3BQIA

Structure of a chondroitin sulphate binding dbl3x from a var2csa encoded pfemp1 protein
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
360
structure length
328
Chain Sequence
SCDLNATNYIRGCQSKTYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKELLKEKIKNAIHKETELLYEYHDTGTAIISKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEHIGKLQEDIKKIIEKGTPQQSTENVNAWWKGIEREMWDAVRCAITKINKKNNNSIFNGDECGVSPPTDQSVSWFKEWGEQFCIERLRYEQNIREACTEKKCINSDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Erythrocyte membrane protein 1
publication title The structure of a chondroitin sulfate-binding domain important in placental malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 115
structure length 328
sequence length 360
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bqiA01
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 3bqiA02
3RRCA 3BQIA 3BQLA 4NUUA 4NUVA 2XU0A 3CMLA 4YFSA 3CPZA 5F3JA 3BQKA 2Y8DA 2YK0A 2WAUA 3C64A
chains in the Genus database with same CATH superfamily
4DBRA 4X1KE 3UULA 2V26A 4QXCB 2CEAA 2FUPA 3N9LA 2VVNA 3ONXA 1OEDA 5LG4A 3AA0B 4B3ST 1XMOT 4O8SA 3SRZA 4HFEA 3ONJA 4OFZA 2KXPB 3N9PA 2NW7A 2DL1A 1ZEEA 3A8YC 3RC3A 3SOLA 4I4TE 2JQHA 3UTKA 4P0AA 2E8IA 2DCFA 3A7MA 3UU6A 1OWAA 1YKEB 2QRXA 1WR6A 4CI1B 4MFRA 1E7PA 4QXBB 2QA7A 1H7CA 3I9YA 4LF9T 2B76A 4F52A 4JEUB 2H7VC 3EVYA 3ZCIA 2DI4A 1EZ3A 3S4UA 1LVKA 5JQGE 4DV7T 1NAFA 1N34T 4A5XA 3FBZA 3R84B 2DWKA 2Z6EA 3AE8A 5KDMC 2BG9A 3TKLB 3H3AA 3N5LA 5JR9B 4OHFA 5IWAT 2BS2A 1T8BA 4HFDA 5JVDE 4GOUA 5JDFA 2NP9A 5BMVE 4JI5T 2BKPA 5LCYA 1MMDA 2HN2A 4ISTA 5LYJE 3AEEA 2PFVA 4DV0T 3ZPOA 5LMNT 4OYKA 2XQ9A 2XAGB 2WP9A 3QB5A 4OK0A 1U6GA 5ETWA 3ZSTA 4DR7T 1XMQT 2W2UA 2K48A 2E2AA 4HWHA 2CXLA 1W09A 2KT9A 1D1CA 2H89A 3LBXB 2XAJB 5LOVE 5LHIB 4YSXA 3L8RA 3AAIA 4PK4A 2CA5A 4CXYA 1UURA 4QH4A 4ANJA 5FY1A 4PW8A 4NUUA 4AQFA 4IT4A 4ZZBA 4P0BA 3MACA 3N9NA 4N78D 2V1DB 3DTOA 4WNKA 3TLSA 3TLTA 4H9QC 4TUYE 1FEWA 3OYXA 1E2AA 3E08A 1WYCA 2ZM0A 3EUHA 4O4LE 5HWYA 3AA1B 2OV9A 2YINA 3CK6A 2PTFA 1G8XA 4HWDA 5J0ZA 5EZYE 3ZMTB 4WBNE 3EHZA 5LB7B 4TV9E 5F5WA 1KNZA 5FXVA 1AJ3A 1LDKB 2QVAA 5JREA 3VKHA 2WMOA 3FZFB 2YDRA 3AA6B 4OX9T 4BJNA 2WWUA 2LOSA 3ABVA 5JDGA 2XQ7A 3RC8A 4F6RC 5LGUB 4DUZT 5HWXA 2VK9A 3AE2A 4H9OC 4G63A 5FL1A 1HNWT 3JAEA 3ZSSA 4IREA 5LGNB 4LMJA 3PTRB 5J1GA 3CQXC 3AB3B 1WCRA 4B3MT 3T8OA 3L3PA 5L47A 2QGSA 4UEMA 5HXSA 4K0KT 3VRAA 2LOPA 2CLYC 1L0VA 1LDJA 2BG9E 3IBPA 4I0UA 2BBJA 4MALA 3AXJB 4IE7A 1DU2A 1HNXT 4WW0A 5LA6E 3SWHA 1J5WA 2XPKA 3IEEA 5H6QB 2XHEB 4GKJT 3UU4A 5ABFB 1WRDA 3NBXX 4P5OA 2DNXA 3P7IA 4AI6A 2ACZA 2WZHA 3NZQA 4KMCA 5J2TE 4EIWA 2RA1A 2WDQA 3KV5A 4GK0E 2YDQA 5JTGA 3Q5WA 5AQSB 1JNZA 3RX6A 3H37A 4IHJE 3ZEFB 2LE8A 2X51A 1VRBA 2GK9A 3VRBA 2LLYA 3P8CD 2M6IA 4DVDA 1ZOYA 5L2LA 2V7KA 4MHCA 2WMNA 4U2ZA 5LHGB 4DR1T 4HFCA 3CVRA 3PUYF 3FZMB 4PJMA 4EV6A 2W0GA 4ADZA 5L4EA 2WZIA 1M62A 2WQYA 2Q9QD 2NW9A 3L39A 3KVBA 2X66A 4L5GA 3RYIE 4H9RC 4E7ZA 4Q25A 3V5UA 3W15B 3UUXB 3GA8A 4CN6A 1KK7A 2VL8A 3GN5A 5LBQB 3UFEA 4ZI2D 3EABA 5LG3A 2VQFT 3AE7A 1HG5A 2LKGA 3EDVA 1UGOA 3AEDA 2IUBA 2V6YB 3AE5A 5DABA 2Y48B 4KI0F 3O1HA 2Q9QA 4ZHQE 2X0HA 4KBMB 5AQVB 1XDOA 3AE4A 3K1SA 5AQUB 5CA1E 5FP3A 2VKHA 2LM2A 4U7IA 2J47A 1I6ZA 4UVAB 2E9XB 3ETUA 2WY2A 3C64A 4HXIB 2VL0A 5AQMB 2W4XA 4X62T 2NWBA 1XDPA 4ZS3A 2HH7A 2X67A 3X1DA 3ZC1A 4A97A 2ES0A 3AA7B 2BKNA 2CLYB 2IMLA 1KEYA 3K3QC 4B3RT 1YQ3A 2LSKA 5JR9C 4EYUA 5JDHA 4AQYT 3KFWX 4P09A 4TV8E 4ILCA 3KVAA 2C0SA 4WZXA 2PBIA 1FIOA 2EHOC 2LRKA 3AVSA 2K5BB 2E5VA 3ETVA 2CM0A 4O2BE 3ZLIA 4FJOA 2W61A 3CX7B 3M65A 5AQOB 4HFBA 3ZC0A 4JI7T 2W67A 5AQLB 2N2NA 1HCIA 1D0YA 4DR6T 2X9HA 5LMUT 4DIDB 4AISA 2KMFA 2WU2A 3WAJA 1YW0A 3TLUA 2WSSV 1MMNA 4F8HA 2LKHA 3EAMA 5AQNB 3PUSA 4OYJA 3EI0A 4C91A 1QUUA 4ZI3C 4IE4A 3O1IA 4UF0A 2VKOA 1X9BA 3RH3A 4QX8B 2BVMA 2DWGA 4EYYR 2JQ9A 2XAHB 4QXHB 4JI4T 1ZP0A 5LBMA 4HWFA 3U78A 3ZMUB 5AQRB 3RRCA 2V5DA 1YQ4A 4UXNB 2IW5B 4LFCT 4TWDA 2UUCT 3LFMA 3H3MA 2ZM2A 1IAPA 2H7OA 5HXRA 2CWYA 1IBMT 2D2SA 3D0TA 4TWHA 4I50E 3QNUA 1UUSA 4TX5A 3ZT5A 3KV4A 2ACXA 3EDUA 5FXWA 1MNEA 1YXRA 2G0UA 4EEBA 3AE3A 3RQWA 5H6RB 1CHUA 2H88A 3RPUA 2J4GA 1CUNA 4DV2T 4ZEYA 1XWMA 2ZMAA 1MIYA 3K3OA 3ZT6A 4L9IA 3AAAB 3KBUA 2CMRA 2X9YA 3ZN1B 4DV3T 1B7TA 4X20E 1HNZT 5GONE 3SS1A 5HCJA 2I6HA 4IDZA 4PAGA 5JDNA 3Q5EA 2NR4A 3UQ7A 4A64A 2EHOB 2W63A 2LT3A 3M3ZB 3FZLB 4EEDA 3SFDA 1VCSA 2XAQB 5CFBA 4JI8T 4QX7B 1Z8UA 5JDQA 3JC6D 2WU5A 2NTYA 3ZKRA 2V7JA 4LFBT 1WFDA 3PUVF 2X68A 3ZT7A 4LF7T 5KXJA 5HEOA 2X9XA 4COFA 4JEHB 4HTEA 3DQVC 1UK5A 2X0YA 3ZJ1A 4V1Av 1BR1A 2M67A 2JQKA 1KNRA 4LF8T 1UX4A 2XM1A 2BS4A 4KUMB 3ESLA 5ADXL 3LK42 3FZHB 4EB6E 4YTPA 4IDOA 4XAXB 3NZPA 5C8YE 1NWMX 4DV6T 2W66A 4ZI7E 5BR8T 5F8PA 3N9MA 1G73A 5C3JA 3JCFA 2SPCA 3IA3A 4ILAA 1QLBA 3LBXA 4LF5T 4PFPA 3ZJ2A 5LHHB 3I0QA 4IDQA 3E22E 1NEKA 4HFHA 3UU5A 2IC9A 2JIWA 3I1AA 4HGAA 5IYZE 3IF8B 2KSRA 2VVSA 4YSYA 3PUGA 3PURA 5HXCA 5ABGA 3RIUC 4I55E 2KWIB 5FYMA 5LJMA 2JRKA 2JMHA 3QK6A 4JI3T 3CMLA 5LGTB 1U5PA 2J62A 2BZBA 3ZCJA 3PUQA 2XQ8A 2L9QA 2WWVA 3QC9A 2XQAA 3PJAA 5HXHA 5JRCA 2XUEA 4DR5T 3B13A 3P4WA 3OKQA 5L3EB 3P4QA 5TAOA 4YSZA 4DR2T 1FMWA 3N2KE 1LDKA 5C2TA 4BJMA 2E9XC 3ZYMA 3OTOT 4CXWA 2R6GF 2F4VT 4JI6T 3NWIA 2NW8A 2BKOA 2XZEA 5L3BB 3FXDB 4NXNT 1N36T 1UX5A 4O4HE 3GWHA 5A1LA 5CJ5A 1HF8A 2J1DG 4AKHA 3N2OA 4TNVA 1YD8G 2FJBA 4H9PC 4HE8A 4A98A 4YY3T 4AIUA 3LK3B 1MNDA 4DV4T 3VKGA 4M1PA 2WAUA 3CPZA 2D0UA 1US7B 3C51A 2XAFB 5L3FB 4PJLA 5CA0E 5FVLA 3MJXA 3O4XE 3PU3A 1WYBA 3AEGA 3PUZF 3LJCA 3O1JA 5FVKA 2YU2A 3P4PA 4H63H 4IE6A 4WQOD 2M6BA 2XQ5A 2IAKA 3MZKB 5ABFA 3AEBA 3AVRA 2A2FX 2K24A 4YFSA 1SUMB 4H9SE 4U74A 4CXXA 3I0OA 4YXDA 2JMKA 5HEUA 3RF1A 1OEDC 3CWZB 3L09A 1Y64B 2D0TA 2XU0A 1WR0A 2DHRA 1HG2A 4ZZCA 1W0BA 2VQET 3RLFF 3OVUA 3AE6A 1IJ5A 4HEAA 2E5LT 3C98B 4LF4T 2WCAA 4PK5A 3RI5A 5HEHA 2KINB 3HKEE 2LEHA 4UVCB 1V9DA 3AEAA 4Z90A 2CHOA 5L3CB 2YKSA 4DUYT 3CQGB 4UVBB 5FNVE 3OBVE 4FI5A 4HN9A 4X1IE 2YU1A 2V6XA 2C5IT 5HXEA 2L3LA 4UR9A 2UXXB 3TLVA 3HKBE 2MAWA 2I0MA 4NUVA 4AXPA 4XBFB 3ZMVB 1HTJF 3PUAA 4DV1T 4DR3T 3OJAA 2X0LB 4JLEA 2FJAA 1VCTA 2V6YA 4WYVA 5L3DB 2BG9C 3CIRA 4U72A 5JDLA 3QUJA 5AQFB 4IL9A 4JBWF 4TZ4C 4EZHA 1W0AA 3UUNA 4LFAT 3DJBA 1IZNB 2RPAA 2LM9A 2LRLA 4YTNA 2YOEA 2FJEA 2HPJA 2VKDA 5LP6E 4J2CA 1OXZA 1HX1B 2LSJA 2MOZA 4N9F3 2BS3A 1W9RA 2NTXA 4GYSA 5M4YA 1BR2A 4AKIA 3FBLA 3PDYA 4ILUA 4X65T 1XNQT 4ILBA 3ANWB 5HEGA 3VHLA 4QH1A 2V7LA 3UT5E 4LMLA 4EXTA 3Q9DA 2I59A 5HAXA 4UV9B 4UF0B 4TN7B 2VB6A 4WBOA 1SE7A 2LHRA 4MLKA 1S35A 3DP7A 1OEDB 4AQFC 1R8IA 2K3WA 3JC6C 1S94A 2VURA 4ZOLE 4PK6A 4IDPA 3FZKB 5DQWA 5E0OA 3J7Yq 4H9NC 5CB4E 2DLRA 2BBHA 5AQHB 4HKAA 4KHPT 4CQIA 5HEJA 3UFGA 3U3IA 5CGMA 2XASB 4UIGA 4JGHD 2YDSA 1UCUA 4DMVA 2JQQA 3N9QA 2WDVA 4TWFA 3KV6A 4H63V 2N9DA 4CI2B 3MKDA 2XQ3A 4IDNA 3R6NA 3K3NA 4JUYA 2CXDA 3P50A 3ZMZB 1KF6A 4KP3C 2W00A 2HHHT 5IHYA 1D0ZA 4GIWA 1M7KA 4B3TT 3G06A 4NIQA 1GQEA 2WDRA 5IUXA 1FMVA 4X64T 2BG9B 2AXDS 4CN4A 2HPLA 3PJAJ 3HKCE 3J9X1 2LSGA 4XZCA 1NENA 4DNDA 2P9BA 2BDEA 4DMWA 2OA5A 4HWIB 2ODUA 4O4JE 2EHOD 2KZ7B 4BAYB 4GYRA 2CBJA 3BQLA 3PUWF 3VU7H 2XTLA 4PJNA 5ABEA 4LF6T 5LNKA 4HFVA 4JI0T 3PUXF 3Q2MA 3C50A 3AE9A 4PNIA 5HYAA 3UU3A 3MA9A 3HI2A 2CE7A 4AP2B 2V8SV 5JDMA 1XZYA 4QWNB 2UXNB 4ASKA 2YEVC 5JR9A 3UU8A 3NRXA 1LRZA 2UU9T 5JH7E 1J5ET 4EZ4A 2V7IA 4YHJA 2EHOA 3UQ4A 4ZI3D 4YJ3E 3ZYLA 3Q5XA 4YTMA 4HWCA 3MXZA 2JJ9A 5FY7A 2CCQA 2VKJA 4APFB 1IBLT 1VOMA 1SHZC 2YN6A 5DQVA 2PJQA 1MMGA 2XY8B 2LJLA 1BR0A 1BR4A 2IHR1 3SFEA 3B5MA 3Q5DA 5AQIB 2D9DA 2CRBA 4U7YA 2MPKA 3C4ZA 2X9WA 1Z0PA 4IE0A 3KDSE 4X66T 3ONLC 2QYWA 4DBQA 4AKGA 5DJQC 3A5XA 2Y6XA 2PG8A 3RYHE 4O2AE 2C5KT 2N1GA 3CX6B 5HCMA 4IIJE 2D5UA 3AE1A 5L4HA 2V7MA 1ZKEA 4CZZB 1X79A 4EAHA 4K0UA 2IIUA 5KMGP 4G2AA 3JAFA 3UUMA 1KNPA 3N2GE 4YHHT 3RGLA 1OEDE 3C4WA 3AECA 3CKDA 1QSDA 4QH5A 4JYAT 5FXXA 3P4SA 5JRCB 2Q9QC 4C90A 1MIWA 2K9AA 3RHWA 2LSIA 4U2YA 2IC6A 1ZHCA 1WLXA 3VR8A 3HKDE 1IBKT 5LJNA 5AQQB 1N32T 2WZKA 4ZI2C 2CXFA 3PU8A 3LDQB 2BVLA 3N9OA 3BQKA 3F2EA 3RQUA 4UELA 3CQCB 2KLQA 2XQ6A 2A72A 5AQKB 1HS7A 1O3XA 4P1NA 4BA9A 3OPCA 4I43B 3C4XA 1LKXA 4YT0A 2JPFA 2UXBT 2V5CA 3UUBA 5FY0A 1MMAA 1I94T 5FMNA 5EK3A 3E0ZA 1KFYA 3CX8B 2NOXA 2MYSA 2KWHA 2WBLA 1FJGT 3RIFA 3GMIA 1IJ6A 1T72A 3AEFA 4DO0A 2C5JA 1ZV4X 1MIVA 2A9UA 2MBGA 2WS3A 2UUAT 4X1YE 1Y01A 2UXDT 3AXJA 3KV9A 3T1HT 4B6XA 3AAEB 4HFIA 5LXTE 3DPLC 4IL4A 5KX5E 4U31A 4YJ2E 3T1YT 4IE5A 2W62A 2XQYA 3RYFE 2XJ7A 5ABHA 4LMKA 3P4RA 3FXEB 1SA0E 2OLTA 4PFOA 3LK2B 5AQJB 3GN5B 4DR4T 2CBIA 2RP4A 4AKLA 1XNRT 3ZYKA 4KHZF 1D1BA 5J2UE 3JADA 2FJDA 4ZS2A 3KBTA 2H3RA 3RYCE 2ODVA 3QB5K 2ZLYA 2LSYA 2Q9QB 3RKGA 3LG7A 2B1EA 4QKNA 2WM9A 1YKHB 3NVOA 4ERRA 5FL0A 3HL6A 4GK5E 4DV5T 4Z91A 2UXCT 4KX6A 2E9XD 3B57A 3RIUA 3VR9A 3RKOA 3F31A 4MBQA 1HX8A 2XSAA 4Z8XA 1D1AA 1LVFA 3HA4A 3LSVA 2ZM8A 4ZXLA 5L3GB 1N33T 2XSBA 4UV8B 2HN1A 3NRYA 4AQGA 3RRWA 4JV5T 3MK7C 3FHNA 4CN1A 3OYZA 2L8KA 4JI2T 2YK0A 3F57A 2AE9A 2E9XA 3HR0A 3RIAA 1J1JA 4X5TA 5FKYA 4L0RA 5AQPB 3QOFA 3K8PC 3BK9A 5AQGB 1HR0T 2FBWA 2Y8DA 4EOZB 2XQ4A 4GKKT 1U4QA 5AQTB 4O4IE 2A3DA 3TLWA 3V5SA 4AKRB 4PJJA 4NPPA 3KINB 4QHOA 2KNDA 2CPTA 1JNRA 3WAKA 4JI1T 3ZMSB 4A56A 4EGWA 2MTQA 5EK2A 4NXMT 4CI3B 3WI3A 2VASA 1E1HB 5EK4A 4TNWA 5AFUL 3FB2A 2XM2A 2IDOB 5FXZA 3ANWA 1T7SA 1D0XA 4U33A 3I9WA 3PE0A 1HFAA 2UUBT 4IGUA 1T98A 4U3CA 5F3JA 3RTRA 2VWAA 3PV0F 3IHRA 4YLHA 3BQIA 2CHNA 3O9XA 2WB5A 3ZN0B 4E7SA 3NKZA 2LHNA 2CWOA 2ZM6T 4ISSA
chains in the Genus database with same CATH topology
4DBRA 4X1KE 1UX5A 3Q5XA 3UULA 2V26A 4O4HE 4QXCB 5DABA 3MXZA 2JJ9A 3GWHA 5FY7A 5A1LA 2CCQA 1HF8A 2CEAA 2J1DG 2Y48B 3N9LA 4AKHA 2VKJA 3N2OA 3ONXA 3O1HA 1VOMA 1SHZC 2Q9QA 1YD8G 4H9PC 4HE8A 4ZHQE 5LG4A 3AA0B 4KBMB 5DQVA 4O8SA 3SRZA 3LK3B 2PJQA 1MNDA 5CA1E 5FP3A 1MMGA 2VKHA 4OFZA 2KXPB 3VKGA 2LJLA 1BR0A 3N9PA 1BR4A 4M1PA 2WAUA 4UVAB 2NW7A 2E9XB 3ETUA 1ZEEA 3CPZA 3C64A 2D0UA 1US7B 3C51A 3RC3A 3SOLA 2XAFB 5L3FB 4I4TE 3C4ZA 4PJLA 2X9WA 3UTKA 1Z0PA 5CA0E 2NWBA 4P0AA 3MJXA 4IE0A 4ZS3A 3O4XE 2E8IA 2HH7A 3KDSE 3PU3A 1WYBA 2X67A 2DCFA 4DBQA 3ZC1A 1OWAA 2ES0A 3AA7B 4AKGA 2CLYB 5DJQC 3A5XA 2Y6XA 3K3QC 1YKEB 2PG8A 3RYHE 1WR6A 4O2AE 2C5KT 3LJCA 4CI1B 2N1GA 3CX6B 4IIJE 4MFRA 3O1JA 2LSKA 2D5UA 2YU2A 4H63H 4IE6A 5JR9C 2V7MA 4EYUA 4QXBB 5JDHA 1ZKEA 4CZZB 1X79A 4EAHA 2IAKA 4K0UA 3KFWX 2QA7A 1H7CA 5KMGP 3MZKB 4P09A 4G2AA 3I9YA 3UUMA 4TV8E 3AVRA 2A2FX 3KVAA 2C0SA 2PBIA 1FIOA 3N2GE 2EHOC 2K24A 4JEUB 4YFSA 3AVSA 2K5BB 4H9SE 2H7VC 3ETVA 3EVYA 2CM0A 3ZCIA 2DI4A 4O2BE 4U74A 3C4WA 4CXXA 3I0OA 1EZ3A 3S4UA 1LVKA 3ZLIA 3CKDA 1QSDA 4FJOA 5JQGE 1NAFA 5FXXA 2JMKA 5JRCB 2Q9QC 2W61A 3CX7B 1MIWA 3CWZB 3FBZA 3M65A 4C90A 3R84B 2DWKA 1Y64B 2Z6EA 3L09A 2K9AA 2D0TA 2LSIA 2XU0A 3ZC0A 5KDMC 2DHRA 1HG2A 3TKLB 2IC6A 1ZHCA 2N2NA 1HCIA 3H3AA 1D0YA 3N5LA 5JR9B 1WLXA 4OHFA 3HKDE 2X9HA 5LJNA 2KMFA 3WAJA 1YW0A 1IJ5A 2WSSV 1MMNA 5JVDE 4ZI2C 2CXFA 3PU8A 4HEAA 2BVLA 4GOUA 5JDFA 2NP9A 3N9OA 3C98B 5BMVE 3BQKA 3F2EA 4UELA 4PK5A 3CQCB 2KLQA 2A72A 3PUSA 4OYJA 2KINB 3HKEE 1HS7A 1O3XA 2LEHA 4C91A 1QUUA 4ZI3C 4UVCB 4BA9A 4IE4A 4I43B 1V9DA 3C4XA 5LCYA 1LKXA 5L3CB 1MMDA 3O1IA 4ISTA 4UF0A 2VKOA 3RH3A 5LYJE 2JPFA 4QX8B 2BVMA 2DWGA 2PFVA 3CQGB 3ZPOA 4UVBB 4EYYR 2XAHB 3OBVE 4FI5A 4OYKA 4HN9A 4QXHB 2YU1A 4X1IE 5FNVE 5FY0A 2XAGB 2C5IT 1MMAA 5HXEA 2L3LA 5LBMA 3U78A 3ZMUB 5FMNA 4OK0A 5EK3A 2UXXB 3E0ZA 3RRCA 5ETWA 3HKBE 3CX8B 4UXNB 2NOXA 2K48A 2IW5B 4NUVA 4AXPA 4XBFB 2MYSA 2KWHA 2WBLA 3ZMVB 3LFMA 2CXLA 2ZM2A 1HTJF 1IAPA 2KT9A 1D1CA 3PUAA 2H7OA 5HXRA 2CWYA 3LBXB 2XAJB 3GMIA 3OJAA 1IJ6A 2X0LB 5LOVE 4JLEA 5LHIB 3AAIA 4DO0A 2D2SA 4PK4A 2C5JA 1ZV4X 5L3DB 1MIVA 3D0TA 2MBGA 2CA5A 4CXYA 4I50E 4U72A 5JDLA 4TX5A 4X1YE 4ANJA 3QUJA 5FY1A 3KV4A 2ACXA 3EDUA 5FXWA 4TZ4C 4PW8A 4EZHA 3KV9A 4NUUA 4AQFA 1MNEA 4B6XA 2G0UA 3AAEB 3UUNA 3DJBA 5LXTE 4P0BA 5H6RB 3MACA 3N9NA 4N78D 1IZNB 2V1DB 3DTOA 4WNKA 5KX5E 3RPUA 4H9QC 2LM9A 4TUYE 1FEWA 3OYXA 2HPJA 3E08A 1CUNA 4YJ2E 2VKDA 1WYCA 5LP6E 4J2CA 1OXZA 4IE5A 2ZM0A 2W62A 2XQYA 3RYFE 3EUHA 2LSJA 2MOZA 4O4LE 2ZMAA 1MIYA 2NTXA 3K3OA 4GYSA 4L9IA 5M4YA 5HWYA 1BR2A 3AA1B 2YINA 3FXEB 1SA0E 3AAAB 4PFOA 4AKIA 3FBLA 3PDYA 3KBUA 1G8XA 4ILUA 2CMRA 2X9YA 3ZN1B 5EZYE 3ANWB 3ZMTB 1B7TA 4X20E 3VHLA 5GONE 4WBNE 3SS1A 3LK2B 4TV9E 1KNZA 5FXVA 3GN5B 1AJ3A 4IDZA 2V7LA 4PAGA 3UT5E 5JDNA 4EXTA 5JREA 3VKHA 2WMOA 3Q9DA 4AKLA 2RP4A 2I59A 3AA6B 3ZYKA 5HAXA 1D1BA 5J2UE 2EHOB 4UV9B 2W63A 4UF0B 4TN7B 2LT3A 4BJNA 2WWUA 2VB6A 4ZS2A 2LOSA 4WBOA 5JDGA 2LHRA 3KBTA 2H3RA 3RYCE 4MLKA 2ODVA 3RC8A 4F6RC 5LGUB 1S35A 2ZLYA 5HWXA 2XAQB 3DP7A 2LSYA 2Q9QB 4AQFC 2VK9A 3JC6C 3LG7A 2B1EA 4H9OC 4QKNA 4G63A 2WM9A 1S94A 4QX7B 5JDQA 4ZOLE 1YKHB 4PK6A 3JC6D 5LGNB 5DQWA 4ERRA 3HL6A 4GK5E 5E0OA 2NTYA 3J7Yq 4H9NC 5CB4E 2V7JA 3PTRB 5J1GA 2DLRA 3CQXC 3AB3B 2E9XD 2X68A 3B57A 4HKAA 3T8OA 3L3PA 3RKOA 3F31A 4CQIA 2QGSA 4UEMA 4MBQA 1HX8A 5HXSA 3U3IA 4Z8XA 1D1AA 2LOPA 2X9XA 2CLYC 2XASB 1LVFA 4HTEA 4JEHB 4UIGA 3IBPA 3HA4A 3ZJ1A 4V1Av 1BR1A 2M67A 2ZM8A 4MALA 5L3GB 1UCUA 4IE7A 4DMVA 1UX4A 2JQQA 3N9QA 3KV6A 4UV8B 3NRYA 4H63V 4KUMB 2N9DA 3ESLA 4WW0A 4AQGA 5LA6E 4CI2B 3LK42 5ADXL 3SWHA 3RRWA 3IEEA 5H6QB 4EB6E 3MKDA 2XHEB 4XAXB 3NZPA 5C8YE 3MK7C 1NWMX 3R6NA 3K3NA 3FHNA 4JUYA 2CXDA 4ZI7E 1WRDA 3NBXX 3OYZA 2L8KA 5F8PA 3ZMZB 3N9MA 1G73A 4KP3C 2W00A 2DNXA 3P7IA 2SPCA 4AI6A 2YK0A 3NZQA 3F57A 5IHYA 4KMCA 2E9XA 3HR0A 3LBXA 1D0ZA 4GIWA 5J2TE 4EIWA 2RA1A 3KV5A 4L0RA 4GK0E 4PFPA 3ZJ2A 5LHHB 3I0QA 3K8PC 3Q5WA 3BK9A 3E22E 1FMVA 2IC9A 3RX6A 3H37A 2Y8DA 4IHJE 4ZI3D 3I1AA 4HGAA 4EOZB 5IYZE 3IF8B 3ZEFB 1U4QA 2HPLA 2LE8A 3HKCE 3J9X1 2LSGA 2X51A 4XZCA 1VRBA 4DNDA 3PUGA 2GK9A 3PURA 5HXCA 3P8CD 4DVDA 4MHCA 2P9BA 2BDEA 2V7KA 4I55E 5L2LA 2WMNA 5LHGB 4O4IE 2KWIB 4DMWA 2OA5A 3CVRA 2A3DA 3V5SA 4AKRB 2ODUA 4PJJA 5FYMA 4O4JE 3KINB 4QHOA 5LJMA 2EHOD 2JRKA 2JMHA 2KNDA 2KZ7B 3QK6A 3BQLA 4GYRA 4PJMA 4BAYB 3CMLA 5LGTB 3VU7H 2XTLA 1U5PA 4PJNA 3WAKA 2BZBA 3ZMSB 3ZCJA 2W0GA 4A56A 4ADZA 3PUQA 5LNKA 2MTQA 4HFVA 5EK2A 2L9QA 3Q2MA 4CI3B 3WI3A 2Q9QD 2NW9A 2VASA 3C50A 3QC9A 3KVBA 2X66A 1E1HB 5EK4A 4L5GA 5HXHA 3RYIE 5JRCA 2XUEA 4H9RC 4PNIA 3B13A 5AFUL 5HYAA 3OKQA 3MA9A 4E7ZA 3HI2A 2CE7A 5L3EB 3FB2A 5TAOA 3V5UA 5FXZA 3UUXB 3ANWA 3W15B 3GA8A 1D0XA 4QWNB 5JDMA 2UXNB 3I9WA 3PE0A 1HFAA 4ASKA 1KK7A 1FMWA 2VL8A 3GN5A 5LBQB 3N2KE 4IGUA 2YEVC 1T98A 3UFEA 5JR9A 4ZI2D 5F3JA 2VWAA 4BJMA 3NRXA 2E9XC 3IHRA 1LRZA 3ZYMA 4YLHA 3BQIA 3O9XA 4CXWA 3ZN0B 5JH7E 4E7SA 4EZ4A 1HG5A 2V7IA 4YHJA 3EDVA 2NW8A 2EHOA 2LHNA 2CWOA 5L3BB 4YJ3E 3FXDB 3ZYLA 4ISSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRC A;  3BQI A;  3BQL A;  4NUU A;  4NUV A;  2XU0 A;  3CML A;  4YFS A;  3CPZ A;  5F3J A;  3BQK A;  2Y8D A;  2YK0 A;  2WAU A;  3C64 A; 
#chains in the Genus database with same CATH topology
 4DBR A;  4X1K E;  3UUL A;  2V26 A;  4QXC B;  2CEA A;  2FUP A;  3N9L A;  2VVN A;  3ONX A;  1OED A;  5LG4 A;  3AA0 B;  4B3S T;  1XMO T;  4O8S A;  3SRZ A;  4HFE A;  3ONJ A;  4OFZ A;  2KXP B;  3N9P A;  2NW7 A;  2DL1 A;  1ZEE A;  3A8Y C;  3RC3 A;  3SOL A;  4I4T E;  2JQH A;  3UTK A;  4P0A A;  2E8I A;  2DCF A;  3A7M A;  3UU6 A;  1OWA A;  1YKE B;  2QRX A;  1WR6 A;  4CI1 B;  4MFR A;  1E7P A;  4QXB B;  2QA7 A;  1H7C A;  3I9Y A;  4LF9 T;  2B76 A;  4F52 A;  4JEU B;  2H7V C;  3EVY A;  3ZCI A;  2DI4 A;  1EZ3 A;  3S4U A;  1LVK A;  5JQG E;  4DV7 T;  1NAF A;  1N34 T;  4A5X A;  3FBZ A;  3R84 B;  2DWK A;  2Z6E A;  3AE8 A;  5KDM C;  2BG9 A;  3TKL B;  3H3A A;  3N5L A;  5JR9 B;  4OHF A;  5IWA T;  2BS2 A;  1T8B A;  4HFD A;  5JVD E;  4GOU A;  5JDF A;  2NP9 A;  5BMV E;  4JI5 T;  2BKP A;  5LCY A;  1MMD A;  2HN2 A;  4IST A;  5LYJ E;  3AEE A;  2PFV A;  4DV0 T;  3ZPO A;  5LMN T;  4OYK A;  2XQ9 A;  2XAG B;  2WP9 A;  3QB5 A;  4OK0 A;  1U6G A;  5ETW A;  3ZST A;  4DR7 T;  1XMQ T;  2W2U A;  2K48 A;  2E2A A;  4HWH A;  2CXL A;  1W09 A;  2KT9 A;  1D1C A;  2H89 A;  3LBX B;  2XAJ B;  5LOV E;  5LHI B;  4YSX A;  3L8R A;  3AAI A;  4PK4 A;  2CA5 A;  4CXY A;  1UUR A;  4QH4 A;  4ANJ A;  5FY1 A;  4PW8 A;  4NUU A;  4AQF A;  4IT4 A;  4ZZB A;  4P0B A;  3MAC A;  3N9N A;  4N78 D;  2V1D B;  3DTO A;  4WNK A;  3TLS A;  3TLT A;  4H9Q C;  4TUY E;  1FEW A;  3OYX A;  1E2A A;  3E08 A;  1WYC A;  2ZM0 A;  3EUH A;  4O4L E;  5HWY A;  3AA1 B;  2OV9 A;  2YIN A;  3CK6 A;  2PTF A;  1G8X A;  4HWD A;  5J0Z A;  5EZY E;  3ZMT B;  4WBN E;  3EHZ A;  5LB7 B;  4TV9 E;  5F5W A;  1KNZ A;  5FXV A;  1AJ3 A;  1LDK B;  2QVA A;  5JRE A;  3VKH A;  2WMO A;  3FZF B;  2YDR A;  3AA6 B;  4OX9 T;  4BJN A;  2WWU A;  2LOS A;  3ABV A;  5JDG A;  2XQ7 A;  3RC8 A;  4F6R C;  5LGU B;  4DUZ T;  5HWX A;  2VK9 A;  3AE2 A;  4H9O C;  4G63 A;  5FL1 A;  1HNW T;  3JAE A;  3ZSS A;  4IRE A;  5LGN B;  4LMJ A;  3PTR B;  5J1G A;  3CQX C;  3AB3 B;  1WCR A;  4B3M T;  3T8O A;  3L3P A;  5L47 A;  2QGS A;  4UEM A;  5HXS A;  4K0K T;  3VRA A;  2LOP A;  2CLY C;  1L0V A;  1LDJ A;  2BG9 E;  3IBP A;  4I0U A;  2BBJ A;  4MAL A;  3AXJ B;  4IE7 A;  1DU2 A;  1HNX T;  4WW0 A;  5LA6 E;  3SWH A;  1J5W A;  2XPK A;  3IEE A;  5H6Q B;  2XHE B;  4GKJ T;  3UU4 A;  5ABF B;  1WRD A;  3NBX X;  4P5O A;  2DNX A;  3P7I A;  4AI6 A;  2ACZ A;  2WZH A;  3NZQ A;  4KMC A;  5J2T E;  4EIW A;  2RA1 A;  2WDQ A;  3KV5 A;  4GK0 E;  2YDQ A;  5JTG A;  3Q5W A;  5AQS B;  1JNZ A;  3RX6 A;  3H37 A;  4IHJ E;  3ZEF B;  2LE8 A;  2X51 A;  1VRB A;  2GK9 A;  3VRB A;  2LLY A;  3P8C D;  2M6I A;  4DVD A;  1ZOY A;  5L2L A;  2V7K A;  4MHC A;  2WMN A;  4U2Z A;  5LHG B;  4DR1 T;  4HFC A;  3CVR A;  3PUY F;  3FZM B;  4PJM A;  4EV6 A;  2W0G A;  4ADZ A;  5L4E A;  2WZI A;  1M62 A;  2WQY A;  2Q9Q D;  2NW9 A;  3L39 A;  3KVB A;  2X66 A;  4L5G A;  3RYI E;  4H9R C;  4E7Z A;  4Q25 A;  3V5U A;  3W15 B;  3UUX B;  3GA8 A;  4CN6 A;  1KK7 A;  2VL8 A;  3GN5 A;  5LBQ B;  3UFE A;  4ZI2 D;  3EAB A;  5LG3 A;  2VQF T;  3AE7 A;  1HG5 A;  2LKG A;  3EDV A;  1UGO A;  3AED A;  2IUB A;  2V6Y B;  3AE5 A;  5DAB A;  2Y48 B;  4KI0 F;  3O1H A;  2Q9Q A;  4ZHQ E;  2X0H A;  4KBM B;  5AQV B;  1XDO A;  3AE4 A;  3K1S A;  5AQU B;  5CA1 E;  5FP3 A;  2VKH A;  2LM2 A;  4U7I A;  2J47 A;  1I6Z A;  4UVA B;  2E9X B;  3ETU A;  2WY2 A;  3C64 A;  4HXI B;  2VL0 A;  5AQM B;  2W4X A;  4X62 T;  2NWB A;  1XDP A;  4ZS3 A;  2HH7 A;  2X67 A;  3X1D A;  3ZC1 A;  4A97 A;  2ES0 A;  3AA7 B;  2BKN A;  2CLY B;  2IML A;  1KEY A;  3K3Q C;  4B3R T;  1YQ3 A;  2LSK A;  5JR9 C;  4EYU A;  5JDH A;  4AQY T;  3KFW X;  4P09 A;  4TV8 E;  4ILC A;  3KVA A;  2C0S A;  4WZX A;  2PBI A;  1FIO A;  2EHO C;  2LRK A;  3AVS A;  2K5B B;  2E5V A;  3ETV A;  2CM0 A;  4O2B E;  3ZLI A;  4FJO A;  2W61 A;  3CX7 B;  3M65 A;  5AQO B;  4HFB A;  3ZC0 A;  4JI7 T;  2W67 A;  5AQL B;  2N2N A;  1HCI A;  1D0Y A;  4DR6 T;  2X9H A;  5LMU T;  4DID B;  4AIS A;  2KMF A;  2WU2 A;  3WAJ A;  1YW0 A;  3TLU A;  2WSS V;  1MMN A;  4F8H A;  2LKH A;  3EAM A;  5AQN B;  3PUS A;  4OYJ A;  3EI0 A;  4C91 A;  1QUU A;  4ZI3 C;  4IE4 A;  3O1I A;  4UF0 A;  2VKO A;  1X9B A;  3RH3 A;  4QX8 B;  2BVM A;  2DWG A;  4EYY R;  2JQ9 A;  2XAH B;  4QXH B;  4JI4 T;  1ZP0 A;  5LBM A;  4HWF A;  3U78 A;  3ZMU B;  5AQR B;  3RRC A;  2V5D A;  1YQ4 A;  4UXN B;  2IW5 B;  4LFC T;  4TWD A;  2UUC T;  3LFM A;  3H3M A;  2ZM2 A;  1IAP A;  2H7O A;  5HXR A;  2CWY A;  1IBM T;  2D2S A;  3D0T A;  4TWH A;  4I50 E;  3QNU A;  1UUS A;  4TX5 A;  3ZT5 A;  3KV4 A;  2ACX A;  3EDU A;  5FXW A;  1MNE A;  1YXR A;  2G0U A;  4EEB A;  3AE3 A;  3RQW A;  5H6R B;  1CHU A;  2H88 A;  3RPU A;  2J4G A;  1CUN A;  4DV2 T;  4ZEY A;  1XWM A;  2ZMA A;  1MIY A;  3K3O A;  3ZT6 A;  4L9I A;  3AAA B;  3KBU A;  2CMR A;  2X9Y A;  3ZN1 B;  4DV3 T;  1B7T A;  4X20 E;  1HNZ T;  5GON E;  3SS1 A;  5HCJ A;  2I6H A;  4IDZ A;  4PAG A;  5JDN A;  3Q5E A;  2NR4 A;  3UQ7 A;  4A64 A;  2EHO B;  2W63 A;  2LT3 A;  3M3Z B;  3FZL B;  4EED A;  3SFD A;  1VCS A;  2XAQ B;  5CFB A;  4JI8 T;  4QX7 B;  1Z8U A;  5JDQ A;  3JC6 D;  2WU5 A;  2NTY A;  3ZKR A;  2V7J A;  4LFB T;  1WFD A;  3PUV F;  2X68 A;  3ZT7 A;  4LF7 T;  5KXJ A;  5HEO A;  2X9X A;  4COF A;  4JEH B;  4HTE A;  3DQV C;  1UK5 A;  2X0Y A;  3ZJ1 A;  4V1A v;  1BR1 A;  2M67 A;  2JQK A;  1KNR A;  4LF8 T;  1UX4 A;  2XM1 A;  2BS4 A;  4KUM B;  3ESL A;  5ADX L;  3LK4 2;  3FZH B;  4EB6 E;  4YTP A;  4IDO A;  4XAX B;  3NZP A;  5C8Y E;  1NWM X;  4DV6 T;  2W66 A;  4ZI7 E;  5BR8 T;  5F8P A;  3N9M A;  1G73 A;  5C3J A;  3JCF A;  2SPC A;  3IA3 A;  4ILA A;  1QLB A;  3LBX A;  4LF5 T;  4PFP A;  3ZJ2 A;  5LHH B;  3I0Q A;  4IDQ A;  3E22 E;  1NEK A;  4HFH A;  3UU5 A;  2IC9 A;  2JIW A;  3I1A A;  4HGA A;  5IYZ E;  3IF8 B;  2KSR A;  2VVS A;  4YSY A;  3PUG A;  3PUR A;  5HXC A;  5ABG A;  3RIU C;  4I55 E;  2KWI B;  5FYM A;  5LJM A;  2JRK A;  2JMH A;  3QK6 A;  4JI3 T;  3CML A;  5LGT B;  1U5P A;  2J62 A;  2BZB A;  3ZCJ A;  3PUQ A;  2XQ8 A;  2L9Q A;  2WWV A;  3QC9 A;  2XQA A;  3PJA A;  5HXH A;  5JRC A;  2XUE A;  4DR5 T;  3B13 A;  3P4W A;  3OKQ A;  5L3E B;  3P4Q A;  5TAO A;  4YSZ A;  4DR2 T;  1FMW A;  3N2K E;  1LDK A;  5C2T A;  4BJM A;  2E9X C;  3ZYM A;  3OTO T;  4CXW A;  2R6G F;  2F4V T;  4JI6 T;  3NWI A;  2NW8 A;  2BKO A;  2XZE A;  5L3B B;  3FXD B;  4NXN T;  1N36 T;  1UX5 A;  4O4H E;  3GWH A;  5A1L A;  5CJ5 A;  1HF8 A;  2J1D G;  4AKH A;  3N2O A;  4TNV A;  1YD8 G;  2FJB A;  4H9P C;  4HE8 A;  4A98 A;  4YY3 T;  4AIU A;  3LK3 B;  1MND A;  4DV4 T;  3VKG A;  4M1P A;  2WAU A;  3CPZ A;  2D0U A;  1US7 B;  3C51 A;  2XAF B;  5L3F B;  4PJL A;  5CA0 E;  5FVL A;  3MJX A;  3O4X E;  3PU3 A;  1WYB A;  3AEG A;  3PUZ F;  3LJC A;  3O1J A;  5FVK A;  2YU2 A;  3P4P A;  4H63 H;  4IE6 A;  4WQO D;  2M6B A;  2XQ5 A;  2IAK A;  3MZK B;  5ABF A;  3AEB A;  3AVR A;  2A2F X;  2K24 A;  4YFS A;  1SUM B;  4H9S E;  4U74 A;  4CXX A;  3I0O A;  4YXD A;  2JMK A;  5HEU A;  3RF1 A;  1OED C;  3CWZ B;  3L09 A;  1Y64 B;  2D0T A;  2XU0 A;  1WR0 A;  2DHR A;  1HG2 A;  4ZZC A;  1W0B A;  2VQE T;  3RLF F;  3OVU A;  3AE6 A;  1IJ5 A;  4HEA A;  2E5L T;  3C98 B;  4LF4 T;  2WCA A;  4PK5 A;  3RI5 A;  5HEH A;  2KIN B;  3HKE E;  2LEH A;  4UVC B;  1V9D A;  3AEA A;  4Z90 A;  2CHO A;  5L3C B;  2YKS A;  4DUY T;  3CQG B;  4UVB B;  5FNV E;  3OBV E;  4FI5 A;  4HN9 A;  4X1I E;  2YU1 A;  2V6X A;  2C5I T;  5HXE A;  2L3L A;  4UR9 A;  2UXX B;  3TLV A;  3HKB E;  2MAW A;  2I0M A;  4NUV A;  4AXP A;  4XBF B;  3ZMV B;  1HTJ F;  3PUA A;  4DV1 T;  4DR3 T;  3OJA A;  2X0L B;  4JLE A;  2FJA A;  1VCT A;  2V6Y A;  4WYV A;  5L3D B;  2BG9 C;  3CIR A;  4U72 A;  5JDL A;  3QUJ A;  5AQF B;  4IL9 A;  4JBW F;  4TZ4 C;  4EZH A;  1W0A A;  3UUN A;  4LFA T;  3DJB A;  1IZN B;  2RPA A;  2LM9 A;  2LRL A;  4YTN A;  2YOE A;  2FJE A;  2HPJ A;  2VKD A;  5LP6 E;  4J2C A;  1OXZ A;  1HX1 B;  2LSJ A;  2MOZ A;  4N9F 3;  2BS3 A;  1W9R A;  2NTX A;  4GYS A;  5M4Y A;  1BR2 A;  4AKI A;  3FBL A;  3PDY A;  4ILU A;  4X65 T;  1XNQ T;  4ILB A;  3ANW B;  5HEG A;  3VHL A;  4QH1 A;  2V7L A;  3UT5 E;  4LML A;  4EXT A;  3Q9D A;  2I59 A;  5HAX A;  4UV9 B;  4UF0 B;  4TN7 B;  2VB6 A;  4WBO A;  1SE7 A;  2LHR A;  4MLK A;  1S35 A;  3DP7 A;  1OED B;  4AQF C;  1R8I A;  2K3W A;  3JC6 C;  1S94 A;  2VUR A;  4ZOL E;  4PK6 A;  4IDP A;  3FZK B;  5DQW A;  5E0O A;  3J7Y q;  4H9N C;  5CB4 E;  2DLR A;  2BBH A;  5AQH B;  4HKA A;  4KHP T;  4CQI A;  5HEJ A;  3UFG A;  3U3I A;  5CGM A;  2XAS B;  4UIG A;  4JGH D;  2YDS A;  1UCU A;  4DMV A;  2JQQ A;  3N9Q A;  2WDV A;  4TWF A;  3KV6 A;  4H63 V;  2N9D A;  4CI2 B;  3MKD A;  2XQ3 A;  4IDN A;  3R6N A;  3K3N A;  4JUY A;  2CXD A;  3P50 A;  3ZMZ B;  1KF6 A;  4KP3 C;  2W00 A;  2HHH T;  5IHY A;  1D0Z A;  4GIW A;  1M7K A;  4B3T T;  3G06 A;  4NIQ A;  1GQE A;  2WDR A;  5IUX A;  1FMV A;  4X64 T;  2BG9 B;  2AXD S;  4CN4 A;  2HPL A;  3PJA J;  3HKC E;  3J9X 1;  2LSG A;  4XZC A;  1NEN A;  4DND A;  2P9B A;  2BDE A;  4DMW A;  2OA5 A;  4HWI B;  2ODU A;  4O4J E;  2EHO D;  2KZ7 B;  4BAY B;  4GYR A;  2CBJ A;  3BQL A;  3PUW F;  3VU7 H;  2XTL A;  4PJN A;  5ABE A;  4LF6 T;  5LNK A;  4HFV A;  4JI0 T;  3PUX F;  3Q2M A;  3C50 A;  3AE9 A;  4PNI A;  5HYA A;  3UU3 A;  3MA9 A;  3HI2 A;  2CE7 A;  4AP2 B;  2V8S V;  5JDM A;  1XZY A;  4QWN B;  2UXN B;  4ASK A;  2YEV C;  5JR9 A;  3UU8 A;  3NRX A;  1LRZ A;  2UU9 T;  5JH7 E;  1J5E T;  4EZ4 A;  2V7I A;  4YHJ A;  2EHO A;  3UQ4 A;  4ZI3 D;  4YJ3 E;  3ZYL A;  3Q5X A;  4YTM A;  4HWC A;  3MXZ A;  2JJ9 A;  5FY7 A;  2CCQ A;  2VKJ A;  4APF B;  1IBL T;  1VOM A;  1SHZ C;  2YN6 A;  5DQV A;  2PJQ A;  1MMG A;  2XY8 B;  2LJL A;  1BR0 A;  1BR4 A;  2IHR 1;  3SFE A;  3B5M A;  3Q5D A;  5AQI B;  2D9D A;  2CRB A;  4U7Y A;  2MPK A;  3C4Z A;  2X9W A;  1Z0P A;  4IE0 A;  3KDS E;  4X66 T;  3ONL C;  2QYW A;  4DBQ A;  4AKG A;  5DJQ C;  3A5X A;  2Y6X A;  2PG8 A;  3RYH E;  4O2A E;  2C5K T;  2N1G A;  3CX6 B;  5HCM A;  4IIJ E;  2D5U A;  3AE1 A;  5L4H A;  2V7M A;  1ZKE A;  4CZZ B;  1X79 A;  4EAH A;  4K0U A;  2IIU A;  5KMG P;  4G2A A;  3JAF A;  3UUM A;  1KNP A;  3N2G E;  4YHH T;  3RGL A;  1OED E;  3C4W A;  3AEC A;  3CKD A;  1QSD A;  4QH5 A;  4JYA T;  5FXX A;  3P4S A;  5JRC B;  2Q9Q C;  4C90 A;  1MIW A;  2K9A A;  3RHW A;  2LSI A;  4U2Y A;  2IC6 A;  1ZHC A;  1WLX A;  3VR8 A;  3HKD E;  1IBK T;  5LJN A;  5AQQ B;  1N32 T;  2WZK A;  4ZI2 C;  2CXF A;  3PU8 A;  3LDQ B;  2BVL A;  3N9O A;  3BQK A;  3F2E A;  3RQU A;  4UEL A;  3CQC B;  2KLQ A;  2XQ6 A;  2A72 A;  5AQK B;  1HS7 A;  1O3X A;  4P1N A;  4BA9 A;  3OPC A;  4I43 B;  3C4X A;  1LKX A;  4YT0 A;  2JPF A;  2UXB T;  2V5C A;  3UUB A;  5FY0 A;  1MMA A;  1I94 T;  5FMN A;  5EK3 A;  3E0Z A;  1KFY A;  3CX8 B;  2NOX A;  2MYS A;  2KWH A;  2WBL A;  1FJG T;  3RIF A;  3GMI A;  1IJ6 A;  1T72 A;  3AEF A;  4DO0 A;  2C5J A;  1ZV4 X;  1MIV A;  2A9U A;  2MBG A;  2WS3 A;  2UUA T;  4X1Y E;  1Y01 A;  2UXD T;  3AXJ A;  3KV9 A;  3T1H T;  4B6X A;  3AAE B;  4HFI A;  5LXT E;  3DPL C;  4IL4 A;  5KX5 E;  4U31 A;  4YJ2 E;  3T1Y T;  4IE5 A;  2W62 A;  2XQY A;  3RYF E;  2XJ7 A;  5ABH A;  4LMK A;  3P4R A;  3FXE B;  1SA0 E;  2OLT A;  4PFO A;  3LK2 B;  5AQJ B;  3GN5 B;  4DR4 T;  2CBI A;  2RP4 A;  4AKL A;  1XNR T;  3ZYK A;  4KHZ F;  1D1B A;  5J2U E;  3JAD A;  2FJD A;  4ZS2 A;  3KBT A;  2H3R A;  3RYC E;  2ODV A;  3QB5 K;  2ZLY A;  2LSY A;  2Q9Q B;  3RKG A;  3LG7 A;  2B1E A;  4QKN A;  2WM9 A;  1YKH B;  3NVO A;  4ERR A;  5FL0 A;  3HL6 A;  4GK5 E;  4DV5 T;  4Z91 A;  2UXC T;  4KX6 A;  2E9X D;  3B57 A;  3RIU A;  3VR9 A;  3RKO A;  3F31 A;  4MBQ A;  1HX8 A;  2XSA A;  4Z8X A;  1D1A A;  1LVF A;  3HA4 A;  3LSV A;  2ZM8 A;  4ZXL A;  5L3G B;  1N33 T;  2XSB A;  4UV8 B;  2HN1 A;  3NRY A;  4AQG A;  3RRW A;  4JV5 T;  3MK7 C;  3FHN A;  4CN1 A;  3OYZ A;  2L8K A;  4JI2 T;  2YK0 A;  3F57 A;  2AE9 A;  2E9X A;  3HR0 A;  3RIA A;  1J1J A;  4X5T A;  5FKY A;  4L0R A;  5AQP B;  3QOF A;  3K8P C;  3BK9 A;  5AQG B;  1HR0 T;  2FBW A;  2Y8D A;  4EOZ B;  2XQ4 A;  4GKK T;  1U4Q A;  5AQT B;  4O4I E;  2A3D A;  3TLW A;  3V5S A;  4AKR B;  4PJJ A;  4NPP A;  3KIN B;  4QHO A;  2KND A;  2CPT A;  1JNR A;  3WAK A;  4JI1 T;  3ZMS B;  4A56 A;  4EGW A;  2MTQ A;  5EK2 A;  4NXM T;  4CI3 B;  3WI3 A;  2VAS A;  1E1H B;  5EK4 A;  4TNW A;  5AFU L;  3FB2 A;  2XM2 A;  2IDO B;  5FXZ A;  3ANW A;  1T7S A;  1D0X A;  4U33 A;  3I9W A;  3PE0 A;  1HFA A;  2UUB T;  4IGU A;  1T98 A;  4U3C A;  5F3J A;  3RTR A;  2VWA A;  3PV0 F;  3IHR A;  4YLH A;  3BQI A;  2CHN A;  3O9X A;  2WB5 A;  3ZN0 B;  4E7S A;  3NKZ A;  2LHN A;  2CWO A;  2ZM6 T;  4ISS A; 
#chains in the Genus database with same CATH homology
 4DBR A;  4X1K E;  1UX5 A;  3Q5X A;  3UUL A;  2V26 A;  4O4H E;  4QXC B;  5DAB A;  3MXZ A;  2JJ9 A;  3GWH A;  5FY7 A;  5A1L A;  2CCQ A;  1HF8 A;  2CEA A;  2J1D G;  2Y48 B;  3N9L A;  4AKH A;  2VKJ A;  3N2O A;  3ONX A;  3O1H A;  1VOM A;  1SHZ C;  2Q9Q A;  1YD8 G;  4H9P C;  4HE8 A;  4ZHQ E;  5LG4 A;  3AA0 B;  4KBM B;  5DQV A;  4O8S A;  3SRZ A;  3LK3 B;  2PJQ A;  1MND A;  5CA1 E;  5FP3 A;  1MMG A;  2VKH A;  4OFZ A;  2KXP B;  3VKG A;  2LJL A;  1BR0 A;  3N9P A;  1BR4 A;  4M1P A;  2WAU A;  4UVA B;  2NW7 A;  2E9X B;  3ETU A;  1ZEE A;  3CPZ A;  3C64 A;  2D0U A;  1US7 B;  3C51 A;  3RC3 A;  3SOL A;  2XAF B;  5L3F B;  4I4T E;  3C4Z A;  4PJL A;  2X9W A;  3UTK A;  1Z0P A;  5CA0 E;  2NWB A;  4P0A A;  3MJX A;  4IE0 A;  4ZS3 A;  3O4X E;  2E8I A;  2HH7 A;  3KDS E;  3PU3 A;  1WYB A;  2X67 A;  2DCF A;  4DBQ A;  3ZC1 A;  1OWA A;  2ES0 A;  3AA7 B;  4AKG A;  2CLY B;  5DJQ C;  3A5X A;  2Y6X A;  3K3Q C;  1YKE B;  2PG8 A;  3RYH E;  1WR6 A;  4O2A E;  2C5K T;  3LJC A;  4CI1 B;  2N1G A;  3CX6 B;  4IIJ E;  4MFR A;  3O1J A;  2LSK A;  2D5U A;  2YU2 A;  4H63 H;  4IE6 A;  5JR9 C;  2V7M A;  4EYU A;  4QXB B;  5JDH A;  1ZKE A;  4CZZ B;  1X79 A;  4EAH A;  2IAK A;  4K0U A;  3KFW X;  2QA7 A;  1H7C A;  5KMG P;  3MZK B;  4P09 A;  4G2A A;  3I9Y A;  3UUM A;  4TV8 E;  3AVR A;  2A2F X;  3KVA A;  2C0S A;  2PBI A;  1FIO A;  3N2G E;  2EHO C;  2K24 A;  4JEU B;  4YFS A;  3AVS A;  2K5B B;  4H9S E;  2H7V C;  3ETV A;  3EVY A;  2CM0 A;  3ZCI A;  2DI4 A;  4O2B E;  4U74 A;  3C4W A;  4CXX A;  3I0O A;  1EZ3 A;  3S4U A;  1LVK A;  3ZLI A;  3CKD A;  1QSD A;  4FJO A;  5JQG E;  1NAF A;  5FXX A;  2JMK A;  5JRC B;  2Q9Q C;  2W61 A;  3CX7 B;  1MIW A;  3CWZ B;  3FBZ A;  3M65 A;  4C90 A;  3R84 B;  2DWK A;  1Y64 B;  2Z6E A;  3L09 A;  2K9A A;  2D0T A;  2LSI A;  2XU0 A;  3ZC0 A;  5KDM C;  2DHR A;  1HG2 A;  3TKL B;  2IC6 A;  1ZHC A;  2N2N A;  1HCI A;  3H3A A;  1D0Y A;  3N5L A;  5JR9 B;  1WLX A;  4OHF A;  3HKD E;  2X9H A;  5LJN A;  2KMF A;  3WAJ A;  1YW0 A;  1IJ5 A;  2WSS V;  1MMN A;  5JVD E;  4ZI2 C;  2CXF A;  3PU8 A;  4HEA A;  2BVL A;  4GOU A;  5JDF A;  2NP9 A;  3N9O A;  3C98 B;  5BMV E;  3BQK A;  3F2E A;  4UEL A;  4PK5 A;  3CQC B;  2KLQ A;  2A72 A;  3PUS A;  4OYJ A;  2KIN B;  3HKE E;  1HS7 A;  1O3X A;  2LEH A;  4C91 A;  1QUU A;  4ZI3 C;  4UVC B;  4BA9 A;  4IE4 A;  4I43 B;  1V9D A;  3C4X A;  5LCY A;  1LKX A;  5L3C B;  1MMD A;  3O1I A;  4IST A;  4UF0 A;  2VKO A;  3RH3 A;  5LYJ E;  2JPF A;  4QX8 B;  2BVM A;  2DWG A;  2PFV A;  3CQG B;  3ZPO A;  4UVB B;  4EYY R;  2XAH B;  3OBV E;  4FI5 A;  4OYK A;  4HN9 A;  4QXH B;  2YU1 A;  4X1I E;  5FNV E;  5FY0 A;  2XAG B;  2C5I T;  1MMA A;  5HXE A;  2L3L A;  5LBM A;  3U78 A;  3ZMU B;  5FMN A;  4OK0 A;  5EK3 A;  2UXX B;  3E0Z A;  3RRC A;  5ETW A;  3HKB E;  3CX8 B;  4UXN B;  2NOX A;  2K48 A;  2IW5 B;  4NUV A;  4AXP A;  4XBF B;  2MYS A;  2KWH A;  2WBL A;  3ZMV B;  3LFM A;  2CXL A;  2ZM2 A;  1HTJ F;  1IAP A;  2KT9 A;  1D1C A;  3PUA A;  2H7O A;  5HXR A;  2CWY A;  3LBX B;  2XAJ B;  3GMI A;  3OJA A;  1IJ6 A;  2X0L B;  5LOV E;  4JLE A;  5LHI B;  3AAI A;  4DO0 A;  2D2S A;  4PK4 A;  2C5J A;  1ZV4 X;  5L3D B;  1MIV A;  3D0T A;  2MBG A;  2CA5 A;  4CXY A;  4I50 E;  4U72 A;  5JDL A;  4TX5 A;  4X1Y E;  4ANJ A;  3QUJ A;  5FY1 A;  3KV4 A;  2ACX A;  3EDU A;  5FXW A;  4TZ4 C;  4PW8 A;  4EZH A;  3KV9 A;  4NUU A;  4AQF A;  1MNE A;  4B6X A;  2G0U A;  3AAE B;  3UUN A;  3DJB A;  5LXT E;  4P0B A;  5H6R B;  3MAC A;  3N9N A;  4N78 D;  1IZN B;  2V1D B;  3DTO A;  4WNK A;  5KX5 E;  3RPU A;  4H9Q C;  2LM9 A;  4TUY E;  1FEW A;  3OYX A;  2HPJ A;  3E08 A;  1CUN A;  4YJ2 E;  2VKD A;  1WYC A;  5LP6 E;  4J2C A;  1OXZ A;  4IE5 A;  2ZM0 A;  2W62 A;  2XQY A;  3RYF E;  3EUH A;  2LSJ A;  2MOZ A;  4O4L E;  2ZMA A;  1MIY A;  2NTX A;  3K3O A;  4GYS A;  4L9I A;  5M4Y A;  5HWY A;  1BR2 A;  3AA1 B;  2YIN A;  3FXE B;  1SA0 E;  3AAA B;  4PFO A;  4AKI A;  3FBL A;  3PDY A;  3KBU A;  1G8X A;  4ILU A;  2CMR A;  2X9Y A;  3ZN1 B;  5EZY E;  3ANW B;  3ZMT B;  1B7T A;  4X20 E;  3VHL A;  5GON E;  4WBN E;  3SS1 A;  3LK2 B;  4TV9 E;  1KNZ A;  5FXV A;  3GN5 B;  1AJ3 A;  4IDZ A;  2V7L A;  4PAG A;  3UT5 E;  5JDN A;  4EXT A;  5JRE A;  3VKH A;  2WMO A;  3Q9D A;  4AKL A;  2RP4 A;  2I59 A;  3AA6 B;  3ZYK A;  5HAX A;  1D1B A;  5J2U E;  2EHO B;  4UV9 B;  2W63 A;  4UF0 B;  4TN7 B;  2LT3 A;  4BJN A;  2WWU A;  2VB6 A;  4ZS2 A;  2LOS A;  4WBO A;  5JDG A;  2LHR A;  3KBT A;  2H3R A;  3RYC E;  4MLK A;  2ODV A;  3RC8 A;  4F6R C;  5LGU B;  1S35 A;  2ZLY A;  5HWX A;  2XAQ B;  3DP7 A;  2LSY A;  2Q9Q B;  4AQF C;  2VK9 A;  3JC6 C;  3LG7 A;  2B1E A;  4H9O C;  4QKN A;  4G63 A;  2WM9 A;  1S94 A;  4QX7 B;  5JDQ A;  4ZOL E;  1YKH B;  4PK6 A;  3JC6 D;  5LGN B;  5DQW A;  4ERR A;  3HL6 A;  4GK5 E;  5E0O A;  2NTY A;  3J7Y q;  4H9N C;  5CB4 E;  2V7J A;  3PTR B;  5J1G A;  2DLR A;  3CQX C;  3AB3 B;  2E9X D;  2X68 A;  3B57 A;  4HKA A;  3T8O A;  3L3P A;  3RKO A;  3F31 A;  4CQI A;  2QGS A;  4UEM A;  4MBQ A;  1HX8 A;  5HXS A;  3U3I A;  4Z8X A;  1D1A A;  2LOP A;  2X9X A;  2CLY C;  2XAS B;  1LVF A;  4HTE A;  4JEH B;  4UIG A;  3IBP A;  3HA4 A;  3ZJ1 A;  4V1A v;  1BR1 A;  2M67 A;  2ZM8 A;  4MAL A;  5L3G B;  1UCU A;  4IE7 A;  4DMV A;  1UX4 A;  2JQQ A;  3N9Q A;  3KV6 A;  4UV8 B;  3NRY A;  4H63 V;  4KUM B;  2N9D A;  3ESL A;  4WW0 A;  4AQG A;  5LA6 E;  4CI2 B;  3LK4 2;  5ADX L;  3SWH A;  3RRW A;  3IEE A;  5H6Q B;  4EB6 E;  3MKD A;  2XHE B;  4XAX B;  3NZP A;  5C8Y E;  3MK7 C;  1NWM X;  3R6N A;  3K3N A;  3FHN A;  4JUY A;  2CXD A;  4ZI7 E;  1WRD A;  3NBX X;  3OYZ A;  2L8K A;  5F8P A;  3ZMZ B;  3N9M A;  1G73 A;  4KP3 C;  2W00 A;  2DNX A;  3P7I A;  2SPC A;  4AI6 A;  2YK0 A;  3NZQ A;  3F57 A;  5IHY A;  4KMC A;  2E9X A;  3HR0 A;  3LBX A;  1D0Z A;  4GIW A;  5J2T E;  4EIW A;  2RA1 A;  3KV5 A;  4L0R A;  4GK0 E;  4PFP A;  3ZJ2 A;  5LHH B;  3I0Q A;  3K8P C;  3Q5W A;  3BK9 A;  3E22 E;  1FMV A;  2IC9 A;  3RX6 A;  3H37 A;  2Y8D A;  4IHJ E;  4ZI3 D;  3I1A A;  4HGA A;  4EOZ B;  5IYZ E;  3IF8 B;  3ZEF B;  1U4Q A;  2HPL A;  2LE8 A;  3HKC E;  3J9X 1;  2LSG A;  2X51 A;  4XZC A;  1VRB A;  4DND A;  3PUG A;  2GK9 A;  3PUR A;  5HXC A;  3P8C D;  4DVD A;  4MHC A;  2P9B A;  2BDE A;  2V7K A;  4I55 E;  5L2L A;  2WMN A;  5LHG B;  4O4I E;  2KWI B;  4DMW A;  2OA5 A;  3CVR A;  2A3D A;  3V5S A;  4AKR B;  2ODU A;  4PJJ A;  5FYM A;  4O4J E;  3KIN B;  4QHO A;  5LJM A;  2EHO D;  2JRK A;  2JMH A;  2KND A;  2KZ7 B;  3QK6 A;  3BQL A;  4GYR A;  4PJM A;  4BAY B;  3CML A;  5LGT B;  3VU7 H;  2XTL A;  1U5P A;  4PJN A;  3WAK A;  2BZB A;  3ZMS B;  3ZCJ A;  2W0G A;  4A56 A;  4ADZ A;  3PUQ A;  5LNK A;  2MTQ A;  4HFV A;  5EK2 A;  2L9Q A;  3Q2M A;  4CI3 B;  3WI3 A;  2Q9Q D;  2NW9 A;  2VAS A;  3C50 A;  3QC9 A;  3KVB A;  2X66 A;  1E1H B;  5EK4 A;  4L5G A;  5HXH A;  3RYI E;  5JRC A;  2XUE A;  4H9R C;  4PNI A;  3B13 A;  5AFU L;  5HYA A;  3OKQ A;  3MA9 A;  4E7Z A;  3HI2 A;  2CE7 A;  5L3E B;  3FB2 A;  5TAO A;  3V5U A;  5FXZ A;  3UUX B;  3ANW A;  3W15 B;  3GA8 A;  1D0X A;  4QWN B;  5JDM A;  2UXN B;  3I9W A;  3PE0 A;  1HFA A;  4ASK A;  1KK7 A;  1FMW A;  2VL8 A;  3GN5 A;  5LBQ B;  3N2K E;  4IGU A;  2YEV C;  1T98 A;  3UFE A;  5JR9 A;  4ZI2 D;  5F3J A;  2VWA A;  4BJM A;  3NRX A;  2E9X C;  3IHR A;  1LRZ A;  3ZYM A;  4YLH A;  3BQI A;  3O9X A;  4CXW A;  3ZN0 B;  5JH7 E;  4E7S A;  4EZ4 A;  1HG5 A;  2V7I A;  4YHJ A;  3EDV A;  2NW8 A;  2EHO A;  2LHN A;  2CWO A;  5L3B B;  4YJ3 E;  3FXD B;  3ZYL A;  4ISS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...