3OVUA

Crystal structure of human alpha-haemoglobin complexed with ahsp and the first neat domain of isdh from staphylococcus aureus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
LKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new haem pocket structure in alpha-haemoglobin
rcsb
source organism Homo sapiens
molecule tags Oxygen transport/protein binding
molecule keywords Alpha-hemoglobin-stabilizing protein
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ovuA00
3IA3A 3Q5DA 4IDOA 3QNUA 1XZYA 3Q5EA 3OVUA 3QOFA 1W0AA 4IDPA 4IDNA 1W0BA 1Y01A 1Z8UA 4IDQA 3X1DA 1W09A
chains in the Genus database with same CATH superfamily
3RYCE 2KT9A 5TAOA 2X0HA 2ZM2A 4LFAT 3QB5A 4QXBB 3LBXA 2DCFA 1WRDA 1D1CA 2RA1A 5EZYE 2XPKA 2JQKA 4HFVA 4PJNA 2E9XD 2CA5A 3P50A 4ZS3A 4EXTA 1KNZA 2FJEA 3RKOA 3T8OA 1N33T 2BKOA 3CKDA 3E0ZA 5C8YE 2BKPA 5M4YA 4DR7T 2X9YA 2XZEA 3RQUA 1HNXT 2BS4A 2WB5A 3C51A 2H88A 4F6RC 5LYJE 4DR3T 1H7CA 5HWYA 1T72A 5FXXA 1J5WA 3O1JA 4NUUA 4UF0B 1Y64B 2LJLA 2NR4A 3QUJA 4QXCB 5FY1A 1HNZT 2LRLA 2UU9T 4OX9T 3AXJA 4TWFA 4OHFA 4CQIA 1BR1A 5JDQA 2Q9QD 4TZ4C 4O2BE 4LF8T 2V5DA 4QH4A 5DQWA 4TN7B 2YOEA 1VCSA 4DBRA 5FMNA 4JEUB 2CCQA 4IL4A 3CQCB 3UU6A 3SOLA 3UUXB 3UUMA 2W0GA 2K48A 3CWZB 2WP9A 3KV6A 4LMKA 1S94A 2EHOA 4WZXA 4JI2T 1YQ4A 5H6QB 1YW0A 4QXHB 4ILAA 2BZBA 2LSJA 4TNWA 2B1EA 2XQ9A 2JRKA 3Q9DA 4UR9A 3KINB 4IL9A 4X20E 1ZHCA 2A2FX 3Q2MA 3ETVA 3VHLA 1LVKA 3RIUA 3RQWA 5HXEA 2CHNA 4TV9E 5AQRB 3DP7A 3AB3B 3CIRA 5JH7E 3TLUA 2ES0A 3KV4A 3N2KE 3ABVA 4I0UA 4MALA 4CI3B 2BG9B 2LOPA 2D9DA 3HL6A 3CX7B 3IA3A 4ZI3D 3KV9A 3ETUA 2ZM8A 5C2TA 4DV6T 1KF6A 2E9XB 2A72A 2BVLA 2OV9A 4ZOLE 3AE3A 5KMGP 3A7MA 4FI5A 4BAYB 3I9YA 4DR4T 2HN1A 3KV5A 1FIOA 4K0KT 4CI1B 4LFBT 4CN4A 2L3LA 5L4HA 3ZMVB 3ZLIA 1UX4A 4JYAT 4G2AA 2X9HA 5HEGA 5ABFB 2C5JA 2VWAA 3I1AA 5AQLB 3GN5A 4V1Av 3ESLA 1D0ZA 2KWIB 4JLEA 4KX6A 5AQKB 4ZXLA 2LOSA 4JEHB 4HGAA 4JI5T 5JTGA 2XAGB 2CWYA 4EZHA 5LG3A 2KNDA 2HPJA 1LKXA 1W0AA 3JC6D 4BJNA 2WWVA 4DV0T 2VURA 3FXEB 4O4LE 3NWIA 5FXWA 3A8YC 2IW5B 3RHWA 3VR9A 1FJGT 1XNQT 3AAAB 3QK6A 2YDRA 3PUAA 1IZNB 4KI0F 3OYXA 4BJMA 1UUSA 2LKGA 2VKOA 4IREA 1HS7A 3VRAA 2KMFA 1WR6A 3SWHA 3RRWA 2IUBA 1MMDA 3F57A 3LFMA 3OBVE 3UFEA 5IUXA 5LG4A 2WCAA 4YHJA 3TLTA 1JNZA 2VVNA 2YINA 1YKEB 3AAIA 1WLXA 3FZFB 3BQKA 3ZT7A 3FBLA 2DNXA 4U2ZA 4CXYA 4TNVA 1U5PA 4B3RT 5JDFA 1UURA 4ZI2C 3MJXA 2AXDS 4H9PC 2V7LA 3FXDB 3MK7C 3FZKB 2MAWA 2YEVC 2PTFA 3AVRA 4UELA 3CX8B 2XUEA 3O1HA 4L0RA 5L47A 1FEWA 4DUYT 3BQLA 2XQ6A 5CJ5A 1HX1B 4O2AE 4AKLA 4U74A 3U78A 3C4WA 4KHPT 4TUYE 2JJ9A 3AA6B 1OEDB 4ISSA 2W62A 3CQGB 4WYVA 3ZCJA 5CA0E 2DWKA 4H63H 1IJ5A 2LT3A 4PJMA 2BG9C 1J1JA 3HI2A 5JDNA 3AE8A 1T8BA 4ILCA 3FHNA 1MMGA 1M62A 4J2CA 2M67A 3AXJB 4ZS2A 4YHHT 3T1YT 1G8XA 4IDNA 3ZSTA 3AECA 2A3DA 5KDMC 5FXVA 3AE9A 2AE9A 2JQQA 4IDZA 2MYSA 3EDVA 1Z0PA 4EEDA 2D2SA 3GN5B 2PJQA 5HAXA 1QSDA 2X66A 3RI5A 3UU5A 2K5BB 4LF7T 4C90A 4ADZA 3HR0A 2M6BA 3F2EA 2CLYB 2LKHA 3CVRA 5LMUT 1KK7A 5JR9C 1ZP0A 1XMQT 3V5UA 3JCFA 4KUMB 2V8SV 1OEDC 3SFEA 3ONLC 3QNUA 2UXCT 4HFDA 4YXDA 2LM2A 3EDUA 1HTJF 4IIJE 5LHHB 2E9XA 4JI1T 4YSZA 2WS3A 2QYWA 3HKCE 3HKBE 4KP3C 5ABGA 3RX6A 3KVAA 3O4XE 4BA9A 3ZJ1A 2J4GA 1HF8A 1NWMX 5F3JA 5FP3A 2XQYA 4HWDA 1VCTA 2BBHA 3ZMZB 4XBFB 4H9NC 4UV8B 2V6YA 3DTOA 3MXZA 2UUCT 4EV6A 3P4QA 3ZN1B 4A56A 5CGMA 4DV5T 4LF9T 4EB6E 2CXDA 3CX6B 4IHJE 2XQAA 3B57A 4C91A 3RYFE 2IDOB 2Q9QA 1YXRA 2CLYC 1EZ3A 4U7IA 5FKYA 4CN6A 3K3OA 5L3EB 2W67A 5JDMA 1IJ6A 3AEDA 3ZC1A 2XTLA 3AEEA 4O4IE 1W09A 3U3IA 2W2UA 1WFDA 4COFA 4O4JE 5JQGE 3P4PA 2K9AA 2UXDT 2H89A 1MIYA 4AQFC 3N9OA 5EK2A 3VU7H 3ZYKA 3OPCA 3LK2B 2LRKA 5ETWA 4JBWF 2FUPA 2K24A 2P9BA 2C0SA 2NOXA 4P1NA 5L3FB 4G63A 5AQJB 5JDHA 2XJ7A 3L3PA 4Q25A 3PURA 5FY0A 4TWDA 4GKJT 4JI0T 2V7KA 4OK0A 3KBUA 4DUZT 4EOZB 2OA5A 4LF5T 5HYAA 3NKZA 4QWNB 2MPKA 3KDSE 1HG5A 5FL1A 4TWHA 3O1IA 1KNPA 4X1KE 3PU3A 5EK4A 4DVDA 2LM9A 4U33A 5LBMA 3LBXB 1W0BA 3AE5A 3JADA 4UVAB 5AQFB 3B5MA 4JV5T 4HTEA 2L8KA 2VKHA 3PUZF 5BMVE 2CBIA 3PUVF 4HFHA 1AJ3A 4AQGA 2V7MA 2UUBT 1XWMA 5LBQB 1D0YA 4E7SA 2J1DG 1WCRA 3OYZA 3IBPA 1MMAA 2J47A 4I55E 3AE4A 1MNEA 2G0UA 2XY8B 3EVYA 4X62T 5H6RB 2CEAA 5LP6E 2XAQB 4DR2T 2I59A 2BS2A 1HR0T 2MTQA 4QH5A 5J2TE 3ZYMA 3E08A 2ZMAA 2GK9A 3HKDE 1FMWA 2WSSV 3LG7A 4ZI3C 2N1GA 2BS3A 2JQ9A 5LGNB 2KINB 2KXPB 2VASA 4GKKT 4LMLA 3ZMTB 4DR5T 2JPFA 2XAHB 2ACZA 1V9DA 3KBTA 4HE8A 4MHCA 4CI2B 3VKGA 1MIVA 2IIUA 5AQUB 2IHR1 2V1DB 4P0AA 4U2YA 4AIUA 5DABA 2NTYA 5AFUL 2LHNA 2WBLA 1X9BA 3I9WA 2XSBA 3QC9A 2IAKA 2YDSA 3PUYF 1M7KA 4H9OC 4F8HA 3N9PA 3N2GE 4L5GA 3AEFA 3N9QA 1L0VA 3UQ4A 5ABEA 3AE2A 2IMLA 3AE7A 3OTOT 4DV2T 2ACXA 3GMIA 4YTMA 3R6NA 2JMKA 3EHZA 3CQXC 4YSXA 4I43B 5J1GA 2R6GF 3LDQB 4JUYA 2V7IA 2CM0A 3KVBA 4ILUA 3TKLB 3FZMB 5CFBA 4H9RC 3EI0A 1NENA 3EUHA 1D0XA 3FBZA 4YFSA 5JREA 3J7Yq 2V26A 3GWHA 5BR8T 3HA4A 2LSYA 5HXCA 2VVSA 5L3BB 3MA9A 3UU4A 1QLBA 4EZ4A 1E1HB 1JNRA 3JAFA 3V5SA 5AQNB 2D0UA 1WYCA 4ZZCA 3N9MA 3VKHA 2W00A 3PV0F 3ZN0B 3RC3A 3AE6A 3MKDA 3LJCA 4UXNB 4ZI2D 3K8PC 3SFDA 1HCIA 4PNIA 5LB7B 5L3CB 1IBKT 1BR4A 1Y01A 3UU3A 5LJMA 1N36T 4LFCT 2BG9E 2W63A 4PW8A 2N9DA 2QA7A 3PE0A 2I6HA 2BBJA 2CRBA 3LK3B 5IHYA 4EGWA 3WAJA 2NWBA 1T98A 3UTKA 3OKQA 3PJAJ 1HX8A 2D0TA 2W4XA 2X67A 3Q5WA 4PK6A 3TLWA 1DU2A 5JR9A 3ZT6A 2FJDA 3AE1A 1WR0A 1D1AA 3SS1A 1IBMT 4QX8B 4DIDB 3ZMSB 4B3MT 2SPCA 3RPUA 3ONXA 5EK3A 4X64T 2V6YB 4IE5A 4NUVA 3O9XA 3ZCIA 4AKIA 2LLYA 3IEEA 3NVOA 1LVFA 2DLRA 2EHOD 2YK0A 1ZV4X 4PJLA 1W9RA 5DJQC 4E7ZA 3RC8A 4HWIB 4YSYA 5J2UE 2X9XA 3JC6C 2CWOA 3EABA 4ZI7E 3L8RA 3CPZA 4PFPA 4EEBA 2UUAT 4H63V 2ODUA 4GK5E 2YU2A 2DWGA 4QKNA 4X5TA 2C5IT 5HEHA 4EYYR 4LF4T 2Y48B 3UUBA 4AKGA 3C64A 4TV8E 5FYMA 4K0UA 2MBGA 4A5XA 2XAFB 4OYJA 3N9NA 3VR8A 2CMRA 3RIFA 2VK9A 2BVMA 3WI3A 3ZJ2A 3RYHE 3P4SA 2CBJA 5LOVE 4ASKA 2LSKA 3PUWF 3RLFF 1BR0A 2WDQA 2YKSA 1I94T 1KNRA 4I50E 2CHOA 2XM1A 4IE7A 3BQIA 4GK0E 2UXNB 4AKRB 1E2AA 2WDRA 1N32T 1HFAA 1WYBA 3ZSSA 3ZYLA 4YT0A 2WY2A 2DL1A 4X65T 1B7TA 2KSRA 3AEBA 1ZKEA 1LRZA 2L9QA 5HCJA 4OYKA 3RIUC 3UFGA 3X1DA 4GOUA 5ABFA 3K3QC 4I4TE 5AQOB 2X9WA 4HFBA 5FVLA 5LXTE 3FZHB 2VB6A 3Q5XA 1VRBA 2B76A 3NRXA 4UVCB 4JI4T 2IC6A 2LSIA 2NP9A 2WMOA 2WZIA 1OEDA 1MMNA 3BK9A 2H3RA 4HWHA 4YJ3E 2XAJB 3DJBA 5LJNA 4DV1T 3TLSA 4HWFA 3P4RA 1Z8UA 4N78D 3AEAA 2XQ5A 2NTXA 5HEOA 3SRZA 2YU1A 2KWHA 4CXWA 5KXJA 4TX5A 3GA8A 1E7PA 5HCMA 1XNRT 1XZYA 2N2NA 3C4ZA 2Q9QB 4H9QC 2BKNA 1ZEEA 2VKDA 3PDYA 5AQQB 5LGUB 4YTPA 4KHZF 2I0MA 2IC9A 2WQYA 1OWAA 2NW9A 3OVUA 2Y8DA 2JMHA 3Q5DA 2Q9QC 4HKAA 5JRCB 4NPPA 3M3ZB 2FBWA 4IGUA 4LMJA 3CK6A 1UGOA 5AQTB 1SA0E 3AAEB 4HFIA 3ZPOA 4DMWA 2YDQA 5AQVB 2Z6EA 5JVDE 5HWXA 5IYZE 1X79A 2LSGA 3AEGA 2LEHA 4AQYT 3L09A 3RH3A 3H3MA 3R84B 4AQFA 4ISTA 5L4EA 5FY7A 2ZM6T 4UEMA 4B3ST 3ANWA 2E9XC 2YN6A 4HFCA 5LGTB 3KFWX 4JI7T 4PK5A 5HEUA 1QUUA 3L39A 1KEYA 2LE8A 5LCYA 2XM2A 2WDVA 2C5KT 3E22E 3P7IA 3QOFA 3UT5E 5CA1E 1OXZA 2E5LT 3ZC0A 4ZHQE 3I0QA 3RYIE 1YD8G 3NZQA 2XASB 3WAKA 4ZEYA 2RP4A 1HNWT 3VRBA 5E0OA 3T1HT 3UULA 5C3JA 2X68A 4NXNT 4JI8T 4U72A 4JI3T 1UX5A 4GIWA 4U3CA 3IF8B 4DV4T 1XMOT 4QHOA 4YLHA 1BR2A 2H7VC 2VKJA 1G73A 2VL8A 3NZPA 2HPLA 2V6XA 3NRYA 4ILBA 4QX7B 4L9IA 4A98A 4AKHA 2W66A 3ANWB 5A1LA 3OJAA 3MZKB 4AXPA 3K1SA 2WAUA 3MACA 4CZZB 2NW7A 3D0TA 4DR6T 2W61A 4ZZBA 4NXMT 4MBQA 3ZKRA 3FZLB 4IE4A 2UXXB 3AA7B 3RIAA 5JDGA 5HXHA 2QVAA 4FJOA 4DR1T 2HHHT 1NAFA 1S35A 4O4HE 4PFOA 2XQ8A 3PUSA 5AQSB 5CB4E 4UIGA 4B6XA 2CXFA 1CHUA 2J62A 4MFRA 5LA6E 5JRCA 4DV3T 4IDPA 2XHEB 3N2OA 4NIQA 1NEKA 2V5CA 5AQGB 4MLKA 5HXSA 1YKHB 5LNKA 3LK42 3UQ7A 5FVKA 2F4VT 5GONE 2K3WA 2RPAA 3M65A 1J5ET 5ADXL 5L2LA 4IE6A 5J0ZA 5ABHA 2EHOB 2QGSA 3C50A 4X1IE 5FXZA 2X0YA 3S4UA 4PK4A 4WW0A 3ZT5A 4X1YE 3P4WA 2LHRA 3C4XA 4XZCA 3UU8A 4XAXB 4KBMB 4WBNE 5KX5E 2MOZA 3PUQA 3HKEE 5F8PA 3IHRA 1KFYA 1T7SA 4X66T 4ERRA 3ZMUB 4AI6A 4KMCA 2UXBT 5AQMB 3RKGA 4ANJA 4DNDA 1UCUA 2A9UA 4UF0A 2VQFT 5L3GB 3RRCA 2JQHA 5JDLA 4IDQA 4DMVA 2BDEA 4A97A 2PBIA 4IE0A 4M1PA 5L3DB 5LHIB 4YTNA 2E5VA 2ZM0A 5FNVE 3LSVA 5LHGB 4B3TT 1N34T 4JI6T 3PUXF 1UK5A 1MNDA 5IWAT 4IT4A 2CXLA 5AQPB 2XQ3A 4U7YA 4DBQA 4AISA 2OLTA 4IDOA 2WM9A 2WWUA 4UV9B 1HG2A 3ONJA 4P09A 4PJJA 2XQ4A 4U31A 3G06A 1SE7A 1XDPA 2HN2A 2E2AA 3N5LA 3PU8A 2KLQA 4HWCA 1SHZC 4OFZA 2PFVA 5HXRA 3RGLA 2H7OA 4Z91A 2WU2A 4PAGA 5AQHB 3UUNA 3H37A 1FMVA 4YY3T 3ZEFB 2BG9A 2X0LB 2ZLYA 5HEJA 5DQVA 4H9SE 2XSAA 2WU5A 4WBOA 2DHRA 3PJAA 4Z90A 5AQIB 4HN9A 3K3NA 3F31A 3B13A 3PTRB 3RF1A 4CXXA 1ZOYA 2FJBA 1US7B 2NW8A 2XQ7A 1IAPA 2WMNA 1YQ3A 4EYUA 2VQET 1MIWA 4EAHA 4UVBB 2X51A 2QRXA 1I6ZA 3PUGA 3J9X1 4YJ2E 4Z8XA 3W15B 3TLVA 5JR9B 1GQEA 3I0OA 2CE7A 2JIWA 4GYRA 4GYSA 4P0BA 3Q5EA 4QH1A 3AVSA 2CPTA 1SUMB 1IBLT 5F5WA 2DI4A 2ODVA 2VL0A 1R8IA 2KZ7B 1CUNA 3A5XA 3C98B 1D1BA 3CMLA 2Y6XA 4O8SA 4WNKA 1U4QA 4EIWA 1OEDE 2WZHA 2V7JA 3AA0B 4HFEA 5LMNT 1VOMA 3FB2A 3JAEA 2EHOC 4DO0A 3N9LA 1XDOA 2PG8A 3NBXX 3EAMA 4HEAA 4DV7T 3H3AA 2HH7A 3P8CD 5FL0A 4CN1A 4LF6T 2M6IA 2D5UA 3AA1B 2E8IA 2FJAA 1O3XA 3QB5K
chains in the Genus database with same CATH topology
3IA3A 3Q5DA 4IDOA 3QNUA 1XZYA 3Q5EA 3OVUA 3QOFA 1W0AA 4IDPA 4IDNA 1W0BA 1Y01A 1Z8UA 4IDQA 3X1DA 1W09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IA3 A;  3Q5D A;  4IDO A;  3QNU A;  1XZY A;  3Q5E A;  3OVU A;  3QOF A;  1W0A A;  4IDP A;  4IDN A;  1W0B A;  1Y01 A;  1Z8U A;  4IDQ A;  3X1D A;  1W09 A; 
#chains in the Genus database with same CATH topology
 3RYC E;  2KT9 A;  5TAO A;  2X0H A;  2ZM2 A;  4LFA T;  3QB5 A;  4QXB B;  3LBX A;  2DCF A;  1WRD A;  1D1C A;  2RA1 A;  5EZY E;  2XPK A;  2JQK A;  4HFV A;  4PJN A;  2E9X D;  2CA5 A;  3P50 A;  4ZS3 A;  4EXT A;  1KNZ A;  2FJE A;  3RKO A;  3T8O A;  1N33 T;  2BKO A;  3CKD A;  3E0Z A;  5C8Y E;  2BKP A;  5M4Y A;  4DR7 T;  2X9Y A;  2XZE A;  3RQU A;  1HNX T;  2BS4 A;  2WB5 A;  3C51 A;  2H88 A;  4F6R C;  5LYJ E;  4DR3 T;  1H7C A;  5HWY A;  1T72 A;  5FXX A;  1J5W A;  3O1J A;  4NUU A;  4UF0 B;  1Y64 B;  2LJL A;  2NR4 A;  3QUJ A;  4QXC B;  5FY1 A;  1HNZ T;  2LRL A;  2UU9 T;  4OX9 T;  3AXJ A;  4TWF A;  4OHF A;  4CQI A;  1BR1 A;  5JDQ A;  2Q9Q D;  4TZ4 C;  4O2B E;  4LF8 T;  2V5D A;  4QH4 A;  5DQW A;  4TN7 B;  2YOE A;  1VCS A;  4DBR A;  5FMN A;  4JEU B;  2CCQ A;  4IL4 A;  3CQC B;  3UU6 A;  3SOL A;  3UUX B;  3UUM A;  2W0G A;  2K48 A;  3CWZ B;  2WP9 A;  3KV6 A;  4LMK A;  1S94 A;  2EHO A;  4WZX A;  4JI2 T;  1YQ4 A;  5H6Q B;  1YW0 A;  4QXH B;  4ILA A;  2BZB A;  2LSJ A;  4TNW A;  2B1E A;  2XQ9 A;  2JRK A;  3Q9D A;  4UR9 A;  3KIN B;  4IL9 A;  4X20 E;  1ZHC A;  2A2F X;  3Q2M A;  3ETV A;  3VHL A;  1LVK A;  3RIU A;  3RQW A;  5HXE A;  2CHN A;  4TV9 E;  5AQR B;  3DP7 A;  3AB3 B;  3CIR A;  5JH7 E;  3TLU A;  2ES0 A;  3KV4 A;  3N2K E;  3ABV A;  4I0U A;  4MAL A;  4CI3 B;  2BG9 B;  2LOP A;  2D9D A;  3HL6 A;  3CX7 B;  3IA3 A;  4ZI3 D;  3KV9 A;  3ETU A;  2ZM8 A;  5C2T A;  4DV6 T;  1KF6 A;  2E9X B;  2A72 A;  2BVL A;  2OV9 A;  4ZOL E;  3AE3 A;  5KMG P;  3A7M A;  4FI5 A;  4BAY B;  3I9Y A;  4DR4 T;  2HN1 A;  3KV5 A;  1FIO A;  4K0K T;  4CI1 B;  4LFB T;  4CN4 A;  2L3L A;  5L4H A;  3ZMV B;  3ZLI A;  1UX4 A;  4JYA T;  4G2A A;  2X9H A;  5HEG A;  5ABF B;  2C5J A;  2VWA A;  3I1A A;  5AQL B;  3GN5 A;  4V1A v;  3ESL A;  1D0Z A;  2KWI B;  4JLE A;  4KX6 A;  5AQK B;  4ZXL A;  2LOS A;  4JEH B;  4HGA A;  4JI5 T;  5JTG A;  2XAG B;  2CWY A;  4EZH A;  5LG3 A;  2KND A;  2HPJ A;  1LKX A;  1W0A A;  3JC6 D;  4BJN A;  2WWV A;  4DV0 T;  2VUR A;  3FXE B;  4O4L E;  3NWI A;  5FXW A;  3A8Y C;  2IW5 B;  3RHW A;  3VR9 A;  1FJG T;  1XNQ T;  3AAA B;  3QK6 A;  2YDR A;  3PUA A;  1IZN B;  4KI0 F;  3OYX A;  4BJM A;  1UUS A;  2LKG A;  2VKO A;  4IRE A;  1HS7 A;  3VRA A;  2KMF A;  1WR6 A;  3SWH A;  3RRW A;  2IUB A;  1MMD A;  3F57 A;  3LFM A;  3OBV E;  3UFE A;  5IUX A;  5LG4 A;  2WCA A;  4YHJ A;  3TLT A;  1JNZ A;  2VVN A;  2YIN A;  1YKE B;  3AAI A;  1WLX A;  3FZF B;  3BQK A;  3ZT7 A;  3FBL A;  2DNX A;  4U2Z A;  4CXY A;  4TNV A;  1U5P A;  4B3R T;  5JDF A;  1UUR A;  4ZI2 C;  3MJX A;  2AXD S;  4H9P C;  2V7L A;  3FXD B;  3MK7 C;  3FZK B;  2MAW A;  2YEV C;  2PTF A;  3AVR A;  4UEL A;  3CX8 B;  2XUE A;  3O1H A;  4L0R A;  5L47 A;  1FEW A;  4DUY T;  3BQL A;  2XQ6 A;  5CJ5 A;  1HX1 B;  4O2A E;  4AKL A;  4U74 A;  3U78 A;  3C4W A;  4KHP T;  4TUY E;  2JJ9 A;  3AA6 B;  1OED B;  4ISS A;  2W62 A;  3CQG B;  4WYV A;  3ZCJ A;  5CA0 E;  2DWK A;  4H63 H;  1IJ5 A;  2LT3 A;  4PJM A;  2BG9 C;  1J1J A;  3HI2 A;  5JDN A;  3AE8 A;  1T8B A;  4ILC A;  3FHN A;  1MMG A;  1M62 A;  4J2C A;  2M67 A;  3AXJ B;  4ZS2 A;  4YHH T;  3T1Y T;  1G8X A;  4IDN A;  3ZST A;  3AEC A;  2A3D A;  5KDM C;  5FXV A;  3AE9 A;  2AE9 A;  2JQQ A;  4IDZ A;  2MYS A;  3EDV A;  1Z0P A;  4EED A;  2D2S A;  3GN5 B;  2PJQ A;  5HAX A;  1QSD A;  2X66 A;  3RI5 A;  3UU5 A;  2K5B B;  4LF7 T;  4C90 A;  4ADZ A;  3HR0 A;  2M6B A;  3F2E A;  2CLY B;  2LKH A;  3CVR A;  5LMU T;  1KK7 A;  5JR9 C;  1ZP0 A;  1XMQ T;  3V5U A;  3JCF A;  4KUM B;  2V8S V;  1OED C;  3SFE A;  3ONL C;  3QNU A;  2UXC T;  4HFD A;  4YXD A;  2LM2 A;  3EDU A;  1HTJ F;  4IIJ E;  5LHH B;  2E9X A;  4JI1 T;  4YSZ A;  2WS3 A;  2QYW A;  3HKC E;  3HKB E;  4KP3 C;  5ABG A;  3RX6 A;  3KVA A;  3O4X E;  4BA9 A;  3ZJ1 A;  2J4G A;  1HF8 A;  1NWM X;  5F3J A;  5FP3 A;  2XQY A;  4HWD A;  1VCT A;  2BBH A;  3ZMZ B;  4XBF B;  4H9N C;  4UV8 B;  2V6Y A;  3DTO A;  3MXZ A;  2UUC T;  4EV6 A;  3P4Q A;  3ZN1 B;  4A56 A;  5CGM A;  4DV5 T;  4LF9 T;  4EB6 E;  2CXD A;  3CX6 B;  4IHJ E;  2XQA A;  3B57 A;  4C91 A;  3RYF E;  2IDO B;  2Q9Q A;  1YXR A;  2CLY C;  1EZ3 A;  4U7I A;  5FKY A;  4CN6 A;  3K3O A;  5L3E B;  2W67 A;  5JDM A;  1IJ6 A;  3AED A;  3ZC1 A;  2XTL A;  3AEE A;  4O4I E;  1W09 A;  3U3I A;  2W2U A;  1WFD A;  4COF A;  4O4J E;  5JQG E;  3P4P A;  2K9A A;  2UXD T;  2H89 A;  1MIY A;  4AQF C;  3N9O A;  5EK2 A;  3VU7 H;  3ZYK A;  3OPC A;  3LK2 B;  2LRK A;  5ETW A;  4JBW F;  2FUP A;  2K24 A;  2P9B A;  2C0S A;  2NOX A;  4P1N A;  5L3F B;  4G63 A;  5AQJ B;  5JDH A;  2XJ7 A;  3L3P A;  4Q25 A;  3PUR A;  5FY0 A;  4TWD A;  4GKJ T;  4JI0 T;  2V7K A;  4OK0 A;  3KBU A;  4DUZ T;  4EOZ B;  2OA5 A;  4LF5 T;  5HYA A;  3NKZ A;  4QWN B;  2MPK A;  3KDS E;  1HG5 A;  5FL1 A;  4TWH A;  3O1I A;  1KNP A;  4X1K E;  3PU3 A;  5EK4 A;  4DVD A;  2LM9 A;  4U33 A;  5LBM A;  3LBX B;  1W0B A;  3AE5 A;  3JAD A;  4UVA B;  5AQF B;  3B5M A;  4JV5 T;  4HTE A;  2L8K A;  2VKH A;  3PUZ F;  5BMV E;  2CBI A;  3PUV F;  4HFH A;  1AJ3 A;  4AQG A;  2V7M A;  2UUB T;  1XWM A;  5LBQ B;  1D0Y A;  4E7S A;  2J1D G;  1WCR A;  3OYZ A;  3IBP A;  1MMA A;  2J47 A;  4I55 E;  3AE4 A;  1MNE A;  2G0U A;  2XY8 B;  3EVY A;  4X62 T;  5H6R B;  2CEA A;  5LP6 E;  2XAQ B;  4DR2 T;  2I59 A;  2BS2 A;  1HR0 T;  2MTQ A;  4QH5 A;  5J2T E;  3ZYM A;  3E08 A;  2ZMA A;  2GK9 A;  3HKD E;  1FMW A;  2WSS V;  3LG7 A;  4ZI3 C;  2N1G A;  2BS3 A;  2JQ9 A;  5LGN B;  2KIN B;  2KXP B;  2VAS A;  4GKK T;  4LML A;  3ZMT B;  4DR5 T;  2JPF A;  2XAH B;  2ACZ A;  1V9D A;  3KBT A;  4HE8 A;  4MHC A;  4CI2 B;  3VKG A;  1MIV A;  2IIU A;  5AQU B;  2IHR 1;  2V1D B;  4P0A A;  4U2Y A;  4AIU A;  5DAB A;  2NTY A;  5AFU L;  2LHN A;  2WBL A;  1X9B A;  3I9W A;  2XSB A;  3QC9 A;  2IAK A;  2YDS A;  3PUY F;  1M7K A;  4H9O C;  4F8H A;  3N9P A;  3N2G E;  4L5G A;  3AEF A;  3N9Q A;  1L0V A;  3UQ4 A;  5ABE A;  3AE2 A;  2IML A;  3AE7 A;  3OTO T;  4DV2 T;  2ACX A;  3GMI A;  4YTM A;  3R6N A;  2JMK A;  3EHZ A;  3CQX C;  4YSX A;  4I43 B;  5J1G A;  2R6G F;  3LDQ B;  4JUY A;  2V7I A;  2CM0 A;  3KVB A;  4ILU A;  3TKL B;  3FZM B;  5CFB A;  4H9R C;  3EI0 A;  1NEN A;  3EUH A;  1D0X A;  3FBZ A;  4YFS A;  5JRE A;  3J7Y q;  2V26 A;  3GWH A;  5BR8 T;  3HA4 A;  2LSY A;  5HXC A;  2VVS A;  5L3B B;  3MA9 A;  3UU4 A;  1QLB A;  4EZ4 A;  1E1H B;  1JNR A;  3JAF A;  3V5S A;  5AQN B;  2D0U A;  1WYC A;  4ZZC A;  3N9M A;  3VKH A;  2W00 A;  3PV0 F;  3ZN0 B;  3RC3 A;  3AE6 A;  3MKD A;  3LJC A;  4UXN B;  4ZI2 D;  3K8P C;  3SFD A;  1HCI A;  4PNI A;  5LB7 B;  5L3C B;  1IBK T;  1BR4 A;  1Y01 A;  3UU3 A;  5LJM A;  1N36 T;  4LFC T;  2BG9 E;  2W63 A;  4PW8 A;  2N9D A;  2QA7 A;  3PE0 A;  2I6H A;  2BBJ A;  2CRB A;  3LK3 B;  5IHY A;  4EGW A;  3WAJ A;  2NWB A;  1T98 A;  3UTK A;  3OKQ A;  3PJA J;  1HX8 A;  2D0T A;  2W4X A;  2X67 A;  3Q5W A;  4PK6 A;  3TLW A;  1DU2 A;  5JR9 A;  3ZT6 A;  2FJD A;  3AE1 A;  1WR0 A;  1D1A A;  3SS1 A;  1IBM T;  4QX8 B;  4DID B;  3ZMS B;  4B3M T;  2SPC A;  3RPU A;  3ONX A;  5EK3 A;  4X64 T;  2V6Y B;  4IE5 A;  4NUV A;  3O9X A;  3ZCI A;  4AKI A;  2LLY A;  3IEE A;  3NVO A;  1LVF A;  2DLR A;  2EHO D;  2YK0 A;  1ZV4 X;  4PJL A;  1W9R A;  5DJQ C;  4E7Z A;  3RC8 A;  4HWI B;  4YSY A;  5J2U E;  2X9X A;  3JC6 C;  2CWO A;  3EAB A;  4ZI7 E;  3L8R A;  3CPZ A;  4PFP A;  4EEB A;  2UUA T;  4H63 V;  2ODU A;  4GK5 E;  2YU2 A;  2DWG A;  4QKN A;  4X5T A;  2C5I T;  5HEH A;  4EYY R;  4LF4 T;  2Y48 B;  3UUB A;  4AKG A;  3C64 A;  4TV8 E;  5FYM A;  4K0U A;  2MBG A;  4A5X A;  2XAF B;  4OYJ A;  3N9N A;  3VR8 A;  2CMR A;  3RIF A;  2VK9 A;  2BVM A;  3WI3 A;  3ZJ2 A;  3RYH E;  3P4S A;  2CBJ A;  5LOV E;  4ASK A;  2LSK A;  3PUW F;  3RLF F;  1BR0 A;  2WDQ A;  2YKS A;  1I94 T;  1KNR A;  4I50 E;  2CHO A;  2XM1 A;  4IE7 A;  3BQI A;  4GK0 E;  2UXN B;  4AKR B;  1E2A A;  2WDR A;  1N32 T;  1HFA A;  1WYB A;  3ZSS A;  3ZYL A;  4YT0 A;  2WY2 A;  2DL1 A;  4X65 T;  1B7T A;  2KSR A;  3AEB A;  1ZKE A;  1LRZ A;  2L9Q A;  5HCJ A;  4OYK A;  3RIU C;  3UFG A;  3X1D A;  4GOU A;  5ABF A;  3K3Q C;  4I4T E;  5AQO B;  2X9W A;  4HFB A;  5FVL A;  5LXT E;  3FZH B;  2VB6 A;  3Q5X A;  1VRB A;  2B76 A;  3NRX A;  4UVC B;  4JI4 T;  2IC6 A;  2LSI A;  2NP9 A;  2WMO A;  2WZI A;  1OED A;  1MMN A;  3BK9 A;  2H3R A;  4HWH A;  4YJ3 E;  2XAJ B;  3DJB A;  5LJN A;  4DV1 T;  3TLS A;  4HWF A;  3P4R A;  1Z8U A;  4N78 D;  3AEA A;  2XQ5 A;  2NTX A;  5HEO A;  3SRZ A;  2YU1 A;  2KWH A;  4CXW A;  5KXJ A;  4TX5 A;  3GA8 A;  1E7P A;  5HCM A;  1XNR T;  1XZY A;  2N2N A;  3C4Z A;  2Q9Q B;  4H9Q C;  2BKN A;  1ZEE A;  2VKD A;  3PDY A;  5AQQ B;  5LGU B;  4YTP A;  4KHZ F;  2I0M A;  2IC9 A;  2WQY A;  1OWA A;  2NW9 A;  3OVU A;  2Y8D A;  2JMH A;  3Q5D A;  2Q9Q C;  4HKA A;  5JRC B;  4NPP A;  3M3Z B;  2FBW A;  4IGU A;  4LMJ A;  3CK6 A;  1UGO A;  5AQT B;  1SA0 E;  3AAE B;  4HFI A;  3ZPO A;  4DMW A;  2YDQ A;  5AQV B;  2Z6E A;  5JVD E;  5HWX A;  5IYZ E;  1X79 A;  2LSG A;  3AEG A;  2LEH A;  4AQY T;  3L09 A;  3RH3 A;  3H3M A;  3R84 B;  4AQF A;  4IST A;  5L4E A;  5FY7 A;  2ZM6 T;  4UEM A;  4B3S T;  3ANW A;  2E9X C;  2YN6 A;  4HFC A;  5LGT B;  3KFW X;  4JI7 T;  4PK5 A;  5HEU A;  1QUU A;  3L39 A;  1KEY A;  2LE8 A;  5LCY A;  2XM2 A;  2WDV A;  2C5K T;  3E22 E;  3P7I A;  3QOF A;  3UT5 E;  5CA1 E;  1OXZ A;  2E5L T;  3ZC0 A;  4ZHQ E;  3I0Q A;  3RYI E;  1YD8 G;  3NZQ A;  2XAS B;  3WAK A;  4ZEY A;  2RP4 A;  1HNW T;  3VRB A;  5E0O A;  3T1H T;  3UUL A;  5C3J A;  2X68 A;  4NXN T;  4JI8 T;  4U72 A;  4JI3 T;  1UX5 A;  4GIW A;  4U3C A;  3IF8 B;  4DV4 T;  1XMO T;  4QHO A;  4YLH A;  1BR2 A;  2H7V C;  2VKJ A;  1G73 A;  2VL8 A;  3NZP A;  2HPL A;  2V6X A;  3NRY A;  4ILB A;  4QX7 B;  4L9I A;  4A98 A;  4AKH A;  2W66 A;  3ANW B;  5A1L A;  3OJA A;  3MZK B;  4AXP A;  3K1S A;  2WAU A;  3MAC A;  4CZZ B;  2NW7 A;  3D0T A;  4DR6 T;  2W61 A;  4ZZB A;  4NXM T;  4MBQ A;  3ZKR A;  3FZL B;  4IE4 A;  2UXX B;  3AA7 B;  3RIA A;  5JDG A;  5HXH A;  2QVA A;  4FJO A;  4DR1 T;  2HHH T;  1NAF A;  1S35 A;  4O4H E;  4PFO A;  2XQ8 A;  3PUS A;  5AQS B;  5CB4 E;  4UIG A;  4B6X A;  2CXF A;  1CHU A;  2J62 A;  4MFR A;  5LA6 E;  5JRC A;  4DV3 T;  4IDP A;  2XHE B;  3N2O A;  4NIQ A;  1NEK A;  2V5C A;  5AQG B;  4MLK A;  5HXS A;  1YKH B;  5LNK A;  3LK4 2;  3UQ7 A;  5FVK A;  2F4V T;  5GON E;  2K3W A;  2RPA A;  3M65 A;  1J5E T;  5ADX L;  5L2L A;  4IE6 A;  5J0Z A;  5ABH A;  2EHO B;  2QGS A;  3C50 A;  4X1I E;  5FXZ A;  2X0Y A;  3S4U A;  4PK4 A;  4WW0 A;  3ZT5 A;  4X1Y E;  3P4W A;  2LHR A;  3C4X A;  4XZC A;  3UU8 A;  4XAX B;  4KBM B;  4WBN E;  5KX5 E;  2MOZ A;  3PUQ A;  3HKE E;  5F8P A;  3IHR A;  1KFY A;  1T7S A;  4X66 T;  4ERR A;  3ZMU B;  4AI6 A;  4KMC A;  2UXB T;  5AQM B;  3RKG A;  4ANJ A;  4DND A;  1UCU A;  2A9U A;  4UF0 A;  2VQF T;  5L3G B;  3RRC A;  2JQH A;  5JDL A;  4IDQ A;  4DMV A;  2BDE A;  4A97 A;  2PBI A;  4IE0 A;  4M1P A;  5L3D B;  5LHI B;  4YTN A;  2E5V A;  2ZM0 A;  5FNV E;  3LSV A;  5LHG B;  4B3T T;  1N34 T;  4JI6 T;  3PUX F;  1UK5 A;  1MND A;  5IWA T;  4IT4 A;  2CXL A;  5AQP B;  2XQ3 A;  4U7Y A;  4DBQ A;  4AIS A;  2OLT A;  4IDO A;  2WM9 A;  2WWU A;  4UV9 B;  1HG2 A;  3ONJ A;  4P09 A;  4PJJ A;  2XQ4 A;  4U31 A;  3G06 A;  1SE7 A;  1XDP A;  2HN2 A;  2E2A A;  3N5L A;  3PU8 A;  2KLQ A;  4HWC A;  1SHZ C;  4OFZ A;  2PFV A;  5HXR A;  3RGL A;  2H7O A;  4Z91 A;  2WU2 A;  4PAG A;  5AQH B;  3UUN A;  3H37 A;  1FMV A;  4YY3 T;  3ZEF B;  2BG9 A;  2X0L B;  2ZLY A;  5HEJ A;  5DQV A;  4H9S E;  2XSA A;  2WU5 A;  4WBO A;  2DHR A;  3PJA A;  4Z90 A;  5AQI B;  4HN9 A;  3K3N A;  3F31 A;  3B13 A;  3PTR B;  3RF1 A;  4CXX A;  1ZOY A;  2FJB A;  1US7 B;  2NW8 A;  2XQ7 A;  1IAP A;  2WMN A;  1YQ3 A;  4EYU A;  2VQE T;  1MIW A;  4EAH A;  4UVB B;  2X51 A;  2QRX A;  1I6Z A;  3PUG A;  3J9X 1;  4YJ2 E;  4Z8X A;  3W15 B;  3TLV A;  5JR9 B;  1GQE A;  3I0O A;  2CE7 A;  2JIW A;  4GYR A;  4GYS A;  4P0B A;  3Q5E A;  4QH1 A;  3AVS A;  2CPT A;  1SUM B;  1IBL T;  5F5W A;  2DI4 A;  2ODV A;  2VL0 A;  1R8I A;  2KZ7 B;  1CUN A;  3A5X A;  3C98 B;  1D1B A;  3CML A;  2Y6X A;  4O8S A;  4WNK A;  1U4Q A;  4EIW A;  1OED E;  2WZH A;  2V7J A;  3AA0 B;  4HFE A;  5LMN T;  1VOM A;  3FB2 A;  3JAE A;  2EHO C;  4DO0 A;  3N9L A;  1XDO A;  2PG8 A;  3NBX X;  3EAM A;  4HEA A;  4DV7 T;  3H3A A;  2HH7 A;  3P8C D;  5FL0 A;  4CN1 A;  4LF6 T;  2M6I A;  2D5U A;  3AA1 B;  2E8I A;  2FJA A;  1O3X A;  3QB5 K; 
#chains in the Genus database with same CATH homology
 3IA3 A;  3Q5D A;  4IDO A;  3QNU A;  1XZY A;  3Q5E A;  3OVU A;  3QOF A;  1W0A A;  4IDP A;  4IDN A;  1W0B A;  1Y01 A;  1Z8U A;  4IDQ A;  3X1D A;  1W09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...