1IBKT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibkT00
1I94T 4JI2T 4JI6T 1HNXT 4LF5T 4YHHT 2E5LT 4GKJT 4DV2T 1N33T 4DR7T 1HNWT 3T1YT 4LFAT 4JI7T 4AQYT 1N34T 4DUYT 4B3TT 4JI0T 4X66T 5LMUT 4LFCT 3OTOT 4KHPT 2VQFT 4GKKT 4LF9T 1IBLT 1IBKT 4LF7T 4X64T 4DR3T 4JI8T 4JI1T 5BR8T 4DUZT 1IBMT 4B3RT 2UXCT 4B3MT 1FJGT 4K0KT 1HNZT 2HHHT 4X62T 4DR2T 4JI5T 4OX9T 4DV5T 4JV5T 4NXNT 1XNRT 4DV6T 1XMQT 4JYAT 5LMNT 2F4VT 1XNQT 4DR5T 2VQET 3T1HT 2UXDT 4JI3T 4NXMT 2UUBT 1HR0T 4B3ST 4LF4T 4DR6T 4JI4T 5IWAT 4DV1T 4DR1T 4DV0T 4LF6T 4LF8T 1XMOT 2UU9T 4YY3T 4DV4T 2UUAT 2ZM6T 1N36T 4LFBT 2UXBT 4DV3T 4DV7T 1J5ET 4X65T 2UUCT 1N32T 4DR4T
chains in the Genus database with same CATH superfamily
2Z6EA 4TNWA 4BA9A 4GK5E 1ZP0A 4JI6T 1E7PA 1XDOA 1KEYA 3ONJA 5FY7A 4DR7T 3I0QA 3ZMZB 1HX1B 4DUYT 2HPJA 3J7Yq 2KINB 4QKNA 3J9X1 4CXWA 2LSIA 2WU2A 4LFCT 4A56A 4KHPT 4YXDA 4B6XA 4QXCB 4GKKT 4LF7T 2BS2A 5ADXL 1IAPA 1X79A 2WWVA 3LK2B 1ZV4X 1UX5A 4WYVA 3SS1A 5JDLA 4B3MT 4G2AA 3EDUA 2V5DA 4GYRA 2FJEA 4U3CA 4IHJE 1IZNB 3I0OA 1YXRA 4HWCA 2JJ9A 4JYAT 4CN6A 5LXTE 3ZKRA 2PG8A 5GONE 3O1JA 4JI3T 2X66A 1S35A 4QXHB 2KWHA 4DV0T 5HEGA 3PUVF 2VKOA 2YKSA 4YT0A 2E2AA 1HFAA 3S4UA 4AIUA 4HWDA 2CWOA 2QVAA 3AAAB 1W0BA 5J0ZA 5L2LA 2CLYC 3RIFA 3CWZB 4EGWA 3EVYA 4ZS3A 3P4SA 3RQUA 3KVAA 3OJAA 2H7OA 2YINA 2LSKA 2C5KT 3CX7B 2M67A 2JQKA 4ZI7E 4A5XA 3WAJA 3ONLC 5EK2A 2VURA 3NZPA 4CI1B 5FL1A 3A5XA 3SOLA 5L3BB 1T7SA 3MKDA 3A8YC 3DP7A 4I43B 4IREA 2M6BA 1IBMT 1NAFA 5C3JA 2NTXA 3N9MA 4ISTA 5AQMB 4NXNT 4L5GA 3N9QA 3V5SA 3OYXA 3LJCA 4QXBB 3SWHA 4AKLA 2SPCA 5ABEA 4IE4A 5CA0E 4XZCA 5CFBA 3OBVE 5M4YA 1UCUA 2E9XB 3QB5K 3L09A 4OYKA 2PJQA 2I0MA 4YSZA 3IHRA 1I94T 2DWGA 5HYAA 2X9HA 2K3WA 3VHLA 2FJDA 5HXSA 2BG9B 2LJLA 3EABA 5F5WA 4FI5A 3F2EA 5JDMA 1T72A 4IGUA 3O9XA 2VWAA 3RYCE 2XAQB 3AEFA 1J1JA 5H6RB 1MNDA 3PU8A 2VKHA 4ZXLA 2H7VC 4ADZA 2D9DA 3ZN1B 2I59A 4LMKA 1KFYA 3ZMSB 4TV9E 3AVRA 5BR8T 3D0TA 3MK7C 4H9PC 4M1PA 3U3IA 4OHFA 4EIWA 4YTMA 2LE8A 3KV4A 1YKEB 3UQ7A 2E9XA 3HKEE 1NWMX 2XQ3A 3RYFE 2WWUA 3AEBA 3AEAA 2LRLA 2V7KA 4HGAA 4WBOA 2UXNB 5F3JA 4I55E 2X9YA 1LVFA 3Q5EA 1XNQT 4Z8XA 5HEJA 2BG9A 4P0AA 4U2ZA 3T1HT 1G8XA 1YW0A 2XQ6A 1NENA 4QH1A 1HS7A 3QNUA 5HEHA 3I9WA 1XMOT 4U2YA 4ASKA 2UU9T 3P4WA 1Z0PA 4LFBT 3RC3A 2UXBT 2UXXB 3NVOA 3N9NA 1M7KA 5AQUB 5CJ5A 3O4XE 2RP4A 3ZSTA 2RPAA 3CQCB 2LSGA 3Q5XA 5LBQB 2BBJA 3L39A 2ZM2A 1VCTA 3P4QA 5LJNA 3TLTA 3RPUA 2J1DG 3ZMTB 3FXEB 3HA4A 3OYZA 1IBLT 1KF6A 5AQQB 3ZPOA 2LKHA 3C4XA 2NWBA 4E7SA 3HI2A 3MZKB 4K0UA 3ZJ1A 5JVDE 4TN7B 4OK0A 2WBLA 5AQOB 2X68A 2ODUA 4EYUA 3T8OA 5AFUL 3FXDB 4DMWA 3I9YA 4TNVA 1MIYA 2WP9A 2KSRA 2IHR1 3I1AA 2XQ7A 1MMDA 2W4XA 2WAUA 3PUQA 1BR1A 4NPPA 2UUCT 3O1HA 3UUXB 3RGLA 4L0RA 4X1KE 1OEDC 2EHOD 1UUSA 2X9WA 4IIJE 4XAXB 2V7JA 2KZ7B 2OLTA 2ZLYA 2D5UA 2FJAA 4AQYT 4DO0A 4ILBA 2YOEA 3MXZA 3JC6C 4CN4A 2CLYB 1U4QA 4KMCA 5HXRA 3PU3A 1JNRA 3R6NA 2WMNA 3QOFA 4DR3T 4JI1T 4TV8E 2VK9A 4QX7B 4XBFB 2FBWA 3AXJB 3RYHE 2X67A 3PJAJ 4K0KT 3RIUC 4OX9T 3UQ4A 2X0YA 2FUPA 5AQHB 4H63H 2CXDA 2K9AA 2XQ4A 4O2BE 4BAYB 5LP6E 3UU4A 2D2SA 5JDGA 2B76A 2UUBT 4DR6T 2XUEA 4WBNE 4ZEYA 1CUNA 3RH3A 4U7IA 3WAKA 3RQWA 4PW8A 4AKIA 4IT4A 2N9DA 2LSJA 5HAXA 2LKGA 5HCMA 3KINB 2Y8DA 2DCFA 2YDQA 3UULA 4LF5T 2XSAA 4YHHT 1W09A 3AXJA 3JC6D 1N33T 2NW7A 5ABHA 1HNWT 1S94A 4JI7T 3C64A 4CQIA 3PDYA 2NOXA 4UR9A 3P4PA 3ZT7A 1US7B 5AQKB 5C2TA 5J2UE 2L3LA 2CMRA 3P50A 2A72A 3E0ZA 1E2AA 3V5UA 4AKGA 5LGNB 4JBWF 2LM2A 5KMGP 3QC9A 2V7LA 1BR0A 4PFOA 1HNZT 2BKPA 2J4GA 5LJMA 4HWFA 5FL0A 4EEDA 3VR8A 4YJ2E 4I50E 4ZI2C 2NW9A 4H9NC 1MIWA 1HCIA 2W2UA 2XJ7A 3E22E 2LEHA 2YU1A 3RKOA 3B5MA 2QRXA 4JI4T 2WZIA 1U5PA 3ZMUB 3ZLIA 3OVUA 5C8YE 4PJMA 2K48A 2E5VA 2A9UA 3UFGA 5FY0A 1N36T 2VL8A 2W0GA 2MPKA 1J5ET 1JNZA 4X65T 2XHEB 2PFVA 1WLXA 4J2CA 5EK4A 3NKZA 4QWNB 4CXYA 3JCFA 4HFVA 4CZZB 2WZHA 1D1BA 2YU2A 3ZCJA 3EAMA 2I6HA 3SRZA 2ES0A 2AXDS 3FBZA 3T1YT 2A2FX 2V7MA 2QYWA 5LOVE 5A1LA 4A98A 2J62A 4TZ4C 3CIRA 4U7YA 4LMLA 4P1NA 3SFDA 4ZOLE 2XAJB 3KV6A 1DU2A 5FNVE 4MLKA 4PK5A 4TWFA 5JDQA 4YFSA 2V5CA 2ACZA 2LOSA 4ZI2D 3CK6A 4PK4A 3ETVA 4Z90A 4O4HE 2VVSA 3N2GE 5CB4E 3KBUA 3JAEA 5KXJA 5FXXA 3P8CD 2IMLA 1BR2A 2CBJA 4IL4A 2JRKA 3M65A 4HN9A 3JADA 2HN2A 3AA6B 3EUHA 1MNEA 2P9BA 4DVDA 2MAWA 4DV1T 3ZYKA 5DQWA 2BBHA 3CX6B 2LRKA 1LKXA 2WCAA 4DV3T 2XQ8A 1T8BA 5LGUB 2KXPB 1UX4A 2WSSV 2N1GA 4MHCA 2V6YB 3IEEA 4HFEA 4DV2T 3AAEB 4YTNA 2XAHB 4V1Av 1IJ5A 5L4HA 2V1DB 4G63A 1XWMA 1OEDB 4P09A 5LG4A 2CE7A 4JEHB 5IHYA 4E7ZA 3AEDA 5FXVA 2LOPA 3E08A 4BJNA 3AEGA 1EZ3A 3EI0A 1WRDA 5LBMA 5HXCA 2BDEA 5HEOA 2ACXA 3ZSSA 4HFDA 3NRYA 2K24A 3PTRB 5EZYE 4DIDB 3M3ZB 3ABVA 4ZI3D 4KBMB 4KUMB 4N78D 4OFZA 2CRBA 2KT9A 5ETWA 4HWIB 4YSXA 1G73A 1NEKA 3A7MA 3B13A 2V6YA 5F8PA 4HFBA 2XAGB 4UVBB 1UK5A 2JPFA 1UGOA 3AE7A 1KK7A 3AE9A 3NWIA 4DR1T 1OEDA 3VKHA 2MBGA 1FIOA 2CXLA 4IDQA 2XPKA 3Q9DA 5CA1E 2IIUA 3AA0B 4PJNA 4JI2T 3AE2A 4NUVA 2CPTA 1D1CA 3N5LA 4TUYE 4ANJA 1LVKA 2YDSA 3BQLA 4EYYR 1YQ3A 2XAFB 5AQTB 3CPZA 4O4JE 3PUWF 1WYCA 4TX5A 2M6IA 2Y6XA 1QSDA 3P4RA 4X66T 2LM9A 3TLSA 2NP9A 4O4LE 3VKGA 4WW0A 3F31A 1HTJF 4HFCA 3RIUA 2CEAA 4YHJA 1YD8G 4X64T 3W15B 2YN6A 2HH7A 5FVKA 4UVCB 4Z91A 5LNKA 5L3GB 5KX5E 4H9OC 2EHOC 2JMHA 3TLVA 2YK0A 4IE7A 4HE8A 2CHNA 2DWKA 1WCRA 3QUJA 3C98B 2X51A 1Z8UA 2JQQA 2DI4A 3JAFA 2XSBA 3MA9A 4NXMT 3Q2MA 4IL9A 5LA6E 3RF1A 1L0VA 2VKDA 1ZKEA 3UFEA 4I0UA 4AQFC 2ZM0A 3AE6A 2PTFA 4AISA 4YY3T 3RRCA 3PJAA 4ILCA 2K5BB 2WDQA 3FZHB 2PBIA 4IDNA 3B57A 4IE6A 3H3MA 2KLQA 2IC6A 5JDHA 3QB5A 2MOZA 1GQEA 2NTYA 5IUXA 4AKHA 3C4WA 3TLUA 3IBPA 3EDVA 2FJBA 2BVMA 2WY2A 3DTOA 3AECA 4QX8B 3PUXF 5IYZE 5H6QB 1UURA 4X1YE 5LGTB 3HKCE 2BG9E 2NW8A 3KFWX 4EEBA 1ZEEA 2W67A 3VRBA 3ZC0A 3KV5A 5AQNB 4WNKA 5L3DB 5FXZA 4DUZT 4X1IE 4B3RT 2QA7A 2WS3A 3GWHA 4KP3C 3KV9A 4COFA 2VVNA 1QLBA 3N2KE 3FZKB 3O1IA 1VCSA 4DV6T 1WR0A 2CWYA 4PFPA 2BS4A 2WDVA 3X1DA 2J47A 1Y64B 3PUYF 3PE0A 3ZT5A 3AAIA 1FMVA 3FBLA 3HL6A 2BKOA 5AQFB 4LF8T 2W66A 2L8KA 2QGSA 4AXPA 2XM1A 1OWAA 3OPCA 4O4IE 2BS3A 4UV9B 4GKJT 2V26A 3FZMB 5JR9C 4U74A 4LFAT 3F57A 3LFMA 3N9LA 2X0HA 4B3TT 3PUAA 3N2OA 5JDFA 3L8RA 2E9XD 3ESLA 3CKDA 1WR6A 4YJ3E 4PAGA 1VRBA 5BMVE 1QUUA 5HWYA 4JUYA 2KMFA 4QH5A 2LHNA 3FB2A 4H9QC 3K3QC 3GN5B 2H3RA 3AE4A 3AA7B 2WQYA 3ZCIA 3ZMVB 1YQ4A 4ERRA 1WFDA 2NR4A 2UXDT 4IDPA 4DMVA 4F6RC 2V8SV 1SHZC 2H89A 4AQGA 5JREA 4UV8B 1FEWA 2BKNA 5AQRB 3RI5A 2CHOA 4DV4T 2UUAT 3AE8A 4TWHA 3N9OA 1WYBA 4CN1A 1N32T 2CXFA 4DR4T 3AVSA 1KNZA 4CXXA 4H63V 3ZEFB 2CCQA 2W61A 5FXWA 1MMAA 3UTKA 3GA8A 4HTEA 3GN5A 1Y01A 4MFRA 2MYSA 5FMNA 3OTOT 5FVLA 3NBXX 5LHIB 5LYJE 3BQIA 2ZM8A 5ABFB 4NUUA 3WI3A 3EHZA 3FZLB 5AQLB 3ZYMA 3RIAA 4DBQA 3SFEA 1AJ3A 2EHOB 1XMQT 5FYMA 5AQJB 3TKLB 5JQGE 3PUGA 2OA5A 2DHRA 3H37A 2D0TA 4B3ST 4IE5A 4LF4T 4QH4A 3PURA 5LCYA 1KNPA 2MTQA 3AE3A 2Q9QC 3MACA 3C51A 5LG3A 2X0LB 3L3PA 3U78A 3HKBE 1SA0E 3R84B 2IDOB 4ZI3C 3LK42 4GIWA 3UU3A 3IF8B 2BZBA 4NIQA 2BVLA 2E8IA 3AE5A 1SUMB 5ABFA 1N34T 5J2TE 2VL0A 5FP3A 2VB6A 4UIGA 3MJXA 3HR0A 5DABA 3NRXA 2EHOA 1H7CA 2XM2A 3UU5A 3Q5DA 4UVAB 5ABGA 3FHNA 1J5WA 4JI8T 4C91A 5AQSB 1KNRA 4X20E 4UELA 3ZN0B 4YTPA 2JQ9A 3K8PC 3CQGB 2XZEA 4GOUA 5EK3A 2KNDA 5TAOA 4AQFA 4DNDA 4JV5T 4UF0B 3UUBA 5LMNT 4LMJA 2F4VT 4DR5T 4KHZF 2VQET 3OKQA 3ZC1A 1I6ZA 2Q9QD 5JH7E 3PUZF 3G06A 4DBRA 2CBIA 4PK6A 4L9IA 4EOZB 2LSYA 2X9XA 2DNXA 2V6XA 5LB7B 2D0UA 2W63A 3CX8B 3TLWA 2ZM6T 2IAKA 4JEUB 5FY1A 4ZS2A 2C5IT 3ZT6A 4IDOA 4ZZCA 5DQVA 1ZHCA 3VR9A 4HWHA 3KBTA 1O3XA 3LK3B 4HFIA 4QHOA 4YLHA 3DJBA 2W62A 3PV0F 4U31A 2WM9A 4ISSA 2XQ9A 5L3CB 5CGMA 2GK9A 3LG7A 3CVRA 1SE7A 1OXZA 3VU7H 4UF0A 4A97A 1HG5A 4WZXA 5JR9B 4H9SE 2ODVA 3IA3A 1VOMA 4LF9T 3CQXC 5LHHB 1MIVA 4PJLA 1YKHB 2UXCT 4GYSA 5KDMC 2ZMAA 1W9RA 4ZZBA 3RKGA 1LRZA 3C50A 1ZOYA 4GK0E 2VKJA 2HHHT 4AKRB 4DV5T 5HEUA 1D0ZA 2R6GF 3BQKA 2JIWA 2IC9A 2LLYA 2WDRA 1D1AA 3LBXB 4YSYA 4PJJA 3RHWA 3LDQB 3K3OA 4MBQA 4OYJA 4PNIA 4IDZA 2B1EA 3KDSE 4LF6T 5JR9A 1X9BA 5L4EA 4IE0A 1XDPA 2WMOA 2RA1A 3AB3B 2JQHA 2AE9A 3RRWA 3P7IA 1XZYA 1D0XA 3UUMA 4ZHQE 4X5TA 4UEMA 4I4TE 5FKYA 4EXTA 2XQYA 4EB6E 1W0AA 4HEAA 1B7TA 3NZQA 2WB5A 4EAHA 3ANWB 4JI0T 3ZYLA 3K3NA 4Q25A 5HCJA 4BJMA 5AQIB 2DLRA 3LBXA 3UU8A 1HF8A 4HFHA 4P0BA 3K1SA 2XTLA 2W00A 5HXHA 3AEEA 2JMKA 2CA5A 3UU6A 2A3DA 4JLEA 2CM0A 1CHUA 5JDNA 1OEDE 5L47A 1HX8A 3RX6A 1FJGT 3N9PA 1R8IA 3HKDE 4DR2T 3UT5E 5AQPB 2HPLA 2C0SA 3FZFB 1E1HB 2KWIB 1HG2A 5J1GA 1D0YA 3C4ZA 4O2AE 2E9XC 3AE1A 2OV9A 4H9RC 2VASA 2H88A 3RC8A 4AI6A 4U72A 1HR0T 5E0OA 2XY8B 5IWAT 4ILUA 3ANWA 2XQAA 2G0UA 5DJQC 3ETUA 4FJOA 3ZJ2A 4ILAA 2BG9C 3KVBA 1T98A 4DV7T 2XASB 2WU5A 2HN1A 5AQGB 2Q9QB 3BK9A 4EZHA 3VRAA 1HNXT 2LHRA 2E5LT 5AQVB 4TWDA 1FMWA 2YDRA 3CMLA 4CI2B 2L9QA 4O8SA 5LMUT 3RYIE 4MALA 5LHGB 4KX6A 2VQFT 1IJ6A 2XQ5A 1IBKT 5JRCB 1V9DA 2IW5B 3QK6A 4EZ4A 1MMGA 4CI3B 3GMIA 2N2NA 3UUNA 4X62T 4JI5T 2C5JA 4UXNB 4KI0F 4C90A 1M62A 2Q9QA 1XNRT 2DL1A 5L3FB 5L3EB 4F8HA 3ONXA 5JTGA 2V7IA 3LSVA 5HWXA 4EV6A 3RLFF 4U33A 1MMNA 3PUSA 1BR4A 2LT3A 3AA1B 3H3AA 2IUBA 4HKAA 2YEVC 3Q5WA 2Y48B 5JRCA 5HXEA
chains in the Genus database with same CATH topology
1I94T 4JI2T 4JI6T 1HNXT 4LF5T 4YHHT 2E5LT 4GKJT 4DV2T 1N33T 4DR7T 1HNWT 3T1YT 4LFAT 4JI7T 4AQYT 1N34T 4DUYT 4B3TT 4JI0T 4X66T 5LMUT 4LFCT 3OTOT 4KHPT 2VQFT 4GKKT 4LF9T 1IBLT 1IBKT 4LF7T 4X64T 4DR3T 4JI8T 4JI1T 5BR8T 4DUZT 1IBMT 4B3RT 2UXCT 4B3MT 1FJGT 4K0KT 1HNZT 2HHHT 4X62T 4DR2T 4JI5T 4OX9T 4DV5T 4JV5T 4NXNT 1XNRT 4DV6T 1XMQT 4JYAT 5LMNT 2F4VT 1XNQT 4DR5T 2VQET 3T1HT 2UXDT 4JI3T 4NXMT 2UUBT 1HR0T 4B3ST 4LF4T 4DR6T 4JI4T 5IWAT 4DV1T 4DR1T 4DV0T 4LF6T 4LF8T 1XMOT 2UU9T 4YY3T 4DV4T 2UUAT 2ZM6T 1N36T 4LFBT 2UXBT 4DV3T 4DV7T 1J5ET 4X65T 2UUCT 1N32T 4DR4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 T;  4JI2 T;  4JI6 T;  1HNX T;  4LF5 T;  4YHH T;  2E5L T;  4GKJ T;  4DV2 T;  1N33 T;  4DR7 T;  1HNW T;  3T1Y T;  4LFA T;  4JI7 T;  4AQY T;  1N34 T;  4DUY T;  4B3T T;  4JI0 T;  4X66 T;  5LMU T;  4LFC T;  3OTO T;  4KHP T;  2VQF T;  4GKK T;  4LF9 T;  1IBL T;  1IBK T;  4LF7 T;  4X64 T;  4DR3 T;  4JI8 T;  4JI1 T;  5BR8 T;  4DUZ T;  1IBM T;  4B3R T;  2UXC T;  4B3M T;  1FJG T;  4K0K T;  1HNZ T;  2HHH T;  4X62 T;  4DR2 T;  4JI5 T;  4OX9 T;  4DV5 T;  4JV5 T;  4NXN T;  1XNR T;  4DV6 T;  1XMQ T;  4JYA T;  5LMN T;  2F4V T;  1XNQ T;  4DR5 T;  2VQE T;  3T1H T;  2UXD T;  4JI3 T;  4NXM T;  2UUB T;  1HR0 T;  4B3S T;  4LF4 T;  4DR6 T;  4JI4 T;  5IWA T;  4DV1 T;  4DR1 T;  4DV0 T;  4LF6 T;  4LF8 T;  1XMO T;  2UU9 T;  4YY3 T;  4DV4 T;  2UUA T;  2ZM6 T;  1N36 T;  4LFB T;  2UXB T;  4DV3 T;  4DV7 T;  1J5E T;  4X65 T;  2UUC T;  1N32 T;  4DR4 T; 
#chains in the Genus database with same CATH topology
 2Z6E A;  4TNW A;  4BA9 A;  4GK5 E;  1ZP0 A;  4JI6 T;  1E7P A;  1XDO A;  1KEY A;  3ONJ A;  5FY7 A;  4DR7 T;  3I0Q A;  3ZMZ B;  1HX1 B;  4DUY T;  2HPJ A;  3J7Y q;  2KIN B;  4QKN A;  3J9X 1;  4CXW A;  2LSI A;  2WU2 A;  4LFC T;  4A56 A;  4KHP T;  4YXD A;  4B6X A;  4QXC B;  4GKK T;  4LF7 T;  2BS2 A;  5ADX L;  1IAP A;  1X79 A;  2WWV A;  3LK2 B;  1ZV4 X;  1UX5 A;  4WYV A;  3SS1 A;  5JDL A;  4B3M T;  4G2A A;  3EDU A;  2V5D A;  4GYR A;  2FJE A;  4U3C A;  4IHJ E;  1IZN B;  3I0O A;  1YXR A;  4HWC A;  2JJ9 A;  4JYA T;  4CN6 A;  5LXT E;  3ZKR A;  2PG8 A;  5GON E;  3O1J A;  4JI3 T;  2X66 A;  1S35 A;  4QXH B;  2KWH A;  4DV0 T;  5HEG A;  3PUV F;  2VKO A;  2YKS A;  4YT0 A;  2E2A A;  1HFA A;  3S4U A;  4AIU A;  4HWD A;  2CWO A;  2QVA A;  3AAA B;  1W0B A;  5J0Z A;  5L2L A;  2CLY C;  3RIF A;  3CWZ B;  4EGW A;  3EVY A;  4ZS3 A;  3P4S A;  3RQU A;  3KVA A;  3OJA A;  2H7O A;  2YIN A;  2LSK A;  2C5K T;  3CX7 B;  2M67 A;  2JQK A;  4ZI7 E;  4A5X A;  3WAJ A;  3ONL C;  5EK2 A;  2VUR A;  3NZP A;  4CI1 B;  5FL1 A;  3A5X A;  3SOL A;  5L3B B;  1T7S A;  3MKD A;  3A8Y C;  3DP7 A;  4I43 B;  4IRE A;  2M6B A;  1IBM T;  1NAF A;  5C3J A;  2NTX A;  3N9M A;  4IST A;  5AQM B;  4NXN T;  4L5G A;  3N9Q A;  3V5S A;  3OYX A;  3LJC A;  4QXB B;  3SWH A;  4AKL A;  2SPC A;  5ABE A;  4IE4 A;  5CA0 E;  4XZC A;  5CFB A;  3OBV E;  5M4Y A;  1UCU A;  2E9X B;  3QB5 K;  3L09 A;  4OYK A;  2PJQ A;  2I0M A;  4YSZ A;  3IHR A;  1I94 T;  2DWG A;  5HYA A;  2X9H A;  2K3W A;  3VHL A;  2FJD A;  5HXS A;  2BG9 B;  2LJL A;  3EAB A;  5F5W A;  4FI5 A;  3F2E A;  5JDM A;  1T72 A;  4IGU A;  3O9X A;  2VWA A;  3RYC E;  2XAQ B;  3AEF A;  1J1J A;  5H6R B;  1MND A;  3PU8 A;  2VKH A;  4ZXL A;  2H7V C;  4ADZ A;  2D9D A;  3ZN1 B;  2I59 A;  4LMK A;  1KFY A;  3ZMS B;  4TV9 E;  3AVR A;  5BR8 T;  3D0T A;  3MK7 C;  4H9P C;  4M1P A;  3U3I A;  4OHF A;  4EIW A;  4YTM A;  2LE8 A;  3KV4 A;  1YKE B;  3UQ7 A;  2E9X A;  3HKE E;  1NWM X;  2XQ3 A;  3RYF E;  2WWU A;  3AEB A;  3AEA A;  2LRL A;  2V7K A;  4HGA A;  4WBO A;  2UXN B;  5F3J A;  4I55 E;  2X9Y A;  1LVF A;  3Q5E A;  1XNQ T;  4Z8X A;  5HEJ A;  2BG9 A;  4P0A A;  4U2Z A;  3T1H T;  1G8X A;  1YW0 A;  2XQ6 A;  1NEN A;  4QH1 A;  1HS7 A;  3QNU A;  5HEH A;  3I9W A;  1XMO T;  4U2Y A;  4ASK A;  2UU9 T;  3P4W A;  1Z0P A;  4LFB T;  3RC3 A;  2UXB T;  2UXX B;  3NVO A;  3N9N A;  1M7K A;  5AQU B;  5CJ5 A;  3O4X E;  2RP4 A;  3ZST A;  2RPA A;  3CQC B;  2LSG A;  3Q5X A;  5LBQ B;  2BBJ A;  3L39 A;  2ZM2 A;  1VCT A;  3P4Q A;  5LJN A;  3TLT A;  3RPU A;  2J1D G;  3ZMT B;  3FXE B;  3HA4 A;  3OYZ A;  1IBL T;  1KF6 A;  5AQQ B;  3ZPO A;  2LKH A;  3C4X A;  2NWB A;  4E7S A;  3HI2 A;  3MZK B;  4K0U A;  3ZJ1 A;  5JVD E;  4TN7 B;  4OK0 A;  2WBL A;  5AQO B;  2X68 A;  2ODU A;  4EYU A;  3T8O A;  5AFU L;  3FXD B;  4DMW A;  3I9Y A;  4TNV A;  1MIY A;  2WP9 A;  2KSR A;  2IHR 1;  3I1A A;  2XQ7 A;  1MMD A;  2W4X A;  2WAU A;  3PUQ A;  1BR1 A;  4NPP A;  2UUC T;  3O1H A;  3UUX B;  3RGL A;  4L0R A;  4X1K E;  1OED C;  2EHO D;  1UUS A;  2X9W A;  4IIJ E;  4XAX B;  2V7J A;  2KZ7 B;  2OLT A;  2ZLY A;  2D5U A;  2FJA A;  4AQY T;  4DO0 A;  4ILB A;  2YOE A;  3MXZ A;  3JC6 C;  4CN4 A;  2CLY B;  1U4Q A;  4KMC A;  5HXR A;  3PU3 A;  1JNR A;  3R6N A;  2WMN A;  3QOF A;  4DR3 T;  4JI1 T;  4TV8 E;  2VK9 A;  4QX7 B;  4XBF B;  2FBW A;  3AXJ B;  3RYH E;  2X67 A;  3PJA J;  4K0K T;  3RIU C;  4OX9 T;  3UQ4 A;  2X0Y A;  2FUP A;  5AQH B;  4H63 H;  2CXD A;  2K9A A;  2XQ4 A;  4O2B E;  4BAY B;  5LP6 E;  3UU4 A;  2D2S A;  5JDG A;  2B76 A;  2UUB T;  4DR6 T;  2XUE A;  4WBN E;  4ZEY A;  1CUN A;  3RH3 A;  4U7I A;  3WAK A;  3RQW A;  4PW8 A;  4AKI A;  4IT4 A;  2N9D A;  2LSJ A;  5HAX A;  2LKG A;  5HCM A;  3KIN B;  2Y8D A;  2DCF A;  2YDQ A;  3UUL A;  4LF5 T;  2XSA A;  4YHH T;  1W09 A;  3AXJ A;  3JC6 D;  1N33 T;  2NW7 A;  5ABH A;  1HNW T;  1S94 A;  4JI7 T;  3C64 A;  4CQI A;  3PDY A;  2NOX A;  4UR9 A;  3P4P A;  3ZT7 A;  1US7 B;  5AQK B;  5C2T A;  5J2U E;  2L3L A;  2CMR A;  3P50 A;  2A72 A;  3E0Z A;  1E2A A;  3V5U A;  4AKG A;  5LGN B;  4JBW F;  2LM2 A;  5KMG P;  3QC9 A;  2V7L A;  1BR0 A;  4PFO A;  1HNZ T;  2BKP A;  2J4G A;  5LJM A;  4HWF A;  5FL0 A;  4EED A;  3VR8 A;  4YJ2 E;  4I50 E;  4ZI2 C;  2NW9 A;  4H9N C;  1MIW A;  1HCI A;  2W2U A;  2XJ7 A;  3E22 E;  2LEH A;  2YU1 A;  3RKO A;  3B5M A;  2QRX A;  4JI4 T;  2WZI A;  1U5P A;  3ZMU B;  3ZLI A;  3OVU A;  5C8Y E;  4PJM A;  2K48 A;  2E5V A;  2A9U A;  3UFG A;  5FY0 A;  1N36 T;  2VL8 A;  2W0G A;  2MPK A;  1J5E T;  1JNZ A;  4X65 T;  2XHE B;  2PFV A;  1WLX A;  4J2C A;  5EK4 A;  3NKZ A;  4QWN B;  4CXY A;  3JCF A;  4HFV A;  4CZZ B;  2WZH A;  1D1B A;  2YU2 A;  3ZCJ A;  3EAM A;  2I6H A;  3SRZ A;  2ES0 A;  2AXD S;  3FBZ A;  3T1Y T;  2A2F X;  2V7M A;  2QYW A;  5LOV E;  5A1L A;  4A98 A;  2J62 A;  4TZ4 C;  3CIR A;  4U7Y A;  4LML A;  4P1N A;  3SFD A;  4ZOL E;  2XAJ B;  3KV6 A;  1DU2 A;  5FNV E;  4MLK A;  4PK5 A;  4TWF A;  5JDQ A;  4YFS A;  2V5C A;  2ACZ A;  2LOS A;  4ZI2 D;  3CK6 A;  4PK4 A;  3ETV A;  4Z90 A;  4O4H E;  2VVS A;  3N2G E;  5CB4 E;  3KBU A;  3JAE A;  5KXJ A;  5FXX A;  3P8C D;  2IML A;  1BR2 A;  2CBJ A;  4IL4 A;  2JRK A;  3M65 A;  4HN9 A;  3JAD A;  2HN2 A;  3AA6 B;  3EUH A;  1MNE A;  2P9B A;  4DVD A;  2MAW A;  4DV1 T;  3ZYK A;  5DQW A;  2BBH A;  3CX6 B;  2LRK A;  1LKX A;  2WCA A;  4DV3 T;  2XQ8 A;  1T8B A;  5LGU B;  2KXP B;  1UX4 A;  2WSS V;  2N1G A;  4MHC A;  2V6Y B;  3IEE A;  4HFE A;  4DV2 T;  3AAE B;  4YTN A;  2XAH B;  4V1A v;  1IJ5 A;  5L4H A;  2V1D B;  4G63 A;  1XWM A;  1OED B;  4P09 A;  5LG4 A;  2CE7 A;  4JEH B;  5IHY A;  4E7Z A;  3AED A;  5FXV A;  2LOP A;  3E08 A;  4BJN A;  3AEG A;  1EZ3 A;  3EI0 A;  1WRD A;  5LBM A;  5HXC A;  2BDE A;  5HEO A;  2ACX A;  3ZSS A;  4HFD A;  3NRY A;  2K24 A;  3PTR B;  5EZY E;  4DID B;  3M3Z B;  3ABV A;  4ZI3 D;  4KBM B;  4KUM B;  4N78 D;  4OFZ A;  2CRB A;  2KT9 A;  5ETW A;  4HWI B;  4YSX A;  1G73 A;  1NEK A;  3A7M A;  3B13 A;  2V6Y A;  5F8P A;  4HFB A;  2XAG B;  4UVB B;  1UK5 A;  2JPF A;  1UGO A;  3AE7 A;  1KK7 A;  3AE9 A;  3NWI A;  4DR1 T;  1OED A;  3VKH A;  2MBG A;  1FIO A;  2CXL A;  4IDQ A;  2XPK A;  3Q9D A;  5CA1 E;  2IIU A;  3AA0 B;  4PJN A;  4JI2 T;  3AE2 A;  4NUV A;  2CPT A;  1D1C A;  3N5L A;  4TUY E;  4ANJ A;  1LVK A;  2YDS A;  3BQL A;  4EYY R;  1YQ3 A;  2XAF B;  5AQT B;  3CPZ A;  4O4J E;  3PUW F;  1WYC A;  4TX5 A;  2M6I A;  2Y6X A;  1QSD A;  3P4R A;  4X66 T;  2LM9 A;  3TLS A;  2NP9 A;  4O4L E;  3VKG A;  4WW0 A;  3F31 A;  1HTJ F;  4HFC A;  3RIU A;  2CEA A;  4YHJ A;  1YD8 G;  4X64 T;  3W15 B;  2YN6 A;  2HH7 A;  5FVK A;  4UVC B;  4Z91 A;  5LNK A;  5L3G B;  5KX5 E;  4H9O C;  2EHO C;  2JMH A;  3TLV A;  2YK0 A;  4IE7 A;  4HE8 A;  2CHN A;  2DWK A;  1WCR A;  3QUJ A;  3C98 B;  2X51 A;  1Z8U A;  2JQQ A;  2DI4 A;  3JAF A;  2XSB A;  3MA9 A;  4NXM T;  3Q2M A;  4IL9 A;  5LA6 E;  3RF1 A;  1L0V A;  2VKD A;  1ZKE A;  3UFE A;  4I0U A;  4AQF C;  2ZM0 A;  3AE6 A;  2PTF A;  4AIS A;  4YY3 T;  3RRC A;  3PJA A;  4ILC A;  2K5B B;  2WDQ A;  3FZH B;  2PBI A;  4IDN A;  3B57 A;  4IE6 A;  3H3M A;  2KLQ A;  2IC6 A;  5JDH A;  3QB5 A;  2MOZ A;  1GQE A;  2NTY A;  5IUX A;  4AKH A;  3C4W A;  3TLU A;  3IBP A;  3EDV A;  2FJB A;  2BVM A;  2WY2 A;  3DTO A;  3AEC A;  4QX8 B;  3PUX F;  5IYZ E;  5H6Q B;  1UUR A;  4X1Y E;  5LGT B;  3HKC E;  2BG9 E;  2NW8 A;  3KFW X;  4EEB A;  1ZEE A;  2W67 A;  3VRB A;  3ZC0 A;  3KV5 A;  5AQN B;  4WNK A;  5L3D B;  5FXZ A;  4DUZ T;  4X1I E;  4B3R T;  2QA7 A;  2WS3 A;  3GWH A;  4KP3 C;  3KV9 A;  4COF A;  2VVN A;  1QLB A;  3N2K E;  3FZK B;  3O1I A;  1VCS A;  4DV6 T;  1WR0 A;  2CWY A;  4PFP A;  2BS4 A;  2WDV A;  3X1D A;  2J47 A;  1Y64 B;  3PUY F;  3PE0 A;  3ZT5 A;  3AAI A;  1FMV A;  3FBL A;  3HL6 A;  2BKO A;  5AQF B;  4LF8 T;  2W66 A;  2L8K A;  2QGS A;  4AXP A;  2XM1 A;  1OWA A;  3OPC A;  4O4I E;  2BS3 A;  4UV9 B;  4GKJ T;  2V26 A;  3FZM B;  5JR9 C;  4U74 A;  4LFA T;  3F57 A;  3LFM A;  3N9L A;  2X0H A;  4B3T T;  3PUA A;  3N2O A;  5JDF A;  3L8R A;  2E9X D;  3ESL A;  3CKD A;  1WR6 A;  4YJ3 E;  4PAG A;  1VRB A;  5BMV E;  1QUU A;  5HWY A;  4JUY A;  2KMF A;  4QH5 A;  2LHN A;  3FB2 A;  4H9Q C;  3K3Q C;  3GN5 B;  2H3R A;  3AE4 A;  3AA7 B;  2WQY A;  3ZCI A;  3ZMV B;  1YQ4 A;  4ERR A;  1WFD A;  2NR4 A;  2UXD T;  4IDP A;  4DMV A;  4F6R C;  2V8S V;  1SHZ C;  2H89 A;  4AQG A;  5JRE A;  4UV8 B;  1FEW A;  2BKN A;  5AQR B;  3RI5 A;  2CHO A;  4DV4 T;  2UUA T;  3AE8 A;  4TWH A;  3N9O A;  1WYB A;  4CN1 A;  1N32 T;  2CXF A;  4DR4 T;  3AVS A;  1KNZ A;  4CXX A;  4H63 V;  3ZEF B;  2CCQ A;  2W61 A;  5FXW A;  1MMA A;  3UTK A;  3GA8 A;  4HTE A;  3GN5 A;  1Y01 A;  4MFR A;  2MYS A;  5FMN A;  3OTO T;  5FVL A;  3NBX X;  5LHI B;  5LYJ E;  3BQI A;  2ZM8 A;  5ABF B;  4NUU A;  3WI3 A;  3EHZ A;  3FZL B;  5AQL B;  3ZYM A;  3RIA A;  4DBQ A;  3SFE A;  1AJ3 A;  2EHO B;  1XMQ T;  5FYM A;  5AQJ B;  3TKL B;  5JQG E;  3PUG A;  2OA5 A;  2DHR A;  3H37 A;  2D0T A;  4B3S T;  4IE5 A;  4LF4 T;  4QH4 A;  3PUR A;  5LCY A;  1KNP A;  2MTQ A;  3AE3 A;  2Q9Q C;  3MAC A;  3C51 A;  5LG3 A;  2X0L B;  3L3P A;  3U78 A;  3HKB E;  1SA0 E;  3R84 B;  2IDO B;  4ZI3 C;  3LK4 2;  4GIW A;  3UU3 A;  3IF8 B;  2BZB A;  4NIQ A;  2BVL A;  2E8I A;  3AE5 A;  1SUM B;  5ABF A;  1N34 T;  5J2T E;  2VL0 A;  5FP3 A;  2VB6 A;  4UIG A;  3MJX A;  3HR0 A;  5DAB A;  3NRX A;  2EHO A;  1H7C A;  2XM2 A;  3UU5 A;  3Q5D A;  4UVA B;  5ABG A;  3FHN A;  1J5W A;  4JI8 T;  4C91 A;  5AQS B;  1KNR A;  4X20 E;  4UEL A;  3ZN0 B;  4YTP A;  2JQ9 A;  3K8P C;  3CQG B;  2XZE A;  4GOU A;  5EK3 A;  2KND A;  5TAO A;  4AQF A;  4DND A;  4JV5 T;  4UF0 B;  3UUB A;  5LMN T;  4LMJ A;  2F4V T;  4DR5 T;  4KHZ F;  2VQE T;  3OKQ A;  3ZC1 A;  1I6Z A;  2Q9Q D;  5JH7 E;  3PUZ F;  3G06 A;  4DBR A;  2CBI A;  4PK6 A;  4L9I A;  4EOZ B;  2LSY A;  2X9X A;  2DNX A;  2V6X A;  5LB7 B;  2D0U A;  2W63 A;  3CX8 B;  3TLW A;  2ZM6 T;  2IAK A;  4JEU B;  5FY1 A;  4ZS2 A;  2C5I T;  3ZT6 A;  4IDO A;  4ZZC A;  5DQV A;  1ZHC A;  3VR9 A;  4HWH A;  3KBT A;  1O3X A;  3LK3 B;  4HFI A;  4QHO A;  4YLH A;  3DJB A;  2W62 A;  3PV0 F;  4U31 A;  2WM9 A;  4ISS A;  2XQ9 A;  5L3C B;  5CGM A;  2GK9 A;  3LG7 A;  3CVR A;  1SE7 A;  1OXZ A;  3VU7 H;  4UF0 A;  4A97 A;  1HG5 A;  4WZX A;  5JR9 B;  4H9S E;  2ODV A;  3IA3 A;  1VOM A;  4LF9 T;  3CQX C;  5LHH B;  1MIV A;  4PJL A;  1YKH B;  2UXC T;  4GYS A;  5KDM C;  2ZMA A;  1W9R A;  4ZZB A;  3RKG A;  1LRZ A;  3C50 A;  1ZOY A;  4GK0 E;  2VKJ A;  2HHH T;  4AKR B;  4DV5 T;  5HEU A;  1D0Z A;  2R6G F;  3BQK A;  2JIW A;  2IC9 A;  2LLY A;  2WDR A;  1D1A A;  3LBX B;  4YSY A;  4PJJ A;  3RHW A;  3LDQ B;  3K3O A;  4MBQ A;  4OYJ A;  4PNI A;  4IDZ A;  2B1E A;  3KDS E;  4LF6 T;  5JR9 A;  1X9B A;  5L4E A;  4IE0 A;  1XDP A;  2WMO A;  2RA1 A;  3AB3 B;  2JQH A;  2AE9 A;  3RRW A;  3P7I A;  1XZY A;  1D0X A;  3UUM A;  4ZHQ E;  4X5T A;  4UEM A;  4I4T E;  5FKY A;  4EXT A;  2XQY A;  4EB6 E;  1W0A A;  4HEA A;  1B7T A;  3NZQ A;  2WB5 A;  4EAH A;  3ANW B;  4JI0 T;  3ZYL A;  3K3N A;  4Q25 A;  5HCJ A;  4BJM A;  5AQI B;  2DLR A;  3LBX A;  3UU8 A;  1HF8 A;  4HFH A;  4P0B A;  3K1S A;  2XTL A;  2W00 A;  5HXH A;  3AEE A;  2JMK A;  2CA5 A;  3UU6 A;  2A3D A;  4JLE A;  2CM0 A;  1CHU A;  5JDN A;  1OED E;  5L47 A;  1HX8 A;  3RX6 A;  1FJG T;  3N9P A;  1R8I A;  3HKD E;  4DR2 T;  3UT5 E;  5AQP B;  2HPL A;  2C0S A;  3FZF B;  1E1H B;  2KWI B;  1HG2 A;  5J1G A;  1D0Y A;  3C4Z A;  4O2A E;  2E9X C;  3AE1 A;  2OV9 A;  4H9R C;  2VAS A;  2H88 A;  3RC8 A;  4AI6 A;  4U72 A;  1HR0 T;  5E0O A;  2XY8 B;  5IWA T;  4ILU A;  3ANW A;  2XQA A;  2G0U A;  5DJQ C;  3ETU A;  4FJO A;  3ZJ2 A;  4ILA A;  2BG9 C;  3KVB A;  1T98 A;  4DV7 T;  2XAS B;  2WU5 A;  2HN1 A;  5AQG B;  2Q9Q B;  3BK9 A;  4EZH A;  3VRA A;  1HNX T;  2LHR A;  2E5L T;  5AQV B;  4TWD A;  1FMW A;  2YDR A;  3CML A;  4CI2 B;  2L9Q A;  4O8S A;  5LMU T;  3RYI E;  4MAL A;  5LHG B;  4KX6 A;  2VQF T;  1IJ6 A;  2XQ5 A;  1IBK T;  5JRC B;  1V9D A;  2IW5 B;  3QK6 A;  4EZ4 A;  1MMG A;  4CI3 B;  3GMI A;  2N2N A;  3UUN A;  4X62 T;  4JI5 T;  2C5J A;  4UXN B;  4KI0 F;  4C90 A;  1M62 A;  2Q9Q A;  1XNR T;  2DL1 A;  5L3F B;  5L3E B;  4F8H A;  3ONX A;  5JTG A;  2V7I A;  3LSV A;  5HWX A;  4EV6 A;  3RLF F;  4U33 A;  1MMN A;  3PUS A;  1BR4 A;  2LT3 A;  3AA1 B;  3H3A A;  2IUB A;  4HKA A;  2YEV C;  3Q5W A;  2Y48 B;  5JRC A;  5HXE A; 
#chains in the Genus database with same CATH homology
 1I94 T;  4JI2 T;  4JI6 T;  1HNX T;  4LF5 T;  4YHH T;  2E5L T;  4GKJ T;  4DV2 T;  1N33 T;  4DR7 T;  1HNW T;  3T1Y T;  4LFA T;  4JI7 T;  4AQY T;  1N34 T;  4DUY T;  4B3T T;  4JI0 T;  4X66 T;  5LMU T;  4LFC T;  3OTO T;  4KHP T;  2VQF T;  4GKK T;  4LF9 T;  1IBL T;  1IBK T;  4LF7 T;  4X64 T;  4DR3 T;  4JI8 T;  4JI1 T;  5BR8 T;  4DUZ T;  1IBM T;  4B3R T;  2UXC T;  4B3M T;  1FJG T;  4K0K T;  1HNZ T;  2HHH T;  4X62 T;  4DR2 T;  4JI5 T;  4OX9 T;  4DV5 T;  4JV5 T;  4NXN T;  1XNR T;  4DV6 T;  1XMQ T;  4JYA T;  5LMN T;  2F4V T;  1XNQ T;  4DR5 T;  2VQE T;  3T1H T;  2UXD T;  4JI3 T;  4NXM T;  2UUB T;  1HR0 T;  4B3S T;  4LF4 T;  4DR6 T;  4JI4 T;  5IWA T;  4DV1 T;  4DR1 T;  4DV0 T;  4LF6 T;  4LF8 T;  1XMO T;  2UU9 T;  4YY3 T;  4DV4 T;  2UUA T;  2ZM6 T;  1N36 T;  4LFB T;  2UXB T;  4DV3 T;  4DV7 T;  1J5E T;  4X65 T;  2UUC T;  1N32 T;  4DR4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...