3BQIA

Structure of a chondroitin sulphate binding dbl3x from a var2csa encoded pfemp1 protein
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
360
structure length
328
Chain Sequence
SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 115
structure length 328
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqiA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqiA02
2YK0A 4NUVA 2Y8DA 3BQLA 4NUUA 3RRCA 2XU0A 3BQIA 3C64A 3CMLA 3CPZA 4YFSA 2WAUA 3BQKA 5F3JA
chains in the Genus database with same CATH superfamily
2OLTA 4ZXLA 2WMNA 2J4GA 2CXLA 5E0OA 4KHZF 3CQCB 4TX5A 2CRBA 4ZI3C 2V6YA 2SPCA 3ZN0B 3N9NA 3W15B 3UUXB 1J5ET 3U3IA 3LFMA 2V1DB 1ZV4X 2X9XA 3UU3A 5JDHA 2UXXB 4C90A 4HFEA 2WS3A 3KBUA 1QSDA 2BG9B 3AEEA 4U3CA 3KV9A 4PW8A 3K3QC 4O2BE 3TLWA 5AQPB 2E9XD 2BKNA 2CXFA 4ASKA 3FZFB 4YJ3E 3JCFA 2KNDA 5CFBA 5FY7A 1V9DA 3NWIA 4H9PC 3RKGA 2AE9A 3F57A 3ZC1A 3RQWA 3N9LA 1E1HB 1S94A 4HKAA 2NWBA 1HNWT 3E22E 1D1CA 2YDRA 2VL8A 1LVFA 3JAFA 2ZM2A 3ANWB 1MMNA 3I9YA 4YHJA 4IL9A 3K3OA 4LMLA 4IT4A 1VCSA 3PU3A 2XAGB 4DUZT 5HEUA 5TAOA 3HA4A 3A5XA 4LMKA 2XHEB 5HXSA 4IDPA 3P4SA 4GKKT 4HGAA 1MMGA 1MNDA 1Z0PA 3M3ZB 3ZT7A 1QLBA 2LSKA 4ZZCA 3RHWA 2D2SA 1SHZC 4YSZA 4IDQA 4I50E 2HN2A 4YXDA 5LA6E 2D9DA 5CA1E 3AE1A 4DV6T 2XQ4A 5JR9B 5DABA 3N9OA 4O4IE 2QGSA 4QX8B 5JDGA 3ZT6A 4APFB 2VKDA 2WAUA 5IWAT 1MIWA 5C8YE 1YQ4A 2YDSA 4IDNA 3ETVA 1YQ3A 3C4WA 4IL4A 3GWHA 4AXPA 1U4QA 4AISA 5LGTB 2YOEA 1SA0E 4KX6A 5KX5E 4U2YA 5L3CB 1WFDA 3UUBA 3AEBA 3ZYLA 2H7VC 4YSYA 4ISSA 2IAKA 4CN4A 3BQIA 4P0BA 3KV6A 3ZKRA 2K5BB 4WQOD 2X9HA 3HKDE 3PU8A 2M6BA 4LF4T 3FZHB 5L3EB 2DNXA 4U72A 1WYBA 1HS7A 3MACA 2BKPA 4UVCB 5F8PA 2LRLA 2MBGA 3EI0A 3UQ7A 4CI3B 5FKYA 3PUAA 4JI0T 2JQKA 3K8PC 2CXDA 1Z8UA 1J5WA 5FXXA 3EABA 3F31A 5JRCA 4LF9T 2XM1A 2KT9A 2E5VA 1E7PA 2JQ9A 1XZYA 5EK2A 2LSGA 2PJQA 4WZXA 4G63A 4X65T 3C4ZA 3UU6A 5BMVE 2VWAA 3I1AA 3H3MA 3E08A 4HWIB 2IC6A 3MA9A 3IEEA 3SWHA 1WR0A 5HEHA 2Z6EA 4L5GA 2XAJB 4JBWF 4YFSA 2CCQA 1HF8A 2XAQB 3ZJ1A 1GQEA 2PTFA 4JI5T 3ZMTB 5AQTB 1G8XA 4U74A 2WDVA 1BR2A 2KINB 3QB5A 4YSXA 4DR6T 5F3JA 5C2TA 4KI0F 1US7B 4O8SA 1X79A 4PAGA 5KMGP 1T8BA 3ZLIA 4TZ4C 4U2ZA 2HH7A 4DV1T 4AKLA 2V7MA 2EHOA 1BR1A 2YEVC 4WYVA 3PUVF 3ZMZB 1WCRA 4GKJT 2JPFA 2WDRA 2DWGA 1LDKB 5L4EA 4PJNA 4K0KT 3N2KE 2M6IA 3ZPOA 1D0XA 2NR4A 2XAHB 4YTMA 4ZZBA 5FY1A 1KNRA 4O4HE 1HG5A 2LSJA 3Q5DA 3AAAB 2XQ6A 3IF8B 1LVKA 2XY8B 3V5SA 3VRAA 2X0HA 3UU5A 3CPZA 3PUQA 2CPTA 2CHOA 2EHOC 3GA8A 2ES0A 2EHOD 5ABEA 2XJ7A 2RPAA 3RQUA 2NW8A 3NRXA 4X62T 5FY0A 4QXCB 4EYUA 2KZ7B 5L3DB 4QWNB 3QB5K 3CK6A 3HKCE 2LRKA 3AA1B 2F4VT 5LXTE 4DV4T 3OYZA 1IZNB 2OA5A 4UF0B 3FXEB 5HYAA 3ONXA 4QXBB 3SRZA 5C3JA 5JVDE 2JMKA 2CLYB 2KWHA 3E0ZA 5LG4A 3PDYA 1OWAA 2WU5A 3RYHE 4AQYT 1R8IA 2FJBA 4ZOLE 4NUVA 2Q9QD 3CIRA 4ZHQE 4HWHA 2CBIA 4YHHT 4DMVA 4XAXB 3KV4A 5L3BB 3X1DA 3TLVA 2QYWA 2CEAA 5FXVA 2KXPB 3K3NA 3D0TA 4UEMA 3N9MA 3EAMA 3T1HT 2P9BA 4H63H 1JNRA 5JDNA 4DBRA 3A8YC 3AE5A 1UX4A 2KLQA 5HWYA 2C0SA 4KBMB 4UVBB 3WAJA 4U31A 2HHHT 4MBQA 3BQLA 4LF7T 3AEAA 4A98A 2XQ3A 3V5UA 4JGHD 1FJGT 4BAYB 4CN1A 2NW7A 4YJ2E 2JIWA 5EZYE 4LMJA 2M67A 1WRDA 5AQHB 5HEJA 2XQ8A 4EAHA 2E9XB 2UUAT 3QNUA 4E7SA 3AA0B 5L2LA 3LK3B 4V1Av 5HXRA 4IE0A 2XQ7A 4B3MT 1BR4A 4HFIA 3AB3B 3O9XA 1OXZA 3PJAJ 1YKEB 4G2AA 3FHNA 3RYIE 2IDOB 1U6GA 5ABFA 4HE8A 4HFBA 3GN5B 4JLEA 2LKGA 1E2AA 1FIOA 1UGOA 5FVLA 3R6NA 3UU4A 3P8CD 4ZI3D 3NZPA 5IHYA 2V7IA 4JI8T 2W66A 3ONJA 4WW0A 5ADXL 1N34T 1VRBA 2W4XA 3IBPA 2KSRA 4ZEYA 1AJ3A 4PFPA 3UUMA 3WAKA 3T1YT 4U7IA 3AAIA 4YT0A 2D0UA 3KVBA 4EEDA 4TNWA 1XMOT 3ONLC 2NOXA 4X20E 3CMLA 1T98A 3UQ4A 4OFZA 3L3PA 4JI6T 4A64A 4TV9E 2YDQA 3AA7B 4H9QC 1IBKT 3PURA 4HEAA 2BG9A 5LHIB 2ODUA 5FL0A 3GMIA 2WP9A 2JQQA 3PE0A 4ANJA 2PFVA 2X0LB 4COFA 2Y48B 5F5WA 4X66T 3AEFA 4JI3T 4F8HA 3ZC0A 2XU0A 1NEKA 1QUUA 2VKHA 2V7LA 1IJ5A 3B5MA 1D0YA 3JC6C 4PJMA 2BS2A 5HCMA 4EZHA 4XBFB 5HAXA 3JC6D 2IW5B 2LHNA 5LP6E 1UUSA 4ZI2C 2BG9C 3PUZF 4X1KE 5LOVE 2IIUA 3MKDA 2BG9E 1WLXA 2J47A 3ANWA 4GOUA 3RRWA 3PUXF 1HX1B 2QRXA 3PUSA 5DQVA 3U78A 4TWFA 3S4UA 3SFDA 4UR9A 2BDEA 2E2AA 3AEDA 2XQ5A 4Q25A 2LSYA 3HL6A 3ZYKA 4IE7A 4HFVA 2X0YA 2LHRA 3F2EA 5J2TE 3UFEA 4F6RC 2V5CA 2ZMAA 1M62A 3AECA 4IIJE 2VB6A 2UU9T 1I6ZA 4NXNT 3M65A 2MYSA 3T8OA 1HTJF 1HNZT 2IUBA 4PNIA 2VURA 3DPLC 4PK6A 3EHZA 5JR9A 2DLRA 4H63V 2K24A 3TLTA 1KF6A 5JDMA 2K3WA 4N78D 4DV7T 3EDVA 3C4XA 4U33A 3SS1A 1W9RA 3UU8A 3NVOA 4MFRA 3MXZA 5IUXA 1UX5A 4TUYE 4M1PA 2D0TA 4Z90A 3TLSA 1I94T 2WY2A 1XNRT 2LEHA 3N2GE 5JR9C 3AXJB 3LJCA 1XDOA 4KMCA 4U7YA 1KFYA 1ZHCA 4ILBA 4X1IE 5J0ZA 2VQET 3RC8A 3LBXB 4C91A 4JUYA 2IC9A 5A1LA 3AE2A 2XTLA 2V7KA 5FP3A 4QXHB 4IGUA 3N5LA 5LNKA 1KNPA 3CX8B 1D1BA 3AE3A 2H3RA 4NPPA 3CWZB 3IHRA 5J1GA 3RPUA 2C5JA 5JDFA 3VU7H 4GYSA 4I43B 4DBQA 3FBLA 3KVAA 4AKRB 3DQVC 2RA1A 2E8IA 2X66A 2X67A 5LJNA 4XZCA 1M7KA 2CWYA 1L0VA 5AQIB 2W67A 4DV0T 4X1YE 1W0AA 3ZEFB 4AP2B 2X9YA 4X64T 5J2UE 1MMAA 2CM0A 1HG2A 2LLYA 2DCFA 2LOPA 4BJMA 2KWIB 4JI4T 2X51A 3EDUA 2DI4A 5JTGA 3ZYMA 3TLUA 5AQVB 3UULA 4JV5T 2XM2A 1NWMX 4QH4A 1HR0T 1W09A 4A97A 2Q9QB 4PFOA 2WWVA 4HFHA 5L47A 2A2FX 3AE8A 4X5TA 5LJMA 1G73A 1FEWA 3KV5A 4DR2T 1X9BA 5LBMA 1OEDB 2WWUA 1LDKA 5CGMA 4HFCA 5M4YA 4CQIA 2FJDA 5CJ5A 1D1AA 3O1HA 5CA0E 2W61A 2NP9A 4HWCA 2I6HA 3UT5E 3VRBA 1MMDA 1O3XA 2YKSA 4LFCT 5LG3A 4AI6A 4EV6A 5HWXA 3Q9DA 1VCTA 4ILUA 3LG7A 3ZMVB 4MHCA 5CB4E 3BQKA 4EOZB 5LGNB 2VQFT 1XDPA 4H9RC 1WR6A 5AQNB 4FJOA 4O4JE 3DP7A 5AQGB 3J9X1 2XSAA 4Z8XA 2DL1A 3OBVE 3SOLA 5LBQB 4PK4A 1Y01A 4B3RT 3QK6A 2HN1A 5LB7B 4KUMB 5H6QB 2W63A 3AE6A 3CQXC 4OYKA 3OJAA 3OVUA 1LKXA 4UF0A 4DMWA 4NIQA 5AQRB 3L39A 5AQOB 3WI3A 2V8SV 4UXNB 2YINA 1YD8G 2BS4A 4DV3T 5AFUL 3RIAA 2W00A 2WBLA 3PUGA 2UXDT 4QH1A 2E5LT 1HCIA 2ODVA 3HI2A 3IA3A 2I0MA 3VR8A 3CKDA 2LE8A 2NTXA 4IHJE 4H9NC 4HXIB 4OK0A 5HXCA 2J62A 2XASB 5LGUB 1NENA 4DO0A 2MPKA 4LF6T 2UXBT 1CUNA 2CLYC 3RKOA 2WQYA 2C5KT 3NRYA 4CI2B 3PTRB 2XSBA 2B1EA 4A5XA 4DR5T 3C51A 1KK7A 3Q5WA 2X9WA 3DTOA 4DR4T 2V6YB 3RC3A 2FUPA 4NUUA 2NTYA 2VKJA 3MK7C 5L4HA 3RLFF 2BKOA 4PJLA 2L8KA 3I0QA 3CX7B 3QC9A 3RGLA 2L9QA 5JDLA 1VOMA 2JJ9A 4GYRA 4YY3T 4DV5T 1S35A 2XQAA 4UELA 3OPCA 3AE4A 4AKGA 2ZM6T 1T72A 5FYMA 4H9SE 3C98B 3P7IA 4LFAT 4LFBT 4DNDA 4A56A 2E9XA 3P4QA 2D5UA 2XAFB 4P0AA 5ETWA 5AQLB 4CN6A 3KINB 1XWMA 2UUCT 2HPJA 3ZSSA 5EK3A 2I59A 2QA7A 4EIWA 4AKIA 4YTPA 4DV2T 4ZS3A 4PJJA 3GN5A 2UUBT 3RIUA 1LRZA 4YLHA 4LF5T 5LHHB 4ADZA 2XQ9A 3O1IA 2H89A 3PV0F 5LCYA 3AA6B 2E9XC 2DHRA 2ZM8A 2ACZA 4O2AE 3UTKA 5AQJB 2BBHA 3AE7A 3G06A 4DR1T 3I9WA 5HXHA 3FBZA 2XPKA 1WYCA 2CE7A 4UV8B 2BVMA 4B3TT 3LK42 3VKHA 2YN6A 4I4TE 3RIUC 5L3GB 2HPLA 3JADA 3KFWX 3Q2MA 2CMRA 5KDMC 5AQSB 5HXEA 2L3LA 4DR3T 2W2UA 3NKZA 3MJXA 3R84B 4IE6A 3RF1A 4EZ4A 5AQMB 1JNZA 3C50A 2ZLYA 2LOSA 3FZMB 2NW9A 2K48A 2AXDS 2WCAA 4ZI2D 2V5DA 3I0OA 4JEUB 2BBJA 3BK9A 2BS3A 3LSVA 2G0UA 2XUEA 4KHPT 5ABGA 4F52A 2ZM0A 2CWOA 1SUMB 1MIYA 1YXRA 5DQWA 1KNZA 4TWHA 2LM2A 2J1DG 3RX6A 2CA5A 3Q5XA 1UCUA 3B57A 4ILAA 2VASA 3FZLB 4TN7B 5IYZE 2WSSV 3HKEE 3A7MA 2JMHA 4ISTA 2BZBA 3KBTA 5AQQB 5FMNA 3PUYF 4UV9B 2DWKA 3LDQB 3ZMSB 3FXDB 1B7TA 3AAEB 3RI5A 5FVKA 3AVSA 1BR0A 1W0BA 4CXYA 1D0ZA 5JREA 1IBLT 5JRCB 3O4XE 3ZCJA 4IREA 3ETUA 2CBJA 2N1GA 1MNEA 3DJBA 2LT3A 4FI5A 3ZCIA 1FMWA 4IDZA 4E7ZA 5FNVE 2MAWA 2PG8A 4N9F3 1H7CA 4OHFA 3UUNA 3CVRA 4ILCA 3B13A 2MTQA 2YU1A 3N9QA 3RYFE 5JDQA 4HN9A 3ESLA 4P5OA 4P1NA 3ZSTA 3RH3A 3OYXA 4ZI7E 3L8RA 1XMQT 1CHUA 2IHR1 5BR8T 2OV9A 5JQGE 3P50A 3N9PA 3QOFA 1SE7A 3SFEA 2VKOA 4IDOA 2MOZA 2EHOB 4MLKA 2R6GF 4B6XA 3OKQA 4GK5E 4JI7T 5GONE 2CHNA 3AXJA 2K9AA 2WZKA 3VHLA 2WM9A 3O1JA 4AQFA 3LBXA 4GIWA 1U5PA 2WB5A 2LM9A 2XQYA 4AIUA 4O4LE 2XZEA 2A9UA 1N36T 2WDQA 4EXTA 1UK5A 1J1JA 1EZ3A 4L9IA 2H88A 3ZJ2A 3N2OA 3P4RA 4UVAB 4B3ST 2VK9A 3KDSE 4DVDA 4ERRA 1HNXT 3TKLB 3LK2B 4CXXA 2A72A 5DJQC 4NXMT 2LJLA 4Z91A 3FB2A 5L3FB 4TV8E 2WMOA 3ZT5A 5FXWA 1LDJA 2Y6XA 4DUYT 2FJEA 2X68A 2WZIA 3QUJA 2VL0A 4AQFC 4IE5A 2BVLA 1ZKEA 4I0UA 1ZP0A 4HFDA 2UXNB 4GK0E 4CZZB 4OX9T 1FMVA 4I55E 4HWFA 1IBMT 4OYJA 3JAEA 3ZN1B 2JQHA 2WU2A 2W62A 1ZOYA 2ACXA 3H37A 5HEOA 1YW0A 3ABVA 1T7SA 3VKGA 4JI1T 3L09A 5FL1A 2QVAA 2KMFA 2Q9QA 4K0UA 4UIGA 3NZQA 4ZS2A 4TNVA 3Q5EA 4QX7B 5AQUB 4CXWA 3C64A 2VVSA 2V7JA 1OEDA 3AEGA 3VR9A 1MIVA 2VVNA 5LMUT 4EEBA 1N32T 3HR0A 4BA9A 5FXZA 4H9OC 4WBNE 3P4PA 4JYAT 3AE9A 3MZKB 3PUWF 4WBOA 1HX8A 3EVYA 4MALA 3PJAA 3RRCA 2Q9QC 3OTOT 5JH7E 4QKNA 4WNKA 4EB6E 4LF8T 3UFGA 4L0RA 2IMLA 4JI2T 3CX6B 3AVRA 4DIDB 3EUHA 1IJ6A 1OEDC 3NBXX 4CI1B 1XNQT 5H6RB 1OEDE 1IAPA 2LKHA 5AQFB 4J2CA 1HFAA 1ZEEA 5AQKB 4TWDA 4YTNA 2UXCT 5KXJA 3RYCE 1UURA 5HCJA 1NAFA 2C5IT 5LMNT 3ZMUB 4EGWA 2FJAA 3RTRA 2V6XA 2JRKA 3HKBE 2RP4A 4EYYR 3H3AA 4P09A 2A3DA 2FBWA 5ABFB 4HTEA 2N9DA 4QH5A 4QHOA 2YK0A 2V26A 5EK4A 2LSIA 2Y8DA 4IE4A 4PK5A 2PBIA 3J7Yq 3FZKB 2GK9A 1KEYA 4BJNA 2B76A 4AKHA 2H7OA 4HWDA 3CQGB 5LHGB 3P4WA 4AQGA 4DR7T 5ABHA 4KP3C 1YKHB 2W0GA 5HEGA 4JEHB 1Y64B 3K1SA 1DU2A 3RIFA 2WZHA 2YU2A 5LYJE 1N33T 2N2NA
chains in the Genus database with same CATH topology
2KWHA 2WMNA 3E0ZA 2ZM0A 2CWOA 5LG4A 2H3RA 3CWZB 1MIYA 2CXLA 3IHRA 5J1GA 5DQWA 3RPUA 5E0OA 3PDYA 1OWAA 3CQCB 1KNZA 4TX5A 4ZI3C 2C5JA 5JDFA 2SPCA 3ZN0B 3VU7H 2J1DG 3N9NA 3RX6A 2CA5A 3Q5XA 3W15B 1UCUA 3B57A 4GYSA 4I43B 3RYHE 4DBQA 2VASA 4ZOLE 4NUVA 3FBLA 3KVAA 2Q9QD 3UUXB 4TN7B 4AKRB 2RA1A 4ZHQE 2E8IA 2X66A 2X67A 2WSSV 3HKEE 5IYZE 3U3IA 3LFMA 5LJNA 2JMHA 4XZCA 4ISTA 2V1DB 1ZV4X 2BZBA 2X9XA 4XAXB 4DMVA 3KBTA 2CWYA 5JDHA 2UXXB 5FMNA 4C90A 3KV4A 4UV9B 5L3BB 2DWKA 3KBUA 1QSDA 4X1YE 2CEAA 3ZEFB 3KV9A 4PW8A 5FXVA 2X9YA 3ZMSB 5J2UE 2KXPB 3FXDB 3K3NA 1B7TA 1MMAA 3AAEB 3D0TA 2CM0A 3AVSA 1BR0A 3K3QC 1HG2A 4O2BE 4CXYA 4UEMA 1D0ZA 3N9MA 5JREA 2DCFA 2LOPA 2E9XD 4BJMA 2P9BA 5JRCB 2KWIB 3O4XE 3ZCJA 2CXFA 4H63H 2X51A 4ASKA 3EDUA 3ETUA 2DI4A 4YJ3E 2N1GA 1MNEA 2KNDA 5JDNA 4DBRA 5FY7A 1V9DA 3ZYMA 3DJBA 2LT3A 4FI5A 3UULA 1UX4A 4H9PC 1NWMX 2Q9QB 3ZCIA 2KLQA 4PFOA 5HWYA 3F57A 3ZC1A 2A2FX 1FMWA 4IDZA 4E7ZA 5FNVE 2PG8A 3N9LA 2C0SA 1E1HB 1S94A 5LJMA 4KBMB 4UVBB 1H7CA 3WAJA 4OHFA 4HKAA 2NWBA 4MBQA 3UUNA 3CVRA 3BQLA 1G73A 3B13A 1FEWA 2MTQA 1D1CA 2YU1A 3E22E 2VL8A 3KV5A 3N9QA 3RYFE 5JDQA 5LBMA 1LVFA 4HN9A 3V5UA 2WWUA 2ZM2A 3ESLA 4BAYB 4YJ2E 2NW7A 5EZYE 3ANWB 2M67A 4CQIA 1WRDA 1MMNA 3I9YA 5M4YA 4YHJA 3RH3A 3OYXA 1D1AA 3K3OA 4EAHA 4ZI7E 2E9XB 3O1HA 4E7SA 3AA0B 5CA0E 5L2LA 2W61A 3LK3B 2NP9A 4V1Av 5HXRA 3PU3A 2XAGB 4IE0A 3UT5E 1MMDA 1BR4A 1O3XA 3AB3B 3O9XA 1OXZA 5JQGE 1YKEB 4G2AA 3N9PA 3FHNA 5TAOA 3RYIE 4AI6A 3HA4A 5HWXA 3Q9DA 2VKOA 3A5XA 4ILUA 3LG7A 3ZMVB 2XHEB 5HXSA 4HE8A 2MOZA 4MHCA 5CB4E 2EHOB 3GN5B 3BQKA 4JLEA 4EOZB 4HGAA 4MLKA 5LGNB 1FIOA 1MMGA 4B6XA 3OKQA 4H9RC 4GK5E 1MNDA 1WR6A 1Z0PA 2LSKA 4FJOA 3R6NA 2D2SA 1SHZC 3P8CD 4ZI3D 4I50E 4O4JE 3DP7A 5GONE 3NZPA 5IHYA 5LA6E 3J9X1 5CA1E 2K9AA 5JR9B 5DABA 4Z8XA 2V7IA 3OBVE 3N9OA 3VHLA 4O4IE 5LBQB 3SOLA 2QGSA 2WM9A 3O1JA 4PK4A 4QX8B 3LBXA 4WW0A 4AQFA 3QK6A 4GIWA 5ADXL 1U5PA 5JDGA 1VRBA 4KUMB 2LM9A 2VKDA 3IBPA 2WAUA 2XQYA 1AJ3A 4O4LE 1MIWA 5C8YE 5H6QB 2W63A 4PFPA 3CQXC 4OYKA 3OJAA 4UF0A 1LKXA 4DMWA 3UUMA 3WAKA 4EXTA 3AAIA 3ETVA 1EZ3A 3C4WA 4L9IA 3ZJ2A 3N2OA 4UVAB 3WI3A 2VK9A 3KDSE 4DVDA 4ERRA 4UXNB 2D0UA 2YINA 3GWHA 3KVBA 3TKLB 4AXPA 1U4QA 1YD8G 3LK2B 4CXXA 5LGTB 2A72A 1SA0E 5DJQC 5KX5E 2NOXA 5L3CB 2LJLA 4X20E 3FB2A 3ZYLA 3CMLA 2H7VC 1T98A 4TV8E 5AFUL 5L3FB 4OFZA 3L3PA 2WMOA 4ISSA 2IAKA 5FXWA 3BQIA 2Y6XA 2W00A 4P0BA 2WBLA 3PUGA 2X68A 3KV6A 4TV9E 1HCIA 2K5BB 2ODVA 2X9HA 3HI2A 3HKDE 3QUJA 3PU8A 3AA7B 3CKDA 2LE8A 4AQFC 2NTXA 4IE5A 4H9QC 2BVLA 1ZKEA 4IHJE 4H9NC 5L3EB 2UXNB 4GK0E 2DNXA 4OK0A 4CZZB 5HXCA 1FMVA 2XASB 4U72A 1WYBA 4I55E 1HS7A 3MACA 5LGUB 3PURA 4HEAA 4DO0A 4UVCB 5F8PA 5LHIB 4OYJA 2MBGA 2ODUA 1CUNA 2CLYC 3RKOA 3ZN1B 2C5KT 3GMIA 3NRYA 4CI3B 4CI2B 3PUAA 2JQQA 3PTRB 3K8PC 2CXDA 2W62A 3PE0A 4ANJA 2B1EA 2PFVA 5FXXA 2ACXA 2X0LB 3C51A 3H37A 3F31A 5JRCA 1KK7A 2Y48B 1YW0A 2KT9A 3Q5WA 2X9WA 3DTOA 3VKGA 5EK2A 2LSGA 3RC3A 3ZC0A 3L09A 4NUUA 2NTYA 2XU0A 1QUUA 2VKHA 2PJQA 2VKJA 2V7LA 1IJ5A 3MK7C 2KMFA 2Q9QA 4G63A 4K0UA 4PJLA 3C4ZA 4UIGA 2L8KA 3I0QA 3CX7B 3NZQA 3QC9A 5BMVE 1D0YA 3JC6C 4PJMA 4ZS2A 4EZHA 2VWAA 3I1AA 4QX7B 4XBFB 3E08A 2L9QA 5HAXA 5JDLA 2IC6A 3JC6D 2IW5B 1VOMA 2LHNA 4CXWA 2JJ9A 4GYRA 3MA9A 5LP6E 3IEEA 3SWHA 3C64A 2V7JA 4ZI2C 1S35A 2Z6EA 4UELA 4X1KE 5LOVE 4AKGA 4L5GA 3MKDA 5FYMA 2XAJB 1WLXA 4H9SE 3C98B 4YFSA 3P7IA 2CCQA 3ANWA 4GOUA 3RRWA 1HF8A 2XAQB 1MIVA 3ZJ1A 4DNDA 3PUSA 5DQVA 3U78A 3S4UA 2BDEA 4A56A 2E9XA 3HR0A 3ZMTB 4BA9A 1G8XA 2D5UA 5FXZA 4U74A 2XAFB 4H9OC 4WBNE 2LSYA 3HL6A 3ZYKA 4P0AA 1BR2A 4IE7A 3MZKB 2KINB 5ETWA 4HFVA 3KINB 1HX8A 3EVYA 4WBOA 2HPJA 5F3JA 4MALA 1US7B 5EK3A 2LHRA 3F2EA 4O8SA 2I59A 3RRCA 2Q9QC 1X79A 2QA7A 5J2TE 5JH7E 4QKNA 4PAGA 4WNKA 4EIWA 5KMGP 4AKIA 3UFEA 4EB6E 4F6RC 3ZLIA 4TZ4C 4L0RA 2HH7A 2ZMAA 4ZS3A 3CX6B 3AVRA 4PJJA 4AKLA 4IIJE 2V7MA 2EHOA 3GN5A 3EUHA 2VB6A 1BR1A 1LRZA 1IJ6A 3NBXX 2YEVC 4CI1B 5H6RB 4YLHA 1IAPA 3ZMZB 5LHHB 4ADZA 3O1IA 3M65A 2JPFA 1HFAA 2MYSA 4J2CA 1ZEEA 3T8OA 2DWGA 1HTJF 5LCYA 3AA6B 4PNIA 3RYCE 2E9XC 4PJNA 4PK6A 2DHRA 3N2KE 5JR9A 3ZPOA 2DLRA 4H63V 1NAFA 1D0XA 2C5IT 2ZM8A 2XAHB 2K24A 4O2AE 3UTKA 5JDMA 3ZMUB 4N78D 5FY1A 4O4HE 3EDVA 1HG5A 2LSJA 3C4XA 3I9WA 3AAAB 3IF8B 3SS1A 5HXHA 1LVKA 3FBZA 2JRKA 3HKBE 3V5SA 2RP4A 1WYCA 2CE7A 4EYYR 4UV8B 2BVMA 3H3AA 4MFRA 3MXZA 3CPZA 3PUQA 4P09A 3LK42 3VKHA 1UX5A 2EHOC 2A3DA 4TUYE 4I4TE 5L3GB 3GA8A 4HTEA 2N9DA 4M1PA 2ES0A 2EHOD 2HPLA 2D0TA 3KFWX 2YK0A 4QHOA 3Q2MA 2CMRA 2NW8A 5KDMC 3NRXA 2V26A 5EK4A 2LSIA 5HXEA 2Y8DA 2L3LA 4IE4A 4PK5A 2PBIA 3J7Yq 5FY0A 2LEHA 3N2GE 4QXCB 5JR9C 3MJXA 4EYUA 2KZ7B 2GK9A 3R84B 3LJCA 4QWNB 4IE6A 4BJNA 5L3DB 4KMCA 4EZ4A 3HKCE 4AKHA 3AA1B 2H7OA 1ZHCA 3C50A 3CQGB 2ZLYA 4X1IE 5LXTE 5LHGB 3RC8A 2LOSA 4AQGA 3LBXB 3OYZA 4KP3C 4C91A 1IZNB 1YKHB 4JUYA 2IC9A 2K48A 2NW9A 2W0GA 2OA5A 5A1LA 4JEHB 1Y64B 4UF0B 3FXEB 5HYAA 2XTLA 4ZI2D 3ONXA 3I0OA 2V7KA 4JEUB 4QXBB 4QXHB 3BK9A 5FP3A 4IGUA 3N5LA 3SRZA 5LNKA 2YU2A 3CX8B 5LYJE 2G0UA 2XUEA 5JVDE 2JMKA 1D1BA 2CLYB 2N2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK0 A;  4NUV A;  2Y8D A;  3BQL A;  4NUU A;  3RRC A;  2XU0 A;  3BQI A;  3C64 A;  3CML A;  3CPZ A;  4YFS A;  2WAU A;  3BQK A;  5F3J A; 
#chains in the Genus database with same CATH topology
 2OLT A;  4ZXL A;  2WMN A;  2J4G A;  2CXL A;  5E0O A;  4KHZ F;  3CQC B;  4TX5 A;  2CRB A;  4ZI3 C;  2V6Y A;  2SPC A;  3ZN0 B;  3N9N A;  3W15 B;  3UUX B;  1J5E T;  3U3I A;  3LFM A;  2V1D B;  1ZV4 X;  2X9X A;  3UU3 A;  5JDH A;  2UXX B;  4C90 A;  4HFE A;  2WS3 A;  3KBU A;  1QSD A;  2BG9 B;  3AEE A;  4U3C A;  3KV9 A;  4PW8 A;  3K3Q C;  4O2B E;  3TLW A;  5AQP B;  2E9X D;  2BKN A;  2CXF A;  4ASK A;  3FZF B;  4YJ3 E;  3JCF A;  2KND A;  5CFB A;  5FY7 A;  1V9D A;  3NWI A;  4H9P C;  3RKG A;  2AE9 A;  3F57 A;  3ZC1 A;  3RQW A;  3N9L A;  1E1H B;  1S94 A;  4HKA A;  2NWB A;  1HNW T;  3E22 E;  1D1C A;  2YDR A;  2VL8 A;  1LVF A;  3JAF A;  2ZM2 A;  3ANW B;  1MMN A;  3I9Y A;  4YHJ A;  4IL9 A;  3K3O A;  4LML A;  4IT4 A;  1VCS A;  3PU3 A;  2XAG B;  4DUZ T;  5HEU A;  5TAO A;  3HA4 A;  3A5X A;  4LMK A;  2XHE B;  5HXS A;  4IDP A;  3P4S A;  4GKK T;  4HGA A;  1MMG A;  1MND A;  1Z0P A;  3M3Z B;  3ZT7 A;  1QLB A;  2LSK A;  4ZZC A;  3RHW A;  2D2S A;  1SHZ C;  4YSZ A;  4IDQ A;  4I50 E;  2HN2 A;  4YXD A;  5LA6 E;  2D9D A;  5CA1 E;  3AE1 A;  4DV6 T;  2XQ4 A;  5JR9 B;  5DAB A;  3N9O A;  4O4I E;  2QGS A;  4QX8 B;  5JDG A;  3ZT6 A;  4APF B;  2VKD A;  2WAU A;  5IWA T;  1MIW A;  5C8Y E;  1YQ4 A;  2YDS A;  4IDN A;  3ETV A;  1YQ3 A;  3C4W A;  4IL4 A;  3GWH A;  4AXP A;  1U4Q A;  4AIS A;  5LGT B;  2YOE A;  1SA0 E;  4KX6 A;  5KX5 E;  4U2Y A;  5L3C B;  1WFD A;  3UUB A;  3AEB A;  3ZYL A;  2H7V C;  4YSY A;  4ISS A;  2IAK A;  4CN4 A;  3BQI A;  4P0B A;  3KV6 A;  3ZKR A;  2K5B B;  4WQO D;  2X9H A;  3HKD E;  3PU8 A;  2M6B A;  4LF4 T;  3FZH B;  5L3E B;  2DNX A;  4U72 A;  1WYB A;  1HS7 A;  3MAC A;  2BKP A;  4UVC B;  5F8P A;  2LRL A;  2MBG A;  3EI0 A;  3UQ7 A;  4CI3 B;  5FKY A;  3PUA A;  4JI0 T;  2JQK A;  3K8P C;  2CXD A;  1Z8U A;  1J5W A;  5FXX A;  3EAB A;  3F31 A;  5JRC A;  4LF9 T;  2XM1 A;  2KT9 A;  2E5V A;  1E7P A;  2JQ9 A;  1XZY A;  5EK2 A;  2LSG A;  2PJQ A;  4WZX A;  4G63 A;  4X65 T;  3C4Z A;  3UU6 A;  5BMV E;  2VWA A;  3I1A A;  3H3M A;  3E08 A;  4HWI B;  2IC6 A;  3MA9 A;  3IEE A;  3SWH A;  1WR0 A;  5HEH A;  2Z6E A;  4L5G A;  2XAJ B;  4JBW F;  4YFS A;  2CCQ A;  1HF8 A;  2XAQ B;  3ZJ1 A;  1GQE A;  2PTF A;  4JI5 T;  3ZMT B;  5AQT B;  1G8X A;  4U74 A;  2WDV A;  1BR2 A;  2KIN B;  3QB5 A;  4YSX A;  4DR6 T;  5F3J A;  5C2T A;  4KI0 F;  1US7 B;  4O8S A;  1X79 A;  4PAG A;  5KMG P;  1T8B A;  3ZLI A;  4TZ4 C;  4U2Z A;  2HH7 A;  4DV1 T;  4AKL A;  2V7M A;  2EHO A;  1BR1 A;  2YEV C;  4WYV A;  3PUV F;  3ZMZ B;  1WCR A;  4GKJ T;  2JPF A;  2WDR A;  2DWG A;  1LDK B;  5L4E A;  4PJN A;  4K0K T;  3N2K E;  2M6I A;  3ZPO A;  1D0X A;  2NR4 A;  2XAH B;  4YTM A;  4ZZB A;  5FY1 A;  1KNR A;  4O4H E;  1HG5 A;  2LSJ A;  3Q5D A;  3AAA B;  2XQ6 A;  3IF8 B;  1LVK A;  2XY8 B;  3V5S A;  3VRA A;  2X0H A;  3UU5 A;  3CPZ A;  3PUQ A;  2CPT A;  2CHO A;  2EHO C;  3GA8 A;  2ES0 A;  2EHO D;  5ABE A;  2XJ7 A;  2RPA A;  3RQU A;  2NW8 A;  3NRX A;  4X62 T;  5FY0 A;  4QXC B;  4EYU A;  2KZ7 B;  5L3D B;  4QWN B;  3QB5 K;  3CK6 A;  3HKC E;  2LRK A;  3AA1 B;  2F4V T;  5LXT E;  4DV4 T;  3OYZ A;  1IZN B;  2OA5 A;  4UF0 B;  3FXE B;  5HYA A;  3ONX A;  4QXB B;  3SRZ A;  5C3J A;  5JVD E;  2JMK A;  2CLY B;  2KWH A;  3E0Z A;  5LG4 A;  3PDY A;  1OWA A;  2WU5 A;  3RYH E;  4AQY T;  1R8I A;  2FJB A;  4ZOL E;  4NUV A;  2Q9Q D;  3CIR A;  4ZHQ E;  4HWH A;  2CBI A;  4YHH T;  4DMV A;  4XAX B;  3KV4 A;  5L3B B;  3X1D A;  3TLV A;  2QYW A;  2CEA A;  5FXV A;  2KXP B;  3K3N A;  3D0T A;  4UEM A;  3N9M A;  3EAM A;  3T1H T;  2P9B A;  4H63 H;  1JNR A;  5JDN A;  4DBR A;  3A8Y C;  3AE5 A;  1UX4 A;  2KLQ A;  5HWY A;  2C0S A;  4KBM B;  4UVB B;  3WAJ A;  4U31 A;  2HHH T;  4MBQ A;  3BQL A;  4LF7 T;  3AEA A;  4A98 A;  2XQ3 A;  3V5U A;  4JGH D;  1FJG T;  4BAY B;  4CN1 A;  2NW7 A;  4YJ2 E;  2JIW A;  5EZY E;  4LMJ A;  2M67 A;  1WRD A;  5AQH B;  5HEJ A;  2XQ8 A;  4EAH A;  2E9X B;  2UUA T;  3QNU A;  4E7S A;  3AA0 B;  5L2L A;  3LK3 B;  4V1A v;  5HXR A;  4IE0 A;  2XQ7 A;  4B3M T;  1BR4 A;  4HFI A;  3AB3 B;  3O9X A;  1OXZ A;  3PJA J;  1YKE B;  4G2A A;  3FHN A;  3RYI E;  2IDO B;  1U6G A;  5ABF A;  4HE8 A;  4HFB A;  3GN5 B;  4JLE A;  2LKG A;  1E2A A;  1FIO A;  1UGO A;  5FVL A;  3R6N A;  3UU4 A;  3P8C D;  4ZI3 D;  3NZP A;  5IHY A;  2V7I A;  4JI8 T;  2W66 A;  3ONJ A;  4WW0 A;  5ADX L;  1N34 T;  1VRB A;  2W4X A;  3IBP A;  2KSR A;  4ZEY A;  1AJ3 A;  4PFP A;  3UUM A;  3WAK A;  3T1Y T;  4U7I A;  3AAI A;  4YT0 A;  2D0U A;  3KVB A;  4EED A;  4TNW A;  1XMO T;  3ONL C;  2NOX A;  4X20 E;  3CML A;  1T98 A;  3UQ4 A;  4OFZ A;  3L3P A;  4JI6 T;  4A64 A;  4TV9 E;  2YDQ A;  3AA7 B;  4H9Q C;  1IBK T;  3PUR A;  4HEA A;  2BG9 A;  5LHI B;  2ODU A;  5FL0 A;  3GMI A;  2WP9 A;  2JQQ A;  3PE0 A;  4ANJ A;  2PFV A;  2X0L B;  4COF A;  2Y48 B;  5F5W A;  4X66 T;  3AEF A;  4JI3 T;  4F8H A;  3ZC0 A;  2XU0 A;  1NEK A;  1QUU A;  2VKH A;  2V7L A;  1IJ5 A;  3B5M A;  1D0Y A;  3JC6 C;  4PJM A;  2BS2 A;  5HCM A;  4EZH A;  4XBF B;  5HAX A;  3JC6 D;  2IW5 B;  2LHN A;  5LP6 E;  1UUS A;  4ZI2 C;  2BG9 C;  3PUZ F;  4X1K E;  5LOV E;  2IIU A;  3MKD A;  2BG9 E;  1WLX A;  2J47 A;  3ANW A;  4GOU A;  3RRW A;  3PUX F;  1HX1 B;  2QRX A;  3PUS A;  5DQV A;  3U78 A;  4TWF A;  3S4U A;  3SFD A;  4UR9 A;  2BDE A;  2E2A A;  3AED A;  2XQ5 A;  4Q25 A;  2LSY A;  3HL6 A;  3ZYK A;  4IE7 A;  4HFV A;  2X0Y A;  2LHR A;  3F2E A;  5J2T E;  3UFE A;  4F6R C;  2V5C A;  2ZMA A;  1M62 A;  3AEC A;  4IIJ E;  2VB6 A;  2UU9 T;  1I6Z A;  4NXN T;  3M65 A;  2MYS A;  3T8O A;  1HTJ F;  1HNZ T;  2IUB A;  4PNI A;  2VUR A;  3DPL C;  4PK6 A;  3EHZ A;  5JR9 A;  2DLR A;  4H63 V;  2K24 A;  3TLT A;  1KF6 A;  5JDM A;  2K3W A;  4N78 D;  4DV7 T;  3EDV A;  3C4X A;  4U33 A;  3SS1 A;  1W9R A;  3UU8 A;  3NVO A;  4MFR A;  3MXZ A;  5IUX A;  1UX5 A;  4TUY E;  4M1P A;  2D0T A;  4Z90 A;  3TLS A;  1I94 T;  2WY2 A;  1XNR T;  2LEH A;  3N2G E;  5JR9 C;  3AXJ B;  3LJC A;  1XDO A;  4KMC A;  4U7Y A;  1KFY A;  1ZHC A;  4ILB A;  4X1I E;  5J0Z A;  2VQE T;  3RC8 A;  3LBX B;  4C91 A;  4JUY A;  2IC9 A;  5A1L A;  3AE2 A;  2XTL A;  2V7K A;  5FP3 A;  4QXH B;  4IGU A;  3N5L A;  5LNK A;  1KNP A;  3CX8 B;  1D1B A;  3AE3 A;  2H3R A;  4NPP A;  3CWZ B;  3IHR A;  5J1G A;  3RPU A;  2C5J A;  5JDF A;  3VU7 H;  4GYS A;  4I43 B;  4DBQ A;  3FBL A;  3KVA A;  4AKR B;  3DQV C;  2RA1 A;  2E8I A;  2X66 A;  2X67 A;  5LJN A;  4XZC A;  1M7K A;  2CWY A;  1L0V A;  5AQI B;  2W67 A;  4DV0 T;  4X1Y E;  1W0A A;  3ZEF B;  4AP2 B;  2X9Y A;  4X64 T;  5J2U E;  1MMA A;  2CM0 A;  1HG2 A;  2LLY A;  2DCF A;  2LOP A;  4BJM A;  2KWI B;  4JI4 T;  2X51 A;  3EDU A;  2DI4 A;  5JTG A;  3ZYM A;  3TLU A;  5AQV B;  3UUL A;  4JV5 T;  2XM2 A;  1NWM X;  4QH4 A;  1HR0 T;  1W09 A;  4A97 A;  2Q9Q B;  4PFO A;  2WWV A;  4HFH A;  5L47 A;  2A2F X;  3AE8 A;  4X5T A;  5LJM A;  1G73 A;  1FEW A;  3KV5 A;  4DR2 T;  1X9B A;  5LBM A;  1OED B;  2WWU A;  1LDK A;  5CGM A;  4HFC A;  5M4Y A;  4CQI A;  2FJD A;  5CJ5 A;  1D1A A;  3O1H A;  5CA0 E;  2W61 A;  2NP9 A;  4HWC A;  2I6H A;  3UT5 E;  3VRB A;  1MMD A;  1O3X A;  2YKS A;  4LFC T;  5LG3 A;  4AI6 A;  4EV6 A;  5HWX A;  3Q9D A;  1VCT A;  4ILU A;  3LG7 A;  3ZMV B;  4MHC A;  5CB4 E;  3BQK A;  4EOZ B;  5LGN B;  2VQF T;  1XDP A;  4H9R C;  1WR6 A;  5AQN B;  4FJO A;  4O4J E;  3DP7 A;  5AQG B;  3J9X 1;  2XSA A;  4Z8X A;  2DL1 A;  3OBV E;  3SOL A;  5LBQ B;  4PK4 A;  1Y01 A;  4B3R T;  3QK6 A;  2HN1 A;  5LB7 B;  4KUM B;  5H6Q B;  2W63 A;  3AE6 A;  3CQX C;  4OYK A;  3OJA A;  3OVU A;  1LKX A;  4UF0 A;  4DMW A;  4NIQ A;  5AQR B;  3L39 A;  5AQO B;  3WI3 A;  2V8S V;  4UXN B;  2YIN A;  1YD8 G;  2BS4 A;  4DV3 T;  5AFU L;  3RIA A;  2W00 A;  2WBL A;  3PUG A;  2UXD T;  4QH1 A;  2E5L T;  1HCI A;  2ODV A;  3HI2 A;  3IA3 A;  2I0M A;  3VR8 A;  3CKD A;  2LE8 A;  2NTX A;  4IHJ E;  4H9N C;  4HXI B;  4OK0 A;  5HXC A;  2J62 A;  2XAS B;  5LGU B;  1NEN A;  4DO0 A;  2MPK A;  4LF6 T;  2UXB T;  1CUN A;  2CLY C;  3RKO A;  2WQY A;  2C5K T;  3NRY A;  4CI2 B;  3PTR B;  2XSB A;  2B1E A;  4A5X A;  4DR5 T;  3C51 A;  1KK7 A;  3Q5W A;  2X9W A;  3DTO A;  4DR4 T;  2V6Y B;  3RC3 A;  2FUP A;  4NUU A;  2NTY A;  2VKJ A;  3MK7 C;  5L4H A;  3RLF F;  2BKO A;  4PJL A;  2L8K A;  3I0Q A;  3CX7 B;  3QC9 A;  3RGL A;  2L9Q A;  5JDL A;  1VOM A;  2JJ9 A;  4GYR A;  4YY3 T;  4DV5 T;  1S35 A;  2XQA A;  4UEL A;  3OPC A;  3AE4 A;  4AKG A;  2ZM6 T;  1T72 A;  5FYM A;  4H9S E;  3C98 B;  3P7I A;  4LFA T;  4LFB T;  4DND A;  4A56 A;  2E9X A;  3P4Q A;  2D5U A;  2XAF B;  4P0A A;  5ETW A;  5AQL B;  4CN6 A;  3KIN B;  1XWM A;  2UUC T;  2HPJ A;  3ZSS A;  5EK3 A;  2I59 A;  2QA7 A;  4EIW A;  4AKI A;  4YTP A;  4DV2 T;  4ZS3 A;  4PJJ A;  3GN5 A;  2UUB T;  3RIU A;  1LRZ A;  4YLH A;  4LF5 T;  5LHH B;  4ADZ A;  2XQ9 A;  3O1I A;  2H89 A;  3PV0 F;  5LCY A;  3AA6 B;  2E9X C;  2DHR A;  2ZM8 A;  2ACZ A;  4O2A E;  3UTK A;  5AQJ B;  2BBH A;  3AE7 A;  3G06 A;  4DR1 T;  3I9W A;  5HXH A;  3FBZ A;  2XPK A;  1WYC A;  2CE7 A;  4UV8 B;  2BVM A;  4B3T T;  3LK4 2;  3VKH A;  2YN6 A;  4I4T E;  3RIU C;  5L3G B;  2HPL A;  3JAD A;  3KFW X;  3Q2M A;  2CMR A;  5KDM C;  5AQS B;  5HXE A;  2L3L A;  4DR3 T;  2W2U A;  3NKZ A;  3MJX A;  3R84 B;  4IE6 A;  3RF1 A;  4EZ4 A;  5AQM B;  1JNZ A;  3C50 A;  2ZLY A;  2LOS A;  3FZM B;  2NW9 A;  2K48 A;  2AXD S;  2WCA A;  4ZI2 D;  2V5D A;  3I0O A;  4JEU B;  2BBJ A;  3BK9 A;  2BS3 A;  3LSV A;  2G0U A;  2XUE A;  4KHP T;  5ABG A;  4F52 A;  2ZM0 A;  2CWO A;  1SUM B;  1MIY A;  1YXR A;  5DQW A;  1KNZ A;  4TWH A;  2LM2 A;  2J1D G;  3RX6 A;  2CA5 A;  3Q5X A;  1UCU A;  3B57 A;  4ILA A;  2VAS A;  3FZL B;  4TN7 B;  5IYZ E;  2WSS V;  3HKE E;  3A7M A;  2JMH A;  4IST A;  2BZB A;  3KBT A;  5AQQ B;  5FMN A;  3PUY F;  4UV9 B;  2DWK A;  3LDQ B;  3ZMS B;  3FXD B;  1B7T A;  3AAE B;  3RI5 A;  5FVK A;  3AVS A;  1BR0 A;  1W0B A;  4CXY A;  1D0Z A;  5JRE A;  1IBL T;  5JRC B;  3O4X E;  3ZCJ A;  4IRE A;  3ETU A;  2CBJ A;  2N1G A;  1MNE A;  3DJB A;  2LT3 A;  4FI5 A;  3ZCI A;  1FMW A;  4IDZ A;  4E7Z A;  5FNV E;  2MAW A;  2PG8 A;  4N9F 3;  1H7C A;  4OHF A;  3UUN A;  3CVR A;  4ILC A;  3B13 A;  2MTQ A;  2YU1 A;  3N9Q A;  3RYF E;  5JDQ A;  4HN9 A;  3ESL A;  4P5O A;  4P1N A;  3ZST A;  3RH3 A;  3OYX A;  4ZI7 E;  3L8R A;  1XMQ T;  1CHU A;  2IHR 1;  5BR8 T;  2OV9 A;  5JQG E;  3P50 A;  3N9P A;  3QOF A;  1SE7 A;  3SFE A;  2VKO A;  4IDO A;  2MOZ A;  2EHO B;  4MLK A;  2R6G F;  4B6X A;  3OKQ A;  4GK5 E;  4JI7 T;  5GON E;  2CHN A;  3AXJ A;  2K9A A;  2WZK A;  3VHL A;  2WM9 A;  3O1J A;  4AQF A;  3LBX A;  4GIW A;  1U5P A;  2WB5 A;  2LM9 A;  2XQY A;  4AIU A;  4O4L E;  2XZE A;  2A9U A;  1N36 T;  2WDQ A;  4EXT A;  1UK5 A;  1J1J A;  1EZ3 A;  4L9I A;  2H88 A;  3ZJ2 A;  3N2O A;  3P4R A;  4UVA B;  4B3S T;  2VK9 A;  3KDS E;  4DVD A;  4ERR A;  1HNX T;  3TKL B;  3LK2 B;  4CXX A;  2A72 A;  5DJQ C;  4NXM T;  2LJL A;  4Z91 A;  3FB2 A;  5L3F B;  4TV8 E;  2WMO A;  3ZT5 A;  5FXW A;  1LDJ A;  2Y6X A;  4DUY T;  2FJE A;  2X68 A;  2WZI A;  3QUJ A;  2VL0 A;  4AQF C;  4IE5 A;  2BVL A;  1ZKE A;  4I0U A;  1ZP0 A;  4HFD A;  2UXN B;  4GK0 E;  4CZZ B;  4OX9 T;  1FMV A;  4I55 E;  4HWF A;  1IBM T;  4OYJ A;  3JAE A;  3ZN1 B;  2JQH A;  2WU2 A;  2W62 A;  1ZOY A;  2ACX A;  3H37 A;  5HEO A;  1YW0 A;  3ABV A;  1T7S A;  3VKG A;  4JI1 T;  3L09 A;  5FL1 A;  2QVA A;  2KMF A;  2Q9Q A;  4K0U A;  4UIG A;  3NZQ A;  4ZS2 A;  4TNV A;  3Q5E A;  4QX7 B;  5AQU B;  4CXW A;  3C64 A;  2VVS A;  2V7J A;  1OED A;  3AEG A;  3VR9 A;  1MIV A;  2VVN A;  5LMU T;  4EEB A;  1N32 T;  3HR0 A;  4BA9 A;  5FXZ A;  4H9O C;  4WBN E;  3P4P A;  4JYA T;  3AE9 A;  3MZK B;  3PUW F;  4WBO A;  1HX8 A;  3EVY A;  4MAL A;  3PJA A;  3RRC A;  2Q9Q C;  3OTO T;  5JH7 E;  4QKN A;  4WNK A;  4EB6 E;  4LF8 T;  3UFG A;  4L0R A;  2IML A;  4JI2 T;  3CX6 B;  3AVR A;  4DID B;  3EUH A;  1IJ6 A;  1OED C;  3NBX X;  4CI1 B;  1XNQ T;  5H6R B;  1OED E;  1IAP A;  2LKH A;  5AQF B;  4J2C A;  1HFA A;  1ZEE A;  5AQK B;  4TWD A;  4YTN A;  2UXC T;  5KXJ A;  3RYC E;  1UUR A;  5HCJ A;  1NAF A;  2C5I T;  5LMN T;  3ZMU B;  4EGW A;  2FJA A;  3RTR A;  2V6X A;  2JRK A;  3HKB E;  2RP4 A;  4EYY R;  3H3A A;  4P09 A;  2A3D A;  2FBW A;  5ABF B;  4HTE A;  2N9D A;  4QH5 A;  4QHO A;  2YK0 A;  2V26 A;  5EK4 A;  2LSI A;  2Y8D A;  4IE4 A;  4PK5 A;  2PBI A;  3J7Y q;  3FZK B;  2GK9 A;  1KEY A;  4BJN A;  2B76 A;  4AKH A;  2H7O A;  4HWD A;  3CQG B;  5LHG B;  3P4W A;  4AQG A;  4DR7 T;  5ABH A;  4KP3 C;  1YKH B;  2W0G A;  5HEG A;  4JEH B;  1Y64 B;  3K1S A;  1DU2 A;  3RIF A;  2WZH A;  2YU2 A;  5LYJ E;  1N33 T;  2N2N A; 
#chains in the Genus database with same CATH homology
 2KWH A;  2WMN A;  3E0Z A;  2ZM0 A;  2CWO A;  5LG4 A;  2H3R A;  3CWZ B;  1MIY A;  2CXL A;  3IHR A;  5J1G A;  5DQW A;  3RPU A;  5E0O A;  3PDY A;  1OWA A;  3CQC B;  1KNZ A;  4TX5 A;  4ZI3 C;  2C5J A;  5JDF A;  2SPC A;  3ZN0 B;  3VU7 H;  2J1D G;  3N9N A;  3RX6 A;  2CA5 A;  3Q5X A;  3W15 B;  1UCU A;  3B57 A;  4GYS A;  4I43 B;  3RYH E;  4DBQ A;  2VAS A;  4ZOL E;  4NUV A;  3FBL A;  3KVA A;  2Q9Q D;  3UUX B;  4TN7 B;  4AKR B;  2RA1 A;  4ZHQ E;  2E8I A;  2X66 A;  2X67 A;  2WSS V;  3HKE E;  5IYZ E;  3U3I A;  3LFM A;  5LJN A;  2JMH A;  4XZC A;  4IST A;  2V1D B;  1ZV4 X;  2BZB A;  2X9X A;  4XAX B;  4DMV A;  3KBT A;  2CWY A;  5JDH A;  2UXX B;  5FMN A;  4C90 A;  3KV4 A;  4UV9 B;  5L3B B;  2DWK A;  3KBU A;  1QSD A;  4X1Y E;  2CEA A;  3ZEF B;  3KV9 A;  4PW8 A;  5FXV A;  2X9Y A;  3ZMS B;  5J2U E;  2KXP B;  3FXD B;  3K3N A;  1B7T A;  1MMA A;  3AAE B;  3D0T A;  2CM0 A;  3AVS A;  1BR0 A;  3K3Q C;  1HG2 A;  4O2B E;  4CXY A;  4UEM A;  1D0Z A;  3N9M A;  5JRE A;  2DCF A;  2LOP A;  2E9X D;  4BJM A;  2P9B A;  5JRC B;  2KWI B;  3O4X E;  3ZCJ A;  2CXF A;  4H63 H;  2X51 A;  4ASK A;  3EDU A;  3ETU A;  2DI4 A;  4YJ3 E;  2N1G A;  1MNE A;  2KND A;  5JDN A;  4DBR A;  5FY7 A;  1V9D A;  3ZYM A;  3DJB A;  2LT3 A;  4FI5 A;  3UUL A;  1UX4 A;  4H9P C;  1NWM X;  2Q9Q B;  3ZCI A;  2KLQ A;  4PFO A;  5HWY A;  3F57 A;  3ZC1 A;  2A2F X;  1FMW A;  4IDZ A;  4E7Z A;  5FNV E;  2PG8 A;  3N9L A;  2C0S A;  1E1H B;  1S94 A;  5LJM A;  4KBM B;  4UVB B;  1H7C A;  3WAJ A;  4OHF A;  4HKA A;  2NWB A;  4MBQ A;  3UUN A;  3CVR A;  3BQL A;  1G73 A;  3B13 A;  1FEW A;  2MTQ A;  1D1C A;  2YU1 A;  3E22 E;  2VL8 A;  3KV5 A;  3N9Q A;  3RYF E;  5JDQ A;  5LBM A;  1LVF A;  4HN9 A;  3V5U A;  2WWU A;  2ZM2 A;  3ESL A;  4BAY B;  4YJ2 E;  2NW7 A;  5EZY E;  3ANW B;  2M67 A;  4CQI A;  1WRD A;  1MMN A;  3I9Y A;  5M4Y A;  4YHJ A;  3RH3 A;  3OYX A;  1D1A A;  3K3O A;  4EAH A;  4ZI7 E;  2E9X B;  3O1H A;  4E7S A;  3AA0 B;  5CA0 E;  5L2L A;  2W61 A;  3LK3 B;  2NP9 A;  4V1A v;  5HXR A;  3PU3 A;  2XAG B;  4IE0 A;  3UT5 E;  1MMD A;  1BR4 A;  1O3X A;  3AB3 B;  3O9X A;  1OXZ A;  5JQG E;  1YKE B;  4G2A A;  3N9P A;  3FHN A;  5TAO A;  3RYI E;  4AI6 A;  3HA4 A;  5HWX A;  3Q9D A;  2VKO A;  3A5X A;  4ILU A;  3LG7 A;  3ZMV B;  2XHE B;  5HXS A;  4HE8 A;  2MOZ A;  4MHC A;  5CB4 E;  2EHO B;  3GN5 B;  3BQK A;  4JLE A;  4EOZ B;  4HGA A;  4MLK A;  5LGN B;  1FIO A;  1MMG A;  4B6X A;  3OKQ A;  4H9R C;  4GK5 E;  1MND A;  1WR6 A;  1Z0P A;  2LSK A;  4FJO A;  3R6N A;  2D2S A;  1SHZ C;  3P8C D;  4ZI3 D;  4I50 E;  4O4J E;  3DP7 A;  5GON E;  3NZP A;  5IHY A;  5LA6 E;  3J9X 1;  5CA1 E;  2K9A A;  5JR9 B;  5DAB A;  4Z8X A;  2V7I A;  3OBV E;  3N9O A;  3VHL A;  4O4I E;  5LBQ B;  3SOL A;  2QGS A;  2WM9 A;  3O1J A;  4PK4 A;  4QX8 B;  3LBX A;  4WW0 A;  4AQF A;  3QK6 A;  4GIW A;  5ADX L;  1U5P A;  5JDG A;  1VRB A;  4KUM B;  2LM9 A;  2VKD A;  3IBP A;  2WAU A;  2XQY A;  1AJ3 A;  4O4L E;  1MIW A;  5C8Y E;  5H6Q B;  2W63 A;  4PFP A;  3CQX C;  4OYK A;  3OJA A;  4UF0 A;  1LKX A;  4DMW A;  3UUM A;  3WAK A;  4EXT A;  3AAI A;  3ETV A;  1EZ3 A;  3C4W A;  4L9I A;  3ZJ2 A;  3N2O A;  4UVA B;  3WI3 A;  2VK9 A;  3KDS E;  4DVD A;  4ERR A;  4UXN B;  2D0U A;  2YIN A;  3GWH A;  3KVB A;  3TKL B;  4AXP A;  1U4Q A;  1YD8 G;  3LK2 B;  4CXX A;  5LGT B;  2A72 A;  1SA0 E;  5DJQ C;  5KX5 E;  2NOX A;  5L3C B;  2LJL A;  4X20 E;  3FB2 A;  3ZYL A;  3CML A;  2H7V C;  1T98 A;  4TV8 E;  5AFU L;  5L3F B;  4OFZ A;  3L3P A;  2WMO A;  4ISS A;  2IAK A;  5FXW A;  3BQI A;  2Y6X A;  2W00 A;  4P0B A;  2WBL A;  3PUG A;  2X68 A;  3KV6 A;  4TV9 E;  1HCI A;  2K5B B;  2ODV A;  2X9H A;  3HI2 A;  3HKD E;  3QUJ A;  3PU8 A;  3AA7 B;  3CKD A;  2LE8 A;  4AQF C;  2NTX A;  4IE5 A;  4H9Q C;  2BVL A;  1ZKE A;  4IHJ E;  4H9N C;  5L3E B;  2UXN B;  4GK0 E;  2DNX A;  4OK0 A;  4CZZ B;  5HXC A;  1FMV A;  2XAS B;  4U72 A;  1WYB A;  4I55 E;  1HS7 A;  3MAC A;  5LGU B;  3PUR A;  4HEA A;  4DO0 A;  4UVC B;  5F8P A;  5LHI B;  4OYJ A;  2MBG A;  2ODU A;  1CUN A;  2CLY C;  3RKO A;  3ZN1 B;  2C5K T;  3GMI A;  3NRY A;  4CI3 B;  4CI2 B;  3PUA A;  2JQQ A;  3PTR B;  3K8P C;  2CXD A;  2W62 A;  3PE0 A;  4ANJ A;  2B1E A;  2PFV A;  5FXX A;  2ACX A;  2X0L B;  3C51 A;  3H37 A;  3F31 A;  5JRC A;  1KK7 A;  2Y48 B;  1YW0 A;  2KT9 A;  3Q5W A;  2X9W A;  3DTO A;  3VKG A;  5EK2 A;  2LSG A;  3RC3 A;  3ZC0 A;  3L09 A;  4NUU A;  2NTY A;  2XU0 A;  1QUU A;  2VKH A;  2PJQ A;  2VKJ A;  2V7L A;  1IJ5 A;  3MK7 C;  2KMF A;  2Q9Q A;  4G63 A;  4K0U A;  4PJL A;  3C4Z A;  4UIG A;  2L8K A;  3I0Q A;  3CX7 B;  3NZQ A;  3QC9 A;  5BMV E;  1D0Y A;  3JC6 C;  4PJM A;  4ZS2 A;  4EZH A;  2VWA A;  3I1A A;  4QX7 B;  4XBF B;  3E08 A;  2L9Q A;  5HAX A;  5JDL A;  2IC6 A;  3JC6 D;  2IW5 B;  1VOM A;  2LHN A;  4CXW A;  2JJ9 A;  4GYR A;  3MA9 A;  5LP6 E;  3IEE A;  3SWH A;  3C64 A;  2V7J A;  4ZI2 C;  1S35 A;  2Z6E A;  4UEL A;  4X1K E;  5LOV E;  4AKG A;  4L5G A;  3MKD A;  5FYM A;  2XAJ B;  1WLX A;  4H9S E;  3C98 B;  4YFS A;  3P7I A;  2CCQ A;  3ANW A;  4GOU A;  3RRW A;  1HF8 A;  2XAQ B;  1MIV A;  3ZJ1 A;  4DND A;  3PUS A;  5DQV A;  3U78 A;  3S4U A;  2BDE A;  4A56 A;  2E9X A;  3HR0 A;  3ZMT B;  4BA9 A;  1G8X A;  2D5U A;  5FXZ A;  4U74 A;  2XAF B;  4H9O C;  4WBN E;  2LSY A;  3HL6 A;  3ZYK A;  4P0A A;  1BR2 A;  4IE7 A;  3MZK B;  2KIN B;  5ETW A;  4HFV A;  3KIN B;  1HX8 A;  3EVY A;  4WBO A;  2HPJ A;  5F3J A;  4MAL A;  1US7 B;  5EK3 A;  2LHR A;  3F2E A;  4O8S A;  2I59 A;  3RRC A;  2Q9Q C;  1X79 A;  2QA7 A;  5J2T E;  5JH7 E;  4QKN A;  4PAG A;  4WNK A;  4EIW A;  5KMG P;  4AKI A;  3UFE A;  4EB6 E;  4F6R C;  3ZLI A;  4TZ4 C;  4L0R A;  2HH7 A;  2ZMA A;  4ZS3 A;  3CX6 B;  3AVR A;  4PJJ A;  4AKL A;  4IIJ E;  2V7M A;  2EHO A;  3GN5 A;  3EUH A;  2VB6 A;  1BR1 A;  1LRZ A;  1IJ6 A;  3NBX X;  2YEV C;  4CI1 B;  5H6R B;  4YLH A;  1IAP A;  3ZMZ B;  5LHH B;  4ADZ A;  3O1I A;  3M65 A;  2JPF A;  1HFA A;  2MYS A;  4J2C A;  1ZEE A;  3T8O A;  2DWG A;  1HTJ F;  5LCY A;  3AA6 B;  4PNI A;  3RYC E;  2E9X C;  4PJN A;  4PK6 A;  2DHR A;  3N2K E;  5JR9 A;  3ZPO A;  2DLR A;  4H63 V;  1NAF A;  1D0X A;  2C5I T;  2ZM8 A;  2XAH B;  2K24 A;  4O2A E;  3UTK A;  5JDM A;  3ZMU B;  4N78 D;  5FY1 A;  4O4H E;  3EDV A;  1HG5 A;  2LSJ A;  3C4X A;  3I9W A;  3AAA B;  3IF8 B;  3SS1 A;  5HXH A;  1LVK A;  3FBZ A;  2JRK A;  3HKB E;  3V5S A;  2RP4 A;  1WYC A;  2CE7 A;  4EYY R;  4UV8 B;  2BVM A;  3H3A A;  4MFR A;  3MXZ A;  3CPZ A;  3PUQ A;  4P09 A;  3LK4 2;  3VKH A;  1UX5 A;  2EHO C;  2A3D A;  4TUY E;  4I4T E;  5L3G B;  3GA8 A;  4HTE A;  2N9D A;  4M1P A;  2ES0 A;  2EHO D;  2HPL A;  2D0T A;  3KFW X;  2YK0 A;  4QHO A;  3Q2M A;  2CMR A;  2NW8 A;  5KDM C;  3NRX A;  2V26 A;  5EK4 A;  2LSI A;  5HXE A;  2Y8D A;  2L3L A;  4IE4 A;  4PK5 A;  2PBI A;  3J7Y q;  5FY0 A;  2LEH A;  3N2G E;  4QXC B;  5JR9 C;  3MJX A;  4EYU A;  2KZ7 B;  2GK9 A;  3R84 B;  3LJC A;  4QWN B;  4IE6 A;  4BJN A;  5L3D B;  4KMC A;  4EZ4 A;  3HKC E;  4AKH A;  3AA1 B;  2H7O A;  1ZHC A;  3C50 A;  3CQG B;  2ZLY A;  4X1I E;  5LXT E;  5LHG B;  3RC8 A;  2LOS A;  4AQG A;  3LBX B;  3OYZ A;  4KP3 C;  4C91 A;  1IZN B;  1YKH B;  4JUY A;  2IC9 A;  2K48 A;  2NW9 A;  2W0G A;  2OA5 A;  5A1L A;  4JEH B;  1Y64 B;  4UF0 B;  3FXE B;  5HYA A;  2XTL A;  4ZI2 D;  3ONX A;  3I0O A;  2V7K A;  4JEU B;  4QXB B;  4QXH B;  3BK9 A;  5FP3 A;  4IGU A;  3N5L A;  3SRZ A;  5LNK A;  2YU2 A;  3CX8 B;  5LYJ E;  2G0U A;  2XUE A;  5JVD E;  2JMK A;  1D1B A;  2CLY B;  2N2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...