5AQHB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
111
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 41
structure length 111
sequence length 113
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqhB00
1HX1B 5AQRB 4HWHA 1I6ZA 5AQKB 2D9DA 3FZFB 3M3ZB 5AQVB 1M62A 5AQMB 5AQGB 3FZHB 4HWCA 3FZMB 5AQPB 5AQSB 5AQQB 5AQNB 1M7KA 5AQTB 5AQIB 3FZLB 5AQOB 3A8YC 1T7SA 4HWFA 4HWDA 3LDQB 4HWIB 5AQUB 5AQHB 5AQLB 1UK5A 5AQJB 1UGOA 3FZKB 5AQFB
chains in the Genus database with same CATH superfamily
3RIUC 2LRKA 2J62A 2PG8A 2LKHA 4GIWA 3FXEB 2NOXA 3AAAB 1HS7A 2ZM0A 4L9IA 4YSZA 4CXXA 4MALA 4F6RC 4CN4A 2V8SV 4P1NA 3TLVA 1NWMX 2VVNA 4EZHA 2CBJA 5LHHB 4NIQA 4UVCB 3EI0A 5F8PA 2FBWA 3PTRB 4B6XA 3TLSA 3DTOA 1QUUA 4DMVA 4ILUA 5HCMA 4DBQA 3PV0F 4H9OC 2Y48B 2CMRA 1HNWT 4ZXLA 2XY8B 3UUXB 2V6XA 2XHEB 2WMOA 4TWHA 2D2SA 1HCIA 3P4WA 3RI5A 4O4IE 5HEJA 1IJ6A 2VL8A 2BKNA 3VRBA 3KFWX 4TUYE 4Z8XA 4B3RT 4K0UA 4PNIA 4TV8E 2LSYA 4MHCA 3T8OA 2RA1A 3PUXF 1T8BA 2D9DA 3JC6C 2W63A 3N9MA 1T72A 4M1PA 4IL4A 2K24A 5LJNA 2JRKA 2QA7A 1NENA 4PJMA 4CN6A 4IE0A 5LGNB 3MA9A 1XDPA 5H6QB 3I1AA 4PK5A 5F5WA 3ZPOA 2HPLA 1MMAA 5AQNB 4HWDA 1US7B 3RIFA 4ZI3D 3N9QA 2MTQA 1EZ3A 1XWMA 4YHHT 3ZYMA 4COFA 1XNQT 1IBMT 4DV3T 5AQQB 1YD8G 5LHGB 2H3RA 4WYVA 2VKJA 4EIWA 2EHOC 3F57A 1D1CA 5JTGA 1WLXA 4H63V 1KF6A 4U72A 4CXYA 2BBHA 5HWYA 3X1DA 2M6BA 1J5WA 2XAHB 4YLHA 2D0TA 3HKDE 2XZEA 1T7SA 3A7MA 4EZ4A 3SOLA 4NUUA 3EABA 2I0MA 5JR9B 4HWHA 1D0ZA 2DHRA 2HPJA 1N32T 5KDMC 3ZMSB 3FZHB 4X5TA 3FZLB 2B76A 2MAWA 3N9OA 4X20E 3NRXA 3ZMZB 5LP6E 1HX1B 3EDUA 4O4JE 2Y8DA 5LB7B 1U5PA 4ASKA 1CUNA 4YY3T 4P0AA 5FL1A 2KXPB 1KNRA 4IREA 4OX9T 3DJBA 2N9DA 3AE5A 3H3MA 2C5KT 3ZMVB 2WDVA 2W2UA 4F8HA 3CX8B 2XQ5A 1D1AA 2KMFA 5AQSB 2LSKA 2LEHA 4DV6T 2KSRA 3PUVF 2WS3A 2LOPA 2WWUA 4H9SE 3RYHE 3PUQA 4EB6E 1KK7A 3KV9A 2KNDA 2W61A 1IBLT 4XBFB 4PJNA 1Y64B 2XASB 4DIDB 1OEDE 3AE6A 3AA1B 5DQVA 3N5LA 4HN9A 4J2CA 4X65T 2JJ9A 4G63A 5BMVE 1VRBA 4U2YA 2J47A 4MLKA 2IAKA 4B3MT 4ZI2C 2D0UA 2YU2A 4AQYT 5AQGB 2BG9E 5JR9A 3C50A 1E2AA 2BKPA 4PW8A 1SA0E 3VR9A 2H89A 4LF7T 4ISTA 2LM2A 2XQ9A 1IBKT 3CQXC 3AE2A 3PURA 1GQEA 2YDRA 2VKHA 3ZLIA 1M62A 3PUSA 1U4QA 5CB4E 3NBXX 4GKJT 2NP9A 1N36T 3C51A 3BQIA 4U7YA 3OBVE 2CCQA 4I50E 4C90A 1MNDA 3SFEA 2PTFA 3ZN0B 2KLQA 2YDQA 2WDRA 4A56A 1S35A 1FMWA 3QOFA 4EAHA 4JI8T 5EK2A 1R8IA 4AISA 5ABEA 4CZZB 2K5BB 3GMIA 2WWVA 4CN1A 3C64A 2QVAA 5J2TE 3P7IA 1XNRT 5JDFA 2V7KA 3AE7A 1D1BA 3NVOA 2LE8A 3RIUA 5LBMA 2Y6XA 5HXEA 3ZT7A 2YK0A 2IMLA 4HFHA 3ZCIA 3MXZA 4NUVA 3Q5DA 2QYWA 3N2OA 3H3AA 3LFMA 2JQ9A 3AA6B 4E7ZA 2EHOB 5L47A 3D0TA 1G73A 3SS1A 1LVKA 2IUBA 4IE4A 3HL6A 5FVLA 3ESLA 3PU8A 3O1IA 2IC6A 4IT4A 3KVBA 4LF6T 4PAGA 2XSBA 5IUXA 4HE8A 2XAJB 2ZLYA 1QSDA 3UULA 3AB3B 4HFBA 3UU8A 5FP3A 2DCFA 4HWIB 3FHNA 3O1JA 5C8YE 4EXTA 2L8KA 3RLFF 2AE9A 1ZKEA 3KV4A 4TV9E 1JNZA 4BA9A 1FMVA 2ODUA 2W0GA 2CA5A 4X66T 3OVUA 2VQET 1SHZC 5AQRB 2W00A 3SWHA 5LG3A 2IDOB 2IHR1 5FYMA 3RQUA 2XQAA 4BAYB 1YQ4A 2XAFB 4YHJA 3CQGB 4PFOA 5AQOB 3FB2A 2GK9A 2LJLA 5AQFB 4AKLA 5JDHA 2V7JA 4IHJE 3VKGA 1MIWA 5FNVE 2K48A 2C5JA 4IE7A 2R6GF 1XMOT 1QLBA 5FXXA 1OWAA 3UUBA 4UR9A 3NKZA 1DU2A 4DMWA 4KHPT 4KHZF 4MFRA 4YSYA 1D0XA 5F3JA 2Q9QB 2L3LA 3PDYA 1ZEEA 4WZXA 2V7LA 2VURA 2XQ8A 3HA4A 4X1KE 4YT0A 2I59A 4HWCA 5L2LA 2VK9A 4TWFA 4QH4A 2LHRA 3ZC1A 5JDMA 4AQGA 3KBTA 4UELA 4DV4T 4ZEYA 3L3PA 4ZS2A 3JC6D 3NWIA 2UUCT 5J0ZA 4YFSA 2BZBA 4ERRA 4KX6A 3MACA 4ZI7E 5DABA 4IIJE 2X0YA 3WI3A 4H9QC 1H7CA 3MK7C 3PJAJ 4HFEA 5HCJA 3V5UA 3AAIA 2X68A 5H6RB 4TX5A 3UFEA 1B7TA 3UFGA 4X62T 2ACZA 2E8IA 5L3BB 3CKDA 1XMQT 5CA0E 4I55E 1FEWA 4LF9T 1AJ3A 4MBQA 4TZ4C 3ONLC 1NAFA 4PJJA 2EHOD 2KWHA 3RHWA 1N34T 4DR4T 2UXDT 1MNEA 2V5DA 3PE0A 3CX6B 4ILBA 5GONE 2Q9QA 5HEUA 1D0YA 5L4EA 3MZKB 3UQ4A 3CWZB 4JI6T 4XZCA 2JQKA 2X9XA 2DWGA 3RX6A 4O4LE 2X0HA 1MIYA 3E22E 2J1DG 5C2TA 5HEOA 1FIOA 5CGMA 4LF4T 2W66A 5LOVE 1G8XA 4NPPA 2VASA 4AKHA 1J1JA 3P4SA 2K9AA 2QRXA 4HKAA 2LSIA 2W67A 5LHIB 3R6NA 3HKBE 1YKHB 5HXCA 1YW0A 3ZJ1A 4ADZA 3B57A 4CQIA 3ZSSA 3K3OA 1YKEB 4GYSA 3ZMTB 3BQLA 4ISSA 4U7IA 3JCFA 4AKIA 2IC9A 3FZMB 4GYRA 2CXLA 3JAFA 2V26A 3QUJA 4YTNA 2WAUA 2XAQB 1HR0T 2OV9A 5LMUT 4GK5E 1LKXA 2SPCA 5L3CB 5FY7A 4X1YE 4JI1T 4H9NC 2G0UA 2LRLA 2WMNA 4B3TT 4UV9B 1VCSA 3E08A 3LDQB 2RP4A 1O3XA 3R84B 4JI5T 2CE7A 4Q25A 4QH1A 4UVBB 4DBRA 4KBMB 2CXDA 3RGLA 2UU9T 4YJ3E 1M7KA 1WR6A 1UUSA 4JLEA 1MIVA 3EUHA 2V1DB 2FJBA 4DR6T 2I6HA 4H9PC 2B1EA 3KV6A 5FVKA 2HH7A 4JI0T 5L4HA 1OEDA 1L0VA 2JQHA 3I0OA 2H7OA 2LHNA 2Z6EA 5ABGA 1HNXT 3W15B 3RIAA 3JAEA 3MJXA 2LKGA 5JDGA 5L3FB 2CHNA 2X67A 4U3CA 5HAXA 5A1LA 3KBUA 4EYYR 2OLTA 5JQGE 2Q9QC 4UV8B 3IEEA 4L0RA 4C91A 4AI6A 3TLUA 2BBJA 4IE6A 3PUWF 2BG9A 4LMKA 4QH5A 4EYUA 1W0AA 4Z90A 3IF8B 2NR4A 2RPAA 2YEVC 3J9X1 3S4UA 5JRCB 3PU3A 5AQJB 3PUAA 3KVAA 1CHUA 3IBPA 3C98B 4QX7B 4EGWA 2M67A 1HX8A 1MMNA 3I0QA 3M3ZB 1HG2A 3KV5A 4JEHB 2XM1A 2ZM8A 3L39A 3ZMUB 5FXWA 4CI2B 1VCTA 4DO0A 4QXBB 4LFCT 1WYBA 1W09A 1MMGA 3MKDA 5C3JA 2HHHT 4P09A 4HFCA 2H88A 3ZYLA 2CWOA 2V7MA 4ANJA 4KUMB 4X1IE 1N33T 3RF1A 2IIUA 5E0OA 4JI7T 3CVRA 3ANWA 2CM0A 3CX7B 3B5MA 4KI0F 2YKSA 3T1HT 4AIUA 2DI4A 4WBNE 4DV0T 3EAMA 2LM9A 3ONXA 3O9XA 2K3WA 2NW9A 2WY2A 5DJQC 2YU1A 3V5SA 3FBZA 1NEKA 1LVFA 3CMLA 2BDEA 4OYJA 5EZYE 1UX4A 2WSSV 2NW8A 1T98A 2E5LT 3AEDA 3L09A 3UUNA 3FZFB 2MBGA 4ZZBA 5JRCA 4YTMA 3GN5B 4UVAB 3VU7H 3I9WA 1OEDC 2FJDA 1BR1A 4JYAT 2E9XA 1S94A 2MOZA 5AQUB 4ZOLE 2X0LB 3RYCE 4JV5T 1J5ET 2YDSA 1E7PA 4ZHQE 2H7VC 2BG9C 2WU2A 5JH7E 4YXDA 1JNRA 4X64T 4HFDA 1IAPA 3J7Yq 3RYFE 3LK2B 4KP3C 5ADXL 2WQYA 4JBWF 1YQ3A 1ZP0A 3ZT6A 3CIRA 2BS4A 1VOMA 2NTXA 3ETUA 3N9LA 5LXTE 4DR5T 2WZHA 4GOUA 1ZV4X 2BS2A 3ONJA 2A2FX 3FZKB 3U3IA 3ZCJA 3F2EA 1X9BA 1WR0A 2P9BA 4A5XA 3A5XA 4CI3B 2V6YA 5LNKA 2E5VA 4UF0B 4HFIA 2UXBT 3RQWA 4QWNB 3UQ7A 3P4QA 1KNZA 2YINA 2DLRA 3AE4A 2CLYC 3QC9A 5AQVB 3TLTA 2UXXB 3G06A 4E7SA 2LSJA 2WM9A 4TNVA 3AE8A 5FL0A 2W62A 3AA7B 4DR7T 3EDVA 3GN5A 4AXPA 3P4RA 2A9UA 4OK0A 4O8SA 4DR1T 3NRYA 3AXJA 4A97A 3B13A 4Z91A 4ILCA 3LSVA 4TN7B 1I94T 3PUYF 4EEDA 2VQFT 1HFAA 3OPCA 3AVSA 3HKEE 2CXFA 4OHFA 3JADA 3RRWA 2VL0A 1V9DA 2YN6A 4FJOA 3AEGA 3UUMA 4B3ST 3UU3A 4BJMA 1HTJF 3C4WA 5LBQB 4H63H 2VKOA 3UU6A 3Q2MA 5AQLB 5BR8T 2BKOA 2E9XC 3GA8A 2KINB 5LG4A 1XZYA 4PK6A 2WU5A 5ABFB 2J4GA 3RRCA 2C5IT 2JMHA 5KMGP 3Q9DA 3RC3A 3QNUA 3K8PC 1SE7A 4UF0A 2WCAA 4H9RC 4UXNB 2X9YA 2PFVA 3FXDB 5AQMB 3CQCB 2A3DA 2X66A 1MMDA 3HKCE 2ZM6T 4WBOA 5AFUL 2HN1A 4HTEA 1XDOA 1FJGT 3SFDA 2VKDA 4IDOA 4HFVA 3KDSE 2X51A 2XQ3A 4IL9A 4I0UA 2X9HA 5KX5E 3K3QC 4ZZCA 4YSXA 4UEMA 5CJ5A 3NZQA 1W9RA 4IDZA 3VRAA 3UTKA 4WW0A 2L9QA 4LMJA 5JVDE 5HXRA 3AVRA 3AE1A 4NXMT 5J1GA 2JIWA 3VKHA 4JI3T 4DR2T 5J2UE 2QGSA 3P8CD 3AA0B 4N78D 2CHOA 4ILAA 4HWFA 1OEDB 3M65A 4CXWA 3CPZA 2UXNB 4LMLA 3ETVA 2XQ4A 3EVYA 4JUYA 3E0ZA 3QB5A 4IDNA 2UUAT 5ETWA 3HI2A 3H37A 4O4HE 3PUZF 4LFBT 3RH3A 3AE9A 2M6IA 5ABFA 3ZJ2A 4U74A 4IGUA 1WFDA 2BG9B 2ACXA 3TLWA 2V5CA 1X79A 3RKOA 3RPUA 2XAGB 3AEEA 3OYXA 3RKGA 1WYCA 3UU5A 3AEFA 2X9WA 2ES0A 3ZC0A 2WB5A 4GKKT 4LF8T 4O2BE 3Q5EA 4TWDA 1ZOYA 2KZ7B 4DUZT 5IWAT 3ZN1B 4IDPA 4ZI3C 3AE3A 5LGTB 2DL1A 5FKYA 1HG5A 3AAEB 4QXCB 1BR0A 2HN2A 4JI2T 4OYKA 2BVMA 3TKLB 4DV2T 5AQHB 2Q9QD 3Q5XA 1W0BA 3C4ZA 5DQWA 4EV6A 3ZT5A 2C0SA 3DP7A 5AQKB 5FY1A 5KXJA 4ZI2D 4LF5T 5FXVA 2WBLA 4QX8B 3HR0A 3VR8A 2CLYB 3ANWB 4LFAT 3K1SA 5IYZE 3ZYKA 1UGOA 4G2AA 5JDQA 1BR4A 3P4PA 4CI1B 2ODVA 3BQKA 4DV7T 1OXZA 5EK4A 3A8YC 1UX5A 2XSAA 1UCUA 2CPTA 2VVSA 1HNZT 1HF8A 2N1GA 4I43B 5LGUB 1Y01A 3ZEFB 2NW7A 2W4XA 5AQTB 3ABVA 3KINB 2BS3A 4HGAA 4YJ2E 4JI4T 2FJEA 3SRZA 1ZHCA 4V1Av 5L3GB 3VHLA 4PJLA 2PJQA 2DNXA 1SUMB 4FI5A 2E9XB 2V7IA 1E1HB 4XAXB 4JEUB 4P0BA 4GK0E 3EHZA 1LRZA 3QK6A 2XUEA 2PBIA 5TAOA 5LYJE 2NWBA 5LJMA 2UXCT 2XPKA 5LMNT 3LJCA 3N9PA 3C4XA 4QXHB 5L3EB 4PFPA 4BJNA 3RC8A 4EEBA 3N9NA 2LLYA 4TNWA 2NTYA 4NXNT 4WNKA 2LT3A 3WAJA 2MYSA 3LBXB 5LCYA 3O4XE 3LK42 3P50A 4DVDA 3BK9A 5CFBA 2V6YB 2KT9A 4IE5A 2JMKA 2FUPA 5HEHA 4PK4A 4AQFA 1IZNB 5AQPB 3AEBA 3U78A 2LSGA 5JREA 2AXDS 3PUGA 3FBLA 2VB6A 1I6ZA 4DNDA 1KEYA 1WRDA 3OKQA 3N2KE 4OFZA 5EK3A 5FMNA 1YXRA 2CBIA 3RYIE 2JQQA 3AXJB 2XTLA 3AEAA 5FXZA 2E2AA 4UIGA 2CEAA 1KFYA 4U31A 3UT5E 3L8RA 5LA6E 3LK3B 3K3NA 4KMCA 2CRBA 5HEGA 3O1HA 3CK6A 2N2NA 4U2ZA 1BR2A 2CWYA 4DV1T 4QHOA 3OTOT 3IHRA 4QKNA 4DR3T 4O2AE 2VWAA 2LOSA 3LG7A 3NZPA 4AKGA 3OJAA 2JPFA 5HXSA 2DWKA 3Q5WA 5ABHA 2XQYA 3GWHA 3UU4A 5JR9C 3IA3A 1Z0PA 5CA1E 1UK5A 4L5GA 2BVLA 3LBXA 4U33A 5HYAA 3OYZA 4K0KT 5M4YA 5JDNA 2YOEA 2XQ7A 2XM2A 3PJAA 3QB5K 3F31A 2FJAA 4YTPA 1WCRA 2UUBT 1KNPA 4ZS3A 4DUYT 2KWIB 3I9YA 1IJ5A 2OA5A 2A72A 5FY0A 2ZMAA 3N2GE 5AQIB 2WDQA 3AECA 4AKRB 2F4VT 2XQ6A 3ZSTA 2ZM2A 1Z8UA 2E9XD 4HEAA 4IDQA 2WZIA 2WP9A 5IHYA 5L3DB 1UURA 4I4TE 4EOZB 2XJ7A 5HXHA 3WAKA 2EHOA 3ZKRA 2IW5B 4A98A 2D5UA 4AQFC 5HWXA 4DV5T 2MPKA 5JDLA 3T1YT
chains in the Genus database with same CATH topology
1HX1B 5AQRB 4HWHA 1I6ZA 5AQKB 2D9DA 3FZFB 3M3ZB 5AQVB 1M62A 5AQMB 5AQGB 3FZHB 4HWCA 3FZMB 5AQPB 5AQSB 5AQQB 5AQNB 1M7KA 5AQTB 5AQIB 3FZLB 5AQOB 3A8YC 1T7SA 4HWFA 4HWDA 3LDQB 4HWIB 5AQUB 5AQHB 5AQLB 1UK5A 5AQJB 1UGOA 3FZKB 5AQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  5AQR B;  4HWH A;  1I6Z A;  5AQK B;  2D9D A;  3FZF B;  3M3Z B;  5AQV B;  1M62 A;  5AQM B;  5AQG B;  3FZH B;  4HWC A;  3FZM B;  5AQP B;  5AQS B;  5AQQ B;  5AQN B;  1M7K A;  5AQT B;  5AQI B;  3FZL B;  5AQO B;  3A8Y C;  1T7S A;  4HWF A;  4HWD A;  3LDQ B;  4HWI B;  5AQU B;  5AQH B;  5AQL B;  1UK5 A;  5AQJ B;  1UGO A;  3FZK B;  5AQF B; 
#chains in the Genus database with same CATH topology
 3RIU C;  2LRK A;  2J62 A;  2PG8 A;  2LKH A;  4GIW A;  3FXE B;  2NOX A;  3AAA B;  1HS7 A;  2ZM0 A;  4L9I A;  4YSZ A;  4CXX A;  4MAL A;  4F6R C;  4CN4 A;  2V8S V;  4P1N A;  3TLV A;  1NWM X;  2VVN A;  4EZH A;  2CBJ A;  5LHH B;  4NIQ A;  4UVC B;  3EI0 A;  5F8P A;  2FBW A;  3PTR B;  4B6X A;  3TLS A;  3DTO A;  1QUU A;  4DMV A;  4ILU A;  5HCM A;  4DBQ A;  3PV0 F;  4H9O C;  2Y48 B;  2CMR A;  1HNW T;  4ZXL A;  2XY8 B;  3UUX B;  2V6X A;  2XHE B;  2WMO A;  4TWH A;  2D2S A;  1HCI A;  3P4W A;  3RI5 A;  4O4I E;  5HEJ A;  1IJ6 A;  2VL8 A;  2BKN A;  3VRB A;  3KFW X;  4TUY E;  4Z8X A;  4B3R T;  4K0U A;  4PNI A;  4TV8 E;  2LSY A;  4MHC A;  3T8O A;  2RA1 A;  3PUX F;  1T8B A;  2D9D A;  3JC6 C;  2W63 A;  3N9M A;  1T72 A;  4M1P A;  4IL4 A;  2K24 A;  5LJN A;  2JRK A;  2QA7 A;  1NEN A;  4PJM A;  4CN6 A;  4IE0 A;  5LGN B;  3MA9 A;  1XDP A;  5H6Q B;  3I1A A;  4PK5 A;  5F5W A;  3ZPO A;  2HPL A;  1MMA A;  5AQN B;  4HWD A;  1US7 B;  3RIF A;  4ZI3 D;  3N9Q A;  2MTQ A;  1EZ3 A;  1XWM A;  4YHH T;  3ZYM A;  4COF A;  1XNQ T;  1IBM T;  4DV3 T;  5AQQ B;  1YD8 G;  5LHG B;  2H3R A;  4WYV A;  2VKJ A;  4EIW A;  2EHO C;  3F57 A;  1D1C A;  5JTG A;  1WLX A;  4H63 V;  1KF6 A;  4U72 A;  4CXY A;  2BBH A;  5HWY A;  3X1D A;  2M6B A;  1J5W A;  2XAH B;  4YLH A;  2D0T A;  3HKD E;  2XZE A;  1T7S A;  3A7M A;  4EZ4 A;  3SOL A;  4NUU A;  3EAB A;  2I0M A;  5JR9 B;  4HWH A;  1D0Z A;  2DHR A;  2HPJ A;  1N32 T;  5KDM C;  3ZMS B;  3FZH B;  4X5T A;  3FZL B;  2B76 A;  2MAW A;  3N9O A;  4X20 E;  3NRX A;  3ZMZ B;  5LP6 E;  1HX1 B;  3EDU A;  4O4J E;  2Y8D A;  5LB7 B;  1U5P A;  4ASK A;  1CUN A;  4YY3 T;  4P0A A;  5FL1 A;  2KXP B;  1KNR A;  4IRE A;  4OX9 T;  3DJB A;  2N9D A;  3AE5 A;  3H3M A;  2C5K T;  3ZMV B;  2WDV A;  2W2U A;  4F8H A;  3CX8 B;  2XQ5 A;  1D1A A;  2KMF A;  5AQS B;  2LSK A;  2LEH A;  4DV6 T;  2KSR A;  3PUV F;  2WS3 A;  2LOP A;  2WWU A;  4H9S E;  3RYH E;  3PUQ A;  4EB6 E;  1KK7 A;  3KV9 A;  2KND A;  2W61 A;  1IBL T;  4XBF B;  4PJN A;  1Y64 B;  2XAS B;  4DID B;  1OED E;  3AE6 A;  3AA1 B;  5DQV A;  3N5L A;  4HN9 A;  4J2C A;  4X65 T;  2JJ9 A;  4G63 A;  5BMV E;  1VRB A;  4U2Y A;  2J47 A;  4MLK A;  2IAK A;  4B3M T;  4ZI2 C;  2D0U A;  2YU2 A;  4AQY T;  5AQG B;  2BG9 E;  5JR9 A;  3C50 A;  1E2A A;  2BKP A;  4PW8 A;  1SA0 E;  3VR9 A;  2H89 A;  4LF7 T;  4IST A;  2LM2 A;  2XQ9 A;  1IBK T;  3CQX C;  3AE2 A;  3PUR A;  1GQE A;  2YDR A;  2VKH A;  3ZLI A;  1M62 A;  3PUS A;  1U4Q A;  5CB4 E;  3NBX X;  4GKJ T;  2NP9 A;  1N36 T;  3C51 A;  3BQI A;  4U7Y A;  3OBV E;  2CCQ A;  4I50 E;  4C90 A;  1MND A;  3SFE A;  2PTF A;  3ZN0 B;  2KLQ A;  2YDQ A;  2WDR A;  4A56 A;  1S35 A;  1FMW A;  3QOF A;  4EAH A;  4JI8 T;  5EK2 A;  1R8I A;  4AIS A;  5ABE A;  4CZZ B;  2K5B B;  3GMI A;  2WWV A;  4CN1 A;  3C64 A;  2QVA A;  5J2T E;  3P7I A;  1XNR T;  5JDF A;  2V7K A;  3AE7 A;  1D1B A;  3NVO A;  2LE8 A;  3RIU A;  5LBM A;  2Y6X A;  5HXE A;  3ZT7 A;  2YK0 A;  2IML A;  4HFH A;  3ZCI A;  3MXZ A;  4NUV A;  3Q5D A;  2QYW A;  3N2O A;  3H3A A;  3LFM A;  2JQ9 A;  3AA6 B;  4E7Z A;  2EHO B;  5L47 A;  3D0T A;  1G73 A;  3SS1 A;  1LVK A;  2IUB A;  4IE4 A;  3HL6 A;  5FVL A;  3ESL A;  3PU8 A;  3O1I A;  2IC6 A;  4IT4 A;  3KVB A;  4LF6 T;  4PAG A;  2XSB A;  5IUX A;  4HE8 A;  2XAJ B;  2ZLY A;  1QSD A;  3UUL A;  3AB3 B;  4HFB A;  3UU8 A;  5FP3 A;  2DCF A;  4HWI B;  3FHN A;  3O1J A;  5C8Y E;  4EXT A;  2L8K A;  3RLF F;  2AE9 A;  1ZKE A;  3KV4 A;  4TV9 E;  1JNZ A;  4BA9 A;  1FMV A;  2ODU A;  2W0G A;  2CA5 A;  4X66 T;  3OVU A;  2VQE T;  1SHZ C;  5AQR B;  2W00 A;  3SWH A;  5LG3 A;  2IDO B;  2IHR 1;  5FYM A;  3RQU A;  2XQA A;  4BAY B;  1YQ4 A;  2XAF B;  4YHJ A;  3CQG B;  4PFO A;  5AQO B;  3FB2 A;  2GK9 A;  2LJL A;  5AQF B;  4AKL A;  5JDH A;  2V7J A;  4IHJ E;  3VKG A;  1MIW A;  5FNV E;  2K48 A;  2C5J A;  4IE7 A;  2R6G F;  1XMO T;  1QLB A;  5FXX A;  1OWA A;  3UUB A;  4UR9 A;  3NKZ A;  1DU2 A;  4DMW A;  4KHP T;  4KHZ F;  4MFR A;  4YSY A;  1D0X A;  5F3J A;  2Q9Q B;  2L3L A;  3PDY A;  1ZEE A;  4WZX A;  2V7L A;  2VUR A;  2XQ8 A;  3HA4 A;  4X1K E;  4YT0 A;  2I59 A;  4HWC A;  5L2L A;  2VK9 A;  4TWF A;  4QH4 A;  2LHR A;  3ZC1 A;  5JDM A;  4AQG A;  3KBT A;  4UEL A;  4DV4 T;  4ZEY A;  3L3P A;  4ZS2 A;  3JC6 D;  3NWI A;  2UUC T;  5J0Z A;  4YFS A;  2BZB A;  4ERR A;  4KX6 A;  3MAC A;  4ZI7 E;  5DAB A;  4IIJ E;  2X0Y A;  3WI3 A;  4H9Q C;  1H7C A;  3MK7 C;  3PJA J;  4HFE A;  5HCJ A;  3V5U A;  3AAI A;  2X68 A;  5H6R B;  4TX5 A;  3UFE A;  1B7T A;  3UFG A;  4X62 T;  2ACZ A;  2E8I A;  5L3B B;  3CKD A;  1XMQ T;  5CA0 E;  4I55 E;  1FEW A;  4LF9 T;  1AJ3 A;  4MBQ A;  4TZ4 C;  3ONL C;  1NAF A;  4PJJ A;  2EHO D;  2KWH A;  3RHW A;  1N34 T;  4DR4 T;  2UXD T;  1MNE A;  2V5D A;  3PE0 A;  3CX6 B;  4ILB A;  5GON E;  2Q9Q A;  5HEU A;  1D0Y A;  5L4E A;  3MZK B;  3UQ4 A;  3CWZ B;  4JI6 T;  4XZC A;  2JQK A;  2X9X A;  2DWG A;  3RX6 A;  4O4L E;  2X0H A;  1MIY A;  3E22 E;  2J1D G;  5C2T A;  5HEO A;  1FIO A;  5CGM A;  4LF4 T;  2W66 A;  5LOV E;  1G8X A;  4NPP A;  2VAS A;  4AKH A;  1J1J A;  3P4S A;  2K9A A;  2QRX A;  4HKA A;  2LSI A;  2W67 A;  5LHI B;  3R6N A;  3HKB E;  1YKH B;  5HXC A;  1YW0 A;  3ZJ1 A;  4ADZ A;  3B57 A;  4CQI A;  3ZSS A;  3K3O A;  1YKE B;  4GYS A;  3ZMT B;  3BQL A;  4ISS A;  4U7I A;  3JCF A;  4AKI A;  2IC9 A;  3FZM B;  4GYR A;  2CXL A;  3JAF A;  2V26 A;  3QUJ A;  4YTN A;  2WAU A;  2XAQ B;  1HR0 T;  2OV9 A;  5LMU T;  4GK5 E;  1LKX A;  2SPC A;  5L3C B;  5FY7 A;  4X1Y E;  4JI1 T;  4H9N C;  2G0U A;  2LRL A;  2WMN A;  4B3T T;  4UV9 B;  1VCS A;  3E08 A;  3LDQ B;  2RP4 A;  1O3X A;  3R84 B;  4JI5 T;  2CE7 A;  4Q25 A;  4QH1 A;  4UVB B;  4DBR A;  4KBM B;  2CXD A;  3RGL A;  2UU9 T;  4YJ3 E;  1M7K A;  1WR6 A;  1UUS A;  4JLE A;  1MIV A;  3EUH A;  2V1D B;  2FJB A;  4DR6 T;  2I6H A;  4H9P C;  2B1E A;  3KV6 A;  5FVK A;  2HH7 A;  4JI0 T;  5L4H A;  1OED A;  1L0V A;  2JQH A;  3I0O A;  2H7O A;  2LHN A;  2Z6E A;  5ABG A;  1HNX T;  3W15 B;  3RIA A;  3JAE A;  3MJX A;  2LKG A;  5JDG A;  5L3F B;  2CHN A;  2X67 A;  4U3C A;  5HAX A;  5A1L A;  3KBU A;  4EYY R;  2OLT A;  5JQG E;  2Q9Q C;  4UV8 B;  3IEE A;  4L0R A;  4C91 A;  4AI6 A;  3TLU A;  2BBJ A;  4IE6 A;  3PUW F;  2BG9 A;  4LMK A;  4QH5 A;  4EYU A;  1W0A A;  4Z90 A;  3IF8 B;  2NR4 A;  2RPA A;  2YEV C;  3J9X 1;  3S4U A;  5JRC B;  3PU3 A;  5AQJ B;  3PUA A;  3KVA A;  1CHU A;  3IBP A;  3C98 B;  4QX7 B;  4EGW A;  2M67 A;  1HX8 A;  1MMN A;  3I0Q A;  3M3Z B;  1HG2 A;  3KV5 A;  4JEH B;  2XM1 A;  2ZM8 A;  3L39 A;  3ZMU B;  5FXW A;  4CI2 B;  1VCT A;  4DO0 A;  4QXB B;  4LFC T;  1WYB A;  1W09 A;  1MMG A;  3MKD A;  5C3J A;  2HHH T;  4P09 A;  4HFC A;  2H88 A;  3ZYL A;  2CWO A;  2V7M A;  4ANJ A;  4KUM B;  4X1I E;  1N33 T;  3RF1 A;  2IIU A;  5E0O A;  4JI7 T;  3CVR A;  3ANW A;  2CM0 A;  3CX7 B;  3B5M A;  4KI0 F;  2YKS A;  3T1H T;  4AIU A;  2DI4 A;  4WBN E;  4DV0 T;  3EAM A;  2LM9 A;  3ONX A;  3O9X A;  2K3W A;  2NW9 A;  2WY2 A;  5DJQ C;  2YU1 A;  3V5S A;  3FBZ A;  1NEK A;  1LVF A;  3CML A;  2BDE A;  4OYJ A;  5EZY E;  1UX4 A;  2WSS V;  2NW8 A;  1T98 A;  2E5L T;  3AED A;  3L09 A;  3UUN A;  3FZF B;  2MBG A;  4ZZB A;  5JRC A;  4YTM A;  3GN5 B;  4UVA B;  3VU7 H;  3I9W A;  1OED C;  2FJD A;  1BR1 A;  4JYA T;  2E9X A;  1S94 A;  2MOZ A;  5AQU B;  4ZOL E;  2X0L B;  3RYC E;  4JV5 T;  1J5E T;  2YDS A;  1E7P A;  4ZHQ E;  2H7V C;  2BG9 C;  2WU2 A;  5JH7 E;  4YXD A;  1JNR A;  4X64 T;  4HFD A;  1IAP A;  3J7Y q;  3RYF E;  3LK2 B;  4KP3 C;  5ADX L;  2WQY A;  4JBW F;  1YQ3 A;  1ZP0 A;  3ZT6 A;  3CIR A;  2BS4 A;  1VOM A;  2NTX A;  3ETU A;  3N9L A;  5LXT E;  4DR5 T;  2WZH A;  4GOU A;  1ZV4 X;  2BS2 A;  3ONJ A;  2A2F X;  3FZK B;  3U3I A;  3ZCJ A;  3F2E A;  1X9B A;  1WR0 A;  2P9B A;  4A5X A;  3A5X A;  4CI3 B;  2V6Y A;  5LNK A;  2E5V A;  4UF0 B;  4HFI A;  2UXB T;  3RQW A;  4QWN B;  3UQ7 A;  3P4Q A;  1KNZ A;  2YIN A;  2DLR A;  3AE4 A;  2CLY C;  3QC9 A;  5AQV B;  3TLT A;  2UXX B;  3G06 A;  4E7S A;  2LSJ A;  2WM9 A;  4TNV A;  3AE8 A;  5FL0 A;  2W62 A;  3AA7 B;  4DR7 T;  3EDV A;  3GN5 A;  4AXP A;  3P4R A;  2A9U A;  4OK0 A;  4O8S A;  4DR1 T;  3NRY A;  3AXJ A;  4A97 A;  3B13 A;  4Z91 A;  4ILC A;  3LSV A;  4TN7 B;  1I94 T;  3PUY F;  4EED A;  2VQF T;  1HFA A;  3OPC A;  3AVS A;  3HKE E;  2CXF A;  4OHF A;  3JAD A;  3RRW A;  2VL0 A;  1V9D A;  2YN6 A;  4FJO A;  3AEG A;  3UUM A;  4B3S T;  3UU3 A;  4BJM A;  1HTJ F;  3C4W A;  5LBQ B;  4H63 H;  2VKO A;  3UU6 A;  3Q2M A;  5AQL B;  5BR8 T;  2BKO A;  2E9X C;  3GA8 A;  2KIN B;  5LG4 A;  1XZY A;  4PK6 A;  2WU5 A;  5ABF B;  2J4G A;  3RRC A;  2C5I T;  2JMH A;  5KMG P;  3Q9D A;  3RC3 A;  3QNU A;  3K8P C;  1SE7 A;  4UF0 A;  2WCA A;  4H9R C;  4UXN B;  2X9Y A;  2PFV A;  3FXD B;  5AQM B;  3CQC B;  2A3D A;  2X66 A;  1MMD A;  3HKC E;  2ZM6 T;  4WBO A;  5AFU L;  2HN1 A;  4HTE A;  1XDO A;  1FJG T;  3SFD A;  2VKD A;  4IDO A;  4HFV A;  3KDS E;  2X51 A;  2XQ3 A;  4IL9 A;  4I0U A;  2X9H A;  5KX5 E;  3K3Q C;  4ZZC A;  4YSX A;  4UEM A;  5CJ5 A;  3NZQ A;  1W9R A;  4IDZ A;  3VRA A;  3UTK A;  4WW0 A;  2L9Q A;  4LMJ A;  5JVD E;  5HXR A;  3AVR A;  3AE1 A;  4NXM T;  5J1G A;  2JIW A;  3VKH A;  4JI3 T;  4DR2 T;  5J2U E;  2QGS A;  3P8C D;  3AA0 B;  4N78 D;  2CHO A;  4ILA A;  4HWF A;  1OED B;  3M65 A;  4CXW A;  3CPZ A;  2UXN B;  4LML A;  3ETV A;  2XQ4 A;  3EVY A;  4JUY A;  3E0Z A;  3QB5 A;  4IDN A;  2UUA T;  5ETW A;  3HI2 A;  3H37 A;  4O4H E;  3PUZ F;  4LFB T;  3RH3 A;  3AE9 A;  2M6I A;  5ABF A;  3ZJ2 A;  4U74 A;  4IGU A;  1WFD A;  2BG9 B;  2ACX A;  3TLW A;  2V5C A;  1X79 A;  3RKO A;  3RPU A;  2XAG B;  3AEE A;  3OYX A;  3RKG A;  1WYC A;  3UU5 A;  3AEF A;  2X9W A;  2ES0 A;  3ZC0 A;  2WB5 A;  4GKK T;  4LF8 T;  4O2B E;  3Q5E A;  4TWD A;  1ZOY A;  2KZ7 B;  4DUZ T;  5IWA T;  3ZN1 B;  4IDP A;  4ZI3 C;  3AE3 A;  5LGT B;  2DL1 A;  5FKY A;  1HG5 A;  3AAE B;  4QXC B;  1BR0 A;  2HN2 A;  4JI2 T;  4OYK A;  2BVM A;  3TKL B;  4DV2 T;  5AQH B;  2Q9Q D;  3Q5X A;  1W0B A;  3C4Z A;  5DQW A;  4EV6 A;  3ZT5 A;  2C0S A;  3DP7 A;  5AQK B;  5FY1 A;  5KXJ A;  4ZI2 D;  4LF5 T;  5FXV A;  2WBL A;  4QX8 B;  3HR0 A;  3VR8 A;  2CLY B;  3ANW B;  4LFA T;  3K1S A;  5IYZ E;  3ZYK A;  1UGO A;  4G2A A;  5JDQ A;  1BR4 A;  3P4P A;  4CI1 B;  2ODV A;  3BQK A;  4DV7 T;  1OXZ A;  5EK4 A;  3A8Y C;  1UX5 A;  2XSA A;  1UCU A;  2CPT A;  2VVS A;  1HNZ T;  1HF8 A;  2N1G A;  4I43 B;  5LGU B;  1Y01 A;  3ZEF B;  2NW7 A;  2W4X A;  5AQT B;  3ABV A;  3KIN B;  2BS3 A;  4HGA A;  4YJ2 E;  4JI4 T;  2FJE A;  3SRZ A;  1ZHC A;  4V1A v;  5L3G B;  3VHL A;  4PJL A;  2PJQ A;  2DNX A;  1SUM B;  4FI5 A;  2E9X B;  2V7I A;  1E1H B;  4XAX B;  4JEU B;  4P0B A;  4GK0 E;  3EHZ A;  1LRZ A;  3QK6 A;  2XUE A;  2PBI A;  5TAO A;  5LYJ E;  2NWB A;  5LJM A;  2UXC T;  2XPK A;  5LMN T;  3LJC A;  3N9P A;  3C4X A;  4QXH B;  5L3E B;  4PFP A;  4BJN A;  3RC8 A;  4EEB A;  3N9N A;  2LLY A;  4TNW A;  2NTY A;  4NXN T;  4WNK A;  2LT3 A;  3WAJ A;  2MYS A;  3LBX B;  5LCY A;  3O4X E;  3LK4 2;  3P50 A;  4DVD A;  3BK9 A;  5CFB A;  2V6Y B;  2KT9 A;  4IE5 A;  2JMK A;  2FUP A;  5HEH A;  4PK4 A;  4AQF A;  1IZN B;  5AQP B;  3AEB A;  3U78 A;  2LSG A;  5JRE A;  2AXD S;  3PUG A;  3FBL A;  2VB6 A;  1I6Z A;  4DND A;  1KEY A;  1WRD A;  3OKQ A;  3N2K E;  4OFZ A;  5EK3 A;  5FMN A;  1YXR A;  2CBI A;  3RYI E;  2JQQ A;  3AXJ B;  2XTL A;  3AEA A;  5FXZ A;  2E2A A;  4UIG A;  2CEA A;  1KFY A;  4U31 A;  3UT5 E;  3L8R A;  5LA6 E;  3LK3 B;  3K3N A;  4KMC A;  2CRB A;  5HEG A;  3O1H A;  3CK6 A;  2N2N A;  4U2Z A;  1BR2 A;  2CWY A;  4DV1 T;  4QHO A;  3OTO T;  3IHR A;  4QKN A;  4DR3 T;  4O2A E;  2VWA A;  2LOS A;  3LG7 A;  3NZP A;  4AKG A;  3OJA A;  2JPF A;  5HXS A;  2DWK A;  3Q5W A;  5ABH A;  2XQY A;  3GWH A;  3UU4 A;  5JR9 C;  3IA3 A;  1Z0P A;  5CA1 E;  1UK5 A;  4L5G A;  2BVL A;  3LBX A;  4U33 A;  5HYA A;  3OYZ A;  4K0K T;  5M4Y A;  5JDN A;  2YOE A;  2XQ7 A;  2XM2 A;  3PJA A;  3QB5 K;  3F31 A;  2FJA A;  4YTP A;  1WCR A;  2UUB T;  1KNP A;  4ZS3 A;  4DUY T;  2KWI B;  3I9Y A;  1IJ5 A;  2OA5 A;  2A72 A;  5FY0 A;  2ZMA A;  3N2G E;  5AQI B;  2WDQ A;  3AEC A;  4AKR B;  2F4V T;  2XQ6 A;  3ZST A;  2ZM2 A;  1Z8U A;  2E9X D;  4HEA A;  4IDQ A;  2WZI A;  2WP9 A;  5IHY A;  5L3D B;  1UUR A;  4I4T E;  4EOZ B;  2XJ7 A;  5HXH A;  3WAK A;  2EHO A;  3ZKR A;  2IW5 B;  4A98 A;  2D5U A;  4AQF C;  5HWX A;  4DV5 T;  2MPK A;  5JDL A;  3T1Y T; 
#chains in the Genus database with same CATH homology
 1HX1 B;  5AQR B;  4HWH A;  1I6Z A;  5AQK B;  2D9D A;  3FZF B;  3M3Z B;  5AQV B;  1M62 A;  5AQM B;  5AQG B;  3FZH B;  4HWC A;  3FZM B;  5AQP B;  5AQS B;  5AQQ B;  5AQN B;  1M7K A;  5AQT B;  5AQI B;  3FZL B;  5AQO B;  3A8Y C;  1T7S A;  4HWF A;  4HWD A;  3LDQ B;  4HWI B;  5AQU B;  5AQH B;  5AQL B;  1UK5 A;  5AQJ B;  1UGO A;  3FZK B;  5AQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...