3OVUA

Crystal structure of human alpha-haemoglobin complexed with ahsp and the first neat domain of isdh from staphylococcus aureus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'LKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin-stabilizing protein
molecule tags Oxygen transport/protein binding
source organism Homo sapiens
publication title A new haem pocket structure in alpha-haemoglobin
rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ovuA00
1W0BA 3QOFA 3Q5DA 3X1DA 1Y01A 1W09A 3Q5EA 3QNUA 1W0AA 4IDNA 4IDQA 4IDOA 4IDPA 3OVUA 3IA3A 1Z8UA 1XZYA
chains in the Genus database with same CATH superfamily
5LNKA 2NWBA 4O4IE 4DR7T 1B7TA 1WR0A 5L3EB 3E08A 3ZMUB 1I94T 2J1DG 2V26A 2BVMA 2E9XC 2XASB 2IC9A 3F31A 3RYFE 3ZEFB 3UUBA 2AE9A 2V7IA 3MK7C 4FJOA 3EI0A 5KMGP 5M4YA 2DLRA 4AKLA 3SFEA 5J2UE 1QLBA 3CQGB 3OPCA 5ABFB 3G06A 4WZXA 2L3LA 5FVKA 2X0HA 2YKSA 2W62A 1FMVA 2NW9A 3R6NA 3N2KE 3ZYLA 2MAWA 5LG3A 4DVDA 2WQYA 4GIWA 4EYUA 3KINB 3P7IA 4TN7B 2XSAA 1E1HB 3JCFA 4IE6A 3AAIA 2DL1A 3QNUA 4PK6A 1O3XA 3PUSA 1OXZA 2AXDS 4JI7T 1U5PA 2UU9T 4LMJA 2VB6A 5LXTE 3VU7H 3UU5A 4H9RC 4HFBA 4QH5A 3GA8A 4ZI3D 4TX5A 2KT9A 4YTPA 3RIFA 4DV4T 1XZYA 2CM0A 5L3BB 2WS3A 3X1DA 1Y01A 3GWHA 4GK0E 4DUZT 3WAJA 4DR4T 1T7SA 2LT3A 2CE7A 1WYBA 2EHOC 2UXXB 3ABVA 2PTFA 1HNXT 2NW8A 3PE0A 2CMRA 2XAJB 2NR4A 5AQRB 3CX8B 4P09A 2JRKA 2I59A 3B13A 4G63A 4UVBB 4HFIA 1T8BA 1GQEA 2CCQA 5FXWA 3K3OA 3RC3A 2UXBT 3J7Yq 1UURA 3QOFA 5EZYE 1M62A 3C50A 2QA7A 3A8YC 4JLEA 5JR9C 1UGOA 3FBLA 3LG7A 1ZP0A 2WZIA 4WYVA 3UQ4A 3IA3A 5CA1E 3FHNA 4PJLA 2E9XD 2BG9B 2W63A 3ZT6A 4E7ZA 2Q9QC 3VRBA 4LMLA 2KZ7B 4H9QC 3ZMTB 5LJNA 4PAGA 1BR4A 1W0AA 4NUUA 2UUAT 1YQ4A 5JDGA 1YKEB 4QH1A 4JI4T 1X9BA 4IREA 2J4GA 4PW8A 2YN6A 3IF8B 4PFPA 3UFEA 5HXHA 3UT5E 3LK3B 4B3TT 4QXCB 2LKGA 4EEDA 3A7MA 3QK6A 2W66A 4UV9B 2X0LB 4H9PC 5AQTB 2VL8A 2K9AA 5AQVB 1IBLT 3AEDA 4IE5A 3N2OA 4B6XA 2CPTA 3AE7A 3I9WA 2XAHB 1KK7A 3GN5B 3MKDA 3AE1A 4DO0A 3CX6B 4X1IE 3HKCE 1S94A 2B76A 2UXNB 2PG8A 4IDPA 4OYKA 5AQHB 3HR0A 4DV6T 4PNIA 2XQ7A 4I55E 2WMNA 4U7IA 5AQPB 3RH3A 3KVAA 3ZCJA 5ABFA 1MMGA 2DWGA 3DJBA 2D2SA 5LBQB 1HR0T 4AKIA 4A97A 5IHYA 3EDUA 4ILBA 4OK0A 4DV3T 3JC6C 5JDHA 3NBXX 4CI3B 5HCMA 4YTNA 5JR9B 4P1NA 1KF6A 4YSXA 3MA9A 2BKOA 2HH7A 3VR9A 3MXZA 3OJAA 4HFCA 2OV9A 2WB5A 4YHHT 2MPKA 5C2TA 4LFAT 2MTQA 2WAUA 2CA5A 5FL0A 1EZ3A 4HEAA 2BKNA 2I0MA 4ERRA 3ETUA 4Z8XA 2C5IT 4C91A 4DV2T 3HI2A 1WR6A 2X0YA 2Y8DA 5L47A 1WFDA 1M7KA 5LMNT 3T1HT 1QUUA 4YSZA 4DR3T 5FNVE 2A3DA 2CLYB 3K3NA 4AQFA 2G0UA 1LVKA 3NZQA 4PK4A 4U74A 1UCUA 4U3CA 5AQOB 3VKGA 3IEEA 3ONJA 4KHPT 2EHOA 3ONXA 1W9RA 3L39A 5JTGA 2NP9A 1BR2A 1MIYA 2K3WA 5IUXA 3CK6A 1W09A 2WWVA 5JRCB 5JVDE 5LOVE 3FZFB 3RYHE 4MFRA 4WNKA 2H7VC 5JREA 1SHZC 2YU2A 3UU8A 4CI1B 3AEGA 4EOZB 2YEVC 4JI8T 2QRXA 3FXEB 5HEUA 4YJ2E 1ZEEA 4IHJE 4X20E 2CXFA 4TV8E 3HA4A 4GK5E 1HX1B 1T98A 3GMIA 1ZV4X 1VOMA 4JI2T 2ZM0A 2XSBA 4IT4A 4CN4A 4L5GA 4QXBB 3H3MA 3RIUC 4ILAA 4AISA 4EEBA 5A1LA 4CZZB 2Y6XA 3OBVE 4ZI3C 4DIDB 2JQQA 3A5XA 2C5KT 4JEUB 2W0GA 3VR8A 4CN6A 2Q9QD 2V5CA 5BMVE 4IDNA 4YSYA 2D9DA 2Q9QB 1NAFA 4IDOA 3O1JA 5LBMA 4LF7T 3PUAA 4DMWA 2KLQA 5HWXA 3ANWB 3S4UA 2YK0A 3L8RA 2CBIA 5LGNB 4AQFC 2CLYC 4EZHA 4WW0A 3AECA 2LRKA 4ILCA 4P0BA 4X65T 3BK9A 4A56A 4GYSA 2ZM2A 4PJMA 1FIOA 3TLUA 1YD8G 2ACZA 5FXZA 1MNEA 1HF8A 2NTYA 4HGAA 4Z91A 1KFYA 3MACA 3ZN0B 3D0TA 4AI6A 4PK5A 2ZMAA 4HN9A 4XBFB 4B3MT 4HFHA 2LJLA 2KWIB 3AAEB 2VQET 4HTEA 5E0OA 1IBMT 2FJEA 2IIUA 4C90A 2NW7A 4X66T 4JI1T 3ZKRA 3SFDA 2ES0A 4AXPA 4N78D 3RPUA 5HEJA 4GYRA 5EK2A 2Q9QA 3WI3A 1YKHB 4DV7T 3F57A 1Z8UA 3RKGA 3E0ZA 1V9DA 3O1IA 2WU2A 4ISSA 1IBKT 4KP3C 2EHOB 1OEDC 3AVSA 3P50A 4NPPA 2MBGA 1HG5A 3TLWA 2ODUA 4DNDA 1KNZA 4ZZCA 3FXDB 3JAEA 4IE0A 5HEOA 1I6ZA 4ZZBA 3JADA 2N1GA 2E2AA 2PBIA 2D0TA 3TLVA 3P4WA 2XJ7A 4E7SA 4K0UA 3N9QA 4AKRB 3RC8A 4CXWA 3FB2A 2XPKA 3OVUA 3ANWA 4WBOA 4H9OC 3PUYF 2WP9A 2V7KA 2X68A 4IIJE 2CWOA 2YDSA 2LSGA 5FL1A 4NXNT 1YXRA 2ODVA 2M6BA 5DABA 5HAXA 3KV9A 4J2CA 2VKJA 4I50E 4YT0A 5F3JA 5FP3A 4HFVA 5CA0E 3UU3A 2OA5A 2EHOD 3UU4A 5AQJB 1IJ5A 3AE3A 1T72A 4UF0B 5ABGA 3ZSTA 1XDPA 5C8YE 3LK42 2FJAA 3ZYKA 4B3ST 3RIAA 4DBRA 5LHHB 5JDFA 4I0UA 4IDQA 5AQNB 2DNXA 2X9YA 2L9QA 4KHZF 2IW5B 3ZN1B 3KBUA 4U33A 2NTXA 2XQ5A 3P8CD 3GN5A 4YHJA 4YTMA 3V5SA 4ZOLE 3PDYA 3AA7B 5F8PA 4A98A 2RPAA 4NXMT 3AEFA 2LHRA 3I1AA 3FZHB 3RKOA 1W0BA 3I0QA 3QUJA 4HWIB 4ZI7E 3Q5EA 2UUBT 2WZHA 4K0KT 3N9PA 3SWHA 1XNQT 1D1AA 2IC6A 4COFA 1X79A 2VVSA 3FZMB 2LLYA 5ADXL 2VWAA 3AVRA 4GKJT 5HEGA 4XZCA 1N33T 5HEHA 3O9XA 4JBWF 2A72A 1J5ET 4QH4A 2PFVA 3P4PA 4F8HA 4KX6A 3CKDA 4LF5T 5AQMB 3T1YT 3PUGA 4YJ3E 1FJGT 3OYXA 2BG9A 2BBJA 4JV5T 1IAPA 3ESLA 4DUYT 2CXDA 4ZS3A 4U2ZA 5LGUB 4Z90A 5HXCA 2KMFA 2LSIA 2Y48B 4H9NC 3AE4A 1ZOYA 3BQLA 4M1PA 4H9SE 4HFDA 3BQIA 2XQ4A 4O4HE 3PUXF 4NIQA 1XWMA 2JQ9A 3RYIE 3AEAA 3HKDE 2M6IA 1HX8A 2V1DB 2WDVA 3ZT7A 5JH7E 5LJMA 4LF4T 3I0OA 3LBXA 5IYZE 3Q5XA 5LGTB 2BS3A 1N36T 1XMQT 4V1Av 3RQUA 3HKEE 1E7PA 1SUMB 2SPCA 2RA1A 1JNRA 2WDRA 3IBPA 1D1BA 2N2NA 4CI2B 3SS1A 2E9XA 1MMDA 5JDNA 3SRZA 2ZM8A 2KWHA 5GONE 1N32T 1WRDA 4X62T 3LK2B 1NEKA 2N9DA 4I43B 4QX8B 4IL9A 2WCAA 5HXSA 2JMKA 3JC6D 4GKKT 5AQIB 2V7LA 1UK5A 4HE8A 2XM1A 5HXEA 5L4HA 4KBMB 2LEHA 3C4ZA 3RRWA 2PJQA 5AQLB 1SA0E 4UEMA 4ANJA 4CN1A 1J5WA 5HXRA 3AE2A 3ETVA 4TV9E 4TUYE 2RP4A 4U72A 2UXCT 4U2YA 5EK4A 2WSSV 2BG9C 3HL6A 3AA1B 4QWNB 1YQ3A 2R6GF 3TLSA 4IE7A 2JJ9A 3CWZB 1NWMX 2E8IA 2YOEA 4QX7B 2VL0A 4DBQA 2F4VT 1XDOA 3EDVA 3KV4A 4HWDA 2X67A 2VVNA 4QKNA 4DR5T 4DR6T 2UXDT 1N34T 4CXYA 3Q2MA 3LSVA 2XQAA 4U31A 5HYAA 4FI5A 2W67A 2XQYA 4H63H 4Q25A 3RIUA 4OHFA 3Q9DA 5AFUL 5LA6E 3RRCA 1D0YA 4EGWA 4DR1T 3AEBA 1WLXA 1IZNB 3OKQA 4O4JE 3C4XA 2E9XB 2I6HA 3P4QA 5FVLA 3EVYA 1U4QA 3E22E 1OEDE 3FZKB 5FMNA 4MLKA 4DR2T 2JQHA 3TKLB 2D0UA 2XM2A 3CIRA 3K8PC 2FBWA 2LSJA 1LVFA 1MIVA 4UR9A 4JI3T 2QVAA 3LBXB 4IL4A 2DCFA 2K24A 2YDQA 1FMWA 3AB3B 4JUYA 2JIWA 3ZC1A 1NENA 5JRCA 4ZS2A 3RI5A 2BZBA 2LHNA 2H3RA 2LRLA 2KXPB 2LOSA 3H37A 4YXDA 3CVRA 3RLFF 1HNZT 4UELA 1D0ZA 1XNRT 1CHUA 4JI6T 3SOLA 1ZHCA 4O2AE 2XAFB 1HCIA 3NVOA 4ISTA 1R8IA 2FJBA 2XAQB 3BQKA 4H63V 4MALA 4O2BE 3ZMSB 2HN2A 2VKHA 5L2LA 4TNWA 3Q5WA 5AQSB 3ZLIA 1FEWA 3NRXA 4F6RC 3AXJA 1BR0A 2LKHA 2OLTA 2LE8A 3Q5DA 2CXLA 3N9MA 2CHNA 1OEDA 2YDRA 3QB5K 1LKXA 4EZ4A 2WU5A 3AXJB 4EXTA 5JQGE 3ZMZB 4LFCT 4UXNB 3ZPOA 2X9XA 4BAYB 1HNWT 4HFEA 2MYSA 1YW0A 5AQKB 5C3JA 2XAGB 3NZPA 2IHR1 4KUMB 5AQQB 4IE4A 2L8KA 4ZXLA 4HWHA 3T8OA 4AQYT 3C4WA 2KNDA 3PURA 3AE9A 2QGSA 5AQGB 1D0XA 3P4RA 3PV0F 2NOXA 3FZLB 3RQWA 4EYYR 3OTOT 2HN1A 4JEHB 1Y64B 3KDSE 3O1HA 2IUBA 3QB5A 4KI0F 3N9LA 4YFSA 3ZJ1A 4LF6T 3N9NA 2XQ8A 5FY1A 2BBHA 2IDOB 3AA0B 1L0VA 1US7B 2V6YA 2BVLA 2Z6EA 1KEYA 4UVAB 3N2GE 4O8SA 5LHGB 4LFBT 1UUSA 3UFGA 4L0RA 2VKDA 1G73A 3PU8A 3NRYA 2KINB 4TWDA 5J0ZA 4BA9A 2CWYA 1OWAA 3L3PA 4AQGA 4UV8B 2CEAA 2WBLA 3AEEA 3N9OA 4G2AA 4A5XA 5AQFB 2W2UA 3ZC0A 2XHEB 4TZ4C 5DQWA 2HHHT 2B1EA 3CPZA 3LJCA 1J1JA 2LOPA 2ZLYA 1JNZA 5J2TE 2W4XA 3PUZF 2GK9A 2DI4A 5LP6E 5JDQA 3PTRB 5CJ5A 3OYZA 5DJQC 1MMNA 4EAHA 4P0AA 5IWAT 3H3AA 4OFZA 5LCYA 5L3DB 3EABA 4BJMA 2V5DA 5LG4A 3LDQB 3PUVF 3LFMA 3VHLA 2BDEA 4JYAT 1MNDA 3RF1A 2BS4A 3ZMVB 2BG9E 3DTOA 3M3ZB 3UUNA 1BR1A 2XQ3A 3UUXB 5H6QB 2LM9A 2VASA 4I4TE 4IGUA 1E2AA 2LSYA 3KBTA 4ADZA 2JMHA 1MIWA 3UUMA 1WCRA 2CHOA 3RGLA 3NWIA 2DHRA 3QC9A 2V7MA 3F2EA 3KV6A 4WBNE 5CFBA 4X1YE 2YU1A 1WYCA 4HKAA 4XAXB 3ZT5A 2E5LT 5KXJA 3CQCB 2XTLA 3WAKA 4TWHA 2HPJA 4MBQA 3AE8A 3CMLA 2A2FX 4MHCA 2FUPA 5L4EA 5BR8T 5L3GB 4ZI2D 2K5BB 2X51A 3ONLC 3C51A 2JPFA 1SE7A 5ABEA 4LF9T 1HFAA 3C64A 5HCJA 3KV5A 1CUNA 3PUQA 4PJJA 5FKYA 5LYJE 3UTKA 1D1CA 4KMCA 3MZKB 5FYMA 3VRAA 5ETWA 4LMKA 2LSKA 5CB4E 3AE6A 3PUWF 5CGMA 4OX9T 3JAFA 4DMVA 2ZM6T 4AKHA 1IJ6A 3CX7B 2X66A 2X9WA 3EHZA 5L3CB 2FJDA 3B5MA 1VCTA 3EAMA 2M67A 3U3IA 3ZCIA 5KX5E 3DP7A 4U7YA 3CQXC 2CBJA 2XUEA 1MMAA 4OYJA 1G8XA 5F5WA 2A9UA 4TWFA 4GOUA 4ASKA 4L9IA 3RYCE 4X1KE 2WM9A 2H7OA 4QXHB 1HS7A 4CQIA 3PJAA 3W15B 2VK9A 3M65A 5H6RB 3NKZA 4EB6E 5J1GA 4DV0T 2C5JA 2KSRA 4UVCB 2C0SA 3AAAB 4O4LE 2BKPA 2DWKA 5TAOA 4DV1T 3AA6B 1DU2A 4DV5T 2E5VA 2X9HA 3V5UA 1HTJF 1KNRA 3HKBE 1HG2A 1AJ3A 3R84B 4ZI2C 2VURA 4PJNA 1LRZA 2V7JA 4AKGA 3UQ7A 4UIGA 2WDQA 5FXXA 2WWUA 3J9X1 3P4SA 5LHIB 2D5UA 3TLTA 2V6XA 3ZJ2A 4HWFA 1H7CA 1Z0PA 4X5TA 4JI5T 3C98B 2P9BA 3RHWA 2QYWA 5FY0A 1UX5A 1QSDA 4TNVA 4ZHQE 2W61A 4JI0T 5LB7B 2VKOA 1VCSA 2IAKA 2WY2A 2H88A 1S35A 2CRBA 2WMOA 4LF8T 5ABHA 2V8SV 3U78A 3KVBA 3UU6A 2IMLA 4B3RT 3RX6A 5KDMC 5LMUT 2XY8B 3FBZA 4YLHA 3N5LA 4HWCA 2ACXA 2J62A 3EUHA 4BJNA 1VRBA 3UULA 2LM2A 2JQKA 4UF0A 5EK3A 5JDMA 4ILUA 2XZEA 3PU3A 4QHOA 4YY3T 1XMOT 5DQVA 2J47A 5FXVA 5JR9A 2UUCT 2MOZA 3VKHA 5HWYA 2XQ9A 3K3QC 3PJAJ 3I9YA 4AIUA 2W00A 3KFWX 3L09A 5L3FB 4X64T 2V6YB 4PFOA 4IDZA 2K48A 3MJXA 5FY7A 4EIWA 3IHRA 1KNPA 1OEDB 2BS2A 2HPLA 1ZKEA 1UX4A 2YINA 3B57A 3O4XE 3ZSSA 4EV6A 4CXXA 3AE5A 3K1SA 4NUVA 2H89A 5AQUB 2XQ6A 3ZYMA 4ZEYA 5JDLA 2VQFT
chains in the Genus database with same CATH topology
1W0BA 3QOFA 3Q5DA 3X1DA 1Y01A 1W09A 3Q5EA 3QNUA 1W0AA 4IDNA 4IDQA 4IDOA 4IDPA 3OVUA 3IA3A 1Z8UA 1XZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0B A;  3QOF A;  3Q5D A;  3X1D A;  1Y01 A;  1W09 A;  3Q5E A;  3QNU A;  1W0A A;  4IDN A;  4IDQ A;  4IDO A;  4IDP A;  3OVU A;  3IA3 A;  1Z8U A;  1XZY A; 
#chains in the Genus database with same CATH topology
 5LNK A;  2NWB A;  4O4I E;  4DR7 T;  1B7T A;  1WR0 A;  5L3E B;  3E08 A;  3ZMU B;  1I94 T;  2J1D G;  2V26 A;  2BVM A;  2E9X C;  2XAS B;  2IC9 A;  3F31 A;  3RYF E;  3ZEF B;  3UUB A;  2AE9 A;  2V7I A;  3MK7 C;  4FJO A;  3EI0 A;  5KMG P;  5M4Y A;  2DLR A;  4AKL A;  3SFE A;  5J2U E;  1QLB A;  3CQG B;  3OPC A;  5ABF B;  3G06 A;  4WZX A;  2L3L A;  5FVK A;  2X0H A;  2YKS A;  2W62 A;  1FMV A;  2NW9 A;  3R6N A;  3N2K E;  3ZYL A;  2MAW A;  5LG3 A;  4DVD A;  2WQY A;  4GIW A;  4EYU A;  3KIN B;  3P7I A;  4TN7 B;  2XSA A;  1E1H B;  3JCF A;  4IE6 A;  3AAI A;  2DL1 A;  3QNU A;  4PK6 A;  1O3X A;  3PUS A;  1OXZ A;  2AXD S;  4JI7 T;  1U5P A;  2UU9 T;  4LMJ A;  2VB6 A;  5LXT E;  3VU7 H;  3UU5 A;  4H9R C;  4HFB A;  4QH5 A;  3GA8 A;  4ZI3 D;  4TX5 A;  2KT9 A;  4YTP A;  3RIF A;  4DV4 T;  1XZY A;  2CM0 A;  5L3B B;  2WS3 A;  3X1D A;  1Y01 A;  3GWH A;  4GK0 E;  4DUZ T;  3WAJ A;  4DR4 T;  1T7S A;  2LT3 A;  2CE7 A;  1WYB A;  2EHO C;  2UXX B;  3ABV A;  2PTF A;  1HNX T;  2NW8 A;  3PE0 A;  2CMR A;  2XAJ B;  2NR4 A;  5AQR B;  3CX8 B;  4P09 A;  2JRK A;  2I59 A;  3B13 A;  4G63 A;  4UVB B;  4HFI A;  1T8B A;  1GQE A;  2CCQ A;  5FXW A;  3K3O A;  3RC3 A;  2UXB T;  3J7Y q;  1UUR A;  3QOF A;  5EZY E;  1M62 A;  3C50 A;  2QA7 A;  3A8Y C;  4JLE A;  5JR9 C;  1UGO A;  3FBL A;  3LG7 A;  1ZP0 A;  2WZI A;  4WYV A;  3UQ4 A;  3IA3 A;  5CA1 E;  3FHN A;  4PJL A;  2E9X D;  2BG9 B;  2W63 A;  3ZT6 A;  4E7Z A;  2Q9Q C;  3VRB A;  4LML A;  2KZ7 B;  4H9Q C;  3ZMT B;  5LJN A;  4PAG A;  1BR4 A;  1W0A A;  4NUU A;  2UUA T;  1YQ4 A;  5JDG A;  1YKE B;  4QH1 A;  4JI4 T;  1X9B A;  4IRE A;  2J4G A;  4PW8 A;  2YN6 A;  3IF8 B;  4PFP A;  3UFE A;  5HXH A;  3UT5 E;  3LK3 B;  4B3T T;  4QXC B;  2LKG A;  4EED A;  3A7M A;  3QK6 A;  2W66 A;  4UV9 B;  2X0L B;  4H9P C;  5AQT B;  2VL8 A;  2K9A A;  5AQV B;  1IBL T;  3AED A;  4IE5 A;  3N2O A;  4B6X A;  2CPT A;  3AE7 A;  3I9W A;  2XAH B;  1KK7 A;  3GN5 B;  3MKD A;  3AE1 A;  4DO0 A;  3CX6 B;  4X1I E;  3HKC E;  1S94 A;  2B76 A;  2UXN B;  2PG8 A;  4IDP A;  4OYK A;  5AQH B;  3HR0 A;  4DV6 T;  4PNI A;  2XQ7 A;  4I55 E;  2WMN A;  4U7I A;  5AQP B;  3RH3 A;  3KVA A;  3ZCJ A;  5ABF A;  1MMG A;  2DWG A;  3DJB A;  2D2S A;  5LBQ B;  1HR0 T;  4AKI A;  4A97 A;  5IHY A;  3EDU A;  4ILB A;  4OK0 A;  4DV3 T;  3JC6 C;  5JDH A;  3NBX X;  4CI3 B;  5HCM A;  4YTN A;  5JR9 B;  4P1N A;  1KF6 A;  4YSX A;  3MA9 A;  2BKO A;  2HH7 A;  3VR9 A;  3MXZ A;  3OJA A;  4HFC A;  2OV9 A;  2WB5 A;  4YHH T;  2MPK A;  5C2T A;  4LFA T;  2MTQ A;  2WAU A;  2CA5 A;  5FL0 A;  1EZ3 A;  4HEA A;  2BKN A;  2I0M A;  4ERR A;  3ETU A;  4Z8X A;  2C5I T;  4C91 A;  4DV2 T;  3HI2 A;  1WR6 A;  2X0Y A;  2Y8D A;  5L47 A;  1WFD A;  1M7K A;  5LMN T;  3T1H T;  1QUU A;  4YSZ A;  4DR3 T;  5FNV E;  2A3D A;  2CLY B;  3K3N A;  4AQF A;  2G0U A;  1LVK A;  3NZQ A;  4PK4 A;  4U74 A;  1UCU A;  4U3C A;  5AQO B;  3VKG A;  3IEE A;  3ONJ A;  4KHP T;  2EHO A;  3ONX A;  1W9R A;  3L39 A;  5JTG A;  2NP9 A;  1BR2 A;  1MIY A;  2K3W A;  5IUX A;  3CK6 A;  1W09 A;  2WWV A;  5JRC B;  5JVD E;  5LOV E;  3FZF B;  3RYH E;  4MFR A;  4WNK A;  2H7V C;  5JRE A;  1SHZ C;  2YU2 A;  3UU8 A;  4CI1 B;  3AEG A;  4EOZ B;  2YEV C;  4JI8 T;  2QRX A;  3FXE B;  5HEU A;  4YJ2 E;  1ZEE A;  4IHJ E;  4X20 E;  2CXF A;  4TV8 E;  3HA4 A;  4GK5 E;  1HX1 B;  1T98 A;  3GMI A;  1ZV4 X;  1VOM A;  4JI2 T;  2ZM0 A;  2XSB A;  4IT4 A;  4CN4 A;  4L5G A;  4QXB B;  3H3M A;  3RIU C;  4ILA A;  4AIS A;  4EEB A;  5A1L A;  4CZZ B;  2Y6X A;  3OBV E;  4ZI3 C;  4DID B;  2JQQ A;  3A5X A;  2C5K T;  4JEU B;  2W0G A;  3VR8 A;  4CN6 A;  2Q9Q D;  2V5C A;  5BMV E;  4IDN A;  4YSY A;  2D9D A;  2Q9Q B;  1NAF A;  4IDO A;  3O1J A;  5LBM A;  4LF7 T;  3PUA A;  4DMW A;  2KLQ A;  5HWX A;  3ANW B;  3S4U A;  2YK0 A;  3L8R A;  2CBI A;  5LGN B;  4AQF C;  2CLY C;  4EZH A;  4WW0 A;  3AEC A;  2LRK A;  4ILC A;  4P0B A;  4X65 T;  3BK9 A;  4A56 A;  4GYS A;  2ZM2 A;  4PJM A;  1FIO A;  3TLU A;  1YD8 G;  2ACZ A;  5FXZ A;  1MNE A;  1HF8 A;  2NTY A;  4HGA A;  4Z91 A;  1KFY A;  3MAC A;  3ZN0 B;  3D0T A;  4AI6 A;  4PK5 A;  2ZMA A;  4HN9 A;  4XBF B;  4B3M T;  4HFH A;  2LJL A;  2KWI B;  3AAE B;  2VQE T;  4HTE A;  5E0O A;  1IBM T;  2FJE A;  2IIU A;  4C90 A;  2NW7 A;  4X66 T;  4JI1 T;  3ZKR A;  3SFD A;  2ES0 A;  4AXP A;  4N78 D;  3RPU A;  5HEJ A;  4GYR A;  5EK2 A;  2Q9Q A;  3WI3 A;  1YKH B;  4DV7 T;  3F57 A;  1Z8U A;  3RKG A;  3E0Z A;  1V9D A;  3O1I A;  2WU2 A;  4ISS A;  1IBK T;  4KP3 C;  2EHO B;  1OED C;  3AVS A;  3P50 A;  4NPP A;  2MBG A;  1HG5 A;  3TLW A;  2ODU A;  4DND A;  1KNZ A;  4ZZC A;  3FXD B;  3JAE A;  4IE0 A;  5HEO A;  1I6Z A;  4ZZB A;  3JAD A;  2N1G A;  2E2A A;  2PBI A;  2D0T A;  3TLV A;  3P4W A;  2XJ7 A;  4E7S A;  4K0U A;  3N9Q A;  4AKR B;  3RC8 A;  4CXW A;  3FB2 A;  2XPK A;  3OVU A;  3ANW A;  4WBO A;  4H9O C;  3PUY F;  2WP9 A;  2V7K A;  2X68 A;  4IIJ E;  2CWO A;  2YDS A;  2LSG A;  5FL1 A;  4NXN T;  1YXR A;  2ODV A;  2M6B A;  5DAB A;  5HAX A;  3KV9 A;  4J2C A;  2VKJ A;  4I50 E;  4YT0 A;  5F3J A;  5FP3 A;  4HFV A;  5CA0 E;  3UU3 A;  2OA5 A;  2EHO D;  3UU4 A;  5AQJ B;  1IJ5 A;  3AE3 A;  1T72 A;  4UF0 B;  5ABG A;  3ZST A;  1XDP A;  5C8Y E;  3LK4 2;  2FJA A;  3ZYK A;  4B3S T;  3RIA A;  4DBR A;  5LHH B;  5JDF A;  4I0U A;  4IDQ A;  5AQN B;  2DNX A;  2X9Y A;  2L9Q A;  4KHZ F;  2IW5 B;  3ZN1 B;  3KBU A;  4U33 A;  2NTX A;  2XQ5 A;  3P8C D;  3GN5 A;  4YHJ A;  4YTM A;  3V5S A;  4ZOL E;  3PDY A;  3AA7 B;  5F8P A;  4A98 A;  2RPA A;  4NXM T;  3AEF A;  2LHR A;  3I1A A;  3FZH B;  3RKO A;  1W0B A;  3I0Q A;  3QUJ A;  4HWI B;  4ZI7 E;  3Q5E A;  2UUB T;  2WZH A;  4K0K T;  3N9P A;  3SWH A;  1XNQ T;  1D1A A;  2IC6 A;  4COF A;  1X79 A;  2VVS A;  3FZM B;  2LLY A;  5ADX L;  2VWA A;  3AVR A;  4GKJ T;  5HEG A;  4XZC A;  1N33 T;  5HEH A;  3O9X A;  4JBW F;  2A72 A;  1J5E T;  4QH4 A;  2PFV A;  3P4P A;  4F8H A;  4KX6 A;  3CKD A;  4LF5 T;  5AQM B;  3T1Y T;  3PUG A;  4YJ3 E;  1FJG T;  3OYX A;  2BG9 A;  2BBJ A;  4JV5 T;  1IAP A;  3ESL A;  4DUY T;  2CXD A;  4ZS3 A;  4U2Z A;  5LGU B;  4Z90 A;  5HXC A;  2KMF A;  2LSI A;  2Y48 B;  4H9N C;  3AE4 A;  1ZOY A;  3BQL A;  4M1P A;  4H9S E;  4HFD A;  3BQI A;  2XQ4 A;  4O4H E;  3PUX F;  4NIQ A;  1XWM A;  2JQ9 A;  3RYI E;  3AEA A;  3HKD E;  2M6I A;  1HX8 A;  2V1D B;  2WDV A;  3ZT7 A;  5JH7 E;  5LJM A;  4LF4 T;  3I0O A;  3LBX A;  5IYZ E;  3Q5X A;  5LGT B;  2BS3 A;  1N36 T;  1XMQ T;  4V1A v;  3RQU A;  3HKE E;  1E7P A;  1SUM B;  2SPC A;  2RA1 A;  1JNR A;  2WDR A;  3IBP A;  1D1B A;  2N2N A;  4CI2 B;  3SS1 A;  2E9X A;  1MMD A;  5JDN A;  3SRZ A;  2ZM8 A;  2KWH A;  5GON E;  1N32 T;  1WRD A;  4X62 T;  3LK2 B;  1NEK A;  2N9D A;  4I43 B;  4QX8 B;  4IL9 A;  2WCA A;  5HXS A;  2JMK A;  3JC6 D;  4GKK T;  5AQI B;  2V7L A;  1UK5 A;  4HE8 A;  2XM1 A;  5HXE A;  5L4H A;  4KBM B;  2LEH A;  3C4Z A;  3RRW A;  2PJQ A;  5AQL B;  1SA0 E;  4UEM A;  4ANJ A;  4CN1 A;  1J5W A;  5HXR A;  3AE2 A;  3ETV A;  4TV9 E;  4TUY E;  2RP4 A;  4U72 A;  2UXC T;  4U2Y A;  5EK4 A;  2WSS V;  2BG9 C;  3HL6 A;  3AA1 B;  4QWN B;  1YQ3 A;  2R6G F;  3TLS A;  4IE7 A;  2JJ9 A;  3CWZ B;  1NWM X;  2E8I A;  2YOE A;  4QX7 B;  2VL0 A;  4DBQ A;  2F4V T;  1XDO A;  3EDV A;  3KV4 A;  4HWD A;  2X67 A;  2VVN A;  4QKN A;  4DR5 T;  4DR6 T;  2UXD T;  1N34 T;  4CXY A;  3Q2M A;  3LSV A;  2XQA A;  4U31 A;  5HYA A;  4FI5 A;  2W67 A;  2XQY A;  4H63 H;  4Q25 A;  3RIU A;  4OHF A;  3Q9D A;  5AFU L;  5LA6 E;  3RRC A;  1D0Y A;  4EGW A;  4DR1 T;  3AEB A;  1WLX A;  1IZN B;  3OKQ A;  4O4J E;  3C4X A;  2E9X B;  2I6H A;  3P4Q A;  5FVL A;  3EVY A;  1U4Q A;  3E22 E;  1OED E;  3FZK B;  5FMN A;  4MLK A;  4DR2 T;  2JQH A;  3TKL B;  2D0U A;  2XM2 A;  3CIR A;  3K8P C;  2FBW A;  2LSJ A;  1LVF A;  1MIV A;  4UR9 A;  4JI3 T;  2QVA A;  3LBX B;  4IL4 A;  2DCF A;  2K24 A;  2YDQ A;  1FMW A;  3AB3 B;  4JUY A;  2JIW A;  3ZC1 A;  1NEN A;  5JRC A;  4ZS2 A;  3RI5 A;  2BZB A;  2LHN A;  2H3R A;  2LRL A;  2KXP B;  2LOS A;  3H37 A;  4YXD A;  3CVR A;  3RLF F;  1HNZ T;  4UEL A;  1D0Z A;  1XNR T;  1CHU A;  4JI6 T;  3SOL A;  1ZHC A;  4O2A E;  2XAF B;  1HCI A;  3NVO A;  4IST A;  1R8I A;  2FJB A;  2XAQ B;  3BQK A;  4H63 V;  4MAL A;  4O2B E;  3ZMS B;  2HN2 A;  2VKH A;  5L2L A;  4TNW A;  3Q5W A;  5AQS B;  3ZLI A;  1FEW A;  3NRX A;  4F6R C;  3AXJ A;  1BR0 A;  2LKH A;  2OLT A;  2LE8 A;  3Q5D A;  2CXL A;  3N9M A;  2CHN A;  1OED A;  2YDR A;  3QB5 K;  1LKX A;  4EZ4 A;  2WU5 A;  3AXJ B;  4EXT A;  5JQG E;  3ZMZ B;  4LFC T;  4UXN B;  3ZPO A;  2X9X A;  4BAY B;  1HNW T;  4HFE A;  2MYS A;  1YW0 A;  5AQK B;  5C3J A;  2XAG B;  3NZP A;  2IHR 1;  4KUM B;  5AQQ B;  4IE4 A;  2L8K A;  4ZXL A;  4HWH A;  3T8O A;  4AQY T;  3C4W A;  2KND A;  3PUR A;  3AE9 A;  2QGS A;  5AQG B;  1D0X A;  3P4R A;  3PV0 F;  2NOX A;  3FZL B;  3RQW A;  4EYY R;  3OTO T;  2HN1 A;  4JEH B;  1Y64 B;  3KDS E;  3O1H A;  2IUB A;  3QB5 A;  4KI0 F;  3N9L A;  4YFS A;  3ZJ1 A;  4LF6 T;  3N9N A;  2XQ8 A;  5FY1 A;  2BBH A;  2IDO B;  3AA0 B;  1L0V A;  1US7 B;  2V6Y A;  2BVL A;  2Z6E A;  1KEY A;  4UVA B;  3N2G E;  4O8S A;  5LHG B;  4LFB T;  1UUS A;  3UFG A;  4L0R A;  2VKD A;  1G73 A;  3PU8 A;  3NRY A;  2KIN B;  4TWD A;  5J0Z A;  4BA9 A;  2CWY A;  1OWA A;  3L3P A;  4AQG A;  4UV8 B;  2CEA A;  2WBL A;  3AEE A;  3N9O A;  4G2A A;  4A5X A;  5AQF B;  2W2U A;  3ZC0 A;  2XHE B;  4TZ4 C;  5DQW A;  2HHH T;  2B1E A;  3CPZ A;  3LJC A;  1J1J A;  2LOP A;  2ZLY A;  1JNZ A;  5J2T E;  2W4X A;  3PUZ F;  2GK9 A;  2DI4 A;  5LP6 E;  5JDQ A;  3PTR B;  5CJ5 A;  3OYZ A;  5DJQ C;  1MMN A;  4EAH A;  4P0A A;  5IWA T;  3H3A A;  4OFZ A;  5LCY A;  5L3D B;  3EAB A;  4BJM A;  2V5D A;  5LG4 A;  3LDQ B;  3PUV F;  3LFM A;  3VHL A;  2BDE A;  4JYA T;  1MND A;  3RF1 A;  2BS4 A;  3ZMV B;  2BG9 E;  3DTO A;  3M3Z B;  3UUN A;  1BR1 A;  2XQ3 A;  3UUX B;  5H6Q B;  2LM9 A;  2VAS A;  4I4T E;  4IGU A;  1E2A A;  2LSY A;  3KBT A;  4ADZ A;  2JMH A;  1MIW A;  3UUM A;  1WCR A;  2CHO A;  3RGL A;  3NWI A;  2DHR A;  3QC9 A;  2V7M A;  3F2E A;  3KV6 A;  4WBN E;  5CFB A;  4X1Y E;  2YU1 A;  1WYC A;  4HKA A;  4XAX B;  3ZT5 A;  2E5L T;  5KXJ A;  3CQC B;  2XTL A;  3WAK A;  4TWH A;  2HPJ A;  4MBQ A;  3AE8 A;  3CML A;  2A2F X;  4MHC A;  2FUP A;  5L4E A;  5BR8 T;  5L3G B;  4ZI2 D;  2K5B B;  2X51 A;  3ONL C;  3C51 A;  2JPF A;  1SE7 A;  5ABE A;  4LF9 T;  1HFA A;  3C64 A;  5HCJ A;  3KV5 A;  1CUN A;  3PUQ A;  4PJJ A;  5FKY A;  5LYJ E;  3UTK A;  1D1C A;  4KMC A;  3MZK B;  5FYM A;  3VRA A;  5ETW A;  4LMK A;  2LSK A;  5CB4 E;  3AE6 A;  3PUW F;  5CGM A;  4OX9 T;  3JAF A;  4DMV A;  2ZM6 T;  4AKH A;  1IJ6 A;  3CX7 B;  2X66 A;  2X9W A;  3EHZ A;  5L3C B;  2FJD A;  3B5M A;  1VCT A;  3EAM A;  2M67 A;  3U3I A;  3ZCI A;  5KX5 E;  3DP7 A;  4U7Y A;  3CQX C;  2CBJ A;  2XUE A;  1MMA A;  4OYJ A;  1G8X A;  5F5W A;  2A9U A;  4TWF A;  4GOU A;  4ASK A;  4L9I A;  3RYC E;  4X1K E;  2WM9 A;  2H7O A;  4QXH B;  1HS7 A;  4CQI A;  3PJA A;  3W15 B;  2VK9 A;  3M65 A;  5H6R B;  3NKZ A;  4EB6 E;  5J1G A;  4DV0 T;  2C5J A;  2KSR A;  4UVC B;  2C0S A;  3AAA B;  4O4L E;  2BKP A;  2DWK A;  5TAO A;  4DV1 T;  3AA6 B;  1DU2 A;  4DV5 T;  2E5V A;  2X9H A;  3V5U A;  1HTJ F;  1KNR A;  3HKB E;  1HG2 A;  1AJ3 A;  3R84 B;  4ZI2 C;  2VUR A;  4PJN A;  1LRZ A;  2V7J A;  4AKG A;  3UQ7 A;  4UIG A;  2WDQ A;  5FXX A;  2WWU A;  3J9X 1;  3P4S A;  5LHI B;  2D5U A;  3TLT A;  2V6X A;  3ZJ2 A;  4HWF A;  1H7C A;  1Z0P A;  4X5T A;  4JI5 T;  3C98 B;  2P9B A;  3RHW A;  2QYW A;  5FY0 A;  1UX5 A;  1QSD A;  4TNV A;  4ZHQ E;  2W61 A;  4JI0 T;  5LB7 B;  2VKO A;  1VCS A;  2IAK A;  2WY2 A;  2H88 A;  1S35 A;  2CRB A;  2WMO A;  4LF8 T;  5ABH A;  2V8S V;  3U78 A;  3KVB A;  3UU6 A;  2IML A;  4B3R T;  3RX6 A;  5KDM C;  5LMU T;  2XY8 B;  3FBZ A;  4YLH A;  3N5L A;  4HWC A;  2ACX A;  2J62 A;  3EUH A;  4BJN A;  1VRB A;  3UUL A;  2LM2 A;  2JQK A;  4UF0 A;  5EK3 A;  5JDM A;  4ILU A;  2XZE A;  3PU3 A;  4QHO A;  4YY3 T;  1XMO T;  5DQV A;  2J47 A;  5FXV A;  5JR9 A;  2UUC T;  2MOZ A;  3VKH A;  5HWY A;  2XQ9 A;  3K3Q C;  3PJA J;  3I9Y A;  4AIU A;  2W00 A;  3KFW X;  3L09 A;  5L3F B;  4X64 T;  2V6Y B;  4PFO A;  4IDZ A;  2K48 A;  3MJX A;  5FY7 A;  4EIW A;  3IHR A;  1KNP A;  1OED B;  2BS2 A;  2HPL A;  1ZKE A;  1UX4 A;  2YIN A;  3B57 A;  3O4X E;  3ZSS A;  4EV6 A;  4CXX A;  3AE5 A;  3K1S A;  4NUV A;  2H89 A;  5AQU B;  2XQ6 A;  3ZYM A;  4ZEY A;  5JDL A;  2VQF T; 
#chains in the Genus database with same CATH homology
 1W0B A;  3QOF A;  3Q5D A;  3X1D A;  1Y01 A;  1W09 A;  3Q5E A;  3QNU A;  1W0A A;  4IDN A;  4IDQ A;  4IDO A;  4IDP A;  3OVU A;  3IA3 A;  1Z8U A;  1XZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...