1X79A

Crystal structure of human gga1 gat domain complexed with the gat-binding domain of rabaptin5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
82
Chain Sequence
ISKRVNAIEEVNNNVKLLTEMVMSHSSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 82
sequence length 89
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1x79A00
1OXZA 1NAFA 1YD8G 1X79A 2N9DA 1O3XA 2N2NA 1NWMX 1WRDA 1WR6A
chains in the Genus database with same CATH superfamily
4G63A 2W00A 2XPKA 5ABFB 3ABVA 5FNVE 5AQJB 3ZMZB 3RIUC 2UUBT 4AKHA 4QWNB 4KX6A 4Z8XA 4AQGA 5HEUA 1DU2A 5KX5E 3C51A 4EB6E 4UF0B 2CHOA 4LMLA 4ILUA 4ILCA 5CFBA 2BZBA 1HG2A 4ASKA 4K0KT 1S94A 5EK3A 4EYYR 3PUVF 5HCJA 3L09A 4A5XA 2HHHT 2RA1A 5BMVE 1HR0T 1X79A 4A98A 3UU6A 3P4PA 4P1NA 1G73A 1ZHCA 5A1LA 4NUUA 2JIWA 4O4LE 4PK5A 2E8IA 2ODUA 5L3DB 2JMHA 1US7B 3O4XE 2WMOA 2V26A 4UR9A 3J7Yq 4I0UA 3RYHE 3TLUA 3MZKB 4E7SA 4IDZA 3H37A 3IEEA 1XNQT 3RLFF 2Q9QD 4PJNA 4IL9A 4CQIA 2C5KT 3EVYA 2BG9E 4AKLA 4TX5A 3EDUA 4OK0A 1YD8G 3VU7H 2JMKA 2XQ6A 5LGTB 4HWHA 2LHRA 5HEGA 2WU5A 4DR6T 3UUBA 4X65T 5AQTB 2IW5B 3VHLA 2KWHA 5C8YE 2C0SA 3L8RA 5CA1E 1IZNB 3F57A 4DV6T 4QH1A 4NXMT 2W4XA 4AQYT 2W61A 1WR0A 4QHOA 2XZEA 2OLTA 1UX4A 1D0YA 5H6RB 2NW8A 3E22E 1O3XA 2PBIA 3SWHA 5LP6E 2CLYB 4HKAA 2KT9A 4HWIB 5HWYA 1KNRA 5ETWA 2CWOA 3WI3A 4NPPA 2VVNA 2XQ5A 1N33T 3ZJ1A 4O2BE 1J5ET 4YTNA 3RQWA 3O1JA 3UT5E 4BJMA 3DTOA 3TLSA 3OJAA 3HR0A 3LJCA 5TAOA 4UELA 5AQLB 1XDOA 2WDVA 4Q25A 3ZT5A 5F3JA 4AIUA 3RIAA 2F4VT 4LFAT 2V6YA 2KLQA 3ZCJA 4H9QC 4U33A 1XZYA 4YFSA 2JQQA 2NP9A 4X1YE 4PJMA 2LLYA 2CXDA 5LNKA 2C5JA 3EABA 3B57A 1AJ3A 3RX6A 1HX1B 3MA9A 3Q2MA 3LBXB 5LHHB 2LOSA 4ZI2C 1M7KA 2V5CA 4O4IE 1D1CA 2XQ7A 3K8PC 2LM2A 2YDQA 3IHRA 3VKGA 3N9PA 2K9AA 4KHPT 3P7IA 3RKOA 3FZFB 4ZZCA 2QVAA 2JQHA 1OEDC 4DR7T 3GN5B 2XJ7A 3DJBA 2N9DA 4P0BA 5F5WA 4B3ST 2VK9A 2Y6XA 2VB6A 1FJGT 2IHR1 4X1KE 1IAPA 3ETUA 2WU2A 3CK6A 1N34T 4HFDA 1BR2A 3FXEB 1MIVA 4B6XA 5ABHA 2LRLA 5LB7B 4LF6T 3RQUA 3AA7B 3KV5A 2BS4A 5L47A 5AQUB 2KMFA 4X66T 5HWXA 4PFPA 5IWAT 2ZM6T 2UUAT 4O4HE 3RI5A 4WYVA 3MKDA 4LFBT 3M65A 2WM9A 3N9MA 4CI2B 1XMQT 1ZOYA 3EUHA 3W15B 1LRZA 1U5PA 3ANWB 5KXJA 3JAEA 2HPLA 4QX7B 4H9NC 3R6NA 2CA5A 3UUNA 1I94T 4B3TT 2LSYA 2BKPA 4JYAT 3KV4A 1OEDB 3RGLA 2E9XA 2V7IA 1IBMT 5J2TE 2Q9QC 4YY3T 2ZM0A 5EK4A 4ZI3D 4CN1A 5FKYA 1N36T 4HGAA 2BKNA 5AFUL 4HWDA 4X1IE 4OHFA 4TWDA 2WDQA 2ES0A 2KNDA 3LDQB 2LKGA 2XHEB 2H89A 4MFRA 4PJJA 3O1IA 4ZS3A 2XQAA 3ZMSB 2FJBA 4LF8T 1XWMA 1E7PA 5L3EB 3AVSA 1QLBA 4V1Av 3PE0A 4IL4A 1YQ4A 2CCQA 2ACXA 4IHJE 1L0VA 2BBJA 2JRKA 2M67A 3ZKRA 3RRWA 3EDVA 3KVAA 4DBRA 2QA7A 3NVOA 4ZHQE 2BVLA 2C5IT 3A5XA 1EZ3A 4GKKT 4EV6A 3P4QA 2Q9QB 5E0OA 5LG4A 3P4WA 4L0RA 2YN6A 2BG9A 2X0HA 4MLKA 3FHNA 2XQ4A 3D0TA 4JLEA 2HH7A 2LM9A 3WAKA 4TV9E 5DQVA 3RC3A 4DR2T 2JQKA 2CM0A 3KBUA 4JI7T 2V6YB 3RKGA 3I0QA 2FJEA 4H9RC 3L3PA 4CXXA 2P9BA 4AXPA 2H7VC 5HAXA 5JDQA 4DV5T 5FY0A 4CI1B 5HYAA 2WMNA 3AEDA 1LVKA 1OXZA 1MIYA 3IF8B 5LYJE 2A72A 5HEHA 4JV5T 2I6HA 3KVBA 3ZSTA 4U31A 2X0YA 3ZC1A 1YKEB 4GOUA 3I0OA 2JPFA 2WWUA 2V7JA 4WNKA 4EZHA 2HN1A 4E7ZA 4QXBB 4O4JE 1HFAA 4DV4T 3U78A 5C3JA 4EAHA 3Q5WA 4QKNA 4KI0F 5IHYA 2L3LA 1HNXT 4DMWA 4BA9A 2CRBA 3RC8A 3ZEFB 2ODVA 3FBLA 1BR4A 5JR9A 4NXNT 4AKIA 4Z90A 5DJQC 5L4HA 3CQGB 4U72A 1D0ZA 2W63A 3NRXA 3CVRA 4IE4A 4GYSA 1T98A 3PUWF 4DR3T 3VRBA 4DBQA 3AEBA 1XNRT 3ZPOA 3UTKA 5FMNA 2L9QA 4DMVA 3RYIE 1E1HB 1NAFA 4CXYA 3CMLA 4TUYE 4I4TE 5FXVA 2VL8A 4X5TA 1I6ZA 1FMWA 4BJNA 4ZI3C 2CLYC 3N9QA 3V5UA 1YXRA 4TN7B 5AQGB 4AQFA 2WBLA 5AQPB 4JI2T 3AXJA 5LGNB 4ILBA 4JEUB 3M3ZB 4UV9B 2E9XB 2FUPA 4QH4A 4KP3C 4PK6A 3PTRB 3LFMA 4IREA 4YXDA 1OWAA 2X0LB 4CN6A 2I59A 3HKCE 2V7MA 3N9OA 3HKEE 3BQLA 2BVMA 2XM1A 5JQGE 5CA0E 1XMOT 3K3NA 1IJ5A 1YKHB 3CX7B 3UU3A 4ANJA 4AKRB 1W9RA 2UU9T 2OA5A 2VASA 4EEBA 5L3CB 1BR0A 2WP9A 1X9BA 2J47A 3PJAA 4LF9T 1CHUA 3AVRA 3FZMB 1HX8A 3H3MA 5FP3A 5GONE 2Y48B 1Z8UA 3PUXF 2WQYA 3KDSE 4ZI7E 2UXDT 3JC6D 2VQFT 1D0XA 5FL1A 3L39A 3F31A 5LCYA 2DI4A 4HFVA 4UVAB 1GQEA 2LOPA 3VKHA 4K0UA 3ZMTB 3AE9A 4YSYA 3AE3A 5LG3A 1NENA 4AKGA 1FEWA 3QC9A 4X20E 4IE0A 4IGUA 3PU3A 2BG9B 4O8SA 2X9YA 1KNPA 3N2GE 4ERRA 2A3DA 3LK2B 3RIFA 4DR5T 5EZYE 2IDOB 5LJMA 3VRAA 4U7YA 3TLVA 4CN4A 3I9YA 4H9SE 3C50A 1JNZA 2W66A 2GK9A 1MMNA 4UV8B 3K1SA 1NEKA 3FZLB 3AE6A 3ZYMA 4PNIA 3C98B 3PUAA 2FJAA 3ZN1B 2RPAA 3ZLIA 1HCIA 2MBGA 3FB2A 1KNZA 3CIRA 3OYXA 2WAUA 2X66A 4WBNE 5LMNT 2BDEA 2MPKA 2ZM2A 5LMUT 4M1PA 2XUEA 1HNZT 4LFCT 3CWZB 4ZS2A 4IDNA 4DV3T 4YSZA 3SS1A 3ZMUB 2RP4A 1WCRA 2PG8A 3AECA 3PUZF 2VL0A 1OEDE 1FMVA 2H3RA 2VKHA 1XDPA 2YDSA 2LSJA 2XQYA 4JI6T 4UVCB 4I55E 2A9UA 5HXEA 2YEVC 2EHOA 3N2KE 3HKDE 1IBKT 1MNEA 3KV6A 4DV2T 2R6GF 2E9XD 2D2SA 2OV9A 3VR9A 5JR9B 3HA4A 2NTYA 1Y64B 3CQCB 3SFDA 4LMJA 5AQQB 2IUBA 5FY7A 2AXDS 1T7SA 3GMIA 2V5DA 4HFCA 3Q5EA 4I43B 3CX8B 5FXXA 2M6BA 3G06A 1UX5A 3AEEA 2VVSA 2XQ3A 3OKQA 5H6QB 1MMDA 3BK9A 3B13A 5CB4E 1W0AA 3OYZA 2E2AA 4DR1T 1MNDA 2YK0A 4YHHT 2WDRA 2DHRA 1KF6A 4GYRA 1JNRA 3AA0B 1NWMX 2D5UA 5HXHA 3C4ZA 3AE8A 3NWIA 2XAFB 5JDMA 1WFDA 2V8SV 1B7TA 2DL1A 4MHCA 5FYMA 4IE7A 1CUNA 3FBZA 3LG7A 4PFOA 1U4QA 5LA6E 3AXJB 3AA1B 4JBWF 5C2TA 4HWCA 1KK7A 4OX9T 2W0GA 4JEHB 4AI6A 2YU2A 3KV9A 5AQFB 3RHWA 3RIUA 4Z91A 2UXBT 4HWFA 3R84B 3RYFE 3ZN0B 4GK5E 3P4RA 2J1DG 3TKLB 1T8BA 4G2AA 2D9DA 5AQSB 3Q5XA 2B1EA 2X9WA 4U2ZA 3DP7A 1ZP0A 3UULA 3JC6C 1IJ6A 2WS3A 3HI2A 3I1AA 1J1JA 4LF4T 2WWVA 5FY1A 2YINA 5ABEA 1MMAA 3JAFA 4XAXB 5JDHA 4ZXLA 2D0TA 2PJQA 2V7KA 2IC6A 3HKBE 3PV0F 3UUXB 4UVBB 3PUSA 4P0AA 2CE7A 2QRXA 3ONJA 3T1YT 4EEDA 5AQOB 4COFA 4TWHA 2KZ7B 2X68A 1LKXA 5L3BB 1VRBA 4IIJE 3LSVA 3N2OA 2WZHA 3OTOT 2LRKA 3UUMA 4CXWA 1HF8A 4H63H 3O9XA 1YW0A 3P8CD 3ESLA 4JI5T 4DV7T 5KMGP 4IE6A 3AA6B 3LK3B 2DWKA 5L3FB 5LHIB 4JI0T 3SRZA 3QUJA 5J0ZA 5JREA 4ZOLE 3X1DA 4U3CA 2UXCT 2CEAA 3T8OA 4U7IA 1WR6A 4LMKA 5JH7E 3T1HT 4IE5A 2ACZA 4AISA 2NTXA 2ZM8A 3PDYA 3AE4A 4HE8A 4QXHB 5AQNB 3EHZA 3Q9DA 4EOZB 4B3MT 4DV1T 2I0MA 3N9NA 5LHGB 5FVKA 2CBJA 3OPCA 4ADZA 2BS2A 4B3RT 2KINB 4QH5A 4NUVA 2E9XC 1VOMA 2Z6EA 5HCMA 4YJ2E 4EYUA 2FJDA 1HG5A 4KMCA 3OVUA 2CXLA 2XSBA 2EHOB 1ZV4X 1W09A 4PAGA 5L2LA 3BQIA 4XZCA 2AE9A 2QGSA 4JI3T 3AEFA 4KHZF 2PTFA 4FJOA 2K48A 4PK4A 1UK5A 4DR4T 3ANWA 5AQKB 3O1HA 3K3QC 2V7LA 1E2AA 3NZQA 4HFEA 3C4WA 3N9LA 4C90A 1OEDA 4H9OC 2XQ9A 2LE8A 4YTPA 2X51A 3CQXC 2UUCT 2VKJA 3A7MA 1HNWT 3ZT6A 2DWGA 4OYKA 4DV0T 4YT0A 5FVLA 5JDNA 2YDRA 4CI3B 5M4YA 4OYJA 1UGOA 2NWBA 1SUMB 3RPUA 4H63V 4O2AE 2ZLYA 3TLWA 3AE5A 4P09A 2K24A 2LSIA 2BG9C 1MIWA 4N78D 1Z0PA 1WRDA 2CMRA 2PFVA 5LGUB 2MYSA 4LF7T 5HEOA 3UFEA 4EIWA 2CBIA 5LXTE 4DO0A 4LF5T 3AE7A 3I9WA 2LKHA 5DQWA 2SPCA 5AQVB 5LBQB 2M6IA 4TV8E 1G8XA 2X67A 4C91A 5HXCA 4DIDB 3UQ7A 4TNWA 2LSGA 3U3IA 3K3OA 4HEAA 1T72A 2KXPB 2Q9QA 3RH3A 1VCSA 2VKDA 3AB3B 3UFGA 2N2NA 2H88A 3ZSSA 2V6XA 2G0UA 2LJLA 2HN2A 2XY8B 2Y8DA 2WSSV 5LOVE 4XBFB 1QUUA 4ILAA 3KBTA 3ZJ2A 4JUYA 3UU5A 4TZ4C 1H7CA 4HN9A 4TWFA 3QK6A 2XAQB 1W0BA 3Q5DA 5JR9C 5AQMB 4EZ4A 5AQHB 2VWAA 4UXNB 4NIQA 1HTJF 5JRCA 4H9PC 3IA3A 5IYZE 4YHJA 1FIOA 2EHOD 3AE2A 4HFBA 3PURA 2KWIB 2XM2A 3OBVE 5AQIB 4ISTA 1WYBA 2W67A 2CXFA 4I50E 3N5LA 3BQKA 4PJLA 5F8PA 1WYCA 3RYCE 2VQET 2W62A 4YTMA 4KUMB 3S4UA 2A2FX 3MK7C 3B5MA 3TLTA 4YSXA 3F2EA 5CGMA 2WY2A 1UUSA 3C4XA 3HL6A 5LBMA 3AAAB 4IT4A 4ZZBA 3NZPA 4AQFC 1R8IA 1BR1A 2WB5A 2XTLA 2DNXA 3FXDB 3UQ4A 3ZCIA 4WW0A 5ABFA 5JVDE 1HS7A 4HTEA 4UIGA 3H3AA 3C64A 2XQ8A 3PUQA 2XSAA 5EK2A 4U2YA 2E5LT 5HEJA 4GK0E 4UF0A 2IMLA 3KINB 2LEHA 2WZIA 2XASB 5J1GA 3AEGA 4WZXA 2IIUA 3NKZA 3AAIA 4ZEYA 3AAEB 3CX6B 3ZMVB 3GA8A 3WAJA 5AQRB 4DUYT 2LHNA 5JDGA 2DLRA 4DVDA 4A97A 5JDLA 3IBPA 4IDOA 1UCUA 5FXZA 3FZKB 4FI5A 3UU8A 4A56A 5BR8T 4X64T 3E08A 4HFIA 3VR8A 3JADA 2JQ9A 5DABA 2WCAA 3UU4A 3PUGA 2D0UA 2V1DB 1J5WA 2H7OA 4KBMB 5LJNA 3EAMA 1D1AA 2HPJA 1V9DA 5L4EA 3KFWX 2QYWA 2KSRA 2DCFA 2LSKA 2W2UA 3PJAJ 2XAHB 5ABGA 2BBHA 4F8HA 3ONXA 2X9HA 5HXRA 4TNVA 3AE1A 3QOFA 2CWYA 3FZHB 1N32T 1IBLT 4MBQA 2MAWA 4UEMA 4L5GA 3PU8A 1SA0E 3RRCA 2XAJB 2K5BB 3RF1A 4JI4T 5J2UE 4EXTA 1KEYA 4QXCB 3MACA 1MMGA 3ZC0A 3MXZA 4EGWA 2LT3A 5L3GB 1YQ3A 2UXXB 2J4GA 3A8YC 3QB5K 4YJ3E 1SE7A 3MJXA 1UURA 2E5VA 3ZYLA 4HFHA 5CJ5A 2XAGB 3SFEA 4YLHA 2YKSA 2IC9A 5IUXA 4ISSA 3ETVA 2MOZA 4BAYB 2NW9A 2IAKA 3CKDA 1S35A 5FL0A 4CZZB 2NW7A 3AEAA 3QB5A 1ZKEA 4PW8A 3V5SA 3LK42 2MTQA 4X62T 3EI0A 2EHOC 3QNUA 3ZT7A 1QSDA 3ONLC 4U74A 2CPTA 3LBXA 2L8KA 4OFZA 2B76A 1D1BA 5HXSA 4L9IA 4DNDA 2BS3A 3P4SA 5JTGA 2VKOA 5JRCB 1Y01A 3E0ZA 5FXWA 5ADXL 3NRYA 1SHZC 1LVFA 4GIWA 2X9XA 3P50A 2FBWA 4WBOA 4MALA 5JDFA 4ZI2D 2UXNB 2N1GA 3GN5A 3JCFA 2BKOA 2ZMAA 2NR4A 4J2CA 2CHNA 2YOEA 4IDQA 3SOLA 1WLXA 3ZYKA 1KFYA 2K3WA 1M62A 4DUZT 2YU1A 4GKJT 4JI1T 3J9X1 2NOXA 4QX8B 4F6RC 2VURA 2J62A 3PUYF 3NBXX 1ZEEA 3GWHA 4IDPA 2JJ9A 4JI8T 5KDMC 3CPZA 1VCTA
chains in the Genus database with same CATH topology
4G63A 2KXPB 2D2SA 2Q9QA 3RH3A 2VKDA 5JR9B 3AB3B 2N2NA 2W00A 3HA4A 2Q9QB 5FNVE 2NTYA 3ZMZB 5E0OA 4AKHA 5LG4A 1Y64B 2G0UA 4QWNB 3CQCB 4Z8XA 4AQGA 2LJLA 2Y8DA 4L0RA 2WSSV 5KX5E 3C51A 5LOVE 4XBFB 4EB6E 5FY7A 4UF0B 1QUUA 4ILUA 3GMIA 3KBTA 4I43B 3CX8B 5FXXA 4MLKA 2BZBA 3FHNA 3ZJ2A 3D0TA 4JUYA 1HG2A 4ASKA 4JLEA 1S94A 5EK3A 2HH7A 1UX5A 2LM9A 4EYYR 4TZ4C 1H7CA 3WAKA 4TV9E 5DQVA 3OKQA 3RC3A 5H6QB 3L09A 1MMDA 3BK9A 3B13A 4HN9A 5CB4E 3QK6A 3OYZA 2RA1A 5BMVE 1MNDA 1X79A 2YK0A 2CM0A 2XAQB 3KBUA 2DHRA 5JR9C 4GYRA 3I0QA 4EZ4A 4H9RC 1G73A 3L3PA 3AA0B 4CXXA 2P9BA 2VWAA 1NWMX 4UXNB 2D5UA 5HXHA 1ZHCA 4AXPA 3C4ZA 5A1LA 4NUUA 1HTJF 2H7VC 4O4LE 4PK5A 5HAXA 5JDQA 2E8IA 5FY0A 5JRCA 2ODUA 2XAFB 5JDMA 4H9PC 5L3DB 2JMHA 1B7TA 1US7B 3O4XE 4CI1B 4MHCA 5FYMA 2WMOA 1CUNA 3FBZA 4IE7A 4YHJA 2V26A 3LG7A 5IYZE 1FIOA 5HYAA 4PFOA 2EHOD 3J7Yq 1U4QA 3PURA 2KWIB 3OBVE 5LA6E 4ISTA 3RYHE 2WMNA 1LVKA 3AA1B 3MZKB 4E7SA 1WYBA 4IDZA 3H37A 2CXFA 4I50E 3N5LA 1KK7A 3IEEA 2W0GA 1OXZA 1MIYA 4JEHB 3IF8B 2Q9QD 4PJNA 2A72A 5LYJE 4AI6A 2YU2A 3BQKA 4HEAA 3KV9A 4CQIA 2C5KT 3EVYA 4PJLA 5F8PA 4AKLA 1WYCA 4TX5A 3RYCE 3EDUA 3KVBA 2W62A 4OK0A 1YD8G 3VU7H 2JMKA 3ZC1A 1YKEB 4GOUA 3R84B 5LGTB 4KUMB 3I0OA 3S4UA 2JPFA 2LHRA 3RYFE 2WWUA 3ZN0B 2V7JA 4WNKA 2A2FX 3MK7C 4GK5E 2IW5B 4EZHA 3VHLA 2KWHA 3F2EA 4E7ZA 4QXBB 4O4JE 1HFAA 2J1DG 3TKLB 3U78A 2C0SA 5C8YE 5CA1E 1IZNB 3F57A 3C4XA 4EAHA 3HL6A 5LBMA 3AAAB 3Q5WA 4QKNA 4G2AA 5IHYA 2L3LA 2W61A 4QHOA 3NZPA 3Q5XA 1UX4A 2B1EA 4DMWA 4BA9A 4AQFC 1D0YA 5H6RB 3RC8A 3ZEFB 2X9WA 1BR1A 3DP7A 2NW8A 3E22E 2ODVA 3JC6C 2XTLA 3FBLA 1IJ6A 3UULA 1O3XA 1BR4A 2PBIA 3HI2A 2DNXA 3I1AA 3FXDB 5JR9A 3SWHA 5LP6E 3ZCIA 4WW0A 5JVDE 4AKIA 1HS7A 4HTEA 5FY1A 4UIGA 3H3AA 5DJQC 2CLYB 2YINA 4HKAA 1MMAA 4XAXB 3C64A 3CQGB 4U72A 5JDHA 1D0ZA 3PUQA 2KT9A 5HWYA 2W63A 2D0TA 2PJQA 5ETWA 2CWOA 3WI3A 5EK2A 2V7KA 2IC6A 3HKBE 3NRXA 3ZJ1A 3CVRA 4O2BE 3UUXB 4IE4A 4GK0E 4UF0A 4UVBB 3PUSA 4GYSA 4P0AA 3O1JA 3KINB 2CE7A 1T98A 3UT5E 4BJMA 3DTOA 2LEHA 4DBQA 2XASB 2KZ7B 2X68A 5J1GA 1LKXA 3ZPOA 3UTKA 5FMNA 5L3BB 1VRBA 3OJAA 4IIJE 3HR0A 2L9QA 3N2OA 3LJCA 4DMVA 5TAOA 3RYIE 1E1HB 4UELA 1NAFA 4CXYA 3CMLA 5F3JA 4TUYE 4I4TE 5FXVA 2VL8A 3UUMA 3AAIA 4CXWA 2KLQA 1HF8A 1FMWA 4H63H 4BJNA 3O9XA 3AAEB 3CX6B 1YW0A 3P8CD 3ZCJA 4H9QC 3ZMVB 4ZI3C 2CLYC 3GA8A 3WAJA 3N9QA 2LHNA 3V5UA 4YFSA 3ESLA 2JQQA 5JDGA 4TN7B 4IE6A 2NP9A 4X1YE 5KMGP 2DLRA 3AA6B 4PJMA 4DVDA 3LK3B 4AQFA 2WBLA 2CXDA 2DWKA 5LNKA 5JDLA 3IBPA 1UCUA 5L3FB 5LGNB 2C5JA 5FXZA 3SRZA 3QUJA 5LHIB 4JEUB 5JREA 4ZOLE 4UV9B 3B57A 2E9XB 1AJ3A 3RX6A 4FI5A 4A56A 3MA9A 3Q2MA 2CEAA 4KP3C 3T8OA 3E08A 3LBXB 4PK6A 5LHHB 5DABA 2LOSA 3PTRB 4ZI2C 1WR6A 3LFMA 3PUGA 5JH7E 4IE5A 2D0UA 2V1DB 4O4IE 1D1CA 1OWAA 2NTXA 2H7OA 2ZM8A 4KBMB 3PDYA 4HE8A 5LJNA 2X0LB 4QXHB 3K8PC 2I59A 3HKCE 1D1AA 2V7MA 3N9OA 3Q9DA 3HKEE 3IHRA 3BQLA 3VKGA 2HPJA 2BVMA 1V9DA 3KFWX 2K9AA 3N9PA 4EOZB 5JQGE 2DCFA 5CA0E 3K3NA 1IJ5A 1YKHB 3CX7B 3N9NA 3P7IA 2LSKA 5LHGB 3RKOA 2XAHB 4ANJA 4AKRB 3ONXA 2X9HA 5HXRA 3GN5B 2OA5A 2VASA 4ADZA 5L3CB 2CWYA 1BR0A 3DJBA 2KINB 2N9DA 4NUVA 2E9XC 1VOMA 4MBQA 2Z6EA 4P0BA 4UEMA 4L5GA 3PU8A 1SA0E 3RRCA 2VK9A 2Y6XA 2VB6A 2XAJB 4X1KE 2K5BB 4YJ2E 1IAPA 3ETUA 3AVRA 5J2UE 4EXTA 1HX8A 4EYUA 4QXCB 3MACA 1MMGA 1BR2A 5FP3A 3MXZA 3ZC0A 5GONE 2Y48B 2LT3A 5L3GB 3FXEB 1MIVA 4B6XA 2UXXB 1HG5A 4KMCA 3KDSE 4ZI7E 2CXLA 2EHOB 3AA7B 3KV5A 3JC6D 1ZV4X 4YJ3E 3MJXA 4PAGA 2KMFA 1D0XA 3ZYLA 5HWXA 5L2LA 4PFPA 3F31A 3BQIA 4XZCA 2QGSA 2XAGB 5LCYA 2DI4A 4HFVA 4UVAB 4O4HE 2LOPA 3VKHA 4YLHA 4FJOA 4K0UA 3ZMTB 2IC9A 3MKDA 3M65A 2WM9A 3N9MA 2K48A 4ISSA 4CI2B 3ETVA 4AKGA 1FEWA 2MOZA 4PK4A 3EUHA 3QC9A 4X20E 3ANWA 4IE0A 2NW9A 4IGUA 3W15B 4BAYB 2IAKA 3CKDA 1S35A 3O1HA 3PU3A 3K3QC 4CZZB 2NW7A 1LRZA 1U5PA 4O8SA 2X9YA 3ANWB 3N2GE 4ERRA 2A3DA 3LK2B 2HPLA 2V7LA 1ZKEA 3NZQA 4H9NC 4QX7B 2CA5A 4PW8A 3R6NA 3UUNA 5EZYE 3V5SA 5LJMA 3C4WA 3N9LA 2LSYA 4C90A 3LK42 2MTQA 2EHOC 3I9YA 1QSDA 3KV4A 4H9SE 4H9OC 3C50A 2LE8A 2E9XA 2X51A 3CQXC 2VKJA 2GK9A 4U74A 2V7IA 1MMNA 4UV8B 5J2TE 3LBXA 2Q9QC 2ZM0A 5EK4A 3ZYMA 4PNIA 4ZI3D 2L8KA 3C98B 2DWGA 3PUAA 4OFZA 4OYKA 1D1BA 3ZN1B 5HXSA 4L9IA 4DNDA 4HGAA 5JDNA 3ZLIA 2VKOA 5JRCB 1HCIA 4CI3B 5M4YA 4OYJA 5AFUL 3E0ZA 2MBGA 5FXWA 2NWBA 4X1IE 3RPUA 3FB2A 4H63V 4OHFA 4O2AE 5ADXL 1KNZA 3OYXA 2WAUA 2ZLYA 3NRYA 2X66A 1SHZC 2ES0A 2KNDA 4WBNE 1LVFA 2BDEA 4P09A 2K24A 2XHEB 2LSIA 1MIWA 2ZM2A 4N78D 1Z0PA 4GIWA 4M1PA 2XUEA 4MFRA 2X9XA 1WRDA 2CMRA 4PJJA 2PFVA 4WBOA 3O1IA 5LGUB 4MALA 4ZS3A 3ZMSB 2MYSA 3CWZB 5JDFA 4ZS2A 4ZI2D 5L3EB 2UXNB 2N1GA 3GN5A 3AVSA 4V1Av 3SS1A 3ZMUB 3PE0A 2ZMAA 4J2CA 2CCQA 3UFEA 2ACXA 4IHJE 2RP4A 4EIWA 2JRKA 2M67A 2PG8A 5LXTE 3RRWA 3EDVA 1FMVA 3SOLA 1WLXA 4DO0A 2H3RA 3ZYKA 2VKHA 2YU1A 3I9WA 3KVAA 4DBRA 2LSJA 3J9X1 5DQWA 2QA7A 2XQYA 4UVCB 2NOXA 2SPCA 4QX8B 4I55E 5LBQB 4F6RC 5HXEA 2YEVC 3NBXX 4TV8E 1ZEEA 4ZHQE 1G8XA 2X67A 3GWHA 2BVLA 2EHOA 2C5IT 3N2KE 4C91A 3HKDE 3A5XA 2JJ9A 5HXCA 1MNEA 1EZ3A 5KDMC 3KV6A 2LSGA 3CPZA 3K3OA 3U3IA 2E9XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXZ A;  1NAF A;  1YD8 G;  1X79 A;  2N9D A;  1O3X A;  2N2N A;  1NWM X;  1WRD A;  1WR6 A; 
#chains in the Genus database with same CATH topology
 4G63 A;  2W00 A;  2XPK A;  5ABF B;  3ABV A;  5FNV E;  5AQJ B;  3ZMZ B;  3RIU C;  2UUB T;  4AKH A;  4QWN B;  4KX6 A;  4Z8X A;  4AQG A;  5HEU A;  1DU2 A;  5KX5 E;  3C51 A;  4EB6 E;  4UF0 B;  2CHO A;  4LML A;  4ILU A;  4ILC A;  5CFB A;  2BZB A;  1HG2 A;  4ASK A;  4K0K T;  1S94 A;  5EK3 A;  4EYY R;  3PUV F;  5HCJ A;  3L09 A;  4A5X A;  2HHH T;  2RA1 A;  5BMV E;  1HR0 T;  1X79 A;  4A98 A;  3UU6 A;  3P4P A;  4P1N A;  1G73 A;  1ZHC A;  5A1L A;  4NUU A;  2JIW A;  4O4L E;  4PK5 A;  2E8I A;  2ODU A;  5L3D B;  2JMH A;  1US7 B;  3O4X E;  2WMO A;  2V26 A;  4UR9 A;  3J7Y q;  4I0U A;  3RYH E;  3TLU A;  3MZK B;  4E7S A;  4IDZ A;  3H37 A;  3IEE A;  1XNQ T;  3RLF F;  2Q9Q D;  4PJN A;  4IL9 A;  4CQI A;  2C5K T;  3EVY A;  2BG9 E;  4AKL A;  4TX5 A;  3EDU A;  4OK0 A;  1YD8 G;  3VU7 H;  2JMK A;  2XQ6 A;  5LGT B;  4HWH A;  2LHR A;  5HEG A;  2WU5 A;  4DR6 T;  3UUB A;  4X65 T;  5AQT B;  2IW5 B;  3VHL A;  2KWH A;  5C8Y E;  2C0S A;  3L8R A;  5CA1 E;  1IZN B;  3F57 A;  4DV6 T;  4QH1 A;  4NXM T;  2W4X A;  4AQY T;  2W61 A;  1WR0 A;  4QHO A;  2XZE A;  2OLT A;  1UX4 A;  1D0Y A;  5H6R B;  2NW8 A;  3E22 E;  1O3X A;  2PBI A;  3SWH A;  5LP6 E;  2CLY B;  4HKA A;  2KT9 A;  4HWI B;  5HWY A;  1KNR A;  5ETW A;  2CWO A;  3WI3 A;  4NPP A;  2VVN A;  2XQ5 A;  1N33 T;  3ZJ1 A;  4O2B E;  1J5E T;  4YTN A;  3RQW A;  3O1J A;  3UT5 E;  4BJM A;  3DTO A;  3TLS A;  3OJA A;  3HR0 A;  3LJC A;  5TAO A;  4UEL A;  5AQL B;  1XDO A;  2WDV A;  4Q25 A;  3ZT5 A;  5F3J A;  4AIU A;  3RIA A;  2F4V T;  4LFA T;  2V6Y A;  2KLQ A;  3ZCJ A;  4H9Q C;  4U33 A;  1XZY A;  4YFS A;  2JQQ A;  2NP9 A;  4X1Y E;  4PJM A;  2LLY A;  2CXD A;  5LNK A;  2C5J A;  3EAB A;  3B57 A;  1AJ3 A;  3RX6 A;  1HX1 B;  3MA9 A;  3Q2M A;  3LBX B;  5LHH B;  2LOS A;  4ZI2 C;  1M7K A;  2V5C A;  4O4I E;  1D1C A;  2XQ7 A;  3K8P C;  2LM2 A;  2YDQ A;  3IHR A;  3VKG A;  3N9P A;  2K9A A;  4KHP T;  3P7I A;  3RKO A;  3FZF B;  4ZZC A;  2QVA A;  2JQH A;  1OED C;  4DR7 T;  3GN5 B;  2XJ7 A;  3DJB A;  2N9D A;  4P0B A;  5F5W A;  4B3S T;  2VK9 A;  2Y6X A;  2VB6 A;  1FJG T;  2IHR 1;  4X1K E;  1IAP A;  3ETU A;  2WU2 A;  3CK6 A;  1N34 T;  4HFD A;  1BR2 A;  3FXE B;  1MIV A;  4B6X A;  5ABH A;  2LRL A;  5LB7 B;  4LF6 T;  3RQU A;  3AA7 B;  3KV5 A;  2BS4 A;  5L47 A;  5AQU B;  2KMF A;  4X66 T;  5HWX A;  4PFP A;  5IWA T;  2ZM6 T;  2UUA T;  4O4H E;  3RI5 A;  4WYV A;  3MKD A;  4LFB T;  3M65 A;  2WM9 A;  3N9M A;  4CI2 B;  1XMQ T;  1ZOY A;  3EUH A;  3W15 B;  1LRZ A;  1U5P A;  3ANW B;  5KXJ A;  3JAE A;  2HPL A;  4QX7 B;  4H9N C;  3R6N A;  2CA5 A;  3UUN A;  1I94 T;  4B3T T;  2LSY A;  2BKP A;  4JYA T;  3KV4 A;  1OED B;  3RGL A;  2E9X A;  2V7I A;  1IBM T;  5J2T E;  2Q9Q C;  4YY3 T;  2ZM0 A;  5EK4 A;  4ZI3 D;  4CN1 A;  5FKY A;  1N36 T;  4HGA A;  2BKN A;  5AFU L;  4HWD A;  4X1I E;  4OHF A;  4TWD A;  2WDQ A;  2ES0 A;  2KND A;  3LDQ B;  2LKG A;  2XHE B;  2H89 A;  4MFR A;  4PJJ A;  3O1I A;  4ZS3 A;  2XQA A;  3ZMS B;  2FJB A;  4LF8 T;  1XWM A;  1E7P A;  5L3E B;  3AVS A;  1QLB A;  4V1A v;  3PE0 A;  4IL4 A;  1YQ4 A;  2CCQ A;  2ACX A;  4IHJ E;  1L0V A;  2BBJ A;  2JRK A;  2M67 A;  3ZKR A;  3RRW A;  3EDV A;  3KVA A;  4DBR A;  2QA7 A;  3NVO A;  4ZHQ E;  2BVL A;  2C5I T;  3A5X A;  1EZ3 A;  4GKK T;  4EV6 A;  3P4Q A;  2Q9Q B;  5E0O A;  5LG4 A;  3P4W A;  4L0R A;  2YN6 A;  2BG9 A;  2X0H A;  4MLK A;  3FHN A;  2XQ4 A;  3D0T A;  4JLE A;  2HH7 A;  2LM9 A;  3WAK A;  4TV9 E;  5DQV A;  3RC3 A;  4DR2 T;  2JQK A;  2CM0 A;  3KBU A;  4JI7 T;  2V6Y B;  3RKG A;  3I0Q A;  2FJE A;  4H9R C;  3L3P A;  4CXX A;  2P9B A;  4AXP A;  2H7V C;  5HAX A;  5JDQ A;  4DV5 T;  5FY0 A;  4CI1 B;  5HYA A;  2WMN A;  3AED A;  1LVK A;  1OXZ A;  1MIY A;  3IF8 B;  5LYJ E;  2A72 A;  5HEH A;  4JV5 T;  2I6H A;  3KVB A;  3ZST A;  4U31 A;  2X0Y A;  3ZC1 A;  1YKE B;  4GOU A;  3I0O A;  2JPF A;  2WWU A;  2V7J A;  4WNK A;  4EZH A;  2HN1 A;  4E7Z A;  4QXB B;  4O4J E;  1HFA A;  4DV4 T;  3U78 A;  5C3J A;  4EAH A;  3Q5W A;  4QKN A;  4KI0 F;  5IHY A;  2L3L A;  1HNX T;  4DMW A;  4BA9 A;  2CRB A;  3RC8 A;  3ZEF B;  2ODV A;  3FBL A;  1BR4 A;  5JR9 A;  4NXN T;  4AKI A;  4Z90 A;  5DJQ C;  5L4H A;  3CQG B;  4U72 A;  1D0Z A;  2W63 A;  3NRX A;  3CVR A;  4IE4 A;  4GYS A;  1T98 A;  3PUW F;  4DR3 T;  3VRB A;  4DBQ A;  3AEB A;  1XNR T;  3ZPO A;  3UTK A;  5FMN A;  2L9Q A;  4DMV A;  3RYI E;  1E1H B;  1NAF A;  4CXY A;  3CML A;  4TUY E;  4I4T E;  5FXV A;  2VL8 A;  4X5T A;  1I6Z A;  1FMW A;  4BJN A;  4ZI3 C;  2CLY C;  3N9Q A;  3V5U A;  1YXR A;  4TN7 B;  5AQG B;  4AQF A;  2WBL A;  5AQP B;  4JI2 T;  3AXJ A;  5LGN B;  4ILB A;  4JEU B;  3M3Z B;  4UV9 B;  2E9X B;  2FUP A;  4QH4 A;  4KP3 C;  4PK6 A;  3PTR B;  3LFM A;  4IRE A;  4YXD A;  1OWA A;  2X0L B;  4CN6 A;  2I59 A;  3HKC E;  2V7M A;  3N9O A;  3HKE E;  3BQL A;  2BVM A;  2XM1 A;  5JQG E;  5CA0 E;  1XMO T;  3K3N A;  1IJ5 A;  1YKH B;  3CX7 B;  3UU3 A;  4ANJ A;  4AKR B;  1W9R A;  2UU9 T;  2OA5 A;  2VAS A;  4EEB A;  5L3C B;  1BR0 A;  2WP9 A;  1X9B A;  2J47 A;  3PJA A;  4LF9 T;  1CHU A;  3AVR A;  3FZM B;  1HX8 A;  3H3M A;  5FP3 A;  5GON E;  2Y48 B;  1Z8U A;  3PUX F;  2WQY A;  3KDS E;  4ZI7 E;  2UXD T;  3JC6 D;  2VQF T;  1D0X A;  5FL1 A;  3L39 A;  3F31 A;  5LCY A;  2DI4 A;  4HFV A;  4UVA B;  1GQE A;  2LOP A;  3VKH A;  4K0U A;  3ZMT B;  3AE9 A;  4YSY A;  3AE3 A;  5LG3 A;  1NEN A;  4AKG A;  1FEW A;  3QC9 A;  4X20 E;  4IE0 A;  4IGU A;  3PU3 A;  2BG9 B;  4O8S A;  2X9Y A;  1KNP A;  3N2G E;  4ERR A;  2A3D A;  3LK2 B;  3RIF A;  4DR5 T;  5EZY E;  2IDO B;  5LJM A;  3VRA A;  4U7Y A;  3TLV A;  4CN4 A;  3I9Y A;  4H9S E;  3C50 A;  1JNZ A;  2W66 A;  2GK9 A;  1MMN A;  4UV8 B;  3K1S A;  1NEK A;  3FZL B;  3AE6 A;  3ZYM A;  4PNI A;  3C98 B;  3PUA A;  2FJA A;  3ZN1 B;  2RPA A;  3ZLI A;  1HCI A;  2MBG A;  3FB2 A;  1KNZ A;  3CIR A;  3OYX A;  2WAU A;  2X66 A;  4WBN E;  5LMN T;  2BDE A;  2MPK A;  2ZM2 A;  5LMU T;  4M1P A;  2XUE A;  1HNZ T;  4LFC T;  3CWZ B;  4ZS2 A;  4IDN A;  4DV3 T;  4YSZ A;  3SS1 A;  3ZMU B;  2RP4 A;  1WCR A;  2PG8 A;  3AEC A;  3PUZ F;  2VL0 A;  1OED E;  1FMV A;  2H3R A;  2VKH A;  1XDP A;  2YDS A;  2LSJ A;  2XQY A;  4JI6 T;  4UVC B;  4I55 E;  2A9U A;  5HXE A;  2YEV C;  2EHO A;  3N2K E;  3HKD E;  1IBK T;  1MNE A;  3KV6 A;  4DV2 T;  2R6G F;  2E9X D;  2D2S A;  2OV9 A;  3VR9 A;  5JR9 B;  3HA4 A;  2NTY A;  1Y64 B;  3CQC B;  3SFD A;  4LMJ A;  5AQQ B;  2IUB A;  5FY7 A;  2AXD S;  1T7S A;  3GMI A;  2V5D A;  4HFC A;  3Q5E A;  4I43 B;  3CX8 B;  5FXX A;  2M6B A;  3G06 A;  1UX5 A;  3AEE A;  2VVS A;  2XQ3 A;  3OKQ A;  5H6Q B;  1MMD A;  3BK9 A;  3B13 A;  5CB4 E;  1W0A A;  3OYZ A;  2E2A A;  4DR1 T;  1MND A;  2YK0 A;  4YHH T;  2WDR A;  2DHR A;  1KF6 A;  4GYR A;  1JNR A;  3AA0 B;  1NWM X;  2D5U A;  5HXH A;  3C4Z A;  3AE8 A;  3NWI A;  2XAF B;  5JDM A;  1WFD A;  2V8S V;  1B7T A;  2DL1 A;  4MHC A;  5FYM A;  4IE7 A;  1CUN A;  3FBZ A;  3LG7 A;  4PFO A;  1U4Q A;  5LA6 E;  3AXJ B;  3AA1 B;  4JBW F;  5C2T A;  4HWC A;  1KK7 A;  4OX9 T;  2W0G A;  4JEH B;  4AI6 A;  2YU2 A;  3KV9 A;  5AQF B;  3RHW A;  3RIU A;  4Z91 A;  2UXB T;  4HWF A;  3R84 B;  3RYF E;  3ZN0 B;  4GK5 E;  3P4R A;  2J1D G;  3TKL B;  1T8B A;  4G2A A;  2D9D A;  5AQS B;  3Q5X A;  2B1E A;  2X9W A;  4U2Z A;  3DP7 A;  1ZP0 A;  3UUL A;  3JC6 C;  1IJ6 A;  2WS3 A;  3HI2 A;  3I1A A;  1J1J A;  4LF4 T;  2WWV A;  5FY1 A;  2YIN A;  5ABE A;  1MMA A;  3JAF A;  4XAX B;  5JDH A;  4ZXL A;  2D0T A;  2PJQ A;  2V7K A;  2IC6 A;  3HKB E;  3PV0 F;  3UUX B;  4UVB B;  3PUS A;  4P0A A;  2CE7 A;  2QRX A;  3ONJ A;  3T1Y T;  4EED A;  5AQO B;  4COF A;  4TWH A;  2KZ7 B;  2X68 A;  1LKX A;  5L3B B;  1VRB A;  4IIJ E;  3LSV A;  3N2O A;  2WZH A;  3OTO T;  2LRK A;  3UUM A;  4CXW A;  1HF8 A;  4H63 H;  3O9X A;  1YW0 A;  3P8C D;  3ESL A;  4JI5 T;  4DV7 T;  5KMG P;  4IE6 A;  3AA6 B;  3LK3 B;  2DWK A;  5L3F B;  5LHI B;  4JI0 T;  3SRZ A;  3QUJ A;  5J0Z A;  5JRE A;  4ZOL E;  3X1D A;  4U3C A;  2UXC T;  2CEA A;  3T8O A;  4U7I A;  1WR6 A;  4LMK A;  5JH7 E;  3T1H T;  4IE5 A;  2ACZ A;  4AIS A;  2NTX A;  2ZM8 A;  3PDY A;  3AE4 A;  4HE8 A;  4QXH B;  5AQN B;  3EHZ A;  3Q9D A;  4EOZ B;  4B3M T;  4DV1 T;  2I0M A;  3N9N A;  5LHG B;  5FVK A;  2CBJ A;  3OPC A;  4ADZ A;  2BS2 A;  4B3R T;  2KIN B;  4QH5 A;  4NUV A;  2E9X C;  1VOM A;  2Z6E A;  5HCM A;  4YJ2 E;  4EYU A;  2FJD A;  1HG5 A;  4KMC A;  3OVU A;  2CXL A;  2XSB A;  2EHO B;  1ZV4 X;  1W09 A;  4PAG A;  5L2L A;  3BQI A;  4XZC A;  2AE9 A;  2QGS A;  4JI3 T;  3AEF A;  4KHZ F;  2PTF A;  4FJO A;  2K48 A;  4PK4 A;  1UK5 A;  4DR4 T;  3ANW A;  5AQK B;  3O1H A;  3K3Q C;  2V7L A;  1E2A A;  3NZQ A;  4HFE A;  3C4W A;  3N9L A;  4C90 A;  1OED A;  4H9O C;  2XQ9 A;  2LE8 A;  4YTP A;  2X51 A;  3CQX C;  2UUC T;  2VKJ A;  3A7M A;  1HNW T;  3ZT6 A;  2DWG A;  4OYK A;  4DV0 T;  4YT0 A;  5FVL A;  5JDN A;  2YDR A;  4CI3 B;  5M4Y A;  4OYJ A;  1UGO A;  2NWB A;  1SUM B;  3RPU A;  4H63 V;  4O2A E;  2ZLY A;  3TLW A;  3AE5 A;  4P09 A;  2K24 A;  2LSI A;  2BG9 C;  1MIW A;  4N78 D;  1Z0P A;  1WRD A;  2CMR A;  2PFV A;  5LGU B;  2MYS A;  4LF7 T;  5HEO A;  3UFE A;  4EIW A;  2CBI A;  5LXT E;  4DO0 A;  4LF5 T;  3AE7 A;  3I9W A;  2LKH A;  5DQW A;  2SPC A;  5AQV B;  5LBQ B;  2M6I A;  4TV8 E;  1G8X A;  2X67 A;  4C91 A;  5HXC A;  4DID B;  3UQ7 A;  4TNW A;  2LSG A;  3U3I A;  3K3O A;  4HEA A;  1T72 A;  2KXP B;  2Q9Q A;  3RH3 A;  1VCS A;  2VKD A;  3AB3 B;  3UFG A;  2N2N A;  2H88 A;  3ZSS A;  2V6X A;  2G0U A;  2LJL A;  2HN2 A;  2XY8 B;  2Y8D A;  2WSS V;  5LOV E;  4XBF B;  1QUU A;  4ILA A;  3KBT A;  3ZJ2 A;  4JUY A;  3UU5 A;  4TZ4 C;  1H7C A;  4HN9 A;  4TWF A;  3QK6 A;  2XAQ B;  1W0B A;  3Q5D A;  5JR9 C;  5AQM B;  4EZ4 A;  5AQH B;  2VWA A;  4UXN B;  4NIQ A;  1HTJ F;  5JRC A;  4H9P C;  3IA3 A;  5IYZ E;  4YHJ A;  1FIO A;  2EHO D;  3AE2 A;  4HFB A;  3PUR A;  2KWI B;  2XM2 A;  3OBV E;  5AQI B;  4IST A;  1WYB A;  2W67 A;  2CXF A;  4I50 E;  3N5L A;  3BQK A;  4PJL A;  5F8P A;  1WYC A;  3RYC E;  2VQE T;  2W62 A;  4YTM A;  4KUM B;  3S4U A;  2A2F X;  3MK7 C;  3B5M A;  3TLT A;  4YSX A;  3F2E A;  5CGM A;  2WY2 A;  1UUS A;  3C4X A;  3HL6 A;  5LBM A;  3AAA B;  4IT4 A;  4ZZB A;  3NZP A;  4AQF C;  1R8I A;  1BR1 A;  2WB5 A;  2XTL A;  2DNX A;  3FXD B;  3UQ4 A;  3ZCI A;  4WW0 A;  5ABF A;  5JVD E;  1HS7 A;  4HTE A;  4UIG A;  3H3A A;  3C64 A;  2XQ8 A;  3PUQ A;  2XSA A;  5EK2 A;  4U2Y A;  2E5L T;  5HEJ A;  4GK0 E;  4UF0 A;  2IML A;  3KIN B;  2LEH A;  2WZI A;  2XAS B;  5J1G A;  3AEG A;  4WZX A;  2IIU A;  3NKZ A;  3AAI A;  4ZEY A;  3AAE B;  3CX6 B;  3ZMV B;  3GA8 A;  3WAJ A;  5AQR B;  4DUY T;  2LHN A;  5JDG A;  2DLR A;  4DVD A;  4A97 A;  5JDL A;  3IBP A;  4IDO A;  1UCU A;  5FXZ A;  3FZK B;  4FI5 A;  3UU8 A;  4A56 A;  5BR8 T;  4X64 T;  3E08 A;  4HFI A;  3VR8 A;  3JAD A;  2JQ9 A;  5DAB A;  2WCA A;  3UU4 A;  3PUG A;  2D0U A;  2V1D B;  1J5W A;  2H7O A;  4KBM B;  5LJN A;  3EAM A;  1D1A A;  2HPJ A;  1V9D A;  5L4E A;  3KFW X;  2QYW A;  2KSR A;  2DCF A;  2LSK A;  2W2U A;  3PJA J;  2XAH B;  5ABG A;  2BBH A;  4F8H A;  3ONX A;  2X9H A;  5HXR A;  4TNV A;  3AE1 A;  3QOF A;  2CWY A;  3FZH B;  1N32 T;  1IBL T;  4MBQ A;  2MAW A;  4UEM A;  4L5G A;  3PU8 A;  1SA0 E;  3RRC A;  2XAJ B;  2K5B B;  3RF1 A;  4JI4 T;  5J2U E;  4EXT A;  1KEY A;  4QXC B;  3MAC A;  1MMG A;  3ZC0 A;  3MXZ A;  4EGW A;  2LT3 A;  5L3G B;  1YQ3 A;  2UXX B;  2J4G A;  3A8Y C;  3QB5 K;  4YJ3 E;  1SE7 A;  3MJX A;  1UUR A;  2E5V A;  3ZYL A;  4HFH A;  5CJ5 A;  2XAG B;  3SFE A;  4YLH A;  2YKS A;  2IC9 A;  5IUX A;  4ISS A;  3ETV A;  2MOZ A;  4BAY B;  2NW9 A;  2IAK A;  3CKD A;  1S35 A;  5FL0 A;  4CZZ B;  2NW7 A;  3AEA A;  3QB5 A;  1ZKE A;  4PW8 A;  3V5S A;  3LK4 2;  2MTQ A;  4X62 T;  3EI0 A;  2EHO C;  3QNU A;  3ZT7 A;  1QSD A;  3ONL C;  4U74 A;  2CPT A;  3LBX A;  2L8K A;  4OFZ A;  2B76 A;  1D1B A;  5HXS A;  4L9I A;  4DND A;  2BS3 A;  3P4S A;  5JTG A;  2VKO A;  5JRC B;  1Y01 A;  3E0Z A;  5FXW A;  5ADX L;  3NRY A;  1SHZ C;  1LVF A;  4GIW A;  2X9X A;  3P50 A;  2FBW A;  4WBO A;  4MAL A;  5JDF A;  4ZI2 D;  2UXN B;  2N1G A;  3GN5 A;  3JCF A;  2BKO A;  2ZMA A;  2NR4 A;  4J2C A;  2CHN A;  2YOE A;  4IDQ A;  3SOL A;  1WLX A;  3ZYK A;  1KFY A;  2K3W A;  1M62 A;  4DUZ T;  2YU1 A;  4GKJ T;  4JI1 T;  3J9X 1;  2NOX A;  4QX8 B;  4F6R C;  2VUR A;  2J62 A;  3PUY F;  3NBX X;  1ZEE A;  3GWH A;  4IDP A;  2JJ9 A;  4JI8 T;  5KDM C;  3CPZ A;  1VCT A; 
#chains in the Genus database with same CATH homology
 4G63 A;  2KXP B;  2D2S A;  2Q9Q A;  3RH3 A;  2VKD A;  5JR9 B;  3AB3 B;  2N2N A;  2W00 A;  3HA4 A;  2Q9Q B;  5FNV E;  2NTY A;  3ZMZ B;  5E0O A;  4AKH A;  5LG4 A;  1Y64 B;  2G0U A;  4QWN B;  3CQC B;  4Z8X A;  4AQG A;  2LJL A;  2Y8D A;  4L0R A;  2WSS V;  5KX5 E;  3C51 A;  5LOV E;  4XBF B;  4EB6 E;  5FY7 A;  4UF0 B;  1QUU A;  4ILU A;  3GMI A;  3KBT A;  4I43 B;  3CX8 B;  5FXX A;  4MLK A;  2BZB A;  3FHN A;  3ZJ2 A;  3D0T A;  4JUY A;  1HG2 A;  4ASK A;  4JLE A;  1S94 A;  5EK3 A;  2HH7 A;  1UX5 A;  2LM9 A;  4EYY R;  4TZ4 C;  1H7C A;  3WAK A;  4TV9 E;  5DQV A;  3OKQ A;  3RC3 A;  5H6Q B;  3L09 A;  1MMD A;  3BK9 A;  3B13 A;  4HN9 A;  5CB4 E;  3QK6 A;  3OYZ A;  2RA1 A;  5BMV E;  1MND A;  1X79 A;  2YK0 A;  2CM0 A;  2XAQ B;  3KBU A;  2DHR A;  5JR9 C;  4GYR A;  3I0Q A;  4EZ4 A;  4H9R C;  1G73 A;  3L3P A;  3AA0 B;  4CXX A;  2P9B A;  2VWA A;  1NWM X;  4UXN B;  2D5U A;  5HXH A;  1ZHC A;  4AXP A;  3C4Z A;  5A1L A;  4NUU A;  1HTJ F;  2H7V C;  4O4L E;  4PK5 A;  5HAX A;  5JDQ A;  2E8I A;  5FY0 A;  5JRC A;  2ODU A;  2XAF B;  5JDM A;  4H9P C;  5L3D B;  2JMH A;  1B7T A;  1US7 B;  3O4X E;  4CI1 B;  4MHC A;  5FYM A;  2WMO A;  1CUN A;  3FBZ A;  4IE7 A;  4YHJ A;  2V26 A;  3LG7 A;  5IYZ E;  1FIO A;  5HYA A;  4PFO A;  2EHO D;  3J7Y q;  1U4Q A;  3PUR A;  2KWI B;  3OBV E;  5LA6 E;  4IST A;  3RYH E;  2WMN A;  1LVK A;  3AA1 B;  3MZK B;  4E7S A;  1WYB A;  4IDZ A;  3H37 A;  2CXF A;  4I50 E;  3N5L A;  1KK7 A;  3IEE A;  2W0G A;  1OXZ A;  1MIY A;  4JEH B;  3IF8 B;  2Q9Q D;  4PJN A;  2A72 A;  5LYJ E;  4AI6 A;  2YU2 A;  3BQK A;  4HEA A;  3KV9 A;  4CQI A;  2C5K T;  3EVY A;  4PJL A;  5F8P A;  4AKL A;  1WYC A;  4TX5 A;  3RYC E;  3EDU A;  3KVB A;  2W62 A;  4OK0 A;  1YD8 G;  3VU7 H;  2JMK A;  3ZC1 A;  1YKE B;  4GOU A;  3R84 B;  5LGT B;  4KUM B;  3I0O A;  3S4U A;  2JPF A;  2LHR A;  3RYF E;  2WWU A;  3ZN0 B;  2V7J A;  4WNK A;  2A2F X;  3MK7 C;  4GK5 E;  2IW5 B;  4EZH A;  3VHL A;  2KWH A;  3F2E A;  4E7Z A;  4QXB B;  4O4J E;  1HFA A;  2J1D G;  3TKL B;  3U78 A;  2C0S A;  5C8Y E;  5CA1 E;  1IZN B;  3F57 A;  3C4X A;  4EAH A;  3HL6 A;  5LBM A;  3AAA B;  3Q5W A;  4QKN A;  4G2A A;  5IHY A;  2L3L A;  2W61 A;  4QHO A;  3NZP A;  3Q5X A;  1UX4 A;  2B1E A;  4DMW A;  4BA9 A;  4AQF C;  1D0Y A;  5H6R B;  3RC8 A;  3ZEF B;  2X9W A;  1BR1 A;  3DP7 A;  2NW8 A;  3E22 E;  2ODV A;  3JC6 C;  2XTL A;  3FBL A;  1IJ6 A;  3UUL A;  1O3X A;  1BR4 A;  2PBI A;  3HI2 A;  2DNX A;  3I1A A;  3FXD B;  5JR9 A;  3SWH A;  5LP6 E;  3ZCI A;  4WW0 A;  5JVD E;  4AKI A;  1HS7 A;  4HTE A;  5FY1 A;  4UIG A;  3H3A A;  5DJQ C;  2CLY B;  2YIN A;  4HKA A;  1MMA A;  4XAX B;  3C64 A;  3CQG B;  4U72 A;  5JDH A;  1D0Z A;  3PUQ A;  2KT9 A;  5HWY A;  2W63 A;  2D0T A;  2PJQ A;  5ETW A;  2CWO A;  3WI3 A;  5EK2 A;  2V7K A;  2IC6 A;  3HKB E;  3NRX A;  3ZJ1 A;  3CVR A;  4O2B E;  3UUX B;  4IE4 A;  4GK0 E;  4UF0 A;  4UVB B;  3PUS A;  4GYS A;  4P0A A;  3O1J A;  3KIN B;  2CE7 A;  1T98 A;  3UT5 E;  4BJM A;  3DTO A;  2LEH A;  4DBQ A;  2XAS B;  2KZ7 B;  2X68 A;  5J1G A;  1LKX A;  3ZPO A;  3UTK A;  5FMN A;  5L3B B;  1VRB A;  3OJA A;  4IIJ E;  3HR0 A;  2L9Q A;  3N2O A;  3LJC A;  4DMV A;  5TAO A;  3RYI E;  1E1H B;  4UEL A;  1NAF A;  4CXY A;  3CML A;  5F3J A;  4TUY E;  4I4T E;  5FXV A;  2VL8 A;  3UUM A;  3AAI A;  4CXW A;  2KLQ A;  1HF8 A;  1FMW A;  4H63 H;  4BJN A;  3O9X A;  3AAE B;  3CX6 B;  1YW0 A;  3P8C D;  3ZCJ A;  4H9Q C;  3ZMV B;  4ZI3 C;  2CLY C;  3GA8 A;  3WAJ A;  3N9Q A;  2LHN A;  3V5U A;  4YFS A;  3ESL A;  2JQQ A;  5JDG A;  4TN7 B;  4IE6 A;  2NP9 A;  4X1Y E;  5KMG P;  2DLR A;  3AA6 B;  4PJM A;  4DVD A;  3LK3 B;  4AQF A;  2WBL A;  2CXD A;  2DWK A;  5LNK A;  5JDL A;  3IBP A;  1UCU A;  5L3F B;  5LGN B;  2C5J A;  5FXZ A;  3SRZ A;  3QUJ A;  5LHI B;  4JEU B;  5JRE A;  4ZOL E;  4UV9 B;  3B57 A;  2E9X B;  1AJ3 A;  3RX6 A;  4FI5 A;  4A56 A;  3MA9 A;  3Q2M A;  2CEA A;  4KP3 C;  3T8O A;  3E08 A;  3LBX B;  4PK6 A;  5LHH B;  5DAB A;  2LOS A;  3PTR B;  4ZI2 C;  1WR6 A;  3LFM A;  3PUG A;  5JH7 E;  4IE5 A;  2D0U A;  2V1D B;  4O4I E;  1D1C A;  1OWA A;  2NTX A;  2H7O A;  2ZM8 A;  4KBM B;  3PDY A;  4HE8 A;  5LJN A;  2X0L B;  4QXH B;  3K8P C;  2I59 A;  3HKC E;  1D1A A;  2V7M A;  3N9O A;  3Q9D A;  3HKE E;  3IHR A;  3BQL A;  3VKG A;  2HPJ A;  2BVM A;  1V9D A;  3KFW X;  2K9A A;  3N9P A;  4EOZ B;  5JQG E;  2DCF A;  5CA0 E;  3K3N A;  1IJ5 A;  1YKH B;  3CX7 B;  3N9N A;  3P7I A;  2LSK A;  5LHG B;  3RKO A;  2XAH B;  4ANJ A;  4AKR B;  3ONX A;  2X9H A;  5HXR A;  3GN5 B;  2OA5 A;  2VAS A;  4ADZ A;  5L3C B;  2CWY A;  1BR0 A;  3DJB A;  2KIN B;  2N9D A;  4NUV A;  2E9X C;  1VOM A;  4MBQ A;  2Z6E A;  4P0B A;  4UEM A;  4L5G A;  3PU8 A;  1SA0 E;  3RRC A;  2VK9 A;  2Y6X A;  2VB6 A;  2XAJ B;  4X1K E;  2K5B B;  4YJ2 E;  1IAP A;  3ETU A;  3AVR A;  5J2U E;  4EXT A;  1HX8 A;  4EYU A;  4QXC B;  3MAC A;  1MMG A;  1BR2 A;  5FP3 A;  3MXZ A;  3ZC0 A;  5GON E;  2Y48 B;  2LT3 A;  5L3G B;  3FXE B;  1MIV A;  4B6X A;  2UXX B;  1HG5 A;  4KMC A;  3KDS E;  4ZI7 E;  2CXL A;  2EHO B;  3AA7 B;  3KV5 A;  3JC6 D;  1ZV4 X;  4YJ3 E;  3MJX A;  4PAG A;  2KMF A;  1D0X A;  3ZYL A;  5HWX A;  5L2L A;  4PFP A;  3F31 A;  3BQI A;  4XZC A;  2QGS A;  2XAG B;  5LCY A;  2DI4 A;  4HFV A;  4UVA B;  4O4H E;  2LOP A;  3VKH A;  4YLH A;  4FJO A;  4K0U A;  3ZMT B;  2IC9 A;  3MKD A;  3M65 A;  2WM9 A;  3N9M A;  2K48 A;  4ISS A;  4CI2 B;  3ETV A;  4AKG A;  1FEW A;  2MOZ A;  4PK4 A;  3EUH A;  3QC9 A;  4X20 E;  3ANW A;  4IE0 A;  2NW9 A;  4IGU A;  3W15 B;  4BAY B;  2IAK A;  3CKD A;  1S35 A;  3O1H A;  3PU3 A;  3K3Q C;  4CZZ B;  2NW7 A;  1LRZ A;  1U5P A;  4O8S A;  2X9Y A;  3ANW B;  3N2G E;  4ERR A;  2A3D A;  3LK2 B;  2HPL A;  2V7L A;  1ZKE A;  3NZQ A;  4H9N C;  4QX7 B;  2CA5 A;  4PW8 A;  3R6N A;  3UUN A;  5EZY E;  3V5S A;  5LJM A;  3C4W A;  3N9L A;  2LSY A;  4C90 A;  3LK4 2;  2MTQ A;  2EHO C;  3I9Y A;  1QSD A;  3KV4 A;  4H9S E;  4H9O C;  3C50 A;  2LE8 A;  2E9X A;  2X51 A;  3CQX C;  2VKJ A;  2GK9 A;  4U74 A;  2V7I A;  1MMN A;  4UV8 B;  5J2T E;  3LBX A;  2Q9Q C;  2ZM0 A;  5EK4 A;  3ZYM A;  4PNI A;  4ZI3 D;  2L8K A;  3C98 B;  2DWG A;  3PUA A;  4OFZ A;  4OYK A;  1D1B A;  3ZN1 B;  5HXS A;  4L9I A;  4DND A;  4HGA A;  5JDN A;  3ZLI A;  2VKO A;  5JRC B;  1HCI A;  4CI3 B;  5M4Y A;  4OYJ A;  5AFU L;  3E0Z A;  2MBG A;  5FXW A;  2NWB A;  4X1I E;  3RPU A;  3FB2 A;  4H63 V;  4OHF A;  4O2A E;  5ADX L;  1KNZ A;  3OYX A;  2WAU A;  2ZLY A;  3NRY A;  2X66 A;  1SHZ C;  2ES0 A;  2KND A;  4WBN E;  1LVF A;  2BDE A;  4P09 A;  2K24 A;  2XHE B;  2LSI A;  1MIW A;  2ZM2 A;  4N78 D;  1Z0P A;  4GIW A;  4M1P A;  2XUE A;  4MFR A;  2X9X A;  1WRD A;  2CMR A;  4PJJ A;  2PFV A;  4WBO A;  3O1I A;  5LGU B;  4MAL A;  4ZS3 A;  3ZMS B;  2MYS A;  3CWZ B;  5JDF A;  4ZS2 A;  4ZI2 D;  5L3E B;  2UXN B;  2N1G A;  3GN5 A;  3AVS A;  4V1A v;  3SS1 A;  3ZMU B;  3PE0 A;  2ZMA A;  4J2C A;  2CCQ A;  3UFE A;  2ACX A;  4IHJ E;  2RP4 A;  4EIW A;  2JRK A;  2M67 A;  2PG8 A;  5LXT E;  3RRW A;  3EDV A;  1FMV A;  3SOL A;  1WLX A;  4DO0 A;  2H3R A;  3ZYK A;  2VKH A;  2YU1 A;  3I9W A;  3KVA A;  4DBR A;  2LSJ A;  3J9X 1;  5DQW A;  2QA7 A;  2XQY A;  4UVC B;  2NOX A;  2SPC A;  4QX8 B;  4I55 E;  5LBQ B;  4F6R C;  5HXE A;  2YEV C;  3NBX X;  4TV8 E;  1ZEE A;  4ZHQ E;  1G8X A;  2X67 A;  3GWH A;  2BVL A;  2EHO A;  2C5I T;  3N2K E;  4C91 A;  3HKD E;  3A5X A;  2JJ9 A;  5HXC A;  1MNE A;  1EZ3 A;  5KDM C;  3KV6 A;  2LSG A;  3CPZ A;  3K3O A;  3U3I A;  2E9X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...