3BQLA

Structure of a chondroitin sulphate binding dbl3x domain from a var2csa encoded pfemp1 protein
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
360
structure length
338
Chain Sequence
SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDKKGQKGKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSGDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 118
structure length 338
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqlA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqlA02
3CPZA 5F3JA 3BQIA 2Y8DA 3BQLA 3BQKA 3CMLA 2YK0A 4YFSA 2XU0A 4NUVA 2WAUA 4NUUA 3RRCA 3C64A
chains in the Genus database with same CATH superfamily
1SE7A 4KX6A 2XM2A 3AVSA 3CWZB 2N9DA 3UU3A 2BG9B 3ZT6A 5AQGB 1WFDA 2K48A 3CX6B 3ZYKA 3QK6A 5ABFB 2WP9A 1HTJF 4MHCA 4H63V 3DPLC 3Q2MA 4A56A 3ZC0A 3AE2A 5HAXA 2WQYA 3PU3A 2VVNA 3PJAJ 1MIVA 3CQXC 3RIUC 3UUXB 2IC6A 3RHWA 1UURA 1HR0T 4NXMT 2XQYA 4YFSA 1Z8UA 3OYXA 3ZEFB 5F5WA 3N9MA 3ZLIA 5DABA 3I9WA 5GONE 5A1LA 4GKKT 2XAQB 2BZBA 1YXRA 1S94A 4AQYT 3VKHA 1YD8G 3BQLA 2X66A 3R6NA 5LGTB 4OK0A 4ILBA 4YHHT 5JRCB 2A2FX 4U33A 3RX6A 2WMOA 3FHNA 2LSIA 4PJMA 2WU5A 4IE7A 2VL0A 2E2AA 3AE1A 4Z90A 5KXJA 1FEWA 3KV9A 4QKNA 4I50E 5FL1A 1BR4A 5EK4A 4AQGA 3TLVA 4FI5A 1OWAA 2D0TA 5LBMA 3ONJA 2YN6A 3ABVA 3N9NA 4KMCA 2QVAA 4JGHD 2JRKA 5CFBA 3C50A 2CXFA 3G06A 3MKDA 3CKDA 2Y6XA 4U7IA 4WQOD 3HKDE 4N9F3 1YQ3A 2EHOA 4UV9B 2CPTA 3AE9A 2QA7A 4EGWA 5C2TA 4UELA 2VKDA 4QX7B 3UUNA 1WR0A 1XMQT 5LB7B 2E9XD 4UF0B 5LOVE 4AISA 2ACZA 2C5KT 2XSAA 4M1PA 3RLFF 3PJAA 1MMAA 4ZI2C 4G2AA 1ZKEA 3ZCIA 1VCTA 2LEHA 5J2UE 4EAHA 2J62A 2IW5B 4JI7T 4I4TE 5L3GB 2VURA 2XAHB 4NIQA 4TV8E 3H3MA 5AFUL 4IDQA 5DQWA 4EZHA 2QRXA 2A9UA 2MPKA 4LFBT 2VK9A 5FVLA 5JDHA 2XQ8A 2QYWA 3EDUA 5FXXA 4UVAB 2BG9A 4PK4A 2DWKA 4OYJA 5E0OA 3ZMTB 5CA0E 3AAIA 3RI5A 2UXCT 4IL9A 4IDOA 3MK7C 2W63A 3TLSA 1BR0A 1MNEA 2CXDA 5ABFA 1FIOA 2Z6EA 2KINB 2LSYA 3P50A 3O9XA 3PU8A 3EDVA 5FVKA 3WAKA 1Y64B 4ZI2D 5LA6E 2W00A 2M6IA 3AECA 3QB5K 3AEBA 4TV9E 2CBJA 4JUYA 3CPZA 3CQCB 3CK6A 2VWAA 3PDYA 4JI8T 1U5PA 2XZEA 2VVSA 4ADZA 5J0ZA 1HNWT 2JJ9A 4ZXLA 3UQ7A 4P1NA 1R8IA 1CUNA 4CZZB 2JQQA 2W67A 1KNPA 4H63H 5JRCA 4IE4A 4H9OC 5LCYA 4YT0A 3T8OA 1XMOT 2E5VA 5HCJA 2YK0A 1GQEA 2LT3A 3ESLA 2BBJA 3OYZA 2D5UA 2XU0A 2LHNA 2CE7A 4TWFA 3NZPA 4X5TA 2PBIA 4EEBA 1SUMB 2W0GA 1E1HB 3BK9A 2WZHA 2AE9A 2YKSA 3A7MA 3B57A 4DR3T 4WBOA 2BVMA 4ILCA 4OYKA 4HKAA 1WLXA 4ZZCA 1ZOYA 4P5OA 2YEVC 4NUUA 3KVBA 4COFA 2WMNA 5AQRB 3GWHA 5J2TE 2ZM0A 5HYAA 2R6GF 4XAXB 4CQIA 4L5GA 3MACA 4LMKA 2VKJA 4JV5T 5AQTB 3P4PA 3JC6C 5IUXA 2X68A 4IDZA 5ETWA 5J1GA 2XQ6A 3EHZA 5KX5E 2C5JA 2FUPA 4DUZT 4YSXA 4LFCT 4EOZB 3ETUA 4B3RT 3NZQA 1T98A 2W62A 3KV5A 5AQMB 2Y8DA 4YJ3E 4DR6T 2V5CA 2XAGB 4ISTA 3K3QC 3AE7A 5FXWA 4KBMB 4A97A 5L3FB 3V5SA 3ZC1A 2M6BA 4WW0A 2DL1A 3LSVA 5AQHB 2OV9A 2KNDA 4DV3T 3TLUA 2YDRA 3UU4A 5L2LA 3N9QA 2K9AA 1XNRT 5JREA 3UU5A 2X67A 2LOPA 4IL4A 4PJJA 2DCFA 2XTLA 2P9BA 2JPFA 4QXCB 2Q9QD 4X1YE 4ZI3D 5ABGA 3AE4A 4ASKA 2IHR1 4K0UA 4KP3C 3JAEA 4NUVA 3AEEA 4TX5A 4B6XA 3UUMA 3RQWA 4J2CA 3C4WA 4ILAA 1KK7A 4QXBB 2YOEA 2LJLA 1V9DA 1HG5A 4MALA 4B3ST 4H9NC 1ZHCA 3AA7B 3ZMVB 4E7ZA 3VRAA 2HPLA 4QH4A 3PV0F 5F8PA 1WYBA 2C0SA 1G73A 1LVFA 2I0MA 4YSYA 3T1HT 3ZJ1A 3RYIE 4DV1T 2IDOB 1LDKB 1W9RA 2AXDS 4IREA 2L9QA 2CWOA 3RQUA 2E8IA 1MMGA 3SRZA 2LKGA 4K0KT 4UEMA 1HS7A 1KNRA 2V7LA 2XM1A 4TZ4C 2KSRA 4O8SA 2IUBA 1E7PA 3J7Yq 5HXCA 3CX7B 1ZP0A 3AA1B 4WYVA 4ZI7E 3KINB 4V1Av 5HEUA 4G63A 3DJBA 5JDFA 4AKHA 2FJDA 2XQAA 3I9YA 3A5XA 2LRLA 5IWAT 3RH3A 4EZ4A 2XQ4A 3PUSA 4AIUA 3PUXF 3EUHA 1VRBA 3KBTA 3Q5XA 1N34T 2VB6A 3RF1A 4Z8XA 2BVLA 2LKHA 3RPUA 5TAOA 3HL6A 2V8SV 1OEDC 4ZS3A 5L3BB 3M65A 2UXDT 2V7MA 4C91A 4N78D 2BG9E 2LHRA 2DNXA 2K5BB 1X79A 3RKGA 3ONLC 3HR0A 1QUUA 1HNXT 2D9DA 4UXNB 3OKQA 4A98A 1LDJA 2WM9A 3V5UA 1D0XA 4ANJA 3AAAB 3PUYF 3IBPA 2LRKA 4H9PC 5LG3A 2H7OA 1XDOA 4YLHA 2CLYB 2DHRA 4P0BA 3HKCE 3F2EA 3UULA 3SFEA 1HF8A 2JQKA 5JQGE 5AQKB 1MMDA 1WRDA 2ES0A 2UXNB 4H9QC 5HEGA 4KI0F 1NAFA 1ZEEA 4IHJE 5DQVA 2OLTA 3JADA 2RPAA 3P4WA 2E9XC 4TNVA 5CA1E 4YTMA 3N2OA 5LGUB 3KV4A 4IE0A 4CI2B 4DBQA 1M62A 3CVRA 5AQPB 4AQFC 5FY0A 5EK3A 3C4ZA 3IA3A 5AQOB 2YDSA 5AQQB 5LMNT 4GKJT 1HG2A 3JAFA 1KF6A 2PJQA 2WDQA 4JI4T 1OEDB 4YHJA 4GK0E 4U3CA 2IAKA 2IMLA 4OFZA 2ZLYA 5CJ5A 4UVBB 5IYZE 4AXPA 3KBUA 5AQVB 3UT5E 1SHZC 3ZN1B 2LE8A 4HN9A 1KNZA 4CI3B 4O4JE 4Z91A 2X9XA 2WAUA 2OA5A 1SA0E 4B3TT 2KMFA 5KMGP 4PK5A 5CB4E 3H3AA 1U4QA 3PUAA 1M7KA 3O4XE 4JLEA 5CGMA 2WDRA 1LDKA 5LGNB 3VHLA 5LJMA 2CBIA 4UVCB 4JI6T 4CXXA 3C4XA 5HCMA 4DR5T 4KUMB 1UX5A 2V6YA 4WZXA 3D0TA 3NWIA 2LLYA 2XAJB 3ZMUB 3C98B 3L3PA 4TNWA 1HCIA 2WCAA 3OPCA 2H3RA 5JDLA 2BKPA 3TLWA 1T72A 4AKRB 4OHFA 5ABEA 1FJGT 2RA1A 4LF4T 4F6RC 2MTQA 3FBZA 1D1CA 4LF5T 2F4VT 4U7YA 1UGOA 3AEFA 4MLKA 3HA4A 2CWYA 1Y01A 3F57A 2YU2A 4F52A 3N9LA 2YU1A 2CCQA 5FL0A 5M4YA 1UK5A 5HXEA 5L4EA 4AP2B 4DVDA 3OTOT 4TWDA 5FYMA 3ONXA 4DNDA 2D0UA 3I1AA 3B13A 1W09A 4JYAT 4DMVA 2VL8A 2WS3A 5C8YE 3N9PA 3IF8B 2ODUA 4DUYT 3TLTA 1IBKT 5JTGA 2BS4A 1DU2A 3Q5DA 1S35A 5AQLB 4X66T 3O1IA 4HWCA 4CI1B 5H6QB 3KFWX 4QXHB 3AE3A 3QB5A 4X64T 4IE6A 3X1DA 4L0RA 3FXEB 3E22E 2KZ7B 3AE8A 3ETVA 2WB5A 1US7B 4PFPA 3ZMSB 5LG4A 4JI2T 2NP9A 5FKYA 3TKLB 1QLBA 5LHIB 2CRBA 1KEYA 2DLRA 5JDNA 4ZZBA 5LYJE 3RGLA 4U2ZA 3RYHE 4EYUA 1G8XA 2H7VC 5JR9C 1OEDA 4DV5T 4DR4T 3CMLA 4LMLA 4LF9T 2B1EA 1I94T 3AA0B 5C3JA 3RC8A 1O3XA 2K3WA 2Q9QC 3GMIA 4ZI3C 3AA6B 5FXVA 5HEJA 2H89A 2L8KA 4PAGA 3RIUA 4YY3T 4KHPT 4GOUA 3PTRB 1Z0PA 2C5IT 3RIAA 1IZNB 4U2YA 4DR1T 2HN1A 3QC9A 1XDPA 1FMVA 5JDMA 2PTFA 4DV2T 2JQHA 4AI6A 3NVOA 2SPCA 3CIRA 5LNKA 3ZMZB 4CXWA 2J1DG 1I6ZA 4EB6E 2EHOC 5L3CB 1LVKA 5H6RB 4A5XA 4UV8B 4PFOA 2IC9A 1IJ6A 4EEDA 2WWUA 4PJNA 3RKOA 2ZM6T 1T8BA 3CQGB 2A72A 4H9SE 5L3EB 3MJXA 3LK2B 1MIWA 4IIJE 4QH5A 3M3ZB 3UUBA 4AQFA 1QSDA 1JNRA 2JIWA 2CA5A 2UU9T 4PNIA 3LJCA 4DR2T 4EV6A 3N2KE 5JR9B 1OXZA 4NXNT 2QGSA 3UU6A 4BJNA 4DV6T 1B7TA 4JI1T 5EK2A 4LF7T 4PW8A 3PUVF 2X9WA 2Q9QB 4TN7B 3U3IA 2XQ3A 1XZYA 3SFDA 2ACXA 4DV4T 2KT9A 4DMWA 4H9RC 4HE8A 2CHNA 4HFEA 3P7IA 5LHHB 2LM2A 2UUBT 2EHOD 4F8HA 3CX8B 5AQSB 2JMKA 1YW0A 3OVUA 1MIYA 3B5MA 3AXJA 2JMHA 3IEEA 5AQUB 4PJLA 2I6HA 2XQ7A 2PG8A 5LXTE 3QOFA 2V6YB 2MOZA 2FJAA 2WZIA 5IHYA 1H7CA 2FBWA 2MYSA 2XJ7A 3L39A 4I55E 2BDEA 2X9YA 2CXLA 4BAYB 4IDNA 2LSJA 5HEHA 3C51A 1WCRA 4ZEYA 1UUSA 3F31A 3LG7A 4P09A 2WBLA 3RIFA 1HX1B 2BBHA 3VR9A 1HNZT 2CHOA 3FZLB 2NTYA 1BR1A 1VOMA 1XNQT 2UUAT 3AEAA 2VKOA 2DI4A 1W0BA 2NOXA 4TWHA 4LMJA 4HWDA 3RRWA 2IIUA 3LBXB 2V7KA 2NW7A 4XBFB 2DWGA 4IGUA 1FMWA 3DQVC 3P8CD 4GYRA 1ZV4X 1E2AA 4MFRA 4DIDB 3K8PC 3IHRA 4HFCA 5FNVE 2NTXA 3ZKRA 5ABHA 3DTOA 2W61A 1IJ5A 3BQIA 1CHUA 2GK9A 3VKGA 3SS1A 3S4UA 3L09A 5AQNB 1IBLT 5EZYE 4HFDA 3KV6A 4YTNA 4HFIA 3EABA 4AKGA 3H37A 2WSSV 2WDVA 4HWFA 4HEAA 2ZMAA 4A64A 5FY7A 4U74A 4U72A 2VKHA 3P4SA 3I0OA 4DO0A 3FZHB 2PFVA 3AVRA 4L9IA 3UFGA 1BR2A 3NRYA 4GIWA 3Q9DA 4EIWA 3EVYA 2KLQA 2LOSA 2HHHT 4HTEA 3PUWF 1D0YA 3NBXX 3SWHA 2XUEA 4O4LE 4KHZF 3OBVE 3HKEE 3ZN0B 3HKBE 5JR9A 5LBQB 3HI2A 5LP6E 1W0AA 2BS2A 2BKNA 2JQ9A 1OEDE 2VASA 3NKZA 3AEDA 4OX9T 2Q9QA 2N2NA 2KWHA 4YJ2E 3OJAA 3AE5A 5KDMC 3J9X1 4U31A 5HEOA 5BR8T 2A3DA 3DP7A 3ZYMA 4GYSA 4HFHA 2XY8B 3R84B 1J1JA 2XQ9A 3P4QA 4HGAA 4IT4A 4ILUA 1JNZA 4YXDA 1WYCA 3L8RA 4I0UA 4X1IE 3WAJA 2X0LB 5JDQA 5L4HA 3UTKA 5HXHA 4Q25A 4B3MT 2E9XB 4HXIB 2NWBA 2WZKA 4O2AE 1AJ3A 3KDSE 1IBMT 2L3LA 3FZMB 3JCFA 1YQ4A 2UXXB 2BS3A 2XSBA 1NWMX 2ZM2A 2ODVA 4JI3T 2V1DB 3WI3A 2D2SA 3FBLA 4CN4A 4BJMA 4JEHB 4X20E 4X1KE 3LBXA 3FB2A 2XAFB 4P0AA 4ZHQE 2J47A 2W4XA 3ZT7A 4QX8B 4GK5E 5FP3A 3LK3B 1WR6A 4CN6A 3C64A 2H88A 4JI0T 1YKEB 2CM0A 5JVDE 4HFVA 1MNDA 5AQFB 3PE0A 3U78A 2G0UA 3AEGA 5BMVE 4QHOA 1NENA 1NEKA 4DV7T 2FJEA 4IDPA 4AKLA 1N36T 3AXJB 3ANWB 2YINA 4NPPA 3GN5B 3A8YC 2WWVA 2BKOA 5L3DB 1LRZA 2MBGA 3AAEB 4HWHA 1D0ZA 2W2UA 5HWXA 2YDQA 3EAMA 2CEAA 2KWIB 2WU2A 3VRBA 3K3OA 3VU7H 3T1YT 3EI0A 4DBRA 2V7IA 3ZJ2A 3ZSSA 4E7SA 3VR8A 1L0VA 4ZS2A 5AQIB 3LFMA 3E0ZA 5FMNA 4QH1A 5F3JA 4PK6A 3RC3A 4AKIA 4BA9A 2VQFT 3KVAA 4X65T 3AE6A 3RYCE 3PUGA 2NR4A 1MMNA 2LSGA 3N9OA 3K1SA 5FXZA 3GA8A 2V6XA 3ZSTA 3QNUA 3N5LA 2W66A 3ZCJA 4HFBA 1N33T 1KFYA 4JI5T 4CN1A 1VCSA 5JDGA 1X9BA 1XWMA 3PURA 4ISSA 1J5ET 2V5DA 2V26A 3BQKA 3SOLA 2Y48B 4FJOA 3QUJA 4LFAT 3P4RA 5AQJB 2VQET 2M67A 1D1AA 3FXDB 4WBNE 2WY2A 2X0YA 3NRXA 5HWYA 2LSKA 5LJNA 4ZOLE 4YSZA 4MBQA 3Q5EA 4O4HE 1N32T 5DJQC 2E9XA 2HN2A 3N2GE 2NW8A 4UF0A 3O1JA 5LMUT 4I43B 2CMRA 2X0HA 4ERRA 2B76A 2UUCT 2I59A 4DV0T 4LF6T 2HPJA 2E5LT 3MXZA 3Q5WA 3FZFB 2KXPB 5ADXL 4EXTA 3LK42 4QWNB 1YKHB 3I0QA 3ZYLA 4YTPA 1T7SA 2ZM8A 3MA9A 4XZCA 4JEUB 1LKXA 3PUZF 4DR7T 5JH7E 4EYYR 4IE5A 2RP4A 4APFB 2BG9C 3AB3B 5LHGB 2HH7A 3PUQA 2X9HA 3JC6D 3UU8A 4O2BE 3RTRA 3ANWA 3RRCA 3GN5A 2EHOB 1HFAA 1UX4A 4X62T 1D1BA 5HXSA 3RYFE 2K24A 3K3NA 3E08A 1J5WA 1HX8A 3ZPOA 1IAPA 2CLYC 3W15B 4UR9A 2X51A 2XHEB 2J4GA 5HXRA 2N1GA 2XASB 4CXYA 4O4IE 2V7JA 2MAWA 4WNKA 3ZT5A 2LM9A 2UXBT 4JBWF 5FY1A 4TUYE 1UCUA 4C90A 2FJBA 3O1HA 1U6GA 5L47A 4UIGA 3UFEA 3UQ4A 3LDQB 3MZKB 2XQ5A 3FZKB 4HWIB 1EZ3A 2XPKA 2NW9A 4LF8T
chains in the Genus database with same CATH topology
4ILUA 3KFWX 4QXHB 3AVSA 2KNDA 3CWZB 1WYCA 2N9DA 4IE6A 4L0RA 4X1IE 3FXEB 3WAJA 5L2LA 3N9QA 2K9AA 3E22E 2X0LB 5JDQA 2KZ7B 5JREA 3ETVA 2X67A 2LOPA 1US7B 4PJJA 2DCFA 2XTLA 4PFPA 3UTKA 2P9BA 2JPFA 2K48A 4QXCB 3ZMSB 5LG4A 3CX6B 3ZYKA 5HXHA 3QK6A 2Q9QD 4X1YE 2NP9A 4ZI3D 3TKLB 1HTJF 4MHCA 4K0UA 4ASKA 5LHIB 4KP3C 4H63V 2E9XB 3Q2MA 4NUVA 4TX5A 4A56A 4B6XA 2DLRA 2NWBA 3UUMA 5JDNA 3ZC0A 4J2CA 5HAXA 4O2AE 1AJ3A 3C4WA 3PU3A 5LYJE 1KK7A 1MIVA 3CQXC 4QXBB 3UUXB 3KDSE 2L3LA 2IC6A 1V9DA 2LJLA 2XQYA 4YFSA 3RYHE 1HG5A 4MALA 4EYUA 1G8XA 4H9NC 1ZHCA 3OYXA 3ZEFB 2UXXB 3AA7B 3N9MA 3ZLIA 5JR9C 5DABA 3I9WA 5GONE 5A1LA 1NWMX 3ZMVB 4E7ZA 2ZM2A 3CMLA 2ODVA 2V1DB 2XAQB 3WI3A 2D2SA 3FBLA 2HPLA 4BJMA 2B1EA 5F8PA 1WYBA 2BZBA 4JEHB 4X20E 2C0SA 1S94A 3AA0B 3VKHA 4X1KE 1YD8G 1G73A 1LVFA 3RC8A 1O3XA 2Q9QC 3BQLA 3ZJ1A 3GMIA 3RYIE 2X66A 3LBXA 4ZI3C 3AA6B 3R6NA 3FB2A 2XAFB 4CI1B 5LGTB 4P0AA 4ZHQE 4OK0A 2L9QA 5FXVA 2CWOA 5JRCB 4QX8B 2L8KA 4GK5E 5FP3A 2A2FX 4PAGA 2E8IA 3LK3B 1WR6A 4GOUA 3PTRB 1Z0PA 1MMGA 2C5IT 3C64A 1IZNB 3RX6A 3SRZA 2WMOA 4UEMA 1YKEB 2CM0A 3FHNA 3QC9A 5JVDE 1FMVA 2LSIA 1HS7A 5JDMA 4HFVA 1MNDA 4PJMA 2V7LA 4AI6A 2SPCA 3PE0A 4TZ4C 3U78A 5LNKA 3ZMZB 4IE7A 4O8SA 4CXWA 2G0UA 2J1DG 5BMVE 3J7Yq 5HXCA 3CX7B 4QHOA 3AA1B 4EB6E 2EHOC 1FEWA 4ZI7E 5L3CB 1LVKA 3KINB 3KV9A 4G63A 4QKNA 4V1Av 5H6RB 4I50E 1BR4A 5EK4A 4AQGA 3DJBA 5JDFA 4AKHA 4UV8B 4FI5A 4PFOA 1OWAA 2IC9A 4AKLA 1IJ6A 3I9YA 2D0TA 3A5XA 5LBMA 3RH3A 3ANWB 2YINA 4EZ4A 3N9NA 2WWUA 3GN5B 4KMCA 3PUSA 3EUHA 1VRBA 4PJNA 2JRKA 3KBTA 3Q5XA 3RKOA 2VB6A 4Z8XA 3C50A 2BVLA 3CQGB 2CXFA 2A72A 4H9SE 5L3DB 1LRZA 3MJXA 3LK2B 1MIWA 4IIJE 2MBGA 3MKDA 5L3EB 3CKDA 3AAEB 1D0ZA 3RPUA 5HWXA 5TAOA 4AQFA 2Y6XA 1QSDA 3HL6A 2CEAA 2KWIB 3HKDE 2EHOA 4ZS3A 4UV9B 3K3OA 2CA5A 3VU7H 3M65A 2QA7A 5L3BB 2V7MA 4DBRA 4C91A 4N78D 2V7IA 4PNIA 3ZJ2A 4E7SA 3LJCA 2LHRA 2DNXA 2K5BB 4ZS2A 3LFMA 1X79A 3E0ZA 5FMNA 4UELA 3N2KE 3HR0A 1OXZA 5JR9B 2VKDA 5F3JA 1QUUA 4PK6A 4QX7B 3UUNA 2QGSA 4BJNA 3RC3A 4UXNB 3OKQA 2E9XD 1B7TA 4AKIA 4UF0B 5EK2A 5LOVE 2WM9A 3V5UA 4BA9A 4PW8A 1D0XA 2C5KT 3AAAB 4ANJA 3KVAA 2X9WA 3IBPA 4M1PA 4H9PC 2H7OA 2Q9QB 4YLHA 4TN7B 3U3IA 1MMAA 2CLYB 2DHRA 4ZI2C 3RYCE 4P0BA 3PUGA 2ACXA 4G2AA 1ZKEA 2KT9A 4DMWA 4H9RC 3HKCE 1MMNA 3F2EA 4HE8A 3ZCIA 2LSGA 3N9OA 3P7IA 2LEHA 5J2UE 4EAHA 3UULA 5FXZA 3GA8A 5LHHB 1HF8A 2EHOD 5JQGE 3N5LA 1MMDA 3CX8B 3ZCJA 2IW5B 1WRDA 2ES0A 4I4TE 5L3GB 2JMKA 1YW0A 1MIYA 2XAHB 2UXNB 4H9QC 1NAFA 1ZEEA 4IHJE 5JDGA 5DQVA 2JMHA 3IEEA 3PURA 4ISSA 4TV8E 5AFUL 2V26A 4PJLA 2E9XC 5DQWA 4EZHA 2PG8A 3BQKA 3SOLA 5LXTE 5CA1E 2VK9A 2Y48B 3N2OA 4FJOA 5LGUB 3KV4A 4IE0A 2MOZA 3QUJA 5JDHA 4CI2B 3EDUA 2M67A 5FXXA 5IHYA 4DBQA 4UVAB 1D1AA 3CVRA 1H7CA 4PK4A 2MYSA 3FXDB 4AQFC 2DWKA 4OYJA 5E0OA 3ZMTB 5CA0E 4WBNE 5FY0A 3AAIA 5EK3A 3C4ZA 4I55E 2BDEA 3MK7C 3NRXA 2W63A 2X9YA 2CXLA 4BAYB 1HG2A 2LSJA 5HWYA 1BR0A 3C51A 2LSKA 5LJNA 2PJQA 1MNEA 3F31A 3LG7A 4P09A 4ZOLE 2CXDA 2WBLA 1FIOA 4MBQA 2Z6EA 2KINB 2LSYA 4YHJA 4GK0E 4O4HE 3O9XA 5DJQC 2E9XA 2IAKA 4OFZA 2ZLYA 2NTYA 3N2GE 1BR1A 2NW8A 4UF0A 1VOMA 4UVBB 5IYZE 4AXPA 2VKOA 3KBUA 3PU8A 3EDVA 3WAKA 2DI4A 1Y64B 3O1JA 3UT5E 1SHZC 2NOXA 4ZI2D 5LA6E 3ZN1B 3RRWA 2LE8A 2W00A 4I43B 3LBXB 4HN9A 2V7KA 2NW7A 1KNZA 4XBFB 4CI3B 4O4JE 2DWGA 2CMRA 4IGUA 1FMWA 2X9XA 2WAUA 2OA5A 3P8CD 4TV9E 4ERRA 4GYRA 4JUYA 3CPZA 1SA0E 2I59A 1ZV4X 2KMFA 3CQCB 5KMGP 2HPJA 4PK5A 2VWAA 3PDYA 5CB4E 3H3AA 4MFRA 3MXZA 3Q5WA 1U5PA 1U4QA 4ADZA 3PUAA 3K8PC 2JJ9A 3O4XE 4JLEA 3IHRA 2KXPB 1CUNA 5ADXL 5FNVE 5LGNB 2NTXA 4EXTA 3VHLA 4CZZB 5LJMA 2JQQA 3LK42 1YKHB 3DTOA 2W61A 4QWNB 1IJ5A 3BQIA 3I0QA 4H63H 4UVCB 5JRCA 2GK9A 3ZYLA 3VKGA 3C4XA 4IE4A 3SS1A 3S4UA 2ZM8A 3MA9A 4H9OC 5LCYA 4CXXA 3T8OA 4KUMB 4XZCA 3L09A 4JEUB 1LKXA 1UX5A 5EZYE 2YK0A 2LT3A 3ESLA 3OYZA 3KV6A 2D5UA 2XU0A 5JH7E 3D0TA 4EYYR 2LHNA 4IE5A 2RP4A 2CE7A 2XAJB 4AKGA 3ZMUB 3C98B 3L3PA 3NZPA 3H37A 2WSSV 2PBIA 1HCIA 2W0GA 1E1HB 3AB3B 2ZMAA 4HEAA 5LHGB 2HH7A 3BK9A 5FY7A 4U74A 2H3RA 3PUQA 2X9HA 3B57A 5JDLA 4U72A 4WBOA 3JC6D 2BVMA 2VKHA 4O2BE 3I0OA 3ANWA 4OYKA 4DO0A 4HKAA 3RRCA 1WLXA 4AKRB 2PFVA 3GN5A 2EHOB 1HFAA 1UX4A 3AVRA 4L9IA 2YEVC 1BR2A 4OHFA 1D1BA 4NUUA 5HXSA 3KVBA 2RA1A 3NRYA 4GIWA 2K24A 2WMNA 3K3NA 3Q9DA 3RYFE 4EIWA 4F6RC 2MTQA 3E08A 3FBZA 1D1CA 1HX8A 3ZPOA 1IAPA 3EVYA 2KLQA 2CLYC 3GWHA 2LOSA 3W15B 5J2TE 4HTEA 1D0YA 4MLKA 3HA4A 2X51A 2CWYA 2XHEB 2ZM0A 5HXRA 2N1GA 2XASB 3NBXX 5HYAA 4CXYA 3SWHA 4XAXB 2XUEA 4O4IE 2V7JA 4CQIA 3F57A 4L5GA 4O4LE 2YU2A 3MACA 3N9LA 2YU1A 2CCQA 3OBVE 2VKJA 4WNKA 3HKEE 3ZN0B 3HKBE 5M4YA 5JR9A 5HXEA 3JC6C 5LBQB 2LM9A 3HI2A 4DVDA 2X68A 4IDZA 5ETWA 5J1GA 5FY1A 5LP6E 4TUYE 5FYMA 5KX5E 2C5JA 3ONXA 1UCUA 4DNDA 4C90A 2VASA 4EOZB 3ETUA 3O1HA 2D0UA 3I1AA 2Q9QA 3B13A 2N2NA 3NZQA 2KWHA 4YJ2E 4UIGA 1T98A 3OJAA 2W62A 3KV5A 3UFEA 4DMVA 2VL8A 5KDMC 5C8YE 3J9X1 3MZKB 2Y8DA 4YJ3E 3N9PA 3IF8B 2A3DA 3DP7A 2ODUA 3ZYMA 2XAGB 1EZ3A 4ISTA 3K3QC 4GYSA 3R84B 5FXWA 4KBMB 5L3FB 1S35A 3V5SA 3ZC1A 3O1IA 4HGAA 5H6QB 4WW0A 2NW9A 2H7VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPZ A;  5F3J A;  3BQI A;  2Y8D A;  3BQL A;  3BQK A;  3CML A;  2YK0 A;  4YFS A;  2XU0 A;  4NUV A;  2WAU A;  4NUU A;  3RRC A;  3C64 A; 
#chains in the Genus database with same CATH topology
 1SE7 A;  4KX6 A;  2XM2 A;  3AVS A;  3CWZ B;  2N9D A;  3UU3 A;  2BG9 B;  3ZT6 A;  5AQG B;  1WFD A;  2K48 A;  3CX6 B;  3ZYK A;  3QK6 A;  5ABF B;  2WP9 A;  1HTJ F;  4MHC A;  4H63 V;  3DPL C;  3Q2M A;  4A56 A;  3ZC0 A;  3AE2 A;  5HAX A;  2WQY A;  3PU3 A;  2VVN A;  3PJA J;  1MIV A;  3CQX C;  3RIU C;  3UUX B;  2IC6 A;  3RHW A;  1UUR A;  1HR0 T;  4NXM T;  2XQY A;  4YFS A;  1Z8U A;  3OYX A;  3ZEF B;  5F5W A;  3N9M A;  3ZLI A;  5DAB A;  3I9W A;  5GON E;  5A1L A;  4GKK T;  2XAQ B;  2BZB A;  1YXR A;  1S94 A;  4AQY T;  3VKH A;  1YD8 G;  3BQL A;  2X66 A;  3R6N A;  5LGT B;  4OK0 A;  4ILB A;  4YHH T;  5JRC B;  2A2F X;  4U33 A;  3RX6 A;  2WMO A;  3FHN A;  2LSI A;  4PJM A;  2WU5 A;  4IE7 A;  2VL0 A;  2E2A A;  3AE1 A;  4Z90 A;  5KXJ A;  1FEW A;  3KV9 A;  4QKN A;  4I50 E;  5FL1 A;  1BR4 A;  5EK4 A;  4AQG A;  3TLV A;  4FI5 A;  1OWA A;  2D0T A;  5LBM A;  3ONJ A;  2YN6 A;  3ABV A;  3N9N A;  4KMC A;  2QVA A;  4JGH D;  2JRK A;  5CFB A;  3C50 A;  2CXF A;  3G06 A;  3MKD A;  3CKD A;  2Y6X A;  4U7I A;  4WQO D;  3HKD E;  4N9F 3;  1YQ3 A;  2EHO A;  4UV9 B;  2CPT A;  3AE9 A;  2QA7 A;  4EGW A;  5C2T A;  4UEL A;  2VKD A;  4QX7 B;  3UUN A;  1WR0 A;  1XMQ T;  5LB7 B;  2E9X D;  4UF0 B;  5LOV E;  4AIS A;  2ACZ A;  2C5K T;  2XSA A;  4M1P A;  3RLF F;  3PJA A;  1MMA A;  4ZI2 C;  4G2A A;  1ZKE A;  3ZCI A;  1VCT A;  2LEH A;  5J2U E;  4EAH A;  2J62 A;  2IW5 B;  4JI7 T;  4I4T E;  5L3G B;  2VUR A;  2XAH B;  4NIQ A;  4TV8 E;  3H3M A;  5AFU L;  4IDQ A;  5DQW A;  4EZH A;  2QRX A;  2A9U A;  2MPK A;  4LFB T;  2VK9 A;  5FVL A;  5JDH A;  2XQ8 A;  2QYW A;  3EDU A;  5FXX A;  4UVA B;  2BG9 A;  4PK4 A;  2DWK A;  4OYJ A;  5E0O A;  3ZMT B;  5CA0 E;  3AAI A;  3RI5 A;  2UXC T;  4IL9 A;  4IDO A;  3MK7 C;  2W63 A;  3TLS A;  1BR0 A;  1MNE A;  2CXD A;  5ABF A;  1FIO A;  2Z6E A;  2KIN B;  2LSY A;  3P50 A;  3O9X A;  3PU8 A;  3EDV A;  5FVK A;  3WAK A;  1Y64 B;  4ZI2 D;  5LA6 E;  2W00 A;  2M6I A;  3AEC A;  3QB5 K;  3AEB A;  4TV9 E;  2CBJ A;  4JUY A;  3CPZ A;  3CQC B;  3CK6 A;  2VWA A;  3PDY A;  4JI8 T;  1U5P A;  2XZE A;  2VVS A;  4ADZ A;  5J0Z A;  1HNW T;  2JJ9 A;  4ZXL A;  3UQ7 A;  4P1N A;  1R8I A;  1CUN A;  4CZZ B;  2JQQ A;  2W67 A;  1KNP A;  4H63 H;  5JRC A;  4IE4 A;  4H9O C;  5LCY A;  4YT0 A;  3T8O A;  1XMO T;  2E5V A;  5HCJ A;  2YK0 A;  1GQE A;  2LT3 A;  3ESL A;  2BBJ A;  3OYZ A;  2D5U A;  2XU0 A;  2LHN A;  2CE7 A;  4TWF A;  3NZP A;  4X5T A;  2PBI A;  4EEB A;  1SUM B;  2W0G A;  1E1H B;  3BK9 A;  2WZH A;  2AE9 A;  2YKS A;  3A7M A;  3B57 A;  4DR3 T;  4WBO A;  2BVM A;  4ILC A;  4OYK A;  4HKA A;  1WLX A;  4ZZC A;  1ZOY A;  4P5O A;  2YEV C;  4NUU A;  3KVB A;  4COF A;  2WMN A;  5AQR B;  3GWH A;  5J2T E;  2ZM0 A;  5HYA A;  2R6G F;  4XAX B;  4CQI A;  4L5G A;  3MAC A;  4LMK A;  2VKJ A;  4JV5 T;  5AQT B;  3P4P A;  3JC6 C;  5IUX A;  2X68 A;  4IDZ A;  5ETW A;  5J1G A;  2XQ6 A;  3EHZ A;  5KX5 E;  2C5J A;  2FUP A;  4DUZ T;  4YSX A;  4LFC T;  4EOZ B;  3ETU A;  4B3R T;  3NZQ A;  1T98 A;  2W62 A;  3KV5 A;  5AQM B;  2Y8D A;  4YJ3 E;  4DR6 T;  2V5C A;  2XAG B;  4IST A;  3K3Q C;  3AE7 A;  5FXW A;  4KBM B;  4A97 A;  5L3F B;  3V5S A;  3ZC1 A;  2M6B A;  4WW0 A;  2DL1 A;  3LSV A;  5AQH B;  2OV9 A;  2KND A;  4DV3 T;  3TLU A;  2YDR A;  3UU4 A;  5L2L A;  3N9Q A;  2K9A A;  1XNR T;  5JRE A;  3UU5 A;  2X67 A;  2LOP A;  4IL4 A;  4PJJ A;  2DCF A;  2XTL A;  2P9B A;  2JPF A;  4QXC B;  2Q9Q D;  4X1Y E;  4ZI3 D;  5ABG A;  3AE4 A;  4ASK A;  2IHR 1;  4K0U A;  4KP3 C;  3JAE A;  4NUV A;  3AEE A;  4TX5 A;  4B6X A;  3UUM A;  3RQW A;  4J2C A;  3C4W A;  4ILA A;  1KK7 A;  4QXB B;  2YOE A;  2LJL A;  1V9D A;  1HG5 A;  4MAL A;  4B3S T;  4H9N C;  1ZHC A;  3AA7 B;  3ZMV B;  4E7Z A;  3VRA A;  2HPL A;  4QH4 A;  3PV0 F;  5F8P A;  1WYB A;  2C0S A;  1G73 A;  1LVF A;  2I0M A;  4YSY A;  3T1H T;  3ZJ1 A;  3RYI E;  4DV1 T;  2IDO B;  1LDK B;  1W9R A;  2AXD S;  4IRE A;  2L9Q A;  2CWO A;  3RQU A;  2E8I A;  1MMG A;  3SRZ A;  2LKG A;  4K0K T;  4UEM A;  1HS7 A;  1KNR A;  2V7L A;  2XM1 A;  4TZ4 C;  2KSR A;  4O8S A;  2IUB A;  1E7P A;  3J7Y q;  5HXC A;  3CX7 B;  1ZP0 A;  3AA1 B;  4WYV A;  4ZI7 E;  3KIN B;  4V1A v;  5HEU A;  4G63 A;  3DJB A;  5JDF A;  4AKH A;  2FJD A;  2XQA A;  3I9Y A;  3A5X A;  2LRL A;  5IWA T;  3RH3 A;  4EZ4 A;  2XQ4 A;  3PUS A;  4AIU A;  3PUX F;  3EUH A;  1VRB A;  3KBT A;  3Q5X A;  1N34 T;  2VB6 A;  3RF1 A;  4Z8X A;  2BVL A;  2LKH A;  3RPU A;  5TAO A;  3HL6 A;  2V8S V;  1OED C;  4ZS3 A;  5L3B B;  3M65 A;  2UXD T;  2V7M A;  4C91 A;  4N78 D;  2BG9 E;  2LHR A;  2DNX A;  2K5B B;  1X79 A;  3RKG A;  3ONL C;  3HR0 A;  1QUU A;  1HNX T;  2D9D A;  4UXN B;  3OKQ A;  4A98 A;  1LDJ A;  2WM9 A;  3V5U A;  1D0X A;  4ANJ A;  3AAA B;  3PUY F;  3IBP A;  2LRK A;  4H9P C;  5LG3 A;  2H7O A;  1XDO A;  4YLH A;  2CLY B;  2DHR A;  4P0B A;  3HKC E;  3F2E A;  3UUL A;  3SFE A;  1HF8 A;  2JQK A;  5JQG E;  5AQK B;  1MMD A;  1WRD A;  2ES0 A;  2UXN B;  4H9Q C;  5HEG A;  4KI0 F;  1NAF A;  1ZEE A;  4IHJ E;  5DQV A;  2OLT A;  3JAD A;  2RPA A;  3P4W A;  2E9X C;  4TNV A;  5CA1 E;  4YTM A;  3N2O A;  5LGU B;  3KV4 A;  4IE0 A;  4CI2 B;  4DBQ A;  1M62 A;  3CVR A;  5AQP B;  4AQF C;  5FY0 A;  5EK3 A;  3C4Z A;  3IA3 A;  5AQO B;  2YDS A;  5AQQ B;  5LMN T;  4GKJ T;  1HG2 A;  3JAF A;  1KF6 A;  2PJQ A;  2WDQ A;  4JI4 T;  1OED B;  4YHJ A;  4GK0 E;  4U3C A;  2IAK A;  2IML A;  4OFZ A;  2ZLY A;  5CJ5 A;  4UVB B;  5IYZ E;  4AXP A;  3KBU A;  5AQV B;  3UT5 E;  1SHZ C;  3ZN1 B;  2LE8 A;  4HN9 A;  1KNZ A;  4CI3 B;  4O4J E;  4Z91 A;  2X9X A;  2WAU A;  2OA5 A;  1SA0 E;  4B3T T;  2KMF A;  5KMG P;  4PK5 A;  5CB4 E;  3H3A A;  1U4Q A;  3PUA A;  1M7K A;  3O4X E;  4JLE A;  5CGM A;  2WDR A;  1LDK A;  5LGN B;  3VHL A;  5LJM A;  2CBI A;  4UVC B;  4JI6 T;  4CXX A;  3C4X A;  5HCM A;  4DR5 T;  4KUM B;  1UX5 A;  2V6Y A;  4WZX A;  3D0T A;  3NWI A;  2LLY A;  2XAJ B;  3ZMU B;  3C98 B;  3L3P A;  4TNW A;  1HCI A;  2WCA A;  3OPC A;  2H3R A;  5JDL A;  2BKP A;  3TLW A;  1T72 A;  4AKR B;  4OHF A;  5ABE A;  1FJG T;  2RA1 A;  4LF4 T;  4F6R C;  2MTQ A;  3FBZ A;  1D1C A;  4LF5 T;  2F4V T;  4U7Y A;  1UGO A;  3AEF A;  4MLK A;  3HA4 A;  2CWY A;  1Y01 A;  3F57 A;  2YU2 A;  4F52 A;  3N9L A;  2YU1 A;  2CCQ A;  5FL0 A;  5M4Y A;  1UK5 A;  5HXE A;  5L4E A;  4AP2 B;  4DVD A;  3OTO T;  4TWD A;  5FYM A;  3ONX A;  4DND A;  2D0U A;  3I1A A;  3B13 A;  1W09 A;  4JYA T;  4DMV A;  2VL8 A;  2WS3 A;  5C8Y E;  3N9P A;  3IF8 B;  2ODU A;  4DUY T;  3TLT A;  1IBK T;  5JTG A;  2BS4 A;  1DU2 A;  3Q5D A;  1S35 A;  5AQL B;  4X66 T;  3O1I A;  4HWC A;  4CI1 B;  5H6Q B;  3KFW X;  4QXH B;  3AE3 A;  3QB5 A;  4X64 T;  4IE6 A;  3X1D A;  4L0R A;  3FXE B;  3E22 E;  2KZ7 B;  3AE8 A;  3ETV A;  2WB5 A;  1US7 B;  4PFP A;  3ZMS B;  5LG4 A;  4JI2 T;  2NP9 A;  5FKY A;  3TKL B;  1QLB A;  5LHI B;  2CRB A;  1KEY A;  2DLR A;  5JDN A;  4ZZB A;  5LYJ E;  3RGL A;  4U2Z A;  3RYH E;  4EYU A;  1G8X A;  2H7V C;  5JR9 C;  1OED A;  4DV5 T;  4DR4 T;  3CML A;  4LML A;  4LF9 T;  2B1E A;  1I94 T;  3AA0 B;  5C3J A;  3RC8 A;  1O3X A;  2K3W A;  2Q9Q C;  3GMI A;  4ZI3 C;  3AA6 B;  5FXV A;  5HEJ A;  2H89 A;  2L8K A;  4PAG A;  3RIU A;  4YY3 T;  4KHP T;  4GOU A;  3PTR B;  1Z0P A;  2C5I T;  3RIA A;  1IZN B;  4U2Y A;  4DR1 T;  2HN1 A;  3QC9 A;  1XDP A;  1FMV A;  5JDM A;  2PTF A;  4DV2 T;  2JQH A;  4AI6 A;  3NVO A;  2SPC A;  3CIR A;  5LNK A;  3ZMZ B;  4CXW A;  2J1D G;  1I6Z A;  4EB6 E;  2EHO C;  5L3C B;  1LVK A;  5H6R B;  4A5X A;  4UV8 B;  4PFO A;  2IC9 A;  1IJ6 A;  4EED A;  2WWU A;  4PJN A;  3RKO A;  2ZM6 T;  1T8B A;  3CQG B;  2A72 A;  4H9S E;  5L3E B;  3MJX A;  3LK2 B;  1MIW A;  4IIJ E;  4QH5 A;  3M3Z B;  3UUB A;  4AQF A;  1QSD A;  1JNR A;  2JIW A;  2CA5 A;  2UU9 T;  4PNI A;  3LJC A;  4DR2 T;  4EV6 A;  3N2K E;  5JR9 B;  1OXZ A;  4NXN T;  2QGS A;  3UU6 A;  4BJN A;  4DV6 T;  1B7T A;  4JI1 T;  5EK2 A;  4LF7 T;  4PW8 A;  3PUV F;  2X9W A;  2Q9Q B;  4TN7 B;  3U3I A;  2XQ3 A;  1XZY A;  3SFD A;  2ACX A;  4DV4 T;  2KT9 A;  4DMW A;  4H9R C;  4HE8 A;  2CHN A;  4HFE A;  3P7I A;  5LHH B;  2LM2 A;  2UUB T;  2EHO D;  4F8H A;  3CX8 B;  5AQS B;  2JMK A;  1YW0 A;  3OVU A;  1MIY A;  3B5M A;  3AXJ A;  2JMH A;  3IEE A;  5AQU B;  4PJL A;  2I6H A;  2XQ7 A;  2PG8 A;  5LXT E;  3QOF A;  2V6Y B;  2MOZ A;  2FJA A;  2WZI A;  5IHY A;  1H7C A;  2FBW A;  2MYS A;  2XJ7 A;  3L39 A;  4I55 E;  2BDE A;  2X9Y A;  2CXL A;  4BAY B;  4IDN A;  2LSJ A;  5HEH A;  3C51 A;  1WCR A;  4ZEY A;  1UUS A;  3F31 A;  3LG7 A;  4P09 A;  2WBL A;  3RIF A;  1HX1 B;  2BBH A;  3VR9 A;  1HNZ T;  2CHO A;  3FZL B;  2NTY A;  1BR1 A;  1VOM A;  1XNQ T;  2UUA T;  3AEA A;  2VKO A;  2DI4 A;  1W0B A;  2NOX A;  4TWH A;  4LMJ A;  4HWD A;  3RRW A;  2IIU A;  3LBX B;  2V7K A;  2NW7 A;  4XBF B;  2DWG A;  4IGU A;  1FMW A;  3DQV C;  3P8C D;  4GYR A;  1ZV4 X;  1E2A A;  4MFR A;  4DID B;  3K8P C;  3IHR A;  4HFC A;  5FNV E;  2NTX A;  3ZKR A;  5ABH A;  3DTO A;  2W61 A;  1IJ5 A;  3BQI A;  1CHU A;  2GK9 A;  3VKG A;  3SS1 A;  3S4U A;  3L09 A;  5AQN B;  1IBL T;  5EZY E;  4HFD A;  3KV6 A;  4YTN A;  4HFI A;  3EAB A;  4AKG A;  3H37 A;  2WSS V;  2WDV A;  4HWF A;  4HEA A;  2ZMA A;  4A64 A;  5FY7 A;  4U74 A;  4U72 A;  2VKH A;  3P4S A;  3I0O A;  4DO0 A;  3FZH B;  2PFV A;  3AVR A;  4L9I A;  3UFG A;  1BR2 A;  3NRY A;  4GIW A;  3Q9D A;  4EIW A;  3EVY A;  2KLQ A;  2LOS A;  2HHH T;  4HTE A;  3PUW F;  1D0Y A;  3NBX X;  3SWH A;  2XUE A;  4O4L E;  4KHZ F;  3OBV E;  3HKE E;  3ZN0 B;  3HKB E;  5JR9 A;  5LBQ B;  3HI2 A;  5LP6 E;  1W0A A;  2BS2 A;  2BKN A;  2JQ9 A;  1OED E;  2VAS A;  3NKZ A;  3AED A;  4OX9 T;  2Q9Q A;  2N2N A;  2KWH A;  4YJ2 E;  3OJA A;  3AE5 A;  5KDM C;  3J9X 1;  4U31 A;  5HEO A;  5BR8 T;  2A3D A;  3DP7 A;  3ZYM A;  4GYS A;  4HFH A;  2XY8 B;  3R84 B;  1J1J A;  2XQ9 A;  3P4Q A;  4HGA A;  4IT4 A;  4ILU A;  1JNZ A;  4YXD A;  1WYC A;  3L8R A;  4I0U A;  4X1I E;  3WAJ A;  2X0L B;  5JDQ A;  5L4H A;  3UTK A;  5HXH A;  4Q25 A;  4B3M T;  2E9X B;  4HXI B;  2NWB A;  2WZK A;  4O2A E;  1AJ3 A;  3KDS E;  1IBM T;  2L3L A;  3FZM B;  3JCF A;  1YQ4 A;  2UXX B;  2BS3 A;  2XSB A;  1NWM X;  2ZM2 A;  2ODV A;  4JI3 T;  2V1D B;  3WI3 A;  2D2S A;  3FBL A;  4CN4 A;  4BJM A;  4JEH B;  4X20 E;  4X1K E;  3LBX A;  3FB2 A;  2XAF B;  4P0A A;  4ZHQ E;  2J47 A;  2W4X A;  3ZT7 A;  4QX8 B;  4GK5 E;  5FP3 A;  3LK3 B;  1WR6 A;  4CN6 A;  3C64 A;  2H88 A;  4JI0 T;  1YKE B;  2CM0 A;  5JVD E;  4HFV A;  1MND A;  5AQF B;  3PE0 A;  3U78 A;  2G0U A;  3AEG A;  5BMV E;  4QHO A;  1NEN A;  1NEK A;  4DV7 T;  2FJE A;  4IDP A;  4AKL A;  1N36 T;  3AXJ B;  3ANW B;  2YIN A;  4NPP A;  3GN5 B;  3A8Y C;  2WWV A;  2BKO A;  5L3D B;  1LRZ A;  2MBG A;  3AAE B;  4HWH A;  1D0Z A;  2W2U A;  5HWX A;  2YDQ A;  3EAM A;  2CEA A;  2KWI B;  2WU2 A;  3VRB A;  3K3O A;  3VU7 H;  3T1Y T;  3EI0 A;  4DBR A;  2V7I A;  3ZJ2 A;  3ZSS A;  4E7S A;  3VR8 A;  1L0V A;  4ZS2 A;  5AQI B;  3LFM A;  3E0Z A;  5FMN A;  4QH1 A;  5F3J A;  4PK6 A;  3RC3 A;  4AKI A;  4BA9 A;  2VQF T;  3KVA A;  4X65 T;  3AE6 A;  3RYC E;  3PUG A;  2NR4 A;  1MMN A;  2LSG A;  3N9O A;  3K1S A;  5FXZ A;  3GA8 A;  2V6X A;  3ZST A;  3QNU A;  3N5L A;  2W66 A;  3ZCJ A;  4HFB A;  1N33 T;  1KFY A;  4JI5 T;  4CN1 A;  1VCS A;  5JDG A;  1X9B A;  1XWM A;  3PUR A;  4ISS A;  1J5E T;  2V5D A;  2V26 A;  3BQK A;  3SOL A;  2Y48 B;  4FJO A;  3QUJ A;  4LFA T;  3P4R A;  5AQJ B;  2VQE T;  2M67 A;  1D1A A;  3FXD B;  4WBN E;  2WY2 A;  2X0Y A;  3NRX A;  5HWY A;  2LSK A;  5LJN A;  4ZOL E;  4YSZ A;  4MBQ A;  3Q5E A;  4O4H E;  1N32 T;  5DJQ C;  2E9X A;  2HN2 A;  3N2G E;  2NW8 A;  4UF0 A;  3O1J A;  5LMU T;  4I43 B;  2CMR A;  2X0H A;  4ERR A;  2B76 A;  2UUC T;  2I59 A;  4DV0 T;  4LF6 T;  2HPJ A;  2E5L T;  3MXZ A;  3Q5W A;  3FZF B;  2KXP B;  5ADX L;  4EXT A;  3LK4 2;  4QWN B;  1YKH B;  3I0Q A;  3ZYL A;  4YTP A;  1T7S A;  2ZM8 A;  3MA9 A;  4XZC A;  4JEU B;  1LKX A;  3PUZ F;  4DR7 T;  5JH7 E;  4EYY R;  4IE5 A;  2RP4 A;  4APF B;  2BG9 C;  3AB3 B;  5LHG B;  2HH7 A;  3PUQ A;  2X9H A;  3JC6 D;  3UU8 A;  4O2B E;  3RTR A;  3ANW A;  3RRC A;  3GN5 A;  2EHO B;  1HFA A;  1UX4 A;  4X62 T;  1D1B A;  5HXS A;  3RYF E;  2K24 A;  3K3N A;  3E08 A;  1J5W A;  1HX8 A;  3ZPO A;  1IAP A;  2CLY C;  3W15 B;  4UR9 A;  2X51 A;  2XHE B;  2J4G A;  5HXR A;  2N1G A;  2XAS B;  4CXY A;  4O4I E;  2V7J A;  2MAW A;  4WNK A;  3ZT5 A;  2LM9 A;  2UXB T;  4JBW F;  5FY1 A;  4TUY E;  1UCU A;  4C90 A;  2FJB A;  3O1H A;  1U6G A;  5L47 A;  4UIG A;  3UFE A;  3UQ4 A;  3LDQ B;  3MZK B;  2XQ5 A;  3FZK B;  4HWI B;  1EZ3 A;  2XPK A;  2NW9 A;  4LF8 T; 
#chains in the Genus database with same CATH homology
 4ILU A;  3KFW X;  4QXH B;  3AVS A;  2KND A;  3CWZ B;  1WYC A;  2N9D A;  4IE6 A;  4L0R A;  4X1I E;  3FXE B;  3WAJ A;  5L2L A;  3N9Q A;  2K9A A;  3E22 E;  2X0L B;  5JDQ A;  2KZ7 B;  5JRE A;  3ETV A;  2X67 A;  2LOP A;  1US7 B;  4PJJ A;  2DCF A;  2XTL A;  4PFP A;  3UTK A;  2P9B A;  2JPF A;  2K48 A;  4QXC B;  3ZMS B;  5LG4 A;  3CX6 B;  3ZYK A;  5HXH A;  3QK6 A;  2Q9Q D;  4X1Y E;  2NP9 A;  4ZI3 D;  3TKL B;  1HTJ F;  4MHC A;  4K0U A;  4ASK A;  5LHI B;  4KP3 C;  4H63 V;  2E9X B;  3Q2M A;  4NUV A;  4TX5 A;  4A56 A;  4B6X A;  2DLR A;  2NWB A;  3UUM A;  5JDN A;  3ZC0 A;  4J2C A;  5HAX A;  4O2A E;  1AJ3 A;  3C4W A;  3PU3 A;  5LYJ E;  1KK7 A;  1MIV A;  3CQX C;  4QXB B;  3UUX B;  3KDS E;  2L3L A;  2IC6 A;  1V9D A;  2LJL A;  2XQY A;  4YFS A;  3RYH E;  1HG5 A;  4MAL A;  4EYU A;  1G8X A;  4H9N C;  1ZHC A;  3OYX A;  3ZEF B;  2UXX B;  3AA7 B;  3N9M A;  3ZLI A;  5JR9 C;  5DAB A;  3I9W A;  5GON E;  5A1L A;  1NWM X;  3ZMV B;  4E7Z A;  2ZM2 A;  3CML A;  2ODV A;  2V1D B;  2XAQ B;  3WI3 A;  2D2S A;  3FBL A;  2HPL A;  4BJM A;  2B1E A;  5F8P A;  1WYB A;  2BZB A;  4JEH B;  4X20 E;  2C0S A;  1S94 A;  3AA0 B;  3VKH A;  4X1K E;  1YD8 G;  1G73 A;  1LVF A;  3RC8 A;  1O3X A;  2Q9Q C;  3BQL A;  3ZJ1 A;  3GMI A;  3RYI E;  2X66 A;  3LBX A;  4ZI3 C;  3AA6 B;  3R6N A;  3FB2 A;  2XAF B;  4CI1 B;  5LGT B;  4P0A A;  4ZHQ E;  4OK0 A;  2L9Q A;  5FXV A;  2CWO A;  5JRC B;  4QX8 B;  2L8K A;  4GK5 E;  5FP3 A;  2A2F X;  4PAG A;  2E8I A;  3LK3 B;  1WR6 A;  4GOU A;  3PTR B;  1Z0P A;  1MMG A;  2C5I T;  3C64 A;  1IZN B;  3RX6 A;  3SRZ A;  2WMO A;  4UEM A;  1YKE B;  2CM0 A;  3FHN A;  3QC9 A;  5JVD E;  1FMV A;  2LSI A;  1HS7 A;  5JDM A;  4HFV A;  1MND A;  4PJM A;  2V7L A;  4AI6 A;  2SPC A;  3PE0 A;  4TZ4 C;  3U78 A;  5LNK A;  3ZMZ B;  4IE7 A;  4O8S A;  4CXW A;  2G0U A;  2J1D G;  5BMV E;  3J7Y q;  5HXC A;  3CX7 B;  4QHO A;  3AA1 B;  4EB6 E;  2EHO C;  1FEW A;  4ZI7 E;  5L3C B;  1LVK A;  3KIN B;  3KV9 A;  4G63 A;  4QKN A;  4V1A v;  5H6R B;  4I50 E;  1BR4 A;  5EK4 A;  4AQG A;  3DJB A;  5JDF A;  4AKH A;  4UV8 B;  4FI5 A;  4PFO A;  1OWA A;  2IC9 A;  4AKL A;  1IJ6 A;  3I9Y A;  2D0T A;  3A5X A;  5LBM A;  3RH3 A;  3ANW B;  2YIN A;  4EZ4 A;  3N9N A;  2WWU A;  3GN5 B;  4KMC A;  3PUS A;  3EUH A;  1VRB A;  4PJN A;  2JRK A;  3KBT A;  3Q5X A;  3RKO A;  2VB6 A;  4Z8X A;  3C50 A;  2BVL A;  3CQG B;  2CXF A;  2A72 A;  4H9S E;  5L3D B;  1LRZ A;  3MJX A;  3LK2 B;  1MIW A;  4IIJ E;  2MBG A;  3MKD A;  5L3E B;  3CKD A;  3AAE B;  1D0Z A;  3RPU A;  5HWX A;  5TAO A;  4AQF A;  2Y6X A;  1QSD A;  3HL6 A;  2CEA A;  2KWI B;  3HKD E;  2EHO A;  4ZS3 A;  4UV9 B;  3K3O A;  2CA5 A;  3VU7 H;  3M65 A;  2QA7 A;  5L3B B;  2V7M A;  4DBR A;  4C91 A;  4N78 D;  2V7I A;  4PNI A;  3ZJ2 A;  4E7S A;  3LJC A;  2LHR A;  2DNX A;  2K5B B;  4ZS2 A;  3LFM A;  1X79 A;  3E0Z A;  5FMN A;  4UEL A;  3N2K E;  3HR0 A;  1OXZ A;  5JR9 B;  2VKD A;  5F3J A;  1QUU A;  4PK6 A;  4QX7 B;  3UUN A;  2QGS A;  4BJN A;  3RC3 A;  4UXN B;  3OKQ A;  2E9X D;  1B7T A;  4AKI A;  4UF0 B;  5EK2 A;  5LOV E;  2WM9 A;  3V5U A;  4BA9 A;  4PW8 A;  1D0X A;  2C5K T;  3AAA B;  4ANJ A;  3KVA A;  2X9W A;  3IBP A;  4M1P A;  4H9P C;  2H7O A;  2Q9Q B;  4YLH A;  4TN7 B;  3U3I A;  1MMA A;  2CLY B;  2DHR A;  4ZI2 C;  3RYC E;  4P0B A;  3PUG A;  2ACX A;  4G2A A;  1ZKE A;  2KT9 A;  4DMW A;  4H9R C;  3HKC E;  1MMN A;  3F2E A;  4HE8 A;  3ZCI A;  2LSG A;  3N9O A;  3P7I A;  2LEH A;  5J2U E;  4EAH A;  3UUL A;  5FXZ A;  3GA8 A;  5LHH B;  1HF8 A;  2EHO D;  5JQG E;  3N5L A;  1MMD A;  3CX8 B;  3ZCJ A;  2IW5 B;  1WRD A;  2ES0 A;  4I4T E;  5L3G B;  2JMK A;  1YW0 A;  1MIY A;  2XAH B;  2UXN B;  4H9Q C;  1NAF A;  1ZEE A;  4IHJ E;  5JDG A;  5DQV A;  2JMH A;  3IEE A;  3PUR A;  4ISS A;  4TV8 E;  5AFU L;  2V26 A;  4PJL A;  2E9X C;  5DQW A;  4EZH A;  2PG8 A;  3BQK A;  3SOL A;  5LXT E;  5CA1 E;  2VK9 A;  2Y48 B;  3N2O A;  4FJO A;  5LGU B;  3KV4 A;  4IE0 A;  2MOZ A;  3QUJ A;  5JDH A;  4CI2 B;  3EDU A;  2M67 A;  5FXX A;  5IHY A;  4DBQ A;  4UVA B;  1D1A A;  3CVR A;  1H7C A;  4PK4 A;  2MYS A;  3FXD B;  4AQF C;  2DWK A;  4OYJ A;  5E0O A;  3ZMT B;  5CA0 E;  4WBN E;  5FY0 A;  3AAI A;  5EK3 A;  3C4Z A;  4I55 E;  2BDE A;  3MK7 C;  3NRX A;  2W63 A;  2X9Y A;  2CXL A;  4BAY B;  1HG2 A;  2LSJ A;  5HWY A;  1BR0 A;  3C51 A;  2LSK A;  5LJN A;  2PJQ A;  1MNE A;  3F31 A;  3LG7 A;  4P09 A;  4ZOL E;  2CXD A;  2WBL A;  1FIO A;  4MBQ A;  2Z6E A;  2KIN B;  2LSY A;  4YHJ A;  4GK0 E;  4O4H E;  3O9X A;  5DJQ C;  2E9X A;  2IAK A;  4OFZ A;  2ZLY A;  2NTY A;  3N2G E;  1BR1 A;  2NW8 A;  4UF0 A;  1VOM A;  4UVB B;  5IYZ E;  4AXP A;  2VKO A;  3KBU A;  3PU8 A;  3EDV A;  3WAK A;  2DI4 A;  1Y64 B;  3O1J A;  3UT5 E;  1SHZ C;  2NOX A;  4ZI2 D;  5LA6 E;  3ZN1 B;  3RRW A;  2LE8 A;  2W00 A;  4I43 B;  3LBX B;  4HN9 A;  2V7K A;  2NW7 A;  1KNZ A;  4XBF B;  4CI3 B;  4O4J E;  2DWG A;  2CMR A;  4IGU A;  1FMW A;  2X9X A;  2WAU A;  2OA5 A;  3P8C D;  4TV9 E;  4ERR A;  4GYR A;  4JUY A;  3CPZ A;  1SA0 E;  2I59 A;  1ZV4 X;  2KMF A;  3CQC B;  5KMG P;  2HPJ A;  4PK5 A;  2VWA A;  3PDY A;  5CB4 E;  3H3A A;  4MFR A;  3MXZ A;  3Q5W A;  1U5P A;  1U4Q A;  4ADZ A;  3PUA A;  3K8P C;  2JJ9 A;  3O4X E;  4JLE A;  3IHR A;  2KXP B;  1CUN A;  5ADX L;  5FNV E;  5LGN B;  2NTX A;  4EXT A;  3VHL A;  4CZZ B;  5LJM A;  2JQQ A;  3LK4 2;  1YKH B;  3DTO A;  2W61 A;  4QWN B;  1IJ5 A;  3BQI A;  3I0Q A;  4H63 H;  4UVC B;  5JRC A;  2GK9 A;  3ZYL A;  3VKG A;  3C4X A;  4IE4 A;  3SS1 A;  3S4U A;  2ZM8 A;  3MA9 A;  4H9O C;  5LCY A;  4CXX A;  3T8O A;  4KUM B;  4XZC A;  3L09 A;  4JEU B;  1LKX A;  1UX5 A;  5EZY E;  2YK0 A;  2LT3 A;  3ESL A;  3OYZ A;  3KV6 A;  2D5U A;  2XU0 A;  5JH7 E;  3D0T A;  4EYY R;  2LHN A;  4IE5 A;  2RP4 A;  2CE7 A;  2XAJ B;  4AKG A;  3ZMU B;  3C98 B;  3L3P A;  3NZP A;  3H37 A;  2WSS V;  2PBI A;  1HCI A;  2W0G A;  1E1H B;  3AB3 B;  2ZMA A;  4HEA A;  5LHG B;  2HH7 A;  3BK9 A;  5FY7 A;  4U74 A;  2H3R A;  3PUQ A;  2X9H A;  3B57 A;  5JDL A;  4U72 A;  4WBO A;  3JC6 D;  2BVM A;  2VKH A;  4O2B E;  3I0O A;  3ANW A;  4OYK A;  4DO0 A;  4HKA A;  3RRC A;  1WLX A;  4AKR B;  2PFV A;  3GN5 A;  2EHO B;  1HFA A;  1UX4 A;  3AVR A;  4L9I A;  2YEV C;  1BR2 A;  4OHF A;  1D1B A;  4NUU A;  5HXS A;  3KVB A;  2RA1 A;  3NRY A;  4GIW A;  2K24 A;  2WMN A;  3K3N A;  3Q9D A;  3RYF E;  4EIW A;  4F6R C;  2MTQ A;  3E08 A;  3FBZ A;  1D1C A;  1HX8 A;  3ZPO A;  1IAP A;  3EVY A;  2KLQ A;  2CLY C;  3GWH A;  2LOS A;  3W15 B;  5J2T E;  4HTE A;  1D0Y A;  4MLK A;  3HA4 A;  2X51 A;  2CWY A;  2XHE B;  2ZM0 A;  5HXR A;  2N1G A;  2XAS B;  3NBX X;  5HYA A;  4CXY A;  3SWH A;  4XAX B;  2XUE A;  4O4I E;  2V7J A;  4CQI A;  3F57 A;  4L5G A;  4O4L E;  2YU2 A;  3MAC A;  3N9L A;  2YU1 A;  2CCQ A;  3OBV E;  2VKJ A;  4WNK A;  3HKE E;  3ZN0 B;  3HKB E;  5M4Y A;  5JR9 A;  5HXE A;  3JC6 C;  5LBQ B;  2LM9 A;  3HI2 A;  4DVD A;  2X68 A;  4IDZ A;  5ETW A;  5J1G A;  5FY1 A;  5LP6 E;  4TUY E;  5FYM A;  5KX5 E;  2C5J A;  3ONX A;  1UCU A;  4DND A;  4C90 A;  2VAS A;  4EOZ B;  3ETU A;  3O1H A;  2D0U A;  3I1A A;  2Q9Q A;  3B13 A;  2N2N A;  3NZQ A;  2KWH A;  4YJ2 E;  4UIG A;  1T98 A;  3OJA A;  2W62 A;  3KV5 A;  3UFE A;  4DMV A;  2VL8 A;  5KDM C;  5C8Y E;  3J9X 1;  3MZK B;  2Y8D A;  4YJ3 E;  3N9P A;  3IF8 B;  2A3D A;  3DP7 A;  2ODU A;  3ZYM A;  2XAG B;  1EZ3 A;  4IST A;  3K3Q C;  4GYS A;  3R84 B;  5FXW A;  4KBM B;  5L3F B;  1S35 A;  3V5S A;  3ZC1 A;  3O1I A;  4HGA A;  5H6Q B;  4WW0 A;  2NW9 A;  2H7V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...