5AQTB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
b'GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
molecule tags Chaperone
source organism Homo sapiens
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqtB00
5AQTB 3FZMB 5AQNB 5AQHB 4HWCA 5AQJB 1UGOA 5AQMB 5AQRB 1M62A 1HX1B 5AQVB 5AQOB 4HWDA 4HWFA 5AQUB 1UK5A 3FZFB 5AQFB 4HWHA 1I6ZA 2D9DA 3A8YC 3FZKB 3FZHB 5AQSB 5AQQB 5AQGB 4HWIB 5AQLB 1M7KA 5AQPB 1T7SA 5AQIB 3LDQB 3FZLB 3M3ZB 5AQKB
chains in the Genus database with same CATH superfamily
2VKOA 4ZS3A 2XM2A 3EABA 3VR9A 1SA0E 2NOXA 3P7IA 2LSKA 3K1SA 5DQWA 3UUMA 4F8HA 5BMVE 4K0KT 2XSAA 3P50A 3AB3B 4ZI2C 4IT4A 5HYAA 3ZC0A 5JDNA 1HCIA 1T72A 5ADXL 1WFDA 2HHHT 4E7SA 3AE9A 2PBIA 1FEWA 1WYBA 2LE8A 1IZNB 4O4HE 3ZJ1A 4DMWA 5LBQB 3EAMA 2OLTA 4ZEYA 4LMKA 3LBXA 3SOLA 2FJBA 2VQET 3UU5A 1BR4A 2JMKA 3PUGA 4Z90A 4I0UA 2V26A 1BR2A 1W09A 2E5VA 3PJAJ 1MNDA 4IE0A 2FUPA 4H9RC 5HEGA 3E0ZA 5AQGB 1D1BA 3H3MA 2FBWA 4EZHA 4F6RC 4JI1T 2CBIA 4JLEA 5H6QB 5HEUA 3ZT7A 1J1JA 4QXHB 1OXZA 5ABGA 4B6XA 5H6RB 5C2TA 4B3RT 5FY7A 3N9QA 4LF8T 4ZHQE 3TLWA 3N9MA 3IBPA 5LHHB 4HGAA 1JNZA 1OEDE 2J1DG 3CIRA 2CMRA 3T8OA 4BJMA 4DNDA 4EOZB 4YFSA 2XJ7A 4X66T 3N9NA 1IBLT 2ACZA 3UU4A 3CMLA 2HN2A 4BA9A 3BQLA 3CQGB 1NAFA 3KV4A 5CFBA 2R6GF 4GIWA 2BG9C 4XAXB 5AQFB 2HH7A 4HFHA 4WW0A 3V5UA 4LF6T 2EHOC 2MYSA 4A56A 5FXZA 2BS2A 4HFCA 4COFA 2BDEA 3FXDB 4ZI3C 3UUNA 5LGTB 3RIUC 2UU9T 4KHZF 4V1Av 3PUAA 2ODUA 3NVOA 4IDQA 5ETWA 2UUCT 5FYMA 1WR6A 1YKEB 5J2TE 4CI2B 2XY8B 4CXWA 3ONLC 4AQYT 4IL9A 4O4LE 4QHOA 2XAFB 3PUZF 5FMNA 3RRWA 3AA7B 4BJNA 2X68A 2EHOD 4YXDA 3W15B 2Z6EA 2BG9E 5TAOA 4ERRA 3EDVA 2K9AA 2Y6XA 4X5TA 2WDVA 5HCJA 3ONJA 2K48A 1FMWA 2X0LB 3KV9A 1Z8UA 5JQGE 5LYJE 2V7KA 5HAXA 4ZZCA 4DV2T 3B13A 4JEUB 2XQYA 2LOSA 3RC8A 5LNKA 3FZFB 3PUVF 4HWHA 3FB2A 3A7MA 2D0UA 3K8PC 4I43B 5FY0A 4ZOLE 3PUXF 2WDRA 2D0TA 4ZI3D 3MA9A 3CX7B 2WAUA 2WY2A 2CLYC 2VB6A 3AEEA 3I0OA 4U74A 3QB5A 2IAKA 2LOPA 3NRYA 2FJAA 2NTXA 3OJAA 1M7KA 2WWVA 2UXCT 3C64A 4QH4A 1D1CA 3RIAA 2E9XB 5FXVA 3MZKB 3F57A 2W4XA 3ZPOA 2ZM0A 4YJ2E 2WU5A 1QLBA 3QC9A 4X1KE 2KWHA 4IHJE 4AIUA 2UUAT 2BKPA 5J0ZA 3ZYMA 1YKHB 4PJJA 4UR9A 1LVKA 3PDYA 2V1DB 2XHEB 2LHNA 2WWUA 3EUHA 4HN9A 4ISSA 5HXCA 3UFGA 4YTNA 5JDHA 5JTGA 5L47A 2Y48B 4H9SE 2XUEA 4LMJA 5L3FB 4EV6A 2W0GA 2YINA 4DUYT 4FI5A 3E08A 4HWFA 4B3ST 3AAEB 4B3TT 5LGUB 2SPCA 2Y8DA 2ES0A 4DBQA 5FL1A 1KEYA 2UXNB 4MFRA 2YU2A 3O4XE 4PJLA 4ZZBA 4LFAT 3EVYA 1D1AA 5LA6E 4NXNT 4GKKT 4U33A 2XQ9A 2VL0A 5JR9A 2QGSA 2AE9A 4TN7B 1E2AA 1W9RA 2FJDA 1YW0A 4TNVA 2ZM8A 2ZLYA 2K5BB 2UXXB 3AE8A 4UV8B 3UFEA 2LSJA 1HF8A 4P0BA 3UTKA 5J2UE 3AECA 3FZLB 2X9WA 3K3NA 4ILUA 4Z91A 5KDMC 4J2CA 2LSIA 3PU8A 4K0UA 1VOMA 3PURA 5L3DB 3C98B 3CWZB 4CXXA 1XNQT 2OA5A 1UCUA 3CKDA 4H9PC 5AQJB 3HR0A 4JI5T 1UGOA 3VKGA 4H9OC 5JVDE 4IE4A 2XSBA 3DP7A 3ZJ2A 4U2YA 3AE5A 5KXJA 1HX1B 2QYWA 1XDPA 1MMDA 3ZT6A 2H7OA 3AXJA 3JC6C 3UQ7A 5AQUB 3PE0A 2NWBA 5IWAT 5LOVE 3TLTA 3FHNA 3QB5K 2MOZA 2V7MA 2E9XA 3A8YC 2M6IA 3T1HT 5JDQA 3I9WA 2YOEA 5LG3A 2WMNA 4PW8A 1N36T 3ETVA 2XZEA 3ESLA 1BR1A 3PUSA 2WQYA 3F2EA 4U31A 4GYRA 5ABFB 2PJQA 4OFZA 1MIYA 4YSYA 2V5DA 4LF4T 2QA7A 4U7YA 2V7JA 3AVSA 3GMIA 3IF8B 3KBUA 2VK9A 4PK5A 2M6BA 2CLYB 4LFBT 4TWDA 1J5ET 1VCTA 4BAYB 2WB5A 4L0RA 2IC9A 3CX8B 4ISTA 4DV4T 4HKAA 5JDLA 5DABA 3AE6A 3ZT5A 2XQ8A 3PTRB 5JRCA 4HWDA 2BZBA 4L5GA 2N2NA 2LSYA 2ZMAA 3KV6A 4UVCB 3L09A 2DLRA 2IUBA 2H3RA 2X9HA 2NR4A 5L3EB 2NW9A 2C5KT 3ZCIA 5HXHA 1UX5A 2A3DA 2WBLA 3FZKB 4HTEA 4PJNA 4QX8B 5AQQB 3UU6A 1I94T 4CN1A 4YTMA 3LFMA 3RH3A 1B7TA 5JREA 3I1AA 2WS3A 2VURA 4O2BE 4DBRA 4X62T 4KMCA 2V8SV 4A5XA 1KFYA 2E9XD 3CVRA 2LT3A 5EK4A 1ZP0A 2XQAA 1HNZT 2PFVA 2LRLA 3D0TA 3NKZA 4MALA 5LBMA 2BS4A 1HFAA 2XAQB 1WCRA 3R6NA 2G0UA 4I4TE 4XZCA 5A1LA 5ABHA 2XPKA 1M62A 3NRXA 5BR8T 3ANWB 4QKNA 1SE7A 3GWHA 2E8IA 3JCFA 4OX9T 4C90A 3AE7A 3JC6D 3Q5XA 4OHFA 4DV0T 4AQGA 4DIDB 2LRKA 5CJ5A 3KBTA 1GQEA 1CUNA 2WP9A 2JJ9A 1ZHCA 3DJBA 5JDGA 3AAIA 5F3JA 2CCQA 3N9OA 4JBWF 2NP9A 2BKNA 3CQCB 3Q2MA 2X0YA 5LP6E 4NXMT 1J5WA 3BK9A 5HEOA 4ANJA 5AQPB 1T7SA 2N1GA 4KI0F 3C4ZA 2KSRA 3I9YA 3PUWF 4NIQA 3VHLA 1HNXT 5FP3A 4QH1A 5JR9B 2X9YA 1CHUA 5AQHB 3IHRA 3RLFF 1IBKT 1WRDA 4JI6T 1US7B 2D2SA 4P1NA 4U2ZA 4U3CA 2CBJA 1XWMA 4KBMB 3S4UA 5HXEA 4CXYA 4DV5T 5LCYA 2BVLA 5LG4A 3RF1A 4JI3T 3N9LA 3ZMZB 4U72A 5L3GB 2WSSV 2DWKA 2I6HA 4O8SA 1ZV4X 3LG7A 3HKEE 1UK5A 3EI0A 1XNRT 3RPUA 3OTOT 4LF5T 4Z8XA 2M67A 2WCAA 2JQ9A 3RYCE 2VQFT 3AA1B 1D0XA 2I0MA 5L3BB 3MK7C 3PUQA 4PFPA 3SFDA 2UXDT 4JI2T 3E22E 2JRKA 1Z0PA 1FIOA 5FVKA 3JADA 2X51A 1X79A 4DR7T 3N5LA 4TV8E 1QUUA 4JEHB 2VVNA 3VRAA 4HFDA 2ODVA 2CWYA 5HEJA 4HWCA 5EZYE 3AEDA 4AXPA 1Y01A 2A9UA 4X65T 1MMNA 3AE1A 3QK6A 3ZYKA 3BQIA 3ZN0B 5JRCB 1YXRA 5LHIB 1VRBA 1LVFA 1T98A 2VKHA 1SHZC 4CI3B 2J62A 3ZC1A 4YY3T 2CHNA 3H37A 4H63V 3OVUA 3X1DA 2YDRA 4ILCA 4PAGA 4HE8A 5FVLA 2Q9QC 2CRBA 3GN5B 3L8RA 4HFVA 1V9DA 2KMFA 5LJMA 5EK3A 2D9DA 1E7PA 5JR9C 3H3AA 2IW5B 3GN5A 4AQFC 4EIWA 4LF7T 3ZN1B 4DO0A 1N32T 4AKHA 3RRCA 3UUXB 2YDQA 3UUBA 3ETUA 4UF0A 1KF6A 3AE3A 3EDUA 4UVBB 1N33T 3ONXA 2YK0A 3T1YT 3J9X1 5AQIB 3QOFA 4CN6A 3RGLA 5JH7E 1H7CA 3HKDE 3RKOA 4HFBA 4EEBA 2DWGA 1S35A 5CA1E 5AQKB 2UUBT 1FJGT 1XMQT 1ZKEA 3FZMB 5KX5E 2LEHA 4WBOA 1S94A 2C5JA 4TWHA 2CWOA 4ADZA 2F4VT 4DR4T 1HR0T 4DMVA 4KHPT 3ZSSA 3F31A 4G2AA 2BKOA 3C4WA 1OWAA 2RPAA 4GYSA 1HG5A 1XZYA 4YSZA 5CGMA 2V7IA 3FBLA 2W66A 4TV9E 5IHYA 2XAGB 3ZSTA 3AE4A 3LK42 3OYZA 3RKGA 4AKIA 2YN6A 4O4IE 3NWIA 3C50A 2P9BA 4PJMA 3FXEB 1R8IA 1UURA 2J47A 1IJ5A 3PU3A 3C4XA 3OPCA 5FXWA 1HNWT 3LJCA 2UXBT 2L8KA 5HEHA 4MHCA 3VU7H 5CA0E 1HS7A 5J1GA 2I59A 3FZHB 4EB6E 3AEFA 3Q5EA 3EHZA 3Q9DA 2KT9A 5GONE 2CM0A 3ABVA 1T8BA 2V5CA 1U4QA 2VKJA 3J7Yq 4B3MT 4P09A 2LSGA 3KDSE 3UU3A 3ZMSB 5LHGB 1U5PA 2XAHB 2E5LT 2XTLA 2W67A 4Q25A 5FNVE 4JI4T 2HPLA 3A5XA 4JI8T 5F8PA 1KNZA 3ZCJA 4IREA 1HG2A 3OBVE 3RX6A 1W0BA 3RYFE 4PK4A 1LRZA 2E9XC 4N78D 4TNWA 3SWHA 3RIFA 2JQQA 3LBXB 3L3PA 3M65A 4UXNB 1IAPA 4X1YE 2A2FX 3P4SA 1MMGA 1NWMX 4QWNB 5AQRB 3HKBE 5JDMA 4ILBA 4JV5T 1WR0A 3K3QC 2LM2A 4NPPA 5HWYA 2HN1A 3RIUA 3KV5A 3TLSA 2GK9A 4FJOA 5FXXA 4AKRB 5FY1A 2LLYA 2RA1A 3AXJB 3DTOA 2IC6A 3LK3B 4JYAT 2CHOA 4HWIB 2X67A 4I55E 4PK6A 3O1HA 3ZMVB 5CB4E 2BG9A 4OK0A 4ASKA 3AEBA 3WAKA 3HL6A 1EZ3A 3RC3A 3WAJA 2IMLA 3AVRA 5AQNB 4JUYA 5M4YA 4YJ3E 4G63A 2XQ6A 5ABFA 4IL4A 2ACXA 4ILAA 4HFEA 3ANWA 4PFOA 5C8YE 4DUZT 2ZM6T 1MIVA 4A97A 3CPZA 4M1PA 1FMVA 3RI5A 4JI7T 2VL8A 4WZXA 2JQHA 5AQVB 4EAHA 4UVAB 2NW8A 4H9NC 1XMOT 2QRXA 2CEAA 2KNDA 1G73A 3GA8A 4MLKA 3UT5E 3VRBA 4GK5E 1YQ3A 2W00A 5KMGP 3P4RA 1I6ZA 1KK7A 3RQUA 1AJ3A 4YHHT 2EHOA 2V6XA 2LM9A 4EZ4A 4NUVA 5L2LA 4UF0B 4AI6A 3AEGA 3U3IA 5DQVA 2DNXA 3PV0F 4KX6A 1DU2A 5HWXA 3RHWA 4MBQA 4O2AE 4X20E 2CXLA 1MMAA 2VASA 2XASB 3CQXC 3NBXX 3RYHE 3L39A 2WM9A 2D5UA 5L3CB 3UU8A 4WBNE 2JPFA 2WZIA 1YD8G 1UX4A 4CN4A 5ABEA 2BVMA 3LDQB 4UV9B 3M3ZB 4EYUA 3OKQA 4OYKA 5FL0A 5LB7B 3ZYLA 3B5MA 4IE7A 3ZMUB 2WZHA 3P4PA 4H63H 1IBMT 2NW7A 4DR5T 2H89A 2HPJA 2VVSA 4TX5A 3PUYF 4CQIA 4YTPA 4IIJE 5E0OA 2BG9B 3ZLIA 4P0AA 3N2OA 2DHRA 2B76A 2FJEA 2JIWA 4ZXLA 4AKLA 3VR8A 2BBJA 2IDOB 4DVDA 2XAJB 3SRZA 1KNPA 1YQ4A 4LFCT 1HTJF 2XM1A 1G8XA 2W2UA 1MIWA 2AXDS 3PJAA 4LMLA 5FKYA 4DV7T 5HXSA 3SS1A 3P8CD 2IHR1 2KLQA 3JAEA 4ZI2D 1BR0A 1VCSA 3AEAA 3I0QA 4IE6A 4X64T 2NTYA 3TLVA 4IE5A 3IEEA 5AQLB 2J4GA 5F5WA 4E7ZA 3K3OA 2YEVC 2MAWA 3NZPA 2Q9QB 3LK2B 2KWIB 1X9BA 2JQKA 3P4QA 4IDPA 1QSDA 2RP4A 4YSXA 1XDOA 2DI4A 2LJLA 2BS3A 2V6YB 3UULA 5L4HA 2CA5A 2VKDA 2BBHA 2W61A 2EHOB 5AQMB 3R84B 2DL1A 3B57A 1HX8A 2XQ5A 1L0VA 1MNEA 3AAAB 3SFEA 1OEDA 5LJNA 3CX6B 2N9DA 2X0HA 4OYJA 5AQOB 4QXBB 1OEDB 2V7LA 5L4EA 3FBZA 3ZKRA 2WDQA 4GKJT 2CPTA 2DCFA 2LHRA 3TLUA 4X1IE 4YHJA 3Q5DA 3O1JA 4GK0E 5EK2A 5AQSB 1NENA 4HFIA 4I50E 2ZM2A 3N2KE 3QNUA 4DV3T 1SUMB 4UIGA 3BQKA 4JI0T 2KZ7B 2C5IT 2L3LA 2JMHA 3AE2A 4IDZA 3TKLB 4CZZB 4YT0A 1N34T 2IIUA 4QH5A 4DV1T 3KFWX 4PNIA 2K24A 3RQWA 5AQTB 4EYYR 5LGNB 1KNRA 2OV9A 2WMOA 4HEAA 4WYVA 2K3WA 2L9QA 2Q9QD 3MACA 4L9IA 5LXTE 4AQFA 4O4JE 3KVAA 4IDNA 3AA6B 5IYZE 4DR1T 4WNKA 4NUUA 3CK6A 1E1HB 3MXZA 3LSVA 3N9PA 3ZEFB 3HI2A 1ZEEA 2X9XA 3AA0B 4UEMA 4DR2T 5AFUL 4YLHA 2MBGA 2H88A 4TUYE 3UQ4A 5JDFA 2VWAA 2YU1A 4GOUA 5LMNT 3OYXA 3MJXA 4EEDA 2KINB 1JNRA 1LKXA 1NEKA 2CE7A 1O3XA 3P4WA 1WLXA 2B1EA 3KINB 4IGUA 4H9QC 5DJQC 4UELA 1OEDC 3JAFA 4AKGA 3RYIE 2H7VC 4C91A 2WU2A 5IUXA 4LF9T 4KP3C 2XQ7A 2X66A 1D0ZA 2E2AA 4ZI7E 4A98A 4QX7B 2CXFA 3O9XA 5C3JA 3VKHA 4TWFA 4EXTA 1ZOYA 4AISA 3C51A 4IDOA 4U7IA 1IJ6A 2PTFA 2YKSA 1WYCA 2LKGA 2XQ4A 3MKDA 3NZQA 5LMUT 3QUJA 3G06A 2A72A 3ZMTB 3KVBA 3IA3A 4KUMB 2LKHA 3V5SA 2C0SA 4TZ4C 4XBFB 1W0AA 2MPKA 2XQ3A 4QXCB 4ZS2A 3U78A 4DV6T 3N2GE 5HCMA 2KXPB 3O1IA 2Q9QA 3HA4A 2CXDA 3HKCE 2YDSA 1UUSA 2QVAA 5HXRA 2W63A 4EGWA 4DR3T 4DR6T 2W62A 1D0YA 3Q5WA 4CI1B 1Y64B 2PG8A 2V6YA 3WI3A 2MTQA
chains in the Genus database with same CATH topology
5AQTB 3FZMB 5AQNB 5AQHB 4HWCA 5AQJB 1UGOA 5AQMB 5AQRB 1M62A 1HX1B 5AQVB 5AQOB 4HWDA 4HWFA 5AQUB 1UK5A 3FZFB 5AQFB 4HWHA 1I6ZA 2D9DA 3A8YC 3FZKB 3FZHB 5AQSB 5AQQB 5AQGB 4HWIB 5AQLB 1M7KA 5AQPB 1T7SA 5AQIB 3LDQB 3FZLB 3M3ZB 5AQKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQT B;  3FZM B;  5AQN B;  5AQH B;  4HWC A;  5AQJ B;  1UGO A;  5AQM B;  5AQR B;  1M62 A;  1HX1 B;  5AQV B;  5AQO B;  4HWD A;  4HWF A;  5AQU B;  1UK5 A;  3FZF B;  5AQF B;  4HWH A;  1I6Z A;  2D9D A;  3A8Y C;  3FZK B;  3FZH B;  5AQS B;  5AQQ B;  5AQG B;  4HWI B;  5AQL B;  1M7K A;  5AQP B;  1T7S A;  5AQI B;  3LDQ B;  3FZL B;  3M3Z B;  5AQK B; 
#chains in the Genus database with same CATH topology
 2VKO A;  4ZS3 A;  2XM2 A;  3EAB A;  3VR9 A;  1SA0 E;  2NOX A;  3P7I A;  2LSK A;  3K1S A;  5DQW A;  3UUM A;  4F8H A;  5BMV E;  4K0K T;  2XSA A;  3P50 A;  3AB3 B;  4ZI2 C;  4IT4 A;  5HYA A;  3ZC0 A;  5JDN A;  1HCI A;  1T72 A;  5ADX L;  1WFD A;  2HHH T;  4E7S A;  3AE9 A;  2PBI A;  1FEW A;  1WYB A;  2LE8 A;  1IZN B;  4O4H E;  3ZJ1 A;  4DMW A;  5LBQ B;  3EAM A;  2OLT A;  4ZEY A;  4LMK A;  3LBX A;  3SOL A;  2FJB A;  2VQE T;  3UU5 A;  1BR4 A;  2JMK A;  3PUG A;  4Z90 A;  4I0U A;  2V26 A;  1BR2 A;  1W09 A;  2E5V A;  3PJA J;  1MND A;  4IE0 A;  2FUP A;  4H9R C;  5HEG A;  3E0Z A;  5AQG B;  1D1B A;  3H3M A;  2FBW A;  4EZH A;  4F6R C;  4JI1 T;  2CBI A;  4JLE A;  5H6Q B;  5HEU A;  3ZT7 A;  1J1J A;  4QXH B;  1OXZ A;  5ABG A;  4B6X A;  5H6R B;  5C2T A;  4B3R T;  5FY7 A;  3N9Q A;  4LF8 T;  4ZHQ E;  3TLW A;  3N9M A;  3IBP A;  5LHH B;  4HGA A;  1JNZ A;  1OED E;  2J1D G;  3CIR A;  2CMR A;  3T8O A;  4BJM A;  4DND A;  4EOZ B;  4YFS A;  2XJ7 A;  4X66 T;  3N9N A;  1IBL T;  2ACZ A;  3UU4 A;  3CML A;  2HN2 A;  4BA9 A;  3BQL A;  3CQG B;  1NAF A;  3KV4 A;  5CFB A;  2R6G F;  4GIW A;  2BG9 C;  4XAX B;  5AQF B;  2HH7 A;  4HFH A;  4WW0 A;  3V5U A;  4LF6 T;  2EHO C;  2MYS A;  4A56 A;  5FXZ A;  2BS2 A;  4HFC A;  4COF A;  2BDE A;  3FXD B;  4ZI3 C;  3UUN A;  5LGT B;  3RIU C;  2UU9 T;  4KHZ F;  4V1A v;  3PUA A;  2ODU A;  3NVO A;  4IDQ A;  5ETW A;  2UUC T;  5FYM A;  1WR6 A;  1YKE B;  5J2T E;  4CI2 B;  2XY8 B;  4CXW A;  3ONL C;  4AQY T;  4IL9 A;  4O4L E;  4QHO A;  2XAF B;  3PUZ F;  5FMN A;  3RRW A;  3AA7 B;  4BJN A;  2X68 A;  2EHO D;  4YXD A;  3W15 B;  2Z6E A;  2BG9 E;  5TAO A;  4ERR A;  3EDV A;  2K9A A;  2Y6X A;  4X5T A;  2WDV A;  5HCJ A;  3ONJ A;  2K48 A;  1FMW A;  2X0L B;  3KV9 A;  1Z8U A;  5JQG E;  5LYJ E;  2V7K A;  5HAX A;  4ZZC A;  4DV2 T;  3B13 A;  4JEU B;  2XQY A;  2LOS A;  3RC8 A;  5LNK A;  3FZF B;  3PUV F;  4HWH A;  3FB2 A;  3A7M A;  2D0U A;  3K8P C;  4I43 B;  5FY0 A;  4ZOL E;  3PUX F;  2WDR A;  2D0T A;  4ZI3 D;  3MA9 A;  3CX7 B;  2WAU A;  2WY2 A;  2CLY C;  2VB6 A;  3AEE A;  3I0O A;  4U74 A;  3QB5 A;  2IAK A;  2LOP A;  3NRY A;  2FJA A;  2NTX A;  3OJA A;  1M7K A;  2WWV A;  2UXC T;  3C64 A;  4QH4 A;  1D1C A;  3RIA A;  2E9X B;  5FXV A;  3MZK B;  3F57 A;  2W4X A;  3ZPO A;  2ZM0 A;  4YJ2 E;  2WU5 A;  1QLB A;  3QC9 A;  4X1K E;  2KWH A;  4IHJ E;  4AIU A;  2UUA T;  2BKP A;  5J0Z A;  3ZYM A;  1YKH B;  4PJJ A;  4UR9 A;  1LVK A;  3PDY A;  2V1D B;  2XHE B;  2LHN A;  2WWU A;  3EUH A;  4HN9 A;  4ISS A;  5HXC A;  3UFG A;  4YTN A;  5JDH A;  5JTG A;  5L47 A;  2Y48 B;  4H9S E;  2XUE A;  4LMJ A;  5L3F B;  4EV6 A;  2W0G A;  2YIN A;  4DUY T;  4FI5 A;  3E08 A;  4HWF A;  4B3S T;  3AAE B;  4B3T T;  5LGU B;  2SPC A;  2Y8D A;  2ES0 A;  4DBQ A;  5FL1 A;  1KEY A;  2UXN B;  4MFR A;  2YU2 A;  3O4X E;  4PJL A;  4ZZB A;  4LFA T;  3EVY A;  1D1A A;  5LA6 E;  4NXN T;  4GKK T;  4U33 A;  2XQ9 A;  2VL0 A;  5JR9 A;  2QGS A;  2AE9 A;  4TN7 B;  1E2A A;  1W9R A;  2FJD A;  1YW0 A;  4TNV A;  2ZM8 A;  2ZLY A;  2K5B B;  2UXX B;  3AE8 A;  4UV8 B;  3UFE A;  2LSJ A;  1HF8 A;  4P0B A;  3UTK A;  5J2U E;  3AEC A;  3FZL B;  2X9W A;  3K3N A;  4ILU A;  4Z91 A;  5KDM C;  4J2C A;  2LSI A;  3PU8 A;  4K0U A;  1VOM A;  3PUR A;  5L3D B;  3C98 B;  3CWZ B;  4CXX A;  1XNQ T;  2OA5 A;  1UCU A;  3CKD A;  4H9P C;  5AQJ B;  3HR0 A;  4JI5 T;  1UGO A;  3VKG A;  4H9O C;  5JVD E;  4IE4 A;  2XSB A;  3DP7 A;  3ZJ2 A;  4U2Y A;  3AE5 A;  5KXJ A;  1HX1 B;  2QYW A;  1XDP A;  1MMD A;  3ZT6 A;  2H7O A;  3AXJ A;  3JC6 C;  3UQ7 A;  5AQU B;  3PE0 A;  2NWB A;  5IWA T;  5LOV E;  3TLT A;  3FHN A;  3QB5 K;  2MOZ A;  2V7M A;  2E9X A;  3A8Y C;  2M6I A;  3T1H T;  5JDQ A;  3I9W A;  2YOE A;  5LG3 A;  2WMN A;  4PW8 A;  1N36 T;  3ETV A;  2XZE A;  3ESL A;  1BR1 A;  3PUS A;  2WQY A;  3F2E A;  4U31 A;  4GYR A;  5ABF B;  2PJQ A;  4OFZ A;  1MIY A;  4YSY A;  2V5D A;  4LF4 T;  2QA7 A;  4U7Y A;  2V7J A;  3AVS A;  3GMI A;  3IF8 B;  3KBU A;  2VK9 A;  4PK5 A;  2M6B A;  2CLY B;  4LFB T;  4TWD A;  1J5E T;  1VCT A;  4BAY B;  2WB5 A;  4L0R A;  2IC9 A;  3CX8 B;  4IST A;  4DV4 T;  4HKA A;  5JDL A;  5DAB A;  3AE6 A;  3ZT5 A;  2XQ8 A;  3PTR B;  5JRC A;  4HWD A;  2BZB A;  4L5G A;  2N2N A;  2LSY A;  2ZMA A;  3KV6 A;  4UVC B;  3L09 A;  2DLR A;  2IUB A;  2H3R A;  2X9H A;  2NR4 A;  5L3E B;  2NW9 A;  2C5K T;  3ZCI A;  5HXH A;  1UX5 A;  2A3D A;  2WBL A;  3FZK B;  4HTE A;  4PJN A;  4QX8 B;  5AQQ B;  3UU6 A;  1I94 T;  4CN1 A;  4YTM A;  3LFM A;  3RH3 A;  1B7T A;  5JRE A;  3I1A A;  2WS3 A;  2VUR A;  4O2B E;  4DBR A;  4X62 T;  4KMC A;  2V8S V;  4A5X A;  1KFY A;  2E9X D;  3CVR A;  2LT3 A;  5EK4 A;  1ZP0 A;  2XQA A;  1HNZ T;  2PFV A;  2LRL A;  3D0T A;  3NKZ A;  4MAL A;  5LBM A;  2BS4 A;  1HFA A;  2XAQ B;  1WCR A;  3R6N A;  2G0U A;  4I4T E;  4XZC A;  5A1L A;  5ABH A;  2XPK A;  1M62 A;  3NRX A;  5BR8 T;  3ANW B;  4QKN A;  1SE7 A;  3GWH A;  2E8I A;  3JCF A;  4OX9 T;  4C90 A;  3AE7 A;  3JC6 D;  3Q5X A;  4OHF A;  4DV0 T;  4AQG A;  4DID B;  2LRK A;  5CJ5 A;  3KBT A;  1GQE A;  1CUN A;  2WP9 A;  2JJ9 A;  1ZHC A;  3DJB A;  5JDG A;  3AAI A;  5F3J A;  2CCQ A;  3N9O A;  4JBW F;  2NP9 A;  2BKN A;  3CQC B;  3Q2M A;  2X0Y A;  5LP6 E;  4NXM T;  1J5W A;  3BK9 A;  5HEO A;  4ANJ A;  5AQP B;  1T7S A;  2N1G A;  4KI0 F;  3C4Z A;  2KSR A;  3I9Y A;  3PUW F;  4NIQ A;  3VHL A;  1HNX T;  5FP3 A;  4QH1 A;  5JR9 B;  2X9Y A;  1CHU A;  5AQH B;  3IHR A;  3RLF F;  1IBK T;  1WRD A;  4JI6 T;  1US7 B;  2D2S A;  4P1N A;  4U2Z A;  4U3C A;  2CBJ A;  1XWM A;  4KBM B;  3S4U A;  5HXE A;  4CXY A;  4DV5 T;  5LCY A;  2BVL A;  5LG4 A;  3RF1 A;  4JI3 T;  3N9L A;  3ZMZ B;  4U72 A;  5L3G B;  2WSS V;  2DWK A;  2I6H A;  4O8S A;  1ZV4 X;  3LG7 A;  3HKE E;  1UK5 A;  3EI0 A;  1XNR T;  3RPU A;  3OTO T;  4LF5 T;  4Z8X A;  2M67 A;  2WCA A;  2JQ9 A;  3RYC E;  2VQF T;  3AA1 B;  1D0X A;  2I0M A;  5L3B B;  3MK7 C;  3PUQ A;  4PFP A;  3SFD A;  2UXD T;  4JI2 T;  3E22 E;  2JRK A;  1Z0P A;  1FIO A;  5FVK A;  3JAD A;  2X51 A;  1X79 A;  4DR7 T;  3N5L A;  4TV8 E;  1QUU A;  4JEH B;  2VVN A;  3VRA A;  4HFD A;  2ODV A;  2CWY A;  5HEJ A;  4HWC A;  5EZY E;  3AED A;  4AXP A;  1Y01 A;  2A9U A;  4X65 T;  1MMN A;  3AE1 A;  3QK6 A;  3ZYK A;  3BQI A;  3ZN0 B;  5JRC B;  1YXR A;  5LHI B;  1VRB A;  1LVF A;  1T98 A;  2VKH A;  1SHZ C;  4CI3 B;  2J62 A;  3ZC1 A;  4YY3 T;  2CHN A;  3H37 A;  4H63 V;  3OVU A;  3X1D A;  2YDR A;  4ILC A;  4PAG A;  4HE8 A;  5FVL A;  2Q9Q C;  2CRB A;  3GN5 B;  3L8R A;  4HFV A;  1V9D A;  2KMF A;  5LJM A;  5EK3 A;  2D9D A;  1E7P A;  5JR9 C;  3H3A A;  2IW5 B;  3GN5 A;  4AQF C;  4EIW A;  4LF7 T;  3ZN1 B;  4DO0 A;  1N32 T;  4AKH A;  3RRC A;  3UUX B;  2YDQ A;  3UUB A;  3ETU A;  4UF0 A;  1KF6 A;  3AE3 A;  3EDU A;  4UVB B;  1N33 T;  3ONX A;  2YK0 A;  3T1Y T;  3J9X 1;  5AQI B;  3QOF A;  4CN6 A;  3RGL A;  5JH7 E;  1H7C A;  3HKD E;  3RKO A;  4HFB A;  4EEB A;  2DWG A;  1S35 A;  5CA1 E;  5AQK B;  2UUB T;  1FJG T;  1XMQ T;  1ZKE A;  3FZM B;  5KX5 E;  2LEH A;  4WBO A;  1S94 A;  2C5J A;  4TWH A;  2CWO A;  4ADZ A;  2F4V T;  4DR4 T;  1HR0 T;  4DMV A;  4KHP T;  3ZSS A;  3F31 A;  4G2A A;  2BKO A;  3C4W A;  1OWA A;  2RPA A;  4GYS A;  1HG5 A;  1XZY A;  4YSZ A;  5CGM A;  2V7I A;  3FBL A;  2W66 A;  4TV9 E;  5IHY A;  2XAG B;  3ZST A;  3AE4 A;  3LK4 2;  3OYZ A;  3RKG A;  4AKI A;  2YN6 A;  4O4I E;  3NWI A;  3C50 A;  2P9B A;  4PJM A;  3FXE B;  1R8I A;  1UUR A;  2J47 A;  1IJ5 A;  3PU3 A;  3C4X A;  3OPC A;  5FXW A;  1HNW T;  3LJC A;  2UXB T;  2L8K A;  5HEH A;  4MHC A;  3VU7 H;  5CA0 E;  1HS7 A;  5J1G A;  2I59 A;  3FZH B;  4EB6 E;  3AEF A;  3Q5E A;  3EHZ A;  3Q9D A;  2KT9 A;  5GON E;  2CM0 A;  3ABV A;  1T8B A;  2V5C A;  1U4Q A;  2VKJ A;  3J7Y q;  4B3M T;  4P09 A;  2LSG A;  3KDS E;  3UU3 A;  3ZMS B;  5LHG B;  1U5P A;  2XAH B;  2E5L T;  2XTL A;  2W67 A;  4Q25 A;  5FNV E;  4JI4 T;  2HPL A;  3A5X A;  4JI8 T;  5F8P A;  1KNZ A;  3ZCJ A;  4IRE A;  1HG2 A;  3OBV E;  3RX6 A;  1W0B A;  3RYF E;  4PK4 A;  1LRZ A;  2E9X C;  4N78 D;  4TNW A;  3SWH A;  3RIF A;  2JQQ A;  3LBX B;  3L3P A;  3M65 A;  4UXN B;  1IAP A;  4X1Y E;  2A2F X;  3P4S A;  1MMG A;  1NWM X;  4QWN B;  5AQR B;  3HKB E;  5JDM A;  4ILB A;  4JV5 T;  1WR0 A;  3K3Q C;  2LM2 A;  4NPP A;  5HWY A;  2HN1 A;  3RIU A;  3KV5 A;  3TLS A;  2GK9 A;  4FJO A;  5FXX A;  4AKR B;  5FY1 A;  2LLY A;  2RA1 A;  3AXJ B;  3DTO A;  2IC6 A;  3LK3 B;  4JYA T;  2CHO A;  4HWI B;  2X67 A;  4I55 E;  4PK6 A;  3O1H A;  3ZMV B;  5CB4 E;  2BG9 A;  4OK0 A;  4ASK A;  3AEB A;  3WAK A;  3HL6 A;  1EZ3 A;  3RC3 A;  3WAJ A;  2IML A;  3AVR A;  5AQN B;  4JUY A;  5M4Y A;  4YJ3 E;  4G63 A;  2XQ6 A;  5ABF A;  4IL4 A;  2ACX A;  4ILA A;  4HFE A;  3ANW A;  4PFO A;  5C8Y E;  4DUZ T;  2ZM6 T;  1MIV A;  4A97 A;  3CPZ A;  4M1P A;  1FMV A;  3RI5 A;  4JI7 T;  2VL8 A;  4WZX A;  2JQH A;  5AQV B;  4EAH A;  4UVA B;  2NW8 A;  4H9N C;  1XMO T;  2QRX A;  2CEA A;  2KND A;  1G73 A;  3GA8 A;  4MLK A;  3UT5 E;  3VRB A;  4GK5 E;  1YQ3 A;  2W00 A;  5KMG P;  3P4R A;  1I6Z A;  1KK7 A;  3RQU A;  1AJ3 A;  4YHH T;  2EHO A;  2V6X A;  2LM9 A;  4EZ4 A;  4NUV A;  5L2L A;  4UF0 B;  4AI6 A;  3AEG A;  3U3I A;  5DQV A;  2DNX A;  3PV0 F;  4KX6 A;  1DU2 A;  5HWX A;  3RHW A;  4MBQ A;  4O2A E;  4X20 E;  2CXL A;  1MMA A;  2VAS A;  2XAS B;  3CQX C;  3NBX X;  3RYH E;  3L39 A;  2WM9 A;  2D5U A;  5L3C B;  3UU8 A;  4WBN E;  2JPF A;  2WZI A;  1YD8 G;  1UX4 A;  4CN4 A;  5ABE A;  2BVM A;  3LDQ B;  4UV9 B;  3M3Z B;  4EYU A;  3OKQ A;  4OYK A;  5FL0 A;  5LB7 B;  3ZYL A;  3B5M A;  4IE7 A;  3ZMU B;  2WZH A;  3P4P A;  4H63 H;  1IBM T;  2NW7 A;  4DR5 T;  2H89 A;  2HPJ A;  2VVS A;  4TX5 A;  3PUY F;  4CQI A;  4YTP A;  4IIJ E;  5E0O A;  2BG9 B;  3ZLI A;  4P0A A;  3N2O A;  2DHR A;  2B76 A;  2FJE A;  2JIW A;  4ZXL A;  4AKL A;  3VR8 A;  2BBJ A;  2IDO B;  4DVD A;  2XAJ B;  3SRZ A;  1KNP A;  1YQ4 A;  4LFC T;  1HTJ F;  2XM1 A;  1G8X A;  2W2U A;  1MIW A;  2AXD S;  3PJA A;  4LML A;  5FKY A;  4DV7 T;  5HXS A;  3SS1 A;  3P8C D;  2IHR 1;  2KLQ A;  3JAE A;  4ZI2 D;  1BR0 A;  1VCS A;  3AEA A;  3I0Q A;  4IE6 A;  4X64 T;  2NTY A;  3TLV A;  4IE5 A;  3IEE A;  5AQL B;  2J4G A;  5F5W A;  4E7Z A;  3K3O A;  2YEV C;  2MAW A;  3NZP A;  2Q9Q B;  3LK2 B;  2KWI B;  1X9B A;  2JQK A;  3P4Q A;  4IDP A;  1QSD A;  2RP4 A;  4YSX A;  1XDO A;  2DI4 A;  2LJL A;  2BS3 A;  2V6Y B;  3UUL A;  5L4H A;  2CA5 A;  2VKD A;  2BBH A;  2W61 A;  2EHO B;  5AQM B;  3R84 B;  2DL1 A;  3B57 A;  1HX8 A;  2XQ5 A;  1L0V A;  1MNE A;  3AAA B;  3SFE A;  1OED A;  5LJN A;  3CX6 B;  2N9D A;  2X0H A;  4OYJ A;  5AQO B;  4QXB B;  1OED B;  2V7L A;  5L4E A;  3FBZ A;  3ZKR A;  2WDQ A;  4GKJ T;  2CPT A;  2DCF A;  2LHR A;  3TLU A;  4X1I E;  4YHJ A;  3Q5D A;  3O1J A;  4GK0 E;  5EK2 A;  5AQS B;  1NEN A;  4HFI A;  4I50 E;  2ZM2 A;  3N2K E;  3QNU A;  4DV3 T;  1SUM B;  4UIG A;  3BQK A;  4JI0 T;  2KZ7 B;  2C5I T;  2L3L A;  2JMH A;  3AE2 A;  4IDZ A;  3TKL B;  4CZZ B;  4YT0 A;  1N34 T;  2IIU A;  4QH5 A;  4DV1 T;  3KFW X;  4PNI A;  2K24 A;  3RQW A;  5AQT B;  4EYY R;  5LGN B;  1KNR A;  2OV9 A;  2WMO A;  4HEA A;  4WYV A;  2K3W A;  2L9Q A;  2Q9Q D;  3MAC A;  4L9I A;  5LXT E;  4AQF A;  4O4J E;  3KVA A;  4IDN A;  3AA6 B;  5IYZ E;  4DR1 T;  4WNK A;  4NUU A;  3CK6 A;  1E1H B;  3MXZ A;  3LSV A;  3N9P A;  3ZEF B;  3HI2 A;  1ZEE A;  2X9X A;  3AA0 B;  4UEM A;  4DR2 T;  5AFU L;  4YLH A;  2MBG A;  2H88 A;  4TUY E;  3UQ4 A;  5JDF A;  2VWA A;  2YU1 A;  4GOU A;  5LMN T;  3OYX A;  3MJX A;  4EED A;  2KIN B;  1JNR A;  1LKX A;  1NEK A;  2CE7 A;  1O3X A;  3P4W A;  1WLX A;  2B1E A;  3KIN B;  4IGU A;  4H9Q C;  5DJQ C;  4UEL A;  1OED C;  3JAF A;  4AKG A;  3RYI E;  2H7V C;  4C91 A;  2WU2 A;  5IUX A;  4LF9 T;  4KP3 C;  2XQ7 A;  2X66 A;  1D0Z A;  2E2A A;  4ZI7 E;  4A98 A;  4QX7 B;  2CXF A;  3O9X A;  5C3J A;  3VKH A;  4TWF A;  4EXT A;  1ZOY A;  4AIS A;  3C51 A;  4IDO A;  4U7I A;  1IJ6 A;  2PTF A;  2YKS A;  1WYC A;  2LKG A;  2XQ4 A;  3MKD A;  3NZQ A;  5LMU T;  3QUJ A;  3G06 A;  2A72 A;  3ZMT B;  3KVB A;  3IA3 A;  4KUM B;  2LKH A;  3V5S A;  2C0S A;  4TZ4 C;  4XBF B;  1W0A A;  2MPK A;  2XQ3 A;  4QXC B;  4ZS2 A;  3U78 A;  4DV6 T;  3N2G E;  5HCM A;  2KXP B;  3O1I A;  2Q9Q A;  3HA4 A;  2CXD A;  3HKC E;  2YDS A;  1UUS A;  2QVA A;  5HXR A;  2W63 A;  4EGW A;  4DR3 T;  4DR6 T;  2W62 A;  1D0Y A;  3Q5W A;  4CI1 B;  1Y64 B;  2PG8 A;  2V6Y A;  3WI3 A;  2MTQ A; 
#chains in the Genus database with same CATH homology
 5AQT B;  3FZM B;  5AQN B;  5AQH B;  4HWC A;  5AQJ B;  1UGO A;  5AQM B;  5AQR B;  1M62 A;  1HX1 B;  5AQV B;  5AQO B;  4HWD A;  4HWF A;  5AQU B;  1UK5 A;  3FZF B;  5AQF B;  4HWH A;  1I6Z A;  2D9D A;  3A8Y C;  3FZK B;  3FZH B;  5AQS B;  5AQQ B;  5AQG B;  4HWI B;  5AQL B;  1M7K A;  5AQP B;  1T7S A;  5AQI B;  3LDQ B;  3FZL B;  3M3Z B;  5AQK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...