3BQLA

Structure of a chondroitin sulphate binding dbl3x domain from a var2csa encoded pfemp1 protein
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
360
structure length
338
Chain Sequence
b'SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDKKGQKGKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSGDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 118
structure length 338
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqlA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqlA02
3CMLA 3RRCA 3C64A 5F3JA 2YK0A 3BQLA 4NUVA 3BQIA 2WAUA 2Y8DA 4YFSA 2XU0A 3BQKA 3CPZA 4NUUA
chains in the Genus database with same CATH superfamily
3RI5A 2XU0A 4CN1A 3JADA 2EHOB 3NRYA 1HFAA 1MNEA 1L0VA 3FZKB 1I6ZA 2JQHA 3LBXB 4KI0F 4H9SE 2I0MA 3C4XA 3Q5DA 3RQWA 4IL4A 4BAYB 4U31A 2CA5A 1WYBA 4ISTA 3NZPA 3UU5A 2WB5A 3AB3B 1YQ4A 4ILAA 4M1PA 3EI0A 1MIVA 5L3DB 2W2UA 4B3TT 5AQMB 4L9IA 1CUNA 1D1AA 1NEKA 4BA9A 3HA4A 4NIQA 3BK9A 4QXBB 2HN2A 5HYAA 4YJ3E 2EHOC 4DV6T 3KVBA 2RA1A 3ZSSA 3PUQA 3LDQB 3SOLA 2VKOA 2LSKA 2K3WA 3EDVA 4AQYT 2W66A 1U5PA 2PJQA 3UTKA 5ABFA 2UUAT 2QA7A 5C3JA 4ZI2C 2VURA 1T7SA 2LOSA 4I50E 4DV0T 1QUUA 2BBHA 1S35A 1JNZA 4DR5T 4HN9A 5LJMA 4DV5T 4KHPT 5EK3A 3J7Yq 4ZHQE 2W00A 3CWZB 2D0UA 1WYCA 4WQOD 2V7KA 4HFBA 2KWHA 2MYSA 3RC8A 4ZS2A 2MTQA 3RLFF 4CN6A 3IBPA 2V7IA 4GKKT 1UX4A 4UXNB 3TKLB 2WCAA 3LK3B 5CFBA 1N33T 2XASB 4QX8B 5L4EA 4KBMB 2XUEA 3LJCA 3E22E 4UELA 4BJMA 5FXWA 2XAQB 2J4GA 2WDRA 3JC6D 4O4LE 3UQ7A 2WDQA 2KWIB 4DR4T 4EGWA 3M3ZB 3J9X1 3GA8A 1IBKT 4IE7A 3QK6A 3N2GE 3U78A 2D5UA 2BG9B 3UFEA 2XQ5A 5LA6E 1ZP0A 1R8IA 3C64A 3O1IA 4X1IE 4QXCB 3RKGA 4GIWA 5LBMA 2YINA 4PAGA 4MLKA 3QB5A 5AQGB 3ZT5A 3FXEB 3ZYKA 1WCRA 1BR4A 5LXTE 3ZMUB 4TZ4C 2M67A 4EV6A 3AVRA 4CI1B 2ACZA 2XQYA 2LSGA 5LG3A 4QX7B 2V5CA 3FBLA 1IJ5A 4IDPA 2AXDS 2LRKA 3P4WA 4XZCA 4AIUA 3P50A 4TNVA 4NUUA 3P7IA 4C90A 2BG9C 2JQKA 4MHCA 1KNZA 4TV8E 3SS1A 4CI2B 4NXMT 4EEDA 2DNXA 3PU3A 2Q9QB 1UK5A 4H63H 1X79A 4U7YA 4LF7T 3TLVA 3CIRA 3MA9A 1WFDA 2V7MA 4X65T 4WBNE 3EHZA 2R6GF 2ES0A 1M62A 4J2CA 2ZM0A 4Z90A 2HHHT 2UXXB 5IUXA 4DUZT 1KNRA 3ESLA 2QGSA 3JAFA 4ILUA 5KXJA 2VK9A 1SA0E 3M65A 5JDHA 1OEDA 4CXYA 1HX1B 2W4XA 5LOVE 4DV3T 3LSVA 4GKJT 2C5IT 5DABA 2EHOA 3FBZA 4IDOA 3I9WA 2BBJA 1D0XA 4XAXB 3LBXA 5EZYE 4ZI7E 4E7SA 1MIWA 3O1HA 5F3JA 4CZZB 4IE4A 3KV6A 3B5MA 4HE8A 4ZI3D 3CPZA 4TUYE 5LP6E 5LCYA 2JIWA 3CX6B 1J5ET 2HN1A 5AQKB 2ZM6T 5H6RB 3OVUA 3W15B 4ZOLE 5LGNB 3I9YA 3OTOT 2NTXA 2LKGA 2BKPA 3RF1A 2WP9A 4EOZB 2WQYA 3N9MA 2Y6XA 3E08A 2UXNB 3CVRA 2WY2A 2OV9A 4YHJA 1LRZA 1N32T 3AEFA 2IDOB 3FB2A 2X9YA 1D1BA 3DJBA 1Y01A 4DO0A 3UU4A 4DV1T 3KBTA 5LHGB 2E5LT 3PUYF 4OYKA 4YHHT 4KMCA 2H89A 4AQGA 3AE8A 3E0ZA 4DBRA 5HXEA 2XAHB 3CX7B 2E9XD 2LM9A 3ZN0B 3GN5B 2B1EA 2CPTA 4DVDA 2I59A 2WZKA 5AQHB 4JV5T 4YTMA 2CLYC 5JH7E 2W63A 3TLTA 4ASKA 1W09A 4HWFA 5FXZA 4CQIA 3K1SA 3VHLA 5FXVA 2K48A 2W62A 2LLYA 3AE3A 3RYIE 3IA3A 2NW8A 3KV9A 3ZMVB 3B13A 4QKNA 3KV4A 3PUGA 5FKYA 2UXCT 1UURA 3ZLIA 5ABEA 2BG9A 2V6YB 3CK6A 4PK4A 4XBFB 5AQIB 4ZEYA 3WAJA 3OKQA 4JEUB 2XTLA 2CM0A 1HCIA 4PJJA 2KXPB 2IC9A 3WI3A 5LMNT 3ONXA 3BQKA 3RHWA 2XQ4A 2CXLA 2K9AA 3AEEA 3RYHE 2V6XA 2VVNA 3T1YT 3HI2A 5JQGE 3N9QA 2FJBA 3KFWX 3MZKB 3OYXA 4UVAB 3UUNA 4HFHA 1HR0T 3ZN1B 3D0TA 1W0AA 4KX6A 5BR8T 5CB4E 2NW9A 2DWKA 2K5BB 4UVCB 5KX5E 5CA1E 5AQOB 2Q9QA 1U6GA 1HTJF 2IW5B 4PW8A 5LGUB 4DR3T 3VKHA 2V7JA 2XPKA 4X1KE 4H9PC 2DL1A 2E8IA 2CWYA 5JDMA 3AA1B 3FZMB 4U33A 2CWOA 3AAIA 3O1JA 2N1GA 2OLTA 3PDYA 3LG7A 2LSIA 2A3DA 4NUVA 3VRBA 2CMRA 2VKHA 1Y64B 3MK7C 1DU2A 4EAHA 5J2UE 2P9BA 2D2SA 4C91A 2XQ8A 5HXCA 4HFCA 5LYJE 3RYCE 3AAAB 4QH4A 3G06A 3H3AA 3V5SA 4EZHA 4LF4T 3L39A 4LMJA 3PJAA 3N9NA 1QSDA 4JLEA 2ZLYA 1XNQT 2XZEA 2KZ7B 4P0BA 5ABHA 3C50A 3P4SA 4EXTA 1M7KA 4MALA 2FJAA 2ZMAA 5FY7A 4AQFA 4N9F3 1G73A 1US7B 2XQ9A 2VQET 1T98A 2YU2A 3PUSA 4PJLA 4HEAA 4N78D 5L47A 3RRWA 3Q5WA 4U2YA 5FVKA 4JI0T 3WAKA 3P8CD 4IREA 3N9OA 4OHFA 5TAOA 1VRBA 4JI7T 3UFGA 3AXJB 4PNIA 5AQRB 2KMFA 2K24A 4P0AA 4AXPA 3UUBA 2VWAA 5ETWA 2N2NA 2E5VA 1LDJA 4ZS3A 1OWAA 4TWHA 2XHEB 5LMUT 3ZYLA 3ONJA 4U3CA 2VL0A 1MNDA 1VOMA 1YKHB 4O8SA 1ZV4X 1D1CA 2BKOA 3HKDE 3ZC1A 2LHRA 3K3QC 2CE7A 2LSYA 3RIFA 3ZMTB 4YSXA 2KNDA 1V9DA 4IE0A 4JEHB 2CXDA 3GN5A 3ANWB 1J1JA 2XSBA 3AEDA 1JNRA 4EZ4A 4AKGA 4AISA 2BS3A 3PUVF 4YJ2E 3OYZA 4F6RC 2V26A 2BDEA 2KT9A 3QNUA 3K8PC 3NKZA 2BS4A 2QRXA 1HF8A 2W61A 2SPCA 4H63V 3T1HT 4PK6A 1LVFA 3FHNA 3KDSE 1QLBA 5ADXL 5HAXA 1XWMA 4X62T 5JRCB 2CXFA 5AFUL 3PJAJ 3ZJ2A 4ZZCA 2VQFT 1B7TA 2V6YA 3EDUA 4U2ZA 3UT5E 2RP4A 4LMLA 3A7MA 3DTOA 2BVLA 3TLWA 1LKXA 1KEYA 2WAUA 3CKDA 5FMNA 1IZNB 5FY0A 2XM1A 4X20E 3RIUC 4JI2T 2Y8DA 3JC6C 4ADZA 5L3EB 1NENA 4MFRA 4AP2B 3PU8A 4LF9T 3SFEA 5DQWA 5HXRA 2CEAA 5M4YA 5AQJB 4DUYT 2DWGA 3AE2A 4UV9B 4DV4T 3N2OA 2WDVA 2X9XA 3ETVA 3ZJ1A 3Q5XA 2N9DA 5E0OA 4O2BE 2H7OA 2VB6A 3S4UA 3PTRB 4DNDA 2LE8A 3FZFB 2VASA 2YK0A 3ZT7A 3TLSA 4KUMB 2X0LB 3ZC0A 1ZOYA 2V1DB 3ZCIA 2CCQA 4Z8XA 3I0QA 4IE5A 1GQEA 2V5DA 4WNKA 2BS2A 3L8RA 5LB7B 4YLHA 3HKEE 3A8YC 4IDQA 3K3OA 3RTRA 4O4HE 4GYRA 2WMNA 4HWCA 1OEDE 3QB5K 2XAFB 5JR9C 3NVOA 3N2KE 4ISSA 4FJOA 5C8YE 4U7IA 4AKHA 3AE4A 2CHNA 4PFPA 2WMOA 4Z91A 4Q25A 2LOPA 4F52A 4DR6T 1SUMB 3NWIA 2VKJA 4JI4T 1HNXT 5JVDE 4IDZA 1LVKA 2WU5A 5AQPB 5L4HA 4UR9A 3RGLA 3LK2B 3OPCA 5HCMA 4PJNA 2IUBA 1FJGT 2L9QA 2XM2A 3KBUA 3F57A 4HXIB 1UUSA 5ABGA 2M6IA 4TNWA 3HKBE 4TWDA 4TV9E 2CLYB 5DJQC 3RH3A 3RX6A 2JMHA 1D0ZA 5A1LA 4EB6E 4F8HA 2LSJA 4APFB 2YEVC 2VKDA 4HWDA 2X66A 4HGAA 2X9HA 4IIJE 3Q9DA 4OFZA 2ZM2A 4YSYA 3CX8B 2MPKA 2RPAA 4UEMA 2NR4A 3KV5A 4TX5A 3AXJA 2UU9T 2IMLA 2C0SA 3CQGB 4TN7B 3P4RA 3JAEA 2ACXA 4P09A 3ETUA 4CXXA 4ZI3C 3CQCB 3ONLC 4ILBA 1HX8A 3HR0A 3EABA 4DBQA 2UXDT 5FNVE 5CA0E 4IGUA 4CXWA 3RRCA 4JYAT 2XY8B 4H9NC 4YTPA 2E9XB 2QYWA 2IIUA 2YKSA 4FI5A 2WZHA 3PUXF 2X0HA 3ANWA 3NRXA 5FXXA 1J5WA 4U74A 1MMDA 2A9UA 1D0YA 4JUYA 2JQ9A 1HG5A 4JI5T 3ZMZB 2YDQA 2B76A 2UXBT 4A64A 3DP7A 1KNPA 2HPJA 5FL0A 3H3MA 5LHIB 2CBJA 2BG9E 5AQQB 4B6XA 3MJXA 4G2AA 3F31A 2DCFA 3UUXB 5JRCA 3JCFA 3RKOA 3UULA 2KSRA 2E9XC 3QUJA 3L09A 3UU3A 3ZEFB 2PTFA 4COFA 4IE6A 3CMLA 3BQLA 1XDPA 2BVMA 1IBMT 2YN6A 3AAEB 5AQLB 4H9QC 2XQAA 3MKDA 3R6NA 3C51A 5JDLA 1WLXA 2ODUA 2Y48B 2IHR1 4YXDA 3LFMA 1YKEB 1YXRA 3AA6B 3R84B 3QC9A 4X5TA 2A2FX 3EAMA 5JDGA 4JGHD 3AE5A 1I94T 3AEBA 4JI8T 5HEUA 2WWUA 2XQ3A 4PK5A 1XNRT 4HWIB 2C5JA 4HWHA 4BJNA 3DQVC 3AE1A 1W9RA 1XDOA 1YW0A 4UF0B 5L3FB 4QXHB 2FBWA 4I4TE 1WR6A 4I55E 3H37A 2DLRA 1NAFA 1LDKA 1FEWA 1VCTA 2JRKA 3ZPOA 1ZHCA 4U72A 2EHOD 2PFVA 4A98A 4I43B 4JI6T 2D0TA 4UV8B 1KFYA 3PE0A 3IF8B 3P4QA 2I6HA 1HG2A 1G8XA 5FL1A 1N36T 4DV7T 4EYUA 4ZI2D 1O3XA 1H7CA 5LGTB 4P5OA 3CQXC 5JDQA 4GK5E 2A72A 5JTGA 4WW0A 5AQSB 4GOUA 4HFIA 4WYVA 2IAKA 2AE9A 1E7PA 4YTNA 1IJ6A 2BZBA 3ZSTA 5FYMA 4CI3B 2E2AA 4PFOA 1OEDC 5AQUB 2H7VC 3N9LA 3RYFE 4QWNB 5L3CB 3UU6A 3RC3A 2X68A 2ODVA 2X51A 3SFDA 3P4PA 5F8PA 3AA0B 3C4ZA 4KHZF 3FZLB 2WU2A 2H3RA 3LK42 2BKNA 2PBIA 5KDMC 4NXNT 1MMNA 4ANJA 4E7ZA 4LFAT 3VR9A 1SE7A 2WWVA 5J1GA 1UX5A 2L3LA 3A5XA 2J47A 3VKGA 2WSSV 2MOZA 3HL6A 2NP9A 2YOEA 3KVAA 3L3PA 3VU7H 3ZMSB 4GK0E 2E9XA 1ZEEA 4YT0A 3F2EA 1XZYA 5FVLA 3T8OA 4WBOA 3EVYA 4ERRA 4IL9A 2FUPA 2X67A 3SRZA 2UUCT 2KINB 1YQ3A 3OJAA 3HKCE 2V8SV 1WRDA 5KMGP 1U4QA 3X1DA 5EK4A 4K0UA 4IT4A 3PUAA 3PV0F 2JQQA 4G63A 4B3RT 2XAJB 4LF6T 5CJ5A 2LJLA 4EEBA 5LJNA 3MACA 4L5GA 5AQTB 2WS3A 5HEGA 5EK2A 2YU1A 3C98B 4DR7T 4O4JE 2CRBA 3AE7A 4AI6A 3B57A 3N5LA 5IWAT 2NTYA 5JR9B 5L3GB 1S94A 1X9BA 2X9WA 2Q9QD 2CBIA 3SWHA 3U3IA 2XSAA 1VCSA 4OK0A 2LT3A 2M6BA 4IDNA 4DV2T 5CGMA 3OBVE 4AKRB 4HTEA 5HXSA 2IC6A 3MXZA 1LDKB 2XQ7A 1Z0PA 5HWYA 4ILCA 4LFBT 3K3NA 2J62A 4UIGA 3PUZF 1FMVA 1Z8UA 2JMKA 4UF0A 4GYSA 2X0YA 4QHOA 1MMAA 4PJMA 5IHYA 3AEAA 2V7LA 4HKAA 3RQUA 2LEHA 1WR0A 1T8BA 2G0UA 4B3MT 3O4XE 4JI1T 5HCJA 5HWXA 4X66T 5HEHA 2GK9A 2LM2A 3AE6A 1HNZT 5LHHB 5GONE 5H6QB 2VL8A 3EUHA 4HFDA 3UU8A 4YY3T 3FZHB 1CHUA 4DR1T 2PG8A 4YFSA 2Q9QC 4LMKA 2MAWA 4HFEA 2NWBA 4O2AE 3VR8A 2DHRA 3AECA 2NOXA 1UCUA 5AQVB 5J2TE 2C5KT 2YDRA 2KLQA 5C2TA 3ABVA 5AQFB 1T72A 3AVSA 2WM9A 3PUWF 3VRAA 1YD8G 2W0GA 5LNKA 2L8KA 2LRLA 5LBQB 3UUMA 5JREA 5ABFB 2FJDA 1OXZA 4IHJE 5FY1A 2HH7A 4QH1A 1KK7A 3RPUA 1MIYA 2LKHA 3ZT6A 3ZKRA 2UUBT 4DMVA 1BR0A 4KP3C 1W0BA 3PURA 4UVBB 3I1AA 3UQ4A 3ZYMA 1EZ3A 3DPLC 4P1NA 4AQFC 2XQ6A 1MMGA 1IAPA 4JBWF 4JI3T 3C4WA 2H88A 4A97A 5L3BB 2J1DG 2JJ9A 2WZIA 2OA5A 5FP3A 2XJ7A 1SHZC 5JDFA 1KF6A 4DMWA 4O4IE 4B3ST 4X1YE 1NWMX 3N9PA 1E1HB 5JDNA 4AKIA 2WBLA 3QOFA 4WZXA 1E2AA 1XMOT 3I0OA 4V1Av 5DQVA 4LF8T 5F5WA 5IYZE 3RIUA 5BMVE 2F4VT 1FMWA 1FIOA 1AJ3A 5J0ZA 5HEOA 3RIAA 3GWHA 5HXHA 5LG4A 2LHNA 3BQIA 2DI4A 4K0KT 3V5UA 1ZKEA 1BR1A 1N34T 4MBQA 4NPPA 3NZQA 4H9RC 4YSZA 4H9OC 3GMIA 1HS7A 4A5XA 4ZXLA 4OYJA 2D9DA 1HNWT 1IBLT 3KINB 2NW7A 4DIDB 2VVSA 1BR2A 4L0RA 4TWFA 4EYYR 3IEEA 3FXDB 3ZCJA 3NBXX 5L2LA 3IHRA 4EIWA 3O9XA 2QVAA 5JR9A 4OX9T 4LFCT 4AKLA 2FJEA 1UGOA 1XMQT 2CHOA 4ZZBA 2HPLA 3Q5EA 4X64T 4CN4A 2YDSA 3AA7B 5AQNB 4QH5A 2MBGA 2ZM8A 2XAGB 2Z6EA 4DR2T 2JPFA 4I0UA 3AEGA 3TLUA 3AE9A 3Q2MA 4HFVA 4LF5T 1OEDB 2W67A 4A56A 5HEJA
chains in the Genus database with same CATH topology
2CLYC 4O4HE 3VU7H 2XU0A 3ZMSB 4GYRA 2WMNA 4GK0E 2E9XA 1ZEEA 2EHOB 2XAFB 3NRYA 5JH7E 1HFAA 5JR9C 3N2KE 4ISSA 2W63A 3F2EA 1MNEA 4FJOA 4ASKA 3T8OA 5C8YE 4WBOA 5FXZA 4AKHA 4CQIA 3EVYA 3LBXB 3VHLA 4ERRA 4H9SE 5FXVA 2K48A 3C4XA 2W62A 4PFPA 2WMOA 2X67A 4BAYB 3SRZA 2CA5A 2LOPA 3RYIE 2KINB 1WYBA 2NW8A 4ISTA 3OJAA 3NZPA 3HKCE 3KV9A 2VKJA 3ZMVB 5JVDE 4IDZA 3AB3B 3B13A 1LVKA 4QKNA 3KV4A 3PUGA 1WRDA 4M1PA 5KMGP 1U4QA 3LK2B 3ZLIA 1MIVA 5EK4A 5L3DB 4PK4A 4XBFB 4K0UA 4PJNA 3WAJA 4L9IA 3PUAA 3OKQA 2JQQA 2L9QA 4JEUB 4G63A 1CUNA 1D1AA 2XAJB 4BA9A 2XTLA 3KBUA 3F57A 2CM0A 1HCIA 2LJLA 3HA4A 4PJJA 2KXPB 5LJNA 3BK9A 3MACA 4L5GA 2IC9A 4QXBB 3WI3A 5HYAA 3ONXA 3BQKA 4YJ3E 2CXLA 5EK2A 2EHOC 3HKBE 2K9AA 2YU1A 3C98B 3KVBA 3RYHE 4TV9E 4O4JE 3HI2A 2RA1A 2CLYB 5DJQC 3RH3A 3N9QA 3RX6A 3PUQA 5JQGE 3B57A 4AI6A 2JMHA 1D0ZA 3N5LA 3SOLA 2VKOA 2LSKA 3KFWX 4EB6E 5A1LA 2LSJA 3EDVA 3MZKB 2YEVC 2NTYA 2VKDA 5JR9B 5L3GB 1S94A 1U5PA 3OYXA 4UVAB 3UUNA 2X66A 2PJQA 2X9HA 4HGAA 3UTKA 2QA7A 4IIJE 3Q9DA 2X9WA 4OFZA 2ZM2A 3ZN1B 4ZI2C 2Q9QD 3CX8B 3D0TA 2LOSA 4I50E 3SWHA 4UEMA 3U3IA 3KV5A 1QUUA 4TX5A 1S35A 4OK0A 5CB4E 2NW9A 2DWKA 2LT3A 2K5BB 4HN9A 4UVCB 5KX5E 5CA1E 2C0SA 5LJMA 3CQGB 4TN7B 5EK3A 3J7Yq 3OBVE 2ACXA 4P09A 4ZHQE 2W00A 3CWZB 2D0UA 3ETUA 1WYCA 4AKRB 4HTEA 4CXXA 5HXSA 2IC6A 3MXZA 2Q9QA 4ZI3C 2V7KA 1HTJF 2IW5B 4PW8A 5LGUB 1Z0PA 3CQCB 2KWHA 2MYSA 1HX8A 3VKHA 3RC8A 4ZS2A 2MTQA 5HWYA 3HR0A 2V7JA 3IBPA 3K3NA 2V7IA 4DBQA 4UIGA 5FNVE 1FMVA 1UX4A 5CA0E 2JMKA 4UXNB 4UF0A 4GYSA 4QHOA 4IGUA 4CXWA 3RRCA 1MMAA 3TKLB 4PJMA 4H9NC 5IHYA 4HKAA 2V7LA 3LK3B 4X1KE 2LEHA 2E9XB 4H9PC 2XASB 2E8IA 2G0UA 4QX8B 3O4XE 2CWYA 5JDMA 4KBMB 2XUEA 3AA1B 3LJCA 3E22E 4UELA 4FI5A 4BJMA 5FXWA 2XAQB 2CWOA 5HWXA 3AAIA 3O1JA 2GK9A 2N1GA 3JC6D 3ANWA 4O4LE 3NRXA 5FXXA 2KWIB 3PDYA 3LG7A 2LSIA 4U74A 2A3DA 5LHHB 4NUVA 5GONE 1MMDA 2CMRA 2VKHA 5H6QB 2VL8A 1Y64B 3MK7C 4EAHA 1D0YA 3J9X1 5J2UE 2P9BA 3EUHA 2D2SA 3GA8A 4JUYA 4IE7A 3QK6A 4C91A 1HG5A 3N2GE 5HXCA 3ZMZB 2PG8A 4YFSA 2Q9QC 5LYJE 3RYCE 3AAAB 3DP7A 3U78A 2D5UA 2HPJA 3H3AA 3V5SA 3UFEA 2NWBA 5LA6E 4EZHA 3C64A 4O2AE 3O1IA 5LHIB 4X1IE 4QXCB 3N9NA 2DHRA 4GIWA 5LBMA 4B6XA 3MJXA 4G2AA 2YINA 4PAGA 2NOXA 3F31A 4MLKA 2DCFA 1UCUA 1QSDA 3UUXB 3FXEB 3RKOA 4JLEA 3ZYKA 2C5KT 3UULA 5J2TE 2ZLYA 5JRCA 2KZ7B 1BR4A 2E9XC 4P0BA 2KLQA 5LXTE 3QUJA 3C50A 3ZMUB 4EXTA 3L09A 4TZ4C 3ZEFB 4MALA 2M67A 2ZMAA 5FY7A 3AVSA 4AQFA 3AVRA 4IE6A 3CMLA 4CI1B 3BQLA 2WM9A 1G73A 2BVMA 1US7B 2LSGA 2XQYA 3AAEB 1YD8G 2W0GA 5LNKA 1T98A 2L8KA 4H9QC 2YU2A 4QX7B 5LBQB 3UUMA 5JREA 3PUSA 4PJLA 3MKDA 3R6NA 4HEAA 3C51A 4N78D 5JDLA 1OXZA 1WLXA 4IHJE 3RRWA 2ODUA 3Q5WA 3FBLA 5FY1A 1IJ5A 3WAKA 2Y48B 2HH7A 3P8CD 1KK7A 3N9OA 4OHFA 5TAOA 1VRBA 4XZCA 3LFMA 4NUUA 1YKEB 3P7IA 4PNIA 3RPUA 3AA6B 4C90A 1MIYA 3R84B 2KMFA 2K24A 4P0AA 4MHCA 3QC9A 2A2FX 5JDGA 4AXPA 1KNZA 4DMVA 2VWAA 4TV8E 5ETWA 1BR0A 3SS1A 2N2NA 4CI2B 4KP3C 4ZS3A 2DNXA 2WWUA 1OWAA 3PU3A 4PK5A 2Q9QB 2XHEB 4H63H 2C5JA 1X79A 3PURA 3ZYLA 4UVBB 3I1AA 3ZYMA 1MNDA 1VOMA 1EZ3A 4BJNA 1YKHB 4O8SA 1ZV4X 3MA9A 1D1CA 3HKDE 2V7MA 4AQFC 1YW0A 4WBNE 4UF0B 5L3FB 4QXHB 2ES0A 3ZC1A 4J2CA 2LHRA 4I4TE 1WR6A 3K3QC 4I55E 2CE7A 1MMGA 1IAPA 3H37A 2DLRA 2LSYA 3ZMTB 1NAFA 2KNDA 2ZM0A 3C4WA 1FEWA 2JRKA 2UXXB 5L3BB 3ZPOA 1ZHCA 1V9DA 4U72A 2EHOD 2PFVA 4IE0A 2J1DG 4JEHB 2CXDA 2JJ9A 3GN5A 3ANWB 2OA5A 3ESLA 4I43B 2QGSA 5FP3A 1SHZC 4ILUA 2D0TA 5JDFA 4UV8B 4DMWA 4O4IE 4X1YE 2VK9A 1NWMX 1SA0E 4EZ4A 3M65A 5JDHA 3N9PA 4AKGA 1E1HB 3PE0A 4CXYA 3IF8B 5JDNA 1HG2A 4AKIA 2WBLA 4YJ2E 3OYZA 4F6RC 1G8XA 5LOVE 2V26A 2BDEA 2C5IT 2EHOA 5DABA 3FBZA 2KT9A 3I0OA 4V1Av 5DQVA 4EYUA 3K8PC 5IYZE 1HF8A 4ZI2D 1O3XA 3I9WA 1D0XA 5BMVE 1H7CA 1FMWA 2W61A 4XAXB 5LGTB 1FIOA 3CQXC 2SPCA 1AJ3A 4H63V 4PK6A 1LVFA 3FHNA 3KDSE 3LBXA 5EZYE 5JDQA 4ZI7E 5ADXL 3GWHA 5HAXA 4E7SA 1MIWA 3O1HA 5F3JA 4GK5E 5HXHA 2A72A 5LG4A 4CZZB 4IE4A 2LHNA 5JRCB 2CXFA 4WW0A 5AFUL 3KV6A 4GOUA 3BQIA 4HE8A 4ZI3D 2IAKA 3CPZA 2DI4A 4TUYE 3ZJ2A 5LP6E 5LCYA 3V5UA 1B7TA 3CX6B 1ZKEA 1BR1A 1IJ6A 3EDUA 2BZBA 4MBQA 5H6RB 3UT5E 5FYMA 4CI3B 2RP4A 3W15B 4PFOA 4ZOLE 5LGNB 3I9YA 3NZQA 4H9RC 4H9OC 2NTXA 3DTOA 3GMIA 1HS7A 2BVLA 2H7VC 1LKXA 4OYJA 2WAUA 3CKDA 3N9LA 5FMNA 1IZNB 5FY0A 3KINB 4EOZB 3RYFE 4X20E 2NW7A 3N9MA 2Y6XA 3E08A 2UXNB 2Y8DA 3CVRA 3JC6C 4ADZA 5L3EB 4QWNB 1BR2A 4L0RA 4EYYR 3IEEA 4YHJA 4MFRA 5L3CB 3FXDB 3PU8A 1LRZA 3ZCJA 3NBXX 3RC3A 5L2LA 5DQWA 3FB2A 3IHRA 2X9YA 5HXRA 2CEAA 2X68A 5M4YA 4EIWA 3O9XA 1D1BA 2DWGA 2ODVA 3DJBA 2X51A 4UV9B 5JR9A 4DO0A 3N2OA 4AKLA 2X9XA 3ETVA 3ZJ1A 3Q5XA 3KBTA 2N9DA 5E0OA 5F8PA 3AA0B 2HPLA 3C4ZA 4O2BE 2H7OA 5LHGB 2VB6A 3S4UA 2H3RA 3PTRB 3LK42 4DNDA 2LE8A 2PBIA 2VASA 2YK0A 5KDMC 4OYKA 3AA7B 1MMNA 4KMCA 4AQGA 4ANJA 4E7ZA 3E0ZA 4KUMB 2X0LB 2MBGA 3ZC0A 2ZM8A 2XAGB 5J1GA 1UX5A 2Z6EA 4DBRA 5HXEA 2XAHB 2V1DB 2L3LA 3CX7B 3ZCIA 3A5XA 2CCQA 2E9XD 2LM9A 2JPFA 4Z8XA 3ZN0B 3I0QA 3GN5B 4IE5A 4WNKA 2B1EA 3VKGA 4DVDA 2WSSV 2I59A 3Q2MA 2MOZA 3HL6A 2NP9A 3KVAA 4HFVA 3L3PA 4YLHA 3HKEE 4A56A 3K3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CML A;  3RRC A;  3C64 A;  5F3J A;  2YK0 A;  3BQL A;  4NUV A;  3BQI A;  2WAU A;  2Y8D A;  4YFS A;  2XU0 A;  3BQK A;  3CPZ A;  4NUU A; 
#chains in the Genus database with same CATH topology
 3RI5 A;  2XU0 A;  4CN1 A;  3JAD A;  2EHO B;  3NRY A;  1HFA A;  1MNE A;  1L0V A;  3FZK B;  1I6Z A;  2JQH A;  3LBX B;  4KI0 F;  4H9S E;  2I0M A;  3C4X A;  3Q5D A;  3RQW A;  4IL4 A;  4BAY B;  4U31 A;  2CA5 A;  1WYB A;  4IST A;  3NZP A;  3UU5 A;  2WB5 A;  3AB3 B;  1YQ4 A;  4ILA A;  4M1P A;  3EI0 A;  1MIV A;  5L3D B;  2W2U A;  4B3T T;  5AQM B;  4L9I A;  1CUN A;  1D1A A;  1NEK A;  4BA9 A;  3HA4 A;  4NIQ A;  3BK9 A;  4QXB B;  2HN2 A;  5HYA A;  4YJ3 E;  2EHO C;  4DV6 T;  3KVB A;  2RA1 A;  3ZSS A;  3PUQ A;  3LDQ B;  3SOL A;  2VKO A;  2LSK A;  2K3W A;  3EDV A;  4AQY T;  2W66 A;  1U5P A;  2PJQ A;  3UTK A;  5ABF A;  2UUA T;  2QA7 A;  5C3J A;  4ZI2 C;  2VUR A;  1T7S A;  2LOS A;  4I50 E;  4DV0 T;  1QUU A;  2BBH A;  1S35 A;  1JNZ A;  4DR5 T;  4HN9 A;  5LJM A;  4DV5 T;  4KHP T;  5EK3 A;  3J7Y q;  4ZHQ E;  2W00 A;  3CWZ B;  2D0U A;  1WYC A;  4WQO D;  2V7K A;  4HFB A;  2KWH A;  2MYS A;  3RC8 A;  4ZS2 A;  2MTQ A;  3RLF F;  4CN6 A;  3IBP A;  2V7I A;  4GKK T;  1UX4 A;  4UXN B;  3TKL B;  2WCA A;  3LK3 B;  5CFB A;  1N33 T;  2XAS B;  4QX8 B;  5L4E A;  4KBM B;  2XUE A;  3LJC A;  3E22 E;  4UEL A;  4BJM A;  5FXW A;  2XAQ B;  2J4G A;  2WDR A;  3JC6 D;  4O4L E;  3UQ7 A;  2WDQ A;  2KWI B;  4DR4 T;  4EGW A;  3M3Z B;  3J9X 1;  3GA8 A;  1IBK T;  4IE7 A;  3QK6 A;  3N2G E;  3U78 A;  2D5U A;  2BG9 B;  3UFE A;  2XQ5 A;  5LA6 E;  1ZP0 A;  1R8I A;  3C64 A;  3O1I A;  4X1I E;  4QXC B;  3RKG A;  4GIW A;  5LBM A;  2YIN A;  4PAG A;  4MLK A;  3QB5 A;  5AQG B;  3ZT5 A;  3FXE B;  3ZYK A;  1WCR A;  1BR4 A;  5LXT E;  3ZMU B;  4TZ4 C;  2M67 A;  4EV6 A;  3AVR A;  4CI1 B;  2ACZ A;  2XQY A;  2LSG A;  5LG3 A;  4QX7 B;  2V5C A;  3FBL A;  1IJ5 A;  4IDP A;  2AXD S;  2LRK A;  3P4W A;  4XZC A;  4AIU A;  3P50 A;  4TNV A;  4NUU A;  3P7I A;  4C90 A;  2BG9 C;  2JQK A;  4MHC A;  1KNZ A;  4TV8 E;  3SS1 A;  4CI2 B;  4NXM T;  4EED A;  2DNX A;  3PU3 A;  2Q9Q B;  1UK5 A;  4H63 H;  1X79 A;  4U7Y A;  4LF7 T;  3TLV A;  3CIR A;  3MA9 A;  1WFD A;  2V7M A;  4X65 T;  4WBN E;  3EHZ A;  2R6G F;  2ES0 A;  1M62 A;  4J2C A;  2ZM0 A;  4Z90 A;  2HHH T;  2UXX B;  5IUX A;  4DUZ T;  1KNR A;  3ESL A;  2QGS A;  3JAF A;  4ILU A;  5KXJ A;  2VK9 A;  1SA0 E;  3M65 A;  5JDH A;  1OED A;  4CXY A;  1HX1 B;  2W4X A;  5LOV E;  4DV3 T;  3LSV A;  4GKJ T;  2C5I T;  5DAB A;  2EHO A;  3FBZ A;  4IDO A;  3I9W A;  2BBJ A;  1D0X A;  4XAX B;  3LBX A;  5EZY E;  4ZI7 E;  4E7S A;  1MIW A;  3O1H A;  5F3J A;  4CZZ B;  4IE4 A;  3KV6 A;  3B5M A;  4HE8 A;  4ZI3 D;  3CPZ A;  4TUY E;  5LP6 E;  5LCY A;  2JIW A;  3CX6 B;  1J5E T;  2HN1 A;  5AQK B;  2ZM6 T;  5H6R B;  3OVU A;  3W15 B;  4ZOL E;  5LGN B;  3I9Y A;  3OTO T;  2NTX A;  2LKG A;  2BKP A;  3RF1 A;  2WP9 A;  4EOZ B;  2WQY A;  3N9M A;  2Y6X A;  3E08 A;  2UXN B;  3CVR A;  2WY2 A;  2OV9 A;  4YHJ A;  1LRZ A;  1N32 T;  3AEF A;  2IDO B;  3FB2 A;  2X9Y A;  1D1B A;  3DJB A;  1Y01 A;  4DO0 A;  3UU4 A;  4DV1 T;  3KBT A;  5LHG B;  2E5L T;  3PUY F;  4OYK A;  4YHH T;  4KMC A;  2H89 A;  4AQG A;  3AE8 A;  3E0Z A;  4DBR A;  5HXE A;  2XAH B;  3CX7 B;  2E9X D;  2LM9 A;  3ZN0 B;  3GN5 B;  2B1E A;  2CPT A;  4DVD A;  2I59 A;  2WZK A;  5AQH B;  4JV5 T;  4YTM A;  2CLY C;  5JH7 E;  2W63 A;  3TLT A;  4ASK A;  1W09 A;  4HWF A;  5FXZ A;  4CQI A;  3K1S A;  3VHL A;  5FXV A;  2K48 A;  2W62 A;  2LLY A;  3AE3 A;  3RYI E;  3IA3 A;  2NW8 A;  3KV9 A;  3ZMV B;  3B13 A;  4QKN A;  3KV4 A;  3PUG A;  5FKY A;  2UXC T;  1UUR A;  3ZLI A;  5ABE A;  2BG9 A;  2V6Y B;  3CK6 A;  4PK4 A;  4XBF B;  5AQI B;  4ZEY A;  3WAJ A;  3OKQ A;  4JEU B;  2XTL A;  2CM0 A;  1HCI A;  4PJJ A;  2KXP B;  2IC9 A;  3WI3 A;  5LMN T;  3ONX A;  3BQK A;  3RHW A;  2XQ4 A;  2CXL A;  2K9A A;  3AEE A;  3RYH E;  2V6X A;  2VVN A;  3T1Y T;  3HI2 A;  5JQG E;  3N9Q A;  2FJB A;  3KFW X;  3MZK B;  3OYX A;  4UVA B;  3UUN A;  4HFH A;  1HR0 T;  3ZN1 B;  3D0T A;  1W0A A;  4KX6 A;  5BR8 T;  5CB4 E;  2NW9 A;  2DWK A;  2K5B B;  4UVC B;  5KX5 E;  5CA1 E;  5AQO B;  2Q9Q A;  1U6G A;  1HTJ F;  2IW5 B;  4PW8 A;  5LGU B;  4DR3 T;  3VKH A;  2V7J A;  2XPK A;  4X1K E;  4H9P C;  2DL1 A;  2E8I A;  2CWY A;  5JDM A;  3AA1 B;  3FZM B;  4U33 A;  2CWO A;  3AAI A;  3O1J A;  2N1G A;  2OLT A;  3PDY A;  3LG7 A;  2LSI A;  2A3D A;  4NUV A;  3VRB A;  2CMR A;  2VKH A;  1Y64 B;  3MK7 C;  1DU2 A;  4EAH A;  5J2U E;  2P9B A;  2D2S A;  4C91 A;  2XQ8 A;  5HXC A;  4HFC A;  5LYJ E;  3RYC E;  3AAA B;  4QH4 A;  3G06 A;  3H3A A;  3V5S A;  4EZH A;  4LF4 T;  3L39 A;  4LMJ A;  3PJA A;  3N9N A;  1QSD A;  4JLE A;  2ZLY A;  1XNQ T;  2XZE A;  2KZ7 B;  4P0B A;  5ABH A;  3C50 A;  3P4S A;  4EXT A;  1M7K A;  4MAL A;  2FJA A;  2ZMA A;  5FY7 A;  4AQF A;  4N9F 3;  1G73 A;  1US7 B;  2XQ9 A;  2VQE T;  1T98 A;  2YU2 A;  3PUS A;  4PJL A;  4HEA A;  4N78 D;  5L47 A;  3RRW A;  3Q5W A;  4U2Y A;  5FVK A;  4JI0 T;  3WAK A;  3P8C D;  4IRE A;  3N9O A;  4OHF A;  5TAO A;  1VRB A;  4JI7 T;  3UFG A;  3AXJ B;  4PNI A;  5AQR B;  2KMF A;  2K24 A;  4P0A A;  4AXP A;  3UUB A;  2VWA A;  5ETW A;  2N2N A;  2E5V A;  1LDJ A;  4ZS3 A;  1OWA A;  4TWH A;  2XHE B;  5LMU T;  3ZYL A;  3ONJ A;  4U3C A;  2VL0 A;  1MND A;  1VOM A;  1YKH B;  4O8S A;  1ZV4 X;  1D1C A;  2BKO A;  3HKD E;  3ZC1 A;  2LHR A;  3K3Q C;  2CE7 A;  2LSY A;  3RIF A;  3ZMT B;  4YSX A;  2KND A;  1V9D A;  4IE0 A;  4JEH B;  2CXD A;  3GN5 A;  3ANW B;  1J1J A;  2XSB A;  3AED A;  1JNR A;  4EZ4 A;  4AKG A;  4AIS A;  2BS3 A;  3PUV F;  4YJ2 E;  3OYZ A;  4F6R C;  2V26 A;  2BDE A;  2KT9 A;  3QNU A;  3K8P C;  3NKZ A;  2BS4 A;  2QRX A;  1HF8 A;  2W61 A;  2SPC A;  4H63 V;  3T1H T;  4PK6 A;  1LVF A;  3FHN A;  3KDS E;  1QLB A;  5ADX L;  5HAX A;  1XWM A;  4X62 T;  5JRC B;  2CXF A;  5AFU L;  3PJA J;  3ZJ2 A;  4ZZC A;  2VQF T;  1B7T A;  2V6Y A;  3EDU A;  4U2Z A;  3UT5 E;  2RP4 A;  4LML A;  3A7M A;  3DTO A;  2BVL A;  3TLW A;  1LKX A;  1KEY A;  2WAU A;  3CKD A;  5FMN A;  1IZN B;  5FY0 A;  2XM1 A;  4X20 E;  3RIU C;  4JI2 T;  2Y8D A;  3JC6 C;  4ADZ A;  5L3E B;  1NEN A;  4MFR A;  4AP2 B;  3PU8 A;  4LF9 T;  3SFE A;  5DQW A;  5HXR A;  2CEA A;  5M4Y A;  5AQJ B;  4DUY T;  2DWG A;  3AE2 A;  4UV9 B;  4DV4 T;  3N2O A;  2WDV A;  2X9X A;  3ETV A;  3ZJ1 A;  3Q5X A;  2N9D A;  5E0O A;  4O2B E;  2H7O A;  2VB6 A;  3S4U A;  3PTR B;  4DND A;  2LE8 A;  3FZF B;  2VAS A;  2YK0 A;  3ZT7 A;  3TLS A;  4KUM B;  2X0L B;  3ZC0 A;  1ZOY A;  2V1D B;  3ZCI A;  2CCQ A;  4Z8X A;  3I0Q A;  4IE5 A;  1GQE A;  2V5D A;  4WNK A;  2BS2 A;  3L8R A;  5LB7 B;  4YLH A;  3HKE E;  3A8Y C;  4IDQ A;  3K3O A;  3RTR A;  4O4H E;  4GYR A;  2WMN A;  4HWC A;  1OED E;  3QB5 K;  2XAF B;  5JR9 C;  3NVO A;  3N2K E;  4ISS A;  4FJO A;  5C8Y E;  4U7I A;  4AKH A;  3AE4 A;  2CHN A;  4PFP A;  2WMO A;  4Z91 A;  4Q25 A;  2LOP A;  4F52 A;  4DR6 T;  1SUM B;  3NWI A;  2VKJ A;  4JI4 T;  1HNX T;  5JVD E;  4IDZ A;  1LVK A;  2WU5 A;  5AQP B;  5L4H A;  4UR9 A;  3RGL A;  3LK2 B;  3OPC A;  5HCM A;  4PJN A;  2IUB A;  1FJG T;  2L9Q A;  2XM2 A;  3KBU A;  3F57 A;  4HXI B;  1UUS A;  5ABG A;  2M6I A;  4TNW A;  3HKB E;  4TWD A;  4TV9 E;  2CLY B;  5DJQ C;  3RH3 A;  3RX6 A;  2JMH A;  1D0Z A;  5A1L A;  4EB6 E;  4F8H A;  2LSJ A;  4APF B;  2YEV C;  2VKD A;  4HWD A;  2X66 A;  4HGA A;  2X9H A;  4IIJ E;  3Q9D A;  4OFZ A;  2ZM2 A;  4YSY A;  3CX8 B;  2MPK A;  2RPA A;  4UEM A;  2NR4 A;  3KV5 A;  4TX5 A;  3AXJ A;  2UU9 T;  2IML A;  2C0S A;  3CQG B;  4TN7 B;  3P4R A;  3JAE A;  2ACX A;  4P09 A;  3ETU A;  4CXX A;  4ZI3 C;  3CQC B;  3ONL C;  4ILB A;  1HX8 A;  3HR0 A;  3EAB A;  4DBQ A;  2UXD T;  5FNV E;  5CA0 E;  4IGU A;  4CXW A;  3RRC A;  4JYA T;  2XY8 B;  4H9N C;  4YTP A;  2E9X B;  2QYW A;  2IIU A;  2YKS A;  4FI5 A;  2WZH A;  3PUX F;  2X0H A;  3ANW A;  3NRX A;  5FXX A;  1J5W A;  4U74 A;  1MMD A;  2A9U A;  1D0Y A;  4JUY A;  2JQ9 A;  1HG5 A;  4JI5 T;  3ZMZ B;  2YDQ A;  2B76 A;  2UXB T;  4A64 A;  3DP7 A;  1KNP A;  2HPJ A;  5FL0 A;  3H3M A;  5LHI B;  2CBJ A;  2BG9 E;  5AQQ B;  4B6X A;  3MJX A;  4G2A A;  3F31 A;  2DCF A;  3UUX B;  5JRC A;  3JCF A;  3RKO A;  3UUL A;  2KSR A;  2E9X C;  3QUJ A;  3L09 A;  3UU3 A;  3ZEF B;  2PTF A;  4COF A;  4IE6 A;  3CML A;  3BQL A;  1XDP A;  2BVM A;  1IBM T;  2YN6 A;  3AAE B;  5AQL B;  4H9Q C;  2XQA A;  3MKD A;  3R6N A;  3C51 A;  5JDL A;  1WLX A;  2ODU A;  2Y48 B;  2IHR 1;  4YXD A;  3LFM A;  1YKE B;  1YXR A;  3AA6 B;  3R84 B;  3QC9 A;  4X5T A;  2A2F X;  3EAM A;  5JDG A;  4JGH D;  3AE5 A;  1I94 T;  3AEB A;  4JI8 T;  5HEU A;  2WWU A;  2XQ3 A;  4PK5 A;  1XNR T;  4HWI B;  2C5J A;  4HWH A;  4BJN A;  3DQV C;  3AE1 A;  1W9R A;  1XDO A;  1YW0 A;  4UF0 B;  5L3F B;  4QXH B;  2FBW A;  4I4T E;  1WR6 A;  4I55 E;  3H37 A;  2DLR A;  1NAF A;  1LDK A;  1FEW A;  1VCT A;  2JRK A;  3ZPO A;  1ZHC A;  4U72 A;  2EHO D;  2PFV A;  4A98 A;  4I43 B;  4JI6 T;  2D0T A;  4UV8 B;  1KFY A;  3PE0 A;  3IF8 B;  3P4Q A;  2I6H A;  1HG2 A;  1G8X A;  5FL1 A;  1N36 T;  4DV7 T;  4EYU A;  4ZI2 D;  1O3X A;  1H7C A;  5LGT B;  4P5O A;  3CQX C;  5JDQ A;  4GK5 E;  2A72 A;  5JTG A;  4WW0 A;  5AQS B;  4GOU A;  4HFI A;  4WYV A;  2IAK A;  2AE9 A;  1E7P A;  4YTN A;  1IJ6 A;  2BZB A;  3ZST A;  5FYM A;  4CI3 B;  2E2A A;  4PFO A;  1OED C;  5AQU B;  2H7V C;  3N9L A;  3RYF E;  4QWN B;  5L3C B;  3UU6 A;  3RC3 A;  2X68 A;  2ODV A;  2X51 A;  3SFD A;  3P4P A;  5F8P A;  3AA0 B;  3C4Z A;  4KHZ F;  3FZL B;  2WU2 A;  2H3R A;  3LK4 2;  2BKN A;  2PBI A;  5KDM C;  4NXN T;  1MMN A;  4ANJ A;  4E7Z A;  4LFA T;  3VR9 A;  1SE7 A;  2WWV A;  5J1G A;  1UX5 A;  2L3L A;  3A5X A;  2J47 A;  3VKG A;  2WSS V;  2MOZ A;  3HL6 A;  2NP9 A;  2YOE A;  3KVA A;  3L3P A;  3VU7 H;  3ZMS B;  4GK0 E;  2E9X A;  1ZEE A;  4YT0 A;  3F2E A;  1XZY A;  5FVL A;  3T8O A;  4WBO A;  3EVY A;  4ERR A;  4IL9 A;  2FUP A;  2X67 A;  3SRZ A;  2UUC T;  2KIN B;  1YQ3 A;  3OJA A;  3HKC E;  2V8S V;  1WRD A;  5KMG P;  1U4Q A;  3X1D A;  5EK4 A;  4K0U A;  4IT4 A;  3PUA A;  3PV0 F;  2JQQ A;  4G63 A;  4B3R T;  2XAJ B;  4LF6 T;  5CJ5 A;  2LJL A;  4EEB A;  5LJN A;  3MAC A;  4L5G A;  5AQT B;  2WS3 A;  5HEG A;  5EK2 A;  2YU1 A;  3C98 B;  4DR7 T;  4O4J E;  2CRB A;  3AE7 A;  4AI6 A;  3B57 A;  3N5L A;  5IWA T;  2NTY A;  5JR9 B;  5L3G B;  1S94 A;  1X9B A;  2X9W A;  2Q9Q D;  2CBI A;  3SWH A;  3U3I A;  2XSA A;  1VCS A;  4OK0 A;  2LT3 A;  2M6B A;  4IDN A;  4DV2 T;  5CGM A;  3OBV E;  4AKR B;  4HTE A;  5HXS A;  2IC6 A;  3MXZ A;  1LDK B;  2XQ7 A;  1Z0P A;  5HWY A;  4ILC A;  4LFB T;  3K3N A;  2J62 A;  4UIG A;  3PUZ F;  1FMV A;  1Z8U A;  2JMK A;  4UF0 A;  4GYS A;  2X0Y A;  4QHO A;  1MMA A;  4PJM A;  5IHY A;  3AEA A;  2V7L A;  4HKA A;  3RQU A;  2LEH A;  1WR0 A;  1T8B A;  2G0U A;  4B3M T;  3O4X E;  4JI1 T;  5HCJ A;  5HWX A;  4X66 T;  5HEH A;  2GK9 A;  2LM2 A;  3AE6 A;  1HNZ T;  5LHH B;  5GON E;  5H6Q B;  2VL8 A;  3EUH A;  4HFD A;  3UU8 A;  4YY3 T;  3FZH B;  1CHU A;  4DR1 T;  2PG8 A;  4YFS A;  2Q9Q C;  4LMK A;  2MAW A;  4HFE A;  2NWB A;  4O2A E;  3VR8 A;  2DHR A;  3AEC A;  2NOX A;  1UCU A;  5AQV B;  5J2T E;  2C5K T;  2YDR A;  2KLQ A;  5C2T A;  3ABV A;  5AQF B;  1T72 A;  3AVS A;  2WM9 A;  3PUW F;  3VRA A;  1YD8 G;  2W0G A;  5LNK A;  2L8K A;  2LRL A;  5LBQ B;  3UUM A;  5JRE A;  5ABF B;  2FJD A;  1OXZ A;  4IHJ E;  5FY1 A;  2HH7 A;  4QH1 A;  1KK7 A;  3RPU A;  1MIY A;  2LKH A;  3ZT6 A;  3ZKR A;  2UUB T;  4DMV A;  1BR0 A;  4KP3 C;  1W0B A;  3PUR A;  4UVB B;  3I1A A;  3UQ4 A;  3ZYM A;  1EZ3 A;  3DPL C;  4P1N A;  4AQF C;  2XQ6 A;  1MMG A;  1IAP A;  4JBW F;  4JI3 T;  3C4W A;  2H88 A;  4A97 A;  5L3B B;  2J1D G;  2JJ9 A;  2WZI A;  2OA5 A;  5FP3 A;  2XJ7 A;  1SHZ C;  5JDF A;  1KF6 A;  4DMW A;  4O4I E;  4B3S T;  4X1Y E;  1NWM X;  3N9P A;  1E1H B;  5JDN A;  4AKI A;  2WBL A;  3QOF A;  4WZX A;  1E2A A;  1XMO T;  3I0O A;  4V1A v;  5DQV A;  4LF8 T;  5F5W A;  5IYZ E;  3RIU A;  5BMV E;  2F4V T;  1FMW A;  1FIO A;  1AJ3 A;  5J0Z A;  5HEO A;  3RIA A;  3GWH A;  5HXH A;  5LG4 A;  2LHN A;  3BQI A;  2DI4 A;  4K0K T;  3V5U A;  1ZKE A;  1BR1 A;  1N34 T;  4MBQ A;  4NPP A;  3NZQ A;  4H9R C;  4YSZ A;  4H9O C;  3GMI A;  1HS7 A;  4A5X A;  4ZXL A;  4OYJ A;  2D9D A;  1HNW T;  1IBL T;  3KIN B;  2NW7 A;  4DID B;  2VVS A;  1BR2 A;  4L0R A;  4TWF A;  4EYY R;  3IEE A;  3FXD B;  3ZCJ A;  3NBX X;  5L2L A;  3IHR A;  4EIW A;  3O9X A;  2QVA A;  5JR9 A;  4OX9 T;  4LFC T;  4AKL A;  2FJE A;  1UGO A;  1XMQ T;  2CHO A;  4ZZB A;  2HPL A;  3Q5E A;  4X64 T;  4CN4 A;  2YDS A;  3AA7 B;  5AQN B;  4QH5 A;  2MBG A;  2ZM8 A;  2XAG B;  2Z6E A;  4DR2 T;  2JPF A;  4I0U A;  3AEG A;  3TLU A;  3AE9 A;  3Q2M A;  4HFV A;  4LF5 T;  1OED B;  2W67 A;  4A56 A;  5HEJ A; 
#chains in the Genus database with same CATH homology
 2CLY C;  4O4H E;  3VU7 H;  2XU0 A;  3ZMS B;  4GYR A;  2WMN A;  4GK0 E;  2E9X A;  1ZEE A;  2EHO B;  2XAF B;  3NRY A;  5JH7 E;  1HFA A;  5JR9 C;  3N2K E;  4ISS A;  2W63 A;  3F2E A;  1MNE A;  4FJO A;  4ASK A;  3T8O A;  5C8Y E;  4WBO A;  5FXZ A;  4AKH A;  4CQI A;  3EVY A;  3LBX B;  3VHL A;  4ERR A;  4H9S E;  5FXV A;  2K48 A;  3C4X A;  2W62 A;  4PFP A;  2WMO A;  2X67 A;  4BAY B;  3SRZ A;  2CA5 A;  2LOP A;  3RYI E;  2KIN B;  1WYB A;  2NW8 A;  4IST A;  3OJA A;  3NZP A;  3HKC E;  3KV9 A;  2VKJ A;  3ZMV B;  5JVD E;  4IDZ A;  3AB3 B;  3B13 A;  1LVK A;  4QKN A;  3KV4 A;  3PUG A;  1WRD A;  4M1P A;  5KMG P;  1U4Q A;  3LK2 B;  3ZLI A;  1MIV A;  5EK4 A;  5L3D B;  4PK4 A;  4XBF B;  4K0U A;  4PJN A;  3WAJ A;  4L9I A;  3PUA A;  3OKQ A;  2JQQ A;  2L9Q A;  4JEU B;  4G63 A;  1CUN A;  1D1A A;  2XAJ B;  4BA9 A;  2XTL A;  3KBU A;  3F57 A;  2CM0 A;  1HCI A;  2LJL A;  3HA4 A;  4PJJ A;  2KXP B;  5LJN A;  3BK9 A;  3MAC A;  4L5G A;  2IC9 A;  4QXB B;  3WI3 A;  5HYA A;  3ONX A;  3BQK A;  4YJ3 E;  2CXL A;  5EK2 A;  2EHO C;  3HKB E;  2K9A A;  2YU1 A;  3C98 B;  3KVB A;  3RYH E;  4TV9 E;  4O4J E;  3HI2 A;  2RA1 A;  2CLY B;  5DJQ C;  3RH3 A;  3N9Q A;  3RX6 A;  3PUQ A;  5JQG E;  3B57 A;  4AI6 A;  2JMH A;  1D0Z A;  3N5L A;  3SOL A;  2VKO A;  2LSK A;  3KFW X;  4EB6 E;  5A1L A;  2LSJ A;  3EDV A;  3MZK B;  2YEV C;  2NTY A;  2VKD A;  5JR9 B;  5L3G B;  1S94 A;  1U5P A;  3OYX A;  4UVA B;  3UUN A;  2X66 A;  2PJQ A;  2X9H A;  4HGA A;  3UTK A;  2QA7 A;  4IIJ E;  3Q9D A;  2X9W A;  4OFZ A;  2ZM2 A;  3ZN1 B;  4ZI2 C;  2Q9Q D;  3CX8 B;  3D0T A;  2LOS A;  4I50 E;  3SWH A;  4UEM A;  3U3I A;  3KV5 A;  1QUU A;  4TX5 A;  1S35 A;  4OK0 A;  5CB4 E;  2NW9 A;  2DWK A;  2LT3 A;  2K5B B;  4HN9 A;  4UVC B;  5KX5 E;  5CA1 E;  2C0S A;  5LJM A;  3CQG B;  4TN7 B;  5EK3 A;  3J7Y q;  3OBV E;  2ACX A;  4P09 A;  4ZHQ E;  2W00 A;  3CWZ B;  2D0U A;  3ETU A;  1WYC A;  4AKR B;  4HTE A;  4CXX A;  5HXS A;  2IC6 A;  3MXZ A;  2Q9Q A;  4ZI3 C;  2V7K A;  1HTJ F;  2IW5 B;  4PW8 A;  5LGU B;  1Z0P A;  3CQC B;  2KWH A;  2MYS A;  1HX8 A;  3VKH A;  3RC8 A;  4ZS2 A;  2MTQ A;  5HWY A;  3HR0 A;  2V7J A;  3IBP A;  3K3N A;  2V7I A;  4DBQ A;  4UIG A;  5FNV E;  1FMV A;  1UX4 A;  5CA0 E;  2JMK A;  4UXN B;  4UF0 A;  4GYS A;  4QHO A;  4IGU A;  4CXW A;  3RRC A;  1MMA A;  3TKL B;  4PJM A;  4H9N C;  5IHY A;  4HKA A;  2V7L A;  3LK3 B;  4X1K E;  2LEH A;  2E9X B;  4H9P C;  2XAS B;  2E8I A;  2G0U A;  4QX8 B;  3O4X E;  2CWY A;  5JDM A;  4KBM B;  2XUE A;  3AA1 B;  3LJC A;  3E22 E;  4UEL A;  4FI5 A;  4BJM A;  5FXW A;  2XAQ B;  2CWO A;  5HWX A;  3AAI A;  3O1J A;  2GK9 A;  2N1G A;  3JC6 D;  3ANW A;  4O4L E;  3NRX A;  5FXX A;  2KWI B;  3PDY A;  3LG7 A;  2LSI A;  4U74 A;  2A3D A;  5LHH B;  4NUV A;  5GON E;  1MMD A;  2CMR A;  2VKH A;  5H6Q B;  2VL8 A;  1Y64 B;  3MK7 C;  4EAH A;  1D0Y A;  3J9X 1;  5J2U E;  2P9B A;  3EUH A;  2D2S A;  3GA8 A;  4JUY A;  4IE7 A;  3QK6 A;  4C91 A;  1HG5 A;  3N2G E;  5HXC A;  3ZMZ B;  2PG8 A;  4YFS A;  2Q9Q C;  5LYJ E;  3RYC E;  3AAA B;  3DP7 A;  3U78 A;  2D5U A;  2HPJ A;  3H3A A;  3V5S A;  3UFE A;  2NWB A;  5LA6 E;  4EZH A;  3C64 A;  4O2A E;  3O1I A;  5LHI B;  4X1I E;  4QXC B;  3N9N A;  2DHR A;  4GIW A;  5LBM A;  4B6X A;  3MJX A;  4G2A A;  2YIN A;  4PAG A;  2NOX A;  3F31 A;  4MLK A;  2DCF A;  1UCU A;  1QSD A;  3UUX B;  3FXE B;  3RKO A;  4JLE A;  3ZYK A;  2C5K T;  3UUL A;  5J2T E;  2ZLY A;  5JRC A;  2KZ7 B;  1BR4 A;  2E9X C;  4P0B A;  2KLQ A;  5LXT E;  3QUJ A;  3C50 A;  3ZMU B;  4EXT A;  3L09 A;  4TZ4 C;  3ZEF B;  4MAL A;  2M67 A;  2ZMA A;  5FY7 A;  3AVS A;  4AQF A;  3AVR A;  4IE6 A;  3CML A;  4CI1 B;  3BQL A;  2WM9 A;  1G73 A;  2BVM A;  1US7 B;  2LSG A;  2XQY A;  3AAE B;  1YD8 G;  2W0G A;  5LNK A;  1T98 A;  2L8K A;  4H9Q C;  2YU2 A;  4QX7 B;  5LBQ B;  3UUM A;  5JRE A;  3PUS A;  4PJL A;  3MKD A;  3R6N A;  4HEA A;  3C51 A;  4N78 D;  5JDL A;  1OXZ A;  1WLX A;  4IHJ E;  3RRW A;  2ODU A;  3Q5W A;  3FBL A;  5FY1 A;  1IJ5 A;  3WAK A;  2Y48 B;  2HH7 A;  3P8C D;  1KK7 A;  3N9O A;  4OHF A;  5TAO A;  1VRB A;  4XZC A;  3LFM A;  4NUU A;  1YKE B;  3P7I A;  4PNI A;  3RPU A;  3AA6 B;  4C90 A;  1MIY A;  3R84 B;  2KMF A;  2K24 A;  4P0A A;  4MHC A;  3QC9 A;  2A2F X;  5JDG A;  4AXP A;  1KNZ A;  4DMV A;  2VWA A;  4TV8 E;  5ETW A;  1BR0 A;  3SS1 A;  2N2N A;  4CI2 B;  4KP3 C;  4ZS3 A;  2DNX A;  2WWU A;  1OWA A;  3PU3 A;  4PK5 A;  2Q9Q B;  2XHE B;  4H63 H;  2C5J A;  1X79 A;  3PUR A;  3ZYL A;  4UVB B;  3I1A A;  3ZYM A;  1MND A;  1VOM A;  1EZ3 A;  4BJN A;  1YKH B;  4O8S A;  1ZV4 X;  3MA9 A;  1D1C A;  3HKD E;  2V7M A;  4AQF C;  1YW0 A;  4WBN E;  4UF0 B;  5L3F B;  4QXH B;  2ES0 A;  3ZC1 A;  4J2C A;  2LHR A;  4I4T E;  1WR6 A;  3K3Q C;  4I55 E;  2CE7 A;  1MMG A;  1IAP A;  3H37 A;  2DLR A;  2LSY A;  3ZMT B;  1NAF A;  2KND A;  2ZM0 A;  3C4W A;  1FEW A;  2JRK A;  2UXX B;  5L3B B;  3ZPO A;  1ZHC A;  1V9D A;  4U72 A;  2EHO D;  2PFV A;  4IE0 A;  2J1D G;  4JEH B;  2CXD A;  2JJ9 A;  3GN5 A;  3ANW B;  2OA5 A;  3ESL A;  4I43 B;  2QGS A;  5FP3 A;  1SHZ C;  4ILU A;  2D0T A;  5JDF A;  4UV8 B;  4DMW A;  4O4I E;  4X1Y E;  2VK9 A;  1NWM X;  1SA0 E;  4EZ4 A;  3M65 A;  5JDH A;  3N9P A;  4AKG A;  1E1H B;  3PE0 A;  4CXY A;  3IF8 B;  5JDN A;  1HG2 A;  4AKI A;  2WBL A;  4YJ2 E;  3OYZ A;  4F6R C;  1G8X A;  5LOV E;  2V26 A;  2BDE A;  2C5I T;  2EHO A;  5DAB A;  3FBZ A;  2KT9 A;  3I0O A;  4V1A v;  5DQV A;  4EYU A;  3K8P C;  5IYZ E;  1HF8 A;  4ZI2 D;  1O3X A;  3I9W A;  1D0X A;  5BMV E;  1H7C A;  1FMW A;  2W61 A;  4XAX B;  5LGT B;  1FIO A;  3CQX C;  2SPC A;  1AJ3 A;  4H63 V;  4PK6 A;  1LVF A;  3FHN A;  3KDS E;  3LBX A;  5EZY E;  5JDQ A;  4ZI7 E;  5ADX L;  3GWH A;  5HAX A;  4E7S A;  1MIW A;  3O1H A;  5F3J A;  4GK5 E;  5HXH A;  2A72 A;  5LG4 A;  4CZZ B;  4IE4 A;  2LHN A;  5JRC B;  2CXF A;  4WW0 A;  5AFU L;  3KV6 A;  4GOU A;  3BQI A;  4HE8 A;  4ZI3 D;  2IAK A;  3CPZ A;  2DI4 A;  4TUY E;  3ZJ2 A;  5LP6 E;  5LCY A;  3V5U A;  1B7T A;  3CX6 B;  1ZKE A;  1BR1 A;  1IJ6 A;  3EDU A;  2BZB A;  4MBQ A;  5H6R B;  3UT5 E;  5FYM A;  4CI3 B;  2RP4 A;  3W15 B;  4PFO A;  4ZOL E;  5LGN B;  3I9Y A;  3NZQ A;  4H9R C;  4H9O C;  2NTX A;  3DTO A;  3GMI A;  1HS7 A;  2BVL A;  2H7V C;  1LKX A;  4OYJ A;  2WAU A;  3CKD A;  3N9L A;  5FMN A;  1IZN B;  5FY0 A;  3KIN B;  4EOZ B;  3RYF E;  4X20 E;  2NW7 A;  3N9M A;  2Y6X A;  3E08 A;  2UXN B;  2Y8D A;  3CVR A;  3JC6 C;  4ADZ A;  5L3E B;  4QWN B;  1BR2 A;  4L0R A;  4EYY R;  3IEE A;  4YHJ A;  4MFR A;  5L3C B;  3FXD B;  3PU8 A;  1LRZ A;  3ZCJ A;  3NBX X;  3RC3 A;  5L2L A;  5DQW A;  3FB2 A;  3IHR A;  2X9Y A;  5HXR A;  2CEA A;  2X68 A;  5M4Y A;  4EIW A;  3O9X A;  1D1B A;  2DWG A;  2ODV A;  3DJB A;  2X51 A;  4UV9 B;  5JR9 A;  4DO0 A;  3N2O A;  4AKL A;  2X9X A;  3ETV A;  3ZJ1 A;  3Q5X A;  3KBT A;  2N9D A;  5E0O A;  5F8P A;  3AA0 B;  2HPL A;  3C4Z A;  4O2B E;  2H7O A;  5LHG B;  2VB6 A;  3S4U A;  2H3R A;  3PTR B;  3LK4 2;  4DND A;  2LE8 A;  2PBI A;  2VAS A;  2YK0 A;  5KDM C;  4OYK A;  3AA7 B;  1MMN A;  4KMC A;  4AQG A;  4ANJ A;  4E7Z A;  3E0Z A;  4KUM B;  2X0L B;  2MBG A;  3ZC0 A;  2ZM8 A;  2XAG B;  5J1G A;  1UX5 A;  2Z6E A;  4DBR A;  5HXE A;  2XAH B;  2V1D B;  2L3L A;  3CX7 B;  3ZCI A;  3A5X A;  2CCQ A;  2E9X D;  2LM9 A;  2JPF A;  4Z8X A;  3ZN0 B;  3I0Q A;  3GN5 B;  4IE5 A;  4WNK A;  2B1E A;  3VKG A;  4DVD A;  2WSS V;  2I59 A;  3Q2M A;  2MOZ A;  3HL6 A;  2NP9 A;  3KVA A;  4HFV A;  3L3P A;  4YLH A;  3HKE E;  4A56 A;  3K3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...