5AQHB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
111
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 111
sequence length 113
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqhB00
5AQLB 3FZLB 1HX1B 4HWDA 3M3ZB 1I6ZA 5AQUB 5AQVB 5AQPB 5AQRB 5AQKB 3FZFB 4HWCA 3FZKB 1UGOA 3A8YC 5AQOB 1UK5A 4HWFA 4HWHA 5AQNB 5AQJB 3FZHB 5AQMB 3FZMB 3LDQB 5AQHB 5AQGB 5AQFB 1T7SA 5AQIB 5AQSB 5AQQB 2D9DA 5AQTB 1M7KA 1M62A 4HWIB
chains in the Genus database with same CATH superfamily
2J1DG 4HE8A 2IAKA 2CE7A 4IDQA 1GQEA 1N32T 2C0SA 3N9OA 3JC6C 4C90A 2W2UA 5JTGA 3KVBA 5JDNA 2VK9A 3TLSA 4ANJA 3LSVA 4C91A 3ETVA 3KFWX 3O1IA 1D0YA 2BKNA 5JDHA 5L2LA 4JYAT 1YKHB 1WR0A 4WBOA 2WM9A 3PTRB 4IDZA 2CCQA 4JUYA 2LSYA 1J5ET 2WB5A 5LMNT 5HXSA 4JI5T 3FZLB 4ZI3C 4A5XA 5FVKA 3PUXF 2H3RA 5HWXA 2NWBA 4PJMA 4DR5T 2IDOB 4DMWA 2PBIA 3FZHB 3NBXX 3KVAA 4ASKA 3RRCA 4I4TE 2X0HA 3PUSA 3MACA 4TZ4C 4F8HA 5IWAT 1MMNA 1LVKA 1VCTA 2M67A 2R6GF 3A7MA 4KHZF 4ZI7E 2BVLA 1VCSA 1HX8A 3P50A 5EK4A 3K3OA 3DP7A 2LT3A 4GYRA 3O4XE 4QX8B 1CUNA 4TNWA 4O2BE 5LHIB 4HWIB 4LMJA 2C5KT 4A56A 2Q9QC 3UFGA 1WRDA 4KP3C 2V6YA 2EHOC 2IUBA 5H6RB 4YFSA 1D1CA 2L8KA 4B6XA 2UXBT 3N9QA 1D0ZA 3IA3A 1HX1B 2UXCT 5JQGE 1VRBA 3G06A 3KV6A 1W0BA 5DQWA 2XUEA 4YT0A 2IMLA 3PJAJ 2XTLA 3ZC0A 3CKDA 4LFCT 3PDYA 4G63A 2Y8DA 4YSYA 5LGTB 5L3DB 2J4GA 2BS3A 3RYHE 2XY8B 4Z90A 4IREA 4AQYT 3HI2A 3DTOA 4CQIA 1UCUA 5FXXA 2VVSA 2E9XB 5AQLB 1N33T 3RYIE 3OTOT 3BQKA 3PE0A 3C50A 3V5SA 2CHOA 4OHFA 2NOXA 3RF1A 4UXNB 1LVFA 4PAGA 1NENA 1T72A 4UR9A 3ZT5A 4A97A 2YN6A 3AA0B 2VQFT 4YJ3E 4ADZA 3CX8B 3T8OA 4ZXLA 5J0ZA 3AEEA 4DR2T 3Q2MA 2P9BA 2BDEA 3UU3A 1KEYA 1ZOYA 2CMRA 2HH7A 3I1AA 1UX5A 3ZMUB 5IUXA 4H9QC 2BVMA 2I59A 4AQFA 4AIUA 3L8RA 4UF0B 3RIUA 2DHRA 1NEKA 1IZNB 4HFBA 2K9AA 4KX6A 3N9NA 2LJLA 5A1LA 3N9PA 2WU5A 4O4JE 4A98A 2XQYA 1X79A 4MALA 1XMOT 3IHRA 5AQUB 4HFDA 4X66T 4HWDA 1HNZT 5HEGA 1B7TA 4YY3T 4X1KE 3I0QA 4OK0A 2BG9B 3AVSA 2E9XD 2JMKA 2ZLYA 2YDSA 3J9X1 5J1GA 3Q5WA 5KX5E 4IE0A 2E5VA 2FJBA 2JQKA 3ESLA 2XM1A 5ETWA 4CN6A 1US7B 3UU5A 1HCIA 2PG8A 4YSXA 3WAJA 5AQNB 2WDRA 2VKHA 3BQIA 1KNRA 3OYZA 2VB6A 4YXDA 4Z8XA 1YKEB 2WDQA 4TWHA 5HEOA 4DMVA 2H7VC 2LKGA 3RYFE 2WSSV 2IHR1 3AAAB 1ZHCA 4QXCB 2LM2A 4X64T 1D0XA 2IIUA 3OJAA 3OYXA 3M65A 4KMCA 2ES0A 5AQPB 4X1YE 2KWIB 3S4UA 2QA7A 3N2GE 2OV9A 3IBPA 5CA0E 4O4LE 2KSRA 4Q25A 4FJOA 2Q9QD 4TWFA 5EK3A 2DNXA 3AA7B 1S35A 3HA4A 4TWDA 5AQRB 3KBTA 2WMNA 4H9OC 3AXJA 4P09A 5FP3A 4U31A 3N5LA 2L9QA 3AE1A 4ERRA 2MBGA 2I6HA 5LNKA 2LLYA 4KBMB 3GA8A 4DR6T 1NAFA 3V5UA 3RIUC 2XQ9A 3P8CD 1HTJF 4L0RA 2ODUA 5HEHA 4JLEA 3P4RA 4PFOA 5F3JA 2OLTA 4XBFB 3FHNA 3ANWB 1AJ3A 5IYZE 5EK2A 3W15B 3T1HT 3WI3A 5TAOA 3B57A 4QXBB 4ILCA 2D9DA 2QGSA 1UX4A 4ZI2D 2HPLA 3U3IA 2CBIA 4YHJA 5FY7A 5HXRA 3ZMZB 4IL4A 1E2AA 5KDMC 1HFAA 2YDRA 1WFDA 4DVDA 3VHLA 3ZN0B 1UUSA 4AKHA 5AQIB 1MMDA 5AQQB 3AE7A 5CB4E 4JV5T 2ZM8A 1WYBA 5JR9A 4IT4A 2LOPA 4DIDB 3RC3A 5LB7B 4CN4A 1OEDB 3N9MA 4DR3T 4HGAA 3PU8A 3FB2A 3X1DA 3UU4A 4H63V 2KT9A 3PUVF 1Y64B 1WR6A 2H88A 2SPCA 2MYSA 4L9IA 5FY1A 5AQFB 5LGNB 2Y48B 4JI8T 4YTMA 5FNVE 3FXDB 5ABEA 4HKAA 1HNWT 3IEEA 5CA1E 1JNZA 1XDPA 2KXPB 2K24A 2LHNA 1UURA 2KNDA 3UU6A 1E7PA 1FMWA 2KLQA 2DI4A 3VKHA 3R6NA 2YU1A 2KINB 4HFHA 3MKDA 3T1YT 4QWNB 2X51A 3ZJ1A 1X9BA 5JREA 2CXLA 5GONE 4AQGA 2XHEB 1CHUA 4AXPA 3RIAA 2HN1A 2JQ9A 5AQTB 4X5TA 5HWYA 4NUVA 2FBWA 3KV9A 2D2SA 3L39A 3KV4A 4ISSA 3C98B 5JVDE 4PJJA 4HWHA 1W0AA 1QLBA 3ZCIA 4MHCA 4EB6E 3GN5B 3OBVE 1M62A 4HWFA 3ONJA 2CLYC 4ILBA 2CBJA 4E7ZA 2NW8A 1ZV4X 2VASA 3FZKB 4M1PA 4DV0T 2J47A 3C4XA 4QKNA 3FXEB 2CA5A 3ZC1A 2CEAA 2HHHT 3QK6A 4JI4T 3P4QA 5AFUL 5L3CB 3MJXA 5DABA 4TUYE 4ZZBA 3CWZB 1I94T 5LG4A 1H7CA 4O2AE 2CXFA 3FZMB 5JR9C 2E5LT 1IBMT 2AXDS 2X67A 5C2TA 3NZQA 4PFPA 4WZXA 4IL9A 5AQKB 5L3BB 2JMHA 4EYUA 4IHJE 3BQLA 3LFMA 4AKIA 4B3RT 1IBLT 3ANWA 4EV6A 3K8PC 2QYWA 2ZM6T 3LG7A 3Q5EA 1I6ZA 4JI7T 4B3ST 5KMGP 3MXZA 4QHOA 3CMLA 1UGOA 2XAQB 3QNUA 5LHGB 5ABHA 3I0OA 5FMNA 3PUGA 4YJ2E 1W09A 3CVRA 3ZSSA 3LBXB 2YKSA 2FUPA 1BR4A 4U74A 3RKGA 1HG2A 1O3XA 5LA6E 5JDGA 3I9YA 5JDFA 3PV0F 4AKGA 4AKRB 3UTKA 3VRAA 2E2AA 2W66A 2XQ3A 3OKQA 2AE9A 2KWHA 2CM0A 3VRBA 2L3LA 3AEFA 3F31A 1OEDA 2VKDA 4EXTA 3JAFA 4CXXA 3WAKA 1J5WA 4NPPA 3CX6B 5IHYA 3UULA 4LMLA 1MIWA 4IE7A 5CJ5A 3NKZA 2W4XA 1ZKEA 2A3DA 3RC8A 5L3FB 4P0AA 3AA1B 3H37A 2V1DB 4ZHQE 3UUNA 2WDVA 2RPAA 3AE5A 3BK9A 4TV9E 5BMVE 4NXNT 4BAYB 4I55E 2IC9A 3UQ4A 2JPFA 1KNPA 3ZCJA 3CPZA 5KXJA 3VU7H 4IDNA 3HKCE 3LK42 2XJ7A 2NW7A 3CK6A 3TLUA 4ZZCA 4V1Av 2XQAA 4DV4T 2Q9QB 1S94A 2EHOB 3JC6D 3KBUA 4P1NA 2YEVC 3AE4A 4QH4A 5ABFB 1XZYA 2VKOA 4DR4T 3LK2B 4DV3T 4EAHA 5LGUB 3EVYA 3HR0A 1Z0PA 4EZHA 3KINB 1IAPA 4Z91A 5LXTE 3FZFB 1ZP0A 3MZKB 3Q5XA 3GN5A 2PJQA 4J2CA 2N1GA 3H3MA 4YTNA 3MA9A 4ZI3D 1D1BA 1SHZC 2KZ7B 4UV8B 3O1JA 1T98A 2V7IA 5M4YA 2YU2A 2BBJA 4U72A 1G73A 5L4HA 2C5JA 2V7LA 2JQQA 4WYVA 4EEDA 1J1JA 4U7YA 2ZM2A 5LBMA 3C4WA 4CI1B 1IJ5A 2WWVA 2UXNB 3QB5K 3TLVA 2UU9T 2V5CA 3AEAA 4ZEYA 4UV9B 2ODVA 3E22E 4IDPA 2ACXA 2BKPA 3P4PA 3RQUA 4GYSA 2MOZA 2EHOD 4EYYR 2UXXB 3AA6B 1KFYA 3UT5E 4N78D 3UQ7A 4HFVA 2DLRA 1WYCA 5FL0A 4DNDA 3RYCE 5DQVA 3O1HA 3ZEFB 4U33A 4AQFC 1YQ4A 2WS3A 3QOFA 3EABA 2ACZA 3PUQA 1HS7A 4XAXB 5HCJA 5L4EA 4CZZB 5LCYA 4O4HE 2VURA 2WZHA 3IF8B 2CPTA 2OA5A 3NVOA 4DUYT 5CFBA 4IE4A 2GK9A 4JEUB 2LSIA 4I43B 2V6YB 1MNDA 4L5GA 4KHPT 2E9XA 5HYAA 2VWAA 5LOVE 2RP4A 4NIQA 3SS1A 4U2YA 4EGWA 5DJQC 2XQ5A 1N34T 3PU3A 4ILUA 3ZYMA 2XQ8A 4ILAA 4H9SE 4IDOA 3A5XA 4B3MT 3EDVA 1SE7A 3A8YC 3L3PA 2XASB 3EI0A 3AE6A 3C64A 2X0YA 4TV8E 4H9PC 3ZLIA 2CWOA 4LF4T 3UUBA 3AE9A 2MTQA 2V7MA 2LE8A 2B76A 3N9LA 5LJMA 4DBQA 4HFIA 4NUUA 1HG5A 1U4QA 3ZMTB 3GWHA 4UF0A 3ZSTA 2XPKA 2BZBA 4OYJA 2PFVA 3EDUA 2X66A 3N2KE 1HR0T 4MLKA 4HFEA 4XZCA 1FMVA 2B1EA 3K3NA 4QH1A 2WZIA 3KDSE 3ZPOA 4CI3B 4EOZB 3OVUA 1G8XA 4TN7B 2H89A 2Q9QA 4DO0A 1XNRT 4B3TT 4LF8T 3P7IA 3UU8A 2RA1A 1XMQT 5HXCA 4JBWF 4HWCA 2JIWA 1FIOA 2BG9A 1LRZA 4DV6T 2WBLA 2WWUA 4UELA 4LF6T 2X9HA 3CIRA 5LG3A 2NTXA 5FY0A 2LM9A 2FJAA 4EZ4A 3ABVA 4MFRA 2VQET 1XWMA 2VVNA 2W61A 4GK0E 4MBQA 2LKHA 3PUYF 2W67A 3E08A 4F6RC 3R84B 3N2OA 4I0UA 4GKJT 3ZYKA 2BBHA 4CN1A 1KNZA 2UUAT 4H9RC 4CXYA 1SUMB 4AI6A 2DCFA 2LSGA 2WP9A 4QX7B 3B5MA 1NWMX 2E9XC 4JEHB 4IE5A 2BG9E 4U3CA 1MIVA 2N9DA 4DR7T 1LKXA 2DWKA 3RH3A 4BA9A 2QVAA 3I9WA 5HEJA 1YQ3A 2CWYA 4TX5A 4KUMB 3NZPA 1KK7A 2LSKA 3AEBA 4DR1T 5JDQA 5F5WA 2YINA 2IC6A 4UVCB 4LFAT 4IGUA 4DBRA 3RPUA 4DV5T 5FKYA 4NXMT 1EZ3A 4JI1T 1FJGT 5HXHA 4DV7T 3F2EA 3UUMA 3JAEA 1BR2A 2LRKA 4COFA 3QUJA 2W0GA 4YSZA 2MAWA 5EZYE 2D5UA 1T7SA 5J2TE 5JRCB 4IIJE 2XM2A 5L47A 2FJEA 5FVLA 5HEUA 3RGLA 4GOUA 5JDMA 2HPJA 5AQJB 3AXJB 2BG9C 3PUZF 5AQGB 3SFEA 2KMFA 3ONLC 5E0OA 2LRLA 3AEGA 1OWAA 2CRBA 3F57A 3HKBE 1HF8A 2XQ4A 1QSDA 4YHHT 4H9NC 3HKEE 3PUWF 2XQ7A 5AQSB 3RHWA 1M7KA 4UEMA 2H7OA 1MMAA 4X62T 2HN2A 4X1IE 3UUXB 2LHRA 2M6IA 3PJAA 3M3ZB 4PJLA 2A9UA 1XNQT 3E0ZA 1BR1A 2M6BA 3QB5A 4O4IE 2X68A 2V6XA 3RI5A 4HN9A 3UFEA 4GKKT 2BS4A 2ZMAA 4LMKA 5JDLA 2CLYB 3OPCA 3DJBA 4I50E 4ZI2C 3K3QC 4BJMA 5JH7E 4PW8A 4AKLA 3RLFF 5AQMB 4K0UA 3J7Yq 3LDQB 2YK0A 3P4SA 5FXVA 3FBZA 2V7JA 2X9YA 2J62A 2G0UA 2IW5B 5FL1A 3P4WA 4YLHA 3AEDA 1YXRA 4WBNE 1IBKT 5C8YE 2VL0A 5JR9B 2NP9A 5HAXA 4FI5A 3Q9DA 2WAUA 2VL8A 2ZM0A 3PURA 3U78A 3HL6A 1OEDE 1ZEEA 4JI3T 3ZT7A 1UK5A 4DV1T 3RRWA 1WCRA 5AQHB 1YD8G 4PJNA 2JJ9A 3GMIA 4EEBA 2XSAA 2XZEA 4U2ZA 3RIFA 1HNXT 3K1SA 4PK4A 2X9WA 2WQYA 4ISTA 5ADXL 2NR4A 5LMUT 4CXWA 3ZT6A 4LF7T 2K5BB 3SFDA 2FJDA 4PK5A 5HCMA 5LYJE 2NTYA 2XQ6A 3ZYLA 1W9RA 3EAMA 1IJ6A 3VKGA 2UUBT 4CI2B 1WLXA 1SA0E 2V8SV 3JCFA 1KF6A 4OX9T 4ZOLE 4ZS2A 3O9XA 5F8PA 3ZKRA 3ZMSB 3B13A 2WMOA 4X20E 4GK5E 2CXDA 2XAHB 5LHHB 4JI0T 1FEWA 3AAIA 2F4VT 3AECA 3AE2A 1R8IA 3EUHA 4DUZT 1OEDC 2LEHA 3RKOA 4LF5T 3HKDE 2LOSA 3JADA 5BR8T 4YTPA 3TLTA 3AB3B 4KI0F 2LSJA 2I0MA 5C3JA 2XAFB 4HFCA 2D0TA 5JRCA 1D1AA 3C51A 2BKOA 4UVBB 3ZJ2A 1T8BA 3TLWA 4LFBT 1VOMA 2V7KA 4QH5A 4OFZA 2JRKA 2W00A 3AAEB 5LJNA 4UVAB 3CQGB 5LP6E 3LBXA 5ABGA 2PTFA 3NRXA 3KV5A 2XAJB 4HEAA 1E1HB 2WCAA 2YOEA 3C4ZA 2A72A 4GIWA 3CX7B 2W63A 4WW0A 3ZMVB 2WY2A 4IE6A 4E7SA 4PNIA 2Y6XA 2V26A 2N2NA 3D0TA 3LK3B 3VR8A 2C5IT 5FYMA 2K48A 1L0VA 5AQVB 5LBQB 1YW0A 2D0UA 3FBLA 2UXDT 3ZN1B 2V5DA 4AISA 2QRXA 2Z6EA 3SOLA 1OXZA 4ZS3A 4H63H 5J2UE 3TKLB 3ETUA 4PK6A 3RQWA 4UIGA 1Z8UA 4DV2T 1V9DA 1DU2A 2UUCT 5AQOB 4EIWA 4LF9T 5L3GB 4HTEA 2DL1A 3EHZA 4G2AA 4P0BA 3AE8A 3LJCA 1JNRA 4OYKA 3VR9A 3NRYA 2MPKA 4BJNA 3AVRA 2VKJA 3H3AA 2NW9A 3ONXA 3Q5DA 4WNKA 3RX6A 1MNEA 2CHNA 2BS2A 2YDQA 5HXEA 4JI2T 5L3EB 3AE3A 3L09A 2EHOA 4X65T 1U5PA 2X0LB 3SWHA 1N36T 4QXHB 5ABFA 4O8SA 1XDOA 3SRZA 1QUUA 2DWGA 4TNVA 5CGMA 1MIYA 5H6QB 2K3WA 2XAGB 3CQXC 2XSBA 3MK7C 2X9XA 5FXZA 2A2FX 4JI6T 4U7IA 2WU2A 4K0KT 5FXWA 1BR0A 3PUAA 3CQCB 1MMGA 2E8IA 2JQHA 2W62A 1Y01A 3NWIA 3QC9A
chains in the Genus database with same CATH topology
5AQLB 3FZLB 1HX1B 4HWDA 3M3ZB 1I6ZA 5AQUB 5AQVB 5AQPB 5AQRB 5AQKB 3FZFB 4HWCA 3FZKB 1UGOA 3A8YC 5AQOB 1UK5A 4HWFA 4HWHA 5AQNB 5AQJB 3FZHB 5AQMB 3FZMB 3LDQB 5AQHB 5AQGB 5AQFB 1T7SA 5AQIB 5AQSB 5AQQB 2D9DA 5AQTB 1M7KA 1M62A 4HWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQL B;  3FZL B;  1HX1 B;  4HWD A;  3M3Z B;  1I6Z A;  5AQU B;  5AQV B;  5AQP B;  5AQR B;  5AQK B;  3FZF B;  4HWC A;  3FZK B;  1UGO A;  3A8Y C;  5AQO B;  1UK5 A;  4HWF A;  4HWH A;  5AQN B;  5AQJ B;  3FZH B;  5AQM B;  3FZM B;  3LDQ B;  5AQH B;  5AQG B;  5AQF B;  1T7S A;  5AQI B;  5AQS B;  5AQQ B;  2D9D A;  5AQT B;  1M7K A;  1M62 A;  4HWI B; 
#chains in the Genus database with same CATH topology
 2J1D G;  4HE8 A;  2IAK A;  2CE7 A;  4IDQ A;  1GQE A;  1N32 T;  2C0S A;  3N9O A;  3JC6 C;  4C90 A;  2W2U A;  5JTG A;  3KVB A;  5JDN A;  2VK9 A;  3TLS A;  4ANJ A;  3LSV A;  4C91 A;  3ETV A;  3KFW X;  3O1I A;  1D0Y A;  2BKN A;  5JDH A;  5L2L A;  4JYA T;  1YKH B;  1WR0 A;  4WBO A;  2WM9 A;  3PTR B;  4IDZ A;  2CCQ A;  4JUY A;  2LSY A;  1J5E T;  2WB5 A;  5LMN T;  5HXS A;  4JI5 T;  3FZL B;  4ZI3 C;  4A5X A;  5FVK A;  3PUX F;  2H3R A;  5HWX A;  2NWB A;  4PJM A;  4DR5 T;  2IDO B;  4DMW A;  2PBI A;  3FZH B;  3NBX X;  3KVA A;  4ASK A;  3RRC A;  4I4T E;  2X0H A;  3PUS A;  3MAC A;  4TZ4 C;  4F8H A;  5IWA T;  1MMN A;  1LVK A;  1VCT A;  2M67 A;  2R6G F;  3A7M A;  4KHZ F;  4ZI7 E;  2BVL A;  1VCS A;  1HX8 A;  3P50 A;  5EK4 A;  3K3O A;  3DP7 A;  2LT3 A;  4GYR A;  3O4X E;  4QX8 B;  1CUN A;  4TNW A;  4O2B E;  5LHI B;  4HWI B;  4LMJ A;  2C5K T;  4A56 A;  2Q9Q C;  3UFG A;  1WRD A;  4KP3 C;  2V6Y A;  2EHO C;  2IUB A;  5H6R B;  4YFS A;  1D1C A;  2L8K A;  4B6X A;  2UXB T;  3N9Q A;  1D0Z A;  3IA3 A;  1HX1 B;  2UXC T;  5JQG E;  1VRB A;  3G06 A;  3KV6 A;  1W0B A;  5DQW A;  2XUE A;  4YT0 A;  2IML A;  3PJA J;  2XTL A;  3ZC0 A;  3CKD A;  4LFC T;  3PDY A;  4G63 A;  2Y8D A;  4YSY A;  5LGT B;  5L3D B;  2J4G A;  2BS3 A;  3RYH E;  2XY8 B;  4Z90 A;  4IRE A;  4AQY T;  3HI2 A;  3DTO A;  4CQI A;  1UCU A;  5FXX A;  2VVS A;  2E9X B;  5AQL B;  1N33 T;  3RYI E;  3OTO T;  3BQK A;  3PE0 A;  3C50 A;  3V5S A;  2CHO A;  4OHF A;  2NOX A;  3RF1 A;  4UXN B;  1LVF A;  4PAG A;  1NEN A;  1T72 A;  4UR9 A;  3ZT5 A;  4A97 A;  2YN6 A;  3AA0 B;  2VQF T;  4YJ3 E;  4ADZ A;  3CX8 B;  3T8O A;  4ZXL A;  5J0Z A;  3AEE A;  4DR2 T;  3Q2M A;  2P9B A;  2BDE A;  3UU3 A;  1KEY A;  1ZOY A;  2CMR A;  2HH7 A;  3I1A A;  1UX5 A;  3ZMU B;  5IUX A;  4H9Q C;  2BVM A;  2I59 A;  4AQF A;  4AIU A;  3L8R A;  4UF0 B;  3RIU A;  2DHR A;  1NEK A;  1IZN B;  4HFB A;  2K9A A;  4KX6 A;  3N9N A;  2LJL A;  5A1L A;  3N9P A;  2WU5 A;  4O4J E;  4A98 A;  2XQY A;  1X79 A;  4MAL A;  1XMO T;  3IHR A;  5AQU B;  4HFD A;  4X66 T;  4HWD A;  1HNZ T;  5HEG A;  1B7T A;  4YY3 T;  4X1K E;  3I0Q A;  4OK0 A;  2BG9 B;  3AVS A;  2E9X D;  2JMK A;  2ZLY A;  2YDS A;  3J9X 1;  5J1G A;  3Q5W A;  5KX5 E;  4IE0 A;  2E5V A;  2FJB A;  2JQK A;  3ESL A;  2XM1 A;  5ETW A;  4CN6 A;  1US7 B;  3UU5 A;  1HCI A;  2PG8 A;  4YSX A;  3WAJ A;  5AQN B;  2WDR A;  2VKH A;  3BQI A;  1KNR A;  3OYZ A;  2VB6 A;  4YXD A;  4Z8X A;  1YKE B;  2WDQ A;  4TWH A;  5HEO A;  4DMV A;  2H7V C;  2LKG A;  3RYF E;  2WSS V;  2IHR 1;  3AAA B;  1ZHC A;  4QXC B;  2LM2 A;  4X64 T;  1D0X A;  2IIU A;  3OJA A;  3OYX A;  3M65 A;  4KMC A;  2ES0 A;  5AQP B;  4X1Y E;  2KWI B;  3S4U A;  2QA7 A;  3N2G E;  2OV9 A;  3IBP A;  5CA0 E;  4O4L E;  2KSR A;  4Q25 A;  4FJO A;  2Q9Q D;  4TWF A;  5EK3 A;  2DNX A;  3AA7 B;  1S35 A;  3HA4 A;  4TWD A;  5AQR B;  3KBT A;  2WMN A;  4H9O C;  3AXJ A;  4P09 A;  5FP3 A;  4U31 A;  3N5L A;  2L9Q A;  3AE1 A;  4ERR A;  2MBG A;  2I6H A;  5LNK A;  2LLY A;  4KBM B;  3GA8 A;  4DR6 T;  1NAF A;  3V5U A;  3RIU C;  2XQ9 A;  3P8C D;  1HTJ F;  4L0R A;  2ODU A;  5HEH A;  4JLE A;  3P4R A;  4PFO A;  5F3J A;  2OLT A;  4XBF B;  3FHN A;  3ANW B;  1AJ3 A;  5IYZ E;  5EK2 A;  3W15 B;  3T1H T;  3WI3 A;  5TAO A;  3B57 A;  4QXB B;  4ILC A;  2D9D A;  2QGS A;  1UX4 A;  4ZI2 D;  2HPL A;  3U3I A;  2CBI A;  4YHJ A;  5FY7 A;  5HXR A;  3ZMZ B;  4IL4 A;  1E2A A;  5KDM C;  1HFA A;  2YDR A;  1WFD A;  4DVD A;  3VHL A;  3ZN0 B;  1UUS A;  4AKH A;  5AQI B;  1MMD A;  5AQQ B;  3AE7 A;  5CB4 E;  4JV5 T;  2ZM8 A;  1WYB A;  5JR9 A;  4IT4 A;  2LOP A;  4DID B;  3RC3 A;  5LB7 B;  4CN4 A;  1OED B;  3N9M A;  4DR3 T;  4HGA A;  3PU8 A;  3FB2 A;  3X1D A;  3UU4 A;  4H63 V;  2KT9 A;  3PUV F;  1Y64 B;  1WR6 A;  2H88 A;  2SPC A;  2MYS A;  4L9I A;  5FY1 A;  5AQF B;  5LGN B;  2Y48 B;  4JI8 T;  4YTM A;  5FNV E;  3FXD B;  5ABE A;  4HKA A;  1HNW T;  3IEE A;  5CA1 E;  1JNZ A;  1XDP A;  2KXP B;  2K24 A;  2LHN A;  1UUR A;  2KND A;  3UU6 A;  1E7P A;  1FMW A;  2KLQ A;  2DI4 A;  3VKH A;  3R6N A;  2YU1 A;  2KIN B;  4HFH A;  3MKD A;  3T1Y T;  4QWN B;  2X51 A;  3ZJ1 A;  1X9B A;  5JRE A;  2CXL A;  5GON E;  4AQG A;  2XHE B;  1CHU A;  4AXP A;  3RIA A;  2HN1 A;  2JQ9 A;  5AQT B;  4X5T A;  5HWY A;  4NUV A;  2FBW A;  3KV9 A;  2D2S A;  3L39 A;  3KV4 A;  4ISS A;  3C98 B;  5JVD E;  4PJJ A;  4HWH A;  1W0A A;  1QLB A;  3ZCI A;  4MHC A;  4EB6 E;  3GN5 B;  3OBV E;  1M62 A;  4HWF A;  3ONJ A;  2CLY C;  4ILB A;  2CBJ A;  4E7Z A;  2NW8 A;  1ZV4 X;  2VAS A;  3FZK B;  4M1P A;  4DV0 T;  2J47 A;  3C4X A;  4QKN A;  3FXE B;  2CA5 A;  3ZC1 A;  2CEA A;  2HHH T;  3QK6 A;  4JI4 T;  3P4Q A;  5AFU L;  5L3C B;  3MJX A;  5DAB A;  4TUY E;  4ZZB A;  3CWZ B;  1I94 T;  5LG4 A;  1H7C A;  4O2A E;  2CXF A;  3FZM B;  5JR9 C;  2E5L T;  1IBM T;  2AXD S;  2X67 A;  5C2T A;  3NZQ A;  4PFP A;  4WZX A;  4IL9 A;  5AQK B;  5L3B B;  2JMH A;  4EYU A;  4IHJ E;  3BQL A;  3LFM A;  4AKI A;  4B3R T;  1IBL T;  3ANW A;  4EV6 A;  3K8P C;  2QYW A;  2ZM6 T;  3LG7 A;  3Q5E A;  1I6Z A;  4JI7 T;  4B3S T;  5KMG P;  3MXZ A;  4QHO A;  3CML A;  1UGO A;  2XAQ B;  3QNU A;  5LHG B;  5ABH A;  3I0O A;  5FMN A;  3PUG A;  4YJ2 E;  1W09 A;  3CVR A;  3ZSS A;  3LBX B;  2YKS A;  2FUP A;  1BR4 A;  4U74 A;  3RKG A;  1HG2 A;  1O3X A;  5LA6 E;  5JDG A;  3I9Y A;  5JDF A;  3PV0 F;  4AKG A;  4AKR B;  3UTK A;  3VRA A;  2E2A A;  2W66 A;  2XQ3 A;  3OKQ A;  2AE9 A;  2KWH A;  2CM0 A;  3VRB A;  2L3L A;  3AEF A;  3F31 A;  1OED A;  2VKD A;  4EXT A;  3JAF A;  4CXX A;  3WAK A;  1J5W A;  4NPP A;  3CX6 B;  5IHY A;  3UUL A;  4LML A;  1MIW A;  4IE7 A;  5CJ5 A;  3NKZ A;  2W4X A;  1ZKE A;  2A3D A;  3RC8 A;  5L3F B;  4P0A A;  3AA1 B;  3H37 A;  2V1D B;  4ZHQ E;  3UUN A;  2WDV A;  2RPA A;  3AE5 A;  3BK9 A;  4TV9 E;  5BMV E;  4NXN T;  4BAY B;  4I55 E;  2IC9 A;  3UQ4 A;  2JPF A;  1KNP A;  3ZCJ A;  3CPZ A;  5KXJ A;  3VU7 H;  4IDN A;  3HKC E;  3LK4 2;  2XJ7 A;  2NW7 A;  3CK6 A;  3TLU A;  4ZZC A;  4V1A v;  2XQA A;  4DV4 T;  2Q9Q B;  1S94 A;  2EHO B;  3JC6 D;  3KBU A;  4P1N A;  2YEV C;  3AE4 A;  4QH4 A;  5ABF B;  1XZY A;  2VKO A;  4DR4 T;  3LK2 B;  4DV3 T;  4EAH A;  5LGU B;  3EVY A;  3HR0 A;  1Z0P A;  4EZH A;  3KIN B;  1IAP A;  4Z91 A;  5LXT E;  3FZF B;  1ZP0 A;  3MZK B;  3Q5X A;  3GN5 A;  2PJQ A;  4J2C A;  2N1G A;  3H3M A;  4YTN A;  3MA9 A;  4ZI3 D;  1D1B A;  1SHZ C;  2KZ7 B;  4UV8 B;  3O1J A;  1T98 A;  2V7I A;  5M4Y A;  2YU2 A;  2BBJ A;  4U72 A;  1G73 A;  5L4H A;  2C5J A;  2V7L A;  2JQQ A;  4WYV A;  4EED A;  1J1J A;  4U7Y A;  2ZM2 A;  5LBM A;  3C4W A;  4CI1 B;  1IJ5 A;  2WWV A;  2UXN B;  3QB5 K;  3TLV A;  2UU9 T;  2V5C A;  3AEA A;  4ZEY A;  4UV9 B;  2ODV A;  3E22 E;  4IDP A;  2ACX A;  2BKP A;  3P4P A;  3RQU A;  4GYS A;  2MOZ A;  2EHO D;  4EYY R;  2UXX B;  3AA6 B;  1KFY A;  3UT5 E;  4N78 D;  3UQ7 A;  4HFV A;  2DLR A;  1WYC A;  5FL0 A;  4DND A;  3RYC E;  5DQV A;  3O1H A;  3ZEF B;  4U33 A;  4AQF C;  1YQ4 A;  2WS3 A;  3QOF A;  3EAB A;  2ACZ A;  3PUQ A;  1HS7 A;  4XAX B;  5HCJ A;  5L4E A;  4CZZ B;  5LCY A;  4O4H E;  2VUR A;  2WZH A;  3IF8 B;  2CPT A;  2OA5 A;  3NVO A;  4DUY T;  5CFB A;  4IE4 A;  2GK9 A;  4JEU B;  2LSI A;  4I43 B;  2V6Y B;  1MND A;  4L5G A;  4KHP T;  2E9X A;  5HYA A;  2VWA A;  5LOV E;  2RP4 A;  4NIQ A;  3SS1 A;  4U2Y A;  4EGW A;  5DJQ C;  2XQ5 A;  1N34 T;  3PU3 A;  4ILU A;  3ZYM A;  2XQ8 A;  4ILA A;  4H9S E;  4IDO A;  3A5X A;  4B3M T;  3EDV A;  1SE7 A;  3A8Y C;  3L3P A;  2XAS B;  3EI0 A;  3AE6 A;  3C64 A;  2X0Y A;  4TV8 E;  4H9P C;  3ZLI A;  2CWO A;  4LF4 T;  3UUB A;  3AE9 A;  2MTQ A;  2V7M A;  2LE8 A;  2B76 A;  3N9L A;  5LJM A;  4DBQ A;  4HFI A;  4NUU A;  1HG5 A;  1U4Q A;  3ZMT B;  3GWH A;  4UF0 A;  3ZST A;  2XPK A;  2BZB A;  4OYJ A;  2PFV A;  3EDU A;  2X66 A;  3N2K E;  1HR0 T;  4MLK A;  4HFE A;  4XZC A;  1FMV A;  2B1E A;  3K3N A;  4QH1 A;  2WZI A;  3KDS E;  3ZPO A;  4CI3 B;  4EOZ B;  3OVU A;  1G8X A;  4TN7 B;  2H89 A;  2Q9Q A;  4DO0 A;  1XNR T;  4B3T T;  4LF8 T;  3P7I A;  3UU8 A;  2RA1 A;  1XMQ T;  5HXC A;  4JBW F;  4HWC A;  2JIW A;  1FIO A;  2BG9 A;  1LRZ A;  4DV6 T;  2WBL A;  2WWU A;  4UEL A;  4LF6 T;  2X9H A;  3CIR A;  5LG3 A;  2NTX A;  5FY0 A;  2LM9 A;  2FJA A;  4EZ4 A;  3ABV A;  4MFR A;  2VQE T;  1XWM A;  2VVN A;  2W61 A;  4GK0 E;  4MBQ A;  2LKH A;  3PUY F;  2W67 A;  3E08 A;  4F6R C;  3R84 B;  3N2O A;  4I0U A;  4GKJ T;  3ZYK A;  2BBH A;  4CN1 A;  1KNZ A;  2UUA T;  4H9R C;  4CXY A;  1SUM B;  4AI6 A;  2DCF A;  2LSG A;  2WP9 A;  4QX7 B;  3B5M A;  1NWM X;  2E9X C;  4JEH B;  4IE5 A;  2BG9 E;  4U3C A;  1MIV A;  2N9D A;  4DR7 T;  1LKX A;  2DWK A;  3RH3 A;  4BA9 A;  2QVA A;  3I9W A;  5HEJ A;  1YQ3 A;  2CWY A;  4TX5 A;  4KUM B;  3NZP A;  1KK7 A;  2LSK A;  3AEB A;  4DR1 T;  5JDQ A;  5F5W A;  2YIN A;  2IC6 A;  4UVC B;  4LFA T;  4IGU A;  4DBR A;  3RPU A;  4DV5 T;  5FKY A;  4NXM T;  1EZ3 A;  4JI1 T;  1FJG T;  5HXH A;  4DV7 T;  3F2E A;  3UUM A;  3JAE A;  1BR2 A;  2LRK A;  4COF A;  3QUJ A;  2W0G A;  4YSZ A;  2MAW A;  5EZY E;  2D5U A;  1T7S A;  5J2T E;  5JRC B;  4IIJ E;  2XM2 A;  5L47 A;  2FJE A;  5FVL A;  5HEU A;  3RGL A;  4GOU A;  5JDM A;  2HPJ A;  5AQJ B;  3AXJ B;  2BG9 C;  3PUZ F;  5AQG B;  3SFE A;  2KMF A;  3ONL C;  5E0O A;  2LRL A;  3AEG A;  1OWA A;  2CRB A;  3F57 A;  3HKB E;  1HF8 A;  2XQ4 A;  1QSD A;  4YHH T;  4H9N C;  3HKE E;  3PUW F;  2XQ7 A;  5AQS B;  3RHW A;  1M7K A;  4UEM A;  2H7O A;  1MMA A;  4X62 T;  2HN2 A;  4X1I E;  3UUX B;  2LHR A;  2M6I A;  3PJA A;  3M3Z B;  4PJL A;  2A9U A;  1XNQ T;  3E0Z A;  1BR1 A;  2M6B A;  3QB5 A;  4O4I E;  2X68 A;  2V6X A;  3RI5 A;  4HN9 A;  3UFE A;  4GKK T;  2BS4 A;  2ZMA A;  4LMK A;  5JDL A;  2CLY B;  3OPC A;  3DJB A;  4I50 E;  4ZI2 C;  3K3Q C;  4BJM A;  5JH7 E;  4PW8 A;  4AKL A;  3RLF F;  5AQM B;  4K0U A;  3J7Y q;  3LDQ B;  2YK0 A;  3P4S A;  5FXV A;  3FBZ A;  2V7J A;  2X9Y A;  2J62 A;  2G0U A;  2IW5 B;  5FL1 A;  3P4W A;  4YLH A;  3AED A;  1YXR A;  4WBN E;  1IBK T;  5C8Y E;  2VL0 A;  5JR9 B;  2NP9 A;  5HAX A;  4FI5 A;  3Q9D A;  2WAU A;  2VL8 A;  2ZM0 A;  3PUR A;  3U78 A;  3HL6 A;  1OED E;  1ZEE A;  4JI3 T;  3ZT7 A;  1UK5 A;  4DV1 T;  3RRW A;  1WCR A;  5AQH B;  1YD8 G;  4PJN A;  2JJ9 A;  3GMI A;  4EEB A;  2XSA A;  2XZE A;  4U2Z A;  3RIF A;  1HNX T;  3K1S A;  4PK4 A;  2X9W A;  2WQY A;  4IST A;  5ADX L;  2NR4 A;  5LMU T;  4CXW A;  3ZT6 A;  4LF7 T;  2K5B B;  3SFD A;  2FJD A;  4PK5 A;  5HCM A;  5LYJ E;  2NTY A;  2XQ6 A;  3ZYL A;  1W9R A;  3EAM A;  1IJ6 A;  3VKG A;  2UUB T;  4CI2 B;  1WLX A;  1SA0 E;  2V8S V;  3JCF A;  1KF6 A;  4OX9 T;  4ZOL E;  4ZS2 A;  3O9X A;  5F8P A;  3ZKR A;  3ZMS B;  3B13 A;  2WMO A;  4X20 E;  4GK5 E;  2CXD A;  2XAH B;  5LHH B;  4JI0 T;  1FEW A;  3AAI A;  2F4V T;  3AEC A;  3AE2 A;  1R8I A;  3EUH A;  4DUZ T;  1OED C;  2LEH A;  3RKO A;  4LF5 T;  3HKD E;  2LOS A;  3JAD A;  5BR8 T;  4YTP A;  3TLT A;  3AB3 B;  4KI0 F;  2LSJ A;  2I0M A;  5C3J A;  2XAF B;  4HFC A;  2D0T A;  5JRC A;  1D1A A;  3C51 A;  2BKO A;  4UVB B;  3ZJ2 A;  1T8B A;  3TLW A;  4LFB T;  1VOM A;  2V7K A;  4QH5 A;  4OFZ A;  2JRK A;  2W00 A;  3AAE B;  5LJN A;  4UVA B;  3CQG B;  5LP6 E;  3LBX A;  5ABG A;  2PTF A;  3NRX A;  3KV5 A;  2XAJ B;  4HEA A;  1E1H B;  2WCA A;  2YOE A;  3C4Z A;  2A72 A;  4GIW A;  3CX7 B;  2W63 A;  4WW0 A;  3ZMV B;  2WY2 A;  4IE6 A;  4E7S A;  4PNI A;  2Y6X A;  2V26 A;  2N2N A;  3D0T A;  3LK3 B;  3VR8 A;  2C5I T;  5FYM A;  2K48 A;  1L0V A;  5AQV B;  5LBQ B;  1YW0 A;  2D0U A;  3FBL A;  2UXD T;  3ZN1 B;  2V5D A;  4AIS A;  2QRX A;  2Z6E A;  3SOL A;  1OXZ A;  4ZS3 A;  4H63 H;  5J2U E;  3TKL B;  3ETU A;  4PK6 A;  3RQW A;  4UIG A;  1Z8U A;  4DV2 T;  1V9D A;  1DU2 A;  2UUC T;  5AQO B;  4EIW A;  4LF9 T;  5L3G B;  4HTE A;  2DL1 A;  3EHZ A;  4G2A A;  4P0B A;  3AE8 A;  3LJC A;  1JNR A;  4OYK A;  3VR9 A;  3NRY A;  2MPK A;  4BJN A;  3AVR A;  2VKJ A;  3H3A A;  2NW9 A;  3ONX A;  3Q5D A;  4WNK A;  3RX6 A;  1MNE A;  2CHN A;  2BS2 A;  2YDQ A;  5HXE A;  4JI2 T;  5L3E B;  3AE3 A;  3L09 A;  2EHO A;  4X65 T;  1U5P A;  2X0L B;  3SWH A;  1N36 T;  4QXH B;  5ABF A;  4O8S A;  1XDO A;  3SRZ A;  1QUU A;  2DWG A;  4TNV A;  5CGM A;  1MIY A;  5H6Q B;  2K3W A;  2XAG B;  3CQX C;  2XSB A;  3MK7 C;  2X9X A;  5FXZ A;  2A2F X;  4JI6 T;  4U7I A;  2WU2 A;  4K0K T;  5FXW A;  1BR0 A;  3PUA A;  3CQC B;  1MMG A;  2E8I A;  2JQH A;  2W62 A;  1Y01 A;  3NWI A;  3QC9 A; 
#chains in the Genus database with same CATH homology
 5AQL B;  3FZL B;  1HX1 B;  4HWD A;  3M3Z B;  1I6Z A;  5AQU B;  5AQV B;  5AQP B;  5AQR B;  5AQK B;  3FZF B;  4HWC A;  3FZK B;  1UGO A;  3A8Y C;  5AQO B;  1UK5 A;  4HWF A;  4HWH A;  5AQN B;  5AQJ B;  3FZH B;  5AQM B;  3FZM B;  3LDQ B;  5AQH B;  5AQG B;  5AQF B;  1T7S A;  5AQI B;  5AQS B;  5AQQ B;  2D9D A;  5AQT B;  1M7K A;  1M62 A;  4HWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...