1IBKT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1ibkT00
4DUYT 4KHPT 4LF5T 4GKKT 4LFBT 4B3RT 4X65T 4LF8T 4K0KT 3T1YT 2UXCT 4DV7T 4DV5T 4LFCT 4JV5T 2HHHT 4JI1T 4DR1T 3T1HT 4LF4T 4DV6T 4JI2T 4LFAT 4JI7T 4B3ST 1HNWT 4NXMT 2ZM6T 4B3MT 4JI4T 4AQYT 4X62T 1XNQT 2UUCT 4LF9T 5IWAT 4X66T 4X64T 4YY3T 1XNRT 1J5ET 5LMNT 1HR0T 2VQFT 2VQET 1IBKT 1N33T 4DR6T 4JI6T 4JI5T 1I94T 1N36T 5LMUT 1IBLT 1XMOT 4LF7T 2UUBT 4DR7T 4OX9T 2F4VT 2UUAT 4DR2T 5BR8T 4JI3T 4JI8T 4JYAT 1N34T 4LF6T 4DV1T 1IBMT 2UU9T 4NXNT 4B3TT 4DR4T 4DV4T 4JI0T 4DV3T 1HNZT 4GKJT 4DV0T 2E5LT 4DUZT 4DR3T 3OTOT 4DR5T 1HNXT 2UXDT 1N32T 1XMQT 1FJGT 2UXBT 4DV2T 4YHHT
chains in the Genus database with same CATH superfamily
2C5JA 4CXXA 2VURA 2LKHA 4OHFA 2BG9A 4CN1A 5CA1E 4DUYT 1XDOA 2XQ9A 2XM1A 4PK4A 1LVKA 4HTEA 1Z0PA 4ZS2A 2D0TA 4KBMB 2X66A 4P0BA 1S94A 4B3RT 4QXHB 5L47A 1WCRA 3UUNA 1W0BA 5LHHB 2K9AA 5AQHB 2KLQA 3FXEB 2NTYA 3JC6C 5AQUB 3LDQB 3RH3A 5C2TA 4K0KT 3AB3B 3KVBA 2J4GA 2YU2A 3NZQA 5HAXA 3TKLB 4DV4T 5JRCA 4DV7T 4CZZB 5LHGB 5FKYA 3GN5B 3O1IA 2V7MA 4WBNE 4JV5T 2L8KA 2WWUA 3T1HT 3K1SA 3ONJA 2W2UA 1UX5A 3P50A 4WNKA 1UK5A 3FXDB 3H3AA 5FXZA 4FI5A 3L3PA 4HWHA 4UV9B 4DBRA 1M7KA 4V1Av 1BR1A 5ADXL 2CE7A 4YFSA 3AE2A 4LFAT 4IDZA 5JH7E 5FVLA 2WS3A 2NTXA 3RC3A 3AE5A 3TLTA 2QA7A 4MALA 1I6ZA 3MZKB 5LGTB 3T1YT 3PE0A 4NXMT 5LP6E 3N9QA 2VVSA 5KXJA 2OA5A 5L3DB 2PTFA 3ETVA 5HCMA 5JDGA 4JUYA 2E9XD 2NWBA 3ZMZB 2E9XB 2FJDA 3AE7A 5LGNB 2WCAA 5HEJA 3N2GE 2JRKA 4X62T 1D1CA 3ETUA 1XNQT 4CXYA 2MYSA 3HKDE 1HX1B 1OEDC 2SPCA 4UF0B 2BKNA 2OLTA 3AA0B 1HCIA 4ZEYA 2YEVC 1MIVA 1UURA 2LLYA 2W66A 2YK0A 4N78D 4U31A 5HEUA 3PUVF 5J2UE 2LT3A 2H3RA 4IE6A 3Q2MA 5DQVA 5IWAT 3CX7B 4U33A 3UU3A 5LG3A 1XNRT 2JQ9A 4XAXB 3IHRA 4PAGA 4X1KE 5EK3A 5AQRB 4HFHA 5LMNT 1J5ET 4YTNA 3B5MA 1HR0T 1U5PA 3UU8A 3D0TA 2BKOA 5EK4A 3RRWA 1M62A 3AE6A 1D0XA 1IBKT 4ZZBA 3OYXA 2D0UA 1MMDA 1D0YA 3RYCE 3VRAA 1E7PA 3AXJA 2C5IT 3PV0F 2KINB 2KWIB 3EDVA 1MMGA 2K24A 1MIWA 3SWHA 1SUMB 2V5DA 3O1JA 3QC9A 5CGMA 3BK9A 3C98B 2V8SV 3Q5WA 4ZI3C 1HTJF 3MACA 5FXWA 3AA7B 3HKEE 4HWCA 3N5LA 5LMUT 2LSKA 5DQWA 4WZXA 3FZHB 5HXCA 3RRCA 3ZJ1A 4A98A 4E7ZA 4ILUA 1XMOT 5LHIB 2WDQA 4H9NC 3MA9A 1IAPA 2R6GF 3AVSA 3GN5A 4LMJA 1T98A 2WP9A 2WBLA 4CQIA 1ZEEA 3FZKB 3BQIA 2ZM8A 3EUHA 3UT5E 5L4EA 4L9IA 3KINB 5F3JA 5JR9C 4PJJA 3EDUA 2J62A 2JPFA 5FYMA 3SRZA 3UUBA 2A9UA 3QB5K 4DV1T 1BR0A 2XSAA 3ZN1B 2JIWA 2NW8A 2Y8DA 3EI0A 3CQCB 5TAOA 4JYAT 3PUYF 3JC6D 2LJLA 4WYVA 3UFGA 3LBXA 4O2AE 3ZJ2A 4U7IA 4PJNA 5IYZE 5CA0E 2CWYA 5C8YE 1W0AA 2XUEA 2Z6EA 3PUZF 3Q5EA 4UXNB 4E7SA 3UU4A 2N2NA 4M1PA 3ZT6A 4DV3T 4JI0T 4P09A 3CK6A 3Q5XA 3PUWF 3CKDA 3PUGA 3OBVE 5H6QB 4AKHA 3AEGA 2KXPB 4ZI2D 3V5SA 4DMWA 3U3IA 2LKGA 3NBXX 1FMVA 4G63A 4XZCA 2JJ9A 3OPCA 2IHR1 4IDNA 2CXDA 4X1YE 2V7LA 1KF6A 3GA8A 2UXBT 3PJAA 2WAUA 3PDYA 4KMCA 2BKPA 3RI5A 5HWXA 3AXJB 4ISSA 4DVDA 4LF5T 4GKKT 3UU6A 3DP7A 2IC6A 4KHPT 3H3MA 1IZNB 3E0ZA 3F31A 4UELA 4XBFB 1KEYA 1UGOA 2VVNA 3FZMB 3ZMVB 3VKGA 4U7YA 4U2ZA 3R84B 2ZMAA 2J1DG 2ODUA 3VR8A 3NKZA 1HFAA 4P1NA 4HFDA 3CMLA 3ONXA 2BG9B 2RA1A 4H9RC 1XWMA 5AQMB 3ZYMA 4ZI2C 4PFOA 2XQ5A 5FY1A 3RQUA 4UEMA 1HX8A 3A7MA 2W67A 3RYIE 3VR9A 3F57A 4PFPA 4JI1T 2WDRA 2BVLA 2J47A 3HR0A 3JADA 3VRBA 5KX5E 1VOMA 1CHUA 4HFCA 4LF4T 2B1EA 4IREA 3KV5A 4BAYB 4AKLA 3EHZA 4DV6T 2FJAA 1OEDA 2UXNB 5HYAA 4U74A 4I50E 3UU5A 4EYYR 2LOSA 3OJAA 3ONLC 4B3ST 1NEKA 2LEHA 2ZLYA 2X9WA 1G8XA 1G73A 4NPPA 5HWYA 2WQYA 2DL1A 5EZYE 1NAFA 1E2AA 2CXFA 2DWKA 4B3MT 4EV6A 2BS2A 2YU1A 5E0OA 2YKSA 3F2EA 1X9BA 1HG2A 1H7CA 1KFYA 4UVCB 4HFEA 4F6RC 1MMNA 2UUCT 5HXEA 1VCTA 2X9XA 5JRCB 3RYHE 1BR2A 2FBWA 2YOEA 2W62A 3M3ZB 4ERRA 2VB6A 1UX4A 2M6BA 2X9HA 2D5UA 3FB2A 4YSYA 4LF9T 4TNVA 3OYZA 1Y64B 2W63A 4KI0F 5L3EB 4GOUA 5A1LA 2X0HA 4X64T 4YY3T 3C51A 4IDQA 4ANJA 2CRBA 4BJMA 1QSDA 5H6RB 2L9QA 2UXXB 5HXHA 2EHOC 2NR4A 4Z91A 3RIFA 5ABFA 1MNDA 4UF0A 3UQ4A 2VQFT 1OXZA 5JVDE 2BS4A 2X0YA 3B13A 3EVYA 4PJMA 2WY2A 4X5TA 3RKOA 2EHOB 2A3DA 2MPKA 2IAKA 3RIUA 3ZT7A 2XTLA 4UIGA 4EB6E 3HA4A 4PW8A 3S4UA 4GYSA 5C3JA 4ILBA 4Z90A 4JI5T 3KFWX 3AVRA 4I0UA 4ISTA 5FY0A 1L0VA 1UCUA 3I0OA 2RP4A 1MIYA 4GK0E 2LM2A 2PJQA 2X51A 3MKDA 4JEUB 4GIWA 4EGWA 2JMHA 1GQEA 1WYBA 3AEEA 3JCFA 2HPJA 3CVRA 3DTOA 2CLYB 2V1DB 2CBIA 3OVUA 4UR9A 3RGLA 3ZT5A 2BVMA 5JDFA 5CFBA 4OX9T 2V7JA 4DR7T 3GWHA 3I9WA 3KDSE 3ZCIA 2EHOD 2CLYC 4O4HE 1J5WA 4EEDA 5J0ZA 4JI3T 2FJBA 3TLVA 3NVOA 4JI8T 4CXWA 3U78A 3UUXB 4H9SE 4HWIB 3PU3A 5AQTB 3IEEA 1N34T 1LKXA 1T7SA 3N9MA 2XQ7A 4KP3C 2X68A 3HKBE 4UVAB 1T72A 4U2YA 1IBMT 3QOFA 4MFRA 2CMRA 2UU9T 2LHNA 2PFVA 2XQ6A 4ZXLA 3O9XA 2P9BA 1VCSA 1Z8UA 4B3TT 1IJ5A 4AKGA 4OK0A 2MOZA 4JBWF 3SS1A 4CI1B 1ZP0A 2WZIA 2BG9C 3FBZA 5JREA 5HEHA 4COFA 2Y6XA 2QRXA 4YT0A 2LOPA 5JR9A 2VKJA 1ZHCA 2IIUA 4HE8A 4HFVA 4OFZA 4QH5A 4X20E 4DV0T 3FHNA 2KZ7B 3HI2A 2XAJB 4TWHA 1YD8G 2C5KT 3AECA 3FBLA 3LBXB 4NUVA 5JDHA 2HN1A 2D2SA 5LNKA 3UQ7A 5LJMA 4IIJE 5L3GB 1O3XA 2WU2A 4DR5T 4HKAA 5LJNA 2UXDT 3AEAA 4B6XA 1XMQT 1HF8A 4CI3B 2K48A 4YHJA 4DBQA 4IGUA 3RIAA 4EZHA 1OEDE 5ABFB 3PTRB 2NOXA 2V6YA 2H7OA 5JR9B 2HH7A 1UUSA 2V6XA 4ZS3A 3N9NA 3AE4A 5KDMC 5DABA 5L2LA 3ZYLA 4ZI3D 1FIOA 3DJBA 2DCFA 3HL6A 1IJ6A 1YQ3A 4TNWA 2NP9A 3K3QC 2QGSA 3PURA 3ZMTB 4LFBT 2DNXA 1MNEA 4MLKA 5HCJA 4KUMB 2HN2A 4LF8T 2N9DA 2IUBA 4EXTA 2WDVA 3GMIA 3LK42 3CWZB 3P4SA 4HFBA 5F5WA 2DHRA 2VKHA 4H63H 4YSXA 4YXDA 2VWAA 4DNDA 5L3CB 4DV5T 4LFCT 2E8IA 5FVKA 5BMVE 2BZBA 4FJOA 2HHHT 3ESLA 3LG7A 3PUXF 5HEOA 4EZ4A 4DR1T 2CBJA 4O4JE 3P4QA 2W0GA 2XM2A 4ADZA 5LCYA 1W09A 4QWNB 5LBQB 2A72A 3C4ZA 4O2BE 3N9PA 4QKNA 4P0AA 1JNZA 5LGUB 2XAHB 3HKCE 2VKDA 2L3LA 1U4QA 3G06A 3LK3B 3MK7C 2EHOA 4QH4A 4TV8E 4JI7T 1YW0A 1ZKEA 2PBIA 2WWVA 4IDOA 3C4XA 4K0UA 1HNWT 2CHOA 2YN6A 2ZM6T 3ZYKA 5AQNB 2ZM2A 4I4TE 2FJEA 4QHOA 4JI4T 3AA6B 2HPLA 4H9OC 4AQYT 2CCQA 1OEDB 1YKHB 2H89A 3SFEA 3I9YA 5FMNA 4OYJA 4O4LE 2K3WA 4GK5E 4H9PC 5M4YA 4EYUA 4HFIA 4CN6A 2VK9A 3CQGB 3IBPA 3NRYA 3ZMUB 5JDMA 4AQFA 2H88A 2Q9QA 3W15B 4X66T 3PJAJ 4TWDA 1N33T 3QB5A 3NZPA 4DV2T 2X67A 3JAEA 4O4IE 5IHYA 1AJ3A 3K3OA 4ILCA 4IL9A 4NIQA 3O1HA 5J1GA 2PG8A 3K8PC 1V9DA 2WZHA 2AE9A 2OV9A 1T8BA 4BA9A 4CI2B 1MMAA 2WM9A 4DR6T 2QVAA 2BBHA 2Q9QB 1WR0A 2XZEA 3WAKA 3NRXA 2JQQA 1W9RA 3J9X1 3VU7H 3KBTA 4WW0A 3RHWA 4C91A 5ABEA 5LXTE 3CQXC 1D1BA 3WI3A 5AQQB 1Y01A 4TX5A 3ZLIA 4QX8B 3ZC0A 3PU8A 4KX6A 2XY8B 3TLUA 2I6HA 4U72A 4QH1A 3TLSA 3AEFA 2KT9A 3CIRA 3AE1A 2IDOB 2UUAT 5EK2A 2DWGA 2V5CA 5FL1A 1KK7A 2B76A 5FXVA 2CHNA 2V6YB 4YSZA 3ZEFB 1LRZA 2ZM0A 4X1IE 4HWDA 1CUNA 4IE7A 4AIUA 5AQPB 5JDQA 3KV6A 2KSRA 3TLWA 1US7B 3CPZA 2IW5B 3RC8A 4AI6A 5JDLA 2YINA 2JQKA 1JNRA 3NWIA 3QUJA 4AKRB 4PNIA 3P4WA 3AA1B 4BJNA 3P7IA 4YTPA 3LK2B 1J1JA 3AAIA 2XAGB 2KMFA 2LE8A 4EOZB 4NXNT 3RX6A 4DR4T 2H7VC 4IE4A 3AE3A 2XAQB 3PUAA 4PJLA 2DI4A 2IMLA 2YDSA 3RKGA 3RPUA 2ACZA 2XQ3A 1D1AA 2LSGA 2VKOA 2E9XC 2XQ4A 3P8CD 4NUUA 4TZ4C 5F8PA 3N9OA 5FNVE 3J7Yq 4DUZT 2E5LT 4GKJT 2CXLA 2XAFB 3R6NA 5FP3A 5CB4E 1HNXT 3KVAA 2IC9A 3I0QA 2E2AA 2VASA 2RPAA 1HG5A 2XQAA 4AQFC 1N32T 1D0ZA 4ASKA 5J2TE 2WMNA 5ETWA 1FJGT 4CN4A 5CJ5A 4YHHT 2BDEA 5AFUL 2LM9A 4A5XA 2XASB 3LSVA 5AQJB 5FY7A 1WR6A 1WFDA 2BS3A 3AE9A 1NENA 4JEHB 4X65T 1KNRA 1BR4A 1X79A 2AXDS 5IUXA 3KV4A 1WLXA 3E08A 3C50A 4Q25A 2E5VA 3PUQA 5JQGE 5KMGP 4L5GA 2JMKA 2XHEB 3EABA 2UXCT 3CX6B 5JTGA 1QUUA 1R8IA 3RF1A 5L3FB 3P4PA 4IE5A 4IDPA 3N2OA 5AQOB 4A97A 5AQFB 4LMLA 4DMVA 3IA3A 5L4HA 3RIUC 1YQ4A 4AXPA 2WB5A 2CM0A 2DLRA 2VL8A 3A8YC 3L8RA 5LYJE 3WAJA 2I0MA 3E22E 4JI2T 2V26A 2WSSV 3T8OA 5LG4A 2N1GA 2XPKA 4YJ3E 4EEBA 2C0SA 4DR3T 3UUMA 3KV9A 2XSBA 4HGAA 2Q9QC 3IF8B 5HEGA 2LRKA 1E1HB 2BBJA 4HEAA 4LMKA 4AISA 4HWFA 4WBOA 4IT4A 3MJXA 4TUYE 3FZFB 3I1AA 1WRDA 2CEAA 3PUSA 3Q5DA 4C90A 1ZOYA 4QXCB 2MBGA 4YJ2E 2XJ7A 3X1DA 4DO0A 2LSIA 3LFMA 3H37A 4ZZCA 2KNDA 3AAAB 2LHRA 2ODVA 4IE0A 1XDPA 3K3NA 4TV9E 3ZC1A 2LRLA 4G2AA 3Q9DA 4ILAA 4QXBB 5AQSB 2CPTA 5LBMA 3ZPOA 2XQYA 3ZSTA 3MXZA 3BQKA 1KNPA 2Y48B 4I55E 2LSJA 2WMOA 3O4XE 3UFEA 3ZN0B 5DJQC 4U3CA 5ABHA 4YTMA 3VHLA 2D9DA 5AQVB 1SA0E 3ANWA 2VQET 4H9QC 3AAEB 3AE8A 5GONE 4EAHA 1YKEB 1QLBA 3ZMSB 4AKIA 2VL0A 5L3BB 2QYWA 2YDRA 2KWHA 2I59A 3QK6A 4JI6T 1DU2A 2NW7A 4J2CA 5AQLB 5JDNA 1I94T 3A5XA 1N36T 4Z8XA 4UV8B 3M65A 3ZSSA 5AQKB 3AEBA 4OYKA 2ES0A 4EIWA 4F8HA 2WU5A 5AQIB 3L09A 2E9XA 4IL4A 4PK6A 1IBLT 2MAWA 2FUPA 2A2FX 3ANWB 2X0LB 4QX7B 3SOLA 4LF7T 4KHZF 4TWFA 3SFDA 1YXRA 2UUBT 4DIDB 3OTOT 2YDQA 5FXXA 4I43B 2F4VT 2XQ8A 3LJCA 1EZ3A 4MHCA 4GYRA 5AQGB 4DR2T 3AEDA 5HXRA 5BR8T 3FZLB 4L0RA 5LB7B 4A56A 2CA5A 3P4RA 1KNZA 3JAFA 3N2KE 3ZKRA 2M67A 4ZHQE 4LF6T 1SHZC 3N9LA 4IHJE 3QNUA 1HS7A 5ABGA 4O8SA 5LOVE 1NWMX 3ZCJA 1SE7A 1ZV4X 4PK5A 1FMWA 3C4WA 2V7IA 5HXSA 2CWOA 3UTKA 4AQGA 2JQHA 2W00A 2NW9A 3RQWA 4ZOLE 3L39A 1FEWA 3RYFE 1WYCA 3VKHA 1XZYA 3UULA 1OWAA 2ACXA 1HNZT 2K5BB 2G0UA 3B57A 3OKQA 5LA6E 4HN9A 4JLEA 3V5UA 2LSYA 5FL0A 2GK9A 4YLHA 3EAMA 3ABVA 2V7KA 4UVBB 2BG9E 2X9YA 4MBQA 2M6IA 1LVFA 1VRBA 1B7TA 2Q9QD 2MTQA 3C64A 4TN7B 3BQLA 3RLFF 4ZI7E 2W61A 2W4XA 4H63V 1S35A 3CX8B 3KBUA
chains in the Genus database with same CATH topology
4DUYT 4KHPT 4LF5T 4GKKT 4LFBT 4B3RT 4X65T 4LF8T 4K0KT 3T1YT 2UXCT 4DV7T 4DV5T 4LFCT 4JV5T 2HHHT 4JI1T 4DR1T 3T1HT 4LF4T 4DV6T 4JI2T 4LFAT 4JI7T 4B3ST 1HNWT 4NXMT 2ZM6T 4B3MT 4JI4T 4AQYT 4X62T 1XNQT 2UUCT 4LF9T 5IWAT 4X66T 4X64T 4YY3T 1XNRT 1J5ET 5LMNT 1HR0T 2VQFT 2VQET 1IBKT 1N33T 4DR6T 4JI6T 4JI5T 1I94T 1N36T 5LMUT 1IBLT 1XMOT 4LF7T 2UUBT 4DR7T 4OX9T 2F4VT 2UUAT 4DR2T 5BR8T 4JI3T 4JI8T 4JYAT 1N34T 4LF6T 4DV1T 1IBMT 2UU9T 4NXNT 4B3TT 4DR4T 4DV4T 4JI0T 4DV3T 1HNZT 4GKJT 4DV0T 2E5LT 4DUZT 4DR3T 3OTOT 4DR5T 1HNXT 2UXDT 1N32T 1XMQT 1FJGT 2UXBT 4DV2T 4YHHT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY T;  4KHP T;  4LF5 T;  4GKK T;  4LFB T;  4B3R T;  4X65 T;  4LF8 T;  4K0K T;  3T1Y T;  2UXC T;  4DV7 T;  4DV5 T;  4LFC T;  4JV5 T;  2HHH T;  4JI1 T;  4DR1 T;  3T1H T;  4LF4 T;  4DV6 T;  4JI2 T;  4LFA T;  4JI7 T;  4B3S T;  1HNW T;  4NXM T;  2ZM6 T;  4B3M T;  4JI4 T;  4AQY T;  4X62 T;  1XNQ T;  2UUC T;  4LF9 T;  5IWA T;  4X66 T;  4X64 T;  4YY3 T;  1XNR T;  1J5E T;  5LMN T;  1HR0 T;  2VQF T;  2VQE T;  1IBK T;  1N33 T;  4DR6 T;  4JI6 T;  4JI5 T;  1I94 T;  1N36 T;  5LMU T;  1IBL T;  1XMO T;  4LF7 T;  2UUB T;  4DR7 T;  4OX9 T;  2F4V T;  2UUA T;  4DR2 T;  5BR8 T;  4JI3 T;  4JI8 T;  4JYA T;  1N34 T;  4LF6 T;  4DV1 T;  1IBM T;  2UU9 T;  4NXN T;  4B3T T;  4DR4 T;  4DV4 T;  4JI0 T;  4DV3 T;  1HNZ T;  4GKJ T;  4DV0 T;  2E5L T;  4DUZ T;  4DR3 T;  3OTO T;  4DR5 T;  1HNX T;  2UXD T;  1N32 T;  1XMQ T;  1FJG T;  2UXB T;  4DV2 T;  4YHH T; 
#chains in the Genus database with same CATH topology
 2C5J A;  4CXX A;  2VUR A;  2LKH A;  4OHF A;  2BG9 A;  4CN1 A;  5CA1 E;  4DUY T;  1XDO A;  2XQ9 A;  2XM1 A;  4PK4 A;  1LVK A;  4HTE A;  1Z0P A;  4ZS2 A;  2D0T A;  4KBM B;  2X66 A;  4P0B A;  1S94 A;  4B3R T;  4QXH B;  5L47 A;  1WCR A;  3UUN A;  1W0B A;  5LHH B;  2K9A A;  5AQH B;  2KLQ A;  3FXE B;  2NTY A;  3JC6 C;  5AQU B;  3LDQ B;  3RH3 A;  5C2T A;  4K0K T;  3AB3 B;  3KVB A;  2J4G A;  2YU2 A;  3NZQ A;  5HAX A;  3TKL B;  4DV4 T;  5JRC A;  4DV7 T;  4CZZ B;  5LHG B;  5FKY A;  3GN5 B;  3O1I A;  2V7M A;  4WBN E;  4JV5 T;  2L8K A;  2WWU A;  3T1H T;  3K1S A;  3ONJ A;  2W2U A;  1UX5 A;  3P50 A;  4WNK A;  1UK5 A;  3FXD B;  3H3A A;  5FXZ A;  4FI5 A;  3L3P A;  4HWH A;  4UV9 B;  4DBR A;  1M7K A;  4V1A v;  1BR1 A;  5ADX L;  2CE7 A;  4YFS A;  3AE2 A;  4LFA T;  4IDZ A;  5JH7 E;  5FVL A;  2WS3 A;  2NTX A;  3RC3 A;  3AE5 A;  3TLT A;  2QA7 A;  4MAL A;  1I6Z A;  3MZK B;  5LGT B;  3T1Y T;  3PE0 A;  4NXM T;  5LP6 E;  3N9Q A;  2VVS A;  5KXJ A;  2OA5 A;  5L3D B;  2PTF A;  3ETV A;  5HCM A;  5JDG A;  4JUY A;  2E9X D;  2NWB A;  3ZMZ B;  2E9X B;  2FJD A;  3AE7 A;  5LGN B;  2WCA A;  5HEJ A;  3N2G E;  2JRK A;  4X62 T;  1D1C A;  3ETU A;  1XNQ T;  4CXY A;  2MYS A;  3HKD E;  1HX1 B;  1OED C;  2SPC A;  4UF0 B;  2BKN A;  2OLT A;  3AA0 B;  1HCI A;  4ZEY A;  2YEV C;  1MIV A;  1UUR A;  2LLY A;  2W66 A;  2YK0 A;  4N78 D;  4U31 A;  5HEU A;  3PUV F;  5J2U E;  2LT3 A;  2H3R A;  4IE6 A;  3Q2M A;  5DQV A;  5IWA T;  3CX7 B;  4U33 A;  3UU3 A;  5LG3 A;  1XNR T;  2JQ9 A;  4XAX B;  3IHR A;  4PAG A;  4X1K E;  5EK3 A;  5AQR B;  4HFH A;  5LMN T;  1J5E T;  4YTN A;  3B5M A;  1HR0 T;  1U5P A;  3UU8 A;  3D0T A;  2BKO A;  5EK4 A;  3RRW A;  1M62 A;  3AE6 A;  1D0X A;  1IBK T;  4ZZB A;  3OYX A;  2D0U A;  1MMD A;  1D0Y A;  3RYC E;  3VRA A;  1E7P A;  3AXJ A;  2C5I T;  3PV0 F;  2KIN B;  2KWI B;  3EDV A;  1MMG A;  2K24 A;  1MIW A;  3SWH A;  1SUM B;  2V5D A;  3O1J A;  3QC9 A;  5CGM A;  3BK9 A;  3C98 B;  2V8S V;  3Q5W A;  4ZI3 C;  1HTJ F;  3MAC A;  5FXW A;  3AA7 B;  3HKE E;  4HWC A;  3N5L A;  5LMU T;  2LSK A;  5DQW A;  4WZX A;  3FZH B;  5HXC A;  3RRC A;  3ZJ1 A;  4A98 A;  4E7Z A;  4ILU A;  1XMO T;  5LHI B;  2WDQ A;  4H9N C;  3MA9 A;  1IAP A;  2R6G F;  3AVS A;  3GN5 A;  4LMJ A;  1T98 A;  2WP9 A;  2WBL A;  4CQI A;  1ZEE A;  3FZK B;  3BQI A;  2ZM8 A;  3EUH A;  3UT5 E;  5L4E A;  4L9I A;  3KIN B;  5F3J A;  5JR9 C;  4PJJ A;  3EDU A;  2J62 A;  2JPF A;  5FYM A;  3SRZ A;  3UUB A;  2A9U A;  3QB5 K;  4DV1 T;  1BR0 A;  2XSA A;  3ZN1 B;  2JIW A;  2NW8 A;  2Y8D A;  3EI0 A;  3CQC B;  5TAO A;  4JYA T;  3PUY F;  3JC6 D;  2LJL A;  4WYV A;  3UFG A;  3LBX A;  4O2A E;  3ZJ2 A;  4U7I A;  4PJN A;  5IYZ E;  5CA0 E;  2CWY A;  5C8Y E;  1W0A A;  2XUE A;  2Z6E A;  3PUZ F;  3Q5E A;  4UXN B;  4E7S A;  3UU4 A;  2N2N A;  4M1P A;  3ZT6 A;  4DV3 T;  4JI0 T;  4P09 A;  3CK6 A;  3Q5X A;  3PUW F;  3CKD A;  3PUG A;  3OBV E;  5H6Q B;  4AKH A;  3AEG A;  2KXP B;  4ZI2 D;  3V5S A;  4DMW A;  3U3I A;  2LKG A;  3NBX X;  1FMV A;  4G63 A;  4XZC A;  2JJ9 A;  3OPC A;  2IHR 1;  4IDN A;  2CXD A;  4X1Y E;  2V7L A;  1KF6 A;  3GA8 A;  2UXB T;  3PJA A;  2WAU A;  3PDY A;  4KMC A;  2BKP A;  3RI5 A;  5HWX A;  3AXJ B;  4ISS A;  4DVD A;  4LF5 T;  4GKK T;  3UU6 A;  3DP7 A;  2IC6 A;  4KHP T;  3H3M A;  1IZN B;  3E0Z A;  3F31 A;  4UEL A;  4XBF B;  1KEY A;  1UGO A;  2VVN A;  3FZM B;  3ZMV B;  3VKG A;  4U7Y A;  4U2Z A;  3R84 B;  2ZMA A;  2J1D G;  2ODU A;  3VR8 A;  3NKZ A;  1HFA A;  4P1N A;  4HFD A;  3CML A;  3ONX A;  2BG9 B;  2RA1 A;  4H9R C;  1XWM A;  5AQM B;  3ZYM A;  4ZI2 C;  4PFO A;  2XQ5 A;  5FY1 A;  3RQU A;  4UEM A;  1HX8 A;  3A7M A;  2W67 A;  3RYI E;  3VR9 A;  3F57 A;  4PFP A;  4JI1 T;  2WDR A;  2BVL A;  2J47 A;  3HR0 A;  3JAD A;  3VRB A;  5KX5 E;  1VOM A;  1CHU A;  4HFC A;  4LF4 T;  2B1E A;  4IRE A;  3KV5 A;  4BAY B;  4AKL A;  3EHZ A;  4DV6 T;  2FJA A;  1OED A;  2UXN B;  5HYA A;  4U74 A;  4I50 E;  3UU5 A;  4EYY R;  2LOS A;  3OJA A;  3ONL C;  4B3S T;  1NEK A;  2LEH A;  2ZLY A;  2X9W A;  1G8X A;  1G73 A;  4NPP A;  5HWY A;  2WQY A;  2DL1 A;  5EZY E;  1NAF A;  1E2A A;  2CXF A;  2DWK A;  4B3M T;  4EV6 A;  2BS2 A;  2YU1 A;  5E0O A;  2YKS A;  3F2E A;  1X9B A;  1HG2 A;  1H7C A;  1KFY A;  4UVC B;  4HFE A;  4F6R C;  1MMN A;  2UUC T;  5HXE A;  1VCT A;  2X9X A;  5JRC B;  3RYH E;  1BR2 A;  2FBW A;  2YOE A;  2W62 A;  3M3Z B;  4ERR A;  2VB6 A;  1UX4 A;  2M6B A;  2X9H A;  2D5U A;  3FB2 A;  4YSY A;  4LF9 T;  4TNV A;  3OYZ A;  1Y64 B;  2W63 A;  4KI0 F;  5L3E B;  4GOU A;  5A1L A;  2X0H A;  4X64 T;  4YY3 T;  3C51 A;  4IDQ A;  4ANJ A;  2CRB A;  4BJM A;  1QSD A;  5H6R B;  2L9Q A;  2UXX B;  5HXH A;  2EHO C;  2NR4 A;  4Z91 A;  3RIF A;  5ABF A;  1MND A;  4UF0 A;  3UQ4 A;  2VQF T;  1OXZ A;  5JVD E;  2BS4 A;  2X0Y A;  3B13 A;  3EVY A;  4PJM A;  2WY2 A;  4X5T A;  3RKO A;  2EHO B;  2A3D A;  2MPK A;  2IAK A;  3RIU A;  3ZT7 A;  2XTL A;  4UIG A;  4EB6 E;  3HA4 A;  4PW8 A;  3S4U A;  4GYS A;  5C3J A;  4ILB A;  4Z90 A;  4JI5 T;  3KFW X;  3AVR A;  4I0U A;  4IST A;  5FY0 A;  1L0V A;  1UCU A;  3I0O A;  2RP4 A;  1MIY A;  4GK0 E;  2LM2 A;  2PJQ A;  2X51 A;  3MKD A;  4JEU B;  4GIW A;  4EGW A;  2JMH A;  1GQE A;  1WYB A;  3AEE A;  3JCF A;  2HPJ A;  3CVR A;  3DTO A;  2CLY B;  2V1D B;  2CBI A;  3OVU A;  4UR9 A;  3RGL A;  3ZT5 A;  2BVM A;  5JDF A;  5CFB A;  4OX9 T;  2V7J A;  4DR7 T;  3GWH A;  3I9W A;  3KDS E;  3ZCI A;  2EHO D;  2CLY C;  4O4H E;  1J5W A;  4EED A;  5J0Z A;  4JI3 T;  2FJB A;  3TLV A;  3NVO A;  4JI8 T;  4CXW A;  3U78 A;  3UUX B;  4H9S E;  4HWI B;  3PU3 A;  5AQT B;  3IEE A;  1N34 T;  1LKX A;  1T7S A;  3N9M A;  2XQ7 A;  4KP3 C;  2X68 A;  3HKB E;  4UVA B;  1T72 A;  4U2Y A;  1IBM T;  3QOF A;  4MFR A;  2CMR A;  2UU9 T;  2LHN A;  2PFV A;  2XQ6 A;  4ZXL A;  3O9X A;  2P9B A;  1VCS A;  1Z8U A;  4B3T T;  1IJ5 A;  4AKG A;  4OK0 A;  2MOZ A;  4JBW F;  3SS1 A;  4CI1 B;  1ZP0 A;  2WZI A;  2BG9 C;  3FBZ A;  5JRE A;  5HEH A;  4COF A;  2Y6X A;  2QRX A;  4YT0 A;  2LOP A;  5JR9 A;  2VKJ A;  1ZHC A;  2IIU A;  4HE8 A;  4HFV A;  4OFZ A;  4QH5 A;  4X20 E;  4DV0 T;  3FHN A;  2KZ7 B;  3HI2 A;  2XAJ B;  4TWH A;  1YD8 G;  2C5K T;  3AEC A;  3FBL A;  3LBX B;  4NUV A;  5JDH A;  2HN1 A;  2D2S A;  5LNK A;  3UQ7 A;  5LJM A;  4IIJ E;  5L3G B;  1O3X A;  2WU2 A;  4DR5 T;  4HKA A;  5LJN A;  2UXD T;  3AEA A;  4B6X A;  1XMQ T;  1HF8 A;  4CI3 B;  2K48 A;  4YHJ A;  4DBQ A;  4IGU A;  3RIA A;  4EZH A;  1OED E;  5ABF B;  3PTR B;  2NOX A;  2V6Y A;  2H7O A;  5JR9 B;  2HH7 A;  1UUS A;  2V6X A;  4ZS3 A;  3N9N A;  3AE4 A;  5KDM C;  5DAB A;  5L2L A;  3ZYL A;  4ZI3 D;  1FIO A;  3DJB A;  2DCF A;  3HL6 A;  1IJ6 A;  1YQ3 A;  4TNW A;  2NP9 A;  3K3Q C;  2QGS A;  3PUR A;  3ZMT B;  4LFB T;  2DNX A;  1MNE A;  4MLK A;  5HCJ A;  4KUM B;  2HN2 A;  4LF8 T;  2N9D A;  2IUB A;  4EXT A;  2WDV A;  3GMI A;  3LK4 2;  3CWZ B;  3P4S A;  4HFB A;  5F5W A;  2DHR A;  2VKH A;  4H63 H;  4YSX A;  4YXD A;  2VWA A;  4DND A;  5L3C B;  4DV5 T;  4LFC T;  2E8I A;  5FVK A;  5BMV E;  2BZB A;  4FJO A;  2HHH T;  3ESL A;  3LG7 A;  3PUX F;  5HEO A;  4EZ4 A;  4DR1 T;  2CBJ A;  4O4J E;  3P4Q A;  2W0G A;  2XM2 A;  4ADZ A;  5LCY A;  1W09 A;  4QWN B;  5LBQ B;  2A72 A;  3C4Z A;  4O2B E;  3N9P A;  4QKN A;  4P0A A;  1JNZ A;  5LGU B;  2XAH B;  3HKC E;  2VKD A;  2L3L A;  1U4Q A;  3G06 A;  3LK3 B;  3MK7 C;  2EHO A;  4QH4 A;  4TV8 E;  4JI7 T;  1YW0 A;  1ZKE A;  2PBI A;  2WWV A;  4IDO A;  3C4X A;  4K0U A;  1HNW T;  2CHO A;  2YN6 A;  2ZM6 T;  3ZYK A;  5AQN B;  2ZM2 A;  4I4T E;  2FJE A;  4QHO A;  4JI4 T;  3AA6 B;  2HPL A;  4H9O C;  4AQY T;  2CCQ A;  1OED B;  1YKH B;  2H89 A;  3SFE A;  3I9Y A;  5FMN A;  4OYJ A;  4O4L E;  2K3W A;  4GK5 E;  4H9P C;  5M4Y A;  4EYU A;  4HFI A;  4CN6 A;  2VK9 A;  3CQG B;  3IBP A;  3NRY A;  3ZMU B;  5JDM A;  4AQF A;  2H88 A;  2Q9Q A;  3W15 B;  4X66 T;  3PJA J;  4TWD A;  1N33 T;  3QB5 A;  3NZP A;  4DV2 T;  2X67 A;  3JAE A;  4O4I E;  5IHY A;  1AJ3 A;  3K3O A;  4ILC A;  4IL9 A;  4NIQ A;  3O1H A;  5J1G A;  2PG8 A;  3K8P C;  1V9D A;  2WZH A;  2AE9 A;  2OV9 A;  1T8B A;  4BA9 A;  4CI2 B;  1MMA A;  2WM9 A;  4DR6 T;  2QVA A;  2BBH A;  2Q9Q B;  1WR0 A;  2XZE A;  3WAK A;  3NRX A;  2JQQ A;  1W9R A;  3J9X 1;  3VU7 H;  3KBT A;  4WW0 A;  3RHW A;  4C91 A;  5ABE A;  5LXT E;  3CQX C;  1D1B A;  3WI3 A;  5AQQ B;  1Y01 A;  4TX5 A;  3ZLI A;  4QX8 B;  3ZC0 A;  3PU8 A;  4KX6 A;  2XY8 B;  3TLU A;  2I6H A;  4U72 A;  4QH1 A;  3TLS A;  3AEF A;  2KT9 A;  3CIR A;  3AE1 A;  2IDO B;  2UUA T;  5EK2 A;  2DWG A;  2V5C A;  5FL1 A;  1KK7 A;  2B76 A;  5FXV A;  2CHN A;  2V6Y B;  4YSZ A;  3ZEF B;  1LRZ A;  2ZM0 A;  4X1I E;  4HWD A;  1CUN A;  4IE7 A;  4AIU A;  5AQP B;  5JDQ A;  3KV6 A;  2KSR A;  3TLW A;  1US7 B;  3CPZ A;  2IW5 B;  3RC8 A;  4AI6 A;  5JDL A;  2YIN A;  2JQK A;  1JNR A;  3NWI A;  3QUJ A;  4AKR B;  4PNI A;  3P4W A;  3AA1 B;  4BJN A;  3P7I A;  4YTP A;  3LK2 B;  1J1J A;  3AAI A;  2XAG B;  2KMF A;  2LE8 A;  4EOZ B;  4NXN T;  3RX6 A;  4DR4 T;  2H7V C;  4IE4 A;  3AE3 A;  2XAQ B;  3PUA A;  4PJL A;  2DI4 A;  2IML A;  2YDS A;  3RKG A;  3RPU A;  2ACZ A;  2XQ3 A;  1D1A A;  2LSG A;  2VKO A;  2E9X C;  2XQ4 A;  3P8C D;  4NUU A;  4TZ4 C;  5F8P A;  3N9O A;  5FNV E;  3J7Y q;  4DUZ T;  2E5L T;  4GKJ T;  2CXL A;  2XAF B;  3R6N A;  5FP3 A;  5CB4 E;  1HNX T;  3KVA A;  2IC9 A;  3I0Q A;  2E2A A;  2VAS A;  2RPA A;  1HG5 A;  2XQA A;  4AQF C;  1N32 T;  1D0Z A;  4ASK A;  5J2T E;  2WMN A;  5ETW A;  1FJG T;  4CN4 A;  5CJ5 A;  4YHH T;  2BDE A;  5AFU L;  2LM9 A;  4A5X A;  2XAS B;  3LSV A;  5AQJ B;  5FY7 A;  1WR6 A;  1WFD A;  2BS3 A;  3AE9 A;  1NEN A;  4JEH B;  4X65 T;  1KNR A;  1BR4 A;  1X79 A;  2AXD S;  5IUX A;  3KV4 A;  1WLX A;  3E08 A;  3C50 A;  4Q25 A;  2E5V A;  3PUQ A;  5JQG E;  5KMG P;  4L5G A;  2JMK A;  2XHE B;  3EAB A;  2UXC T;  3CX6 B;  5JTG A;  1QUU A;  1R8I A;  3RF1 A;  5L3F B;  3P4P A;  4IE5 A;  4IDP A;  3N2O A;  5AQO B;  4A97 A;  5AQF B;  4LML A;  4DMV A;  3IA3 A;  5L4H A;  3RIU C;  1YQ4 A;  4AXP A;  2WB5 A;  2CM0 A;  2DLR A;  2VL8 A;  3A8Y C;  3L8R A;  5LYJ E;  3WAJ A;  2I0M A;  3E22 E;  4JI2 T;  2V26 A;  2WSS V;  3T8O A;  5LG4 A;  2N1G A;  2XPK A;  4YJ3 E;  4EEB A;  2C0S A;  4DR3 T;  3UUM A;  3KV9 A;  2XSB A;  4HGA A;  2Q9Q C;  3IF8 B;  5HEG A;  2LRK A;  1E1H B;  2BBJ A;  4HEA A;  4LMK A;  4AIS A;  4HWF A;  4WBO A;  4IT4 A;  3MJX A;  4TUY E;  3FZF B;  3I1A A;  1WRD A;  2CEA A;  3PUS A;  3Q5D A;  4C90 A;  1ZOY A;  4QXC B;  2MBG A;  4YJ2 E;  2XJ7 A;  3X1D A;  4DO0 A;  2LSI A;  3LFM A;  3H37 A;  4ZZC A;  2KND A;  3AAA B;  2LHR A;  2ODV A;  4IE0 A;  1XDP A;  3K3N A;  4TV9 E;  3ZC1 A;  2LRL A;  4G2A A;  3Q9D A;  4ILA A;  4QXB B;  5AQS B;  2CPT A;  5LBM A;  3ZPO A;  2XQY A;  3ZST A;  3MXZ A;  3BQK A;  1KNP A;  2Y48 B;  4I55 E;  2LSJ A;  2WMO A;  3O4X E;  3UFE A;  3ZN0 B;  5DJQ C;  4U3C A;  5ABH A;  4YTM A;  3VHL A;  2D9D A;  5AQV B;  1SA0 E;  3ANW A;  2VQE T;  4H9Q C;  3AAE B;  3AE8 A;  5GON E;  4EAH A;  1YKE B;  1QLB A;  3ZMS B;  4AKI A;  2VL0 A;  5L3B B;  2QYW A;  2YDR A;  2KWH A;  2I59 A;  3QK6 A;  4JI6 T;  1DU2 A;  2NW7 A;  4J2C A;  5AQL B;  5JDN A;  1I94 T;  3A5X A;  1N36 T;  4Z8X A;  4UV8 B;  3M65 A;  3ZSS A;  5AQK B;  3AEB A;  4OYK A;  2ES0 A;  4EIW A;  4F8H A;  2WU5 A;  5AQI B;  3L09 A;  2E9X A;  4IL4 A;  4PK6 A;  1IBL T;  2MAW A;  2FUP A;  2A2F X;  3ANW B;  2X0L B;  4QX7 B;  3SOL A;  4LF7 T;  4KHZ F;  4TWF A;  3SFD A;  1YXR A;  2UUB T;  4DID B;  3OTO T;  2YDQ A;  5FXX A;  4I43 B;  2F4V T;  2XQ8 A;  3LJC A;  1EZ3 A;  4MHC A;  4GYR A;  5AQG B;  4DR2 T;  3AED A;  5HXR A;  5BR8 T;  3FZL B;  4L0R A;  5LB7 B;  4A56 A;  2CA5 A;  3P4R A;  1KNZ A;  3JAF A;  3N2K E;  3ZKR A;  2M67 A;  4ZHQ E;  4LF6 T;  1SHZ C;  3N9L A;  4IHJ E;  3QNU A;  1HS7 A;  5ABG A;  4O8S A;  5LOV E;  1NWM X;  3ZCJ A;  1SE7 A;  1ZV4 X;  4PK5 A;  1FMW A;  3C4W A;  2V7I A;  5HXS A;  2CWO A;  3UTK A;  4AQG A;  2JQH A;  2W00 A;  2NW9 A;  3RQW A;  4ZOL E;  3L39 A;  1FEW A;  3RYF E;  1WYC A;  3VKH A;  1XZY A;  3UUL A;  1OWA A;  2ACX A;  1HNZ T;  2K5B B;  2G0U A;  3B57 A;  3OKQ A;  5LA6 E;  4HN9 A;  4JLE A;  3V5U A;  2LSY A;  5FL0 A;  2GK9 A;  4YLH A;  3EAM A;  3ABV A;  2V7K A;  4UVB B;  2BG9 E;  2X9Y A;  4MBQ A;  2M6I A;  1LVF A;  1VRB A;  1B7T A;  2Q9Q D;  2MTQ A;  3C64 A;  4TN7 B;  3BQL A;  3RLF F;  4ZI7 E;  2W61 A;  2W4X A;  4H63 V;  1S35 A;  3CX8 B;  3KBU A; 
#chains in the Genus database with same CATH homology
 4DUY T;  4KHP T;  4LF5 T;  4GKK T;  4LFB T;  4B3R T;  4X65 T;  4LF8 T;  4K0K T;  3T1Y T;  2UXC T;  4DV7 T;  4DV5 T;  4LFC T;  4JV5 T;  2HHH T;  4JI1 T;  4DR1 T;  3T1H T;  4LF4 T;  4DV6 T;  4JI2 T;  4LFA T;  4JI7 T;  4B3S T;  1HNW T;  4NXM T;  2ZM6 T;  4B3M T;  4JI4 T;  4AQY T;  4X62 T;  1XNQ T;  2UUC T;  4LF9 T;  5IWA T;  4X66 T;  4X64 T;  4YY3 T;  1XNR T;  1J5E T;  5LMN T;  1HR0 T;  2VQF T;  2VQE T;  1IBK T;  1N33 T;  4DR6 T;  4JI6 T;  4JI5 T;  1I94 T;  1N36 T;  5LMU T;  1IBL T;  1XMO T;  4LF7 T;  2UUB T;  4DR7 T;  4OX9 T;  2F4V T;  2UUA T;  4DR2 T;  5BR8 T;  4JI3 T;  4JI8 T;  4JYA T;  1N34 T;  4LF6 T;  4DV1 T;  1IBM T;  2UU9 T;  4NXN T;  4B3T T;  4DR4 T;  4DV4 T;  4JI0 T;  4DV3 T;  1HNZ T;  4GKJ T;  4DV0 T;  2E5L T;  4DUZ T;  4DR3 T;  3OTO T;  4DR5 T;  1HNX T;  2UXD T;  1N32 T;  1XMQ T;  1FJG T;  2UXB T;  4DV2 T;  4YHH T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...