1IBKT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibkT00
2ZM6T 4JI4T 4JYAT 4DR3T 2VQET 4DR4T 1XNQT 1IBLT 4DV4T 4DUZT 2VQFT 1FJGT 4DR2T 3OTOT 2UU9T 4YHHT 2E5LT 2UUBT 4DR1T 1N32T 4JI5T 4JI8T 2HHHT 1HNXT 4OX9T 2F4VT 4GKKT 2UXBT 1N36T 4LFCT 1XMQT 4KHPT 1I94T 4K0KT 4LFAT 2UUCT 2UXDT 5IWAT 4LF9T 1J5ET 5BR8T 4GKJT 4DV2T 4B3MT 4JI0T 5LMNT 4DR6T 1XNRT 4B3RT 4DV1T 1HNWT 3T1YT 1HR0T 4AQYT 4JI1T 2UXCT 4LF4T 4YY3T 4DV5T 4LF8T 1N34T 4B3TT 3T1HT 1XMOT 4DR7T 4JI6T 4DV0T 1IBKT 4DR5T 4NXNT 5LMUT 4X65T 1IBMT 4LF7T 1HNZT 4NXMT 4X62T 4LFBT 4JI3T 2UUAT 4LF5T 4X64T 4DUYT 1N33T 4DV7T 4DV3T 4LF6T 4DV6T 4X66T 4B3ST 4JV5T 4JI2T 4JI7T
chains in the Genus database with same CATH superfamily
2VQET 1I6ZA 5AQKB 4EV6A 1IJ5A 1OEDE 2X0HA 2WY2A 3FB2A 4ISSA 4PK6A 4HWCA 5FKYA 2BBJA 4TV8E 1KNPA 2LOSA 2HHHT 5KMGP 4OX9T 2LRKA 2WU5A 3UFGA 2HN2A 5HEOA 1S35A 4EZ4A 4K0KT 4WBNE 2XAJB 4TN7B 3P4WA 4JI0T 3UU3A 2BS4A 2Y48B 3ZJ1A 4MLKA 2NW9A 5JVDE 2H3RA 2KWIB 2XPKA 2CEAA 4U72A 1KNZA 5C2TA 3U3IA 4DR5T 4DMVA 4I55E 2W2UA 2XY8B 5L3EB 5JREA 3BQKA 1D1AA 2Z6EA 2C0SA 3QNUA 3WI3A 3C98B 4IE5A 3CIRA 3RYCE 4LF6T 3E22E 4A97A 2XHEB 4GYSA 2LKGA 4TV9E 2E9XD 5EK2A 4WNKA 1W0BA 4CI3B 1T7SA 2DL1A 1WFDA 1HTJF 4LMLA 2KXPB 2DWGA 3RQWA 4WZXA 4TX5A 3ABVA 3V5SA 5CFBA 3C64A 2WAUA 2MBGA 3IA3A 4I4TE 3RYFE 2VKHA 2LLYA 2L8KA 1OEDC 2CM0A 3OKQA 4AIUA 3MA9A 3CMLA 2GK9A 2E2AA 4A56A 2Q9QD 4UV9B 4UVAB 4A5XA 4TZ4C 3UU6A 3AE1A 4CN6A 4TWDA 1Y64B 4NUUA 1YXRA 1OWAA 4CXYA 4DV2T 1E1HB 2LHNA 5HEHA 1HG5A 4UIGA 2HN1A 1HR0T 1XDPA 2PTFA 2KNDA 3UU4A 2WMOA 4BAYB 4F6RC 5IHYA 3LFMA 1T98A 3RYIE 3NZQA 5A1LA 2WQYA 3UTKA 3KBTA 4X65T 2WP9A 3KBUA 1IBMT 4YJ3E 3KFWX 5AQTB 4IL9A 4IE6A 4LFBT 4AI6A 4DIDB 2CBJA 3BQIA 2MYSA 1D0YA 4IE4A 4DV3T 5ABGA 1IJ6A 1FIOA 4UEMA 2FJDA 3AB3B 3A8YC 2ZLYA 3LK2B 4UELA 4QX7B 4UF0A 2HPLA 3GA8A 2CBIA 3UQ7A 3VU7H 4MFRA 5JDLA 3NZPA 3ONXA 5F5WA 4ILAA 3PUWF 2Q9QA 1HF8A 1CHUA 2CHOA 1ZKEA 5J2TE 4X1IE 3FBZA 4HFIA 1WR6A 3VR8A 2NTXA 1HG2A 4P0AA 2VKJA 3Q5EA 5LHGB 4PFPA 4AQYT 2LM2A 4JI1T 4WYVA 5CGMA 5JRCA 4DR7T 3T1HT 2D5UA 1HX8A 2D0TA 4X5TA 2LM9A 2BS2A 5L3FB 1ZHCA 2JQQA 3I0OA 2BKOA 3ESLA 3RX6A 4ILBA 4NXMT 4TWFA 5AQVB 4H63H 3JC6C 5JDHA 1L0VA 2KWHA 1HX1B 4DV6T 2WWUA 3TLSA 2RPAA 4DMWA 2QVAA 4JI4T 4UF0B 3FZHB 3EI0A 3CQGB 1S94A 1MIVA 1H7CA 2DWKA 3N9QA 5AQRB 3PUVF 1UCUA 2Q9QB 2MPKA 5EK4A 2KZ7B 1FEWA 1T72A 2K3WA 5JR9C 4EEBA 3FXEB 3ZCIA 3TLUA 5AQOB 3ZCJA 1MMGA 2SPCA 3PUXF 1T8BA 2PJQA 2RP4A 3IEEA 2PFVA 4ZOLE 5JRCB 5LMNT 4DR6T 3NRYA 3ZT6A 2UXCT 4LF4T 3K1SA 4I50E 4ZS3A 3HR0A 5L47A 2LKHA 3PUYF 4P09A 3QK6A 3UFEA 2X9WA 2XM2A 3LK3B 4DUYT 5ETWA 4AKHA 4YT0A 2YU1A 4JV5T 2E5VA 2ES0A 3M65A 4IHJE 4PJLA 2PBIA 2N2NA 5HYAA 2CLYB 2E9XC 3J9X1 4E7ZA 5J1GA 5CJ5A 4DR4T 5AQLB 3N9PA 3FZKB 5HXRA 4PJJA 2WU2A 4AKGA 4ILCA 2V7KA 3AE4A 3OBVE 3JAFA 3FBLA 4YXDA 2CE7A 2X66A 2IC9A 4PAGA 1N36T 4LFCT 1OEDA 3AVSA 5HWYA 1QSDA 2Q9QC 3RC8A 1WRDA 2UXDT 3OYZA 5C3JA 3GMIA 2ODUA 2WCAA 4AQFC 2XQAA 4DNDA 5JDNA 4DV1T 5CB4E 1NAFA 2NWBA 3ZT5A 2NW8A 3K3QC 5H6QB 2XTLA 5JQGE 3TKLB 3VKHA 4H9RC 1AJ3A 1LKXA 4UV8B 5AQMB 4LF7T 2JQ9A 3PDYA 3KDSE 4ZZCA 1JNRA 3P4SA 4X1KE 3QUJA 1NEKA 3AE6A 4I0UA 4LF5T 2XM1A 3CQXC 3MJXA 4EYUA 5JDMA 3CQCB 3PU8A 1LRZA 2N9DA 4CZZB 2H89A 5LBMA 3O1HA 2LSKA 4O4JE 3EAMA 2CA5A 3N2OA 3EHZA 1IAPA 3LSVA 1VOMA 4AISA 2K48A 5LHHB 1XNQT 3JC6D 2W66A 1ZV4X 1QLBA 3RIAA 2JMKA 4N78D 3RKGA 4EYYR 3OJAA 3LK42 3PUSA 4HFVA 4IL4A 3Q5DA 3P4RA 3H3MA 4DBRA 1SHZC 5JTGA 2BKPA 2VK9A 1OEDB 4LMKA 2KSRA 5KXJA 3RKOA 5J0ZA 4JI8T 1JNZA 3RLFF 3AE9A 3M3ZB 2NW7A 4GKKT 4CXWA 3HI2A 2X9XA 3CWZB 4QXHB 5EZYE 2WS3A 5BR8T 3T8OA 1J5WA 4TUYE 2ZMAA 4X1YE 3B57A 1ZOYA 5FXXA 2XQ6A 2BBHA 1VCTA 2D2SA 2XAHB 5LG3A 4EXTA 2HPJA 3ZSSA 3NBXX 3C4WA 3UU5A 3PTRB 3ZN1B 5AQJB 3N9NA 3ZYMA 2V7MA 2E8IA 4JBWF 2V7JA 4G63A 2PG8A 2X51A 3QC9A 4HWHA 4COFA 3EUHA 4V1Av 2XQ8A 4XAXB 4TNVA 3RRCA 4GYRA 3LDQB 4QXCB 4JYAT 2DCFA 5TAOA 1MMDA 3ZMZB 3C50A 2AXDS 2B76A 2VKDA 3R84B 3EVYA 3W15B 4DR2T 2OV9A 1G8XA 4H9OC 3ZMUB 4O4LE 4YSXA 2UUBT 4EEDA 3VRBA 1NWMX 2FUPA 3CPZA 1KEYA 5AQQB 4EZHA 3F2EA 2DHRA 3PUGA 1UX5A 5JR9A 3RGLA 5ABFA 2XSAA 1IZNB 5AQGB 2LSJA 2LSGA 4Q25A 1B7TA 3R6NA 3K8PC 4L9IA 4CQIA 2JJ9A 3CX7B 2XZEA 2IUBA 4DV5T 4MALA 4B3TT 4JUYA 2A2FX 2M6IA 2WZIA 1W9RA 3AEFA 1Y01A 5HWXA 4QKNA 2V6XA 2A3DA 2KT9A 3OVUA 2WDRA 1YD8G 5JDGA 3ZPOA 4OYKA 3AXJB 5LCYA 2LOPA 3HKEE 3ZC1A 3RHWA 3QOFA 3UULA 4U7YA 2EHOD 2CWYA 5FMNA 1Z0PA 3AE5A 1FMWA 4TWHA 1V9DA 2VKOA 3KVAA 4IIJE 4JLEA 2E9XA 4ANJA 3KV9A 5HCMA 3NWIA 1WR0A 1YQ4A 4GK5E 3LBXB 2WZHA 4H9QC 5JH7E 4JI5T 1M7KA 4AKRB 1U5PA 2ZM8A 4YFSA 4YTPA 5JR9B 5ABFB 2FJAA 2NOXA 5FL1A 2VASA 3RRWA 2QGSA 2M6BA 2FBWA 3AEGA 2WB5A 4PK4A 4EAHA 4CN4A 1O3XA 3N9LA 1EZ3A 4TNWA 2R6GF 1XNRT 1MIYA 5AQIB 1LVFA 3T1YT 4PK5A 5FVKA 5L3BB 4AQFA 1XMOT 1WYBA 2XQ7A 5FL0A 2C5KT 3RC3A 1HNZT 2NP9A 2LEHA 4X62T 3EABA 3JADA 4JI3T 4X64T 3K3OA 3ZMTB 2V7IA 4MHCA 4OFZA 3AA0B 5LA6E 2YEVC 3O9XA 4IDNA 3AE7A 4AKIA 3MK7C 4HGAA 3RI5A 2E9XB 2HH7A 5FY1A 2CWOA 4KP3C 2CRBA 1D1CA 5HXSA 4X20E 2VQFT 3D0TA 2W0GA 5IYZE 1N32T 4ZI2D 2XQ5A 1HNXT 3JAEA 1SUMB 5AQSB 4IDPA 1XMQT 2G0UA 2JMHA 4DO0A 2L3LA 2B1EA 1D1BA 4IE7A 4HE8A 2UUCT 4NPPA 1J5ET 2LE8A 1HS7A 3ZJ2A 3HKBE 5HXHA 2ACZA 3Q9DA 5HEUA 5FNVE 4KI0F 3ZYKA 1D0XA 3NVOA 2YKSA 3AE2A 5KDMC 2YDQA 4YSYA 2OLTA 3AE8A 3ZMVB 3ANWA 2BZBA 1ZEEA 4JEHB 5GONE 2V8SV 3FZMB 1US7B 4IDQA 5LP6E 3GWHA 3I0QA 3S4UA 3IHRA 3AAEB 4ISTA 2IAKA 4LMJA 3C4XA 3C51A 5HEGA 3PJAJ 1Z8UA 4EGWA 4ZEYA 3MKDA 2XQ3A 3BQLA 3L3PA 3NRXA 3B13A 4P1NA 3B5MA 4PNIA 2KLQA 1MNEA 2XAGB 5FP3A 2D9DA 3UUNA 3PE0A 2W63A 2LT3A 5LG4A 4LF9T 3PV0F 3AA7B 2QRXA 3VR9A 4EOZB 3F31A 5AQUB 2BG9E 3AEBA 3RF1A 3O1JA 5LXTE 5CA0E 3ANWB 1DU2A 4NXNT 5C8YE 3OPCA 2ZM2A 2H88A 2J47A 3CK6A 1QUUA 2UUAT 4K0UA 2W67A 4KMCA 3RH3A 1M62A 2DLRA 2Y6XA 3VKGA 2BDEA 1UURA 2W00A 3AAAB 4B3ST 4GOUA 4H9SE 3J7Yq 4IE0A 2FJBA 2V26A 4YSZA 4J2CA 4DV4T 3IF8B 3A5XA 2EHOC 5FY0A 3DP7A 4F8HA 5LOVE 1J1JA 2YDRA 4P0BA 3EDUA 4HKAA 2CMRA 2X67A 1UGOA 3P4PA 2VB6A 4DR1T 2I59A 2V7LA 3ZSTA 3AE3A 3RIUC 5L3CB 2D0UA 3RQUA 2WBLA 3UUBA 2UXBT 3A7MA 5AQHB 3JCFA 4KHPT 2V6YA 4HFDA 4LFAT 5LNKA 4XZCA 1XDOA 2IC6A 1R8IA 1FMVA 2A72A 2XUEA 5IWAT 1GQEA 3ZEFB 2CXDA 3O1IA 4ASKA 4HWDA 4Z8XA 1X9BA 3I1AA 1N34T 2JPFA 2YINA 2P9BA 3WAJA 1IBKT 2BG9C 3C4ZA 4QXBB 5HXEA 4CN1A 1D0ZA 2VWAA 3H37A 2ZM0A 4HTEA 3SRZA 4HN9A 3PUQA 2VURA 5L2LA 4KHZF 4XBFB 4GK0E 3AEAA 4QH4A 2LRLA 2H7OA 3N5LA 2NTYA 2MTQA 2UXXB 3UU8A 5M4YA 1FJGT 3F57A 2XAQB 4YHHT 3ONJA 4QHOA 3AXJA 2E5LT 1BR1A 4C91A 2V6YB 2X68A 3PURA 4ZI2C 3KV4A 4CXXA 4G2AA 3SFDA 3KV6A 5FXWA 4WW0A 1WYCA 2XQ9A 3HA4A 4HFCA 1I94T 3ZYLA 3MZKB 2WDVA 3HL6A 3LG7A 4O2BE 3QB5A 5L4EA 1UUSA 1OXZA 3VRAA 4YTNA 4B3RT 3AVRA 1E7PA 2J1DG 2W62A 2Y8DA 5LGTB 3LBXA 4JI6T 1MMNA 4DV0T 2DI4A 4BJMA 5LMUT 5HXCA 3RIFA 4HFHA 3AEEA 4FI5A 1MMAA 1YW0A 3X1DA 4DBQA 4DV7T 2C5JA 4HWIB 2X0YA 2YN6A 5LB7B 3MXZA 5LJNA 3ETUA 2JQKA 4PJMA 4DR3T 4ZZBA 4ZXLA 3N9MA 2V5DA 5FXVA 1SE7A 4DUZT 4PJNA 5ABHA 4JEUB 3AA1B 4ZI3C 4IDOA 5HAXA 1KF6A 2I0MA 4HEAA 2WM9A 3MACA 5LYJE 4QWNB 3TLTA 2CXLA 2YK0A 3RPUA 4KX6A 3FZLB 5LGNB 5HEJA 3L39A 2V5CA 1W0AA 5DQVA 2XSBA 3FXDB 3Q5XA 2C5IT 1KNRA 2JQHA 3AA6B 4I43B 3PUZF 4BJNA 3UUXB 1HNWT 1CUNA 3E08A 5E0OA 1X79A 4EIWA 3G06A 5FY7A 4OK0A 2MAWA 2RA1A 2UXNB 3KV5A 4KUMB 3DJBA 1VCSA 3PJAA 2K24A 5LBQB 3ONLC 1VRBA 1UX4A 1XZYA 3BK9A 2BKNA 1KK7A 5BMVE 2V1DB 5DABA 2ODVA 2WDQA 1KFYA 4UVBB 4IREA 3AEDA 3I9YA 4HFBA 4JI7T 4U3CA 4AQGA 5ADXL 3KINB 5FXZA 4O8SA 4OHFA 1IBLT 1BR4A 4NUVA 2XASB 4U31A 2UU9T 3Q2MA 4UVCB 4ZHQE 2QYWA 3FZFB 2EHOA 4H9NC 2BVLA 2CPTA 5AQPB 4B6XA 2CHNA 5JDFA 1HFAA 5LHIB 3UQ4A 4EB6E 2W61A 3RIUA 4OYJA 3P8CD 5KX5E 1HCIA 1UK5A 3H3AA 2XQ4A 2X9HA 4ZS2A 2QA7A 4O2AE 4LF8T 3QB5K 4E7SA 3TLWA 4PW8A 2FJEA 4L5GA 3LJCA 4ZI7E 5L3DB 5LJMA 1BR2A 1WLXA 3UUMA 2DNXA 2BG9A 4AXPA 1SA0E 3ZLIA 5CA1E 4CI2B 5JDQA 3L8RA 2WMNA 1G73A 4U7IA 4AKLA 1WCRA 2LSIA 4X66T 3I9WA 4UXNB 1YKEB 5HCJA 3VHLA 5AQNB 3SOLA 2VVSA 4O4IE 4U2YA 2K9AA 3HKDE 2VL0A 3SWHA 4U33A 3CX8B 3ETVA 2MOZA 2EHOB 4FJOA 3U78A 1MIWA 3O4XE 2VL8A 4UR9A 4BA9A 5J2UE 5L3GB 2K5BB 2IW5B 1YQ3A 3N2GE 4GIWA 4IDZA 2YDSA 2CCQA 5IUXA 3PUAA 2L9QA 4ZI3D 4QX8B 2IDOB 4QH5A 3N2KE 4U2ZA 3L09A 3CVRA 2I6HA 3ZKRA 3SS1A 2XJ7A 4YLHA 4B3MT 5L4HA 4CI1B 5AQFB 1U4QA 3HKCE 4NIQA 5DQWA 3ZMSB 3P4QA 2XQYA 3AAIA 3AECA 3DTOA 2NR4A 4YTMA 3ZT7A 2WWVA 4Z91A 2IIUA 5DJQC 5LGUB 3Q5WA 1NENA 4MBQA 2LJLA 2BG9B 5F8PA 4U74A 3TLVA 1LVKA 1XWMA 4HWFA 3ZC0A 5F3JA 2LHRA 2JRKA 3GN5A 4JI2T 2CXFA 3V5UA 2BVMA 2ZM6T 4ILUA 2WSSV 3IBPA 3N9OA 2N1GA 4IGUA 2M67A 2YOEA 4YJ2E 3CX6B 4M1PA 4L0RA 3E0ZA 2JIWA 3OTOT 3FHNA 3P50A 2J62A 2ACXA 5ABEA 3SFEA 2J4GA 3ZN0B 4HFEA 4KBMB 2A9UA 2F4VT 5AFUL 4DVDA 4WBOA 5H6RB 4H9PC 4YHJA 3K3NA 1W09A 4ADZA 4PFOA 3P7IA 2IMLA 4GKJT 2XAFB 3RYHE 2IHR1 3KVBA 4H63V 4IT4A 2X0LB 1ZP0A 2YU2A 2AE9A 2VVNA 4ERRA 1YKHB 1BR0A 2H7VC 4YY3T 2BS3A 2LSYA 4A98A 3OYXA 1E2AA 2KMFA 3PU3A 3GN5B 2W4XA 3CKDA 3WAKA 2KINB 4QH1A 5EK3A 1N33T 4C90A 3NKZA 4Z90A 1MNDA 2X9YA 4O4HE 5FVLA 3EDVA 3UT5E 5FYMA 2OA5A 2CLYC
chains in the Genus database with same CATH topology
2ZM6T 4JI4T 4JYAT 4DR3T 2VQET 4DR4T 1XNQT 1IBLT 4DV4T 4DUZT 2VQFT 1FJGT 4DR2T 3OTOT 2UU9T 4YHHT 2E5LT 2UUBT 4DR1T 1N32T 4JI5T 4JI8T 2HHHT 1HNXT 4OX9T 2F4VT 4GKKT 2UXBT 1N36T 4LFCT 1XMQT 4KHPT 1I94T 4K0KT 4LFAT 2UUCT 2UXDT 5IWAT 4LF9T 1J5ET 5BR8T 4GKJT 4DV2T 4B3MT 4JI0T 5LMNT 4DR6T 1XNRT 4B3RT 4DV1T 1HNWT 3T1YT 1HR0T 4AQYT 4JI1T 2UXCT 4LF4T 4YY3T 4DV5T 4LF8T 1N34T 4B3TT 3T1HT 1XMOT 4DR7T 4JI6T 4DV0T 1IBKT 4DR5T 4NXNT 5LMUT 4X65T 1IBMT 4LF7T 1HNZT 4NXMT 4X62T 4LFBT 4JI3T 2UUAT 4LF5T 4X64T 4DUYT 1N33T 4DV7T 4DV3T 4LF6T 4DV6T 4X66T 4B3ST 4JV5T 4JI2T 4JI7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 T;  4JI4 T;  4JYA T;  4DR3 T;  2VQE T;  4DR4 T;  1XNQ T;  1IBL T;  4DV4 T;  4DUZ T;  2VQF T;  1FJG T;  4DR2 T;  3OTO T;  2UU9 T;  4YHH T;  2E5L T;  2UUB T;  4DR1 T;  1N32 T;  4JI5 T;  4JI8 T;  2HHH T;  1HNX T;  4OX9 T;  2F4V T;  4GKK T;  2UXB T;  1N36 T;  4LFC T;  1XMQ T;  4KHP T;  1I94 T;  4K0K T;  4LFA T;  2UUC T;  2UXD T;  5IWA T;  4LF9 T;  1J5E T;  5BR8 T;  4GKJ T;  4DV2 T;  4B3M T;  4JI0 T;  5LMN T;  4DR6 T;  1XNR T;  4B3R T;  4DV1 T;  1HNW T;  3T1Y T;  1HR0 T;  4AQY T;  4JI1 T;  2UXC T;  4LF4 T;  4YY3 T;  4DV5 T;  4LF8 T;  1N34 T;  4B3T T;  3T1H T;  1XMO T;  4DR7 T;  4JI6 T;  4DV0 T;  1IBK T;  4DR5 T;  4NXN T;  5LMU T;  4X65 T;  1IBM T;  4LF7 T;  1HNZ T;  4NXM T;  4X62 T;  4LFB T;  4JI3 T;  2UUA T;  4LF5 T;  4X64 T;  4DUY T;  1N33 T;  4DV7 T;  4DV3 T;  4LF6 T;  4DV6 T;  4X66 T;  4B3S T;  4JV5 T;  4JI2 T;  4JI7 T; 
#chains in the Genus database with same CATH topology
 2VQE T;  1I6Z A;  5AQK B;  4EV6 A;  1IJ5 A;  1OED E;  2X0H A;  2WY2 A;  3FB2 A;  4ISS A;  4PK6 A;  4HWC A;  5FKY A;  2BBJ A;  4TV8 E;  1KNP A;  2LOS A;  2HHH T;  5KMG P;  4OX9 T;  2LRK A;  2WU5 A;  3UFG A;  2HN2 A;  5HEO A;  1S35 A;  4EZ4 A;  4K0K T;  4WBN E;  2XAJ B;  4TN7 B;  3P4W A;  4JI0 T;  3UU3 A;  2BS4 A;  2Y48 B;  3ZJ1 A;  4MLK A;  2NW9 A;  5JVD E;  2H3R A;  2KWI B;  2XPK A;  2CEA A;  4U72 A;  1KNZ A;  5C2T A;  3U3I A;  4DR5 T;  4DMV A;  4I55 E;  2W2U A;  2XY8 B;  5L3E B;  5JRE A;  3BQK A;  1D1A A;  2Z6E A;  2C0S A;  3QNU A;  3WI3 A;  3C98 B;  4IE5 A;  3CIR A;  3RYC E;  4LF6 T;  3E22 E;  4A97 A;  2XHE B;  4GYS A;  2LKG A;  4TV9 E;  2E9X D;  5EK2 A;  4WNK A;  1W0B A;  4CI3 B;  1T7S A;  2DL1 A;  1WFD A;  1HTJ F;  4LML A;  2KXP B;  2DWG A;  3RQW A;  4WZX A;  4TX5 A;  3ABV A;  3V5S A;  5CFB A;  3C64 A;  2WAU A;  2MBG A;  3IA3 A;  4I4T E;  3RYF E;  2VKH A;  2LLY A;  2L8K A;  1OED C;  2CM0 A;  3OKQ A;  4AIU A;  3MA9 A;  3CML A;  2GK9 A;  2E2A A;  4A56 A;  2Q9Q D;  4UV9 B;  4UVA B;  4A5X A;  4TZ4 C;  3UU6 A;  3AE1 A;  4CN6 A;  4TWD A;  1Y64 B;  4NUU A;  1YXR A;  1OWA A;  4CXY A;  4DV2 T;  1E1H B;  2LHN A;  5HEH A;  1HG5 A;  4UIG A;  2HN1 A;  1HR0 T;  1XDP A;  2PTF A;  2KND A;  3UU4 A;  2WMO A;  4BAY B;  4F6R C;  5IHY A;  3LFM A;  1T98 A;  3RYI E;  3NZQ A;  5A1L A;  2WQY A;  3UTK A;  3KBT A;  4X65 T;  2WP9 A;  3KBU A;  1IBM T;  4YJ3 E;  3KFW X;  5AQT B;  4IL9 A;  4IE6 A;  4LFB T;  4AI6 A;  4DID B;  2CBJ A;  3BQI A;  2MYS A;  1D0Y A;  4IE4 A;  4DV3 T;  5ABG A;  1IJ6 A;  1FIO A;  4UEM A;  2FJD A;  3AB3 B;  3A8Y C;  2ZLY A;  3LK2 B;  4UEL A;  4QX7 B;  4UF0 A;  2HPL A;  3GA8 A;  2CBI A;  3UQ7 A;  3VU7 H;  4MFR A;  5JDL A;  3NZP A;  3ONX A;  5F5W A;  4ILA A;  3PUW F;  2Q9Q A;  1HF8 A;  1CHU A;  2CHO A;  1ZKE A;  5J2T E;  4X1I E;  3FBZ A;  4HFI A;  1WR6 A;  3VR8 A;  2NTX A;  1HG2 A;  4P0A A;  2VKJ A;  3Q5E A;  5LHG B;  4PFP A;  4AQY T;  2LM2 A;  4JI1 T;  4WYV A;  5CGM A;  5JRC A;  4DR7 T;  3T1H T;  2D5U A;  1HX8 A;  2D0T A;  4X5T A;  2LM9 A;  2BS2 A;  5L3F B;  1ZHC A;  2JQQ A;  3I0O A;  2BKO A;  3ESL A;  3RX6 A;  4ILB A;  4NXM T;  4TWF A;  5AQV B;  4H63 H;  3JC6 C;  5JDH A;  1L0V A;  2KWH A;  1HX1 B;  4DV6 T;  2WWU A;  3TLS A;  2RPA A;  4DMW A;  2QVA A;  4JI4 T;  4UF0 B;  3FZH B;  3EI0 A;  3CQG B;  1S94 A;  1MIV A;  1H7C A;  2DWK A;  3N9Q A;  5AQR B;  3PUV F;  1UCU A;  2Q9Q B;  2MPK A;  5EK4 A;  2KZ7 B;  1FEW A;  1T72 A;  2K3W A;  5JR9 C;  4EEB A;  3FXE B;  3ZCI A;  3TLU A;  5AQO B;  3ZCJ A;  1MMG A;  2SPC A;  3PUX F;  1T8B A;  2PJQ A;  2RP4 A;  3IEE A;  2PFV A;  4ZOL E;  5JRC B;  5LMN T;  4DR6 T;  3NRY A;  3ZT6 A;  2UXC T;  4LF4 T;  3K1S A;  4I50 E;  4ZS3 A;  3HR0 A;  5L47 A;  2LKH A;  3PUY F;  4P09 A;  3QK6 A;  3UFE A;  2X9W A;  2XM2 A;  3LK3 B;  4DUY T;  5ETW A;  4AKH A;  4YT0 A;  2YU1 A;  4JV5 T;  2E5V A;  2ES0 A;  3M65 A;  4IHJ E;  4PJL A;  2PBI A;  2N2N A;  5HYA A;  2CLY B;  2E9X C;  3J9X 1;  4E7Z A;  5J1G A;  5CJ5 A;  4DR4 T;  5AQL B;  3N9P A;  3FZK B;  5HXR A;  4PJJ A;  2WU2 A;  4AKG A;  4ILC A;  2V7K A;  3AE4 A;  3OBV E;  3JAF A;  3FBL A;  4YXD A;  2CE7 A;  2X66 A;  2IC9 A;  4PAG A;  1N36 T;  4LFC T;  1OED A;  3AVS A;  5HWY A;  1QSD A;  2Q9Q C;  3RC8 A;  1WRD A;  2UXD T;  3OYZ A;  5C3J A;  3GMI A;  2ODU A;  2WCA A;  4AQF C;  2XQA A;  4DND A;  5JDN A;  4DV1 T;  5CB4 E;  1NAF A;  2NWB A;  3ZT5 A;  2NW8 A;  3K3Q C;  5H6Q B;  2XTL A;  5JQG E;  3TKL B;  3VKH A;  4H9R C;  1AJ3 A;  1LKX A;  4UV8 B;  5AQM B;  4LF7 T;  2JQ9 A;  3PDY A;  3KDS E;  4ZZC A;  1JNR A;  3P4S A;  4X1K E;  3QUJ A;  1NEK A;  3AE6 A;  4I0U A;  4LF5 T;  2XM1 A;  3CQX C;  3MJX A;  4EYU A;  5JDM A;  3CQC B;  3PU8 A;  1LRZ A;  2N9D A;  4CZZ B;  2H89 A;  5LBM A;  3O1H A;  2LSK A;  4O4J E;  3EAM A;  2CA5 A;  3N2O A;  3EHZ A;  1IAP A;  3LSV A;  1VOM A;  4AIS A;  2K48 A;  5LHH B;  1XNQ T;  3JC6 D;  2W66 A;  1ZV4 X;  1QLB A;  3RIA A;  2JMK A;  4N78 D;  3RKG A;  4EYY R;  3OJA A;  3LK4 2;  3PUS A;  4HFV A;  4IL4 A;  3Q5D A;  3P4R A;  3H3M A;  4DBR A;  1SHZ C;  5JTG A;  2BKP A;  2VK9 A;  1OED B;  4LMK A;  2KSR A;  5KXJ A;  3RKO A;  5J0Z A;  4JI8 T;  1JNZ A;  3RLF F;  3AE9 A;  3M3Z B;  2NW7 A;  4GKK T;  4CXW A;  3HI2 A;  2X9X A;  3CWZ B;  4QXH B;  5EZY E;  2WS3 A;  5BR8 T;  3T8O A;  1J5W A;  4TUY E;  2ZMA A;  4X1Y E;  3B57 A;  1ZOY A;  5FXX A;  2XQ6 A;  2BBH A;  1VCT A;  2D2S A;  2XAH B;  5LG3 A;  4EXT A;  2HPJ A;  3ZSS A;  3NBX X;  3C4W A;  3UU5 A;  3PTR B;  3ZN1 B;  5AQJ B;  3N9N A;  3ZYM A;  2V7M A;  2E8I A;  4JBW F;  2V7J A;  4G63 A;  2PG8 A;  2X51 A;  3QC9 A;  4HWH A;  4COF A;  3EUH A;  4V1A v;  2XQ8 A;  4XAX B;  4TNV A;  3RRC A;  4GYR A;  3LDQ B;  4QXC B;  4JYA T;  2DCF A;  5TAO A;  1MMD A;  3ZMZ B;  3C50 A;  2AXD S;  2B76 A;  2VKD A;  3R84 B;  3EVY A;  3W15 B;  4DR2 T;  2OV9 A;  1G8X A;  4H9O C;  3ZMU B;  4O4L E;  4YSX A;  2UUB T;  4EED A;  3VRB A;  1NWM X;  2FUP A;  3CPZ A;  1KEY A;  5AQQ B;  4EZH A;  3F2E A;  2DHR A;  3PUG A;  1UX5 A;  5JR9 A;  3RGL A;  5ABF A;  2XSA A;  1IZN B;  5AQG B;  2LSJ A;  2LSG A;  4Q25 A;  1B7T A;  3R6N A;  3K8P C;  4L9I A;  4CQI A;  2JJ9 A;  3CX7 B;  2XZE A;  2IUB A;  4DV5 T;  4MAL A;  4B3T T;  4JUY A;  2A2F X;  2M6I A;  2WZI A;  1W9R A;  3AEF A;  1Y01 A;  5HWX A;  4QKN A;  2V6X A;  2A3D A;  2KT9 A;  3OVU A;  2WDR A;  1YD8 G;  5JDG A;  3ZPO A;  4OYK A;  3AXJ B;  5LCY A;  2LOP A;  3HKE E;  3ZC1 A;  3RHW A;  3QOF A;  3UUL A;  4U7Y A;  2EHO D;  2CWY A;  5FMN A;  1Z0P A;  3AE5 A;  1FMW A;  4TWH A;  1V9D A;  2VKO A;  3KVA A;  4IIJ E;  4JLE A;  2E9X A;  4ANJ A;  3KV9 A;  5HCM A;  3NWI A;  1WR0 A;  1YQ4 A;  4GK5 E;  3LBX B;  2WZH A;  4H9Q C;  5JH7 E;  4JI5 T;  1M7K A;  4AKR B;  1U5P A;  2ZM8 A;  4YFS A;  4YTP A;  5JR9 B;  5ABF B;  2FJA A;  2NOX A;  5FL1 A;  2VAS A;  3RRW A;  2QGS A;  2M6B A;  2FBW A;  3AEG A;  2WB5 A;  4PK4 A;  4EAH A;  4CN4 A;  1O3X A;  3N9L A;  1EZ3 A;  4TNW A;  2R6G F;  1XNR T;  1MIY A;  5AQI B;  1LVF A;  3T1Y T;  4PK5 A;  5FVK A;  5L3B B;  4AQF A;  1XMO T;  1WYB A;  2XQ7 A;  5FL0 A;  2C5K T;  3RC3 A;  1HNZ T;  2NP9 A;  2LEH A;  4X62 T;  3EAB A;  3JAD A;  4JI3 T;  4X64 T;  3K3O A;  3ZMT B;  2V7I A;  4MHC A;  4OFZ A;  3AA0 B;  5LA6 E;  2YEV C;  3O9X A;  4IDN A;  3AE7 A;  4AKI A;  3MK7 C;  4HGA A;  3RI5 A;  2E9X B;  2HH7 A;  5FY1 A;  2CWO A;  4KP3 C;  2CRB A;  1D1C A;  5HXS A;  4X20 E;  2VQF T;  3D0T A;  2W0G A;  5IYZ E;  1N32 T;  4ZI2 D;  2XQ5 A;  1HNX T;  3JAE A;  1SUM B;  5AQS B;  4IDP A;  1XMQ T;  2G0U A;  2JMH A;  4DO0 A;  2L3L A;  2B1E A;  1D1B A;  4IE7 A;  4HE8 A;  2UUC T;  4NPP A;  1J5E T;  2LE8 A;  1HS7 A;  3ZJ2 A;  3HKB E;  5HXH A;  2ACZ A;  3Q9D A;  5HEU A;  5FNV E;  4KI0 F;  3ZYK A;  1D0X A;  3NVO A;  2YKS A;  3AE2 A;  5KDM C;  2YDQ A;  4YSY A;  2OLT A;  3AE8 A;  3ZMV B;  3ANW A;  2BZB A;  1ZEE A;  4JEH B;  5GON E;  2V8S V;  3FZM B;  1US7 B;  4IDQ A;  5LP6 E;  3GWH A;  3I0Q A;  3S4U A;  3IHR A;  3AAE B;  4IST A;  2IAK A;  4LMJ A;  3C4X A;  3C51 A;  5HEG A;  3PJA J;  1Z8U A;  4EGW A;  4ZEY A;  3MKD A;  2XQ3 A;  3BQL A;  3L3P A;  3NRX A;  3B13 A;  4P1N A;  3B5M A;  4PNI A;  2KLQ A;  1MNE A;  2XAG B;  5FP3 A;  2D9D A;  3UUN A;  3PE0 A;  2W63 A;  2LT3 A;  5LG4 A;  4LF9 T;  3PV0 F;  3AA7 B;  2QRX A;  3VR9 A;  4EOZ B;  3F31 A;  5AQU B;  2BG9 E;  3AEB A;  3RF1 A;  3O1J A;  5LXT E;  5CA0 E;  3ANW B;  1DU2 A;  4NXN T;  5C8Y E;  3OPC A;  2ZM2 A;  2H88 A;  2J47 A;  3CK6 A;  1QUU A;  2UUA T;  4K0U A;  2W67 A;  4KMC A;  3RH3 A;  1M62 A;  2DLR A;  2Y6X A;  3VKG A;  2BDE A;  1UUR A;  2W00 A;  3AAA B;  4B3S T;  4GOU A;  4H9S E;  3J7Y q;  4IE0 A;  2FJB A;  2V26 A;  4YSZ A;  4J2C A;  4DV4 T;  3IF8 B;  3A5X A;  2EHO C;  5FY0 A;  3DP7 A;  4F8H A;  5LOV E;  1J1J A;  2YDR A;  4P0B A;  3EDU A;  4HKA A;  2CMR A;  2X67 A;  1UGO A;  3P4P A;  2VB6 A;  4DR1 T;  2I59 A;  2V7L A;  3ZST A;  3AE3 A;  3RIU C;  5L3C B;  2D0U A;  3RQU A;  2WBL A;  3UUB A;  2UXB T;  3A7M A;  5AQH B;  3JCF A;  4KHP T;  2V6Y A;  4HFD A;  4LFA T;  5LNK A;  4XZC A;  1XDO A;  2IC6 A;  1R8I A;  1FMV A;  2A72 A;  2XUE A;  5IWA T;  1GQE A;  3ZEF B;  2CXD A;  3O1I A;  4ASK A;  4HWD A;  4Z8X A;  1X9B A;  3I1A A;  1N34 T;  2JPF A;  2YIN A;  2P9B A;  3WAJ A;  1IBK T;  2BG9 C;  3C4Z A;  4QXB B;  5HXE A;  4CN1 A;  1D0Z A;  2VWA A;  3H37 A;  2ZM0 A;  4HTE A;  3SRZ A;  4HN9 A;  3PUQ A;  2VUR A;  5L2L A;  4KHZ F;  4XBF B;  4GK0 E;  3AEA A;  4QH4 A;  2LRL A;  2H7O A;  3N5L A;  2NTY A;  2MTQ A;  2UXX B;  3UU8 A;  5M4Y A;  1FJG T;  3F57 A;  2XAQ B;  4YHH T;  3ONJ A;  4QHO A;  3AXJ A;  2E5L T;  1BR1 A;  4C91 A;  2V6Y B;  2X68 A;  3PUR A;  4ZI2 C;  3KV4 A;  4CXX A;  4G2A A;  3SFD A;  3KV6 A;  5FXW A;  4WW0 A;  1WYC A;  2XQ9 A;  3HA4 A;  4HFC A;  1I94 T;  3ZYL A;  3MZK B;  2WDV A;  3HL6 A;  3LG7 A;  4O2B E;  3QB5 A;  5L4E A;  1UUS A;  1OXZ A;  3VRA A;  4YTN A;  4B3R T;  3AVR A;  1E7P A;  2J1D G;  2W62 A;  2Y8D A;  5LGT B;  3LBX A;  4JI6 T;  1MMN A;  4DV0 T;  2DI4 A;  4BJM A;  5LMU T;  5HXC A;  3RIF A;  4HFH A;  3AEE A;  4FI5 A;  1MMA A;  1YW0 A;  3X1D A;  4DBQ A;  4DV7 T;  2C5J A;  4HWI B;  2X0Y A;  2YN6 A;  5LB7 B;  3MXZ A;  5LJN A;  3ETU A;  2JQK A;  4PJM A;  4DR3 T;  4ZZB A;  4ZXL A;  3N9M A;  2V5D A;  5FXV A;  1SE7 A;  4DUZ T;  4PJN A;  5ABH A;  4JEU B;  3AA1 B;  4ZI3 C;  4IDO A;  5HAX A;  1KF6 A;  2I0M A;  4HEA A;  2WM9 A;  3MAC A;  5LYJ E;  4QWN B;  3TLT A;  2CXL A;  2YK0 A;  3RPU A;  4KX6 A;  3FZL B;  5LGN B;  5HEJ A;  3L39 A;  2V5C A;  1W0A A;  5DQV A;  2XSB A;  3FXD B;  3Q5X A;  2C5I T;  1KNR A;  2JQH A;  3AA6 B;  4I43 B;  3PUZ F;  4BJN A;  3UUX B;  1HNW T;  1CUN A;  3E08 A;  5E0O A;  1X79 A;  4EIW A;  3G06 A;  5FY7 A;  4OK0 A;  2MAW A;  2RA1 A;  2UXN B;  3KV5 A;  4KUM B;  3DJB A;  1VCS A;  3PJA A;  2K24 A;  5LBQ B;  3ONL C;  1VRB A;  1UX4 A;  1XZY A;  3BK9 A;  2BKN A;  1KK7 A;  5BMV E;  2V1D B;  5DAB A;  2ODV A;  2WDQ A;  1KFY A;  4UVB B;  4IRE A;  3AED A;  3I9Y A;  4HFB A;  4JI7 T;  4U3C A;  4AQG A;  5ADX L;  3KIN B;  5FXZ A;  4O8S A;  4OHF A;  1IBL T;  1BR4 A;  4NUV A;  2XAS B;  4U31 A;  2UU9 T;  3Q2M A;  4UVC B;  4ZHQ E;  2QYW A;  3FZF B;  2EHO A;  4H9N C;  2BVL A;  2CPT A;  5AQP B;  4B6X A;  2CHN A;  5JDF A;  1HFA A;  5LHI B;  3UQ4 A;  4EB6 E;  2W61 A;  3RIU A;  4OYJ A;  3P8C D;  5KX5 E;  1HCI A;  1UK5 A;  3H3A A;  2XQ4 A;  2X9H A;  4ZS2 A;  2QA7 A;  4O2A E;  4LF8 T;  3QB5 K;  4E7S A;  3TLW A;  4PW8 A;  2FJE A;  4L5G A;  3LJC A;  4ZI7 E;  5L3D B;  5LJM A;  1BR2 A;  1WLX A;  3UUM A;  2DNX A;  2BG9 A;  4AXP A;  1SA0 E;  3ZLI A;  5CA1 E;  4CI2 B;  5JDQ A;  3L8R A;  2WMN A;  1G73 A;  4U7I A;  4AKL A;  1WCR A;  2LSI A;  4X66 T;  3I9W A;  4UXN B;  1YKE B;  5HCJ A;  3VHL A;  5AQN B;  3SOL A;  2VVS A;  4O4I E;  4U2Y A;  2K9A A;  3HKD E;  2VL0 A;  3SWH A;  4U33 A;  3CX8 B;  3ETV A;  2MOZ A;  2EHO B;  4FJO A;  3U78 A;  1MIW A;  3O4X E;  2VL8 A;  4UR9 A;  4BA9 A;  5J2U E;  5L3G B;  2K5B B;  2IW5 B;  1YQ3 A;  3N2G E;  4GIW A;  4IDZ A;  2YDS A;  2CCQ A;  5IUX A;  3PUA A;  2L9Q A;  4ZI3 D;  4QX8 B;  2IDO B;  4QH5 A;  3N2K E;  4U2Z A;  3L09 A;  3CVR A;  2I6H A;  3ZKR A;  3SS1 A;  2XJ7 A;  4YLH A;  4B3M T;  5L4H A;  4CI1 B;  5AQF B;  1U4Q A;  3HKC E;  4NIQ A;  5DQW A;  3ZMS B;  3P4Q A;  2XQY A;  3AAI A;  3AEC A;  3DTO A;  2NR4 A;  4YTM A;  3ZT7 A;  2WWV A;  4Z91 A;  2IIU A;  5DJQ C;  5LGU B;  3Q5W A;  1NEN A;  4MBQ A;  2LJL A;  2BG9 B;  5F8P A;  4U74 A;  3TLV A;  1LVK A;  1XWM A;  4HWF A;  3ZC0 A;  5F3J A;  2LHR A;  2JRK A;  3GN5 A;  4JI2 T;  2CXF A;  3V5U A;  2BVM A;  2ZM6 T;  4ILU A;  2WSS V;  3IBP A;  3N9O A;  2N1G A;  4IGU A;  2M67 A;  2YOE A;  4YJ2 E;  3CX6 B;  4M1P A;  4L0R A;  3E0Z A;  2JIW A;  3OTO T;  3FHN A;  3P50 A;  2J62 A;  2ACX A;  5ABE A;  3SFE A;  2J4G A;  3ZN0 B;  4HFE A;  4KBM B;  2A9U A;  2F4V T;  5AFU L;  4DVD A;  4WBO A;  5H6R B;  4H9P C;  4YHJ A;  3K3N A;  1W09 A;  4ADZ A;  4PFO A;  3P7I A;  2IML A;  4GKJ T;  2XAF B;  3RYH E;  2IHR 1;  3KVB A;  4H63 V;  4IT4 A;  2X0L B;  1ZP0 A;  2YU2 A;  2AE9 A;  2VVN A;  4ERR A;  1YKH B;  1BR0 A;  2H7V C;  4YY3 T;  2BS3 A;  2LSY A;  4A98 A;  3OYX A;  1E2A A;  2KMF A;  3PU3 A;  3GN5 B;  2W4X A;  3CKD A;  3WAK A;  2KIN B;  4QH1 A;  5EK3 A;  1N33 T;  4C90 A;  3NKZ A;  4Z90 A;  1MND A;  2X9Y A;  4O4H E;  5FVL A;  3EDV A;  3UT5 E;  5FYM A;  2OA5 A;  2CLY C; 
#chains in the Genus database with same CATH homology
 2ZM6 T;  4JI4 T;  4JYA T;  4DR3 T;  2VQE T;  4DR4 T;  1XNQ T;  1IBL T;  4DV4 T;  4DUZ T;  2VQF T;  1FJG T;  4DR2 T;  3OTO T;  2UU9 T;  4YHH T;  2E5L T;  2UUB T;  4DR1 T;  1N32 T;  4JI5 T;  4JI8 T;  2HHH T;  1HNX T;  4OX9 T;  2F4V T;  4GKK T;  2UXB T;  1N36 T;  4LFC T;  1XMQ T;  4KHP T;  1I94 T;  4K0K T;  4LFA T;  2UUC T;  2UXD T;  5IWA T;  4LF9 T;  1J5E T;  5BR8 T;  4GKJ T;  4DV2 T;  4B3M T;  4JI0 T;  5LMN T;  4DR6 T;  1XNR T;  4B3R T;  4DV1 T;  1HNW T;  3T1Y T;  1HR0 T;  4AQY T;  4JI1 T;  2UXC T;  4LF4 T;  4YY3 T;  4DV5 T;  4LF8 T;  1N34 T;  4B3T T;  3T1H T;  1XMO T;  4DR7 T;  4JI6 T;  4DV0 T;  1IBK T;  4DR5 T;  4NXN T;  5LMU T;  4X65 T;  1IBM T;  4LF7 T;  1HNZ T;  4NXM T;  4X62 T;  4LFB T;  4JI3 T;  2UUA T;  4LF5 T;  4X64 T;  4DUY T;  1N33 T;  4DV7 T;  4DV3 T;  4LF6 T;  4DV6 T;  4X66 T;  4B3S T;  4JV5 T;  4JI2 T;  4JI7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...