3BQIA

Structure of a chondroitin sulphate binding dbl3x from a var2csa encoded pfemp1 protein
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
360
structure length
328
Chain Sequence
b'SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 115
structure length 328
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqiA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqiA02
4YFSA 3BQKA 3C64A 5F3JA 3RRCA 3BQLA 3CPZA 4NUVA 2Y8DA 4NUUA 2WAUA 2XU0A 3CMLA 2YK0A 3BQIA
chains in the Genus database with same CATH superfamily
4PAGA 4EIWA 1VCSA 5LJMA 1HNZT 4O2AE 3SFDA 3N9OA 4CXWA 4DUYT 5L4HA 5DABA 1M7KA 2CLYC 1O3XA 3C4WA 2KZ7B 3ZMSB 2XAHB 2RPAA 4DR1T 4JEHB 3ONLC 3KV4A 1YW0A 4NUUA 2D9DA 4BJNA 1MNDA 2CMRA 4I50E 2IAKA 2R6GF 4AQFA 2W67A 5HXEA 3QNUA 2HPJA 3ESLA 2WDQA 4HFDA 3CKDA 5JDFA 3DQVC 1BR4A 3C98B 2LRKA 5AQKB 4QXHB 4L9IA 4ISTA 3SWHA 3CIRA 2XQYA 2X9WA 1FEWA 5JR9B 2NW8A 3AEGA 2QRXA 5JTGA 4BA9A 1I94T 2XQAA 1W0BA 4EYYR 3S4UA 5LGTB 2CM0A 5HEHA 2M6IA 1T8BA 3O9XA 2QYWA 4HN9A 3C4XA 1EZ3A 2L9QA 3L39A 4TZ4C 3FBZA 4GKJT 3EAMA 1XDPA 2IC9A 3A8YC 3RYHE 4JI1T 2LE8A 5DJQC 3AA0B 2YU1A 5CA1E 5LGNB 4X1IE 5HEOA 2YINA 2Z6EA 3T1HT 3RIUA 4DMWA 2BG9C 2UXXB 1SE7A 3HR0A 3AEAA 2X9YA 2G0UA 4HFVA 3RYIE 3NBXX 1OEDE 1ZEEA 4YY3T 1V9DA 3RQUA 2LSGA 2JRKA 5IHYA 3SFEA 2MOZA 3UU8A 4ANJA 1XMQT 4UELA 3GA8A 4WBOA 3O1JA 4CI1B 3BQIA 2A2FX 2Y48B 4QXBB 2WQYA 2XAFB 2WMNA 2D5UA 4MBQA 4E7ZA 4PK6A 3RHWA 4EZHA 5LJNA 5TAOA 3HA4A 3M3ZB 1B7TA 3TLSA 1VCTA 4O4HE 2PJQA 3ZMZB 3PV0F 4C90A 2CCQA 2NW9A 3ZMTB 3ANWA 4ZI3D 1W0AA 3NRYA 1HR0T 5FVKA 2ODVA 3I9YA 2LSKA 4BAYB 4WYVA 4H63V 4A64A 2X0HA 5HEGA 3KV5A 3DTOA 2LKGA 4B3MT 4OK0A 3P4PA 1FMWA 4YTPA 5ETWA 4AI6A 4JV5T 2WZKA 1WLXA 4PFOA 4B3RT 2C5JA 4UEMA 2WZIA 4HWIB 5CFBA 1XNQT 3ONXA 3P4WA 2J1DG 5LG4A 4YJ2E 2YN6A 4B6XA 5L3EB 3G06A 1Z8UA 2WB5A 4V1Av 3ANWB 2VKDA 3SOLA 2VVSA 3PTRB 4H9OC 1N32T 4ZI3C 3K3QC 3FBLA 1WR0A 2JJ9A 2N9DA 4CI3B 2XUEA 4WQOD 4AP2B 1R8IA 2X9HA 3EDUA 2BG9A 5JREA 4QWNB 2C5KT 3ZPOA 2ZM0A 5ABFA 2E9XD 3A7MA 3OJAA 5LBQB 3PJAA 4DR6T 4AKHA 2XJ7A 4U7YA 3AXJA 4JI7T 1KEYA 1J5ET 1E7PA 4HTEA 2ZM8A 2XHEB 2XSBA 1GQEA 3TLWA 3EI0A 3JADA 4DV5T 3UULA 4YFSA 2D0TA 5AQNB 4IIJE 4L0RA 2LHRA 4UV8B 2DL1A 2I6HA 4PJMA 1NWMX 5LMNT 1OEDC 2UXNB 3PU3A 2BG9B 3HI2A 2CWYA 2FUPA 5AQGB 4DV3T 4U33A 4B3TT 2E8IA 2XQ9A 5AQPB 4HFHA 3LJCA 1UURA 2MPKA 5J2TE 2E9XC 4DV2T 2WWVA 2N2NA 2FJDA 3PUSA 3BK9A 3AXJB 4F52A 1SA0E 1MMNA 2A72A 4KI0F 2WU2A 5FNVE 2V26A 3FZFB 4UVCB 3AA6B 4CZZB 3N5LA 4X5TA 2WDVA 4DV6T 4KX6A 4QKNA 2V1DB 5CGMA 2H7VC 2X0LB 2XTLA 4ZZCA 4DVDA 4U2YA 2ZM2A 4CN6A 3AE4A 4K0UA 3CQGB 3H3MA 4X1YE 1IZNB 3WAJA 2AE9A 2XSAA 3ABVA 4JYAT 2PTFA 2OV9A 3FZHB 4PJJA 3RKGA 3DPLC 4TV9E 1HFAA 5FMNA 2KWHA 2M67A 1MMDA 3Q5XA 4TWDA 4MLKA 5FP3A 2CHOA 3ZLIA 4ZOLE 5LHIB 2ZMAA 2LM2A 3RGLA 2FJAA 1WRDA 4PNIA 4HFEA 4QH1A 4ERRA 4UXNB 4O4JE 4U7IA 3ONJA 5AQSB 3IEEA 4DUZT 4IDPA 3RQWA 3L09A 4CXYA 4ADZA 4ILBA 3RF1A 3QUJA 4Z91A 3EDVA 1LRZA 4IL9A 3BQLA 2W4XA 5HCJA 3UUNA 4AQFC 3KVAA 1OEDA 4QX8B 3VKHA 1N34T 1MMGA 3RX6A 2WBLA 2BBJA 4JI0T 3GMIA 5KX5E 3Q5WA 4X66T 4IE6A 5AQLB 2KLQA 4AKGA 1JNZA 2LHNA 2LSJA 4NXMT 3RIAA 2CA5A 1BR2A 4ILAA 3LK3B 3RRWA 3ZN0B 4GOUA 5AQJB 1HTJF 4O8SA 3MJXA 3RPUA 2BVLA 1D1BA 3NKZA 4AQYT 4IGUA 4U2ZA 2ODUA 3R84B 2V8SV 2MYSA 2HN2A 3KFWX 3N2KE 1D0XA 3PUWF 3P4RA 4YTMA 2VQET 1OEDB 1W09A 4PJLA 4LF8T 3LK42 2CRBA 4CXXA 4YTNA 1HF8A 4H9NC 4JI4T 4YJ3E 1JNRA 1FJGT 3VKGA 3J9X1 3EHZA 2E9XB 1UK5A 1MMAA 1M62A 3PURA 3PUQA 4IREA 5HCMA 3UT5E 3VRBA 5FY7A 4P5OA 4TNWA 5L3FB 4N78D 2XPKA 3N9QA 4JLEA 4MHCA 5HEJA 3CX7B 5AQRB 2KXPB 4AISA 3AEFA 1CUNA 3PUAA 1S94A 5A1LA 4GYRA 1BR0A 2OLTA 4IT4A 3RI5A 1Y64B 2XASB 4LFCT 1ZP0A 2IDOB 2DWKA 2NOXA 4I43B 5HWXA 2W2UA 3MACA 2ZM6T 4LMKA 5IYZE 2KNDA 2XQ6A 1KK7A 4OYKA 5EK4A 4JEUB 3MZKB 4MFRA 2W0GA 1Y01A 5FYMA 4HFIA 5L3GB 2BBHA 4U31A 4WW0A 3UQ4A 2BKPA 4N9F3 2VL0A 3P4QA 2WZHA 3AAIA 4PK4A 3IBPA 3ZT7A 2V5CA 3AE3A 2Y8DA 3DP7A 3ZCJA 5HEUA 4DR4T 5JH7E 4X64T 4YSYA 5H6RB 5HWYA 4EAHA 2YDRA 5LMUT 1QUUA 3NZPA 4EYUA 3CMLA 2HN1A 5LOVE 4LF6T 2JIWA 2CEAA 3AE9A 2UXDT 4YHHT 1J1JA 3HL6A 5FXVA 1MIYA 2VKJA 2OA5A 4WNKA 2JMHA 3AECA 2V6YA 2IW5B 1UX4A 2W00A 2XZEA 3MKDA 4M1PA 4KBMB 2C0SA 2YKSA 3SRZA 4QH5A 3AE7A 3CQXC 4P0AA 1HX8A 5ABHA 3MK7C 3I1AA 3CK6A 2ACXA 3ZYLA 2XM1A 4EOZB 3LFMA 1BR1A 4A5XA 2CE7A 4AIUA 3NRXA 4CI2B 2LEHA 1WYBA 4APFB 3AAEB 1T98A 2BVMA 2Y6XA 5BMVE 4JI3T 2DCFA 2X0YA 1T72A 4IHJE 4YSXA 5JDHA 2XQ5A 2V7LA 2I59A 4IE4A 3NWIA 2WS3A 2K24A 4IDQA 3JC6D 2V6YB 1G73A 2VK9A 3PUZF 3AEEA 3X1DA 3ZJ2A 3UFEA 4EGWA 4AQGA 2CHNA 3AVRA 3FXDB 3OYXA 3KV6A 1J5WA 2W66A 2VKOA 4NPPA 3C4ZA 4JI5T 5JRCA 2PFVA 2QVAA 4TV8E 4QX7B 1UCUA 1LVFA 3VR8A 4NXNT 4DNDA 2XQ3A 3ZN1B 4IDNA 4COFA 3PJAJ 1XNRT 2XQ4A 5AQOB 4DV0T 3UUXB 3PDYA 5LNKA 4H9PC 5EK3A 4WBNE 2W63A 4LFBT 3FXEB 3Q2MA 2IIUA 2E5LT 4HWHA 4DBQA 3KVBA 4A97A 4YXDA 4UF0A 3JC6C 1MNEA 3VHLA 4DBRA 4IE5A 5CB4E 3L8RA 3K8PC 5C2TA 5LBMA 2BS4A 5KXJA 2NP9A 1MIWA 5LCYA 4U74A 5LA6E 5JRCB 1YKEB 1WCRA 2XQ8A 3ZMUB 5L4EA 1OWAA 1SUMB 2DWGA 3KINB 5F3JA 2LJLA 2LLYA 3H3AA 4NIQA 3ZT5A 4NUVA 4HFBA 2NR4A 3OTOT 4TX5A 5C8YE 2WDRA 4X20E 5KDMC 4L5GA 4YSZA 5ABFB 1ZOYA 2DLRA 2V6XA 2J4GA 5L3CB 2VVNA 4UIGA 4LF9T 1CHUA 3AE8A 3FZMB 4X1KE 2HPLA 4UF0B 4XAXB 4XZCA 3AVSA 4X62T 4HEAA 1HX1B 3C64A 5LB7B 3VRAA 1XWMA 2V7KA 5J2UE 2V7IA 1T7SA 2L8KA 1U5PA 1WFDA 5FVLA 1W9RA 1YQ4A 4DR7T 4ZHQE 3HKEE 4G2AA 5AQTB 3FZLB 2FJBA 3RH3A 1X79A 2I0MA 1KNRA 1N36T 5AQFB 3D0TA 2ACZA 3RYFE 2YK0A 3ZC0A 4AKLA 4ZS2A 4GK5E 2LSYA 3A5XA 2DHRA 1LVKA 1I6ZA 4KP3C 2VURA 3GN5A 5L3BB 3UQ7A 2MTQA 3ETUA 2IMLA 5AQHB 3MA9A 5IWAT 2SPCA 3ZKRA 2BKNA 2VL8A 2WMOA 3ZJ1A 5LYJE 2IUBA 3P8CD 3F57A 5FXZA 4DIDB 4BJMA 3UU4A 2BZBA 4IDZA 3NVOA 2JQHA 3RYCE 3SS1A 3GWHA 3L3PA 4DV7T 2LOPA 3U3IA 4ILUA 4K0KT 3ETVA 2IC6A 3I0OA 3UU3A 1QSDA 3CX8B 3QB5A 4JUYA 4H9RC 4AXPA 3K1SA 5F8PA 5LG3A 3O1HA 5LHGB 4YT0A 3BQKA 3LK2B 4MALA 3GN5B 3AA7B 3OKQA 4AKIA 2YDSA 1YKHB 2A3DA 2XM2A 4J2CA 1FMVA 1IBMT 2VQFT 4IDOA 4KHPT 2JQ9A 3TLVA 2YU2A 2WWUA 4EEDA 5EZYE 4ZI7E 3C51A 4F8HA 3VU7H 5FL1A 1U6GA 3KV9A 2BS3A 3ZSSA 5AQVB 4E7SA 3E0ZA 3OYZA 4ISSA 2LSIA 4TWFA 3F31A 2X66A 2D0UA 4YLHA 4H9SE 5JDGA 1HS7A 2DI4A 2CWOA 2WU5A 2P9BA 1US7B 2MAWA 2JMKA 4HWFA 5IUXA 2EHOD 3R6NA 2WP9A 4UR9A 1D1AA 4GYSA 3I0QA 4IE7A 1HNXT 4DMVA 3EABA 2KWIB 4PJNA 3IA3A 2FBWA 2XAQB 4EZ4A 3VR9A 4JBWF 3UUBA 2VASA 5AQMB 4X65T 3LBXA 4AKRB 3ZMVB 2LKHA 5CA0E 5JR9A 2CXDA 2RP4A 3CVRA 3JAFA 1XZYA 1HNWT 2XAGB 4DV4T 2UXBT 3ZEFB 1HG2A 1FIOA 4LF4T 1G8XA 2HHHT 2BS2A 5J1GA 3U78A 3PUGA 3FHNA 4WZXA 3N2OA 4B3ST 3ZYMA 1KF6A 3AE1A 5FY0A 4EEBA 2IHR1 4JI2T 4GKKT 5AQQB 2EHOC 3KBTA 3RTRA 3WI3A 5FXXA 4LMLA 1AJ3A 2HH7A 5LHHB 4JI6T 5M4YA 1ZKEA 2JQQA 4EV6A 1YXRA 2K3WA 2X67A 3PU8A 2Q9QD 3LBXB 4LFAT 3O4XE 3AE2A 2NTYA 3OPCA 4ILCA 1UGOA 4HKAA 4CQIA 2KMFA 4JGHD 4HWDA 1X9BA 2CBIA 3O1IA 2H89A 4PFPA 2WCAA 4ASKA 3B57A 2UUCT 3QC9A 3W15B 3N9PA 5DQWA 4UVBB 2F4VT 3KDSE 2X9XA 2W61A 4DR5T 1OXZA 1VRBA 2A9UA 5JQGE 5BR8T 3RLFF 4TNVA 3LDQB 1LKXA 4EXTA 5L3DB 5FY1A 4P0BA 4Q25A 3B13A 2XU0A 2NW7A 2CXFA 1IBLT 3K3OA 2Q9QC 2H3RA 3UU5A 1UX5A 1D0YA 2NTXA 5FL0A 5HXRA 3UFGA 3F2EA 3V5UA 3M65A 3P50A 2WY2A 5EK2A 2ES0A 4O4LE 1WYCA 3AE6A 2C5IT 2JQKA 3AAAB 3ZT6A 1MIVA 4O4IE 3NZQA 4A98A 4C91A 1Z0PA 4GIWA 3N9LA 2WSSV 5JDNA 2CXLA 3N9MA 4ZI2D 3N2GE 2E2AA 5GONE 5LGUB 1DU2A 4LF5T 2EHOA 1NAFA 3C50A 3CQCB 3P7IA 5HXHA 2YEVC 3T8OA 4ZXLA 3JCFA 4ZEYA 3Q5DA 4ZZBA 5AQIB 4JI8T 5ADXL 3P4SA 3UU6A 3JAEA 3LG7A 4FJOA 1IAPA 3J7Yq 2CLYB 1KFYA 3CPZA 1E1HB 2KSRA 4DR3T 5JDQA 5LXTE 4HE8A 1IJ5A 2VKHA 5JDLA 1N33T 5E0OA 2VB6A 5H6QB 1H7CA 3ZYKA 2ZLYA 3MXZA 1QLBA 2NWBA 4PK5A 4TUYE 4KUMB 4F6RC 3CWZB 4G63A 2BKOA 2QGSA 5AFUL 4ZI2C 3B5MA 4HWCA 2EHOB 5C3JA 2H88A 4IL4A 2PBIA 2K5BB 3AEDA 5ABEA 1HG5A 4EB6E 2PG8A 4CN4A 3H37A 3I9WA 1XMOT 3QK6A 4CN1A 2Q9QA 2B1EA 2AXDS 2V7JA 1IBKT 3AEBA 4PW8A 1IJ6A 4O2BE 5L47A 3CX6B 5L2LA 4H63H 3AB3B 1L0VA 3TLTA 5J0ZA 4U72A 3RKOA 3DJBA 2KT9A 2DNXA 4UV9B 3UTKA 5HYAA 3OVUA 4UVAB 5FKYA 1HCIA 5JVDE 1U4QA 1KNZA 2B76A 2K9AA 4DV1T 2UU9T 1NEKA 3RIFA 3ZSTA 3IHRA 4QXCB 2M6BA 3WAKA 1ZV4X 2Q9QB 3Q5EA 4TWHA 2K48A 2X68A 3QB5K 2KINB 2H7OA 4KHZF 2X51A 4OYJA 4OFZA 3PUVF 3RRCA 2XQ7A 4HXIB 3RC3A 4DR2T 1YQ3A 4TN7B 2BDEA 4XBFB 3AA1B 2UUBT 4A56A 3ZC1A 5JDMA 4ZS3A 1LDKA 2W62A 1D1CA 1WR6A 4I0UA 1D0ZA 5KMGP 2XAJB 2D2SA 4GK0E 4DO0A 2MBGA 4QHOA 2V5DA 1XDOA 1E2AA 4IE0A 2JPFA 3PUYF 5JR9C 3AE5A 1YD8G 4OHFA 3UUMA 3E08A 2J62A 5HAXA 2QA7A 4P09A 4H9QC 4Z90A 1S35A 3LSVA 4P1NA 3IF8B 3FB2A 4YHJA 1VOMA 2FJEA 5F5WA 3T1YT 1UUSA 2YOEA 1SHZC 1LDKB 2GK9A 2LM9A 2LT3A 3N9NA 2UXCT 2CBJA 5DQVA 3HKCE 2WM9A 5CJ5A 2LRLA 4HGAA 1LDJA 2WAUA 2LOSA 1ZHCA 4LMJA 4Z8XA 2YDQA 2E9XA 2UUAT 1NENA 3QOFA 1KNPA 4LF7T 3TKLB 3V5SA 2BG9E 2CPTA 4QH4A 5LP6E 3K3NA 3PUXF 3RC8A 2VWAA 2V7MA 4KMCA 5AQUB 3EUHA 3E22E 5FXWA 3KBUA 4HFCA 5HXCA 2XY8B 3HKBE 2N1GA 3Q9DA 3HKDE 2L3LA 2E5VA 3OBVE 4U3CA 4I4TE 2J47A 3FZKB 4OX9T 2RA1A 3TLUA 5ABGA 3ZCIA 5HXSA 4FI5A 3RIUC 3EVYA 4I55E 3PE0A
chains in the Genus database with same CATH topology
2M67A 1LKXA 4EXTA 1MMDA 3Q5XA 4PAGA 5FY1A 4P0BA 4EIWA 5L3DB 4MLKA 4DBQA 3KVBA 5FP3A 5LJMA 4UF0A 3JC6C 3B13A 2XU0A 3ZLIA 2NW7A 2CXFA 4ZOLE 3K3OA 2Q9QC 4O2AE 1MNEA 2H3RA 3N9OA 3VHLA 1UX5A 4DBRA 5LHIB 1D0YA 2NTXA 4IE5A 5CB4E 4CXWA 3K8PC 2ZMAA 5HXRA 5LBMA 3F2EA 3V5UA 1WRDA 4PNIA 5DABA 3M65A 2CLYC 1O3XA 2NP9A 3C4WA 2KZ7B 3ZMSB 4ERRA 2XAHB 1MIWA 4JEHB 5LCYA 4U74A 3KV4A 4UXNB 5LA6E 5JRCB 4O4JE 1YKEB 3IEEA 3ZMUB 1OWAA 3L09A 5EK2A 1YW0A 2ES0A 4NUUA 2DWGA 4BJNA 3KINB 4O4LE 5F3JA 1WYCA 4CXYA 4ADZA 2C5IT 3AAAB 1MNDA 1MIVA 2LJLA 4O4IE 3QUJA 3NZQA 4C91A 1Z0PA 2CMRA 1LRZA 3EDVA 3BQLA 2WSSV 3H3AA 3N9LA 4GIWA 3UUNA 4AQFC 5JDNA 4NUVA 4I50E 2IAKA 2CXLA 4TX5A 5C8YE 3KVAA 3N9MA 4ZI2D 4AQFA 4X20E 3N2GE 5HXEA 4QX8B 2HPJA 3ESLA 3VKHA 5GONE 5KDMC 4L5GA 1MMGA 3RX6A 5LGUB 2WBLA 3CKDA 5JDFA 2EHOA 2DLRA 3GMIA 1BR4A 1NAFA 3C98B 5KX5E 3C50A 3CQCB 3Q5WA 5L3CB 3P7IA 5HXHA 2YEVC 4UIGA 4IE6A 2KLQA 4QXHB 4L9IA 4AKGA 3T8OA 4ISTA 4X1KE 3SWHA 2HPLA 4UF0B 2LHNA 2XQYA 4XAXB 4XZCA 2LSJA 2X9WA 1FEWA 5JR9B 2NW8A 5ADXL 3AVSA 2CA5A 1BR2A 3RRWA 3LK3B 4HEAA 3ZN0B 3C64A 4GOUA 3LG7A 1HTJF 4BA9A 2V7KA 4FJOA 2V7IA 5J2UE 1IAPA 4O8SA 2L8KA 1U5PA 3J7Yq 4EYYR 2CLYB 3MJXA 3S4UA 5LGTB 3RPUA 3CPZA 1E1HB 2BVLA 1D1BA 2CM0A 5JDQA 4IGUA 2ODUA 3R84B 5LXTE 4HE8A 4ZHQE 3O9XA 1IJ5A 2VKHA 5JDLA 3HKEE 2MYSA 3KFWX 5E0OA 2VB6A 3N2KE 4G2AA 1D0XA 4HN9A 5H6QB 3C4XA 1EZ3A 1H7CA 3ZYKA 2L9QA 2ZLYA 3MXZA 4TZ4C 3FBZA 2NWBA 4PK5A 4TUYE 4KUMB 4F6RC 3CWZB 4G63A 3RH3A 1X79A 4PJLA 2IC9A 3D0TA 3LK42 3RYHE 2QGSA 2LE8A 3RYFE 4ZI2C 2YK0A 5AFUL 3ZC0A 4CXXA 4AKLA 5DJQC 1HF8A 4H9NC 3AA0B 2EHOB 2YU1A 4GK5E 2LSYA 4YJ3E 4ZS2A 5CA1E 5LGNB 4X1IE 3VKGA 2YINA 3A5XA 2DHRA 2PBIA 1LVKA 2Z6EA 3J9X1 4DMWA 2UXXB 3HR0A 4KP3C 2E9XB 3GN5A 2K5BB 5L3BB 2X9YA 1HG5A 2G0UA 4EB6E 2PG8A 2MTQA 1MMAA 3H37A 4HFVA 3RYIE 3ETUA 3NBXX 3PURA 3MA9A 3PUQA 3I9WA 1ZEEA 3QK6A 1V9DA 2SPCA 2Q9QA 2B1EA 2LSGA 2JRKA 5IHYA 3UT5E 2MOZA 2VL8A 5FY7A 4ANJA 2WMOA 4UELA 3ZJ1A 5LYJE 2V7JA 3GA8A 3F57A 3P8CD 4PW8A 4WBOA 4N78D 5FXZA 5L3FB 4BJMA 3O1JA 1IJ6A 4CI1B 3N9QA 4O2BE 3BQIA 3CX6B 2A2FX 2Y48B 2BZBA 4JLEA 4QXBB 4H63H 5L2LA 3AB3B 4MHCA 2XAFB 2WMNA 2D5UA 4IDZA 3CX7B 4MBQA 3RYCE 4E7ZA 3SS1A 3GWHA 2KXPB 4PK6A 3L3PA 1CUNA 2LOPA 3U3IA 4U72A 4ILUA 3RKOA 4EZHA 3DJBA 3PUAA 1S94A 2KT9A 5A1LA 4GYRA 5LJNA 1BR0A 3ETVA 5TAOA 2IC6A 3I0OA 2DNXA 3HA4A 4UV9B 3UTKA 1B7TA 5HYAA 1Y64B 1QSDA 2XASB 3CX8B 4JUYA 2DWKA 4O4HE 4H9RC 4AXPA 2PJQA 3ZMZB 2NOXA 4C90A 4UVAB 2CCQA 2NW9A 1HCIA 3ZMTB 5F8PA 5JVDE 3O1HA 4I43B 5LHGB 3ANWA 1U4QA 4ZI3D 5HWXA 3NRYA 3BQKA 1KNZA 2K9AA 2ODVA 3MACA 3I9YA 3LK2B 2LSKA 4MALA 5IYZE 2KNDA 3GN5B 4BAYB 3AA7B 3OKQA 4H63V 4AKIA 1KK7A 4OYKA 5EK4A 3IHRA 4QXCB 3KV5A 1YKHB 4JEUB 3MZKB 3WAKA 2A3DA 2W0GA 3DTOA 4MFRA 4J2CA 1FMVA 5FYMA 1ZV4X 4OK0A 2Q9QB 5L3GB 1FMWA 5ETWA 4AI6A 2YU2A 2K48A 2WWUA 1WLXA 2X68A 4PFOA 4WW0A 5EZYE 4ZI7E 2C5JA 4UEMA 3C51A 3VU7H 2KINB 3KV9A 3ONXA 2H7OA 2J1DG 3AAIA 5LG4A 2X51A 4OYJA 4PK4A 3IBPA 4YJ2E 4OFZA 3RRCA 4E7SA 3RC3A 3E0ZA 4B6XA 2Y8DA 3OYZA 4ISSA 3DP7A 2LSIA 3F31A 3ZCJA 4TN7B 2X66A 5L3EB 5JH7E 5H6RB 5HWYA 2D0UA 4YLHA 4V1Av 4H9SE 4EAHA 5JDGA 1HS7A 2DI4A 2CWOA 3ANWB 2VKDA 2BDEA 3SOLA 3PTRB 4XBFB 4H9OC 1QUUA 3NZPA 3AA1B 4ZI3C 2P9BA 3K3QC 3FBLA 4EYUA 4A56A 2JJ9A 2N9DA 3ZC1A 1US7B 2XUEA 4CI3B 3CMLA 5JDMA 5LOVE 2X9HA 3EDUA 2JMKA 4ZS3A 2W62A 1D1CA 2EHOD 3R6NA 1WR6A 1D1AA 2CEAA 4GYSA 3I0QA 4IE7A 5JREA 1D0ZA 4QWNB 5KMGP 4DMVA 2C5KT 3ZPOA 2ZM0A 2XAJB 2D2SA 2KWIB 3HL6A 4PJNA 5FXVA 1MIYA 2VKJA 2E9XD 2OA5A 4GK0E 4DO0A 4WNKA 2MBGA 3OJAA 4QHOA 2XAQB 2JMHA 5LBQB 4IE0A 4AKHA 2JPFA 4EZ4A 5JR9C 1YD8G 2VASA 2IW5B 1UX4A 2W00A 3LBXA 3ZMVB 4AKRB 5CA0E 3MKDA 4M1PA 4KBMB 4OHFA 5JR9A 2C0SA 3UUMA 2CXDA 2RP4A 3CVRA 3E08A 2XAGB 3SRZA 4HTEA 3ZEFB 1HG2A 2ZM8A 3CQXC 5HAXA 1FIOA 2XHEB 2QA7A 4P0AA 1G8XA 1HX8A 5J1GA 3MK7C 4P09A 3I1AA 4H9QC 2ACXA 3ZYLA 4EOZB 3U78A 3PUGA 3UULA 3LFMA 1S35A 3FHNA 1BR1A 4YFSA 2D0TA 3N2OA 2CE7A 3NRXA 4CI2B 3IF8B 2LEHA 4IIJE 4L0RA 1WYBA 3ZYMA 3FB2A 2LHRA 3AAEB 4YHJA 1T98A 1VOMA 4UV8B 2BVMA 2Y6XA 4PJMA 1NWMX 5BMVE 5FY0A 1SHZC 2UXNB 3PU3A 2GK9A 3HI2A 2CWYA 2DCFA 2LM9A 2LT3A 3N9NA 5DQVA 2EHOC 3KBTA 3HKCE 4IHJE 3WI3A 5FXXA 2E8IA 1AJ3A 2HH7A 2WM9A 5LHHB 5M4YA 3LJCA 4HGAA 2WAUA 1ZKEA 5J2TE 2LOSA 1ZHCA 2E9XC 5JDHA 4Z8XA 2N2NA 2V7LA 2I59A 4IE4A 2JQQA 2E9XA 3PUSA 2K24A 3BK9A 3JC6D 2X67A 3PU8A 2Q9QD 1G73A 3LBXB 2VK9A 3TKLB 1SA0E 3O4XE 3V5SA 1MMNA 2NTYA 5LP6E 2A72A 3ZJ2A 3K3NA 5FNVE 3UFEA 4HKAA 3RC8A 2V26A 4CQIA 4AQGA 4UVCB 2VWAA 2KMFA 3AA6B 3AVRA 4CZZB 3FXDB 3N5LA 3OYXA 2V7MA 3KV6A 4KMCA 2VKOA 3EUHA 3O1IA 4QKNA 3C4ZA 2V1DB 5JRCA 3E22E 5FXWA 4PFPA 4ASKA 3KBUA 2H7VC 2PFVA 2X0LB 3B57A 5HXCA 3QC9A 3W15B 2XTLA 4DVDA 4TV8E 4QX7B 1UCUA 1LVFA 3N9PA 2ZM2A 3HKBE 5DQWA 4UVBB 4DNDA 4K0UA 3KDSE 3CQGB 3ZN1B 2N1GA 2X9XA 3Q9DA 3HKDE 4X1YE 2L3LA 1IZNB 2W61A 3OBVE 4I4TE 3WAJA 1OXZA 1VRBA 2RA1A 3UUXB 3PDYA 3ZCIA 5LNKA 4H9PC 5EK3A 5HXSA 4WBNE 5JQGE 2W63A 4FI5A 4PJJA 3EVYA 4I55E 3FXEB 4TV9E 3Q2MA 1HFAA 3PE0A 5FMNA 2KWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFS A;  3BQK A;  3C64 A;  5F3J A;  3RRC A;  3BQL A;  3CPZ A;  4NUV A;  2Y8D A;  4NUU A;  2WAU A;  2XU0 A;  3CML A;  2YK0 A;  3BQI A; 
#chains in the Genus database with same CATH topology
 4PAG A;  4EIW A;  1VCS A;  5LJM A;  1HNZ T;  4O2A E;  3SFD A;  3N9O A;  4CXW A;  4DUY T;  5L4H A;  5DAB A;  1M7K A;  2CLY C;  1O3X A;  3C4W A;  2KZ7 B;  3ZMS B;  2XAH B;  2RPA A;  4DR1 T;  4JEH B;  3ONL C;  3KV4 A;  1YW0 A;  4NUU A;  2D9D A;  4BJN A;  1MND A;  2CMR A;  4I50 E;  2IAK A;  2R6G F;  4AQF A;  2W67 A;  5HXE A;  3QNU A;  2HPJ A;  3ESL A;  2WDQ A;  4HFD A;  3CKD A;  5JDF A;  3DQV C;  1BR4 A;  3C98 B;  2LRK A;  5AQK B;  4QXH B;  4L9I A;  4IST A;  3SWH A;  3CIR A;  2XQY A;  2X9W A;  1FEW A;  5JR9 B;  2NW8 A;  3AEG A;  2QRX A;  5JTG A;  4BA9 A;  1I94 T;  2XQA A;  1W0B A;  4EYY R;  3S4U A;  5LGT B;  2CM0 A;  5HEH A;  2M6I A;  1T8B A;  3O9X A;  2QYW A;  4HN9 A;  3C4X A;  1EZ3 A;  2L9Q A;  3L39 A;  4TZ4 C;  3FBZ A;  4GKJ T;  3EAM A;  1XDP A;  2IC9 A;  3A8Y C;  3RYH E;  4JI1 T;  2LE8 A;  5DJQ C;  3AA0 B;  2YU1 A;  5CA1 E;  5LGN B;  4X1I E;  5HEO A;  2YIN A;  2Z6E A;  3T1H T;  3RIU A;  4DMW A;  2BG9 C;  2UXX B;  1SE7 A;  3HR0 A;  3AEA A;  2X9Y A;  2G0U A;  4HFV A;  3RYI E;  3NBX X;  1OED E;  1ZEE A;  4YY3 T;  1V9D A;  3RQU A;  2LSG A;  2JRK A;  5IHY A;  3SFE A;  2MOZ A;  3UU8 A;  4ANJ A;  1XMQ T;  4UEL A;  3GA8 A;  4WBO A;  3O1J A;  4CI1 B;  3BQI A;  2A2F X;  2Y48 B;  4QXB B;  2WQY A;  2XAF B;  2WMN A;  2D5U A;  4MBQ A;  4E7Z A;  4PK6 A;  3RHW A;  4EZH A;  5LJN A;  5TAO A;  3HA4 A;  3M3Z B;  1B7T A;  3TLS A;  1VCT A;  4O4H E;  2PJQ A;  3ZMZ B;  3PV0 F;  4C90 A;  2CCQ A;  2NW9 A;  3ZMT B;  3ANW A;  4ZI3 D;  1W0A A;  3NRY A;  1HR0 T;  5FVK A;  2ODV A;  3I9Y A;  2LSK A;  4BAY B;  4WYV A;  4H63 V;  4A64 A;  2X0H A;  5HEG A;  3KV5 A;  3DTO A;  2LKG A;  4B3M T;  4OK0 A;  3P4P A;  1FMW A;  4YTP A;  5ETW A;  4AI6 A;  4JV5 T;  2WZK A;  1WLX A;  4PFO A;  4B3R T;  2C5J A;  4UEM A;  2WZI A;  4HWI B;  5CFB A;  1XNQ T;  3ONX A;  3P4W A;  2J1D G;  5LG4 A;  4YJ2 E;  2YN6 A;  4B6X A;  5L3E B;  3G06 A;  1Z8U A;  2WB5 A;  4V1A v;  3ANW B;  2VKD A;  3SOL A;  2VVS A;  3PTR B;  4H9O C;  1N32 T;  4ZI3 C;  3K3Q C;  3FBL A;  1WR0 A;  2JJ9 A;  2N9D A;  4CI3 B;  2XUE A;  4WQO D;  4AP2 B;  1R8I A;  2X9H A;  3EDU A;  2BG9 A;  5JRE A;  4QWN B;  2C5K T;  3ZPO A;  2ZM0 A;  5ABF A;  2E9X D;  3A7M A;  3OJA A;  5LBQ B;  3PJA A;  4DR6 T;  4AKH A;  2XJ7 A;  4U7Y A;  3AXJ A;  4JI7 T;  1KEY A;  1J5E T;  1E7P A;  4HTE A;  2ZM8 A;  2XHE B;  2XSB A;  1GQE A;  3TLW A;  3EI0 A;  3JAD A;  4DV5 T;  3UUL A;  4YFS A;  2D0T A;  5AQN B;  4IIJ E;  4L0R A;  2LHR A;  4UV8 B;  2DL1 A;  2I6H A;  4PJM A;  1NWM X;  5LMN T;  1OED C;  2UXN B;  3PU3 A;  2BG9 B;  3HI2 A;  2CWY A;  2FUP A;  5AQG B;  4DV3 T;  4U33 A;  4B3T T;  2E8I A;  2XQ9 A;  5AQP B;  4HFH A;  3LJC A;  1UUR A;  2MPK A;  5J2T E;  2E9X C;  4DV2 T;  2WWV A;  2N2N A;  2FJD A;  3PUS A;  3BK9 A;  3AXJ B;  4F52 A;  1SA0 E;  1MMN A;  2A72 A;  4KI0 F;  2WU2 A;  5FNV E;  2V26 A;  3FZF B;  4UVC B;  3AA6 B;  4CZZ B;  3N5L A;  4X5T A;  2WDV A;  4DV6 T;  4KX6 A;  4QKN A;  2V1D B;  5CGM A;  2H7V C;  2X0L B;  2XTL A;  4ZZC A;  4DVD A;  4U2Y A;  2ZM2 A;  4CN6 A;  3AE4 A;  4K0U A;  3CQG B;  3H3M A;  4X1Y E;  1IZN B;  3WAJ A;  2AE9 A;  2XSA A;  3ABV A;  4JYA T;  2PTF A;  2OV9 A;  3FZH B;  4PJJ A;  3RKG A;  3DPL C;  4TV9 E;  1HFA A;  5FMN A;  2KWH A;  2M67 A;  1MMD A;  3Q5X A;  4TWD A;  4MLK A;  5FP3 A;  2CHO A;  3ZLI A;  4ZOL E;  5LHI B;  2ZMA A;  2LM2 A;  3RGL A;  2FJA A;  1WRD A;  4PNI A;  4HFE A;  4QH1 A;  4ERR A;  4UXN B;  4O4J E;  4U7I A;  3ONJ A;  5AQS B;  3IEE A;  4DUZ T;  4IDP A;  3RQW A;  3L09 A;  4CXY A;  4ADZ A;  4ILB A;  3RF1 A;  3QUJ A;  4Z91 A;  3EDV A;  1LRZ A;  4IL9 A;  3BQL A;  2W4X A;  5HCJ A;  3UUN A;  4AQF C;  3KVA A;  1OED A;  4QX8 B;  3VKH A;  1N34 T;  1MMG A;  3RX6 A;  2WBL A;  2BBJ A;  4JI0 T;  3GMI A;  5KX5 E;  3Q5W A;  4X66 T;  4IE6 A;  5AQL B;  2KLQ A;  4AKG A;  1JNZ A;  2LHN A;  2LSJ A;  4NXM T;  3RIA A;  2CA5 A;  1BR2 A;  4ILA A;  3LK3 B;  3RRW A;  3ZN0 B;  4GOU A;  5AQJ B;  1HTJ F;  4O8S A;  3MJX A;  3RPU A;  2BVL A;  1D1B A;  3NKZ A;  4AQY T;  4IGU A;  4U2Z A;  2ODU A;  3R84 B;  2V8S V;  2MYS A;  2HN2 A;  3KFW X;  3N2K E;  1D0X A;  3PUW F;  3P4R A;  4YTM A;  2VQE T;  1OED B;  1W09 A;  4PJL A;  4LF8 T;  3LK4 2;  2CRB A;  4CXX A;  4YTN A;  1HF8 A;  4H9N C;  4JI4 T;  4YJ3 E;  1JNR A;  1FJG T;  3VKG A;  3J9X 1;  3EHZ A;  2E9X B;  1UK5 A;  1MMA A;  1M62 A;  3PUR A;  3PUQ A;  4IRE A;  5HCM A;  3UT5 E;  3VRB A;  5FY7 A;  4P5O A;  4TNW A;  5L3F B;  4N78 D;  2XPK A;  3N9Q A;  4JLE A;  4MHC A;  5HEJ A;  3CX7 B;  5AQR B;  2KXP B;  4AIS A;  3AEF A;  1CUN A;  3PUA A;  1S94 A;  5A1L A;  4GYR A;  1BR0 A;  2OLT A;  4IT4 A;  3RI5 A;  1Y64 B;  2XAS B;  4LFC T;  1ZP0 A;  2IDO B;  2DWK A;  2NOX A;  4I43 B;  5HWX A;  2W2U A;  3MAC A;  2ZM6 T;  4LMK A;  5IYZ E;  2KND A;  2XQ6 A;  1KK7 A;  4OYK A;  5EK4 A;  4JEU B;  3MZK B;  4MFR A;  2W0G A;  1Y01 A;  5FYM A;  4HFI A;  5L3G B;  2BBH A;  4U31 A;  4WW0 A;  3UQ4 A;  2BKP A;  4N9F 3;  2VL0 A;  3P4Q A;  2WZH A;  3AAI A;  4PK4 A;  3IBP A;  3ZT7 A;  2V5C A;  3AE3 A;  2Y8D A;  3DP7 A;  3ZCJ A;  5HEU A;  4DR4 T;  5JH7 E;  4X64 T;  4YSY A;  5H6R B;  5HWY A;  4EAH A;  2YDR A;  5LMU T;  1QUU A;  3NZP A;  4EYU A;  3CML A;  2HN1 A;  5LOV E;  4LF6 T;  2JIW A;  2CEA A;  3AE9 A;  2UXD T;  4YHH T;  1J1J A;  3HL6 A;  5FXV A;  1MIY A;  2VKJ A;  2OA5 A;  4WNK A;  2JMH A;  3AEC A;  2V6Y A;  2IW5 B;  1UX4 A;  2W00 A;  2XZE A;  3MKD A;  4M1P A;  4KBM B;  2C0S A;  2YKS A;  3SRZ A;  4QH5 A;  3AE7 A;  3CQX C;  4P0A A;  1HX8 A;  5ABH A;  3MK7 C;  3I1A A;  3CK6 A;  2ACX A;  3ZYL A;  2XM1 A;  4EOZ B;  3LFM A;  1BR1 A;  4A5X A;  2CE7 A;  4AIU A;  3NRX A;  4CI2 B;  2LEH A;  1WYB A;  4APF B;  3AAE B;  1T98 A;  2BVM A;  2Y6X A;  5BMV E;  4JI3 T;  2DCF A;  2X0Y A;  1T72 A;  4IHJ E;  4YSX A;  5JDH A;  2XQ5 A;  2V7L A;  2I59 A;  4IE4 A;  3NWI A;  2WS3 A;  2K24 A;  4IDQ A;  3JC6 D;  2V6Y B;  1G73 A;  2VK9 A;  3PUZ F;  3AEE A;  3X1D A;  3ZJ2 A;  3UFE A;  4EGW A;  4AQG A;  2CHN A;  3AVR A;  3FXD B;  3OYX A;  3KV6 A;  1J5W A;  2W66 A;  2VKO A;  4NPP A;  3C4Z A;  4JI5 T;  5JRC A;  2PFV A;  2QVA A;  4TV8 E;  4QX7 B;  1UCU A;  1LVF A;  3VR8 A;  4NXN T;  4DND A;  2XQ3 A;  3ZN1 B;  4IDN A;  4COF A;  3PJA J;  1XNR T;  2XQ4 A;  5AQO B;  4DV0 T;  3UUX B;  3PDY A;  5LNK A;  4H9P C;  5EK3 A;  4WBN E;  2W63 A;  4LFB T;  3FXE B;  3Q2M A;  2IIU A;  2E5L T;  4HWH A;  4DBQ A;  3KVB A;  4A97 A;  4YXD A;  4UF0 A;  3JC6 C;  1MNE A;  3VHL A;  4DBR A;  4IE5 A;  5CB4 E;  3L8R A;  3K8P C;  5C2T A;  5LBM A;  2BS4 A;  5KXJ A;  2NP9 A;  1MIW A;  5LCY A;  4U74 A;  5LA6 E;  5JRC B;  1YKE B;  1WCR A;  2XQ8 A;  3ZMU B;  5L4E A;  1OWA A;  1SUM B;  2DWG A;  3KIN B;  5F3J A;  2LJL A;  2LLY A;  3H3A A;  4NIQ A;  3ZT5 A;  4NUV A;  4HFB A;  2NR4 A;  3OTO T;  4TX5 A;  5C8Y E;  2WDR A;  4X20 E;  5KDM C;  4L5G A;  4YSZ A;  5ABF B;  1ZOY A;  2DLR A;  2V6X A;  2J4G A;  5L3C B;  2VVN A;  4UIG A;  4LF9 T;  1CHU A;  3AE8 A;  3FZM B;  4X1K E;  2HPL A;  4UF0 B;  4XAX B;  4XZC A;  3AVS A;  4X62 T;  4HEA A;  1HX1 B;  3C64 A;  5LB7 B;  3VRA A;  1XWM A;  2V7K A;  5J2U E;  2V7I A;  1T7S A;  2L8K A;  1U5P A;  1WFD A;  5FVL A;  1W9R A;  1YQ4 A;  4DR7 T;  4ZHQ E;  3HKE E;  4G2A A;  5AQT B;  3FZL B;  2FJB A;  3RH3 A;  1X79 A;  2I0M A;  1KNR A;  1N36 T;  5AQF B;  3D0T A;  2ACZ A;  3RYF E;  2YK0 A;  3ZC0 A;  4AKL A;  4ZS2 A;  4GK5 E;  2LSY A;  3A5X A;  2DHR A;  1LVK A;  1I6Z A;  4KP3 C;  2VUR A;  3GN5 A;  5L3B B;  3UQ7 A;  2MTQ A;  3ETU A;  2IML A;  5AQH B;  3MA9 A;  5IWA T;  2SPC A;  3ZKR A;  2BKN A;  2VL8 A;  2WMO A;  3ZJ1 A;  5LYJ E;  2IUB A;  3P8C D;  3F57 A;  5FXZ A;  4DID B;  4BJM A;  3UU4 A;  2BZB A;  4IDZ A;  3NVO A;  2JQH A;  3RYC E;  3SS1 A;  3GWH A;  3L3P A;  4DV7 T;  2LOP A;  3U3I A;  4ILU A;  4K0K T;  3ETV A;  2IC6 A;  3I0O A;  3UU3 A;  1QSD A;  3CX8 B;  3QB5 A;  4JUY A;  4H9R C;  4AXP A;  3K1S A;  5F8P A;  5LG3 A;  3O1H A;  5LHG B;  4YT0 A;  3BQK A;  3LK2 B;  4MAL A;  3GN5 B;  3AA7 B;  3OKQ A;  4AKI A;  2YDS A;  1YKH B;  2A3D A;  2XM2 A;  4J2C A;  1FMV A;  1IBM T;  2VQF T;  4IDO A;  4KHP T;  2JQ9 A;  3TLV A;  2YU2 A;  2WWU A;  4EED A;  5EZY E;  4ZI7 E;  3C51 A;  4F8H A;  3VU7 H;  5FL1 A;  1U6G A;  3KV9 A;  2BS3 A;  3ZSS A;  5AQV B;  4E7S A;  3E0Z A;  3OYZ A;  4ISS A;  2LSI A;  4TWF A;  3F31 A;  2X66 A;  2D0U A;  4YLH A;  4H9S E;  5JDG A;  1HS7 A;  2DI4 A;  2CWO A;  2WU5 A;  2P9B A;  1US7 B;  2MAW A;  2JMK A;  4HWF A;  5IUX A;  2EHO D;  3R6N A;  2WP9 A;  4UR9 A;  1D1A A;  4GYS A;  3I0Q A;  4IE7 A;  1HNX T;  4DMV A;  3EAB A;  2KWI B;  4PJN A;  3IA3 A;  2FBW A;  2XAQ B;  4EZ4 A;  3VR9 A;  4JBW F;  3UUB A;  2VAS A;  5AQM B;  4X65 T;  3LBX A;  4AKR B;  3ZMV B;  2LKH A;  5CA0 E;  5JR9 A;  2CXD A;  2RP4 A;  3CVR A;  3JAF A;  1XZY A;  1HNW T;  2XAG B;  4DV4 T;  2UXB T;  3ZEF B;  1HG2 A;  1FIO A;  4LF4 T;  1G8X A;  2HHH T;  2BS2 A;  5J1G A;  3U78 A;  3PUG A;  3FHN A;  4WZX A;  3N2O A;  4B3S T;  3ZYM A;  1KF6 A;  3AE1 A;  5FY0 A;  4EEB A;  2IHR 1;  4JI2 T;  4GKK T;  5AQQ B;  2EHO C;  3KBT A;  3RTR A;  3WI3 A;  5FXX A;  4LML A;  1AJ3 A;  2HH7 A;  5LHH B;  4JI6 T;  5M4Y A;  1ZKE A;  2JQQ A;  4EV6 A;  1YXR A;  2K3W A;  2X67 A;  3PU8 A;  2Q9Q D;  3LBX B;  4LFA T;  3O4X E;  3AE2 A;  2NTY A;  3OPC A;  4ILC A;  1UGO A;  4HKA A;  4CQI A;  2KMF A;  4JGH D;  4HWD A;  1X9B A;  2CBI A;  3O1I A;  2H89 A;  4PFP A;  2WCA A;  4ASK A;  3B57 A;  2UUC T;  3QC9 A;  3W15 B;  3N9P A;  5DQW A;  4UVB B;  2F4V T;  3KDS E;  2X9X A;  2W61 A;  4DR5 T;  1OXZ A;  1VRB A;  2A9U A;  5JQG E;  5BR8 T;  3RLF F;  4TNV A;  3LDQ B;  1LKX A;  4EXT A;  5L3D B;  5FY1 A;  4P0B A;  4Q25 A;  3B13 A;  2XU0 A;  2NW7 A;  2CXF A;  1IBL T;  3K3O A;  2Q9Q C;  2H3R A;  3UU5 A;  1UX5 A;  1D0Y A;  2NTX A;  5FL0 A;  5HXR A;  3UFG A;  3F2E A;  3V5U A;  3M65 A;  3P50 A;  2WY2 A;  5EK2 A;  2ES0 A;  4O4L E;  1WYC A;  3AE6 A;  2C5I T;  2JQK A;  3AAA B;  3ZT6 A;  1MIV A;  4O4I E;  3NZQ A;  4A98 A;  4C91 A;  1Z0P A;  4GIW A;  3N9L A;  2WSS V;  5JDN A;  2CXL A;  3N9M A;  4ZI2 D;  3N2G E;  2E2A A;  5GON E;  5LGU B;  1DU2 A;  4LF5 T;  2EHO A;  1NAF A;  3C50 A;  3CQC B;  3P7I A;  5HXH A;  2YEV C;  3T8O A;  4ZXL A;  3JCF A;  4ZEY A;  3Q5D A;  4ZZB A;  5AQI B;  4JI8 T;  5ADX L;  3P4S A;  3UU6 A;  3JAE A;  3LG7 A;  4FJO A;  1IAP A;  3J7Y q;  2CLY B;  1KFY A;  3CPZ A;  1E1H B;  2KSR A;  4DR3 T;  5JDQ A;  5LXT E;  4HE8 A;  1IJ5 A;  2VKH A;  5JDL A;  1N33 T;  5E0O A;  2VB6 A;  5H6Q B;  1H7C A;  3ZYK A;  2ZLY A;  3MXZ A;  1QLB A;  2NWB A;  4PK5 A;  4TUY E;  4KUM B;  4F6R C;  3CWZ B;  4G63 A;  2BKO A;  2QGS A;  5AFU L;  4ZI2 C;  3B5M A;  4HWC A;  2EHO B;  5C3J A;  2H88 A;  4IL4 A;  2PBI A;  2K5B B;  3AED A;  5ABE A;  1HG5 A;  4EB6 E;  2PG8 A;  4CN4 A;  3H37 A;  3I9W A;  1XMO T;  3QK6 A;  4CN1 A;  2Q9Q A;  2B1E A;  2AXD S;  2V7J A;  1IBK T;  3AEB A;  4PW8 A;  1IJ6 A;  4O2B E;  5L47 A;  3CX6 B;  5L2L A;  4H63 H;  3AB3 B;  1L0V A;  3TLT A;  5J0Z A;  4U72 A;  3RKO A;  3DJB A;  2KT9 A;  2DNX A;  4UV9 B;  3UTK A;  5HYA A;  3OVU A;  4UVA B;  5FKY A;  1HCI A;  5JVD E;  1U4Q A;  1KNZ A;  2B76 A;  2K9A A;  4DV1 T;  2UU9 T;  1NEK A;  3RIF A;  3ZST A;  3IHR A;  4QXC B;  2M6B A;  3WAK A;  1ZV4 X;  2Q9Q B;  3Q5E A;  4TWH A;  2K48 A;  2X68 A;  3QB5 K;  2KIN B;  2H7O A;  4KHZ F;  2X51 A;  4OYJ A;  4OFZ A;  3PUV F;  3RRC A;  2XQ7 A;  4HXI B;  3RC3 A;  4DR2 T;  1YQ3 A;  4TN7 B;  2BDE A;  4XBF B;  3AA1 B;  2UUB T;  4A56 A;  3ZC1 A;  5JDM A;  4ZS3 A;  1LDK A;  2W62 A;  1D1C A;  1WR6 A;  4I0U A;  1D0Z A;  5KMG P;  2XAJ B;  2D2S A;  4GK0 E;  4DO0 A;  2MBG A;  4QHO A;  2V5D A;  1XDO A;  1E2A A;  4IE0 A;  2JPF A;  3PUY F;  5JR9 C;  3AE5 A;  1YD8 G;  4OHF A;  3UUM A;  3E08 A;  2J62 A;  5HAX A;  2QA7 A;  4P09 A;  4H9Q C;  4Z90 A;  1S35 A;  3LSV A;  4P1N A;  3IF8 B;  3FB2 A;  4YHJ A;  1VOM A;  2FJE A;  5F5W A;  3T1Y T;  1UUS A;  2YOE A;  1SHZ C;  1LDK B;  2GK9 A;  2LM9 A;  2LT3 A;  3N9N A;  2UXC T;  2CBJ A;  5DQV A;  3HKC E;  2WM9 A;  5CJ5 A;  2LRL A;  4HGA A;  1LDJ A;  2WAU A;  2LOS A;  1ZHC A;  4LMJ A;  4Z8X A;  2YDQ A;  2E9X A;  2UUA T;  1NEN A;  3QOF A;  1KNP A;  4LF7 T;  3TKL B;  3V5S A;  2BG9 E;  2CPT A;  4QH4 A;  5LP6 E;  3K3N A;  3PUX F;  3RC8 A;  2VWA A;  2V7M A;  4KMC A;  5AQU B;  3EUH A;  3E22 E;  5FXW A;  3KBU A;  4HFC A;  5HXC A;  2XY8 B;  3HKB E;  2N1G A;  3Q9D A;  3HKD E;  2L3L A;  2E5V A;  3OBV E;  4U3C A;  4I4T E;  2J47 A;  3FZK B;  4OX9 T;  2RA1 A;  3TLU A;  5ABG A;  3ZCI A;  5HXS A;  4FI5 A;  3RIU C;  3EVY A;  4I55 E;  3PE0 A; 
#chains in the Genus database with same CATH homology
 2M67 A;  1LKX A;  4EXT A;  1MMD A;  3Q5X A;  4PAG A;  5FY1 A;  4P0B A;  4EIW A;  5L3D B;  4MLK A;  4DBQ A;  3KVB A;  5FP3 A;  5LJM A;  4UF0 A;  3JC6 C;  3B13 A;  2XU0 A;  3ZLI A;  2NW7 A;  2CXF A;  4ZOL E;  3K3O A;  2Q9Q C;  4O2A E;  1MNE A;  2H3R A;  3N9O A;  3VHL A;  1UX5 A;  4DBR A;  5LHI B;  1D0Y A;  2NTX A;  4IE5 A;  5CB4 E;  4CXW A;  3K8P C;  2ZMA A;  5HXR A;  5LBM A;  3F2E A;  3V5U A;  1WRD A;  4PNI A;  5DAB A;  3M65 A;  2CLY C;  1O3X A;  2NP9 A;  3C4W A;  2KZ7 B;  3ZMS B;  4ERR A;  2XAH B;  1MIW A;  4JEH B;  5LCY A;  4U74 A;  3KV4 A;  4UXN B;  5LA6 E;  5JRC B;  4O4J E;  1YKE B;  3IEE A;  3ZMU B;  1OWA A;  3L09 A;  5EK2 A;  1YW0 A;  2ES0 A;  4NUU A;  2DWG A;  4BJN A;  3KIN B;  4O4L E;  5F3J A;  1WYC A;  4CXY A;  4ADZ A;  2C5I T;  3AAA B;  1MND A;  1MIV A;  2LJL A;  4O4I E;  3QUJ A;  3NZQ A;  4C91 A;  1Z0P A;  2CMR A;  1LRZ A;  3EDV A;  3BQL A;  2WSS V;  3H3A A;  3N9L A;  4GIW A;  3UUN A;  4AQF C;  5JDN A;  4NUV A;  4I50 E;  2IAK A;  2CXL A;  4TX5 A;  5C8Y E;  3KVA A;  3N9M A;  4ZI2 D;  4AQF A;  4X20 E;  3N2G E;  5HXE A;  4QX8 B;  2HPJ A;  3ESL A;  3VKH A;  5GON E;  5KDM C;  4L5G A;  1MMG A;  3RX6 A;  5LGU B;  2WBL A;  3CKD A;  5JDF A;  2EHO A;  2DLR A;  3GMI A;  1BR4 A;  1NAF A;  3C98 B;  5KX5 E;  3C50 A;  3CQC B;  3Q5W A;  5L3C B;  3P7I A;  5HXH A;  2YEV C;  4UIG A;  4IE6 A;  2KLQ A;  4QXH B;  4L9I A;  4AKG A;  3T8O A;  4IST A;  4X1K E;  3SWH A;  2HPL A;  4UF0 B;  2LHN A;  2XQY A;  4XAX B;  4XZC A;  2LSJ A;  2X9W A;  1FEW A;  5JR9 B;  2NW8 A;  5ADX L;  3AVS A;  2CA5 A;  1BR2 A;  3RRW A;  3LK3 B;  4HEA A;  3ZN0 B;  3C64 A;  4GOU A;  3LG7 A;  1HTJ F;  4BA9 A;  2V7K A;  4FJO A;  2V7I A;  5J2U E;  1IAP A;  4O8S A;  2L8K A;  1U5P A;  3J7Y q;  4EYY R;  2CLY B;  3MJX A;  3S4U A;  5LGT B;  3RPU A;  3CPZ A;  1E1H B;  2BVL A;  1D1B A;  2CM0 A;  5JDQ A;  4IGU A;  2ODU A;  3R84 B;  5LXT E;  4HE8 A;  4ZHQ E;  3O9X A;  1IJ5 A;  2VKH A;  5JDL A;  3HKE E;  2MYS A;  3KFW X;  5E0O A;  2VB6 A;  3N2K E;  4G2A A;  1D0X A;  4HN9 A;  5H6Q B;  3C4X A;  1EZ3 A;  1H7C A;  3ZYK A;  2L9Q A;  2ZLY A;  3MXZ A;  4TZ4 C;  3FBZ A;  2NWB A;  4PK5 A;  4TUY E;  4KUM B;  4F6R C;  3CWZ B;  4G63 A;  3RH3 A;  1X79 A;  4PJL A;  2IC9 A;  3D0T A;  3LK4 2;  3RYH E;  2QGS A;  2LE8 A;  3RYF E;  4ZI2 C;  2YK0 A;  5AFU L;  3ZC0 A;  4CXX A;  4AKL A;  5DJQ C;  1HF8 A;  4H9N C;  3AA0 B;  2EHO B;  2YU1 A;  4GK5 E;  2LSY A;  4YJ3 E;  4ZS2 A;  5CA1 E;  5LGN B;  4X1I E;  3VKG A;  2YIN A;  3A5X A;  2DHR A;  2PBI A;  1LVK A;  2Z6E A;  3J9X 1;  4DMW A;  2UXX B;  3HR0 A;  4KP3 C;  2E9X B;  3GN5 A;  2K5B B;  5L3B B;  2X9Y A;  1HG5 A;  2G0U A;  4EB6 E;  2PG8 A;  2MTQ A;  1MMA A;  3H37 A;  4HFV A;  3RYI E;  3ETU A;  3NBX X;  3PUR A;  3MA9 A;  3PUQ A;  3I9W A;  1ZEE A;  3QK6 A;  1V9D A;  2SPC A;  2Q9Q A;  2B1E A;  2LSG A;  2JRK A;  5IHY A;  3UT5 E;  2MOZ A;  2VL8 A;  5FY7 A;  4ANJ A;  2WMO A;  4UEL A;  3ZJ1 A;  5LYJ E;  2V7J A;  3GA8 A;  3F57 A;  3P8C D;  4PW8 A;  4WBO A;  4N78 D;  5FXZ A;  5L3F B;  4BJM A;  3O1J A;  1IJ6 A;  4CI1 B;  3N9Q A;  4O2B E;  3BQI A;  3CX6 B;  2A2F X;  2Y48 B;  2BZB A;  4JLE A;  4QXB B;  4H63 H;  5L2L A;  3AB3 B;  4MHC A;  2XAF B;  2WMN A;  2D5U A;  4IDZ A;  3CX7 B;  4MBQ A;  3RYC E;  4E7Z A;  3SS1 A;  3GWH A;  2KXP B;  4PK6 A;  3L3P A;  1CUN A;  2LOP A;  3U3I A;  4U72 A;  4ILU A;  3RKO A;  4EZH A;  3DJB A;  3PUA A;  1S94 A;  2KT9 A;  5A1L A;  4GYR A;  5LJN A;  1BR0 A;  3ETV A;  5TAO A;  2IC6 A;  3I0O A;  2DNX A;  3HA4 A;  4UV9 B;  3UTK A;  1B7T A;  5HYA A;  1Y64 B;  1QSD A;  2XAS B;  3CX8 B;  4JUY A;  2DWK A;  4O4H E;  4H9R C;  4AXP A;  2PJQ A;  3ZMZ B;  2NOX A;  4C90 A;  4UVA B;  2CCQ A;  2NW9 A;  1HCI A;  3ZMT B;  5F8P A;  5JVD E;  3O1H A;  4I43 B;  5LHG B;  3ANW A;  1U4Q A;  4ZI3 D;  5HWX A;  3NRY A;  3BQK A;  1KNZ A;  2K9A A;  2ODV A;  3MAC A;  3I9Y A;  3LK2 B;  2LSK A;  4MAL A;  5IYZ E;  2KND A;  3GN5 B;  4BAY B;  3AA7 B;  3OKQ A;  4H63 V;  4AKI A;  1KK7 A;  4OYK A;  5EK4 A;  3IHR A;  4QXC B;  3KV5 A;  1YKH B;  4JEU B;  3MZK B;  3WAK A;  2A3D A;  2W0G A;  3DTO A;  4MFR A;  4J2C A;  1FMV A;  5FYM A;  1ZV4 X;  4OK0 A;  2Q9Q B;  5L3G B;  1FMW A;  5ETW A;  4AI6 A;  2YU2 A;  2K48 A;  2WWU A;  1WLX A;  2X68 A;  4PFO A;  4WW0 A;  5EZY E;  4ZI7 E;  2C5J A;  4UEM A;  3C51 A;  3VU7 H;  2KIN B;  3KV9 A;  3ONX A;  2H7O A;  2J1D G;  3AAI A;  5LG4 A;  2X51 A;  4OYJ A;  4PK4 A;  3IBP A;  4YJ2 E;  4OFZ A;  3RRC A;  4E7S A;  3RC3 A;  3E0Z A;  4B6X A;  2Y8D A;  3OYZ A;  4ISS A;  3DP7 A;  2LSI A;  3F31 A;  3ZCJ A;  4TN7 B;  2X66 A;  5L3E B;  5JH7 E;  5H6R B;  5HWY A;  2D0U A;  4YLH A;  4V1A v;  4H9S E;  4EAH A;  5JDG A;  1HS7 A;  2DI4 A;  2CWO A;  3ANW B;  2VKD A;  2BDE A;  3SOL A;  3PTR B;  4XBF B;  4H9O C;  1QUU A;  3NZP A;  3AA1 B;  4ZI3 C;  2P9B A;  3K3Q C;  3FBL A;  4EYU A;  4A56 A;  2JJ9 A;  2N9D A;  3ZC1 A;  1US7 B;  2XUE A;  4CI3 B;  3CML A;  5JDM A;  5LOV E;  2X9H A;  3EDU A;  2JMK A;  4ZS3 A;  2W62 A;  1D1C A;  2EHO D;  3R6N A;  1WR6 A;  1D1A A;  2CEA A;  4GYS A;  3I0Q A;  4IE7 A;  5JRE A;  1D0Z A;  4QWN B;  5KMG P;  4DMV A;  2C5K T;  3ZPO A;  2ZM0 A;  2XAJ B;  2D2S A;  2KWI B;  3HL6 A;  4PJN A;  5FXV A;  1MIY A;  2VKJ A;  2E9X D;  2OA5 A;  4GK0 E;  4DO0 A;  4WNK A;  2MBG A;  3OJA A;  4QHO A;  2XAQ B;  2JMH A;  5LBQ B;  4IE0 A;  4AKH A;  2JPF A;  4EZ4 A;  5JR9 C;  1YD8 G;  2VAS A;  2IW5 B;  1UX4 A;  2W00 A;  3LBX A;  3ZMV B;  4AKR B;  5CA0 E;  3MKD A;  4M1P A;  4KBM B;  4OHF A;  5JR9 A;  2C0S A;  3UUM A;  2CXD A;  2RP4 A;  3CVR A;  3E08 A;  2XAG B;  3SRZ A;  4HTE A;  3ZEF B;  1HG2 A;  2ZM8 A;  3CQX C;  5HAX A;  1FIO A;  2XHE B;  2QA7 A;  4P0A A;  1G8X A;  1HX8 A;  5J1G A;  3MK7 C;  4P09 A;  3I1A A;  4H9Q C;  2ACX A;  3ZYL A;  4EOZ B;  3U78 A;  3PUG A;  3UUL A;  3LFM A;  1S35 A;  3FHN A;  1BR1 A;  4YFS A;  2D0T A;  3N2O A;  2CE7 A;  3NRX A;  4CI2 B;  3IF8 B;  2LEH A;  4IIJ E;  4L0R A;  1WYB A;  3ZYM A;  3FB2 A;  2LHR A;  3AAE B;  4YHJ A;  1T98 A;  1VOM A;  4UV8 B;  2BVM A;  2Y6X A;  4PJM A;  1NWM X;  5BMV E;  5FY0 A;  1SHZ C;  2UXN B;  3PU3 A;  2GK9 A;  3HI2 A;  2CWY A;  2DCF A;  2LM9 A;  2LT3 A;  3N9N A;  5DQV A;  2EHO C;  3KBT A;  3HKC E;  4IHJ E;  3WI3 A;  5FXX A;  2E8I A;  1AJ3 A;  2HH7 A;  2WM9 A;  5LHH B;  5M4Y A;  3LJC A;  4HGA A;  2WAU A;  1ZKE A;  5J2T E;  2LOS A;  1ZHC A;  2E9X C;  5JDH A;  4Z8X A;  2N2N A;  2V7L A;  2I59 A;  4IE4 A;  2JQQ A;  2E9X A;  3PUS A;  2K24 A;  3BK9 A;  3JC6 D;  2X67 A;  3PU8 A;  2Q9Q D;  1G73 A;  3LBX B;  2VK9 A;  3TKL B;  1SA0 E;  3O4X E;  3V5S A;  1MMN A;  2NTY A;  5LP6 E;  2A72 A;  3ZJ2 A;  3K3N A;  5FNV E;  3UFE A;  4HKA A;  3RC8 A;  2V26 A;  4CQI A;  4AQG A;  4UVC B;  2VWA A;  2KMF A;  3AA6 B;  3AVR A;  4CZZ B;  3FXD B;  3N5L A;  3OYX A;  2V7M A;  3KV6 A;  4KMC A;  2VKO A;  3EUH A;  3O1I A;  4QKN A;  3C4Z A;  2V1D B;  5JRC A;  3E22 E;  5FXW A;  4PFP A;  4ASK A;  3KBU A;  2H7V C;  2PFV A;  2X0L B;  3B57 A;  5HXC A;  3QC9 A;  3W15 B;  2XTL A;  4DVD A;  4TV8 E;  4QX7 B;  1UCU A;  1LVF A;  3N9P A;  2ZM2 A;  3HKB E;  5DQW A;  4UVB B;  4DND A;  4K0U A;  3KDS E;  3CQG B;  3ZN1 B;  2N1G A;  2X9X A;  3Q9D A;  3HKD E;  4X1Y E;  2L3L A;  1IZN B;  2W61 A;  3OBV E;  4I4T E;  3WAJ A;  1OXZ A;  1VRB A;  2RA1 A;  3UUX B;  3PDY A;  3ZCI A;  5LNK A;  4H9P C;  5EK3 A;  5HXS A;  4WBN E;  5JQG E;  2W63 A;  4FI5 A;  4PJJ A;  3EVY A;  4I55 E;  3FXE B;  4TV9 E;  3Q2M A;  1HFA A;  3PE0 A;  5FMN A;  2KWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...