1X79A

Crystal structure of human gga1 gat domain complexed with the gat-binding domain of rabaptin5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
82
Chain Sequence
b'ISKRVNAIEEVNNNVKLLTEMVMSHSSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 32
structure length 82
sequence length 89
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1x79A00
2N9DA 1NAFA 1OXZA 1O3XA 1X79A 1WR6A 2N2NA 1WRDA 1NWMX 1YD8G
chains in the Genus database with same CATH superfamily
4YTPA 1WYBA 4LF9T 2PFVA 3C51A 2CLYB 1OWAA 1WLXA 1WYCA 3AEEA 4L0RA 3ZJ2A 4EAHA 4X66T 2LJLA 2WWUA 4PNIA 1YQ3A 4PJMA 1IZNB 4E7SA 2QVAA 2W61A 5L3FB 4O4JE 2VL8A 2KNDA 5IWAT 2M67A 2E9XB 2RP4A 3O1JA 2LRLA 1ZV4X 1ZP0A 2LM9A 2CXLA 4DR4T 2VL0A 4NXMT 2H89A 5L47A 4DR5T 2NW7A 4HFBA 4YFSA 3E08A 3GA8A 3LK3B 3EVYA 2D0TA 4WYVA 2KMFA 1UX4A 2WWVA 2WM9A 3LSVA 3PUXF 3N2KE 3ZYLA 2XAQB 2K5BB 4PW8A 4ILCA 2UUAT 2WSSV 4LF8T 3HKDE 5LGUB 3N2OA 3ANWB 4WBNE 1HX8A 4I43B 3GN5A 5CA1E 1BR0A 4IIJE 3UQ4A 4HFCA 5J0ZA 4DV3T 4Z91A 4PAGA 5ABFA 2WBLA 4P09A 4U7IA 4CZZB 2OLTA 2VQET 5BR8T 2HPJA 2X0HA 4NUUA 4Q25A 3MXZA 3RPUA 1FIOA 4PJNA 4EEDA 3VU7H 4CN6A 1XMQT 4EZ4A 4IE4A 5DJQC 2NP9A 5FP3A 2LOPA 2EHOB 4H9PC 3CWZB 5BMVE 2E2AA 2FJDA 2X51A 4TWDA 2CHNA 4HE8A 3EDVA 4UXNB 3EABA 5LHGB 2UUBT 2W66A 3DTOA 4H9QC 3AE3A 4MALA 1T7SA 3OKQA 4ZI7E 2CHOA 2ACXA 2CRBA 2B76A 4DV1T 4KI0F 4TNVA 5EK4A 2VURA 4WNKA 3FBZA 4N78D 5AQSB 5FXVA 1N36T 1QLBA 3UT5E 4H9RC 5L2LA 1N33T 4WZXA 2IHR1 5JREA 2KWHA 3CPZA 1UCUA 4UVCB 3N2GE 4ZI2D 3GMIA 1N32T 3S4UA 3PUAA 3ZYKA 2X68A 5FVKA 5LHIB 4TNWA 3UUMA 2PTFA 4HEAA 4HWIB 3V5UA 3VRAA 4OYJA 2H7OA 3AB3B 3P4SA 3OBVE 1IBKT 2N9DA 3ZCJA 5A1LA 4IE0A 5AQJB 3SFDA 5HEGA 4ZZCA 1VCTA 5H6RB 3MA9A 1S35A 4DV6T 5IUXA 3UQ7A 3Q5DA 3Q2MA 2MPKA 3CX8B 4CI2B 2VQFT 2WS3A 4GYRA 1YXRA 1YQ4A 4AKRB 3C98B 3KDSE 3CK6A 4WBOA 3E0ZA 2WP9A 1NWMX 1MNDA 2CXFA 2XUEA 4IDQA 1HCIA 2DCFA 2V7KA 4CI1B 3H3AA 3JC6C 3PURA 1VRBA 4HN9A 5FVLA 2V7JA 4YT0A 3AEBA 3ZN1B 2XZEA 1AJ3A 3JAEA 2RA1A 5ABFB 4UF0A 4OX9T 4I55E 4GKKT 3K1SA 3RIAA 2YN6A 2UXNB 2DNXA 4YTNA 2XJ7A 1OEDC 4EIWA 3RYFE 2WMNA 3ZKRA 4X1YE 2E9XD 3J7Yq 4EXTA 2BKNA 3MKDA 4XBFB 3CIRA 3IEEA 2XQ9A 1J1JA 3AA6B 4UIGA 3ONXA 2CLYC 3AE1A 3K3OA 1S94A 2RPAA 2AXDS 2LKGA 2WZIA 5JDMA 1MMDA 4DO0A 2UXBT 1FJGT 1HG5A 4ISSA 4P1NA 4JI0T 5LGNB 1V9DA 5CFBA 3X1DA 5FY7A 3C4ZA 5LMNT 2XQ3A 2L9QA 4P0BA 2XTLA 3LK42 4GK0E 3RHWA 3CMLA 3N9PA 2X66A 3AE8A 2FBWA 3B13A 3RQWA 1I6ZA 4JI4T 1UK5A 4CN1A 5F5WA 4UELA 2WU5A 4HWHA 4MFRA 3H3MA 3L3PA 3VKHA 2XQAA 2BDEA 2MYSA 1G73A 1J5WA 1L0VA 4K0UA 2V5CA 3VRBA 5FXWA 2CCQA 3UULA 2W00A 2JMHA 2Y6XA 2VVNA 3AXJA 3E22E 3V5SA 4U74A 2KINB 4QX7B 4HWFA 3LBXB 3ZMUB 2BG9C 4DV0T 4H63H 2AE9A 3F57A 5AQNB 2WB5A 4Z8XA 1IAPA 2K9AA 4J2CA 2XQ8A 3D0TA 5HAXA 5FMNA 5CJ5A 2Q9QC 1E7PA 1HF8A 2UXCT 2QYWA 5LJNA 2CBIA 5M4YA 1DU2A 3NKZA 2A2FX 3PTRB 3N9NA 2LOSA 5EK3A 4E7ZA 4Z90A 4ISTA 2JJ9A 3ONLC 3PUYF 3LK2B 4O8SA 3IA3A 2DL1A 2IC6A 3EI0A 2UXXB 3AAEB 3FZHB 3FBLA 5JDHA 3OPCA 4YHJA 2LRKA 1OEDB 4JEUB 1HX1B 3FXDB 4NXNT 3CKDA 5FL0A 3ONJA 4ZS2A 4MHCA 5FY0A 2XAGB 2LHNA 3QC9A 2LSIA 2ZM8A 1ZEEA 3T1YT 3AVRA 2BKPA 1LVFA 3Q5XA 4A5XA 5AQUB 2SPCA 2WCAA 3UU3A 5L3EB 4XAXB 5FXZA 5LCYA 1SUMB 5AQVB 1JNZA 5LB7B 4LFAT 4ILBA 1FMWA 1SHZC 4TV8E 5IHYA 3RGLA 3TLWA 4JV5T 3P8CD 2W62A 4DMWA 3R84B 3MJXA 1HTJF 3AEGA 4YTMA 4LF7T 4IE6A 3KFWX 3C50A 5JVDE 4UEMA 2FJBA 4JI2T 5FKYA 4AI6A 3ESLA 4DUZT 4EEBA 3ZJ1A 3AAIA 4GIWA 2JIWA 1UGOA 4A56A 1U5PA 5AQPB 1HFAA 2I0MA 3BK9A 1YD8G 4UV8B 1LKXA 2H88A 2V7IA 4BJNA 4I4TE 4HFDA 2M6BA 4CXYA 2B1EA 3LG7A 2JPFA 3KVAA 4U2ZA 2GK9A 4U31A 3LFMA 1W9RA 1HNWT 4UVAB 1HNZT 5HXRA 4AIUA 4F8HA 2H3RA 5JRCA 4DV2T 3ZC1A 2W2UA 4C90A 2V7MA 1Z0PA 4AQYT 3RC3A 5HEOA 4H9NC 1YKHB 2CEAA 2KXPB 4IE5A 5L4EA 2BG9B 3K3QC 2XSBA 4TV9E 4ZEYA 3M3ZB 4LMKA 2X9XA 1VCSA 4O2AE 3O9XA 4EYYR 3ZT6A 2Q9QB 4ZS3A 3AEFA 5J2UE 4IE7A 1NAFA 4YSYA 5LOVE 3KBTA 3O4XE 1WFDA 4ZXLA 2BS2A 3UU5A 3SFEA 4DIDB 2KLQA 3RIUA 5AQKB 2XAHB 3ZT5A 3IHRA 4V1Av 4B3ST 5KMGP 4DR6T 4CXWA 3PU8A 2ZM2A 5AQQB 3RYCE 3TLSA 4ANJA 2JMKA 2F4VT 5FYMA 1MIYA 3GWHA 4YHHT 3AEDA 2ZM6T 1OEDE 5FY1A 2YU1A 2LSYA 5LBMA 3AVSA 2CWOA 4QXHB 2CM0A 3LJCA 2WDVA 3RRCA 1UX5A 2VKOA 2PG8A 2IAKA 5AQGB 3Q5WA 2NR4A 4G2AA 2V6YA 2BBHA 3AA1B 4JI6T 3SWHA 4ILUA 3HKEE 1WCRA 5HEJA 5JR9A 1KEYA 1XMOT 1EZ3A 2C5IT 4M1PA 2MAWA 2KZ7B 1XDPA 4CI3B 5L3BB 3JC6D 1HG2A 4KHPT 4X64T 4DR1T 4YJ3E 4AKGA 4QH1A 3QOFA 4LMLA 2YU2A 3NZQA 3UUNA 2V7LA 4QH4A 4DV7T 3QUJA 2XASB 4TZ4C 3ZLIA 3F2EA 3AE5A 2UUCT 5GONE 2LSKA 2XSAA 1HR0T 3JCFA 5F3JA 2DHRA 3UFGA 3P50A 3AA0B 1WR6A 3ETUA 5HXCA 3CQGB 3RI5A 4ZZBA 4IL4A 2NTYA 3PJAJ 2CPTA 4JI8T 4IREA 5AQIB 3OTOT 1J5ET 4HGAA 3O1IA 4X5TA 3PUQA 4AQGA 3VKGA 4ZI2C 3SS1A 3SRZA 1Y01A 4GK5E 2VVSA 5CB4E 3TLUA 1X9BA 3I9WA 1IJ6A 3FXEB 3GN5B 1JNRA 1U4QA 3NBXX 2WZHA 2LKHA 5FXXA 4DR3T 2YDRA 2HH7A 2WDRA 4AKIA 1HS7A 3MACA 4ZI3D 2M6IA 2A9UA 1D0YA 3U3IA 3ZCIA 3AE6A 3RYHE 2IDOB 2BG9E 3UTKA 4FJOA 3UU4A 2K3WA 4BA9A 3L09A 3QB5K 2BVMA 3WAKA 2W4XA 1LRZA 5F8PA 2K48A 2XAJB 3KBUA 3T1HT 4PK5A 4OYKA 2LSJA 1T98A 5FNVE 3L8RA 4A98A 1MIWA 4LF4T 1W0AA 2MOZA 3Q5EA 2D9DA 2YEVC 3ZYMA 4BAYB 2E8IA 4HKAA 2X67A 3KV6A 5JDGA 2OA5A 3ZEFB 4YSZA 2UU9T 4QX8B 2CBJA 4U72A 2X9WA 5KXJA 5AQMB 4IGUA 2PJQA 5LMUT 2ZLYA 5LBQB 4QHOA 2H7VC 3CQCB 1D0XA 4JI3T 2KSRA 2YDQA 2FJEA 3P4PA 4DVDA 3FZFB 2G0UA 4H63V 1MIVA 1I94T 4LMJA 2J4GA 2EHOD 1FMVA 5AQHB 3CX6B 5HYAA 5AQFB 1US7B 2E9XA 3RRWA 4I0UA 4JI1T 5DQWA 5L3GB 2WDQA 1YKEB 3N9MA 2UXDT 4TWHA 4IL9A 3T8OA 3R6NA 3TKLB 3NWIA 2CE7A 2VWAA 4ERRA 1X79A 4O4LE 5HEUA 3U78A 1CUNA 5ABHA 2QRXA 1XWMA 2XQ5A 2DWGA 2QA7A 3J9X1 1M7KA 4OFZA 2V1DB 4B6XA 1W09A 3ANWA 2NW8A 1B7TA 2BKOA 4UF0B 4QKNA 4PFOA 3I1AA 3WI3A 2DLRA 4QH5A 4PK6A 5LYJE 5J1GA 3SOLA 1Z8UA 4HTEA 5AQLB 2XY8B 4U7YA 2LT3A 3I0OA 2E5LT 4UVBB 4YY3T 4NUVA 4EB6E 4OK0A 1IBLT 5ETWA 1D1CA 2EHOA 2A3DA 2V8SV 3O1HA 4U3CA 2MBGA 4L9IA 3KV9A 1NEKA 4IT4A 1OXZA 5LNKA 4AQFA 2L3LA 4AXPA 3C4XA 2WU2A 5L3DB 3ZPOA 1IBMT 4HFVA 5HXEA 3PUGA 2VK9A 1D0ZA 3ZMSB 3P4QA 3ZC0A 4MLKA 2MTQA 4YJ2E 2PBIA 4G63A 2X9YA 4AKLA 4HFEA 2XM1A 2QGSA 3PUSA 2LLYA 3TLTA 3AE9A 4ILAA 3C4WA 5KX5E 3IBPA 3HL6A 4DNDA 2OV9A 3H37A 1M62A 4TUYE 3EHZA 3P4RA 3WAJA 1D1BA 1W0BA 4JLEA 3JADA 3HR0A 3AE7A 3KV4A 5HCMA 2W0GA 3QK6A 3AXJB 3Q9DA 4BJMA 3RIFA 4AKHA 4TWFA 4H9OC 2E5VA 3VHLA 2J62A 2ODUA 5KDMC 1O3XA 3RH3A 2WMOA 1CHUA 2VB6A 1KFYA 1N34T 4WW0A 3PDYA 2IMLA 3JAFA 2WQYA 3P7IA 2VASA 2FJAA 3K8PC 1BR4A 3A7MA 5CGMA 4PFPA 1KNPA 5LP6E 5HXSA 5EZYE 2XQ7A 3N9LA 1HNXT 3NRYA 4DBQA 4LF6T 3RIUC 1ZHCA 4U2YA 3AEAA 2J47A 2J1DG 1KNRA 2JQHA 1XNRT 4DBRA 2ODVA 3DP7A 3FB2A 2YOEA 2R6GF 3RQUA 2LSGA 5C3JA 2BZBA 2LM2A 4QXBB 3ZSSA 2JQ9A 4X1IE 2D0UA 2X9HA 5TAOA 2BS3A 3KVBA 3AAAB 4X65T 4JBWF 4X20E 4EGWA 5HXHA 2V6XA 2Z6EA 4XZCA 2X0YA 3ZSTA 4TX5A 4LFCT 2FUPA 4PJJA 3C64A 4JI7T 3RF1A 3RKOA 5AFUL 5JR9C 5HWYA 4ADZA 1SE7A 3PV0F 2W63A 2XQ6A 4JEHB 4ZHQE 2HN1A 5JQGE 2V26A 3RLFF 2JRKA 4JI5T 1BR2A 1BR1A 4P0AA 5AQRB 3CX7B 3A8YC 5JH7E 3EUHA 2A72A 1XNQT 3UU8A 4X62T 5C8YE 4KUMB 3EAMA 2N2NA 2ZMAA 4C91A 2JQQA 2XQYA 5LA6E 4UV9B 2Y8DA 3ZMVB 5DABA 1WRDA 5JDQA 1IJ5A 3ZN0B 4X1KE 3VR8A 3HKCE 2I59A 2ZM0A 1D1AA 3B5MA 4KMCA 2LEHA 3BQKA 3N9QA 5LG4A 4NIQA 4KBMB 4ASKA 3FZLB 3CQXC 4LF5T 3ABVA 3PUZF 4L5GA 3PUVF 4IDPA 5EK2A 3OYZA 1R8IA 3NVOA 2IC9A 3FZMB 5JRCB 2C5KT 4QWNB 2VKJA 2XQ4A 2P9BA 4IDOA 5JDNA 4UR9A 4EV6A 2LHRA 3LBXA 2BVLA 4AISA 5DQVA 1Y64B 3FZKB 3UUXB 3N9OA 1MNEA 2JQKA 4DV5T 2ES0A 3QNUA 4YLHA 3MZKB 3N5LA 1FEWA 4O4HE 5JTGA 2N1GA 3DJBA 2NW9A 1WR0A 1T72A 3HI2A 4LFBT 5L4HA 2C0SA 4QXCB 3P4WA 5IYZE 5FL1A 3AE4A 2YDSA 1LVKA 2X0LB 3NZPA 3OVUA 2NTXA 3RC8A 3CVRA 4YXDA 4IDZA 4COFA 4KP3C 2L8KA 3RYIE 3TLVA 3UUBA 5LG3A 2W67A 2BBJA 1GQEA 4CN4A 4DV4T 3NRXA 1KNZA 3FHNA 3UFEA 4IHJE 4MBQA 1OEDA 3BQIA 3KINB 2DWKA 2VKDA 1MMGA 1KF6A 2YK0A 2HN2A 1QUUA 2LE8A 5CA0E 4DUYT 4YSXA 3I9YA 2DI4A 4HFHA 5LHHB 1KK7A 2YINA 1E2AA 2WY2A 4ZI3C 2VKHA 5LJMA 2V6YB 4I50E 4JYAT 5HWXA 2HHHT 3PUWF 2IUBA 3PJAA 3QB5A 4DMVA 4U33A 5JR9B 2E9XC 3PU3A 1YW0A 3RKGA 4KX6A 2HPLA 2Q9QD 4O2BE 3OJAA 2C5JA 2IIUA 4O4IE 3HA4A 2NWBA 3ZT7A 4B3MT 5LXTE 2CWYA 3F31A 2I6HA 4DR7T 3OYXA 2KT9A 4FI5A 2XHEB 4TN7B 2D2SA 4GKJT 3G06A 3MK7C 1H7CA 2ACZA 3PE0A 3VR9A 5JDLA 4B3RT 2XAFB 5HEHA 4H9SE 2D5UA 4HWDA 4JUYA 4HFIA 3UU6A 2XPKA 5L3CB 5JDFA 1MMNA 3KV5A 2Y48B 4DR2T 3LDQB 4K0KT 3B57A 3IF8B 4HWCA 2XM2A 4GYSA 5AQOB 1SA0E 1UUSA 4CQIA 4CXXA 4EOZB 3W15B 3RX6A 4PJLA 3AE2A 3L39A 1NENA 1T8BA 2EHOC 2NOXA 4EZHA 2BG9A 5ABGA 3ZMZB 2CA5A 4NPPA 5ABEA 2K24A 3HKBE 1ZOYA 4GOUA 2WAUA 1XZYA 5E0OA 3AA7B 4AQFC 1MMAA 2YKSA 3I0QA 2Q9QA 1VOMA 4ZOLE 4IDNA 1QSDA 4B3TT 1ZKEA 3K3NA 4A97A 1XDOA 4OHFA 2CXDA 5ADXL 4EYUA 1G8XA 2V5DA 4PK4A 5C2TA 5LGTB 3BQLA 5H6QB 3AECA 3M65A 4KHZF 2IW5B 1UURA 4F6RC 5J2TE 5AQTB 3ETVA 3ZMTB 2BS4A 3EDUA 3A5XA 1E1HB 5HCJA 2CMRA 2KWIB
chains in the Genus database with same CATH topology
3SS1A 3SRZA 4MFRA 4GK5E 5CB4E 3I9WA 3L3PA 1IJ6A 1WYBA 3FXEB 2PFVA 3GN5B 3VKHA 3C51A 4X1IE 1U4QA 2D0UA 3NBXX 2CLYB 1OWAA 1WLXA 1WYCA 2X9HA 5FXXA 2BDEA 5TAOA 4L0RA 3ZJ2A 4EAHA 2MYSA 1G73A 2HH7A 3KVBA 4K0UA 4AKIA 2LJLA 1HS7A 3AAAB 2WWUA 5FXWA 3MACA 4ZI3D 2CCQA 4PNIA 4X20E 5HXHA 1D0YA 2Z6EA 4PJMA 1IZNB 3U3IA 3UULA 2W00A 4E7SA 2JMHA 3ZCIA 4XZCA 2Y6XA 2W61A 5L3FB 4O4JE 3E22E 3V5SA 2VL8A 4TX5A 4U74A 2KNDA 3RYHE 4PJJA 3UTKA 4FJOA 3C64A 2KINB 4QX7B 3LBXB 3ZMUB 2M67A 2E9XB 3RKOA 4BA9A 5AFUL 5JR9C 2RP4A 5HWYA 4ADZA 3O1JA 3L09A 4H63H 1ZV4X 3F57A 2W63A 2BVMA 3WAKA 4Z8XA 1IAPA 2K9AA 4J2CA 3D0TA 1LRZA 2CXLA 2LM9A 5F8PA 5HAXA 2K48A 4JEHB 2XAJB 3KBUA 4ZHQE 5FMNA 2Q9QC 4PK5A 4OYKA 5JQGE 2LSJA 2V26A 1HF8A 1T98A 5FNVE 2NW7A 2JRKA 4YFSA 3E08A 1BR2A 3GA8A 1BR1A 1MIWA 3LK3B 4P0AA 2MOZA 3CX7B 3EVYA 5JH7E 5LJNA 3EUHA 2A72A 2D0TA 5M4YA 2KMFA 1UX4A 2YEVC 2A2FX 2WM9A 3ZYMA 3PTRB 3N9NA 5C8YE 4KUMB 2LOSA 4BAYB 5EK3A 3N2KE 3ZYLA 4E7ZA 2XAQB 4ISTA 2E8IA 2JJ9A 4HKAA 2X67A 3KV6A 5JDGA 2OA5A 3ZEFB 2N2NA 2ZMAA 2K5BB 4PW8A 4C91A 2JQQA 2XQYA 5LA6E 4UV9B 2Y8DA 3LK2B 4O8SA 3ZMVB 5DABA 2WSSV 1WRDA 3HKDE 4QX8B 2IC6A 5JDQA 1IJ5A 4U72A 5LGUB 3ZN0B 3N2OA 2UXXB 3AAEB 3ANWB 4X1KE 3HKCE 2X9WA 3FBLA 5JDHA 4WBNE 2I59A 1HX8A 2ZM0A 1D1AA 4I43B 4YHJA 3GN5A 5CA1E 1BR0A 4KMCA 2LEHA 3BQKA 4IGUA 3N9QA 4IIJE 4JEUB 3FXDB 5LG4A 2PJQA 3CKDA 4PAGA 4KBMB 2ZLYA 5LBQB 4ASKA 5FY0A 4ZS2A 4MHCA 3CQXC 2XAGB 2WBLA 4QHOA 4L5GA 4P09A 2H7VC 3CQCB 4CZZB 2LHNA 3QC9A 1D0XA 2LSIA 2HPJA 2ZM8A 4NUUA 1ZEEA 5EK2A 3MXZA 3AVRA 3OYZA 1LVFA 3Q5XA 3RPUA 2IC9A 1FIOA 5JRCB 2C5KT 2SPCA 4PJNA 4QWNB 3VU7H 4DVDA 2G0UA 4EZ4A 5L3EB 4H63V 4IE4A 4XAXB 1MIVA 5DJQC 2VKJA 2EHOD 5FXZA 1FMVA 2P9BA 5LCYA 2NP9A 5FP3A 2LOPA 3CX6B 2EHOB 4H9PC 5HYAA 5JDNA 3CWZB 2LHRA 3LBXA 2BVLA 5BMVE 5DQVA 1US7B 1Y64B 2E9XA 2X51A 3UUXB 3N9OA 4HE8A 1FMWA 3EDVA 3RRWA 1SHZC 1MNEA 4TV8E 4UXNB 5IHYA 5DQWA 5L3GB 2ES0A 5LHGB 3P8CD 2W62A 1YKEB 4YLHA 3N9MA 3R84B 4DMWA 3MZKB 3MJXA 1HTJF 3N5LA 1FEWA 3DTOA 4O4HE 4H9QC 3T8OA 4IE6A 4MALA 2N1GA 3OKQA 3DJBA 2NW9A 4ZI7E 2ACXA 3KFWX 3R6NA 3C50A 3HI2A 5JVDE 3TKLB 2C0SA 4QXCB 4UEMA 5EK4A 5IYZE 4WNKA 2CE7A 2VWAA 3FBZA 4ERRA 1X79A 4O4LE 4N78D 4AI6A 3U78A 5FXVA 1CUNA 3ESLA 3ZJ1A 1LVKA 2X0LB 3AAIA 3NZPA 4GIWA 2DWGA 3UT5E 2NTXA 2QA7A 4H9RC 5L2LA 3RC8A 3CVRA 3J9X1 4A56A 1U5PA 4IDZA 1HFAA 4KP3C 4OFZA 3BK9A 2L8KA 1YD8G 2V1DB 4UV8B 4B6XA 1LKXA 3RYIE 5JREA 2V7IA 2KWHA 4BJNA 3CPZA 1UCUA 4I4TE 3ANWA 2NW8A 1B7TA 3N2GE 4UVCB 4ZI2D 3GMIA 4QKNA 4UF0B 3S4UA 3PUAA 4PFOA 3ZYKA 3I1AA 3NRXA 4CXYA 1KNZA 2B1EA 3FHNA 2X68A 3UFEA 3WI3A 4IHJE 5LHIB 2DLRA 4MBQA 4PK6A 3UUMA 3LG7A 5LYJE 2JPFA 4HEAA 3KVAA 3BQIA 2GK9A 5J1GA 3SOLA 3KINB 2DWKA 4UELA 2VKDA 3LFMA 1MMGA 4HTEA 3V5UA 4OYJA 2H7OA 2YK0A 3AB3B 3OBVE 1QUUA 2LE8A 4UVAB 5CA0E 3I9YA 2N9DA 5HXRA 3ZCJA 2DI4A 2LT3A 3I0OA 4UVBB 5LHHB 1KK7A 2H3RA 5A1LA 4IE0A 2YINA 5JRCA 4NUVA 4ZI3C 4EB6E 5H6RB 3MA9A 3ZC1A 4OK0A 1S35A 2VKHA 4C90A 2V7MA 5ETWA 1Z0PA 3RC3A 5LJMA 1D1CA 4H9NC 1YKHB 2EHOA 4I50E 2A3DA 2CEAA 2KXPB 5HWXA 3O1HA 4IE5A 3Q2MA 2MBGA 4L9IA 3KV9A 3K3QC 4DMVA 5JR9B 1OXZA 2E9XC 5LNKA 3CX8B 3PU3A 4AQFA 4CI2B 4TV9E 2L3LA 4GYRA 1YW0A 4AXPA 3C4XA 2HPLA 5L3DB 2Q9QD 3ZPOA 4O2BE 4HFVA 2X9XA 5HXEA 4O2AE 4AKRB 3OJAA 4EYYR 3O9XA 3C98B 2Q9QB 3KDSE 3PUGA 2C5JA 4WBOA 4ZS3A 2VK9A 3E0ZA 4O4IE 5J2UE 1NWMX 3HA4A 4IE7A 1D0ZA 2NWBA 1NAFA 3ZMSB 5LOVE 3ZC0A 1MNDA 2CXFA 2XUEA 3KBTA 4MLKA 1HCIA 2MTQA 4YJ2E 3O4XE 5LXTE 2DCFA 2CWYA 2PBIA 3F31A 2V7KA 4G63A 3OYXA 2X9YA 2KT9A 4FI5A 4CI1B 2KLQA 2XHEB 4TN7B 3H3AA 3JC6C 3PURA 1VRBA 2D2SA 4HN9A 4AKLA 2XAHB 2V7JA 3IHRA 2QGSA 3PUSA 3ZN1B 4V1Av 3MK7C 1H7CA 1AJ3A 5KMGP 2RA1A 3PE0A 4CXWA 3PU8A 5JDLA 2ZM2A 4UF0A 2XAFB 4I55E 3RYCE 3C4WA 5KX5E 4ANJA 2JMKA 3IBPA 5FYMA 1MIYA 3GWHA 2UXNB 2DNXA 3HL6A 4DNDA 3H37A 4H9SE 5FY1A 2D5UA 4JUYA 4TUYE 4EIWA 2YU1A 2LSYA 3RYFE 3WAJA 2WMNA 1D1BA 5LBMA 5L3CB 5JDFA 4X1YE 4JLEA 3AVSA 2E9XD 1MMNA 3KV5A 2Y48B 2CWOA 3HR0A 4QXHB 2CM0A 3J7Yq 4EXTA 3LJCA 3RRCA 1UX5A 3B57A 3IF8B 3MKDA 2VKOA 4XBFB 3KV4A 3IEEA 2W0GA 3QK6A 4GYSA 2PG8A 2IAKA 3Q5WA 1SA0E 4G2AA 4CQIA 4CXXA 4EOZB 3AA6B 3W15B 3RX6A 3Q9DA 3AA1B 4BJMA 4PJLA 4UIGA 3ONXA 4AKHA 2CLYC 2EHOC 2NOXA 3SWHA 4EZHA 3K3OA 4ILUA 3ZMZB 3HKEE 2CA5A 4H9OC 1S94A 5JR9A 3VHLA 2K24A 1EZ3A 2C5IT 3HKBE 2ODUA 2KZ7B 4M1PA 1O3XA 5KDMC 4GOUA 4CI3B 5L3BB 2WAUA 5E0OA 3RH3A 3JC6D 5JDMA 3AA7B 1HG2A 2WMOA 4AQFC 1MMAA 2VB6A 3I0QA 1MMDA 2Q9QA 4WW0A 1VOMA 4ZOLE 3PDYA 4DO0A 4YJ3E 4AKGA 1QSDA 1ZKEA 3K3NA 3P7IA 1HG5A 2VASA 4ISSA 2YU2A 3NZQA 4OHFA 3K8PC 2CXDA 1BR4A 2V7LA 3UUNA 5ADXL 4EYUA 5LGNB 3QUJA 2XASB 1V9DA 4TZ4C 3F2EA 3ZLIA 1G8XA 4PK4A 5FY7A 4PFPA 5LGTB 3BQLA 5LP6E 5H6QB 5GONE 2LSKA 5HXSA 5EZYE 3C4ZA 3M65A 3N9LA 2IW5B 2DHRA 5F3JA 3AA0B 1WR6A 3ETUA 3NRYA 5HXCA 4DBQA 4F6RC 5J2TE 3CQGB 2L9QA 1ZHCA 4P0BA 2XTLA 3LK42 4GK0E 3CMLA 3N9PA 2X66A 3ETVA 2J1DG 3ZMTB 2NTYA 3EDUA 3A5XA 1E1HB 4HGAA 3B13A 4DBRA 2CMRA 2ODVA 3DP7A 3O1IA 3FB2A 3PUQA 2LSGA 4AQGA 2BZBA 3VKGA 2KWIB 4ZI2C 4QXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9D A;  1NAF A;  1OXZ A;  1O3X A;  1X79 A;  1WR6 A;  2N2N A;  1WRD A;  1NWM X;  1YD8 G; 
#chains in the Genus database with same CATH topology
 4YTP A;  1WYB A;  4LF9 T;  2PFV A;  3C51 A;  2CLY B;  1OWA A;  1WLX A;  1WYC A;  3AEE A;  4L0R A;  3ZJ2 A;  4EAH A;  4X66 T;  2LJL A;  2WWU A;  4PNI A;  1YQ3 A;  4PJM A;  1IZN B;  4E7S A;  2QVA A;  2W61 A;  5L3F B;  4O4J E;  2VL8 A;  2KND A;  5IWA T;  2M67 A;  2E9X B;  2RP4 A;  3O1J A;  2LRL A;  1ZV4 X;  1ZP0 A;  2LM9 A;  2CXL A;  4DR4 T;  2VL0 A;  4NXM T;  2H89 A;  5L47 A;  4DR5 T;  2NW7 A;  4HFB A;  4YFS A;  3E08 A;  3GA8 A;  3LK3 B;  3EVY A;  2D0T A;  4WYV A;  2KMF A;  1UX4 A;  2WWV A;  2WM9 A;  3LSV A;  3PUX F;  3N2K E;  3ZYL A;  2XAQ B;  2K5B B;  4PW8 A;  4ILC A;  2UUA T;  2WSS V;  4LF8 T;  3HKD E;  5LGU B;  3N2O A;  3ANW B;  4WBN E;  1HX8 A;  4I43 B;  3GN5 A;  5CA1 E;  1BR0 A;  4IIJ E;  3UQ4 A;  4HFC A;  5J0Z A;  4DV3 T;  4Z91 A;  4PAG A;  5ABF A;  2WBL A;  4P09 A;  4U7I A;  4CZZ B;  2OLT A;  2VQE T;  5BR8 T;  2HPJ A;  2X0H A;  4NUU A;  4Q25 A;  3MXZ A;  3RPU A;  1FIO A;  4PJN A;  4EED A;  3VU7 H;  4CN6 A;  1XMQ T;  4EZ4 A;  4IE4 A;  5DJQ C;  2NP9 A;  5FP3 A;  2LOP A;  2EHO B;  4H9P C;  3CWZ B;  5BMV E;  2E2A A;  2FJD A;  2X51 A;  4TWD A;  2CHN A;  4HE8 A;  3EDV A;  4UXN B;  3EAB A;  5LHG B;  2UUB T;  2W66 A;  3DTO A;  4H9Q C;  3AE3 A;  4MAL A;  1T7S A;  3OKQ A;  4ZI7 E;  2CHO A;  2ACX A;  2CRB A;  2B76 A;  4DV1 T;  4KI0 F;  4TNV A;  5EK4 A;  2VUR A;  4WNK A;  3FBZ A;  4N78 D;  5AQS B;  5FXV A;  1N36 T;  1QLB A;  3UT5 E;  4H9R C;  5L2L A;  1N33 T;  4WZX A;  2IHR 1;  5JRE A;  2KWH A;  3CPZ A;  1UCU A;  4UVC B;  3N2G E;  4ZI2 D;  3GMI A;  1N32 T;  3S4U A;  3PUA A;  3ZYK A;  2X68 A;  5FVK A;  5LHI B;  4TNW A;  3UUM A;  2PTF A;  4HEA A;  4HWI B;  3V5U A;  3VRA A;  4OYJ A;  2H7O A;  3AB3 B;  3P4S A;  3OBV E;  1IBK T;  2N9D A;  3ZCJ A;  5A1L A;  4IE0 A;  5AQJ B;  3SFD A;  5HEG A;  4ZZC A;  1VCT A;  5H6R B;  3MA9 A;  1S35 A;  4DV6 T;  5IUX A;  3UQ7 A;  3Q5D A;  3Q2M A;  2MPK A;  3CX8 B;  4CI2 B;  2VQF T;  2WS3 A;  4GYR A;  1YXR A;  1YQ4 A;  4AKR B;  3C98 B;  3KDS E;  3CK6 A;  4WBO A;  3E0Z A;  2WP9 A;  1NWM X;  1MND A;  2CXF A;  2XUE A;  4IDQ A;  1HCI A;  2DCF A;  2V7K A;  4CI1 B;  3H3A A;  3JC6 C;  3PUR A;  1VRB A;  4HN9 A;  5FVL A;  2V7J A;  4YT0 A;  3AEB A;  3ZN1 B;  2XZE A;  1AJ3 A;  3JAE A;  2RA1 A;  5ABF B;  4UF0 A;  4OX9 T;  4I55 E;  4GKK T;  3K1S A;  3RIA A;  2YN6 A;  2UXN B;  2DNX A;  4YTN A;  2XJ7 A;  1OED C;  4EIW A;  3RYF E;  2WMN A;  3ZKR A;  4X1Y E;  2E9X D;  3J7Y q;  4EXT A;  2BKN A;  3MKD A;  4XBF B;  3CIR A;  3IEE A;  2XQ9 A;  1J1J A;  3AA6 B;  4UIG A;  3ONX A;  2CLY C;  3AE1 A;  3K3O A;  1S94 A;  2RPA A;  2AXD S;  2LKG A;  2WZI A;  5JDM A;  1MMD A;  4DO0 A;  2UXB T;  1FJG T;  1HG5 A;  4ISS A;  4P1N A;  4JI0 T;  5LGN B;  1V9D A;  5CFB A;  3X1D A;  5FY7 A;  3C4Z A;  5LMN T;  2XQ3 A;  2L9Q A;  4P0B A;  2XTL A;  3LK4 2;  4GK0 E;  3RHW A;  3CML A;  3N9P A;  2X66 A;  3AE8 A;  2FBW A;  3B13 A;  3RQW A;  1I6Z A;  4JI4 T;  1UK5 A;  4CN1 A;  5F5W A;  4UEL A;  2WU5 A;  4HWH A;  4MFR A;  3H3M A;  3L3P A;  3VKH A;  2XQA A;  2BDE A;  2MYS A;  1G73 A;  1J5W A;  1L0V A;  4K0U A;  2V5C A;  3VRB A;  5FXW A;  2CCQ A;  3UUL A;  2W00 A;  2JMH A;  2Y6X A;  2VVN A;  3AXJ A;  3E22 E;  3V5S A;  4U74 A;  2KIN B;  4QX7 B;  4HWF A;  3LBX B;  3ZMU B;  2BG9 C;  4DV0 T;  4H63 H;  2AE9 A;  3F57 A;  5AQN B;  2WB5 A;  4Z8X A;  1IAP A;  2K9A A;  4J2C A;  2XQ8 A;  3D0T A;  5HAX A;  5FMN A;  5CJ5 A;  2Q9Q C;  1E7P A;  1HF8 A;  2UXC T;  2QYW A;  5LJN A;  2CBI A;  5M4Y A;  1DU2 A;  3NKZ A;  2A2F X;  3PTR B;  3N9N A;  2LOS A;  5EK3 A;  4E7Z A;  4Z90 A;  4IST A;  2JJ9 A;  3ONL C;  3PUY F;  3LK2 B;  4O8S A;  3IA3 A;  2DL1 A;  2IC6 A;  3EI0 A;  2UXX B;  3AAE B;  3FZH B;  3FBL A;  5JDH A;  3OPC A;  4YHJ A;  2LRK A;  1OED B;  4JEU B;  1HX1 B;  3FXD B;  4NXN T;  3CKD A;  5FL0 A;  3ONJ A;  4ZS2 A;  4MHC A;  5FY0 A;  2XAG B;  2LHN A;  3QC9 A;  2LSI A;  2ZM8 A;  1ZEE A;  3T1Y T;  3AVR A;  2BKP A;  1LVF A;  3Q5X A;  4A5X A;  5AQU B;  2SPC A;  2WCA A;  3UU3 A;  5L3E B;  4XAX B;  5FXZ A;  5LCY A;  1SUM B;  5AQV B;  1JNZ A;  5LB7 B;  4LFA T;  4ILB A;  1FMW A;  1SHZ C;  4TV8 E;  5IHY A;  3RGL A;  3TLW A;  4JV5 T;  3P8C D;  2W62 A;  4DMW A;  3R84 B;  3MJX A;  1HTJ F;  3AEG A;  4YTM A;  4LF7 T;  4IE6 A;  3KFW X;  3C50 A;  5JVD E;  4UEM A;  2FJB A;  4JI2 T;  5FKY A;  4AI6 A;  3ESL A;  4DUZ T;  4EEB A;  3ZJ1 A;  3AAI A;  4GIW A;  2JIW A;  1UGO A;  4A56 A;  1U5P A;  5AQP B;  1HFA A;  2I0M A;  3BK9 A;  1YD8 G;  4UV8 B;  1LKX A;  2H88 A;  2V7I A;  4BJN A;  4I4T E;  4HFD A;  2M6B A;  4CXY A;  2B1E A;  3LG7 A;  2JPF A;  3KVA A;  4U2Z A;  2GK9 A;  4U31 A;  3LFM A;  1W9R A;  1HNW T;  4UVA B;  1HNZ T;  5HXR A;  4AIU A;  4F8H A;  2H3R A;  5JRC A;  4DV2 T;  3ZC1 A;  2W2U A;  4C90 A;  2V7M A;  1Z0P A;  4AQY T;  3RC3 A;  5HEO A;  4H9N C;  1YKH B;  2CEA A;  2KXP B;  4IE5 A;  5L4E A;  2BG9 B;  3K3Q C;  2XSB A;  4TV9 E;  4ZEY A;  3M3Z B;  4LMK A;  2X9X A;  1VCS A;  4O2A E;  3O9X A;  4EYY R;  3ZT6 A;  2Q9Q B;  4ZS3 A;  3AEF A;  5J2U E;  4IE7 A;  1NAF A;  4YSY A;  5LOV E;  3KBT A;  3O4X E;  1WFD A;  4ZXL A;  2BS2 A;  3UU5 A;  3SFE A;  4DID B;  2KLQ A;  3RIU A;  5AQK B;  2XAH B;  3ZT5 A;  3IHR A;  4V1A v;  4B3S T;  5KMG P;  4DR6 T;  4CXW A;  3PU8 A;  2ZM2 A;  5AQQ B;  3RYC E;  3TLS A;  4ANJ A;  2JMK A;  2F4V T;  5FYM A;  1MIY A;  3GWH A;  4YHH T;  3AED A;  2ZM6 T;  1OED E;  5FY1 A;  2YU1 A;  2LSY A;  5LBM A;  3AVS A;  2CWO A;  4QXH B;  2CM0 A;  3LJC A;  2WDV A;  3RRC A;  1UX5 A;  2VKO A;  2PG8 A;  2IAK A;  5AQG B;  3Q5W A;  2NR4 A;  4G2A A;  2V6Y A;  2BBH A;  3AA1 B;  4JI6 T;  3SWH A;  4ILU A;  3HKE E;  1WCR A;  5HEJ A;  5JR9 A;  1KEY A;  1XMO T;  1EZ3 A;  2C5I T;  4M1P A;  2MAW A;  2KZ7 B;  1XDP A;  4CI3 B;  5L3B B;  3JC6 D;  1HG2 A;  4KHP T;  4X64 T;  4DR1 T;  4YJ3 E;  4AKG A;  4QH1 A;  3QOF A;  4LML A;  2YU2 A;  3NZQ A;  3UUN A;  2V7L A;  4QH4 A;  4DV7 T;  3QUJ A;  2XAS B;  4TZ4 C;  3ZLI A;  3F2E A;  3AE5 A;  2UUC T;  5GON E;  2LSK A;  2XSA A;  1HR0 T;  3JCF A;  5F3J A;  2DHR A;  3UFG A;  3P50 A;  3AA0 B;  1WR6 A;  3ETU A;  5HXC A;  3CQG B;  3RI5 A;  4ZZB A;  4IL4 A;  2NTY A;  3PJA J;  2CPT A;  4JI8 T;  4IRE A;  5AQI B;  3OTO T;  1J5E T;  4HGA A;  3O1I A;  4X5T A;  3PUQ A;  4AQG A;  3VKG A;  4ZI2 C;  3SS1 A;  3SRZ A;  1Y01 A;  4GK5 E;  2VVS A;  5CB4 E;  3TLU A;  1X9B A;  3I9W A;  1IJ6 A;  3FXE B;  3GN5 B;  1JNR A;  1U4Q A;  3NBX X;  2WZH A;  2LKH A;  5FXX A;  4DR3 T;  2YDR A;  2HH7 A;  2WDR A;  4AKI A;  1HS7 A;  3MAC A;  4ZI3 D;  2M6I A;  2A9U A;  1D0Y A;  3U3I A;  3ZCI A;  3AE6 A;  3RYH E;  2IDO B;  2BG9 E;  3UTK A;  4FJO A;  3UU4 A;  2K3W A;  4BA9 A;  3L09 A;  3QB5 K;  2BVM A;  3WAK A;  2W4X A;  1LRZ A;  5F8P A;  2K48 A;  2XAJ B;  3KBU A;  3T1H T;  4PK5 A;  4OYK A;  2LSJ A;  1T98 A;  5FNV E;  3L8R A;  4A98 A;  1MIW A;  4LF4 T;  1W0A A;  2MOZ A;  3Q5E A;  2D9D A;  2YEV C;  3ZYM A;  4BAY B;  2E8I A;  4HKA A;  2X67 A;  3KV6 A;  5JDG A;  2OA5 A;  3ZEF B;  4YSZ A;  2UU9 T;  4QX8 B;  2CBJ A;  4U72 A;  2X9W A;  5KXJ A;  5AQM B;  4IGU A;  2PJQ A;  5LMU T;  2ZLY A;  5LBQ B;  4QHO A;  2H7V C;  3CQC B;  1D0X A;  4JI3 T;  2KSR A;  2YDQ A;  2FJE A;  3P4P A;  4DVD A;  3FZF B;  2G0U A;  4H63 V;  1MIV A;  1I94 T;  4LMJ A;  2J4G A;  2EHO D;  1FMV A;  5AQH B;  3CX6 B;  5HYA A;  5AQF B;  1US7 B;  2E9X A;  3RRW A;  4I0U A;  4JI1 T;  5DQW A;  5L3G B;  2WDQ A;  1YKE B;  3N9M A;  2UXD T;  4TWH A;  4IL9 A;  3T8O A;  3R6N A;  3TKL B;  3NWI A;  2CE7 A;  2VWA A;  4ERR A;  1X79 A;  4O4L E;  5HEU A;  3U78 A;  1CUN A;  5ABH A;  2QRX A;  1XWM A;  2XQ5 A;  2DWG A;  2QA7 A;  3J9X 1;  1M7K A;  4OFZ A;  2V1D B;  4B6X A;  1W09 A;  3ANW A;  2NW8 A;  1B7T A;  2BKO A;  4UF0 B;  4QKN A;  4PFO A;  3I1A A;  3WI3 A;  2DLR A;  4QH5 A;  4PK6 A;  5LYJ E;  5J1G A;  3SOL A;  1Z8U A;  4HTE A;  5AQL B;  2XY8 B;  4U7Y A;  2LT3 A;  3I0O A;  2E5L T;  4UVB B;  4YY3 T;  4NUV A;  4EB6 E;  4OK0 A;  1IBL T;  5ETW A;  1D1C A;  2EHO A;  2A3D A;  2V8S V;  3O1H A;  4U3C A;  2MBG A;  4L9I A;  3KV9 A;  1NEK A;  4IT4 A;  1OXZ A;  5LNK A;  4AQF A;  2L3L A;  4AXP A;  3C4X A;  2WU2 A;  5L3D B;  3ZPO A;  1IBM T;  4HFV A;  5HXE A;  3PUG A;  2VK9 A;  1D0Z A;  3ZMS B;  3P4Q A;  3ZC0 A;  4MLK A;  2MTQ A;  4YJ2 E;  2PBI A;  4G63 A;  2X9Y A;  4AKL A;  4HFE A;  2XM1 A;  2QGS A;  3PUS A;  2LLY A;  3TLT A;  3AE9 A;  4ILA A;  3C4W A;  5KX5 E;  3IBP A;  3HL6 A;  4DND A;  2OV9 A;  3H37 A;  1M62 A;  4TUY E;  3EHZ A;  3P4R A;  3WAJ A;  1D1B A;  1W0B A;  4JLE A;  3JAD A;  3HR0 A;  3AE7 A;  3KV4 A;  5HCM A;  2W0G A;  3QK6 A;  3AXJ B;  3Q9D A;  4BJM A;  3RIF A;  4AKH A;  4TWF A;  4H9O C;  2E5V A;  3VHL A;  2J62 A;  2ODU A;  5KDM C;  1O3X A;  3RH3 A;  2WMO A;  1CHU A;  2VB6 A;  1KFY A;  1N34 T;  4WW0 A;  3PDY A;  2IML A;  3JAF A;  2WQY A;  3P7I A;  2VAS A;  2FJA A;  3K8P C;  1BR4 A;  3A7M A;  5CGM A;  4PFP A;  1KNP A;  5LP6 E;  5HXS A;  5EZY E;  2XQ7 A;  3N9L A;  1HNX T;  3NRY A;  4DBQ A;  4LF6 T;  3RIU C;  1ZHC A;  4U2Y A;  3AEA A;  2J47 A;  2J1D G;  1KNR A;  2JQH A;  1XNR T;  4DBR A;  2ODV A;  3DP7 A;  3FB2 A;  2YOE A;  2R6G F;  3RQU A;  2LSG A;  5C3J A;  2BZB A;  2LM2 A;  4QXB B;  3ZSS A;  2JQ9 A;  4X1I E;  2D0U A;  2X9H A;  5TAO A;  2BS3 A;  3KVB A;  3AAA B;  4X65 T;  4JBW F;  4X20 E;  4EGW A;  5HXH A;  2V6X A;  2Z6E A;  4XZC A;  2X0Y A;  3ZST A;  4TX5 A;  4LFC T;  2FUP A;  4PJJ A;  3C64 A;  4JI7 T;  3RF1 A;  3RKO A;  5AFU L;  5JR9 C;  5HWY A;  4ADZ A;  1SE7 A;  3PV0 F;  2W63 A;  2XQ6 A;  4JEH B;  4ZHQ E;  2HN1 A;  5JQG E;  2V26 A;  3RLF F;  2JRK A;  4JI5 T;  1BR2 A;  1BR1 A;  4P0A A;  5AQR B;  3CX7 B;  3A8Y C;  5JH7 E;  3EUH A;  2A72 A;  1XNQ T;  3UU8 A;  4X62 T;  5C8Y E;  4KUM B;  3EAM A;  2N2N A;  2ZMA A;  4C91 A;  2JQQ A;  2XQY A;  5LA6 E;  4UV9 B;  2Y8D A;  3ZMV B;  5DAB A;  1WRD A;  5JDQ A;  1IJ5 A;  3ZN0 B;  4X1K E;  3VR8 A;  3HKC E;  2I59 A;  2ZM0 A;  1D1A A;  3B5M A;  4KMC A;  2LEH A;  3BQK A;  3N9Q A;  5LG4 A;  4NIQ A;  4KBM B;  4ASK A;  3FZL B;  3CQX C;  4LF5 T;  3ABV A;  3PUZ F;  4L5G A;  3PUV F;  4IDP A;  5EK2 A;  3OYZ A;  1R8I A;  3NVO A;  2IC9 A;  3FZM B;  5JRC B;  2C5K T;  4QWN B;  2VKJ A;  2XQ4 A;  2P9B A;  4IDO A;  5JDN A;  4UR9 A;  4EV6 A;  2LHR A;  3LBX A;  2BVL A;  4AIS A;  5DQV A;  1Y64 B;  3FZK B;  3UUX B;  3N9O A;  1MNE A;  2JQK A;  4DV5 T;  2ES0 A;  3QNU A;  4YLH A;  3MZK B;  3N5L A;  1FEW A;  4O4H E;  5JTG A;  2N1G A;  3DJB A;  2NW9 A;  1WR0 A;  1T72 A;  3HI2 A;  4LFB T;  5L4H A;  2C0S A;  4QXC B;  3P4W A;  5IYZ E;  5FL1 A;  3AE4 A;  2YDS A;  1LVK A;  2X0L B;  3NZP A;  3OVU A;  2NTX A;  3RC8 A;  3CVR A;  4YXD A;  4IDZ A;  4COF A;  4KP3 C;  2L8K A;  3RYI E;  3TLV A;  3UUB A;  5LG3 A;  2W67 A;  2BBJ A;  1GQE A;  4CN4 A;  4DV4 T;  3NRX A;  1KNZ A;  3FHN A;  3UFE A;  4IHJ E;  4MBQ A;  1OED A;  3BQI A;  3KIN B;  2DWK A;  2VKD A;  1MMG A;  1KF6 A;  2YK0 A;  2HN2 A;  1QUU A;  2LE8 A;  5CA0 E;  4DUY T;  4YSX A;  3I9Y A;  2DI4 A;  4HFH A;  5LHH B;  1KK7 A;  2YIN A;  1E2A A;  2WY2 A;  4ZI3 C;  2VKH A;  5LJM A;  2V6Y B;  4I50 E;  4JYA T;  5HWX A;  2HHH T;  3PUW F;  2IUB A;  3PJA A;  3QB5 A;  4DMV A;  4U33 A;  5JR9 B;  2E9X C;  3PU3 A;  1YW0 A;  3RKG A;  4KX6 A;  2HPL A;  2Q9Q D;  4O2B E;  3OJA A;  2C5J A;  2IIU A;  4O4I E;  3HA4 A;  2NWB A;  3ZT7 A;  4B3M T;  5LXT E;  2CWY A;  3F31 A;  2I6H A;  4DR7 T;  3OYX A;  2KT9 A;  4FI5 A;  2XHE B;  4TN7 B;  2D2S A;  4GKJ T;  3G06 A;  3MK7 C;  1H7C A;  2ACZ A;  3PE0 A;  3VR9 A;  5JDL A;  4B3R T;  2XAF B;  5HEH A;  4H9S E;  2D5U A;  4HWD A;  4JUY A;  4HFI A;  3UU6 A;  2XPK A;  5L3C B;  5JDF A;  1MMN A;  3KV5 A;  2Y48 B;  4DR2 T;  3LDQ B;  4K0K T;  3B57 A;  3IF8 B;  4HWC A;  2XM2 A;  4GYS A;  5AQO B;  1SA0 E;  1UUS A;  4CQI A;  4CXX A;  4EOZ B;  3W15 B;  3RX6 A;  4PJL A;  3AE2 A;  3L39 A;  1NEN A;  1T8B A;  2EHO C;  2NOX A;  4EZH A;  2BG9 A;  5ABG A;  3ZMZ B;  2CA5 A;  4NPP A;  5ABE A;  2K24 A;  3HKB E;  1ZOY A;  4GOU A;  2WAU A;  1XZY A;  5E0O A;  3AA7 B;  4AQF C;  1MMA A;  2YKS A;  3I0Q A;  2Q9Q A;  1VOM A;  4ZOL E;  4IDN A;  1QSD A;  4B3T T;  1ZKE A;  3K3N A;  4A97 A;  1XDO A;  4OHF A;  2CXD A;  5ADX L;  4EYU A;  1G8X A;  2V5D A;  4PK4 A;  5C2T A;  5LGT B;  3BQL A;  5H6Q B;  3AEC A;  3M65 A;  4KHZ F;  2IW5 B;  1UUR A;  4F6R C;  5J2T E;  5AQT B;  3ETV A;  3ZMT B;  2BS4 A;  3EDU A;  3A5X A;  1E1H B;  5HCJ A;  2CMR A;  2KWI B; 
#chains in the Genus database with same CATH homology
 3SS1 A;  3SRZ A;  4MFR A;  4GK5 E;  5CB4 E;  3I9W A;  3L3P A;  1IJ6 A;  1WYB A;  3FXE B;  2PFV A;  3GN5 B;  3VKH A;  3C51 A;  4X1I E;  1U4Q A;  2D0U A;  3NBX X;  2CLY B;  1OWA A;  1WLX A;  1WYC A;  2X9H A;  5FXX A;  2BDE A;  5TAO A;  4L0R A;  3ZJ2 A;  4EAH A;  2MYS A;  1G73 A;  2HH7 A;  3KVB A;  4K0U A;  4AKI A;  2LJL A;  1HS7 A;  3AAA B;  2WWU A;  5FXW A;  3MAC A;  4ZI3 D;  2CCQ A;  4PNI A;  4X20 E;  5HXH A;  1D0Y A;  2Z6E A;  4PJM A;  1IZN B;  3U3I A;  3UUL A;  2W00 A;  4E7S A;  2JMH A;  3ZCI A;  4XZC A;  2Y6X A;  2W61 A;  5L3F B;  4O4J E;  3E22 E;  3V5S A;  2VL8 A;  4TX5 A;  4U74 A;  2KND A;  3RYH E;  4PJJ A;  3UTK A;  4FJO A;  3C64 A;  2KIN B;  4QX7 B;  3LBX B;  3ZMU B;  2M67 A;  2E9X B;  3RKO A;  4BA9 A;  5AFU L;  5JR9 C;  2RP4 A;  5HWY A;  4ADZ A;  3O1J A;  3L09 A;  4H63 H;  1ZV4 X;  3F57 A;  2W63 A;  2BVM A;  3WAK A;  4Z8X A;  1IAP A;  2K9A A;  4J2C A;  3D0T A;  1LRZ A;  2CXL A;  2LM9 A;  5F8P A;  5HAX A;  2K48 A;  4JEH B;  2XAJ B;  3KBU A;  4ZHQ E;  5FMN A;  2Q9Q C;  4PK5 A;  4OYK A;  5JQG E;  2LSJ A;  2V26 A;  1HF8 A;  1T98 A;  5FNV E;  2NW7 A;  2JRK A;  4YFS A;  3E08 A;  1BR2 A;  3GA8 A;  1BR1 A;  1MIW A;  3LK3 B;  4P0A A;  2MOZ A;  3CX7 B;  3EVY A;  5JH7 E;  5LJN A;  3EUH A;  2A72 A;  2D0T A;  5M4Y A;  2KMF A;  1UX4 A;  2YEV C;  2A2F X;  2WM9 A;  3ZYM A;  3PTR B;  3N9N A;  5C8Y E;  4KUM B;  2LOS A;  4BAY B;  5EK3 A;  3N2K E;  3ZYL A;  4E7Z A;  2XAQ B;  4IST A;  2E8I A;  2JJ9 A;  4HKA A;  2X67 A;  3KV6 A;  5JDG A;  2OA5 A;  3ZEF B;  2N2N A;  2ZMA A;  2K5B B;  4PW8 A;  4C91 A;  2JQQ A;  2XQY A;  5LA6 E;  4UV9 B;  2Y8D A;  3LK2 B;  4O8S A;  3ZMV B;  5DAB A;  2WSS V;  1WRD A;  3HKD E;  4QX8 B;  2IC6 A;  5JDQ A;  1IJ5 A;  4U72 A;  5LGU B;  3ZN0 B;  3N2O A;  2UXX B;  3AAE B;  3ANW B;  4X1K E;  3HKC E;  2X9W A;  3FBL A;  5JDH A;  4WBN E;  2I59 A;  1HX8 A;  2ZM0 A;  1D1A A;  4I43 B;  4YHJ A;  3GN5 A;  5CA1 E;  1BR0 A;  4KMC A;  2LEH A;  3BQK A;  4IGU A;  3N9Q A;  4IIJ E;  4JEU B;  3FXD B;  5LG4 A;  2PJQ A;  3CKD A;  4PAG A;  4KBM B;  2ZLY A;  5LBQ B;  4ASK A;  5FY0 A;  4ZS2 A;  4MHC A;  3CQX C;  2XAG B;  2WBL A;  4QHO A;  4L5G A;  4P09 A;  2H7V C;  3CQC B;  4CZZ B;  2LHN A;  3QC9 A;  1D0X A;  2LSI A;  2HPJ A;  2ZM8 A;  4NUU A;  1ZEE A;  5EK2 A;  3MXZ A;  3AVR A;  3OYZ A;  1LVF A;  3Q5X A;  3RPU A;  2IC9 A;  1FIO A;  5JRC B;  2C5K T;  2SPC A;  4PJN A;  4QWN B;  3VU7 H;  4DVD A;  2G0U A;  4EZ4 A;  5L3E B;  4H63 V;  4IE4 A;  4XAX B;  1MIV A;  5DJQ C;  2VKJ A;  2EHO D;  5FXZ A;  1FMV A;  2P9B A;  5LCY A;  2NP9 A;  5FP3 A;  2LOP A;  3CX6 B;  2EHO B;  4H9P C;  5HYA A;  5JDN A;  3CWZ B;  2LHR A;  3LBX A;  2BVL A;  5BMV E;  5DQV A;  1US7 B;  1Y64 B;  2E9X A;  2X51 A;  3UUX B;  3N9O A;  4HE8 A;  1FMW A;  3EDV A;  3RRW A;  1SHZ C;  1MNE A;  4TV8 E;  4UXN B;  5IHY A;  5DQW A;  5L3G B;  2ES0 A;  5LHG B;  3P8C D;  2W62 A;  1YKE B;  4YLH A;  3N9M A;  3R84 B;  4DMW A;  3MZK B;  3MJX A;  1HTJ F;  3N5L A;  1FEW A;  3DTO A;  4O4H E;  4H9Q C;  3T8O A;  4IE6 A;  4MAL A;  2N1G A;  3OKQ A;  3DJB A;  2NW9 A;  4ZI7 E;  2ACX A;  3KFW X;  3R6N A;  3C50 A;  3HI2 A;  5JVD E;  3TKL B;  2C0S A;  4QXC B;  4UEM A;  5EK4 A;  5IYZ E;  4WNK A;  2CE7 A;  2VWA A;  3FBZ A;  4ERR A;  1X79 A;  4O4L E;  4N78 D;  4AI6 A;  3U78 A;  5FXV A;  1CUN A;  3ESL A;  3ZJ1 A;  1LVK A;  2X0L B;  3AAI A;  3NZP A;  4GIW A;  2DWG A;  3UT5 E;  2NTX A;  2QA7 A;  4H9R C;  5L2L A;  3RC8 A;  3CVR A;  3J9X 1;  4A56 A;  1U5P A;  4IDZ A;  1HFA A;  4KP3 C;  4OFZ A;  3BK9 A;  2L8K A;  1YD8 G;  2V1D B;  4UV8 B;  4B6X A;  1LKX A;  3RYI E;  5JRE A;  2V7I A;  2KWH A;  4BJN A;  3CPZ A;  1UCU A;  4I4T E;  3ANW A;  2NW8 A;  1B7T A;  3N2G E;  4UVC B;  4ZI2 D;  3GMI A;  4QKN A;  4UF0 B;  3S4U A;  3PUA A;  4PFO A;  3ZYK A;  3I1A A;  3NRX A;  4CXY A;  1KNZ A;  2B1E A;  3FHN A;  2X68 A;  3UFE A;  3WI3 A;  4IHJ E;  5LHI B;  2DLR A;  4MBQ A;  4PK6 A;  3UUM A;  3LG7 A;  5LYJ E;  2JPF A;  4HEA A;  3KVA A;  3BQI A;  2GK9 A;  5J1G A;  3SOL A;  3KIN B;  2DWK A;  4UEL A;  2VKD A;  3LFM A;  1MMG A;  4HTE A;  3V5U A;  4OYJ A;  2H7O A;  2YK0 A;  3AB3 B;  3OBV E;  1QUU A;  2LE8 A;  4UVA B;  5CA0 E;  3I9Y A;  2N9D A;  5HXR A;  3ZCJ A;  2DI4 A;  2LT3 A;  3I0O A;  4UVB B;  5LHH B;  1KK7 A;  2H3R A;  5A1L A;  4IE0 A;  2YIN A;  5JRC A;  4NUV A;  4ZI3 C;  4EB6 E;  5H6R B;  3MA9 A;  3ZC1 A;  4OK0 A;  1S35 A;  2VKH A;  4C90 A;  2V7M A;  5ETW A;  1Z0P A;  3RC3 A;  5LJM A;  1D1C A;  4H9N C;  1YKH B;  2EHO A;  4I50 E;  2A3D A;  2CEA A;  2KXP B;  5HWX A;  3O1H A;  4IE5 A;  3Q2M A;  2MBG A;  4L9I A;  3KV9 A;  3K3Q C;  4DMV A;  5JR9 B;  1OXZ A;  2E9X C;  5LNK A;  3CX8 B;  3PU3 A;  4AQF A;  4CI2 B;  4TV9 E;  2L3L A;  4GYR A;  1YW0 A;  4AXP A;  3C4X A;  2HPL A;  5L3D B;  2Q9Q D;  3ZPO A;  4O2B E;  4HFV A;  2X9X A;  5HXE A;  4O2A E;  4AKR B;  3OJA A;  4EYY R;  3O9X A;  3C98 B;  2Q9Q B;  3KDS E;  3PUG A;  2C5J A;  4WBO A;  4ZS3 A;  2VK9 A;  3E0Z A;  4O4I E;  5J2U E;  1NWM X;  3HA4 A;  4IE7 A;  1D0Z A;  2NWB A;  1NAF A;  3ZMS B;  5LOV E;  3ZC0 A;  1MND A;  2CXF A;  2XUE A;  3KBT A;  4MLK A;  1HCI A;  2MTQ A;  4YJ2 E;  3O4X E;  5LXT E;  2DCF A;  2CWY A;  2PBI A;  3F31 A;  2V7K A;  4G63 A;  3OYX A;  2X9Y A;  2KT9 A;  4FI5 A;  4CI1 B;  2KLQ A;  2XHE B;  4TN7 B;  3H3A A;  3JC6 C;  3PUR A;  1VRB A;  2D2S A;  4HN9 A;  4AKL A;  2XAH B;  2V7J A;  3IHR A;  2QGS A;  3PUS A;  3ZN1 B;  4V1A v;  3MK7 C;  1H7C A;  1AJ3 A;  5KMG P;  2RA1 A;  3PE0 A;  4CXW A;  3PU8 A;  5JDL A;  2ZM2 A;  4UF0 A;  2XAF B;  4I55 E;  3RYC E;  3C4W A;  5KX5 E;  4ANJ A;  2JMK A;  3IBP A;  5FYM A;  1MIY A;  3GWH A;  2UXN B;  2DNX A;  3HL6 A;  4DND A;  3H37 A;  4H9S E;  5FY1 A;  2D5U A;  4JUY A;  4TUY E;  4EIW A;  2YU1 A;  2LSY A;  3RYF E;  3WAJ A;  2WMN A;  1D1B A;  5LBM A;  5L3C B;  5JDF A;  4X1Y E;  4JLE A;  3AVS A;  2E9X D;  1MMN A;  3KV5 A;  2Y48 B;  2CWO A;  3HR0 A;  4QXH B;  2CM0 A;  3J7Y q;  4EXT A;  3LJC A;  3RRC A;  1UX5 A;  3B57 A;  3IF8 B;  3MKD A;  2VKO A;  4XBF B;  3KV4 A;  3IEE A;  2W0G A;  3QK6 A;  4GYS A;  2PG8 A;  2IAK A;  3Q5W A;  1SA0 E;  4G2A A;  4CQI A;  4CXX A;  4EOZ B;  3AA6 B;  3W15 B;  3RX6 A;  3Q9D A;  3AA1 B;  4BJM A;  4PJL A;  4UIG A;  3ONX A;  4AKH A;  2CLY C;  2EHO C;  2NOX A;  3SWH A;  4EZH A;  3K3O A;  4ILU A;  3ZMZ B;  3HKE E;  2CA5 A;  4H9O C;  1S94 A;  5JR9 A;  3VHL A;  2K24 A;  1EZ3 A;  2C5I T;  3HKB E;  2ODU A;  2KZ7 B;  4M1P A;  1O3X A;  5KDM C;  4GOU A;  4CI3 B;  5L3B B;  2WAU A;  5E0O A;  3RH3 A;  3JC6 D;  5JDM A;  3AA7 B;  1HG2 A;  2WMO A;  4AQF C;  1MMA A;  2VB6 A;  3I0Q A;  1MMD A;  2Q9Q A;  4WW0 A;  1VOM A;  4ZOL E;  3PDY A;  4DO0 A;  4YJ3 E;  4AKG A;  1QSD A;  1ZKE A;  3K3N A;  3P7I A;  1HG5 A;  2VAS A;  4ISS A;  2YU2 A;  3NZQ A;  4OHF A;  3K8P C;  2CXD A;  1BR4 A;  2V7L A;  3UUN A;  5ADX L;  4EYU A;  5LGN B;  3QUJ A;  2XAS B;  1V9D A;  4TZ4 C;  3F2E A;  3ZLI A;  1G8X A;  4PK4 A;  5FY7 A;  4PFP A;  5LGT B;  3BQL A;  5LP6 E;  5H6Q B;  5GON E;  2LSK A;  5HXS A;  5EZY E;  3C4Z A;  3M65 A;  3N9L A;  2IW5 B;  2DHR A;  5F3J A;  3AA0 B;  1WR6 A;  3ETU A;  3NRY A;  5HXC A;  4DBQ A;  4F6R C;  5J2T E;  3CQG B;  2L9Q A;  1ZHC A;  4P0B A;  2XTL A;  3LK4 2;  4GK0 E;  3CML A;  3N9P A;  2X66 A;  3ETV A;  2J1D G;  3ZMT B;  2NTY A;  3EDU A;  3A5X A;  1E1H B;  4HGA A;  3B13 A;  4DBR A;  2CMR A;  2ODV A;  3DP7 A;  3O1I A;  3FB2 A;  3PUQ A;  2LSG A;  4AQG A;  2BZB A;  3VKG A;  2KWI B;  4ZI2 C;  4QXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...