  3JC6 D;  1FMV A;  4JI5 T;  1D1A A;  3RIF A;  4TWD A;  5CA0 E;  2UXN B;  3HR0 A;  2YDR A;  2EHO C;  1S94 A;  5CGM A;  4U2Y A;  3I9Y A;  3UTK A;  1E1H B;  1M7K A;  1MMG A;  5EK3 A;  5HXH A;  1QUU A;  5IUX A;  3TLW A;  4HN9 A;  5TAO A;  5EK4 A;  2VL8 A;  4PK6 A;  5AQQ B;  2ODV A;  3VR9 A;  3HL6 A;  3M3Z B;  1XMQ T;  4UV8 B;  1UX4 A;  4HFB A;  1WCR A;  3AA1 B;  1MMD A;  2L8K A;  3J7Y q;  4HKA A;  1T7S A;  3EAM A;  2XAF B;  2XQ8 A;  4TV8 E;  1HX8 A;  1YQ3 A;  4UF0 A;  4CXW A;  3P4Q A;  2DI4 A;  2HN1 A;  5AQG B;  4O4J E;  4AQG A;  2XM2 A;  4PW8 A;  4PFP A;  2XQ3 A;  5FP3 A;  4X1K E;  4LF5 T;  1XZY A;  2J4G A;  4AKI A;  5AQO B;  3EVY A;  3ZN0 B;  2VUR A;  3SOL A;  4X64 T;  3JAD A;  3KDS E;  3AA0 B;  5LNK A;  2LSG A;  2RPA A;  3HA4 A;  2X9H A;  4DV6 T;  1SE7 A;  1Z8U A;  1WYC A;  5LA6 E;  5ADX L;  1HG2 A;  2RP4 A;  4HFE A;  3NZQ A;  3CK6 A;  5LGU B;  2R6G F;  4ZZB A;  3I9W A;  5LGT B;  4IDN A;  3J9X 1;  4A5X A;  3AEC A;  5LJN A;  4G2A A;  5AQM B;  4DUY T;  1D0Y A;  5JVD E;  3PUR A;  4EGW A;  2XQA A;  3AE1 A;  3GA8 A;  2VB6 A;  3WI3 A;  2JMH A;  4I43 B;  1JNR A;  3NRX A;  4LFC T;  5HEH A;  1OXZ A;  4B3T T;  4WW0 A;  2LHR A;  1WR0 A;  4UV9 B;  3NZP A;  2WS3 A;  2V8S V;  5LYJ E;  3P4P A;  4U7Y A;  3UT5 E;  3HI2 A;  2LSK A;  2NW7 A;  5ABH A;  5JR9 C;  2YK0 A;  3IBP A;  2YEV C;  3ZC0 A;  4K0U A;  2BS4 A;  5AQV B;  5GON E;  4IDP A;  4DMW A;  4DND A;  2CHN A;  2J62 A;  2VKD A;  3C64 A;  4AQF C;  5IWA T;  4P09 A;  3DJB A;  2VKJ A;  2VVS A;  3IHR A;  4KHZ F;  3RGL A;  3OVU A;  1KK7 A;  4IDQ A;  2VK9 A;  3F31 A;  2KSR A;  3FZH B;  1L0V A;  2YKS A;  3PJA J;  3QK6 A;  3RPU A;  2HH7 A;  4EZH A;  2BZB A;  2BG9 B;  3BK9 A;  3K8P C;  3VKG A;  1CUN A;  2XQ6 A;  1YW0 A;  5HXE A;  4AI6 A;  3V5U A;  3CX7 B;  1YKE B;  4ILB A;  2CWO A;  2JQH A;  3CKD A;  2VVN A;  4JV5 T;  2WAU A;  2V7J A;  3UQ7 A;  1WR6 A;  4Z8X A;  5AQI B;  3NVO A;  3I1A A;  3S4U A;  1YQ4 A;  2PBI A;  4DR6 T;  3MKD A;  1FMW A;  4HFH A;  3KBT A;  3OJA A;  5ABF A;  2CBI A;  2XAQ B;  2N2N A;  2X67 A;  1KNP A;  3RYI E;  4NIQ A;  1N36 T;  4GK5 E;  4PK4 A;  3R84 B;  2EHO D;  4PK5 A;  3FHN A;  3HKC E;  2MBG A;  5JRC A;  4LF4 T;  1YD8 G;  2W62 A;  5DQW A;  4GK0 E;  2PTF A;  4DV4 T;  1LRZ A;  4P0B A;  4DR4 T;  1D1C A;  2AE9 A;  4CXY A;  3UU4 A;  1BR1 A;  3UQ4 A;  3AE3 A;  2WSS V;  1ZV4 X;  2XQ9 A;  5LBQ B;  4AKR B;  1MIY A;  2DNX A;  2V7L A;  2WMO A;  1I94 T;  3AEB A;  3AEF A;  4ANJ A;  5LG3 A;  2CEA A;  2XQ7 A;  4JI3 T;  4PJM A;  4OK0 A;  5LGN B;  4TNW A;  2D5U A;  3RQW A;  4ZS2 A;  2WZH A;  5AQK B;  3QC9 A;  1ZKE A;  1LVF A;  5J1G A;  3CX6 B;  3AA7 B;  3TLT A;  1N32 T;  2IC6 A;  4BAY B;  4IIJ E;  1E2A A;  1XNR T;  5CA1 E;  3O1I A;  3JCF A;  4B3M T;  2CWY A;  2HHH T;  2BKO A;  1D0Z A;  3FBZ A;  4LF6 T;  4LF9 T;  4XZC A;  4B6X A;  2CLY C;  1MMN A;  4Z90 A;  3P4S A;  5IHY A;  3OYZ A;  4ILC A;  5AQR B;  2K9A A;  3ETU A;  3LBX A;  3UUL A;  5J2T E;  1KNR A;  3OKQ A;  1HNZ T;  3VHL A;  2C5I T;  4H9S E;  4EAH A;  2Y6X A;  2JQK A;  3ZMS B;  2MPK A;  2BBJ A;  5L4H A;  2PFV A;  2RA1 A;  2DWG A;  2K24 A;  3ZLI A;  4TNV A;  3WAJ A;  1J5W A;  2K5B B;  4WBO A;  4ZZC A;  5JDN A;  1US7 B;  1FEW A;  1N34 T;  4H9O C;  3HKE E;  4EB6 E;  2E5L T;  4YT0 A;  2UUC T;  3KFW X;  3SRZ A;  3PUA A;  1UGO A;  4HFI A;  2XTL A;  2N9D A;  3FXE B;  4AIU A;  4EV6 A;  2CM0 A;  4HGA A;  2D2S A;  1HG5 A;  4DR3 T;  2BBH A;  4YFS A;  5HCM A;  3QUJ A;  2VQF T;  3CPZ A;  3RYF E;  5J2U E;  3A5X A;  1ZEE A;  1U5P A;  2XHE B;  3MAC A;  5JDG A;  2HPJ A;  3CIR A;  2CBJ A;  3KV9 A;  1UUS A;  1W09 A;  5LCY A;  2CXD A;  2MYS A;  3UUM A;  5AQJ B;  2BG9 A;  1MMA A;  2XSB A;  1HTJ F;  1OED A;  4U74 A;  1NWM X;  2BKN A;  5HEJ A;  4DV7 T;  2P9B A;  2XQ5 A;  1VCS A;  3FZM B;  2WU5 A;  3FZF B;  2BKP A;  3MZK B;  4GYS A;  4U3C A;  5HXR A;  3O4X E;  2UXC T;  2A2F X;  2E9X C;  2V7K A;  4KMC A;  1SA0 E;  3C50 A;  3MJX A;  2XAG B;  5HEG A;  2X51 A;  3ZST A;  3ZYM A;  1LKX A;  2ZM8 A;  2FBW A;  4ILU A;  3AB3 B;  2E5V A;  3CML A;  1OWA A;  1D1B A;  3AAA B;  4HE8 A;  1H7C A;  3Q5D A;  4CN6 A;  2IUB A;  2LSY A;  3NWI A;  5ABF B;  4QXB B;  4CI1 B;  2LSI A;  4MAL A;  3RX6 A;  1IAP A;  3B13 A;  4OFZ A;  2JPF A;  3ZSS A;  4ZEY A;  5AQS B;  3Q5E A;  4EED A;  3UU5 A;  2WMN A;  3EDV A;  5JRC B;  3MXZ A;  5LXT E;  3AE6 A;  2X9W A;  1WYB A;  4U31 A;  2H89 A;  3PE0 A;  1XDO A;  2G0U A;  3ZT6 A;  4G63 A;  5HWX A;  5L3E B;  4X1Y E;  3KV6 A;  3M65 A;  4GYR A;  2WB5 A;  1UUR A;  3E22 E;  4X20 E;  3RKG A;  3FZK B;  1VOM A;  4YHJ A;  5JDM A;  2VWA A;  1BR4 A;  4DR2 T;  4DO0 A;  3MK7 C;  3AE7 A;  2LOP A;  2NTX A;  4PJJ A;  3N9P A;  4QXC B;  2X0H A;  4KX6 A;  3L09 A;  3IA3 A;  4WYV A;  2IC9 A;  1IJ5 A;  4LF7 T;  3PU8 A;  4JEH B;  4JEU B;  2DL1 A;  3UFE A;  2BVM A;  2BS3 A;  5KDM C;  5BMV E;  4QWN B;  3WAK A;  5LHG B;  3LFM A;  2H88 A;  4CI2 B;  2VKH A;  4UVB B;  1W0B A;  2I6H A;  3LBX B;  2JJ9 A;  5L2L A;  2WWU A;  5JDQ A;  5LP6 E;  3N2K E;  2WU2 A;  1SUM B;  1S35 A;  4BA9 A;  4DV3 T;  3RIU A;  4WBN E;  2NOX A;  5LBM A;  2GK9 A;  5E0O A;  2Z6E A;  1T98 A;  5ABE A;  3T1Y T;  2LKG A;  2ODU A;  2W67 A;  4IDO A;  3VKH A;  3ZT7 A;  4DBQ A;  3I0Q A;  4UEL A;  5LHI B;  1WRD A;  4H9Q C;  5JTG A;  4COF A;  3FXD B;  4I50 E;  3LK3 B;  2A3D A;  1W9R A;  3IF8 B;  2HN2 A;  3N9O A;  5C3J A;  3SFE A;  2LKH A;  2KWH A;  3P8C D;  4MHC A;  3PUS A;  2WY2 A;  2XZE A;  3KVB A;  3MA9 A;  3ZYL A;  4JI8 T;  2WP9 A;  2X9X A;  1M62 A;  4O4L E;  4YTN A;  5H6Q B;  2K3W A;  3RH3 A;  3Q9D A;  4P0A A;  5LG4 A;  2FUP A;  4M1P A;  4LF8 T;  3PUG A;  3E08 A;  3OPC A;  2WQY A;  3AAI A;  4Q25 A;  4E7Z A;  2LE8 A;  4O4H E;  5L3G B;  4F8H A;  4UEM A;  1EZ3 A;  3P50 A;  4TUY E;  4UVC B;  3LK4 2;  4JLE A;  3ZKR A;  3PUQ A;  1DU2 A;  3O1H A;  4YJ2 E;  2CMR A;  4QHO A;  4QH5 A;  2ZM2 A;  1B7T A;  3H3M A;  3BQK A;  1N33 T;  3O9X A;  2D9D A;  3FZL B;  3RIA A;  1OED B;  3N2O A;  3A8Y C;  4NUU A;  1QSD A;  2E9X D;  3D0T A;  2JIW A;  5DQV A;  4B3R T;  2BG9 C;  1KEY A;  3Q5X A;  1OED C;  4IGU A;  5L4E A;  3P7I A;  3A7M A;  4ZHQ E;  4OYJ A;  4MBQ A;  2JRK A;  2WM9 A;  3SWH A;  4DVD A;  3O1J A;  4U72 A;  2I0M A;  2L3L A;  4IL9 A;  3P4R A;  2V7I A;  1YKH B;  5ABG A;  4EYY R;  3GMI A;  4DID B;  3B57 A;  5KMG P;  4PJN A;  1X9B A;  4DR1 T;  3VU7 H;  4HWI B;  4DR7 T;  4YSZ A;  3AE4 A;  1V9D A;  5ETW A;  3K1S A;  4IL4 A;  3EAB A;  2BDE A;  3RF1 A;  2QGS A;  4HFV A;  4AXP A;  3UU3 A;  4AKL A;  2YDS A;  1VCT A;  5F3J A;  4LFA T;  2LT3 A;  1HFA A;  4DUZ T;  3NRY A;  3PU3 A;  4TWF A;  4ZI2 C;  4FI5 A;  4OYK A;  2W00 A;  3EDU A;  5AFU L;  4QXH B;  3UUB A;  2LEH A;  4X62 T;  5H6R B;  3KIN B;  3PUV F;  4GOU A;  4GIW A;  3FBL A;  1SHZ C;  3H3A A;  4X66 T;  1HF8 A;  4PFO A;  5HCJ A;  3ONL C;  3N5L A;  1HCI A;  4JI6 T;  3PUY F;  2C0S A;  2BG9 E;  4QX7 B;  3AE2 A;  2XPK A;  1OED E;  4IT4 A;  1Z0P A;  4ZI3 C;  2M67 A;  3AEG A;  4EZ4 A;  3L8R A;  2X68 A;  2LSJ A;  3KV4 A;  4CN4 A;  4OX9 T;  5HXS A;  3GWH A;  2ZM6 T;  2V1D B;  2SPC A;  4X5T A;  4AQY T;  3ZN1 B;  1U4Q A;  2FJD A;  3ZT5 A;  4YXD A;  4P1N A;  4ILA A;  2WBL A;  4DBR A;  1HS7 A;  5FMN A;  1JNZ A;  3C98 B;  5FYM A;  3RKO A;  1MNE A;  3GN5 A;  3PDY A;  3RIU C;  1YXR A;  2X9Y A;  3UUX B;  2IHR 1;  4TZ4 C;  3RQU A;  2XJ7 A;  4HTE A;  2NR4 A;  2J47 A;  1ZHC A;  3ZMU B;  5A1L A;  5JRE A;  5AQF B;  1XWM A;  5CFB A;  4IE6 A;  2XQY A;  2J1D G;  4QKN A;  3CX8 B;  5AQT B;  5JR9 A;  4PNI A;  2XUE A;  2W2U A;  3N9M A;  3Q2M A;  3LSV A;  5HEO A;  1NEK A;  3N9Q A;  2XAS B;  2LOS A;  4L5G A;  2WDQ A;  4L9I A;  1G73 A;  2H7O A;  4K0K T;  3ESL A;  4V1A v;  1E7P A;  3ONX A;  2D0T A;  4N78 D;  5FVK A;  2ZLY A;  4AKH A;  3P4W A;  2PJQ A;  1W0A A;  4NXN T;  4JI0 T;  3ANW A;  4DV1 T;  2YU1 A;  4PJL A;  3QNU A;  2DHR A;  2Q9Q A;  4UVA B;  3W15 B;  1UCU A;  2JQ9 A;  1NAF A;  3ZCJ A;  3BQL A;  4X1I E;  1HNX T;  1X79 A;  1MIW A;  5LB7 B;  3ZJ1 A;  1IBM T;  3T1H T;  4X65 T;  5LJM A;  2XAJ B;  3TLV A;  3QB5 A;  3EHZ A;  1MND A;  4QH4 A;  3ETV A;  2IIU A;  4JBW F;  2JQQ A;  5HAX A;  2PG8 A;  3HKB E;  2LM2 A;  4CN1 A;  3G06 A;  5C2T A;  4H63 H;  4ZS3 A;  3L39 A;  4U2Z A;  2A72 A;  5LMU T;  4CQI A;  4JUY A;  3VRA A;  2XSA A;  4H9N C;  2BVL A;  4YSX A;  4ADZ A;  4TV9 E;  4EYU A;  2W0G A;  4ASK A;  2N1G A;  1T72 A;  2YIN A;  3SS1 A;  4IST A;  4PAG A;  3OTO T;  4H9P C;  4ZI2 D;  3AXJ B;  3FB2 A;  4I4T E;  5L3C B;  2IAK A;  5FXZ A;  1ZOY A;  5FY1 A;  4WNK A;  3LDQ B;  2WWV A;  4LML A;  3ONJ A;  5CJ5 A;  3RLF F;  5DJQ C;  1XDP A;  4U33 A;  4CI3 B;  4I0U A;  5EK2 A;  3AE5 A;  5JDF A;  3KBU A;  3CQG B;  3C4Z A;  4E7S A;  2NP9 A;  2AXD S;  4UR9 A;  3PUX F;  2W63 A;  2UUB T;  4QX8 B;  4ZI3 D;  3C4W A;  1XNQ T;  3BQI A;  3F57 A;  2UXX B;  4UIG A;  2QRX A;  3C51 A;  2XQ4 A;  3DTO A;  2MOZ A;  2YOE A;  3QB5 K;  4ZOL E;  3EUH A;  4YY3 T;  4DV2 T;  5HYA A;  3AVR A;  3N9L A;  4O8S A;  3UU8 A;  3AAE B;  4YSY A;  1IZN B;  3PV0 F;  2IDO B;  2B1E A;  2DWK A;  4TN7 B;  4WZX A;  2V6Y B;  4KUM B;  3TKL B;  2DCF A;  5JH7 E;  1XMO T;  1GQE A;  3GN5 B;  2MTQ A;  2FJB A;  2KND A;  2D0U A;  5AQU B;  5AQN B;  2QVA A;  3K3Q C;  4LMK A;  4ZXL A;  5FL0 A;  2FJE A;  3OYX A;  3ZMT B;  3X1D A;  2YN6 A;  2KZ7 B;  4FJO A;  3U3I A;  3ZMV B;  4LMJ A;  5BR8 T;  2KWI B;  2CXL A;  4H63 V;  4JI1 T;  3UFG A;  3RRW A;  3PJA A;  4YTM A;  2KT9 A;  4KI0 F;  2M6B A;  2M6I A;  5CB4 E;  2LHN A;  4IE0 A;  1CHU A;  2CRB A;  2CCQ A;  2CA5 A;  4HWH A;  3CWZ B;  5JR9 B;  3H37 A;  3IEE A;  1FJG T;  3AEE A;  2OA5 A;  5LOV E;  5DAB A;  2L9Q A;  2CHO A;  3RRC A;  2QA7 A;  3AE9 A;  3PTR B;  4HFC A;  2NWB A;  3RI5 A;  1WLX A;  4J2C A;  5FY7 A;  3TLU A;  2QYW A;  1O3X A;  4Z91 A;  5FXX A;  2VL0 A;  3RYH E;  5HEU A;  5L3F B;  5AQH B;  2Y8D A;  4A97 A;  2CPT A;  4NPP A;  4IRE A;  3ZJ2 A;  3RC8 A;  4LFB T;  3C4X A;  3ANW B;  2LLY A;  3PUW F;  2Q9Q B;  1QLB A;  3AED A;  2LRK A;  2C5J A;  2WCA A;  3ZYK A;  4IE4 A;  4CZZ B;  2E2A A;  3AE8 A;  3T8O A;  2E9X A;  2X66 A;  5JQG E;  5FNV E;  4KBM B;  2WZI A;  2XAH B;  2Q9Q C;  2F4V T;  5FXW A;  3CVR A;  4DR5 T;  4HWC A;  5LMN T;  2K48 A;  1NEN A;  3UU6 A;  1HX1 B;  3LG7 A;  4HWF A;  1FIO A;  2LM9 A;  4KP3 C;  4UXN B;  4HFD A;  4F6R C;  4O2A E;  5HWY A;  1AJ3 A;  5HXC A;  2CE7 A;  5J0Z A;  5EZY E;  3CQC B;  1KF6 A;  4A98 A;  3RYC E;  5KXJ A;  3E0Z A;  3LJC A;  4I55 E;  3N9N A;  2EHO A;  2VKO A;  1BR2 A;  5L47 A;  3DP7 A;  1G8X A;  1Y64 B;  3JC6 C;  3RC3 A;  2A9U A;  1T8B A;  2UXD T;  3N2G E;  3AXJ A;  2KIN B;  4NXM T;  3VR8 A;  4O4I E;  4BJM A;  1Y01 A;  3PUZ F;  4C91 A;  1J1J A;  2YU2 A;  2UXB T;  3ZPO A;  2IML A;  1UK5 A;  3RHW A;  3UUN A;  2V26 A;  3NKZ A;  2FJA A;  4DMV A;  5JDL A;  2ES0 A;  2JMK A;  4IHJ E;  3QOF A;  4IE7 A;  4YHH T;  5FKY A;  3HKD E;  2OV9 A;  2V6X A;  3ZMZ B;  4IDZ A;  3Q5W A;  4YLH A;  3JAE A;  5JDH A;  4YJ3 E;  4YTP A;  2NTY A;  3R6N A;  5FVL A;  2CLY B;  4A56 A;  4UF0 B;  3ZEF B;  2V7M A;  3NBX X;  4GKJ T;  1ZP0 A;  1MIV A;  1HR0 T;  3F2E A;  1BR0 A;  1WFD A;  2KXP B;  5FXV A;  2UUA T;  2VAS A;  4DV0 T;  2X0Y A;  4XAX B;  3OBV E;  5M4Y A;  2V6Y A;  4HEA A;  3ABV A;  1LVK A;  3KV5 A;  5F5W A;  3AEA A;  3JAF A;  2H3R A;  5L3D B;  2LJL A;  1UX5 A;  3KVA A;  3K3N A;  2V5C A;  4U7I A;  2W4X A;  3B5M A;  2ZM0 A;  2UU9 T;  1J5E T;  4JI7 T;  5AQP B;  4AIS A;  4IE5 A;  4JI4 T;  2X0L B;  5AQL B;  4BJN A;  1IJ6 A;  4NUV A;  2MAW A; 
#chains in the Genus database with same CATH homology
 4LF4 T;  5IWA T;  4DV4 T;  4OX9 T;  4YHH T;  3OTO T;  4K0K T;  2ZM6 T;  4JI8 T;  2UXC T;  4DR4 T;  4X64 T;  2F4V T;  4DR5 T;  4AQY T;  5LMN T;  5BR8 T;  1N34 T;  4LF7 T;  4DR1 T;  4DV6 T;  4NXN T;  1I94 T;  4JI0 T;  4JI1 T;  4GKJ T;  4DV1 T;  4DR7 T;  4B3S T;  4LF8 T;  2E5L T;  1HR0 T;  4GKK T;  4JI5 T;  4JI3 T;  2UUC T;  4JYA T;  2UUA T;  1HNX T;  4DV5 T;  4DV0 T;  1IBL T;  1FJG T;  1IBK T;  1IBM T;  1N32 T;  4LFA T;  4JV5 T;  4DR3 T;  3T1H T;  1XNR T;  4X65 T;  4DUZ T;  4DUY T;  2UUB T;  4DV3 T;  4B3M T;  2VQF T;  1N33 T;  2HHH T;  1XNQ T;  4LF6 T;  3T1Y T;  4LF9 T;  4X62 T;  4DR6 T;  4LFC T;  4B3T T;  1XMQ T;  4KHP T;  4YY3 T;  4X66 T;  2UXD T;  4B3R T;  4DV2 T;  1HNZ T;  4NXM T;  2UU9 T;  1J5E T;  4JI7 T;  4JI6 T;  5LMU T;  2VQE T;  2UXB T;  4LFB T;  4JI4 T;  1N36 T;  1XMO T;  4JI2 T;  1HNW T;  4LF5 T;  4DR2 T;  4DV7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...