3BQIA

Structure of a chondroitin sulphate binding dbl3x from a var2csa encoded pfemp1 protein
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
360
structure length
328
Chain Sequence
SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
molecule keywords Erythrocyte membrane protein 1
total genus 115
structure length 328
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqiA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqiA02
4YFSA 3CMLA 2WAUA 3BQKA 4NUVA 4NUUA 5F3JA 2YK0A 3C64A 2XU0A 2Y8DA 3BQIA 3RRCA 3BQLA 3CPZA
chains in the Genus database with same CATH superfamily
1M7KA 2D2SA 3RI5A 4B6XA 4YHHT 4YXDA 3AVRA 3ZMZB 2XQYA 5JRCA 1IBMT 2V26A 4ILUA 4YTNA 1YXRA 4AQGA 3ETUA 5LBMA 3JC6D 4PK4A 4PJJA 2LSIA 4YJ3E 1S35A 3FZLB 2GK9A 4GK0E 3S4UA 2KXPB 2V5DA 4ZOLE 5F8PA 1T7SA 4ZI7E 4HFEA 5HAXA 1XNRT 2LRKA 2I0MA 1MNEA 2Q9QB 3EVYA 3OVUA 4IDPA 4QHOA 4UVAB 4YLHA 3RH3A 3TLWA 4QXBB 3UUBA 1WRDA 1UX4A 3LSVA 4U31A 4DMVA 5ABFB 5JH7E 5LGNB 5FP3A 2HH7A 3NRXA 3PUZF 2XQ5A 3QC9A 4EZHA 5L3CB 3ZC1A 2CE7A 2V6YB 4P0AA 3P50A 4APFB 2ZM0A 3O1IA 2WP9A 2D9DA 3P4PA 3QK6A 4JEUB 3ZEFB 1X9BA 3SRZA 4F52A 2BBHA 4JV5T 4AP2B 2HHHT 2H3RA 5LBQB 2MPKA 3JAEA 1KNPA 3NVOA 4KHZF 5HCMA 4JI5T 4E7ZA 2XAJB 4TWFA 4EV6A 2BS2A 2W62A 1S94A 3RX6A 4U74A 2IDOB 3CWZB 3AVSA 1M62A 3PURA 3FXEB 3E22E 3LK42 4HFVA 4DR2T 5FL1A 4LFBT 4DMWA 3ZT6A 1OEDA 2BS3A 3F2EA 3Q9DA 2BG9B 2MTQA 3L3PA 3CPZA 2MOZA 5DQWA 4DNDA 3MKDA 1B7TA 5LYJE 4LF7T 4NUUA 4TWHA 4TUYE 5CB4E 1N34T 4JBWF 1XDPA 2B76A 1CUNA 2V6XA 2Y8DA 3MXZA 4IL9A 4UV9B 3PJAJ 3O1JA 2KWIB 3DTOA 4UEMA 5BMVE 4H9PC 3PV0F 1LDKB 4J2CA 3RYFE 1KFYA 1U5PA 1BR1A 2IMLA 2WMNA 3RIFA 3CX6B 3T8OA 1QUUA 5JDLA 3TLVA 5FNVE 4QKNA 4AKLA 5J0ZA 4DUZT 4H9QC 2YU1A 3N9NA 2LM9A 4TNWA 4NPPA 1GQEA 4U2ZA 4WW0A 5L3GB 3CK6A 3ZCJA 1WFDA 2XTLA 3CIRA 1E7PA 3VR8A 4NXMT 3M3ZB 3MJXA 3ONJA 4IIJE 4X20E 3RKGA 5LHGB 4YY3T 2L3LA 3JC6C 4UV8B 5EK3A 1HG5A 2CEAA 2OA5A 4O2BE 3RGLA 4AXPA 1MMAA 2RP4A 4IE4A 5AQQB 2XAFB 1NWMX 1UK5A 1QSDA 5LNKA 2LSYA 2Y6XA 3RIUC 4ZEYA 1OEDE 4QXHB 5EK2A 4I4TE 4FJOA 3KVBA 2W66A 4F6RC 1J5ET 5HCJA 4LF6T 4TX5A 5LP6E 4LFCT 4C90A 3PUVF 4HFDA 4QXCB 4KX6A 3N5LA 2KZ7B 5FKYA 4N9F3 1XMOT 2YDRA 3B13A 1YKHB 2LRLA 3AA7B 3GN5A 4HWCA 4O2AE 2XU0A 2Q9QC 4IREA 5HEHA 2E9XC 2Q9QD 3AEBA 3KDSE 2A72A 4JI2T 3NZPA 3Q5DA 4ILBA 5DJQC 3OTOT 2VKOA 5ETWA 2X9WA 3VR9A 3UQ7A 1IBLT 2WZKA 2J62A 1YD8G 2N9DA 3N9QA 3CKDA 3IEEA 1HCIA 4UELA 4YTMA 3PDYA 2WU5A 3RC8A 4DR1T 4CXXA 4BAYB 2WS3A 4DBRA 4WBNE 1CHUA 3N9MA 2JQ9A 1J1JA 3N9OA 2UXCT 4XZCA 4AKHA 5H6QB 2X67A 2RPAA 2XQAA 3DJBA 4KMCA 2E9XD 4LMLA 4IHJE 1KNRA 2FJAA 3KV9A 3ZYMA 4JI8T 2F4VT 4U3CA 5HXSA 3N9PA 5KX5E 2UUAT 1R8IA 3I1AA 1Z8UA 2NOXA 1OEDC 4Z8XA 1VOMA 4UR9A 5FVLA 3CQCB 4EZ4A 5LMUT 4WZXA 4AQFA 2VK9A 2BG9C 2KNDA 3EDVA 5AQNB 4EAHA 4TV9E 3FB2A 2AXDS 1IZNB 2UXNB 2CBJA 2NP9A 2X68A 1E2AA 2XUEA 3ANWA 3C50A 2QRXA 2JRKA 3GWHA 1LKXA 2K5BB 3KVAA 3AEFA 3NRYA 3AXJA 4NXNT 2WZHA 4PJLA 4LF8T 2XQ7A 4QH1A 5AQPB 1D1AA 3CX8B 3U78A 3L8RA 2E5VA 2YOEA 4MALA 3VU7H 3HKDE 3I9YA 3LK3B 3MACA 4OHFA 2X0HA 3KV5A 3PU8A 3VHLA 3ZMTB 4CN4A 3ZCIA 5BR8T 1LVFA 2WZIA 4HFBA 3DQVC 3MK7C 2LKGA 2WAUA 2WDRA 5FY1A 2OLTA 3FZFB 4IE7A 2P9BA 5AQOB 2BZBA 4A98A 2WSSV 5A1LA 4KHPT 4JI7T 4WYVA 1U6GA 1SHZC 2I59A 1ZKEA 2PFVA 3AA0B 4TZ4C 1VCTA 3UFGA 4GYRA 5HEOA 1D0XA 2N1GA 2NTYA 2WMOA 2X66A 3BQLA 3RC3A 2BDEA 3FZHB 4YJ2E 1BR2A 5J2TE 4GKKT 2QGSA 4HFCA 4PAGA 2OV9A 4KP3C 4UIGA 5LG4A 2WWVA 3F31A 3KFWX 5AQMB 3ZT7A 3P8CD 5FY7A 2JQKA 3OKQA 3Q5EA 5ABHA 3C51A 3ESLA 5AQUB 3Q5XA 1SUMB 2A2FX 3RF1A 1WLXA 3J9X1 2IW5B 3X1DA 3UU8A 2JMKA 2BBJA 1SE7A 4HE8A 4LF4T 3IBPA 2NW8A 1YQ3A 3KV6A 2NW7A 4YHJA 3TLUA 4DR7T 2VWAA 4AI6A 2XAGB 4DUYT 2X0LB 2IC9A 2D0UA 3SOLA 4U33A 4ZI2D 5ABFA 3TKLB 4JI4T 1YW0A 4PJNA 2LLYA 2VKDA 4MHCA 3RYHE 3HR0A 4PK5A 2BS4A 2CA5A 4HN9A 3ANWB 2EHOB 2J47A 2BKOA 1MNDA 4PJMA 3O4XE 3VKGA 3VRAA 5DQVA 2XQ6A 5JQGE 2ODVA 4X1YE 4JUYA 3ABVA 4PK6A 3UU6A 4ADZA 5JDNA 4V1Av 2A3DA 4U7IA 4PNIA 5LXTE 1ZP0A 2W63A 3IF8B 5AQVB 2X51A 2VQET 4HXIB 1Y64B 3H3AA 2G0UA 2JQQA 5FL0A 5KDMC 3NZQA 4DV4T 3K3NA 2C5KT 4X65T 4XBFB 4ZS3A 1SA0E 3BQIA 3ZMVB 5HWXA 4LFAT 2LOPA 4H9SE 4G63A 1MMNA 4WNKA 1LRZA 2VVNA 3T1HT 1N32T 4JGHD 4A64A 4HWIB 1L0VA 1HNZT 3ZT5A 3VKHA 3RRWA 5M4YA 3AE9A 3LK2B 4IDOA 4WQOD 3R6NA 5KXJA 4DV0T 4IL4A 2WM9A 3AAIA 4CXYA 4DV5T 2JMHA 3RYIE 4U72A 3A5XA 1E1HB 4UVBB 4EOZB 5L2LA 1UX5A 1W9RA 5JTGA 3C64A 2ES0A 2XHEB 3C4XA 3LG7A 3J7Yq 4AIUA 1FJGT 2LT3A 2V7LA 3UU5A 1WCRA 2V7MA 3PTRB 4P1NA 4BJMA 1OWAA 5J1GA 4ZI3D 3RTRA 1NENA 4EEDA 3AE2A 3N2OA 5FXZA 2YK0A 1HFAA 1DU2A 1T8BA 2LHRA 2K3WA 2QA7A 5AQLB 3E0ZA 5L3DB 4IE5A 5AQHB 4EIWA 2IHR1 2KT9A 4TWDA 2NW9A 3HKCE 1W0AA 2VURA 5CA1E 4TV8E 4PW8A 4M1PA 3C4ZA 2D0TA 1YQ4A 3MZKB 1YKEB 4ISTA 2C0SA 4DO0A 1WR6A 2UU9T 4COFA 5TAOA 2H89A 3ZN0B 5ADXL 2YDQA 3ZJ1A 3ZN1B 5AQIB 2KWHA 2YU2A 3P4WA 3V5UA 3H3MA 2LM2A 2R6GF 3QNUA 3I0OA 4X1IE 4HFIA 1HG2A 3MA9A 3LBXA 2VASA 2E9XA 4Q25A 3UU4A 5JDHA 2HN1A 1IJ6A 3RLFF 2NWBA 4I50E 2WB5A 2ZMAA 4ANJA 4XAXB 2LE8A 5LOVE 3QB5A 4H9RC 5FMNA 2PBIA 4IDNA 4CI3B 2N2NA 3ONLC 4JEHB 1MMGA 4I43B 3ZC0A 4B3ST 4ISSA 2VL0A 2V8SV 4MFRA 4NUVA 4ZZBA 5JDFA 2VKHA 4G2AA 2H7OA 2ODUA 3WI3A 2XQ4A 2CXFA 3ZPOA 5CJ5A 3OPCA 4DBQA 4GKJT 5L47A 4DR5T 3EI0A 3PUYF 3LFMA 1VCSA 2XSBA 2VKJA 4TN7B 2L8KA 2V6YA 3N9LA 3NBXX 4IDZA 5FYMA 3IA3A 1O3XA 3L39A 2V7JA 5FXVA 3AEEA 2KMFA 4I55E 5IWAT 2VB6A 1N36T 5AQTB 4EB6E 4H63H 4O4LE 5CGMA 1KF6A 5ABEA 3CVRA 1T98A 3ETVA 1LDKA 3A8YC 2VVSA 4UVCB 3ZJ2A 3O9XA 2LHNA 4Z91A 3JAFA 3B5MA 3P4QA 2DWKA 3T1YT 3EHZA 3AE6A 1OEDB 3AEDA 3ZMUB 5AQRB 3B57A 3AE8A 3RQWA 4AKRB 3AAEB 1ZHCA 2X0YA 2WQYA 3EUHA 4QH5A 3ZSSA 4CQIA 2K24A 3RYCE 2W4XA 3HI2A 5AQGB 4HGAA 3P4SA 4DR4T 3UUMA 5C3JA 1D1BA 4BA9A 2HPLA 1OXZA 4BJNA 2WCAA 2Z6EA 4OFZA 3H37A 2JIWA 3M65A 4QX8B 4GOUA 3KBUA 4ILAA 3UUNA 3U3IA 4Z90A 4EEBA 3AE3A 3OYZA 3UFEA 4P0BA 4ZZCA 2C5JA 3GMIA 5HXCA 1FEWA 3UULA 4DR6T 2UXDT 1LVKA 3AE7A 5L4HA 3HA4A 2UUCT 2BG9E 2LJLA 2E2AA 3FZMB 2FUPA 5C2TA 1UUSA 4GYSA 4MBQA 4YFSA 5LHIB 2V5CA 4HTEA 3AB3B 4DVDA 3EABA 3RRCA 5HXEA 4QWNB 1UCUA 2CMRA 5JDQA 2UUBT 4K0KT 4HEAA 4WBOA 4HWFA 3FHNA 5FY0A 4IDQA 4O4JE 3IHRA 2M6BA 3DP7A 3L09A 2XM1A 4ERRA 2WWUA 1FMWA 4FI5A 1MMDA 2RA1A 4OX9T 4JYAT 3CQXC 2W00A 3HKBE 2DWGA 4A56A 4YT0A 4CXWA 5HXRA 3PUGA 3P7IA 1HS7A 4L9IA 2BKNA 2CXLA 2LSJA 5F5WA 1HX1B 2E8IA 3ONXA 4KBMB 4P09A 1ZOYA 2DL1A 4ASKA 1VRBA 2CWYA 5HEUA 5L3BB 2LSKA 2Q9QA 5IUXA 3G06A 5LCYA 4JI0T 2QVAA 5LA6E 3AE1A 3I9WA 2W61A 3NKZA 2ZM6T 3N2GE 5C8YE 4HKAA 4O4HE 1XZYA 5IHYA 4EYUA 3V5SA 2YN6A 4GIWA 4NIQA 2VQFT 3PUQA 4JLEA 2CM0A 2M6IA 2EHOC 2IIUA 4DV2T 5F3JA 4DV3T 2FJDA 1NAFA 4CN1A 4EXTA 2BKPA 2QYWA 4AKIA 3R84B 4TNVA 2J4GA 5L3EB 2LKHA 4O4IE 5AQFB 5GONE 3RIAA 1HNWT 2KINB 5HWYA 4AQYT 2IC6A 3K3QC 4F8HA 4GK5E 1IJ5A 1D1CA 1FIOA 3CQGB 3TLTA 5JR9B 2KLQA 2H7VC 3AEGA 4OK0A 2ZM8A 2MAWA 2ACXA 2MYSA 3AXJB 4L0RA 4OYJA 4PFPA 2I6HA 2W2UA 3WAKA 4AQFC 2LSGA 2W67A 2X9XA 3EDUA 1J5WA 2JJ9A 3QB5K 4K0UA 2XZEA 3SFDA 3FBZA 1D0ZA 3OBVE 4IE0A 2CBIA 3RHWA 5EK4A 1HR0T 3BQKA 1HX8A 3ZMSB 1V9DA 1JNZA 1KK7A 2NR4A 3PUWF 5E0OA 3OJAA 1IBKT 4EYYR 4JI3T 2J1DG 4QX7B 1I6ZA 2XAHB 4P5OA 3KBTA 4YSXA 4UF0A 4LF9T 1EZ3A 2SPCA 4CN6A 4IE6A 2IUBA 2UXXB 5LGUB 3I0QA 4A5XA 4LF5T 2LEHA 3AA1B 4PFOA 2WU2A 4H9OC 3UU3A 4JI1T 1XNQT 1AJ3A 1T72A 4KI0F 4ZS2A 5CA0E 2DNXA 2VL8A 2AE9A 1WYCA 4U2YA 1US7B 2E9XB 2HPJA 3N2KE 1I94T 3E08A 1IAPA 3GN5B 2C5IT 3SFEA 1QLBA 2CHNA 3PJAA 4H9NC 1ZV4X 4C91A 4YTPA 4H63V 5LMNT 3F57A 5J2UE 3VRBA 2WDQA 3W15B 3ZLIA 2WBLA 3RIUA 3KV4A 1XWMA 2PJQA 4YSZA 4B3MT 3Q5WA 5EZYE 2V7IA 3PE0A 2XAQB 3LDQB 2FBWA 3AE4A 2DCFA 2CPTA 1G73A 3HKEE 1XDOA 3NWIA 1KNZA 2YKSA 2XQ8A 3CMLA 2PTFA 3FXDB 4KUMB 4HWDA 2EHOD 2PG8A 2EHOA 4X1KE 2WY2A 3EAMA 5FXWA 3TLSA 1LDJA 1MIYA 2E5LT 2DLRA 5LJNA 4A97A 1U4QA 2FJEA 2K9AA 2XPKA 2YDSA 3AECA 3UQ4A 5L4EA 5JREA 4ILCA 4X62T 4DV1T 3RQUA 2M67A 4N78D 4LMJA 3QUJA 5HYAA 4CI2B 5JDGA 5JDMA 4DV7T 2HN2A 1KEYA 5HXHA 2LOSA 3CX7B 3ZSTA 3BK9A 5H6RB 1D0YA 3FZKB 3UTKA 4ZI2C 1ZEEA 1UURA 3O1HA 2XM2A 5JR9C 4HWHA 2CHOA 2CLYB 5AQJB 2DHRA 1XMQT 5IYZE 3DPLC 3A7MA 4ZXLA 2XQ3A 2CXDA 3PUAA 3JCFA 2CWOA 3OYXA 4L5GA 1HF8A 1WYBA 3Q2MA 2XJ7A 4DIDB 2A9UA 4X66T 2H88A 4UF0B 1N33T 3C4WA 5AFUL 4ZHQE 5ABGA 2W0GA 2ACZA 2WDVA 3AEAA 5JVDE 4CI1B 4E7SA 1W09A 3SS1A 2XQ9A 2BVMA 4MLKA 4QH4A 3UT5E 3WAJA 4B3TT 3PUXF 5LB7B 2FJBA 5HEJA 4U7YA 4I0UA 5FVKA 4HFHA 3QOFA 2YINA 3ZKRA 4JI6T 2V7KA 4LMKA 5KMGP 5DABA 5LG3A 1UGOA 2L9QA 4AKGA 1BR4A 5AQKB 2NTXA 2Y48B 4X5TA 5CFBA 3HL6A 3K3OA 4CZZB 1G8XA 4IGUA 1Y01A 2IAKA 5JR9A 3AE5A 3ZYLA 2BG9A 3P4RA 1JNRA 3LBXB 1BR0A 2MBGA 1MIVA 2D5UA 2XY8B 2YEVC 3FBLA 3RPUA 3ZYKA 1W0BA 3PU3A 5L3FB 3KINB 3JADA 5LJMA 4B3RT 1WR0A 4IT4A 1HNXT 2BVLA 5LGTB 3PUSA 2UXBT 2JQHA 3AAAB 2KSRA 2X9HA 4O8SA 2X9YA 2ZLYA 2CRBA 2JPFA 4X64T 5HEGA 2B1EA 2K48A 4ZI3C 5JRCB 4OYKA 3LJCA 2CLYC 3UUXB 2XASB 3K1SA 5FXXA 2DI4A 3RKOA 4UXNB 4YSYA 4DR3T 4DV6T 2XSAA 1H7CA 1NEKA 5AQSB 3SWHA 3D0TA 1Z0PA 3AA6B 5LHHB 1FMVA 1HTJF 3K8PC 3GA8A 1MIWA 2V1DB 4AISA 2ZM2A 4EGWA 1X79A 2CCQA 3C98B
chains in the Genus database with same CATH topology
2D2SA 4B6XA 3AVRA 3ZMZB 2XQYA 5JRCA 2V26A 4ILUA 4AQGA 3ETUA 5LBMA 3JC6D 4PK4A 4PJJA 2LSIA 4YJ3E 1S35A 3S4UA 2GK9A 4GK0E 2KXPB 4ZI7E 4ZOLE 5F8PA 5HAXA 3EVYA 1MNEA 2Q9QB 4QHOA 3RH3A 4UVAB 4YLHA 4DMVA 4QXBB 5JH7E 1WRDA 1UX4A 5FP3A 2HH7A 3NRXA 3QC9A 5L3CB 4EZHA 3ZC1A 2CE7A 4P0AA 2ZM0A 3O1IA 3QK6A 4JEUB 3ZEFB 3SRZA 2H3RA 5LBQB 4E7ZA 2XAJB 3RX6A 2W62A 1S94A 4U74A 3CWZB 3PURA 3AVSA 3FXEB 3E22E 3LK42 4HFVA 4DMWA 3F2EA 3Q9DA 2MTQA 3L3PA 3CPZA 2MOZA 5DQWA 4DNDA 3MKDA 1B7TA 4NUUA 4TUYE 5CB4E 5LGNB 4UV9B 1CUNA 2Y8DA 3MXZA 3O1JA 2KWIB 3DTOA 4UEMA 5BMVE 4H9PC 4J2CA 3RYFE 1U5PA 1BR1A 2WMNA 3CX6B 3T8OA 1QUUA 5JDLA 5FNVE 4QKNA 4AKLA 4H9QC 2YU1A 3N9NA 2LM9A 4WW0A 5L3GB 3ZCJA 2XTLA 3MJXA 4IIJE 5LHGB 4X20E 2L3LA 3JC6C 4UV8B 5EK3A 1HG5A 2CEAA 2OA5A 4O2BE 4AXPA 1MMAA 2RP4A 4IE4A 2XAFB 1NWMX 1QSDA 5LNKA 2LSYA 2Y6XA 4QXHB 5EK2A 4I4TE 4FJOA 3KVBA 4F6RC 4TX5A 5LP6E 4C90A 4QXCB 3N5LA 2KZ7B 2XU0A 3B13A 1YKHB 3AA7B 3GN5A 4O2AE 2Q9QC 2E9XC 2Q9QD 3KDSE 2A72A 3NZPA 5DJQC 2VKOA 5ETWA 2X9WA 3N9QA 1YD8G 2N9DA 4UELA 3CKDA 3IEEA 1HCIA 3UULA 3RC8A 3PDYA 4CXXA 4BAYB 4DBRA 4WBNE 3N9MA 3N9OA 4AKHA 4XZCA 5H6QB 2X67A 3DJBA 4KMCA 3ZYMA 2E9XD 4IHJE 3KV9A 5HXSA 3N9PA 5KX5E 2NOXA 4Z8XA 1VOMA 4EZ4A 3CQCB 4AQFA 2VK9A 2KNDA 3EDVA 4EAHA 4TV9E 3FB2A 1IZNB 2UXNB 2X68A 3C50A 2NP9A 2XUEA 3ANWA 3I1AA 3KVAA 5ADXL 2JRKA 3GWHA 1LKXA 2K5BB 3NRYA 4PJLA 1D1AA 3CX8B 3U78A 5LJMA 4MALA 3VU7H 3HKDE 3I9YA 3LK3B 3MACA 4OHFA 3VHLA 3KV5A 3PU8A 3ZMTB 3ZCIA 1LVFA 3MK7C 2WAUA 5FY1A 4IE7A 2P9BA 2BZBA 2WSSV 5A1LA 1SHZC 2I59A 1ZKEA 2PFVA 3AA0B 4TZ4C 4GYRA 1D0XA 2N1GA 2NTYA 2WMOA 2X66A 3BQLA 3RC3A 2BDEA 4YJ2E 5J2TE 1BR2A 2QGSA 4PAGA 4UIGA 4KP3C 5LYJE 5LG4A 3F31A 3KFWX 3P8CD 5FY7A 3OKQA 3C51A 3ESLA 3Q5XA 2A2FX 1WLXA 3J9X1 2IW5B 2JMKA 4HE8A 3IBPA 4YHJA 3KV6A 2NW7A 2VWAA 4AI6A 2XAGB 2X0LB 2IC9A 2D0UA 3SOLA 4ZI2D 3TKLB 1YW0A 4PJNA 2VKDA 4MHCA 3RYHE 3HR0A 4PK5A 2CA5A 4HN9A 3ANWB 2EHOB 1MNDA 4PJMA 3O4XE 3VKGA 5DQVA 5JQGE 2ODVA 4X1YE 4JUYA 4PK6A 4ADZA 5JDNA 4V1Av 2A3DA 5LXTE 4PNIA 2W63A 3IF8B 2X51A 1Y64B 3H3AA 2G0UA 2JQQA 5KDMC 3NZQA 3K3NA 2C5KT 4XBFB 4ZS3A 1SA0E 3BQIA 3ZMVB 5HWXA 2LOPA 4H9SE 4G63A 1MMNA 4WNKA 1LRZA 3VKHA 3RRWA 5M4YA 3LK2B 3R6NA 2WM9A 3AAIA 4CXYA 2JMHA 3RYIE 4U72A 3A5XA 1E1HB 4UVBB 4EOZB 5L2LA 1UX5A 3C64A 2ES0A 2XHEB 3C4XA 3LG7A 3J7Yq 2LT3A 2V7LA 2V7MA 3PTRB 4BJMA 4ZI3D 1OWAA 5J1GA 3N2OA 5FXZA 2YK0A 1HFAA 2LHRA 2QA7A 3E0ZA 5L3DB 4IE5A 4EIWA 2KT9A 2NW9A 3HKCE 5CA1E 4TV8E 4PW8A 4M1PA 3C4ZA 2D0TA 3MZKB 1YKEB 4ISTA 2C0SA 4DO0A 1WR6A 5TAOA 3ZN0B 3ZJ1A 3ZN1B 2KWHA 2YU2A 3V5UA 3I0OA 4X1IE 1HG2A 3MA9A 3LBXA 2VASA 2E9XA 5JDHA 1IJ6A 2NWBA 4I50E 2ZMAA 4ANJA 4XAXB 2LE8A 5LOVE 4H9RC 5FMNA 2PBIA 4CI3B 2N2NA 4JEHB 1MMGA 4I43B 3ZC0A 4ISSA 4MFRA 4NUVA 5JDFA 2VKHA 4G2AA 2H7OA 2ODUA 3WI3A 3ZPOA 2CXFA 4DBQA 3LFMA 2VKJA 4TN7B 2L8KA 3N9LA 3NBXX 4IDZA 5FYMA 1O3XA 5FXVA 2V7JA 1X79A 2KMFA 4I55E 2VB6A 4EB6E 4H63H 4O4LE 3CVRA 1T98A 3ETVA 3ZJ2A 4UVCB 3O9XA 2LHNA 2DWKA 3ZMUB 3B57A 4AKRB 3AAEB 1ZHCA 3EUHA 4CQIA 2K24A 3RYCE 3HI2A 4HGAA 3UUMA 1D1BA 4BA9A 2HPLA 1OXZA 4BJNA 2Z6EA 4OFZA 3H37A 3M65A 4QX8B 4GOUA 3KBUA 3UUNA 3U3IA 3OYZA 3UFEA 4P0BA 2C5JA 3GMIA 5HXCA 1FEWA 1LVKA 3HA4A 2LJLA 4GYSA 4MBQA 4HTEA 3AB3B 4DVDA 3RRCA 5HXEA 4QWNB 1UCUA 2CMRA 5JDQA 4HEAA 4WBOA 3FHNA 5FY0A 4O4JE 3IHRA 3DP7A 3L09A 4ERRA 2WWUA 1FMWA 4FI5A 1MMDA 2RA1A 3CQXC 2W00A 3HKBE 2DWGA 4A56A 4CXWA 5HXRA 3PUGA 3P7IA 1HS7A 4L9IA 2CXLA 2LSJA 2E8IA 3ONXA 4ASKA 4KBMB 4P09A 1VRBA 2CWYA 5L3BB 2LSKA 2Q9QA 5LCYA 5LA6E 3I9WA 2W61A 3N2GE 5C8YE 4HKAA 4O4HE 5IHYA 4EYUA 3V5SA 4GIWA 3PUQA 4JLEA 2CM0A 2EHOC 5F3JA 1NAFA 4AKIA 4EXTA 3R84B 5L3EB 4O4IE 5GONE 2KINB 5HWYA 2IC6A 3K3QC 4GK5E 1IJ5A 1D1CA 1FIOA 3CQGB 5JR9B 2KLQA 2H7VC 4OK0A 2ZM8A 4L0RA 2ACXA 2MYSA 4OYJA 4PFPA 4YFSA 3WAKA 4AQFC 1AJ3A 2LSGA 2X9XA 3EDUA 2JJ9A 4K0UA 3FBZA 1D0ZA 3OBVE 4IE0A 5EK4A 3BQKA 1HX8A 3ZMSB 1V9DA 1KK7A 5E0OA 3OJAA 4EYYR 2J1DG 4QX7B 2XAHB 3KBTA 4UF0A 1EZ3A 2SPCA 4IE6A 2UXXB 5LGUB 3I0QA 2LEHA 3AA1B 4PFOA 4H9OC 4ZS2A 5CA0E 2DNXA 2VL8A 1WYCA 1US7B 2E9XB 2HPJA 3N2KE 3E08A 1IAPA 3GN5B 2C5IT 4H9NC 1ZV4X 4C91A 4H63V 3F57A 5J2UE 3W15B 3ZLIA 2WBLA 3KV4A 2PJQA 3Q5WA 5EZYE 2V7IA 3PE0A 2XAQB 2DCFA 3HKEE 1G73A 1KNZA 3CMLA 3FXDB 4KUMB 4X1KE 5LHIB 2EHOD 2PG8A 2EHOA 5FXWA 1MIYA 2DLRA 5LJNA 1U4QA 5JREA 2K9AA 2M67A 4N78D 3QUJA 5HYAA 4CI2B 5JDGA 5JDMA 5HXHA 2LOSA 3CX7B 3BK9A 5H6RB 1D0YA 3UTKA 4ZI2C 1ZEEA 3O1HA 5JR9C 2CLYB 2DHRA 5IYZE 2CXDA 3PUAA 3OYXA 2CWOA 4L5GA 1HF8A 1WYBA 3Q2MA 4UF0B 3C4WA 5AFUL 4ZHQE 2W0GA 5JVDE 4CI1B 4E7SA 3SS1A 4MLKA 2BVMA 3UT5E 3WAJA 2YINA 2V7KA 5KMGP 5DABA 4AKGA 2L9QA 1BR4A 2NTXA 2Y48B 3HL6A 3K3OA 4CZZB 1G8XA 4IGUA 5JR9A 2IAKA 3ZYLA 3LBXB 1BR0A 2MBGA 1MIVA 2D5UA 2YEVC 3FBLA 3RPUA 3ZYKA 5L3FB 3PU3A 3KINB 2BVLA 5LGTB 3PUSA 3AAAB 2X9HA 4O8SA 2X9YA 2ZLYA 2JPFA 5JRCB 4ZI3C 2B1EA 2K48A 4OYKA 3LJCA 2CLYC 3UUXB 2XASB 5FXXA 2DI4A 3RKOA 4UXNB 1H7CA 3SWHA 3D0TA 1Z0PA 3AA6B 5LHHB 1FMVA 1HTJF 3K8PC 3GA8A 1MIWA 2V1DB 2ZM2A 2NW8A 2CCQA 3C98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFS A;  3CML A;  2WAU A;  3BQK A;  4NUV A;  4NUU A;  5F3J A;  2YK0 A;  3C64 A;  2XU0 A;  2Y8D A;  3BQI A;  3RRC A;  3BQL A;  3CPZ A; 
#chains in the Genus database with same CATH topology
 1M7K A;  2D2S A;  3RI5 A;  4B6X A;  4YHH T;  4YXD A;  3AVR A;  3ZMZ B;  2XQY A;  5JRC A;  1IBM T;  2V26 A;  4ILU A;  4YTN A;  1YXR A;  4AQG A;  3ETU A;  5LBM A;  3JC6 D;  4PK4 A;  4PJJ A;  2LSI A;  4YJ3 E;  1S35 A;  3FZL B;  2GK9 A;  4GK0 E;  3S4U A;  2KXP B;  2V5D A;  4ZOL E;  5F8P A;  1T7S A;  4ZI7 E;  4HFE A;  5HAX A;  1XNR T;  2LRK A;  2I0M A;  1MNE A;  2Q9Q B;  3EVY A;  3OVU A;  4IDP A;  4QHO A;  4UVA B;  4YLH A;  3RH3 A;  3TLW A;  4QXB B;  3UUB A;  1WRD A;  1UX4 A;  3LSV A;  4U31 A;  4DMV A;  5ABF B;  5JH7 E;  5LGN B;  5FP3 A;  2HH7 A;  3NRX A;  3PUZ F;  2XQ5 A;  3QC9 A;  4EZH A;  5L3C B;  3ZC1 A;  2CE7 A;  2V6Y B;  4P0A A;  3P50 A;  4APF B;  2ZM0 A;  3O1I A;  2WP9 A;  2D9D A;  3P4P A;  3QK6 A;  4JEU B;  3ZEF B;  1X9B A;  3SRZ A;  4F52 A;  2BBH A;  4JV5 T;  4AP2 B;  2HHH T;  2H3R A;  5LBQ B;  2MPK A;  3JAE A;  1KNP A;  3NVO A;  4KHZ F;  5HCM A;  4JI5 T;  4E7Z A;  2XAJ B;  4TWF A;  4EV6 A;  2BS2 A;  2W62 A;  1S94 A;  3RX6 A;  4U74 A;  2IDO B;  3CWZ B;  3AVS A;  1M62 A;  3PUR A;  3FXE B;  3E22 E;  3LK4 2;  4HFV A;  4DR2 T;  5FL1 A;  4LFB T;  4DMW A;  3ZT6 A;  1OED A;  2BS3 A;  3F2E A;  3Q9D A;  2BG9 B;  2MTQ A;  3L3P A;  3CPZ A;  2MOZ A;  5DQW A;  4DND A;  3MKD A;  1B7T A;  5LYJ E;  4LF7 T;  4NUU A;  4TWH A;  4TUY E;  5CB4 E;  1N34 T;  4JBW F;  1XDP A;  2B76 A;  1CUN A;  2V6X A;  2Y8D A;  3MXZ A;  4IL9 A;  4UV9 B;  3PJA J;  3O1J A;  2KWI B;  3DTO A;  4UEM A;  5BMV E;  4H9P C;  3PV0 F;  1LDK B;  4J2C A;  3RYF E;  1KFY A;  1U5P A;  1BR1 A;  2IML A;  2WMN A;  3RIF A;  3CX6 B;  3T8O A;  1QUU A;  5JDL A;  3TLV A;  5FNV E;  4QKN A;  4AKL A;  5J0Z A;  4DUZ T;  4H9Q C;  2YU1 A;  3N9N A;  2LM9 A;  4TNW A;  4NPP A;  1GQE A;  4U2Z A;  4WW0 A;  5L3G B;  3CK6 A;  3ZCJ A;  1WFD A;  2XTL A;  3CIR A;  1E7P A;  3VR8 A;  4NXM T;  3M3Z B;  3MJX A;  3ONJ A;  4IIJ E;  4X20 E;  3RKG A;  5LHG B;  4YY3 T;  2L3L A;  3JC6 C;  4UV8 B;  5EK3 A;  1HG5 A;  2CEA A;  2OA5 A;  4O2B E;  3RGL A;  4AXP A;  1MMA A;  2RP4 A;  4IE4 A;  5AQQ B;  2XAF B;  1NWM X;  1UK5 A;  1QSD A;  5LNK A;  2LSY A;  2Y6X A;  3RIU C;  4ZEY A;  1OED E;  4QXH B;  5EK2 A;  4I4T E;  4FJO A;  3KVB A;  2W66 A;  4F6R C;  1J5E T;  5HCJ A;  4LF6 T;  4TX5 A;  5LP6 E;  4LFC T;  4C90 A;  3PUV F;  4HFD A;  4QXC B;  4KX6 A;  3N5L A;  2KZ7 B;  5FKY A;  4N9F 3;  1XMO T;  2YDR A;  3B13 A;  1YKH B;  2LRL A;  3AA7 B;  3GN5 A;  4HWC A;  4O2A E;  2XU0 A;  2Q9Q C;  4IRE A;  5HEH A;  2E9X C;  2Q9Q D;  3AEB A;  3KDS E;  2A72 A;  4JI2 T;  3NZP A;  3Q5D A;  4ILB A;  5DJQ C;  3OTO T;  2VKO A;  5ETW A;  2X9W A;  3VR9 A;  3UQ7 A;  1IBL T;  2WZK A;  2J62 A;  1YD8 G;  2N9D A;  3N9Q A;  3CKD A;  3IEE A;  1HCI A;  4UEL A;  4YTM A;  3PDY A;  2WU5 A;  3RC8 A;  4DR1 T;  4CXX A;  4BAY B;  2WS3 A;  4DBR A;  4WBN E;  1CHU A;  3N9M A;  2JQ9 A;  1J1J A;  3N9O A;  2UXC T;  4XZC A;  4AKH A;  5H6Q B;  2X67 A;  2RPA A;  2XQA A;  3DJB A;  4KMC A;  2E9X D;  4LML A;  4IHJ E;  1KNR A;  2FJA A;  3KV9 A;  3ZYM A;  4JI8 T;  2F4V T;  4U3C A;  5HXS A;  3N9P A;  5KX5 E;  2UUA T;  1R8I A;  3I1A A;  1Z8U A;  2NOX A;  1OED C;  4Z8X A;  1VOM A;  4UR9 A;  5FVL A;  3CQC B;  4EZ4 A;  5LMU T;  4WZX A;  4AQF A;  2VK9 A;  2BG9 C;  2KND A;  3EDV A;  5AQN B;  4EAH A;  4TV9 E;  3FB2 A;  2AXD S;  1IZN B;  2UXN B;  2CBJ A;  2NP9 A;  2X68 A;  1E2A A;  2XUE A;  3ANW A;  3C50 A;  2QRX A;  2JRK A;  3GWH A;  1LKX A;  2K5B B;  3KVA A;  3AEF A;  3NRY A;  3AXJ A;  4NXN T;  2WZH A;  4PJL A;  4LF8 T;  2XQ7 A;  4QH1 A;  5AQP B;  1D1A A;  3CX8 B;  3U78 A;  3L8R A;  2E5V A;  2YOE A;  4MAL A;  3VU7 H;  3HKD E;  3I9Y A;  3LK3 B;  3MAC A;  4OHF A;  2X0H A;  3KV5 A;  3PU8 A;  3VHL A;  3ZMT B;  4CN4 A;  3ZCI A;  5BR8 T;  1LVF A;  2WZI A;  4HFB A;  3DQV C;  3MK7 C;  2LKG A;  2WAU A;  2WDR A;  5FY1 A;  2OLT A;  3FZF B;  4IE7 A;  2P9B A;  5AQO B;  2BZB A;  4A98 A;  2WSS V;  5A1L A;  4KHP T;  4JI7 T;  4WYV A;  1U6G A;  1SHZ C;  2I59 A;  1ZKE A;  2PFV A;  3AA0 B;  4TZ4 C;  1VCT A;  3UFG A;  4GYR A;  5HEO A;  1D0X A;  2N1G A;  2NTY A;  2WMO A;  2X66 A;  3BQL A;  3RC3 A;  2BDE A;  3FZH B;  4YJ2 E;  1BR2 A;  5J2T E;  4GKK T;  2QGS A;  4HFC A;  4PAG A;  2OV9 A;  4KP3 C;  4UIG A;  5LG4 A;  2WWV A;  3F31 A;  3KFW X;  5AQM B;  3ZT7 A;  3P8C D;  5FY7 A;  2JQK A;  3OKQ A;  3Q5E A;  5ABH A;  3C51 A;  3ESL A;  5AQU B;  3Q5X A;  1SUM B;  2A2F X;  3RF1 A;  1WLX A;  3J9X 1;  2IW5 B;  3X1D A;  3UU8 A;  2JMK A;  2BBJ A;  1SE7 A;  4HE8 A;  4LF4 T;  3IBP A;  2NW8 A;  1YQ3 A;  3KV6 A;  2NW7 A;  4YHJ A;  3TLU A;  4DR7 T;  2VWA A;  4AI6 A;  2XAG B;  4DUY T;  2X0L B;  2IC9 A;  2D0U A;  3SOL A;  4U33 A;  4ZI2 D;  5ABF A;  3TKL B;  4JI4 T;  1YW0 A;  4PJN A;  2LLY A;  2VKD A;  4MHC A;  3RYH E;  3HR0 A;  4PK5 A;  2BS4 A;  2CA5 A;  4HN9 A;  3ANW B;  2EHO B;  2J47 A;  2BKO A;  1MND A;  4PJM A;  3O4X E;  3VKG A;  3VRA A;  5DQV A;  2XQ6 A;  5JQG E;  2ODV A;  4X1Y E;  4JUY A;  3ABV A;  4PK6 A;  3UU6 A;  4ADZ A;  5JDN A;  4V1A v;  2A3D A;  4U7I A;  4PNI A;  5LXT E;  1ZP0 A;  2W63 A;  3IF8 B;  5AQV B;  2X51 A;  2VQE T;  4HXI B;  1Y64 B;  3H3A A;  2G0U A;  2JQQ A;  5FL0 A;  5KDM C;  3NZQ A;  4DV4 T;  3K3N A;  2C5K T;  4X65 T;  4XBF B;  4ZS3 A;  1SA0 E;  3BQI A;  3ZMV B;  5HWX A;  4LFA T;  2LOP A;  4H9S E;  4G63 A;  1MMN A;  4WNK A;  1LRZ A;  2VVN A;  3T1H T;  1N32 T;  4JGH D;  4A64 A;  4HWI B;  1L0V A;  1HNZ T;  3ZT5 A;  3VKH A;  3RRW A;  5M4Y A;  3AE9 A;  3LK2 B;  4IDO A;  4WQO D;  3R6N A;  5KXJ A;  4DV0 T;  4IL4 A;  2WM9 A;  3AAI A;  4CXY A;  4DV5 T;  2JMH A;  3RYI E;  4U72 A;  3A5X A;  1E1H B;  4UVB B;  4EOZ B;  5L2L A;  1UX5 A;  1W9R A;  5JTG A;  3C64 A;  2ES0 A;  2XHE B;  3C4X A;  3LG7 A;  3J7Y q;  4AIU A;  1FJG T;  2LT3 A;  2V7L A;  3UU5 A;  1WCR A;  2V7M A;  3PTR B;  4P1N A;  4BJM A;  1OWA A;  5J1G A;  4ZI3 D;  3RTR A;  1NEN A;  4EED A;  3AE2 A;  3N2O A;  5FXZ A;  2YK0 A;  1HFA A;  1DU2 A;  1T8B A;  2LHR A;  2K3W A;  2QA7 A;  5AQL B;  3E0Z A;  5L3D B;  4IE5 A;  5AQH B;  4EIW A;  2IHR 1;  2KT9 A;  4TWD A;  2NW9 A;  3HKC E;  1W0A A;  2VUR A;  5CA1 E;  4TV8 E;  4PW8 A;  4M1P A;  3C4Z A;  2D0T A;  1YQ4 A;  3MZK B;  1YKE B;  4IST A;  2C0S A;  4DO0 A;  1WR6 A;  2UU9 T;  4COF A;  5TAO A;  2H89 A;  3ZN0 B;  5ADX L;  2YDQ A;  3ZJ1 A;  3ZN1 B;  5AQI B;  2KWH A;  2YU2 A;  3P4W A;  3V5U A;  3H3M A;  2LM2 A;  2R6G F;  3QNU A;  3I0O A;  4X1I E;  4HFI A;  1HG2 A;  3MA9 A;  3LBX A;  2VAS A;  2E9X A;  4Q25 A;  3UU4 A;  5JDH A;  2HN1 A;  1IJ6 A;  3RLF F;  2NWB A;  4I50 E;  2WB5 A;  2ZMA A;  4ANJ A;  4XAX B;  2LE8 A;  5LOV E;  3QB5 A;  4H9R C;  5FMN A;  2PBI A;  4IDN A;  4CI3 B;  2N2N A;  3ONL C;  4JEH B;  1MMG A;  4I43 B;  3ZC0 A;  4B3S T;  4ISS A;  2VL0 A;  2V8S V;  4MFR A;  4NUV A;  4ZZB A;  5JDF A;  2VKH A;  4G2A A;  2H7O A;  2ODU A;  3WI3 A;  2XQ4 A;  2CXF A;  3ZPO A;  5CJ5 A;  3OPC A;  4DBQ A;  4GKJ T;  5L47 A;  4DR5 T;  3EI0 A;  3PUY F;  3LFM A;  1VCS A;  2XSB A;  2VKJ A;  4TN7 B;  2L8K A;  2V6Y A;  3N9L A;  3NBX X;  4IDZ A;  5FYM A;  3IA3 A;  1O3X A;  3L39 A;  2V7J A;  5FXV A;  3AEE A;  2KMF A;  4I55 E;  5IWA T;  2VB6 A;  1N36 T;  5AQT B;  4EB6 E;  4H63 H;  4O4L E;  5CGM A;  1KF6 A;  5ABE A;  3CVR A;  1T98 A;  3ETV A;  1LDK A;  3A8Y C;  2VVS A;  4UVC B;  3ZJ2 A;  3O9X A;  2LHN A;  4Z91 A;  3JAF A;  3B5M A;  3P4Q A;  2DWK A;  3T1Y T;  3EHZ A;  3AE6 A;  1OED B;  3AED A;  3ZMU B;  5AQR B;  3B57 A;  3AE8 A;  3RQW A;  4AKR B;  3AAE B;  1ZHC A;  2X0Y A;  2WQY A;  3EUH A;  4QH5 A;  3ZSS A;  4CQI A;  2K24 A;  3RYC E;  2W4X A;  3HI2 A;  5AQG B;  4HGA A;  3P4S A;  4DR4 T;  3UUM A;  5C3J A;  1D1B A;  4BA9 A;  2HPL A;  1OXZ A;  4BJN A;  2WCA A;  2Z6E A;  4OFZ A;  3H37 A;  2JIW A;  3M65 A;  4QX8 B;  4GOU A;  3KBU A;  4ILA A;  3UUN A;  3U3I A;  4Z90 A;  4EEB A;  3AE3 A;  3OYZ A;  3UFE A;  4P0B A;  4ZZC A;  2C5J A;  3GMI A;  5HXC A;  1FEW A;  3UUL A;  4DR6 T;  2UXD T;  1LVK A;  3AE7 A;  5L4H A;  3HA4 A;  2UUC T;  2BG9 E;  2LJL A;  2E2A A;  3FZM B;  2FUP A;  5C2T A;  1UUS A;  4GYS A;  4MBQ A;  4YFS A;  5LHI B;  2V5C A;  4HTE A;  3AB3 B;  4DVD A;  3EAB A;  3RRC A;  5HXE A;  4QWN B;  1UCU A;  2CMR A;  5JDQ A;  2UUB T;  4K0K T;  4HEA A;  4WBO A;  4HWF A;  3FHN A;  5FY0 A;  4IDQ A;  4O4J E;  3IHR A;  2M6B A;  3DP7 A;  3L09 A;  2XM1 A;  4ERR A;  2WWU A;  1FMW A;  4FI5 A;  1MMD A;  2RA1 A;  4OX9 T;  4JYA T;  3CQX C;  2W00 A;  3HKB E;  2DWG A;  4A56 A;  4YT0 A;  4CXW A;  5HXR A;  3PUG A;  3P7I A;  1HS7 A;  4L9I A;  2BKN A;  2CXL A;  2LSJ A;  5F5W A;  1HX1 B;  2E8I A;  3ONX A;  4KBM B;  4P09 A;  1ZOY A;  2DL1 A;  4ASK A;  1VRB A;  2CWY A;  5HEU A;  5L3B B;  2LSK A;  2Q9Q A;  5IUX A;  3G06 A;  5LCY A;  4JI0 T;  2QVA A;  5LA6 E;  3AE1 A;  3I9W A;  2W61 A;  3NKZ A;  2ZM6 T;  3N2G E;  5C8Y E;  4HKA A;  4O4H E;  1XZY A;  5IHY A;  4EYU A;  3V5S A;  2YN6 A;  4GIW A;  4NIQ A;  2VQF T;  3PUQ A;  4JLE A;  2CM0 A;  2M6I A;  2EHO C;  2IIU A;  4DV2 T;  5F3J A;  4DV3 T;  2FJD A;  1NAF A;  4CN1 A;  4EXT A;  2BKP A;  2QYW A;  4AKI A;  3R84 B;  4TNV A;  2J4G A;  5L3E B;  2LKH A;  4O4I E;  5AQF B;  5GON E;  3RIA A;  1HNW T;  2KIN B;  5HWY A;  4AQY T;  2IC6 A;  3K3Q C;  4F8H A;  4GK5 E;  1IJ5 A;  1D1C A;  1FIO A;  3CQG B;  3TLT A;  5JR9 B;  2KLQ A;  2H7V C;  3AEG A;  4OK0 A;  2ZM8 A;  2MAW A;  2ACX A;  2MYS A;  3AXJ B;  4L0R A;  4OYJ A;  4PFP A;  2I6H A;  2W2U A;  3WAK A;  4AQF C;  2LSG A;  2W67 A;  2X9X A;  3EDU A;  1J5W A;  2JJ9 A;  3QB5 K;  4K0U A;  2XZE A;  3SFD A;  3FBZ A;  1D0Z A;  3OBV E;  4IE0 A;  2CBI A;  3RHW A;  5EK4 A;  1HR0 T;  3BQK A;  1HX8 A;  3ZMS B;  1V9D A;  1JNZ A;  1KK7 A;  2NR4 A;  3PUW F;  5E0O A;  3OJA A;  1IBK T;  4EYY R;  4JI3 T;  2J1D G;  4QX7 B;  1I6Z A;  2XAH B;  4P5O A;  3KBT A;  4YSX A;  4UF0 A;  4LF9 T;  1EZ3 A;  2SPC A;  4CN6 A;  4IE6 A;  2IUB A;  2UXX B;  5LGU B;  3I0Q A;  4A5X A;  4LF5 T;  2LEH A;  3AA1 B;  4PFO A;  2WU2 A;  4H9O C;  3UU3 A;  4JI1 T;  1XNQ T;  1AJ3 A;  1T72 A;  4KI0 F;  4ZS2 A;  5CA0 E;  2DNX A;  2VL8 A;  2AE9 A;  1WYC A;  4U2Y A;  1US7 B;  2E9X B;  2HPJ A;  3N2K E;  1I94 T;  3E08 A;  1IAP A;  3GN5 B;  2C5I T;  3SFE A;  1QLB A;  2CHN A;  3PJA A;  4H9N C;  1ZV4 X;  4C91 A;  4YTP A;  4H63 V;  5LMN T;  3F57 A;  5J2U E;  3VRB A;  2WDQ A;  3W15 B;  3ZLI A;  2WBL A;  3RIU A;  3KV4 A;  1XWM A;  2PJQ A;  4YSZ A;  4B3M T;  3Q5W A;  5EZY E;  2V7I A;  3PE0 A;  2XAQ B;  3LDQ B;  2FBW A;  3AE4 A;  2DCF A;  2CPT A;  1G73 A;  3HKE E;  1XDO A;  3NWI A;  1KNZ A;  2YKS A;  2XQ8 A;  3CML A;  2PTF A;  3FXD B;  4KUM B;  4HWD A;  2EHO D;  2PG8 A;  2EHO A;  4X1K E;  2WY2 A;  3EAM A;  5FXW A;  3TLS A;  1LDJ A;  1MIY A;  2E5L T;  2DLR A;  5LJN A;  4A97 A;  1U4Q A;  2FJE A;  2K9A A;  2XPK A;  2YDS A;  3AEC A;  3UQ4 A;  5L4E A;  5JRE A;  4ILC A;  4X62 T;  4DV1 T;  3RQU A;  2M67 A;  4N78 D;  4LMJ A;  3QUJ A;  5HYA A;  4CI2 B;  5JDG A;  5JDM A;  4DV7 T;  2HN2 A;  1KEY A;  5HXH A;  2LOS A;  3CX7 B;  3ZST A;  3BK9 A;  5H6R B;  1D0Y A;  3FZK B;  3UTK A;  4ZI2 C;  1ZEE A;  1UUR A;  3O1H A;  2XM2 A;  5JR9 C;  4HWH A;  2CHO A;  2CLY B;  5AQJ B;  2DHR A;  1XMQ T;  5IYZ E;  3DPL C;  3A7M A;  4ZXL A;  2XQ3 A;  2CXD A;  3PUA A;  3JCF A;  2CWO A;  3OYX A;  4L5G A;  1HF8 A;  1WYB A;  3Q2M A;  2XJ7 A;  4DID B;  2A9U A;  4X66 T;  2H88 A;  4UF0 B;  1N33 T;  3C4W A;  5AFU L;  4ZHQ E;  5ABG A;  2W0G A;  2ACZ A;  2WDV A;  3AEA A;  5JVD E;  4CI1 B;  4E7S A;  1W09 A;  3SS1 A;  2XQ9 A;  2BVM A;  4MLK A;  4QH4 A;  3UT5 E;  3WAJ A;  4B3T T;  3PUX F;  5LB7 B;  2FJB A;  5HEJ A;  4U7Y A;  4I0U A;  5FVK A;  4HFH A;  3QOF A;  2YIN A;  3ZKR A;  4JI6 T;  2V7K A;  4LMK A;  5KMG P;  5DAB A;  5LG3 A;  1UGO A;  2L9Q A;  4AKG A;  1BR4 A;  5AQK B;  2NTX A;  2Y48 B;  4X5T A;  5CFB A;  3HL6 A;  3K3O A;  4CZZ B;  1G8X A;  4IGU A;  1Y01 A;  2IAK A;  5JR9 A;  3AE5 A;  3ZYL A;  2BG9 A;  3P4R A;  1JNR A;  3LBX B;  1BR0 A;  2MBG A;  1MIV A;  2D5U A;  2XY8 B;  2YEV C;  3FBL A;  3RPU A;  3ZYK A;  1W0B A;  3PU3 A;  5L3F B;  3KIN B;  3JAD A;  5LJM A;  4B3R T;  1WR0 A;  4IT4 A;  1HNX T;  2BVL A;  5LGT B;  3PUS A;  2UXB T;  2JQH A;  3AAA B;  2KSR A;  2X9H A;  4O8S A;  2X9Y A;  2ZLY A;  2CRB A;  2JPF A;  4X64 T;  5HEG A;  2B1E A;  2K48 A;  4ZI3 C;  5JRC B;  4OYK A;  3LJC A;  2CLY C;  3UUX B;  2XAS B;  3K1S A;  5FXX A;  2DI4 A;  3RKO A;  4UXN B;  4YSY A;  4DR3 T;  4DV6 T;  2XSA A;  1H7C A;  1NEK A;  5AQS B;  3SWH A;  3D0T A;  1Z0P A;  3AA6 B;  5LHH B;  1FMV A;  1HTJ F;  3K8P C;  3GA8 A;  1MIW A;  2V1D B;  4AIS A;  2ZM2 A;  4EGW A;  1X79 A;  2CCQ A;  3C98 B; 
#chains in the Genus database with same CATH homology
 2D2S A;  4B6X A;  3AVR A;  3ZMZ B;  2XQY A;  5JRC A;  2V26 A;  4ILU A;  4AQG A;  3ETU A;  5LBM A;  3JC6 D;  4PK4 A;  4PJJ A;  2LSI A;  4YJ3 E;  1S35 A;  3S4U A;  2GK9 A;  4GK0 E;  2KXP B;  4ZI7 E;  4ZOL E;  5F8P A;  5HAX A;  3EVY A;  1MNE A;  2Q9Q B;  4QHO A;  3RH3 A;  4UVA B;  4YLH A;  4DMV A;  4QXB B;  5JH7 E;  1WRD A;  1UX4 A;  5FP3 A;  2HH7 A;  3NRX A;  3QC9 A;  5L3C B;  4EZH A;  3ZC1 A;  2CE7 A;  4P0A A;  2ZM0 A;  3O1I A;  3QK6 A;  4JEU B;  3ZEF B;  3SRZ A;  2H3R A;  5LBQ B;  4E7Z A;  2XAJ B;  3RX6 A;  2W62 A;  1S94 A;  4U74 A;  3CWZ B;  3PUR A;  3AVS A;  3FXE B;  3E22 E;  3LK4 2;  4HFV A;  4DMW A;  3F2E A;  3Q9D A;  2MTQ A;  3L3P A;  3CPZ A;  2MOZ A;  5DQW A;  4DND A;  3MKD A;  1B7T A;  4NUU A;  4TUY E;  5CB4 E;  5LGN B;  4UV9 B;  1CUN A;  2Y8D A;  3MXZ A;  3O1J A;  2KWI B;  3DTO A;  4UEM A;  5BMV E;  4H9P C;  4J2C A;  3RYF E;  1U5P A;  1BR1 A;  2WMN A;  3CX6 B;  3T8O A;  1QUU A;  5JDL A;  5FNV E;  4QKN A;  4AKL A;  4H9Q C;  2YU1 A;  3N9N A;  2LM9 A;  4WW0 A;  5L3G B;  3ZCJ A;  2XTL A;  3MJX A;  4IIJ E;  5LHG B;  4X20 E;  2L3L A;  3JC6 C;  4UV8 B;  5EK3 A;  1HG5 A;  2CEA A;  2OA5 A;  4O2B E;  4AXP A;  1MMA A;  2RP4 A;  4IE4 A;  2XAF B;  1NWM X;  1QSD A;  5LNK A;  2LSY A;  2Y6X A;  4QXH B;  5EK2 A;  4I4T E;  4FJO A;  3KVB A;  4F6R C;  4TX5 A;  5LP6 E;  4C90 A;  4QXC B;  3N5L A;  2KZ7 B;  2XU0 A;  3B13 A;  1YKH B;  3AA7 B;  3GN5 A;  4O2A E;  2Q9Q C;  2E9X C;  2Q9Q D;  3KDS E;  2A72 A;  3NZP A;  5DJQ C;  2VKO A;  5ETW A;  2X9W A;  3N9Q A;  1YD8 G;  2N9D A;  4UEL A;  3CKD A;  3IEE A;  1HCI A;  3UUL A;  3RC8 A;  3PDY A;  4CXX A;  4BAY B;  4DBR A;  4WBN E;  3N9M A;  3N9O A;  4AKH A;  4XZC A;  5H6Q B;  2X67 A;  3DJB A;  4KMC A;  3ZYM A;  2E9X D;  4IHJ E;  3KV9 A;  5HXS A;  3N9P A;  5KX5 E;  2NOX A;  4Z8X A;  1VOM A;  4EZ4 A;  3CQC B;  4AQF A;  2VK9 A;  2KND A;  3EDV A;  4EAH A;  4TV9 E;  3FB2 A;  1IZN B;  2UXN B;  2X68 A;  3C50 A;  2NP9 A;  2XUE A;  3ANW A;  3I1A A;  3KVA A;  5ADX L;  2JRK A;  3GWH A;  1LKX A;  2K5B B;  3NRY A;  4PJL A;  1D1A A;  3CX8 B;  3U78 A;  5LJM A;  4MAL A;  3VU7 H;  3HKD E;  3I9Y A;  3LK3 B;  3MAC A;  4OHF A;  3VHL A;  3KV5 A;  3PU8 A;  3ZMT B;  3ZCI A;  1LVF A;  3MK7 C;  2WAU A;  5FY1 A;  4IE7 A;  2P9B A;  2BZB A;  2WSS V;  5A1L A;  1SHZ C;  2I59 A;  1ZKE A;  2PFV A;  3AA0 B;  4TZ4 C;  4GYR A;  1D0X A;  2N1G A;  2NTY A;  2WMO A;  2X66 A;  3BQL A;  3RC3 A;  2BDE A;  4YJ2 E;  5J2T E;  1BR2 A;  2QGS A;  4PAG A;  4UIG A;  4KP3 C;  5LYJ E;  5LG4 A;  3F31 A;  3KFW X;  3P8C D;  5FY7 A;  3OKQ A;  3C51 A;  3ESL A;  3Q5X A;  2A2F X;  1WLX A;  3J9X 1;  2IW5 B;  2JMK A;  4HE8 A;  3IBP A;  4YHJ A;  3KV6 A;  2NW7 A;  2VWA A;  4AI6 A;  2XAG B;  2X0L B;  2IC9 A;  2D0U A;  3SOL A;  4ZI2 D;  3TKL B;  1YW0 A;  4PJN A;  2VKD A;  4MHC A;  3RYH E;  3HR0 A;  4PK5 A;  2CA5 A;  4HN9 A;  3ANW B;  2EHO B;  1MND A;  4PJM A;  3O4X E;  3VKG A;  5DQV A;  5JQG E;  2ODV A;  4X1Y E;  4JUY A;  4PK6 A;  4ADZ A;  5JDN A;  4V1A v;  2A3D A;  5LXT E;  4PNI A;  2W63 A;  3IF8 B;  2X51 A;  1Y64 B;  3H3A A;  2G0U A;  2JQQ A;  5KDM C;  3NZQ A;  3K3N A;  2C5K T;  4XBF B;  4ZS3 A;  1SA0 E;  3BQI A;  3ZMV B;  5HWX A;  2LOP A;  4H9S E;  4G63 A;  1MMN A;  4WNK A;  1LRZ A;  3VKH A;  3RRW A;  5M4Y A;  3LK2 B;  3R6N A;  2WM9 A;  3AAI A;  4CXY A;  2JMH A;  3RYI E;  4U72 A;  3A5X A;  1E1H B;  4UVB B;  4EOZ B;  5L2L A;  1UX5 A;  3C64 A;  2ES0 A;  2XHE B;  3C4X A;  3LG7 A;  3J7Y q;  2LT3 A;  2V7L A;  2V7M A;  3PTR B;  4BJM A;  4ZI3 D;  1OWA A;  5J1G A;  3N2O A;  5FXZ A;  2YK0 A;  1HFA A;  2LHR A;  2QA7 A;  3E0Z A;  5L3D B;  4IE5 A;  4EIW A;  2KT9 A;  2NW9 A;  3HKC E;  5CA1 E;  4TV8 E;  4PW8 A;  4M1P A;  3C4Z A;  2D0T A;  3MZK B;  1YKE B;  4IST A;  2C0S A;  4DO0 A;  1WR6 A;  5TAO A;  3ZN0 B;  3ZJ1 A;  3ZN1 B;  2KWH A;  2YU2 A;  3V5U A;  3I0O A;  4X1I E;  1HG2 A;  3MA9 A;  3LBX A;  2VAS A;  2E9X A;  5JDH A;  1IJ6 A;  2NWB A;  4I50 E;  2ZMA A;  4ANJ A;  4XAX B;  2LE8 A;  5LOV E;  4H9R C;  5FMN A;  2PBI A;  4CI3 B;  2N2N A;  4JEH B;  1MMG A;  4I43 B;  3ZC0 A;  4ISS A;  4MFR A;  4NUV A;  5JDF A;  2VKH A;  4G2A A;  2H7O A;  2ODU A;  3WI3 A;  3ZPO A;  2CXF A;  4DBQ A;  3LFM A;  2VKJ A;  4TN7 B;  2L8K A;  3N9L A;  3NBX X;  4IDZ A;  5FYM A;  1O3X A;  5FXV A;  2V7J A;  1X79 A;  2KMF A;  4I55 E;  2VB6 A;  4EB6 E;  4H63 H;  4O4L E;  3CVR A;  1T98 A;  3ETV A;  3ZJ2 A;  4UVC B;  3O9X A;  2LHN A;  2DWK A;  3ZMU B;  3B57 A;  4AKR B;  3AAE B;  1ZHC A;  3EUH A;  4CQI A;  2K24 A;  3RYC E;  3HI2 A;  4HGA A;  3UUM A;  1D1B A;  4BA9 A;  2HPL A;  1OXZ A;  4BJN A;  2Z6E A;  4OFZ A;  3H37 A;  3M65 A;  4QX8 B;  4GOU A;  3KBU A;  3UUN A;  3U3I A;  3OYZ A;  3UFE A;  4P0B A;  2C5J A;  3GMI A;  5HXC A;  1FEW A;  1LVK A;  3HA4 A;  2LJL A;  4GYS A;  4MBQ A;  4HTE A;  3AB3 B;  4DVD A;  3RRC A;  5HXE A;  4QWN B;  1UCU A;  2CMR A;  5JDQ A;  4HEA A;  4WBO A;  3FHN A;  5FY0 A;  4O4J E;  3IHR A;  3DP7 A;  3L09 A;  4ERR A;  2WWU A;  1FMW A;  4FI5 A;  1MMD A;  2RA1 A;  3CQX C;  2W00 A;  3HKB E;  2DWG A;  4A56 A;  4CXW A;  5HXR A;  3PUG A;  3P7I A;  1HS7 A;  4L9I A;  2CXL A;  2LSJ A;  2E8I A;  3ONX A;  4ASK A;  4KBM B;  4P09 A;  1VRB A;  2CWY A;  5L3B B;  2LSK A;  2Q9Q A;  5LCY A;  5LA6 E;  3I9W A;  2W61 A;  3N2G E;  5C8Y E;  4HKA A;  4O4H E;  5IHY A;  4EYU A;  3V5S A;  4GIW A;  3PUQ A;  4JLE A;  2CM0 A;  2EHO C;  5F3J A;  1NAF A;  4AKI A;  4EXT A;  3R84 B;  5L3E B;  4O4I E;  5GON E;  2KIN B;  5HWY A;  2IC6 A;  3K3Q C;  4GK5 E;  1IJ5 A;  1D1C A;  1FIO A;  3CQG B;  5JR9 B;  2KLQ A;  2H7V C;  4OK0 A;  2ZM8 A;  4L0R A;  2ACX A;  2MYS A;  4OYJ A;  4PFP A;  4YFS A;  3WAK A;  4AQF C;  1AJ3 A;  2LSG A;  2X9X A;  3EDU A;  2JJ9 A;  4K0U A;  3FBZ A;  1D0Z A;  3OBV E;  4IE0 A;  5EK4 A;  3BQK A;  1HX8 A;  3ZMS B;  1V9D A;  1KK7 A;  5E0O A;  3OJA A;  4EYY R;  2J1D G;  4QX7 B;  2XAH B;  3KBT A;  4UF0 A;  1EZ3 A;  2SPC A;  4IE6 A;  2UXX B;  5LGU B;  3I0Q A;  2LEH A;  3AA1 B;  4PFO A;  4H9O C;  4ZS2 A;  5CA0 E;  2DNX A;  2VL8 A;  1WYC A;  1US7 B;  2E9X B;  2HPJ A;  3N2K E;  3E08 A;  1IAP A;  3GN5 B;  2C5I T;  4H9N C;  1ZV4 X;  4C91 A;  4H63 V;  3F57 A;  5J2U E;  3W15 B;  3ZLI A;  2WBL A;  3KV4 A;  2PJQ A;  3Q5W A;  5EZY E;  2V7I A;  3PE0 A;  2XAQ B;  2DCF A;  3HKE E;  1G73 A;  1KNZ A;  3CML A;  3FXD B;  4KUM B;  4X1K E;  5LHI B;  2EHO D;  2PG8 A;  2EHO A;  5FXW A;  1MIY A;  2DLR A;  5LJN A;  1U4Q A;  5JRE A;  2K9A A;  2M67 A;  4N78 D;  3QUJ A;  5HYA A;  4CI2 B;  5JDG A;  5JDM A;  5HXH A;  2LOS A;  3CX7 B;  3BK9 A;  5H6R B;  1D0Y A;  3UTK A;  4ZI2 C;  1ZEE A;  3O1H A;  5JR9 C;  2CLY B;  2DHR A;  5IYZ E;  2CXD A;  3PUA A;  3OYX A;  2CWO A;  4L5G A;  1HF8 A;  1WYB A;  3Q2M A;  4UF0 B;  3C4W A;  5AFU L;  4ZHQ E;  2W0G A;  5JVD E;  4CI1 B;  4E7S A;  3SS1 A;  4MLK A;  2BVM A;  3UT5 E;  3WAJ A;  2YIN A;  2V7K A;  5KMG P;  5DAB A;  4AKG A;  2L9Q A;  1BR4 A;  2NTX A;  2Y48 B;  3HL6 A;  3K3O A;  4CZZ B;  1G8X A;  4IGU A;  5JR9 A;  2IAK A;  3ZYL A;  3LBX B;  1BR0 A;  2MBG A;  1MIV A;  2D5U A;  2YEV C;  3FBL A;  3RPU A;  3ZYK A;  5L3F B;  3PU3 A;  3KIN B;  2BVL A;  5LGT B;  3PUS A;  3AAA B;  2X9H A;  4O8S A;  2X9Y A;  2ZLY A;  2JPF A;  5JRC B;  4ZI3 C;  2B1E A;  2K48 A;  4OYK A;  3LJC A;  2CLY C;  3UUX B;  2XAS B;  5FXX A;  2DI4 A;  3RKO A;  4UXN B;  1H7C A;  3SWH A;  3D0T A;  1Z0P A;  3AA6 B;  5LHH B;  1FMV A;  1HTJ F;  3K8P C;  3GA8 A;  1MIW A;  2V1D B;  2ZM2 A;  2NW8 A;  2CCQ A;  3C98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...