2W0GA

Hsp90 co-chaperone cdc37
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
129
structure length
129
Chain Sequence
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HSP90 CO-CHAPERONE CDC37
publication title The Human Cdc37.Hsp90 Complex Studied by Heteronuclear NMR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 57
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08565 CDC37_M Cdc37 Hsp90 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w0gA00
2W0GA 2K5BB 1US7B
chains in the Genus database with same CATH superfamily
3N9PA 5KX5E 3FZMB 1G8XA 1X9BA 1XNRT 3FZHB 5AQIB 3BQKA 3T1HT 1YXRA 5A1LA 4X62T 4HGAA 3TLWA 1NWMX 2V7KA 4X1IE 1N36T 2Q9QC 2N2NA 1GQEA 4PK6A 1HTJF 4DMWA 4DUZT 5KMGP 3SWHA 1MIWA 4O8SA 2BS3A 3ANWB 3WAKA 5AQRB 1MMNA 1HX1B 4A97A 4DO0A 1XZYA 4U2ZA 2NTYA 2X68A 2H7OA 4IREA 1XDOA 5FL1A 1S94A 5AQOB 1ZP0A 4HN9A 5LOVE 5LGUB 4UVAB 4X5TA 4CI2B 2E5VA 4PAGA 5EK2A 4DV1T 4P1NA 5ABHA 1Y64B 3RKOA 2Q9QB 2C5JA 2V8SV 3OYZA 3MJXA 1UGOA 5ABEA 2VL8A 4H9RC 4GYSA 3ABVA 2XQ9A 4LF9T 5EK4A 4JEUB 3ZEFB 4KHZF 4PJJA 4X1YE 5L3BB 3CX8B 3ZC1A 1DU2A 3RF1A 3AVRA 5FXXA 1X79A 3MK7C 2K3WA 3AXJB 3M3ZB 3NWIA 4YFSA 2QA7A 5HAXA 3C64A 3JADA 2DCFA 2V7MA 2YDQA 4IDZA 4CXXA 3ETUA 1FEWA 4KHPT 5F5WA 4ZZBA 2W00A 2XM2A 5L3DB 4ZI3C 5L3CB 3NBXX 1W9RA 5LCYA 5HCMA 5TAOA 2IAKA 2IHR1 2JQ9A 1KNZA 4ASKA 3RX6A 4U2YA 3EDUA 5HXEA 4GKKT 3IF8B 4NUVA 5JRCA 2HPLA 4TV8E 4Z91A 2WP9A 4CZZB 2W61A 1OEDE 1D0ZA 3AE7A 4JI8T 3UUNA 3KV5A 4IL9A 4HEAA 5JDLA 4JI5T 4QH1A 3UU4A 2FJDA 3RGLA 3EABA 5C2TA 3N2OA 2N9DA 2PFVA 1Z8UA 1OEDB 3GA8A 4ILBA 2VKDA 4TZ4C 3GN5A 1MNDA 2XQYA 4ZI3D 1SA0E 2NW9A 4GOUA 2DNXA 4KBMB 1MMDA 4HWIB 1D0XA 3N2GE 1ZHCA 2BKOA 2LSYA 4IHJE 4BJMA 3LG7A 4LF8T 3A7MA 5AFUL 4JI1T 1VCSA 4JUYA 5IHYA 4WZXA 1HS7A 4Q25A 2LSJA 3AEAA 5LJMA 2WDQA 2C5KT 3H3MA 3Q5WA 4H9OC 5F8PA 3FXEB 4ILUA 4IE0A 3QB5K 3TKLB 1H7CA 5ABFB 2OV9A 5FY7A 2CA5A 4UV9B 3FHNA 4ZI2C 1LRZA 2WAUA 2X0LB 2VK9A 3AAAB 4NUUA 4KP3C 2E9XB 2BG9C 2E2AA 4YHHT 5AQFB 3ZYMA 4WBNE 4JLEA 5KDMC 4QXCB 5AQTB 2BS2A 5H6RB 4KI0F 3UU3A 3ZKRA 3ZMTB 2YDRA 4TNVA 1T98A 4JI6T 4NIQA 5AQLB 2W67A 2WB5A 5DJQC 4TV9E 4O2AE 4DR5T 5AQNB 3AE5A 2UXNB 3G06A 4ZS3A 3VU7H 4B3RT 4EOZB 3DTOA 3CKDA 2I0MA 1ZV4X 1LKXA 5L47A 2H3RA 2ZM8A 4DV4T 5AQSB 1BR0A 1FIOA 1KEYA 4XBFB 3AVSA 5HEOA 2QVAA 2YDSA 4DV5T 5JDHA 2LT3A 3C4XA 1IJ6A 4BAYB 1EZ3A 1E7PA 4EV6A 4EEBA 5J0ZA 4LFAT 3TLUA 4ZI2D 4AKGA 3OJAA 3LBXA 3RIUA 2EHOC 2X9YA 2J47A 4Z90A 3Q5DA 1I6ZA 4IDOA 4QX7B 2DWGA 1UX5A 5CJ5A 3AE3A 4AKLA 4HFBA 3SOLA 3RC8A 3JC6D 2V1DB 2WDRA 4UVBB 4AISA 2M6IA 3L39A 3KBTA 2QGSA 4LMJA 1L0VA 2MTQA 2WU2A 4JI4T 1D1CA 3NKZA 3ZLIA 4FI5A 1YKEB 4IGUA 2K9AA 2VASA 4XAXB 3ZMSB 4K0KT 4JEHB 3F57A 4X66T 4N78D 3MACA 3LSVA 4QKNA 4U7IA 3OBVE 3Q5XA 2EHOB 3WI3A 5LA6E 3P4SA 3AE8A 5L3EB 2BBJA 4IL4A 1US7B 2DWKA 4CN4A 4C90A 3QC9A 4PNIA 2QRXA 3L8RA 3KDSE 2DHRA 2WSSV 1NENA 4HE8A 2KINB 3UULA 1WYCA 5LYJE 2WS3A 2OLTA 3QNUA 3F2EA 4HTEA 2WWVA 4HFVA 2XASB 3CQCB 3ZJ2A 1J5ET 2FBWA 3LK3B 3L09A 3PUZF 4B3ST 3PUVF 3ONXA 2DLRA 4A5XA 2W62A 2FJBA 2NWBA 3FXDB 4WYVA 2IC6A 3N9QA 3E08A 2ZM0A 1SUMB 2LRLA 1J1JA 3CWZB 5KXJA 4LF5T 4V1Av 4EIWA 5C3JA 3U3IA 4ZEYA 5DABA 2YEVC 3GN5B 3LFMA 2FJAA 4O4IE 2W4XA 3CX7B 4ZZCA 4U3CA 2WQYA 4TWFA 3X1DA 1MIVA 3HKBE 4HFIA 2K48A 5LGTB 3RYIE 2A72A 5CA1E 4G2AA 4EAHA 2CEAA 3I0OA 3K1SA 2RPAA 1O3XA 2IW5B 4TWHA 3ZJ1A 4P09A 2WU5A 3PUWF 5IWAT 5HEGA 2WZHA 4PK5A 2BVLA 3PUQA 4UIGA 2ES0A 4B6XA 4IDNA 2YU1A 5EZYE 4GK0E 2CE7A 1JNZA 2ACXA 3O1IA 2KWIB 4EZ4A 5LJNA 1HNXT 1MNEA 2ZM2A 3UU5A 3KV6A 4EXTA 5ETWA 3D0TA 2NP9A 3IA3A 4YTNA 5JR9A 1WCRA 3EAMA 4YT0A 5JREA 2CHNA 1KK7A 1WFDA 4X64T 1KFYA 1IAPA 5LHGB 4MALA 4HFCA 1HG5A 4ZOLE 2CWYA 3VRBA 3AE6A 3C4ZA 2IMLA 2KT9A 3VR9A 1ZEEA 2X9WA 4PJMA 5LHIB 2NW7A 2ODVA 3FBLA 5LHHB 2FUPA 2KLQA 2W66A 5AQHB 4JI0T 5FL0A 1W0BA 2RP4A 3O1HA 3OPCA 2Q9QD 3OYXA 2N1GA 4O4JE 5JQGE 4J2CA 4YY3T 3UFEA 2WY2A 4OHFA 2XUEA 4IE5A 2VQET 1QUUA 3EI0A 3SFDA 1HNWT 4U72A 2HPJA 4DVDA 3RPUA 4DUYT 1W0AA 3P7IA 3PU3A 3P4RA 3EVYA 3PV0F 3AE4A 4UF0A 3NRYA 3LBXB 4ILAA 2V7JA 2JQKA 4L9IA 3UU8A 4YTMA 3PUGA 3UUMA 2LKHA 4UEMA 1OEDC 4COFA 3ONJA 4GKJT 2L9QA 2WMNA 2Y6XA 3RI5A 3FZLB 4H63H 2D5UA 4LF7T 1ZKEA 2NTXA 3CQGB 5AQKB 3FBZA 2KXPB 1YW0A 2J1DG 2I59A 3ZMZB 5LMNT 4H9SE 3T1YT 5CFBA 3ZCIA 2VL0A 3UUBA 2C0SA 3CPZA 3I0QA 4CI3B 2PG8A 1FJGT 1IBMT 3HR0A 3VKHA 2XZEA 2WDVA 4ANJA 2XQ4A 3KINB 4GK5E 2HH7A 3C50A 4BJNA 4EYUA 5EK3A 2OA5A 1FMWA 3VR8A 3ZMVB 4HFEA 4DR3T 4LMLA 4UELA 3JAEA 3ONLC 5DQVA 2XQ3A 4AQFC 5L4HA 3AA0B 3SFEA 1Y01A 2LKGA 2LM2A 3UFGA 2CXLA 1E2AA 3ZN1B 1KNPA 4X1KE 1UURA 1NEKA 3BQIA 4JV5T 2A9UA 3LDQB 2Z6EA 2E9XC 2XQ5A 3GWHA 3M65A 2V5CA 4QH5A 3W15B 4E7ZA 1D1AA 1WRDA 2JRKA 3H3AA 4K0UA 3C4WA 4EEDA 5C8YE 5JTGA 5CGMA 2W2UA 1N33T 5LXTE 4X20E 3AE1A 4PK4A 4H63V 2LM9A 2IDOB 5HCJA 2QYWA 2CHOA 2YOEA 3VHLA 1IBKT 4MLKA 4DV3T 4IDQA 2XHEB 3N9MA 3B5MA 3P50A 4U33A 2JQHA 2XQ6A 2KWHA 2XQAA 3AAIA 1NAFA 4A56A 5HEUA 4WBOA 3IBPA 3ZSSA 4NXMT 5JDGA 4P0AA 3ZT6A 2V6YA 3B57A 4Z8XA 3RYHE 3J7Yq 3Q5EA 4PFPA 4PW8A 3FB2A 3LJCA 4HFDA 2V7LA 2E9XD 4DNDA 2XQ8A 5HEHA 2CWOA 4OK0A 1UX4A 2LRKA 2Q9QA 3C98B 2MPKA 1D1BA 5AQUB 2V26A 3B13A 4TN7B 3P4QA 2WWUA 3I9YA 2VKHA 4AI6A 1WR6A 2WMOA 2BVMA 3Q9DA 5JH7E 2FJEA 2JQQA 4DV6T 4DMVA 5JDNA 4DR7T 4AKRB 4DR6T 4JI2T 1T8BA 2GK9A 2LLYA 5LB7B 5JR9B 2BDEA 1HX8A 3MXZA 2BKPA 2J62A 2X66A 2JPFA 3AXJA 2PJQA 4NPPA 2UXXB 5FP3A 5FVKA 5FXZA 2WM9A 5FKYA 4IE7A 2UXCT 1T7SA 4M1PA 2NW8A 2LOPA 3RIAA 1HCIA 2XTLA 4U7YA 3CQXC 3PJAJ 1CUNA 2H88A 1HF8A 3KBUA 2CM0A 3N9OA 2IUBA 3ZPOA 4U74A 2CBJA 2XJ7A 3PURA 3UT5E 3AE9A 3FZKB 4TX5A 4YXDA 2MYSA 4IIJE 3OVUA 3JCFA 3RHWA 2CCQA 2W0GA 3AEFA 3E0ZA 2KNDA 4UV8B 3V5UA 3ZYKA 3O1JA 3KFWX 5JVDE 3S4UA 4XZCA 4E7SA 2WCAA 5J2TE 2UUCT 1UK5A 3HL6A 4CXYA 4IDPA 3NZQA 1XDPA 2R6GF 4IE6A 2EHOD 3NZPA 1XMOT 3RYFE 4BA9A 2KMFA 4ZS2A 3ZT7A 2YU2A 3DP7A 3EHZA 3K3QC 5IYZE 2E5LT 3PU8A 5JRCB 5FVLA 2D0TA 4LFCT 2D9DA 2V6XA 1SE7A 2NR4A 4MHCA 2A3DA 4O4LE 5M4YA 3PUXF 2CPTA 2MOZA 2L8KA 3C51A 2XAFB 3IHRA 3EDVA 4DBRA 3VRAA 3SS1A 3PE0A 4FJOA 2HN1A 2ACZA 2PTFA 3MKDA 3ZC0A 4IT4A 1ZOYA 5LBMA 3RRCA 4X65T 2LEHA 2WBLA 3ZT5A 3KVAA 4ZI7E 5LG4A 2Y8DA 3N5LA 1T72A 3QUJA 3ZCJA 3PDYA 3A5XA 4YLHA 3AA6B 2LSKA 4YHJA 3RKGA 2X67A 1VOMA 4O4HE 2M67A 2VVSA 3R6NA 3OTOT 5LG3A 5LP6E 3HKDE 3OKQA 4ZXLA 1AJ3A 3HA4A 4KMCA 3J9X1 3TLSA 2X0YA 3A8YC 1N34T 5DQWA 1YQ4A 1R8IA 4DR4T 3L3PA 4TWDA 1XNQT 4AQYT 3UU6A 5FXVA 3F31A 2BG9A 5L3GB 2V6YB 2VVNA 3AEDA 4EYYR 2ZLYA 3BK9A 1V9DA 2YINA 3RYCE 2VQFT 2VKJA 2B76A 3U78A 1OXZA 3RIUC 3K3NA 3KVBA 2VB6A 3NRXA 3PUSA 1MIYA 3DJBA 4B3MT 1D0YA 5HYAA 3UUXB 1J5WA 3ZMUB 4EGWA 1N32T 2ZM6T 5HWYA 4UR9A 1VRBA 2D0UA 4IE4A 2HHHT 1U5PA 5LMUT 1M62A 4DBQA 2C5IT 3HKCE 2RA1A 2VURA 5L2LA 1S35A 4C91A 3RQWA 2LJLA 5FY0A 4YJ2E 4EZHA 1XWMA 2VWAA 2XAHB 1BR4A 2EHOA 2HN2A 2XAGB 3MA9A 2K5BB 2CRBA 2LHRA 3P4WA 4U31A 1SHZC 1B7TA 5ABGA 3QOFA 1KNRA 4WNKA 2YKSA 4JI7T 2MAWA 5FY1A 3CIRA 2NOXA 2G0UA 4YTPA 2JJ9A 3TLVA 1E1HB 3CMLA 4DR2T 4AKHA 3QB5A 2KZ7B 1UCUA 4ADZA 3AAEB 2AXDS 3IEEA 3RC3A 3KV4A 3AEEA 3AA7B 4MBQA 2YK0A 4H9PC 5F3JA 4KX6A 4AQGA 4CN6A 3V5SA 2J4GA 3K3OA 3PUYF 3E22E 2E8IA 4OYKA 4HWDA 1OWAA 4I0UA 1YKHB 2V5DA 3QK6A 2V7IA 3RH3A 5AQMB 4AKIA 1IBLT 4QH4A 3PTRB 4ERRA 2XSAA 3CK6A 2P9BA 2UXBT 3PUAA 2K24A 2VKOA 5E0OA 4DV0T 2F4VT 4TNWA 3I9WA 3HI2A 4B3TT 4GIWA 2JIWA 4LMKA 4DR1T 3AE2A 1FMVA 3CX6B 3MZKB 5ADXL 5BR8T 2L3LA 2AE9A 4UXNB 4TUYE 2UUBT 1I94T 1Z0PA 2JMKA 4OYJA 3ANWA 4O2BE 5FYMA 1M7KA 5LGNB 2LE8A 3ZN0B 3TLTA 4LFBT 3R84B 3ETVA 5LNKA 3I1AA 2H7VC 3O4XE 1IJ5A 5JDFA 4YJ3E 5JR9C 4CN1A 2X9HA 4YSYA 2DI4A 5IUXA 3FZFB 5FNVE 2XSBA 2I6HA 2KSRA 2CXDA 1JNRA 3EUHA 4AXPA 3JC6C 2BBHA 3SRZA 5FMNA 4I50E 1LVKA 1YQ3A 5HXHA 2BG9E 4WW0A 4ILCA 3WAJA 5GONE 4CI1B 4YSZA 1WR0A 4ISSA 1HFAA 3T8OA 2YN6A 2D2SA 3JAFA 4MFRA 5CA0E 4CQIA 4PJNA 4HWFA 1BR1A 3AB3B 2BG9B 5AQQB 1HNZT 3VKGA 3LK2B 5HWXA 4P0BA 4OFZA 1HR0T 4F8HA 5AQGB 2IIUA 4I55E 3K8PC 2LSIA 3ESLA 2IC9A 2SPCA 2X51A 4F6RC 2CMRA 1YD8G 1QSDA 3CVRA 2A2FX 5AQVB 2XQ7A 4EB6E 4HKAA 4CXWA 4OX9T 5FXWA 5L3FB 1XMQT 4G63A 3N9NA 3RQUA 4QXHB 3RIFA 2WZIA 3O9XA 2CLYC 2CXFA 1G73A 1LVFA 5HXSA 1MMGA 2ZMAA 3UQ7A 1BR2A 4HWCA 2B1EA 2H89A 1KF6A 2LSGA 4DV7T 4QX8B 3AEGA 3AEBA 2DL1A 4L5GA 2XM1A 4DV2T 4QWNB 4KUMB 5CB4E 4NXNT 4PJLA 4UF0B 3BQLA 1IZNB 2BZBA 4H9QC 2UUAT 4GYRA 4ZHQE 5AQJB 2BS4A 3AECA 4H9NC 4ISTA 4JYAT 1UUSA 1W09A 1OEDA 3P4PA 2CLYB 2ODUA 3UQ4A 2XPKA 4PFOA 2LOSA 1WYBA 2JMHA 4QHOA 4HWHA 5HEJA 2BKNA 3NVOA 4L0RA 4LF6T 4AIUA 2X0HA 2XAQB 3N9LA 1VCTA 3ZSTA 4A98A 5HXRA 3H37A 2M6BA 3GMIA 2XAJB 2PBIA 1MMAA 2UU9T 3UTKA 4I4TE 2Y48B 1WLXA 1QLBA 5J2UE 3Q2MA 4UVCB 5HXCA 5L4EA 3KV9A 1HG2A 5AQPB 5JDMA 2UXDT 4LF4T 3RLFF 2LHNA 2MBGA 3LK42 3HKEE 3P8CD 5H6QB 4AQFA 2W63A 2CBIA 4JI3T 5J1GA 4DIDB 3PJAA 2X9XA 2XY8B 5ABFA 4I43B 4HFHA 5BMVE 5LBQB 4QXBB 1CHUA 1U4QA 4JBWF 4YSXA 2E9XA 3AA1B 5JDQA 3ZYLA 3N2KE 3RRWA
chains in the Genus database with same CATH topology
4YJ2E 3N9PA 5KX5E 2MTQA 1G8XA 4EZHA 3VHLA 4MLKA 1D1CA 2VWAA 2XAHB 1BR4A 2EHOA 2XHEB 3ZLIA 3N9MA 3BQKA 4FI5A 1YKEB 2KWHA 2XAGB 3AAIA 1NAFA 3MA9A 4IGUA 5A1LA 2K9AA 2K5BB 2VASA 4XAXB 3ZMSB 4HGAA 4JEHB 3F57A 4A56A 4WBOA 2LHRA 4N78D 1NWMX 3IBPA 5JDGA 2V7KA 4X1IE 3MACA 4P0AA 2Q9QC 2N2NA 4QKNA 1SHZC 1B7TA 3B57A 4WNKA 3OBVE 4Z8XA 3RYHE 4PK6A 3Q5XA 5FY1A 3J7Yq 2EHOB 2NOXA 3WI3A 5LA6E 1HTJF 4DMWA 4PFPA 5L3EB 2G0UA 4PW8A 5KMGP 2JJ9A 3SWHA 3FB2A 1MIWA 4O8SA 3ANWB 1US7B 3WAKA 1E1HB 3CMLA 2DWKA 3LJCA 1MMNA 2V7LA 4DO0A 4C90A 4AKHA 2KZ7B 1UCUA 2NTYA 2E9XD 4DNDA 3QC9A 4PNIA 4ADZA 3AAEB 2X68A 2CWOA 4OK0A 1UX4A 3KDSE 2DHRA 2Q9QA 2H7OA 2WSSV 3C98B 3IEEA 3RC3A 4HE8A 3KV4A 1D1BA 1S94A 3AA7B 2KINB 2V26A 3UULA 1WYCA 4MBQA 2YK0A 5LYJE 3B13A 4H9PC 3F2EA 4HN9A 4TN7B 5LOVE 5LGUB 2WWUA 3I9YA 4UVAB 5F3JA 2VKHA 4AI6A 4HTEA 4AQGA 1WR6A 4HFVA 4CI2B 4PAGA 3V5SA 2WMOA 2XASB 3CQCB 3ZJ2A 5EK2A 2BVMA 3Q9DA 3K3OA 5JH7E 3LK3B 2JQQA 3E22E 1Y64B 4DMVA 3L09A 3RKOA 5JDNA 2Q9QB 4AKRB 2E8IA 2C5JA 4OYKA 1OWAA 3OYZA 3ONXA 1YKHB 2DLRA 3MJXA 2W62A 2NWBA 3QK6A 2V7IA 3RH3A 2VL8A 3FXDB 2GK9A 2IC6A 4H9RC 2BDEA 4GYSA 5JR9B 3N9QA 4AKIA 1HX8A 3MXZA 3RRWA 3E08A 5EK4A 2ZM0A 2X66A 4JEUB 2JPFA 2PJQA 3PTRB 2UXXB 4PJJA 5FP3A 5FXZA 4ERRA 3ZEFB 4X1YE 5L3BB 2WM9A 3CWZB 2P9BA 3CX8B 4IE7A 3ZC1A 3PUAA 2K24A 2VKOA 5E0OA 4M1PA 3AVRA 2NW8A 2LOPA 4V1Av 5FXXA 3I9WA 4EIWA 1X79A 3HI2A 1HCIA 2XTLA 3MK7C 3U3IA 3CQXC 1CUNA 5DABA 1HF8A 2YEVC 2CM0A 3KBUA 4GIWA 3GN5B 1FMVA 3LFMA 4O4IE 3N9OA 3CX7B 3CX6B 3MZKB 3ZPOA 5ADXL 2L3LA 4YFSA 4U74A 2QA7A 3PURA 5HAXA 3UT5E 1MIVA 3C64A 3HKBE 2DCFA 2K48A 2V7MA 4UXNB 4IDZA 4CXXA 4TUYE 3RYIE 5LGTB 1Z0PA 2A72A 4TX5A 3ETUA 2MYSA 1FEWA 2JMKA 4OYJA 4G2AA 4IIJE 5CA1E 4EAHA 2W00A 3ANWA 2CEAA 4O2BE 2CCQA 3I0OA 2W0GA 5FYMA 5L3DB 1O3XA 5LGNB 4ZI3C 2IW5B 3ZJ1A 5L3CB 2LE8A 3E0ZA 3ZN0B 2KNDA 3NBXX 4P09A 3R84B 5LCYA 3ETVA 5LNKA 4PK5A 5TAOA 2IAKA 2BVLA 3I1AA 3PUQA 1KNZA 4ASKA 4UIGA 4UV8B 2H7VC 3RX6A 2ES0A 3O4XE 3V5UA 4B6XA 3ZYKA 3O1JA 1IJ5A 2YU1A 3KFWX 5JDFA 4YJ3E 5EZYE 5JR9C 5JVDE 2X9HA 4GK0E 3S4UA 4XZCA 4E7SA 3EDUA 2CE7A 5J2TE 5HXEA 2DI4A 5FNVE 2ACXA 3IF8B 2CXDA 3O1IA 2KWIB 3EUHA 4NUVA 3JC6C 4AXPA 3HL6A 5JRCA 2HPLA 3SRZA 4TV8E 4CXYA 5FMNA 4EZ4A 5LJNA 3NZQA 4I50E 1MNEA 2ZM2A 3KV6A 1LVKA 4IE6A 2W61A 4CZZB 5HXHA 1D0ZA 2EHOD 3NZPA 3RYFE 4BA9A 4EXTA 5ETWA 3D0TA 2KMFA 2NP9A 3KV5A 4WW0A 3UUNA 4ZS2A 5JR9A 5JREA 2YU2A 3DP7A 3K3QC 4HEAA 5IYZE 3WAJA 1KK7A 5JDLA 5GONE 3PU8A 4CI1B 1IAPA 5JRCB 4ISSA 5LHGB 1HFAA 2D0TA 3T8OA 3N2OA 4MALA 2D2SA 1HG5A 4ZOLE 2N9DA 2PFVA 4MFRA 2CWYA 5CA0E 4CQIA 3GA8A 4PJNA 4MHCA 2A3DA 1BR1A 3C4ZA 3AB3B 4O4LE 5M4YA 3VKGA 3LK2B 2KT9A 2VKDA 2MOZA 4TZ4C 5HWXA 1ZEEA 2L8KA 2X9WA 3C51A 4PJMA 2XAFB 3IHRA 3GN5A 4P0BA 4OFZA 2NW7A 5LHIB 3EDVA 2ODVA 3FBLA 4DBRA 5LHHB 3SS1A 1MNDA 3PE0A 2KLQA 2XQYA 4FJOA 4ZI3D 1SA0E 2RP4A 3O1HA 2NW9A 4GOUA 2Q9QD 4I55E 3MKDA 3K8PC 2DNXA 2LSIA 3ESLA 2IC9A 3OYXA 3ZC0A 2N1GA 4KBMB 2SPCA 2X51A 4O4JE 1MMDA 5LBMA 3RRCA 5JQGE 4J2CA 4F6RC 3UFEA 1D0XA 3N2GE 4OHFA 2LEHA 2WBLA 2XUEA 2CMRA 1ZHCA 1YD8G 2LSYA 4IHJE 1QSDA 3KVAA 3CVRA 4BJMA 3LG7A 2A2FX 4IE5A 1QUUA 4ZI7E 5LG4A 4EB6E 4HKAA 2Y8DA 4U72A 2HPJA 5AFUL 4DVDA 3RPUA 3N5LA 4CXWA 5FXWA 3P7IA 4JUYA 5IHYA 5L3FB 1HS7A 3PU3A 4G63A 3QUJA 2LSJA 3N9NA 4QXHB 3ZCJA 3PDYA 3A5XA 4YLHA 3AA6B 3O9XA 2CLYC 3EVYA 2LSKA 5LJMA 4YHJA 2CXFA 2C5KT 1G73A 1LVFA 2X67A 4UF0A 1VOMA 3Q5WA 3NRYA 1MMGA 5HXSA 4H9OC 3LBXB 2ZMAA 1BR2A 4O4HE 5F8PA 2V7JA 2M67A 3FXEB 2B1EA 4ILUA 4IE0A 3R6NA 3TKLB 4L9IA 1H7CA 2LSGA 5FY0A 4QX8B 3PUGA 5FY7A 3UUMA 2CA5A 4UV9B 3FHNA 4ZI2C 4UEMA 4L5GA 1LRZA 5LP6E 2WAUA 3HKDE 3OKQA 1AJ3A 2X0LB 2VK9A 3AAAB 4NUUA 4KP3C 2E9XB 4QWNB 4KUMB 3HA4A 5CB4E 4KMCA 3ZYMA 4WBNE 4PJLA 2WMNA 2Y6XA 4JLEA 4QXCB 4UF0B 3BQLA 1IZNB 5KDMC 4H63H 2BZBA 3J9X1 4H9QC 2D5UA 5H6RB 1ZKEA 2NTXA 3CQGB 4GYRA 3FBZA 5DQWA 4ZHQE 2KXPB 4H9NC 4ISTA 1YW0A 3ZMTB 2J1DG 2I59A 3L3PA 3ZMZB 4H9SE 1T98A 3ZCIA 2C0SA 3CPZA 5DJQC 3I0QA 5FXVA 3F31A 4CI3B 2PG8A 2CLYB 2ODUA 4TV9E 3HR0A 4O2AE 3VKHA 5L3GB 4PFOA 4ANJA 4EYYR 3KINB 4GK5E 2LOSA 2UXNB 1WYBA 2ZLYA 3BK9A 2HH7A 3C50A 2JMHA 4ZS3A 4QHOA 3VU7H 4BJNA 4EYUA 1V9DA 2YINA 5EK3A 2OA5A 4EOZB 4L0RA 1FMWA 3RYCE 3DTOA 2XAQB 3ZMVB 3N9LA 3CKDA 1ZV4X 2VKJA 1LKXA 5HXRA 3H37A 4UELA 5DQVA 4AQFC 3GMIA 3U78A 2XAJB 1OXZA 3AA0B 2H3RA 2PBIA 2ZM8A 3K3NA 1MMAA 3KVBA 3UTKA 4I4TE 1BR0A 1FIOA 2VB6A 3NRXA 2Y48B 1WLXA 2CXLA 3ZN1B 3PUSA 5J2UE 3AVSA 4XBFB 4X1KE 1MIYA 3Q2MA 3DJBA 5JDHA 4UVCB 2LT3A 3BQIA 1D0YA 3C4XA 1IJ6A 5HXCA 4BAYB 5HYAA 2Z6EA 1EZ3A 3UUXB 2E9XC 3KV9A 1HG2A 5JDMA 3GWHA 3M65A 2LHNA 3ZMUB 4ZI2D 3W15B 4E7ZA 1D1AA 2MBGA 3LK42 1WRDA 3HKEE 4AKGA 5HWYA 2JRKA 3H3AA 3P8CD 5H6QB 3OJAA 4AQFA 4K0UA 3LBXA 2EHOC 2W63A 2X9YA 3C4WA 1VRBA 5J1GA 2D0UA 4IE4A 5C8YE 1U5PA 2X9XA 4QX7B 2DWGA 1UX5A 4I43B 5BMVE 5LBQB 4QXBB 4AKLA 3SOLA 4DBQA 2C5IT 3HKCE 2RA1A 3RC8A 3JC6D 5LXTE 4X20E 2V1DB 1U4QA 5L2LA 1S35A 4C91A 2E9XA 4PK4A 3AA1B 4H63V 4UVBB 2LM9A 5JDQA 3KBTA 3ZYLA 2LJLA 3N2KE 2QGSA 2L9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0G A;  2K5B B;  1US7 B; 
#chains in the Genus database with same CATH topology
 3N9P A;  5KX5 E;  3FZM B;  1G8X A;  1X9B A;  1XNR T;  3FZH B;  5AQI B;  3BQK A;  3T1H T;  1YXR A;  5A1L A;  4X62 T;  4HGA A;  3TLW A;  1NWM X;  2V7K A;  4X1I E;  1N36 T;  2Q9Q C;  2N2N A;  1GQE A;  4PK6 A;  1HTJ F;  4DMW A;  4DUZ T;  5KMG P;  3SWH A;  1MIW A;  4O8S A;  2BS3 A;  3ANW B;  3WAK A;  5AQR B;  1MMN A;  1HX1 B;  4A97 A;  4DO0 A;  1XZY A;  4U2Z A;  2NTY A;  2X68 A;  2H7O A;  4IRE A;  1XDO A;  5FL1 A;  1S94 A;  5AQO B;  1ZP0 A;  4HN9 A;  5LOV E;  5LGU B;  4UVA B;  4X5T A;  4CI2 B;  2E5V A;  4PAG A;  5EK2 A;  4DV1 T;  4P1N A;  5ABH A;  1Y64 B;  3RKO A;  2Q9Q B;  2C5J A;  2V8S V;  3OYZ A;  3MJX A;  1UGO A;  5ABE A;  2VL8 A;  4H9R C;  4GYS A;  3ABV A;  2XQ9 A;  4LF9 T;  5EK4 A;  4JEU B;  3ZEF B;  4KHZ F;  4PJJ A;  4X1Y E;  5L3B B;  3CX8 B;  3ZC1 A;  1DU2 A;  3RF1 A;  3AVR A;  5FXX A;  1X79 A;  3MK7 C;  2K3W A;  3AXJ B;  3M3Z B;  3NWI A;  4YFS A;  2QA7 A;  5HAX A;  3C64 A;  3JAD A;  2DCF A;  2V7M A;  2YDQ A;  4IDZ A;  4CXX A;  3ETU A;  1FEW A;  4KHP T;  5F5W A;  4ZZB A;  2W00 A;  2XM2 A;  5L3D B;  4ZI3 C;  5L3C B;  3NBX X;  1W9R A;  5LCY A;  5HCM A;  5TAO A;  2IAK A;  2IHR 1;  2JQ9 A;  1KNZ A;  4ASK A;  3RX6 A;  4U2Y A;  3EDU A;  5HXE A;  4GKK T;  3IF8 B;  4NUV A;  5JRC A;  2HPL A;  4TV8 E;  4Z91 A;  2WP9 A;  4CZZ B;  2W61 A;  1OED E;  1D0Z A;  3AE7 A;  4JI8 T;  3UUN A;  3KV5 A;  4IL9 A;  4HEA A;  5JDL A;  4JI5 T;  4QH1 A;  3UU4 A;  2FJD A;  3RGL A;  3EAB A;  5C2T A;  3N2O A;  2N9D A;  2PFV A;  1Z8U A;  1OED B;  3GA8 A;  4ILB A;  2VKD A;  4TZ4 C;  3GN5 A;  1MND A;  2XQY A;  4ZI3 D;  1SA0 E;  2NW9 A;  4GOU A;  2DNX A;  4KBM B;  1MMD A;  4HWI B;  1D0X A;  3N2G E;  1ZHC A;  2BKO A;  2LSY A;  4IHJ E;  4BJM A;  3LG7 A;  4LF8 T;  3A7M A;  5AFU L;  4JI1 T;  1VCS A;  4JUY A;  5IHY A;  4WZX A;  1HS7 A;  4Q25 A;  2LSJ A;  3AEA A;  5LJM A;  2WDQ A;  2C5K T;  3H3M A;  3Q5W A;  4H9O C;  5F8P A;  3FXE B;  4ILU A;  4IE0 A;  3QB5 K;  3TKL B;  1H7C A;  5ABF B;  2OV9 A;  5FY7 A;  2CA5 A;  4UV9 B;  3FHN A;  4ZI2 C;  1LRZ A;  2WAU A;  2X0L B;  2VK9 A;  3AAA B;  4NUU A;  4KP3 C;  2E9X B;  2BG9 C;  2E2A A;  4YHH T;  5AQF B;  3ZYM A;  4WBN E;  4JLE A;  5KDM C;  4QXC B;  5AQT B;  2BS2 A;  5H6R B;  4KI0 F;  3UU3 A;  3ZKR A;  3ZMT B;  2YDR A;  4TNV A;  1T98 A;  4JI6 T;  4NIQ A;  5AQL B;  2W67 A;  2WB5 A;  5DJQ C;  4TV9 E;  4O2A E;  4DR5 T;  5AQN B;  3AE5 A;  2UXN B;  3G06 A;  4ZS3 A;  3VU7 H;  4B3R T;  4EOZ B;  3DTO A;  3CKD A;  2I0M A;  1ZV4 X;  1LKX A;  5L47 A;  2H3R A;  2ZM8 A;  4DV4 T;  5AQS B;  1BR0 A;  1FIO A;  1KEY A;  4XBF B;  3AVS A;  5HEO A;  2QVA A;  2YDS A;  4DV5 T;  5JDH A;  2LT3 A;  3C4X A;  1IJ6 A;  4BAY B;  1EZ3 A;  1E7P A;  4EV6 A;  4EEB A;  5J0Z A;  4LFA T;  3TLU A;  4ZI2 D;  4AKG A;  3OJA A;  3LBX A;  3RIU A;  2EHO C;  2X9Y A;  2J47 A;  4Z90 A;  3Q5D A;  1I6Z A;  4IDO A;  4QX7 B;  2DWG A;  1UX5 A;  5CJ5 A;  3AE3 A;  4AKL A;  4HFB A;  3SOL A;  3RC8 A;  3JC6 D;  2V1D B;  2WDR A;  4UVB B;  4AIS A;  2M6I A;  3L39 A;  3KBT A;  2QGS A;  4LMJ A;  1L0V A;  2MTQ A;  2WU2 A;  4JI4 T;  1D1C A;  3NKZ A;  3ZLI A;  4FI5 A;  1YKE B;  4IGU A;  2K9A A;  2VAS A;  4XAX B;  3ZMS B;  4K0K T;  4JEH B;  3F57 A;  4X66 T;  4N78 D;  3MAC A;  3LSV A;  4QKN A;  4U7I A;  3OBV E;  3Q5X A;  2EHO B;  3WI3 A;  5LA6 E;  3P4S A;  3AE8 A;  5L3E B;  2BBJ A;  4IL4 A;  1US7 B;  2DWK A;  4CN4 A;  4C90 A;  3QC9 A;  4PNI A;  2QRX A;  3L8R A;  3KDS E;  2DHR A;  2WSS V;  1NEN A;  4HE8 A;  2KIN B;  3UUL A;  1WYC A;  5LYJ E;  2WS3 A;  2OLT A;  3QNU A;  3F2E A;  4HTE A;  2WWV A;  4HFV A;  2XAS B;  3CQC B;  3ZJ2 A;  1J5E T;  2FBW A;  3LK3 B;  3L09 A;  3PUZ F;  4B3S T;  3PUV F;  3ONX A;  2DLR A;  4A5X A;  2W62 A;  2FJB A;  2NWB A;  3FXD B;  4WYV A;  2IC6 A;  3N9Q A;  3E08 A;  2ZM0 A;  1SUM B;  2LRL A;  1J1J A;  3CWZ B;  5KXJ A;  4LF5 T;  4V1A v;  4EIW A;  5C3J A;  3U3I A;  4ZEY A;  5DAB A;  2YEV C;  3GN5 B;  3LFM A;  2FJA A;  4O4I E;  2W4X A;  3CX7 B;  4ZZC A;  4U3C A;  2WQY A;  4TWF A;  3X1D A;  1MIV A;  3HKB E;  4HFI A;  2K48 A;  5LGT B;  3RYI E;  2A72 A;  5CA1 E;  4G2A A;  4EAH A;  2CEA A;  3I0O A;  3K1S A;  2RPA A;  1O3X A;  2IW5 B;  4TWH A;  3ZJ1 A;  4P09 A;  2WU5 A;  3PUW F;  5IWA T;  5HEG A;  2WZH A;  4PK5 A;  2BVL A;  3PUQ A;  4UIG A;  2ES0 A;  4B6X A;  4IDN A;  2YU1 A;  5EZY E;  4GK0 E;  2CE7 A;  1JNZ A;  2ACX A;  3O1I A;  2KWI B;  4EZ4 A;  5LJN A;  1HNX T;  1MNE A;  2ZM2 A;  3UU5 A;  3KV6 A;  4EXT A;  5ETW A;  3D0T A;  2NP9 A;  3IA3 A;  4YTN A;  5JR9 A;  1WCR A;  3EAM A;  4YT0 A;  5JRE A;  2CHN A;  1KK7 A;  1WFD A;  4X64 T;  1KFY A;  1IAP A;  5LHG B;  4MAL A;  4HFC A;  1HG5 A;  4ZOL E;  2CWY A;  3VRB A;  3AE6 A;  3C4Z A;  2IML A;  2KT9 A;  3VR9 A;  1ZEE A;  2X9W A;  4PJM A;  5LHI B;  2NW7 A;  2ODV A;  3FBL A;  5LHH B;  2FUP A;  2KLQ A;  2W66 A;  5AQH B;  4JI0 T;  5FL0 A;  1W0B A;  2RP4 A;  3O1H A;  3OPC A;  2Q9Q D;  3OYX A;  2N1G A;  4O4J E;  5JQG E;  4J2C A;  4YY3 T;  3UFE A;  2WY2 A;  4OHF A;  2XUE A;  4IE5 A;  2VQE T;  1QUU A;  3EI0 A;  3SFD A;  1HNW T;  4U72 A;  2HPJ A;  4DVD A;  3RPU A;  4DUY T;  1W0A A;  3P7I A;  3PU3 A;  3P4R A;  3EVY A;  3PV0 F;  3AE4 A;  4UF0 A;  3NRY A;  3LBX B;  4ILA A;  2V7J A;  2JQK A;  4L9I A;  3UU8 A;  4YTM A;  3PUG A;  3UUM A;  2LKH A;  4UEM A;  1OED C;  4COF A;  3ONJ A;  4GKJ T;  2L9Q A;  2WMN A;  2Y6X A;  3RI5 A;  3FZL B;  4H63 H;  2D5U A;  4LF7 T;  1ZKE A;  2NTX A;  3CQG B;  5AQK B;  3FBZ A;  2KXP B;  1YW0 A;  2J1D G;  2I59 A;  3ZMZ B;  5LMN T;  4H9S E;  3T1Y T;  5CFB A;  3ZCI A;  2VL0 A;  3UUB A;  2C0S A;  3CPZ A;  3I0Q A;  4CI3 B;  2PG8 A;  1FJG T;  1IBM T;  3HR0 A;  3VKH A;  2XZE A;  2WDV A;  4ANJ A;  2XQ4 A;  3KIN B;  4GK5 E;  2HH7 A;  3C50 A;  4BJN A;  4EYU A;  5EK3 A;  2OA5 A;  1FMW A;  3VR8 A;  3ZMV B;  4HFE A;  4DR3 T;  4LML A;  4UEL A;  3JAE A;  3ONL C;  5DQV A;  2XQ3 A;  4AQF C;  5L4H A;  3AA0 B;  3SFE A;  1Y01 A;  2LKG A;  2LM2 A;  3UFG A;  2CXL A;  1E2A A;  3ZN1 B;  1KNP A;  4X1K E;  1UUR A;  1NEK A;  3BQI A;  4JV5 T;  2A9U A;  3LDQ B;  2Z6E A;  2E9X C;  2XQ5 A;  3GWH A;  3M65 A;  2V5C A;  4QH5 A;  3W15 B;  4E7Z A;  1D1A A;  1WRD A;  2JRK A;  3H3A A;  4K0U A;  3C4W A;  4EED A;  5C8Y E;  5JTG A;  5CGM A;  2W2U A;  1N33 T;  5LXT E;  4X20 E;  3AE1 A;  4PK4 A;  4H63 V;  2LM9 A;  2IDO B;  5HCJ A;  2QYW A;  2CHO A;  2YOE A;  3VHL A;  1IBK T;  4MLK A;  4DV3 T;  4IDQ A;  2XHE B;  3N9M A;  3B5M A;  3P50 A;  4U33 A;  2JQH A;  2XQ6 A;  2KWH A;  2XQA A;  3AAI A;  1NAF A;  4A56 A;  5HEU A;  4WBO A;  3IBP A;  3ZSS A;  4NXM T;  5JDG A;  4P0A A;  3ZT6 A;  2V6Y A;  3B57 A;  4Z8X A;  3RYH E;  3J7Y q;  3Q5E A;  4PFP A;  4PW8 A;  3FB2 A;  3LJC A;  4HFD A;  2V7L A;  2E9X D;  4DND A;  2XQ8 A;  5HEH A;  2CWO A;  4OK0 A;  1UX4 A;  2LRK A;  2Q9Q A;  3C98 B;  2MPK A;  1D1B A;  5AQU B;  2V26 A;  3B13 A;  4TN7 B;  3P4Q A;  2WWU A;  3I9Y A;  2VKH A;  4AI6 A;  1WR6 A;  2WMO A;  2BVM A;  3Q9D A;  5JH7 E;  2FJE A;  2JQQ A;  4DV6 T;  4DMV A;  5JDN A;  4DR7 T;  4AKR B;  4DR6 T;  4JI2 T;  1T8B A;  2GK9 A;  2LLY A;  5LB7 B;  5JR9 B;  2BDE A;  1HX8 A;  3MXZ A;  2BKP A;  2J62 A;  2X66 A;  2JPF A;  3AXJ A;  2PJQ A;  4NPP A;  2UXX B;  5FP3 A;  5FVK A;  5FXZ A;  2WM9 A;  5FKY A;  4IE7 A;  2UXC T;  1T7S A;  4M1P A;  2NW8 A;  2LOP A;  3RIA A;  1HCI A;  2XTL A;  4U7Y A;  3CQX C;  3PJA J;  1CUN A;  2H88 A;  1HF8 A;  3KBU A;  2CM0 A;  3N9O A;  2IUB A;  3ZPO A;  4U74 A;  2CBJ A;  2XJ7 A;  3PUR A;  3UT5 E;  3AE9 A;  3FZK B;  4TX5 A;  4YXD A;  2MYS A;  4IIJ E;  3OVU A;  3JCF A;  3RHW A;  2CCQ A;  2W0G A;  3AEF A;  3E0Z A;  2KND A;  4UV8 B;  3V5U A;  3ZYK A;  3O1J A;  3KFW X;  5JVD E;  3S4U A;  4XZC A;  4E7S A;  2WCA A;  5J2T E;  2UUC T;  1UK5 A;  3HL6 A;  4CXY A;  4IDP A;  3NZQ A;  1XDP A;  2R6G F;  4IE6 A;  2EHO D;  3NZP A;  1XMO T;  3RYF E;  4BA9 A;  2KMF A;  4ZS2 A;  3ZT7 A;  2YU2 A;  3DP7 A;  3EHZ A;  3K3Q C;  5IYZ E;  2E5L T;  3PU8 A;  5JRC B;  5FVL A;  2D0T A;  4LFC T;  2D9D A;  2V6X A;  1SE7 A;  2NR4 A;  4MHC A;  2A3D A;  4O4L E;  5M4Y A;  3PUX F;  2CPT A;  2MOZ A;  2L8K A;  3C51 A;  2XAF B;  3IHR A;  3EDV A;  4DBR A;  3VRA A;  3SS1 A;  3PE0 A;  4FJO A;  2HN1 A;  2ACZ A;  2PTF A;  3MKD A;  3ZC0 A;  4IT4 A;  1ZOY A;  5LBM A;  3RRC A;  4X65 T;  2LEH A;  2WBL A;  3ZT5 A;  3KVA A;  4ZI7 E;  5LG4 A;  2Y8D A;  3N5L A;  1T72 A;  3QUJ A;  3ZCJ A;  3PDY A;  3A5X A;  4YLH A;  3AA6 B;  2LSK A;  4YHJ A;  3RKG A;  2X67 A;  1VOM A;  4O4H E;  2M67 A;  2VVS A;  3R6N A;  3OTO T;  5LG3 A;  5LP6 E;  3HKD E;  3OKQ A;  4ZXL A;  1AJ3 A;  3HA4 A;  4KMC A;  3J9X 1;  3TLS A;  2X0Y A;  3A8Y C;  1N34 T;  5DQW A;  1YQ4 A;  1R8I A;  4DR4 T;  3L3P A;  4TWD A;  1XNQ T;  4AQY T;  3UU6 A;  5FXV A;  3F31 A;  2BG9 A;  5L3G B;  2V6Y B;  2VVN A;  3AED A;  4EYY R;  2ZLY A;  3BK9 A;  1V9D A;  2YIN A;  3RYC E;  2VQF T;  2VKJ A;  2B76 A;  3U78 A;  1OXZ A;  3RIU C;  3K3N A;  3KVB A;  2VB6 A;  3NRX A;  3PUS A;  1MIY A;  3DJB A;  4B3M T;  1D0Y A;  5HYA A;  3UUX B;  1J5W A;  3ZMU B;  4EGW A;  1N32 T;  2ZM6 T;  5HWY A;  4UR9 A;  1VRB A;  2D0U A;  4IE4 A;  2HHH T;  1U5P A;  5LMU T;  1M62 A;  4DBQ A;  2C5I T;  3HKC E;  2RA1 A;  2VUR A;  5L2L A;  1S35 A;  4C91 A;  3RQW A;  2LJL A;  5FY0 A;  4YJ2 E;  4EZH A;  1XWM A;  2VWA A;  2XAH B;  1BR4 A;  2EHO A;  2HN2 A;  2XAG B;  3MA9 A;  2K5B B;  2CRB A;  2LHR A;  3P4W A;  4U31 A;  1SHZ C;  1B7T A;  5ABG A;  3QOF A;  1KNR A;  4WNK A;  2YKS A;  4JI7 T;  2MAW A;  5FY1 A;  3CIR A;  2NOX A;  2G0U A;  4YTP A;  2JJ9 A;  3TLV A;  1E1H B;  3CML A;  4DR2 T;  4AKH A;  3QB5 A;  2KZ7 B;  1UCU A;  4ADZ A;  3AAE B;  2AXD S;  3IEE A;  3RC3 A;  3KV4 A;  3AEE A;  3AA7 B;  4MBQ A;  2YK0 A;  4H9P C;  5F3J A;  4KX6 A;  4AQG A;  4CN6 A;  3V5S A;  2J4G A;  3K3O A;  3PUY F;  3E22 E;  2E8I A;  4OYK A;  4HWD A;  1OWA A;  4I0U A;  1YKH B;  2V5D A;  3QK6 A;  2V7I A;  3RH3 A;  5AQM B;  4AKI A;  1IBL T;  4QH4 A;  3PTR B;  4ERR A;  2XSA A;  3CK6 A;  2P9B A;  2UXB T;  3PUA A;  2K24 A;  2VKO A;  5E0O A;  4DV0 T;  2F4V T;  4TNW A;  3I9W A;  3HI2 A;  4B3T T;  4GIW A;  2JIW A;  4LMK A;  4DR1 T;  3AE2 A;  1FMV A;  3CX6 B;  3MZK B;  5ADX L;  5BR8 T;  2L3L A;  2AE9 A;  4UXN B;  4TUY E;  2UUB T;  1I94 T;  1Z0P A;  2JMK A;  4OYJ A;  3ANW A;  4O2B E;  5FYM A;  1M7K A;  5LGN B;  2LE8 A;  3ZN0 B;  3TLT A;  4LFB T;  3R84 B;  3ETV A;  5LNK A;  3I1A A;  2H7V C;  3O4X E;  1IJ5 A;  5JDF A;  4YJ3 E;  5JR9 C;  4CN1 A;  2X9H A;  4YSY A;  2DI4 A;  5IUX A;  3FZF B;  5FNV E;  2XSB A;  2I6H A;  2KSR A;  2CXD A;  1JNR A;  3EUH A;  4AXP A;  3JC6 C;  2BBH A;  3SRZ A;  5FMN A;  4I50 E;  1LVK A;  1YQ3 A;  5HXH A;  2BG9 E;  4WW0 A;  4ILC A;  3WAJ A;  5GON E;  4CI1 B;  4YSZ A;  1WR0 A;  4ISS A;  1HFA A;  3T8O A;  2YN6 A;  2D2S A;  3JAF A;  4MFR A;  5CA0 E;  4CQI A;  4PJN A;  4HWF A;  1BR1 A;  3AB3 B;  2BG9 B;  5AQQ B;  1HNZ T;  3VKG A;  3LK2 B;  5HWX A;  4P0B A;  4OFZ A;  1HR0 T;  4F8H A;  5AQG B;  2IIU A;  4I55 E;  3K8P C;  2LSI A;  3ESL A;  2IC9 A;  2SPC A;  2X51 A;  4F6R C;  2CMR A;  1YD8 G;  1QSD A;  3CVR A;  2A2F X;  5AQV B;  2XQ7 A;  4EB6 E;  4HKA A;  4CXW A;  4OX9 T;  5FXW A;  5L3F B;  1XMQ T;  4G63 A;  3N9N A;  3RQU A;  4QXH B;  3RIF A;  2WZI A;  3O9X A;  2CLY C;  2CXF A;  1G73 A;  1LVF A;  5HXS A;  1MMG A;  2ZMA A;  3UQ7 A;  1BR2 A;  4HWC A;  2B1E A;  2H89 A;  1KF6 A;  2LSG A;  4DV7 T;  4QX8 B;  3AEG A;  3AEB A;  2DL1 A;  4L5G A;  2XM1 A;  4DV2 T;  4QWN B;  4KUM B;  5CB4 E;  4NXN T;  4PJL A;  4UF0 B;  3BQL A;  1IZN B;  2BZB A;  4H9Q C;  2UUA T;  4GYR A;  4ZHQ E;  5AQJ B;  2BS4 A;  3AEC A;  4H9N C;  4IST A;  4JYA T;  1UUS A;  1W09 A;  1OED A;  3P4P A;  2CLY B;  2ODU A;  3UQ4 A;  2XPK A;  4PFO A;  2LOS A;  1WYB A;  2JMH A;  4QHO A;  4HWH A;  5HEJ A;  2BKN A;  3NVO A;  4L0R A;  4LF6 T;  4AIU A;  2X0H A;  2XAQ B;  3N9L A;  1VCT A;  3ZST A;  4A98 A;  5HXR A;  3H37 A;  2M6B A;  3GMI A;  2XAJ B;  2PBI A;  1MMA A;  2UU9 T;  3UTK A;  4I4T E;  2Y48 B;  1WLX A;  1QLB A;  5J2U E;  3Q2M A;  4UVC B;  5HXC A;  5L4E A;  3KV9 A;  1HG2 A;  5AQP B;  5JDM A;  2UXD T;  4LF4 T;  3RLF F;  2LHN A;  2MBG A;  3LK4 2;  3HKE E;  3P8C D;  5H6Q B;  4AQF A;  2W63 A;  2CBI A;  4JI3 T;  5J1G A;  4DID B;  3PJA A;  2X9X A;  2XY8 B;  5ABF A;  4I43 B;  4HFH A;  5BMV E;  5LBQ B;  4QXB B;  1CHU A;  1U4Q A;  4JBW F;  4YSX A;  2E9X A;  3AA1 B;  5JDQ A;  3ZYL A;  3N2K E;  3RRW A; 
#chains in the Genus database with same CATH homology
 4YJ2 E;  3N9P A;  5KX5 E;  2MTQ A;  1G8X A;  4EZH A;  3VHL A;  4MLK A;  1D1C A;  2VWA A;  2XAH B;  1BR4 A;  2EHO A;  2XHE B;  3ZLI A;  3N9M A;  3BQK A;  4FI5 A;  1YKE B;  2KWH A;  2XAG B;  3AAI A;  1NAF A;  3MA9 A;  4IGU A;  5A1L A;  2K9A A;  2K5B B;  2VAS A;  4XAX B;  3ZMS B;  4HGA A;  4JEH B;  3F57 A;  4A56 A;  4WBO A;  2LHR A;  4N78 D;  1NWM X;  3IBP A;  5JDG A;  2V7K A;  4X1I E;  3MAC A;  4P0A A;  2Q9Q C;  2N2N A;  4QKN A;  1SHZ C;  1B7T A;  3B57 A;  4WNK A;  3OBV E;  4Z8X A;  3RYH E;  4PK6 A;  3Q5X A;  5FY1 A;  3J7Y q;  2EHO B;  2NOX A;  3WI3 A;  5LA6 E;  1HTJ F;  4DMW A;  4PFP A;  5L3E B;  2G0U A;  4PW8 A;  5KMG P;  2JJ9 A;  3SWH A;  3FB2 A;  1MIW A;  4O8S A;  3ANW B;  1US7 B;  3WAK A;  1E1H B;  3CML A;  2DWK A;  3LJC A;  1MMN A;  2V7L A;  4DO0 A;  4C90 A;  4AKH A;  2KZ7 B;  1UCU A;  2NTY A;  2E9X D;  4DND A;  3QC9 A;  4PNI A;  4ADZ A;  3AAE B;  2X68 A;  2CWO A;  4OK0 A;  1UX4 A;  3KDS E;  2DHR A;  2Q9Q A;  2H7O A;  2WSS V;  3C98 B;  3IEE A;  3RC3 A;  4HE8 A;  3KV4 A;  1D1B A;  1S94 A;  3AA7 B;  2KIN B;  2V26 A;  3UUL A;  1WYC A;  4MBQ A;  2YK0 A;  5LYJ E;  3B13 A;  4H9P C;  3F2E A;  4HN9 A;  4TN7 B;  5LOV E;  5LGU B;  2WWU A;  3I9Y A;  4UVA B;  5F3J A;  2VKH A;  4AI6 A;  4HTE A;  4AQG A;  1WR6 A;  4HFV A;  4CI2 B;  4PAG A;  3V5S A;  2WMO A;  2XAS B;  3CQC B;  3ZJ2 A;  5EK2 A;  2BVM A;  3Q9D A;  3K3O A;  5JH7 E;  3LK3 B;  2JQQ A;  3E22 E;  1Y64 B;  4DMV A;  3L09 A;  3RKO A;  5JDN A;  2Q9Q B;  4AKR B;  2E8I A;  2C5J A;  4OYK A;  1OWA A;  3OYZ A;  3ONX A;  1YKH B;  2DLR A;  3MJX A;  2W62 A;  2NWB A;  3QK6 A;  2V7I A;  3RH3 A;  2VL8 A;  3FXD B;  2GK9 A;  2IC6 A;  4H9R C;  2BDE A;  4GYS A;  5JR9 B;  3N9Q A;  4AKI A;  1HX8 A;  3MXZ A;  3RRW A;  3E08 A;  5EK4 A;  2ZM0 A;  2X66 A;  4JEU B;  2JPF A;  2PJQ A;  3PTR B;  2UXX B;  4PJJ A;  5FP3 A;  5FXZ A;  4ERR A;  3ZEF B;  4X1Y E;  5L3B B;  2WM9 A;  3CWZ B;  2P9B A;  3CX8 B;  4IE7 A;  3ZC1 A;  3PUA A;  2K24 A;  2VKO A;  5E0O A;  4M1P A;  3AVR A;  2NW8 A;  2LOP A;  4V1A v;  5FXX A;  3I9W A;  4EIW A;  1X79 A;  3HI2 A;  1HCI A;  2XTL A;  3MK7 C;  3U3I A;  3CQX C;  1CUN A;  5DAB A;  1HF8 A;  2YEV C;  2CM0 A;  3KBU A;  4GIW A;  3GN5 B;  1FMV A;  3LFM A;  4O4I E;  3N9O A;  3CX7 B;  3CX6 B;  3MZK B;  3ZPO A;  5ADX L;  2L3L A;  4YFS A;  4U74 A;  2QA7 A;  3PUR A;  5HAX A;  3UT5 E;  1MIV A;  3C64 A;  3HKB E;  2DCF A;  2K48 A;  2V7M A;  4UXN B;  4IDZ A;  4CXX A;  4TUY E;  3RYI E;  5LGT B;  1Z0P A;  2A72 A;  4TX5 A;  3ETU A;  2MYS A;  1FEW A;  2JMK A;  4OYJ A;  4G2A A;  4IIJ E;  5CA1 E;  4EAH A;  2W00 A;  3ANW A;  2CEA A;  4O2B E;  2CCQ A;  3I0O A;  2W0G A;  5FYM A;  5L3D B;  1O3X A;  5LGN B;  4ZI3 C;  2IW5 B;  3ZJ1 A;  5L3C B;  2LE8 A;  3E0Z A;  3ZN0 B;  2KND A;  3NBX X;  4P09 A;  3R84 B;  5LCY A;  3ETV A;  5LNK A;  4PK5 A;  5TAO A;  2IAK A;  2BVL A;  3I1A A;  3PUQ A;  1KNZ A;  4ASK A;  4UIG A;  4UV8 B;  2H7V C;  3RX6 A;  2ES0 A;  3O4X E;  3V5U A;  4B6X A;  3ZYK A;  3O1J A;  1IJ5 A;  2YU1 A;  3KFW X;  5JDF A;  4YJ3 E;  5EZY E;  5JR9 C;  5JVD E;  2X9H A;  4GK0 E;  3S4U A;  4XZC A;  4E7S A;  3EDU A;  2CE7 A;  5J2T E;  5HXE A;  2DI4 A;  5FNV E;  2ACX A;  3IF8 B;  2CXD A;  3O1I A;  2KWI B;  3EUH A;  4NUV A;  3JC6 C;  4AXP A;  3HL6 A;  5JRC A;  2HPL A;  3SRZ A;  4TV8 E;  4CXY A;  5FMN A;  4EZ4 A;  5LJN A;  3NZQ A;  4I50 E;  1MNE A;  2ZM2 A;  3KV6 A;  1LVK A;  4IE6 A;  2W61 A;  4CZZ B;  5HXH A;  1D0Z A;  2EHO D;  3NZP A;  3RYF E;  4BA9 A;  4EXT A;  5ETW A;  3D0T A;  2KMF A;  2NP9 A;  3KV5 A;  4WW0 A;  3UUN A;  4ZS2 A;  5JR9 A;  5JRE A;  2YU2 A;  3DP7 A;  3K3Q C;  4HEA A;  5IYZ E;  3WAJ A;  1KK7 A;  5JDL A;  5GON E;  3PU8 A;  4CI1 B;  1IAP A;  5JRC B;  4ISS A;  5LHG B;  1HFA A;  2D0T A;  3T8O A;  3N2O A;  4MAL A;  2D2S A;  1HG5 A;  4ZOL E;  2N9D A;  2PFV A;  4MFR A;  2CWY A;  5CA0 E;  4CQI A;  3GA8 A;  4PJN A;  4MHC A;  2A3D A;  1BR1 A;  3C4Z A;  3AB3 B;  4O4L E;  5M4Y A;  3VKG A;  3LK2 B;  2KT9 A;  2VKD A;  2MOZ A;  4TZ4 C;  5HWX A;  1ZEE A;  2L8K A;  2X9W A;  3C51 A;  4PJM A;  2XAF B;  3IHR A;  3GN5 A;  4P0B A;  4OFZ A;  2NW7 A;  5LHI B;  3EDV A;  2ODV A;  3FBL A;  4DBR A;  5LHH B;  3SS1 A;  1MND A;  3PE0 A;  2KLQ A;  2XQY A;  4FJO A;  4ZI3 D;  1SA0 E;  2RP4 A;  3O1H A;  2NW9 A;  4GOU A;  2Q9Q D;  4I55 E;  3MKD A;  3K8P C;  2DNX A;  2LSI A;  3ESL A;  2IC9 A;  3OYX A;  3ZC0 A;  2N1G A;  4KBM B;  2SPC A;  2X51 A;  4O4J E;  1MMD A;  5LBM A;  3RRC A;  5JQG E;  4J2C A;  4F6R C;  3UFE A;  1D0X A;  3N2G E;  4OHF A;  2LEH A;  2WBL A;  2XUE A;  2CMR A;  1ZHC A;  1YD8 G;  2LSY A;  4IHJ E;  1QSD A;  3KVA A;  3CVR A;  4BJM A;  3LG7 A;  2A2F X;  4IE5 A;  1QUU A;  4ZI7 E;  5LG4 A;  4EB6 E;  4HKA A;  2Y8D A;  4U72 A;  2HPJ A;  5AFU L;  4DVD A;  3RPU A;  3N5L A;  4CXW A;  5FXW A;  3P7I A;  4JUY A;  5IHY A;  5L3F B;  1HS7 A;  3PU3 A;  4G63 A;  3QUJ A;  2LSJ A;  3N9N A;  4QXH B;  3ZCJ A;  3PDY A;  3A5X A;  4YLH A;  3AA6 B;  3O9X A;  2CLY C;  3EVY A;  2LSK A;  5LJM A;  4YHJ A;  2CXF A;  2C5K T;  1G73 A;  1LVF A;  2X67 A;  4UF0 A;  1VOM A;  3Q5W A;  3NRY A;  1MMG A;  5HXS A;  4H9O C;  3LBX B;  2ZMA A;  1BR2 A;  4O4H E;  5F8P A;  2V7J A;  2M67 A;  3FXE B;  2B1E A;  4ILU A;  4IE0 A;  3R6N A;  3TKL B;  4L9I A;  1H7C A;  2LSG A;  5FY0 A;  4QX8 B;  3PUG A;  5FY7 A;  3UUM A;  2CA5 A;  4UV9 B;  3FHN A;  4ZI2 C;  4UEM A;  4L5G A;  1LRZ A;  5LP6 E;  2WAU A;  3HKD E;  3OKQ A;  1AJ3 A;  2X0L B;  2VK9 A;  3AAA B;  4NUU A;  4KP3 C;  2E9X B;  4QWN B;  4KUM B;  3HA4 A;  5CB4 E;  4KMC A;  3ZYM A;  4WBN E;  4PJL A;  2WMN A;  2Y6X A;  4JLE A;  4QXC B;  4UF0 B;  3BQL A;  1IZN B;  5KDM C;  4H63 H;  2BZB A;  3J9X 1;  4H9Q C;  2D5U A;  5H6R B;  1ZKE A;  2NTX A;  3CQG B;  4GYR A;  3FBZ A;  5DQW A;  4ZHQ E;  2KXP B;  4H9N C;  4IST A;  1YW0 A;  3ZMT B;  2J1D G;  2I59 A;  3L3P A;  3ZMZ B;  4H9S E;  1T98 A;  3ZCI A;  2C0S A;  3CPZ A;  5DJQ C;  3I0Q A;  5FXV A;  3F31 A;  4CI3 B;  2PG8 A;  2CLY B;  2ODU A;  4TV9 E;  3HR0 A;  4O2A E;  3VKH A;  5L3G B;  4PFO A;  4ANJ A;  4EYY R;  3KIN B;  4GK5 E;  2LOS A;  2UXN B;  1WYB A;  2ZLY A;  3BK9 A;  2HH7 A;  3C50 A;  2JMH A;  4ZS3 A;  4QHO A;  3VU7 H;  4BJN A;  4EYU A;  1V9D A;  2YIN A;  5EK3 A;  2OA5 A;  4EOZ B;  4L0R A;  1FMW A;  3RYC E;  3DTO A;  2XAQ B;  3ZMV B;  3N9L A;  3CKD A;  1ZV4 X;  2VKJ A;  1LKX A;  5HXR A;  3H37 A;  4UEL A;  5DQV A;  4AQF C;  3GMI A;  3U78 A;  2XAJ B;  1OXZ A;  3AA0 B;  2H3R A;  2PBI A;  2ZM8 A;  3K3N A;  1MMA A;  3KVB A;  3UTK A;  4I4T E;  1BR0 A;  1FIO A;  2VB6 A;  3NRX A;  2Y48 B;  1WLX A;  2CXL A;  3ZN1 B;  3PUS A;  5J2U E;  3AVS A;  4XBF B;  4X1K E;  1MIY A;  3Q2M A;  3DJB A;  5JDH A;  4UVC B;  2LT3 A;  3BQI A;  1D0Y A;  3C4X A;  1IJ6 A;  5HXC A;  4BAY B;  5HYA A;  2Z6E A;  1EZ3 A;  3UUX B;  2E9X C;  3KV9 A;  1HG2 A;  5JDM A;  3GWH A;  3M65 A;  2LHN A;  3ZMU B;  4ZI2 D;  3W15 B;  4E7Z A;  1D1A A;  2MBG A;  3LK4 2;  1WRD A;  3HKE E;  4AKG A;  5HWY A;  2JRK A;  3H3A A;  3P8C D;  5H6Q B;  3OJA A;  4AQF A;  4K0U A;  3LBX A;  2EHO C;  2W63 A;  2X9Y A;  3C4W A;  1VRB A;  5J1G A;  2D0U A;  4IE4 A;  5C8Y E;  1U5P A;  2X9X A;  4QX7 B;  2DWG A;  1UX5 A;  4I43 B;  5BMV E;  5LBQ B;  4QXB B;  4AKL A;  3SOL A;  4DBQ A;  2C5I T;  3HKC E;  2RA1 A;  3RC8 A;  3JC6 D;  5LXT E;  4X20 E;  2V1D B;  1U4Q A;  5L2L A;  1S35 A;  4C91 A;  2E9X A;  4PK4 A;  3AA1 B;  4H63 V;  4UVB B;  2LM9 A;  5JDQ A;  3KBT A;  3ZYL A;  2LJL A;  3N2K E;  2QGS A;  2L9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...