5AQTB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
b'GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqtB00
4HWHA 1HX1B 3FZKB 1M7KA 2D9DA 4HWDA 5AQHB 5AQRB 3FZFB 3FZMB 5AQIB 1I6ZA 1UK5A 4HWFA 1M62A 3A8YC 5AQMB 4HWIB 3LDQB 5AQVB 3M3ZB 5AQJB 5AQSB 5AQQB 5AQFB 3FZHB 5AQLB 5AQTB 4HWCA 5AQUB 5AQPB 1T7SA 5AQNB 5AQOB 1UGOA 3FZLB 5AQGB 5AQKB
chains in the Genus database with same CATH superfamily
4A56A 1HS7A 3N5LA 3N9LA 4AQFA 2LM9A 4P0BA 4B3TT 3FB2A 3I1AA 2V8SV 3H37A 4HKAA 2E9XB 1SA0E 3E22E 3T1HT 3MA9A 5L2LA 4KI0F 2VL0A 4EZ4A 3AECA 2CBIA 3ANWA 5C2TA 3AE1A 3K8PC 4DIDB 1OXZA 1WYCA 4TUYE 2I0MA 3RLFF 5E0OA 4EB6E 4H63V 1D0YA 4GYRA 4WBNE 3OPCA 2X0HA 2X68A 5JDMA 3AA1B 2UXNB 2XHEB 3UUNA 2WMNA 4K0KT 4UF0B 4ISTA 3V5SA 4JBWF 1E7PA 4EYYR 2WDRA 2CPTA 5F5WA 2CXLA 1N33T 2W0GA 3ZJ1A 3RIFA 1UX4A 4ADZA 4LFCT 2EHOB 5FYMA 2PFVA 1WFDA 3ZT7A 1D0XA 4YSZA 2V6YB 2K24A 2XAJB 1IJ5A 4QWNB 3AEFA 1OEDB 3MZKB 4MHCA 4DO0A 4AKRB 4CXWA 5HYAA 4C90A 3E0ZA 4E7SA 4BAYB 3SS1A 4JI7T 4EOZB 4EXTA 3OVUA 4PAGA 4HFCA 2YDRA 2NR4A 2ZM0A 4EIWA 2WAUA 3CKDA 2KZ7B 1MMAA 4ZZBA 3FZMB 4XZCA 1XDPA 5L47A 2C5IT 3T1YT 4I43B 4X1IE 5FNVE 3I9YA 2D0TA 2W61A 3UUBA 2VURA 4IL4A 2IW5B 3WAKA 4EV6A 4DR6T 4YTNA 1MIVA 5ABFA 2DLRA 1HCIA 1IBLT 4IGUA 2Q9QA 2X0YA 2X51A 2X9HA 5JDHA 1UGOA 3AA0B 2V5DA 3P4PA 3HKBE 3K3QC 1FJGT 4CN4A 4JLEA 4L5GA 4HFEA 1L0VA 4AQYT 4UXNB 2H89A 4X5TA 5C8YE 3C98B 5FL1A 4C91A 2CLYB 5J1GA 2CM0A 1I6ZA 5LGUB 2BG9E 2X67A 3RYFE 2DNXA 3B13A 2A2FX 1XDOA 3FHNA 3IEEA 2GK9A 1XNRT 4WYVA 2VWAA 2XM2A 4BJMA 3ZT6A 1D1CA 3JC6D 3AEDA 2UXDT 1B7TA 2RPAA 2X9XA 2ZM2A 4KHZF 2ODVA 1IBKT 4JI2T 3P4RA 3Q2MA 2LRLA 1VOMA 4A97A 1LRZA 3A7MA 5J2UE 4P09A 2VVSA 2YU2A 5FXXA 3M65A 1D0ZA 4AIUA 3UQ4A 3J7Yq 1YQ3A 2LOSA 3N2OA 4LF4T 2MTQA 3U78A 4TV9E 5AQSB 1NENA 4Z8XA 5AQLB 4ILAA 3RIUC 1GQEA 3AAAB 4K0UA 2NWBA 4DVDA 2MPKA 3C50A 3PUXF 3QOFA 3LJCA 3RQUA 3W15B 4DV0T 3QB5A 4YXDA 3IHRA 1D1AA 4DV6T 4QXBB 2BKOA 5FL0A 4PJLA 5AQVB 1MNDA 2YEVC 2J1DG 2CE7A 3AA7B 2WDQA 2BVMA 2BG9C 4XBFB 2BDEA 4PW8A 3RKOA 5LA6E 2UUBT 2H7OA 2WZIA 5IUXA 3KBUA 1JNZA 2LHRA 2OV9A 4IDOA 3Q5WA 2YK0A 2F4VT 1Z8UA 3EVYA 5LBQB 3FZHB 2NOXA 4TNVA 5JDFA 2IHR1 4YLHA 4IE5A 2K5BB 3KVAA 1XMQT 2NW9A 4PJMA 3CQCB 3ZPOA 3RIAA 4ZI3C 5AQQB 2BVLA 4IDPA 4I50E 4V1Av 1WLXA 4MFRA 2OA5A 1NAFA 3LBXA 5L3GB 3FZLB 2KINB 3KV4A 1Y01A 5LGNB 4ZI2C 5FKYA 1QSDA 4U72A 4QH4A 5AQJB 2C5JA 2PTFA 4O4LE 2ACXA 2BS3A 2VL8A 5FXWA 4ZEYA 4X64T 3BK9A 3QNUA 2CWYA 2RA1A 5JQGE 1I94T 4HWFA 3CK6A 4G63A 3NRYA 5JRCB 3UU3A 4JI8T 1MMNA 4ILBA 2W63A 4Q25A 5CJ5A 2BG9B 2SPCA 3AA6B 2VK9A 4I4TE 2ACZA 5JDNA 2LEHA 3ZSSA 2KT9A 2IIUA 2XQ3A 3AE4A 1KNRA 4H9QC 1HX8A 3PJAA 4PFOA 2KLQA 4HFIA 3AE3A 1YW0A 5JTGA 5ABGA 4GYSA 4QXHB 2D2SA 2X9WA 3ZKRA 2E9XC 2BZBA 2L8KA 4TWHA 3NWIA 3HL6A 4EAHA 2NP9A 3ZN0B 4PFPA 2H7VC 3RC8A 5JDGA 2AE9A 5F3JA 5JR9B 3RYHE 3N2GE 2DI4A 2Y48B 3NBXX 1EZ3A 3N9OA 1XZYA 3EHZA 1UCUA 4UIGA 4B3MT 2CMRA 1WCRA 2ES0A 4U31A 2EHOC 2PJQA 4JUYA 4B3ST 4HN9A 3Q5EA 4EZHA 3N9PA 4JEHB 5LB7B 3CX7B 4GK0E 3IBPA 5LJNA 2JQKA 1MIYA 1QUUA 4TN7B 3ANWB 2DCFA 3O1HA 2OLTA 3O4XE 3QK6A 4ZI7E 3RI5A 4X66T 3R6NA 1J1JA 4UR9A 5KMGP 1IAPA 4IE7A 3AB3B 1T7SA 2J62A 1W0BA 5HWYA 3ZMUB 3AE8A 4H9RC 3QB5K 5DABA 4IDZA 5AQRB 2HPLA 3JAFA 5FY0A 1BR2A 5M4YA 1NWMX 1HNZT 4OHFA 4ILCA 1SHZC 3VR8A 3AVRA 3AXJA 3WI3A 2KWIB 2XQ4A 4ANJA 2IAKA 4H9PC 4KHPT 3RHWA 1YD8G 4ZI3D 2BS2A 5HXCA 5F8PA 2JMHA 5LMNT 3BQKA 4IE6A 4HFVA 4AKIA 3VHLA 2UU9T 2NW8A 3FBZA 2CBJA 3ONJA 2Y8DA 3J9X1 4ZI2D 4QXCB 2MAWA 2JIWA 4NUUA 1FEWA 2VASA 3D0TA 2LE8A 1HFAA 2IC9A 5AQPB 4GKJT 2Z6EA 4DUYT 3C4XA 2JQHA 4HGAA 5LJMA 1OWAA 2YINA 2W66A 5L3CB 4MLKA 2VVNA 2WB5A 4CN6A 2W00A 1WR0A 3KFWX 3ZJ2A 3C64A 2LSYA 5LMUT 4JI6T 4TZ4C 1KEYA 4DV2T 2CLYC 3WAJA 4HTEA 4H9OC 4Z91A 4YJ2E 4B6XA 2YU1A 5ABFB 2NTYA 3ZMVB 3K3NA 3UU5A 1J5WA 3N9NA 3N9QA 3PURA 2D9DA 2LOPA 4U74A 4EEDA 4HWIB 3H3AA 5HXEA 4LF9T 4I55E 1HNWT 4PNIA 2XQ8A 2XQYA 2V6YA 4YTPA 3ZMSB 2N1GA 2E9XD 3C4ZA 4CI2B 3OBVE 3AE7A 2CXFA 4CI1B 1OEDA 2VKHA 4CXYA 1UURA 3P4QA 2HN2A 2UUCT 5L4HA 2WSSV 2LHNA 3I0QA 4NUVA 3TKLB 5L3DB 5HEHA 5FVKA 3ESLA 3VRBA 3NVOA 3F57A 2V7IA 4UVBB 5HXRA 3O1IA 2P9BA 4QX8B 5LHHB 4COFA 1YKEB 3PUQA 4ZS2A 2ZLYA 4G2AA 2FJBA 1WR6A 2XQ6A 2BKNA 1T8BA 2QYWA 4AKGA 4L9IA 1T72A 2KSRA 4HWHA 1VRBA 2BS4A 2EHOD 4TX5A 5FY1A 2V6XA 2LRKA 2QRXA 4HFHA 2J4GA 3AAEB 2LM2A 3NZQA 2L9QA 4F8HA 3MACA 4HWDA 4E7ZA 3KV5A 3OYXA 2WCAA 5A1LA 3PDYA 3CWZB 4UV9B 3KDSE 5JREA 5KX5E 3MXZA 5HWXA 2RP4A 2QA7A 3K1SA 3ZSTA 2B76A 3FZFB 4DNDA 4OFZA 2KWHA 4PK5A 3AVSA 3PJAJ 2CEAA 3ZYKA 4ZZCA 4QX7B 4DMWA 3BQIA 4U3CA 3VKGA 2ZM8A 4IL9A 4H63H 5AQKB 4Z90A 3RH3A 3EAMA 2IDOB 2WDVA 3PUGA 2K48A 1VCSA 1QLBA 5BMVE 4P0AA 1MMDA 4NPPA 1HX1B 3KINB 2XQ9A 4X20E 2J47A 3ABVA 2VB6A 3LK2B 3ETUA 3LSVA 5JVDE 3TLWA 3PE0A 2XUEA 5ABHA 2LKGA 1O3XA 2UXXB 1M7KA 3CX8B 5AQHB 1ZEEA 2W67A 4F6RC 2XZEA 3PUVF 5LXTE 1N32T 3G06A 5IYZE 1US7B 3CIRA 1V9DA 5HEJA 4UV8B 2LLYA 5DQWA 4X65T 2G0UA 4ASKA 1VCTA 3CPZA 2V7LA 3C51A 5JDLA 4O8SA 3FXDB 5AQTB 4LF7T 2FJAA 3HKCE 1T98A 3RF1A 5LYJE 5JR9C 4ZS3A 3VRAA 4GOUA 1U5PA 3I0OA 5H6RB 1X79A 2PG8A 3GN5A 2L3LA 2HN1A 2CXDA 2XAFB 4AQFC 4IREA 4QH1A 1J5ET 3OTOT 5HCJA 4IE0A 4N78D 4YHHT 3UULA 3RPUA 4LF5T 2MOZA 3HKDE 3UFEA 4U33A 4HEAA 1FMWA 4UELA 2UUAT 2DHRA 3NKZA 4CZZB 4MBQA 3SFDA 4AXPA 2XQ5A 2E8IA 3P8CD 3MJXA 3RIUA 1CHUA 1KNZA 5AFUL 3PUAA 4IHJE 1UUSA 3UU6A 5AQOB 5LBMA 4DV5T 3AAIA 3UUMA 2WQYA 5J0ZA 3L39A 2QVAA 2JRKA 4WW0A 3KV6A 4P1NA 4TWDA 3U3IA 2R6GF 4PK4A 4DV7T 1E2AA 2BG9A 2M6IA 4CN1A 4AQGA 2V7KA 3HKEE 4IDQA 1YQ4A 2NW7A 2A72A 4PK6A 2XAQB 2JPFA 3VR9A 1YKHB 4LMKA 3RRCA 5HAXA 2H88A 5CA1E 2PBIA 1XNQT 2V5CA 5LG4A 3Q5XA 5L3FB 1WRDA 2M6BA 4ZXLA 3DJBA 3UQ7A 4U7IA 2VKJA 1KNPA 4ZOLE 4QKNA 2VKDA 4AISA 2DWGA 2VQFT 4DV1T 3RYCE 4FI5A 2LSGA 1HR0T 2WM9A 2A9UA 2LKHA 2JJ9A 2YDSA 3AEEA 3K3OA 1Y64B 5FVLA 1LVFA 1IZNB 2IC6A 4JV5T 3BQLA 3UT5E 1D1BA 3C4WA 3B5MA 3UUXB 3P50A 1BR0A 2Q9QC 3AE2A 2JMKA 3PTRB 2DWKA 2MBGA 3QC9A 3ZYMA 3OJAA 2WWVA 3R84B 5GONE 2XAGB 4BA9A 2ZM6T 4TV8E 4OYKA 5LGTB 3V5UA 4LF8T 1KF6A 2YN6A 4PJNA 3KV9A 4DMVA 4H9NC 5DQVA 5HXSA 3SRZA 3LK3B 4A98A 3UU8A 5L3BB 1ZP0A 3GMIA 3AE9A 5CFBA 1ZOYA 1CUNA 4GIWA 2XY8B 3N9MA 3ZMTB 1SE7A 4ERRA 2VQET 2E9XA 3P4SA 4AKLA 4WNKA 1G8XA 1Z0PA 5AQFB 3ZEFB 3HA4A 2B1EA 5FMNA 2JQ9A 3PUSA 4DR5T 3S4UA 4ISSA 5H6QB 3FZKB 2W4XA 2CWOA 4WZXA 2XM1A 3KBTA 1YXRA 1XMOT 2XSBA 3LK42 1ZHCA 2KMFA 3JCFA 4UF0A 3IA3A 4AKHA 3NRXA 1HTJF 5EK3A 3T8OA 3TLUA 4DR2T 2Q9QB 4X1KE 4UVAB 5LG3A 2XAHB 1UK5A 2JQQA 2EHOA 2CCQA 3AE6A 4IDNA 2V7JA 3EDVA 3ZCJA 4JI5T 3ZLIA 3SWHA 3LG7A 2MYSA 5KXJA 4MALA 2M67A 3FBLA 4TNWA 2WS3A 3VKHA 2CHOA 1IJ6A 3RKGA 4YTMA 2LT3A 5DJQC 4YY3T 1JNRA 2KNDA 2WU2A 1FIOA 3CQXC 3UFGA 5AQNB 3HR0A 5FXZA 2UXCT 1W09A 3ONLC 4OK0A 4ZHQE 2ZMAA 4LMLA 3ZMZB 5IWAT 4DR1T 3N2KE 4WBOA 4TWFA 5AQMB 3RX6A 5EZYE 4KX6A 3PUWF 2XASB 1W9RA 3MK7C 3FXEB 5HEGA 2BKPA 3KVBA 1S35A 4DBQA 3P7IA 1AJ3A 1W0AA 3NZPA 4DR4T 2E5LT 4U7YA 2CRBA 3AEBA 2Y6XA 5JDQA 4KBMB 1KK7A 1E1HB 2WP9A 3PUZF 5FY7A 4LFBT 1BR1A 2V7MA 3EI0A 4DUZT 1M62A 2HHHT 2VKOA 5KDMC 5EK2A 2E2AA 1N34T 1KFYA 4O4HE 2XQAA 2AXDS 5CB4E 5CA0E 2DL1A 2N2NA 2ODUA 1R8IA 5C3JA 1X9BA 5LP6E 2Q9QD 3RC3A 3P4WA 4B3RT 1MMGA 4X62T 1ZV4X 3PUYF 4I0UA 3PU3A 4EEBA 3OKQA 5LOVE 2XPKA 1MNEA 1U4QA 4LFAT 4CXXA 2H3RA 4AI6A 2KXPB 3ZCIA 4JI1T 4YFSA 2NTXA 3F31A 4PJJA 3F2EA 4O2AE 3OYZA 5L4EA 3LDQB 2WU5A 2IMLA 3ZYLA 3O9XA 1NEKA 3X1DA 2XQ7A 4O2BE 3AE5A 3Q5DA 1G73A 4IIJE 2HPJA 3AEAA 3B57A 2WY2A 4IT4A 4JEUB 3LBXB 2BBJA 4OYJA 2A3DA 5LNKA 2X66A 4HWCA 1S94A 3RYIE 3L09A 3DP7A 1UX5A 1FMVA 4EGWA 2W2UA 2E5VA 4QHOA 5JH7E 3PV0F 3UTKA 5J2TE 2V26A 2W62A 2WWUA 3GN5B 3JAEA 2V1DB 5FP3A 3PU8A 4JI3T 4J2CA 2I6HA 3LFMA 4KP3C 3A8YC 2FBWA 2FJEA 2WZHA 3ZC0A 1SUMB 2WBLA 2I59A 4UEMA 4FJOA 2XSAA 4GK5E 5AQGB 4EYUA 3VU7H 1HG2A 5TAOA 4YSYA 1LVKA 1HG5A 3CX6B 2C5KT 3GA8A 3O1JA 2QGSA 5ADXL 3I9WA 4KMCA 4YHJA 1MIWA 2XJ7A 3SFEA 2YDQA 3L3PA 1N36T 2FJDA 3EUHA 3MKDA 3ZN1B 4DR3T 4DBRA 4A5XA 3ETVA 1H7CA 4HFBA 2LJLA 2CA5A 2K9AA 4M1PA 2YKSA 3CMLA 3QUJA 2BBHA 4CI3B 5LHIB 3JADA 3CVRA 4JI0T 1OEDE 4IE4A 5ABEA 4YJ3E 4DV4T 5IHYA 3E08A 2K3WA 5JRCA 5FXVA 4JYAT 1WYBA 3A5XA 2CHNA 3HI2A 3SOLA 3EABA 4KUMB 3ONXA 5BR8T 4NXNT 3RQWA 2IUBA 4U2ZA 3ZC1A 5HXHA 2LSKA 2UXBT 5AQIB 3UU4A 4X1YE 4HFDA 5LCYA 3M3ZB 4O4IE 5HEOA 5LHGB 5AQUB 2FUPA 2LSJA 1XWMA 4NXMT 4HE8A 4NIQA 3CQGB 2N9DA 4UVCB 4OX9T 2YOEA 2D5UA 3IF8B 5EK4A 2X9YA 2C0SA 4DV3T 2WMOA 1LKXA 4U2YA 2XTLA 3TLSA 4DR7T 1BR4A 4XAXB 4LF6T 3AEGA 3AXJB 3EDUA 1IBMT 5ETWA 3DTOA 4O4JE 2LSIA 4L0RA 3Q9DA 3TLVA 4YT0A 3RRWA 3GWHA 4YSXA 1DU2A 2D0UA 4BJNA 2HH7A 3TLTA 4JI4T 3L8RA 5CGMA 4LMJA 5HEUA 3RGLA 1HF8A 4H9SE 5JR9A 1OEDC 4GKKT 3H3MA 4QH5A 1HNXT 4CQIA 3JC6C 4ILUA 3ZT5A 1ZKEA 5L3EB 2X0LB 5HCMA
chains in the Genus database with same CATH topology
4HWHA 1HX1B 3FZKB 1M7KA 2D9DA 4HWDA 5AQHB 5AQRB 3FZFB 3FZMB 5AQIB 1I6ZA 1UK5A 4HWFA 1M62A 3A8YC 5AQMB 4HWIB 3LDQB 5AQVB 3M3ZB 5AQJB 5AQSB 5AQQB 5AQFB 3FZHB 5AQLB 5AQTB 4HWCA 5AQUB 5AQPB 1T7SA 5AQNB 5AQOB 1UGOA 3FZLB 5AQGB 5AQKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWH A;  1HX1 B;  3FZK B;  1M7K A;  2D9D A;  4HWD A;  5AQH B;  5AQR B;  3FZF B;  3FZM B;  5AQI B;  1I6Z A;  1UK5 A;  4HWF A;  1M62 A;  3A8Y C;  5AQM B;  4HWI B;  3LDQ B;  5AQV B;  3M3Z B;  5AQJ B;  5AQS B;  5AQQ B;  5AQF B;  3FZH B;  5AQL B;  5AQT B;  4HWC A;  5AQU B;  5AQP B;  1T7S A;  5AQN B;  5AQO B;  1UGO A;  3FZL B;  5AQG B;  5AQK B; 
#chains in the Genus database with same CATH topology
 4A56 A;  1HS7 A;  3N5L A;  3N9L A;  4AQF A;  2LM9 A;  4P0B A;  4B3T T;  3FB2 A;  3I1A A;  2V8S V;  3H37 A;  4HKA A;  2E9X B;  1SA0 E;  3E22 E;  3T1H T;  3MA9 A;  5L2L A;  4KI0 F;  2VL0 A;  4EZ4 A;  3AEC A;  2CBI A;  3ANW A;  5C2T A;  3AE1 A;  3K8P C;  4DID B;  1OXZ A;  1WYC A;  4TUY E;  2I0M A;  3RLF F;  5E0O A;  4EB6 E;  4H63 V;  1D0Y A;  4GYR A;  4WBN E;  3OPC A;  2X0H A;  2X68 A;  5JDM A;  3AA1 B;  2UXN B;  2XHE B;  3UUN A;  2WMN A;  4K0K T;  4UF0 B;  4IST A;  3V5S A;  4JBW F;  1E7P A;  4EYY R;  2WDR A;  2CPT A;  5F5W A;  2CXL A;  1N33 T;  2W0G A;  3ZJ1 A;  3RIF A;  1UX4 A;  4ADZ A;  4LFC T;  2EHO B;  5FYM A;  2PFV A;  1WFD A;  3ZT7 A;  1D0X A;  4YSZ A;  2V6Y B;  2K24 A;  2XAJ B;  1IJ5 A;  4QWN B;  3AEF A;  1OED B;  3MZK B;  4MHC A;  4DO0 A;  4AKR B;  4CXW A;  5HYA A;  4C90 A;  3E0Z A;  4E7S A;  4BAY B;  3SS1 A;  4JI7 T;  4EOZ B;  4EXT A;  3OVU A;  4PAG A;  4HFC A;  2YDR A;  2NR4 A;  2ZM0 A;  4EIW A;  2WAU A;  3CKD A;  2KZ7 B;  1MMA A;  4ZZB A;  3FZM B;  4XZC A;  1XDP A;  5L47 A;  2C5I T;  3T1Y T;  4I43 B;  4X1I E;  5FNV E;  3I9Y A;  2D0T A;  2W61 A;  3UUB A;  2VUR A;  4IL4 A;  2IW5 B;  3WAK A;  4EV6 A;  4DR6 T;  4YTN A;  1MIV A;  5ABF A;  2DLR A;  1HCI A;  1IBL T;  4IGU A;  2Q9Q A;  2X0Y A;  2X51 A;  2X9H A;  5JDH A;  1UGO A;  3AA0 B;  2V5D A;  3P4P A;  3HKB E;  3K3Q C;  1FJG T;  4CN4 A;  4JLE A;  4L5G A;  4HFE A;  1L0V A;  4AQY T;  4UXN B;  2H89 A;  4X5T A;  5C8Y E;  3C98 B;  5FL1 A;  4C91 A;  2CLY B;  5J1G A;  2CM0 A;  1I6Z A;  5LGU B;  2BG9 E;  2X67 A;  3RYF E;  2DNX A;  3B13 A;  2A2F X;  1XDO A;  3FHN A;  3IEE A;  2GK9 A;  1XNR T;  4WYV A;  2VWA A;  2XM2 A;  4BJM A;  3ZT6 A;  1D1C A;  3JC6 D;  3AED A;  2UXD T;  1B7T A;  2RPA A;  2X9X A;  2ZM2 A;  4KHZ F;  2ODV A;  1IBK T;  4JI2 T;  3P4R A;  3Q2M A;  2LRL A;  1VOM A;  4A97 A;  1LRZ A;  3A7M A;  5J2U E;  4P09 A;  2VVS A;  2YU2 A;  5FXX A;  3M65 A;  1D0Z A;  4AIU A;  3UQ4 A;  3J7Y q;  1YQ3 A;  2LOS A;  3N2O A;  4LF4 T;  2MTQ A;  3U78 A;  4TV9 E;  5AQS B;  1NEN A;  4Z8X A;  5AQL B;  4ILA A;  3RIU C;  1GQE A;  3AAA B;  4K0U A;  2NWB A;  4DVD A;  2MPK A;  3C50 A;  3PUX F;  3QOF A;  3LJC A;  3RQU A;  3W15 B;  4DV0 T;  3QB5 A;  4YXD A;  3IHR A;  1D1A A;  4DV6 T;  4QXB B;  2BKO A;  5FL0 A;  4PJL A;  5AQV B;  1MND A;  2YEV C;  2J1D G;  2CE7 A;  3AA7 B;  2WDQ A;  2BVM A;  2BG9 C;  4XBF B;  2BDE A;  4PW8 A;  3RKO A;  5LA6 E;  2UUB T;  2H7O A;  2WZI A;  5IUX A;  3KBU A;  1JNZ A;  2LHR A;  2OV9 A;  4IDO A;  3Q5W A;  2YK0 A;  2F4V T;  1Z8U A;  3EVY A;  5LBQ B;  3FZH B;  2NOX A;  4TNV A;  5JDF A;  2IHR 1;  4YLH A;  4IE5 A;  2K5B B;  3KVA A;  1XMQ T;  2NW9 A;  4PJM A;  3CQC B;  3ZPO A;  3RIA A;  4ZI3 C;  5AQQ B;  2BVL A;  4IDP A;  4I50 E;  4V1A v;  1WLX A;  4MFR A;  2OA5 A;  1NAF A;  3LBX A;  5L3G B;  3FZL B;  2KIN B;  3KV4 A;  1Y01 A;  5LGN B;  4ZI2 C;  5FKY A;  1QSD A;  4U72 A;  4QH4 A;  5AQJ B;  2C5J A;  2PTF A;  4O4L E;  2ACX A;  2BS3 A;  2VL8 A;  5FXW A;  4ZEY A;  4X64 T;  3BK9 A;  3QNU A;  2CWY A;  2RA1 A;  5JQG E;  1I94 T;  4HWF A;  3CK6 A;  4G63 A;  3NRY A;  5JRC B;  3UU3 A;  4JI8 T;  1MMN A;  4ILB A;  2W63 A;  4Q25 A;  5CJ5 A;  2BG9 B;  2SPC A;  3AA6 B;  2VK9 A;  4I4T E;  2ACZ A;  5JDN A;  2LEH A;  3ZSS A;  2KT9 A;  2IIU A;  2XQ3 A;  3AE4 A;  1KNR A;  4H9Q C;  1HX8 A;  3PJA A;  4PFO A;  2KLQ A;  4HFI A;  3AE3 A;  1YW0 A;  5JTG A;  5ABG A;  4GYS A;  4QXH B;  2D2S A;  2X9W A;  3ZKR A;  2E9X C;  2BZB A;  2L8K A;  4TWH A;  3NWI A;  3HL6 A;  4EAH A;  2NP9 A;  3ZN0 B;  4PFP A;  2H7V C;  3RC8 A;  5JDG A;  2AE9 A;  5F3J A;  5JR9 B;  3RYH E;  3N2G E;  2DI4 A;  2Y48 B;  3NBX X;  1EZ3 A;  3N9O A;  1XZY A;  3EHZ A;  1UCU A;  4UIG A;  4B3M T;  2CMR A;  1WCR A;  2ES0 A;  4U31 A;  2EHO C;  2PJQ A;  4JUY A;  4B3S T;  4HN9 A;  3Q5E A;  4EZH A;  3N9P A;  4JEH B;  5LB7 B;  3CX7 B;  4GK0 E;  3IBP A;  5LJN A;  2JQK A;  1MIY A;  1QUU A;  4TN7 B;  3ANW B;  2DCF A;  3O1H A;  2OLT A;  3O4X E;  3QK6 A;  4ZI7 E;  3RI5 A;  4X66 T;  3R6N A;  1J1J A;  4UR9 A;  5KMG P;  1IAP A;  4IE7 A;  3AB3 B;  1T7S A;  2J62 A;  1W0B A;  5HWY A;  3ZMU B;  3AE8 A;  4H9R C;  3QB5 K;  5DAB A;  4IDZ A;  5AQR B;  2HPL A;  3JAF A;  5FY0 A;  1BR2 A;  5M4Y A;  1NWM X;  1HNZ T;  4OHF A;  4ILC A;  1SHZ C;  3VR8 A;  3AVR A;  3AXJ A;  3WI3 A;  2KWI B;  2XQ4 A;  4ANJ A;  2IAK A;  4H9P C;  4KHP T;  3RHW A;  1YD8 G;  4ZI3 D;  2BS2 A;  5HXC A;  5F8P A;  2JMH A;  5LMN T;  3BQK A;  4IE6 A;  4HFV A;  4AKI A;  3VHL A;  2UU9 T;  2NW8 A;  3FBZ A;  2CBJ A;  3ONJ A;  2Y8D A;  3J9X 1;  4ZI2 D;  4QXC B;  2MAW A;  2JIW A;  4NUU A;  1FEW A;  2VAS A;  3D0T A;  2LE8 A;  1HFA A;  2IC9 A;  5AQP B;  4GKJ T;  2Z6E A;  4DUY T;  3C4X A;  2JQH A;  4HGA A;  5LJM A;  1OWA A;  2YIN A;  2W66 A;  5L3C B;  4MLK A;  2VVN A;  2WB5 A;  4CN6 A;  2W00 A;  1WR0 A;  3KFW X;  3ZJ2 A;  3C64 A;  2LSY A;  5LMU T;  4JI6 T;  4TZ4 C;  1KEY A;  4DV2 T;  2CLY C;  3WAJ A;  4HTE A;  4H9O C;  4Z91 A;  4YJ2 E;  4B6X A;  2YU1 A;  5ABF B;  2NTY A;  3ZMV B;  3K3N A;  3UU5 A;  1J5W A;  3N9N A;  3N9Q A;  3PUR A;  2D9D A;  2LOP A;  4U74 A;  4EED A;  4HWI B;  3H3A A;  5HXE A;  4LF9 T;  4I55 E;  1HNW T;  4PNI A;  2XQ8 A;  2XQY A;  2V6Y A;  4YTP A;  3ZMS B;  2N1G A;  2E9X D;  3C4Z A;  4CI2 B;  3OBV E;  3AE7 A;  2CXF A;  4CI1 B;  1OED A;  2VKH A;  4CXY A;  1UUR A;  3P4Q A;  2HN2 A;  2UUC T;  5L4H A;  2WSS V;  2LHN A;  3I0Q A;  4NUV A;  3TKL B;  5L3D B;  5HEH A;  5FVK A;  3ESL A;  3VRB A;  3NVO A;  3F57 A;  2V7I A;  4UVB B;  5HXR A;  3O1I A;  2P9B A;  4QX8 B;  5LHH B;  4COF A;  1YKE B;  3PUQ A;  4ZS2 A;  2ZLY A;  4G2A A;  2FJB A;  1WR6 A;  2XQ6 A;  2BKN A;  1T8B A;  2QYW A;  4AKG A;  4L9I A;  1T72 A;  2KSR A;  4HWH A;  1VRB A;  2BS4 A;  2EHO D;  4TX5 A;  5FY1 A;  2V6X A;  2LRK A;  2QRX A;  4HFH A;  2J4G A;  3AAE B;  2LM2 A;  3NZQ A;  2L9Q A;  4F8H A;  3MAC A;  4HWD A;  4E7Z A;  3KV5 A;  3OYX A;  2WCA A;  5A1L A;  3PDY A;  3CWZ B;  4UV9 B;  3KDS E;  5JRE A;  5KX5 E;  3MXZ A;  5HWX A;  2RP4 A;  2QA7 A;  3K1S A;  3ZST A;  2B76 A;  3FZF B;  4DND A;  4OFZ A;  2KWH A;  4PK5 A;  3AVS A;  3PJA J;  2CEA A;  3ZYK A;  4ZZC A;  4QX7 B;  4DMW A;  3BQI A;  4U3C A;  3VKG A;  2ZM8 A;  4IL9 A;  4H63 H;  5AQK B;  4Z90 A;  3RH3 A;  3EAM A;  2IDO B;  2WDV A;  3PUG A;  2K48 A;  1VCS A;  1QLB A;  5BMV E;  4P0A A;  1MMD A;  4NPP A;  1HX1 B;  3KIN B;  2XQ9 A;  4X20 E;  2J47 A;  3ABV A;  2VB6 A;  3LK2 B;  3ETU A;  3LSV A;  5JVD E;  3TLW A;  3PE0 A;  2XUE A;  5ABH A;  2LKG A;  1O3X A;  2UXX B;  1M7K A;  3CX8 B;  5AQH B;  1ZEE A;  2W67 A;  4F6R C;  2XZE A;  3PUV F;  5LXT E;  1N32 T;  3G06 A;  5IYZ E;  1US7 B;  3CIR A;  1V9D A;  5HEJ A;  4UV8 B;  2LLY A;  5DQW A;  4X65 T;  2G0U A;  4ASK A;  1VCT A;  3CPZ A;  2V7L A;  3C51 A;  5JDL A;  4O8S A;  3FXD B;  5AQT B;  4LF7 T;  2FJA A;  3HKC E;  1T98 A;  3RF1 A;  5LYJ E;  5JR9 C;  4ZS3 A;  3VRA A;  4GOU A;  1U5P A;  3I0O A;  5H6R B;  1X79 A;  2PG8 A;  3GN5 A;  2L3L A;  2HN1 A;  2CXD A;  2XAF B;  4AQF C;  4IRE A;  4QH1 A;  1J5E T;  3OTO T;  5HCJ A;  4IE0 A;  4N78 D;  4YHH T;  3UUL A;  3RPU A;  4LF5 T;  2MOZ A;  3HKD E;  3UFE A;  4U33 A;  4HEA A;  1FMW A;  4UEL A;  2UUA T;  2DHR A;  3NKZ A;  4CZZ B;  4MBQ A;  3SFD A;  4AXP A;  2XQ5 A;  2E8I A;  3P8C D;  3MJX A;  3RIU A;  1CHU A;  1KNZ A;  5AFU L;  3PUA A;  4IHJ E;  1UUS A;  3UU6 A;  5AQO B;  5LBM A;  4DV5 T;  3AAI A;  3UUM A;  2WQY A;  5J0Z A;  3L39 A;  2QVA A;  2JRK A;  4WW0 A;  3KV6 A;  4P1N A;  4TWD A;  3U3I A;  2R6G F;  4PK4 A;  4DV7 T;  1E2A A;  2BG9 A;  2M6I A;  4CN1 A;  4AQG A;  2V7K A;  3HKE E;  4IDQ A;  1YQ4 A;  2NW7 A;  2A72 A;  4PK6 A;  2XAQ B;  2JPF A;  3VR9 A;  1YKH B;  4LMK A;  3RRC A;  5HAX A;  2H88 A;  5CA1 E;  2PBI A;  1XNQ T;  2V5C A;  5LG4 A;  3Q5X A;  5L3F B;  1WRD A;  2M6B A;  4ZXL A;  3DJB A;  3UQ7 A;  4U7I A;  2VKJ A;  1KNP A;  4ZOL E;  4QKN A;  2VKD A;  4AIS A;  2DWG A;  2VQF T;  4DV1 T;  3RYC E;  4FI5 A;  2LSG A;  1HR0 T;  2WM9 A;  2A9U A;  2LKH A;  2JJ9 A;  2YDS A;  3AEE A;  3K3O A;  1Y64 B;  5FVL A;  1LVF A;  1IZN B;  2IC6 A;  4JV5 T;  3BQL A;  3UT5 E;  1D1B A;  3C4W A;  3B5M A;  3UUX B;  3P50 A;  1BR0 A;  2Q9Q C;  3AE2 A;  2JMK A;  3PTR B;  2DWK A;  2MBG A;  3QC9 A;  3ZYM A;  3OJA A;  2WWV A;  3R84 B;  5GON E;  2XAG B;  4BA9 A;  2ZM6 T;  4TV8 E;  4OYK A;  5LGT B;  3V5U A;  4LF8 T;  1KF6 A;  2YN6 A;  4PJN A;  3KV9 A;  4DMV A;  4H9N C;  5DQV A;  5HXS A;  3SRZ A;  3LK3 B;  4A98 A;  3UU8 A;  5L3B B;  1ZP0 A;  3GMI A;  3AE9 A;  5CFB A;  1ZOY A;  1CUN A;  4GIW A;  2XY8 B;  3N9M A;  3ZMT B;  1SE7 A;  4ERR A;  2VQE T;  2E9X A;  3P4S A;  4AKL A;  4WNK A;  1G8X A;  1Z0P A;  5AQF B;  3ZEF B;  3HA4 A;  2B1E A;  5FMN A;  2JQ9 A;  3PUS A;  4DR5 T;  3S4U A;  4ISS A;  5H6Q B;  3FZK B;  2W4X A;  2CWO A;  4WZX A;  2XM1 A;  3KBT A;  1YXR A;  1XMO T;  2XSB A;  3LK4 2;  1ZHC A;  2KMF A;  3JCF A;  4UF0 A;  3IA3 A;  4AKH A;  3NRX A;  1HTJ F;  5EK3 A;  3T8O A;  3TLU A;  4DR2 T;  2Q9Q B;  4X1K E;  4UVA B;  5LG3 A;  2XAH B;  1UK5 A;  2JQQ A;  2EHO A;  2CCQ A;  3AE6 A;  4IDN A;  2V7J A;  3EDV A;  3ZCJ A;  4JI5 T;  3ZLI A;  3SWH A;  3LG7 A;  2MYS A;  5KXJ A;  4MAL A;  2M67 A;  3FBL A;  4TNW A;  2WS3 A;  3VKH A;  2CHO A;  1IJ6 A;  3RKG A;  4YTM A;  2LT3 A;  5DJQ C;  4YY3 T;  1JNR A;  2KND A;  2WU2 A;  1FIO A;  3CQX C;  3UFG A;  5AQN B;  3HR0 A;  5FXZ A;  2UXC T;  1W09 A;  3ONL C;  4OK0 A;  4ZHQ E;  2ZMA A;  4LML A;  3ZMZ B;  5IWA T;  4DR1 T;  3N2K E;  4WBO A;  4TWF A;  5AQM B;  3RX6 A;  5EZY E;  4KX6 A;  3PUW F;  2XAS B;  1W9R A;  3MK7 C;  3FXE B;  5HEG A;  2BKP A;  3KVB A;  1S35 A;  4DBQ A;  3P7I A;  1AJ3 A;  1W0A A;  3NZP A;  4DR4 T;  2E5L T;  4U7Y A;  2CRB A;  3AEB A;  2Y6X A;  5JDQ A;  4KBM B;  1KK7 A;  1E1H B;  2WP9 A;  3PUZ F;  5FY7 A;  4LFB T;  1BR1 A;  2V7M A;  3EI0 A;  4DUZ T;  1M62 A;  2HHH T;  2VKO A;  5KDM C;  5EK2 A;  2E2A A;  1N34 T;  1KFY A;  4O4H E;  2XQA A;  2AXD S;  5CB4 E;  5CA0 E;  2DL1 A;  2N2N A;  2ODU A;  1R8I A;  5C3J A;  1X9B A;  5LP6 E;  2Q9Q D;  3RC3 A;  3P4W A;  4B3R T;  1MMG A;  4X62 T;  1ZV4 X;  3PUY F;  4I0U A;  3PU3 A;  4EEB A;  3OKQ A;  5LOV E;  2XPK A;  1MNE A;  1U4Q A;  4LFA T;  4CXX A;  2H3R A;  4AI6 A;  2KXP B;  3ZCI A;  4JI1 T;  4YFS A;  2NTX A;  3F31 A;  4PJJ A;  3F2E A;  4O2A E;  3OYZ A;  5L4E A;  3LDQ B;  2WU5 A;  2IML A;  3ZYL A;  3O9X A;  1NEK A;  3X1D A;  2XQ7 A;  4O2B E;  3AE5 A;  3Q5D A;  1G73 A;  4IIJ E;  2HPJ A;  3AEA A;  3B57 A;  2WY2 A;  4IT4 A;  4JEU B;  3LBX B;  2BBJ A;  4OYJ A;  2A3D A;  5LNK A;  2X66 A;  4HWC A;  1S94 A;  3RYI E;  3L09 A;  3DP7 A;  1UX5 A;  1FMV A;  4EGW A;  2W2U A;  2E5V A;  4QHO A;  5JH7 E;  3PV0 F;  3UTK A;  5J2T E;  2V26 A;  2W62 A;  2WWU A;  3GN5 B;  3JAE A;  2V1D B;  5FP3 A;  3PU8 A;  4JI3 T;  4J2C A;  2I6H A;  3LFM A;  4KP3 C;  3A8Y C;  2FBW A;  2FJE A;  2WZH A;  3ZC0 A;  1SUM B;  2WBL A;  2I59 A;  4UEM A;  4FJO A;  2XSA A;  4GK5 E;  5AQG B;  4EYU A;  3VU7 H;  1HG2 A;  5TAO A;  4YSY A;  1LVK A;  1HG5 A;  3CX6 B;  2C5K T;  3GA8 A;  3O1J A;  2QGS A;  5ADX L;  3I9W A;  4KMC A;  4YHJ A;  1MIW A;  2XJ7 A;  3SFE A;  2YDQ A;  3L3P A;  1N36 T;  2FJD A;  3EUH A;  3MKD A;  3ZN1 B;  4DR3 T;  4DBR A;  4A5X A;  3ETV A;  1H7C A;  4HFB A;  2LJL A;  2CA5 A;  2K9A A;  4M1P A;  2YKS A;  3CML A;  3QUJ A;  2BBH A;  4CI3 B;  5LHI B;  3JAD A;  3CVR A;  4JI0 T;  1OED E;  4IE4 A;  5ABE A;  4YJ3 E;  4DV4 T;  5IHY A;  3E08 A;  2K3W A;  5JRC A;  5FXV A;  4JYA T;  1WYB A;  3A5X A;  2CHN A;  3HI2 A;  3SOL A;  3EAB A;  4KUM B;  3ONX A;  5BR8 T;  4NXN T;  3RQW A;  2IUB A;  4U2Z A;  3ZC1 A;  5HXH A;  2LSK A;  2UXB T;  5AQI B;  3UU4 A;  4X1Y E;  4HFD A;  5LCY A;  3M3Z B;  4O4I E;  5HEO A;  5LHG B;  5AQU B;  2FUP A;  2LSJ A;  1XWM A;  4NXM T;  4HE8 A;  4NIQ A;  3CQG B;  2N9D A;  4UVC B;  4OX9 T;  2YOE A;  2D5U A;  3IF8 B;  5EK4 A;  2X9Y A;  2C0S A;  4DV3 T;  2WMO A;  1LKX A;  4U2Y A;  2XTL A;  3TLS A;  4DR7 T;  1BR4 A;  4XAX B;  4LF6 T;  3AEG A;  3AXJ B;  3EDU A;  1IBM T;  5ETW A;  3DTO A;  4O4J E;  2LSI A;  4L0R A;  3Q9D A;  3TLV A;  4YT0 A;  3RRW A;  3GWH A;  4YSX A;  1DU2 A;  2D0U A;  4BJN A;  2HH7 A;  3TLT A;  4JI4 T;  3L8R A;  5CGM A;  4LMJ A;  5HEU A;  3RGL A;  1HF8 A;  4H9S E;  5JR9 A;  1OED C;  4GKK T;  3H3M A;  4QH5 A;  1HNX T;  4CQI A;  3JC6 C;  4ILU A;  3ZT5 A;  1ZKE A;  5L3E B;  2X0L B;  5HCM A; 
#chains in the Genus database with same CATH homology
 4HWH A;  1HX1 B;  3FZK B;  1M7K A;  2D9D A;  4HWD A;  5AQH B;  5AQR B;  3FZF B;  3FZM B;  5AQI B;  1I6Z A;  1UK5 A;  4HWF A;  1M62 A;  3A8Y C;  5AQM B;  4HWI B;  3LDQ B;  5AQV B;  3M3Z B;  5AQJ B;  5AQS B;  5AQQ B;  5AQF B;  3FZH B;  5AQL B;  5AQT B;  4HWC A;  5AQU B;  5AQP B;  1T7S A;  5AQN B;  5AQO B;  1UGO A;  3FZL B;  5AQG B;  5AQK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...