5AQTB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqtB00
5AQFB 3FZKB 5AQHB 5AQIB 3FZMB 5AQRB 5AQQB 5AQJB 3FZLB 5AQOB 2D9DA 5AQPB 5AQGB 5AQLB 1M62A 4HWHA 4HWIB 4HWCA 3FZFB 5AQNB 5AQUB 3FZHB 5AQKB 4HWFA 5AQSB 5AQVB 5AQMB 1T7SA 5AQTB 1I6ZA 3M3ZB 1M7KA 1UK5A 1HX1B 3A8YC 3LDQB 1UGOA 4HWDA
chains in the Genus database with same CATH superfamily
2LOSA 1OWAA 2ODVA 4U74A 5AQGB 4H9NC 5AQVB 3AB3B 5FL1A 2FUPA 2HPJA 2X0HA 3AA6B 2VK9A 4GIWA 2LM2A 1CHUA 2EHOC 3RIUA 2PG8A 2SPCA 3AEEA 1U5PA 3PURA 2D0UA 3SOLA 2LSYA 3IHRA 2CXFA 2J4GA 1LRZA 4DUYT 2UUCT 5HEHA 2J47A 4IE6A 3P4PA 4EB6E 5L3GB 1ZKEA 3RF1A 2XQ8A 2OLTA 3ZSSA 3E22E 3H3MA 2WDRA 3QUJA 3BQIA 4XZCA 2HH7A 4PK4A 2K9AA 3CQGB 2C0SA 4EXTA 5JR9A 1BR1A 5ADXL 4X65T 2DLRA 2Q9QB 4U3CA 3AVSA 3Q5EA 3NKZA 2V7KA 1MMNA 4DIDB 3PUSA 4YJ3E 2LSGA 2QGSA 5IUXA 4OX9T 2BKOA 2OA5A 4DV5T 3WAJA 2BG9B 3ZCIA 4KHPT 3OBVE 5JREA 1HG5A 2EHOA 4N78D 4TZ4C 3GN5A 4I50E 3K3NA 2LT3A 4DR6T 2NW7A 4JI7T 4OYKA 2LHRA 2XY8B 4IHJE 3QOFA 4CXWA 3AA1B 4YSZA 5KDMC 1BR2A 3QB5A 5LG4A 3L09A 2X9WA 4QXBB 2W61A 1QUUA 3UFGA 3AE6A 2D5UA 2FJDA 1OEDA 2K5BB 2VKHA 3DJBA 3P7IA 4U2ZA 2VVSA 1HNWT 4O4IE 4UR9A 4ZZCA 5TAOA 1FIOA 3IA3A 3LK42 3ZMUB 4H63V 1N32T 4EYUA 3J7Yq 5CA1E 3F57A 2IDOB 3BK9A 2W67A 1IJ6A 2LHNA 5L47A 4NIQA 3NBXX 4A56A 4QH5A 4YY3T 5ABFA 2QVAA 4DVDA 3NWIA 4OYJA 2WS3A 2B76A 4GKJT 4DNDA 4JLEA 5HEUA 2XAQB 2QA7A 5ABEA 3VKHA 3PE0A 4ILCA 2E8IA 3KV9A 3CIRA 5J2TE 4C90A 3QK6A 3HKCE 5IWAT 5FVKA 2FBWA 4HWIB 3AA7B 2KT9A 4EEBA 4IDNA 3C64A 4QX8B 4YTMA 4YXDA 5FXVA 5JR9B 2A9UA 1XZYA 5LGNB 3C98B 5LHIB 4KHZF 3O1JA 2HN1A 5AQMB 1Y64B 4HFEA 4PW8A 4IGUA 5LMNT 2E9XA 4DV6T 3N2GE 4HFCA 4AXPA 2A2FX 2V7LA 4H9QC 4H63H 5FXWA 3CX6B 2JRKA 2XZEA 4QXCB 4WBNE 1G8XA 3UUMA 3KV6A 2IIUA 3OYXA 4IE4A 3LG7A 2WZHA 2EHOB 3ZMSB 1LVFA 2E2AA 2XTLA 1J5WA 1W0AA 4BA9A 3E0ZA 3GN5B 1DU2A 3RRCA 1HTJF 4ZI3D 2WAUA 2H88A 2JMHA 1J5ET 4LF8T 5L3CB 1D1BA 3K8PC 1L0VA 2JPFA 2WZIA 4QH1A 1X9BA 3RKOA 2ZM2A 5JTGA 3ONXA 4EEDA 4IIJE 1OEDB 2ZM0A 4UIGA 3ZC0A 1SE7A 3AE5A 1WR6A 3PUWF 4P0BA 3RIFA 2BVMA 3E08A 4DBQA 1FJGT 2XASB 4JI2T 4YSYA 4LMJA 3RC3A 5HWXA 3G06A 5AQSB 5H6QB 3N9NA 5ABFB 3NRYA 1UGOA 3UTKA 4A97A 1MNDA 3KINB 2Q9QC 2I6HA 4U33A 3C51A 4ILUA 2X9HA 4P1NA 3CVRA 2VB6A 4FJOA 3AEBA 5ABGA 5FY1A 1M7KA 2UUAT 2IC6A 5DQWA 4NXMT 2X67A 4IDQA 1D1CA 2V26A 4L5GA 1IAPA 3ZN1B 2WM9A 3SS1A 1T72A 1D0XA 4QH4A 3PJAA 4CN6A 5CJ5A 1WRDA 2XSBA 1XMOT 4CXXA 1XMQT 4H9RC 3NZQA 2E9XB 3ZMTB 2HHHT 3LSVA 3UQ4A 5JQGE 4CN4A 5LCYA 3MZKB 4DR7T 3C4WA 2XQYA 3HKDE 3RLFF 2D0TA 4U31A 2XQ5A 3LK3B 2XJ7A 4NUVA 5IHYA 4PK5A 2KZ7B 3RYIE 4WZXA 1ZP0A 3TLWA 2WMNA 1KNPA 3I1AA 3UU5A 4P09A 3MXZA 2C5IT 4LFCT 1ZHCA 2P9BA 3AXJA 4B3RT 2LE8A 2LSIA 3HKBE 3RIUC 3FXEB 5AFUL 2UXNB 5FYMA 3MJXA 5LNKA 5E0OA 1B7TA 3LBXA 4LF5T 1W09A 4UVBB 1HNZT 5DABA 4ASKA 1YD8G 3W15B 2YEVC 3PUGA 1KNRA 4JI0T 2B1EA 2OV9A 1O3XA 4ZEYA 3GMIA 4OHFA 1JNRA 2D2SA 5KXJA 4DMVA 3UU6A 4DV4T 3EHZA 2F4VT 2WSSV 1OXZA 1KF6A 4ANJA 4JI3T 3RRWA 2XM2A 3B13A 3PU3A 5IYZE 4PAGA 2JQ9A 2LM9A 2X51A 1NENA 5CB4E 2FJBA 2LRKA 4OFZA 4G63A 4EYYR 5AQKB 2K3WA 2A72A 3MA9A 2CPTA 2IHR1 4GYSA 4CXYA 3AE2A 5HCJA 3TLSA 3KBUA 3KBTA 2BS2A 1T98A 3FXDB 3A7MA 2CBJA 3TLVA 2KMFA 1MIYA 3RQUA 4U72A 2YN6A 5AQFB 5JDLA 3FBLA 2VKJA 4X64T 3FHNA 3HI2A 4TWFA 3CQXC 3AECA 4IDOA 4CI3B 4LFAT 3PTRB 1I6ZA 3AE3A 4ISSA 3AAAB 3NRXA 3AEGA 2E5LT 4JV5T 3AEFA 4ZOLE 3EUHA 2CXDA 2WB5A 4YSXA 4IE0A 2YU1A 1OEDE 1OEDC 4KI0F 3DP7A 1IJ5A 2RPAA 4E7ZA 5HEOA 2JQQA 3PUXF 5JRCA 4Z91A 5HEGA 3SFDA 5A1LA 3HA4A 1BR0A 1KFYA 3AXJB 2VKOA 3GWHA 3FZLB 2XAJB 2XM1A 2DHRA 3A5XA 2DWGA 3B57A 5FXZA 3QC9A 3LBXB 3ZN0B 4H9SE 2PFVA 2W4XA 3IF8B 1WFDA 1G73A 2YINA 4MLKA 4PJLA 4AIUA 2RA1A 3GA8A 2MBGA 1UURA 3IBPA 4I55E 4TV9E 5FP3A 3TKLB 3Q5WA 4DV7T 2ZLYA 4KBMB 3I9WA 4DR1T 2WU5A 5FL0A 1WYBA 2CBIA 3PJAJ 3FZMB 3EAMA 3RHWA 1XDOA 2W63A 1X79A 3AE4A 3CMLA 3KVAA 2HPLA 2VWAA 4MALA 3L39A 3WI3A 1VCTA 1IZNB 1BR4A 4PFPA 4ILAA 3ZC1A 3JC6C 2E9XC 1LKXA 4ISTA 4O8SA 1UUSA 5FY7A 1LVKA 2CLYB 1HX1B 3ZJ2A 4B3TT 2CE7A 4DUZT 4V1Av 4UV8B 5AQRB 2FJEA 5M4YA 1HFAA 4LF6T 2EHOD 2NW9A 3P4QA 2JQKA 4IE7A 2JJ9A 3UUBA 3X1DA 1US7B 4LF7T 1MIWA 1YKHB 3U78A 2I0MA 2D9DA 5HXSA 3EDUA 2W66A 4TN7B 5C3JA 4ADZA 1HG2A 3JCFA 1EZ3A 3C50A 4NUUA 5HYAA 2Y8DA 3N2OA 2JQHA 3KDSE 3P50A 4DV1T 3EABA 3RPUA 4BJNA 5EK4A 5JRCB 4YJ2E 4WNKA 3OJAA 4GKKT 3KV5A 4DR3T 2NW8A 2UXXB 1JNZA 3RX6A 4YTPA 5HXEA 2UXDT 3ONJA 1YQ3A 2DNXA 4DR4T 5HWYA 3MACA 5DJQC 4TNWA 4AKRB 4JYAT 3O1IA 5LB7B 2CEAA 4AI6A 3RH3A 4I0UA 3MKDA 3I0QA 4NPPA 3A8YC 3K3QC 4C91A 5AQJB 3SRZA 5AQOB 4PJJA 3I9YA 4BAYB 4HWFA 1UX4A 2CRBA 3U3IA 2BBJA 3N9QA 1ZEEA 3VU7H 4KX6A 4QHOA 5AQIB 3FBZA 4JI5T 5AQQB 5JDHA 3CX7B 3KVBA 4AQYT 3VR8A 2CHNA 3AEDA 2R6GF 3ESLA 2XSAA 5CFBA 3ZJ1A 2WU2A 2VURA 3CPZA 2NOXA 2LSKA 4IL9A 4Z8XA 1UCUA 5JDQA 5AQLB 2X68A 1T8BA 4DO0A 3C4XA 5C8YE 5HCMA 3WAKA 4HGAA 4JUYA 1XNQT 5F8PA 1MMDA 2KWHA 4UELA 3QB5K 3PUQA 3AE7A 3PDYA 4WBOA 2AXDS 2KXPB 2CCQA 2X0LB 1WLXA 4Z90A 3AE1A 4G2AA 4I43B 1QSDA 4HTEA 3NZPA 4O2AE 3JAFA 2WMOA 3N9LA 1XNRT 2CM0A 4A5XA 2YDSA 4DBRA 5AQUB 2DCFA 3MK7C 3M65A 2ZM8A 3H37A 4J2CA 4KMCA 1YW0A 2KSRA 4FI5A 1FEWA 5GONE 5F5WA 4DV2T 3RYFE 2V6YA 5L3DB 3L8RA 5JDNA 3PV0F 2YKSA 3LK2B 4UXNB 4HFHA 1H7CA 5L2LA 5L3EB 2J62A 3PUYF 2XAGB 5F3JA 4YHHT 2NTXA 2GK9A 4HFBA 2CLYC 3RYCE 2E5VA 2UXBT 2ACXA 2KLQA 4WYVA 2LOPA 3F31A 2LEHA 3AVRA 1Z0PA 3AE8A 1SHZC 1NAFA 2IUBA 4AISA 4LMKA 1S35A 3Q2MA 4EIWA 1D0YA 4YLHA 3HR0A 5LHGB 5JH7E 3CQCB 3ZT5A 5AQTB 2LJLA 2X9YA 1E7PA 2M6IA 4XBFB 1AJ3A 2YU2A 2CWYA 4IT4A 3ZLIA 2WBLA 2YK0A 4MFRA 2J1DG 4PK6A 2W00A 4O4HE 5CGMA 2XQ7A 2M67A 2AE9A 1IBLT 1SA0E 4COFA 4IL4A 4QXHB 2BVLA 2MAWA 4PNIA 3B5MA 3ABVA 1W0BA 4O4LE 5LBQB 3TLUA 5EK2A 3H3AA 4X20E 3UUNA 3VHLA 3ZT6A 2LRLA 3ZSTA 2BG9A 5L3FB 3EI0A 3EDVA 3N9OA 2IC9A 4AQGA 4AKIA 1W9RA 4X62T 3AAIA 2Q9QD 3ETUA 2XPKA 1UK5A 4DR5T 2Y6XA 4JI1T 1XWMA 2V1DB 2CXLA 4YFSA 5AQPB 4H9PC 5LP6E 4HE8A 4PJMA 1M62A 5BMVE 1SUMB 4KUMB 5LOVE 3JADA 4LF9T 5HXCA 4ZI7E 3FZKB 3ZMZB 2ZMAA 1ZV4X 4HN9A 4I4TE 4XAXB 4CZZB 5LA6E 1KNZA 4KP3C 3R6NA 4EOZB 2V6YB 3BQKA 3M3ZB 2PTFA 2G0UA 4CQIA 3ZYKA 3RKGA 2CWOA 1MMGA 3FB2A 3R84B 4X66T 2QRXA 3F2EA 3L3PA 3N9PA 4TX5A 3PUAA 5LBMA 3RC8A 2RP4A 4JEHB 2C5JA 1Z8UA 2NWBA 2BDEA 3VRBA 3RGLA 1YXRA 3EVYA 2M6BA 2XQ6A 4DV3T 4ERRA 1J1JA 1N33T 1WR0A 3ANWA 5JDGA 1HR0T 3ZKRA 2NR4A 3C4ZA 2CMRA 3KV4A 3PUVF 4IE5A 2V6XA 1HNXT 2WCAA 3UU3A 3PU8A 4HWCA 3FZHB 4EV6A 2MOZA 3VR9A 1UX5A 1T7SA 1HS7A 2V8SV 4L9IA 3OVUA 5JDFA 3Q9DA 3P8CD 4OK0A 2XHEB 4QWNB 1E2AA 3T8OA 5C2TA 5AQNB 1FMWA 3OPCA 2W2UA 2XQ9A 1N34T 2VKDA 2VVNA 5KMGP 2UU9T 4UEMA 4ZI3C 5JDMA 4DR2T 4M1PA 3SFEA 4TV8E 4X1KE 4TWDA 1QLBA 3Q5XA 3RIAA 2LKHA 5FXXA 3UU4A 5EK3A 4NXNT 3UQ7A 2PBIA 4ZS2A 4HWDA 3RI5A 2MTQA 3UU8A 4JI6T 1FMVA 4GYRA 2JMKA 2V5DA 3JAEA 4ZHQE 2WWUA 2MYSA 4JEUB 2XAFB 2BKNA 3AAEB 4EAHA 5ABHA 3V5UA 4IDZA 4TNVA 1YQ4A 5FY0A 3K3OA 2VASA 2YDQA 4YHJA 2LSJA 1MMAA 4IDPA 4AKHA 2BBHA 3UUXB 1IBMT 3RQWA 1D0ZA 2VL0A 4H9OC 1E1HB 4X5TA 3UULA 2NTYA 3ETVA 4MBQA 4L0RA 5LJNA 4DMWA 3Q5DA 4TWHA 4A98A 3CX8B 4JI4T 4YT0A 3P4SA 4UVAB 3ANWB 2XUEA 5CA0E 4LFBT 3T1YT 2UXCT 4ZI2C 2A3DA 2WDQA 4ZXLA 4PFOA 3VKGA 3LJCA 2X66A 2Z6EA 5LJMA 4CI1B 1HX8A 4UVCB 2BZBA 4X1IE 1MNEA 2ZM6T 4UV9B 2JIWA 5LYJE 4QX7B 4MHCA 3CWZB 3ZEFB 1D1AA 4YTNA 4U7YA 4O2BE 2H89A 1VRBA 2VL8A 4AKGA 3RYHE 5EZYE 4JI8T 1N36T 4B6XA 2XAHB 1YKEB 3AEAA 1XDPA 2WP9A 4K0UA 1WYCA 2FJAA 3NVOA 4HFVA 1VOMA 3JC6D 2XQAA 1VCSA 2YDRA 3O1HA 2E9XD 2DL1A 2L8KA 2H3RA 5HXRA 5JVDE 4U2YA 4ZZBA 4Q25A 4AQFC 2VQET 2KINB 4EZHA 1NEKA 5LG3A 3T1HT 4UF0A 2ES0A 3FZFB 4ILBA 3ZYLA 1IBKT 4HKAA 5HXHA 4F6RC 3N9MA 3OKQA 1S94A 4B3ST 4B3MT 3DTOA 2K48A 3D0TA 2Y48B 4HFDA 4P0AA 1KK7A 3O9XA 5FKYA 3P4WA 4GK0E 3ZCJA 4PJNA 3ZT7A 3LDQB 2LLYA 5AQHB 1U4QA 2BKPA 2DI4A 3UT5E 3J9X1 2PJQA 2X0YA 2WQYA 3V5SA 1KEYA 4HEAA 3PUZF 5LXTE 2IW5B 5LGUB 2BS3A 2IAKA 4ZI2D 2BG9E 4BJMA 2BG9C 2N2NA 1I94T 2L3LA 2YOEA 3VRAA 1CUNA 1GQEA 2W62A 4WW0A 5KX5E 5H6RB 2BS4A 4AQFA 5LHHB 3TLTA 1HF8A 3KFWX 5DQVA 2N1GA 4E7SA 3OTOT 2H7VC 3ONLC 2ODUA 5LGTB 4CN1A 5FNVE 2NP9A 2IMLA 4QKNA 4LF4T 2L9QA 5HEJA 3OYZA 2LKGA 2N9DA 3AA0B 1R8IA 3HL6A 2V7JA 5J2UE 4EGWA 3UFEA 3BQLA 3I0OA 2MPKA 3N2KE 3S4UA 3SWHA 4IREA 4ZS3A 3ZMVB 4HFIA 5J0ZA 5FVLA 3CK6A 5FMNA 4JBWF 4U7IA 4DV0T 2KNDA 2Q9QA 2V7MA 3N5LA 4TUYE 4CI2B 5LMUT 4AKLA 2V5CA 4GK5E 2XQ3A 2HN2A 2XQ4A 4F8HA 1ZOYA 2W0GA 4K0KT 3QNUA 4HWHA 5BR8T 5J1GA 4LMLA 2WY2A 1MIVA 4UF0B 3K1SA 2K24A 3AE9A 2WWVA 2CA5A 2ACZA 4EZ4A 5ETWA 2V7IA 3O4XE 5HAXA 3ZYMA 4GOUA 3P4RA 5L3BB 5L4EA 4O4JE 1NWMX 1V9DA 3CKDA 3HKEE 1WCRA 3ZPOA 5L4HA 4X1YE 5JR9C 2X9XA 3IEEA 2CHOA 1Y01A 2VQFT 1HCIA 3LFMA 2UUBT 2I59A 2DWKA 2QYWA 2C5KT 2WDVA 2H7OA 2KWIB
chains in the Genus database with same CATH topology
5AQFB 3FZKB 5AQHB 5AQIB 3FZMB 5AQRB 5AQQB 5AQJB 3FZLB 5AQOB 2D9DA 5AQPB 5AQGB 5AQLB 1M62A 4HWHA 4HWIB 4HWCA 3FZFB 5AQNB 5AQUB 3FZHB 5AQKB 4HWFA 5AQSB 5AQVB 5AQMB 1T7SA 5AQTB 1I6ZA 3M3ZB 1M7KA 1UK5A 1HX1B 3A8YC 3LDQB 1UGOA 4HWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQF B;  3FZK B;  5AQH B;  5AQI B;  3FZM B;  5AQR B;  5AQQ B;  5AQJ B;  3FZL B;  5AQO B;  2D9D A;  5AQP B;  5AQG B;  5AQL B;  1M62 A;  4HWH A;  4HWI B;  4HWC A;  3FZF B;  5AQN B;  5AQU B;  3FZH B;  5AQK B;  4HWF A;  5AQS B;  5AQV B;  5AQM B;  1T7S A;  5AQT B;  1I6Z A;  3M3Z B;  1M7K A;  1UK5 A;  1HX1 B;  3A8Y C;  3LDQ B;  1UGO A;  4HWD A; 
#chains in the Genus database with same CATH topology
 2LOS A;  1OWA A;  2ODV A;  4U74 A;  5AQG B;  4H9N C;  5AQV B;  3AB3 B;  5FL1 A;  2FUP A;  2HPJ A;  2X0H A;  3AA6 B;  2VK9 A;  4GIW A;  2LM2 A;  1CHU A;  2EHO C;  3RIU A;  2PG8 A;  2SPC A;  3AEE A;  1U5P A;  3PUR A;  2D0U A;  3SOL A;  2LSY A;  3IHR A;  2CXF A;  2J4G A;  1LRZ A;  4DUY T;  2UUC T;  5HEH A;  2J47 A;  4IE6 A;  3P4P A;  4EB6 E;  5L3G B;  1ZKE A;  3RF1 A;  2XQ8 A;  2OLT A;  3ZSS A;  3E22 E;  3H3M A;  2WDR A;  3QUJ A;  3BQI A;  4XZC A;  2HH7 A;  4PK4 A;  2K9A A;  3CQG B;  2C0S A;  4EXT A;  5JR9 A;  1BR1 A;  5ADX L;  4X65 T;  2DLR A;  2Q9Q B;  4U3C A;  3AVS A;  3Q5E A;  3NKZ A;  2V7K A;  1MMN A;  4DID B;  3PUS A;  4YJ3 E;  2LSG A;  2QGS A;  5IUX A;  4OX9 T;  2BKO A;  2OA5 A;  4DV5 T;  3WAJ A;  2BG9 B;  3ZCI A;  4KHP T;  3OBV E;  5JRE A;  1HG5 A;  2EHO A;  4N78 D;  4TZ4 C;  3GN5 A;  4I50 E;  3K3N A;  2LT3 A;  4DR6 T;  2NW7 A;  4JI7 T;  4OYK A;  2LHR A;  2XY8 B;  4IHJ E;  3QOF A;  4CXW A;  3AA1 B;  4YSZ A;  5KDM C;  1BR2 A;  3QB5 A;  5LG4 A;  3L09 A;  2X9W A;  4QXB B;  2W61 A;  1QUU A;  3UFG A;  3AE6 A;  2D5U A;  2FJD A;  1OED A;  2K5B B;  2VKH A;  3DJB A;  3P7I A;  4U2Z A;  2VVS A;  1HNW T;  4O4I E;  4UR9 A;  4ZZC A;  5TAO A;  1FIO A;  3IA3 A;  3LK4 2;  3ZMU B;  4H63 V;  1N32 T;  4EYU A;  3J7Y q;  5CA1 E;  3F57 A;  2IDO B;  3BK9 A;  2W67 A;  1IJ6 A;  2LHN A;  5L47 A;  4NIQ A;  3NBX X;  4A56 A;  4QH5 A;  4YY3 T;  5ABF A;  2QVA A;  4DVD A;  3NWI A;  4OYJ A;  2WS3 A;  2B76 A;  4GKJ T;  4DND A;  4JLE A;  5HEU A;  2XAQ B;  2QA7 A;  5ABE A;  3VKH A;  3PE0 A;  4ILC A;  2E8I A;  3KV9 A;  3CIR A;  5J2T E;  4C90 A;  3QK6 A;  3HKC E;  5IWA T;  5FVK A;  2FBW A;  4HWI B;  3AA7 B;  2KT9 A;  4EEB A;  4IDN A;  3C64 A;  4QX8 B;  4YTM A;  4YXD A;  5FXV A;  5JR9 B;  2A9U A;  1XZY A;  5LGN B;  3C98 B;  5LHI B;  4KHZ F;  3O1J A;  2HN1 A;  5AQM B;  1Y64 B;  4HFE A;  4PW8 A;  4IGU A;  5LMN T;  2E9X A;  4DV6 T;  3N2G E;  4HFC A;  4AXP A;  2A2F X;  2V7L A;  4H9Q C;  4H63 H;  5FXW A;  3CX6 B;  2JRK A;  2XZE A;  4QXC B;  4WBN E;  1G8X A;  3UUM A;  3KV6 A;  2IIU A;  3OYX A;  4IE4 A;  3LG7 A;  2WZH A;  2EHO B;  3ZMS B;  1LVF A;  2E2A A;  2XTL A;  1J5W A;  1W0A A;  4BA9 A;  3E0Z A;  3GN5 B;  1DU2 A;  3RRC A;  1HTJ F;  4ZI3 D;  2WAU A;  2H88 A;  2JMH A;  1J5E T;  4LF8 T;  5L3C B;  1D1B A;  3K8P C;  1L0V A;  2JPF A;  2WZI A;  4QH1 A;  1X9B A;  3RKO A;  2ZM2 A;  5JTG A;  3ONX A;  4EED A;  4IIJ E;  1OED B;  2ZM0 A;  4UIG A;  3ZC0 A;  1SE7 A;  3AE5 A;  1WR6 A;  3PUW F;  4P0B A;  3RIF A;  2BVM A;  3E08 A;  4DBQ A;  1FJG T;  2XAS B;  4JI2 T;  4YSY A;  4LMJ A;  3RC3 A;  5HWX A;  3G06 A;  5AQS B;  5H6Q B;  3N9N A;  5ABF B;  3NRY A;  1UGO A;  3UTK A;  4A97 A;  1MND A;  3KIN B;  2Q9Q C;  2I6H A;  4U33 A;  3C51 A;  4ILU A;  2X9H A;  4P1N A;  3CVR A;  2VB6 A;  4FJO A;  3AEB A;  5ABG A;  5FY1 A;  1M7K A;  2UUA T;  2IC6 A;  5DQW A;  4NXM T;  2X67 A;  4IDQ A;  1D1C A;  2V26 A;  4L5G A;  1IAP A;  3ZN1 B;  2WM9 A;  3SS1 A;  1T72 A;  1D0X A;  4QH4 A;  3PJA A;  4CN6 A;  5CJ5 A;  1WRD A;  2XSB A;  1XMO T;  4CXX A;  1XMQ T;  4H9R C;  3NZQ A;  2E9X B;  3ZMT B;  2HHH T;  3LSV A;  3UQ4 A;  5JQG E;  4CN4 A;  5LCY A;  3MZK B;  4DR7 T;  3C4W A;  2XQY A;  3HKD E;  3RLF F;  2D0T A;  4U31 A;  2XQ5 A;  3LK3 B;  2XJ7 A;  4NUV A;  5IHY A;  4PK5 A;  2KZ7 B;  3RYI E;  4WZX A;  1ZP0 A;  3TLW A;  2WMN A;  1KNP A;  3I1A A;  3UU5 A;  4P09 A;  3MXZ A;  2C5I T;  4LFC T;  1ZHC A;  2P9B A;  3AXJ A;  4B3R T;  2LE8 A;  2LSI A;  3HKB E;  3RIU C;  3FXE B;  5AFU L;  2UXN B;  5FYM A;  3MJX A;  5LNK A;  5E0O A;  1B7T A;  3LBX A;  4LF5 T;  1W09 A;  4UVB B;  1HNZ T;  5DAB A;  4ASK A;  1YD8 G;  3W15 B;  2YEV C;  3PUG A;  1KNR A;  4JI0 T;  2B1E A;  2OV9 A;  1O3X A;  4ZEY A;  3GMI A;  4OHF A;  1JNR A;  2D2S A;  5KXJ A;  4DMV A;  3UU6 A;  4DV4 T;  3EHZ A;  2F4V T;  2WSS V;  1OXZ A;  1KF6 A;  4ANJ A;  4JI3 T;  3RRW A;  2XM2 A;  3B13 A;  3PU3 A;  5IYZ E;  4PAG A;  2JQ9 A;  2LM9 A;  2X51 A;  1NEN A;  5CB4 E;  2FJB A;  2LRK A;  4OFZ A;  4G63 A;  4EYY R;  5AQK B;  2K3W A;  2A72 A;  3MA9 A;  2CPT A;  2IHR 1;  4GYS A;  4CXY A;  3AE2 A;  5HCJ A;  3TLS A;  3KBU A;  3KBT A;  2BS2 A;  1T98 A;  3FXD B;  3A7M A;  2CBJ A;  3TLV A;  2KMF A;  1MIY A;  3RQU A;  4U72 A;  2YN6 A;  5AQF B;  5JDL A;  3FBL A;  2VKJ A;  4X64 T;  3FHN A;  3HI2 A;  4TWF A;  3CQX C;  3AEC A;  4IDO A;  4CI3 B;  4LFA T;  3PTR B;  1I6Z A;  3AE3 A;  4ISS A;  3AAA B;  3NRX A;  3AEG A;  2E5L T;  4JV5 T;  3AEF A;  4ZOL E;  3EUH A;  2CXD A;  2WB5 A;  4YSX A;  4IE0 A;  2YU1 A;  1OED E;  1OED C;  4KI0 F;  3DP7 A;  1IJ5 A;  2RPA A;  4E7Z A;  5HEO A;  2JQQ A;  3PUX F;  5JRC A;  4Z91 A;  5HEG A;  3SFD A;  5A1L A;  3HA4 A;  1BR0 A;  1KFY A;  3AXJ B;  2VKO A;  3GWH A;  3FZL B;  2XAJ B;  2XM1 A;  2DHR A;  3A5X A;  2DWG A;  3B57 A;  5FXZ A;  3QC9 A;  3LBX B;  3ZN0 B;  4H9S E;  2PFV A;  2W4X A;  3IF8 B;  1WFD A;  1G73 A;  2YIN A;  4MLK A;  4PJL A;  4AIU A;  2RA1 A;  3GA8 A;  2MBG A;  1UUR A;  3IBP A;  4I55 E;  4TV9 E;  5FP3 A;  3TKL B;  3Q5W A;  4DV7 T;  2ZLY A;  4KBM B;  3I9W A;  4DR1 T;  2WU5 A;  5FL0 A;  1WYB A;  2CBI A;  3PJA J;  3FZM B;  3EAM A;  3RHW A;  1XDO A;  2W63 A;  1X79 A;  3AE4 A;  3CML A;  3KVA A;  2HPL A;  2VWA A;  4MAL A;  3L39 A;  3WI3 A;  1VCT A;  1IZN B;  1BR4 A;  4PFP A;  4ILA A;  3ZC1 A;  3JC6 C;  2E9X C;  1LKX A;  4IST A;  4O8S A;  1UUS A;  5FY7 A;  1LVK A;  2CLY B;  1HX1 B;  3ZJ2 A;  4B3T T;  2CE7 A;  4DUZ T;  4V1A v;  4UV8 B;  5AQR B;  2FJE A;  5M4Y A;  1HFA A;  4LF6 T;  2EHO D;  2NW9 A;  3P4Q A;  2JQK A;  4IE7 A;  2JJ9 A;  3UUB A;  3X1D A;  1US7 B;  4LF7 T;  1MIW A;  1YKH B;  3U78 A;  2I0M A;  2D9D A;  5HXS A;  3EDU A;  2W66 A;  4TN7 B;  5C3J A;  4ADZ A;  1HG2 A;  3JCF A;  1EZ3 A;  3C50 A;  4NUU A;  5HYA A;  2Y8D A;  3N2O A;  2JQH A;  3KDS E;  3P50 A;  4DV1 T;  3EAB A;  3RPU A;  4BJN A;  5EK4 A;  5JRC B;  4YJ2 E;  4WNK A;  3OJA A;  4GKK T;  3KV5 A;  4DR3 T;  2NW8 A;  2UXX B;  1JNZ A;  3RX6 A;  4YTP A;  5HXE A;  2UXD T;  3ONJ A;  1YQ3 A;  2DNX A;  4DR4 T;  5HWY A;  3MAC A;  5DJQ C;  4TNW A;  4AKR B;  4JYA T;  3O1I A;  5LB7 B;  2CEA A;  4AI6 A;  3RH3 A;  4I0U A;  3MKD A;  3I0Q A;  4NPP A;  3A8Y C;  3K3Q C;  4C91 A;  5AQJ B;  3SRZ A;  5AQO B;  4PJJ A;  3I9Y A;  4BAY B;  4HWF A;  1UX4 A;  2CRB A;  3U3I A;  2BBJ A;  3N9Q A;  1ZEE A;  3VU7 H;  4KX6 A;  4QHO A;  5AQI B;  3FBZ A;  4JI5 T;  5AQQ B;  5JDH A;  3CX7 B;  3KVB A;  4AQY T;  3VR8 A;  2CHN A;  3AED A;  2R6G F;  3ESL A;  2XSA A;  5CFB A;  3ZJ1 A;  2WU2 A;  2VUR A;  3CPZ A;  2NOX A;  2LSK A;  4IL9 A;  4Z8X A;  1UCU A;  5JDQ A;  5AQL B;  2X68 A;  1T8B A;  4DO0 A;  3C4X A;  5C8Y E;  5HCM A;  3WAK A;  4HGA A;  4JUY A;  1XNQ T;  5F8P A;  1MMD A;  2KWH A;  4UEL A;  3QB5 K;  3PUQ A;  3AE7 A;  3PDY A;  4WBO A;  2AXD S;  2KXP B;  2CCQ A;  2X0L B;  1WLX A;  4Z90 A;  3AE1 A;  4G2A A;  4I43 B;  1QSD A;  4HTE A;  3NZP A;  4O2A E;  3JAF A;  2WMO A;  3N9L A;  1XNR T;  2CM0 A;  4A5X A;  2YDS A;  4DBR A;  5AQU B;  2DCF A;  3MK7 C;  3M65 A;  2ZM8 A;  3H37 A;  4J2C A;  4KMC A;  1YW0 A;  2KSR A;  4FI5 A;  1FEW A;  5GON E;  5F5W A;  4DV2 T;  3RYF E;  2V6Y A;  5L3D B;  3L8R A;  5JDN A;  3PV0 F;  2YKS A;  3LK2 B;  4UXN B;  4HFH A;  1H7C A;  5L2L A;  5L3E B;  2J62 A;  3PUY F;  2XAG B;  5F3J A;  4YHH T;  2NTX A;  2GK9 A;  4HFB A;  2CLY C;  3RYC E;  2E5V A;  2UXB T;  2ACX A;  2KLQ A;  4WYV A;  2LOP A;  3F31 A;  2LEH A;  3AVR A;  1Z0P A;  3AE8 A;  1SHZ C;  1NAF A;  2IUB A;  4AIS A;  4LMK A;  1S35 A;  3Q2M A;  4EIW A;  1D0Y A;  4YLH A;  3HR0 A;  5LHG B;  5JH7 E;  3CQC B;  3ZT5 A;  5AQT B;  2LJL A;  2X9Y A;  1E7P A;  2M6I A;  4XBF B;  1AJ3 A;  2YU2 A;  2CWY A;  4IT4 A;  3ZLI A;  2WBL A;  2YK0 A;  4MFR A;  2J1D G;  4PK6 A;  2W00 A;  4O4H E;  5CGM A;  2XQ7 A;  2M67 A;  2AE9 A;  1IBL T;  1SA0 E;  4COF A;  4IL4 A;  4QXH B;  2BVL A;  2MAW A;  4PNI A;  3B5M A;  3ABV A;  1W0B A;  4O4L E;  5LBQ B;  3TLU A;  5EK2 A;  3H3A A;  4X20 E;  3UUN A;  3VHL A;  3ZT6 A;  2LRL A;  3ZST A;  2BG9 A;  5L3F B;  3EI0 A;  3EDV A;  3N9O A;  2IC9 A;  4AQG A;  4AKI A;  1W9R A;  4X62 T;  3AAI A;  2Q9Q D;  3ETU A;  2XPK A;  1UK5 A;  4DR5 T;  2Y6X A;  4JI1 T;  1XWM A;  2V1D B;  2CXL A;  4YFS A;  5AQP B;  4H9P C;  5LP6 E;  4HE8 A;  4PJM A;  1M62 A;  5BMV E;  1SUM B;  4KUM B;  5LOV E;  3JAD A;  4LF9 T;  5HXC A;  4ZI7 E;  3FZK B;  3ZMZ B;  2ZMA A;  1ZV4 X;  4HN9 A;  4I4T E;  4XAX B;  4CZZ B;  5LA6 E;  1KNZ A;  4KP3 C;  3R6N A;  4EOZ B;  2V6Y B;  3BQK A;  3M3Z B;  2PTF A;  2G0U A;  4CQI A;  3ZYK A;  3RKG A;  2CWO A;  1MMG A;  3FB2 A;  3R84 B;  4X66 T;  2QRX A;  3F2E A;  3L3P A;  3N9P A;  4TX5 A;  3PUA A;  5LBM A;  3RC8 A;  2RP4 A;  4JEH B;  2C5J A;  1Z8U A;  2NWB A;  2BDE A;  3VRB A;  3RGL A;  1YXR A;  3EVY A;  2M6B A;  2XQ6 A;  4DV3 T;  4ERR A;  1J1J A;  1N33 T;  1WR0 A;  3ANW A;  5JDG A;  1HR0 T;  3ZKR A;  2NR4 A;  3C4Z A;  2CMR A;  3KV4 A;  3PUV F;  4IE5 A;  2V6X A;  1HNX T;  2WCA A;  3UU3 A;  3PU8 A;  4HWC A;  3FZH B;  4EV6 A;  2MOZ A;  3VR9 A;  1UX5 A;  1T7S A;  1HS7 A;  2V8S V;  4L9I A;  3OVU A;  5JDF A;  3Q9D A;  3P8C D;  4OK0 A;  2XHE B;  4QWN B;  1E2A A;  3T8O A;  5C2T A;  5AQN B;  1FMW A;  3OPC A;  2W2U A;  2XQ9 A;  1N34 T;  2VKD A;  2VVN A;  5KMG P;  2UU9 T;  4UEM A;  4ZI3 C;  5JDM A;  4DR2 T;  4M1P A;  3SFE A;  4TV8 E;  4X1K E;  4TWD A;  1QLB A;  3Q5X A;  3RIA A;  2LKH A;  5FXX A;  3UU4 A;  5EK3 A;  4NXN T;  3UQ7 A;  2PBI A;  4ZS2 A;  4HWD A;  3RI5 A;  2MTQ A;  3UU8 A;  4JI6 T;  1FMV A;  4GYR A;  2JMK A;  2V5D A;  3JAE A;  4ZHQ E;  2WWU A;  2MYS A;  4JEU B;  2XAF B;  2BKN A;  3AAE B;  4EAH A;  5ABH A;  3V5U A;  4IDZ A;  4TNV A;  1YQ4 A;  5FY0 A;  3K3O A;  2VAS A;  2YDQ A;  4YHJ A;  2LSJ A;  1MMA A;  4IDP A;  4AKH A;  2BBH A;  3UUX B;  1IBM T;  3RQW A;  1D0Z A;  2VL0 A;  4H9O C;  1E1H B;  4X5T A;  3UUL A;  2NTY A;  3ETV A;  4MBQ A;  4L0R A;  5LJN A;  4DMW A;  3Q5D A;  4TWH A;  4A98 A;  3CX8 B;  4JI4 T;  4YT0 A;  3P4S A;  4UVA B;  3ANW B;  2XUE A;  5CA0 E;  4LFB T;  3T1Y T;  2UXC T;  4ZI2 C;  2A3D A;  2WDQ A;  4ZXL A;  4PFO A;  3VKG A;  3LJC A;  2X66 A;  2Z6E A;  5LJM A;  4CI1 B;  1HX8 A;  4UVC B;  2BZB A;  4X1I E;  1MNE A;  2ZM6 T;  4UV9 B;  2JIW A;  5LYJ E;  4QX7 B;  4MHC A;  3CWZ B;  3ZEF B;  1D1A A;  4YTN A;  4U7Y A;  4O2B E;  2H89 A;  1VRB A;  2VL8 A;  4AKG A;  3RYH E;  5EZY E;  4JI8 T;  1N36 T;  4B6X A;  2XAH B;  1YKE B;  3AEA A;  1XDP A;  2WP9 A;  4K0U A;  1WYC A;  2FJA A;  3NVO A;  4HFV A;  1VOM A;  3JC6 D;  2XQA A;  1VCS A;  2YDR A;  3O1H A;  2E9X D;  2DL1 A;  2L8K A;  2H3R A;  5HXR A;  5JVD E;  4U2Y A;  4ZZB A;  4Q25 A;  4AQF C;  2VQE T;  2KIN B;  4EZH A;  1NEK A;  5LG3 A;  3T1H T;  4UF0 A;  2ES0 A;  3FZF B;  4ILB A;  3ZYL A;  1IBK T;  4HKA A;  5HXH A;  4F6R C;  3N9M A;  3OKQ A;  1S94 A;  4B3S T;  4B3M T;  3DTO A;  2K48 A;  3D0T A;  2Y48 B;  4HFD A;  4P0A A;  1KK7 A;  3O9X A;  5FKY A;  3P4W A;  4GK0 E;  3ZCJ A;  4PJN A;  3ZT7 A;  3LDQ B;  2LLY A;  5AQH B;  1U4Q A;  2BKP A;  2DI4 A;  3UT5 E;  3J9X 1;  2PJQ A;  2X0Y A;  2WQY A;  3V5S A;  1KEY A;  4HEA A;  3PUZ F;  5LXT E;  2IW5 B;  5LGU B;  2BS3 A;  2IAK A;  4ZI2 D;  2BG9 E;  4BJM A;  2BG9 C;  2N2N A;  1I94 T;  2L3L A;  2YOE A;  3VRA A;  1CUN A;  1GQE A;  2W62 A;  4WW0 A;  5KX5 E;  5H6R B;  2BS4 A;  4AQF A;  5LHH B;  3TLT A;  1HF8 A;  3KFW X;  5DQV A;  2N1G A;  4E7S A;  3OTO T;  2H7V C;  3ONL C;  2ODU A;  5LGT B;  4CN1 A;  5FNV E;  2NP9 A;  2IML A;  4QKN A;  4LF4 T;  2L9Q A;  5HEJ A;  3OYZ A;  2LKG A;  2N9D A;  3AA0 B;  1R8I A;  3HL6 A;  2V7J A;  5J2U E;  4EGW A;  3UFE A;  3BQL A;  3I0O A;  2MPK A;  3N2K E;  3S4U A;  3SWH A;  4IRE A;  4ZS3 A;  3ZMV B;  4HFI A;  5J0Z A;  5FVL A;  3CK6 A;  5FMN A;  4JBW F;  4U7I A;  4DV0 T;  2KND A;  2Q9Q A;  2V7M A;  3N5L A;  4TUY E;  4CI2 B;  5LMU T;  4AKL A;  2V5C A;  4GK5 E;  2XQ3 A;  2HN2 A;  2XQ4 A;  4F8H A;  1ZOY A;  2W0G A;  4K0K T;  3QNU A;  4HWH A;  5BR8 T;  5J1G A;  4LML A;  2WY2 A;  1MIV A;  4UF0 B;  3K1S A;  2K24 A;  3AE9 A;  2WWV A;  2CA5 A;  2ACZ A;  4EZ4 A;  5ETW A;  2V7I A;  3O4X E;  5HAX A;  3ZYM A;  4GOU A;  3P4R A;  5L3B B;  5L4E A;  4O4J E;  1NWM X;  1V9D A;  3CKD A;  3HKE E;  1WCR A;  3ZPO A;  5L4H A;  4X1Y E;  5JR9 C;  2X9X A;  3IEE A;  2CHO A;  1Y01 A;  2VQF T;  1HCI A;  3LFM A;  2UUB T;  2I59 A;  2DWK A;  2QYW A;  2C5K T;  2WDV A;  2H7O A;  2KWI B; 
#chains in the Genus database with same CATH homology
 5AQF B;  3FZK B;  5AQH B;  5AQI B;  3FZM B;  5AQR B;  5AQQ B;  5AQJ B;  3FZL B;  5AQO B;  2D9D A;  5AQP B;  5AQG B;  5AQL B;  1M62 A;  4HWH A;  4HWI B;  4HWC A;  3FZF B;  5AQN B;  5AQU B;  3FZH B;  5AQK B;  4HWF A;  5AQS B;  5AQV B;  5AQM B;  1T7S A;  5AQT B;  1I6Z A;  3M3Z B;  1M7K A;  1UK5 A;  1HX1 B;  3A8Y C;  3LDQ B;  1UGO A;  4HWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...