2W0GA

Hsp90 co-chaperone cdc37
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
129
structure length
129
Chain Sequence
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HSP90 CO-CHAPERONE CDC37
publication title The Human Cdc37.Hsp90 Complex Studied by Heteronuclear NMR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08565 CDC37_M Cdc37 Hsp90 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w0gA00
2W0GA 2K5BB 1US7B
chains in the Genus database with same CATH superfamily
4EV6A 5JRCB 3A7MA 4DV4T 4G63A 4N78D 2LT3A 4LF7T 4HFVA 2L8KA 5HXCA 2B1EA 2V6YA 2X51A 5JDGA 4LMJA 3EDVA 3QNUA 5ABFB 1HS7A 3E08A 1W09A 2I0MA 4EAHA 1XNRT 3AE3A 4U3CA 5FNVE 4KHPT 4DUZT 2UU9T 2V7JA 3K3OA 4PW8A 4ILCA 5AQUB 3O1JA 3CKDA 3LK2B 1XDPA 3GWHA 1EZ3A 3N2GE 4ILBA 4JI4T 4LF5T 2XUEA 2VL8A 5C8YE 2X0YA 2CHNA 2HPLA 3HI2A 4XBFB 2MBGA 2Q9QA 2WU2A 3ZJ2A 4Z91A 4I55E 4TWDA 5LA6E 4EZHA 5LXTE 3SFDA 3R6NA 3JC6C 3RKOA 4MHCA 2VASA 2V6YB 4ERRA 2ZM0A 5KXJA 3H3AA 2Q9QD 4X1KE 2YINA 2Q9QC 3LBXB 5CB4E 5FXVA 4NUUA 2JRKA 1D0YA 2MTQA 2VB6A 2M6IA 4U7IA 4IDOA 4MFRA 5AQFB 5EK2A 3QB5K 2KLQA 4CI1B 4PNIA 4YTPA 4YJ3E 2QYWA 1WR6A 4DMWA 4PK5A 5DJQC 2XQ3A 2WZIA 4GK5E 1X9BA 2YU2A 3UUMA 2KWHA 2LHNA 4IGUA 2Q9QB 3B57A 4X64T 3KBTA 1NWMX 2XQ7A 2J47A 2CLYC 2W66A 4ZI2D 4ZHQE 3FXEB 4DV6T 4E7ZA 4KUMB 2Z6EA 4B3RT 2IW5B 2LKGA 3JADA 3AECA 2BBHA 4YHHT 1HCIA 4YSYA 1I94T 2W0GA 1Z8UA 2UUCT 2WSSV 4AQFA 4GIWA 3AE5A 3ZLIA 2FBWA 5JQGE 4WNKA 4LFAT 2XHEB 2BVLA 3ABVA 4B6XA 2YK0A 2CLYB 5EK3A 3ZMTB 2IHR1 4DR6T 3AE9A 3AEAA 4WZXA 4AQFC 2W61A 2XAJB 3PJAJ 4TWFA 3N2OA 4AKLA 1VOMA 4KHZF 3P50A 4U33A 1US7B 2LSIA 2VKDA 1J5WA 3SOLA 2H88A 2UXBT 3FHNA 2LEHA 2V6XA 1N32T 2BKPA 4HFCA 3KVBA 3B5MA 4IL4A 2D0UA 4U2YA 3RYHE 1UK5A 2WP9A 3P4QA 1VCTA 1Z0PA 4CXXA 2JQKA 4ASKA 4BA9A 2JQHA 3ZMSB 4ZZBA 2BKNA 2BZBA 4DV7T 3PV0F 4JI0T 2CXFA 3Q5WA 1KEYA 4OHFA 4DBRA 5LYJE 4AISA 3UUXB 5LJMA 4YTNA 3HR0A 1L0VA 2BG9E 5IUXA 4JBWF 3HKDE 4NXMT 1YQ3A 4HFDA 3A5XA 3HKEE 3QUJA 4IHJE 5CA1E 3H3MA 3KV6A 4IE4A 3HKCE 5HWYA 4QKNA 2K5BB 3VRBA 3VU7H 3LJCA 2YN6A 2XY8B 4A5XA 4DR3T 1ZOYA 3F2EA 5FVKA 1FEWA 5FY1A 5FXZA 4ILAA 4JV5T 4UV9B 5BMVE 4TX5A 3CPZA 2CXDA 2PTFA 4ZEYA 4I43B 5L3CB 3NZPA 4LMLA 4PFPA 4WBNE 4BJMA 4UXNB 3N9OA 4F6RC 4I4TE 3AEFA 5GONE 5AQKB 1WFDA 5AQJB 3PUGA 3ANWA 2E9XA 3O4XE 3KVAA 4PK6A 3EI0A 2H7OA 5HYAA 1HG5A 5AQTB 5ADXL 2WDRA 5LNKA 2DLRA 3I9WA 4OFZA 5L2LA 4IE6A 1BR1A 2DL1A 2K9AA 4J2CA 5AQSB 2LSYA 2V7LA 1WYCA 1OEDA 4HWFA 4IDQA 2XSAA 3ZJ1A 2E9XD 4GYSA 5DQVA 3ZEFB 4V1Av 5AQOB 1HF8A 3OYXA 3ZT5A 1T7SA 5HXSA 3AE2A 5FVLA 1D0ZA 3MXZA 5L3BB 2ODUA 3NRXA 1HFAA 3N9PA 5J2UE 1MNDA 5LB7B 4GKJT 2E5VA 2WDVA 2GK9A 2VVNA 3WAJA 3M65A 1OEDC 3ZC0A 3F57A 4DV3T 3AE8A 2RPAA 3K8PC 4U31A 4EEBA 3C50A 3ANWB 3IEEA 2V7KA 4EYUA 3KV9A 4U72A 3PJAA 4DIDB 4TNWA 4CXWA 2WMNA 3TKLB 5LP6E 1IJ6A 5JDMA 3PUQA 2KMFA 3AEBA 2V8SV 2A9UA 4PJMA 2WM9A 5J1GA 1OEDB 4IE7A 3PUSA 2Y6XA 2X9WA 1DU2A 3O1IA 5JVDE 4P1NA 3IBPA 3FZHB 1Y01A 2WWUA 2KT9A 2RA1A 3SRZA 2QVAA 1T98A 2FJEA 3UUBA 3MZKB 5AQHB 1UGOA 5F3JA 2CRBA 2WMOA 3Q5XA 3F31A 5LBQB 3ONJA 3ONLC 3CIRA 1AJ3A 4NIQA 1QLBA 3TLSA 1M62A 2NP9A 4UVCB 3VRAA 4PJNA 2LRLA 3NBXX 5L47A 4B3TT 4TWHA 5LBMA 2OV9A 4A56A 2LHRA 2M6BA 2LM9A 3RIFA 4H63V 2X66A 5BR8T 4HKAA 4U2ZA 4UR9A 3LK3B 4DV5T 4UIGA 1HNZT 1ZV4X 4IDPA 2K48A 4YT0A 4U7YA 3AE4A 1D1BA 1J1JA 3PUXF 2PJQA 4O4IE 3TLUA 3TLWA 5FYMA 3X1DA 3Q5DA 2BS4A 2BS2A 5L3DB 4MLKA 3CQXC 2IUBA 1WLXA 4KI0F 2JPFA 3DP7A 1JNRA 3FBZA 2IIUA 1J5ET 4DV2T 2QGSA 4EGWA 1UURA 3EDUA 3SFEA 5LOVE 3RYIE 4BJNA 3ZMVB 4JYAT 4AQYT 2V7IA 3FBLA 2IMLA 5HCMA 4Q25A 1IAPA 1OXZA 4EB6E 2XAQB 3MKDA 2CPTA 3E0ZA 4O2AE 4OK0A 3ZCJA 2BBJA 2ACXA 3LDQB 4YSXA 3AVSA 1H7CA 1QUUA 3AEEA 2DHRA 1HX1B 4E7SA 4JEHB 4XAXB 5HAXA 3UFEA 2ODVA 5ABGA 4NPPA 4YY3T 1SE7A 4XZCA 3C4XA 5AQGB 5LMUT 3PE0A 5LHHB 3KINB 3KBUA 4CZZB 3AAEB 3JCFA 3RF1A 2HN2A 1BR0A 4HTEA 4UVAB 5AQLB 5CFBA 5M4YA 1KF6A 2ZM6T 5LMNT 2UUBT 2XAGB 2VKJA 2JQQA 3AAAB 3N9LA 2ZMAA 4ISSA 4NUVA 3SWHA 2XQ5A 3K1SA 2I59A 4UVBB 4ZI2C 1OWAA 5JTGA 4UF0A 1NEKA 2D5UA 3C4WA 2VQFT 3EABA 4MBQA 3D0TA 1D1AA 3P7IA 2RP4A 3ZPOA 3UULA 1LVKA 4KMCA 2LKHA 4L9IA 5LGNB 1LVFA 3RQWA 3C4ZA 5AQNB 2W4XA 1JNZA 3K3NA 3T1HT 5AFUL 4UEMA 1U5PA 2V5CA 3CWZB 3M3ZB 4U74A 3AA7B 2VL0A 4X65T 1S94A 2NOXA 5AQRB 3N5LA 5JDNA 2V7MA 4NXNT 5DABA 3BQLA 4DUYT 2PBIA 2IC6A 3UT5E 5FP3A 1YW0A 2X9YA 1MMNA 4X1IE 1UUSA 3LG7A 1U4QA 2CXLA 4LMKA 3PTRB 3PURA 2LSKA 2N2NA 3UU4A 3WAKA 5HEOA 3RRWA 4GYRA 4JI5T 2HH7A 5CJ5A 4YHJA 4HWCA 4IREA 2A3DA 3A8YC 4K0UA 5LJNA 2LM2A 3AE7A 3BK9A 3FZKB 5FL0A 4HEAA 3PUWF 1NENA 1HTJF 4YTMA 3E22E 4AKRB 4DR2T 3P8CD 4ZOLE 3SS1A 1KNZA 2KNDA 4WYVA 2DNXA 5KX5E 4QXHB 3AA6B 3NZQA 4JI2T 4PK4A 4HWHA 2MYSA 1HX8A 4WW0A 3ZT6A 2WAUA 2Y8DA 3KV4A 4QXCB 4FJOA 3P4SA 5CGMA 5AQIB 3EUHA 3PUAA 3Q2MA 5E0OA 1UCUA 4P0BA 2CEAA 3N9NA 2XPKA 2YDRA 4YFSA 3AAIA 2X0HA 4QX7B 4P0AA 4LFCT 2VKHA 5JREA 2EHOA 2QA7A 2MAWA 5FKYA 3CX8B 2W63A 5ABHA 4X20E 2V5DA 3CQCB 1UX5A 2JMKA 2HHHT 1OEDE 4WBOA 2KINB 3FZFB 3RHWA 1X79A 3DJBA 2DWKA 3VKHA 4AXPA 2VQET 2CCQA 3GA8A 2J62A 3WI3A 3C98B 1W0BA 3LK42 4GK0E 2JQ9A 3RGLA 4OYKA 4PAGA 1FMVA 2EHOD 2LLYA 4QH1A 5H6RB 2Y48B 3T1YT 4X62T 1HNWT 3CK6A 3UUNA 5F8PA 4QH5A 2MOZA 1WYBA 2XASB 2X68A 2BG9A 3UU5A 5LCYA 4ZI7E 3IA3A 3QB5A 2LOSA 1KNPA 4L0RA 4YLHA 4EOZB 3OVUA 5FL1A 4AKIA 4A97A 3CX7B 3ONXA 1KK7A 2E9XC 2UXDT 1N33T 4X5TA 2XM1A 4PJLA 5HEHA 4IE5A 1FIOA 5FY0A 4ADZA 3RYCE 4HFHA 5EZYE 5HXRA 2ZM8A 3UU3A 4F8HA 1CHUA 1HR0T 5LHGB 1FJGT 2PG8A 1MIVA 4KP3C 2L3LA 4PJJA 4EEDA 3MA9A 4CI3B 2C5JA 4LFBT 4O4HE 2E9XB 3ZSSA 4K0KT 3NRYA 2FUPA 4DBQA 2HPJA 1LRZA 2BG9B 2FJBA 5ABEA 5LGTB 3UQ4A 1IBMT 3DTOA 4I0UA 3Q9DA 1MMAA 3ZYLA 1I6ZA 3J7Yq 1YD8G 1QSDA 4O2BE 2WS3A 1XDOA 2FJDA 4COFA 1ZKEA 5J0ZA 4EZ4A 4LF9T 4JLEA 3RQUA 3AA0B 2C5IT 3MACA 2A2FX 1HG2A 3W15B 4CN1A 1M7KA 5L4EA 2XQ6A 2VURA 2R6GF 2C0SA 5JDLA 3EHZA 2X0LB 2NW7A 4H9SE 3VR8A 4HWIB 5ABFA 1S35A 1IJ5A 3UTKA 2DI4A 1E7PA 4KX6A 2XTLA 4AIUA 1CUNA 2WU5A 3L8RA 2XAHB 3ZC1A 3QK6A 3FXDB 2JJ9A 3S4UA 2NTYA 4DR4T 1XMOT 1N36T 4ZS3A 2B76A 2F4VT 1W9RA 5AQQB 2LJLA 1IBKT 4H9QC 3ZN0B 5J2TE 4YXDA 1BR2A 1GQEA 2ACZA 2XZEA 4IIJE 3UU6A 1FMWA 3RPUA 3ZN1B 4O8SA 3RYFE 2ES0A 2NR4A 3ZT7A 4ZI3D 3RC8A 4ZI3C 2D0TA 2WZHA 5HEJA 5JH7E 1NAFA 5LHIB 4O4JE 3EAMA 3N9QA 4P09A 2HN1A 1ZEEA 4IT4A 3VKGA 3VR9A 3I0OA 1D0XA 3LBXA 4QWNB 1E1HB 3EVYA 4JI8T 3TLTA 3RLFF 1BR4A 2C5KT 3CX6B 3AE6A 5LG4A 5LGUB 2W2UA 3O1HA 1UX4A 3H37A 2LSJA 1XMQT 1WRDA 1SHZC 4HN9A 1W0AA 3ETVA 3R84B 1SA0E 4QXBB 1T8BA 4DV1T 3P4WA 3AXJA 2CBIA 3OPCA 3QC9A 2FJAA 4IDNA 2E5LT 5EK4A 3JC6D 2E8IA 2V1DB 4AKGA 5IYZE 3QOFA 2XJ7A 3ZKRA 1O3XA 3AE1A 1ZP0A 3N9MA 4JI3T 4LF6T 2VK9A 4AI6A 2D9DA 2NW9A 1YQ4A 4C90A 4MALA 2CE7A 3CMLA 1E2AA 3J9X1 2J4GA 4TZ4C 1G8XA 4H9NC 5HEGA 4AKHA 2J1DG 2DWGA 1B7TA 5F5WA 2MPKA 3PU3A 4EXTA 2IC9A 3V5SA 3GN5A 4CN6A 2OA5A 1VCSA 2W00A 3B13A 2YDQA 3AXJB 4X66T 1WR0A 5L4HA 4H9PC 2BVMA 3AA1B 4H63H 1MIWA 3U78A 3T8OA 1R8IA 2D2SA 3RI5A 5C2TA 3AB3B 2NW8A 5IHYA 2UXCT 3RC3A 4DNDA 2N9DA 2XQ4A 5FY7A 5AQPB 3LSVA 2QRXA 4CI2B 5KDMC 4G2AA 4B3ST 1G73A 3HA4A 3NKZA 2L9QA 2WY2A 2YEVC 5ETWA 3NWIA 3Q5EA 2KWIB 4QHOA 4IDZA 4B3MT 4UF0B 5DQWA 2UXNB 5AQVB 2CWOA 5LG3A 4C91A 2XSBA 2YKSA 2XQ9A 3GN5B 3I9YA 3IF8B 3RRCA 4A98A 5JDQA 1SUMB 2CBJA 2VKOA 4ANJA 5H6QB 3RH3A 4EYYR 1N34T 2CHOA 3IHRA 2ZLYA 1XNQT 4GKKT 4Z8XA 4TNVA 3NVOA 4H9OC 1MMDA 3JAFA 4ZS2A 4HFEA 4DO0A 4DMVA 4JI1T 4IL9A 3K3QC 4FI5A 4HFIA 4LF8T 5HCJA 2CMRA 3AEGA 2XQYA 2BDEA 2YOEA 4ILUA 5IWAT 2PFVA 2N1GA 2BS3A 3KFWX 3MK7C 4ISTA 3KV5A 3O9XA 2YDSA 4JI7T 1V9DA 1XZYA 4HE8A 2XM2A 1KNRA 3OBVE 4UELA 3PUZF 4HGAA 2LRKA 4UV8B 2NTXA 3HKBE 4OYJA 3ZMZB 3N2KE 2X67A 2A72A 5C3JA 2AXDS 4QX8B 3I0QA 4L5GA 1MNEA 3ETUA 2CM0A 4BAYB 2ZM2A 5FMNA 4I50E 2H89A 2EHOC 4GOUA 2OLTA 3ZCIA 4HFBA 1KFYA 2M67A 2E2AA 3ZYKA 2WDQA 3P4RA 5JDHA 2H7VC 2LOPA 3RIAA 1ZHCA 4DR7T 4KBMB 2W62A 2KSRA 4X1YE 3TLVA 2WQYA 5HEUA 1YKHB 5FXXA 4CN4A 2AE9A 3V5UA 3ZMUB 5L3EB 1VRBA 2WB5A 5L3GB 2EHOB 2K3WA 2LSGA 3U3IA 5HWXA 2V26A 2BG9C 4HWDA 5A1LA 3FB2A 4JI6T 2WWVA 3OKQA 3PU8A 2KXPB 4CXYA 2K24A 2UXXB 3AVRA 1YKEB 3OJAA 1IZNB 5AQMB 2I6HA 2P9BA 4AQGA 3RIUA 4LF4T 4YJ2E 2SPCA 3UU8A 1MIYA 4IE0A 4TV8E 1T72A 3UQ7A 5HXEA 5TAOA 5JR9A 2XQ8A 3PUVF 4CQIA 3RIUC 4H9RC 4TUYE 4QH4A 3P4PA 3C64A 3LFMA 3L3PA 4OX9T 4JUYA 2W67A 2WCAA 3L09A 1YXRA 3PDYA 3C51A 4TN7B 3VHLA 3JAEA 2G0UA 2X9XA 2KZ7B 1HNXT 5JR9C 1XWMA 3GMIA 4PFOA 2VWAA 3OTOT 2JMHA 3L39A 1Y64B 2LE8A 4M1PA 2H3RA 3FZLB 2CWYA 4O4LE 5JRCA 5CA0E 2CA5A 2XAFB 3UFGA 3ZYMA 3PUYF 1D1CA 2IDOB 2JIWA 3RKGA 3I1AA 4ZZCA 4DVDA 3G06A 5FXWA 2XQAA 3ZSTA 5JR9B 4DV0T 5JDFA 3HL6A 4JEUB 1IBLT 1MMGA 3FZMB 5L3FB 2VVSA 2WBLA 4Z90A 3CVRA 2NWBA 3BQIA 4DR1T 1WCRA 3ESLA 4DR5T 4TV9E 4ZXLA 3BQKA 4EIWA 3RX6A 2YU1A 2IAKA 3KDSE 5KMGP 3MJXA 1LKXA 3AEDA 2BKOA 2DCFA 3OYZA 5HXHA 3CQGB 2UUAT 4YSZA 2X9HA
chains in the Genus database with same CATH topology
3AA6B 4AKHA 3N9PA 3NZQA 2J1DG 5J2UE 4PK4A 1MNDA 2MYSA 1HX8A 4WW0A 2DWGA 1B7TA 2WAUA 5JRCB 2Y8DA 2GK9A 3KV4A 4QXCB 3WAJA 4FJOA 3M65A 3PU3A 4G63A 2IC9A 2LT3A 4N78D 4EXTA 3ZC0A 3V5SA 3GN5A 2OA5A 2W00A 3B13A 4HFVA 3F57A 2L8KA 5HXCA 2B1EA 2X51A 3EUHA 3PUAA 5JDGA 3Q2MA 5E0OA 1UCUA 4P0BA 3EDVA 3K8PC 2CEAA 3C50A 3N9NA 1HS7A 3ANWB 3E08A 3IEEA 2V7KA 4YFSA 4EYUA 4H9PC 3KV9A 2BVMA 4EAHA 3AA1B 4U72A 5FNVE 4H63H 4CXWA 1MIWA 3U78A 2WMNA 3TKLB 3AAIA 5LP6E 2V7JA 4QX7B 3K3OA 4PW8A 4P0AA 2VKHA 3T8OA 1IJ6A 5JDMA 5JREA 2EHOA 2D2SA 3PUQA 2QA7A 2KMFA 3CX8B 2W63A 3AB3B 2NW8A 3O1JA 4X20E 3CQCB 1UX5A 5IHYA 3RC3A 4DNDA 3CKDA 3LK2B 2JMKA 2N9DA 3GWHA 4WBOA 2KINB 1EZ3A 3N2GE 4PJMA 5FY7A 2WM9A 1X79A 3DJBA 5J1GA 4IE7A 2XUEA 3PUSA 2DWKA 2VL8A 3VKHA 4AXPA 2CCQA 2X9WA 2Y6XA 3GA8A 3O1IA 5JVDE 4CI2B 5C8YE 5KDMC 4G2AA 3IBPA 3WI3A 1G73A 2HPLA 3HI2A 3C98B 3LK42 4GK0E 4XBFB 2WWUA 2KT9A 2RA1A 3HA4A 4OYKA 4PAGA 3SRZA 1FMVA 2EHOD 2MBGA 2L9QA 2YEVC 2Q9QA 3ZJ2A 5H6RB 5ETWA 1T98A 2Y48B 2KWIB 4QHOA 5KX5E 4IDZA 4I55E 3MZKB 4QXHB 3UUNA 5LA6E 4EZHA 4UF0B 5F3JA 5DQWA 2UXNB 5LXTE 2CWOA 2WMOA 5F8PA 3Q5XA 4C91A 2MOZA 3F31A 3R6NA 3GN5B 1WYBA 3JC6C 2XASB 3I9YA 5LBQB 3RKOA 4MHCA 2X68A 3IF8B 5LCYA 3RRCA 5JDQA 1AJ3A 4ZI7E 2VASA 4ERRA 2NP9A 4UVCB 2ZM0A 2VKOA 2LOSA 4ANJA 4L0RA 5H6QB 3RH3A 4YLHA 4PJNA 4EOZB 4EYYR 3H3AA 2Q9QD 3NBXX 4X1KE 2YINA 2Q9QC 3IHRA 5LBMA 3LBXB 5CB4E 5FXVA 4AKIA 4A56A 2LHRA 4NUUA 2JRKA 3CX7B 1D0YA 2ZLYA 2MTQA 2LM9A 2VB6A 4Z8XA 3ONXA 4H63V 1KK7A 2E9XC 2X66A 4MFRA 4HKAA 4H9OC 5EK2A 1MMDA 4PJLA 3LK3B 4UIGA 4IE5A 1FIOA 4ZS2A 2KLQA 4DO0A 4DMVA 5FY0A 4ADZA 1ZV4X 4CI1B 4PNIA 2K48A 3RYCE 3K3QC 4YJ3E 4FI5A 5EZYE 5HXRA 1WR6A 2ZM8A 4DMWA 4PK5A 5DJQC 1D1BA 4GK5E 2CMRA 2YU2A 3UUMA 2KWHA 2LHNA 2XQYA 2PJQA 4IGUA 5LHGB 2BDEA 2PG8A 2Q9QB 3B57A 1MIVA 4ILUA 3KBTA 4O4IE 5FYMA 4KP3C 2L3LA 2PFVA 4PJJA 2N1GA 3KFWX 1NWMX 3MA9A 4CI3B 3MK7C 2C5JA 4ISTA 2CLYC 3KV5A 4ZI2D 4O4HE 4ZHQE 5L3DB 2E9XB 4MLKA 3O9XA 3FXEB 3NRYA 3CQXC 4E7ZA 1WLXA 4DBQA 4KUMB 2HPJA 2Z6EA 2JPFA 3DP7A 1LRZA 2IW5B 1V9DA 4HE8A 3OBVE 5LGTB 3FBZA 1HCIA 4UELA 3DTOA 2W0GA 4HGAA 4UV8B 2WSSV 3Q9DA 4AQFA 2NTXA 3HKBE 4OYJA 4GIWA 2QGSA 3N2KE 1MMAA 3ZMZB 3ZLIA 3ZYLA 5JQGE 2X67A 3J7Yq 1YD8G 1QSDA 3EDUA 4WNKA 2A72A 4O2BE 5LOVE 4QX8B 3RYIE 4BJNA 3I0QA 2XHEB 3ZMVB 2BVLA 4L5GA 4B6XA 1MNEA 3ETUA 2CM0A 1ZKEA 2V7IA 3FBLA 4BAYB 2YK0A 2CLYB 2ZM2A 5EK3A 1IAPA 4EZ4A 3ZMTB 5FMNA 4I50E 4JLEA 3AA0B 1OXZA 2EHOC 4EB6E 2C5IT 3MACA 4GOUA 2A2FX 1HG2A 2XAQB 3W15B 3MKDA 3E0ZA 4O2AE 4OK0A 3ZCIA 4AQFC 2W61A 2M67A 3ZYKA 3ZCJA 5JDHA 2ACXA 2H7VC 2XAJB 2LOPA 1ZHCA 3N2OA 2C0SA 4AKLA 5JDLA 1VOMA 4KBMB 2X0LB 3AVSA 1H7CA 2NW7A 2W62A 1QUUA 4X1YE 2DHRA 4H9SE 4E7SA 4JEHB 4XAXB 1YKHB 5HAXA 1US7B 2LSIA 5FXXA 2VKDA 3V5UA 1S35A 3UFEA 3ZMUB 5L3EB 2ODVA 3SOLA 1VRBA 1IJ5A 3UTKA 3FHNA 2LEHA 2DI4A 5L3GB 4XZCA 2XTLA 3C4XA 2EHOB 1CUNA 2LSGA 3U3IA 5HWXA 3KVBA 2D0UA 3PE0A 2V26A 2XAHB 3KINB 3RYHE 5LHHB 3KBUA 3ZC1A 4CZZB 3QK6A 3AAEB 1Z0PA 3FXDB 5A1LA 3FB2A 4CXXA 2JJ9A 4ASKA 3S4UA 4BA9A 2NTYA 3OKQA 3ZMSB 3PU8A 1BR0A 2KXPB 4HTEA 4CXYA 4ZS3A 2BZBA 4UVAB 2K24A 5M4YA 2CXFA 2UXXB 3AVRA 1YKEB 3Q5WA 3OJAA 1IZNB 2LJLA 4DBRA 2XAGB 4H9QC 4OHFA 5LYJE 3ZN0B 2VKJA 2P9BA 4AQGA 5J2TE 2JQQA 1BR2A 3AAAB 3N9LA 3UUXB 4YJ2E 4IIJE 2SPCA 2ZMAA 4ISSA 4NUVA 3SWHA 1FMWA 3RPUA 1MIYA 2I59A 4UVBB 5LJMA 4IE0A 3ZN1B 3HR0A 4TV8E 4O8SA 3RYFE 4ZI2C 1OWAA 4UF0A 2ES0A 5HXEA 2D5UA 3C4WA 5TAOA 4ZI3D 3RC8A 3HKDE 4ZI3C 2D0TA 4MBQA 5JR9A 5JH7E 3D0TA 1D1AA 3A5XA 3HKEE 3P7IA 3QUJA 4IHJE 5CA1E 1NAFA 2RP4A 3ZPOA 5LHIB 3UULA 1LVKA 4KMCA 4O4JE 3N9QA 4L9IA 4P09A 5LGNB 1LVFA 4CQIA 3KV6A 4H9RC 4IE4A 4TUYE 1ZEEA 3C4ZA 3C64A 3HKCE 5HWYA 3LFMA 3L3PA 3VKGA 4QKNA 3I0OA 1D0XA 2K5BB 3LBXA 4QWNB 4JUYA 1E1HB 3VU7H 3EVYA 3LJCA 3L09A 3K3NA 3PDYA 5AFUL 3C51A 4TN7B 1BR4A 2C5KT 3VHLA 3CX6B 1U5PA 4UEMA 2G0UA 2X9XA 3CWZB 3F2EA 4U74A 2KZ7B 5JR9C 3AA7B 3GMIA 5LG4A 4PFOA 1S94A 5LGUB 2VWAA 2NOXA 2JMHA 1Y64B 2LE8A 1FEWA 4M1PA 2H3RA 3O1HA 5FY1A 3N5LA 5JDNA 2V7MA 5FXZA 1UX4A 3H37A 4UV9B 2LSJA 5DABA 3BQLA 5BMVE 4TX5A 2CWYA 1WRDA 3CPZA 2PBIA 2IC6A 3UT5E 2CXDA 1SHZC 4O4LE 5FP3A 1YW0A 4HN9A 2X9YA 3ETVA 4I43B 3R84B 5CA0E 5JRCA 5L3CB 1SA0E 2CA5A 3NZPA 1MMNA 4QXBB 4PFPA 4X1IE 4WBNE 3LG7A 4BJMA 1U4QA 2XAFB 3ZYMA 1D1CA 2CXLA 4UXNB 3N9OA 3QC9A 3PTRB 4F6RC 4I4TE 3I1AA 5GONE 3PURA 2LSKA 2N2NA 3PUGA 3ANWA 2E9XA 3O4XE 3KVAA 3WAKA 4DVDA 3RRWA 5FXWA 4PK6A 5EK4A 4GYRA 5JR9B 2HH7A 3JC6D 2E8IA 2V1DB 5JDFA 2H7OA 5HYAA 4AKGA 1HG5A 5IYZE 3HL6A 5ADXL 4JEUB 4YHJA 5LNKA 2A3DA 2DLRA 1MMGA 3I9WA 4OFZA 4K0UA 5L3FB 1O3XA 5L2LA 4IE6A 1BR1A 2K9AA 2WBLA 5LJNA 4J2CA 3CVRA 2NWBA 2LSYA 2V7LA 3BQIA 3N9MA 1WYCA 3ESLA 2VK9A 4AI6A 4TV9E 3BQKA 3BK9A 3RX6A 4EIWA 3ZJ1A 2E9XD 2YU1A 4HEAA 2NW9A 4GYSA 4C90A 5DQVA 2IAKA 1HTJF 3KDSE 3ZEFB 4MALA 3E22E 4V1Av 4AKRB 2CE7A 1HF8A 3OYXA 3P8CD 5KMGP 4ZOLE 3CMLA 3MJXA 1LKXA 5HXSA 3SS1A 1D0ZA 3J9X1 1KNZA 2KNDA 3MXZA 2DCFA 5L3BB 3OYZA 2ODUA 5HXHA 3CQGB 2DNXA 3NRXA 1HFAA 4TZ4C 1G8XA 4H9NC 2X9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0G A;  2K5B B;  1US7 B; 
#chains in the Genus database with same CATH topology
 4EV6 A;  5JRC B;  3A7M A;  4DV4 T;  4G63 A;  4N78 D;  2LT3 A;  4LF7 T;  4HFV A;  2L8K A;  5HXC A;  2B1E A;  2V6Y A;  2X51 A;  5JDG A;  4LMJ A;  3EDV A;  3QNU A;  5ABF B;  1HS7 A;  3E08 A;  1W09 A;  2I0M A;  4EAH A;  1XNR T;  3AE3 A;  4U3C A;  5FNV E;  4KHP T;  4DUZ T;  2UU9 T;  2V7J A;  3K3O A;  4PW8 A;  4ILC A;  5AQU B;  3O1J A;  3CKD A;  3LK2 B;  1XDP A;  3GWH A;  1EZ3 A;  3N2G E;  4ILB A;  4JI4 T;  4LF5 T;  2XUE A;  2VL8 A;  5C8Y E;  2X0Y A;  2CHN A;  2HPL A;  3HI2 A;  4XBF B;  2MBG A;  2Q9Q A;  2WU2 A;  3ZJ2 A;  4Z91 A;  4I55 E;  4TWD A;  5LA6 E;  4EZH A;  5LXT E;  3SFD A;  3R6N A;  3JC6 C;  3RKO A;  4MHC A;  2VAS A;  2V6Y B;  4ERR A;  2ZM0 A;  5KXJ A;  3H3A A;  2Q9Q D;  4X1K E;  2YIN A;  2Q9Q C;  3LBX B;  5CB4 E;  5FXV A;  4NUU A;  2JRK A;  1D0Y A;  2MTQ A;  2VB6 A;  2M6I A;  4U7I A;  4IDO A;  4MFR A;  5AQF B;  5EK2 A;  3QB5 K;  2KLQ A;  4CI1 B;  4PNI A;  4YTP A;  4YJ3 E;  2QYW A;  1WR6 A;  4DMW A;  4PK5 A;  5DJQ C;  2XQ3 A;  2WZI A;  4GK5 E;  1X9B A;  2YU2 A;  3UUM A;  2KWH A;  2LHN A;  4IGU A;  2Q9Q B;  3B57 A;  4X64 T;  3KBT A;  1NWM X;  2XQ7 A;  2J47 A;  2CLY C;  2W66 A;  4ZI2 D;  4ZHQ E;  3FXE B;  4DV6 T;  4E7Z A;  4KUM B;  2Z6E A;  4B3R T;  2IW5 B;  2LKG A;  3JAD A;  3AEC A;  2BBH A;  4YHH T;  1HCI A;  4YSY A;  1I94 T;  2W0G A;  1Z8U A;  2UUC T;  2WSS V;  4AQF A;  4GIW A;  3AE5 A;  3ZLI A;  2FBW A;  5JQG E;  4WNK A;  4LFA T;  2XHE B;  2BVL A;  3ABV A;  4B6X A;  2YK0 A;  2CLY B;  5EK3 A;  3ZMT B;  2IHR 1;  4DR6 T;  3AE9 A;  3AEA A;  4WZX A;  4AQF C;  2W61 A;  2XAJ B;  3PJA J;  4TWF A;  3N2O A;  4AKL A;  1VOM A;  4KHZ F;  3P50 A;  4U33 A;  1US7 B;  2LSI A;  2VKD A;  1J5W A;  3SOL A;  2H88 A;  2UXB T;  3FHN A;  2LEH A;  2V6X A;  1N32 T;  2BKP A;  4HFC A;  3KVB A;  3B5M A;  4IL4 A;  2D0U A;  4U2Y A;  3RYH E;  1UK5 A;  2WP9 A;  3P4Q A;  1VCT A;  1Z0P A;  4CXX A;  2JQK A;  4ASK A;  4BA9 A;  2JQH A;  3ZMS B;  4ZZB A;  2BKN A;  2BZB A;  4DV7 T;  3PV0 F;  4JI0 T;  2CXF A;  3Q5W A;  1KEY A;  4OHF A;  4DBR A;  5LYJ E;  4AIS A;  3UUX B;  5LJM A;  4YTN A;  3HR0 A;  1L0V A;  2BG9 E;  5IUX A;  4JBW F;  3HKD E;  4NXM T;  1YQ3 A;  4HFD A;  3A5X A;  3HKE E;  3QUJ A;  4IHJ E;  5CA1 E;  3H3M A;  3KV6 A;  4IE4 A;  3HKC E;  5HWY A;  4QKN A;  2K5B B;  3VRB A;  3VU7 H;  3LJC A;  2YN6 A;  2XY8 B;  4A5X A;  4DR3 T;  1ZOY A;  3F2E A;  5FVK A;  1FEW A;  5FY1 A;  5FXZ A;  4ILA A;  4JV5 T;  4UV9 B;  5BMV E;  4TX5 A;  3CPZ A;  2CXD A;  2PTF A;  4ZEY A;  4I43 B;  5L3C B;  3NZP A;  4LML A;  4PFP A;  4WBN E;  4BJM A;  4UXN B;  3N9O A;  4F6R C;  4I4T E;  3AEF A;  5GON E;  5AQK B;  1WFD A;  5AQJ B;  3PUG A;  3ANW A;  2E9X A;  3O4X E;  3KVA A;  4PK6 A;  3EI0 A;  2H7O A;  5HYA A;  1HG5 A;  5AQT B;  5ADX L;  2WDR A;  5LNK A;  2DLR A;  3I9W A;  4OFZ A;  5L2L A;  4IE6 A;  1BR1 A;  2DL1 A;  2K9A A;  4J2C A;  5AQS B;  2LSY A;  2V7L A;  1WYC A;  1OED A;  4HWF A;  4IDQ A;  2XSA A;  3ZJ1 A;  2E9X D;  4GYS A;  5DQV A;  3ZEF B;  4V1A v;  5AQO B;  1HF8 A;  3OYX A;  3ZT5 A;  1T7S A;  5HXS A;  3AE2 A;  5FVL A;  1D0Z A;  3MXZ A;  5L3B B;  2ODU A;  3NRX A;  1HFA A;  3N9P A;  5J2U E;  1MND A;  5LB7 B;  4GKJ T;  2E5V A;  2WDV A;  2GK9 A;  2VVN A;  3WAJ A;  3M65 A;  1OED C;  3ZC0 A;  3F57 A;  4DV3 T;  3AE8 A;  2RPA A;  3K8P C;  4U31 A;  4EEB A;  3C50 A;  3ANW B;  3IEE A;  2V7K A;  4EYU A;  3KV9 A;  4U72 A;  3PJA A;  4DID B;  4TNW A;  4CXW A;  2WMN A;  3TKL B;  5LP6 E;  1IJ6 A;  5JDM A;  3PUQ A;  2KMF A;  3AEB A;  2V8S V;  2A9U A;  4PJM A;  2WM9 A;  5J1G A;  1OED B;  4IE7 A;  3PUS A;  2Y6X A;  2X9W A;  1DU2 A;  3O1I A;  5JVD E;  4P1N A;  3IBP A;  3FZH B;  1Y01 A;  2WWU A;  2KT9 A;  2RA1 A;  3SRZ A;  2QVA A;  1T98 A;  2FJE A;  3UUB A;  3MZK B;  5AQH B;  1UGO A;  5F3J A;  2CRB A;  2WMO A;  3Q5X A;  3F31 A;  5LBQ B;  3ONJ A;  3ONL C;  3CIR A;  1AJ3 A;  4NIQ A;  1QLB A;  3TLS A;  1M62 A;  2NP9 A;  4UVC B;  3VRA A;  4PJN A;  2LRL A;  3NBX X;  5L47 A;  4B3T T;  4TWH A;  5LBM A;  2OV9 A;  4A56 A;  2LHR A;  2M6B A;  2LM9 A;  3RIF A;  4H63 V;  2X66 A;  5BR8 T;  4HKA A;  4U2Z A;  4UR9 A;  3LK3 B;  4DV5 T;  4UIG A;  1HNZ T;  1ZV4 X;  4IDP A;  2K48 A;  4YT0 A;  4U7Y A;  3AE4 A;  1D1B A;  1J1J A;  3PUX F;  2PJQ A;  4O4I E;  3TLU A;  3TLW A;  5FYM A;  3X1D A;  3Q5D A;  2BS4 A;  2BS2 A;  5L3D B;  4MLK A;  3CQX C;  2IUB A;  1WLX A;  4KI0 F;  2JPF A;  3DP7 A;  1JNR A;  3FBZ A;  2IIU A;  1J5E T;  4DV2 T;  2QGS A;  4EGW A;  1UUR A;  3EDU A;  3SFE A;  5LOV E;  3RYI E;  4BJN A;  3ZMV B;  4JYA T;  4AQY T;  2V7I A;  3FBL A;  2IML A;  5HCM A;  4Q25 A;  1IAP A;  1OXZ A;  4EB6 E;  2XAQ B;  3MKD A;  2CPT A;  3E0Z A;  4O2A E;  4OK0 A;  3ZCJ A;  2BBJ A;  2ACX A;  3LDQ B;  4YSX A;  3AVS A;  1H7C A;  1QUU A;  3AEE A;  2DHR A;  1HX1 B;  4E7S A;  4JEH B;  4XAX B;  5HAX A;  3UFE A;  2ODV A;  5ABG A;  4NPP A;  4YY3 T;  1SE7 A;  4XZC A;  3C4X A;  5AQG B;  5LMU T;  3PE0 A;  5LHH B;  3KIN B;  3KBU A;  4CZZ B;  3AAE B;  3JCF A;  3RF1 A;  2HN2 A;  1BR0 A;  4HTE A;  4UVA B;  5AQL B;  5CFB A;  5M4Y A;  1KF6 A;  2ZM6 T;  5LMN T;  2UUB T;  2XAG B;  2VKJ A;  2JQQ A;  3AAA B;  3N9L A;  2ZMA A;  4ISS A;  4NUV A;  3SWH A;  2XQ5 A;  3K1S A;  2I59 A;  4UVB B;  4ZI2 C;  1OWA A;  5JTG A;  4UF0 A;  1NEK A;  2D5U A;  3C4W A;  2VQF T;  3EAB A;  4MBQ A;  3D0T A;  1D1A A;  3P7I A;  2RP4 A;  3ZPO A;  3UUL A;  1LVK A;  4KMC A;  2LKH A;  4L9I A;  5LGN B;  1LVF A;  3RQW A;  3C4Z A;  5AQN B;  2W4X A;  1JNZ A;  3K3N A;  3T1H T;  5AFU L;  4UEM A;  1U5P A;  2V5C A;  3CWZ B;  3M3Z B;  4U74 A;  3AA7 B;  2VL0 A;  4X65 T;  1S94 A;  2NOX A;  5AQR B;  3N5L A;  5JDN A;  2V7M A;  4NXN T;  5DAB A;  3BQL A;  4DUY T;  2PBI A;  2IC6 A;  3UT5 E;  5FP3 A;  1YW0 A;  2X9Y A;  1MMN A;  4X1I E;  1UUS A;  3LG7 A;  1U4Q A;  2CXL A;  4LMK A;  3PTR B;  3PUR A;  2LSK A;  2N2N A;  3UU4 A;  3WAK A;  5HEO A;  3RRW A;  4GYR A;  4JI5 T;  2HH7 A;  5CJ5 A;  4YHJ A;  4HWC A;  4IRE A;  2A3D A;  3A8Y C;  4K0U A;  5LJN A;  2LM2 A;  3AE7 A;  3BK9 A;  3FZK B;  5FL0 A;  4HEA A;  3PUW F;  1NEN A;  1HTJ F;  4YTM A;  3E22 E;  4AKR B;  4DR2 T;  3P8C D;  4ZOL E;  3SS1 A;  1KNZ A;  2KND A;  4WYV A;  2DNX A;  5KX5 E;  4QXH B;  3AA6 B;  3NZQ A;  4JI2 T;  4PK4 A;  4HWH A;  2MYS A;  1HX8 A;  4WW0 A;  3ZT6 A;  2WAU A;  2Y8D A;  3KV4 A;  4QXC B;  4FJO A;  3P4S A;  5CGM A;  5AQI B;  3EUH A;  3PUA A;  3Q2M A;  5E0O A;  1UCU A;  4P0B A;  2CEA A;  3N9N A;  2XPK A;  2YDR A;  4YFS A;  3AAI A;  2X0H A;  4QX7 B;  4P0A A;  4LFC T;  2VKH A;  5JRE A;  2EHO A;  2QA7 A;  2MAW A;  5FKY A;  3CX8 B;  2W63 A;  5ABH A;  4X20 E;  2V5D A;  3CQC B;  1UX5 A;  2JMK A;  2HHH T;  1OED E;  4WBO A;  2KIN B;  3FZF B;  3RHW A;  1X79 A;  3DJB A;  2DWK A;  3VKH A;  4AXP A;  2VQE T;  2CCQ A;  3GA8 A;  2J62 A;  3WI3 A;  3C98 B;  1W0B A;  3LK4 2;  4GK0 E;  2JQ9 A;  3RGL A;  4OYK A;  4PAG A;  1FMV A;  2EHO D;  2LLY A;  4QH1 A;  5H6R B;  2Y48 B;  3T1Y T;  4X62 T;  1HNW T;  3CK6 A;  3UUN A;  5F8P A;  4QH5 A;  2MOZ A;  1WYB A;  2XAS B;  2X68 A;  2BG9 A;  3UU5 A;  5LCY A;  4ZI7 E;  3IA3 A;  3QB5 A;  2LOS A;  1KNP A;  4L0R A;  4YLH A;  4EOZ B;  3OVU A;  5FL1 A;  4AKI A;  4A97 A;  3CX7 B;  3ONX A;  1KK7 A;  2E9X C;  2UXD T;  1N33 T;  4X5T A;  2XM1 A;  4PJL A;  5HEH A;  4IE5 A;  1FIO A;  5FY0 A;  4ADZ A;  3RYC E;  4HFH A;  5EZY E;  5HXR A;  2ZM8 A;  3UU3 A;  4F8H A;  1CHU A;  1HR0 T;  5LHG B;  1FJG T;  2PG8 A;  1MIV A;  4KP3 C;  2L3L A;  4PJJ A;  4EED A;  3MA9 A;  4CI3 B;  2C5J A;  4LFB T;  4O4H E;  2E9X B;  3ZSS A;  4K0K T;  3NRY A;  2FUP A;  4DBQ A;  2HPJ A;  1LRZ A;  2BG9 B;  2FJB A;  5ABE A;  5LGT B;  3UQ4 A;  1IBM T;  3DTO A;  4I0U A;  3Q9D A;  1MMA A;  3ZYL A;  1I6Z A;  3J7Y q;  1YD8 G;  1QSD A;  4O2B E;  2WS3 A;  1XDO A;  2FJD A;  4COF A;  1ZKE A;  5J0Z A;  4EZ4 A;  4LF9 T;  4JLE A;  3RQU A;  3AA0 B;  2C5I T;  3MAC A;  2A2F X;  1HG2 A;  3W15 B;  4CN1 A;  1M7K A;  5L4E A;  2XQ6 A;  2VUR A;  2R6G F;  2C0S A;  5JDL A;  3EHZ A;  2X0L B;  2NW7 A;  4H9S E;  3VR8 A;  4HWI B;  5ABF A;  1S35 A;  1IJ5 A;  3UTK A;  2DI4 A;  1E7P A;  4KX6 A;  2XTL A;  4AIU A;  1CUN A;  2WU5 A;  3L8R A;  2XAH B;  3ZC1 A;  3QK6 A;  3FXD B;  2JJ9 A;  3S4U A;  2NTY A;  4DR4 T;  1XMO T;  1N36 T;  4ZS3 A;  2B76 A;  2F4V T;  1W9R A;  5AQQ B;  2LJL A;  1IBK T;  4H9Q C;  3ZN0 B;  5J2T E;  4YXD A;  1BR2 A;  1GQE A;  2ACZ A;  2XZE A;  4IIJ E;  3UU6 A;  1FMW A;  3RPU A;  3ZN1 B;  4O8S A;  3RYF E;  2ES0 A;  2NR4 A;  3ZT7 A;  4ZI3 D;  3RC8 A;  4ZI3 C;  2D0T A;  2WZH A;  5HEJ A;  5JH7 E;  1NAF A;  5LHI B;  4O4J E;  3EAM A;  3N9Q A;  4P09 A;  2HN1 A;  1ZEE A;  4IT4 A;  3VKG A;  3VR9 A;  3I0O A;  1D0X A;  3LBX A;  4QWN B;  1E1H B;  3EVY A;  4JI8 T;  3TLT A;  3RLF F;  1BR4 A;  2C5K T;  3CX6 B;  3AE6 A;  5LG4 A;  5LGU B;  2W2U A;  3O1H A;  1UX4 A;  3H37 A;  2LSJ A;  1XMQ T;  1WRD A;  1SHZ C;  4HN9 A;  1W0A A;  3ETV A;  3R84 B;  1SA0 E;  4QXB B;  1T8B A;  4DV1 T;  3P4W A;  3AXJ A;  2CBI A;  3OPC A;  3QC9 A;  2FJA A;  4IDN A;  2E5L T;  5EK4 A;  3JC6 D;  2E8I A;  2V1D B;  4AKG A;  5IYZ E;  3QOF A;  2XJ7 A;  3ZKR A;  1O3X A;  3AE1 A;  1ZP0 A;  3N9M A;  4JI3 T;  4LF6 T;  2VK9 A;  4AI6 A;  2D9D A;  2NW9 A;  1YQ4 A;  4C90 A;  4MAL A;  2CE7 A;  3CML A;  1E2A A;  3J9X 1;  2J4G A;  4TZ4 C;  1G8X A;  4H9N C;  5HEG A;  4AKH A;  2J1D G;  2DWG A;  1B7T A;  5F5W A;  2MPK A;  3PU3 A;  4EXT A;  2IC9 A;  3V5S A;  3GN5 A;  4CN6 A;  2OA5 A;  1VCS A;  2W00 A;  3B13 A;  2YDQ A;  3AXJ B;  4X66 T;  1WR0 A;  5L4H A;  4H9P C;  2BVM A;  3AA1 B;  4H63 H;  1MIW A;  3U78 A;  3T8O A;  1R8I A;  2D2S A;  3RI5 A;  5C2T A;  3AB3 B;  2NW8 A;  5IHY A;  2UXC T;  3RC3 A;  4DND A;  2N9D A;  2XQ4 A;  5FY7 A;  5AQP B;  3LSV A;  2QRX A;  4CI2 B;  5KDM C;  4G2A A;  4B3S T;  1G73 A;  3HA4 A;  3NKZ A;  2L9Q A;  2WY2 A;  2YEV C;  5ETW A;  3NWI A;  3Q5E A;  2KWI B;  4QHO A;  4IDZ A;  4B3M T;  4UF0 B;  5DQW A;  2UXN B;  5AQV B;  2CWO A;  5LG3 A;  4C91 A;  2XSB A;  2YKS A;  2XQ9 A;  3GN5 B;  3I9Y A;  3IF8 B;  3RRC A;  4A98 A;  5JDQ A;  1SUM B;  2CBJ A;  2VKO A;  4ANJ A;  5H6Q B;  3RH3 A;  4EYY R;  1N34 T;  2CHO A;  3IHR A;  2ZLY A;  1XNQ T;  4GKK T;  4Z8X A;  4TNV A;  3NVO A;  4H9O C;  1MMD A;  3JAF A;  4ZS2 A;  4HFE A;  4DO0 A;  4DMV A;  4JI1 T;  4IL9 A;  3K3Q C;  4FI5 A;  4HFI A;  4LF8 T;  5HCJ A;  2CMR A;  3AEG A;  2XQY A;  2BDE A;  2YOE A;  4ILU A;  5IWA T;  2PFV A;  2N1G A;  2BS3 A;  3KFW X;  3MK7 C;  4IST A;  3KV5 A;  3O9X A;  2YDS A;  4JI7 T;  1V9D A;  1XZY A;  4HE8 A;  2XM2 A;  1KNR A;  3OBV E;  4UEL A;  3PUZ F;  4HGA A;  2LRK A;  4UV8 B;  2NTX A;  3HKB E;  4OYJ A;  3ZMZ B;  3N2K E;  2X67 A;  2A72 A;  5C3J A;  2AXD S;  4QX8 B;  3I0Q A;  4L5G A;  1MNE A;  3ETU A;  2CM0 A;  4BAY B;  2ZM2 A;  5FMN A;  4I50 E;  2H89 A;  2EHO C;  4GOU A;  2OLT A;  3ZCI A;  4HFB A;  1KFY A;  2M67 A;  2E2A A;  3ZYK A;  2WDQ A;  3P4R A;  5JDH A;  2H7V C;  2LOP A;  3RIA A;  1ZHC A;  4DR7 T;  4KBM B;  2W62 A;  2KSR A;  4X1Y E;  3TLV A;  2WQY A;  5HEU A;  1YKH B;  5FXX A;  4CN4 A;  2AE9 A;  3V5U A;  3ZMU B;  5L3E B;  1VRB A;  2WB5 A;  5L3G B;  2EHO B;  2K3W A;  2LSG A;  3U3I A;  5HWX A;  2V26 A;  2BG9 C;  4HWD A;  5A1L A;  3FB2 A;  4JI6 T;  2WWV A;  3OKQ A;  3PU8 A;  2KXP B;  4CXY A;  2K24 A;  2UXX B;  3AVR A;  1YKE B;  3OJA A;  1IZN B;  5AQM B;  2I6H A;  2P9B A;  4AQG A;  3RIU A;  4LF4 T;  4YJ2 E;  2SPC A;  3UU8 A;  1MIY A;  4IE0 A;  4TV8 E;  1T72 A;  3UQ7 A;  5HXE A;  5TAO A;  5JR9 A;  2XQ8 A;  3PUV F;  4CQI A;  3RIU C;  4H9R C;  4TUY E;  4QH4 A;  3P4P A;  3C64 A;  3LFM A;  3L3P A;  4OX9 T;  4JUY A;  2W67 A;  2WCA A;  3L09 A;  1YXR A;  3PDY A;  3C51 A;  4TN7 B;  3VHL A;  3JAE A;  2G0U A;  2X9X A;  2KZ7 B;  1HNX T;  5JR9 C;  1XWM A;  3GMI A;  4PFO A;  2VWA A;  3OTO T;  2JMH A;  3L39 A;  1Y64 B;  2LE8 A;  4M1P A;  2H3R A;  3FZL B;  2CWY A;  4O4L E;  5JRC A;  5CA0 E;  2CA5 A;  2XAF B;  3UFG A;  3ZYM A;  3PUY F;  1D1C A;  2IDO B;  2JIW A;  3RKG A;  3I1A A;  4ZZC A;  4DVD A;  3G06 A;  5FXW A;  2XQA A;  3ZST A;  5JR9 B;  4DV0 T;  5JDF A;  3HL6 A;  4JEU B;  1IBL T;  1MMG A;  3FZM B;  5L3F B;  2VVS A;  2WBL A;  4Z90 A;  3CVR A;  2NWB A;  3BQI A;  4DR1 T;  1WCR A;  3ESL A;  4DR5 T;  4TV9 E;  4ZXL A;  3BQK A;  4EIW A;  3RX6 A;  2YU1 A;  2IAK A;  3KDS E;  5KMG P;  3MJX A;  1LKX A;  3AED A;  2BKO A;  2DCF A;  3OYZ A;  5HXH A;  3CQG B;  2UUA T;  4YSZ A;  2X9H A; 
#chains in the Genus database with same CATH homology
 3AA6 B;  4AKH A;  3N9P A;  3NZQ A;  2J1D G;  5J2U E;  4PK4 A;  1MND A;  2MYS A;  1HX8 A;  4WW0 A;  2DWG A;  1B7T A;  2WAU A;  5JRC B;  2Y8D A;  2GK9 A;  3KV4 A;  4QXC B;  3WAJ A;  4FJO A;  3M65 A;  3PU3 A;  4G63 A;  2IC9 A;  2LT3 A;  4N78 D;  4EXT A;  3ZC0 A;  3V5S A;  3GN5 A;  2OA5 A;  2W00 A;  3B13 A;  4HFV A;  3F57 A;  2L8K A;  5HXC A;  2B1E A;  2X51 A;  3EUH A;  3PUA A;  5JDG A;  3Q2M A;  5E0O A;  1UCU A;  4P0B A;  3EDV A;  3K8P C;  2CEA A;  3C50 A;  3N9N A;  1HS7 A;  3ANW B;  3E08 A;  3IEE A;  2V7K A;  4YFS A;  4EYU A;  4H9P C;  3KV9 A;  2BVM A;  4EAH A;  3AA1 B;  4U72 A;  5FNV E;  4H63 H;  4CXW A;  1MIW A;  3U78 A;  2WMN A;  3TKL B;  3AAI A;  5LP6 E;  2V7J A;  4QX7 B;  3K3O A;  4PW8 A;  4P0A A;  2VKH A;  3T8O A;  1IJ6 A;  5JDM A;  5JRE A;  2EHO A;  2D2S A;  3PUQ A;  2QA7 A;  2KMF A;  3CX8 B;  2W63 A;  3AB3 B;  2NW8 A;  3O1J A;  4X20 E;  3CQC B;  1UX5 A;  5IHY A;  3RC3 A;  4DND A;  3CKD A;  3LK2 B;  2JMK A;  2N9D A;  3GWH A;  4WBO A;  2KIN B;  1EZ3 A;  3N2G E;  4PJM A;  5FY7 A;  2WM9 A;  1X79 A;  3DJB A;  5J1G A;  4IE7 A;  2XUE A;  3PUS A;  2DWK A;  2VL8 A;  3VKH A;  4AXP A;  2CCQ A;  2X9W A;  2Y6X A;  3GA8 A;  3O1I A;  5JVD E;  4CI2 B;  5C8Y E;  5KDM C;  4G2A A;  3IBP A;  3WI3 A;  1G73 A;  2HPL A;  3HI2 A;  3C98 B;  3LK4 2;  4GK0 E;  4XBF B;  2WWU A;  2KT9 A;  2RA1 A;  3HA4 A;  4OYK A;  4PAG A;  3SRZ A;  1FMV A;  2EHO D;  2MBG A;  2L9Q A;  2YEV C;  2Q9Q A;  3ZJ2 A;  5H6R B;  5ETW A;  1T98 A;  2Y48 B;  2KWI B;  4QHO A;  5KX5 E;  4IDZ A;  4I55 E;  3MZK B;  4QXH B;  3UUN A;  5LA6 E;  4EZH A;  4UF0 B;  5F3J A;  5DQW A;  2UXN B;  5LXT E;  2CWO A;  2WMO A;  5F8P A;  3Q5X A;  4C91 A;  2MOZ A;  3F31 A;  3R6N A;  3GN5 B;  1WYB A;  3JC6 C;  2XAS B;  3I9Y A;  5LBQ B;  3RKO A;  4MHC A;  2X68 A;  3IF8 B;  5LCY A;  3RRC A;  5JDQ A;  1AJ3 A;  4ZI7 E;  2VAS A;  4ERR A;  2NP9 A;  4UVC B;  2ZM0 A;  2VKO A;  2LOS A;  4ANJ A;  4L0R A;  5H6Q B;  3RH3 A;  4YLH A;  4PJN A;  4EOZ B;  4EYY R;  3H3A A;  2Q9Q D;  3NBX X;  4X1K E;  2YIN A;  2Q9Q C;  3IHR A;  5LBM A;  3LBX B;  5CB4 E;  5FXV A;  4AKI A;  4A56 A;  2LHR A;  4NUU A;  2JRK A;  3CX7 B;  1D0Y A;  2ZLY A;  2MTQ A;  2LM9 A;  2VB6 A;  4Z8X A;  3ONX A;  4H63 V;  1KK7 A;  2E9X C;  2X66 A;  4MFR A;  4HKA A;  4H9O C;  5EK2 A;  1MMD A;  4PJL A;  3LK3 B;  4UIG A;  4IE5 A;  1FIO A;  4ZS2 A;  2KLQ A;  4DO0 A;  4DMV A;  5FY0 A;  4ADZ A;  1ZV4 X;  4CI1 B;  4PNI A;  2K48 A;  3RYC E;  3K3Q C;  4YJ3 E;  4FI5 A;  5EZY E;  5HXR A;  1WR6 A;  2ZM8 A;  4DMW A;  4PK5 A;  5DJQ C;  1D1B A;  4GK5 E;  2CMR A;  2YU2 A;  3UUM A;  2KWH A;  2LHN A;  2XQY A;  2PJQ A;  4IGU A;  5LHG B;  2BDE A;  2PG8 A;  2Q9Q B;  3B57 A;  1MIV A;  4ILU A;  3KBT A;  4O4I E;  5FYM A;  4KP3 C;  2L3L A;  2PFV A;  4PJJ A;  2N1G A;  3KFW X;  1NWM X;  3MA9 A;  4CI3 B;  3MK7 C;  2C5J A;  4IST A;  2CLY C;  3KV5 A;  4ZI2 D;  4O4H E;  4ZHQ E;  5L3D B;  2E9X B;  4MLK A;  3O9X A;  3FXE B;  3NRY A;  3CQX C;  4E7Z A;  1WLX A;  4DBQ A;  4KUM B;  2HPJ A;  2Z6E A;  2JPF A;  3DP7 A;  1LRZ A;  2IW5 B;  1V9D A;  4HE8 A;  3OBV E;  5LGT B;  3FBZ A;  1HCI A;  4UEL A;  3DTO A;  2W0G A;  4HGA A;  4UV8 B;  2WSS V;  3Q9D A;  4AQF A;  2NTX A;  3HKB E;  4OYJ A;  4GIW A;  2QGS A;  3N2K E;  1MMA A;  3ZMZ B;  3ZLI A;  3ZYL A;  5JQG E;  2X67 A;  3J7Y q;  1YD8 G;  1QSD A;  3EDU A;  4WNK A;  2A72 A;  4O2B E;  5LOV E;  4QX8 B;  3RYI E;  4BJN A;  3I0Q A;  2XHE B;  3ZMV B;  2BVL A;  4L5G A;  4B6X A;  1MNE A;  3ETU A;  2CM0 A;  1ZKE A;  2V7I A;  3FBL A;  4BAY B;  2YK0 A;  2CLY B;  2ZM2 A;  5EK3 A;  1IAP A;  4EZ4 A;  3ZMT B;  5FMN A;  4I50 E;  4JLE A;  3AA0 B;  1OXZ A;  2EHO C;  4EB6 E;  2C5I T;  3MAC A;  4GOU A;  2A2F X;  1HG2 A;  2XAQ B;  3W15 B;  3MKD A;  3E0Z A;  4O2A E;  4OK0 A;  3ZCI A;  4AQF C;  2W61 A;  2M67 A;  3ZYK A;  3ZCJ A;  5JDH A;  2ACX A;  2H7V C;  2XAJ B;  2LOP A;  1ZHC A;  3N2O A;  2C0S A;  4AKL A;  5JDL A;  1VOM A;  4KBM B;  2X0L B;  3AVS A;  1H7C A;  2NW7 A;  2W62 A;  1QUU A;  4X1Y E;  2DHR A;  4H9S E;  4E7S A;  4JEH B;  4XAX B;  1YKH B;  5HAX A;  1US7 B;  2LSI A;  5FXX A;  2VKD A;  3V5U A;  1S35 A;  3UFE A;  3ZMU B;  5L3E B;  2ODV A;  3SOL A;  1VRB A;  1IJ5 A;  3UTK A;  3FHN A;  2LEH A;  2DI4 A;  5L3G B;  4XZC A;  2XTL A;  3C4X A;  2EHO B;  1CUN A;  2LSG A;  3U3I A;  5HWX A;  3KVB A;  2D0U A;  3PE0 A;  2V26 A;  2XAH B;  3KIN B;  3RYH E;  5LHH B;  3KBU A;  3ZC1 A;  4CZZ B;  3QK6 A;  3AAE B;  1Z0P A;  3FXD B;  5A1L A;  3FB2 A;  4CXX A;  2JJ9 A;  4ASK A;  3S4U A;  4BA9 A;  2NTY A;  3OKQ A;  3ZMS B;  3PU8 A;  1BR0 A;  2KXP B;  4HTE A;  4CXY A;  4ZS3 A;  2BZB A;  4UVA B;  2K24 A;  5M4Y A;  2CXF A;  2UXX B;  3AVR A;  1YKE B;  3Q5W A;  3OJA A;  1IZN B;  2LJL A;  4DBR A;  2XAG B;  4H9Q C;  4OHF A;  5LYJ E;  3ZN0 B;  2VKJ A;  2P9B A;  4AQG A;  5J2T E;  2JQQ A;  1BR2 A;  3AAA B;  3N9L A;  3UUX B;  4YJ2 E;  4IIJ E;  2SPC A;  2ZMA A;  4ISS A;  4NUV A;  3SWH A;  1FMW A;  3RPU A;  1MIY A;  2I59 A;  4UVB B;  5LJM A;  4IE0 A;  3ZN1 B;  3HR0 A;  4TV8 E;  4O8S A;  3RYF E;  4ZI2 C;  1OWA A;  4UF0 A;  2ES0 A;  5HXE A;  2D5U A;  3C4W A;  5TAO A;  4ZI3 D;  3RC8 A;  3HKD E;  4ZI3 C;  2D0T A;  4MBQ A;  5JR9 A;  5JH7 E;  3D0T A;  1D1A A;  3A5X A;  3HKE E;  3P7I A;  3QUJ A;  4IHJ E;  5CA1 E;  1NAF A;  2RP4 A;  3ZPO A;  5LHI B;  3UUL A;  1LVK A;  4KMC A;  4O4J E;  3N9Q A;  4L9I A;  4P09 A;  5LGN B;  1LVF A;  4CQI A;  3KV6 A;  4H9R C;  4IE4 A;  4TUY E;  1ZEE A;  3C4Z A;  3C64 A;  3HKC E;  5HWY A;  3LFM A;  3L3P A;  3VKG A;  4QKN A;  3I0O A;  1D0X A;  2K5B B;  3LBX A;  4QWN B;  4JUY A;  1E1H B;  3VU7 H;  3EVY A;  3LJC A;  3L09 A;  3K3N A;  3PDY A;  5AFU L;  3C51 A;  4TN7 B;  1BR4 A;  2C5K T;  3VHL A;  3CX6 B;  1U5P A;  4UEM A;  2G0U A;  2X9X A;  3CWZ B;  3F2E A;  4U74 A;  2KZ7 B;  5JR9 C;  3AA7 B;  3GMI A;  5LG4 A;  4PFO A;  1S94 A;  5LGU B;  2VWA A;  2NOX A;  2JMH A;  1Y64 B;  2LE8 A;  1FEW A;  4M1P A;  2H3R A;  3O1H A;  5FY1 A;  3N5L A;  5JDN A;  2V7M A;  5FXZ A;  1UX4 A;  3H37 A;  4UV9 B;  2LSJ A;  5DAB A;  3BQL A;  5BMV E;  4TX5 A;  2CWY A;  1WRD A;  3CPZ A;  2PBI A;  2IC6 A;  3UT5 E;  2CXD A;  1SHZ C;  4O4L E;  5FP3 A;  1YW0 A;  4HN9 A;  2X9Y A;  3ETV A;  4I43 B;  3R84 B;  5CA0 E;  5JRC A;  5L3C B;  1SA0 E;  2CA5 A;  3NZP A;  1MMN A;  4QXB B;  4PFP A;  4X1I E;  4WBN E;  3LG7 A;  4BJM A;  1U4Q A;  2XAF B;  3ZYM A;  1D1C A;  2CXL A;  4UXN B;  3N9O A;  3QC9 A;  3PTR B;  4F6R C;  4I4T E;  3I1A A;  5GON E;  3PUR A;  2LSK A;  2N2N A;  3PUG A;  3ANW A;  2E9X A;  3O4X E;  3KVA A;  3WAK A;  4DVD A;  3RRW A;  5FXW A;  4PK6 A;  5EK4 A;  4GYR A;  5JR9 B;  2HH7 A;  3JC6 D;  2E8I A;  2V1D B;  5JDF A;  2H7O A;  5HYA A;  4AKG A;  1HG5 A;  5IYZ E;  3HL6 A;  5ADX L;  4JEU B;  4YHJ A;  5LNK A;  2A3D A;  2DLR A;  1MMG A;  3I9W A;  4OFZ A;  4K0U A;  5L3F B;  1O3X A;  5L2L A;  4IE6 A;  1BR1 A;  2K9A A;  2WBL A;  5LJN A;  4J2C A;  3CVR A;  2NWB A;  2LSY A;  2V7L A;  3BQI A;  3N9M A;  1WYC A;  3ESL A;  2VK9 A;  4AI6 A;  4TV9 E;  3BQK A;  3BK9 A;  3RX6 A;  4EIW A;  3ZJ1 A;  2E9X D;  2YU1 A;  4HEA A;  2NW9 A;  4GYS A;  4C90 A;  5DQV A;  2IAK A;  1HTJ F;  3KDS E;  3ZEF B;  4MAL A;  3E22 E;  4V1A v;  4AKR B;  2CE7 A;  1HF8 A;  3OYX A;  3P8C D;  5KMG P;  4ZOL E;  3CML A;  3MJX A;  1LKX A;  5HXS A;  3SS1 A;  1D0Z A;  3J9X 1;  1KNZ A;  2KND A;  3MXZ A;  2DCF A;  5L3B B;  3OYZ A;  2ODU A;  5HXH A;  3CQG B;  2DNX A;  3NRX A;  1HFA A;  4TZ4 C;  1G8X A;  4H9N C;  2X9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...