3OVUA

Crystal structure of human alpha-haemoglobin complexed with ahsp and the first neat domain of isdh from staphylococcus aureus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
LKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin-stabilizing protein
publication title A new haem pocket structure in alpha-haemoglobin
rcsb
source organism Homo sapiens
molecule tags Oxygen transport/protein binding
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ovuA00
3QNUA 1Z8UA 3QOFA 1XZYA 1W09A 1W0BA 3Q5DA 3OVUA 1W0AA 1Y01A 3X1DA 4IDQA 3Q5EA 3IA3A 4IDPA 4IDOA 4IDNA
chains in the Genus database with same CATH superfamily
1HCIA 1ZV4X 4EIWA 4YFSA 3O1HA 2XZEA 2LHNA 3RRWA 4YT0A 2QYWA 1QSDA 2ZM0A 5CGMA 4DBRA 3MACA 3KDSE 2BG9E 4CZZB 4PNIA 5FVLA 1LKXA 4JI8T 2FJEA 3RIAA 3KINB 1N36T 2C5JA 1LRZA 4GK5E 4CI2B 2BBHA 3LSVA 3VR8A 3AEAA 5KMGP 3ZYLA 4FJOA 5IHYA 1E7PA 4O2AE 2E9XB 3RYFE 1UURA 2P9BA 4PK6A 1YXRA 3Q5DA 5AQJB 3LBXB 3PV0F 2HH7A 2B76A 1O3XA 2DI4A 2JQHA 1Y64B 4WW0A 3CQGB 4NPPA 4GIWA 2D0TA 1JNZA 3E08A 1N32T 4U2ZA 4DO0A 3H3AA 2BVLA 2UUCT 5BR8T 3ZPOA 3DP7A 3VU7H 3V5UA 2EHOB 1HFAA 2OA5A 3OBVE 2FBWA 3P4PA 3CK6A 4TX5A 2DNXA 4HFCA 4X1KE 2Q9QC 3EABA 2Q9QA 1QUUA 2X67A 2XAFB 4MBQA 1FEWA 4E7ZA 3EDUA 3AA6B 5C8YE 3K1SA 4DBQA 4ISSA 1YQ4A 2BG9B 5JR9C 5JR9A 1E1HB 2LRLA 2LSIA 3L8RA 2KNDA 3IHRA 3QOFA 4U33A 2LSKA 3P8CD 2XM1A 3CVRA 4P0AA 4X5TA 1KNPA 2I6HA 4DR4T 2Y6XA 4HFHA 4K0UA 3WI3A 5DQWA 2A3DA 3PUYF 2WDQA 2IIUA 1VRBA 2E5VA 3PUSA 4DVDA 1UX5A 5HXCA 4X20E 4ZI7E 1UX4A 1MIVA 5KDMC 5CA1E 4JI4T 4AQFA 4B3RT 1MMGA 2MBGA 4DV3T 4HWIB 1M7KA 5LMUT 5J0ZA 3PUWF 2D5UA 4AXPA 1BR1A 4U2YA 3AE7A 5GONE 2Z6EA 3ZMSB 3ZYKA 4JEHB 3C4ZA 3K3NA 4EZ4A 1S94A 5FL0A 1B7TA 2AXDS 2WP9A 1YQ3A 1YKHB 5KX5E 5FL1A 2NWBA 2WDVA 3AEEA 2VKHA 3ZYMA 1L0VA 3M3ZB 5E0OA 3C50A 3HI2A 5ABHA 3AE2A 1D0YA 4HGAA 4EAHA 5IWAT 2WM9A 2WWUA 2H7VC 2OV9A 3RGLA 1W9RA 4BJMA 4LF8T 4AKHA 3Q5WA 3RF1A 4L5GA 5L3BB 4Z8XA 4CN6A 2UXBT 3PU8A 5FKYA 5DABA 1ZHCA 1KF6A 2WU5A 1IAPA 3AA7B 3TLSA 2V8SV 4UVAB 4X65T 5JREA 3NBXX 2D9DA 1IJ5A 4ILBA 2AE9A 4QX8B 3T1YT 2UXXB 1MMDA 2XAGB 3ANWB 2IW5B 5ABGA 2XAQB 2XPKA 4IE0A 3TLUA 3ONJA 5FY1A 3W15B 4DV4T 2X0YA 4H9NC 2JJ9A 3VHLA 4KHZF 4PFPA 3IBPA 4GYRA 3ZJ2A 2XM2A 4O4JE 5TAOA 2XASB 5L3CB 1OEDE 4GKJT 4PJNA 1HNXT 3E22E 1KEYA 3AEGA 4IL9A 1BR0A 1CHUA 3N9QA 4EYUA 3HR0A 3JAFA 2WY2A 3NVOA 2CLYC 4COFA 3MZKB 5LBMA 5LGUB 3MXZA 3LFMA 4HE8A 5KXJA 2XJ7A 4GKKT 1HTJF 1J5WA 2CHNA 3EDVA 4DUZT 2F4VT 1J5ET 4F8HA 4ILAA 3Q5EA 3UFGA 3PJAJ 2UXCT 3VR9A 2CA5A 2K9AA 3KV6A 4AKRB 4YLHA 4YTNA 2I59A 2PTFA 3ZT5A 1WR0A 3FB2A 4EYYR 3RIUC 4UVBB 3U3IA 2LSYA 2NP9A 4PJMA 4B3ST 2NR4A 1HX1B 2L3LA 1XMOT 2W4XA 3K3OA 2LOSA 4ADZA 5AQSB 2G0UA 5AQVB 3C64A 5LG4A 2L8KA 2J1DG 5J2TE 2CMRA 3JCFA 2YN6A 2R6GF 3HA4A 1LVFA 3J7Yq 3UU3A 3QNUA 4LMKA 5FYMA 4LFAT 3VKHA 3MJXA 2WU2A 3P4QA 4KUMB 5AQGB 4A97A 5LG3A 2N9DA 1OEDB 5EK4A 4JUYA 4EEBA 1YD8G 3O4XE 3CX8B 4Z91A 4KHPT 3QB5K 4CXXA 3RQWA 1M62A 4J2CA 1MIYA 4DR7T 5HWYA 4U72A 3TKLB 4YY3T 4WBOA 5F3JA 3AA0B 3AEBA 2WB5A 4LF4T 3AXJA 3UQ7A 1SUMB 4F6RC 5L4EA 1IBMT 3KBUA 4TV9E 2VKDA 3OYZA 2YK0A 3A7MA 5LYJE 3CX6B 2QGSA 3Q5XA 3SFEA 3VRBA 4HWFA 5JVDE 2E2AA 2W00A 4HFIA 3UU5A 4QWNB 3RYCE 3GA8A 4HTEA 4UV9B 1D0XA 2LKGA 4UR9A 3SRZA 3AEFA 1V9DA 2V1DB 3FZFB 4TWFA 5CA0E 3T1HT 5CJ5A 3H37A 5EK3A 4HEAA 2VKJA 4JI5T 2ODUA 5JDHA 5AQMB 3KV9A 5AQHB 2V6XA 4O4IE 1Y01A 4PFOA 1MNEA 4EV6A 4DR6T 4BAYB 5DJQC 2LLYA 4U74A 2RP4A 4XBFB 2MYSA 3UUXB 3D0TA 5AQQB 3G06A 4YJ3E 4B3TT 4H9SE 3FZLB 5LA6E 1W09A 4PW8A 3ZSSA 3C51A 2X66A 3U78A 4JI3T 4HWDA 2IMLA 3EHZA 2CCQA 2NOXA 5ETWA 2XQ9A 2CXDA 3LDQB 3ZLIA 1SHZC 2DL1A 2X51A 2OLTA 3NKZA 5LGNB 4DV0T 1HNWT 5ABFB 3VKGA 2ZLYA 2K48A 3QUJA 3HKCE 4QHOA 2LJLA 4TWDA 3PUQA 4JBWF 3WAJA 2IDOB 2XAHB 1MNDA 1E2AA 3I9YA 2PFVA 4X1IE 3PDYA 2YU2A 3O1JA 4AI6A 2W2UA 4QKNA 2YDRA 2V7KA 2XQ5A 2E9XD 3UT5E 2DCFA 1XNQT 2BKOA 1HS7A 2UXNB 3ZC1A 4IE4A 2ZM8A 4CN4A 2LSGA 2QA7A 2FUPA 5FY0A 2I0MA 3OKQA 4U3CA 4QH5A 2DWGA 2VVNA 1U4QA 2X0HA 4C91A 2LEHA 3IA3A 1XMQT 4UV8B 3TLVA 1W0BA 4YHJA 2VURA 4AISA 5LCYA 2IC6A 2ODVA 2JQQA 1WCRA 2Y48B 4EEDA 1D1CA 5H6RB 4DR2T 2KZ7B 2BBJA 2C5IT 2BS4A 2V6YB 2H89A 4HN9A 3OVUA 3RHWA 4I4TE 3R6NA 3RLFF 4PK4A 2V7IA 4DR5T 3Q9DA 1OXZA 2KLQA 4YSXA 4GOUA 3FZKB 1UK5A 3N2GE 3HL6A 4BA9A 2CHOA 2CEAA 3KV4A 3A5XA 4HFVA 3GWHA 3X1DA 3GN5B 2YU1A 3KVBA 5AFUL 4E7SA 4KBMB 5CB4E 4ISTA 3AE1A 1XNRT 4AKGA 2A2FX 5JRCA 4CXWA 4WBNE 5EK2A 4P1NA 1NEKA 3QC9A 2DHRA 2X9WA 4HKAA 3ONLC 5LMNT 2XQ4A 4CI3B 1YW0A 4DV1T 3PU3A 3RRCA 4UEMA 4QXCB 4IL4A 2HN2A 4MLKA 4LF6T 4ILUA 1W0AA 3ZC0A 5HXEA 3ONXA 2YKSA 3IF8B 1VOMA 4FI5A 3RIFA 2V7LA 2E9XC 2E9XA 4QH4A 4YSYA 4TN7B 1R8IA 4UELA 3P50A 2LE8A 2BS3A 4ZOLE 2KWIB 2M6IA 2XQ6A 5HCJA 4ERRA 3AE6A 3ETVA 2LM2A 3Q2MA 3RKOA 4ZS3A 5BMVE 2KT9A 3NZPA 3DJBA 2HPJA 4I50E 3O1IA 4X66T 2KXPB 3AAIA 3CKDA 4UF0B 1OWAA 4ILCA 1BR2A 4L9IA 1US7B 3QK6A 3ZT7A 4ZHQE 1FJGT 5AQNB 2W67A 3RC3A 5AQKB 1NAFA 5LJMA 1AJ3A 4IDZA 1VCSA 2EHOC 1ZKEA 3JAEA 2EHOA 2XAJB 3WAKA 1HG5A 5J2UE 3SWHA 5AQTB 5C2TA 3R84B 1HF8A 2WSSV 3EAMA 2LOPA 3EUHA 4KX6A 2ACXA 3ABVA 2NW9A 3ZCJA 2CXLA 2XSBA 1X9BA 2IUBA 2VK9A 3N2OA 2IAKA 4OX9T 2XUEA 3SOLA 2BG9C 2BG9A 2CPTA 2HN1A 2LM9A 2WCAA 2BZBA 1JNRA 2BKPA 2YINA 4OHFA 3K3QC 3ZEFB 4LFCT 3RIUA 2BKNA 5CFBA 2MAWA 3AE3A 3FXDB 4DR1T 3B13A 5H6QB 4H9PC 3RX6A 4DR3T 4DV7T 3N9LA 2VVSA 3UUMA 4DMVA 2H88A 1UGOA 4LMLA 5HXHA 2C5KT 4JEUB 1UCUA 2YEVC 2J62A 3PTRB 4TNWA 5JDQA 1H7CA 3CWZB 5FVKA 4ZEYA 3N9OA 1MIWA 2BS2A 1HX8A 2CWOA 3FHNA 3I0QA 4LMJA 1KK7A 1WR6A 5JTGA 3UTKA 2V5DA 2VB6A 1CUNA 4IDPA 4JLEA 4X62T 2LSJA 4YSZA 2FJDA 4IE7A 4ZI2D 4EZHA 2W63A 2K24A 3CQCB 5LHGB 5HAXA 1QLBA 2Q9QB 3JADA 5JH7E 5LOVE 4PAGA 1G73A 4ZS2A 2JMHA 5HYAA 4Q25A 1EZ3A 2NTXA 3C98B 3FBLA 2W62A 3KBTA 2MPKA 5JR9B 3LK3B 3PJAA 3PUGA 4YTPA 2PJQA 3ZN1B 3FXEB 4IE6A 2XSAA 3HKEE 3NRXA 1ZOYA 3ANWA 4O8SA 2X9HA 4HWCA 4QX7B 3OJAA 3RKGA 2W61A 2V5CA 2XQAA 3P7IA 2DLRA 3B5MA 4DV5T 4B6XA 4CI1B 3NWIA 5HXSA 3CMLA 5ABEA 5HEUA 3F57A 2WDRA 3V5SA 2KWHA 3ESLA 3PURA 2UU9T 1DU2A 3AAEB 3C4WA 3OPCA 5FMNA 4OK0A 4IDQA 3M65A 3RC8A 4QH1A 3N2KE 4TV8E 4A98A 2UUAT 2XQ7A 3NZQA 4TUYE 3UU8A 4U31A 2KSRA 2A9UA 3CQXC 4ZZCA 2V26A 3UULA 3L39A 4UVCB 1N33T 3UFEA 3PE0A 1LVKA 1IBKT 2ACZA 4G63A 1WFDA 1WYBA 3UU4A 3BK9A 5C3JA 3ZSTA 3AB3B 2RPAA 2X9XA 2JQKA 4L0RA 3HKDE 3ETUA 4JI7T 4OFZA 4OYKA 3BQIA 3OYXA 4AIUA 2V7MA 2D0UA 2FJBA 3P4SA 4V1Av 1ZEEA 2CE7A 3CX7B 4JI0T 4H9RC 1N34T 3OTOT 4XZCA 4P09A 3N9MA 1I94T 5F5WA 2WMOA 1GQEA 4MHCA 3J9X1 5IYZE 5JQGE 3MKDA 2JPFA 4WYVA 4X1YE 3FBZA 4ZI2C 2J4GA 2JQ9A 4P0BA 4H9OC 3TLTA 5HEJA 2NTYA 3C4XA 4JI2T 2HHHT 3AE4A 2RA1A 3ZMUB 2X9YA 4NIQA 5HEHA 4EXTA 5L3DB 2ZMAA 3LK42 3JC6C 4N78D 3ZT6A 4UXNB 4ASKA 1FMWA 2CXFA 1D0ZA 2X68A 3RYHE 3AEDA 4AKIA 1UUSA 4QXHB 3RPUA 3UU6A 3FZMB 4YJ2E 4K0KT 2VL8A 4HFEA 4IREA 1KNRA 2JMKA 4U7IA 3I9WA 3MA9A 3KV5A 5L2LA 4DIDB 5IUXA 5FY7A 3GMIA 4ZI3C 1OEDC 1OEDA 1XZYA 4M1PA 5A1LA 4YTMA 3UUBA 1U5PA 3SS1A 3ZCIA 4H63V 1I6ZA 3AECA 4PK5A 2CLYB 4DUYT 2XQ8A 3EVYA 3PUVF 2N1GA 3ZMTB 2ES0A 1YKEB 4JI1T 5DQVA 4WZXA 3ZMZB 2EHOD 5EZYE 5FXXA 3PUXF 2VWAA 5AQPB 4CXYA 4LF9T 1FIOA 4AQGA 5F8PA 4EGWA 3AVSA 4CQIA 2VASA 3F2EA 2WS3A 3L09A 3PUAA 3AVRA 1FMVA 5LHHB 4I43B 5L3EB 3CIRA 2ZM2A 2PBIA 5J1GA 4MALA 3AE9A 2H3RA 2KINB 4AQFC 4QXBB 3P4RA 3NRYA 4U7YA 1IJ6A 5ADXL 2E5LT 1HG2A 4TWHA 2MTQA 2ZM6T 4O2BE 1S35A 5LJNA 1ZP0A 3F31A 1HNZT 1IZNB 1T7SA 4IT4A 3DTOA 2E8IA 4GK0E 2QVAA 3RQUA 2CBIA 2LRKA 3H3MA 4X64T 5JDFA 1J1JA 4NUVA 4PJJA 3N9NA 5FXZA 3IEEA 3BQLA 3ZMVB 1BR4A 2IHR1 1NWMX 5LP6E 5JDGA 1T72A 1Z0PA 2L9QA 3EI0A 4HFDA 2WZIA 1WYCA 3KFWX 1T8BA 3LBXA 3B57A 5LB7B 5AQUB 3CPZA 5HCMA 2K5BB 1IBLT 5ABFA 3TLWA 1MMNA 2KMFA 5LNKA 5AQOB 1SA0E 3LG7A 4KI0F 5L47A 3AXJB 5AQLB 4AQYT 2D2SA 2LT3A 4IDNA 1D1AA 3UUNA 3BQKA 4PJLA 2WWVA 2CWYA 5FXWA 2V7JA 5JDMA 2MOZA 2M67A 5FNVE 2GK9A 4IHJE 3VRAA 1D1BA 4MFRA 5AQFB 3O9XA 4JV5T 1KNZA 4DNDA 2CRBA 4XAXB 2XTLA 3RH3A 2CBJA 2JRKA 2JIWA 2WZHA 4TNVA 2A72A 3N5LA 2YDQA 4OYJA 2WAUA 4I0UA 4WNKA 5HWXA 2BDEA 4AKLA 5L3FB 2XQYA 2NW7A 4TZ4C 4IDOA 5JDLA 3RI5A 2WBLA 2Y8DA 5LBQB 3UQ4A 1XDPA 4KMCA 4DMWA 1MMAA 3AAAB 2V6YA 2J47A 4B3MT 1NENA 4GYSA 4H9QC 4C90A 3L3PA 4NUUA 3ZKRA 3HKBE 5FXVA 3E0ZA 1X79A 2YDSA 2UXDT 5M4YA 4CN1A 3I1AA 4NXMT 3FZHB 2K3WA 2PG8A 2IC9A 3GN5A 2DWKA 4Z90A 2C0SA 2VKOA 4A5XA 2LKHA 5L4HA 4O4LE 4LF5T 4NXNT 2WMNA 1WLXA 2BVMA 2VL0A 2X0LB 4A56A 4G2AA 2W66A 3AE8A 1HR0T 4EB6E 3A8YC 1XDOA 3PUZF 2QRXA 2XQ3A 4ZXLA 3N9PA 4UIGA 2NW8A 5HEGA 2YOEA 3MK7C 3SFDA 3LK2B 4YHHT 5HXRA 3P4WA 5FP3A 3RYIE 5HEOA 4IIJE 3ZN0B 1VCTA 3T8OA 4KP3C 3ZJ1A 3JC6D 3AA1B 4O4HE 1T98A 4JYAT 4JI6T 1XWMA 5LHIB 1Z8UA 2M6BA 2HPLA 2VQFT 4IE5A 4LFBT 1G8XA 4ANJA 2N2NA 4HWHA 5LGTB 5AQRB 1KFYA 4ZI3D 3AE5A 3S4UA 4EOZB 4UF0A 5JDNA 2H7OA 5LXTE 4DV2T 2Q9QD 1SE7A 2XHEB 2CM0A 3KVAA 3LJCA 2SPCA 2W0GA 4YXDA 5L3GB 3QB5A 2XY8B 2UUBT 2LHRA 2FJAA 3I0OA 2WQYA 4HFBA 4IGUA 3K8PC 2VQET 2B1EA 4BJNA 4ZZBA 5AQIB 4DV6T 1WRDA 4LF7T 4H63H 5JRCB 4I55E
chains in the Genus database with same CATH topology
3QNUA 1Z8UA 3QOFA 1XZYA 1W09A 1W0BA 3Q5DA 3OVUA 1W0AA 1Y01A 3X1DA 4IDQA 3Q5EA 3IA3A 4IDPA 4IDOA 4IDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNU A;  1Z8U A;  3QOF A;  1XZY A;  1W09 A;  1W0B A;  3Q5D A;  3OVU A;  1W0A A;  1Y01 A;  3X1D A;  4IDQ A;  3Q5E A;  3IA3 A;  4IDP A;  4IDO A;  4IDN A; 
#chains in the Genus database with same CATH topology
 1HCI A;  1ZV4 X;  4EIW A;  4YFS A;  3O1H A;  2XZE A;  2LHN A;  3RRW A;  4YT0 A;  2QYW A;  1QSD A;  2ZM0 A;  5CGM A;  4DBR A;  3MAC A;  3KDS E;  2BG9 E;  4CZZ B;  4PNI A;  5FVL A;  1LKX A;  4JI8 T;  2FJE A;  3RIA A;  3KIN B;  1N36 T;  2C5J A;  1LRZ A;  4GK5 E;  4CI2 B;  2BBH A;  3LSV A;  3VR8 A;  3AEA A;  5KMG P;  3ZYL A;  4FJO A;  5IHY A;  1E7P A;  4O2A E;  2E9X B;  3RYF E;  1UUR A;  2P9B A;  4PK6 A;  1YXR A;  3Q5D A;  5AQJ B;  3LBX B;  3PV0 F;  2HH7 A;  2B76 A;  1O3X A;  2DI4 A;  2JQH A;  1Y64 B;  4WW0 A;  3CQG B;  4NPP A;  4GIW A;  2D0T A;  1JNZ A;  3E08 A;  1N32 T;  4U2Z A;  4DO0 A;  3H3A A;  2BVL A;  2UUC T;  5BR8 T;  3ZPO A;  3DP7 A;  3VU7 H;  3V5U A;  2EHO B;  1HFA A;  2OA5 A;  3OBV E;  2FBW A;  3P4P A;  3CK6 A;  4TX5 A;  2DNX A;  4HFC A;  4X1K E;  2Q9Q C;  3EAB A;  2Q9Q A;  1QUU A;  2X67 A;  2XAF B;  4MBQ A;  1FEW A;  4E7Z A;  3EDU A;  3AA6 B;  5C8Y E;  3K1S A;  4DBQ A;  4ISS A;  1YQ4 A;  2BG9 B;  5JR9 C;  5JR9 A;  1E1H B;  2LRL A;  2LSI A;  3L8R A;  2KND A;  3IHR A;  3QOF A;  4U33 A;  2LSK A;  3P8C D;  2XM1 A;  3CVR A;  4P0A A;  4X5T A;  1KNP A;  2I6H A;  4DR4 T;  2Y6X A;  4HFH A;  4K0U A;  3WI3 A;  5DQW A;  2A3D A;  3PUY F;  2WDQ A;  2IIU A;  1VRB A;  2E5V A;  3PUS A;  4DVD A;  1UX5 A;  5HXC A;  4X20 E;  4ZI7 E;  1UX4 A;  1MIV A;  5KDM C;  5CA1 E;  4JI4 T;  4AQF A;  4B3R T;  1MMG A;  2MBG A;  4DV3 T;  4HWI B;  1M7K A;  5LMU T;  5J0Z A;  3PUW F;  2D5U A;  4AXP A;  1BR1 A;  4U2Y A;  3AE7 A;  5GON E;  2Z6E A;  3ZMS B;  3ZYK A;  4JEH B;  3C4Z A;  3K3N A;  4EZ4 A;  1S94 A;  5FL0 A;  1B7T A;  2AXD S;  2WP9 A;  1YQ3 A;  1YKH B;  5KX5 E;  5FL1 A;  2NWB A;  2WDV A;  3AEE A;  2VKH A;  3ZYM A;  1L0V A;  3M3Z B;  5E0O A;  3C50 A;  3HI2 A;  5ABH A;  3AE2 A;  1D0Y A;  4HGA A;  4EAH A;  5IWA T;  2WM9 A;  2WWU A;  2H7V C;  2OV9 A;  3RGL A;  1W9R A;  4BJM A;  4LF8 T;  4AKH A;  3Q5W A;  3RF1 A;  4L5G A;  5L3B B;  4Z8X A;  4CN6 A;  2UXB T;  3PU8 A;  5FKY A;  5DAB A;  1ZHC A;  1KF6 A;  2WU5 A;  1IAP A;  3AA7 B;  3TLS A;  2V8S V;  4UVA B;  4X65 T;  5JRE A;  3NBX X;  2D9D A;  1IJ5 A;  4ILB A;  2AE9 A;  4QX8 B;  3T1Y T;  2UXX B;  1MMD A;  2XAG B;  3ANW B;  2IW5 B;  5ABG A;  2XAQ B;  2XPK A;  4IE0 A;  3TLU A;  3ONJ A;  5FY1 A;  3W15 B;  4DV4 T;  2X0Y A;  4H9N C;  2JJ9 A;  3VHL A;  4KHZ F;  4PFP A;  3IBP A;  4GYR A;  3ZJ2 A;  2XM2 A;  4O4J E;  5TAO A;  2XAS B;  5L3C B;  1OED E;  4GKJ T;  4PJN A;  1HNX T;  3E22 E;  1KEY A;  3AEG A;  4IL9 A;  1BR0 A;  1CHU A;  3N9Q A;  4EYU A;  3HR0 A;  3JAF A;  2WY2 A;  3NVO A;  2CLY C;  4COF A;  3MZK B;  5LBM A;  5LGU B;  3MXZ A;  3LFM A;  4HE8 A;  5KXJ A;  2XJ7 A;  4GKK T;  1HTJ F;  1J5W A;  2CHN A;  3EDV A;  4DUZ T;  2F4V T;  1J5E T;  4F8H A;  4ILA A;  3Q5E A;  3UFG A;  3PJA J;  2UXC T;  3VR9 A;  2CA5 A;  2K9A A;  3KV6 A;  4AKR B;  4YLH A;  4YTN A;  2I59 A;  2PTF A;  3ZT5 A;  1WR0 A;  3FB2 A;  4EYY R;  3RIU C;  4UVB B;  3U3I A;  2LSY A;  2NP9 A;  4PJM A;  4B3S T;  2NR4 A;  1HX1 B;  2L3L A;  1XMO T;  2W4X A;  3K3O A;  2LOS A;  4ADZ A;  5AQS B;  2G0U A;  5AQV B;  3C64 A;  5LG4 A;  2L8K A;  2J1D G;  5J2T E;  2CMR A;  3JCF A;  2YN6 A;  2R6G F;  3HA4 A;  1LVF A;  3J7Y q;  3UU3 A;  3QNU A;  4LMK A;  5FYM A;  4LFA T;  3VKH A;  3MJX A;  2WU2 A;  3P4Q A;  4KUM B;  5AQG B;  4A97 A;  5LG3 A;  2N9D A;  1OED B;  5EK4 A;  4JUY A;  4EEB A;  1YD8 G;  3O4X E;  3CX8 B;  4Z91 A;  4KHP T;  3QB5 K;  4CXX A;  3RQW A;  1M62 A;  4J2C A;  1MIY A;  4DR7 T;  5HWY A;  4U72 A;  3TKL B;  4YY3 T;  4WBO A;  5F3J A;  3AA0 B;  3AEB A;  2WB5 A;  4LF4 T;  3AXJ A;  3UQ7 A;  1SUM B;  4F6R C;  5L4E A;  1IBM T;  3KBU A;  4TV9 E;  2VKD A;  3OYZ A;  2YK0 A;  3A7M A;  5LYJ E;  3CX6 B;  2QGS A;  3Q5X A;  3SFE A;  3VRB A;  4HWF A;  5JVD E;  2E2A A;  2W00 A;  4HFI A;  3UU5 A;  4QWN B;  3RYC E;  3GA8 A;  4HTE A;  4UV9 B;  1D0X A;  2LKG A;  4UR9 A;  3SRZ A;  3AEF A;  1V9D A;  2V1D B;  3FZF B;  4TWF A;  5CA0 E;  3T1H T;  5CJ5 A;  3H37 A;  5EK3 A;  4HEA A;  2VKJ A;  4JI5 T;  2ODU A;  5JDH A;  5AQM B;  3KV9 A;  5AQH B;  2V6X A;  4O4I E;  1Y01 A;  4PFO A;  1MNE A;  4EV6 A;  4DR6 T;  4BAY B;  5DJQ C;  2LLY A;  4U74 A;  2RP4 A;  4XBF B;  2MYS A;  3UUX B;  3D0T A;  5AQQ B;  3G06 A;  4YJ3 E;  4B3T T;  4H9S E;  3FZL B;  5LA6 E;  1W09 A;  4PW8 A;  3ZSS A;  3C51 A;  2X66 A;  3U78 A;  4JI3 T;  4HWD A;  2IML A;  3EHZ A;  2CCQ A;  2NOX A;  5ETW A;  2XQ9 A;  2CXD A;  3LDQ B;  3ZLI A;  1SHZ C;  2DL1 A;  2X51 A;  2OLT A;  3NKZ A;  5LGN B;  4DV0 T;  1HNW T;  5ABF B;  3VKG A;  2ZLY A;  2K48 A;  3QUJ A;  3HKC E;  4QHO A;  2LJL A;  4TWD A;  3PUQ A;  4JBW F;  3WAJ A;  2IDO B;  2XAH B;  1MND A;  1E2A A;  3I9Y A;  2PFV A;  4X1I E;  3PDY A;  2YU2 A;  3O1J A;  4AI6 A;  2W2U A;  4QKN A;  2YDR A;  2V7K A;  2XQ5 A;  2E9X D;  3UT5 E;  2DCF A;  1XNQ T;  2BKO A;  1HS7 A;  2UXN B;  3ZC1 A;  4IE4 A;  2ZM8 A;  4CN4 A;  2LSG A;  2QA7 A;  2FUP A;  5FY0 A;  2I0M A;  3OKQ A;  4U3C A;  4QH5 A;  2DWG A;  2VVN A;  1U4Q A;  2X0H A;  4C91 A;  2LEH A;  3IA3 A;  1XMQ T;  4UV8 B;  3TLV A;  1W0B A;  4YHJ A;  2VUR A;  4AIS A;  5LCY A;  2IC6 A;  2ODV A;  2JQQ A;  1WCR A;  2Y48 B;  4EED A;  1D1C A;  5H6R B;  4DR2 T;  2KZ7 B;  2BBJ A;  2C5I T;  2BS4 A;  2V6Y B;  2H89 A;  4HN9 A;  3OVU A;  3RHW A;  4I4T E;  3R6N A;  3RLF F;  4PK4 A;  2V7I A;  4DR5 T;  3Q9D A;  1OXZ A;  2KLQ A;  4YSX A;  4GOU A;  3FZK B;  1UK5 A;  3N2G E;  3HL6 A;  4BA9 A;  2CHO A;  2CEA A;  3KV4 A;  3A5X A;  4HFV A;  3GWH A;  3X1D A;  3GN5 B;  2YU1 A;  3KVB A;  5AFU L;  4E7S A;  4KBM B;  5CB4 E;  4IST A;  3AE1 A;  1XNR T;  4AKG A;  2A2F X;  5JRC A;  4CXW A;  4WBN E;  5EK2 A;  4P1N A;  1NEK A;  3QC9 A;  2DHR A;  2X9W A;  4HKA A;  3ONL C;  5LMN T;  2XQ4 A;  4CI3 B;  1YW0 A;  4DV1 T;  3PU3 A;  3RRC A;  4UEM A;  4QXC B;  4IL4 A;  2HN2 A;  4MLK A;  4LF6 T;  4ILU A;  1W0A A;  3ZC0 A;  5HXE A;  3ONX A;  2YKS A;  3IF8 B;  1VOM A;  4FI5 A;  3RIF A;  2V7L A;  2E9X C;  2E9X A;  4QH4 A;  4YSY A;  4TN7 B;  1R8I A;  4UEL A;  3P50 A;  2LE8 A;  2BS3 A;  4ZOL E;  2KWI B;  2M6I A;  2XQ6 A;  5HCJ A;  4ERR A;  3AE6 A;  3ETV A;  2LM2 A;  3Q2M A;  3RKO A;  4ZS3 A;  5BMV E;  2KT9 A;  3NZP A;  3DJB A;  2HPJ A;  4I50 E;  3O1I A;  4X66 T;  2KXP B;  3AAI A;  3CKD A;  4UF0 B;  1OWA A;  4ILC A;  1BR2 A;  4L9I A;  1US7 B;  3QK6 A;  3ZT7 A;  4ZHQ E;  1FJG T;  5AQN B;  2W67 A;  3RC3 A;  5AQK B;  1NAF A;  5LJM A;  1AJ3 A;  4IDZ A;  1VCS A;  2EHO C;  1ZKE A;  3JAE A;  2EHO A;  2XAJ B;  3WAK A;  1HG5 A;  5J2U E;  3SWH A;  5AQT B;  5C2T A;  3R84 B;  1HF8 A;  2WSS V;  3EAM A;  2LOP A;  3EUH A;  4KX6 A;  2ACX A;  3ABV A;  2NW9 A;  3ZCJ A;  2CXL A;  2XSB A;  1X9B A;  2IUB A;  2VK9 A;  3N2O A;  2IAK A;  4OX9 T;  2XUE A;  3SOL A;  2BG9 C;  2BG9 A;  2CPT A;  2HN1 A;  2LM9 A;  2WCA A;  2BZB A;  1JNR A;  2BKP A;  2YIN A;  4OHF A;  3K3Q C;  3ZEF B;  4LFC T;  3RIU A;  2BKN A;  5CFB A;  2MAW A;  3AE3 A;  3FXD B;  4DR1 T;  3B13 A;  5H6Q B;  4H9P C;  3RX6 A;  4DR3 T;  4DV7 T;  3N9L A;  2VVS A;  3UUM A;  4DMV A;  2H88 A;  1UGO A;  4LML A;  5HXH A;  2C5K T;  4JEU B;  1UCU A;  2YEV C;  2J62 A;  3PTR B;  4TNW A;  5JDQ A;  1H7C A;  3CWZ B;  5FVK A;  4ZEY A;  3N9O A;  1MIW A;  2BS2 A;  1HX8 A;  2CWO A;  3FHN A;  3I0Q A;  4LMJ A;  1KK7 A;  1WR6 A;  5JTG A;  3UTK A;  2V5D A;  2VB6 A;  1CUN A;  4IDP A;  4JLE A;  4X62 T;  2LSJ A;  4YSZ A;  2FJD A;  4IE7 A;  4ZI2 D;  4EZH A;  2W63 A;  2K24 A;  3CQC B;  5LHG B;  5HAX A;  1QLB A;  2Q9Q B;  3JAD A;  5JH7 E;  5LOV E;  4PAG A;  1G73 A;  4ZS2 A;  2JMH A;  5HYA A;  4Q25 A;  1EZ3 A;  2NTX A;  3C98 B;  3FBL A;  2W62 A;  3KBT A;  2MPK A;  5JR9 B;  3LK3 B;  3PJA A;  3PUG A;  4YTP A;  2PJQ A;  3ZN1 B;  3FXE B;  4IE6 A;  2XSA A;  3HKE E;  3NRX A;  1ZOY A;  3ANW A;  4O8S A;  2X9H A;  4HWC A;  4QX7 B;  3OJA A;  3RKG A;  2W61 A;  2V5C A;  2XQA A;  3P7I A;  2DLR A;  3B5M A;  4DV5 T;  4B6X A;  4CI1 B;  3NWI A;  5HXS A;  3CML A;  5ABE A;  5HEU A;  3F57 A;  2WDR A;  3V5S A;  2KWH A;  3ESL A;  3PUR A;  2UU9 T;  1DU2 A;  3AAE B;  3C4W A;  3OPC A;  5FMN A;  4OK0 A;  4IDQ A;  3M65 A;  3RC8 A;  4QH1 A;  3N2K E;  4TV8 E;  4A98 A;  2UUA T;  2XQ7 A;  3NZQ A;  4TUY E;  3UU8 A;  4U31 A;  2KSR A;  2A9U A;  3CQX C;  4ZZC A;  2V26 A;  3UUL A;  3L39 A;  4UVC B;  1N33 T;  3UFE A;  3PE0 A;  1LVK A;  1IBK T;  2ACZ A;  4G63 A;  1WFD A;  1WYB A;  3UU4 A;  3BK9 A;  5C3J A;  3ZST A;  3AB3 B;  2RPA A;  2X9X A;  2JQK A;  4L0R A;  3HKD E;  3ETU A;  4JI7 T;  4OFZ A;  4OYK A;  3BQI A;  3OYX A;  4AIU A;  2V7M A;  2D0U A;  2FJB A;  3P4S A;  4V1A v;  1ZEE A;  2CE7 A;  3CX7 B;  4JI0 T;  4H9R C;  1N34 T;  3OTO T;  4XZC A;  4P09 A;  3N9M A;  1I94 T;  5F5W A;  2WMO A;  1GQE A;  4MHC A;  3J9X 1;  5IYZ E;  5JQG E;  3MKD A;  2JPF A;  4WYV A;  4X1Y E;  3FBZ A;  4ZI2 C;  2J4G A;  2JQ9 A;  4P0B A;  4H9O C;  3TLT A;  5HEJ A;  2NTY A;  3C4X A;  4JI2 T;  2HHH T;  3AE4 A;  2RA1 A;  3ZMU B;  2X9Y A;  4NIQ A;  5HEH A;  4EXT A;  5L3D B;  2ZMA A;  3LK4 2;  3JC6 C;  4N78 D;  3ZT6 A;  4UXN B;  4ASK A;  1FMW A;  2CXF A;  1D0Z A;  2X68 A;  3RYH E;  3AED A;  4AKI A;  1UUS A;  4QXH B;  3RPU A;  3UU6 A;  3FZM B;  4YJ2 E;  4K0K T;  2VL8 A;  4HFE A;  4IRE A;  1KNR A;  2JMK A;  4U7I A;  3I9W A;  3MA9 A;  3KV5 A;  5L2L A;  4DID B;  5IUX A;  5FY7 A;  3GMI A;  4ZI3 C;  1OED C;  1OED A;  1XZY A;  4M1P A;  5A1L A;  4YTM A;  3UUB A;  1U5P A;  3SS1 A;  3ZCI A;  4H63 V;  1I6Z A;  3AEC A;  4PK5 A;  2CLY B;  4DUY T;  2XQ8 A;  3EVY A;  3PUV F;  2N1G A;  3ZMT B;  2ES0 A;  1YKE B;  4JI1 T;  5DQV A;  4WZX A;  3ZMZ B;  2EHO D;  5EZY E;  5FXX A;  3PUX F;  2VWA A;  5AQP B;  4CXY A;  4LF9 T;  1FIO A;  4AQG A;  5F8P A;  4EGW A;  3AVS A;  4CQI A;  2VAS A;  3F2E A;  2WS3 A;  3L09 A;  3PUA A;  3AVR A;  1FMV A;  5LHH B;  4I43 B;  5L3E B;  3CIR A;  2ZM2 A;  2PBI A;  5J1G A;  4MAL A;  3AE9 A;  2H3R A;  2KIN B;  4AQF C;  4QXB B;  3P4R A;  3NRY A;  4U7Y A;  1IJ6 A;  5ADX L;  2E5L T;  1HG2 A;  4TWH A;  2MTQ A;  2ZM6 T;  4O2B E;  1S35 A;  5LJN A;  1ZP0 A;  3F31 A;  1HNZ T;  1IZN B;  1T7S A;  4IT4 A;  3DTO A;  2E8I A;  4GK0 E;  2QVA A;  3RQU A;  2CBI A;  2LRK A;  3H3M A;  4X64 T;  5JDF A;  1J1J A;  4NUV A;  4PJJ A;  3N9N A;  5FXZ A;  3IEE A;  3BQL A;  3ZMV B;  1BR4 A;  2IHR 1;  1NWM X;  5LP6 E;  5JDG A;  1T72 A;  1Z0P A;  2L9Q A;  3EI0 A;  4HFD A;  2WZI A;  1WYC A;  3KFW X;  1T8B A;  3LBX A;  3B57 A;  5LB7 B;  5AQU B;  3CPZ A;  5HCM A;  2K5B B;  1IBL T;  5ABF A;  3TLW A;  1MMN A;  2KMF A;  5LNK A;  5AQO B;  1SA0 E;  3LG7 A;  4KI0 F;  5L47 A;  3AXJ B;  5AQL B;  4AQY T;  2D2S A;  2LT3 A;  4IDN A;  1D1A A;  3UUN A;  3BQK A;  4PJL A;  2WWV A;  2CWY A;  5FXW A;  2V7J A;  5JDM A;  2MOZ A;  2M67 A;  5FNV E;  2GK9 A;  4IHJ E;  3VRA A;  1D1B A;  4MFR A;  5AQF B;  3O9X A;  4JV5 T;  1KNZ A;  4DND A;  2CRB A;  4XAX B;  2XTL A;  3RH3 A;  2CBJ A;  2JRK A;  2JIW A;  2WZH A;  4TNV A;  2A72 A;  3N5L A;  2YDQ A;  4OYJ A;  2WAU A;  4I0U A;  4WNK A;  5HWX A;  2BDE A;  4AKL A;  5L3F B;  2XQY A;  2NW7 A;  4TZ4 C;  4IDO A;  5JDL A;  3RI5 A;  2WBL A;  2Y8D A;  5LBQ B;  3UQ4 A;  1XDP A;  4KMC A;  4DMW A;  1MMA A;  3AAA B;  2V6Y A;  2J47 A;  4B3M T;  1NEN A;  4GYS A;  4H9Q C;  4C90 A;  3L3P A;  4NUU A;  3ZKR A;  3HKB E;  5FXV A;  3E0Z A;  1X79 A;  2YDS A;  2UXD T;  5M4Y A;  4CN1 A;  3I1A A;  4NXM T;  3FZH B;  2K3W A;  2PG8 A;  2IC9 A;  3GN5 A;  2DWK A;  4Z90 A;  2C0S A;  2VKO A;  4A5X A;  2LKH A;  5L4H A;  4O4L E;  4LF5 T;  4NXN T;  2WMN A;  1WLX A;  2BVM A;  2VL0 A;  2X0L B;  4A56 A;  4G2A A;  2W66 A;  3AE8 A;  1HR0 T;  4EB6 E;  3A8Y C;  1XDO A;  3PUZ F;  2QRX A;  2XQ3 A;  4ZXL A;  3N9P A;  4UIG A;  2NW8 A;  5HEG A;  2YOE A;  3MK7 C;  3SFD A;  3LK2 B;  4YHH T;  5HXR A;  3P4W A;  5FP3 A;  3RYI E;  5HEO A;  4IIJ E;  3ZN0 B;  1VCT A;  3T8O A;  4KP3 C;  3ZJ1 A;  3JC6 D;  3AA1 B;  4O4H E;  1T98 A;  4JYA T;  4JI6 T;  1XWM A;  5LHI B;  1Z8U A;  2M6B A;  2HPL A;  2VQF T;  4IE5 A;  4LFB T;  1G8X A;  4ANJ A;  2N2N A;  4HWH A;  5LGT B;  5AQR B;  1KFY A;  4ZI3 D;  3AE5 A;  3S4U A;  4EOZ B;  4UF0 A;  5JDN A;  2H7O A;  5LXT E;  4DV2 T;  2Q9Q D;  1SE7 A;  2XHE B;  2CM0 A;  3KVA A;  3LJC A;  2SPC A;  2W0G A;  4YXD A;  5L3G B;  3QB5 A;  2XY8 B;  2UUB T;  2LHR A;  2FJA A;  3I0O A;  2WQY A;  4HFB A;  4IGU A;  3K8P C;  2VQE T;  2B1E A;  4BJN A;  4ZZB A;  5AQI B;  4DV6 T;  1WRD A;  4LF7 T;  4H63 H;  5JRC B;  4I55 E; 
#chains in the Genus database with same CATH homology
 3QNU A;  1Z8U A;  3QOF A;  1XZY A;  1W09 A;  1W0B A;  3Q5D A;  3OVU A;  1W0A A;  1Y01 A;  3X1D A;  4IDQ A;  3Q5E A;  3IA3 A;  4IDP A;  4IDO A;  4IDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...