1IBKT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibkT00
2UU9T 1IBMT 4LFAT 5LMUT 4KHPT 4B3MT 4DV2T 4DV6T 4DV3T 4JI1T 4DR6T 2UUBT 4K0KT 1HNWT 4X66T 4B3ST 5IWAT 1HR0T 4JI3T 4X64T 2ZM6T 1XMQT 1N36T 1IBKT 2VQFT 2UUAT 4DV1T 4JI2T 2F4VT 4JI7T 4DR3T 4JI4T 4LF8T 2UXDT 4DUYT 4YY3T 4LF9T 1XNQT 4AQYT 4X62T 4LF4T 4JI5T 4DV4T 4LF6T 3OTOT 4LF5T 3T1HT 2UUCT 4DR7T 1HNXT 4DUZT 4NXNT 5BR8T 1J5ET 4GKJT 1XMOT 4B3TT 4X65T 4JV5T 4YHHT 4JI0T 1FJGT 4NXMT 4DV7T 4LF7T 4LFCT 4JI6T 4DR5T 4JYAT 2UXBT 4DV0T 1I94T 1N32T 4DR2T 4LFBT 1IBLT 4GKKT 4JI8T 2E5LT 5LMNT 4OX9T 1XNRT 1N34T 4B3RT 2HHHT 1HNZT 4DR4T 4DR1T 2UXCT 3T1YT 2VQET 4DV5T 1N33T
chains in the Genus database with same CATH superfamily
3FZMB 4H63V 1MNDA 2PG8A 5EZYE 1KNPA 3K1SA 4IDOA 3UT5E 2E9XA 2Q9QC 4TV8E 3NZPA 3Q5EA 2NOXA 5FP3A 4YSXA 5LXTE 2CHOA 2W61A 3PUSA 4CN1A 4DV2T 3UUNA 3VHLA 2WU5A 1T8BA 5FXWA 5HEOA 4DV6T 2ZLYA 2YDQA 2VKDA 4DV3T 2HPJA 4UR9A 3HKEE 3FXDB 2FUPA 2A3DA 2SPCA 1HTJF 5HXRA 5C8YE 2UUBT 2WU2A 4WBOA 2X9XA 2YDSA 2J62A 3LBXA 3LG7A 2W0GA 4U2ZA 1SHZC 3EDUA 4I4TE 4EGWA 5ABGA 4B3ST 5IWAT 3L39A 1CHUA 2XUEA 2X0HA 2ZM0A 3A8YC 5AQIB 4X64T 4QHOA 3D0TA 2L8KA 2N2NA 3OBVE 4HE8A 1Z0PA 4O2BE 2X51A 4U3CA 2YU2A 3PV0F 4HTEA 5EK2A 2UUAT 3TLTA 4HGAA 4OFZA 3CX8B 3TLSA 3CX6B 1KK7A 3PJAJ 2JQKA 3KBUA 1WYCA 2YDRA 4DR3T 4AI6A 3E08A 3TLVA 3AEBA 4YSYA 2VVSA 3N9PA 2HPLA 2XAQB 4EEBA 4YY3T 2CLYB 2CXDA 2IDOB 3FZHB 4HFDA 5AQHB 5FVKA 3X1DA 3ZT7A 5LHHB 3RRCA 4JBWF 2XQ4A 3K8PC 1Y01A 3PE0A 4WYVA 3TKLB 4UVCB 2N9DA 4X1KE 4CN4A 4AQFA 3PUWF 1D1AA 3JCFA 2XSAA 3FHNA 3K3NA 2W67A 5AQVB 4U72A 1T98A 3ZYLA 2H88A 1N33T 4LF6T 2ZM8A 2WDRA 3KV9A 3MJXA 2YU1A 3UU3A 3FZLB 1D0YA 2R6GF 1MMDA 2CA5A 3ONXA 3ZN0B 4CZZB 2A72A 1J5WA 3AA6B 3FBZA 2DNXA 3P4WA 2BKOA 4OK0A 3OTOT 3T1HT 1MIVA 3ZSTA 3C50A 4JLEA 2WCAA 4K0UA 4DR7T 3CVRA 4YT0A 3DJBA 2PBIA 2IC6A 3JADA 5LGUB 2XJ7A 5ETWA 1HNXT 3KDSE 4IE4A 2CEAA 3FZKB 3CQCB 3ZT6A 5CGMA 4FI5A 2C5KT 4XBFB 2V7IA 4DBQA 1J5ET 3S4UA 4B3TT 3C98B 4NUVA 3OKQA 2E5VA 2H7OA 2W62A 4WNKA 3RYHE 4YHHT 1SUMB 2HN2A 3RF1A 2JMKA 2KMFA 3UTKA 3U3IA 3MZKB 4EV6A 5L2LA 2KT9A 3LK42 2W00A 4TZ4C 3ZMVB 4YHJA 5J0ZA 2KXPB 2WM9A 4U2YA 5FY0A 3O1IA 5H6QB 3RH3A 2LEHA 1FEWA 3AE2A 2NW8A 2HH7A 1KNRA 2CM0A 2VL8A 2CCQA 2WB5A 3HI2A 2DWGA 3NRYA 4H9OC 4PNIA 4DV0T 1IZNB 1WYBA 3AXJB 4A97A 1IBLT 3LBXB 5J2TE 2V8SV 4GKKT 4CI1B 1KNZA 1HFAA 4MALA 4EYYR 4JI8T 3AEFA 4GK5E 4ILBA 3K3QC 4IL4A 4P1NA 4HEAA 2KZ7B 2Q9QA 2E9XC 2X66A 4B3RT 1WCRA 1W0BA 2IHR1 4L9IA 3ZCIA 4ASKA 3RQWA 4IL9A 2CHNA 4DR4T 1BR0A 2V7MA 4H9QC 2LKHA 3WAJA 1XDPA 1X9BA 4PW8A 4CI2B 3P8CD 2H3RA 3PJAA 1IJ5A 2XQ7A 4TNWA 3RLFF 2L9QA 2BDEA 4QXCB 2DCFA 4J2CA 1KFYA 2K3WA 3JC6C 3PTRB 3ZMSB 2EHOB 5LJMA 2MOZA 2V5CA 3ESLA 3PUQA 2P9BA 4DBRA 4ZI7E 5JDLA 1HG5A 1OXZA 3EABA 3M65A 2RA1A 2XTLA 3N2KE 1D0ZA 5CA0E 5L3DB 3AEDA 3N9NA 4KMCA 1IBMT 2WDVA 2MAWA 5LMUT 2MYSA 4IGUA 4O2AE 2LKGA 5AQNB 5AQTB 3J9X1 3NBXX 1XWMA 2DLRA 3N2OA 3CIRA 4OYJA 1M62A 3H3MA 2A2FX 5AQUB 1SE7A 5LG4A 4U33A 2CXLA 5JRCA 1MIWA 2QRXA 3BQIA 3FBLA 2NP9A 2CBJA 5HCMA 4JI1T 4DR6T 3C4XA 4K0KT 5DQWA 2XQ5A 4C90A 4AKIA 4H63H 2M6IA 3RX6A 5JVDE 2UXXB 3QB5K 1LVFA 3RPUA 4GK0E 4ZI2C 4H9NC 2LT3A 3AE1A 3KV4A 3RYFE 3SFEA 4F8HA 3RC8A 3OYXA 1VCTA 1OEDA 4LMKA 3DTOA 4PK5A 1D1CA 2H7VC 4AQGA 2JQ9A 2V1DB 3CKDA 3CX7B 2V5DA 2ZMAA 3KFWX 2PFVA 4HWDA 4O4LE 1UX5A 4TNVA 5L4HA 2C5IT 1E7PA 4AQFC 2ZM6T 3IA3A 4ILAA 3RIUC 4OYKA 2VQFT 4QXBB 3N9MA 4DV1T 2F4VT 2PJQA 5F3JA 4AKLA 3F2EA 5AQPB 4YTNA 3AE6A 5KMGP 4BJNA 4JI4T 1HF8A 2ODUA 3ETVA 3G06A 2Y6XA 2NTYA 4N78D 2VASA 5FKYA 3AAEB 2UXDT 3WI3A 1HNZT 5DJQC 1MMGA 3V5SA 2K9AA 4CI3B 3OVUA 4IT4A 2X68A 3Q5DA 3L8RA 3HA4A 1XZYA 3AECA 2V7JA 1UX4A 5AQOB 4CXXA 4LF9T 4YTMA 4AQYT 2XAHB 1Y64B 3RIUA 1FMVA 4DV4T 2JQQA 1QUUA 4JI5T 2D0TA 3QB5A 3PUYF 3LJCA 3O1JA 3N5LA 4KBMB 2VWAA 5LOVE 3HL6A 4G63A 3AAAB 2AXDS 4IIJE 5AQGB 3MK7C 5JDFA 2IW5B 3ZMZB 4V1Av 5AQMB 2X9HA 4KI0F 5L3BB 2UUCT 2XQ9A 4TWFA 3AAIA 4IHJE 1NWMX 4COFA 3NRXA 2ACXA 5H6RB 5TAOA 4C91A 4TUYE 1XDOA 4DUZT 4NXNT 3Q9DA 2KNDA 2W4XA 4ZZBA 1OEDE 3CQXC 2WWUA 2XM2A 1LVKA 3EI0A 3NWIA 3OYZA 4ILUA 5C3JA 3PU3A 2WP9A 3ANWA 3PUXF 4I50E 5IHYA 4JI0T 4I55E 4P09A 4DMVA 2IC9A 3KVAA 4EOZB 5KXJA 3AEAA 4NXMT 1IJ6A 2W2UA 3C51A 3MKDA 3N9OA 1W0AA 2QGSA 4NPPA 3SWHA 2XQYA 4L0RA 2FBWA 4O4JE 5FYMA 2Q9QB 3TLUA 4ADZA 4BA9A 2ES0A 3UU6A 4DIDB 2BBJA 4G2AA 4KHZF 4UIGA 2X0YA 1WRDA 5FMNA 5HYAA 4JEHB 4TWHA 4P0AA 2H89A 1T7SA 2LHNA 3CPZA 5KX5E 1N32T 2Y8DA 1ZV4X 3F57A 5IUXA 1KF6A 4DR2T 4LFBT 3RKOA 1UURA 4AKHA 2E9XD 2IIUA 2JQHA 4IE0A 5FXXA 3RKGA 2CXFA 5HEGA 2BVMA 3SOLA 4OX9T 1HX8A 2FJDA 2I59A 3GN5A 4UF0B 4HWCA 4UVAB 1N34T 2B1EA 2KINB 1MIYA 2WZIA 3ONLC 2FJEA 2XPKA 3AEGA 3Q2MA 4GOUA 3B57A 4KUMB 4O4IE 5E0OA 2NWBA 3ZC1A 4MLKA 4IE5A 4Z91A 3R6NA 4ISTA 3PUZF 2VVNA 2WQYA 2XASB 4YLHA 2E9XB 1BR4A 3EHZA 4HWIB 3SFDA 3NKZA 4DR1T 5HXSA 4JYAT 2LM2A 4QH1A 1DU2A 2UXCT 3RHWA 1I6ZA 1JNRA 2LM9A 4ZEYA 3VRBA 3T1YT 2WMNA 2XQ3A 3IHRA 3RIAA 1OEDC 5EK4A 2PTFA 3L09A 5ABHA 2XAGB 2UU9T 5LBMA 1VRBA 5AQFB 1ZKEA 2W66A 2A9UA 3ETUA 3A7MA 1Z8UA 2XAJB 3BK9A 4B3MT 2NTXA 2EHOC 3QC9A 1VOMA 1AJ3A 4ZXLA 4MBQA 1ZOYA 1SA0E 2BS2A 1YD8G 2JPFA 4CQIA 4AKGA 3OPCA 1R8IA 1U5PA 2BS4A 4HWFA 4CXYA 2VKOA 5LNKA 3RGLA 5HXEA 1YXRA 1YQ3A 4PK6A 2BG9E 5FXVA 4TX5A 2WZHA 2V26A 4A56A 5CJ5A 3B13A 5L3GB 5JTGA 3ZJ2A 3ZEFB 1UCUA 4JI6T 2FJAA 2WBLA 5HEUA 4IDZA 2BG9A 4HFEA 4HFIA 3F31A 3AVRA 5JR9B 2Q9QD 1NENA 1XMQT 1WFDA 1N36T 3FZFB 2LSYA 1IBKT 1QSDA 2EHOD 3C4WA 3P4RA 4O4HE 4JI2T 3RYIE 3MXZA 4JI7T 2HN1A 4GYRA 4DMWA 3KINB 4BJMA 3AVSA 4YTPA 3HKDE 5HXHA 4LF8T 3AA0B 5HEJA 2WMOA 4UVBB 3AEEA 2M67A 3RQUA 3UQ4A 2CE7A 5BMVE 5LGNB 3JAFA 4DUYT 3KBTA 4HWHA 4ILCA 3N9LA 2K5BB 3QOFA 4A5XA 4WZXA 4GIWA 5JR9C 3O9XA 3OJAA 5F5WA 3N9QA 5LJNA 1L0VA 2JRKA 2WDQA 5L4EA 1NAFA 4X62T 4LF4T 2NW7A 2X0LB 3ZLIA 2V6YA 2K48A 3I0QA 2MTQA 2V6XA 3C4ZA 3QNUA 4BAYB 5M4YA 5F8PA 1EZ3A 3L3PA 3ONJA 4YXDA 4PAGA 1WR6A 3FB2A 3UU4A 3VR8A 1GQEA 4Q25A 5IYZE 2V6YB 3T8OA 1UUSA 2XM1A 2XHEB 3V5UA 4HFCA 5JREA 2FJBA 1WLXA 3Q5XA 5FVLA 1W09A 3GA8A 4PJLA 5FL0A 4LMLA 2NW9A 4ANJA 5JDGA 2KWIB 3SS1A 3UULA 3ZSSA 3E22E 5LG3A 2WSSV 4EXTA 1D0XA 4IDQA 4GKJT 1XMOT 5KDMC 1S94A 1YKHB 3EVYA 3H3AA 2CLYC 2E2AA 2GK9A 5AQKB 2DI4A 5ABEA 4QX8B 2DWKA 3AE5A 4IREA 5FNVE 2NR4A 5C2TA 3VKHA 2LSKA 3J7Yq 5FL1A 4DV7T 4HFVA 4LF7T 3VKGA 2Y48B 2YN6A 3H37A 4O8SA 5HXCA 3EUHA 3HKBE 3O1HA 4EB6E 4UEMA 4NUUA 1QLBA 2LJLA 2XZEA 3CMLA 5DABA 5HWXA 5LP6E 2UXBT 4TN7B 2G0UA 1OEDB 5A1LA 3PDYA 5JQGE 4NIQA 2N1GA 3PU8A 1I94T 2MPKA 4Z8XA 4JUYA 4DVDA 3TLWA 1HX1B 3AE7A 4QXHB 5ADXL 3Q5WA 5LMNT 2X9YA 4MFRA 2RPAA 3VU7H 2D0UA 3UUXB 2WAUA 1M7KA 5JDQA 3VRAA 1ZP0A 4DO0A 5AFUL 3U78A 5JDMA 2HHHT 1OWAA 4E7ZA 3PURA 5L3EB 4PFOA 2E8IA 4ZS2A 4L5GA 2VKJA 2LOSA 3AB3B 1MNEA 3B5MA 3UU5A 2LSJA 4B6XA 1YW0A 4EZHA 4IDPA 3ZC0A 3QUJA 1FMWA 3SRZA 5ABFB 3ZMUB 4UELA 4Z90A 2LRKA 2QVAA 2XQ8A 3MA9A 5AQQB 3I1AA 3I9YA 2V7KA 1HCIA 3P7IA 4YFSA 3UFGA 1WR0A 2CWOA 2JMHA 3UU8A 3KV6A 5L47A 1BR1A 1O3XA 3QK6A 3ZYKA 3WAKA 4XAXB 2OV9A 4A98A 1YKEB 2CWYA 2LE8A 4LFAT 3ZJ1A 4KHPT 4U7YA 4H9RC 3ZKRA 4H9SE 1LRZA 1UGOA 3AA7B 2I0MA 2AE9A 5AQJB 2X9WA 3GMIA 3NZQA 4AISA 4WBNE 5JDNA 1H7CA 5JH7E 3AE9A 5HAXA 4I0UA 4EAHA 3MACA 1ZHCA 4F6RC 3ZN1B 2BG9B 1HNWT 4X66T 2LSIA 4JEUB 4ZZCA 5JRCB 3I9WA 2ZM2A 4XZCA 2ACZA 2XQAA 3N2GE 2MBGA 3C64A 3UUMA 2IUBA 1B7TA 1E1HB 5L3FB 2J1DG 2BVLA 2QYWA 3EAMA 1MMAA 1NEKA 1UK5A 5FY7A 2YINA 5HWYA 3K3OA 5JR9A 4JI3T 4EZ4A 5LBQB 4TV9E 5ABFA 2J4GA 1X79A 5LB7B 3ZMTB 1BR2A 3O4XE 4HFBA 5AQLB 4OHFA 1ZEEA 5CFBA 3KVBA 3ZT5A 5JDHA 4HFHA 3ABVA 5LGTB 2JJ9A 2X67A 5HCJA 2CPTA 4AXPA 4KP3C 3KV5A 4X1IE 4ZHQE 1HS7A 4ERRA 2XAFB 1CUNA 3GN5B 4PJNA 4PJMA 4UF0A 4EYUA 2WWVA 3LK3B 4LMJA 4ZI3D 2IMLA 1E2AA 3PUAA 2J47A 4PFPA 5AQRB 3BQKA 4GYSA 1XNQT 4IE7A 3AE3A 4WW0A 2B76A 4AKRB 4EEDA 3M3ZB 3W15B 1S35A 1FIOA 2BKNA 2VB6A 3LDQB 3CWZB 3IBPA 3PUGA 4H9PC 1D1BA 4PJJA 3UQ7A 4X5TA 2LLYA 4EIWA 2LSGA 1HR0T 2EHOA 4ISSA 3EDVA 2IAKA 2YOEA 3LK2B 3NVOA 3ZCJA 4DNDA 4CN6A 2OLTA 2ODVA 2YK0A 2BZBA 3IF8B 3R84B 3JC6D 4LF5T 4I43B 3ANWB 3E0ZA 3ZYMA 4P0BA 4AIUA 1KEYA 3AA1B 2LRLA 4QKNA 5FY1A 5GONE 3CQGB 5LCYA 5LYJE 2WY2A 3PUVF 5CB4E 5DQVA 2YKSA 4IDNA 2CBIA 2BKPA 5BR8T 3AE4A 4QX7B 2I6HA 2CMRA 4X65T 2BG9C 4YJ2E 4X1YE 4JV5T 2OA5A 2WS3A 2UXNB 2XSBA 3LFMA 4PK4A 3I0OA 5J2UE 2BS3A 2C0SA 2KLQA 5LHGB 5LHIB 3GWHA 3LSVA 1FJGT 4UXNB 3RI5A 4X20E 2DL1A 3DP7A 3VR9A 5L3CB 4LFCT 2VK9A 4QH5A 1J1JA 2QA7A 3RC3A 4U7IA 4DR5T 3IEEA 3HR0A 3P4QA 2CRBA 5AQSB 2XQ6A 4KX6A 2VL0A 3ZPOA 2W63A 4UV9B 4ZOLE 2RP4A 1MMNA 3AE8A 4IE6A 5CA1E 5LA6E 3RRWA 3RYCE 5FXZA 3AXJA 4FJOA 2E5LT 1G8XA 2K24A 3HKCE 4ZI2D 2D9DA 1G73A 1US7B 2VKHA 1V9DA 3UUBA 1XNRT 2L3LA 3BQLA 4UV8B 2XY8B 1JNZA 4U31A 2VURA 4YJ3E 4MHCA 4ZS3A 4TWDA 3A5XA 2YEVC 4U74A 2D5UA 4YSZA 3FXEB 3P4SA 4E7SA 1LKXA 2KWHA 2KSRA 3P4PA 2JIWA 2LHRA 2C5JA 4M1PA 5HEHA 2V7LA 1VCSA 2Z6EA 2M6BA 3P50A 2BBHA 1HG2A 4QWNB 5EK3A 3JAEA 1U4QA 5J1GA 4ZI3C 2LOPA 2D2SA 1W9RA 3UFEA 3RIFA 2DHRA 4CXWA 1T72A 3CK6A 2VQET 4QH4A 4HKAA 4DV5T 4HN9A 1YQ4A 1IAPA
chains in the Genus database with same CATH topology
2UU9T 1IBMT 4LFAT 5LMUT 4KHPT 4B3MT 4DV2T 4DV6T 4DV3T 4JI1T 4DR6T 2UUBT 4K0KT 1HNWT 4X66T 4B3ST 5IWAT 1HR0T 4JI3T 4X64T 2ZM6T 1XMQT 1N36T 1IBKT 2VQFT 2UUAT 4DV1T 4JI2T 2F4VT 4JI7T 4DR3T 4JI4T 4LF8T 2UXDT 4DUYT 4YY3T 4LF9T 1XNQT 4AQYT 4X62T 4LF4T 4JI5T 4DV4T 4LF6T 3OTOT 4LF5T 3T1HT 2UUCT 4DR7T 1HNXT 4DUZT 4NXNT 5BR8T 1J5ET 4GKJT 1XMOT 4B3TT 4X65T 4JV5T 4YHHT 4JI0T 1FJGT 4NXMT 4DV7T 4LF7T 4LFCT 4JI6T 4DR5T 4JYAT 2UXBT 4DV0T 1I94T 1N32T 4DR2T 4LFBT 1IBLT 4GKKT 4JI8T 2E5LT 5LMNT 4OX9T 1XNRT 1N34T 4B3RT 2HHHT 1HNZT 4DR4T 4DR1T 2UXCT 3T1YT 2VQET 4DV5T 1N33T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  1IBM T;  4LFA T;  5LMU T;  4KHP T;  4B3M T;  4DV2 T;  4DV6 T;  4DV3 T;  4JI1 T;  4DR6 T;  2UUB T;  4K0K T;  1HNW T;  4X66 T;  4B3S T;  5IWA T;  1HR0 T;  4JI3 T;  4X64 T;  2ZM6 T;  1XMQ T;  1N36 T;  1IBK T;  2VQF T;  2UUA T;  4DV1 T;  4JI2 T;  2F4V T;  4JI7 T;  4DR3 T;  4JI4 T;  4LF8 T;  2UXD T;  4DUY T;  4YY3 T;  4LF9 T;  1XNQ T;  4AQY T;  4X62 T;  4LF4 T;  4JI5 T;  4DV4 T;  4LF6 T;  3OTO T;  4LF5 T;  3T1H T;  2UUC T;  4DR7 T;  1HNX T;  4DUZ T;  4NXN T;  5BR8 T;  1J5E T;  4GKJ T;  1XMO T;  4B3T T;  4X65 T;  4JV5 T;  4YHH T;  4JI0 T;  1FJG T;  4NXM T;  4DV7 T;  4LF7 T;  4LFC T;  4JI6 T;  4DR5 T;  4JYA T;  2UXB T;  4DV0 T;  1I94 T;  1N32 T;  4DR2 T;  4LFB T;  1IBL T;  4GKK T;  4JI8 T;  2E5L T;  5LMN T;  4OX9 T;  1XNR T;  1N34 T;  4B3R T;  2HHH T;  1HNZ T;  4DR4 T;  4DR1 T;  2UXC T;  3T1Y T;  2VQE T;  4DV5 T;  1N33 T; 
#chains in the Genus database with same CATH topology
 3FZM B;  4H63 V;  1MND A;  2PG8 A;  5EZY E;  1KNP A;  3K1S A;  4IDO A;  3UT5 E;  2E9X A;  2Q9Q C;  4TV8 E;  3NZP A;  3Q5E A;  2NOX A;  5FP3 A;  4YSX A;  5LXT E;  2CHO A;  2W61 A;  3PUS A;  4CN1 A;  4DV2 T;  3UUN A;  3VHL A;  2WU5 A;  1T8B A;  5FXW A;  5HEO A;  4DV6 T;  2ZLY A;  2YDQ A;  2VKD A;  4DV3 T;  2HPJ A;  4UR9 A;  3HKE E;  3FXD B;  2FUP A;  2A3D A;  2SPC A;  1HTJ F;  5HXR A;  5C8Y E;  2UUB T;  2WU2 A;  4WBO A;  2X9X A;  2YDS A;  2J62 A;  3LBX A;  3LG7 A;  2W0G A;  4U2Z A;  1SHZ C;  3EDU A;  4I4T E;  4EGW A;  5ABG A;  4B3S T;  5IWA T;  3L39 A;  1CHU A;  2XUE A;  2X0H A;  2ZM0 A;  3A8Y C;  5AQI B;  4X64 T;  4QHO A;  3D0T A;  2L8K A;  2N2N A;  3OBV E;  4HE8 A;  1Z0P A;  4O2B E;  2X51 A;  4U3C A;  2YU2 A;  3PV0 F;  4HTE A;  5EK2 A;  2UUA T;  3TLT A;  4HGA A;  4OFZ A;  3CX8 B;  3TLS A;  3CX6 B;  1KK7 A;  3PJA J;  2JQK A;  3KBU A;  1WYC A;  2YDR A;  4DR3 T;  4AI6 A;  3E08 A;  3TLV A;  3AEB A;  4YSY A;  2VVS A;  3N9P A;  2HPL A;  2XAQ B;  4EEB A;  4YY3 T;  2CLY B;  2CXD A;  2IDO B;  3FZH B;  4HFD A;  5AQH B;  5FVK A;  3X1D A;  3ZT7 A;  5LHH B;  3RRC A;  4JBW F;  2XQ4 A;  3K8P C;  1Y01 A;  3PE0 A;  4WYV A;  3TKL B;  4UVC B;  2N9D A;  4X1K E;  4CN4 A;  4AQF A;  3PUW F;  1D1A A;  3JCF A;  2XSA A;  3FHN A;  3K3N A;  2W67 A;  5AQV B;  4U72 A;  1T98 A;  3ZYL A;  2H88 A;  1N33 T;  4LF6 T;  2ZM8 A;  2WDR A;  3KV9 A;  3MJX A;  2YU1 A;  3UU3 A;  3FZL B;  1D0Y A;  2R6G F;  1MMD A;  2CA5 A;  3ONX A;  3ZN0 B;  4CZZ B;  2A72 A;  1J5W A;  3AA6 B;  3FBZ A;  2DNX A;  3P4W A;  2BKO A;  4OK0 A;  3OTO T;  3T1H T;  1MIV A;  3ZST A;  3C50 A;  4JLE A;  2WCA A;  4K0U A;  4DR7 T;  3CVR A;  4YT0 A;  3DJB A;  2PBI A;  2IC6 A;  3JAD A;  5LGU B;  2XJ7 A;  5ETW A;  1HNX T;  3KDS E;  4IE4 A;  2CEA A;  3FZK B;  3CQC B;  3ZT6 A;  5CGM A;  4FI5 A;  2C5K T;  4XBF B;  2V7I A;  4DBQ A;  1J5E T;  3S4U A;  4B3T T;  3C98 B;  4NUV A;  3OKQ A;  2E5V A;  2H7O A;  2W62 A;  4WNK A;  3RYH E;  4YHH T;  1SUM B;  2HN2 A;  3RF1 A;  2JMK A;  2KMF A;  3UTK A;  3U3I A;  3MZK B;  4EV6 A;  5L2L A;  2KT9 A;  3LK4 2;  2W00 A;  4TZ4 C;  3ZMV B;  4YHJ A;  5J0Z A;  2KXP B;  2WM9 A;  4U2Y A;  5FY0 A;  3O1I A;  5H6Q B;  3RH3 A;  2LEH A;  1FEW A;  3AE2 A;  2NW8 A;  2HH7 A;  1KNR A;  2CM0 A;  2VL8 A;  2CCQ A;  2WB5 A;  3HI2 A;  2DWG A;  3NRY A;  4H9O C;  4PNI A;  4DV0 T;  1IZN B;  1WYB A;  3AXJ B;  4A97 A;  1IBL T;  3LBX B;  5J2T E;  2V8S V;  4GKK T;  4CI1 B;  1KNZ A;  1HFA A;  4MAL A;  4EYY R;  4JI8 T;  3AEF A;  4GK5 E;  4ILB A;  3K3Q C;  4IL4 A;  4P1N A;  4HEA A;  2KZ7 B;  2Q9Q A;  2E9X C;  2X66 A;  4B3R T;  1WCR A;  1W0B A;  2IHR 1;  4L9I A;  3ZCI A;  4ASK A;  3RQW A;  4IL9 A;  2CHN A;  4DR4 T;  1BR0 A;  2V7M A;  4H9Q C;  2LKH A;  3WAJ A;  1XDP A;  1X9B A;  4PW8 A;  4CI2 B;  3P8C D;  2H3R A;  3PJA A;  1IJ5 A;  2XQ7 A;  4TNW A;  3RLF F;  2L9Q A;  2BDE A;  4QXC B;  2DCF A;  4J2C A;  1KFY A;  2K3W A;  3JC6 C;  3PTR B;  3ZMS B;  2EHO B;  5LJM A;  2MOZ A;  2V5C A;  3ESL A;  3PUQ A;  2P9B A;  4DBR A;  4ZI7 E;  5JDL A;  1HG5 A;  1OXZ A;  3EAB A;  3M65 A;  2RA1 A;  2XTL A;  3N2K E;  1D0Z A;  5CA0 E;  5L3D B;  3AED A;  3N9N A;  4KMC A;  1IBM T;  2WDV A;  2MAW A;  5LMU T;  2MYS A;  4IGU A;  4O2A E;  2LKG A;  5AQN B;  5AQT B;  3J9X 1;  3NBX X;  1XWM A;  2DLR A;  3N2O A;  3CIR A;  4OYJ A;  1M62 A;  3H3M A;  2A2F X;  5AQU B;  1SE7 A;  5LG4 A;  4U33 A;  2CXL A;  5JRC A;  1MIW A;  2QRX A;  3BQI A;  3FBL A;  2NP9 A;  2CBJ A;  5HCM A;  4JI1 T;  4DR6 T;  3C4X A;  4K0K T;  5DQW A;  2XQ5 A;  4C90 A;  4AKI A;  4H63 H;  2M6I A;  3RX6 A;  5JVD E;  2UXX B;  3QB5 K;  1LVF A;  3RPU A;  4GK0 E;  4ZI2 C;  4H9N C;  2LT3 A;  3AE1 A;  3KV4 A;  3RYF E;  3SFE A;  4F8H A;  3RC8 A;  3OYX A;  1VCT A;  1OED A;  4LMK A;  3DTO A;  4PK5 A;  1D1C A;  2H7V C;  4AQG A;  2JQ9 A;  2V1D B;  3CKD A;  3CX7 B;  2V5D A;  2ZMA A;  3KFW X;  2PFV A;  4HWD A;  4O4L E;  1UX5 A;  4TNV A;  5L4H A;  2C5I T;  1E7P A;  4AQF C;  2ZM6 T;  3IA3 A;  4ILA A;  3RIU C;  4OYK A;  2VQF T;  4QXB B;  3N9M A;  4DV1 T;  2F4V T;  2PJQ A;  5F3J A;  4AKL A;  3F2E A;  5AQP B;  4YTN A;  3AE6 A;  5KMG P;  4BJN A;  4JI4 T;  1HF8 A;  2ODU A;  3ETV A;  3G06 A;  2Y6X A;  2NTY A;  4N78 D;  2VAS A;  5FKY A;  3AAE B;  2UXD T;  3WI3 A;  1HNZ T;  5DJQ C;  1MMG A;  3V5S A;  2K9A A;  4CI3 B;  3OVU A;  4IT4 A;  2X68 A;  3Q5D A;  3L8R A;  3HA4 A;  1XZY A;  3AEC A;  2V7J A;  1UX4 A;  5AQO B;  4CXX A;  4LF9 T;  4YTM A;  4AQY T;  2XAH B;  1Y64 B;  3RIU A;  1FMV A;  4DV4 T;  2JQQ A;  1QUU A;  4JI5 T;  2D0T A;  3QB5 A;  3PUY F;  3LJC A;  3O1J A;  3N5L A;  4KBM B;  2VWA A;  5LOV E;  3HL6 A;  4G63 A;  3AAA B;  2AXD S;  4IIJ E;  5AQG B;  3MK7 C;  5JDF A;  2IW5 B;  3ZMZ B;  4V1A v;  5AQM B;  2X9H A;  4KI0 F;  5L3B B;  2UUC T;  2XQ9 A;  4TWF A;  3AAI A;  4IHJ E;  1NWM X;  4COF A;  3NRX A;  2ACX A;  5H6R B;  5TAO A;  4C91 A;  4TUY E;  1XDO A;  4DUZ T;  4NXN T;  3Q9D A;  2KND A;  2W4X A;  4ZZB A;  1OED E;  3CQX C;  2WWU A;  2XM2 A;  1LVK A;  3EI0 A;  3NWI A;  3OYZ A;  4ILU A;  5C3J A;  3PU3 A;  2WP9 A;  3ANW A;  3PUX F;  4I50 E;  5IHY A;  4JI0 T;  4I55 E;  4P09 A;  4DMV A;  2IC9 A;  3KVA A;  4EOZ B;  5KXJ A;  3AEA A;  4NXM T;  1IJ6 A;  2W2U A;  3C51 A;  3MKD A;  3N9O A;  1W0A A;  2QGS A;  4NPP A;  3SWH A;  2XQY A;  4L0R A;  2FBW A;  4O4J E;  5FYM A;  2Q9Q B;  3TLU A;  4ADZ A;  4BA9 A;  2ES0 A;  3UU6 A;  4DID B;  2BBJ A;  4G2A A;  4KHZ F;  4UIG A;  2X0Y A;  1WRD A;  5FMN A;  5HYA A;  4JEH B;  4TWH A;  4P0A A;  2H89 A;  1T7S A;  2LHN A;  3CPZ A;  5KX5 E;  1N32 T;  2Y8D A;  1ZV4 X;  3F57 A;  5IUX A;  1KF6 A;  4DR2 T;  4LFB T;  3RKO A;  1UUR A;  4AKH A;  2E9X D;  2IIU A;  2JQH A;  4IE0 A;  5FXX A;  3RKG A;  2CXF A;  5HEG A;  2BVM A;  3SOL A;  4OX9 T;  1HX8 A;  2FJD A;  2I59 A;  3GN5 A;  4UF0 B;  4HWC A;  4UVA B;  1N34 T;  2B1E A;  2KIN B;  1MIY A;  2WZI A;  3ONL C;  2FJE A;  2XPK A;  3AEG A;  3Q2M A;  4GOU A;  3B57 A;  4KUM B;  4O4I E;  5E0O A;  2NWB A;  3ZC1 A;  4MLK A;  4IE5 A;  4Z91 A;  3R6N A;  4IST A;  3PUZ F;  2VVN A;  2WQY A;  2XAS B;  4YLH A;  2E9X B;  1BR4 A;  3EHZ A;  4HWI B;  3SFD A;  3NKZ A;  4DR1 T;  5HXS A;  4JYA T;  2LM2 A;  4QH1 A;  1DU2 A;  2UXC T;  3RHW A;  1I6Z A;  1JNR A;  2LM9 A;  4ZEY A;  3VRB A;  3T1Y T;  2WMN A;  2XQ3 A;  3IHR A;  3RIA A;  1OED C;  5EK4 A;  2PTF A;  3L09 A;  5ABH A;  2XAG B;  2UU9 T;  5LBM A;  1VRB A;  5AQF B;  1ZKE A;  2W66 A;  2A9U A;  3ETU A;  3A7M A;  1Z8U A;  2XAJ B;  3BK9 A;  4B3M T;  2NTX A;  2EHO C;  3QC9 A;  1VOM A;  1AJ3 A;  4ZXL A;  4MBQ A;  1ZOY A;  1SA0 E;  2BS2 A;  1YD8 G;  2JPF A;  4CQI A;  4AKG A;  3OPC A;  1R8I A;  1U5P A;  2BS4 A;  4HWF A;  4CXY A;  2VKO A;  5LNK A;  3RGL A;  5HXE A;  1YXR A;  1YQ3 A;  4PK6 A;  2BG9 E;  5FXV A;  4TX5 A;  2WZH A;  2V26 A;  4A56 A;  5CJ5 A;  3B13 A;  5L3G B;  5JTG A;  3ZJ2 A;  3ZEF B;  1UCU A;  4JI6 T;  2FJA A;  2WBL A;  5HEU A;  4IDZ A;  2BG9 A;  4HFE A;  4HFI A;  3F31 A;  3AVR A;  5JR9 B;  2Q9Q D;  1NEN A;  1XMQ T;  1WFD A;  1N36 T;  3FZF B;  2LSY A;  1IBK T;  1QSD A;  2EHO D;  3C4W A;  3P4R A;  4O4H E;  4JI2 T;  3RYI E;  3MXZ A;  4JI7 T;  2HN1 A;  4GYR A;  4DMW A;  3KIN B;  4BJM A;  3AVS A;  4YTP A;  3HKD E;  5HXH A;  4LF8 T;  3AA0 B;  5HEJ A;  2WMO A;  4UVB B;  3AEE A;  2M67 A;  3RQU A;  3UQ4 A;  2CE7 A;  5BMV E;  5LGN B;  3JAF A;  4DUY T;  3KBT A;  4HWH A;  4ILC A;  3N9L A;  2K5B B;  3QOF A;  4A5X A;  4WZX A;  4GIW A;  5JR9 C;  3O9X A;  3OJA A;  5F5W A;  3N9Q A;  5LJN A;  1L0V A;  2JRK A;  2WDQ A;  5L4E A;  1NAF A;  4X62 T;  4LF4 T;  2NW7 A;  2X0L B;  3ZLI A;  2V6Y A;  2K48 A;  3I0Q A;  2MTQ A;  2V6X A;  3C4Z A;  3QNU A;  4BAY B;  5M4Y A;  5F8P A;  1EZ3 A;  3L3P A;  3ONJ A;  4YXD A;  4PAG A;  1WR6 A;  3FB2 A;  3UU4 A;  3VR8 A;  1GQE A;  4Q25 A;  5IYZ E;  2V6Y B;  3T8O A;  1UUS A;  2XM1 A;  2XHE B;  3V5U A;  4HFC A;  5JRE A;  2FJB A;  1WLX A;  3Q5X A;  5FVL A;  1W09 A;  3GA8 A;  4PJL A;  5FL0 A;  4LML A;  2NW9 A;  4ANJ A;  5JDG A;  2KWI B;  3SS1 A;  3UUL A;  3ZSS A;  3E22 E;  5LG3 A;  2WSS V;  4EXT A;  1D0X A;  4IDQ A;  4GKJ T;  1XMO T;  5KDM C;  1S94 A;  1YKH B;  3EVY A;  3H3A A;  2CLY C;  2E2A A;  2GK9 A;  5AQK B;  2DI4 A;  5ABE A;  4QX8 B;  2DWK A;  3AE5 A;  4IRE A;  5FNV E;  2NR4 A;  5C2T A;  3VKH A;  2LSK A;  3J7Y q;  5FL1 A;  4DV7 T;  4HFV A;  4LF7 T;  3VKG A;  2Y48 B;  2YN6 A;  3H37 A;  4O8S A;  5HXC A;  3EUH A;  3HKB E;  3O1H A;  4EB6 E;  4UEM A;  4NUU A;  1QLB A;  2LJL A;  2XZE A;  3CML A;  5DAB A;  5HWX A;  5LP6 E;  2UXB T;  4TN7 B;  2G0U A;  1OED B;  5A1L A;  3PDY A;  5JQG E;  4NIQ A;  2N1G A;  3PU8 A;  1I94 T;  2MPK A;  4Z8X A;  4JUY A;  4DVD A;  3TLW A;  1HX1 B;  3AE7 A;  4QXH B;  5ADX L;  3Q5W A;  5LMN T;  2X9Y A;  4MFR A;  2RPA A;  3VU7 H;  2D0U A;  3UUX B;  2WAU A;  1M7K A;  5JDQ A;  3VRA A;  1ZP0 A;  4DO0 A;  5AFU L;  3U78 A;  5JDM A;  2HHH T;  1OWA A;  4E7Z A;  3PUR A;  5L3E B;  4PFO A;  2E8I A;  4ZS2 A;  4L5G A;  2VKJ A;  2LOS A;  3AB3 B;  1MNE A;  3B5M A;  3UU5 A;  2LSJ A;  4B6X A;  1YW0 A;  4EZH A;  4IDP A;  3ZC0 A;  3QUJ A;  1FMW A;  3SRZ A;  5ABF B;  3ZMU B;  4UEL A;  4Z90 A;  2LRK A;  2QVA A;  2XQ8 A;  3MA9 A;  5AQQ B;  3I1A A;  3I9Y A;  2V7K A;  1HCI A;  3P7I A;  4YFS A;  3UFG A;  1WR0 A;  2CWO A;  2JMH A;  3UU8 A;  3KV6 A;  5L47 A;  1BR1 A;  1O3X A;  3QK6 A;  3ZYK A;  3WAK A;  4XAX B;  2OV9 A;  4A98 A;  1YKE B;  2CWY A;  2LE8 A;  4LFA T;  3ZJ1 A;  4KHP T;  4U7Y A;  4H9R C;  3ZKR A;  4H9S E;  1LRZ A;  1UGO A;  3AA7 B;  2I0M A;  2AE9 A;  5AQJ B;  2X9W A;  3GMI A;  3NZQ A;  4AIS A;  4WBN E;  5JDN A;  1H7C A;  5JH7 E;  3AE9 A;  5HAX A;  4I0U A;  4EAH A;  3MAC A;  1ZHC A;  4F6R C;  3ZN1 B;  2BG9 B;  1HNW T;  4X66 T;  2LSI A;  4JEU B;  4ZZC A;  5JRC B;  3I9W A;  2ZM2 A;  4XZC A;  2ACZ A;  2XQA A;  3N2G E;  2MBG A;  3C64 A;  3UUM A;  2IUB A;  1B7T A;  1E1H B;  5L3F B;  2J1D G;  2BVL A;  2QYW A;  3EAM A;  1MMA A;  1NEK A;  1UK5 A;  5FY7 A;  2YIN A;  5HWY A;  3K3O A;  5JR9 A;  4JI3 T;  4EZ4 A;  5LBQ B;  4TV9 E;  5ABF A;  2J4G A;  1X79 A;  5LB7 B;  3ZMT B;  1BR2 A;  3O4X E;  4HFB A;  5AQL B;  4OHF A;  1ZEE A;  5CFB A;  3KVB A;  3ZT5 A;  5JDH A;  4HFH A;  3ABV A;  5LGT B;  2JJ9 A;  2X67 A;  5HCJ A;  2CPT A;  4AXP A;  4KP3 C;  3KV5 A;  4X1I E;  4ZHQ E;  1HS7 A;  4ERR A;  2XAF B;  1CUN A;  3GN5 B;  4PJN A;  4PJM A;  4UF0 A;  4EYU A;  2WWV A;  3LK3 B;  4LMJ A;  4ZI3 D;  2IML A;  1E2A A;  3PUA A;  2J47 A;  4PFP A;  5AQR B;  3BQK A;  4GYS A;  1XNQ T;  4IE7 A;  3AE3 A;  4WW0 A;  2B76 A;  4AKR B;  4EED A;  3M3Z B;  3W15 B;  1S35 A;  1FIO A;  2BKN A;  2VB6 A;  3LDQ B;  3CWZ B;  3IBP A;  3PUG A;  4H9P C;  1D1B A;  4PJJ A;  3UQ7 A;  4X5T A;  2LLY A;  4EIW A;  2LSG A;  1HR0 T;  2EHO A;  4ISS A;  3EDV A;  2IAK A;  2YOE A;  3LK2 B;  3NVO A;  3ZCJ A;  4DND A;  4CN6 A;  2OLT A;  2ODV A;  2YK0 A;  2BZB A;  3IF8 B;  3R84 B;  3JC6 D;  4LF5 T;  4I43 B;  3ANW B;  3E0Z A;  3ZYM A;  4P0B A;  4AIU A;  1KEY A;  3AA1 B;  2LRL A;  4QKN A;  5FY1 A;  5GON E;  3CQG B;  5LCY A;  5LYJ E;  2WY2 A;  3PUV F;  5CB4 E;  5DQV A;  2YKS A;  4IDN A;  2CBI A;  2BKP A;  5BR8 T;  3AE4 A;  4QX7 B;  2I6H A;  2CMR A;  4X65 T;  2BG9 C;  4YJ2 E;  4X1Y E;  4JV5 T;  2OA5 A;  2WS3 A;  2UXN B;  2XSB A;  3LFM A;  4PK4 A;  3I0O A;  5J2U E;  2BS3 A;  2C0S A;  2KLQ A;  5LHG B;  5LHI B;  3GWH A;  3LSV A;  1FJG T;  4UXN B;  3RI5 A;  4X20 E;  2DL1 A;  3DP7 A;  3VR9 A;  5L3C B;  4LFC T;  2VK9 A;  4QH5 A;  1J1J A;  2QA7 A;  3RC3 A;  4U7I A;  4DR5 T;  3IEE A;  3HR0 A;  3P4Q A;  2CRB A;  5AQS B;  2XQ6 A;  4KX6 A;  2VL0 A;  3ZPO A;  2W63 A;  4UV9 B;  4ZOL E;  2RP4 A;  1MMN A;  3AE8 A;  4IE6 A;  5CA1 E;  5LA6 E;  3RRW A;  3RYC E;  5FXZ A;  3AXJ A;  4FJO A;  2E5L T;  1G8X A;  2K24 A;  3HKC E;  4ZI2 D;  2D9D A;  1G73 A;  1US7 B;  2VKH A;  1V9D A;  3UUB A;  1XNR T;  2L3L A;  3BQL A;  4UV8 B;  2XY8 B;  1JNZ A;  4U31 A;  2VUR A;  4YJ3 E;  4MHC A;  4ZS3 A;  4TWD A;  3A5X A;  2YEV C;  4U74 A;  2D5U A;  4YSZ A;  3FXE B;  3P4S A;  4E7S A;  1LKX A;  2KWH A;  2KSR A;  3P4P A;  2JIW A;  2LHR A;  2C5J A;  4M1P A;  5HEH A;  2V7L A;  1VCS A;  2Z6E A;  2M6B A;  3P50 A;  2BBH A;  1HG2 A;  4QWN B;  5EK3 A;  3JAE A;  1U4Q A;  5J1G A;  4ZI3 C;  2LOP A;  2D2S A;  1W9R A;  3UFE A;  3RIF A;  2DHR A;  4CXW A;  1T72 A;  3CK6 A;  2VQE T;  4QH4 A;  4HKA A;  4DV5 T;  4HN9 A;  1YQ4 A;  1IAP A; 
#chains in the Genus database with same CATH homology
 2UU9 T;  1IBM T;  4LFA T;  5LMU T;  4KHP T;  4B3M T;  4DV2 T;  4DV6 T;  4DV3 T;  4JI1 T;  4DR6 T;  2UUB T;  4K0K T;  1HNW T;  4X66 T;  4B3S T;  5IWA T;  1HR0 T;  4JI3 T;  4X64 T;  2ZM6 T;  1XMQ T;  1N36 T;  1IBK T;  2VQF T;  2UUA T;  4DV1 T;  4JI2 T;  2F4V T;  4JI7 T;  4DR3 T;  4JI4 T;  4LF8 T;  2UXD T;  4DUY T;  4YY3 T;  4LF9 T;  1XNQ T;  4AQY T;  4X62 T;  4LF4 T;  4JI5 T;  4DV4 T;  4LF6 T;  3OTO T;  4LF5 T;  3T1H T;  2UUC T;  4DR7 T;  1HNX T;  4DUZ T;  4NXN T;  5BR8 T;  1J5E T;  4GKJ T;  1XMO T;  4B3T T;  4X65 T;  4JV5 T;  4YHH T;  4JI0 T;  1FJG T;  4NXM T;  4DV7 T;  4LF7 T;  4LFC T;  4JI6 T;  4DR5 T;  4JYA T;  2UXB T;  4DV0 T;  1I94 T;  1N32 T;  4DR2 T;  4LFB T;  1IBL T;  4GKK T;  4JI8 T;  2E5L T;  5LMN T;  4OX9 T;  1XNR T;  1N34 T;  4B3R T;  2HHH T;  1HNZ T;  4DR4 T;  4DR1 T;  2UXC T;  3T1Y T;  2VQE T;  4DV5 T;  1N33 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...