1X79A

Crystal structure of human gga1 gat domain complexed with the gat-binding domain of rabaptin5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
82
Chain Sequence
ISKRVNAIEEVNNNVKLLTEMVMSHSSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 32
structure length 82
sequence length 89
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1x79A00
1NWMX 1X79A 1WR6A 1NAFA 2N2NA 1WRDA 2N9DA 1O3XA 1YD8G 1OXZA
chains in the Genus database with same CATH superfamily
2KMFA 3AE8A 2E9XC 4AKHA 4HFEA 3C4XA 5IYZE 4YSYA 3QNUA 2JIWA 3LK42 2CA5A 5HXHA 3VRAA 2Q9QD 5TAOA 4DV1T 2IC6A 4B3MT 1HNZT 5FXZA 3VR8A 1IBLT 1ZV4X 1FJGT 3JCFA 3QUJA 3RHWA 4C90A 2LLYA 2FJBA 4ZS3A 2MYSA 4MBQA 3KDSE 2PFVA 2HH7A 3AVSA 2WMNA 3FBLA 2EHOB 1YXRA 3KV4A 3I9YA 5HWXA 3B57A 1FIOA 2XSAA 2A72A 3LBXB 2E2AA 4I55E 3TLSA 3JC6C 3LK2B 2XTLA 4QXBB 2B76A 1OEDB 4ZS2A 5LHIB 3NRXA 4DR4T 4U31A 3K3NA 4B3RT 1BR4A 3AA6B 2XQYA 2XAQB 2WBLA 5HEGA 4WZXA 4AQGA 3AAEB 1ZP0A 3PUWF 1T8BA 4HTEA 1OEDC 5H6RB 5LMNT 4NUUA 3HKCE 1ZKEA 2FJDA 2IHR1 5EK4A 3RIFA 3UUXB 3VU7H 5LJMA 5ABFB 3RKOA 3GWHA 3RF1A 4UV8B 2V7MA 3C98B 1NWMX 2BVLA 3RKGA 4CXYA 3RX6A 3T1YT 4N78D 5LP6E 3EAMA 3OKQA 3ETUA 4X62T 2WSSV 2XQ7A 1LVFA 4ZHQE 4HFHA 3E08A 2LOPA 1OEDE 3WAKA 4MHCA 3PUZF 3PU8A 3TKLB 4ILBA 2DWKA 5CFBA 4OK0A 4CI1B 3Q5XA 3ZYKA 1N33T 1XDOA 3UUNA 5AFUL 4NXNT 3PJAA 1FEWA 4PJLA 1QLBA 3PUXF 3ZPOA 2LSYA 5AQTB 4M1PA 4DBQA 3E22E 4QH4A 3V5SA 2FBWA 4HFBA 2XAJB 2NW7A 5J0ZA 3SFEA 1VRBA 2YEVC 3K3QC 3OVUA 1IBKT 2VQFT 5J2UE 2LJLA 4BAYB 4LFAT 3T8OA 5EZYE 4OX9T 3X1DA 4UIGA 5EK3A 1HG5A 1XNQT 3SFDA 2X9HA 2RP4A 4EXTA 2BS4A 4DR6T 5C3JA 4YLHA 4F6RC 1UX5A 3KV6A 2VASA 3FXDB 3RIAA 4JYAT 2V7JA 1BR0A 3KBTA 2X51A 4LF4T 3O1JA 4AXPA 4ILAA 5L3GB 4EV6A 2YU1A 2EHOA 5JQGE 3PU3A 4LF6T 5J1GA 3LBXA 5JREA 2QGSA 2J62A 3F57A 5AQQB 1OEDA 2BBJA 2QYWA 3PUSA 2FUPA 1KFYA 2VB6A 3MACA 2PG8A 1T7SA 3AAAB 4IDPA 2V7IA 4EYYR 2LM2A 3DP7A 2DL1A 5C2TA 3JADA 4HFIA 4WW0A 4P0AA 5JH7E 4AIUA 3M3ZB 4GK0E 2CXLA 3NVOA 2CLYB 3CMLA 2RPAA 2UUBT 3B5MA 3ABVA 3JC6D 4QXCB 2JQKA 5ABFA 4CI3B 1HF8A 1U4QA 2WU2A 1QSDA 2W63A 2V1DB 4X66T 2LOSA 5DQVA 4XZCA 4JV5T 2V26A 2HN2A 3JAEA 3P4RA 3OBVE 2CXDA 2LHNA 4I4TE 4L5GA 4DO0A 1LVKA 4H63V 4IREA 2KNDA 4KMCA 2JQQA 1S94A 1US7B 2E5LT 5JTGA 4A98A 4YXDA 3FB2A 2Z6EA 4CZZB 4NIQA 2H3RA 3E0ZA 3LJCA 3EDVA 1EZ3A 2LEHA 2YU2A 4O8SA 4WYVA 1SHZC 2UU9T 5LGTB 1JNZA 2IAKA 2M6BA 4HWCA 5FXVA 2I6HA 5HXRA 3IHRA 2WU5A 3HA4A 4QKNA 2FJAA 3PUQA 5FL1A 3A8YC 4DR7T 2WZHA 4H9PC 1E2AA 3KVBA 1U5PA 3ONLC 3QK6A 3Q5EA 2XQ8A 3HKBE 3HI2A 2BBHA 2D2SA 3C4WA 5HCJA 2KINB 4ZI2C 3HR0A 3LK3B 3TLUA 3AE5A 2MTQA 4WBOA 4PFPA 3ZT5A 4E7ZA 1MIVA 2WQYA 3C50A 4UVCB 3R6NA 3MXZA 1YW0A 2OV9A 3ZCIA 4IDOA 4ZEYA 2LM9A 3CPZA 2W62A 2XAFB 5LHHB 3QC9A 4U7YA 4LMLA 2UXBT 5AQFB 4DV7T 5L3BB 3ESLA 2X66A 2VKHA 4TZ4C 1H7CA 5LHGB 1LRZA 2QRXA 5LBMA 2VKJA 2N1GA 3FBZA 2YDQA 4XAXB 3T1HT 4IE4A 3MA9A 3PJAJ 3RLFF 3SS1A 2YINA 3FZLB 3O1HA 5ABGA 3FZKB 5CJ5A 5FYMA 2J47A 2HPLA 3PUVF 1MNDA 2VVSA 3CWZB 2LRKA 4HWIB 5JDHA 2DNXA 1Z0PA 4YHJA 2IMLA 4ZI3C 3KVAA 5HYAA 4B3ST 2PJQA 4JEHB 1I6ZA 5LMUT 3UFGA 5JDFA 5IWAT 3L8RA 5JDMA 3ZN0B 3NRYA 4X20E 2K3WA 4H9RC 3AECA 5DJQC 3FHNA 3AE6A 3ZJ2A 4X5TA 1E1HB 1JNRA 3ZSSA 4L0RA 1Y64B 4CQIA 4DV5T 3ETVA 2K48A 2NTYA 2Y48B 3A7MA 4YTPA 3L09A 4YT0A 2F4VT 3FXEB 1HG2A 2XUEA 3PDYA 4OHFA 3RYHE 3QB5K 2BG9B 2UXCT 4YHHT 4EIWA 2FJEA 2JQHA 2XM1A 3LFMA 5LYJE 4C91A 4OYJA 3NZPA 4O4JE 4O4LE 4AKRB 4HWHA 3UU8A 4O2AE 4ZZCA 2A9UA 3O4XE 2BS3A 3AB3B 4KX6A 3AE1A 3BQIA 3L39A 5AQKB 2BG9C 3PUGA 4X64T 4ZOLE 5CA1E 3N9PA 2WY2A 3FZHB 2OLTA 2BKNA 4AKGA 2CCQA 2A2FX 1UUSA 5AQUB 2DCFA 1J1JA 2CHOA 3BK9A 2EHOC 1X9BA 2WM9A 5ABEA 1FMVA 4LF9T 4GKJT 3B13A 3MJXA 3TLTA 3FZFB 3MKDA 3VR9A 2BVMA 3P4QA 3UTKA 3ZC1A 2W4XA 2XZEA 4E7SA 4PK4A 3RI5A 3ZYLA 4DR2T 2H88A 4H63H 4NUVA 4X65T 3RYIE 3ZC0A 2V7KA 5HEOA 2YN6A 2ZMAA 2M67A 1YD8G 4YJ3E 3CX8B 3UT5E 3AA0B 3AEBA 2UXDT 2JPFA 2AE9A 4L9IA 2L9QA 4DV2T 2DWGA 4QWNB 1UURA 1J5WA 2WAUA 2D9DA 4WBNE 4QH1A 4HWFA 2VKDA 4H9QC 4HE8A 3S4UA 4UEMA 2WS3A 3KV9A 3GA8A 4GYSA 4EZ4A 2LT3A 1T72A 5L3EB 4QXHB 3LG7A 3J9X1 4EZHA 1HS7A 2KT9A 4CN6A 3ZMSB 1Y01A 4ZI2D 3C51A 3UQ4A 4TWFA 3CKDA 2NW8A 5H6QB 3HKDE 5L2LA 3RPUA 1IJ5A 3AXJB 1R8IA 1M62A 1N34T 3KBUA 1LKXA 3UU5A 4BA9A 2XAGB 4IDZA 4P0BA 4Z91A 2XPKA 3EUHA 3MZKB 2WMOA 3I0QA 4ILCA 1D0YA 5IHYA 4CN1A 1NENA 2N2NA 3F2EA 3H3MA 2H7OA 3EHZA 5AQNB 4G2AA 4TWDA 4KHZF 5C8YE 4TV8E 3UUMA 2IC9A 2V6YB 4EYUA 2XHEB 4YJ2E 2YDRA 2NWBA 3F31A 5AQLB 5FVLA 5LCYA 3H37A 2W2UA 5KDMC 4EGWA 4ZI3D 2HPJA 2PTFA 3IF8B 4IE7A 2X9WA 2BG9A 2WWUA 2L3LA 1VOMA 2ZM0A 4YTNA 5DABA 1KNRA 3GMIA 3OYXA 4EEBA 2X9XA 1CHUA 4HFCA 4IE0A 3CQXC 5LG3A 2JQ9A 4O4IE 4DUYT 3AVRA 2Q9QB 3IA3A 3GN5B 1L0VA 3ZT7A 2N9DA 2X67A 5HXCA 2HN1A 4MALA 1QUUA 3AE2A 2XQAA 1VCTA 5JDGA 3P4PA 4KP3C 3Q2MA 1SUMB 3W15B 3RC8A 2V5CA 4BJMA 2CE7A 2D0TA 2XQ6A 4MLKA 3UFEA 4JI8T 3ONXA 3RGLA 4DMVA 4DR5T 3IEEA 3RRWA 1HCIA 4LF8T 3ZMUB 3N2GE 4ERRA 2ACZA 1FMWA 2K5BB 5DQWA 1T98A 3OPCA 4JLEA 4IGUA 4QH5A 3N2KE 3CQGB 4U72A 2CWOA 2NOXA 4CXWA 2KZ7B 2EHOD 3JAFA 5L3DB 5HWYA 2K24A 4PNIA 2CLYC 5LA6E 4GOUA 1D1AA 5F8PA 4NXMT 5LNKA 3ZMZB 3D0TA 4UR9A 5BMVE 1DU2A 4UF0B 2CBIA 1IZNB 4OYKA 4TN7B 4IDNA 4ZZBA 1YKEB 1B7TA 1WYBA 1W0BA 3U78A 4I43B 2W61A 3EI0A 2LE8A 1J5ET 4IT4A 4KI0F 3ZLIA 4GYRA 3PUAA 3AXJA 4I0UA 4YY3T 4OFZA 3C4ZA 2AXDS 3V5UA 5AQRB 3OJAA 1MIWA 2YOEA 4ILUA 4DV6T 2MAWA 1G73A 5FY0A 1MMAA 5AQIB 2LRLA 5M4YA 1BR1A 1IBMT 3ONJA 4YTMA 2IW5B 4IL9A 4AI6A 4J2CA 1D1BA 3SRZA 2VL0A 4DNDA 4LF7T 3AA1B 5HEUA 2C0SA 3SOLA 3HL6A 4DVDA 2V6YA 1M7KA 4HFDA 4H9OC 4UVBB 2MPKA 3L3PA 4DMWA 3AE3A 1OWAA 2CXFA 3CVRA 5GONE 2J4GA 5LXTE 1AJ3A 3WAJA 4JBWF 3AEFA 4I50E 2CHNA 2E5VA 2XQ9A 2YK0A 2LSJA 2WZIA 5AQPB 4K0UA 4YFSA 5BR8T 2WCAA 4A97A 5ABHA 1V9DA 2A3DA 2IDOB 2SPCA 4PAGA 3ZJ1A 2LSGA 1YKHB 1I94T 1CUNA 3ANWB 4O4HE 3ZSTA 2Q9QA 5FY7A 2VURA 3EVYA 5FP3A 3GN5A 3K3OA 3KFWX 3I9WA 4YSXA 2XM2A 1D0ZA 4DV4T 3UU6A 4DIDB 4UV9B 4FI5A 5HXSA 4EB6E 2QVAA 1GQEA 2ZM2A 2V5DA 3N9LA 4IE5A 4ZI7E 4JI1T 1W9RA 3NKZA 2E9XB 2IUBA 3ZCJA 5JRCB 5LOVE 3RH3A 4WNKA 3K8PC 3ZKRA 4JEUB 2K9AA 2CM0A 4PJJA 2BKPA 4AKIA 3RQUA 3CK6A 4HEAA 4IHJE 2JMKA 1ZOYA 2W0GA 4PW8A 5FMNA 3Q5DA 3AE4A 3P8CD 3RYCE 2UXXB 4B6XA 4PK6A 5JR9B 4DV0T 5AQVB 4EOZB 2Y6XA 3I0OA 1KEYA 3BQLA 1HR0T 4JI2T 3PV0F 4UF0A 2BS2A 5JR9C 4AQFA 2D5UA 3AE9A 4P1NA 5ADXL 5L47A 3VRBA 5E0OA 5AQMB 2XAHB 4UXNB 3P4SA 4KBMB 3MK7C 4P09A 5FXXA 2X0LB 5CA0E 1MNEA 5FXWA 1D0XA 1KK7A 2UUAT 1MMGA 4KHPT 2LSKA 2LSIA 2JRKA 3HKEE 5KX5E 3H3AA 4JUYA 3DJBA 3ZMTB 2BG9E 2LKHA 2BDEA 2JMHA 4HN9A 3UQ7A 2G0UA 2P9BA 2WDQA 5LGNB 2V6XA 1HX8A 1E7PA 5CGMA 4JI5T 5L4EA 4U3CA 2KXPB 1D1CA 5LJNA 1WRDA 2WDRA 1UGOA 2ES0A 3QOFA 4ASKA 4Z8XA 5FL0A 4BJNA 2I0MA 2CEAA 4ANJA 5L3CB 4PFOA 5AQOB 2PBIA 2XQ3A 3UULA 4EEDA 2KWIB 4JI4T 2IIUA 3NBXX 4G63A 3VKHA 4IL4A 4JI0T 1VCSA 1O3XA 4B3TT 3ANWA 5ETWA 2YKSA 5KXJA 3EDUA 3NWIA 2VL8A 5IUXA 1UX4A 4LF5T 4U7IA 3UU3A 1HNWT 5KMGP 1XWMA 4TV9E 3RIUA 2H89A 5LBQB 4IDQA 1Z8UA 4A5XA 1G8XA 3AEAA 4F8HA 2LHRA 2WWVA 1OXZA 3CX7B 2CPTA 1XDPA 4H9NC 4U74A 2W00A 1IAPA 2H7VC 1MMDA 1SE7A 2JJ9A 3CQCB 1WYCA 3Q5WA 4CXXA 5AQJB 2E9XA 2NP9A 5JRCA 4EAHA 1ZEEA 1WLXA 1HX1B 5L4HA 1IJ6A 4LFCT 3AA7B 5J2TE 2CBJA 2M6IA 2GK9A 5FVKA 1NEKA 3WI3A 4DV3T 4O2BE 1X79A 2OA5A 3M65A 5JR9A 2VQET 4ISTA 5JVDE 4QX7B 2CRBA 3VHLA 3AE7A 3AEGA 4COFA 1XMOT 1WCRA 2V8SV 1W09A 3RC3A 4PJNA 3PUYF 3ZYMA 5LB7B 5JDQA 4GIWA 2HHHT 4X1KE 3N9QA 2DHRA 2XJ7A 3IBPA 2VVNA 3UU4A 5AQSB 2ZM8A 4A56A 3CIRA 2E9XD 3N9NA 3EABA 2UUCT 4HGAA 1HNXT 2RA1A 3O1IA 3OYZA 2X68A 2E8IA 2DI4A 2Q9QC 2CMRA 4LMJA 3LSVA 3UUBA 2XY8B 2C5IT 5A1LA 4FJOA 4GK5E 5LG4A 4U2YA 3BQKA 2XQ5A 2MOZA 2NR4A 2X0HA 2VKOA 2XQ4A 3CX6B 3SWHA 2BZBA 5FNVE 3PTRB 1XNRT 4V1Av 5JDLA 1KNPA 2XASB 1YQ4A 3P7IA 4PJMA 3Q9DA 1NAFA 2Y8DA 2WB5A 2KSRA 3P4WA 2KWHA 4AISA 2VK9A 1KF6A 4GKKT 2LKGA 4JI7T 4NPPA 2WP9A 4AKLA 2ODUA 4QX8B 4ISSA 4CN4A 4X1YE 1N36T 1MMNA 4DR1T 3N5LA 4KUMB 2X9YA 2CWYA 1WFDA 3AEEA 2J1DG 2XSBA 3N2OA 4H9SE 1XMQT 3N9OA 3O9XA 3LDQB 3RYFE 3AEDA 5HEHA 4Z90A 1KNZA 3P50A 3ZN1B 4U2ZA 2W67A 4AQFC 3N9MA 2V7LA 4HWDA 3G06A 2DLRA 3K1SA 4JI6T 2KLQA 4K0KT 3AAIA 1HTJF 2I59A 1SA0E 1N32T 4TNWA 5EK2A 3KINB 3ZMVB 1XZYA 4ADZA 5LGUB 2ZLYA 3TLWA 5FKYA 2BKOA 2NTXA 5JDNA 4X1IE 2X0YA 2C5KT 2WDVA 2ODVA 4AQYT 4U33A 3ZEFB 3NZQA 4DUZT 3I1AA 4HFVA 4Q25A 1BR2A 1S35A 5CB4E 4IIJE 4DBRA 3RRCA 3C64A 5HEJA 1WR6A 4MFRA 4PK5A 3KV5A 4UVAB 2UXNB 3QB5A 3FZMB 3DTOA 2VWAA 4JI3T 3PE0A 3U3IA 4TNVA 1ZHCA 4QHOA 1YQ3A 4IE6A 1MIYA 5HAXA 4TWHA 2C5JA 3OTOT 2NW9A 2ZM6T 2B1EA 4HKAA 5F5WA 3VKGA 5HCMA 2R6GF 4YSZA 5AQGB 2MBGA 3R84B 5AQHB 1HFAA 1UK5A 5L3FB 1UCUA 4TX5A 1WR0A 4TUYE 5FY1A 4LMKA 3ZT6A 4XBFB 3RIUC 2ACXA 1W0AA 3A5XA 5HXEA 3PURA 3TLVA 4ZXLA 5F3JA 2YDSA 4LFBT 4DR3T 2QA7A 2L8KA 3J7Yq 3RQWA 4UELA 2D0UA 4CI2B 2W66A
chains in the Genus database with same CATH topology
3PUQA 3AVRA 2KMFA 2Q9QB 2E9XC 2ES0A 4H9PC 4ASKA 3GN5B 4Z8XA 4BJNA 4AKHA 3KVBA 2N9DA 3C4XA 2X67A 5HXCA 2CEAA 1U5PA 4ANJA 4PFOA 5L3CB 2PBIA 4MALA 5IYZE 1QUUA 3QK6A 3UULA 3LK42 2KWIB 3NBXX 4G63A 5JDGA 3HKBE 3VKHA 2CA5A 5HXHA 2Q9QD 5TAOA 3HI2A 4KP3C 2IC6A 3Q2MA 3W15B 3RC8A 2D2SA 1O3XA 3C4WA 4BJMA 3ANWA 5ETWA 2KINB 4ZI2C 2CE7A 2D0TA 3HR0A 5FXZA 3LK3B 3EDUA 2VL8A 4MLKA 2MTQA 4WBOA 1UX4A 1ZV4X 3UFEA 3QUJA 4PFPA 5KMGP 4TV9E 4C90A 3ONXA 4ZS3A 4E7ZA 4DMVA 5LBQB 1MIVA 3IEEA 2MYSA 4MBQA 1G8XA 3C50A 3KDSE 4UVCB 2LHRA 3RRWA 2PFVA 1OXZA 3R6NA 1HCIA 3MXZA 3CX7B 2HH7A 3AVSA 1YW0A 2WMNA 4H9NC 3ZCIA 4U74A 3FBLA 3ZMUB 2W00A 2EHOB 3N2GE 1IAPA 4ERRA 2H7VC 1MMDA 3KV4A 1FMWA 2LM9A 2K5BB 2JJ9A 3I9YA 3CQCB 1WYCA 3CPZA 3Q5WA 5DQWA 4CXXA 5HWXA 2W62A 2XAFB 1T98A 4JLEA 3B57A 2E9XA 2NP9A 1FIOA 4IGUA 5LHHB 3QC9A 2A72A 3LBXB 5JRCA 4I55E 4EAHA 3N2KE 1ZEEA 3CQGB 4U72A 3JC6C 3LK2B 2CWOA 1WLXA 2XTLA 5L3BB 2NOXA 1IJ6A 3ESLA 2X66A 4QXBB 3AA7B 4CXWA 2VKHA 4TZ4C 1H7CA 2KZ7B 1LRZA 5LHGB 2EHOD 5L3DB 5J2TE 4ZS2A 5HWYA 5LHIB 3NRXA 5LBMA 2VKJA 2K24A 4PNIA 3K3NA 2CLYC 5LA6E 2GK9A 3AA6B 1BR4A 3WI3A 4GOUA 1D1AA 2XQYA 2N1GA 3FBZA 5F8PA 5LNKA 2XAQB 2WBLA 3ZMZB 3D0TA 4XAXB 4O2BE 4AQGA 4IE4A 3MA9A 3SS1A 3AAEB 2YINA 5BMVE 3O1HA 5FYMA 2HPLA 4UF0B 4HTEA 1MNDA 1IZNB 1X79A 2OA5A 3CWZB 3M65A 4OYKA 5JR9A 4TN7B 4ISTA 5JDHA 2DNXA 5H6RB 1Z0PA 4YHJA 4NUUA 1YKEB 1B7TA 1WYBA 3HKCE 5JVDE 3KVAA 4ZI3C 1ZKEA 3U78A 4I43B 5HYAA 4QX7B 2W61A 2PJQA 2LE8A 4JEHB 3VHLA 5EK4A 3UUXB 3ZLIA 3VU7H 4GYRA 5LJMA 3PUAA 5JDFA 5JDMA 4OFZA 3RC3A 3RKOA 3GWHA 4PJNA 3C4ZA 3ZN0B 3NRYA 3ZYMA 4X20E 4H9RC 4UV8B 2V7MA 3V5UA 3C98B 4GIWA 5JDQA 3OJAA 1NWMX 3FHNA 5DJQC 1MIWA 2BVLA 4X1KE 3ZJ2A 3N9QA 1E1HB 4ILUA 2DHRA 4L0RA 1Y64B 3IBPA 1G73A 2ZM8A 4A56A 5FY0A 4CQIA 1MMAA 4CXYA 3RX6A 2E9XD 3ETVA 3N9NA 2K48A 4N78D 5LP6E 5M4YA 3OKQA 1BR1A 3ETUA 2NTYA 2Y48B 2WSSV 4HGAA 1LVFA 4ZHQE 3E08A 2RA1A 2LOPA 3L09A 2IW5B 3FXEB 1HG2A 3O1IA 3OYZA 3WAKA 2X68A 4MHCA 4AI6A 2XUEA 2E8IA 3PDYA 2DI4A 4J2CA 2Q9QC 2CMRA 3PU8A 4OHFA 3RYHE 3TKLB 1D1BA 3SRZA 4DNDA 2C5IT 3AA1B 5A1LA 4FJOA 2DWKA 4GK5E 5LG4A 2C0SA 4OK0A 4CI1B 3BQKA 3Q5XA 3SOLA 2MOZA 3HL6A 3ZYKA 4DVDA 4EIWA 3LFMA 4H9OC 2VKOA 4UVBB 3CX6B 3SWHA 2BZBA 3UUNA 5FNVE 5LYJE 3L3PA 4C91A 4DMWA 4OYJA 3NZPA 3PTRB 4O4JE 4O4LE 4V1Av 4AKRB 1OWAA 5JDLA 5AFUL 3CVRA 2CXFA 5GONE 5LXTE 2XASB 1AJ3A 1FEWA 4O2AE 3WAJA 3O4XE 4PJLA 3AB3B 4I50E 3BQIA 3P7IA 2YK0A 4PJMA 2LSJA 3Q9DA 1NAFA 2Y8DA 4K0UA 3PUGA 4YFSA 3ZPOA 4ZOLE 5CA1E 3N9PA 2KWHA 2LSYA 4AKGA 2CCQA 4M1PA 1V9DA 2A2FX 2VK9A 2A3DA 4DBQA 2SPCA 3E22E 2DCFA 4PAGA 3BK9A 2EHOC 3ZJ1A 4AKLA 2LSGA 1YKHB 2WM9A 3V5SA 2ODUA 4QX8B 1FMVA 4ISSA 1CUNA 4X1YE 3ANWB 1MMNA 4O4HE 5FY7A 2Q9QA 3B13A 2XAJB 3MJXA 2NW7A 3EVYA 3N5LA 1VRBA 2YEVC 3GN5A 3K3QC 3MKDA 3K3OA 3KFWX 4KUMB 2BVMA 3I9WA 2X9YA 2CWYA 5J2UE 3UTKA 2LJLA 1D0ZA 4BAYB 2J1DG 3ZC1A 3T8OA 4E7SA 3N2OA 4H9SE 4PK4A 5EZYE 3ZYLA 3N9OA 3O9XA 3RYFE 4UIGA 5EK3A 1HG5A 4UV9B 4H63H 4FI5A 5HXSA 4NUVA 3RYIE 3ZC0A 2V7KA 2X9HA 4EB6E 2RP4A 1KNZA 2ZMAA 4EXTA 2M67A 1YD8G 4YJ3E 2ZM2A 3CX8B 3UT5E 4YLHA 3N9LA 3ZN1B 4F6RC 1UX5A 4IE5A 3AA0B 4ZI7E 2JPFA 4L9IA 2L9QA 2E9XB 3KV6A 2VASA 4AQFC 3FXDB 3ZCJA 3N9MA 5LOVE 5JRCB 2DWGA 3RH3A 4WNKA 4QWNB 3K8PC 2V7LA 2V7JA 1BR0A 4JEUB 2K9AA 3KBTA 2DLRA 2WAUA 2X51A 4WBNE 2KLQA 3AAIA 3O1JA 4AXPA 2CM0A 2VKDA 5L3GB 1HTJF 2I59A 1SA0E 4PJJA 4AKIA 4H9QC 4HE8A 3S4UA 4UEMA 5EK2A 3KINB 2YU1A 4HEAA 2EHOA 5JQGE 4IHJE 3PU3A 2JMKA 2W0GA 3ZMVB 4PW8A 3KV9A 3GA8A 4GYSA 4EZ4A 2LT3A 5FMNA 4ADZA 5J1GA 3P8CD 5LGUB 3RYCE 2ZLYA 3LBXA 2UXXB 5L3EB 4QXHB 4B6XA 5JREA 4PK6A 5JR9B 3LG7A 2QGSA 3J9X1 2NTXA 3F57A 4EZHA 1HS7A 5JDNA 4EOZB 2Y6XA 3PUSA 2KT9A 4X1IE 3ZMSB 2C5KT 2VB6A 3I0OA 3MACA 2PG8A 4ZI2D 2ODVA 3C51A 3AAAB 3CKDA 2V7IA 3BQLA 4EYYR 2NW8A 3ZEFB 5H6QB 3NZQA 3I1AA 3HKDE 5L2LA 4HFVA 3RPUA 1IJ5A 1BR2A 4UF0A 1S35A 5JR9C 3DP7A 5CB4E 3KBUA 4AQFA 4IIJE 1LKXA 3RRCA 2D5UA 3C64A 4WW0A 4DBRA 5JH7E 4P0AA 4BA9A 1WR6A 2XAGB 4MFRA 4IDZA 4P0BA 4GK0E 5ADXL 4PK5A 3KV5A 2CXLA 4UVAB 2UXNB 5E0OA 2CLYB 3EUHA 3MZKB 2WMOA 3CMLA 3I0QA 2XAHB 1D0YA 4UXNB 5FP3A 5IHYA 3DTOA 2VWAA 2N2NA 3F2EA 3JC6D 4QXCB 2H7OA 3PE0A 4KBMB 3U3IA 4G2AA 4CI3B 1ZHCA 3MK7C 1HF8A 1U4QA 4QHOA 4IE6A 1MIYA 1QSDA 5HAXA 4P09A 5FXXA 2W63A 2X0LB 2V1DB 2C5JA 5C8YE 2LOSA 5CA0E 4TV8E 5DQVA 4XZCA 1MNEA 5FXWA 3UUMA 2V26A 2NW9A 1D0XA 1KK7A 2IC9A 4EYUA 1MMGA 2XHEB 2B1EA 4YJ2E 4HKAA 2LSKA 2LSIA 3OBVE 2CXDA 2LHNA 4I4TE 4L5GA 4DO0A 2JRKA 3HKEE 2NWBA 5KX5E 3VKGA 1LVKA 4H63V 3F31A 2KNDA 4KMCA 3H3AA 4JUYA 2JQQA 3DJBA 2MBGA 3R84B 1S94A 3ZMTB 1US7B 1HFAA 5LCYA 3H37A 5L3FB 1UCUA 2BDEA 2JMHA 5KDMC 4ZI3D 2HPJA 3FB2A 4TX5A 2Z6EA 4CZZB 4TUYE 5FY1A 4HN9A 4XBFB 2H3RA 3E0ZA 3IF8B 3LJCA 2G0UA 4IE7A 2P9BA 2X9WA 3EDVA 1EZ3A 2LEHA 2L3LA 2ACXA 2WWUA 2YU2A 4O8SA 3A5XA 1SHZC 1VOMA 2ZM0A 5HXEA 5LGNB 3PURA 5DABA 1HX8A 2IAKA 5LGTB 5F3JA 3GMIA 3OYXA 2X9XA 2KXPB 5FXVA 5HXRA 4IE0A 3CQXC 3IHRA 2QA7A 2L8KA 3J7Yq 1D1CA 4UELA 5LJNA 2D0UA 4CI2B 3HA4A 1WRDA 4QKNA 4O4IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWM X;  1X79 A;  1WR6 A;  1NAF A;  2N2N A;  1WRD A;  2N9D A;  1O3X A;  1YD8 G;  1OXZ A; 
#chains in the Genus database with same CATH topology
 2KMF A;  3AE8 A;  2E9X C;  4AKH A;  4HFE A;  3C4X A;  5IYZ E;  4YSY A;  3QNU A;  2JIW A;  3LK4 2;  2CA5 A;  5HXH A;  3VRA A;  2Q9Q D;  5TAO A;  4DV1 T;  2IC6 A;  4B3M T;  1HNZ T;  5FXZ A;  3VR8 A;  1IBL T;  1ZV4 X;  1FJG T;  3JCF A;  3QUJ A;  3RHW A;  4C90 A;  2LLY A;  2FJB A;  4ZS3 A;  2MYS A;  4MBQ A;  3KDS E;  2PFV A;  2HH7 A;  3AVS A;  2WMN A;  3FBL A;  2EHO B;  1YXR A;  3KV4 A;  3I9Y A;  5HWX A;  3B57 A;  1FIO A;  2XSA A;  2A72 A;  3LBX B;  2E2A A;  4I55 E;  3TLS A;  3JC6 C;  3LK2 B;  2XTL A;  4QXB B;  2B76 A;  1OED B;  4ZS2 A;  5LHI B;  3NRX A;  4DR4 T;  4U31 A;  3K3N A;  4B3R T;  1BR4 A;  3AA6 B;  2XQY A;  2XAQ B;  2WBL A;  5HEG A;  4WZX A;  4AQG A;  3AAE B;  1ZP0 A;  3PUW F;  1T8B A;  4HTE A;  1OED C;  5H6R B;  5LMN T;  4NUU A;  3HKC E;  1ZKE A;  2FJD A;  2IHR 1;  5EK4 A;  3RIF A;  3UUX B;  3VU7 H;  5LJM A;  5ABF B;  3RKO A;  3GWH A;  3RF1 A;  4UV8 B;  2V7M A;  3C98 B;  1NWM X;  2BVL A;  3RKG A;  4CXY A;  3RX6 A;  3T1Y T;  4N78 D;  5LP6 E;  3EAM A;  3OKQ A;  3ETU A;  4X62 T;  2WSS V;  2XQ7 A;  1LVF A;  4ZHQ E;  4HFH A;  3E08 A;  2LOP A;  1OED E;  3WAK A;  4MHC A;  3PUZ F;  3PU8 A;  3TKL B;  4ILB A;  2DWK A;  5CFB A;  4OK0 A;  4CI1 B;  3Q5X A;  3ZYK A;  1N33 T;  1XDO A;  3UUN A;  5AFU L;  4NXN T;  3PJA A;  1FEW A;  4PJL A;  1QLB A;  3PUX F;  3ZPO A;  2LSY A;  5AQT B;  4M1P A;  4DBQ A;  3E22 E;  4QH4 A;  3V5S A;  2FBW A;  4HFB A;  2XAJ B;  2NW7 A;  5J0Z A;  3SFE A;  1VRB A;  2YEV C;  3K3Q C;  3OVU A;  1IBK T;  2VQF T;  5J2U E;  2LJL A;  4BAY B;  4LFA T;  3T8O A;  5EZY E;  4OX9 T;  3X1D A;  4UIG A;  5EK3 A;  1HG5 A;  1XNQ T;  3SFD A;  2X9H A;  2RP4 A;  4EXT A;  2BS4 A;  4DR6 T;  5C3J A;  4YLH A;  4F6R C;  1UX5 A;  3KV6 A;  2VAS A;  3FXD B;  3RIA A;  4JYA T;  2V7J A;  1BR0 A;  3KBT A;  2X51 A;  4LF4 T;  3O1J A;  4AXP A;  4ILA A;  5L3G B;  4EV6 A;  2YU1 A;  2EHO A;  5JQG E;  3PU3 A;  4LF6 T;  5J1G A;  3LBX A;  5JRE A;  2QGS A;  2J62 A;  3F57 A;  5AQQ B;  1OED A;  2BBJ A;  2QYW A;  3PUS A;  2FUP A;  1KFY A;  2VB6 A;  3MAC A;  2PG8 A;  1T7S A;  3AAA B;  4IDP A;  2V7I A;  4EYY R;  2LM2 A;  3DP7 A;  2DL1 A;  5C2T A;  3JAD A;  4HFI A;  4WW0 A;  4P0A A;  5JH7 E;  4AIU A;  3M3Z B;  4GK0 E;  2CXL A;  3NVO A;  2CLY B;  3CML A;  2RPA A;  2UUB T;  3B5M A;  3ABV A;  3JC6 D;  4QXC B;  2JQK A;  5ABF A;  4CI3 B;  1HF8 A;  1U4Q A;  2WU2 A;  1QSD A;  2W63 A;  2V1D B;  4X66 T;  2LOS A;  5DQV A;  4XZC A;  4JV5 T;  2V26 A;  2HN2 A;  3JAE A;  3P4R A;  3OBV E;  2CXD A;  2LHN A;  4I4T E;  4L5G A;  4DO0 A;  1LVK A;  4H63 V;  4IRE A;  2KND A;  4KMC A;  2JQQ A;  1S94 A;  1US7 B;  2E5L T;  5JTG A;  4A98 A;  4YXD A;  3FB2 A;  2Z6E A;  4CZZ B;  4NIQ A;  2H3R A;  3E0Z A;  3LJC A;  3EDV A;  1EZ3 A;  2LEH A;  2YU2 A;  4O8S A;  4WYV A;  1SHZ C;  2UU9 T;  5LGT B;  1JNZ A;  2IAK A;  2M6B A;  4HWC A;  5FXV A;  2I6H A;  5HXR A;  3IHR A;  2WU5 A;  3HA4 A;  4QKN A;  2FJA A;  3PUQ A;  5FL1 A;  3A8Y C;  4DR7 T;  2WZH A;  4H9P C;  1E2A A;  3KVB A;  1U5P A;  3ONL C;  3QK6 A;  3Q5E A;  2XQ8 A;  3HKB E;  3HI2 A;  2BBH A;  2D2S A;  3C4W A;  5HCJ A;  2KIN B;  4ZI2 C;  3HR0 A;  3LK3 B;  3TLU A;  3AE5 A;  2MTQ A;  4WBO A;  4PFP A;  3ZT5 A;  4E7Z A;  1MIV A;  2WQY A;  3C50 A;  4UVC B;  3R6N A;  3MXZ A;  1YW0 A;  2OV9 A;  3ZCI A;  4IDO A;  4ZEY A;  2LM9 A;  3CPZ A;  2W62 A;  2XAF B;  5LHH B;  3QC9 A;  4U7Y A;  4LML A;  2UXB T;  5AQF B;  4DV7 T;  5L3B B;  3ESL A;  2X66 A;  2VKH A;  4TZ4 C;  1H7C A;  5LHG B;  1LRZ A;  2QRX A;  5LBM A;  2VKJ A;  2N1G A;  3FBZ A;  2YDQ A;  4XAX B;  3T1H T;  4IE4 A;  3MA9 A;  3PJA J;  3RLF F;  3SS1 A;  2YIN A;  3FZL B;  3O1H A;  5ABG A;  3FZK B;  5CJ5 A;  5FYM A;  2J47 A;  2HPL A;  3PUV F;  1MND A;  2VVS A;  3CWZ B;  2LRK A;  4HWI B;  5JDH A;  2DNX A;  1Z0P A;  4YHJ A;  2IML A;  4ZI3 C;  3KVA A;  5HYA A;  4B3S T;  2PJQ A;  4JEH B;  1I6Z A;  5LMU T;  3UFG A;  5JDF A;  5IWA T;  3L8R A;  5JDM A;  3ZN0 B;  3NRY A;  4X20 E;  2K3W A;  4H9R C;  3AEC A;  5DJQ C;  3FHN A;  3AE6 A;  3ZJ2 A;  4X5T A;  1E1H B;  1JNR A;  3ZSS A;  4L0R A;  1Y64 B;  4CQI A;  4DV5 T;  3ETV A;  2K48 A;  2NTY A;  2Y48 B;  3A7M A;  4YTP A;  3L09 A;  4YT0 A;  2F4V T;  3FXE B;  1HG2 A;  2XUE A;  3PDY A;  4OHF A;  3RYH E;  3QB5 K;  2BG9 B;  2UXC T;  4YHH T;  4EIW A;  2FJE A;  2JQH A;  2XM1 A;  3LFM A;  5LYJ E;  4C91 A;  4OYJ A;  3NZP A;  4O4J E;  4O4L E;  4AKR B;  4HWH A;  3UU8 A;  4O2A E;  4ZZC A;  2A9U A;  3O4X E;  2BS3 A;  3AB3 B;  4KX6 A;  3AE1 A;  3BQI A;  3L39 A;  5AQK B;  2BG9 C;  3PUG A;  4X64 T;  4ZOL E;  5CA1 E;  3N9P A;  2WY2 A;  3FZH B;  2OLT A;  2BKN A;  4AKG A;  2CCQ A;  2A2F X;  1UUS A;  5AQU B;  2DCF A;  1J1J A;  2CHO A;  3BK9 A;  2EHO C;  1X9B A;  2WM9 A;  5ABE A;  1FMV A;  4LF9 T;  4GKJ T;  3B13 A;  3MJX A;  3TLT A;  3FZF B;  3MKD A;  3VR9 A;  2BVM A;  3P4Q A;  3UTK A;  3ZC1 A;  2W4X A;  2XZE A;  4E7S A;  4PK4 A;  3RI5 A;  3ZYL A;  4DR2 T;  2H88 A;  4H63 H;  4NUV A;  4X65 T;  3RYI E;  3ZC0 A;  2V7K A;  5HEO A;  2YN6 A;  2ZMA A;  2M67 A;  1YD8 G;  4YJ3 E;  3CX8 B;  3UT5 E;  3AA0 B;  3AEB A;  2UXD T;  2JPF A;  2AE9 A;  4L9I A;  2L9Q A;  4DV2 T;  2DWG A;  4QWN B;  1UUR A;  1J5W A;  2WAU A;  2D9D A;  4WBN E;  4QH1 A;  4HWF A;  2VKD A;  4H9Q C;  4HE8 A;  3S4U A;  4UEM A;  2WS3 A;  3KV9 A;  3GA8 A;  4GYS A;  4EZ4 A;  2LT3 A;  1T72 A;  5L3E B;  4QXH B;  3LG7 A;  3J9X 1;  4EZH A;  1HS7 A;  2KT9 A;  4CN6 A;  3ZMS B;  1Y01 A;  4ZI2 D;  3C51 A;  3UQ4 A;  4TWF A;  3CKD A;  2NW8 A;  5H6Q B;  3HKD E;  5L2L A;  3RPU A;  1IJ5 A;  3AXJ B;  1R8I A;  1M62 A;  1N34 T;  3KBU A;  1LKX A;  3UU5 A;  4BA9 A;  2XAG B;  4IDZ A;  4P0B A;  4Z91 A;  2XPK A;  3EUH A;  3MZK B;  2WMO A;  3I0Q A;  4ILC A;  1D0Y A;  5IHY A;  4CN1 A;  1NEN A;  2N2N A;  3F2E A;  3H3M A;  2H7O A;  3EHZ A;  5AQN B;  4G2A A;  4TWD A;  4KHZ F;  5C8Y E;  4TV8 E;  3UUM A;  2IC9 A;  2V6Y B;  4EYU A;  2XHE B;  4YJ2 E;  2YDR A;  2NWB A;  3F31 A;  5AQL B;  5FVL A;  5LCY A;  3H37 A;  2W2U A;  5KDM C;  4EGW A;  4ZI3 D;  2HPJ A;  2PTF A;  3IF8 B;  4IE7 A;  2X9W A;  2BG9 A;  2WWU A;  2L3L A;  1VOM A;  2ZM0 A;  4YTN A;  5DAB A;  1KNR A;  3GMI A;  3OYX A;  4EEB A;  2X9X A;  1CHU A;  4HFC A;  4IE0 A;  3CQX C;  5LG3 A;  2JQ9 A;  4O4I E;  4DUY T;  3AVR A;  2Q9Q B;  3IA3 A;  3GN5 B;  1L0V A;  3ZT7 A;  2N9D A;  2X67 A;  5HXC A;  2HN1 A;  4MAL A;  1QUU A;  3AE2 A;  2XQA A;  1VCT A;  5JDG A;  3P4P A;  4KP3 C;  3Q2M A;  1SUM B;  3W15 B;  3RC8 A;  2V5C A;  4BJM A;  2CE7 A;  2D0T A;  2XQ6 A;  4MLK A;  3UFE A;  4JI8 T;  3ONX A;  3RGL A;  4DMV A;  4DR5 T;  3IEE A;  3RRW A;  1HCI A;  4LF8 T;  3ZMU B;  3N2G E;  4ERR A;  2ACZ A;  1FMW A;  2K5B B;  5DQW A;  1T98 A;  3OPC A;  4JLE A;  4IGU A;  4QH5 A;  3N2K E;  3CQG B;  4U72 A;  2CWO A;  2NOX A;  4CXW A;  2KZ7 B;  2EHO D;  3JAF A;  5L3D B;  5HWY A;  2K24 A;  4PNI A;  2CLY C;  5LA6 E;  4GOU A;  1D1A A;  5F8P A;  4NXM T;  5LNK A;  3ZMZ B;  3D0T A;  4UR9 A;  5BMV E;  1DU2 A;  4UF0 B;  2CBI A;  1IZN B;  4OYK A;  4TN7 B;  4IDN A;  4ZZB A;  1YKE B;  1B7T A;  1WYB A;  1W0B A;  3U78 A;  4I43 B;  2W61 A;  3EI0 A;  2LE8 A;  1J5E T;  4IT4 A;  4KI0 F;  3ZLI A;  4GYR A;  3PUA A;  3AXJ A;  4I0U A;  4YY3 T;  4OFZ A;  3C4Z A;  2AXD S;  3V5U A;  5AQR B;  3OJA A;  1MIW A;  2YOE A;  4ILU A;  4DV6 T;  2MAW A;  1G73 A;  5FY0 A;  1MMA A;  5AQI B;  2LRL A;  5M4Y A;  1BR1 A;  1IBM T;  3ONJ A;  4YTM A;  2IW5 B;  4IL9 A;  4AI6 A;  4J2C A;  1D1B A;  3SRZ A;  2VL0 A;  4DND A;  4LF7 T;  3AA1 B;  5HEU A;  2C0S A;  3SOL A;  3HL6 A;  4DVD A;  2V6Y A;  1M7K A;  4HFD A;  4H9O C;  4UVB B;  2MPK A;  3L3P A;  4DMW A;  3AE3 A;  1OWA A;  2CXF A;  3CVR A;  5GON E;  2J4G A;  5LXT E;  1AJ3 A;  3WAJ A;  4JBW F;  3AEF A;  4I50 E;  2CHN A;  2E5V A;  2XQ9 A;  2YK0 A;  2LSJ A;  2WZI A;  5AQP B;  4K0U A;  4YFS A;  5BR8 T;  2WCA A;  4A97 A;  5ABH A;  1V9D A;  2A3D A;  2IDO B;  2SPC A;  4PAG A;  3ZJ1 A;  2LSG A;  1YKH B;  1I94 T;  1CUN A;  3ANW B;  4O4H E;  3ZST A;  2Q9Q A;  5FY7 A;  2VUR A;  3EVY A;  5FP3 A;  3GN5 A;  3K3O A;  3KFW X;  3I9W A;  4YSX A;  2XM2 A;  1D0Z A;  4DV4 T;  3UU6 A;  4DID B;  4UV9 B;  4FI5 A;  5HXS A;  4EB6 E;  2QVA A;  1GQE A;  2ZM2 A;  2V5D A;  3N9L A;  4IE5 A;  4ZI7 E;  4JI1 T;  1W9R A;  3NKZ A;  2E9X B;  2IUB A;  3ZCJ A;  5JRC B;  5LOV E;  3RH3 A;  4WNK A;  3K8P C;  3ZKR A;  4JEU B;  2K9A A;  2CM0 A;  4PJJ A;  2BKP A;  4AKI A;  3RQU A;  3CK6 A;  4HEA A;  4IHJ E;  2JMK A;  1ZOY A;  2W0G A;  4PW8 A;  5FMN A;  3Q5D A;  3AE4 A;  3P8C D;  3RYC E;  2UXX B;  4B6X A;  4PK6 A;  5JR9 B;  4DV0 T;  5AQV B;  4EOZ B;  2Y6X A;  3I0O A;  1KEY A;  3BQL A;  1HR0 T;  4JI2 T;  3PV0 F;  4UF0 A;  2BS2 A;  5JR9 C;  4AQF A;  2D5U A;  3AE9 A;  4P1N A;  5ADX L;  5L47 A;  3VRB A;  5E0O A;  5AQM B;  2XAH B;  4UXN B;  3P4S A;  4KBM B;  3MK7 C;  4P09 A;  5FXX A;  2X0L B;  5CA0 E;  1MNE A;  5FXW A;  1D0X A;  1KK7 A;  2UUA T;  1MMG A;  4KHP T;  2LSK A;  2LSI A;  2JRK A;  3HKE E;  5KX5 E;  3H3A A;  4JUY A;  3DJB A;  3ZMT B;  2BG9 E;  2LKH A;  2BDE A;  2JMH A;  4HN9 A;  3UQ7 A;  2G0U A;  2P9B A;  2WDQ A;  5LGN B;  2V6X A;  1HX8 A;  1E7P A;  5CGM A;  4JI5 T;  5L4E A;  4U3C A;  2KXP B;  1D1C A;  5LJN A;  1WRD A;  2WDR A;  1UGO A;  2ES0 A;  3QOF A;  4ASK A;  4Z8X A;  5FL0 A;  4BJN A;  2I0M A;  2CEA A;  4ANJ A;  5L3C B;  4PFO A;  5AQO B;  2PBI A;  2XQ3 A;  3UUL A;  4EED A;  2KWI B;  4JI4 T;  2IIU A;  3NBX X;  4G63 A;  3VKH A;  4IL4 A;  4JI0 T;  1VCS A;  1O3X A;  4B3T T;  3ANW A;  5ETW A;  2YKS A;  5KXJ A;  3EDU A;  3NWI A;  2VL8 A;  5IUX A;  1UX4 A;  4LF5 T;  4U7I A;  3UU3 A;  1HNW T;  5KMG P;  1XWM A;  4TV9 E;  3RIU A;  2H89 A;  5LBQ B;  4IDQ A;  1Z8U A;  4A5X A;  1G8X A;  3AEA A;  4F8H A;  2LHR A;  2WWV A;  1OXZ A;  3CX7 B;  2CPT A;  1XDP A;  4H9N C;  4U74 A;  2W00 A;  1IAP A;  2H7V C;  1MMD A;  1SE7 A;  2JJ9 A;  3CQC B;  1WYC A;  3Q5W A;  4CXX A;  5AQJ B;  2E9X A;  2NP9 A;  5JRC A;  4EAH A;  1ZEE A;  1WLX A;  1HX1 B;  5L4H A;  1IJ6 A;  4LFC T;  3AA7 B;  5J2T E;  2CBJ A;  2M6I A;  2GK9 A;  5FVK A;  1NEK A;  3WI3 A;  4DV3 T;  4O2B E;  1X79 A;  2OA5 A;  3M65 A;  5JR9 A;  2VQE T;  4IST A;  5JVD E;  4QX7 B;  2CRB A;  3VHL A;  3AE7 A;  3AEG A;  4COF A;  1XMO T;  1WCR A;  2V8S V;  1W09 A;  3RC3 A;  4PJN A;  3PUY F;  3ZYM A;  5LB7 B;  5JDQ A;  4GIW A;  2HHH T;  4X1K E;  3N9Q A;  2DHR A;  2XJ7 A;  3IBP A;  2VVN A;  3UU4 A;  5AQS B;  2ZM8 A;  4A56 A;  3CIR A;  2E9X D;  3N9N A;  3EAB A;  2UUC T;  4HGA A;  1HNX T;  2RA1 A;  3O1I A;  3OYZ A;  2X68 A;  2E8I A;  2DI4 A;  2Q9Q C;  2CMR A;  4LMJ A;  3LSV A;  3UUB A;  2XY8 B;  2C5I T;  5A1L A;  4FJO A;  4GK5 E;  5LG4 A;  4U2Y A;  3BQK A;  2XQ5 A;  2MOZ A;  2NR4 A;  2X0H A;  2VKO A;  2XQ4 A;  3CX6 B;  3SWH A;  2BZB A;  5FNV E;  3PTR B;  1XNR T;  4V1A v;  5JDL A;  1KNP A;  2XAS B;  1YQ4 A;  3P7I A;  4PJM A;  3Q9D A;  1NAF A;  2Y8D A;  2WB5 A;  2KSR A;  3P4W A;  2KWH A;  4AIS A;  2VK9 A;  1KF6 A;  4GKK T;  2LKG A;  4JI7 T;  4NPP A;  2WP9 A;  4AKL A;  2ODU A;  4QX8 B;  4ISS A;  4CN4 A;  4X1Y E;  1N36 T;  1MMN A;  4DR1 T;  3N5L A;  4KUM B;  2X9Y A;  2CWY A;  1WFD A;  3AEE A;  2J1D G;  2XSB A;  3N2O A;  4H9S E;  1XMQ T;  3N9O A;  3O9X A;  3LDQ B;  3RYF E;  3AED A;  5HEH A;  4Z90 A;  1KNZ A;  3P50 A;  3ZN1 B;  4U2Z A;  2W67 A;  4AQF C;  3N9M A;  2V7L A;  4HWD A;  3G06 A;  2DLR A;  3K1S A;  4JI6 T;  2KLQ A;  4K0K T;  3AAI A;  1HTJ F;  2I59 A;  1SA0 E;  1N32 T;  4TNW A;  5EK2 A;  3KIN B;  3ZMV B;  1XZY A;  4ADZ A;  5LGU B;  2ZLY A;  3TLW A;  5FKY A;  2BKO A;  2NTX A;  5JDN A;  4X1I E;  2X0Y A;  2C5K T;  2WDV A;  2ODV A;  4AQY T;  4U33 A;  3ZEF B;  3NZQ A;  4DUZ T;  3I1A A;  4HFV A;  4Q25 A;  1BR2 A;  1S35 A;  5CB4 E;  4IIJ E;  4DBR A;  3RRC A;  3C64 A;  5HEJ A;  1WR6 A;  4MFR A;  4PK5 A;  3KV5 A;  4UVA B;  2UXN B;  3QB5 A;  3FZM B;  3DTO A;  2VWA A;  4JI3 T;  3PE0 A;  3U3I A;  4TNV A;  1ZHC A;  4QHO A;  1YQ3 A;  4IE6 A;  1MIY A;  5HAX A;  4TWH A;  2C5J A;  3OTO T;  2NW9 A;  2ZM6 T;  2B1E A;  4HKA A;  5F5W A;  3VKG A;  5HCM A;  2R6G F;  4YSZ A;  5AQG B;  2MBG A;  3R84 B;  5AQH B;  1HFA A;  1UK5 A;  5L3F B;  1UCU A;  4TX5 A;  1WR0 A;  4TUY E;  5FY1 A;  4LMK A;  3ZT6 A;  4XBF B;  3RIU C;  2ACX A;  1W0A A;  3A5X A;  5HXE A;  3PUR A;  3TLV A;  4ZXL A;  5F3J A;  2YDS A;  4LFB T;  4DR3 T;  2QA7 A;  2L8K A;  3J7Y q;  3RQW A;  4UEL A;  2D0U A;  4CI2 B;  2W66 A; 
#chains in the Genus database with same CATH homology
 3PUQ A;  3AVR A;  2KMF A;  2Q9Q B;  2E9X C;  2ES0 A;  4H9P C;  4ASK A;  3GN5 B;  4Z8X A;  4BJN A;  4AKH A;  3KVB A;  2N9D A;  3C4X A;  2X67 A;  5HXC A;  2CEA A;  1U5P A;  4ANJ A;  4PFO A;  5L3C B;  2PBI A;  4MAL A;  5IYZ E;  1QUU A;  3QK6 A;  3UUL A;  3LK4 2;  2KWI B;  3NBX X;  4G63 A;  5JDG A;  3HKB E;  3VKH A;  2CA5 A;  5HXH A;  2Q9Q D;  5TAO A;  3HI2 A;  4KP3 C;  2IC6 A;  3Q2M A;  3W15 B;  3RC8 A;  2D2S A;  1O3X A;  3C4W A;  4BJM A;  3ANW A;  5ETW A;  2KIN B;  4ZI2 C;  2CE7 A;  2D0T A;  3HR0 A;  5FXZ A;  3LK3 B;  3EDU A;  2VL8 A;  4MLK A;  2MTQ A;  4WBO A;  1UX4 A;  1ZV4 X;  3UFE A;  3QUJ A;  4PFP A;  5KMG P;  4TV9 E;  4C90 A;  3ONX A;  4ZS3 A;  4E7Z A;  4DMV A;  5LBQ B;  1MIV A;  3IEE A;  2MYS A;  4MBQ A;  1G8X A;  3C50 A;  3KDS E;  4UVC B;  2LHR A;  3RRW A;  2PFV A;  1OXZ A;  3R6N A;  1HCI A;  3MXZ A;  3CX7 B;  2HH7 A;  3AVS A;  1YW0 A;  2WMN A;  4H9N C;  3ZCI A;  4U74 A;  3FBL A;  3ZMU B;  2W00 A;  2EHO B;  3N2G E;  1IAP A;  4ERR A;  2H7V C;  1MMD A;  3KV4 A;  1FMW A;  2LM9 A;  2K5B B;  2JJ9 A;  3I9Y A;  3CQC B;  1WYC A;  3CPZ A;  3Q5W A;  5DQW A;  4CXX A;  5HWX A;  2W62 A;  2XAF B;  1T98 A;  4JLE A;  3B57 A;  2E9X A;  2NP9 A;  1FIO A;  4IGU A;  5LHH B;  3QC9 A;  2A72 A;  3LBX B;  5JRC A;  4I55 E;  4EAH A;  3N2K E;  1ZEE A;  3CQG B;  4U72 A;  3JC6 C;  3LK2 B;  2CWO A;  1WLX A;  2XTL A;  5L3B B;  2NOX A;  1IJ6 A;  3ESL A;  2X66 A;  4QXB B;  3AA7 B;  4CXW A;  2VKH A;  4TZ4 C;  1H7C A;  2KZ7 B;  1LRZ A;  5LHG B;  2EHO D;  5L3D B;  5J2T E;  4ZS2 A;  5HWY A;  5LHI B;  3NRX A;  5LBM A;  2VKJ A;  2K24 A;  4PNI A;  3K3N A;  2CLY C;  5LA6 E;  2GK9 A;  3AA6 B;  1BR4 A;  3WI3 A;  4GOU A;  1D1A A;  2XQY A;  2N1G A;  3FBZ A;  5F8P A;  5LNK A;  2XAQ B;  2WBL A;  3ZMZ B;  3D0T A;  4XAX B;  4O2B E;  4AQG A;  4IE4 A;  3MA9 A;  3SS1 A;  3AAE B;  2YIN A;  5BMV E;  3O1H A;  5FYM A;  2HPL A;  4UF0 B;  4HTE A;  1MND A;  1IZN B;  1X79 A;  2OA5 A;  3CWZ B;  3M65 A;  4OYK A;  5JR9 A;  4TN7 B;  4IST A;  5JDH A;  2DNX A;  5H6R B;  1Z0P A;  4YHJ A;  4NUU A;  1YKE B;  1B7T A;  1WYB A;  3HKC E;  5JVD E;  3KVA A;  4ZI3 C;  1ZKE A;  3U78 A;  4I43 B;  5HYA A;  4QX7 B;  2W61 A;  2PJQ A;  2LE8 A;  4JEH B;  3VHL A;  5EK4 A;  3UUX B;  3ZLI A;  3VU7 H;  4GYR A;  5LJM A;  3PUA A;  5JDF A;  5JDM A;  4OFZ A;  3RC3 A;  3RKO A;  3GWH A;  4PJN A;  3C4Z A;  3ZN0 B;  3NRY A;  3ZYM A;  4X20 E;  4H9R C;  4UV8 B;  2V7M A;  3V5U A;  3C98 B;  4GIW A;  5JDQ A;  3OJA A;  1NWM X;  3FHN A;  5DJQ C;  1MIW A;  2BVL A;  4X1K E;  3ZJ2 A;  3N9Q A;  1E1H B;  4ILU A;  2DHR A;  4L0R A;  1Y64 B;  3IBP A;  1G73 A;  2ZM8 A;  4A56 A;  5FY0 A;  4CQI A;  1MMA A;  4CXY A;  3RX6 A;  2E9X D;  3ETV A;  3N9N A;  2K48 A;  4N78 D;  5LP6 E;  5M4Y A;  3OKQ A;  1BR1 A;  3ETU A;  2NTY A;  2Y48 B;  2WSS V;  4HGA A;  1LVF A;  4ZHQ E;  3E08 A;  2RA1 A;  2LOP A;  3L09 A;  2IW5 B;  3FXE B;  1HG2 A;  3O1I A;  3OYZ A;  3WAK A;  2X68 A;  4MHC A;  4AI6 A;  2XUE A;  2E8I A;  3PDY A;  2DI4 A;  4J2C A;  2Q9Q C;  2CMR A;  3PU8 A;  4OHF A;  3RYH E;  3TKL B;  1D1B A;  3SRZ A;  4DND A;  2C5I T;  3AA1 B;  5A1L A;  4FJO A;  2DWK A;  4GK5 E;  5LG4 A;  2C0S A;  4OK0 A;  4CI1 B;  3BQK A;  3Q5X A;  3SOL A;  2MOZ A;  3HL6 A;  3ZYK A;  4DVD A;  4EIW A;  3LFM A;  4H9O C;  2VKO A;  4UVB B;  3CX6 B;  3SWH A;  2BZB A;  3UUN A;  5FNV E;  5LYJ E;  3L3P A;  4C91 A;  4DMW A;  4OYJ A;  3NZP A;  3PTR B;  4O4J E;  4O4L E;  4V1A v;  4AKR B;  1OWA A;  5JDL A;  5AFU L;  3CVR A;  2CXF A;  5GON E;  5LXT E;  2XAS B;  1AJ3 A;  1FEW A;  4O2A E;  3WAJ A;  3O4X E;  4PJL A;  3AB3 B;  4I50 E;  3BQI A;  3P7I A;  2YK0 A;  4PJM A;  2LSJ A;  3Q9D A;  1NAF A;  2Y8D A;  4K0U A;  3PUG A;  4YFS A;  3ZPO A;  4ZOL E;  5CA1 E;  3N9P A;  2KWH A;  2LSY A;  4AKG A;  2CCQ A;  4M1P A;  1V9D A;  2A2F X;  2VK9 A;  2A3D A;  4DBQ A;  2SPC A;  3E22 E;  2DCF A;  4PAG A;  3BK9 A;  2EHO C;  3ZJ1 A;  4AKL A;  2LSG A;  1YKH B;  2WM9 A;  3V5S A;  2ODU A;  4QX8 B;  1FMV A;  4ISS A;  1CUN A;  4X1Y E;  3ANW B;  1MMN A;  4O4H E;  5FY7 A;  2Q9Q A;  3B13 A;  2XAJ B;  3MJX A;  2NW7 A;  3EVY A;  3N5L A;  1VRB A;  2YEV C;  3GN5 A;  3K3Q C;  3MKD A;  3K3O A;  3KFW X;  4KUM B;  2BVM A;  3I9W A;  2X9Y A;  2CWY A;  5J2U E;  3UTK A;  2LJL A;  1D0Z A;  4BAY B;  2J1D G;  3ZC1 A;  3T8O A;  4E7S A;  3N2O A;  4H9S E;  4PK4 A;  5EZY E;  3ZYL A;  3N9O A;  3O9X A;  3RYF E;  4UIG A;  5EK3 A;  1HG5 A;  4UV9 B;  4H63 H;  4FI5 A;  5HXS A;  4NUV A;  3RYI E;  3ZC0 A;  2V7K A;  2X9H A;  4EB6 E;  2RP4 A;  1KNZ A;  2ZMA A;  4EXT A;  2M67 A;  1YD8 G;  4YJ3 E;  2ZM2 A;  3CX8 B;  3UT5 E;  4YLH A;  3N9L A;  3ZN1 B;  4F6R C;  1UX5 A;  4IE5 A;  3AA0 B;  4ZI7 E;  2JPF A;  4L9I A;  2L9Q A;  2E9X B;  3KV6 A;  2VAS A;  4AQF C;  3FXD B;  3ZCJ A;  3N9M A;  5LOV E;  5JRC B;  2DWG A;  3RH3 A;  4WNK A;  4QWN B;  3K8P C;  2V7L A;  2V7J A;  1BR0 A;  4JEU B;  2K9A A;  3KBT A;  2DLR A;  2WAU A;  2X51 A;  4WBN E;  2KLQ A;  3AAI A;  3O1J A;  4AXP A;  2CM0 A;  2VKD A;  5L3G B;  1HTJ F;  2I59 A;  1SA0 E;  4PJJ A;  4AKI A;  4H9Q C;  4HE8 A;  3S4U A;  4UEM A;  5EK2 A;  3KIN B;  2YU1 A;  4HEA A;  2EHO A;  5JQG E;  4IHJ E;  3PU3 A;  2JMK A;  2W0G A;  3ZMV B;  4PW8 A;  3KV9 A;  3GA8 A;  4GYS A;  4EZ4 A;  2LT3 A;  5FMN A;  4ADZ A;  5J1G A;  3P8C D;  5LGU B;  3RYC E;  2ZLY A;  3LBX A;  2UXX B;  5L3E B;  4QXH B;  4B6X A;  5JRE A;  4PK6 A;  5JR9 B;  3LG7 A;  2QGS A;  3J9X 1;  2NTX A;  3F57 A;  4EZH A;  1HS7 A;  5JDN A;  4EOZ B;  2Y6X A;  3PUS A;  2KT9 A;  4X1I E;  3ZMS B;  2C5K T;  2VB6 A;  3I0O A;  3MAC A;  2PG8 A;  4ZI2 D;  2ODV A;  3C51 A;  3AAA B;  3CKD A;  2V7I A;  3BQL A;  4EYY R;  2NW8 A;  3ZEF B;  5H6Q B;  3NZQ A;  3I1A A;  3HKD E;  5L2L A;  4HFV A;  3RPU A;  1IJ5 A;  1BR2 A;  4UF0 A;  1S35 A;  5JR9 C;  3DP7 A;  5CB4 E;  3KBU A;  4AQF A;  4IIJ E;  1LKX A;  3RRC A;  2D5U A;  3C64 A;  4WW0 A;  4DBR A;  5JH7 E;  4P0A A;  4BA9 A;  1WR6 A;  2XAG B;  4MFR A;  4IDZ A;  4P0B A;  4GK0 E;  5ADX L;  4PK5 A;  3KV5 A;  2CXL A;  4UVA B;  2UXN B;  5E0O A;  2CLY B;  3EUH A;  3MZK B;  2WMO A;  3CML A;  3I0Q A;  2XAH B;  1D0Y A;  4UXN B;  5FP3 A;  5IHY A;  3DTO A;  2VWA A;  2N2N A;  3F2E A;  3JC6 D;  4QXC B;  2H7O A;  3PE0 A;  4KBM B;  3U3I A;  4G2A A;  4CI3 B;  1ZHC A;  3MK7 C;  1HF8 A;  1U4Q A;  4QHO A;  4IE6 A;  1MIY A;  1QSD A;  5HAX A;  4P09 A;  5FXX A;  2W63 A;  2X0L B;  2V1D B;  2C5J A;  5C8Y E;  2LOS A;  5CA0 E;  4TV8 E;  5DQV A;  4XZC A;  1MNE A;  5FXW A;  3UUM A;  2V26 A;  2NW9 A;  1D0X A;  1KK7 A;  2IC9 A;  4EYU A;  1MMG A;  2XHE B;  2B1E A;  4YJ2 E;  4HKA A;  2LSK A;  2LSI A;  3OBV E;  2CXD A;  2LHN A;  4I4T E;  4L5G A;  4DO0 A;  2JRK A;  3HKE E;  2NWB A;  5KX5 E;  3VKG A;  1LVK A;  4H63 V;  3F31 A;  2KND A;  4KMC A;  3H3A A;  4JUY A;  2JQQ A;  3DJB A;  2MBG A;  3R84 B;  1S94 A;  3ZMT B;  1US7 B;  1HFA A;  5LCY A;  3H37 A;  5L3F B;  1UCU A;  2BDE A;  2JMH A;  5KDM C;  4ZI3 D;  2HPJ A;  3FB2 A;  4TX5 A;  2Z6E A;  4CZZ B;  4TUY E;  5FY1 A;  4HN9 A;  4XBF B;  2H3R A;  3E0Z A;  3IF8 B;  3LJC A;  2G0U A;  4IE7 A;  2P9B A;  2X9W A;  3EDV A;  1EZ3 A;  2LEH A;  2L3L A;  2ACX A;  2WWU A;  2YU2 A;  4O8S A;  3A5X A;  1SHZ C;  1VOM A;  2ZM0 A;  5HXE A;  5LGN B;  3PUR A;  5DAB A;  1HX8 A;  2IAK A;  5LGT B;  5F3J A;  3GMI A;  3OYX A;  2X9X A;  2KXP B;  5FXV A;  5HXR A;  4IE0 A;  3CQX C;  3IHR A;  2QA7 A;  2L8K A;  3J7Y q;  1D1C A;  4UEL A;  5LJN A;  2D0U A;  4CI2 B;  3HA4 A;  1WRD A;  4QKN A;  4O4I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...