5AQHB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
111
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 41
structure length 111
sequence length 113
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqhB00
4HWIB 3FZHB 5AQIB 5AQLB 1UK5A 4HWHA 5AQFB 2D9DA 1T7SA 5AQGB 5AQTB 1I6ZA 5AQUB 1M62A 4HWDA 5AQOB 5AQSB 5AQHB 3FZMB 4HWCA 5AQPB 5AQMB 1HX1B 5AQKB 3A8YC 1M7KA 3LDQB 3FZKB 5AQNB 5AQVB 1UGOA 5AQQB 3FZFB 3M3ZB 4HWFA 5AQJB 5AQRB 3FZLB
chains in the Genus database with same CATH superfamily
1ZP0A 4GK5E 5L3GB 4TWHA 4B6XA 3ZYLA 3ZMZB 4DR5T 1MIYA 3I1AA 2IW5B 5AQPB 3IF8B 2UXNB 5JR9C 1WR6A 2VKHA 3KDSE 3CX7B 2BDEA 4GIWA 2DCFA 5LG3A 4HE8A 1CUNA 1XZYA 3WAKA 2XQAA 5LB7B 3UUMA 2WZIA 4PFPA 2XQ4A 3PUZF 3OVUA 2VL0A 2X0LB 1W9RA 2N1GA 3GN5A 3RRWA 5FL0A 4AXPA 5HWYA 4YSXA 5H6RB 2CE7A 5DQWA 4ISTA 4ZXLA 3N9PA 3ZKRA 4ZZBA 5JDFA 3AAEB 3CQCB 2Y8DA 4UV8B 5LG4A 4CI2B 2V7JA 2VQET 5F3JA 4LFAT 5JDLA 3T1YT 1JNRA 3ZN1B 5AQIB 1KNZA 3LFMA 2H7VC 3ZJ2A 3ONLC 2X67A 1HNWT 3QB5K 4QH4A 4PK6A 5HXCA 1X9BA 4UF0A 4K0KT 3NBXX 3EDUA 3A8YC 3ZT5A 1V9DA 4C90A 1VCTA 3ZT6A 2NWBA 5FXZA 3LK42 5CJ5A 1HTJF 2VKDA 4JV5T 1MIVA 2N2NA 3I0QA 4LMKA 2UXCT 3X1DA 3MXZA 1HG2A 4TWDA 5J1GA 4IL9A 4E7ZA 3ZC0A 1HX8A 3MK7C 3AE1A 3ZMSB 3RKGA 1XWMA 3E22E 4P1NA 4KI0F 4DVDA 2AXDS 1QLBA 1WYCA 4NPPA 5ADXL 2WDQA 3EHZA 1YW0A 3CIRA 3BQIA 4JI0T 1VCSA 4PJJA 1T98A 3BQLA 4NXMT 4QXHB 1LKXA 4PJNA 1SA0E 3IA3A 5L47A 4LMJA 4H9NC 1UX5A 2LKGA 2XJ7A 2ZM2A 4CZZB 2W2UA 1Y01A 2YOEA 3AXJA 2EHOA 2I0MA 2IC9A 3I9YA 4BAYB 2CWOA 5ABFA 5FNVE 2HPLA 2VVSA 2ZLYA 3S4UA 5AQQB 2KT9A 2V6YA 1XMQT 4Z8XA 2C5JA 3JAFA 1EZ3A 4I4TE 1E7PA 3RYIE 3BK9A 2E9XC 5J0ZA 3FBLA 2JMHA 4H9QC 4KUMB 1NAFA 2YN6A 4UV9B 1KK7A 5AQFB 5EZYE 5BMVE 4LF7T 4EGWA 4DNDA 3KBTA 4JI3T 4NXNT 3M65A 4G63A 5JDQA 4GYSA 4X62T 2WAUA 4EYUA 2VKOA 4HKAA 5FKYA 2LJLA 2XM2A 5AQKB 2QRXA 3C4XA 2IUBA 3H37A 1W0BA 3FXEB 4CN6A 1US7B 4WBOA 3L09A 5C3JA 4O4HE 2X9HA 4YHHT 2FUPA 4QHOA 1KEYA 4ANJA 2LT3A 5AQVB 1HNZT 4IHJE 2BS3A 2NOXA 5LHHB 4P09A 3EUHA 4AKLA 4TWFA 2JQQA 5LNKA 4X1YE 5IWAT 3EAMA 3FZKB 4AIUA 3ETVA 5FXXA 4YSZA 3C4ZA 4QH1A 3N2GE 2IMLA 3SRZA 3JC6C 2W67A 3Q5DA 3ZT7A 4YTMA 1BR2A 3GN5B 4QXCB 4F8HA 1AJ3A 3VRBA 2VKJA 2I59A 1MIWA 2AE9A 2Q9QB 1MMDA 2WZHA 4DO0A 2VB6A 5HEUA 4ZHQE 5HEOA 2D5UA 4QXBB 3AE5A 5L4EA 1XDPA 4KX6A 5JDMA 4YJ3E 1LRZA 5FL1A 2KXPB 3CQXC 2XAHB 3QC9A 3U3IA 3F57A 3HL6A 3K3QC 1IBKT 3ZMUB 3RQUA 1UGOA 5CGMA 5HXRA 3RYCE 3KFWX 2W66A 5CA0E 4E7SA 4UVCB 3AEGA 4UF0B 3UT5E 2KMFA 3RC3A 3U78A 2LEHA 3B5MA 4I50E 1D0YA 4QX7B 1YXRA 1D1AA 4TZ4C 4EV6A 2BZBA 4QWNB 3SFEA 2A2FX 5L4HA 2W4XA 3P4RA 1M62A 3AEFA 4X1KE 3HI2A 1UUSA 5AFUL 4KMCA 3O1IA 1G8XA 4EZ4A 3ZPOA 3E0ZA 3VHLA 3GA8A 2X9WA 3IEEA 4ZI3C 4HTEA 4U2YA 5JQGE 1CHUA 2VQFT 2W00A 4WYVA 3PU3A 2UXXB 5FY1A 2WWVA 3LK2B 2V7LA 4EIWA 4GYRA 2HH7A 2CPTA 5JDHA 4X1IE 1OEDB 4CI3B 3SFDA 4ZS2A 3PURA 3UUBA 4FJOA 1B7TA 2L3LA 4ZEYA 5FVLA 4DIDB 2DLRA 2V7IA 1M7KA 3AA0B 4YTPA 1IBLT 3L8RA 4MLKA 3AXJB 2K3WA 1UURA 3RIAA 2EHOB 2NTXA 4ILUA 1I6ZA 5ABFB 4IIJE 1UX4A 4H63H 1MMGA 5IHYA 2J1DG 3V5UA 2JMKA 3B57A 2V6YB 1SE7A 2BG9A 3EI0A 2CHOA 1J1JA 4H9PC 5JH7E 3OYXA 1MNEA 2E8IA 4IDOA 3UUNA 5FVKA 2B1EA 3PUXF 1YQ3A 4B3TT 5DQVA 2BBHA 2KSRA 3Q5XA 1ZV4X 2JJ9A 4GKJT 5LGTB 2A9UA 3N9OA 3C4WA 2M6BA 3PDYA 5HXHA 3ZCIA 5C2TA 4DR1T 3ONJA 4LFBT 3P7IA 3UUXB 4YTNA 2BKNA 4TNWA 4U7YA 5AQUB 4EEBA 3KV6A 3UU5A 4XBFB 1Z0PA 5L3BB 3PUGA 4H9RC 3TKLB 4TV8E 3M3ZB 3B13A 4NUUA 2Q9QA 3IBPA 5CA1E 2WDRA 2WQYA 2XQ3A 3GWHA 4I0UA 4AQGA 1YKHB 3RKOA 3C51A 1IZNB 2CXLA 2LSIA 4PK5A 3WI3A 4U7IA 5LMNT 3RC8A 3N9LA 2MOZA 4DV5T 3A5XA 2ACZA 2MTQA 4ZZCA 2QYWA 4JEHB 4COFA 2G0UA 5E0OA 3UFEA 3JADA 4F6RC 4LF9T 4B3ST 2RA1A 3G06A 3NRXA 4JLEA 2K48A 4LF8T 3ZMVB 4CXYA 4HWHA 4ILAA 2E9XD 2BS4A 5LXTE 2JQKA 1T72A 1Y64B 1W09A 3LJCA 5IUXA 2ES0A 2R6GF 3QK6A 2XPKA 4DR4T 4QKNA 1LVFA 4UEMA 3EVYA 1YKEB 1XNQT 2LE8A 2E5VA 1D1CA 5AQGB 5LCYA 2VURA 2LKHA 4KP3C 2RPAA 2WDVA 3RIUA 1NEKA 4JI6T 3PV0F 3P8CD 5ABHA 3VR9A 3RX6A 3P4PA 3K8PC 4KBMB 1OEDA 4YJ2E 3UTKA 4ZI7E 2XY8B 2KLQA 3ZEFB 5L3FB 4B3RT 4ZI2D 3CK6A 5GONE 4A5XA 1S94A 3AA1B 2V7KA 3OTOT 4DV0T 3V5SA 1X79A 4IGUA 5LGUB 4L5GA 4PAGA 3ANWB 5HAXA 5L3DB 3ZJ1A 2XM1A 2H7OA 2XAFB 2DWGA 3OJAA 4DV3T 2QVAA 3RRCA 3N9QA 5HXEA 3KV4A 4U2ZA 2WY2A 4A56A 1HR0T 4QH5A 2ODUA 4X66T 3JC6D 3MZKB 3AEDA 3FZFB 4O8SA 1WRDA 1HCIA 4QX8B 1N32T 3UQ7A 3ZYMA 2CXDA 2WMOA 4UELA 4DR3T 4V1Av 2D0TA 2ZMAA 3QOFA 1D0ZA 5HCMA 1HFAA 4EOZB 5DJQC 2CEAA 2MYSA 3BQKA 4UXNB 3PJAJ 5EK2A 2QGSA 5JTGA 4HGAA 1Z8UA 1NWMX 4WZXA 1O3XA 3AEEA 2WCAA 5JRCB 3VKHA 2X0YA 2XAGB 3DP7A 3Q2MA 3C50A 3F31A 5LOVE 5AQOB 4ZOLE 3P4SA 4KHZF 1VRBA 4OYJA 2W62A 5LJNA 2N9DA 1L0VA 5LBQB 2K9AA 3L3PA 3ZC1A 4EZHA 1J5ET 2DL1A 3ZN0B 3VRAA 2A3DA 3SOLA 2CA5A 3JAEA 3HR0A 3O9XA 2BG9B 2CM0A 4DV2T 2NW9A 3D0TA 1ZHCA 3RQWA 3PUQA 4LF4T 2XQ9A 2MAWA 4A98A 3PJAA 4OHFA 2WSSV 3I0OA 2CLYB 3C98B 5AQSB 3T8OA 2YDQA 2FJBA 3NWIA 2UXDT 4JI8T 3LDQB 3DJBA 2B76A 2XQ7A 2X9YA 4TNVA 4U74A 1ZOYA 4NUVA 2BVMA 1HF8A 4ZI3D 3AA6B 1QSDA 3LG7A 3NVOA 5LA6E 2KNDA 3FB2A 4HFCA 4P0AA 4K0UA 4TUYE 1MMAA 4JI5T 2YEVC 4EEDA 5FYMA 4HFIA 2UUAT 2XQ8A 2P9BA 1YD8G 3PUSA 4OX9T 4CXWA 2LOSA 4N78D 2C5KT 2L8KA 2XAJB 4AQFA 5ABEA 1U5PA 1JNZA 4AKRB 2XZEA 2V1DB 5AQTB 4U3CA 1OXZA 2M6IA 3AB3B 2CRBA 2BG9E 2NW7A 4H9OC 1E2AA 4JI4T 4JUYA 2ZM8A 5LHGB 1BR1A 2VL8A 4JYAT 3ZSSA 1VOMA 4YY3T 2NR4A 1H7CA 5JDNA 2LSKA 3UULA 5LGNB 3TLVA 3Q5WA 2IDOB 2WU2A 3NZQA 5LYJE 2BVLA 4GKKT 4H9SE 3HKEE 3AE4A 3N2KE 2JRKA 3ANWA 3ETUA 3ZLIA 2OA5A 2NTYA 5FY7A 5DABA 2KWHA 3ESLA 2LRKA 2BG9C 3RYFE 4TN7B 4DBRA 4Q25A 5KDMC 4MFRA 5JVDE 5HCJA 3R84B 3PE0A 2NP9A 4IDQA 3H3AA 4U72A 2J4GA 4DMWA 1HS7A 2WP9A 3RF1A 2QA7A 4LMLA 2WM9A 4I55E 2CLYC 4IE7A 1DU2A 1WLXA 2F4VT 4BA9A 5H6QB 2LRLA 4ERRA 5KX5E 2CMRA 4TV9E 4H63V 5HEHA 5JRCA 1YQ4A 2H88A 2YDSA 2XSBA 5L3EB 3EDVA 4HWCA 2PFVA 5FP3A 3SWHA 2Q9QC 2WMNA 4IREA 4PNIA 4G2AA 4B3MT 3PUVF 5A1LA 2A72A 5HWXA 3KBUA 2M67A 4XAXB 4O2BE 2J62A 3UFGA 5FMNA 4HWDA 4NIQA 3R6NA 3FZMB 1HX1B 4OFZA 1XMOT 4YFSA 1IAPA 2DNXA 2PJQA 3RIFA 3AVRA 2BS2A 4CXXA 5AQLB 5L3CB 3TLWA 2LHRA 4UR9A 4JBWF 1OEDE 4IE0A 3DTOA 4EXTA 5KMGP 5F8PA 2HN1A 3Q9DA 2HHHT 2XUEA 4DMVA 4BJMA 5LMUT 5EK4A 4PFOA 3CVRA 3K3OA 2CCQA 1E1HB 1BR4A 4Z90A 3J9X1 2X0HA 2DWKA 4ILCA 4J2CA 3NRYA 2BKOA 3L39A 3CX8B 2W0GA 5FY0A 3LSVA 5TAOA 3ABVA 3CPZA 3K3NA 2VASA 4U31A 3AE2A 4EYYR 3RI5A 1IBMT 3PUWF 3VR8A 4IE5A 2E2AA 3RIUC 2D2SA 1FIOA 4UVAB 1WYBA 4ASKA 2V5CA 3AE8A 2K24A 3P4QA 3QNUA 3UU4A 2GK9A 1OEDC 3CX6B 2K5BB 5LBMA 2JQHA 4AKIA 2LOPA 1ZEEA 2WS3A 5HYAA 3CMLA 3AEAA 2DHRA 2IAKA 1N34T 3UQ4A 4DR7T 2E9XB 4MHCA 5JR9A 1SUMB 1D0XA 4L9IA 2YU1A 2X51A 4MALA 1FMWA 3FZHB 1KF6A 2IHR1 4P0BA 2EHOC 4KHPT 2MPKA 3P50A 3KVAA 5AQMB 5J2TE 3HA4A 2JQ9A 3AE9A 5AQNB 3LBXA 2XSAA 4YSYA 5HEGA 5HEJA 3N9NA 4IT4A 4LFCT 4IL4A 4ILBA 4EB6E 2LHNA 4IE4A 4HFEA 2XAQB 2CBIA 3T1HT 2IC6A 2ZM6T 1T8BA 2VVNA 5ABGA 2XTLA 3FHNA 3I9WA 4UIGA 2KZ7B 2LM9A 2Y6XA 3KINB 3RPUA 2KINB 3RHWA 1FMVA 2YU2A 2W61A 5FXVA 2YK0A 1HNXT 3P4WA 4IDPA 3AEBA 4C91A 1WR0A 1G73A 2PG8A 3AE3A 5J2UE 3AE6A 2J47A 4DV1T 3FXDB 3LK3B 3MA9A 2Y48B 5L2LA 2RP4A 2V8SV 3GMIA 5BR8T 4HFDA 2PTFA 5JDGA 4DUYT 4OK0A 2YINA 4XZCA 3ZYKA 3ZMTB 3RLFF 1NENA 4DV4T 2V7MA 5LHIB 2H89A 1U4QA 4GOUA 1FJGT 2I6HA 3RYHE 3K1SA 2CXFA 2LSJA 4JI2T 2DI4A 2BKPA 2L9QA 3IHRA 4X20E 3OPCA 2NW8A 5LP6E 4AKHA 4AKGA 5CFBA 3AVSA 4HFBA 1WCRA 2FJAA 2LM2A 5EK3A 4PJLA 3A7MA 4IE6A 1GQEA 1UCUA 2X68A 3SS1A 3ZSTA 3RGLA 4MBQA 4DBQA 5HXSA 2V5DA 2CWYA 2LSGA 3ZCJA 1R8IA 2PBIA 2C0SA 4JI1T 2X9XA 2XQ5A 4AQFC 3HKBE 4YXDA 4AISA 2FJEA 3E08A 3OKQA 4UVBB 3EABA 4X65T 1HG5A 1XDOA 3UU8A 3HKDE 4O4LE 3TLSA 5CB4E 4DUZT 4WBNE 4I43B 5KXJA 2BBJA 4OYKA 2XHEB 3O1JA 4LF6T 3MKDA 4ZI2C 2JIWA 2ACXA 1XNRT 4PW8A 2C5IT 2WU5A 1MMNA 1I94T 5C8YE 2W63A 2HPJA 3ONXA 3AA7B 2OV9A 2E9XA 2XQ6A 4DR2T 3JCFA 1N33T 2YDRA 2WWUA 3VU7H 4CI1B 4X5TA 1W0AA 2FJDA 2H3RA 3CWZB 2XASB 4WNKA 3Q5EA 1D1BA 3UU3A 2WBLA 4JEUB 4YHJA 1N36T 1KNPA 2CHNA 4PK4A 3OBVE 4O2AE 3PU8A 2SPCA 2WB5A 1UK5A 3PTRB 2UUBT 3RH3A 2V26A 2XQYA 5LJMA 4CN4A 3CQGB 1SHZC 1KFYA 1BR0A 4GK0E 4EAHA 1MNDA 3W15B 5ETWA 4CN1A 4ISSA 2UXBT 2KWIB 3QB5A 1T7SA 2Q9QD 2X66A 2VWAA 3VKGA 5M4YA 3QUJA 3O4XE 5JR9B 2Z6EA 3TLUA 3FZLB 2ZM0A 2UUCT 1LVKA 5IYZE 3HKCE 2IIUA 4BJNA 3N9MA 1OWAA 4AQYT 2LLYA 3KV9A 3J7Yq 4DV7T 3LBXB 2LSYA 1ZKEA 2YKSA 4Z91A 4HWIB 3AAIA 3AECA 3CKDA 1KNRA 4DV6T 3MACA 4ADZA 3PUAA 5AQHB 1WFDA 2OLTA 5F5WA 4HEAA 3FBZA 1J5WA 3KVBA 3NKZA 4A97A 4YLHA 3H3MA 2ODVA 4U33A 3N5LA 5JREA 3UU6A 1S35A 2VK9A 3AAAB 4YT0A 5FXWA 2E5LT 4X64T 5AQJB 5AQRB 1IJ6A 3NZPA 2UU9T 4FI5A 3O1HA 2CBJA 4CQIA 3C64A 2D9DA 3TLTA 3KV5A 3N2OA 4TX5A 3PUYF 4JI7T 2HN2A 4L0RA 2FBWA 1QUUA 2D0UA 4LF5T 2V6XA 4HN9A 4HFHA 2MBGA 3F2EA 4AI6A 4O4IE 3WAJA 4O4JE 4HFVA 4DR6T 2JPFA 3OYZA 2EHOD 4IDZA 1IJ5A 3MJXA 4WW0A 3AE7A 4PJMA 4HWFA 4ZS3A 4M1PA 4IDNA 1FEWA
chains in the Genus database with same CATH topology
4HWIB 3FZHB 5AQIB 5AQLB 1UK5A 4HWHA 5AQFB 2D9DA 1T7SA 5AQGB 5AQTB 1I6ZA 5AQUB 1M62A 4HWDA 5AQOB 5AQSB 5AQHB 3FZMB 4HWCA 5AQPB 5AQMB 1HX1B 5AQKB 3A8YC 1M7KA 3LDQB 3FZKB 5AQNB 5AQVB 1UGOA 5AQQB 3FZFB 3M3ZB 4HWFA 5AQJB 5AQRB 3FZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWI B;  3FZH B;  5AQI B;  5AQL B;  1UK5 A;  4HWH A;  5AQF B;  2D9D A;  1T7S A;  5AQG B;  5AQT B;  1I6Z A;  5AQU B;  1M62 A;  4HWD A;  5AQO B;  5AQS B;  5AQH B;  3FZM B;  4HWC A;  5AQP B;  5AQM B;  1HX1 B;  5AQK B;  3A8Y C;  1M7K A;  3LDQ B;  3FZK B;  5AQN B;  5AQV B;  1UGO A;  5AQQ B;  3FZF B;  3M3Z B;  4HWF A;  5AQJ B;  5AQR B;  3FZL B; 
#chains in the Genus database with same CATH topology
 1ZP0 A;  4GK5 E;  5L3G B;  4TWH A;  4B6X A;  3ZYL A;  3ZMZ B;  4DR5 T;  1MIY A;  3I1A A;  2IW5 B;  5AQP B;  3IF8 B;  2UXN B;  5JR9 C;  1WR6 A;  2VKH A;  3KDS E;  3CX7 B;  2BDE A;  4GIW A;  2DCF A;  5LG3 A;  4HE8 A;  1CUN A;  1XZY A;  3WAK A;  2XQA A;  5LB7 B;  3UUM A;  2WZI A;  4PFP A;  2XQ4 A;  3PUZ F;  3OVU A;  2VL0 A;  2X0L B;  1W9R A;  2N1G A;  3GN5 A;  3RRW A;  5FL0 A;  4AXP A;  5HWY A;  4YSX A;  5H6R B;  2CE7 A;  5DQW A;  4IST A;  4ZXL A;  3N9P A;  3ZKR A;  4ZZB A;  5JDF A;  3AAE B;  3CQC B;  2Y8D A;  4UV8 B;  5LG4 A;  4CI2 B;  2V7J A;  2VQE T;  5F3J A;  4LFA T;  5JDL A;  3T1Y T;  1JNR A;  3ZN1 B;  5AQI B;  1KNZ A;  3LFM A;  2H7V C;  3ZJ2 A;  3ONL C;  2X67 A;  1HNW T;  3QB5 K;  4QH4 A;  4PK6 A;  5HXC A;  1X9B A;  4UF0 A;  4K0K T;  3NBX X;  3EDU A;  3A8Y C;  3ZT5 A;  1V9D A;  4C90 A;  1VCT A;  3ZT6 A;  2NWB A;  5FXZ A;  3LK4 2;  5CJ5 A;  1HTJ F;  2VKD A;  4JV5 T;  1MIV A;  2N2N A;  3I0Q A;  4LMK A;  2UXC T;  3X1D A;  3MXZ A;  1HG2 A;  4TWD A;  5J1G A;  4IL9 A;  4E7Z A;  3ZC0 A;  1HX8 A;  3MK7 C;  3AE1 A;  3ZMS B;  3RKG A;  1XWM A;  3E22 E;  4P1N A;  4KI0 F;  4DVD A;  2AXD S;  1QLB A;  1WYC A;  4NPP A;  5ADX L;  2WDQ A;  3EHZ A;  1YW0 A;  3CIR A;  3BQI A;  4JI0 T;  1VCS A;  4PJJ A;  1T98 A;  3BQL A;  4NXM T;  4QXH B;  1LKX A;  4PJN A;  1SA0 E;  3IA3 A;  5L47 A;  4LMJ A;  4H9N C;  1UX5 A;  2LKG A;  2XJ7 A;  2ZM2 A;  4CZZ B;  2W2U A;  1Y01 A;  2YOE A;  3AXJ A;  2EHO A;  2I0M A;  2IC9 A;  3I9Y A;  4BAY B;  2CWO A;  5ABF A;  5FNV E;  2HPL A;  2VVS A;  2ZLY A;  3S4U A;  5AQQ B;  2KT9 A;  2V6Y A;  1XMQ T;  4Z8X A;  2C5J A;  3JAF A;  1EZ3 A;  4I4T E;  1E7P A;  3RYI E;  3BK9 A;  2E9X C;  5J0Z A;  3FBL A;  2JMH A;  4H9Q C;  4KUM B;  1NAF A;  2YN6 A;  4UV9 B;  1KK7 A;  5AQF B;  5EZY E;  5BMV E;  4LF7 T;  4EGW A;  4DND A;  3KBT A;  4JI3 T;  4NXN T;  3M65 A;  4G63 A;  5JDQ A;  4GYS A;  4X62 T;  2WAU A;  4EYU A;  2VKO A;  4HKA A;  5FKY A;  2LJL A;  2XM2 A;  5AQK B;  2QRX A;  3C4X A;  2IUB A;  3H37 A;  1W0B A;  3FXE B;  4CN6 A;  1US7 B;  4WBO A;  3L09 A;  5C3J A;  4O4H E;  2X9H A;  4YHH T;  2FUP A;  4QHO A;  1KEY A;  4ANJ A;  2LT3 A;  5AQV B;  1HNZ T;  4IHJ E;  2BS3 A;  2NOX A;  5LHH B;  4P09 A;  3EUH A;  4AKL A;  4TWF A;  2JQQ A;  5LNK A;  4X1Y E;  5IWA T;  3EAM A;  3FZK B;  4AIU A;  3ETV A;  5FXX A;  4YSZ A;  3C4Z A;  4QH1 A;  3N2G E;  2IML A;  3SRZ A;  3JC6 C;  2W67 A;  3Q5D A;  3ZT7 A;  4YTM A;  1BR2 A;  3GN5 B;  4QXC B;  4F8H A;  1AJ3 A;  3VRB A;  2VKJ A;  2I59 A;  1MIW A;  2AE9 A;  2Q9Q B;  1MMD A;  2WZH A;  4DO0 A;  2VB6 A;  5HEU A;  4ZHQ E;  5HEO A;  2D5U A;  4QXB B;  3AE5 A;  5L4E A;  1XDP A;  4KX6 A;  5JDM A;  4YJ3 E;  1LRZ A;  5FL1 A;  2KXP B;  3CQX C;  2XAH B;  3QC9 A;  3U3I A;  3F57 A;  3HL6 A;  3K3Q C;  1IBK T;  3ZMU B;  3RQU A;  1UGO A;  5CGM A;  5HXR A;  3RYC E;  3KFW X;  2W66 A;  5CA0 E;  4E7S A;  4UVC B;  3AEG A;  4UF0 B;  3UT5 E;  2KMF A;  3RC3 A;  3U78 A;  2LEH A;  3B5M A;  4I50 E;  1D0Y A;  4QX7 B;  1YXR A;  1D1A A;  4TZ4 C;  4EV6 A;  2BZB A;  4QWN B;  3SFE A;  2A2F X;  5L4H A;  2W4X A;  3P4R A;  1M62 A;  3AEF A;  4X1K E;  3HI2 A;  1UUS A;  5AFU L;  4KMC A;  3O1I A;  1G8X A;  4EZ4 A;  3ZPO A;  3E0Z A;  3VHL A;  3GA8 A;  2X9W A;  3IEE A;  4ZI3 C;  4HTE A;  4U2Y A;  5JQG E;  1CHU A;  2VQF T;  2W00 A;  4WYV A;  3PU3 A;  2UXX B;  5FY1 A;  2WWV A;  3LK2 B;  2V7L A;  4EIW A;  4GYR A;  2HH7 A;  2CPT A;  5JDH A;  4X1I E;  1OED B;  4CI3 B;  3SFD A;  4ZS2 A;  3PUR A;  3UUB A;  4FJO A;  1B7T A;  2L3L A;  4ZEY A;  5FVL A;  4DID B;  2DLR A;  2V7I A;  1M7K A;  3AA0 B;  4YTP A;  1IBL T;  3L8R A;  4MLK A;  3AXJ B;  2K3W A;  1UUR A;  3RIA A;  2EHO B;  2NTX A;  4ILU A;  1I6Z A;  5ABF B;  4IIJ E;  1UX4 A;  4H63 H;  1MMG A;  5IHY A;  2J1D G;  3V5U A;  2JMK A;  3B57 A;  2V6Y B;  1SE7 A;  2BG9 A;  3EI0 A;  2CHO A;  1J1J A;  4H9P C;  5JH7 E;  3OYX A;  1MNE A;  2E8I A;  4IDO A;  3UUN A;  5FVK A;  2B1E A;  3PUX F;  1YQ3 A;  4B3T T;  5DQV A;  2BBH A;  2KSR A;  3Q5X A;  1ZV4 X;  2JJ9 A;  4GKJ T;  5LGT B;  2A9U A;  3N9O A;  3C4W A;  2M6B A;  3PDY A;  5HXH A;  3ZCI A;  5C2T A;  4DR1 T;  3ONJ A;  4LFB T;  3P7I A;  3UUX B;  4YTN A;  2BKN A;  4TNW A;  4U7Y A;  5AQU B;  4EEB A;  3KV6 A;  3UU5 A;  4XBF B;  1Z0P A;  5L3B B;  3PUG A;  4H9R C;  3TKL B;  4TV8 E;  3M3Z B;  3B13 A;  4NUU A;  2Q9Q A;  3IBP A;  5CA1 E;  2WDR A;  2WQY A;  2XQ3 A;  3GWH A;  4I0U A;  4AQG A;  1YKH B;  3RKO A;  3C51 A;  1IZN B;  2CXL A;  2LSI A;  4PK5 A;  3WI3 A;  4U7I A;  5LMN T;  3RC8 A;  3N9L A;  2MOZ A;  4DV5 T;  3A5X A;  2ACZ A;  2MTQ A;  4ZZC A;  2QYW A;  4JEH B;  4COF A;  2G0U A;  5E0O A;  3UFE A;  3JAD A;  4F6R C;  4LF9 T;  4B3S T;  2RA1 A;  3G06 A;  3NRX A;  4JLE A;  2K48 A;  4LF8 T;  3ZMV B;  4CXY A;  4HWH A;  4ILA A;  2E9X D;  2BS4 A;  5LXT E;  2JQK A;  1T72 A;  1Y64 B;  1W09 A;  3LJC A;  5IUX A;  2ES0 A;  2R6G F;  3QK6 A;  2XPK A;  4DR4 T;  4QKN A;  1LVF A;  4UEM A;  3EVY A;  1YKE B;  1XNQ T;  2LE8 A;  2E5V A;  1D1C A;  5AQG B;  5LCY A;  2VUR A;  2LKH A;  4KP3 C;  2RPA A;  2WDV A;  3RIU A;  1NEK A;  4JI6 T;  3PV0 F;  3P8C D;  5ABH A;  3VR9 A;  3RX6 A;  3P4P A;  3K8P C;  4KBM B;  1OED A;  4YJ2 E;  3UTK A;  4ZI7 E;  2XY8 B;  2KLQ A;  3ZEF B;  5L3F B;  4B3R T;  4ZI2 D;  3CK6 A;  5GON E;  4A5X A;  1S94 A;  3AA1 B;  2V7K A;  3OTO T;  4DV0 T;  3V5S A;  1X79 A;  4IGU A;  5LGU B;  4L5G A;  4PAG A;  3ANW B;  5HAX A;  5L3D B;  3ZJ1 A;  2XM1 A;  2H7O A;  2XAF B;  2DWG A;  3OJA A;  4DV3 T;  2QVA A;  3RRC A;  3N9Q A;  5HXE A;  3KV4 A;  4U2Z A;  2WY2 A;  4A56 A;  1HR0 T;  4QH5 A;  2ODU A;  4X66 T;  3JC6 D;  3MZK B;  3AED A;  3FZF B;  4O8S A;  1WRD A;  1HCI A;  4QX8 B;  1N32 T;  3UQ7 A;  3ZYM A;  2CXD A;  2WMO A;  4UEL A;  4DR3 T;  4V1A v;  2D0T A;  2ZMA A;  3QOF A;  1D0Z A;  5HCM A;  1HFA A;  4EOZ B;  5DJQ C;  2CEA A;  2MYS A;  3BQK A;  4UXN B;  3PJA J;  5EK2 A;  2QGS A;  5JTG A;  4HGA A;  1Z8U A;  1NWM X;  4WZX A;  1O3X A;  3AEE A;  2WCA A;  5JRC B;  3VKH A;  2X0Y A;  2XAG B;  3DP7 A;  3Q2M A;  3C50 A;  3F31 A;  5LOV E;  5AQO B;  4ZOL E;  3P4S A;  4KHZ F;  1VRB A;  4OYJ A;  2W62 A;  5LJN A;  2N9D A;  1L0V A;  5LBQ B;  2K9A A;  3L3P A;  3ZC1 A;  4EZH A;  1J5E T;  2DL1 A;  3ZN0 B;  3VRA A;  2A3D A;  3SOL A;  2CA5 A;  3JAE A;  3HR0 A;  3O9X A;  2BG9 B;  2CM0 A;  4DV2 T;  2NW9 A;  3D0T A;  1ZHC A;  3RQW A;  3PUQ A;  4LF4 T;  2XQ9 A;  2MAW A;  4A98 A;  3PJA A;  4OHF A;  2WSS V;  3I0O A;  2CLY B;  3C98 B;  5AQS B;  3T8O A;  2YDQ A;  2FJB A;  3NWI A;  2UXD T;  4JI8 T;  3LDQ B;  3DJB A;  2B76 A;  2XQ7 A;  2X9Y A;  4TNV A;  4U74 A;  1ZOY A;  4NUV A;  2BVM A;  1HF8 A;  4ZI3 D;  3AA6 B;  1QSD A;  3LG7 A;  3NVO A;  5LA6 E;  2KND A;  3FB2 A;  4HFC A;  4P0A A;  4K0U A;  4TUY E;  1MMA A;  4JI5 T;  2YEV C;  4EED A;  5FYM A;  4HFI A;  2UUA T;  2XQ8 A;  2P9B A;  1YD8 G;  3PUS A;  4OX9 T;  4CXW A;  2LOS A;  4N78 D;  2C5K T;  2L8K A;  2XAJ B;  4AQF A;  5ABE A;  1U5P A;  1JNZ A;  4AKR B;  2XZE A;  2V1D B;  5AQT B;  4U3C A;  1OXZ A;  2M6I A;  3AB3 B;  2CRB A;  2BG9 E;  2NW7 A;  4H9O C;  1E2A A;  4JI4 T;  4JUY A;  2ZM8 A;  5LHG B;  1BR1 A;  2VL8 A;  4JYA T;  3ZSS A;  1VOM A;  4YY3 T;  2NR4 A;  1H7C A;  5JDN A;  2LSK A;  3UUL A;  5LGN B;  3TLV A;  3Q5W A;  2IDO B;  2WU2 A;  3NZQ A;  5LYJ E;  2BVL A;  4GKK T;  4H9S E;  3HKE E;  3AE4 A;  3N2K E;  2JRK A;  3ANW A;  3ETU A;  3ZLI A;  2OA5 A;  2NTY A;  5FY7 A;  5DAB A;  2KWH A;  3ESL A;  2LRK A;  2BG9 C;  3RYF E;  4TN7 B;  4DBR A;  4Q25 A;  5KDM C;  4MFR A;  5JVD E;  5HCJ A;  3R84 B;  3PE0 A;  2NP9 A;  4IDQ A;  3H3A A;  4U72 A;  2J4G A;  4DMW A;  1HS7 A;  2WP9 A;  3RF1 A;  2QA7 A;  4LML A;  2WM9 A;  4I55 E;  2CLY C;  4IE7 A;  1DU2 A;  1WLX A;  2F4V T;  4BA9 A;  5H6Q B;  2LRL A;  4ERR A;  5KX5 E;  2CMR A;  4TV9 E;  4H63 V;  5HEH A;  5JRC A;  1YQ4 A;  2H88 A;  2YDS A;  2XSB A;  5L3E B;  3EDV A;  4HWC A;  2PFV A;  5FP3 A;  3SWH A;  2Q9Q C;  2WMN A;  4IRE A;  4PNI A;  4G2A A;  4B3M T;  3PUV F;  5A1L A;  2A72 A;  5HWX A;  3KBU A;  2M67 A;  4XAX B;  4O2B E;  2J62 A;  3UFG A;  5FMN A;  4HWD A;  4NIQ A;  3R6N A;  3FZM B;  1HX1 B;  4OFZ A;  1XMO T;  4YFS A;  1IAP A;  2DNX A;  2PJQ A;  3RIF A;  3AVR A;  2BS2 A;  4CXX A;  5AQL B;  5L3C B;  3TLW A;  2LHR A;  4UR9 A;  4JBW F;  1OED E;  4IE0 A;  3DTO A;  4EXT A;  5KMG P;  5F8P A;  2HN1 A;  3Q9D A;  2HHH T;  2XUE A;  4DMV A;  4BJM A;  5LMU T;  5EK4 A;  4PFO A;  3CVR A;  3K3O A;  2CCQ A;  1E1H B;  1BR4 A;  4Z90 A;  3J9X 1;  2X0H A;  2DWK A;  4ILC A;  4J2C A;  3NRY A;  2BKO A;  3L39 A;  3CX8 B;  2W0G A;  5FY0 A;  3LSV A;  5TAO A;  3ABV A;  3CPZ A;  3K3N A;  2VAS A;  4U31 A;  3AE2 A;  4EYY R;  3RI5 A;  1IBM T;  3PUW F;  3VR8 A;  4IE5 A;  2E2A A;  3RIU C;  2D2S A;  1FIO A;  4UVA B;  1WYB A;  4ASK A;  2V5C A;  3AE8 A;  2K24 A;  3P4Q A;  3QNU A;  3UU4 A;  2GK9 A;  1OED C;  3CX6 B;  2K5B B;  5LBM A;  2JQH A;  4AKI A;  2LOP A;  1ZEE A;  2WS3 A;  5HYA A;  3CML A;  3AEA A;  2DHR A;  2IAK A;  1N34 T;  3UQ4 A;  4DR7 T;  2E9X B;  4MHC A;  5JR9 A;  1SUM B;  1D0X A;  4L9I A;  2YU1 A;  2X51 A;  4MAL A;  1FMW A;  3FZH B;  1KF6 A;  2IHR 1;  4P0B A;  2EHO C;  4KHP T;  2MPK A;  3P50 A;  3KVA A;  5AQM B;  5J2T E;  3HA4 A;  2JQ9 A;  3AE9 A;  5AQN B;  3LBX A;  2XSA A;  4YSY A;  5HEG A;  5HEJ A;  3N9N A;  4IT4 A;  4LFC T;  4IL4 A;  4ILB A;  4EB6 E;  2LHN A;  4IE4 A;  4HFE A;  2XAQ B;  2CBI A;  3T1H T;  2IC6 A;  2ZM6 T;  1T8B A;  2VVN A;  5ABG A;  2XTL A;  3FHN A;  3I9W A;  4UIG A;  2KZ7 B;  2LM9 A;  2Y6X A;  3KIN B;  3RPU A;  2KIN B;  3RHW A;  1FMV A;  2YU2 A;  2W61 A;  5FXV A;  2YK0 A;  1HNX T;  3P4W A;  4IDP A;  3AEB A;  4C91 A;  1WR0 A;  1G73 A;  2PG8 A;  3AE3 A;  5J2U E;  3AE6 A;  2J47 A;  4DV1 T;  3FXD B;  3LK3 B;  3MA9 A;  2Y48 B;  5L2L A;  2RP4 A;  2V8S V;  3GMI A;  5BR8 T;  4HFD A;  2PTF A;  5JDG A;  4DUY T;  4OK0 A;  2YIN A;  4XZC A;  3ZYK A;  3ZMT B;  3RLF F;  1NEN A;  4DV4 T;  2V7M A;  5LHI B;  2H89 A;  1U4Q A;  4GOU A;  1FJG T;  2I6H A;  3RYH E;  3K1S A;  2CXF A;  2LSJ A;  4JI2 T;  2DI4 A;  2BKP A;  2L9Q A;  3IHR A;  4X20 E;  3OPC A;  2NW8 A;  5LP6 E;  4AKH A;  4AKG A;  5CFB A;  3AVS A;  4HFB A;  1WCR A;  2FJA A;  2LM2 A;  5EK3 A;  4PJL A;  3A7M A;  4IE6 A;  1GQE A;  1UCU A;  2X68 A;  3SS1 A;  3ZST A;  3RGL A;  4MBQ A;  4DBQ A;  5HXS A;  2V5D A;  2CWY A;  2LSG A;  3ZCJ A;  1R8I A;  2PBI A;  2C0S A;  4JI1 T;  2X9X A;  2XQ5 A;  4AQF C;  3HKB E;  4YXD A;  4AIS A;  2FJE A;  3E08 A;  3OKQ A;  4UVB B;  3EAB A;  4X65 T;  1HG5 A;  1XDO A;  3UU8 A;  3HKD E;  4O4L E;  3TLS A;  5CB4 E;  4DUZ T;  4WBN E;  4I43 B;  5KXJ A;  2BBJ A;  4OYK A;  2XHE B;  3O1J A;  4LF6 T;  3MKD A;  4ZI2 C;  2JIW A;  2ACX A;  1XNR T;  4PW8 A;  2C5I T;  2WU5 A;  1MMN A;  1I94 T;  5C8Y E;  2W63 A;  2HPJ A;  3ONX A;  3AA7 B;  2OV9 A;  2E9X A;  2XQ6 A;  4DR2 T;  3JCF A;  1N33 T;  2YDR A;  2WWU A;  3VU7 H;  4CI1 B;  4X5T A;  1W0A A;  2FJD A;  2H3R A;  3CWZ B;  2XAS B;  4WNK A;  3Q5E A;  1D1B A;  3UU3 A;  2WBL A;  4JEU B;  4YHJ A;  1N36 T;  1KNP A;  2CHN A;  4PK4 A;  3OBV E;  4O2A E;  3PU8 A;  2SPC A;  2WB5 A;  1UK5 A;  3PTR B;  2UUB T;  3RH3 A;  2V26 A;  2XQY A;  5LJM A;  4CN4 A;  3CQG B;  1SHZ C;  1KFY A;  1BR0 A;  4GK0 E;  4EAH A;  1MND A;  3W15 B;  5ETW A;  4CN1 A;  4ISS A;  2UXB T;  2KWI B;  3QB5 A;  1T7S A;  2Q9Q D;  2X66 A;  2VWA A;  3VKG A;  5M4Y A;  3QUJ A;  3O4X E;  5JR9 B;  2Z6E A;  3TLU A;  3FZL B;  2ZM0 A;  2UUC T;  1LVK A;  5IYZ E;  3HKC E;  2IIU A;  4BJN A;  3N9M A;  1OWA A;  4AQY T;  2LLY A;  3KV9 A;  3J7Y q;  4DV7 T;  3LBX B;  2LSY A;  1ZKE A;  2YKS A;  4Z91 A;  4HWI B;  3AAI A;  3AEC A;  3CKD A;  1KNR A;  4DV6 T;  3MAC A;  4ADZ A;  3PUA A;  5AQH B;  1WFD A;  2OLT A;  5F5W A;  4HEA A;  3FBZ A;  1J5W A;  3KVB A;  3NKZ A;  4A97 A;  4YLH A;  3H3M A;  2ODV A;  4U33 A;  3N5L A;  5JRE A;  3UU6 A;  1S35 A;  2VK9 A;  3AAA B;  4YT0 A;  5FXW A;  2E5L T;  4X64 T;  5AQJ B;  5AQR B;  1IJ6 A;  3NZP A;  2UU9 T;  4FI5 A;  3O1H A;  2CBJ A;  4CQI A;  3C64 A;  2D9D A;  3TLT A;  3KV5 A;  3N2O A;  4TX5 A;  3PUY F;  4JI7 T;  2HN2 A;  4L0R A;  2FBW A;  1QUU A;  2D0U A;  4LF5 T;  2V6X A;  4HN9 A;  4HFH A;  2MBG A;  3F2E A;  4AI6 A;  4O4I E;  3WAJ A;  4O4J E;  4HFV A;  4DR6 T;  2JPF A;  3OYZ A;  2EHO D;  4IDZ A;  1IJ5 A;  3MJX A;  4WW0 A;  3AE7 A;  4PJM A;  4HWF A;  4ZS3 A;  4M1P A;  4IDN A;  1FEW A; 
#chains in the Genus database with same CATH homology
 4HWI B;  3FZH B;  5AQI B;  5AQL B;  1UK5 A;  4HWH A;  5AQF B;  2D9D A;  1T7S A;  5AQG B;  5AQT B;  1I6Z A;  5AQU B;  1M62 A;  4HWD A;  5AQO B;  5AQS B;  5AQH B;  3FZM B;  4HWC A;  5AQP B;  5AQM B;  1HX1 B;  5AQK B;  3A8Y C;  1M7K A;  3LDQ B;  3FZK B;  5AQN B;  5AQV B;  1UGO A;  5AQQ B;  3FZF B;  3M3Z B;  4HWF A;  5AQJ B;  5AQR B;  3FZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...