3BQLA

Structure of a chondroitin sulphate binding dbl3x domain from a var2csa encoded pfemp1 protein
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
360
structure length
338
Chain Sequence
SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDKKGQKGKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSGDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 118
structure length 338
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqlA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqlA02
3CPZA 3C64A 2YK0A 2Y8DA 3BQKA 3BQLA 2WAUA 3BQIA 4YFSA 3RRCA 4NUVA 5F3JA 4NUUA 3CMLA 2XU0A
chains in the Genus database with same CATH superfamily
3ZJ2A 3OPCA 2VK9A 3FHNA 4JI7T 4TWHA 5JQGE 1BR0A 3MA9A 2BVMA 3TLSA 1WYBA 4WBNE 4ZI3C 1KNZA 4MLKA 4PJNA 2M6IA 2H3RA 3O1HA 4L5GA 2N2NA 1WRDA 3AE4A 3GWHA 1D1AA 4IGUA 3VHLA 2V8SV 1YKEB 3M65A 4A97A 3KVAA 3ETVA 4IDZA 3EABA 2CHOA 4E7ZA 2DI4A 4CXXA 4CI3B 4DMWA 3ONXA 1L0VA 3OJAA 1W0AA 2M6BA 4ZS2A 3AA0B 4UV8B 2CXFA 3PU8A 4JV5T 2CXLA 3TLWA 3NZPA 2JQQA 3H3MA 2KNDA 1MMDA 3SOLA 2VVNA 5CA1E 5F3JA 2E9XD 2Y6XA 2WSSV 4NUUA 4TN7B 4ILAA 4X1IE 5C3JA 2NOXA 1D0XA 1XMQT 4ZI2C 4DMVA 5EK3A 4PNIA 3OVUA 5AQFB 3EAMA 2LKGA 2NW9A 3I9YA 2CXDA 4ISSA 1WYCA 3UFGA 4TWDA 2CEAA 5CA0E 1WCRA 3RC8A 1AJ3A 3N9OA 2EHOD 1HNZT 3ZSSA 3RF1A 2LHNA 3NBXX 4IE7A 2MBGA 3P8CD 4JYAT 4TV8E 2X66A 4HXIB 3UUNA 3H37A 2XQYA 3OYZA 4TNWA 3ZMTB 2LLYA 4ERRA 4H9NC 3LK2B 3RPUA 3FB2A 3MXZA 3EVYA 2W00A 3QC9A 3K3OA 2QVAA 3F57A 3RQWA 3K1SA 3CK6A 2IHR1 2YDQA 5AQKB 3AVRA 2Q9QD 4UV9B 1EZ3A 5KXJA 3FBLA 3ZCIA 3C64A 1Z8UA 5LB7B 4B3ST 3NRYA 1HS7A 3MZKB 5AQMB 2Y8DA 4CZZB 2N1GA 2XPKA 4CXWA 1IJ6A 3V5UA 2EHOA 3S4UA 3LDQB 1HNXT 4O4IE 3PDYA 3U78A 4FJOA 1HG2A 3TLVA 4A5XA 3M3ZB 3K3NA 4PFPA 4F6RC 2VKHA 4CI2B 4AP2B 4EEBA 1HR0T 4XBFB 2ZM6T 4ILUA 4K0UA 4B3MT 1YD8G 5L2LA 2X0HA 3UUMA 4CXYA 2W2UA 4I43B 4XZCA 5L3FB 1BR4A 3LJCA 5JR9C 4YTNA 3NVOA 2KSRA 2UUAT 2MOZA 5FL1A 4CN1A 2J1DG 2HN2A 2JQHA 3PJAJ 1IBLT 2X0LB 1UGOA 3JC6D 5CGMA 3C51A 3L39A 2LT3A 3P4SA 3ZN1B 2VL8A 2LJLA 2UXDT 5ADXL 3CVRA 2W4XA 4DR1T 1LDKA 2UXXB 4UVAB 3AE2A 5HCJA 4E7SA 5JRCA 2ZM2A 3AE7A 5HXEA 2ES0A 5ABFB 5FVLA 1LVKA 3RIAA 2WBLA 4QWNB 3C4WA 2I6HA 4UXNB 5DJQC 4IIJE 1CHUA 4X66T 4IHJE 3B57A 5LOVE 2FJAA 4H63H 2X67A 5JDGA 2B1EA 3ZMSB 4HE8A 5EK2A 2A9UA 3MK7C 1IAPA 4UF0B 1QLBA 4YJ2E 3ZMZB 1M7KA 1ZV4X 2PTFA 4TWFA 2BZBA 2LOSA 1Y01A 2WB5A 4HGAA 4HFVA 1X79A 5JVDE 2WDVA 5JR9A 2MYSA 4TUYE 3CX6B 1S94A 2CBJA 2ACXA 5L3GB 2XM1A 3A5XA 2XQ3A 2V5CA 3L09A 3JADA 1YXRA 3CMLA 1JNRA 2I59A 4GYRA 2VVSA 4YFSA 3PUQA 1OEDB 1IZNB 2ZLYA 1BR2A 4AKRB 3ZPOA 2V7JA 3FBZA 1KF6A 4V1Av 4ZS3A 2WU5A 4DR4T 1D1BA 3AA1B 3AEFA 1QUUA 5HCMA 1SE7A 3KBUA 2E2AA 4H9RC 4IE6A 2XM2A 3TLUA 5HEGA 2KWHA 3DP7A 1WFDA 3OKQA 2W67A 3KV5A 2KZ7B 3NWIA 2NWBA 5AQQB 4AQFC 5AFUL 5HEJA 4IDOA 4DUZT 3Q2MA 3HR0A 4DBQA 2V1DB 4A56A 4PK6A 2PJQA 4ZEYA 3N5LA 5HXHA 1I94T 4EXTA 4JI1T 5EK4A 5JTGA 3F31A 2K48A 4BAYB 4ZZCA 2DNXA 2DCFA 4G63A 4YSYA 2CA5A 1U6GA 2A72A 4U33A 1FMWA 2AE9A 4LF9T 4IDNA 1YQ3A 3NRXA 5L47A 3AE1A 2JMKA 4MBQA 5DQWA 4GKJT 4B3RT 2X51A 3I9WA 5KMGP 2XASB 4U2YA 3SS1A 1UUSA 4L9IA 4ZOLE 2JJ9A 1U4QA 2LM9A 2L9QA 3UU4A 3BK9A 1MNEA 4QX7B 2YKSA 3B13A 3VU7H 2LSJA 2OV9A 4U7YA 3HA4A 3AAAB 4X62T 2SPCA 2BG9B 4PFOA 5LJMA 5LJNA 2YOEA 4OK0A 3NKZA 5H6QB 3ZCJA 3T1HT 4F8HA 5AQPB 5AQJB 2KMFA 3IEEA 3CX7B 2DL1A 1HTJF 2LSIA 3KINB 4DR2T 2WMNA 5AQUB 2YDRA 4JEHB 4QHOA 3NZQA 1UX4A 3HKCE 3ZKRA 4AQFA 3GMIA 4H9PC 1HCIA 4JI3T 1T7SA 5LG3A 2XSBA 4ZI7E 1XNQT 4JGHD 2JPFA 1UCUA 2XSAA 4HFBA 3RRWA 4OFZA 3KDSE 3AXJB 3PUZF 1VOMA 5ETWA 4G2AA 2BKPA 4ILCA 4I50E 4QH1A 4Q25A 1W09A 3O1IA 5FMNA 2YU2A 2KXPB 2W0GA 2X9HA 4AQGA 2IAKA 4AKIA 3GN5A 3FXEB 1YQ4A 3MJXA 2ACZA 4P0BA 1MIVA 4AXPA 2WWVA 2VQET 2WZKA 4UEMA 2V5DA 2AXDS 2YDSA 4PAGA 3VRBA 4ZZBA 4GK0E 4BA9A 4DR6T 3N9NA 2K3WA 3AEBA 2UXCT 3N9QA 4HEAA 3UUBA 3AA7B 4ANJA 4ZI3D 3RYFE 4APFB 4CN6A 4KBMB 2D2SA 1SHZC 4JI4T 4M1PA 3AEEA 4P5OA 2JQ9A 3I0OA 3CQGB 2WY2A 2I0MA 4I55E 2RP4A 3ZMUB 4DIDB 3RYCE 3N9PA 2C5IT 3LG7A 1FEWA 4EYYR 3AE6A 3KV4A 3IBPA 5LCYA 1KNPA 5FNVE 4I0UA 2K9AA 3UU3A 3F2EA 3RLFF 4N78D 3C4XA 4UR9A 5LP6E 4AQYT 2JIWA 5L4EA 4U72A 1VRBA 5JDQA 4DV3T 2UU9T 2CLYB 2YINA 2XY8B 4YT0A 4DV2T 3CIRA 5EZYE 4ZI2D 3AE3A 3ANWB 4EV6A 1XWMA 2VQFT 3Q5WA 3DPLC 2HN1A 1OEDC 3EI0A 3ZC1A 4QKNA 5LHGB 2MPKA 5LG4A 3TKLB 2MAWA 1ZEEA 2KLQA 2VKOA 2H88A 3ZYMA 2HHHT 3FZMB 4O2BE 5FVKA 5AQLB 4JUYA 2X9YA 3P7IA 4HKAA 4CI1B 4Z91A 5HYAA 2WWUA 3EHZA 3Q5EA 3RYIE 4IL9A 5AQIB 1NAFA 3O1JA 2OLTA 4ADZA 2R6GF 3PUGA 3HKDE 4DR3T 2J4GA 2LSKA 2QA7A 1X9BA 1UX5A 5A1LA 4A64A 5L4HA 1BR1A 5LA6E 5AQNB 2CWOA 2V7LA 3E0ZA 4YTMA 2XQ7A 4F52A 3DQVC 5ABGA 4WW0A 2QGSA 2V6YA 3UU5A 2E5LT 3EDVA 3L8RA 4GKKT 4X20E 3RRCA 2A2FX 3ZJ1A 2D0TA 3E22E 3A7MA 1ZP0A 4JBWF 2H89A 3ZMVB 1E7PA 5LYJE 4EYUA 5HXCA 1HX1B 3ZC0A 5LBMA 5LMUT 4LMKA 2LEHA 3C4ZA 1OEDA 4PK5A 2V6XA 3PURA 2DWGA 3RQUA 5JDLA 3IA3A 1XDOA 4HTEA 4XAXB 2W66A 2LSYA 1N33T 4PJMA 1OWAA 3UFEA 4IDQA 3ABVA 2BS3A 2BG9C 3AECA 4O4LE 2IW5B 4TV9E 3RHWA 2E9XB 5M4YA 3AEAA 4L0RA 5BR8T 4UIGA 4FI5A 3MACA 2HPJA 2KINB 3O4XE 2WDQA 1FMVA 3N2GE 2KT9A 3C98B 5FY0A 2XAGB 4LFCT 1VCTA 4X1YE 5HWYA 4H9OC 2YU1A 4KP3C 4KMCA 2V7IA 2LHRA 2K24A 3SRZA 2BDEA 3ONLC 2EHOB 2UXNB 4QH5A 2MTQA 3ESLA 2XHEB 1VCSA 2XZEA 1MNDA 2P9BA 4DV5T 5LHHB 1HNWT 4LMJA 5LGTB 4TNVA 3LBXA 4MFRA 3R84B 5JREA 3K3QC 3KV9A 1KK7A 3CWZB 2YN6A 2Q9QB 2FJEA 2QRXA 4HWCA 4KI0F 2UXBT 2J62A 4NXNT 1MIWA 2CE7A 3C50A 2UUCT 2NP9A 4CQIA 3U3IA 5FXXA 5L3DB 3J9X1 3RI5A 4EB6E 2OA5A 1WLXA 4HFIA 1G73A 4EZHA 1YKHB 5ABEA 3ZYLA 2VURA 3RTRA 2XAQB 2FJBA 4P09A 4O4HE 5FXWA 2CPTA 5LGUB 1LDKB 5C8YE 1T98A 3EUHA 3PUVF 5HEUA 2D9DA 5GONE 5JRCB 3HKEE 4AIUA 2WCAA 4O8SA 3PUWF 2DLRA 2XQAA 1SA0E 5LMNT 5FY1A 3PTRB 3BQIA 3AXJA 1B7TA 2WDRA 3H3AA 3KV6A 5IYZE 2CM0A 2WS3A 3X1DA 3UT5E 4NXMT 4IE0A 1IBMT 4KHZF 3IF8B 5L3EB 3CX8B 3DJBA 4N9F3 3AB3B 2XTLA 4WYVA 4I4TE 3T1YT 2J47A 4QXHB 4MALA 2XQ8A 2YEVC 2DWKA 4PJJA 2WP9A 2IC9A 1J5WA 4YHJA 4LF5T 5KDMC 3OTOT 4LF8T 4JI0T 2CCQA 2L8KA 3ZT5A 1J5ET 3W15B 5IHYA 3OYXA 5HAXA 4X64T 1KFYA 4DV1T 5L3CB 4NUVA 3RGLA 3AAIA 2X9XA 2X9WA 5J1GA 2LE8A 2ZM8A 4YJ3E 3ONJA 3PV0F 2VKJA 2Z6EA 1T72A 3RIFA 1W9RA 3KVBA 1HG5A 3PE0A 4DV6T 2XU0A 2XAHB 3AAEB 3RKGA 3QUJA 1IBKT 2BBJA 2V7KA 3PUXF 1WR0A 2X0YA 4H9SE 5FXVA 4DVDA 3AE9A 2BS2A 5FYMA 1NENA 3N9MA 2B76A 2W61A 3RH3A 2W63A 1ZOYA 2KWIB 2BKNA 3RKOA 3RIUC 4JI2T 2WZHA 3D0TA 3IHRA 5H6RB 4YSXA 2FUPA 1Z0PA 2C5JA 4WZXA 5L3BB 3P4RA 2RA1A 5DQVA 4JEUB 3ANWA 3UULA 4H63V 5CFBA 3HKBE 2ZM0A 2D0UA 3JCFA 2LRLA 1O3XA 2D5UA 1N36T 2VWAA 1H7CA 2WZIA 3PU3A 4UVBB 1XNRT 3HL6A 5DABA 2NTXA 4HN9A 3PUAA 5LHIB 4DBRA 2E9XC 4JI5T 4JI6T 1GQEA 1MMGA 5TAOA 2VASA 4GK5E 2XQ4A 1HFAA 2LOPA 4GIWA 2CMRA 4LMLA 5CJ5A 2QYWA 1NEKA 2M67A 4PJLA 3GA8A 2DHRA 1R8IA 2WM9A 3KFWX 3T8OA 3AA6B 4AKLA 3EDUA 3LFMA 2EHOC 4OYJA 2LRKA 4O2AE 4QXCB 2XJ7A 4AKHA 3UQ4A 4TX5A 1KNRA 3RIUA 3JAEA 5AQSB 2GK9A 1XZYA 3WAKA 3JAFA 4BJNA 2H7OA 4ZHQE 4LF4T 1N34T 1LRZA 4GOUA 4DR5T 2JQKA 3MKDA 4KHPT 4EGWA 3FZFB 4HFDA 4PK4A 4U7IA 2CWYA 4IE5A 3ZT6A 4ASKA 2Q9QC 4UELA 5J0ZA 3FXDB 1WR6A 4UVCB 3FZLB 3QB5K 4JI8T 2RPAA 4TZ4C 5FL0A 3GN5B 1UK5A 3PUYF 1UURA 3VRAA 1KEYA 4X5TA 1W0BA 2E9XA 5ABFA 3AVSA 3Q5DA 5F8PA 3G06A 5J2UE 3RX6A 2CBIA 4GYSA 1I6ZA 5F5WA 4U74A 4IL4A 5FKYA 1E2AA 4OHFA 2E5VA 4P0AA 3DTOA 5J2TE 2YK0A 3I1AA 3AEGA 2IUBA 3ZSTA 4UF0A 5IWAT 3P4QA 5C2TA 2UUBT 2FJDA 1LVFA 1QSDA 4OX9T 3B5MA 3O9XA 2XQ6A 4HFHA 2WQYA 2W62A 1OXZA 1D1CA 3ZT7A 4DR7T 3AE8A 3R6NA 4ILBA 2LSGA 3JC6C 4COFA 4LFBT 3CQXC 2BS4A 2C5KT 1ZHCA 3QB5A 4QX8B 4YTPA 4U2ZA 1US7B 3SFEA 2Q9QA 2NW7A 3I0QA 3SFDA 2LKHA 4DUYT 1MMAA 4AI6A 1J1JA 4HWDA 1CUNA 3PUSA 5HXSA 4HWHA 4HFCA 2VKDA 3CQCB 4YHHT 2ODUA 3UUXB 4EEDA 4EIWA 2A3DA 3L3PA 1LKXA 4X65T 1G8XA 4NIQA 2E8IA 3N9LA 3LK42 3PJAA 3QK6A 3WI3A 4WQOD 2IMLA 1V9DA 1HF8A 4ISTA 4O4JE 4LF7T 4HFEA 2L3LA 4DV4T 2FBWA 5HWXA 2CRBA 2PG8A 4PW8A 3J7Yq 2ZMAA 4KX6A 5HEHA 2XAJB 3BQLA 3ZN0B 3P4PA 1T8BA 4C91A 5HXRA 3SWHA 4C90A 2Y48B 2NTYA 2VL0A 2XQ9A 1YW0A 1FIOA 5FP3A 2N9DA 1OEDE 5JDHA 3VKHA 3UTKA 1SUMB 5AQVB 5JDMA 4U3CA 1N32T 2XAFB 2G0UA 2V6YB 2WMOA 2NR4A 2HPLA 3TLTA 5LBQB 5IUXA 4LF6T 3CPZA 1DU2A 2NW8A 2BBHA 4X1KE 1M62A 2C0SA 4H9QC 1MIYA 2BG9A 1D0ZA 2WAUA 5KX5E 3UQ7A 3RC3A 4DV0T 1ZKEA 5CB4E 4YY3T 1XMOT 4IREA 4JLEA 3LSVA 4IE4A 5FY7A 2PBIA 2BVLA 4DNDA 3BQKA 2X68A 2H7VC 4CN4A 4YLHA 1XDPA 3V5SA 4Z90A 3ZEFB 2V26A 3VKGA 2CHNA 4EZ4A 1Y64B 4P1NA 5HEOA 5ABHA 4A98A 3FZHB 2BKOA 3K8PC 3N2OA 2JRKA 3ETUA 3P50A 2V7MA 5AQGB 3VR8A 4AKGA 2CLYC 3ZYKA 2K5BB 3OBVE 4B3TT 2WU2A 3LK3B 4YSZA 4NPPA 1S35A 1JNZA 5AQRB 3ZLIA 5LNKA 5AQHB 1IJ5A 5LXTE 1FJGT 2HH7A 2PFVA 2BG9E 1LDJA 3P4WA 4AISA 5E0OA 4OYKA 3QOFA 5JR9B 4EOZB 4IT4A 4HWIB 2ODVA 3QNUA 3LBXB 4LFAT 1NWMX 3KBTA 1U5PA 4WNKA 1HX8A 5AQTB 3WAJA 3UU6A 4QXBB 2F4VT 3AE5A 4U31A 5JDFA 4YXDA 2XUEA 1E1HB 4MHCA 3FZKB 2VB6A 3N2KE 5BMVE 2IIUA 4HWFA 4DO0A 2IC6A 3E08A 4QH4A 5JDNA 3VR9A 3A8YC 4EAHA 4ZXLA 4IDPA 4Z8XA 4BJMA 4WBOA 4K0KT 3HI2A 2JMHA 2LM2A 5LGNB 1MMNA 5AQOB 4B6XA 3CKDA 3Q9DA 5FXZA 5JH7E 4DV7T 4J2CA 4KUMB 2XQ5A 1D0YA 3Q5XA 2IDOB 3UU8A 3AEDA 3RYHE
chains in the Genus database with same CATH topology
1WR6A 3OKQA 3ZJ2A 3KV5A 2VK9A 4O4LE 4UVCB 2KZ7B 3FHNA 2IW5B 4TV9E 2E9XB 5M4YA 2NWBA 4AQFC 4L0RA 5AFUL 5JQGE 1BR0A 4UIGA 4TZ4C 4FI5A 3MACA 3GN5B 2HPJA 2KINB 3Q2MA 3O4XE 3MA9A 2BVMA 1FMVA 3HR0A 4DBQA 2V1DB 2E9XA 1WYBA 3N2GE 2PJQA 4PK6A 3N5LA 2KT9A 3C98B 4A56A 4EXTA 4WBNE 3AVSA 4ZI3C 5FY0A 2XAGB 1KNZA 4MLKA 5F8PA 4PJNA 5EK4A 4X1YE 3F31A 2K48A 5HWYA 2H3RA 5J2UE 3O1HA 4H9OC 2YU1A 3RX6A 4BAYB 4KP3C 2DNXA 4KMCA 2V7IA 2LHRA 2K24A 4GYSA 2DCFA 2N2NA 4L5GA 1WRDA 4G63A 3SRZA 3GWHA 4U74A 2CA5A 1D1AA 2BDEA 2A72A 4IGUA 2EHOB 3VHLA 1FMWA 2UXNB 4OHFA 1YKEB 4P0AA 3M65A 3NRXA 3KVAA 3ETVA 2MTQA 3DTOA 4IDZA 5J2TE 3ESLA 4E7ZA 2JMKA 2YK0A 3I1AA 2XHEB 4MBQA 2DI4A 5DQWA 4CXXA 4CI3B 1MNDA 2X51A 3I9WA 5KMGP 2XASB 4DMWA 2P9BA 3ONXA 3SS1A 5LHHB 4L9IA 4UF0A 4ZOLE 2JJ9A 1U4QA 2LM9A 2L9QA 3BK9A 3OJAA 1MNEA 4QX7B 5LGTB 1LVFA 1QSDA 3B13A 3VU7H 3O9XA 2LSJA 4ZS2A 3LBXA 3AA0B 2W62A 3HA4A 3AAAB 1OXZA 4UV8B 2CXFA 1D1CA 4MFRA 3R84B 2SPCA 3PU8A 5JREA 2CXLA 3K3QC 3NZPA 2JQQA 2KNDA 3KV9A 1KK7A 3CWZB 3R6NA 1MMDA 3SOLA 2Q9QB 5CA1E 2LSGA 3JC6C 2E9XD 5F3JA 4PFOA 2Y6XA 5LJMA 5LJNA 2WSSV 4OK0A 3CQXC 5H6QB 4NUUA 1MIWA 3ZCJA 2CE7A 4TN7B 3C50A 2C5KT 1ZHCA 4X1IE 2NP9A 4CQIA 3U3IA 2NOXA 4QX8B 1D0XA 1US7B 2KMFA 5FXXA 3IEEA 5L3DB 3J9X1 4EB6E 2Q9QA 4ZI2C 2NW7A 4DMVA 3I0QA 3CX7B 5EK3A 2OA5A 1WLXA 1HTJF 4PNIA 2LSIA 3KINB 1MMAA 1G73A 2WMNA 4AI6A 2NW9A 3I9YA 4JEHB 2CXDA 4QHOA 4EZHA 3NZQA 1UX4A 3HKCE 4ISSA 4AQFA 1WYCA 3GMIA 4H9PC 1CUNA 1YKHB 2CEAA 3PUSA 1HCIA 5CA0E 3ZYLA 5HXSA 3RC8A 2XAQB 1AJ3A 3N9OA 4P09A 4O4HE 5FXWA 4ZI7E 2VKDA 3CQCB 2EHOD 5LGUB 2JPFA 5C8YE 1UCUA 2ODUA 2LHNA 3NBXX 1T98A 3EUHA 4IE7A 2MBGA 3RRWA 3UUXB 4OFZA 3P8CD 4EIWA 2A3DA 3L3PA 3KDSE 1LKXA 5GONE 1VOMA 4TV8E 5JRCB 2X66A 5ETWA 3HKEE 1G8XA 4G2AA 2E8IA 4I50E 3O1IA 4O8SA 3N9LA 3UUNA 2DLRA 3H37A 1SA0E 2XQYA 5FMNA 3OYZA 3LK42 5FY1A 2YU2A 3PTRB 3BQIA 3ZMTB 2KXPB 4ERRA 2W0GA 3QK6A 1B7TA 4H9NC 2X9HA 3LK2B 3RPUA 3FB2A 3H3AA 3WI3A 3KV6A 3MXZA 3EVYA 1V9DA 2W00A 1HF8A 4AQGA 3QC9A 4ISTA 3K3OA 2IAKA 4O4JE 4AKIA 5IYZE 2CM0A 3GN5A 3FXEB 3F57A 3UT5E 4IE0A 3MJXA 4P0BA 1MIVA 3AVRA 3IF8B 2L3LA 2Q9QD 5L3EB 4UV9B 1EZ3A 4AXPA 3CX8B 3FBLA 3DJBA 4UEMA 5HWXA 3ZCIA 2PG8A 4PW8A 3C64A 3AB3B 3J7Yq 2ZMAA 2XTLA 4I4TE 3NRYA 2XAJB 1HS7A 4PAGA 3MZKB 2Y8DA 4QXHB 4CZZB 4GK0E 4MALA 4BA9A 3BQLA 2N1GA 2YEVC 4CXWA 3ZN0B 2DWKA 4C91A 3N9NA 1IJ6A 4PJJA 3V5UA 2IC9A 3N9QA 5HXRA 3SWHA 2EHOA 4C90A 4HEAA 2Y48B 2NTYA 3AA7B 3S4UA 4YHJA 4ANJA 5KDMC 4O4IE 4ZI3D 3RYFE 1YW0A 4KBMB 2D2SA 1FIOA 3PDYA 1SHZC 2N9DA 5FP3A 3U78A 4FJOA 1HG2A 5JDHA 3VKHA 4M1PA 3UTKA 2CCQA 5JDMA 3K3NA 2L8KA 4PFPA 4F6RC 3I0OA 2XAFB 3CQGB 5IHYA 3W15B 2VKHA 3OYXA 5HAXA 4CI2B 2G0UA 2WMOA 2HPLA 5L3CB 4NUVA 4I55E 4XBFB 2RP4A 3ZMUB 3AAIA 3RYCE 2X9XA 2X9WA 3N9PA 5LBQB 5J1GA 4ILUA 3CPZA 2C5IT 4K0UA 2NW8A 2LE8A 3LG7A 2ZM8A 4X1KE 4YJ3E 1YD8G 1FEWA 4EYYR 2C0SA 4H9QC 5L2LA 1MIYA 3IBPA 3KV4A 3UUMA 4CXYA 1D0ZA 2VKJA 2WAUA 2Z6EA 4I43B 4XZCA 5KX5E 5LCYA 3KVBA 1HG5A 5FNVE 3PE0A 3RC3A 5L3FB 1BR4A 1ZKEA 3LJCA 5CB4E 5JR9C 2K9AA 3F2EA 2XU0A 4N78D 2XAHB 3AAEB 3C4XA 2MOZA 2J1DG 3QUJA 4JLEA 5LP6E 2V7KA 4H9SE 5FXVA 4DVDA 4IE4A 5FY7A 2X0LB 4U72A 5FYMA 2PBIA 1VRBA 3JC6D 5JDQA 3C51A 2LT3A 3N9MA 2CLYB 2VL8A 3ZN1B 2W61A 2LJLA 2YINA 2BVLA 4DNDA 3RH3A 3BQKA 2W63A 2X68A 2H7VC 2KWIB 4YLHA 5ADXL 3CVRA 3V5SA 5EZYE 4ZI2D 3ANWB 3RKOA 3ZEFB 2UXXB 4UVAB 3D0TA 3IHRA 5H6RB 3Q5WA 2V26A 3VKGA 1Z0PA 2C5JA 4EZ4A 4E7SA 5L3BB 5JRCA 2ZM2A 2RA1A 5HXEA 5DQVA 1Y64B 2ES0A 3ZC1A 4QKNA 5LHGB 4JEUB 1LVKA 3ANWA 5LG4A 3K8PC 3UULA 4H63V 2WBLA 3N2OA 3TKLB 2JRKA 1ZEEA 3ETUA 3C4WA 4QWNB 4UXNB 5DJQC 2KLQA 3HKBE 2V7MA 2ZM0A 2D0UA 2VKOA 4IIJE 4AKGA 3ZYMA 2CLYC 3ZYKA 2K5BB 4IHJE 3B57A 4O2BE 3OBVE 5LOVE 4H63H 4JUYA 3LK3B 1O3XA 1S35A 2D5UA 2X9YA 2VWAA 1H7CA 3ZLIA 5LNKA 3P7IA 1IJ5A 2X67A 3PU3A 4HKAA 5JDGA 2B1EA 4UVBB 4CI1B 5LXTE 5HYAA 2HH7A 2WWUA 3HL6A 4HE8A 3ZMSB 2PFVA 3RYIE 5DABA 2NTXA 4HN9A 3PUAA 5EK2A 5LHIB 4DBRA 1NAFA 3O1JA 3MK7C 1IAPA 4UF0B 2E9XC 5E0OA 4ADZA 4YJ2E 4OYKA 5JR9B 4EOZB 3ZMZB 1ZV4X 3PUGA 1MMGA 2ODVA 3HKDE 3LBXB 5TAOA 2BZBA 2LOSA 4HGAA 1NWMX 4HFVA 1X79A 3KBTA 1U5PA 5JVDE 2VASA 2LSKA 4WNKA 1HX8A 2QA7A 1UX5A 4GK5E 1HFAA 5A1LA 2LOPA 4GIWA 5JR9A 2CMRA 3WAJA 4QXBB 1BR1A 2MYSA 4TUYE 5LA6E 3CX6B 1S94A 5JDFA 2ACXA 2XUEA 5L3GB 1E1HB 2CWOA 2V7LA 2M67A 3E0ZA 4PJLA 3A5XA 3GA8A 2DHRA 4MHCA 2VB6A 2WM9A 3KFWX 4WW0A 2QGSA 3L09A 3T8OA 3N2KE 5BMVE 3AA6B 3EDVA 4AKLA 4X20E 3RRCA 4DO0A 3EDUA 2IC6A 3CMLA 3E08A 5JDNA 3LFMA 2EHOC 4OYJA 4EAHA 2I59A 4GYRA 2A2FX 4YFSA 3ZJ1A 3PUQA 2D0TA 4O2AE 3E22E 4Z8XA 4QXCB 4BJMA 4AKHA 4WBOA 3HI2A 2JMHA 1IZNB 2ZLYA 3ZMVB 4TX5A 5LGNB 5HXHA 5LYJE 1BR2A 1MMNA 4EYUA 5HXCA 4AKRB 3ZPOA 3ZC0A 5LBMA 2V7JA 4B6XA 2GK9A 3FBZA 4V1Av 4ZS3A 2LEHA 3WAKA 4BJNA 2H7OA 3C4ZA 1D1BA 4ZHQE 4PK5A 1LRZA 3AA1B 4GOUA 3CKDA 3PURA 1QUUA 2DWGA 5JDLA 3MKDA 3Q9DA 3KBUA 4HTEA 4XAXB 4H9RC 2LSYA 5FXZA 5JH7E 4PJMA 4PK4A 2CWYA 4IE5A 1OWAA 4IE6A 4J2CA 4KUMB 3UFEA 4ASKA 1D0YA 3Q5XA 2Q9QC 2KWHA 4UELA 3DP7A 3RYHE 3FXDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPZ A;  3C64 A;  2YK0 A;  2Y8D A;  3BQK A;  3BQL A;  2WAU A;  3BQI A;  4YFS A;  3RRC A;  4NUV A;  5F3J A;  4NUU A;  3CML A;  2XU0 A; 
#chains in the Genus database with same CATH topology
 3ZJ2 A;  3OPC A;  2VK9 A;  3FHN A;  4JI7 T;  4TWH A;  5JQG E;  1BR0 A;  3MA9 A;  2BVM A;  3TLS A;  1WYB A;  4WBN E;  4ZI3 C;  1KNZ A;  4MLK A;  4PJN A;  2M6I A;  2H3R A;  3O1H A;  4L5G A;  2N2N A;  1WRD A;  3AE4 A;  3GWH A;  1D1A A;  4IGU A;  3VHL A;  2V8S V;  1YKE B;  3M65 A;  4A97 A;  3KVA A;  3ETV A;  4IDZ A;  3EAB A;  2CHO A;  4E7Z A;  2DI4 A;  4CXX A;  4CI3 B;  4DMW A;  3ONX A;  1L0V A;  3OJA A;  1W0A A;  2M6B A;  4ZS2 A;  3AA0 B;  4UV8 B;  2CXF A;  3PU8 A;  4JV5 T;  2CXL A;  3TLW A;  3NZP A;  2JQQ A;  3H3M A;  2KND A;  1MMD A;  3SOL A;  2VVN A;  5CA1 E;  5F3J A;  2E9X D;  2Y6X A;  2WSS V;  4NUU A;  4TN7 B;  4ILA A;  4X1I E;  5C3J A;  2NOX A;  1D0X A;  1XMQ T;  4ZI2 C;  4DMV A;  5EK3 A;  4PNI A;  3OVU A;  5AQF B;  3EAM A;  2LKG A;  2NW9 A;  3I9Y A;  2CXD A;  4ISS A;  1WYC A;  3UFG A;  4TWD A;  2CEA A;  5CA0 E;  1WCR A;  3RC8 A;  1AJ3 A;  3N9O A;  2EHO D;  1HNZ T;  3ZSS A;  3RF1 A;  2LHN A;  3NBX X;  4IE7 A;  2MBG A;  3P8C D;  4JYA T;  4TV8 E;  2X66 A;  4HXI B;  3UUN A;  3H37 A;  2XQY A;  3OYZ A;  4TNW A;  3ZMT B;  2LLY A;  4ERR A;  4H9N C;  3LK2 B;  3RPU A;  3FB2 A;  3MXZ A;  3EVY A;  2W00 A;  3QC9 A;  3K3O A;  2QVA A;  3F57 A;  3RQW A;  3K1S A;  3CK6 A;  2IHR 1;  2YDQ A;  5AQK B;  3AVR A;  2Q9Q D;  4UV9 B;  1EZ3 A;  5KXJ A;  3FBL A;  3ZCI A;  3C64 A;  1Z8U A;  5LB7 B;  4B3S T;  3NRY A;  1HS7 A;  3MZK B;  5AQM B;  2Y8D A;  4CZZ B;  2N1G A;  2XPK A;  4CXW A;  1IJ6 A;  3V5U A;  2EHO A;  3S4U A;  3LDQ B;  1HNX T;  4O4I E;  3PDY A;  3U78 A;  4FJO A;  1HG2 A;  3TLV A;  4A5X A;  3M3Z B;  3K3N A;  4PFP A;  4F6R C;  2VKH A;  4CI2 B;  4AP2 B;  4EEB A;  1HR0 T;  4XBF B;  2ZM6 T;  4ILU A;  4K0U A;  4B3M T;  1YD8 G;  5L2L A;  2X0H A;  3UUM A;  4CXY A;  2W2U A;  4I43 B;  4XZC A;  5L3F B;  1BR4 A;  3LJC A;  5JR9 C;  4YTN A;  3NVO A;  2KSR A;  2UUA T;  2MOZ A;  5FL1 A;  4CN1 A;  2J1D G;  2HN2 A;  2JQH A;  3PJA J;  1IBL T;  2X0L B;  1UGO A;  3JC6 D;  5CGM A;  3C51 A;  3L39 A;  2LT3 A;  3P4S A;  3ZN1 B;  2VL8 A;  2LJL A;  2UXD T;  5ADX L;  3CVR A;  2W4X A;  4DR1 T;  1LDK A;  2UXX B;  4UVA B;  3AE2 A;  5HCJ A;  4E7S A;  5JRC A;  2ZM2 A;  3AE7 A;  5HXE A;  2ES0 A;  5ABF B;  5FVL A;  1LVK A;  3RIA A;  2WBL A;  4QWN B;  3C4W A;  2I6H A;  4UXN B;  5DJQ C;  4IIJ E;  1CHU A;  4X66 T;  4IHJ E;  3B57 A;  5LOV E;  2FJA A;  4H63 H;  2X67 A;  5JDG A;  2B1E A;  3ZMS B;  4HE8 A;  5EK2 A;  2A9U A;  3MK7 C;  1IAP A;  4UF0 B;  1QLB A;  4YJ2 E;  3ZMZ B;  1M7K A;  1ZV4 X;  2PTF A;  4TWF A;  2BZB A;  2LOS A;  1Y01 A;  2WB5 A;  4HGA A;  4HFV A;  1X79 A;  5JVD E;  2WDV A;  5JR9 A;  2MYS A;  4TUY E;  3CX6 B;  1S94 A;  2CBJ A;  2ACX A;  5L3G B;  2XM1 A;  3A5X A;  2XQ3 A;  2V5C A;  3L09 A;  3JAD A;  1YXR A;  3CML A;  1JNR A;  2I59 A;  4GYR A;  2VVS A;  4YFS A;  3PUQ A;  1OED B;  1IZN B;  2ZLY A;  1BR2 A;  4AKR B;  3ZPO A;  2V7J A;  3FBZ A;  1KF6 A;  4V1A v;  4ZS3 A;  2WU5 A;  4DR4 T;  1D1B A;  3AA1 B;  3AEF A;  1QUU A;  5HCM A;  1SE7 A;  3KBU A;  2E2A A;  4H9R C;  4IE6 A;  2XM2 A;  3TLU A;  5HEG A;  2KWH A;  3DP7 A;  1WFD A;  3OKQ A;  2W67 A;  3KV5 A;  2KZ7 B;  3NWI A;  2NWB A;  5AQQ B;  4AQF C;  5AFU L;  5HEJ A;  4IDO A;  4DUZ T;  3Q2M A;  3HR0 A;  4DBQ A;  2V1D B;  4A56 A;  4PK6 A;  2PJQ A;  4ZEY A;  3N5L A;  5HXH A;  1I94 T;  4EXT A;  4JI1 T;  5EK4 A;  5JTG A;  3F31 A;  2K48 A;  4BAY B;  4ZZC A;  2DNX A;  2DCF A;  4G63 A;  4YSY A;  2CA5 A;  1U6G A;  2A72 A;  4U33 A;  1FMW A;  2AE9 A;  4LF9 T;  4IDN A;  1YQ3 A;  3NRX A;  5L47 A;  3AE1 A;  2JMK A;  4MBQ A;  5DQW A;  4GKJ T;  4B3R T;  2X51 A;  3I9W A;  5KMG P;  2XAS B;  4U2Y A;  3SS1 A;  1UUS A;  4L9I A;  4ZOL E;  2JJ9 A;  1U4Q A;  2LM9 A;  2L9Q A;  3UU4 A;  3BK9 A;  1MNE A;  4QX7 B;  2YKS A;  3B13 A;  3VU7 H;  2LSJ A;  2OV9 A;  4U7Y A;  3HA4 A;  3AAA B;  4X62 T;  2SPC A;  2BG9 B;  4PFO A;  5LJM A;  5LJN A;  2YOE A;  4OK0 A;  3NKZ A;  5H6Q B;  3ZCJ A;  3T1H T;  4F8H A;  5AQP B;  5AQJ B;  2KMF A;  3IEE A;  3CX7 B;  2DL1 A;  1HTJ F;  2LSI A;  3KIN B;  4DR2 T;  2WMN A;  5AQU B;  2YDR A;  4JEH B;  4QHO A;  3NZQ A;  1UX4 A;  3HKC E;  3ZKR A;  4AQF A;  3GMI A;  4H9P C;  1HCI A;  4JI3 T;  1T7S A;  5LG3 A;  2XSB A;  4ZI7 E;  1XNQ T;  4JGH D;  2JPF A;  1UCU A;  2XSA A;  4HFB A;  3RRW A;  4OFZ A;  3KDS E;  3AXJ B;  3PUZ F;  1VOM A;  5ETW A;  4G2A A;  2BKP A;  4ILC A;  4I50 E;  4QH1 A;  4Q25 A;  1W09 A;  3O1I A;  5FMN A;  2YU2 A;  2KXP B;  2W0G A;  2X9H A;  4AQG A;  2IAK A;  4AKI A;  3GN5 A;  3FXE B;  1YQ4 A;  3MJX A;  2ACZ A;  4P0B A;  1MIV A;  4AXP A;  2WWV A;  2VQE T;  2WZK A;  4UEM A;  2V5D A;  2AXD S;  2YDS A;  4PAG A;  3VRB A;  4ZZB A;  4GK0 E;  4BA9 A;  4DR6 T;  3N9N A;  2K3W A;  3AEB A;  2UXC T;  3N9Q A;  4HEA A;  3UUB A;  3AA7 B;  4ANJ A;  4ZI3 D;  3RYF E;  4APF B;  4CN6 A;  4KBM B;  2D2S A;  1SHZ C;  4JI4 T;  4M1P A;  3AEE A;  4P5O A;  2JQ9 A;  3I0O A;  3CQG B;  2WY2 A;  2I0M A;  4I55 E;  2RP4 A;  3ZMU B;  4DID B;  3RYC E;  3N9P A;  2C5I T;  3LG7 A;  1FEW A;  4EYY R;  3AE6 A;  3KV4 A;  3IBP A;  5LCY A;  1KNP A;  5FNV E;  4I0U A;  2K9A A;  3UU3 A;  3F2E A;  3RLF F;  4N78 D;  3C4X A;  4UR9 A;  5LP6 E;  4AQY T;  2JIW A;  5L4E A;  4U72 A;  1VRB A;  5JDQ A;  4DV3 T;  2UU9 T;  2CLY B;  2YIN A;  2XY8 B;  4YT0 A;  4DV2 T;  3CIR A;  5EZY E;  4ZI2 D;  3AE3 A;  3ANW B;  4EV6 A;  1XWM A;  2VQF T;  3Q5W A;  3DPL C;  2HN1 A;  1OED C;  3EI0 A;  3ZC1 A;  4QKN A;  5LHG B;  2MPK A;  5LG4 A;  3TKL B;  2MAW A;  1ZEE A;  2KLQ A;  2VKO A;  2H88 A;  3ZYM A;  2HHH T;  3FZM B;  4O2B E;  5FVK A;  5AQL B;  4JUY A;  2X9Y A;  3P7I A;  4HKA A;  4CI1 B;  4Z91 A;  5HYA A;  2WWU A;  3EHZ A;  3Q5E A;  3RYI E;  4IL9 A;  5AQI B;  1NAF A;  3O1J A;  2OLT A;  4ADZ A;  2R6G F;  3PUG A;  3HKD E;  4DR3 T;  2J4G A;  2LSK A;  2QA7 A;  1X9B A;  1UX5 A;  5A1L A;  4A64 A;  5L4H A;  1BR1 A;  5LA6 E;  5AQN B;  2CWO A;  2V7L A;  3E0Z A;  4YTM A;  2XQ7 A;  4F52 A;  3DQV C;  5ABG A;  4WW0 A;  2QGS A;  2V6Y A;  3UU5 A;  2E5L T;  3EDV A;  3L8R A;  4GKK T;  4X20 E;  3RRC A;  2A2F X;  3ZJ1 A;  2D0T A;  3E22 E;  3A7M A;  1ZP0 A;  4JBW F;  2H89 A;  3ZMV B;  1E7P A;  5LYJ E;  4EYU A;  5HXC A;  1HX1 B;  3ZC0 A;  5LBM A;  5LMU T;  4LMK A;  2LEH A;  3C4Z A;  1OED A;  4PK5 A;  2V6X A;  3PUR A;  2DWG A;  3RQU A;  5JDL A;  3IA3 A;  1XDO A;  4HTE A;  4XAX B;  2W66 A;  2LSY A;  1N33 T;  4PJM A;  1OWA A;  3UFE A;  4IDQ A;  3ABV A;  2BS3 A;  2BG9 C;  3AEC A;  4O4L E;  2IW5 B;  4TV9 E;  3RHW A;  2E9X B;  5M4Y A;  3AEA A;  4L0R A;  5BR8 T;  4UIG A;  4FI5 A;  3MAC A;  2HPJ A;  2KIN B;  3O4X E;  2WDQ A;  1FMV A;  3N2G E;  2KT9 A;  3C98 B;  5FY0 A;  2XAG B;  4LFC T;  1VCT A;  4X1Y E;  5HWY A;  4H9O C;  2YU1 A;  4KP3 C;  4KMC A;  2V7I A;  2LHR A;  2K24 A;  3SRZ A;  2BDE A;  3ONL C;  2EHO B;  2UXN B;  4QH5 A;  2MTQ A;  3ESL A;  2XHE B;  1VCS A;  2XZE A;  1MND A;  2P9B A;  4DV5 T;  5LHH B;  1HNW T;  4LMJ A;  5LGT B;  4TNV A;  3LBX A;  4MFR A;  3R84 B;  5JRE A;  3K3Q C;  3KV9 A;  1KK7 A;  3CWZ B;  2YN6 A;  2Q9Q B;  2FJE A;  2QRX A;  4HWC A;  4KI0 F;  2UXB T;  2J62 A;  4NXN T;  1MIW A;  2CE7 A;  3C50 A;  2UUC T;  2NP9 A;  4CQI A;  3U3I A;  5FXX A;  5L3D B;  3J9X 1;  3RI5 A;  4EB6 E;  2OA5 A;  1WLX A;  4HFI A;  1G73 A;  4EZH A;  1YKH B;  5ABE A;  3ZYL A;  2VUR A;  3RTR A;  2XAQ B;  2FJB A;  4P09 A;  4O4H E;  5FXW A;  2CPT A;  5LGU B;  1LDK B;  5C8Y E;  1T98 A;  3EUH A;  3PUV F;  5HEU A;  2D9D A;  5GON E;  5JRC B;  3HKE E;  4AIU A;  2WCA A;  4O8S A;  3PUW F;  2DLR A;  2XQA A;  1SA0 E;  5LMN T;  5FY1 A;  3PTR B;  3BQI A;  3AXJ A;  1B7T A;  2WDR A;  3H3A A;  3KV6 A;  5IYZ E;  2CM0 A;  2WS3 A;  3X1D A;  3UT5 E;  4NXM T;  4IE0 A;  1IBM T;  4KHZ F;  3IF8 B;  5L3E B;  3CX8 B;  3DJB A;  4N9F 3;  3AB3 B;  2XTL A;  4WYV A;  4I4T E;  3T1Y T;  2J47 A;  4QXH B;  4MAL A;  2XQ8 A;  2YEV C;  2DWK A;  4PJJ A;  2WP9 A;  2IC9 A;  1J5W A;  4YHJ A;  4LF5 T;  5KDM C;  3OTO T;  4LF8 T;  4JI0 T;  2CCQ A;  2L8K A;  3ZT5 A;  1J5E T;  3W15 B;  5IHY A;  3OYX A;  5HAX A;  4X64 T;  1KFY A;  4DV1 T;  5L3C B;  4NUV A;  3RGL A;  3AAI A;  2X9X A;  2X9W A;  5J1G A;  2LE8 A;  2ZM8 A;  4YJ3 E;  3ONJ A;  3PV0 F;  2VKJ A;  2Z6E A;  1T72 A;  3RIF A;  1W9R A;  3KVB A;  1HG5 A;  3PE0 A;  4DV6 T;  2XU0 A;  2XAH B;  3AAE B;  3RKG A;  3QUJ A;  1IBK T;  2BBJ A;  2V7K A;  3PUX F;  1WR0 A;  2X0Y A;  4H9S E;  5FXV A;  4DVD A;  3AE9 A;  2BS2 A;  5FYM A;  1NEN A;  3N9M A;  2B76 A;  2W61 A;  3RH3 A;  2W63 A;  1ZOY A;  2KWI B;  2BKN A;  3RKO A;  3RIU C;  4JI2 T;  2WZH A;  3D0T A;  3IHR A;  5H6R B;  4YSX A;  2FUP A;  1Z0P A;  2C5J A;  4WZX A;  5L3B B;  3P4R A;  2RA1 A;  5DQV A;  4JEU B;  3ANW A;  3UUL A;  4H63 V;  5CFB A;  3HKB E;  2ZM0 A;  2D0U A;  3JCF A;  2LRL A;  1O3X A;  2D5U A;  1N36 T;  2VWA A;  1H7C A;  2WZI A;  3PU3 A;  4UVB B;  1XNR T;  3HL6 A;  5DAB A;  2NTX A;  4HN9 A;  3PUA A;  5LHI B;  4DBR A;  2E9X C;  4JI5 T;  4JI6 T;  1GQE A;  1MMG A;  5TAO A;  2VAS A;  4GK5 E;  2XQ4 A;  1HFA A;  2LOP A;  4GIW A;  2CMR A;  4LML A;  5CJ5 A;  2QYW A;  1NEK A;  2M67 A;  4PJL A;  3GA8 A;  2DHR A;  1R8I A;  2WM9 A;  3KFW X;  3T8O A;  3AA6 B;  4AKL A;  3EDU A;  3LFM A;  2EHO C;  4OYJ A;  2LRK A;  4O2A E;  4QXC B;  2XJ7 A;  4AKH A;  3UQ4 A;  4TX5 A;  1KNR A;  3RIU A;  3JAE A;  5AQS B;  2GK9 A;  1XZY A;  3WAK A;  3JAF A;  4BJN A;  2H7O A;  4ZHQ E;  4LF4 T;  1N34 T;  1LRZ A;  4GOU A;  4DR5 T;  2JQK A;  3MKD A;  4KHP T;  4EGW A;  3FZF B;  4HFD A;  4PK4 A;  4U7I A;  2CWY A;  4IE5 A;  3ZT6 A;  4ASK A;  2Q9Q C;  4UEL A;  5J0Z A;  3FXD B;  1WR6 A;  4UVC B;  3FZL B;  3QB5 K;  4JI8 T;  2RPA A;  4TZ4 C;  5FL0 A;  3GN5 B;  1UK5 A;  3PUY F;  1UUR A;  3VRA A;  1KEY A;  4X5T A;  1W0B A;  2E9X A;  5ABF A;  3AVS A;  3Q5D A;  5F8P A;  3G06 A;  5J2U E;  3RX6 A;  2CBI A;  4GYS A;  1I6Z A;  5F5W A;  4U74 A;  4IL4 A;  5FKY A;  1E2A A;  4OHF A;  2E5V A;  4P0A A;  3DTO A;  5J2T E;  2YK0 A;  3I1A A;  3AEG A;  2IUB A;  3ZST A;  4UF0 A;  5IWA T;  3P4Q A;  5C2T A;  2UUB T;  2FJD A;  1LVF A;  1QSD A;  4OX9 T;  3B5M A;  3O9X A;  2XQ6 A;  4HFH A;  2WQY A;  2W62 A;  1OXZ A;  1D1C A;  3ZT7 A;  4DR7 T;  3AE8 A;  3R6N A;  4ILB A;  2LSG A;  3JC6 C;  4COF A;  4LFB T;  3CQX C;  2BS4 A;  2C5K T;  1ZHC A;  3QB5 A;  4QX8 B;  4YTP A;  4U2Z A;  1US7 B;  3SFE A;  2Q9Q A;  2NW7 A;  3I0Q A;  3SFD A;  2LKH A;  4DUY T;  1MMA A;  4AI6 A;  1J1J A;  4HWD A;  1CUN A;  3PUS A;  5HXS A;  4HWH A;  4HFC A;  2VKD A;  3CQC B;  4YHH T;  2ODU A;  3UUX B;  4EED A;  4EIW A;  2A3D A;  3L3P A;  1LKX A;  4X65 T;  1G8X A;  4NIQ A;  2E8I A;  3N9L A;  3LK4 2;  3PJA A;  3QK6 A;  3WI3 A;  4WQO D;  2IML A;  1V9D A;  1HF8 A;  4IST A;  4O4J E;  4LF7 T;  4HFE A;  2L3L A;  4DV4 T;  2FBW A;  5HWX A;  2CRB A;  2PG8 A;  4PW8 A;  3J7Y q;  2ZMA A;  4KX6 A;  5HEH A;  2XAJ B;  3BQL A;  3ZN0 B;  3P4P A;  1T8B A;  4C91 A;  5HXR A;  3SWH A;  4C90 A;  2Y48 B;  2NTY A;  2VL0 A;  2XQ9 A;  1YW0 A;  1FIO A;  5FP3 A;  2N9D A;  1OED E;  5JDH A;  3VKH A;  3UTK A;  1SUM B;  5AQV B;  5JDM A;  4U3C A;  1N32 T;  2XAF B;  2G0U A;  2V6Y B;  2WMO A;  2NR4 A;  2HPL A;  3TLT A;  5LBQ B;  5IUX A;  4LF6 T;  3CPZ A;  1DU2 A;  2NW8 A;  2BBH A;  4X1K E;  1M62 A;  2C0S A;  4H9Q C;  1MIY A;  2BG9 A;  1D0Z A;  2WAU A;  5KX5 E;  3UQ7 A;  3RC3 A;  4DV0 T;  1ZKE A;  5CB4 E;  4YY3 T;  1XMO T;  4IRE A;  4JLE A;  3LSV A;  4IE4 A;  5FY7 A;  2PBI A;  2BVL A;  4DND A;  3BQK A;  2X68 A;  2H7V C;  4CN4 A;  4YLH A;  1XDP A;  3V5S A;  4Z90 A;  3ZEF B;  2V26 A;  3VKG A;  2CHN A;  4EZ4 A;  1Y64 B;  4P1N A;  5HEO A;  5ABH A;  4A98 A;  3FZH B;  2BKO A;  3K8P C;  3N2O A;  2JRK A;  3ETU A;  3P50 A;  2V7M A;  5AQG B;  3VR8 A;  4AKG A;  2CLY C;  3ZYK A;  2K5B B;  3OBV E;  4B3T T;  2WU2 A;  3LK3 B;  4YSZ A;  4NPP A;  1S35 A;  1JNZ A;  5AQR B;  3ZLI A;  5LNK A;  5AQH B;  1IJ5 A;  5LXT E;  1FJG T;  2HH7 A;  2PFV A;  2BG9 E;  1LDJ A;  3P4W A;  4AIS A;  5E0O A;  4OYK A;  3QOF A;  5JR9 B;  4EOZ B;  4IT4 A;  4HWI B;  2ODV A;  3QNU A;  3LBX B;  4LFA T;  1NWM X;  3KBT A;  1U5P A;  4WNK A;  1HX8 A;  5AQT B;  3WAJ A;  3UU6 A;  4QXB B;  2F4V T;  3AE5 A;  4U31 A;  5JDF A;  4YXD A;  2XUE A;  1E1H B;  4MHC A;  3FZK B;  2VB6 A;  3N2K E;  5BMV E;  2IIU A;  4HWF A;  4DO0 A;  2IC6 A;  3E08 A;  4QH4 A;  5JDN A;  3VR9 A;  3A8Y C;  4EAH A;  4ZXL A;  4IDP A;  4Z8X A;  4BJM A;  4WBO A;  4K0K T;  3HI2 A;  2JMH A;  2LM2 A;  5LGN B;  1MMN A;  5AQO B;  4B6X A;  3CKD A;  3Q9D A;  5FXZ A;  5JH7 E;  4DV7 T;  4J2C A;  4KUM B;  2XQ5 A;  1D0Y A;  3Q5X A;  2IDO B;  3UU8 A;  3AED A;  3RYH E; 
#chains in the Genus database with same CATH homology
 1WR6 A;  3OKQ A;  3ZJ2 A;  3KV5 A;  2VK9 A;  4O4L E;  4UVC B;  2KZ7 B;  3FHN A;  2IW5 B;  4TV9 E;  2E9X B;  5M4Y A;  2NWB A;  4AQF C;  4L0R A;  5AFU L;  5JQG E;  1BR0 A;  4UIG A;  4TZ4 C;  4FI5 A;  3MAC A;  3GN5 B;  2HPJ A;  2KIN B;  3Q2M A;  3O4X E;  3MA9 A;  2BVM A;  1FMV A;  3HR0 A;  4DBQ A;  2V1D B;  2E9X A;  1WYB A;  3N2G E;  2PJQ A;  4PK6 A;  3N5L A;  2KT9 A;  3C98 B;  4A56 A;  4EXT A;  4WBN E;  3AVS A;  4ZI3 C;  5FY0 A;  2XAG B;  1KNZ A;  4MLK A;  5F8P A;  4PJN A;  5EK4 A;  4X1Y E;  3F31 A;  2K48 A;  5HWY A;  2H3R A;  5J2U E;  3O1H A;  4H9O C;  2YU1 A;  3RX6 A;  4BAY B;  4KP3 C;  2DNX A;  4KMC A;  2V7I A;  2LHR A;  2K24 A;  4GYS A;  2DCF A;  2N2N A;  4L5G A;  1WRD A;  4G63 A;  3SRZ A;  3GWH A;  4U74 A;  2CA5 A;  1D1A A;  2BDE A;  2A72 A;  4IGU A;  2EHO B;  3VHL A;  1FMW A;  2UXN B;  4OHF A;  1YKE B;  4P0A A;  3M65 A;  3NRX A;  3KVA A;  3ETV A;  2MTQ A;  3DTO A;  4IDZ A;  5J2T E;  3ESL A;  4E7Z A;  2JMK A;  2YK0 A;  3I1A A;  2XHE B;  4MBQ A;  2DI4 A;  5DQW A;  4CXX A;  4CI3 B;  1MND A;  2X51 A;  3I9W A;  5KMG P;  2XAS B;  4DMW A;  2P9B A;  3ONX A;  3SS1 A;  5LHH B;  4L9I A;  4UF0 A;  4ZOL E;  2JJ9 A;  1U4Q A;  2LM9 A;  2L9Q A;  3BK9 A;  3OJA A;  1MNE A;  4QX7 B;  5LGT B;  1LVF A;  1QSD A;  3B13 A;  3VU7 H;  3O9X A;  2LSJ A;  4ZS2 A;  3LBX A;  3AA0 B;  2W62 A;  3HA4 A;  3AAA B;  1OXZ A;  4UV8 B;  2CXF A;  1D1C A;  4MFR A;  3R84 B;  2SPC A;  3PU8 A;  5JRE A;  2CXL A;  3K3Q C;  3NZP A;  2JQQ A;  2KND A;  3KV9 A;  1KK7 A;  3CWZ B;  3R6N A;  1MMD A;  3SOL A;  2Q9Q B;  5CA1 E;  2LSG A;  3JC6 C;  2E9X D;  5F3J A;  4PFO A;  2Y6X A;  5LJM A;  5LJN A;  2WSS V;  4OK0 A;  3CQX C;  5H6Q B;  4NUU A;  1MIW A;  3ZCJ A;  2CE7 A;  4TN7 B;  3C50 A;  2C5K T;  1ZHC A;  4X1I E;  2NP9 A;  4CQI A;  3U3I A;  2NOX A;  4QX8 B;  1D0X A;  1US7 B;  2KMF A;  5FXX A;  3IEE A;  5L3D B;  3J9X 1;  4EB6 E;  2Q9Q A;  4ZI2 C;  2NW7 A;  4DMV A;  3I0Q A;  3CX7 B;  5EK3 A;  2OA5 A;  1WLX A;  1HTJ F;  4PNI A;  2LSI A;  3KIN B;  1MMA A;  1G73 A;  2WMN A;  4AI6 A;  2NW9 A;  3I9Y A;  4JEH B;  2CXD A;  4QHO A;  4EZH A;  3NZQ A;  1UX4 A;  3HKC E;  4ISS A;  4AQF A;  1WYC A;  3GMI A;  4H9P C;  1CUN A;  1YKH B;  2CEA A;  3PUS A;  1HCI A;  5CA0 E;  3ZYL A;  5HXS A;  3RC8 A;  2XAQ B;  1AJ3 A;  3N9O A;  4P09 A;  4O4H E;  5FXW A;  4ZI7 E;  2VKD A;  3CQC B;  2EHO D;  5LGU B;  2JPF A;  5C8Y E;  1UCU A;  2ODU A;  2LHN A;  3NBX X;  1T98 A;  3EUH A;  4IE7 A;  2MBG A;  3RRW A;  3UUX B;  4OFZ A;  3P8C D;  4EIW A;  2A3D A;  3L3P A;  3KDS E;  1LKX A;  5GON E;  1VOM A;  4TV8 E;  5JRC B;  2X66 A;  5ETW A;  3HKE E;  1G8X A;  4G2A A;  2E8I A;  4I50 E;  3O1I A;  4O8S A;  3N9L A;  3UUN A;  2DLR A;  3H37 A;  1SA0 E;  2XQY A;  5FMN A;  3OYZ A;  3LK4 2;  5FY1 A;  2YU2 A;  3PTR B;  3BQI A;  3ZMT B;  2KXP B;  4ERR A;  2W0G A;  3QK6 A;  1B7T A;  4H9N C;  2X9H A;  3LK2 B;  3RPU A;  3FB2 A;  3H3A A;  3WI3 A;  3KV6 A;  3MXZ A;  3EVY A;  1V9D A;  2W00 A;  1HF8 A;  4AQG A;  3QC9 A;  4IST A;  3K3O A;  2IAK A;  4O4J E;  4AKI A;  5IYZ E;  2CM0 A;  3GN5 A;  3FXE B;  3F57 A;  3UT5 E;  4IE0 A;  3MJX A;  4P0B A;  1MIV A;  3AVR A;  3IF8 B;  2L3L A;  2Q9Q D;  5L3E B;  4UV9 B;  1EZ3 A;  4AXP A;  3CX8 B;  3FBL A;  3DJB A;  4UEM A;  5HWX A;  3ZCI A;  2PG8 A;  4PW8 A;  3C64 A;  3AB3 B;  3J7Y q;  2ZMA A;  2XTL A;  4I4T E;  3NRY A;  2XAJ B;  1HS7 A;  4PAG A;  3MZK B;  2Y8D A;  4QXH B;  4CZZ B;  4GK0 E;  4MAL A;  4BA9 A;  3BQL A;  2N1G A;  2YEV C;  4CXW A;  3ZN0 B;  2DWK A;  4C91 A;  3N9N A;  1IJ6 A;  4PJJ A;  3V5U A;  2IC9 A;  3N9Q A;  5HXR A;  3SWH A;  2EHO A;  4C90 A;  4HEA A;  2Y48 B;  2NTY A;  3AA7 B;  3S4U A;  4YHJ A;  4ANJ A;  5KDM C;  4O4I E;  4ZI3 D;  3RYF E;  1YW0 A;  4KBM B;  2D2S A;  1FIO A;  3PDY A;  1SHZ C;  2N9D A;  5FP3 A;  3U78 A;  4FJO A;  1HG2 A;  5JDH A;  3VKH A;  4M1P A;  3UTK A;  2CCQ A;  5JDM A;  3K3N A;  2L8K A;  4PFP A;  4F6R C;  3I0O A;  2XAF B;  3CQG B;  5IHY A;  3W15 B;  2VKH A;  3OYX A;  5HAX A;  4CI2 B;  2G0U A;  2WMO A;  2HPL A;  5L3C B;  4NUV A;  4I55 E;  4XBF B;  2RP4 A;  3ZMU B;  3AAI A;  3RYC E;  2X9X A;  2X9W A;  3N9P A;  5LBQ B;  5J1G A;  4ILU A;  3CPZ A;  2C5I T;  4K0U A;  2NW8 A;  2LE8 A;  3LG7 A;  2ZM8 A;  4X1K E;  4YJ3 E;  1YD8 G;  1FEW A;  4EYY R;  2C0S A;  4H9Q C;  5L2L A;  1MIY A;  3IBP A;  3KV4 A;  3UUM A;  4CXY A;  1D0Z A;  2VKJ A;  2WAU A;  2Z6E A;  4I43 B;  4XZC A;  5KX5 E;  5LCY A;  3KVB A;  1HG5 A;  5FNV E;  3PE0 A;  3RC3 A;  5L3F B;  1BR4 A;  1ZKE A;  3LJC A;  5CB4 E;  5JR9 C;  2K9A A;  3F2E A;  2XU0 A;  4N78 D;  2XAH B;  3AAE B;  3C4X A;  2MOZ A;  2J1D G;  3QUJ A;  4JLE A;  5LP6 E;  2V7K A;  4H9S E;  5FXV A;  4DVD A;  4IE4 A;  5FY7 A;  2X0L B;  4U72 A;  5FYM A;  2PBI A;  1VRB A;  3JC6 D;  5JDQ A;  3C51 A;  2LT3 A;  3N9M A;  2CLY B;  2VL8 A;  3ZN1 B;  2W61 A;  2LJL A;  2YIN A;  2BVL A;  4DND A;  3RH3 A;  3BQK A;  2W63 A;  2X68 A;  2H7V C;  2KWI B;  4YLH A;  5ADX L;  3CVR A;  3V5S A;  5EZY E;  4ZI2 D;  3ANW B;  3RKO A;  3ZEF B;  2UXX B;  4UVA B;  3D0T A;  3IHR A;  5H6R B;  3Q5W A;  2V26 A;  3VKG A;  1Z0P A;  2C5J A;  4EZ4 A;  4E7S A;  5L3B B;  5JRC A;  2ZM2 A;  2RA1 A;  5HXE A;  5DQV A;  1Y64 B;  2ES0 A;  3ZC1 A;  4QKN A;  5LHG B;  4JEU B;  1LVK A;  3ANW A;  5LG4 A;  3K8P C;  3UUL A;  4H63 V;  2WBL A;  3N2O A;  3TKL B;  2JRK A;  1ZEE A;  3ETU A;  3C4W A;  4QWN B;  4UXN B;  5DJQ C;  2KLQ A;  3HKB E;  2V7M A;  2ZM0 A;  2D0U A;  2VKO A;  4IIJ E;  4AKG A;  3ZYM A;  2CLY C;  3ZYK A;  2K5B B;  4IHJ E;  3B57 A;  4O2B E;  3OBV E;  5LOV E;  4H63 H;  4JUY A;  3LK3 B;  1O3X A;  1S35 A;  2D5U A;  2X9Y A;  2VWA A;  1H7C A;  3ZLI A;  5LNK A;  3P7I A;  1IJ5 A;  2X67 A;  3PU3 A;  4HKA A;  5JDG A;  2B1E A;  4UVB B;  4CI1 B;  5LXT E;  5HYA A;  2HH7 A;  2WWU A;  3HL6 A;  4HE8 A;  3ZMS B;  2PFV A;  3RYI E;  5DAB A;  2NTX A;  4HN9 A;  3PUA A;  5EK2 A;  5LHI B;  4DBR A;  1NAF A;  3O1J A;  3MK7 C;  1IAP A;  4UF0 B;  2E9X C;  5E0O A;  4ADZ A;  4YJ2 E;  4OYK A;  5JR9 B;  4EOZ B;  3ZMZ B;  1ZV4 X;  3PUG A;  1MMG A;  2ODV A;  3HKD E;  3LBX B;  5TAO A;  2BZB A;  2LOS A;  4HGA A;  1NWM X;  4HFV A;  1X79 A;  3KBT A;  1U5P A;  5JVD E;  2VAS A;  2LSK A;  4WNK A;  1HX8 A;  2QA7 A;  1UX5 A;  4GK5 E;  1HFA A;  5A1L A;  2LOP A;  4GIW A;  5JR9 A;  2CMR A;  3WAJ A;  4QXB B;  1BR1 A;  2MYS A;  4TUY E;  5LA6 E;  3CX6 B;  1S94 A;  5JDF A;  2ACX A;  2XUE A;  5L3G B;  1E1H B;  2CWO A;  2V7L A;  2M67 A;  3E0Z A;  4PJL A;  3A5X A;  3GA8 A;  2DHR A;  4MHC A;  2VB6 A;  2WM9 A;  3KFW X;  4WW0 A;  2QGS A;  3L09 A;  3T8O A;  3N2K E;  5BMV E;  3AA6 B;  3EDV A;  4AKL A;  4X20 E;  3RRC A;  4DO0 A;  3EDU A;  2IC6 A;  3CML A;  3E08 A;  5JDN A;  3LFM A;  2EHO C;  4OYJ A;  4EAH A;  2I59 A;  4GYR A;  2A2F X;  4YFS A;  3ZJ1 A;  3PUQ A;  2D0T A;  4O2A E;  3E22 E;  4Z8X A;  4QXC B;  4BJM A;  4AKH A;  4WBO A;  3HI2 A;  2JMH A;  1IZN B;  2ZLY A;  3ZMV B;  4TX5 A;  5LGN B;  5HXH A;  5LYJ E;  1BR2 A;  1MMN A;  4EYU A;  5HXC A;  4AKR B;  3ZPO A;  3ZC0 A;  5LBM A;  2V7J A;  4B6X A;  2GK9 A;  3FBZ A;  4V1A v;  4ZS3 A;  2LEH A;  3WAK A;  4BJN A;  2H7O A;  3C4Z A;  1D1B A;  4ZHQ E;  4PK5 A;  1LRZ A;  3AA1 B;  4GOU A;  3CKD A;  3PUR A;  1QUU A;  2DWG A;  5JDL A;  3MKD A;  3Q9D A;  3KBU A;  4HTE A;  4XAX B;  4H9R C;  2LSY A;  5FXZ A;  5JH7 E;  4PJM A;  4PK4 A;  2CWY A;  4IE5 A;  1OWA A;  4IE6 A;  4J2C A;  4KUM B;  3UFE A;  4ASK A;  1D0Y A;  3Q5X A;  2Q9Q C;  2KWH A;  4UEL A;  3DP7 A;  3RYH E;  3FXD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...