3OVUA

Crystal structure of human alpha-haemoglobin complexed with ahsp and the first neat domain of isdh from staphylococcus aureus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
LKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen transport/protein binding
molecule keywords Alpha-hemoglobin-stabilizing protein
publication title A new haem pocket structure in alpha-haemoglobin
rcsb
source organism Homo sapiens
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 3ovuA00
1XZYA 4IDNA 4IDQA 1W0BA 1Z8UA 3X1DA 4IDOA 3Q5DA 1Y01A 3QOFA 3Q5EA 4IDPA 3OVUA 3QNUA 1W0AA 3IA3A 1W09A
chains in the Genus database with same CATH superfamily
4DV7T 2VL8A 3NRYA 4DUYT 1IJ6A 2LKGA 5EK3A 4PFOA 1XNRT 1WYBA 1N33T 1XNQT 3ANWB 3O9XA 4N78D 2K5BB 5LB7B 1WYCA 4OYKA 2N2NA 3C4XA 4EEDA 2BG9B 3AVRA 3IHRA 3AA6B 2MBGA 2RPAA 4PK4A 4YTPA 1IJ5A 3SFDA 4AIUA 3S4UA 2JQ9A 2XQ7A 4UVAB 1VOMA 3ONLC 1OXZA 2WWUA 4DV2T 4HWFA 1HG2A 3PUZF 3EVYA 2EHOA 2X0LB 2UUCT 4CXYA 3K1SA 5L4HA 2DWKA 5FXZA 3UU4A 4XAXB 4KX6A 2WDVA 3TLVA 3C64A 5AQTB 5HCMA 2LHRA 3FZFB 1S35A 2YOEA 4HWHA 2I59A 3LBXB 4L5GA 3FB2A 4HFDA 3V5SA 4XZCA 1U4QA 3MZKB 4LF5T 2VKHA 5HXHA 1XDOA 5HYAA 3O1JA 2LKHA 4ILAA 4ILCA 4CN1A 2NR4A 3KVAA 2WZIA 2FUPA 3ZMTB 1VRBA 5EK4A 1ZV4X 4AISA 2XAGB 3ZLIA 3KINB 4H9QC 4DR5T 4ZI3C 4QH5A 5BMVE 3RKOA 4I55E 5JRCB 1J1JA 1I94T 4Q25A 5FMNA 3RIFA 2LOPA 2X68A 2ODUA 3ZKRA 5FVKA 5ABGA 2K48A 2VK9A 2M67A 4JEUB 5C8YE 2XASB 5KMGP 2LE8A 4KI0F 2IUBA 1J5WA 3DJBA 2CPTA 2X51A 3VKGA 3E08A 4X5TA 3UFGA 1B7TA 1JNZA 1G8XA 2ZM0A 1HNZT 4UR9A 2CBJA 1W0BA 2K3WA 5KDMC 4XBFB 3IA3A 3T1HT 2VURA 4B3MT 3SFEA 4DBRA 1HFAA 4EYYR 3EUHA 3IBPA 4COFA 2W00A 4UV9B 5HXSA 2LSYA 2LSIA 3F57A 5LMNT 5JH7E 2X67A 1U5PA 4P0BA 2X9XA 2A9UA 2V6YA 1N34T 5JREA 2VASA 2JPFA 2WDRA 4X1IE 2YEVC 1AJ3A 2E9XA 4UVCB 3KV4A 1I6ZA 4EV6A 4O4JE 5HEGA 3RYIE 1VCTA 5LHGB 4PJNA 4GKKT 3RF1A 2LM9A 3OPCA 2XAJB 4HE8A 1KNRA 3JADA 5L3FB 1MNDA 2XQ5A 3PUGA 5JR9A 4X66T 4ZOLE 1WR6A 2WB5A 1OWAA 1D1CA 3AEFA 2XQ3A 4DV3T 2JIWA 2VVSA 4IE5A 3AB3B 2IAKA 3LK42 4BAYB 4ZI2C 3EDUA 5JDMA 4LF8T 2OLTA 2CA5A 4YJ2E 2D0TA 3VR8A 2D5UA 4X64T 4GYRA 3RIUA 3J7Yq 4GYSA 3BQLA 1M62A 5J2TE 2I6HA 3ZYMA 4K0KT 5E0OA 2N9DA 2E9XC 3Q2MA 3EI0A 5DJQC 1OEDE 3ZCJA 3AE6A 3UUBA 2MTQA 4DR2T 4H9PC 4ERRA 4DR3T 2YU2A 1KNZA 2G0UA 5JR9C 2VVNA 5L3EB 4M1PA 3ZYLA 3TLUA 1OEDA 5LP6E 5AFUL 4JI3T 3O1IA 4KHPT 5AQUB 2CE7A 3U3IA 2JMKA 3UUXB 4EGWA 4YT0A 4CXXA 1Z8UA 4JI2T 1VCSA 3RYCE 4UELA 2ZM8A 2W4XA 2J47A 2H89A 2VL0A 3N9MA 4TNWA 3OJAA 3C50A 3H37A 5HWXA 3EABA 3UU3A 5ABEA 5AQFB 2JRKA 2XTLA 3RHWA 2JQHA 3EAMA 4DMWA 4YHHT 3IF8B 2VKOA 5FNVE 3UUMA 5AQGB 4IT4A 2CLYC 2GK9A 2VKJA 2WAUA 2KWIB 4JI8T 5FY7A 3H3MA 4X65T 1W9RA 2HN1A 3NWIA 4NXNT 5AQRB 3K8PC 2HN2A 2X0YA 1HNWT 1OEDC 4DV5T 3ABVA 3N9LA 2AE9A 2CRBA 3ETUA 4DO0A 3OTOT 2R6GF 3I0QA 3GWHA 4CQIA 4HFCA 3KV5A 5ABFB 1E1HB 1D0YA 2NW7A 3CVRA 5F5WA 3RQWA 2LOSA 3FXEB 4QH1A 3ZC0A 2Y48B 1NEKA 2BKOA 3RC3A 3PUSA 2XY8B 2J4GA 2J1DG 1IBMT 1MNEA 2NOXA 2CWOA 3OYXA 4UF0A 4GK0E 3I9WA 2ACZA 2ZMAA 1LVFA 4PK6A 5C3JA 1D0ZA 1US7B 4O4IE 1T8BA 3D0TA 4LF6T 4F8HA 4JI1T 4JI7T 2WSSV 1IZNB 2OV9A 4IDOA 3VU7H 3AEGA 3HI2A 2WU2A 3ZSSA 4LMLA 2E5LT 1SUMB 3RKGA 5AQHB 3P4RA 2NW8A 2CHOA 4A97A 4HEAA 4LMJA 5FYMA 5KXJA 3R84B 3RH3A 4CN6A 2N1GA 2QYWA 4HTEA 3RPUA 3AEDA 4EB6E 3DP7A 2UUAT 3ZCIA 3P4WA 3ESLA 3RI5A 3MKDA 2JMHA 1HTJF 3CX7B 3G06A 5ADXL 2WS3A 3P50A 2WQYA 3BK9A 4U2ZA 3PUQA 4HFEA 4AXPA 5FP3A 3TKLB 5ABHA 3AEAA 4GK5E 2C5IT 4O4HE 4ZS3A 3AEEA 2LLYA 3BQKA 5IHYA 3RC8A 2LHNA 3NKZA 2RP4A 2A72A 2BS3A 2X9HA 2JQQA 2FJBA 4UVBB 3OBVE 4DIDB 1BR0A 5LA6E 1HF8A 3OYZA 4TV9E 3ZMZB 4B3TT 4GOUA 4KP3C 1T7SA 2IW5B 2H7OA 3FZLB 5AQOB 3ZT5A 5LGTB 1E2AA 3PU3A 4YTNA 4TWDA 1KEYA 3KVBA 4U7YA 1YKEB 1X9BA 2ZM2A 1HG5A 2LEHA 2CWYA 4PK5A 2L9QA 3ZPOA 2CHNA 4X1KE 2CXDA 5LOVE 3K3NA 1M7KA 2K9AA 3ZYKA 4ANJA 4NUVA 4J2CA 4U2YA 5F3JA 1Y01A 2BVLA 3RYHE 2ODVA 2PTFA 3RGLA 2WCAA 3NZPA 4QHOA 4AQFA 5CFBA 4X20E 4I4TE 4WZXA 4AKRB 1QLBA 1ZKEA 3NZQA 2EHOC 3HA4A 3ZT6A 3T8OA 3CKDA 2MYSA 3Q5XA 2UU9T 4TN7B 3GA8A 5AQKB 1YQ4A 2XM1A 4TWHA 1HNXT 3T1YT 4FI5A 1FIOA 2XQ8A 4IDQA 4HN9A 3MA9A 5FVLA 3LBXA 4IDNA 1XDPA 1D1BA 1XMQT 3ZMSB 2Q9QB 2V6YB 5IWAT 4QXCB 2BDEA 2QA7A 4JV5T 3V5UA 4OX9T 1KNPA 3MJXA 4IE7A 1NENA 1R8IA 4HWIB 2H3RA 4TNVA 3ONXA 2KLQA 2KINB 5TAOA 4ADZA 4JI5T 2MPKA 2NTXA 4LFBT 5LHHB 2BBJA 2UXXB 4DR6T 3P4QA 5HAXA 1YQ3A 3U78A 3N9QA 3B13A 4MFRA 3KV6A 3JAFA 4E7ZA 3PV0F 4IGUA 4DR1T 4L0RA 4YXDA 1MIWA 4U31A 1KK7A 4OHFA 2D9DA 2BZBA 3RYFE 2CCQA 4O2AE 3AA1B 3O4XE 5HEOA 2X9WA 4IE4A 5JDFA 3H3AA 3CQCB 3UU8A 3AECA 4UXNB 4BJNA 3K3QC 3Q9DA 2F4VT 2XJ7A 3UU6A 3QC9A 3PDYA 4IL9A 2IC9A 5DQVA 4C91A 3PUVF 3LFMA 3A5XA 2BVMA 3UTKA 4YY3T 4IE6A 4G2AA 2V26A 4ZI3D 2CLYB 2L3LA 1UGOA 1W0AA 4F6RC 3JCFA 3WAJA 3OKQA 3QUJA 4HFVA 5BR8T 3HKEE 5FY1A 5LJNA 4WBNE 4DR4T 2W67A 2E8IA 2XHEB 4UIGA 2XQ9A 3VRBA 5L3GB 4JLEA 2XAHB 5LBQB 2YDRA 3IEEA 2XSAA 1BR1A 5CA0E 3SS1A 3KDSE 4AKHA 4AQGA 5JDNA 2WU5A 3FBZA 4BJMA 4A98A 2CM0A 5CA1E 2K24A 2A2FX 2PJQA 4JI4T 3LK3B 4MHCA 2J62A 5HEUA 4U74A 3LJCA 3AAEB 1HCIA 4QWNB 1W09A 4HGAA 3K3OA 4EZ4A 5AQMB 4AKIA 5LJMA 3WAKA 2WY2A 3VR9A 4DMVA 4UEMA 5CGMA 4HWCA 5L3CB 2FJEA 3RRCA 4TWFA 1UK5A 4EEBA 2KSRA 5FXVA 2WWVA 3RIUC 2FJAA 4AKGA 5CJ5A 1V9DA 3NVOA 3ZMUB 2CXLA 1UCUA 5FXWA 4PNIA 3AA7B 4DVDA 4O2BE 2B1EA 3KBTA 3UUNA 3AAIA 2LSGA 3JAEA 4HFIA 2UXNB 4B3ST 3CK6A 2DNXA 3JC6C 1D1AA 3PUWF 5LGUB 1FEWA 4JUYA 3TLWA 3KBUA 2LT3A 3A8YC 5AQJB 2V5DA 1UX4A 1HR0T 4PJLA 4EOZB 5FL1A 2NTYA 1LKXA 2E2AA 2IDOB 2VQET 2XQ6A 1E7PA 3AA0B 4LFAT 2Q9QD 4DR7T 5LMUT 4JBWF 5AQVB 2OA5A 3Q5EA 2YINA 3FXDB 4JYAT 4KHZF 2FJDA 2YK0A 1MIYA 3AXJB 3KV9A 5HXRA 2WP9A 1CHUA 2BS4A 1UURA 4ILBA 3C4WA 4MBQA 2FBWA 5JVDE 4JI6T 1ZHCA 2DWGA 4AKLA 4P09A 3SRZA 3B57A 2W66A 3DTOA 3GN5B 5L47A 3P4SA 4ZS2A 1NWMX 4H9SE 2NWBA 2V7LA 3PU8A 2MOZA 4AQYT 1WFDA 2XM2A 4DUZT 3AE3A 3EHZA 4YJ3E 5FKYA 1IBLT 4HWDA 2UXCT 3CQGB 3SOLA 2HH7A 2W63A 4AI6A 5LGNB 3Q5DA 5LG4A 1O3XA 5EZYE 1S94A 4DV6T 5HCJA 2EHOB 1ZP0A 2WBLA 3AE4A 2ACXA 2JQKA 2X66A 4B6XA 4HFBA 4EAHA 3PUAA 2CMRA 3ZT7A 4TUYE 2M6IA 2KXPB 4DV0T 4NPPA 1N36T 4IE0A 1T72A 5JQGE 4H63V 4IIJE 3PTRB 4CN4A 4LF4T 4U72A 4EXTA 1WCRA 3J9X1 3N2GE 3TLTA 2H88A 4HFHA 2VWAA 3F2EA 3PUXF 5H6QB 2IHR1 2KT9A 4LFCT 3FZKB 3ZEFB 4TX5A 2DHRA 2LSKA 2BS2A 3LDQB 3AVSA 3P7IA 5DQWA 3QNUA 3A7MA 2E5VA 4Z91A 3LG7A 2DI4A 5ETWA 4IDZA 1MIVA 2LM2A 3EDVA 4ISTA 3VRAA 3N2KE 5JDHA 3L09A 2C5KT 2BG9E 4NXMT 4ZXLA 4KMCA 2HPJA 5EK2A 2LJLA 3PUYF 2YKSA 1LRZA 3X1DA 1N32T 3M65A 3ZJ2A 1JNRA 2AXDS 3MXZA 2KNDA 4GIWA 4EYUA 4QKNA 5FY0A 2W61A 3ANWA 2V7KA 2XAQB 3AE9A 1XWMA 5AQIB 5FL0A 3CQXC 2BG9A 2ZLYA 5L3BB 2SPCA 5IYZE 2HPLA 2WDQA 4EZHA 2YDQA 4HKAA 4H63H 3N2OA 4E7SA 4TZ4C 2QGSA 3HKCE 5JDGA 4PW8A 3C4ZA 4YSYA 5KX5E 2A3DA 4DNDA 1YKHB 2X9YA 5JTGA 1WRDA 2XQYA 1D0XA 5HXEA 3OVUA 2PFVA 3ONJA 3I9YA 3R6NA 4I0UA 4MALA 3L39A 3QK6A 3UQ4A 2KMFA 2Z6EA 4G63A 4CI3B 2LSJA 2W2UA 5HWYA 3FHNA 2E9XB 3ZN1B 3L8RA 3O1HA 2BKPA 1X79A 4QXBB 4U7IA 4X62T 1HX8A 2BG9C 2WMOA 2W62A 3B5MA 2XZEA 5LNKA 5DABA 4YSZA 3MACA 5HEJA 2IMLA 3AE1A 5AQPB 4PJJA 5JR9B 1DU2A 4AQFC 1SHZC 4QH4A 1QSDA 5LBMA 5JRCA 2C0SA 2XQ4A 2VKDA 2DL1A 1WLXA 2IIUA 2XPKA 4YTMA 4BA9A 1WR0A 3N9OA 3VHLA 1UX5A 1H7CA 2VQFT 4Z8XA 4ZEYA 5JDQA 2XQAA 1CUNA 2KWHA 4PFPA 1HS7A 2Q9QA 3QB5K 5HXCA 2V7IA 5AQNB 3FZHB 2LRKA 3Q5WA 3UULA 1Z0PA 5AQQB 3QOFA 3E0ZA 5A1LA 2QVAA 3CX8B 2VB6A 5J1GA 5L3DB 5AQLB 2EHOD 5JDLA 3I1AA 3PE0A 2CBIA 4LF7T 2V7MA 3SWHA 4O8SA 4IDPA 2HHHT 2WM9A 3KFWX 1YXRA 4WYVA 1Y64B 2M6BA 2NW9A 1UUSA 2PG8A 4I43B 4OFZA 3LK2B 1OEDB 1ZEEA 3AEBA 1BR4A 4NUUA 4OYJA 4MLKA 3FZMB 5HEHA 1FMWA 1NAFA 2CXFA 1MMAA 2BKNA 1T98A 1SA0E 1BR2A 5M4YA 5AQSB 1QUUA 3AE7A 1FJGT 4ZHQE 5CB4E 1GQEA 4CZZB 4ZZCA 4ILUA 3CPZA 2PBIA 4YSXA 4ZZBA 3ZSTA 3PJAA 5J0ZA 3RLFF 2Q9QC 2WMNA 3BQIA 1IBKT 3RRWA 1MMDA 4ISSA 2X0HA 4EIWA 4IHJE 4WBOA 3M3ZB 5FXXA 4U33A 2RA1A 3FBLA 3CMLA 4CI2B 4L9IA 4YHJA 3P8CD 3PJAJ 3WI3A 2H7VC 1G73A 3CWZB 3HKDE 3PURA 2MAWA 4A5XA 4YLHA 1MMGA 2V6XA 3NBXX 2NP9A 4JEHB 2WZHA 3CX6B 4IREA 5L4EA 4LF9T 2XAFB 4DV1T 2BBHA 3CIRA 3UU5A 4KBMB 4H9OC 4B3RT 1YW0A 2D0UA 4A56A 1XZYA 4UF0B 1XMOT 4NIQA 4QX7B 2QRXA 4FJOA 5J2UE 1KF6A 3N5LA 4V1Av 4P1NA 1YD8G 4ZI2D 3ETVA 3HL6A 5F8PA 3TLSA 2JJ9A 2DLRA 2UXDT 1HX1B 3MK7C 3ZMVB 4C90A 3F31A 2YDSA 4DBQA 1EZ3A 2I0MA 5C2TA 2DCFA 3C51A 2UUBT 3C98B 4H9NC 4U3CA 1LVKA 3HKBE 4H9RC 3AAAB 4GKJT 5IUXA 1SE7A 2E9XD 2IC6A 1MMNA 2Y6XA 5H6RB 3AE5A 5LCYA 2YU1A 4CXWA 4O4LE 3RIAA 4UV8B 3NRXA 3N9NA 1FMVA 4YFSA 4KUMB 4OK0A 3L3PA 2V7JA 5LXTE 2V5CA 3W15B 2W0GA 4DV4T 4K0UA 1KFYA 5GONE 4Z90A 3QB5A 1ZOYA 3AE8A 4WNKA 1J5ET 2Y8DA 2UXBT 3N9PA 4LMKA 3LSVA 4PJMA 2CEAA 4QX8B 4ASKA 2ZM6T 1L0VA 2P9BA 2V1DB 2C5JA 2D2SA 3GMIA 3ZC1A 3UT5E 4CI1B 4ZI7E 5LG3A 4JI0T 5ABFA 3UFEA 2ES0A 5LHIB 4IL4A 4P0AA 2KZ7B 2V8SV 4WW0A 2LRLA 3UQ7A 3VKHA 5LYJE 3RQUA 3ZJ1A 4X1YE 2B76A 4I50E 3HR0A 3AXJA 2L8KA 2YN6A 4PAGA 3ZN0B 2XUEA 3E22E 3I0OA 1IAPA 4QXHB 5L2LA 3RX6A 3JC6D 3P4PA 4TV8E 3AE2A 3GN5A 2XSBA
chains in the Genus database with same CATH topology
1XZYA 4IDNA 4IDQA 1W0BA 1Z8UA 3X1DA 4IDOA 3Q5DA 1Y01A 3QOFA 3Q5EA 4IDPA 3OVUA 3QNUA 1W0AA 3IA3A 1W09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZY A;  4IDN A;  4IDQ A;  1W0B A;  1Z8U A;  3X1D A;  4IDO A;  3Q5D A;  1Y01 A;  3QOF A;  3Q5E A;  4IDP A;  3OVU A;  3QNU A;  1W0A A;  3IA3 A;  1W09 A; 
#chains in the Genus database with same CATH topology
 4DV7 T;  2VL8 A;  3NRY A;  4DUY T;  1IJ6 A;  2LKG A;  5EK3 A;  4PFO A;  1XNR T;  1WYB A;  1N33 T;  1XNQ T;  3ANW B;  3O9X A;  4N78 D;  2K5B B;  5LB7 B;  1WYC A;  4OYK A;  2N2N A;  3C4X A;  4EED A;  2BG9 B;  3AVR A;  3IHR A;  3AA6 B;  2MBG A;  2RPA A;  4PK4 A;  4YTP A;  1IJ5 A;  3SFD A;  4AIU A;  3S4U A;  2JQ9 A;  2XQ7 A;  4UVA B;  1VOM A;  3ONL C;  1OXZ A;  2WWU A;  4DV2 T;  4HWF A;  1HG2 A;  3PUZ F;  3EVY A;  2EHO A;  2X0L B;  2UUC T;  4CXY A;  3K1S A;  5L4H A;  2DWK A;  5FXZ A;  3UU4 A;  4XAX B;  4KX6 A;  2WDV A;  3TLV A;  3C64 A;  5AQT B;  5HCM A;  2LHR A;  3FZF B;  1S35 A;  2YOE A;  4HWH A;  2I59 A;  3LBX B;  4L5G A;  3FB2 A;  4HFD A;  3V5S A;  4XZC A;  1U4Q A;  3MZK B;  4LF5 T;  2VKH A;  5HXH A;  1XDO A;  5HYA A;  3O1J A;  2LKH A;  4ILA A;  4ILC A;  4CN1 A;  2NR4 A;  3KVA A;  2WZI A;  2FUP A;  3ZMT B;  1VRB A;  5EK4 A;  1ZV4 X;  4AIS A;  2XAG B;  3ZLI A;  3KIN B;  4H9Q C;  4DR5 T;  4ZI3 C;  4QH5 A;  5BMV E;  3RKO A;  4I55 E;  5JRC B;  1J1J A;  1I94 T;  4Q25 A;  5FMN A;  3RIF A;  2LOP A;  2X68 A;  2ODU A;  3ZKR A;  5FVK A;  5ABG A;  2K48 A;  2VK9 A;  2M67 A;  4JEU B;  5C8Y E;  2XAS B;  5KMG P;  2LE8 A;  4KI0 F;  2IUB A;  1J5W A;  3DJB A;  2CPT A;  2X51 A;  3VKG A;  3E08 A;  4X5T A;  3UFG A;  1B7T A;  1JNZ A;  1G8X A;  2ZM0 A;  1HNZ T;  4UR9 A;  2CBJ A;  1W0B A;  2K3W A;  5KDM C;  4XBF B;  3IA3 A;  3T1H T;  2VUR A;  4B3M T;  3SFE A;  4DBR A;  1HFA A;  4EYY R;  3EUH A;  3IBP A;  4COF A;  2W00 A;  4UV9 B;  5HXS A;  2LSY A;  2LSI A;  3F57 A;  5LMN T;  5JH7 E;  2X67 A;  1U5P A;  4P0B A;  2X9X A;  2A9U A;  2V6Y A;  1N34 T;  5JRE A;  2VAS A;  2JPF A;  2WDR A;  4X1I E;  2YEV C;  1AJ3 A;  2E9X A;  4UVC B;  3KV4 A;  1I6Z A;  4EV6 A;  4O4J E;  5HEG A;  3RYI E;  1VCT A;  5LHG B;  4PJN A;  4GKK T;  3RF1 A;  2LM9 A;  3OPC A;  2XAJ B;  4HE8 A;  1KNR A;  3JAD A;  5L3F B;  1MND A;  2XQ5 A;  3PUG A;  5JR9 A;  4X66 T;  4ZOL E;  1WR6 A;  2WB5 A;  1OWA A;  1D1C A;  3AEF A;  2XQ3 A;  4DV3 T;  2JIW A;  2VVS A;  4IE5 A;  3AB3 B;  2IAK A;  3LK4 2;  4BAY B;  4ZI2 C;  3EDU A;  5JDM A;  4LF8 T;  2OLT A;  2CA5 A;  4YJ2 E;  2D0T A;  3VR8 A;  2D5U A;  4X64 T;  4GYR A;  3RIU A;  3J7Y q;  4GYS A;  3BQL A;  1M62 A;  5J2T E;  2I6H A;  3ZYM A;  4K0K T;  5E0O A;  2N9D A;  2E9X C;  3Q2M A;  3EI0 A;  5DJQ C;  1OED E;  3ZCJ A;  3AE6 A;  3UUB A;  2MTQ A;  4DR2 T;  4H9P C;  4ERR A;  4DR3 T;  2YU2 A;  1KNZ A;  2G0U A;  5JR9 C;  2VVN A;  5L3E B;  4M1P A;  3ZYL A;  3TLU A;  1OED A;  5LP6 E;  5AFU L;  4JI3 T;  3O1I A;  4KHP T;  5AQU B;  2CE7 A;  3U3I A;  2JMK A;  3UUX B;  4EGW A;  4YT0 A;  4CXX A;  1Z8U A;  4JI2 T;  1VCS A;  3RYC E;  4UEL A;  2ZM8 A;  2W4X A;  2J47 A;  2H89 A;  2VL0 A;  3N9M A;  4TNW A;  3OJA A;  3C50 A;  3H37 A;  5HWX A;  3EAB A;  3UU3 A;  5ABE A;  5AQF B;  2JRK A;  2XTL A;  3RHW A;  2JQH A;  3EAM A;  4DMW A;  4YHH T;  3IF8 B;  2VKO A;  5FNV E;  3UUM A;  5AQG B;  4IT4 A;  2CLY C;  2GK9 A;  2VKJ A;  2WAU A;  2KWI B;  4JI8 T;  5FY7 A;  3H3M A;  4X65 T;  1W9R A;  2HN1 A;  3NWI A;  4NXN T;  5AQR B;  3K8P C;  2HN2 A;  2X0Y A;  1HNW T;  1OED C;  4DV5 T;  3ABV A;  3N9L A;  2AE9 A;  2CRB A;  3ETU A;  4DO0 A;  3OTO T;  2R6G F;  3I0Q A;  3GWH A;  4CQI A;  4HFC A;  3KV5 A;  5ABF B;  1E1H B;  1D0Y A;  2NW7 A;  3CVR A;  5F5W A;  3RQW A;  2LOS A;  3FXE B;  4QH1 A;  3ZC0 A;  2Y48 B;  1NEK A;  2BKO A;  3RC3 A;  3PUS A;  2XY8 B;  2J4G A;  2J1D G;  1IBM T;  1MNE A;  2NOX A;  2CWO A;  3OYX A;  4UF0 A;  4GK0 E;  3I9W A;  2ACZ A;  2ZMA A;  1LVF A;  4PK6 A;  5C3J A;  1D0Z A;  1US7 B;  4O4I E;  1T8B A;  3D0T A;  4LF6 T;  4F8H A;  4JI1 T;  4JI7 T;  2WSS V;  1IZN B;  2OV9 A;  4IDO A;  3VU7 H;  3AEG A;  3HI2 A;  2WU2 A;  3ZSS A;  4LML A;  2E5L T;  1SUM B;  3RKG A;  5AQH B;  3P4R A;  2NW8 A;  2CHO A;  4A97 A;  4HEA A;  4LMJ A;  5FYM A;  5KXJ A;  3R84 B;  3RH3 A;  4CN6 A;  2N1G A;  2QYW A;  4HTE A;  3RPU A;  3AED A;  4EB6 E;  3DP7 A;  2UUA T;  3ZCI A;  3P4W A;  3ESL A;  3RI5 A;  3MKD A;  2JMH A;  1HTJ F;  3CX7 B;  3G06 A;  5ADX L;  2WS3 A;  3P50 A;  2WQY A;  3BK9 A;  4U2Z A;  3PUQ A;  4HFE A;  4AXP A;  5FP3 A;  3TKL B;  5ABH A;  3AEA A;  4GK5 E;  2C5I T;  4O4H E;  4ZS3 A;  3AEE A;  2LLY A;  3BQK A;  5IHY A;  3RC8 A;  2LHN A;  3NKZ A;  2RP4 A;  2A72 A;  2BS3 A;  2X9H A;  2JQQ A;  2FJB A;  4UVB B;  3OBV E;  4DID B;  1BR0 A;  5LA6 E;  1HF8 A;  3OYZ A;  4TV9 E;  3ZMZ B;  4B3T T;  4GOU A;  4KP3 C;  1T7S A;  2IW5 B;  2H7O A;  3FZL B;  5AQO B;  3ZT5 A;  5LGT B;  1E2A A;  3PU3 A;  4YTN A;  4TWD A;  1KEY A;  3KVB A;  4U7Y A;  1YKE B;  1X9B A;  2ZM2 A;  1HG5 A;  2LEH A;  2CWY A;  4PK5 A;  2L9Q A;  3ZPO A;  2CHN A;  4X1K E;  2CXD A;  5LOV E;  3K3N A;  1M7K A;  2K9A A;  3ZYK A;  4ANJ A;  4NUV A;  4J2C A;  4U2Y A;  5F3J A;  1Y01 A;  2BVL A;  3RYH E;  2ODV A;  2PTF A;  3RGL A;  2WCA A;  3NZP A;  4QHO A;  4AQF A;  5CFB A;  4X20 E;  4I4T E;  4WZX A;  4AKR B;  1QLB A;  1ZKE A;  3NZQ A;  2EHO C;  3HA4 A;  3ZT6 A;  3T8O A;  3CKD A;  2MYS A;  3Q5X A;  2UU9 T;  4TN7 B;  3GA8 A;  5AQK B;  1YQ4 A;  2XM1 A;  4TWH A;  1HNX T;  3T1Y T;  4FI5 A;  1FIO A;  2XQ8 A;  4IDQ A;  4HN9 A;  3MA9 A;  5FVL A;  3LBX A;  4IDN A;  1XDP A;  1D1B A;  1XMQ T;  3ZMS B;  2Q9Q B;  2V6Y B;  5IWA T;  4QXC B;  2BDE A;  2QA7 A;  4JV5 T;  3V5U A;  4OX9 T;  1KNP A;  3MJX A;  4IE7 A;  1NEN A;  1R8I A;  4HWI B;  2H3R A;  4TNV A;  3ONX A;  2KLQ A;  2KIN B;  5TAO A;  4ADZ A;  4JI5 T;  2MPK A;  2NTX A;  4LFB T;  5LHH B;  2BBJ A;  2UXX B;  4DR6 T;  3P4Q A;  5HAX A;  1YQ3 A;  3U78 A;  3N9Q A;  3B13 A;  4MFR A;  3KV6 A;  3JAF A;  4E7Z A;  3PV0 F;  4IGU A;  4DR1 T;  4L0R A;  4YXD A;  1MIW A;  4U31 A;  1KK7 A;  4OHF A;  2D9D A;  2BZB A;  3RYF E;  2CCQ A;  4O2A E;  3AA1 B;  3O4X E;  5HEO A;  2X9W A;  4IE4 A;  5JDF A;  3H3A A;  3CQC B;  3UU8 A;  3AEC A;  4UXN B;  4BJN A;  3K3Q C;  3Q9D A;  2F4V T;  2XJ7 A;  3UU6 A;  3QC9 A;  3PDY A;  4IL9 A;  2IC9 A;  5DQV A;  4C91 A;  3PUV F;  3LFM A;  3A5X A;  2BVM A;  3UTK A;  4YY3 T;  4IE6 A;  4G2A A;  2V26 A;  4ZI3 D;  2CLY B;  2L3L A;  1UGO A;  1W0A A;  4F6R C;  3JCF A;  3WAJ A;  3OKQ A;  3QUJ A;  4HFV A;  5BR8 T;  3HKE E;  5FY1 A;  5LJN A;  4WBN E;  4DR4 T;  2W67 A;  2E8I A;  2XHE B;  4UIG A;  2XQ9 A;  3VRB A;  5L3G B;  4JLE A;  2XAH B;  5LBQ B;  2YDR A;  3IEE A;  2XSA A;  1BR1 A;  5CA0 E;  3SS1 A;  3KDS E;  4AKH A;  4AQG A;  5JDN A;  2WU5 A;  3FBZ A;  4BJM A;  4A98 A;  2CM0 A;  5CA1 E;  2K24 A;  2A2F X;  2PJQ A;  4JI4 T;  3LK3 B;  4MHC A;  2J62 A;  5HEU A;  4U74 A;  3LJC A;  3AAE B;  1HCI A;  4QWN B;  1W09 A;  4HGA A;  3K3O A;  4EZ4 A;  5AQM B;  4AKI A;  5LJM A;  3WAK A;  2WY2 A;  3VR9 A;  4DMV A;  4UEM A;  5CGM A;  4HWC A;  5L3C B;  2FJE A;  3RRC A;  4TWF A;  1UK5 A;  4EEB A;  2KSR A;  5FXV A;  2WWV A;  3RIU C;  2FJA A;  4AKG A;  5CJ5 A;  1V9D A;  3NVO A;  3ZMU B;  2CXL A;  1UCU A;  5FXW A;  4PNI A;  3AA7 B;  4DVD A;  4O2B E;  2B1E A;  3KBT A;  3UUN A;  3AAI A;  2LSG A;  3JAE A;  4HFI A;  2UXN B;  4B3S T;  3CK6 A;  2DNX A;  3JC6 C;  1D1A A;  3PUW F;  5LGU B;  1FEW A;  4JUY A;  3TLW A;  3KBU A;  2LT3 A;  3A8Y C;  5AQJ B;  2V5D A;  1UX4 A;  1HR0 T;  4PJL A;  4EOZ B;  5FL1 A;  2NTY A;  1LKX A;  2E2A A;  2IDO B;  2VQE T;  2XQ6 A;  1E7P A;  3AA0 B;  4LFA T;  2Q9Q D;  4DR7 T;  5LMU T;  4JBW F;  5AQV B;  2OA5 A;  3Q5E A;  2YIN A;  3FXD B;  4JYA T;  4KHZ F;  2FJD A;  2YK0 A;  1MIY A;  3AXJ B;  3KV9 A;  5HXR A;  2WP9 A;  1CHU A;  2BS4 A;  1UUR A;  4ILB A;  3C4W A;  4MBQ A;  2FBW A;  5JVD E;  4JI6 T;  1ZHC A;  2DWG A;  4AKL A;  4P09 A;  3SRZ A;  3B57 A;  2W66 A;  3DTO A;  3GN5 B;  5L47 A;  3P4S A;  4ZS2 A;  1NWM X;  4H9S E;  2NWB A;  2V7L A;  3PU8 A;  2MOZ A;  4AQY T;  1WFD A;  2XM2 A;  4DUZ T;  3AE3 A;  3EHZ A;  4YJ3 E;  5FKY A;  1IBL T;  4HWD A;  2UXC T;  3CQG B;  3SOL A;  2HH7 A;  2W63 A;  4AI6 A;  5LGN B;  3Q5D A;  5LG4 A;  1O3X A;  5EZY E;  1S94 A;  4DV6 T;  5HCJ A;  2EHO B;  1ZP0 A;  2WBL A;  3AE4 A;  2ACX A;  2JQK A;  2X66 A;  4B6X A;  4HFB A;  4EAH A;  3PUA A;  2CMR A;  3ZT7 A;  4TUY E;  2M6I A;  2KXP B;  4DV0 T;  4NPP A;  1N36 T;  4IE0 A;  1T72 A;  5JQG E;  4H63 V;  4IIJ E;  3PTR B;  4CN4 A;  4LF4 T;  4U72 A;  4EXT A;  1WCR A;  3J9X 1;  3N2G E;  3TLT A;  2H88 A;  4HFH A;  2VWA A;  3F2E A;  3PUX F;  5H6Q B;  2IHR 1;  2KT9 A;  4LFC T;  3FZK B;  3ZEF B;  4TX5 A;  2DHR A;  2LSK A;  2BS2 A;  3LDQ B;  3AVS A;  3P7I A;  5DQW A;  3QNU A;  3A7M A;  2E5V A;  4Z91 A;  3LG7 A;  2DI4 A;  5ETW A;  4IDZ A;  1MIV A;  2LM2 A;  3EDV A;  4IST A;  3VRA A;  3N2K E;  5JDH A;  3L09 A;  2C5K T;  2BG9 E;  4NXM T;  4ZXL A;  4KMC A;  2HPJ A;  5EK2 A;  2LJL A;  3PUY F;  2YKS A;  1LRZ A;  3X1D A;  1N32 T;  3M65 A;  3ZJ2 A;  1JNR A;  2AXD S;  3MXZ A;  2KND A;  4GIW A;  4EYU A;  4QKN A;  5FY0 A;  2W61 A;  3ANW A;  2V7K A;  2XAQ B;  3AE9 A;  1XWM A;  5AQI B;  5FL0 A;  3CQX C;  2BG9 A;  2ZLY A;  5L3B B;  2SPC A;  5IYZ E;  2HPL A;  2WDQ A;  4EZH A;  2YDQ A;  4HKA A;  4H63 H;  3N2O A;  4E7S A;  4TZ4 C;  2QGS A;  3HKC E;  5JDG A;  4PW8 A;  3C4Z A;  4YSY A;  5KX5 E;  2A3D A;  4DND A;  1YKH B;  2X9Y A;  5JTG A;  1WRD A;  2XQY A;  1D0X A;  5HXE A;  3OVU A;  2PFV A;  3ONJ A;  3I9Y A;  3R6N A;  4I0U A;  4MAL A;  3L39 A;  3QK6 A;  3UQ4 A;  2KMF A;  2Z6E A;  4G63 A;  4CI3 B;  2LSJ A;  2W2U A;  5HWY A;  3FHN A;  2E9X B;  3ZN1 B;  3L8R A;  3O1H A;  2BKP A;  1X79 A;  4QXB B;  4U7I A;  4X62 T;  1HX8 A;  2BG9 C;  2WMO A;  2W62 A;  3B5M A;  2XZE A;  5LNK A;  5DAB A;  4YSZ A;  3MAC A;  5HEJ A;  2IML A;  3AE1 A;  5AQP B;  4PJJ A;  5JR9 B;  1DU2 A;  4AQF C;  1SHZ C;  4QH4 A;  1QSD A;  5LBM A;  5JRC A;  2C0S A;  2XQ4 A;  2VKD A;  2DL1 A;  1WLX A;  2IIU A;  2XPK A;  4YTM A;  4BA9 A;  1WR0 A;  3N9O A;  3VHL A;  1UX5 A;  1H7C A;  2VQF T;  4Z8X A;  4ZEY A;  5JDQ A;  2XQA A;  1CUN A;  2KWH A;  4PFP A;  1HS7 A;  2Q9Q A;  3QB5 K;  5HXC A;  2V7I A;  5AQN B;  3FZH B;  2LRK A;  3Q5W A;  3UUL A;  1Z0P A;  5AQQ B;  3QOF A;  3E0Z A;  5A1L A;  2QVA A;  3CX8 B;  2VB6 A;  5J1G A;  5L3D B;  5AQL B;  2EHO D;  5JDL A;  3I1A A;  3PE0 A;  2CBI A;  4LF7 T;  2V7M A;  3SWH A;  4O8S A;  4IDP A;  2HHH T;  2WM9 A;  3KFW X;  1YXR A;  4WYV A;  1Y64 B;  2M6B A;  2NW9 A;  1UUS A;  2PG8 A;  4I43 B;  4OFZ A;  3LK2 B;  1OED B;  1ZEE A;  3AEB A;  1BR4 A;  4NUU A;  4OYJ A;  4MLK A;  3FZM B;  5HEH A;  1FMW A;  1NAF A;  2CXF A;  1MMA A;  2BKN A;  1T98 A;  1SA0 E;  1BR2 A;  5M4Y A;  5AQS B;  1QUU A;  3AE7 A;  1FJG T;  4ZHQ E;  5CB4 E;  1GQE A;  4CZZ B;  4ZZC A;  4ILU A;  3CPZ A;  2PBI A;  4YSX A;  4ZZB A;  3ZST A;  3PJA A;  5J0Z A;  3RLF F;  2Q9Q C;  2WMN A;  3BQI A;  1IBK T;  3RRW A;  1MMD A;  4ISS A;  2X0H A;  4EIW A;  4IHJ E;  4WBO A;  3M3Z B;  5FXX A;  4U33 A;  2RA1 A;  3FBL A;  3CML A;  4CI2 B;  4L9I A;  4YHJ A;  3P8C D;  3PJA J;  3WI3 A;  2H7V C;  1G73 A;  3CWZ B;  3HKD E;  3PUR A;  2MAW A;  4A5X A;  4YLH A;  1MMG A;  2V6X A;  3NBX X;  2NP9 A;  4JEH B;  2WZH A;  3CX6 B;  4IRE A;  5L4E A;  4LF9 T;  2XAF B;  4DV1 T;  2BBH A;  3CIR A;  3UU5 A;  4KBM B;  4H9O C;  4B3R T;  1YW0 A;  2D0U A;  4A56 A;  1XZY A;  4UF0 B;  1XMO T;  4NIQ A;  4QX7 B;  2QRX A;  4FJO A;  5J2U E;  1KF6 A;  3N5L A;  4V1A v;  4P1N A;  1YD8 G;  4ZI2 D;  3ETV A;  3HL6 A;  5F8P A;  3TLS A;  2JJ9 A;  2DLR A;  2UXD T;  1HX1 B;  3MK7 C;  3ZMV B;  4C90 A;  3F31 A;  2YDS A;  4DBQ A;  1EZ3 A;  2I0M A;  5C2T A;  2DCF A;  3C51 A;  2UUB T;  3C98 B;  4H9N C;  4U3C A;  1LVK A;  3HKB E;  4H9R C;  3AAA B;  4GKJ T;  5IUX A;  1SE7 A;  2E9X D;  2IC6 A;  1MMN A;  2Y6X A;  5H6R B;  3AE5 A;  5LCY A;  2YU1 A;  4CXW A;  4O4L E;  3RIA A;  4UV8 B;  3NRX A;  3N9N A;  1FMV A;  4YFS A;  4KUM B;  4OK0 A;  3L3P A;  2V7J A;  5LXT E;  2V5C A;  3W15 B;  2W0G A;  4DV4 T;  4K0U A;  1KFY A;  5GON E;  4Z90 A;  3QB5 A;  1ZOY A;  3AE8 A;  4WNK A;  1J5E T;  2Y8D A;  2UXB T;  3N9P A;  4LMK A;  3LSV A;  4PJM A;  2CEA A;  4QX8 B;  4ASK A;  2ZM6 T;  1L0V A;  2P9B A;  2V1D B;  2C5J A;  2D2S A;  3GMI A;  3ZC1 A;  3UT5 E;  4CI1 B;  4ZI7 E;  5LG3 A;  4JI0 T;  5ABF A;  3UFE A;  2ES0 A;  5LHI B;  4IL4 A;  4P0A A;  2KZ7 B;  2V8S V;  4WW0 A;  2LRL A;  3UQ7 A;  3VKH A;  5LYJ E;  3RQU A;  3ZJ1 A;  4X1Y E;  2B76 A;  4I50 E;  3HR0 A;  3AXJ A;  2L8K A;  2YN6 A;  4PAG A;  3ZN0 B;  2XUE A;  3E22 E;  3I0O A;  1IAP A;  4QXH B;  5L2L A;  3RX6 A;  3JC6 D;  3P4P A;  4TV8 E;  3AE2 A;  3GN5 A;  2XSB A; 
#chains in the Genus database with same CATH homology
 1XZY A;  4IDN A;  4IDQ A;  1W0B A;  1Z8U A;  3X1D A;  4IDO A;  3Q5D A;  1Y01 A;  3QOF A;  3Q5E A;  4IDP A;  3OVU A;  3QNU A;  1W0A A;  3IA3 A;  1W09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...