2W0GA

Hsp90 co-chaperone cdc37
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
129
structure length
129
Chain Sequence
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Human Cdc37.Hsp90 Complex Studied by Heteronuclear NMR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HSP90 CO-CHAPERONE CDC37
total genus 57
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08565 CDC37_M Cdc37 Hsp90 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w0gA00
2W0GA 2K5BB 1US7B
chains in the Genus database with same CATH superfamily
2V5DA 3PUYF 3UQ4A 2SPCA 2RA1A 3P7IA 4H9OC 3ZT7A 3OYXA 4DO0A 4EAHA 1BR0A 3RKOA 2K9AA 5HCMA 3CVRA 2WAUA 2Y6XA 4AQFA 4CXXA 1KFYA 2X9YA 1X79A 3GWHA 4X1KE 3CQCB 4CN1A 4EYYR 3H3AA 3FB2A 1EZ3A 2FJDA 2QVAA 2V6YA 3AE2A 3ZJ2A 2MTQA 2PFVA 3RF1A 3VR9A 4K0KT 4LF8T 3MA9A 5EK4A 1VCTA 5JDNA 2G0UA 4IIJE 4MALA 2YN6A 3C4ZA 2W00A 4BAYB 1MNDA 3RC3A 4UIGA 2BG9A 2JJ9A 3BQLA 5JDQA 5J2TE 3EI0A 3M3ZB 3GN5A 3AAEB 4I0UA 1ZHCA 3SFDA 3ZSSA 4TV8E 4BA9A 3C4XA 3N5LA 2YEVC 3CKDA 3KV9A 1OEDB 2LSKA 4H9RC 4P1NA 5LB7B 3UU5A 4OYKA 2X0YA 2KWIB 1VCSA 2R6GF 2ODVA 1OXZA 4H9SE 1LVFA 3F31A 4O2BE 2DCFA 4YTMA 5HCJA 3RYFE 5FXZA 2XZEA 1FIOA 2ZM8A 4C90A 2KWHA 4EB6E 2XM2A 3ANWB 4E7ZA 5KX5E 3QOFA 1XNQT 1IJ5A 5F8PA 3MACA 4I50E 2B1EA 1B7TA 2DNXA 3NKZA 4PK6A 5AQPB 5JR9B 2M67A 5DQWA 1X9BA 5JVDE 2AXDS 5JR9C 1IAPA 5L4EA 4A98A 4CN6A 4EIWA 1HTJF 2M6IA 3JCFA 3V5UA 1XDPA 1LKXA 2WSSV 3AAIA 3UFEA 2WDRA 4X65T 4X20E 5LGTB 1XMQT 2K48A 4U33A 3PTRB 3ZC1A 1N32T 3ZSTA 4HWIB 5HWYA 3ONJA 2CMRA 1BR2A 2NWBA 3BQIA 4DVDA 4DV6T 1V9DA 3LK42 4A5XA 4ILUA 3EHZA 5LHGB 4H9PC 3DP7A 2I59A 3P50A 2KZ7B 4G63A 4TN7B 3PE0A 5L3BB 2F4VT 2C0SA 4DV5T 3RQWA 5JRCB 3QB5K 3Q9DA 4U7IA 2EHOD 5FY0A 2LM9A 1LVKA 2LEHA 1YQ3A 1UGOA 2L9QA 4QWNB 4TZ4C 3T8OA 3N9QA 4GIWA 4KHPT 1SE7A 2BDEA 2ES0A 2Y8DA 3AVRA 3I9YA 2JQHA 3E0ZA 2CPTA 2D0TA 3N9PA 4QH5A 5FVLA 4HWHA 3OYZA 4QHOA 2CXDA 2YK0A 4PAGA 2V1DB 2W0GA 4HFIA 3DJBA 2LSGA 4YJ3E 3OJAA 2XSAA 3O4XE 4IL4A 4OK0A 1JNRA 1W9RA 4PFOA 5L3EB 3C51A 1MMDA 2XQ8A 3RPUA 3S4UA 2ZM0A 2NP9A 4L5GA 5JDMA 2X68A 2X51A 3ZMUB 5CA1E 2GK9A 4IE4A 4N78D 4JI2T 4YHHT 1IBLT 3PV0F 5HYAA 1R8IA 3KVAA 3A7MA 3NRXA 3AAAB 3UUMA 3VHLA 2NOXA 2V7MA 2RP4A 3K3OA 1WFDA 3TLUA 4DUZT 4AQYT 1I94T 4JI8T 1MIVA 2WWUA 3K8PC 4AKHA 2BG9E 4P0AA 2KT9A 3FZFB 2CXLA 4JYAT 2PJQA 4P09A 3NZPA 4U2ZA 4X1YE 5AQVB 3KV6A 1HX8A 4MLKA 1XWMA 3PUXF 1G8XA 2EHOA 2XAJB 2Q9QB 5L4HA 2XQ6A 4ZI3D 5HXSA 4LFCT 4HGAA 2DWGA 3U78A 4CI3B 5LHHB 4ISTA 4A97A 3KDSE 1HS7A 3FXEB 2HHHT 4HFBA 2ACXA 2C5KT 4QKNA 2JQKA 4YSYA 1XMOT 2JQQA 2UU9T 1N33T 2HN2A 2JQ9A 3AA6B 3TLWA 3Q5EA 1CHUA 1D0XA 2DWKA 2VK9A 4TNWA 3C64A 2UUBT 3ZC0A 1GQEA 3QB5A 3UU3A 4DV7T 1US7B 4TX5A 3F2EA 5F5WA 4XBFB 4UV8B 4JEUB 2WB5A 3ZEFB 3PUVF 4LF5T 4TWDA 1L0VA 1YD8G 4ILCA 5ABHA 2XJ7A 2V7IA 4HKAA 4HWDA 5AFUL 5JH7E 2W4XA 2FUPA 3UUXB 2JPFA 3NVOA 2L3LA 3ZLIA 2V7JA 5DABA 4IDQA 4AISA 2LOPA 3UU6A 2VQFT 4PJNA 3ABVA 4LFBT 1E2AA 4ZS3A 5HEOA 3CX7B 4IE7A 2A72A 2A9UA 2CHNA 4YTNA 1FMVA 1NENA 1ZEEA 2X9XA 1KNPA 2HN1A 3AEGA 3LK2B 3H37A 2FJAA 3PUGA 4AKLA 4QXBB 3ESLA 3M65A 5DJQC 3WAKA 2A2FX 4KMCA 3I0OA 3AE5A 3ZYLA 4DR7T 4JEHB 4ISSA 3SWHA 1SHZC 3AEBA 4X66T 4DMWA 5ADXL 2WMNA 4V1Av 2IUBA 4WYVA 4F8HA 3VKGA 1UUSA 2D0UA 1HFAA 1T7SA 3N9LA 1XZYA 4GYSA 5FYMA 5HEGA 2IW5B 3RX6A 4EEBA 3K3NA 4ZS2A 2PBIA 3J9X1 1WR6A 3PURA 3CIRA 4MHCA 3O1JA 4GYRA 1WLXA 5FKYA 4IDOA 4CXYA 3PUZF 3UULA 3HKCE 2VKJA 2UUCT 1JNZA 1U4QA 3FZMB 4NUVA 4PJLA 3HR0A 4QX7B 2D5UA 5ETWA 5LP6E 4LMKA 2UXCT 1IBMT 3GMIA 2DL1A 5LMNT 3ZYMA 2KMFA 2Y48B 1KEYA 3P4SA 4UVAB 1D1BA 2IIUA 2NW7A 4HE8A 2C5IT 1QUUA 1CUNA 2DLRA 1YXRA 1WYCA 3V5SA 5EK3A 3T1HT 1S35A 3AE1A 5C8YE 4DBQA 4PJJA 1HNWT 4AKIA 4A56A 2IC9A 3B5MA 2CWOA 1XDOA 3AB3B 3CK6A 3E08A 4HFHA 3ZN1B 4ZI2D 4OX9T 1T98A 2WBLA 2ZM6T 4IL9A 1KF6A 2YU1A 3KBTA 4Q25A 3ZMVB 4U2YA 4EZHA 2D9DA 2BS4A 4EEDA 4CI1B 5LG4A 5LHIB 2OA5A 5AQRB 3UUBA 3ONXA 3RYCE 3B13A 3DTOA 4IREA 4EOZB 5BMVE 2IAKA 2JRKA 2BKOA 3L3PA 3ETUA 4MBQA 4HWFA 3SFEA 3P4WA 2A3DA 5J2UE 2X9WA 2XUEA 4YSXA 3FHNA 3RIFA 5FXVA 1OEDC 2VB6A 5FL0A 3OTOT 3P4QA 5HAXA 2YU2A 4B3RT 3CWZB 5L3CB 3OVUA 3KBUA 4KP3C 3LK3B 5E0OA 4H63V 2CHOA 4JLEA 4ANJA 4UVBB 5IUXA 2E8IA 1N34T 1ZP0A 4DNDA 2LLYA 3UTKA 1U5PA 2HPJA 2H7VC 2LSIA 2VL8A 2XAGB 4DR3T 5JRCA 2BBHA 2V7LA 4EZ4A 5KDMC 3AECA 1VRBA 4PNIA 1HF8A 2LSJA 4TWFA 4DIDB 2VL0A 1WYBA 3IEEA 1FJGT 4PJMA 5LOVE 4F6RC 4IE0A 1LRZA 5JDHA 2ACZA 2B76A 2ZM2A 4HFCA 4QH4A 4BJMA 5JREA 5HXHA 2P9BA 2VKHA 2VVSA 2PTFA 4UF0A 4Z8XA 3A8YC 3QNUA 4OYJA 4TV9E 4X5TA 5ABGA 3IA3A 2NW8A 3NZQA 2LOSA 5H6RB 5HXEA 5JDLA 5M4YA 5L2LA 4YHJA 1ZV4X 2WQYA 3Q2MA 5HXCA 5IYZE 4AQGA 2J47A 2WCAA 4H9QC 1UURA 5FVKA 2BZBA 4ILBA 2UXXB 1KK7A 3RGLA 4NXNT 3RLFF 1QSDA 3K1SA 3EDUA 4BJNA 2KXPB 2J62A 4XZCA 4FJOA 5AQTB 4UV9B 5LXTE 1MIYA 1IZNB 3P4RA 3X1DA 3T1YT 4JV5T 4JI5T 2VKOA 2Z6EA 3FXDB 2NW9A 1D0ZA 2LE8A 2MAWA 2V6YB 3L39A 2XQYA 2XQ4A 2FBWA 3CPZA 4UVCB 1BR4A 2JMHA 2OLTA 3UUNA 3FZKB 5ABFB 3FBLA 3VR8A 1QLBA 3ZJ1A 4QXCB 3RRCA 4U3CA 2LHNA 3SRZA 2W66A 2ZMAA 2XAFB 4L9IA 3SS1A 3N2KE 4O4JE 3VU7H 4IDNA 5LG3A 1I6ZA 1FEWA 2IMLA 3R84B 1NWMX 5LBQB 4LFAT 3F57A 4O2AE 2UXBT 4EV6A 1HCIA 2NTYA 2X0HA 3C4WA 5FNVE 3C98B 2KNDA 2BKPA 2CA5A 4EXTA 2WY2A 4I4TE 4UEMA 3TLTA 3O1HA 3UQ7A 3N9OA 4JI3T 1DU2A 3ZMZB 2E5VA 3I0QA 5L3FB 4B3MT 4JI1T 2CM0A 3AXJB 1VOMA 3NBXX 2Q9QD 4H63H 5LNKA 2UXDT 1YKHB 2X9HA 3KVBA 5FMNA 1Y01A 2FJBA 2EHOC 3L09A 4TNVA 3UU8A 5J0ZA 4DR1T 3PUSA 4B3TT 3KV4A 2IHR1 5ABFA 5AQIB 5AQMB 5L3GB 3IHRA 1UX4A 4HN9A 4I43B 4ZXLA 3LBXA 4MFRA 3A5XA 4KBMB 3PUQA 4CXWA 4ZHQE 1HX1B 4U31A 3BK9A 2WZHA 2W63A 4U72A 2E9XD 3AEFA 3EVYA 1D0YA 4QH1A 3AE9A 3UFGA 2XM1A 3ZPOA 3CX6B 1HNXT 4DR4T 2XSBA 4JI4T 5LYJE 2XASB 2E9XC 2IC6A 4WZXA 4X1IE 2QYWA 3N9NA 4ADZA 5CB4E 5FL1A 3EUHA 5LMUT 4HFDA 5ABEA 4UXNB 3LFMA 4DR5T 3LBXB 5FY1A 3H3MA 4UELA 5C2TA 4LF4T 5L3DB 5GONE 1Z0PA 3PJAJ 3RC8A 2CBIA 3NRYA 4IDZA 5JR9A 2JMKA 2KINB 4U7YA 4G2AA 3RH3A 3RKGA 2WS3A 3AE8A 2LRKA 3QC9A 2BG9B 4ILAA 3PUWF 1UX5A 2LJLA 2BS2A 3CQGB 3ZN0B 4DV0T 2H3RA 1NAFA 3TLSA 2WDQA 4K0UA 3RIAA 3AE3A 2WDVA 3LDQB 5CFBA 2W62A 3HI2A 2CWYA 3O1IA 5LBMA 5JQGE 5JDFA 4YY3T 1Z8UA 1ZKEA 3N2GE 3Q5WA 4HWCA 4NPPA 5FP3A 2CLYC 3PU8A 4LF9T 2NR4A 2XAHB 4IE5A 5HXRA 1NEKA 3J7Yq 2H89A 2CLYB 2I0MA 3HKDE 3C50A 3HKEE 2YDSA 2J4GA 3ZKRA 3I9WA 4DV3T 2E9XA 2UUAT 2N1GA 4PFPA 5HEJA 2I6HA 2VWAA 3ANWA 3GN5B 3OPCA 1BR1A 1WRDA 1T72A 2PG8A 4IT4A 2XPKA 4UR9A 1S94A 2W61A 4YJ2E 5LGNB 4DV4T 2V5CA 1J5ET 3MK7C 2LRLA 2QRXA 1KNZA 2MYSA 4E7SA 3RRWA 2BVLA 3GA8A 5AQJB 1OEDA 2XQ7A 3N9MA 3KV5A 2VQET 3JC6C 4DV1T 3RHWA 1HG2A 1SA0E 2H88A 5FY7A 4NUUA 2BKNA 4H9NC 3PDYA 4DBRA 3FZHB 4P0BA 2WMOA 3AEEA 3VRBA 2DI4A 2LKHA 4U74A 4YLHA 4WNKA 2HH7A 1J1JA 1YKEB 2RPAA 5AQOB 3ZYKA 1KNRA 3ZT6A 2VVNA 4JBWF 5AQSB 3ZMSB 1D1CA 4WBNE 5LJNA 2E2AA 3AA0B 2E9XB 4GK5E 4LMLA 3R6NA 4IHJE 4YSZA 3G06A 3KINB 5JDGA 4LF6T 1Y64B 5AQQB 3RYHE 2C5JA 4HEAA 3AEAA 5JTGA 3AE7A 4EGWA 2BBJA 5C3JA 3IBPA 4KX6A 5DQVA 1FMWA 2DHRA 3RI5A 2IDOB 3N2OA 1ZOYA 2CRBA 4IDPA 1W0AA 2BG9C 5FXWA 3ONLC 2K24A 2V6XA 5J1GA 5HWXA 5BR8T 4PK5A 3AE6A 3FZLB 3PU3A 2YKSA 5H6QB 5LGUB 4JI0T 3W15B 3AXJA 4LMJA 2WP9A 2HPLA 5CGMA 5F3JA 2FJEA 2X67A 4J2CA 3JC6D 4ZOLE 3RYIE 3NWIA 1J5WA 4O4HE 3UU4A 3B57A 3JADA 4UF0B 3ZCJA 1MNEA 3PUAA 1H7CA 2VASA 2W2UA 3CMLA 4FI5A 4CZZB 4KUMB 3TLVA 2LM2A 2YDQA 3ETVA 3MJXA 3ZT5A 3AVSA 5IWAT 2YDRA 4C91A 4GKJT 4O4IE 5AQHB 4TUYE 2UXNB 5CA0E 1M7KA 5HEHA 3VRAA 4QXHB 4WW0A 4JI7T 4GKKT 4ZI7E 2YOEA 4YTPA 5L47A 5KMGP 5TAOA 3EAMA 2W67A 2XAQB 2N2NA 2WU2A 3K3QC 1SUMB 1W0BA 1W09A 1WCRA 1YQ4A 3FBZA 2CEAA 4TWHA 2MPKA 3VKHA 2M6BA 5A1LA 2H7OA 1MMAA 2EHOB 2XY8B 3LSVA 1HG5A 4Z90A 3ZMTB 4X64T 1HR0T 3CX8B 2XQAA 3MKDA 2D2SA 2BS3A 2NTXA 3L8RA 2XHEB 4YT0A 4OHFA 3LG7A 4GOUA 5AQUB 4ASKA 1G73A 2X66A 4KHZF 4YXDA 5AQNB 4AKRB 3SOLA 4L0RA 3ZCIA 2WM9A 2CBJA 3CQXC 3PJAA 2YINA 3JAEA 2J1DG 2LT3A 4AI6A 2Q9QC 4JUYA 2Q9QA 4ERRA 2WU5A 4CQIA 2WWVA 5AQKB 2QA7A 4HFEA 1M62A 3E22E 1N36T 4HTEA 1IBKT 2V8SV 1OEDE 2VURA 5AQFB 3RIUA 4DV2T 1MIWA 3AA1B 1MMGA 2KSRA 3IF8B 2VKDA 5LA6E 4B6XA 2CCQA 4DMVA 5IHYA 5AQGB 5EK2A 2LSYA 2KLQA 4ZZCA 5LJMA 3JAFA 4XAXB 3MXZA 4GK0E 4IGUA 2BVMA 3AEDA 5EZYE 2ODUA 3EDVA 3QK6A 2OV9A 2X0LB 5KXJA 1UCUA 2ZLYA 2XTLA 3AA7B 4IE6A 3O9XA 1MMNA 1O3XA 2K5BB 3UT5E 4PK4A 5CJ5A 3OKQA 2K3WA 4DUYT 4DR2T 4EYUA 3OBVE 2XQ3A 5FXXA 3KFWX 3Q5XA 4YFSA 4AXPA 4ZEYA 1YW0A 3EABA 4KI0F 4NIQA 1T8BA 3I1AA 3BQKA 4I55E 2XQ9A 4COFA 5HEUA 2N9DA 4O8SA 2QGSA 2MBGA 2CE7A 2LHRA 4ZZBA 2WZIA 3HKBE 3LJCA 1XNRT 1E7PA 4Z91A 3MZKB 3WI3A 1HNZT 3RIUC 2V7KA 3D0TA 3P4PA 1WR0A 5AQLB 1IJ6A 3AE4A 4AQFC 4NXMT 2LKGA 3P8CD 1AJ3A 4HFVA 1E1HB 3TKLB 1OWAA 2V26A 4M1PA 4CN4A 4X62T 4ZI2C 2AE9A 4AKGA 3QUJA 1UK5A 2L8KA 4O4LE 3HL6A 1D1AA 3HA4A 3RQUA 4DR6T 4CI2B 3Q5DA 4LF7T 4B3ST 2E5LT 2JIWA 2CXFA 4WBOA 4ZI3C 4PW8A 4AIUA 2MOZA 4OFZA 3U3IA 5LCYA 4JI6T 2XQ5A 4QX8B 3WAJA
chains in the Genus database with same CATH topology
2SPCA 2RA1A 3P7IA 4H9OC 3OYXA 4DO0A 4EAHA 1BR0A 3RKOA 2K9AA 3CVRA 2WAUA 2Y6XA 4AQFA 4CXXA 2X9YA 1X79A 3GWHA 4X1KE 3CQCB 4EYYR 3H3AA 3FB2A 1EZ3A 3ZJ2A 2MTQA 2PFVA 3MA9A 5EK4A 5JDNA 2G0UA 4IIJE 4MALA 3C4ZA 2W00A 4BAYB 1MNDA 3RC3A 4UIGA 2JJ9A 3BQLA 5JDQA 5J2TE 3GN5A 3AAEB 1ZHCA 4TV8E 4BA9A 3C4XA 3N5LA 2YEVC 3CKDA 3KV9A 2LSKA 4H9RC 4OYKA 2KWIB 4H9SE 2ODVA 1OXZA 4O2BE 1LVFA 3F31A 2DCFA 5FXZA 1FIOA 2ZM8A 4C90A 2KWHA 4EB6E 5KX5E 3ANWB 4E7ZA 1IJ5A 5F8PA 3MACA 4I50E 2B1EA 1B7TA 2DNXA 4PK6A 5JR9B 2M67A 5DQWA 5JVDE 5JR9C 1IAPA 4EIWA 1HTJF 2WSSV 1LKXA 3AAIA 3UFEA 4X20E 5LGTB 2K48A 3ZC1A 3PTRB 5HWYA 2CMRA 1BR2A 2NWBA 3BQIA 4DVDA 1V9DA 3LK42 4ILUA 5LHGB 4H9PC 3DP7A 2I59A 5L3BB 2KZ7B 4G63A 4TN7B 3PE0A 2C0SA 5JRCB 3Q9DA 2EHOD 5FY0A 2LM9A 1LVKA 2LEHA 2L9QA 4QWNB 4TZ4C 3T8OA 3N9QA 4GIWA 2Y8DA 2BDEA 2ES0A 3AVRA 3I9YA 3SRZA 3N9PA 3E0ZA 2D0TA 5JDHA 3OYZA 4QHOA 2CXDA 2YK0A 4PAGA 2V1DB 2W0GA 3DJBA 2LSGA 4YJ3E 3OJAA 4OK0A 3O4XE 4PFOA 5L3EB 3C51A 1MMDA 3RPUA 3S4UA 2ZM0A 2NP9A 4L5GA 5JDMA 2X68A 2X51A 3ZMUB 5CA1E 2GK9A 4IE4A 4N78D 5HYAA 3KVAA 3NRXA 3AAAB 3UUMA 2NOXA 2V7MA 2RP4A 3K3OA 1MIVA 2WWUA 3K8PC 4AKHA 4P0AA 2KT9A 2CXLA 2PJQA 4P09A 3NZPA 4X1YE 3KV6A 1HX8A 4MLKA 5HXSA 1G8XA 2EHOA 2XAJB 2Q9QB 4ZI3D 4HGAA 2DWGA 3U78A 4CI3B 5LHHB 4ISTA 3KDSE 1HS7A 3FXEB 2ACXA 2C5KT 4QKNA 2JQQA 3AA6B 2DWKA 1D0XA 2VK9A 3C64A 1US7B 4TX5A 3F2EA 4XBFB 4UV8B 4JEUB 3ZEFB 1YD8G 2V7IA 4HKAA 5AFUL 5JH7E 3UUXB 2JPFA 2L3LA 3ZLIA 2V7JA 5DABA 2LOPA 4PJNA 4ZS3A 3CX7B 4IE7A 2A72A 1FMVA 3LK2B 1ZEEA 2X9XA 4IGUA 4AKLA 3H37A 3PUGA 4QXBB 3ESLA 3M65A 5DJQC 3WAKA 2A2FX 4KMCA 3I0OA 3ZYLA 4JEHB 4ISSA 3SWHA 1SHZC 4DMWA 5ADXL 2WMNA 4V1Av 3VKGA 2D0UA 2IW5B 1HFAA 3N9LA 5L2LA 5FYMA 4GYSA 4AKGA 3RX6A 3K3NA 4ZS2A 2PBIA 3J9X1 1WR6A 3PURA 4MHCA 3O1JA 4GYRA 1WLXA 4CXYA 3UULA 3HKCE 2VKJA 1U4QA 4NUVA 4PJLA 3HR0A 4QX7B 2D5UA 5ETWA 5LP6E 3GMIA 3ZYMA 2KMFA 4UVAB 1D1BA 2NW7A 4HE8A 2C5IT 1QUUA 1CUNA 2DLRA 1WYCA 3V5SA 5EK3A 1S35A 5C8YE 4DBQA 4PJJA 4AKIA 4A56A 2IC9A 2CWOA 3AB3B 3E08A 3ZN1B 4ZI2D 1T98A 2WBLA 2YU1A 3KBTA 3ZMVB 4EZHA 4CI1B 5LHIB 5LG4A 2OA5A 3ONXA 3RYCE 3B13A 3DTOA 4EOZB 5BMVE 2IAKA 2JRKA 3L3PA 3ETUA 4MBQA 2A3DA 5J2UE 2X9WA 2XUEA 3FHNA 5FXVA 2VB6A 5HAXA 2YU2A 3CWZB 5L3CB 3KBUA 4KP3C 3LK3B 5E0OA 4H63V 4ANJA 4JLEA 4UVBB 2E8IA 4DNDA 3UTKA 1U5PA 2HPJA 2H7VC 2LSIA 2VL8A 2XAGB 5JRCA 4EZ4A 2V7LA 5KDMC 4PNIA 1VRBA 1HF8A 2LSJA 1WYBA 3IEEA 4PJMA 5LOVE 4F6RC 4IE0A 1LRZA 2ZM2A 5JREA 4BJMA 5HXHA 2P9BA 2VKHA 4UF0A 3RYFE 4Z8XA 3V5UA 4OYJA 4TV9E 5JDLA 5H6RB 2NW8A 3NZQA 2LOSA 5HXEA 5M4YA 4YHJA 1ZV4X 3Q2MA 5HXCA 5IYZE 4AQGA 4H9QC 2BZBA 2UXXB 1KK7A 1QSDA 3EDUA 4BJNA 2KXPB 4XZCA 5LXTE 4FJOA 4UV9B 1MIYA 1IZNB 2VKOA 2Z6EA 3FXDB 2NW9A 1D0ZA 2LE8A 4UVCB 5CA0E 2XQYA 3CPZA 3UUNA 1BR4A 2JMHA 3FBLA 3ZJ1A 4QXCB 3RRCA 2LHNA 3VU7H 4L9IA 2ZMAA 2XAFB 3SS1A 3N2KE 4O4JE 1FEWA 3R84B 1NWMX 5LBQB 3F57A 4O2AE 1HCIA 2NTYA 5FNVE 3C4WA 3C98B 2KNDA 4EXTA 2CA5A 4I4TE 4UEMA 3O1HA 3N9OA 3ZMZB 3I0QA 5L3FB 2CM0A 1VOMA 3NBXX 2Q9QD 4H63H 5LNKA 1YKHB 2X9HA 3KVBA 5FMNA 2EHOC 3L09A 3PUSA 3KV4A 5L3GB 3IHRA 1UX4A 4HN9A 4I43B 4CXWA 3LBXA 4MFRA 3A5XA 4KBMB 3PUQA 4ZHQE 3BK9A 2W63A 4U72A 2E9XD 3EVYA 1D0YA 3ZPOA 3CX6B 5LYJE 2XASB 2E9XC 2IC6A 4X1IE 4ADZA 3N9NA 5CB4E 3EUHA 4UXNB 3LFMA 3LBXB 5FY1A 4UELA 5L3DB 5GONE 1Z0PA 3RC8A 5JR9A 3NRYA 4IDZA 2JMKA 2KINB 3RH3A 4G2AA 3QC9A 3ZN0B 1UX5A 2LJLA 3CQGB 2H3RA 1NAFA 4K0UA 2W62A 3HI2A 2CWYA 3O1IA 5LBMA 5JQGE 5JDFA 1ZKEA 3N2GE 3Q5WA 5FP3A 2CLYC 3PU8A 2XAHB 4IE5A 5HXRA 3J7Yq 2CLYB 3HKDE 3C50A 3HKEE 3I9WA 2E9XA 2N1GA 4PFPA 3ANWA 2VWAA 3GN5B 5LA6E 1BR1A 1WRDA 2PG8A 1S94A 2W61A 4YJ2E 5LGNB 3MK7C 1KNZA 2MYSA 4E7SA 3RRWA 2BVLA 3GA8A 3N9MA 3KV5A 3JC6C 1HG2A 1SA0E 5FY7A 4NUUA 4H9NC 3PDYA 4DBRA 4P0BA 2WMOA 2DI4A 4U74A 4YLHA 4WNKA 2HH7A 1YKEB 3ZYKA 3ZMSB 1D1CA 4WBNE 5LJNA 3AA0B 2E9XB 4GK5E 3R6NA 4IHJE 3KINB 5JDGA 1Y64B 3RYHE 2C5JA 4HEAA 3IBPA 5DQVA 1FMWA 2DHRA 3N2OA 5HWXA 5FXWA 2K24A 5J1GA 4PK5A 3PU3A 5LGUB 5H6QB 3W15B 2HPLA 5F3JA 2X67A 4J2CA 3JC6D 4ZOLE 3RYIE 4O4HE 3ZCJA 3B57A 4UF0B 4CZZB 1MNEA 3PUAA 1H7CA 2VASA 3CMLA 4FI5A 4KUMB 3ETVA 3MJXA 3AVSA 4C91A 4O4IE 4TUYE 2UXNB 4QXHB 4WW0A 4ZI7E 5KMGP 5TAOA 2XAQB 2N2NA 3K3QC 3VHLA 3VKHA 3FBZA 2CEAA 5A1LA 2H7OA 1MMAA 2EHOB 3ZC0A 1HG5A 3ZMTB 3CX8B 3MKDA 2D2SA 2NTXA 2XHEB 4OHFA 3LG7A 4GOUA 4ASKA 1G73A 2X66A 4AKRB 3SOLA 4L0RA 3ZCIA 2WM9A 3CQXC 2YINA 2J1DG 2LT3A 4AI6A 2Q9QC 4JUYA 2Q9QA 4ERRA 4CQIA 2QA7A 3E22E 4HTEA 1MIWA 3AA1B 1MMGA 3IF8B 2VKDA 4B6XA 4DMVA 2CCQA 5EK2A 5IHYA 5LJMA 2LSYA 2KLQA 4XAXB 3MXZA 4GK0E 2BVMA 5EZYE 2ODUA 3EDVA 3QK6A 2X0LB 1UCUA 2ZLYA 2XTLA 3AA7B 4IE6A 3O9XA 1MMNA 1O3XA 2K5BB 3UT5E 4PK4A 3OKQA 4EYUA 3OBVE 5FXXA 3KFWX 3Q5XA 4YFSA 4AXPA 1YW0A 3I1AA 3BQKA 4I55E 2N9DA 4O8SA 2QGSA 2MBGA 2CE7A 2LHRA 3HKBE 3LJCA 3MZKB 3WI3A 2V7KA 3D0TA 1IJ6A 4AQFC 3P8CD 1AJ3A 4HFVA 1E1HB 3TKLB 1OWAA 2V26A 4M1PA 4ZI2C 3QUJA 2L8KA 4O4LE 3HL6A 1D1AA 3HA4A 4CI2B 2CXFA 4WBOA 4ZI3C 4PW8A 2MOZA 4OFZA 3U3IA 5LCYA 2Y48B 4QX8B 3WAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0G A;  2K5B B;  1US7 B; 
#chains in the Genus database with same CATH topology
 2V5D A;  3PUY F;  3UQ4 A;  2SPC A;  2RA1 A;  3P7I A;  4H9O C;  3ZT7 A;  3OYX A;  4DO0 A;  4EAH A;  1BR0 A;  3RKO A;  2K9A A;  5HCM A;  3CVR A;  2WAU A;  2Y6X A;  4AQF A;  4CXX A;  1KFY A;  2X9Y A;  1X79 A;  3GWH A;  4X1K E;  3CQC B;  4CN1 A;  4EYY R;  3H3A A;  3FB2 A;  1EZ3 A;  2FJD A;  2QVA A;  2V6Y A;  3AE2 A;  3ZJ2 A;  2MTQ A;  2PFV A;  3RF1 A;  3VR9 A;  4K0K T;  4LF8 T;  3MA9 A;  5EK4 A;  1VCT A;  5JDN A;  2G0U A;  4IIJ E;  4MAL A;  2YN6 A;  3C4Z A;  2W00 A;  4BAY B;  1MND A;  3RC3 A;  4UIG A;  2BG9 A;  2JJ9 A;  3BQL A;  5JDQ A;  5J2T E;  3EI0 A;  3M3Z B;  3GN5 A;  3AAE B;  4I0U A;  1ZHC A;  3SFD A;  3ZSS A;  4TV8 E;  4BA9 A;  3C4X A;  3N5L A;  2YEV C;  3CKD A;  3KV9 A;  1OED B;  2LSK A;  4H9R C;  4P1N A;  5LB7 B;  3UU5 A;  4OYK A;  2X0Y A;  2KWI B;  1VCS A;  2R6G F;  2ODV A;  1OXZ A;  4H9S E;  1LVF A;  3F31 A;  4O2B E;  2DCF A;  4YTM A;  5HCJ A;  3RYF E;  5FXZ A;  2XZE A;  1FIO A;  2ZM8 A;  4C90 A;  2KWH A;  4EB6 E;  2XM2 A;  3ANW B;  4E7Z A;  5KX5 E;  3QOF A;  1XNQ T;  1IJ5 A;  5F8P A;  3MAC A;  4I50 E;  2B1E A;  1B7T A;  2DNX A;  3NKZ A;  4PK6 A;  5AQP B;  5JR9 B;  2M67 A;  5DQW A;  1X9B A;  5JVD E;  2AXD S;  5JR9 C;  1IAP A;  5L4E A;  4A98 A;  4CN6 A;  4EIW A;  1HTJ F;  2M6I A;  3JCF A;  3V5U A;  1XDP A;  1LKX A;  2WSS V;  3AAI A;  3UFE A;  2WDR A;  4X65 T;  4X20 E;  5LGT B;  1XMQ T;  2K48 A;  4U33 A;  3PTR B;  3ZC1 A;  1N32 T;  3ZST A;  4HWI B;  5HWY A;  3ONJ A;  2CMR A;  1BR2 A;  2NWB A;  3BQI A;  4DVD A;  4DV6 T;  1V9D A;  3LK4 2;  4A5X A;  4ILU A;  3EHZ A;  5LHG B;  4H9P C;  3DP7 A;  2I59 A;  3P50 A;  2KZ7 B;  4G63 A;  4TN7 B;  3PE0 A;  5L3B B;  2F4V T;  2C0S A;  4DV5 T;  3RQW A;  5JRC B;  3QB5 K;  3Q9D A;  4U7I A;  2EHO D;  5FY0 A;  2LM9 A;  1LVK A;  2LEH A;  1YQ3 A;  1UGO A;  2L9Q A;  4QWN B;  4TZ4 C;  3T8O A;  3N9Q A;  4GIW A;  4KHP T;  1SE7 A;  2BDE A;  2ES0 A;  2Y8D A;  3AVR A;  3I9Y A;  2JQH A;  3E0Z A;  2CPT A;  2D0T A;  3N9P A;  4QH5 A;  5FVL A;  4HWH A;  3OYZ A;  4QHO A;  2CXD A;  2YK0 A;  4PAG A;  2V1D B;  2W0G A;  4HFI A;  3DJB A;  2LSG A;  4YJ3 E;  3OJA A;  2XSA A;  3O4X E;  4IL4 A;  4OK0 A;  1JNR A;  1W9R A;  4PFO A;  5L3E B;  3C51 A;  1MMD A;  2XQ8 A;  3RPU A;  3S4U A;  2ZM0 A;  2NP9 A;  4L5G A;  5JDM A;  2X68 A;  2X51 A;  3ZMU B;  5CA1 E;  2GK9 A;  4IE4 A;  4N78 D;  4JI2 T;  4YHH T;  1IBL T;  3PV0 F;  5HYA A;  1R8I A;  3KVA A;  3A7M A;  3NRX A;  3AAA B;  3UUM A;  3VHL A;  2NOX A;  2V7M A;  2RP4 A;  3K3O A;  1WFD A;  3TLU A;  4DUZ T;  4AQY T;  1I94 T;  4JI8 T;  1MIV A;  2WWU A;  3K8P C;  4AKH A;  2BG9 E;  4P0A A;  2KT9 A;  3FZF B;  2CXL A;  4JYA T;  2PJQ A;  4P09 A;  3NZP A;  4U2Z A;  4X1Y E;  5AQV B;  3KV6 A;  1HX8 A;  4MLK A;  1XWM A;  3PUX F;  1G8X A;  2EHO A;  2XAJ B;  2Q9Q B;  5L4H A;  2XQ6 A;  4ZI3 D;  5HXS A;  4LFC T;  4HGA A;  2DWG A;  3U78 A;  4CI3 B;  5LHH B;  4IST A;  4A97 A;  3KDS E;  1HS7 A;  3FXE B;  2HHH T;  4HFB A;  2ACX A;  2C5K T;  4QKN A;  2JQK A;  4YSY A;  1XMO T;  2JQQ A;  2UU9 T;  1N33 T;  2HN2 A;  2JQ9 A;  3AA6 B;  3TLW A;  3Q5E A;  1CHU A;  1D0X A;  2DWK A;  2VK9 A;  4TNW A;  3C64 A;  2UUB T;  3ZC0 A;  1GQE A;  3QB5 A;  3UU3 A;  4DV7 T;  1US7 B;  4TX5 A;  3F2E A;  5F5W A;  4XBF B;  4UV8 B;  4JEU B;  2WB5 A;  3ZEF B;  3PUV F;  4LF5 T;  4TWD A;  1L0V A;  1YD8 G;  4ILC A;  5ABH A;  2XJ7 A;  2V7I A;  4HKA A;  4HWD A;  5AFU L;  5JH7 E;  2W4X A;  2FUP A;  3UUX B;  2JPF A;  3NVO A;  2L3L A;  3ZLI A;  2V7J A;  5DAB A;  4IDQ A;  4AIS A;  2LOP A;  3UU6 A;  2VQF T;  4PJN A;  3ABV A;  4LFB T;  1E2A A;  4ZS3 A;  5HEO A;  3CX7 B;  4IE7 A;  2A72 A;  2A9U A;  2CHN A;  4YTN A;  1FMV A;  1NEN A;  1ZEE A;  2X9X A;  1KNP A;  2HN1 A;  3AEG A;  3LK2 B;  3H37 A;  2FJA A;  3PUG A;  4AKL A;  4QXB B;  3ESL A;  3M65 A;  5DJQ C;  3WAK A;  2A2F X;  4KMC A;  3I0O A;  3AE5 A;  3ZYL A;  4DR7 T;  4JEH B;  4ISS A;  3SWH A;  1SHZ C;  3AEB A;  4X66 T;  4DMW A;  5ADX L;  2WMN A;  4V1A v;  2IUB A;  4WYV A;  4F8H A;  3VKG A;  1UUS A;  2D0U A;  1HFA A;  1T7S A;  3N9L A;  1XZY A;  4GYS A;  5FYM A;  5HEG A;  2IW5 B;  3RX6 A;  4EEB A;  3K3N A;  4ZS2 A;  2PBI A;  3J9X 1;  1WR6 A;  3PUR A;  3CIR A;  4MHC A;  3O1J A;  4GYR A;  1WLX A;  5FKY A;  4IDO A;  4CXY A;  3PUZ F;  3UUL A;  3HKC E;  2VKJ A;  2UUC T;  1JNZ A;  1U4Q A;  3FZM B;  4NUV A;  4PJL A;  3HR0 A;  4QX7 B;  2D5U A;  5ETW A;  5LP6 E;  4LMK A;  2UXC T;  1IBM T;  3GMI A;  2DL1 A;  5LMN T;  3ZYM A;  2KMF A;  2Y48 B;  1KEY A;  3P4S A;  4UVA B;  1D1B A;  2IIU A;  2NW7 A;  4HE8 A;  2C5I T;  1QUU A;  1CUN A;  2DLR A;  1YXR A;  1WYC A;  3V5S A;  5EK3 A;  3T1H T;  1S35 A;  3AE1 A;  5C8Y E;  4DBQ A;  4PJJ A;  1HNW T;  4AKI A;  4A56 A;  2IC9 A;  3B5M A;  2CWO A;  1XDO A;  3AB3 B;  3CK6 A;  3E08 A;  4HFH A;  3ZN1 B;  4ZI2 D;  4OX9 T;  1T98 A;  2WBL A;  2ZM6 T;  4IL9 A;  1KF6 A;  2YU1 A;  3KBT A;  4Q25 A;  3ZMV B;  4U2Y A;  4EZH A;  2D9D A;  2BS4 A;  4EED A;  4CI1 B;  5LG4 A;  5LHI B;  2OA5 A;  5AQR B;  3UUB A;  3ONX A;  3RYC E;  3B13 A;  3DTO A;  4IRE A;  4EOZ B;  5BMV E;  2IAK A;  2JRK A;  2BKO A;  3L3P A;  3ETU A;  4MBQ A;  4HWF A;  3SFE A;  3P4W A;  2A3D A;  5J2U E;  2X9W A;  2XUE A;  4YSX A;  3FHN A;  3RIF A;  5FXV A;  1OED C;  2VB6 A;  5FL0 A;  3OTO T;  3P4Q A;  5HAX A;  2YU2 A;  4B3R T;  3CWZ B;  5L3C B;  3OVU A;  3KBU A;  4KP3 C;  3LK3 B;  5E0O A;  4H63 V;  2CHO A;  4JLE A;  4ANJ A;  4UVB B;  5IUX A;  2E8I A;  1N34 T;  1ZP0 A;  4DND A;  2LLY A;  3UTK A;  1U5P A;  2HPJ A;  2H7V C;  2LSI A;  2VL8 A;  2XAG B;  4DR3 T;  5JRC A;  2BBH A;  2V7L A;  4EZ4 A;  5KDM C;  3AEC A;  1VRB A;  4PNI A;  1HF8 A;  2LSJ A;  4TWF A;  4DID B;  2VL0 A;  1WYB A;  3IEE A;  1FJG T;  4PJM A;  5LOV E;  4F6R C;  4IE0 A;  1LRZ A;  5JDH A;  2ACZ A;  2B76 A;  2ZM2 A;  4HFC A;  4QH4 A;  4BJM A;  5JRE A;  5HXH A;  2P9B A;  2VKH A;  2VVS A;  2PTF A;  4UF0 A;  4Z8X A;  3A8Y C;  3QNU A;  4OYJ A;  4TV9 E;  4X5T A;  5ABG A;  3IA3 A;  2NW8 A;  3NZQ A;  2LOS A;  5H6R B;  5HXE A;  5JDL A;  5M4Y A;  5L2L A;  4YHJ A;  1ZV4 X;  2WQY A;  3Q2M A;  5HXC A;  5IYZ E;  4AQG A;  2J47 A;  2WCA A;  4H9Q C;  1UUR A;  5FVK A;  2BZB A;  4ILB A;  2UXX B;  1KK7 A;  3RGL A;  4NXN T;  3RLF F;  1QSD A;  3K1S A;  3EDU A;  4BJN A;  2KXP B;  2J62 A;  4XZC A;  4FJO A;  5AQT B;  4UV9 B;  5LXT E;  1MIY A;  1IZN B;  3P4R A;  3X1D A;  3T1Y T;  4JV5 T;  4JI5 T;  2VKO A;  2Z6E A;  3FXD B;  2NW9 A;  1D0Z A;  2LE8 A;  2MAW A;  2V6Y B;  3L39 A;  2XQY A;  2XQ4 A;  2FBW A;  3CPZ A;  4UVC B;  1BR4 A;  2JMH A;  2OLT A;  3UUN A;  3FZK B;  5ABF B;  3FBL A;  3VR8 A;  1QLB A;  3ZJ1 A;  4QXC B;  3RRC A;  4U3C A;  2LHN A;  3SRZ A;  2W66 A;  2ZMA A;  2XAF B;  4L9I A;  3SS1 A;  3N2K E;  4O4J E;  3VU7 H;  4IDN A;  5LG3 A;  1I6Z A;  1FEW A;  2IML A;  3R84 B;  1NWM X;  5LBQ B;  4LFA T;  3F57 A;  4O2A E;  2UXB T;  4EV6 A;  1HCI A;  2NTY A;  2X0H A;  3C4W A;  5FNV E;  3C98 B;  2KND A;  2BKP A;  2CA5 A;  4EXT A;  2WY2 A;  4I4T E;  4UEM A;  3TLT A;  3O1H A;  3UQ7 A;  3N9O A;  4JI3 T;  1DU2 A;  3ZMZ B;  2E5V A;  3I0Q A;  5L3F B;  4B3M T;  4JI1 T;  2CM0 A;  3AXJ B;  1VOM A;  3NBX X;  2Q9Q D;  4H63 H;  5LNK A;  2UXD T;  1YKH B;  2X9H A;  3KVB A;  5FMN A;  1Y01 A;  2FJB A;  2EHO C;  3L09 A;  4TNV A;  3UU8 A;  5J0Z A;  4DR1 T;  3PUS A;  4B3T T;  3KV4 A;  2IHR 1;  5ABF A;  5AQI B;  5AQM B;  5L3G B;  3IHR A;  1UX4 A;  4HN9 A;  4I43 B;  4ZXL A;  3LBX A;  4MFR A;  3A5X A;  4KBM B;  3PUQ A;  4CXW A;  4ZHQ E;  1HX1 B;  4U31 A;  3BK9 A;  2WZH A;  2W63 A;  4U72 A;  2E9X D;  3AEF A;  3EVY A;  1D0Y A;  4QH1 A;  3AE9 A;  3UFG A;  2XM1 A;  3ZPO A;  3CX6 B;  1HNX T;  4DR4 T;  2XSB A;  4JI4 T;  5LYJ E;  2XAS B;  2E9X C;  2IC6 A;  4WZX A;  4X1I E;  2QYW A;  3N9N A;  4ADZ A;  5CB4 E;  5FL1 A;  3EUH A;  5LMU T;  4HFD A;  5ABE A;  4UXN B;  3LFM A;  4DR5 T;  3LBX B;  5FY1 A;  3H3M A;  4UEL A;  5C2T A;  4LF4 T;  5L3D B;  5GON E;  1Z0P A;  3PJA J;  3RC8 A;  2CBI A;  3NRY A;  4IDZ A;  5JR9 A;  2JMK A;  2KIN B;  4U7Y A;  4G2A A;  3RH3 A;  3RKG A;  2WS3 A;  3AE8 A;  2LRK A;  3QC9 A;  2BG9 B;  4ILA A;  3PUW F;  1UX5 A;  2LJL A;  2BS2 A;  3CQG B;  3ZN0 B;  4DV0 T;  2H3R A;  1NAF A;  3TLS A;  2WDQ A;  4K0U A;  3RIA A;  3AE3 A;  2WDV A;  3LDQ B;  5CFB A;  2W62 A;  3HI2 A;  2CWY A;  3O1I A;  5LBM A;  5JQG E;  5JDF A;  4YY3 T;  1Z8U A;  1ZKE A;  3N2G E;  3Q5W A;  4HWC A;  4NPP A;  5FP3 A;  2CLY C;  3PU8 A;  4LF9 T;  2NR4 A;  2XAH B;  4IE5 A;  5HXR A;  1NEK A;  3J7Y q;  2H89 A;  2CLY B;  2I0M A;  3HKD E;  3C50 A;  3HKE E;  2YDS A;  2J4G A;  3ZKR A;  3I9W A;  4DV3 T;  2E9X A;  2UUA T;  2N1G A;  4PFP A;  5HEJ A;  2I6H A;  2VWA A;  3ANW A;  3GN5 B;  3OPC A;  1BR1 A;  1WRD A;  1T72 A;  2PG8 A;  4IT4 A;  2XPK A;  4UR9 A;  1S94 A;  2W61 A;  4YJ2 E;  5LGN B;  4DV4 T;  2V5C A;  1J5E T;  3MK7 C;  2LRL A;  2QRX A;  1KNZ A;  2MYS A;  4E7S A;  3RRW A;  2BVL A;  3GA8 A;  5AQJ B;  1OED A;  2XQ7 A;  3N9M A;  3KV5 A;  2VQE T;  3JC6 C;  4DV1 T;  3RHW A;  1HG2 A;  1SA0 E;  2H88 A;  5FY7 A;  4NUU A;  2BKN A;  4H9N C;  3PDY A;  4DBR A;  3FZH B;  4P0B A;  2WMO A;  3AEE A;  3VRB A;  2DI4 A;  2LKH A;  4U74 A;  4YLH A;  4WNK A;  2HH7 A;  1J1J A;  1YKE B;  2RPA A;  5AQO B;  3ZYK A;  1KNR A;  3ZT6 A;  2VVN A;  4JBW F;  5AQS B;  3ZMS B;  1D1C A;  4WBN E;  5LJN A;  2E2A A;  3AA0 B;  2E9X B;  4GK5 E;  4LML A;  3R6N A;  4IHJ E;  4YSZ A;  3G06 A;  3KIN B;  5JDG A;  4LF6 T;  1Y64 B;  5AQQ B;  3RYH E;  2C5J A;  4HEA A;  3AEA A;  5JTG A;  3AE7 A;  4EGW A;  2BBJ A;  5C3J A;  3IBP A;  4KX6 A;  5DQV A;  1FMW A;  2DHR A;  3RI5 A;  2IDO B;  3N2O A;  1ZOY A;  2CRB A;  4IDP A;  1W0A A;  2BG9 C;  5FXW A;  3ONL C;  2K24 A;  2V6X A;  5J1G A;  5HWX A;  5BR8 T;  4PK5 A;  3AE6 A;  3FZL B;  3PU3 A;  2YKS A;  5H6Q B;  5LGU B;  4JI0 T;  3W15 B;  3AXJ A;  4LMJ A;  2WP9 A;  2HPL A;  5CGM A;  5F3J A;  2FJE A;  2X67 A;  4J2C A;  3JC6 D;  4ZOL E;  3RYI E;  3NWI A;  1J5W A;  4O4H E;  3UU4 A;  3B57 A;  3JAD A;  4UF0 B;  3ZCJ A;  1MNE A;  3PUA A;  1H7C A;  2VAS A;  2W2U A;  3CML A;  4FI5 A;  4CZZ B;  4KUM B;  3TLV A;  2LM2 A;  2YDQ A;  3ETV A;  3MJX A;  3ZT5 A;  3AVS A;  5IWA T;  2YDR A;  4C91 A;  4GKJ T;  4O4I E;  5AQH B;  4TUY E;  2UXN B;  5CA0 E;  1M7K A;  5HEH A;  3VRA A;  4QXH B;  4WW0 A;  4JI7 T;  4GKK T;  4ZI7 E;  2YOE A;  4YTP A;  5L47 A;  5KMG P;  5TAO A;  3EAM A;  2W67 A;  2XAQ B;  2N2N A;  2WU2 A;  3K3Q C;  1SUM B;  1W0B A;  1W09 A;  1WCR A;  1YQ4 A;  3FBZ A;  2CEA A;  4TWH A;  2MPK A;  3VKH A;  2M6B A;  5A1L A;  2H7O A;  1MMA A;  2EHO B;  2XY8 B;  3LSV A;  1HG5 A;  4Z90 A;  3ZMT B;  4X64 T;  1HR0 T;  3CX8 B;  2XQA A;  3MKD A;  2D2S A;  2BS3 A;  2NTX A;  3L8R A;  2XHE B;  4YT0 A;  4OHF A;  3LG7 A;  4GOU A;  5AQU B;  4ASK A;  1G73 A;  2X66 A;  4KHZ F;  4YXD A;  5AQN B;  4AKR B;  3SOL A;  4L0R A;  3ZCI A;  2WM9 A;  2CBJ A;  3CQX C;  3PJA A;  2YIN A;  3JAE A;  2J1D G;  2LT3 A;  4AI6 A;  2Q9Q C;  4JUY A;  2Q9Q A;  4ERR A;  2WU5 A;  4CQI A;  2WWV A;  5AQK B;  2QA7 A;  4HFE A;  1M62 A;  3E22 E;  1N36 T;  4HTE A;  1IBK T;  2V8S V;  1OED E;  2VUR A;  5AQF B;  3RIU A;  4DV2 T;  1MIW A;  3AA1 B;  1MMG A;  2KSR A;  3IF8 B;  2VKD A;  5LA6 E;  4B6X A;  2CCQ A;  4DMV A;  5IHY A;  5AQG B;  5EK2 A;  2LSY A;  2KLQ A;  4ZZC A;  5LJM A;  3JAF A;  4XAX B;  3MXZ A;  4GK0 E;  4IGU A;  2BVM A;  3AED A;  5EZY E;  2ODU A;  3EDV A;  3QK6 A;  2OV9 A;  2X0L B;  5KXJ A;  1UCU A;  2ZLY A;  2XTL A;  3AA7 B;  4IE6 A;  3O9X A;  1MMN A;  1O3X A;  2K5B B;  3UT5 E;  4PK4 A;  5CJ5 A;  3OKQ A;  2K3W A;  4DUY T;  4DR2 T;  4EYU A;  3OBV E;  2XQ3 A;  5FXX A;  3KFW X;  3Q5X A;  4YFS A;  4AXP A;  4ZEY A;  1YW0 A;  3EAB A;  4KI0 F;  4NIQ A;  1T8B A;  3I1A A;  3BQK A;  4I55 E;  2XQ9 A;  4COF A;  5HEU A;  2N9D A;  4O8S A;  2QGS A;  2MBG A;  2CE7 A;  2LHR A;  4ZZB A;  2WZI A;  3HKB E;  3LJC A;  1XNR T;  1E7P A;  4Z91 A;  3MZK B;  3WI3 A;  1HNZ T;  3RIU C;  2V7K A;  3D0T A;  3P4P A;  1WR0 A;  5AQL B;  1IJ6 A;  3AE4 A;  4AQF C;  4NXM T;  2LKG A;  3P8C D;  1AJ3 A;  4HFV A;  1E1H B;  3TKL B;  1OWA A;  2V26 A;  4M1P A;  4CN4 A;  4X62 T;  4ZI2 C;  2AE9 A;  4AKG A;  3QUJ A;  1UK5 A;  2L8K A;  4O4L E;  3HL6 A;  1D1A A;  3HA4 A;  3RQU A;  4DR6 T;  4CI2 B;  3Q5D A;  4LF7 T;  4B3S T;  2E5L T;  2JIW A;  2CXF A;  4WBO A;  4ZI3 C;  4PW8 A;  4AIU A;  2MOZ A;  4OFZ A;  3U3I A;  5LCY A;  4JI6 T;  2XQ5 A;  4QX8 B;  3WAJ A; 
#chains in the Genus database with same CATH homology
 2SPC A;  2RA1 A;  3P7I A;  4H9O C;  3OYX A;  4DO0 A;  4EAH A;  1BR0 A;  3RKO A;  2K9A A;  3CVR A;  2WAU A;  2Y6X A;  4AQF A;  4CXX A;  2X9Y A;  1X79 A;  3GWH A;  4X1K E;  3CQC B;  4EYY R;  3H3A A;  3FB2 A;  1EZ3 A;  3ZJ2 A;  2MTQ A;  2PFV A;  3MA9 A;  5EK4 A;  5JDN A;  2G0U A;  4IIJ E;  4MAL A;  3C4Z A;  2W00 A;  4BAY B;  1MND A;  3RC3 A;  4UIG A;  2JJ9 A;  3BQL A;  5JDQ A;  5J2T E;  3GN5 A;  3AAE B;  1ZHC A;  4TV8 E;  4BA9 A;  3C4X A;  3N5L A;  2YEV C;  3CKD A;  3KV9 A;  2LSK A;  4H9R C;  4OYK A;  2KWI B;  4H9S E;  2ODV A;  1OXZ A;  4O2B E;  1LVF A;  3F31 A;  2DCF A;  5FXZ A;  1FIO A;  2ZM8 A;  4C90 A;  2KWH A;  4EB6 E;  5KX5 E;  3ANW B;  4E7Z A;  1IJ5 A;  5F8P A;  3MAC A;  4I50 E;  2B1E A;  1B7T A;  2DNX A;  4PK6 A;  5JR9 B;  2M67 A;  5DQW A;  5JVD E;  5JR9 C;  1IAP A;  4EIW A;  1HTJ F;  2WSS V;  1LKX A;  3AAI A;  3UFE A;  4X20 E;  5LGT B;  2K48 A;  3ZC1 A;  3PTR B;  5HWY A;  2CMR A;  1BR2 A;  2NWB A;  3BQI A;  4DVD A;  1V9D A;  3LK4 2;  4ILU A;  5LHG B;  4H9P C;  3DP7 A;  2I59 A;  5L3B B;  2KZ7 B;  4G63 A;  4TN7 B;  3PE0 A;  2C0S A;  5JRC B;  3Q9D A;  2EHO D;  5FY0 A;  2LM9 A;  1LVK A;  2LEH A;  2L9Q A;  4QWN B;  4TZ4 C;  3T8O A;  3N9Q A;  4GIW A;  2Y8D A;  2BDE A;  2ES0 A;  3AVR A;  3I9Y A;  3SRZ A;  3N9P A;  3E0Z A;  2D0T A;  5JDH A;  3OYZ A;  4QHO A;  2CXD A;  2YK0 A;  4PAG A;  2V1D B;  2W0G A;  3DJB A;  2LSG A;  4YJ3 E;  3OJA A;  4OK0 A;  3O4X E;  4PFO A;  5L3E B;  3C51 A;  1MMD A;  3RPU A;  3S4U A;  2ZM0 A;  2NP9 A;  4L5G A;  5JDM A;  2X68 A;  2X51 A;  3ZMU B;  5CA1 E;  2GK9 A;  4IE4 A;  4N78 D;  5HYA A;  3KVA A;  3NRX A;  3AAA B;  3UUM A;  2NOX A;  2V7M A;  2RP4 A;  3K3O A;  1MIV A;  2WWU A;  3K8P C;  4AKH A;  4P0A A;  2KT9 A;  2CXL A;  2PJQ A;  4P09 A;  3NZP A;  4X1Y E;  3KV6 A;  1HX8 A;  4MLK A;  5HXS A;  1G8X A;  2EHO A;  2XAJ B;  2Q9Q B;  4ZI3 D;  4HGA A;  2DWG A;  3U78 A;  4CI3 B;  5LHH B;  4IST A;  3KDS E;  1HS7 A;  3FXE B;  2ACX A;  2C5K T;  4QKN A;  2JQQ A;  3AA6 B;  2DWK A;  1D0X A;  2VK9 A;  3C64 A;  1US7 B;  4TX5 A;  3F2E A;  4XBF B;  4UV8 B;  4JEU B;  3ZEF B;  1YD8 G;  2V7I A;  4HKA A;  5AFU L;  5JH7 E;  3UUX B;  2JPF A;  2L3L A;  3ZLI A;  2V7J A;  5DAB A;  2LOP A;  4PJN A;  4ZS3 A;  3CX7 B;  4IE7 A;  2A72 A;  1FMV A;  3LK2 B;  1ZEE A;  2X9X A;  4IGU A;  4AKL A;  3H37 A;  3PUG A;  4QXB B;  3ESL A;  3M65 A;  5DJQ C;  3WAK A;  2A2F X;  4KMC A;  3I0O A;  3ZYL A;  4JEH B;  4ISS A;  3SWH A;  1SHZ C;  4DMW A;  5ADX L;  2WMN A;  4V1A v;  3VKG A;  2D0U A;  2IW5 B;  1HFA A;  3N9L A;  5L2L A;  5FYM A;  4GYS A;  4AKG A;  3RX6 A;  3K3N A;  4ZS2 A;  2PBI A;  3J9X 1;  1WR6 A;  3PUR A;  4MHC A;  3O1J A;  4GYR A;  1WLX A;  4CXY A;  3UUL A;  3HKC E;  2VKJ A;  1U4Q A;  4NUV A;  4PJL A;  3HR0 A;  4QX7 B;  2D5U A;  5ETW A;  5LP6 E;  3GMI A;  3ZYM A;  2KMF A;  4UVA B;  1D1B A;  2NW7 A;  4HE8 A;  2C5I T;  1QUU A;  1CUN A;  2DLR A;  1WYC A;  3V5S A;  5EK3 A;  1S35 A;  5C8Y E;  4DBQ A;  4PJJ A;  4AKI A;  4A56 A;  2IC9 A;  2CWO A;  3AB3 B;  3E08 A;  3ZN1 B;  4ZI2 D;  1T98 A;  2WBL A;  2YU1 A;  3KBT A;  3ZMV B;  4EZH A;  4CI1 B;  5LHI B;  5LG4 A;  2OA5 A;  3ONX A;  3RYC E;  3B13 A;  3DTO A;  4EOZ B;  5BMV E;  2IAK A;  2JRK A;  3L3P A;  3ETU A;  4MBQ A;  2A3D A;  5J2U E;  2X9W A;  2XUE A;  3FHN A;  5FXV A;  2VB6 A;  5HAX A;  2YU2 A;  3CWZ B;  5L3C B;  3KBU A;  4KP3 C;  3LK3 B;  5E0O A;  4H63 V;  4ANJ A;  4JLE A;  4UVB B;  2E8I A;  4DND A;  3UTK A;  1U5P A;  2HPJ A;  2H7V C;  2LSI A;  2VL8 A;  2XAG B;  5JRC A;  4EZ4 A;  2V7L A;  5KDM C;  4PNI A;  1VRB A;  1HF8 A;  2LSJ A;  1WYB A;  3IEE A;  4PJM A;  5LOV E;  4F6R C;  4IE0 A;  1LRZ A;  2ZM2 A;  5JRE A;  4BJM A;  5HXH A;  2P9B A;  2VKH A;  4UF0 A;  3RYF E;  4Z8X A;  3V5U A;  4OYJ A;  4TV9 E;  5JDL A;  5H6R B;  2NW8 A;  3NZQ A;  2LOS A;  5HXE A;  5M4Y A;  4YHJ A;  1ZV4 X;  3Q2M A;  5HXC A;  5IYZ E;  4AQG A;  4H9Q C;  2BZB A;  2UXX B;  1KK7 A;  1QSD A;  3EDU A;  4BJN A;  2KXP B;  4XZC A;  5LXT E;  4FJO A;  4UV9 B;  1MIY A;  1IZN B;  2VKO A;  2Z6E A;  3FXD B;  2NW9 A;  1D0Z A;  2LE8 A;  4UVC B;  5CA0 E;  2XQY A;  3CPZ A;  3UUN A;  1BR4 A;  2JMH A;  3FBL A;  3ZJ1 A;  4QXC B;  3RRC A;  2LHN A;  3VU7 H;  4L9I A;  2ZMA A;  2XAF B;  3SS1 A;  3N2K E;  4O4J E;  1FEW A;  3R84 B;  1NWM X;  5LBQ B;  3F57 A;  4O2A E;  1HCI A;  2NTY A;  5FNV E;  3C4W A;  3C98 B;  2KND A;  4EXT A;  2CA5 A;  4I4T E;  4UEM A;  3O1H A;  3N9O A;  3ZMZ B;  3I0Q A;  5L3F B;  2CM0 A;  1VOM A;  3NBX X;  2Q9Q D;  4H63 H;  5LNK A;  1YKH B;  2X9H A;  3KVB A;  5FMN A;  2EHO C;  3L09 A;  3PUS A;  3KV4 A;  5L3G B;  3IHR A;  1UX4 A;  4HN9 A;  4I43 B;  4CXW A;  3LBX A;  4MFR A;  3A5X A;  4KBM B;  3PUQ A;  4ZHQ E;  3BK9 A;  2W63 A;  4U72 A;  2E9X D;  3EVY A;  1D0Y A;  3ZPO A;  3CX6 B;  5LYJ E;  2XAS B;  2E9X C;  2IC6 A;  4X1I E;  4ADZ A;  3N9N A;  5CB4 E;  3EUH A;  4UXN B;  3LFM A;  3LBX B;  5FY1 A;  4UEL A;  5L3D B;  5GON E;  1Z0P A;  3RC8 A;  5JR9 A;  3NRY A;  4IDZ A;  2JMK A;  2KIN B;  3RH3 A;  4G2A A;  3QC9 A;  3ZN0 B;  1UX5 A;  2LJL A;  3CQG B;  2H3R A;  1NAF A;  4K0U A;  2W62 A;  3HI2 A;  2CWY A;  3O1I A;  5LBM A;  5JQG E;  5JDF A;  1ZKE A;  3N2G E;  3Q5W A;  5FP3 A;  2CLY C;  3PU8 A;  2XAH B;  4IE5 A;  5HXR A;  3J7Y q;  2CLY B;  3HKD E;  3C50 A;  3HKE E;  3I9W A;  2E9X A;  2N1G A;  4PFP A;  3ANW A;  2VWA A;  3GN5 B;  5LA6 E;  1BR1 A;  1WRD A;  2PG8 A;  1S94 A;  2W61 A;  4YJ2 E;  5LGN B;  3MK7 C;  1KNZ A;  2MYS A;  4E7S A;  3RRW A;  2BVL A;  3GA8 A;  3N9M A;  3KV5 A;  3JC6 C;  1HG2 A;  1SA0 E;  5FY7 A;  4NUU A;  4H9N C;  3PDY A;  4DBR A;  4P0B A;  2WMO A;  2DI4 A;  4U74 A;  4YLH A;  4WNK A;  2HH7 A;  1YKE B;  3ZYK A;  3ZMS B;  1D1C A;  4WBN E;  5LJN A;  3AA0 B;  2E9X B;  4GK5 E;  3R6N A;  4IHJ E;  3KIN B;  5JDG A;  1Y64 B;  3RYH E;  2C5J A;  4HEA A;  3IBP A;  5DQV A;  1FMW A;  2DHR A;  3N2O A;  5HWX A;  5FXW A;  2K24 A;  5J1G A;  4PK5 A;  3PU3 A;  5LGU B;  5H6Q B;  3W15 B;  2HPL A;  5F3J A;  2X67 A;  4J2C A;  3JC6 D;  4ZOL E;  3RYI E;  4O4H E;  3ZCJ A;  3B57 A;  4UF0 B;  4CZZ B;  1MNE A;  3PUA A;  1H7C A;  2VAS A;  3CML A;  4FI5 A;  4KUM B;  3ETV A;  3MJX A;  3AVS A;  4C91 A;  4O4I E;  4TUY E;  2UXN B;  4QXH B;  4WW0 A;  4ZI7 E;  5KMG P;  5TAO A;  2XAQ B;  2N2N A;  3K3Q C;  3VHL A;  3VKH A;  3FBZ A;  2CEA A;  5A1L A;  2H7O A;  1MMA A;  2EHO B;  3ZC0 A;  1HG5 A;  3ZMT B;  3CX8 B;  3MKD A;  2D2S A;  2NTX A;  2XHE B;  4OHF A;  3LG7 A;  4GOU A;  4ASK A;  1G73 A;  2X66 A;  4AKR B;  3SOL A;  4L0R A;  3ZCI A;  2WM9 A;  3CQX C;  2YIN A;  2J1D G;  2LT3 A;  4AI6 A;  2Q9Q C;  4JUY A;  2Q9Q A;  4ERR A;  4CQI A;  2QA7 A;  3E22 E;  4HTE A;  1MIW A;  3AA1 B;  1MMG A;  3IF8 B;  2VKD A;  4B6X A;  4DMV A;  2CCQ A;  5EK2 A;  5IHY A;  5LJM A;  2LSY A;  2KLQ A;  4XAX B;  3MXZ A;  4GK0 E;  2BVM A;  5EZY E;  2ODU A;  3EDV A;  3QK6 A;  2X0L B;  1UCU A;  2ZLY A;  2XTL A;  3AA7 B;  4IE6 A;  3O9X A;  1MMN A;  1O3X A;  2K5B B;  3UT5 E;  4PK4 A;  3OKQ A;  4EYU A;  3OBV E;  5FXX A;  3KFW X;  3Q5X A;  4YFS A;  4AXP A;  1YW0 A;  3I1A A;  3BQK A;  4I55 E;  2N9D A;  4O8S A;  2QGS A;  2MBG A;  2CE7 A;  2LHR A;  3HKB E;  3LJC A;  3MZK B;  3WI3 A;  2V7K A;  3D0T A;  1IJ6 A;  4AQF C;  3P8C D;  1AJ3 A;  4HFV A;  1E1H B;  3TKL B;  1OWA A;  2V26 A;  4M1P A;  4ZI2 C;  3QUJ A;  2L8K A;  4O4L E;  3HL6 A;  1D1A A;  3HA4 A;  4CI2 B;  2CXF A;  4WBO A;  4ZI3 C;  4PW8 A;  2MOZ A;  4OFZ A;  3U3I A;  5LCY A;  2Y48 B;  4QX8 B;  3WAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...