3OVUA

Crystal structure of human alpha-haemoglobin complexed with ahsp and the first neat domain of isdh from staphylococcus aureus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
LKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new haem pocket structure in alpha-haemoglobin
rcsb
source organism Homo sapiens
molecule tags Oxygen transport/protein binding
molecule keywords Alpha-hemoglobin-stabilizing protein
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ovuA00
1W09A 1Y01A 3QOFA 3IA3A 3Q5DA 4IDOA 4IDNA 4IDQA 4IDPA 1XZYA 3QNUA 1W0AA 3OVUA 1Z8UA 1W0BA 3Q5EA 3X1DA
chains in the Genus database with same CATH superfamily
3C64A 2V6YA 2LKHA 5EK2A 2N9DA 2E2AA 2JJ9A 3FZFB 4IDOA 2PG8A 4KX6A 4X20E 5FY1A 3ONXA 2LJLA 5JQGE 5LG3A 4HFVA 3N9OA 1W9RA 4P0BA 3HKBE 5CB4E 3P4SA 1NEKA 2LE8A 2HH7A 2CBIA 2LRLA 2XQYA 4GYSA 3HL6A 3UFEA 3ZPOA 2WDQA 3D0TA 1OWAA 4Z91A 4DR1T 1N32T 2UUCT 3JAFA 2WMNA 3V5UA 4TUYE 4ZHQE 2Q9QB 4X1KE 1UX4A 3ZSTA 3NRXA 2EHOB 3I0OA 1HX1B 4G63A 4JLEA 4H9PC 2H88A 4NUUA 4WBNE 2DI4A 2YU2A 4PAGA 2VKDA 2MAWA 2XASB 4EYUA 2LKGA 1I94T 3VHLA 1G8XA 3O4XE 4JEUB 5HCJA 2CEAA 4ZI3D 3RRCA 5BMVE 5JRCB 4AQYT 4WBOA 4O2BE 3K3NA 3FXDB 3RYIE 3ZLIA 3RYFE 2XM2A 3JC6D 3ZEFB 2EHOD 5C8YE 3AVRA 4KI0F 2WDVA 1MMGA 5AQJB 1N33T 1HX8A 4IGUA 2DNXA 2XAGB 5FY7A 2CRBA 2Q9QA 2PFVA 3GA8A 2IDOB 1QLBA 4JI6T 4FI5A 2G0UA 3MJXA 2ES0A 1B7TA 1MNDA 3CWZB 1FJGT 2DHRA 2L3LA 4YTMA 5LGTB 2X9HA 4JI1T 5JDGA 2ZM2A 3RC8A 2NWBA 1KEYA 1T72A 4A5XA 3T8OA 5L3CB 3PJAJ 5J1GA 2LSKA 1HF8A 4X65T 2XTLA 4GIWA 2NW8A 3I1AA 4ZS2A 3Q5EA 3ZSSA 1HG2A 4AKLA 1IBLT 1US7B 3IBPA 3RIAA 4GKKT 3AEBA 4U2YA 3RYCE 5H6RB 5AQHB 3K3QC 2K5BB 2UUBT 1UCUA 4PJLA 5AQGB 2RA1A 3AECA 4MALA 2EHOC 2XQ4A 1XMQT 3ZMUB 5ABHA 2CPTA 2WM9A 4DBQA 4U2ZA 3B57A 3O9XA 3OBVE 1WRDA 1D0YA 3AEGA 4HFCA 4HFBA 1L0VA 4BJMA 3KV4A 5KMGP 3C4WA 2BKNA 4UF0A 3NRYA 3RQUA 3ESLA 2UXXB 1IBKT 2NW7A 3PUAA 5L2LA 2XUEA 2MTQA 2X9XA 2LOSA 5ADXL 3JAEA 1G73A 3UU5A 4DR7T 3VR9A 3UQ4A 5LB7B 4CI3B 5BR8T 2CA5A 4ILUA 1S35A 3FB2A 4NXNT 5L3DB 5EZYE 4ISSA 4QH4A 1VRBA 4CI1B 2C5KT 4PK6A 4HWIB 4ZOLE 5AQPB 4JI4T 1OEDB 2IMLA 2KXPB 1W0AA 2CHOA 3CK6A 2K9AA 2LSJA 2ZMAA 4GYRA 4PW8A 2W66A 3AE4A 4H9QC 4A97A 4ANJA 4DR6T 3KV9A 2AXDS 2JQ9A 4U74A 2VKHA 2WZHA 2FJBA 3AEEA 3L3PA 4OYKA 1IZNB 1V9DA 2XAJB 3L8RA 4WZXA 1VCTA 2LM2A 3EDUA 3UFGA 4YSYA 2VQET 1CUNA 4ISTA 4QXCB 2YKSA 2JQKA 3WAKA 5FXVA 4C90A 2D0TA 4LF9T 3AAEB 1SHZC 2R6GF 4ILAA 3PUQA 4DV0T 2WU2A 1ZOYA 1IJ6A 2IUBA 2H89A 1UX5A 3RIFA 4A98A 5CA1E 4TWDA 4WNKA 2KWIB 4P1NA 2BS3A 2L9QA 1ZV4X 2A3DA 4QWNB 5ABFB 3C50A 2E9XD 1CHUA 1YKHB 1HNZT 1KNRA 2X68A 3JCFA 3FXEB 3UQ7A 2JQHA 3KDSE 3ONLC 4UVBB 1KK7A 3ZCJA 3HA4A 5FXWA 5E0OA 4AXPA 3TKLB 2V1DB 5LMUT 3Q2MA 4YJ2E 4TZ4C 3MACA 2HHHT 1MMDA 2K48A 2XHEB 4GOUA 4IL4A 4IIJE 2BG9A 1T7SA 5FVKA 2BKPA 3VRBA 1YD8G 2NP9A 3TLSA 5HXSA 2E5VA 2VL0A 3KVBA 4NUVA 3E22E 3BQLA 1MIYA 4OK0A 2MBGA 5DQWA 5AQSB 3RRWA 4X62T 4LF8T 2PTFA 2IW5B 4EEBA 5IUXA 1ZP0A 4IHJE 4IL9A 3N2OA 5AQMB 5FXZA 2CLYB 4QH5A 3FBZA 2WMOA 4IE7A 3HI2A 4JI5T 4U7IA 4JI0T 4AKIA 1ZEEA 5F5WA 3FZHB 5LBMA 2QA7A 4MLKA 2LM9A 3U3IA 2LLYA 4EXTA 5LJNA 1E7PA 2BBJA 5FP3A 5LCYA 3B5MA 3UT5E 2ACXA 2EHOA 2WQYA 2CXDA 4U3CA 3ABVA 3F57A 4YJ3E 4ASKA 1KNZA 3LK42 3EVYA 4YFSA 1LVFA 2A9UA 5AQNB 4JI7T 3RKGA 3QC9A 3N2KE 3KINB 2XAQB 2KT9A 2CM0A 2LSYA 3ZYMA 5JREA 3SFEA 2XQAA 5LYJE 4DMVA 1SUMB 4JUYA 5GONE 4QXBB 2JIWA 4QX8B 2Y48B 5JTGA 3TLUA 2CWYA 5FNVE 5J2TE 2H7OA 2KLQA 2NOXA 4IE0A 4YHHT 1HNWT 3UU8A 1XDPA 2JMHA 2XZEA 2XAFB 4N78D 3GN5A 4UV8B 1IJ5A 5F8PA 5L3EB 4DUZT 5ETWA 3WI3A 1W0BA 2FJDA 3Q5WA 3LJCA 3VU7H 3R84B 3LK2B 3QB5A 3M3ZB 1HFAA 3O1IA 4H9RC 4IE4A 4DR3T 2KSRA 4IE5A 4EYYR 3LDQB 2HPJA 4I50E 4YHJA 2OV9A 4JI2T 3AAAB 3I9YA 1UURA 4JBWF 5FKYA 3UUNA 3PUZF 3N5LA 5L3GB 1HG5A 5HXCA 3P50A 1D1BA 1MMAA 5ABEA 4Z90A 1YQ4A 4P09A 4HWHA 3HKCE 2FUPA 3AA0B 1IAPA 3OJAA 3S4UA 1QUUA 4TX5A 5HEGA 3TLTA 4AKGA 2XQ8A 4GK5E 1YQ3A 1S94A 2UXNB 3UUXB 4CQIA 5KDMC 4DV4T 1T8BA 2WBLA 3MA9A 4TWHA 2C0SA 1WYCA 3CIRA 4ILBA 4KP3C 1KF6A 2X0YA 3CX7B 2E9XB 1JNRA 2BVLA 4L5GA 3AE5A 3AXJB 2IC9A 2YN6A 1XWMA 3MKDA 4F8HA 4AKRB 5AQKB 2BZBA 2D0UA 2WWUA 3PUSA 4KUMB 4UEMA 2ZM8A 5HWYA 2E8IA 1KFYA 4IT4A 2LSIA 4LMKA 4AIUA 4B3MT 3HKEE 1XNQT 4X5TA 4YLHA 4G2AA 3GN5B 4ADZA 3E08A 4UELA 5HEUA 2MYSA 3TLVA 2XM1A 1WCRA 5FL0A 1M7KA 5IWAT 2DL1A 3ZJ2A 1IBMT 2J4GA 5AQIB 3UU6A 1I6ZA 5LJMA 2IHR1 2LRKA 3F31A 2WAUA 1ZKEA 2H7VC 2XY8B 2V5CA 5ABFA 2D2SA 3ANWB 1NWMX 2JPFA 3ETVA 3P4RA 3I0QA 2DLRA 3P4QA 2V5DA 1M62A 3QNUA 5JVDE 3RIUA 4QXHB 4ZEYA 5CFBA 3V5SA 1HNXT 1E1HB 2SPCA 1Y64B 3RKOA 4I4TE 3ZT6A 4QH1A 1N36T 2H3RA 3E0ZA 1LRZA 2UU9T 4PJJA 3RH3A 3RI5A 4TNVA 4DV1T 1BR0A 3UU4A 2ODVA 3NZPA 1U4QA 5HWXA 4LFBT 4YSZA 5HYAA 1FMWA 2YEVC 4O4LE 4ILCA 2BG9E 4U33A 1KNPA 2LHRA 3AE6A 3N9LA 2NTYA 5FY0A 3R6NA 5HEOA 3JADA 2X0LB 3RLFF 3SRZA 4LF5T 4TV9E 3P4PA 5EK3A 5FMNA 5ABGA 1J5WA 3VR8A 5JDQA 2V7MA 3HR0A 3Q5DA 4DV7T 2VVSA 1QSDA 2VASA 2VVNA 2QVAA 4ZI2D 4UVAB 3CKDA 4PK5A 4TWFA 2NW9A 3B13A 2W67A 3PJAA 4I43B 3MK7C 2LEHA 3K1SA 5AQRB 2CHNA 2CWOA 3CX6B 3LFMA 2WDRA 4FJOA 4XAXB 1J5ET 4YY3T 4IREA 4LFCT 3JC6C 2VL8A 5IYZE 4J2CA 3BK9A 4K0UA 4PJMA 5JDFA 2YOEA 2Y8DA 4DBRA 4AISA 5JDMA 2D5UA 3AVSA 5LOVE 4NXMT 3PV0F 3ZKRA 2CLYC 2N2NA 5HEHA 2JQQA 2OLTA 3T1HT 4LMJA 4U72A 2M6IA 2V7JA 3EUHA 3K8PC 3EAMA 3FZKB 1UGOA 3W15B 4V1Av 4JI8T 2DWGA 2L8KA 3AEFA 5AQTB 4YTPA 4LF6T 4GKJT 3KV6A 4LF7T 1MIVA 3PUWF 5L3BB 3H3AA 3Q5XA 5LA6E 3N9MA 4MHCA 3N9PA 4BJNA 3ZC0A 2FJEA 2VWAA 2CMRA 4JYAT 3SWHA 2V8SV 4HWFA 3C4ZA 2AE9A 4AQFC 4JI3T 4NIQA 2LSGA 3QK6A 3RQWA 2KZ7B 3NVOA 3OYZA 3UULA 2JRKA 4H9OC 4X66T 2W61A 1SE7A 2XQ3A 3P8CD 3QB5K 3A7MA 4YXDA 5L47A 1OEDA 2BBHA 4B3ST 3UUBA 1D0XA 2IC6A 3ZMZB 5FVLA 5DQVA 3FHNA 2FJAA 1OEDC 2KWHA 2RPAA 3AAIA 3U78A 1HTJF 2C5JA 4KBMB 2UUAT 3AB3B 3KFWX 2XQ5A 2ZM0A 5HAXA 1OEDE 5A1LA 4TNWA 5AQOB 5L3FB 1YW0A 4EOZB 2YINA 1R8IA 5JR9C 3LBXB 2MOZA 2I6HA 3AE7A 3NKZA 3O1HA 2PBIA 3IEEA 3OKQA 4PK4A 3J9X1 3PU8A 4U31A 4UXNB 4KHZF 4L9IA 5LGUB 4DV2T 4LF4T 2J47A 3CQXC 3VRAA 3OPCA 2UXCT 2XPKA 4XBFB 3PURA 2DWKA 2HN2A 2KINB 4OFZA 1WFDA 4TV8E 4L0RA 1J1JA 4WW0A 4CN4A 2QYWA 4HWCA 4DIDB 4EZHA 4DV3T 2X9WA 3P4WA 2IIUA 5AQQB 4EIWA 2V7LA 5JDNA 2WCAA 1X9BA 2NTXA 3CX8B 3PUGA 4UR9A 1D1AA 4O4JE 3H37A 3ZT5A 4H9NC 1Y01A 4EGWA 4EB6E 5HEJA 4ZZCA 4HEAA 2B76A 3ETUA 4GK0E 2Q9QC 3SFDA 5LHGB 1XNRT 3AEDA 3EABA 3OYXA 4UVCB 3H3MA 5LBQB 3HKDE 4CXWA 5C3JA 5CA0E 5JH7E 4EEDA 4DR4T 4AKHA 3RC3A 3RGLA 1HS7A 4BAYB 4PNIA 2XJ7A 2LT3A 2XSAA 2ZM6T 4DV5T 4DMWA 5H6QB 3GMIA 3PDYA 2W2UA 4COFA 1HR0T 5LP6E 1BR1A 3QUJA 1AJ3A 1EZ3A 4ZI3C 4H63V 3VKGA 3ZMVB 3ZYLA 3EHZA 2YDRA 2I0MA 4E7ZA 2BG9C 2P9BA 5CJ5A 4B3TT 2X51A 2W00A 3PTRB 2CBJA 4DNDA 3NBXX 4H9SE 3ZCIA 1BR4A 3G06A 3L39A 2XAHB 1FMVA 4PJNA 2K3WA 1HCIA 5JR9A 3ZYKA 5AQUB 4CZZB 2CCQA 3IHRA 5FL1A 2YDQA 4XZCA 1VCSA 2ODUA 2X0HA 1UK5A 4ZXLA 5HCMA 2WZIA 3N9NA 4DO0A 4YTNA 4LFAT 2N1GA 3ONJA 5HXRA 4OHFA 3C51A 4IDQA 3GWHA 4EZ4A 4F6RC 3KBTA 2MPKA 5FYMA 1YXRA 2NR4A 2WU5A 2KMFA 3A8YC 3MZKB 4EAHA 5JDLA 2FBWA 2B1EA 2VURA 2LOPA 2XSBA 1D0ZA 4H63H 4O8SA 5DJQC 1WYBA 4A56A 4DVDA 5J2UE 4AI6A 4P0AA 3UU3A 2RP4A 3KV5A 1VOMA 3CQCB 4O2AE 3X1DA 2BS4A 2UXBT 4AQGA 4QHOA 5F3JA 5HXEA 3L09A 3DTOA 3FZLB 4C91A 4UF0B 4HTEA 4IDZA 1MNEA 4TN7B 2E5LT 1Z8UA 5CGMA 1D1CA 3PUXF 5L4HA 4B3RT 3TLWA 4KHPT 3UTKA 2X67A 3UUMA 4CXXA 5LHHB 4ERRA 2ZLYA 4DR5T 2DCFA 3OVUA 2VK9A 3AE1A 3AE3A 1SA0E 2YU1A 3QOFA 1WR6A 3RYHE 5JR9B 5KXJA 2M67A 5LHIB 4X64T 2VKOA 4K0KT 2I59A 3ZN0B 3DJBA 5IHYA 4O4IE 3MXZA 4U7YA 5FXXA 1MMNA 1N34T 4HFHA 4M1PA 5LXTE 2A72A 3AXJA 2YK0A 3LSVA 3PUVF 4HKAA 2Q9QD 4WYVA 2V7KA 2WS3A 3DP7A 4OYJA 3ZC1A 4O4HE 5LGNB 3LG7A 2J1DG 2X9YA 4UIGA 4OX9T 3I9WA 4ZI2C 4HWDA 3ZJ1A 2K24A 1BR2A 4MFRA 1MIWA 3AA1B 1OXZA 2V6YB 2Z6EA 3LBXA 3RF1A 3RX6A 4BA9A 4JV5T 4NPPA 2CXFA 3VKHA 2F4VT 2BKOA 4MBQA 5TAOA 4ZI7E 4PFPA 2BDEA 2WB5A 3AA6B 4IDPA 4KMCA 5DABA 4CN1A 5LNKA 3T1YT 1Z0PA 2V6XA 3C4XA 2ACZA 1XDOA 2WSSV 1NENA 3ANWA 3Q9DA 4X1IE 5AQVB 3PU3A 1UUSA 2V7IA 3FZMB 4HE8A 4ZS3A 3ZN1B 4DR2T 1DU2A 2C5IT 3EDVA 4Q25A 4HN9A 1ZHCA 1LVKA 1FIOA 1U5PA 3BQIA 3SS1A 3IA3A 2CE7A 3N2GE 3RIUC 4B6XA 4CXYA 2OA5A 1FEWA 2J62A 2JMKA 4HFDA 5AFUL 3ZMTB 2QRXA 3LK3B 3WAJA 2GK9A 4I0UA 2QGSA 3AE8A 1LKXA 3BQKA 4QKNA 2M6BA 3M65A 3OTOT 1E2AA 1T98A 3ZMSB 2XQ7A 4HGAA 4HFIA 4JEHB 4LMLA 3RPUA 4E7SA 3AE2A 3J7Yq 4DUYT 2BVMA 3PUYF 5J0ZA 2WWVA 4IE6A 5JDHA 2IAKA 1XZYA 4DV6T 4HFEA 4CI2B 3AA7B 4PFOA 2W63A 3KBUA 1YKEB 1W09A 2LHNA 2X66A 3A5XA 3CVRA 3FBLA 3SOLA 5LMNT 3CMLA 4EV6A 3PE0A 3RHWA 3IF8B 2XQ9A 3N9QA 1H7CA 3K3OA 2BS2A 5L4EA 4YT0A 2A2FX 5KX5E 1XMOT 2UXDT 1WR0A 3EI0A 3KVAA 2D9DA 2KNDA 2PJQA 5C2TA 5JRCA 1X79A 3F2EA 3AEAA 2HPLA 2XQ6A 3AE9A 2WP9A 1NAFA 3NZQA 5HXHA 3CQGB 2VB6A 5EK4A 3ZT7A 2VKJA 2YDSA 4UV9B 1GQEA 4IDNA 4YSXA 2CXLA 3CPZA 4ZZBA 2Y6XA 2HN1A 4CN6A 4I55E 3O1JA 1WLXA 2W4XA 3P7IA 4QX7B 4X1YE 2VQFT 2E9XC 2W62A 1O3XA 3NWIA 5M4YA 2BG9B 5AQLB 2W0GA 2WY2A 3C98B 2E9XA 4Z8XA 2V26A 1JNZA 5LG4A 5AQFB 4AQFA
chains in the Genus database with same CATH topology
1W09A 1Y01A 3QOFA 3IA3A 3Q5DA 4IDOA 4IDNA 4IDQA 4IDPA 1XZYA 3QNUA 1W0AA 3OVUA 1Z8UA 1W0BA 3Q5EA 3X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W09 A;  1Y01 A;  3QOF A;  3IA3 A;  3Q5D A;  4IDO A;  4IDN A;  4IDQ A;  4IDP A;  1XZY A;  3QNU A;  1W0A A;  3OVU A;  1Z8U A;  1W0B A;  3Q5E A;  3X1D A; 
#chains in the Genus database with same CATH topology
 3C64 A;  2V6Y A;  2LKH A;  5EK2 A;  2N9D A;  2E2A A;  2JJ9 A;  3FZF B;  4IDO A;  2PG8 A;  4KX6 A;  4X20 E;  5FY1 A;  3ONX A;  2LJL A;  5JQG E;  5LG3 A;  4HFV A;  3N9O A;  1W9R A;  4P0B A;  3HKB E;  5CB4 E;  3P4S A;  1NEK A;  2LE8 A;  2HH7 A;  2CBI A;  2LRL A;  2XQY A;  4GYS A;  3HL6 A;  3UFE A;  3ZPO A;  2WDQ A;  3D0T A;  1OWA A;  4Z91 A;  4DR1 T;  1N32 T;  2UUC T;  3JAF A;  2WMN A;  3V5U A;  4TUY E;  4ZHQ E;  2Q9Q B;  4X1K E;  1UX4 A;  3ZST A;  3NRX A;  2EHO B;  3I0O A;  1HX1 B;  4G63 A;  4JLE A;  4H9P C;  2H88 A;  4NUU A;  4WBN E;  2DI4 A;  2YU2 A;  4PAG A;  2VKD A;  2MAW A;  2XAS B;  4EYU A;  2LKG A;  1I94 T;  3VHL A;  1G8X A;  3O4X E;  4JEU B;  5HCJ A;  2CEA A;  4ZI3 D;  3RRC A;  5BMV E;  5JRC B;  4AQY T;  4WBO A;  4O2B E;  3K3N A;  3FXD B;  3RYI E;  3ZLI A;  3RYF E;  2XM2 A;  3JC6 D;  3ZEF B;  2EHO D;  5C8Y E;  3AVR A;  4KI0 F;  2WDV A;  1MMG A;  5AQJ B;  1N33 T;  1HX8 A;  4IGU A;  2DNX A;  2XAG B;  5FY7 A;  2CRB A;  2Q9Q A;  2PFV A;  3GA8 A;  2IDO B;  1QLB A;  4JI6 T;  4FI5 A;  2G0U A;  3MJX A;  2ES0 A;  1B7T A;  1MND A;  3CWZ B;  1FJG T;  2DHR A;  2L3L A;  4YTM A;  5LGT B;  2X9H A;  4JI1 T;  5JDG A;  2ZM2 A;  3RC8 A;  2NWB A;  1KEY A;  1T72 A;  4A5X A;  3T8O A;  5L3C B;  3PJA J;  5J1G A;  2LSK A;  1HF8 A;  4X65 T;  2XTL A;  4GIW A;  2NW8 A;  3I1A A;  4ZS2 A;  3Q5E A;  3ZSS A;  1HG2 A;  4AKL A;  1IBL T;  1US7 B;  3IBP A;  3RIA A;  4GKK T;  3AEB A;  4U2Y A;  3RYC E;  5H6R B;  5AQH B;  3K3Q C;  2K5B B;  2UUB T;  1UCU A;  4PJL A;  5AQG B;  2RA1 A;  3AEC A;  4MAL A;  2EHO C;  2XQ4 A;  1XMQ T;  3ZMU B;  5ABH A;  2CPT A;  2WM9 A;  4DBQ A;  4U2Z A;  3B57 A;  3O9X A;  3OBV E;  1WRD A;  1D0Y A;  3AEG A;  4HFC A;  4HFB A;  1L0V A;  4BJM A;  3KV4 A;  5KMG P;  3C4W A;  2BKN A;  4UF0 A;  3NRY A;  3RQU A;  3ESL A;  2UXX B;  1IBK T;  2NW7 A;  3PUA A;  5L2L A;  2XUE A;  2MTQ A;  2X9X A;  2LOS A;  5ADX L;  3JAE A;  1G73 A;  3UU5 A;  4DR7 T;  3VR9 A;  3UQ4 A;  5LB7 B;  4CI3 B;  5BR8 T;  2CA5 A;  4ILU A;  1S35 A;  3FB2 A;  4NXN T;  5L3D B;  5EZY E;  4ISS A;  4QH4 A;  1VRB A;  4CI1 B;  2C5K T;  4PK6 A;  4HWI B;  4ZOL E;  5AQP B;  4JI4 T;  1OED B;  2IML A;  2KXP B;  1W0A A;  2CHO A;  3CK6 A;  2K9A A;  2LSJ A;  2ZMA A;  4GYR A;  4PW8 A;  2W66 A;  3AE4 A;  4H9Q C;  4A97 A;  4ANJ A;  4DR6 T;  3KV9 A;  2AXD S;  2JQ9 A;  4U74 A;  2VKH A;  2WZH A;  2FJB A;  3AEE A;  3L3P A;  4OYK A;  1IZN B;  1V9D A;  2XAJ B;  3L8R A;  4WZX A;  1VCT A;  2LM2 A;  3EDU A;  3UFG A;  4YSY A;  2VQE T;  1CUN A;  4IST A;  4QXC B;  2YKS A;  2JQK A;  3WAK A;  5FXV A;  4C90 A;  2D0T A;  4LF9 T;  3AAE B;  1SHZ C;  2R6G F;  4ILA A;  3PUQ A;  4DV0 T;  2WU2 A;  1ZOY A;  1IJ6 A;  2IUB A;  2H89 A;  1UX5 A;  3RIF A;  4A98 A;  5CA1 E;  4TWD A;  4WNK A;  2KWI B;  4P1N A;  2BS3 A;  2L9Q A;  1ZV4 X;  2A3D A;  4QWN B;  5ABF B;  3C50 A;  2E9X D;  1CHU A;  1YKH B;  1HNZ T;  1KNR A;  2X68 A;  3JCF A;  3FXE B;  3UQ7 A;  2JQH A;  3KDS E;  3ONL C;  4UVB B;  1KK7 A;  3ZCJ A;  3HA4 A;  5FXW A;  5E0O A;  4AXP A;  3TKL B;  2V1D B;  5LMU T;  3Q2M A;  4YJ2 E;  4TZ4 C;  3MAC A;  2HHH T;  1MMD A;  2K48 A;  2XHE B;  4GOU A;  4IL4 A;  4IIJ E;  2BG9 A;  1T7S A;  5FVK A;  2BKP A;  3VRB A;  1YD8 G;  2NP9 A;  3TLS A;  5HXS A;  2E5V A;  2VL0 A;  3KVB A;  4NUV A;  3E22 E;  3BQL A;  1MIY A;  4OK0 A;  2MBG A;  5DQW A;  5AQS B;  3RRW A;  4X62 T;  4LF8 T;  2PTF A;  2IW5 B;  4EEB A;  5IUX A;  1ZP0 A;  4IHJ E;  4IL9 A;  3N2O A;  5AQM B;  5FXZ A;  2CLY B;  4QH5 A;  3FBZ A;  2WMO A;  4IE7 A;  3HI2 A;  4JI5 T;  4U7I A;  4JI0 T;  4AKI A;  1ZEE A;  5F5W A;  3FZH B;  5LBM A;  2QA7 A;  4MLK A;  2LM9 A;  3U3I A;  2LLY A;  4EXT A;  5LJN A;  1E7P A;  2BBJ A;  5FP3 A;  5LCY A;  3B5M A;  3UT5 E;  2ACX A;  2EHO A;  2WQY A;  2CXD A;  4U3C A;  3ABV A;  3F57 A;  4YJ3 E;  4ASK A;  1KNZ A;  3LK4 2;  3EVY A;  4YFS A;  1LVF A;  2A9U A;  5AQN B;  4JI7 T;  3RKG A;  3QC9 A;  3N2K E;  3KIN B;  2XAQ B;  2KT9 A;  2CM0 A;  2LSY A;  3ZYM A;  5JRE A;  3SFE A;  2XQA A;  5LYJ E;  4DMV A;  1SUM B;  4JUY A;  5GON E;  4QXB B;  2JIW A;  4QX8 B;  2Y48 B;  5JTG A;  3TLU A;  2CWY A;  5FNV E;  5J2T E;  2H7O A;  2KLQ A;  2NOX A;  4IE0 A;  4YHH T;  1HNW T;  3UU8 A;  1XDP A;  2JMH A;  2XZE A;  2XAF B;  4N78 D;  3GN5 A;  4UV8 B;  1IJ5 A;  5F8P A;  5L3E B;  4DUZ T;  5ETW A;  3WI3 A;  1W0B A;  2FJD A;  3Q5W A;  3LJC A;  3VU7 H;  3R84 B;  3LK2 B;  3QB5 A;  3M3Z B;  1HFA A;  3O1I A;  4H9R C;  4IE4 A;  4DR3 T;  2KSR A;  4IE5 A;  4EYY R;  3LDQ B;  2HPJ A;  4I50 E;  4YHJ A;  2OV9 A;  4JI2 T;  3AAA B;  3I9Y A;  1UUR A;  4JBW F;  5FKY A;  3UUN A;  3PUZ F;  3N5L A;  5L3G B;  1HG5 A;  5HXC A;  3P50 A;  1D1B A;  1MMA A;  5ABE A;  4Z90 A;  1YQ4 A;  4P09 A;  4HWH A;  3HKC E;  2FUP A;  3AA0 B;  1IAP A;  3OJA A;  3S4U A;  1QUU A;  4TX5 A;  5HEG A;  3TLT A;  4AKG A;  2XQ8 A;  4GK5 E;  1YQ3 A;  1S94 A;  2UXN B;  3UUX B;  4CQI A;  5KDM C;  4DV4 T;  1T8B A;  2WBL A;  3MA9 A;  4TWH A;  2C0S A;  1WYC A;  3CIR A;  4ILB A;  4KP3 C;  1KF6 A;  2X0Y A;  3CX7 B;  2E9X B;  1JNR A;  2BVL A;  4L5G A;  3AE5 A;  3AXJ B;  2IC9 A;  2YN6 A;  1XWM A;  3MKD A;  4F8H A;  4AKR B;  5AQK B;  2BZB A;  2D0U A;  2WWU A;  3PUS A;  4KUM B;  4UEM A;  2ZM8 A;  5HWY A;  2E8I A;  1KFY A;  4IT4 A;  2LSI A;  4LMK A;  4AIU A;  4B3M T;  3HKE E;  1XNQ T;  4X5T A;  4YLH A;  4G2A A;  3GN5 B;  4ADZ A;  3E08 A;  4UEL A;  5HEU A;  2MYS A;  3TLV A;  2XM1 A;  1WCR A;  5FL0 A;  1M7K A;  5IWA T;  2DL1 A;  3ZJ2 A;  1IBM T;  2J4G A;  5AQI B;  3UU6 A;  1I6Z A;  5LJM A;  2IHR 1;  2LRK A;  3F31 A;  2WAU A;  1ZKE A;  2H7V C;  2XY8 B;  2V5C A;  5ABF A;  2D2S A;  3ANW B;  1NWM X;  2JPF A;  3ETV A;  3P4R A;  3I0Q A;  2DLR A;  3P4Q A;  2V5D A;  1M62 A;  3QNU A;  5JVD E;  3RIU A;  4QXH B;  4ZEY A;  5CFB A;  3V5S A;  1HNX T;  1E1H B;  2SPC A;  1Y64 B;  3RKO A;  4I4T E;  3ZT6 A;  4QH1 A;  1N36 T;  2H3R A;  3E0Z A;  1LRZ A;  2UU9 T;  4PJJ A;  3RH3 A;  3RI5 A;  4TNV A;  4DV1 T;  1BR0 A;  3UU4 A;  2ODV A;  3NZP A;  1U4Q A;  5HWX A;  4LFB T;  4YSZ A;  5HYA A;  1FMW A;  2YEV C;  4O4L E;  4ILC A;  2BG9 E;  4U33 A;  1KNP A;  2LHR A;  3AE6 A;  3N9L A;  2NTY A;  5FY0 A;  3R6N A;  5HEO A;  3JAD A;  2X0L B;  3RLF F;  3SRZ A;  4LF5 T;  4TV9 E;  3P4P A;  5EK3 A;  5FMN A;  5ABG A;  1J5W A;  3VR8 A;  5JDQ A;  2V7M A;  3HR0 A;  3Q5D A;  4DV7 T;  2VVS A;  1QSD A;  2VAS A;  2VVN A;  2QVA A;  4ZI2 D;  4UVA B;  3CKD A;  4PK5 A;  4TWF A;  2NW9 A;  3B13 A;  2W67 A;  3PJA A;  4I43 B;  3MK7 C;  2LEH A;  3K1S A;  5AQR B;  2CHN A;  2CWO A;  3CX6 B;  3LFM A;  2WDR A;  4FJO A;  4XAX B;  1J5E T;  4YY3 T;  4IRE A;  4LFC T;  3JC6 C;  2VL8 A;  5IYZ E;  4J2C A;  3BK9 A;  4K0U A;  4PJM A;  5JDF A;  2YOE A;  2Y8D A;  4DBR A;  4AIS A;  5JDM A;  2D5U A;  3AVS A;  5LOV E;  4NXM T;  3PV0 F;  3ZKR A;  2CLY C;  2N2N A;  5HEH A;  2JQQ A;  2OLT A;  3T1H T;  4LMJ A;  4U72 A;  2M6I A;  2V7J A;  3EUH A;  3K8P C;  3EAM A;  3FZK B;  1UGO A;  3W15 B;  4V1A v;  4JI8 T;  2DWG A;  2L8K A;  3AEF A;  5AQT B;  4YTP A;  4LF6 T;  4GKJ T;  3KV6 A;  4LF7 T;  1MIV A;  3PUW F;  5L3B B;  3H3A A;  3Q5X A;  5LA6 E;  3N9M A;  4MHC A;  3N9P A;  4BJN A;  3ZC0 A;  2FJE A;  2VWA A;  2CMR A;  4JYA T;  3SWH A;  2V8S V;  4HWF A;  3C4Z A;  2AE9 A;  4AQF C;  4JI3 T;  4NIQ A;  2LSG A;  3QK6 A;  3RQW A;  2KZ7 B;  3NVO A;  3OYZ A;  3UUL A;  2JRK A;  4H9O C;  4X66 T;  2W61 A;  1SE7 A;  2XQ3 A;  3P8C D;  3QB5 K;  3A7M A;  4YXD A;  5L47 A;  1OED A;  2BBH A;  4B3S T;  3UUB A;  1D0X A;  2IC6 A;  3ZMZ B;  5FVL A;  5DQV A;  3FHN A;  2FJA A;  1OED C;  2KWH A;  2RPA A;  3AAI A;  3U78 A;  1HTJ F;  2C5J A;  4KBM B;  2UUA T;  3AB3 B;  3KFW X;  2XQ5 A;  2ZM0 A;  5HAX A;  1OED E;  5A1L A;  4TNW A;  5AQO B;  5L3F B;  1YW0 A;  4EOZ B;  2YIN A;  1R8I A;  5JR9 C;  3LBX B;  2MOZ A;  2I6H A;  3AE7 A;  3NKZ A;  3O1H A;  2PBI A;  3IEE A;  3OKQ A;  4PK4 A;  3J9X 1;  3PU8 A;  4U31 A;  4UXN B;  4KHZ F;  4L9I A;  5LGU B;  4DV2 T;  4LF4 T;  2J47 A;  3CQX C;  3VRA A;  3OPC A;  2UXC T;  2XPK A;  4XBF B;  3PUR A;  2DWK A;  2HN2 A;  2KIN B;  4OFZ A;  1WFD A;  4TV8 E;  4L0R A;  1J1J A;  4WW0 A;  4CN4 A;  2QYW A;  4HWC A;  4DID B;  4EZH A;  4DV3 T;  2X9W A;  3P4W A;  2IIU A;  5AQQ B;  4EIW A;  2V7L A;  5JDN A;  2WCA A;  1X9B A;  2NTX A;  3CX8 B;  3PUG A;  4UR9 A;  1D1A A;  4O4J E;  3H37 A;  3ZT5 A;  4H9N C;  1Y01 A;  4EGW A;  4EB6 E;  5HEJ A;  4ZZC A;  4HEA A;  2B76 A;  3ETU A;  4GK0 E;  2Q9Q C;  3SFD A;  5LHG B;  1XNR T;  3AED A;  3EAB A;  3OYX A;  4UVC B;  3H3M A;  5LBQ B;  3HKD E;  4CXW A;  5C3J A;  5CA0 E;  5JH7 E;  4EED A;  4DR4 T;  4AKH A;  3RC3 A;  3RGL A;  1HS7 A;  4BAY B;  4PNI A;  2XJ7 A;  2LT3 A;  2XSA A;  2ZM6 T;  4DV5 T;  4DMW A;  5H6Q B;  3GMI A;  3PDY A;  2W2U A;  4COF A;  1HR0 T;  5LP6 E;  1BR1 A;  3QUJ A;  1AJ3 A;  1EZ3 A;  4ZI3 C;  4H63 V;  3VKG A;  3ZMV B;  3ZYL A;  3EHZ A;  2YDR A;  2I0M A;  4E7Z A;  2BG9 C;  2P9B A;  5CJ5 A;  4B3T T;  2X51 A;  2W00 A;  3PTR B;  2CBJ A;  4DND A;  3NBX X;  4H9S E;  3ZCI A;  1BR4 A;  3G06 A;  3L39 A;  2XAH B;  1FMV A;  4PJN A;  2K3W A;  1HCI A;  5JR9 A;  3ZYK A;  5AQU B;  4CZZ B;  2CCQ A;  3IHR A;  5FL1 A;  2YDQ A;  4XZC A;  1VCS A;  2ODU A;  2X0H A;  1UK5 A;  4ZXL A;  5HCM A;  2WZI A;  3N9N A;  4DO0 A;  4YTN A;  4LFA T;  2N1G A;  3ONJ A;  5HXR A;  4OHF A;  3C51 A;  4IDQ A;  3GWH A;  4EZ4 A;  4F6R C;  3KBT A;  2MPK A;  5FYM A;  1YXR A;  2NR4 A;  2WU5 A;  2KMF A;  3A8Y C;  3MZK B;  4EAH A;  5JDL A;  2FBW A;  2B1E A;  2VUR A;  2LOP A;  2XSB A;  1D0Z A;  4H63 H;  4O8S A;  5DJQ C;  1WYB A;  4A56 A;  4DVD A;  5J2U E;  4AI6 A;  4P0A A;  3UU3 A;  2RP4 A;  3KV5 A;  1VOM A;  3CQC B;  4O2A E;  3X1D A;  2BS4 A;  2UXB T;  4AQG A;  4QHO A;  5F3J A;  5HXE A;  3L09 A;  3DTO A;  3FZL B;  4C91 A;  4UF0 B;  4HTE A;  4IDZ A;  1MNE A;  4TN7 B;  2E5L T;  1Z8U A;  5CGM A;  1D1C A;  3PUX F;  5L4H A;  4B3R T;  3TLW A;  4KHP T;  3UTK A;  2X67 A;  3UUM A;  4CXX A;  5LHH B;  4ERR A;  2ZLY A;  4DR5 T;  2DCF A;  3OVU A;  2VK9 A;  3AE1 A;  3AE3 A;  1SA0 E;  2YU1 A;  3QOF A;  1WR6 A;  3RYH E;  5JR9 B;  5KXJ A;  2M67 A;  5LHI B;  4X64 T;  2VKO A;  4K0K T;  2I59 A;  3ZN0 B;  3DJB A;  5IHY A;  4O4I E;  3MXZ A;  4U7Y A;  5FXX A;  1MMN A;  1N34 T;  4HFH A;  4M1P A;  5LXT E;  2A72 A;  3AXJ A;  2YK0 A;  3LSV A;  3PUV F;  4HKA A;  2Q9Q D;  4WYV A;  2V7K A;  2WS3 A;  3DP7 A;  4OYJ A;  3ZC1 A;  4O4H E;  5LGN B;  3LG7 A;  2J1D G;  2X9Y A;  4UIG A;  4OX9 T;  3I9W A;  4ZI2 C;  4HWD A;  3ZJ1 A;  2K24 A;  1BR2 A;  4MFR A;  1MIW A;  3AA1 B;  1OXZ A;  2V6Y B;  2Z6E A;  3LBX A;  3RF1 A;  3RX6 A;  4BA9 A;  4JV5 T;  4NPP A;  2CXF A;  3VKH A;  2F4V T;  2BKO A;  4MBQ A;  5TAO A;  4ZI7 E;  4PFP A;  2BDE A;  2WB5 A;  3AA6 B;  4IDP A;  4KMC A;  5DAB A;  4CN1 A;  5LNK A;  3T1Y T;  1Z0P A;  2V6X A;  3C4X A;  2ACZ A;  1XDO A;  2WSS V;  1NEN A;  3ANW A;  3Q9D A;  4X1I E;  5AQV B;  3PU3 A;  1UUS A;  2V7I A;  3FZM B;  4HE8 A;  4ZS3 A;  3ZN1 B;  4DR2 T;  1DU2 A;  2C5I T;  3EDV A;  4Q25 A;  4HN9 A;  1ZHC A;  1LVK A;  1FIO A;  1U5P A;  3BQI A;  3SS1 A;  3IA3 A;  2CE7 A;  3N2G E;  3RIU C;  4B6X A;  4CXY A;  2OA5 A;  1FEW A;  2J62 A;  2JMK A;  4HFD A;  5AFU L;  3ZMT B;  2QRX A;  3LK3 B;  3WAJ A;  2GK9 A;  4I0U A;  2QGS A;  3AE8 A;  1LKX A;  3BQK A;  4QKN A;  2M6B A;  3M65 A;  3OTO T;  1E2A A;  1T98 A;  3ZMS B;  2XQ7 A;  4HGA A;  4HFI A;  4JEH B;  4LML A;  3RPU A;  4E7S A;  3AE2 A;  3J7Y q;  4DUY T;  2BVM A;  3PUY F;  5J0Z A;  2WWV A;  4IE6 A;  5JDH A;  2IAK A;  1XZY A;  4DV6 T;  4HFE A;  4CI2 B;  3AA7 B;  4PFO A;  2W63 A;  3KBU A;  1YKE B;  1W09 A;  2LHN A;  2X66 A;  3A5X A;  3CVR A;  3FBL A;  3SOL A;  5LMN T;  3CML A;  4EV6 A;  3PE0 A;  3RHW A;  3IF8 B;  2XQ9 A;  3N9Q A;  1H7C A;  3K3O A;  2BS2 A;  5L4E A;  4YT0 A;  2A2F X;  5KX5 E;  1XMO T;  2UXD T;  1WR0 A;  3EI0 A;  3KVA A;  2D9D A;  2KND A;  2PJQ A;  5C2T A;  5JRC A;  1X79 A;  3F2E A;  3AEA A;  2HPL A;  2XQ6 A;  3AE9 A;  2WP9 A;  1NAF A;  3NZQ A;  5HXH A;  3CQG B;  2VB6 A;  5EK4 A;  3ZT7 A;  2VKJ A;  2YDS A;  4UV9 B;  1GQE A;  4IDN A;  4YSX A;  2CXL A;  3CPZ A;  4ZZB A;  2Y6X A;  2HN1 A;  4CN6 A;  4I55 E;  3O1J A;  1WLX A;  2W4X A;  3P7I A;  4QX7 B;  4X1Y E;  2VQF T;  2E9X C;  2W62 A;  1O3X A;  3NWI A;  5M4Y A;  2BG9 B;  5AQL B;  2W0G A;  2WY2 A;  3C98 B;  2E9X A;  4Z8X A;  2V26 A;  1JNZ A;  5LG4 A;  5AQF B;  4AQF A; 
#chains in the Genus database with same CATH homology
 1W09 A;  1Y01 A;  3QOF A;  3IA3 A;  3Q5D A;  4IDO A;  4IDN A;  4IDQ A;  4IDP A;  1XZY A;  3QNU A;  1W0A A;  3OVU A;  1Z8U A;  1W0B A;  3Q5E A;  3X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...