5AQTB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqtB00
1I6ZA 5AQNB 5AQTB 3M3ZB 3FZHB 1M62A 4HWIB 5AQOB 5AQKB 5AQHB 3FZMB 4HWCA 5AQIB 3FZLB 5AQQB 1T7SA 5AQLB 4HWFA 1HX1B 1M7KA 3FZKB 4HWDA 5AQMB 1UGOA 3LDQB 5AQFB 1UK5A 5AQRB 5AQPB 3FZFB 3A8YC 5AQVB 5AQSB 4HWHA 5AQGB 5AQJB 2D9DA 5AQUB
chains in the Genus database with same CATH superfamily
2KT9A 2Y8DA 2ES0A 2H89A 3Q5XA 2A9UA 3EDVA 5FP3A 4X66T 4HGAA 3U3IA 2A2FX 4OYKA 2W2UA 3LK3B 4DV2T 4UV8B 5A1LA 2D5UA 2LT3A 1YD8G 2R6GF 4YLHA 1W9RA 4O4IE 4JYAT 1XZYA 4DV1T 1ZV4X 2AXDS 3FXEB 2CE7A 3PUWF 4KX6A 2E5LT 1S35A 4AKIA 3RQWA 4WNKA 2BS3A 4DV0T 4AISA 2QA7A 4U2YA 2HH7A 4OHFA 1L0VA 3ZYLA 4YTNA 4YFSA 2G0UA 4GIWA 2YN6A 4UEMA 3VKHA 3ONXA 2BG9A 4EYYR 3ETVA 4BAYB 4TV9E 3LBXA 2E9XB 3RIUC 5LJNA 4ILCA 3ZN1B 2WDVA 4PFPA 4DV5T 4V1Av 4AKGA 3ZT5A 3RRWA 2LEHA 4TWHA 5LHGB 3H3MA 3UU4A 5AQNB 3IBPA 2J62A 3AE4A 4JEUB 4X1YE 5L4HA 3RC3A 5CFBA 3PUXF 3FZHB 1XNQT 4DR2T 2W67A 4EYUA 2CHNA 4BA9A 4ZI3D 5AQHB 4I4TE 4LF4T 2EHOD 3ZC0A 1OEDE 2WU5A 1VCSA 2MPKA 3P4WA 4DR6T 5AQQB 3VKGA 5AQLB 2KMFA 3P4RA 2V8SV 2A3DA 4X1IE 4XZCA 2FJDA 4NPPA 2IC9A 5C2TA 2BKOA 2YDRA 5HEUA 3BQIA 4JI1T 4HWDA 5LGTB 4UELA 3W15B 5J2UE 4DR4T 4H9OC 4MALA 1NWMX 3N9QA 4MBQA 5AQFB 4K0KT 3C51A 3J9X1 2ACZA 3AAEB 2V7IA 5FY1A 3RH3A 4A56A 3JC6D 2PFVA 3N2GE 4JLEA 2J1DG 5ABGA 2JQQA 3JAFA 3OTOT 3RIUA 4H9PC 2WDRA 2V6YB 2X9WA 5LP6E 3SFEA 1D0YA 2V5CA 3X1DA 3UU5A 5FL1A 2WSSV 1W0BA 3NVOA 2BS4A 5JDQA 2H88A 1HTJF 5HEOA 3EI0A 5CB4E 4LF6T 5ABFA 4KI0F 4EZ4A 4B3ST 3RHWA 3T1HT 1OEDA 4IDQA 3P4SA 1G73A 1US7B 4TN7B 3QK6A 4F6RC 4YTPA 2XM2A 4ZI7E 3AAAB 2W0GA 1IAPA 2VKHA 4I43B 3RF1A 2CA5A 1HNZT 3PJAJ 2W4XA 2WCAA 1Y64B 3C64A 3OKQA 2RA1A 3PE0A 2N2NA 4U7IA 5EK2A 2VL8A 4JI2T 3K3QC 4QH1A 3QOFA 2CPTA 5GONE 5HCJA 3SWHA 2NR4A 4EXTA 1HFAA 4AQFC 4GYRA 3LJCA 1MMAA 3N9PA 2WDQA 2HHHT 1FIOA 3UUMA 2WBLA 2FJEA 3UUNA 5C3JA 2H3RA 2X67A 3E08A 4XBFB 3AEFA 5LBQB 3KV9A 5LCYA 3LSVA 3QUJA 3PUSA 4O4HE 1IBLT 3UULA 4DV3T 1YQ3A 5JDMA 4DR3T 1N33T 2XAHB 4B6XA 2WWUA 3Q5DA 1J5WA 5LHIB 1HX1B 3AE9A 1WLXA 2LOPA 3HA4A 3PURA 4PNIA 3FXDB 2LHNA 2YEVC 3PV0F 4PJJA 3AEBA 3RQUA 4A5XA 4B3MT 2UUBT 3T1YT 3A5XA 3AE3A 1D1AA 2WQYA 2XJ7A 2CLYB 5LMUT 1SHZC 1MNDA 2HPJA 1KNRA 3PU3A 5HEGA 3UFEA 4EOZB 1MIYA 2X0YA 5IHYA 2P9BA 2J47A 2RPAA 3HR0A 2YU2A 4EZHA 2Q9QB 3KBTA 5AQUB 3I0QA 5ADXL 5HWYA 4IREA 3AECA 1I6ZA 5L3GB 5BMVE 4QKNA 4WBOA 3GWHA 2NTYA 1W09A 3AE8A 3HKEE 4DR1T 1H7CA 3Q5WA 4DVDA 3AE1A 2WM9A 3T8OA 4CI2B 4KUMB 2WMOA 2XAJB 2MTQA 1MIWA 5ABHA 2FBWA 3WI3A 4YY3T 3C50A 4KHZF 3CMLA 3VHLA 3ZSTA 1KFYA 3PUVF 3I9WA 2W62A 3ZYMA 1U4QA 4QH5A 5FYMA 2V7JA 1VRBA 5L47A 2LLYA 2LSGA 4NXNT 4ZS2A 5AQRB 2BDEA 4O2AE 4O4JE 2XQ4A 4WW0A 4QXBB 5FL0A 2NWBA 3ZLIA 4ZI2D 3IF8B 3A8YC 2BG9C 2CEAA 2IDOB 4E7SA 1BR0A 4HFDA 4DBQA 3IHRA 3JADA 1N36T 4EIWA 5AQJB 5JDFA 2XQAA 3RIAA 4AQGA 4B3TT 4DV6T 2KZ7B 3AAIA 4JV5T 2YOEA 5AQTB 2K9AA 5HCMA 3VU7H 1IBMT 2WZIA 2IMLA 3ANWB 4PK6A 2BVLA 2X68A 4C91A 3V5SA 4I50E 3KVBA 4IE5A 5AQIB 4ADZA 3FZLB 4JI7T 3P4PA 1Z8UA 4PJNA 2Q9QC 1YW0A 3TKLB 2V6XA 4AKHA 3CK6A 2L3LA 4HEAA 4ISTA 4EB6E 5JQGE 2JRKA 2VKJA 2FJAA 4CI3B 1XNRT 3ZCJA 2W63A 5JR9B 1XMQT 5CA0E 1UCUA 2E9XC 2LOSA 1E1HB 3EAMA 4X5TA 3ZKRA 2VQET 2QRXA 2LSJA 3RX6A 3UQ7A 2NTXA 3FZFB 3OYZA 2HN1A 2YINA 4MLKA 2XSAA 2MYSA 3R84B 2CXLA 1HF8A 4O8SA 2V26A 3GMIA 5JR9A 4TWDA 4CXWA 2LSKA 2VASA 4YSZA 3OBVE 5LGUB 2D9DA 3RRCA 2YK0A 5DQVA 3AXJB 4UVCB 2XASB 5EK3A 3U78A 2ZM0A 1X9BA 4H63V 4LMJA 3RYIE 3PUYF 4DMWA 2PJQA 4JEHB 4HWIB 4IE4A 3ANWA 4OK0A 4DUZT 2HPLA 3FZMB 3PTRB 2IUBA 3OPCA 1JNRA 4WZXA 3DTOA 3N5LA 4NUUA 2V7LA 4U3CA 5FVKA 1UX4A 5LBMA 4CXYA 1WYBA 3CWZB 4GKJT 1XWMA 2WY2A 3KBUA 4IE7A 4ZOLE 1M7KA 2OLTA 3L39A 2KSRA 3LK2B 1OEDC 3MZKB 3RGLA 2EHOB 3MK7C 3OYXA 4JI8T 4IDNA 4IIJE 5FNVE 3M65A 3EVYA 5E0OA 2CLYC 4DR7T 3RYCE 3E0ZA 4PAGA 3VR9A 2D2SA 4GK5E 3AEGA 5KX5E 2XTLA 2Q9QD 1WYCA 3P8CD 3GN5B 5LOVE 3RYFE 2JQ9A 3PJAA 1XDOA 4LMLA 3TLUA 4MFRA 4MHCA 3F2EA 3N2KE 2MBGA 1I94T 2JJ9A 4CZZB 3K1SA 5F3JA 4P1NA 3AXJA 2YDQA 3ZJ1A 4X65T 4UXNB 3AVRA 2BVMA 2BS2A 2LRKA 2ODVA 3BQKA 3UU8A 5L3CB 2BKNA 4PJLA 3ZMUB 4KMCA 3ZPOA 1N32T 1UX5A 4TZ4C 4P09A 1NEKA 4UF0B 3O9XA 4BJMA 1WCRA 3JC6C 4G63A 3ZJ2A 5HXRA 4WBNE 4L0RA 1IJ5A 3VRAA 4NUVA 5AFUL 3UU3A 5LG4A 5TAOA 3I9YA 2CRBA 4HFVA 3D0TA 2SPCA 3LG7A 5FY7A 3ZMVB 4YSYA 4IE6A 4EV6A 2NW9A 2XQ8A 2K24A 1KK7A 3FBZA 3I0OA 4X1KE 4H9QC 2BBJA 2DNXA 2LM2A 2XAGB 2IW5B 4ERRA 3CVRA 2CCQA 2XQ5A 2X66A 4HKAA 4NIQA 4UF0A 4A97A 1FMVA 4P0AA 1QLBA 5FMNA 4IHJE 3ZMZB 3K8PC 2LJLA 2E8IA 3LK42 4ZI3C 1ZKEA 3NRXA 1S94A 3JAEA 3PUQA 5DJQC 3ZT6A 1N34T 1IBKT 4HFBA 1D0XA 1YKHB 4IL9A 3S4UA 2YDSA 3FHNA 3C98B 4GK0E 3F31A 3TLVA 1EZ3A 3UUBA 2I0MA 2LSYA 4JBWF 3CQXC 4UR9A 2XM1A 3LBXB 3RIFA 3RLFF 3SOLA 2LSIA 5HEJA 5JREA 2UXCT 2WZHA 1B7TA 2LKHA 3HI2A 4TX5A 5LNKA 3ONJA 1QUUA 2KNDA 3C4ZA 4YT0A 4FJOA 2XY8B 2PG8A 2KWIB 1W0AA 1WRDA 2WU2A 5CJ5A 1SA0E 4Z91A 3CX8B 4ZZBA 5IWAT 4TUYE 2I59A 2XAFB 3ETUA 3P7IA 4L5GA 3VRBA 4JI4T 2D0TA 1WR0A 4HE8A 2GK9A 3ZT7A 5JVDE 4X62T 2VQFT 3N9LA 2QGSA 4KBMB 4B3RT 3KDSE 3UT5E 2DLRA 2JMHA 2KXPB 2N9DA 1MIVA 3PUGA 4U2ZA 3AA7B 2K3WA 2XZEA 3DP7A 4FI5A 2QVAA 3KV4A 1D0ZA 3HL6A 4L9IA 4O2BE 4ZZCA 5EZYE 3AEDA 4HFCA 5AQOB 5AQKB 1BR1A 4EEBA 3SFDA 5JDNA 1YKEB 1MMDA 3OJAA 2DWGA 3MKDA 3QB5K 3ZCIA 4A98A 4G2AA 2N1GA 4TV8E 1X79A 3CPZA 3IA3A 4AI6A 1BR4A 2K5BB 1HNXT 3UFGA 2OV9A 2OA5A 3AA0B 2DCFA 4U74A 1QSDA 5L3DB 3R6NA 2X9YA 3EHZA 3NWIA 4OFZA 4UIGA 3EUHA 5HAXA 4GKKT 3N9OA 3UU6A 3AA6B 3B5MA 5JH7E 4AQFA 1HS7A 2CXDA 2X0LB 2Z6EA 4YSXA 3CIRA 2BBHA 3NZQA 3N9MA 2UXNB 2V1DB 1OWAA 3PUAA 4ILBA 3MJXA 1JNZA 4Z8XA 3RPUA 3CX7B 3ZSSA 4ZHQE 5LHHB 4DR5T 4QXCB 3MA9A 5J1GA 1NAFA 2LM9A 5H6RB 4EGWA 3PU8A 4WYVA 4QX8B 2Y6XA 3HKDE 3M3ZB 1UUSA 3WAKA 1OXZA 2VK9A 3Q5EA 2VURA 3KV6A 3LFMA 1ZP0A 2CBJA 2FUPA 2V7MA 4GYSA 5DABA 5DQWA 1SUMB 3B13A 2H7OA 3KFWX 3O1IA 3L8RA 4PJMA 4YJ3E 1CUNA 5F8PA 4HWFA 5HWXA 1HNWT 5KDMC 2CM0A 3Q2MA 2ZLYA 2E9XA 3MXZA 5JRCB 4QHOA 4QXHB 2W61A 1MMNA 5HXHA 3C4XA 3ZEFB 3A7MA 4BJNA 1WR6A 2VWAA 1T98A 2X51A 3JCFA 4DO0A 2ZM6T 2LHRA 4Q25A 5LMNT 3AB3B 3P50A 2E5VA 2NOXA 3UQ4A 2W00A 4AIUA 4IL4A 3RI5A 2WAUA 2FJBA 2WMNA 5FXVA 2ODUA 4IDOA 1XDPA 5IYZE 4IT4A 2UXDT 4I0UA 4IE0A 2DI4A 5FVLA 2NW8A 2UU9T 3K3NA 4CN6A 5FXWA 4IGUA 3RKOA 2KINB 2XAQB 2ZM8A 1NENA 2DL1A 2I6HA 3NKZA 3TLWA 3TLTA 2E2AA 4U7YA 4DNDA 1HCIA 2E9XD 2JQHA 4U72A 4E7ZA 4AQYT 5LA6E 4C90A 4LF5T 3ZYKA 3HKBE 4GOUA 4PK5A 1LRZA 2YKSA 1ZOYA 4UVAB 5IUXA 5J0ZA 3KV5A 1LVFA 4TWFA 3GN5A 5AQPB 5H6QB 5EK4A 1D1BA 3UTKA 3J7Yq 2Y48B 4U31A 1T72A 2BG9B 3KVAA 3NZPA 2HN2A 1GQEA 1LVKA 2XQ9A 4ZS3A 1DU2A 4PK4A 1IZNB 4QWNB 5AQGB 4ANJA 2KWHA 5HXSA 2DWKA 3HKCE 1MMGA 1SE7A 5CA1E 2YU1A 1M62A 1BR2A 2WWVA 4ASKA 5L3FB 2XHEB 4I55E 1U5PA 4CN1A 1FEWA 5LJMA 3K3OA 3N9NA 4AKRB 2L9QA 2J4GA 2XUEA 4PFOA 2QYWA 4DBRA 4XAXB 1HG5A 3AVSA 3H3AA 2LRLA 3TLSA 4DUYT 4YHHT 4HTEA 4DMVA 2M67A 3AEAA 5HYAA 2F4VT 5L3BB 2CBIA 3ZN0B 3L09A 2M6IA 4YJ2E 4NXMT 4ILUA 1LKXA 2PBIA 4N78D 3PDYA 3RYHE 2JPFA 3NRYA 1KEYA 2IHR1 2IIUA 4P0BA 3EABA 4IDZA 3CX6B 4H9NC 1R8IA 2ACXA 5AQSB 5L4EA 2VL0A 3BQLA 2VKOA 4DIDB 3VR8A 3PUZF 3KINB 4KP3C 2MOZA 3O1JA 5J2TE 2VVNA 2BKPA 2V6YA 2X0HA 4CQIA 3ZC1A 4TNWA 2VVSA 3SS1A 4F8HA 3B57A 4AXPA 3QNUA 4LF8T 4QX7B 4CI1B 1J1JA 2CMRA 2CHOA 5ETWA 1FJGT 4X64T 3QB5A 2LE8A 4HFEA 5FKYA 4HWCA 5FXXA 3CQCB 4UV9B 3V5UA 2XQ3A 2A72A 4YHJA 3P4QA 4O4LE 1ZEEA 1OEDB 2WS3A 3ONLC 5HXCA 4EEDA 3ZMTB 2ZM2A 5AQMB 3BK9A 4LF9T 5ABFB 1IJ6A 1UK5A 2V7KA 4ILAA 2JIWA 5C8YE 3DJBA 4ZEYA 2C5KT 5F5WA 2DHRA 4U33A 3AE7A 4UVBB 5LB7B 5AQVB 3FBLA 5LXTE 4JI0T 2L8KA 1E7PA 2IAKA 3UUXB 2C5IT 2XSBA 1CHUA 3N2OA 3CQGB 2C0SA 1FMWA 3EDUA 1Y01A 2AE9A 2BZBA 4PW8A 3WAJA 2D0UA 4IDPA 4JI5T 3RC8A 4HN9A 4H9SE 1UURA 2B1EA 2NW7A 4TNVA 4ISSA 2WB5A 2KLQA 4JUYA 2UXXB 1T8BA 1YQ4A 1T7SA 2JQKA 5KMGP 4EAHA 5BR8T 4OX9T 2W66A 4HFHA 1ZHCA 3ABVA 3OVUA 3Q9DA 4JI6T 2UXBT 5JRCA 4ZXLA 2Q9QA 2H7VC 1UGOA 4H63H 3AEEA 2WP9A 3LDQB 3AE5A 2JMKA 2K48A 4H9RC 5CGMA 2LKGA 1KF6A 3ZMSB 5JTGA 1HR0T 2CWOA 4LF7T 5JDHA 2VB6A 3MACA 2EHOA 3SRZA 4CN4A 4CXXA 2XQYA 3FB2A 1E2AA 2XQ7A 5HEHA 4AKLA 1XMOT 1Z0PA 4LFCT 4HWHA 3RKGA 2ZMAA 1KNPA 5L2LA 4DV7T 2X9XA 3C4WA 4X20E 4LFAT 3F57A 5JR9C 2PTFA 3H37A 4QH4A 5ABEA 1HG2A 1V9DA 3CKDA 4JI3T 3QC9A 4YTMA 4KHPT 3E22E 5HXEA 5KXJA 5JDGA 2IC6A 1VOMA 1AJ3A 3O1HA 2UUCT 5FXZA 4YXDA 2M6BA 1YXRA 1D1CA 2NP9A 2X9HA 2CWYA 3ESLA 1MNEA 1O3XA 5JDLA 5LYJE 5LG3A 2RP4A 2XQ6A 2B76A 4M1PA 3FZKB 4DV4T 5FY0A 4ZI2C 3G06A 3IEEA 2BG9E 2CXFA 2MAWA 5LGNB 5L3EB 3I1AA 4J2CA 4LMKA 3L3PA 4HFIA 2XPKA 1G8XA 4LFBT 2V5DA 5M4YA 1VCTA 3NBXX 4COFA 3AE2A 2C5JA 3AA1B 1J5ET 1WFDA 3O4XE 2UUAT 3AE6A 4OYJA 1HX8A 2VKDA 4Z90A 2EHOC 4K0UA 1KNZA 3GA8A
chains in the Genus database with same CATH topology
1I6ZA 5AQNB 5AQTB 3M3ZB 3FZHB 1M62A 4HWIB 5AQOB 5AQKB 5AQHB 3FZMB 4HWCA 5AQIB 3FZLB 5AQQB 1T7SA 5AQLB 4HWFA 1HX1B 1M7KA 3FZKB 4HWDA 5AQMB 1UGOA 3LDQB 5AQFB 1UK5A 5AQRB 5AQPB 3FZFB 3A8YC 5AQVB 5AQSB 4HWHA 5AQGB 5AQJB 2D9DA 5AQUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  5AQN B;  5AQT B;  3M3Z B;  3FZH B;  1M62 A;  4HWI B;  5AQO B;  5AQK B;  5AQH B;  3FZM B;  4HWC A;  5AQI B;  3FZL B;  5AQQ B;  1T7S A;  5AQL B;  4HWF A;  1HX1 B;  1M7K A;  3FZK B;  4HWD A;  5AQM B;  1UGO A;  3LDQ B;  5AQF B;  1UK5 A;  5AQR B;  5AQP B;  3FZF B;  3A8Y C;  5AQV B;  5AQS B;  4HWH A;  5AQG B;  5AQJ B;  2D9D A;  5AQU B; 
#chains in the Genus database with same CATH topology
 2KT9 A;  2Y8D A;  2ES0 A;  2H89 A;  3Q5X A;  2A9U A;  3EDV A;  5FP3 A;  4X66 T;  4HGA A;  3U3I A;  2A2F X;  4OYK A;  2W2U A;  3LK3 B;  4DV2 T;  4UV8 B;  5A1L A;  2D5U A;  2LT3 A;  1YD8 G;  2R6G F;  4YLH A;  1W9R A;  4O4I E;  4JYA T;  1XZY A;  4DV1 T;  1ZV4 X;  2AXD S;  3FXE B;  2CE7 A;  3PUW F;  4KX6 A;  2E5L T;  1S35 A;  4AKI A;  3RQW A;  4WNK A;  2BS3 A;  4DV0 T;  4AIS A;  2QA7 A;  4U2Y A;  2HH7 A;  4OHF A;  1L0V A;  3ZYL A;  4YTN A;  4YFS A;  2G0U A;  4GIW A;  2YN6 A;  4UEM A;  3VKH A;  3ONX A;  2BG9 A;  4EYY R;  3ETV A;  4BAY B;  4TV9 E;  3LBX A;  2E9X B;  3RIU C;  5LJN A;  4ILC A;  3ZN1 B;  2WDV A;  4PFP A;  4DV5 T;  4V1A v;  4AKG A;  3ZT5 A;  3RRW A;  2LEH A;  4TWH A;  5LHG B;  3H3M A;  3UU4 A;  5AQN B;  3IBP A;  2J62 A;  3AE4 A;  4JEU B;  4X1Y E;  5L4H A;  3RC3 A;  5CFB A;  3PUX F;  3FZH B;  1XNQ T;  4DR2 T;  2W67 A;  4EYU A;  2CHN A;  4BA9 A;  4ZI3 D;  5AQH B;  4I4T E;  4LF4 T;  2EHO D;  3ZC0 A;  1OED E;  2WU5 A;  1VCS A;  2MPK A;  3P4W A;  4DR6 T;  5AQQ B;  3VKG A;  5AQL B;  2KMF A;  3P4R A;  2V8S V;  2A3D A;  4X1I E;  4XZC A;  2FJD A;  4NPP A;  2IC9 A;  5C2T A;  2BKO A;  2YDR A;  5HEU A;  3BQI A;  4JI1 T;  4HWD A;  5LGT B;  4UEL A;  3W15 B;  5J2U E;  4DR4 T;  4H9O C;  4MAL A;  1NWM X;  3N9Q A;  4MBQ A;  5AQF B;  4K0K T;  3C51 A;  3J9X 1;  2ACZ A;  3AAE B;  2V7I A;  5FY1 A;  3RH3 A;  4A56 A;  3JC6 D;  2PFV A;  3N2G E;  4JLE A;  2J1D G;  5ABG A;  2JQQ A;  3JAF A;  3OTO T;  3RIU A;  4H9P C;  2WDR A;  2V6Y B;  2X9W A;  5LP6 E;  3SFE A;  1D0Y A;  2V5C A;  3X1D A;  3UU5 A;  5FL1 A;  2WSS V;  1W0B A;  3NVO A;  2BS4 A;  5JDQ A;  2H88 A;  1HTJ F;  5HEO A;  3EI0 A;  5CB4 E;  4LF6 T;  5ABF A;  4KI0 F;  4EZ4 A;  4B3S T;  3RHW A;  3T1H T;  1OED A;  4IDQ A;  3P4S A;  1G73 A;  1US7 B;  4TN7 B;  3QK6 A;  4F6R C;  4YTP A;  2XM2 A;  4ZI7 E;  3AAA B;  2W0G A;  1IAP A;  2VKH A;  4I43 B;  3RF1 A;  2CA5 A;  1HNZ T;  3PJA J;  2W4X A;  2WCA A;  1Y64 B;  3C64 A;  3OKQ A;  2RA1 A;  3PE0 A;  2N2N A;  4U7I A;  5EK2 A;  2VL8 A;  4JI2 T;  3K3Q C;  4QH1 A;  3QOF A;  2CPT A;  5GON E;  5HCJ A;  3SWH A;  2NR4 A;  4EXT A;  1HFA A;  4AQF C;  4GYR A;  3LJC A;  1MMA A;  3N9P A;  2WDQ A;  2HHH T;  1FIO A;  3UUM A;  2WBL A;  2FJE A;  3UUN A;  5C3J A;  2H3R A;  2X67 A;  3E08 A;  4XBF B;  3AEF A;  5LBQ B;  3KV9 A;  5LCY A;  3LSV A;  3QUJ A;  3PUS A;  4O4H E;  1IBL T;  3UUL A;  4DV3 T;  1YQ3 A;  5JDM A;  4DR3 T;  1N33 T;  2XAH B;  4B6X A;  2WWU A;  3Q5D A;  1J5W A;  5LHI B;  1HX1 B;  3AE9 A;  1WLX A;  2LOP A;  3HA4 A;  3PUR A;  4PNI A;  3FXD B;  2LHN A;  2YEV C;  3PV0 F;  4PJJ A;  3AEB A;  3RQU A;  4A5X A;  4B3M T;  2UUB T;  3T1Y T;  3A5X A;  3AE3 A;  1D1A A;  2WQY A;  2XJ7 A;  2CLY B;  5LMU T;  1SHZ C;  1MND A;  2HPJ A;  1KNR A;  3PU3 A;  5HEG A;  3UFE A;  4EOZ B;  1MIY A;  2X0Y A;  5IHY A;  2P9B A;  2J47 A;  2RPA A;  3HR0 A;  2YU2 A;  4EZH A;  2Q9Q B;  3KBT A;  5AQU B;  3I0Q A;  5ADX L;  5HWY A;  4IRE A;  3AEC A;  1I6Z A;  5L3G B;  5BMV E;  4QKN A;  4WBO A;  3GWH A;  2NTY A;  1W09 A;  3AE8 A;  3HKE E;  4DR1 T;  1H7C A;  3Q5W A;  4DVD A;  3AE1 A;  2WM9 A;  3T8O A;  4CI2 B;  4KUM B;  2WMO A;  2XAJ B;  2MTQ A;  1MIW A;  5ABH A;  2FBW A;  3WI3 A;  4YY3 T;  3C50 A;  4KHZ F;  3CML A;  3VHL A;  3ZST A;  1KFY A;  3PUV F;  3I9W A;  2W62 A;  3ZYM A;  1U4Q A;  4QH5 A;  5FYM A;  2V7J A;  1VRB A;  5L47 A;  2LLY A;  2LSG A;  4NXN T;  4ZS2 A;  5AQR B;  2BDE A;  4O2A E;  4O4J E;  2XQ4 A;  4WW0 A;  4QXB B;  5FL0 A;  2NWB A;  3ZLI A;  4ZI2 D;  3IF8 B;  3A8Y C;  2BG9 C;  2CEA A;  2IDO B;  4E7S A;  1BR0 A;  4HFD A;  4DBQ A;  3IHR A;  3JAD A;  1N36 T;  4EIW A;  5AQJ B;  5JDF A;  2XQA A;  3RIA A;  4AQG A;  4B3T T;  4DV6 T;  2KZ7 B;  3AAI A;  4JV5 T;  2YOE A;  5AQT B;  2K9A A;  5HCM A;  3VU7 H;  1IBM T;  2WZI A;  2IML A;  3ANW B;  4PK6 A;  2BVL A;  2X68 A;  4C91 A;  3V5S A;  4I50 E;  3KVB A;  4IE5 A;  5AQI B;  4ADZ A;  3FZL B;  4JI7 T;  3P4P A;  1Z8U A;  4PJN A;  2Q9Q C;  1YW0 A;  3TKL B;  2V6X A;  4AKH A;  3CK6 A;  2L3L A;  4HEA A;  4IST A;  4EB6 E;  5JQG E;  2JRK A;  2VKJ A;  2FJA A;  4CI3 B;  1XNR T;  3ZCJ A;  2W63 A;  5JR9 B;  1XMQ T;  5CA0 E;  1UCU A;  2E9X C;  2LOS A;  1E1H B;  3EAM A;  4X5T A;  3ZKR A;  2VQE T;  2QRX A;  2LSJ A;  3RX6 A;  3UQ7 A;  2NTX A;  3FZF B;  3OYZ A;  2HN1 A;  2YIN A;  4MLK A;  2XSA A;  2MYS A;  3R84 B;  2CXL A;  1HF8 A;  4O8S A;  2V26 A;  3GMI A;  5JR9 A;  4TWD A;  4CXW A;  2LSK A;  2VAS A;  4YSZ A;  3OBV E;  5LGU B;  2D9D A;  3RRC A;  2YK0 A;  5DQV A;  3AXJ B;  4UVC B;  2XAS B;  5EK3 A;  3U78 A;  2ZM0 A;  1X9B A;  4H63 V;  4LMJ A;  3RYI E;  3PUY F;  4DMW A;  2PJQ A;  4JEH B;  4HWI B;  4IE4 A;  3ANW A;  4OK0 A;  4DUZ T;  2HPL A;  3FZM B;  3PTR B;  2IUB A;  3OPC A;  1JNR A;  4WZX A;  3DTO A;  3N5L A;  4NUU A;  2V7L A;  4U3C A;  5FVK A;  1UX4 A;  5LBM A;  4CXY A;  1WYB A;  3CWZ B;  4GKJ T;  1XWM A;  2WY2 A;  3KBU A;  4IE7 A;  4ZOL E;  1M7K A;  2OLT A;  3L39 A;  2KSR A;  3LK2 B;  1OED C;  3MZK B;  3RGL A;  2EHO B;  3MK7 C;  3OYX A;  4JI8 T;  4IDN A;  4IIJ E;  5FNV E;  3M65 A;  3EVY A;  5E0O A;  2CLY C;  4DR7 T;  3RYC E;  3E0Z A;  4PAG A;  3VR9 A;  2D2S A;  4GK5 E;  3AEG A;  5KX5 E;  2XTL A;  2Q9Q D;  1WYC A;  3P8C D;  3GN5 B;  5LOV E;  3RYF E;  2JQ9 A;  3PJA A;  1XDO A;  4LML A;  3TLU A;  4MFR A;  4MHC A;  3F2E A;  3N2K E;  2MBG A;  1I94 T;  2JJ9 A;  4CZZ B;  3K1S A;  5F3J A;  4P1N A;  3AXJ A;  2YDQ A;  3ZJ1 A;  4X65 T;  4UXN B;  3AVR A;  2BVM A;  2BS2 A;  2LRK A;  2ODV A;  3BQK A;  3UU8 A;  5L3C B;  2BKN A;  4PJL A;  3ZMU B;  4KMC A;  3ZPO A;  1N32 T;  1UX5 A;  4TZ4 C;  4P09 A;  1NEK A;  4UF0 B;  3O9X A;  4BJM A;  1WCR A;  3JC6 C;  4G63 A;  3ZJ2 A;  5HXR A;  4WBN E;  4L0R A;  1IJ5 A;  3VRA A;  4NUV A;  5AFU L;  3UU3 A;  5LG4 A;  5TAO A;  3I9Y A;  2CRB A;  4HFV A;  3D0T A;  2SPC A;  3LG7 A;  5FY7 A;  3ZMV B;  4YSY A;  4IE6 A;  4EV6 A;  2NW9 A;  2XQ8 A;  2K24 A;  1KK7 A;  3FBZ A;  3I0O A;  4X1K E;  4H9Q C;  2BBJ A;  2DNX A;  2LM2 A;  2XAG B;  2IW5 B;  4ERR A;  3CVR A;  2CCQ A;  2XQ5 A;  2X66 A;  4HKA A;  4NIQ A;  4UF0 A;  4A97 A;  1FMV A;  4P0A A;  1QLB A;  5FMN A;  4IHJ E;  3ZMZ B;  3K8P C;  2LJL A;  2E8I A;  3LK4 2;  4ZI3 C;  1ZKE A;  3NRX A;  1S94 A;  3JAE A;  3PUQ A;  5DJQ C;  3ZT6 A;  1N34 T;  1IBK T;  4HFB A;  1D0X A;  1YKH B;  4IL9 A;  3S4U A;  2YDS A;  3FHN A;  3C98 B;  4GK0 E;  3F31 A;  3TLV A;  1EZ3 A;  3UUB A;  2I0M A;  2LSY A;  4JBW F;  3CQX C;  4UR9 A;  2XM1 A;  3LBX B;  3RIF A;  3RLF F;  3SOL A;  2LSI A;  5HEJ A;  5JRE A;  2UXC T;  2WZH A;  1B7T A;  2LKH A;  3HI2 A;  4TX5 A;  5LNK A;  3ONJ A;  1QUU A;  2KND A;  3C4Z A;  4YT0 A;  4FJO A;  2XY8 B;  2PG8 A;  2KWI B;  1W0A A;  1WRD A;  2WU2 A;  5CJ5 A;  1SA0 E;  4Z91 A;  3CX8 B;  4ZZB A;  5IWA T;  4TUY E;  2I59 A;  2XAF B;  3ETU A;  3P7I A;  4L5G A;  3VRB A;  4JI4 T;  2D0T A;  1WR0 A;  4HE8 A;  2GK9 A;  3ZT7 A;  5JVD E;  4X62 T;  2VQF T;  3N9L A;  2QGS A;  4KBM B;  4B3R T;  3KDS E;  3UT5 E;  2DLR A;  2JMH A;  2KXP B;  2N9D A;  1MIV A;  3PUG A;  4U2Z A;  3AA7 B;  2K3W A;  2XZE A;  3DP7 A;  4FI5 A;  2QVA A;  3KV4 A;  1D0Z A;  3HL6 A;  4L9I A;  4O2B E;  4ZZC A;  5EZY E;  3AED A;  4HFC A;  5AQO B;  5AQK B;  1BR1 A;  4EEB A;  3SFD A;  5JDN A;  1YKE B;  1MMD A;  3OJA A;  2DWG A;  3MKD A;  3QB5 K;  3ZCI A;  4A98 A;  4G2A A;  2N1G A;  4TV8 E;  1X79 A;  3CPZ A;  3IA3 A;  4AI6 A;  1BR4 A;  2K5B B;  1HNX T;  3UFG A;  2OV9 A;  2OA5 A;  3AA0 B;  2DCF A;  4U74 A;  1QSD A;  5L3D B;  3R6N A;  2X9Y A;  3EHZ A;  3NWI A;  4OFZ A;  4UIG A;  3EUH A;  5HAX A;  4GKK T;  3N9O A;  3UU6 A;  3AA6 B;  3B5M A;  5JH7 E;  4AQF A;  1HS7 A;  2CXD A;  2X0L B;  2Z6E A;  4YSX A;  3CIR A;  2BBH A;  3NZQ A;  3N9M A;  2UXN B;  2V1D B;  1OWA A;  3PUA A;  4ILB A;  3MJX A;  1JNZ A;  4Z8X A;  3RPU A;  3CX7 B;  3ZSS A;  4ZHQ E;  5LHH B;  4DR5 T;  4QXC B;  3MA9 A;  5J1G A;  1NAF A;  2LM9 A;  5H6R B;  4EGW A;  3PU8 A;  4WYV A;  4QX8 B;  2Y6X A;  3HKD E;  3M3Z B;  1UUS A;  3WAK A;  1OXZ A;  2VK9 A;  3Q5E A;  2VUR A;  3KV6 A;  3LFM A;  1ZP0 A;  2CBJ A;  2FUP A;  2V7M A;  4GYS A;  5DAB A;  5DQW A;  1SUM B;  3B13 A;  2H7O A;  3KFW X;  3O1I A;  3L8R A;  4PJM A;  4YJ3 E;  1CUN A;  5F8P A;  4HWF A;  5HWX A;  1HNW T;  5KDM C;  2CM0 A;  3Q2M A;  2ZLY A;  2E9X A;  3MXZ A;  5JRC B;  4QHO A;  4QXH B;  2W61 A;  1MMN A;  5HXH A;  3C4X A;  3ZEF B;  3A7M A;  4BJN A;  1WR6 A;  2VWA A;  1T98 A;  2X51 A;  3JCF A;  4DO0 A;  2ZM6 T;  2LHR A;  4Q25 A;  5LMN T;  3AB3 B;  3P50 A;  2E5V A;  2NOX A;  3UQ4 A;  2W00 A;  4AIU A;  4IL4 A;  3RI5 A;  2WAU A;  2FJB A;  2WMN A;  5FXV A;  2ODU A;  4IDO A;  1XDP A;  5IYZ E;  4IT4 A;  2UXD T;  4I0U A;  4IE0 A;  2DI4 A;  5FVL A;  2NW8 A;  2UU9 T;  3K3N A;  4CN6 A;  5FXW A;  4IGU A;  3RKO A;  2KIN B;  2XAQ B;  2ZM8 A;  1NEN A;  2DL1 A;  2I6H A;  3NKZ A;  3TLW A;  3TLT A;  2E2A A;  4U7Y A;  4DND A;  1HCI A;  2E9X D;  2JQH A;  4U72 A;  4E7Z A;  4AQY T;  5LA6 E;  4C90 A;  4LF5 T;  3ZYK A;  3HKB E;  4GOU A;  4PK5 A;  1LRZ A;  2YKS A;  1ZOY A;  4UVA B;  5IUX A;  5J0Z A;  3KV5 A;  1LVF A;  4TWF A;  3GN5 A;  5AQP B;  5H6Q B;  5EK4 A;  1D1B A;  3UTK A;  3J7Y q;  2Y48 B;  4U31 A;  1T72 A;  2BG9 B;  3KVA A;  3NZP A;  2HN2 A;  1GQE A;  1LVK A;  2XQ9 A;  4ZS3 A;  1DU2 A;  4PK4 A;  1IZN B;  4QWN B;  5AQG B;  4ANJ A;  2KWH A;  5HXS A;  2DWK A;  3HKC E;  1MMG A;  1SE7 A;  5CA1 E;  2YU1 A;  1M62 A;  1BR2 A;  2WWV A;  4ASK A;  5L3F B;  2XHE B;  4I55 E;  1U5P A;  4CN1 A;  1FEW A;  5LJM A;  3K3O A;  3N9N A;  4AKR B;  2L9Q A;  2J4G A;  2XUE A;  4PFO A;  2QYW A;  4DBR A;  4XAX B;  1HG5 A;  3AVS A;  3H3A A;  2LRL A;  3TLS A;  4DUY T;  4YHH T;  4HTE A;  4DMV A;  2M67 A;  3AEA A;  5HYA A;  2F4V T;  5L3B B;  2CBI A;  3ZN0 B;  3L09 A;  2M6I A;  4YJ2 E;  4NXM T;  4ILU A;  1LKX A;  2PBI A;  4N78 D;  3PDY A;  3RYH E;  2JPF A;  3NRY A;  1KEY A;  2IHR 1;  2IIU A;  4P0B A;  3EAB A;  4IDZ A;  3CX6 B;  4H9N C;  1R8I A;  2ACX A;  5AQS B;  5L4E A;  2VL0 A;  3BQL A;  2VKO A;  4DID B;  3VR8 A;  3PUZ F;  3KIN B;  4KP3 C;  2MOZ A;  3O1J A;  5J2T E;  2VVN A;  2BKP A;  2V6Y A;  2X0H A;  4CQI A;  3ZC1 A;  4TNW A;  2VVS A;  3SS1 A;  4F8H A;  3B57 A;  4AXP A;  3QNU A;  4LF8 T;  4QX7 B;  4CI1 B;  1J1J A;  2CMR A;  2CHO A;  5ETW A;  1FJG T;  4X64 T;  3QB5 A;  2LE8 A;  4HFE A;  5FKY A;  4HWC A;  5FXX A;  3CQC B;  4UV9 B;  3V5U A;  2XQ3 A;  2A72 A;  4YHJ A;  3P4Q A;  4O4L E;  1ZEE A;  1OED B;  2WS3 A;  3ONL C;  5HXC A;  4EED A;  3ZMT B;  2ZM2 A;  5AQM B;  3BK9 A;  4LF9 T;  5ABF B;  1IJ6 A;  1UK5 A;  2V7K A;  4ILA A;  2JIW A;  5C8Y E;  3DJB A;  4ZEY A;  2C5K T;  5F5W A;  2DHR A;  4U33 A;  3AE7 A;  4UVB B;  5LB7 B;  5AQV B;  3FBL A;  5LXT E;  4JI0 T;  2L8K A;  1E7P A;  2IAK A;  3UUX B;  2C5I T;  2XSB A;  1CHU A;  3N2O A;  3CQG B;  2C0S A;  1FMW A;  3EDU A;  1Y01 A;  2AE9 A;  2BZB A;  4PW8 A;  3WAJ A;  2D0U A;  4IDP A;  4JI5 T;  3RC8 A;  4HN9 A;  4H9S E;  1UUR A;  2B1E A;  2NW7 A;  4TNV A;  4ISS A;  2WB5 A;  2KLQ A;  4JUY A;  2UXX B;  1T8B A;  1YQ4 A;  1T7S A;  2JQK A;  5KMG P;  4EAH A;  5BR8 T;  4OX9 T;  2W66 A;  4HFH A;  1ZHC A;  3ABV A;  3OVU A;  3Q9D A;  4JI6 T;  2UXB T;  5JRC A;  4ZXL A;  2Q9Q A;  2H7V C;  1UGO A;  4H63 H;  3AEE A;  2WP9 A;  3LDQ B;  3AE5 A;  2JMK A;  2K48 A;  4H9R C;  5CGM A;  2LKG A;  1KF6 A;  3ZMS B;  5JTG A;  1HR0 T;  2CWO A;  4LF7 T;  5JDH A;  2VB6 A;  3MAC A;  2EHO A;  3SRZ A;  4CN4 A;  4CXX A;  2XQY A;  3FB2 A;  1E2A A;  2XQ7 A;  5HEH A;  4AKL A;  1XMO T;  1Z0P A;  4LFC T;  4HWH A;  3RKG A;  2ZMA A;  1KNP A;  5L2L A;  4DV7 T;  2X9X A;  3C4W A;  4X20 E;  4LFA T;  3F57 A;  5JR9 C;  2PTF A;  3H37 A;  4QH4 A;  5ABE A;  1HG2 A;  1V9D A;  3CKD A;  4JI3 T;  3QC9 A;  4YTM A;  4KHP T;  3E22 E;  5HXE A;  5KXJ A;  5JDG A;  2IC6 A;  1VOM A;  1AJ3 A;  3O1H A;  2UUC T;  5FXZ A;  4YXD A;  2M6B A;  1YXR A;  1D1C A;  2NP9 A;  2X9H A;  2CWY A;  3ESL A;  1MNE A;  1O3X A;  5JDL A;  5LYJ E;  5LG3 A;  2RP4 A;  2XQ6 A;  2B76 A;  4M1P A;  3FZK B;  4DV4 T;  5FY0 A;  4ZI2 C;  3G06 A;  3IEE A;  2BG9 E;  2CXF A;  2MAW A;  5LGN B;  5L3E B;  3I1A A;  4J2C A;  4LMK A;  3L3P A;  4HFI A;  2XPK A;  1G8X A;  4LFB T;  2V5D A;  5M4Y A;  1VCT A;  3NBX X;  4COF A;  3AE2 A;  2C5J A;  3AA1 B;  1J5E T;  1WFD A;  3O4X E;  2UUA T;  3AE6 A;  4OYJ A;  1HX8 A;  2VKD A;  4Z90 A;  2EHO C;  4K0U A;  1KNZ A;  3GA8 A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  5AQN B;  5AQT B;  3M3Z B;  3FZH B;  1M62 A;  4HWI B;  5AQO B;  5AQK B;  5AQH B;  3FZM B;  4HWC A;  5AQI B;  3FZL B;  5AQQ B;  1T7S A;  5AQL B;  4HWF A;  1HX1 B;  1M7K A;  3FZK B;  4HWD A;  5AQM B;  1UGO A;  3LDQ B;  5AQF B;  1UK5 A;  5AQR B;  5AQP B;  3FZF B;  3A8Y C;  5AQV B;  5AQS B;  4HWH A;  5AQG B;  5AQJ B;  2D9D A;  5AQU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...