5AQTB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqtB00
5AQJB 5AQSB 5AQQB 1UGOA 1M62A 4HWFA 3FZFB 5AQVB 5AQNB 1HX1B 2D9DA 4HWIB 3FZMB 1UK5A 1M7KA 3FZLB 4HWCA 5AQKB 4HWHA 5AQUB 3M3ZB 3LDQB 5AQHB 3FZKB 5AQFB 5AQPB 5AQMB 3A8YC 4HWDA 1I6ZA 5AQLB 5AQIB 5AQOB 1T7SA 3FZHB 5AQGB 5AQRB 5AQTB
chains in the Genus database with same CATH superfamily
5AQJB 2XAHB 1HTJF 4MBQA 3RI5A 1M7KA 4U31A 4F8HA 3N9OA 3EHZA 4KI0F 3RHWA 3CMLA 3AEBA 4DV6T 4AKHA 3Q5XA 4AQYT 3UQ4A 3AXJA 2YDSA 4HEAA 2WU2A 2HN1A 3GWHA 4ZI3D 3O1HA 4I43B 5AQPB 4YJ3E 4AI6A 3H3MA 1CHUA 2ZMAA 1ZKEA 3LK3B 2CLYB 4JEUB 3UFGA 3P7IA 4ILAA 2X66A 2NOXA 5FVLA 2WB5A 2V7IA 5LMNT 4GKJT 5JRCA 4ASKA 1CUNA 1HNXT 2V6XA 2WDVA 4UXNB 3CX8B 3K1SA 2XTLA 1UGOA 5CGMA 4OFZA 1ZEEA 3RKOA 2VQET 3UUNA 1HS7A 2HH7A 4I55E 3PDYA 2LOSA 3BQKA 5JQGE 4LMLA 4LMKA 3EAMA 5KDMC 4DV7T 2LHRA 4DR7T 4AISA 2H7OA 1D1AA 4H9NC 2A9UA 4EZHA 1ZHCA 3AAIA 2NTXA 4PFOA 3V5UA 1BR1A 2CA5A 2IC6A 4HFEA 4HGAA 3ZT7A 2LSKA 2IUBA 1XMQT 2IDOB 2K9AA 4IL9A 3RH3A 1OXZA 4MFRA 5FL0A 2NW7A 2IW5B 2BVMA 3Q5DA 1XMOT 4ZS2A 1KNPA 2YOEA 3ZT5A 4DR6T 2YU2A 4C90A 4XBFB 4ERRA 4HFBA 2XQ3A 3NWIA 1DU2A 2WDQA 4YSXA 3U78A 4JLEA 4PW8A 4JEHB 5DQWA 3OPCA 3RYCE 3ZCJA 4U7YA 4U74A 5DABA 2CCQA 4X20E 4H9SE 4MALA 2H7VC 3CWZB 3PE0A 5ABFB 5FXWA 3VRAA 4YTPA 4F6RC 2W2UA 1QUUA 2J4GA 5LBMA 2V6YB 2VASA 3PUGA 4Z91A 4UVCB 4AQGA 3FXDB 5JR9B 3KV9A 4IE0A 3ZCIA 2KSRA 2NWBA 4EAHA 4PNIA 4BAYB 3UU5A 2JRKA 2WQYA 3K3QC 5KX5E 2M67A 2RA1A 1E2AA 3MXZA 1HX8A 1H7CA 5LCYA 2JIWA 4H9RC 2DL1A 2XPKA 1T72A 2LKGA 2W66A 5FXZA 1N34T 4GOUA 2PTFA 2VKHA 4DV5T 1UX4A 3K3OA 3LBXB 3X1DA 4B6XA 1KFYA 2P9BA 3HKDE 4AKRB 5J0ZA 3EUHA 3AECA 2JPFA 4J2CA 1VOMA 2H88A 2ZLYA 5AQQB 5AFUL 2WP9A 4CI3B 2VVSA 2UUBT 4BA9A 4DV4T 4AKIA 3N9NA 3VKHA 3B13A 1EZ3A 5M4YA 3Q2MA 3KVBA 1Z0PA 4TUYE 2KNDA 2LSJA 4DBRA 4PFPA 4A56A 1GQEA 4HE8A 5JH7E 4YJ2E 4YLHA 4O2BE 3ETUA 4IE7A 4DV0T 2WY2A 1I94T 4IL4A 4E7SA 2XQ9A 3FZLB 4O4IE 4X1YE 5AQKB 3WI3A 2RP4A 3LDQB 4ILCA 4E7ZA 4EEBA 2M6BA 1XDOA 3PUXF 2FJBA 5EZYE 5FL1A 4WZXA 2JQQA 2YKSA 3PUAA 2V6YA 3MZKB 2L9QA 3M65A 4EGWA 5JR9A 1W0AA 3B5MA 4LF8T 5FY7A 3PUWF 4WYVA 3PUSA 3BK9A 3OYZA 1LVKA 2WWUA 1UK5A 2YK0A 1MIYA 4P0BA 1D0YA 3CX6B 3CX7B 4PJMA 3MKDA 2EHOB 1WR0A 3FZHB 4LF6T 3C4ZA 3FHNA 2BG9C 3LBXA 2WZIA 3QB5A 4P09A 4LMJA 3FZMB 2FBWA 1WFDA 3QNUA 2WCAA 2A2FX 5FKYA 2H89A 2LSYA 5AQIB 4DO0A 1T7SA 1LRZA 2HPJA 3LK42 2YU1A 4WNKA 4AQFC 2R6GF 5CB4E 2LSGA 4HFHA 2WDRA 3PUZF 3AE8A 4X1KE 2LT3A 2XQYA 3ZN0B 1FMWA 4COFA 1FIOA 2VVNA 3KBUA 4ZI2D 3AE9A 5FYMA 3TLWA 4DUZT 1Y01A 3AA7B 1OWAA 2NW9A 1XZYA 3KV5A 2FJDA 4H63H 2VL8A 2CMRA 4CXWA 4YT0A 3CVRA 2X68A 5FY0A 2BKNA 4QH1A 1HX1B 3NVOA 1XNRT 4M1PA 4TV8E 3AA6B 1XWMA 3SS1A 3C4WA 3TLUA 3AE2A 2NW8A 4HWDA 2A72A 5DJQC 3QUJA 1WCRA 3E0ZA 1WR6A 1MNDA 3NZQA 1JNRA 4UEMA 2XASB 5J2TE 5LHIB 2BZBA 2KWHA 4CQIA 2E5LT 2W67A 5TAOA 2LE8A 4ZI3C 3FB2A 1MIVA 4LF4T 5CA0E 3RYHE 4V1Av 5AQTB 5HAXA 2VURA 1HF8A 1O3XA 3RF1A 2XQAA 4IDOA 3ONJA 4EYUA 4K0KT 4CN1A 3C64A 2MAWA 2GK9A 2PFVA 4QHOA 4KHPT 3GA8A 1W0BA 2EHOA 2ACXA 1ZV4X 3GN5B 1J5WA 5J1GA 3ZPOA 1D0XA 4ZEYA 2DHRA 4O2AE 5HXRA 3SFEA 4HFDA 2CHOA 3M3ZB 4TWFA 4LFAT 3MACA 5KMGP 2Q9QD 5LMUT 3UU3A 3L8RA 5DQVA 5HEJA 4O4JE 5LGTB 2Z6EA 3N9QA 4YFSA 4DMWA 4AXPA 4HWIB 1FJGT 2K48A 3VR9A 3R84B 2W62A 2E9XC 4AKGA 5EK4A 4U2YA 4IDQA 3UUBA 3OKQA 4X62T 2XHEB 4DVDA 1OEDB 2W4XA 5JDFA 3AAAB 4HFCA 3KV4A 1L0VA 2BG9B 2CXLA 5CFBA 4EB6E 4TV9E 1M62A 2XM2A 3O1JA 3P50A 1SA0E 2X0HA 5E0OA 1D1BA 3UT5E 3L09A 1MMDA 4P0AA 5HWXA 3AE7A 4TN7B 3PJAJ 3PU3A 3ZEFB 3P4RA 1IZNB 2XM1A 2LKHA 3OTOT 3PTRB 2CXFA 2A3DA 3T1YT 5L47A 2WM9A 2XAJB 2D2SA 4HN9A 3UUMA 3F31A 3JAEA 3KFWX 4P1NA 4PK5A 2E9XD 4QWNB 2H3RA 2WZHA 2XZEA 5HEOA 2LM2A 5AQGB 5LB7B 4N78D 2E2AA 2LM9A 3HL6A 3AEGA 5HEGA 4ISTA 2VB6A 3NBXX 4PJJA 4EOZB 2PG8A 1BR0A 4KX6A 2YDQA 3ZMZB 4YTMA 1W9RA 4JI3T 4DR3T 1NEKA 3RQUA 3GN5A 2E8IA 2D0TA 4Q25A 5F8PA 4NXNT 5L3FB 2FJEA 4AIUA 4ADZA 2KINB 3ZSTA 1HFAA 2BKOA 4KUMB 3Q5WA 2CBIA 4FI5A 3RGLA 3V5SA 3AEEA 3FXEB 4BJMA 1QSDA 1QLBA 2I0MA 5LHHB 5H6RB 3PV0F 3SRZA 4U33A 3QB5K 1XDPA 3JC6C 1IJ6A 3FBLA 3N9LA 3HR0A 1ZOYA 1U5PA 2C0SA 3J9X1 2ZM2A 5C8YE 2KT9A 2L8KA 3HKEE 1V9DA 3G06A 1OEDA 4KHZF 3RRCA 5CA1E 3ETVA 1BR2A 2BG9A 5FXVA 5FXXA 1E1HB 2QVAA 2VKOA 5AQRB 3TLVA 5AQSB 5HCJA 4EV6A 5L3CB 3IF8B 2V8SV 2UXCT 2L3LA 2LRKA 4ISSA 5JDGA 4U3CA 4X66T 2JMKA 5IYZE 4AQFA 5HXCA 2M6IA 1IAPA 4JI6T 2JQHA 2YINA 4QH5A 4ZZBA 5CJ5A 2WS3A 2JMHA 5JDNA 2X67A 4U7IA 3JC6D 4UELA 3AE6A 5JVDE 5FP3A 2CWOA 5ABEA 3O1IA 4XAXB 2OLTA 1OEDE 4HFVA 3C4XA 3OYXA 4YSYA 2BG9E 3NRXA 4JUYA 5H6QB 3PJAA 4JV5T 2MPKA 4TWDA 5LA6E 4JYAT 3JCFA 4AKLA 4EZ4A 1T98A 3JAFA 2YEVC 4ANJA 3ZJ1A 4JI8T 4UIGA 4G63A 3R6NA 2C5JA 2IIUA 2QGSA 3IEEA 3C50A 5F5WA 5L3DB 2W0GA 3BQLA 1Z8UA 3OJAA 5F3JA 3A5XA 1KF6A 2UXDT 3LFMA 2XQ8A 4NXMT 1KNZA 4L0RA 4GK5E 2SPCA 3SWHA 4B3RT 4ZI2C 2J1DG 1SUMB 3I0OA 3UU4A 3ZC1A 4PK6A 4DNDA 1YKHB 4GKKT 3RC8A 4I0UA 4QH4A 4A5XA 4TNWA 5LHGB 2N2NA 4X65T 3QK6A 4IE6A 2CRBA 2UXXB 3FZFB 2CLYC 3MA9A 5LYJE 3OBVE 3NRYA 3AVRA 1NAFA 1MIWA 2HHHT 4YHJA 4ZI7E 3ONXA 5LJMA 4JI7T 3JADA 3D0TA 4BJNA 3HA4A 5AQVB 2W61A 2LHNA 4GIWA 3UUXB 3CKDA 3N5LA 2E9XA 4OYKA 1US7B 2X0LB 3O9XA 2QA7A 1MMGA 3HKBE 5HEHA 3PURA 2CE7A 2DCFA 5LOVE 2X9HA 4PAGA 3SOLA 2CXDA 5L4HA 2AE9A 2VWAA 4LFBT 5IWAT 2E5VA 5EK3A 4H9OC 2YDRA 1HCIA 2WSSV 2XQ5A 3PUYF 1LVFA 2KWIB 2F4VT 5HXEA 4PK4A 2I59A 2CM0A 4NIQA 2Y48B 1IJ5A 4IT4A 3AE3A 2UXBT 3N9MA 4HWHA 2JQ9A 2DWKA 2LOPA 5AQHB 2CWYA 3ZKRA 2V7LA 4JBWF 3RIUC 4EEDA 3SFDA 4QXBB 2Q9QC 2XUEA 3VRBA 2LEHA 3H37A 2ZM8A 4OX9T 4PJNA 1E7PA 2BBHA 4HKAA 4UV8B 4TNVA 4NUUA 2OA5A 5FY1A 4EIWA 4B3TT 3CK6A 2WMNA 2WU5A 3MJXA 4Z8XA 1B7TA 2OV9A 4CI1B 5L3EB 2X9WA 2VQFT 3IHRA 1X79A 3UFEA 3K8PC 4DR2T 2LJLA 5JR9C 2MOZA 4K0UA 2DNXA 3FBZA 2QYWA 3LG7A 2D9DA 3VU7H 3I9WA 1IBKT 4UF0B 2UUAT 4UVBB 1T8BA 4B3ST 3KBTA 3KVAA 1HR0T 2J62A 1W09A 4JI2T 5HCMA 1ZP0A 4I4TE 4YTNA 3UQ7A 4IIJE 5FVKA 5KXJA 1UX5A 2NP9A 4U2ZA 4GK0E 4IGUA 2DWGA 2X9XA 2HN2A 2ODVA 3HKCE 4ZZCA 4B3MT 5L3GB 2BBJA 2Y6XA 2DI4A 2VKDA 1XNQT 2BVLA 3U3IA 2N1GA 3ZMVB 2X9YA 2LLYA 2IMLA 2ES0A 5JDHA 3P4PA 2NR4A 4HFIA 4HWFA 5EK2A 3N2OA 3BQIA 1YXRA 4FJOA 2XQ6A 5L2LA 3EDVA 2MYSA 3S4UA 2BS3A 5HWYA 5ADXL 3C98B 4OHFA 4YXDA 3MK7C 2WBLA 1YKEB 1WYCA 4DV3T 2UXNB 3TLSA 2IHR1 3RLFF 4EYYR 5ETWA 5ABGA 3DJBA 2V5DA 3RX6A 4XZCA 4U72A 5GONE 2V5CA 4NUVA 3HI2A 2KLQA 4LF7T 2B76A 3VKGA 4LFCT 2CBJA 4TX5A 3ZYKA 4C91A 1VCTA 3NZPA 3AE4A 4X64T 3ZSSA 3CPZA 3L39A 1I6ZA 1AJ3A 3DP7A 2IAKA 5AQOB 2JJ9A 3VHLA 5HYAA 3A7MA 1JNZA 4ZHQE 2KZ7B 3RIAA 1R8IA 4CZZB 2C5KT 2IC9A 2Q9QB 2JQKA 4DV2T 3TKLB 3AEFA 2HPLA 4UF0A 1HG2A 4X1IE 1VCSA 4HTEA 4OYJA 1YW0A 4DR1T 2EHOC 5AQNB 1UCUA 3ONLC 3ZMSB 2XSAA 4WBNE 1FEWA 4X5TA 1WLXA 3RQWA 4YY3T 4OK0A 3L3PA 3K3NA 2ZM0A 5LBQB 4H9QC 3LSVA 5JDLA 2XY8B 3N9PA 3WAJA 3NKZA 4H9PC 4I50E 4KBMB 3ZYLA 1N32T 3RRWA 3ZMUB 4LF9T 2VK9A 2XQ7A 4TZ4C 1NWMX 3EI0A 1MMNA 4IE4A 3N2GE 5JDQA 2VL0A 2KXPB 3LK2B 3CQXC 3Q5EA 5LGUB 5LNKA 4A97A 4ZOLE 3PUVF 2V7KA 4DMVA 4DR4T 2XJ7A 3UTKA 4IDNA 2EHOD 1YD8G 3I1AA 3J7Yq 1X9BA 4GYSA 3IBPA 3ZC0A 3AA0B 2V7JA 4CI2B 5LP6E 1WYBA 3P4SA 2WAUA 5IUXA 2XAGB 2AXDS 2E9XB 3AA1B 1N33T 2MTQA 3AEAA 1J1JA 2ACZA 3GMIA 1HNZT 4KP3C 1MNEA 1G73A 3T8OA 5A1LA 4WW0A 4IHJE 4ZXLA 3CQCB 1UUSA 5AQMB 4IDPA 3PUQA 2RPAA 2VKJA 3I9YA 5JDMA 5C3JA 5C2TA 3T1HT 3F57A 1D0ZA 3ABVA 4QXCB 3B57A 4PJLA 4L9IA 5JREA 3RIUA 2Q9QA 3A8YC 4L5GA 4QXHB 1WRDA 3OVUA 2V7MA 3DTOA 3KV6A 4EXTA 1UURA 4O4LE 5HEUA 5L4EA 4DIDB 5LGNB 4IDZA 4UVAB 5LXTE 3RC3A 2CPTA 3RYFE 1U4QA 1D1CA 2XAQB 4A98A 5ABFA 3CIRA 4UR9A 4TWHA 4Z90A 3ZJ2A 2PJQA 3H3AA 2B1EA 5AQUB 4DBQA 4CN4A 1N36T 4IE5A 2LSIA 4MHCA 4ILBA 1G8XA 3KDSE 3N2KE 2I6HA 1SE7A 2PBIA 2BDEA 4H63V 4QX8B 4JI5T 4HWCA 2UU9T 1KNRA 3AB3B 3PU8A 4QX7B 3RYIE 2D5UA 5AQFB 2BKPA 2V26A 3ZMTB 1FMVA 3ANWB 2K3WA 3LJCA 1YQ4A 4G2AA 1OEDC 2QRXA 3AE5A 4JI0T 3RIFA 3EVYA 2D0UA 3I0QA 3P4WA 3AVSA 1LKXA 4CXYA 5HXSA 2J47A 3IA3A 2ZM6T 1VRBA 4QKNA 5AQLB 2G0UA 3P8CD 2CHNA 5LG3A 1Y64B 3AXJB 3W15B 5BMVE 2V1DB 1IBLT 4YSZA 2K24A 2MBGA 3WAKA 4O8SA 1IBMT 5FMNA 3QOFA 5BR8T 1KEYA 4GYRA 5LG4A 2XQ4A 5IHYA 5J2UE 1J5ET 1YQ3A 5L3BB 5LJNA 2BS4A 1S94A 3TLTA 2FUPA 3AEDA 4DUYT 3P4QA 3E22E 2DLRA 3UU8A 4IREA 3FZKB 5JRCB 3ESLA 2WMOA 4JI1T 4KMCA 5JTGA 2Y8DA 3EDUA 4YHHT 4O4HE 1BR4A 2YN6A 2CEAA 2N9DA 1NENA 2C5IT 1HNWT 3ZLIA 4NPPA 3Q9DA 2FJAA 4LF5T 4ZS3A 1S35A 2NTYA 3CQGB 2K5BB 3QC9A 2X51A 2LRLA 4WBOA 1SHZC 2W00A 3KINB 3ZT6A 2X0YA 2XSBA 3F2EA 3AAEB 2W63A 5ABHA 2KMFA 2WWVA 4CN6A 4DR5T 2ODUA 3ZN1B 3RPUA 2BS2A 3C51A 1KK7A 4ILUA 1HG5A 4CXXA 4DV1T 5HXHA 2UUCT 3O4XE 3RKGA 4UV9B 3E08A 3AE1A 4JI4T 3EABA 5FNVE 3ANWA 1MMAA 3ZYMA 4MLKA 3UULA 3UU6A 2XAFB 3VR8A
chains in the Genus database with same CATH topology
5AQJB 5AQSB 5AQQB 1UGOA 1M62A 4HWFA 3FZFB 5AQVB 5AQNB 1HX1B 2D9DA 4HWIB 3FZMB 1UK5A 1M7KA 3FZLB 4HWCA 5AQKB 4HWHA 5AQUB 3M3ZB 3LDQB 5AQHB 3FZKB 5AQFB 5AQPB 5AQMB 3A8YC 4HWDA 1I6ZA 5AQLB 5AQIB 5AQOB 1T7SA 3FZHB 5AQGB 5AQRB 5AQTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ B;  5AQS B;  5AQQ B;  1UGO A;  1M62 A;  4HWF A;  3FZF B;  5AQV B;  5AQN B;  1HX1 B;  2D9D A;  4HWI B;  3FZM B;  1UK5 A;  1M7K A;  3FZL B;  4HWC A;  5AQK B;  4HWH A;  5AQU B;  3M3Z B;  3LDQ B;  5AQH B;  3FZK B;  5AQF B;  5AQP B;  5AQM B;  3A8Y C;  4HWD A;  1I6Z A;  5AQL B;  5AQI B;  5AQO B;  1T7S A;  3FZH B;  5AQG B;  5AQR B;  5AQT B; 
#chains in the Genus database with same CATH topology
 5AQJ B;  2XAH B;  1HTJ F;  4MBQ A;  3RI5 A;  1M7K A;  4U31 A;  4F8H A;  3N9O A;  3EHZ A;  4KI0 F;  3RHW A;  3CML A;  3AEB A;  4DV6 T;  4AKH A;  3Q5X A;  4AQY T;  3UQ4 A;  3AXJ A;  2YDS A;  4HEA A;  2WU2 A;  2HN1 A;  3GWH A;  4ZI3 D;  3O1H A;  4I43 B;  5AQP B;  4YJ3 E;  4AI6 A;  3H3M A;  1CHU A;  2ZMA A;  1ZKE A;  3LK3 B;  2CLY B;  4JEU B;  3UFG A;  3P7I A;  4ILA A;  2X66 A;  2NOX A;  5FVL A;  2WB5 A;  2V7I A;  5LMN T;  4GKJ T;  5JRC A;  4ASK A;  1CUN A;  1HNX T;  2V6X A;  2WDV A;  4UXN B;  3CX8 B;  3K1S A;  2XTL A;  1UGO A;  5CGM A;  4OFZ A;  1ZEE A;  3RKO A;  2VQE T;  3UUN A;  1HS7 A;  2HH7 A;  4I55 E;  3PDY A;  2LOS A;  3BQK A;  5JQG E;  4LML A;  4LMK A;  3EAM A;  5KDM C;  4DV7 T;  2LHR A;  4DR7 T;  4AIS A;  2H7O A;  1D1A A;  4H9N C;  2A9U A;  4EZH A;  1ZHC A;  3AAI A;  2NTX A;  4PFO A;  3V5U A;  1BR1 A;  2CA5 A;  2IC6 A;  4HFE A;  4HGA A;  3ZT7 A;  2LSK A;  2IUB A;  1XMQ T;  2IDO B;  2K9A A;  4IL9 A;  3RH3 A;  1OXZ A;  4MFR A;  5FL0 A;  2NW7 A;  2IW5 B;  2BVM A;  3Q5D A;  1XMO T;  4ZS2 A;  1KNP A;  2YOE A;  3ZT5 A;  4DR6 T;  2YU2 A;  4C90 A;  4XBF B;  4ERR A;  4HFB A;  2XQ3 A;  3NWI A;  1DU2 A;  2WDQ A;  4YSX A;  3U78 A;  4JLE A;  4PW8 A;  4JEH B;  5DQW A;  3OPC A;  3RYC E;  3ZCJ A;  4U7Y A;  4U74 A;  5DAB A;  2CCQ A;  4X20 E;  4H9S E;  4MAL A;  2H7V C;  3CWZ B;  3PE0 A;  5ABF B;  5FXW A;  3VRA A;  4YTP A;  4F6R C;  2W2U A;  1QUU A;  2J4G A;  5LBM A;  2V6Y B;  2VAS A;  3PUG A;  4Z91 A;  4UVC B;  4AQG A;  3FXD B;  5JR9 B;  3KV9 A;  4IE0 A;  3ZCI A;  2KSR A;  2NWB A;  4EAH A;  4PNI A;  4BAY B;  3UU5 A;  2JRK A;  2WQY A;  3K3Q C;  5KX5 E;  2M67 A;  2RA1 A;  1E2A A;  3MXZ A;  1HX8 A;  1H7C A;  5LCY A;  2JIW A;  4H9R C;  2DL1 A;  2XPK A;  1T72 A;  2LKG A;  2W66 A;  5FXZ A;  1N34 T;  4GOU A;  2PTF A;  2VKH A;  4DV5 T;  1UX4 A;  3K3O A;  3LBX B;  3X1D A;  4B6X A;  1KFY A;  2P9B A;  3HKD E;  4AKR B;  5J0Z A;  3EUH A;  3AEC A;  2JPF A;  4J2C A;  1VOM A;  2H88 A;  2ZLY A;  5AQQ B;  5AFU L;  2WP9 A;  4CI3 B;  2VVS A;  2UUB T;  4BA9 A;  4DV4 T;  4AKI A;  3N9N A;  3VKH A;  3B13 A;  1EZ3 A;  5M4Y A;  3Q2M A;  3KVB A;  1Z0P A;  4TUY E;  2KND A;  2LSJ A;  4DBR A;  4PFP A;  4A56 A;  1GQE A;  4HE8 A;  5JH7 E;  4YJ2 E;  4YLH A;  4O2B E;  3ETU A;  4IE7 A;  4DV0 T;  2WY2 A;  1I94 T;  4IL4 A;  4E7S A;  2XQ9 A;  3FZL B;  4O4I E;  4X1Y E;  5AQK B;  3WI3 A;  2RP4 A;  3LDQ B;  4ILC A;  4E7Z A;  4EEB A;  2M6B A;  1XDO A;  3PUX F;  2FJB A;  5EZY E;  5FL1 A;  4WZX A;  2JQQ A;  2YKS A;  3PUA A;  2V6Y A;  3MZK B;  2L9Q A;  3M65 A;  4EGW A;  5JR9 A;  1W0A A;  3B5M A;  4LF8 T;  5FY7 A;  3PUW F;  4WYV A;  3PUS A;  3BK9 A;  3OYZ A;  1LVK A;  2WWU A;  1UK5 A;  2YK0 A;  1MIY A;  4P0B A;  1D0Y A;  3CX6 B;  3CX7 B;  4PJM A;  3MKD A;  2EHO B;  1WR0 A;  3FZH B;  4LF6 T;  3C4Z A;  3FHN A;  2BG9 C;  3LBX A;  2WZI A;  3QB5 A;  4P09 A;  4LMJ A;  3FZM B;  2FBW A;  1WFD A;  3QNU A;  2WCA A;  2A2F X;  5FKY A;  2H89 A;  2LSY A;  5AQI B;  4DO0 A;  1T7S A;  1LRZ A;  2HPJ A;  3LK4 2;  2YU1 A;  4WNK A;  4AQF C;  2R6G F;  5CB4 E;  2LSG A;  4HFH A;  2WDR A;  3PUZ F;  3AE8 A;  4X1K E;  2LT3 A;  2XQY A;  3ZN0 B;  1FMW A;  4COF A;  1FIO A;  2VVN A;  3KBU A;  4ZI2 D;  3AE9 A;  5FYM A;  3TLW A;  4DUZ T;  1Y01 A;  3AA7 B;  1OWA A;  2NW9 A;  1XZY A;  3KV5 A;  2FJD A;  4H63 H;  2VL8 A;  2CMR A;  4CXW A;  4YT0 A;  3CVR A;  2X68 A;  5FY0 A;  2BKN A;  4QH1 A;  1HX1 B;  3NVO A;  1XNR T;  4M1P A;  4TV8 E;  3AA6 B;  1XWM A;  3SS1 A;  3C4W A;  3TLU A;  3AE2 A;  2NW8 A;  4HWD A;  2A72 A;  5DJQ C;  3QUJ A;  1WCR A;  3E0Z A;  1WR6 A;  1MND A;  3NZQ A;  1JNR A;  4UEM A;  2XAS B;  5J2T E;  5LHI B;  2BZB A;  2KWH A;  4CQI A;  2E5L T;  2W67 A;  5TAO A;  2LE8 A;  4ZI3 C;  3FB2 A;  1MIV A;  4LF4 T;  5CA0 E;  3RYH E;  4V1A v;  5AQT B;  5HAX A;  2VUR A;  1HF8 A;  1O3X A;  3RF1 A;  2XQA A;  4IDO A;  3ONJ A;  4EYU A;  4K0K T;  4CN1 A;  3C64 A;  2MAW A;  2GK9 A;  2PFV A;  4QHO A;  4KHP T;  3GA8 A;  1W0B A;  2EHO A;  2ACX A;  1ZV4 X;  3GN5 B;  1J5W A;  5J1G A;  3ZPO A;  1D0X A;  4ZEY A;  2DHR A;  4O2A E;  5HXR A;  3SFE A;  4HFD A;  2CHO A;  3M3Z B;  4TWF A;  4LFA T;  3MAC A;  5KMG P;  2Q9Q D;  5LMU T;  3UU3 A;  3L8R A;  5DQV A;  5HEJ A;  4O4J E;  5LGT B;  2Z6E A;  3N9Q A;  4YFS A;  4DMW A;  4AXP A;  4HWI B;  1FJG T;  2K48 A;  3VR9 A;  3R84 B;  2W62 A;  2E9X C;  4AKG A;  5EK4 A;  4U2Y A;  4IDQ A;  3UUB A;  3OKQ A;  4X62 T;  2XHE B;  4DVD A;  1OED B;  2W4X A;  5JDF A;  3AAA B;  4HFC A;  3KV4 A;  1L0V A;  2BG9 B;  2CXL A;  5CFB A;  4EB6 E;  4TV9 E;  1M62 A;  2XM2 A;  3O1J A;  3P50 A;  1SA0 E;  2X0H A;  5E0O A;  1D1B A;  3UT5 E;  3L09 A;  1MMD A;  4P0A A;  5HWX A;  3AE7 A;  4TN7 B;  3PJA J;  3PU3 A;  3ZEF B;  3P4R A;  1IZN B;  2XM1 A;  2LKH A;  3OTO T;  3PTR B;  2CXF A;  2A3D A;  3T1Y T;  5L47 A;  2WM9 A;  2XAJ B;  2D2S A;  4HN9 A;  3UUM A;  3F31 A;  3JAE A;  3KFW X;  4P1N A;  4PK5 A;  2E9X D;  4QWN B;  2H3R A;  2WZH A;  2XZE A;  5HEO A;  2LM2 A;  5AQG B;  5LB7 B;  4N78 D;  2E2A A;  2LM9 A;  3HL6 A;  3AEG A;  5HEG A;  4IST A;  2VB6 A;  3NBX X;  4PJJ A;  4EOZ B;  2PG8 A;  1BR0 A;  4KX6 A;  2YDQ A;  3ZMZ B;  4YTM A;  1W9R A;  4JI3 T;  4DR3 T;  1NEK A;  3RQU A;  3GN5 A;  2E8I A;  2D0T A;  4Q25 A;  5F8P A;  4NXN T;  5L3F B;  2FJE A;  4AIU A;  4ADZ A;  2KIN B;  3ZST A;  1HFA A;  2BKO A;  4KUM B;  3Q5W A;  2CBI A;  4FI5 A;  3RGL A;  3V5S A;  3AEE A;  3FXE B;  4BJM A;  1QSD A;  1QLB A;  2I0M A;  5LHH B;  5H6R B;  3PV0 F;  3SRZ A;  4U33 A;  3QB5 K;  1XDP A;  3JC6 C;  1IJ6 A;  3FBL A;  3N9L A;  3HR0 A;  1ZOY A;  1U5P A;  2C0S A;  3J9X 1;  2ZM2 A;  5C8Y E;  2KT9 A;  2L8K A;  3HKE E;  1V9D A;  3G06 A;  1OED A;  4KHZ F;  3RRC A;  5CA1 E;  3ETV A;  1BR2 A;  2BG9 A;  5FXV A;  5FXX A;  1E1H B;  2QVA A;  2VKO A;  5AQR B;  3TLV A;  5AQS B;  5HCJ A;  4EV6 A;  5L3C B;  3IF8 B;  2V8S V;  2UXC T;  2L3L A;  2LRK A;  4ISS A;  5JDG A;  4U3C A;  4X66 T;  2JMK A;  5IYZ E;  4AQF A;  5HXC A;  2M6I A;  1IAP A;  4JI6 T;  2JQH A;  2YIN A;  4QH5 A;  4ZZB A;  5CJ5 A;  2WS3 A;  2JMH A;  5JDN A;  2X67 A;  4U7I A;  3JC6 D;  4UEL A;  3AE6 A;  5JVD E;  5FP3 A;  2CWO A;  5ABE A;  3O1I A;  4XAX B;  2OLT A;  1OED E;  4HFV A;  3C4X A;  3OYX A;  4YSY A;  2BG9 E;  3NRX A;  4JUY A;  5H6Q B;  3PJA A;  4JV5 T;  2MPK A;  4TWD A;  5LA6 E;  4JYA T;  3JCF A;  4AKL A;  4EZ4 A;  1T98 A;  3JAF A;  2YEV C;  4ANJ A;  3ZJ1 A;  4JI8 T;  4UIG A;  4G63 A;  3R6N A;  2C5J A;  2IIU A;  2QGS A;  3IEE A;  3C50 A;  5F5W A;  5L3D B;  2W0G A;  3BQL A;  1Z8U A;  3OJA A;  5F3J A;  3A5X A;  1KF6 A;  2UXD T;  3LFM A;  2XQ8 A;  4NXM T;  1KNZ A;  4L0R A;  4GK5 E;  2SPC A;  3SWH A;  4B3R T;  4ZI2 C;  2J1D G;  1SUM B;  3I0O A;  3UU4 A;  3ZC1 A;  4PK6 A;  4DND A;  1YKH B;  4GKK T;  3RC8 A;  4I0U A;  4QH4 A;  4A5X A;  4TNW A;  5LHG B;  2N2N A;  4X65 T;  3QK6 A;  4IE6 A;  2CRB A;  2UXX B;  3FZF B;  2CLY C;  3MA9 A;  5LYJ E;  3OBV E;  3NRY A;  3AVR A;  1NAF A;  1MIW A;  2HHH T;  4YHJ A;  4ZI7 E;  3ONX A;  5LJM A;  4JI7 T;  3JAD A;  3D0T A;  4BJN A;  3HA4 A;  5AQV B;  2W61 A;  2LHN A;  4GIW A;  3UUX B;  3CKD A;  3N5L A;  2E9X A;  4OYK A;  1US7 B;  2X0L B;  3O9X A;  2QA7 A;  1MMG A;  3HKB E;  5HEH A;  3PUR A;  2CE7 A;  2DCF A;  5LOV E;  2X9H A;  4PAG A;  3SOL A;  2CXD A;  5L4H A;  2AE9 A;  2VWA A;  4LFB T;  5IWA T;  2E5V A;  5EK3 A;  4H9O C;  2YDR A;  1HCI A;  2WSS V;  2XQ5 A;  3PUY F;  1LVF A;  2KWI B;  2F4V T;  5HXE A;  4PK4 A;  2I59 A;  2CM0 A;  4NIQ A;  2Y48 B;  1IJ5 A;  4IT4 A;  3AE3 A;  2UXB T;  3N9M A;  4HWH A;  2JQ9 A;  2DWK A;  2LOP A;  5AQH B;  2CWY A;  3ZKR A;  2V7L A;  4JBW F;  3RIU C;  4EED A;  3SFD A;  4QXB B;  2Q9Q C;  2XUE A;  3VRB A;  2LEH A;  3H37 A;  2ZM8 A;  4OX9 T;  4PJN A;  1E7P A;  2BBH A;  4HKA A;  4UV8 B;  4TNV A;  4NUU A;  2OA5 A;  5FY1 A;  4EIW A;  4B3T T;  3CK6 A;  2WMN A;  2WU5 A;  3MJX A;  4Z8X A;  1B7T A;  2OV9 A;  4CI1 B;  5L3E B;  2X9W A;  2VQF T;  3IHR A;  1X79 A;  3UFE A;  3K8P C;  4DR2 T;  2LJL A;  5JR9 C;  2MOZ A;  4K0U A;  2DNX A;  3FBZ A;  2QYW A;  3LG7 A;  2D9D A;  3VU7 H;  3I9W A;  1IBK T;  4UF0 B;  2UUA T;  4UVB B;  1T8B A;  4B3S T;  3KBT A;  3KVA A;  1HR0 T;  2J62 A;  1W09 A;  4JI2 T;  5HCM A;  1ZP0 A;  4I4T E;  4YTN A;  3UQ7 A;  4IIJ E;  5FVK A;  5KXJ A;  1UX5 A;  2NP9 A;  4U2Z A;  4GK0 E;  4IGU A;  2DWG A;  2X9X A;  2HN2 A;  2ODV A;  3HKC E;  4ZZC A;  4B3M T;  5L3G B;  2BBJ A;  2Y6X A;  2DI4 A;  2VKD A;  1XNQ T;  2BVL A;  3U3I A;  2N1G A;  3ZMV B;  2X9Y A;  2LLY A;  2IML A;  2ES0 A;  5JDH A;  3P4P A;  2NR4 A;  4HFI A;  4HWF A;  5EK2 A;  3N2O A;  3BQI A;  1YXR A;  4FJO A;  2XQ6 A;  5L2L A;  3EDV A;  2MYS A;  3S4U A;  2BS3 A;  5HWY A;  5ADX L;  3C98 B;  4OHF A;  4YXD A;  3MK7 C;  2WBL A;  1YKE B;  1WYC A;  4DV3 T;  2UXN B;  3TLS A;  2IHR 1;  3RLF F;  4EYY R;  5ETW A;  5ABG A;  3DJB A;  2V5D A;  3RX6 A;  4XZC A;  4U72 A;  5GON E;  2V5C A;  4NUV A;  3HI2 A;  2KLQ A;  4LF7 T;  2B76 A;  3VKG A;  4LFC T;  2CBJ A;  4TX5 A;  3ZYK A;  4C91 A;  1VCT A;  3NZP A;  3AE4 A;  4X64 T;  3ZSS A;  3CPZ A;  3L39 A;  1I6Z A;  1AJ3 A;  3DP7 A;  2IAK A;  5AQO B;  2JJ9 A;  3VHL A;  5HYA A;  3A7M A;  1JNZ A;  4ZHQ E;  2KZ7 B;  3RIA A;  1R8I A;  4CZZ B;  2C5K T;  2IC9 A;  2Q9Q B;  2JQK A;  4DV2 T;  3TKL B;  3AEF A;  2HPL A;  4UF0 A;  1HG2 A;  4X1I E;  1VCS A;  4HTE A;  4OYJ A;  1YW0 A;  4DR1 T;  2EHO C;  5AQN B;  1UCU A;  3ONL C;  3ZMS B;  2XSA A;  4WBN E;  1FEW A;  4X5T A;  1WLX A;  3RQW A;  4YY3 T;  4OK0 A;  3L3P A;  3K3N A;  2ZM0 A;  5LBQ B;  4H9Q C;  3LSV A;  5JDL A;  2XY8 B;  3N9P A;  3WAJ A;  3NKZ A;  4H9P C;  4I50 E;  4KBM B;  3ZYL A;  1N32 T;  3RRW A;  3ZMU B;  4LF9 T;  2VK9 A;  2XQ7 A;  4TZ4 C;  1NWM X;  3EI0 A;  1MMN A;  4IE4 A;  3N2G E;  5JDQ A;  2VL0 A;  2KXP B;  3LK2 B;  3CQX C;  3Q5E A;  5LGU B;  5LNK A;  4A97 A;  4ZOL E;  3PUV F;  2V7K A;  4DMV A;  4DR4 T;  2XJ7 A;  3UTK A;  4IDN A;  2EHO D;  1YD8 G;  3I1A A;  3J7Y q;  1X9B A;  4GYS A;  3IBP A;  3ZC0 A;  3AA0 B;  2V7J A;  4CI2 B;  5LP6 E;  1WYB A;  3P4S A;  2WAU A;  5IUX A;  2XAG B;  2AXD S;  2E9X B;  3AA1 B;  1N33 T;  2MTQ A;  3AEA A;  1J1J A;  2ACZ A;  3GMI A;  1HNZ T;  4KP3 C;  1MNE A;  1G73 A;  3T8O A;  5A1L A;  4WW0 A;  4IHJ E;  4ZXL A;  3CQC B;  1UUS A;  5AQM B;  4IDP A;  3PUQ A;  2RPA A;  2VKJ A;  3I9Y A;  5JDM A;  5C3J A;  5C2T A;  3T1H T;  3F57 A;  1D0Z A;  3ABV A;  4QXC B;  3B57 A;  4PJL A;  4L9I A;  5JRE A;  3RIU A;  2Q9Q A;  3A8Y C;  4L5G A;  4QXH B;  1WRD A;  3OVU A;  2V7M A;  3DTO A;  3KV6 A;  4EXT A;  1UUR A;  4O4L E;  5HEU A;  5L4E A;  4DID B;  5LGN B;  4IDZ A;  4UVA B;  5LXT E;  3RC3 A;  2CPT A;  3RYF E;  1U4Q A;  1D1C A;  2XAQ B;  4A98 A;  5ABF A;  3CIR A;  4UR9 A;  4TWH A;  4Z90 A;  3ZJ2 A;  2PJQ A;  3H3A A;  2B1E A;  5AQU B;  4DBQ A;  4CN4 A;  1N36 T;  4IE5 A;  2LSI A;  4MHC A;  4ILB A;  1G8X A;  3KDS E;  3N2K E;  2I6H A;  1SE7 A;  2PBI A;  2BDE A;  4H63 V;  4QX8 B;  4JI5 T;  4HWC A;  2UU9 T;  1KNR A;  3AB3 B;  3PU8 A;  4QX7 B;  3RYI E;  2D5U A;  5AQF B;  2BKP A;  2V26 A;  3ZMT B;  1FMV A;  3ANW B;  2K3W A;  3LJC A;  1YQ4 A;  4G2A A;  1OED C;  2QRX A;  3AE5 A;  4JI0 T;  3RIF A;  3EVY A;  2D0U A;  3I0Q A;  3P4W A;  3AVS A;  1LKX A;  4CXY A;  5HXS A;  2J47 A;  3IA3 A;  2ZM6 T;  1VRB A;  4QKN A;  5AQL B;  2G0U A;  3P8C D;  2CHN A;  5LG3 A;  1Y64 B;  3AXJ B;  3W15 B;  5BMV E;  2V1D B;  1IBL T;  4YSZ A;  2K24 A;  2MBG A;  3WAK A;  4O8S A;  1IBM T;  5FMN A;  3QOF A;  5BR8 T;  1KEY A;  4GYR A;  5LG4 A;  2XQ4 A;  5IHY A;  5J2U E;  1J5E T;  1YQ3 A;  5L3B B;  5LJN A;  2BS4 A;  1S94 A;  3TLT A;  2FUP A;  3AED A;  4DUY T;  3P4Q A;  3E22 E;  2DLR A;  3UU8 A;  4IRE A;  3FZK B;  5JRC B;  3ESL A;  2WMO A;  4JI1 T;  4KMC A;  5JTG A;  2Y8D A;  3EDU A;  4YHH T;  4O4H E;  1BR4 A;  2YN6 A;  2CEA A;  2N9D A;  1NEN A;  2C5I T;  1HNW T;  3ZLI A;  4NPP A;  3Q9D A;  2FJA A;  4LF5 T;  4ZS3 A;  1S35 A;  2NTY A;  3CQG B;  2K5B B;  3QC9 A;  2X51 A;  2LRL A;  4WBO A;  1SHZ C;  2W00 A;  3KIN B;  3ZT6 A;  2X0Y A;  2XSB A;  3F2E A;  3AAE B;  2W63 A;  5ABH A;  2KMF A;  2WWV A;  4CN6 A;  4DR5 T;  2ODU A;  3ZN1 B;  3RPU A;  2BS2 A;  3C51 A;  1KK7 A;  4ILU A;  1HG5 A;  4CXX A;  4DV1 T;  5HXH A;  2UUC T;  3O4X E;  3RKG A;  4UV9 B;  3E08 A;  3AE1 A;  4JI4 T;  3EAB A;  5FNV E;  3ANW A;  1MMA A;  3ZYM A;  4MLK A;  3UUL A;  3UU6 A;  2XAF B;  3VR8 A; 
#chains in the Genus database with same CATH homology
 5AQJ B;  5AQS B;  5AQQ B;  1UGO A;  1M62 A;  4HWF A;  3FZF B;  5AQV B;  5AQN B;  1HX1 B;  2D9D A;  4HWI B;  3FZM B;  1UK5 A;  1M7K A;  3FZL B;  4HWC A;  5AQK B;  4HWH A;  5AQU B;  3M3Z B;  3LDQ B;  5AQH B;  3FZK B;  5AQF B;  5AQP B;  5AQM B;  3A8Y C;  4HWD A;  1I6Z A;  5AQL B;  5AQI B;  5AQO B;  1T7S A;  3FZH B;  5AQG B;  5AQR B;  5AQT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...