2N2NA

Tom1 negatively modulates binding of tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of Myb protein 1
publication title Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n2nA00
1X79A 1WRDA 2N2NA 1WR6A 2N9DA 1YD8G 1OXZA 1NWMX 1O3XA 1NAFA
chains in the Genus database with same CATH superfamily
3G06A 4Q25A 3RHWA 5L3DB 3SWHA 4TV9E 4LF5T 2CBIA 3CX7B 4TNVA 2C5JA 1E1HB 2UU9T 4FJOA 5AQTB 2K9AA 3AEDA 1OEDE 5HWYA 3AA0B 2EHOC 3QNUA 3AE7A 2PG8A 2VKDA 1IBMT 5JRCA 1I6ZA 1QSDA 3W15B 2RA1A 4EEBA 3TLVA 3V5UA 4ZI3D 2A3DA 2L9QA 4DUYT 2YK0A 4F6RC 2Q9QD 3VKGA 2SPCA 5LP6E 4IREA 1HX1B 2V26A 2FUPA 1HG2A 5L4HA 3ETVA 1WYBA 4PW8A 4X1YE 4PFOA 3HKCE 2WMOA 2WAUA 5L2LA 3AAAB 3PUZF 2G0UA 3I0OA 3UUMA 4CXXA 5FL0A 5F3JA 4HFVA 2VK9A 3O9XA 2FJEA 2P9BA 2WMNA 5CFBA 3QB5A 2Q9QC 5FY7A 3ZMUB 2LLYA 3EABA 1ZV4X 4HWFA 3U3IA 4EV6A 5HEGA 3KV9A 1G73A 1HNZT 1E2AA 3VR8A 2BS4A 4LFBT 3AVSA 3PE0A 2XQAA 2XQ7A 3JAEA 4GYRA 3ZEFB 5JDFA 2CE7A 3KBUA 3ONLC 2WDRA 2XQ6A 1BR2A 3TLSA 4WNKA 5DABA 3PUQA 3I9YA 4LF4T 4KI0F 4LMLA 5ABFA 4YY3T 3FXDB 4ERRA 3N9LA 5AQKB 5AQPB 1WR6A 3CQXC 2W63A 4O4HE 4IIJE 2NW9A 3ZN0B 1WYCA 1Z0PA 4YTNA 3UQ4A 2UXXB 5AQMB 1Y64B 4JEHB 3UFGA 2W00A 2WZIA 2MAWA 2LHRA 2V1DB 3ZYKA 3BQKA 3SRZA 4V1Av 2LRKA 4DR3T 1XMOT 2F4VT 3NZPA 4GYSA 4OX9T 4ILBA 4LF8T 2IC6A 3R6NA 1IJ6A 2ZM2A 2BBHA 2WU5A 2XPKA 1S35A 2E9XA 3PDYA 2QA7A 3AA6B 5HEUA 1SE7A 2FJBA 5EK3A 4UV8B 2CLYC 3KV5A 3JC6C 2NW8A 4LMJA 2LEHA 5JDMA 5FKYA 4DNDA 3F57A 4IDQA 2X9HA 3O1HA 1FJGT 5HCMA 1GQEA 2DI4A 3CWZB 4JI1T 4HEAA 3RX6A 2AXDS 5C3JA 3NWIA 2WWVA 2JMKA 4DVDA 4X5TA 5AQVB 4H9QC 4KHZF 5ABHA 1E7PA 5J2TE 3RYIE 4QH5A 1BR1A 5TAOA 2VASA 4N78D 5LB7B 3OVUA 4U72A 5LOVE 1D0ZA 3CPZA 3SFDA 2CHOA 4HWCA 4I55E 3AEEA 4PFPA 2UXNB 3OJAA 4DV6T 3CX6B 3WI3A 3ZC1A 2HN1A 5LHIB 4WBNE 3AEAA 2CWYA 4PNIA 4NXNT 2CEAA 4FI5A 2MPKA 3VRBA 3AA7B 4ZI2D 4ISTA 3B57A 5KDMC 3DJBA 3TKLB 3AE3A 3JADA 4IDZA 4P09A 1MMGA 3EDVA 3TLWA 5JRCB 2CXLA 4ILUA 2UXBT 3P50A 2JIWA 3KVBA 3GMIA 1HNXT 2IW5B 2BVLA 3AVRA 2NWBA 2XAQB 2PFVA 2ACXA 3PURA 4HFCA 4ZI2C 4U3CA 3UT5E 4UR9A 3SS1A 2I59A 1L0VA 4TWFA 5JREA 4I43B 2LSGA 3I0QA 4C90A 2DHRA 3VKHA 4X1IE 2XM1A 2MTQA 4H63H 2H88A 5CA0E 2X0HA 5F8PA 3QUJA 2YDRA 2J62A 4DIDB 4AKLA 2H3RA 2FJAA 2AE9A 1MIWA 4DV1T 3ZCIA 5LMNT 4YSZA 5AQRB 3AEFA 2CRBA 3ZSSA 3ZT7A 3AE1A 2BKOA 3HKDE 2NTXA 2WWUA 2VL8A 2VKJA 4XBFB 3FB2A 2I0MA 4NIQA 1LVFA 4PJJA 3C50A 2VQFT 3QOFA 5ABFB 3F31A 2LSJA 2KWHA 3KV4A 2KMFA 3TLTA 4CI2B 2XAJB 2MYSA 2Q9QB 5LGTB 4WBOA 2XAHB 1XZYA 2JQQA 3NKZA 5KXJA 4JEUB 3ABVA 1J1JA 4ASKA 2LOPA 2LE8A 4I50E 3C64A 4OFZA 4O4LE 2JRKA 3LG7A 4KMCA 1SA0E 2BVMA 4DR5T 3Q5DA 1UURA 3UU8A 3KINB 4YXDA 2E9XB 1N34T 3K8PC 4L0RA 3QK6A 2IDOB 1Y01A 2K24A 2X66A 3EVYA 3MACA 5ETWA 2XQ5A 3RQUA 3VHLA 4Z90A 2IC9A 1S94A 1QLBA 2M6BA 5JVDE 4L5GA 2LSKA 4CXWA 3RYHE 1W09A 2OA5A 3GA8A 2XSAA 4X64T 3ESLA 3RKOA 3R84B 2E8IA 4MLKA 2V6XA 4JUYA 5CA1E 4GOUA 3HKEE 4YTPA 2WS3A 4CI3B 3N5LA 4JV5T 2BG9E 3FZHB 1N36T 5FMNA 2NOXA 4JI4T 1J5WA 4HFEA 3AXJA 4ADZA 5HYAA 5AQHB 5JTGA 2HPJA 2MOZA 3OKQA 1KNPA 3O1JA 1WRDA 4F8HA 4O4IE 4BJNA 1FEWA 2RP4A 2ZM6T 5DQVA 2CXDA 3ZT5A 3P4PA 5AQFB 3S4UA 2JQKA 3ZMVB 5FP3A 3RH3A 2V6YB 3KFWX 3ZSTA 2WM9A 5LGNB 3ZMZB 1ZHCA 3Q5XA 5EK2A 4O2AE 5IWAT 4OYKA 3U78A 3ZC0A 4IDPA 2WCAA 2D5UA 4IL4A 5BMVE 2ODUA 3K3QC 3OTOT 2V7KA 4IL9A 5JDLA 5H6RB 4QH1A 2WU2A 2ACZA 5HXHA 2XQ3A 2XQ9A 2QVAA 4KUMB 3UUXB 3LK3B 3RRCA 2VURA 1ZKEA 2D0TA 4AQFA 3AAIA 2XASB 3PUGA 4H9OC 3OBVE 2KSRA 3CQGB 4AKRB 4X62T 4HFIA 5LJNA 4CZZB 3A5XA 2Z6EA 2E9XD 1VOMA 3PUWF 3KBTA 2WQYA 2VKOA 4JLEA 5FXZA 1XMQT 1XDPA 3PJAA 1YKHB 5C2TA 3N2KE 3ZLIA 3NRXA 3QB5K 2V5DA 4LF6T 4DMVA 3IA3A 2CCQA 3LK2B 1DU2A 3E0ZA 4H9PC 5HEHA 4EEDA 5HXCA 1SHZC 2DWGA 2NR4A 1R8IA 4EZ4A 2E9XC 1SUMB 4UF0A 1M62A 4HKAA 4UIGA 2J4GA 1HCIA 3CX8B 4GIWA 4GK5E 1KNZA 1JNZA 4KHPT 3RIAA 3JC6D 3KVAA 5EZYE 2X9YA 3LDQB 2C5IT 3P4WA 4CN4A 4CI1B 3Q5EA 3FHNA 3KDSE 5HAXA 4B3TT 4X1KE 2H7VC 3TLUA 3NBXX 4MFRA 4WW0A 5GONE 4IDOA 2WP9A 2CPTA 3AEBA 4OHFA 4JI6T 3RIUA 4X65T 1OEDA 2W66A 4U31A 4AXPA 1B7TA 1MNEA 2V7MA 3VR9A 1IBKT 2BKNA 3AEGA 4XAXB 4EGWA 4GKJT 3JCFA 5LBQB 1UCUA 1HS7A 2LSIA 2FJDA 2L8KA 4ZOLE 3RKGA 2X9WA 2V7IA 5JR9C 5CB4E 2XAGB 4ZHQE 5BR8T 3MZKB 1HR0T 4P0BA 2IHR1 2XQ4A 2QRXA 1WCRA 3Q5WA 3RLFF 4NXMT 3H3AA 4UVCB 2X51A 4HWHA 5FNVE 1M7KA 1UUSA 3A8YC 4JYAT 3FBZA 3AXJB 2H89A 5EK4A 5IYZE 1KEYA 3B5MA 4H63V 3EAMA 3L09A 4HFDA 2ODVA 3MK7C 3C98B 3K1SA 4UVBB 5JR9A 2IMLA 5IHYA 2CHNA 3WAKA 2D0UA 2VKHA 1CUNA 3VU7H 4ANJA 2LKHA 1ZP0A 4HGAA 4WZXA 2IAKA 4EXTA 2CWOA 3HKBE 2RPAA 5AFUL 1D1CA 4EIWA 3AA1B 4ZEYA 5ABEA 1VCTA 3RIFA 4COFA 4QHOA 2W4XA 5FXWA 5L3CB 3ZJ2A 5LXTE 5E0OA 5HXSA 4ZZCA 3ETUA 5LYJE 4TWHA 4YFSA 2XQ8A 4HTEA 4WYVA 2Y48B 4B6XA 3A7MA 1WLXA 1UGOA 4AKIA 1G8XA 3E08A 2LKGA 2X68A 3I9WA 2QYWA 2LSYA 3ZKRA 1X79A 2PBIA 4X20E 4DV5T 4C91A 1YD8G 5FXXA 4QXBB 1IZNB 3NZQA 4JI0T 1HF8A 3IHRA 5L4EA 2A9UA 4QXCB 3UUBA 3ZT6A 3GN5A 4GK0E 1MNDA 4H9RC 3AE6A 3N9NA 2X0YA 3FZLB 4DR1T 1XNQT 5LHHB 3ZJ1A 5AQQB 3RC8A 3LK42 3MA9A 2CXFA 2ES0A 5JQGE 1U4QA 4O4JE 2YOEA 5JH7E 4UF0B 4O2BE 3IEEA 1OWAA 2CA5A 5AQNB 4U7YA 4TV8E 5J1GA 3PU3A 4KBMB 4U2ZA 3PJAJ 4TX5A 5JDHA 5AQOB 5FL1A 4DUZT 3PUYF 3I1AA 2JQ9A 2UXDT 1HFAA 4ZZBA 4YLHA 2YDQA 4P1NA 4AKHA 2JMHA 3J7Yq 2LM9A 3ZPOA 4B3RT 5HWXA 4IT4A 2WSSV 2ZM0A 3MKDA 1IJ5A 4NUUA 4X66T 3L39A 2ZMAA 3MXZA 2YINA 4A98A 4IE5A 1OEDB 4A56A 2VWAA 4IE6A 4CQIA 1AJ3A 4BA9A 2FBWA 3UUNA 4IGUA 4YSXA 2VVNA 3ONXA 3O4XE 4AISA 2YU2A 3K3OA 5KX5E 4DV0T 5HCJA 4MHCA 3CQCB 5FVLA 5LBMA 3HA4A 4QX7B 5LHGB 1X9BA 2W0GA 4MALA 2A72A 2XM2A 3SFEA 4CN6A 3H37A 4YTMA 4ILAA 4QKNA 1N33T 4QXHB 4I0UA 2LT3A 3BQLA 4G63A 2BS2A 4JI8T 4IE0A 5FYMA 1EZ3A 2W62A 4CXYA 3T8OA 3PTRB 3CKDA 5HXEA 5JR9B 1LRZA 4TNWA 3PUSA 4HN9A 3UU6A 3AE9A 1JNRA 4PK5A 2YKSA 4EAHA 3T1HT 4YHJA 5LG3A 4HWIB 1FMVA 2N1GA 2X9XA 1U5PA 2XUEA 3CMLA 1O3XA 3VRAA 4PJNA 4JBWF 2CMRA 1WFDA 1WR0A 5F5WA 1MMNA 4AQFC 2WDQA 1NWMX 2BKPA 3N9PA 3RRWA 4ZI7E 3FZFB 4ILCA 5JDNA 4EZHA 5L3FB 2X0LB 1MMDA 3RC3A 1YKEB 3UTKA 4U7IA 2BS3A 2XY8B 2XTLA 2KXPB 2L3LA 4LMKA 4K0UA 4EYYR 4B3MT 5JDQA 1MIVA 4KX6A 4LF7T 4ZXLA 2V7JA 5J0ZA 3H3MA 4ZS2A 4I4TE 4JI3T 3AE2A 1XWMA 2PTFA 2KZ7B 3PUAA 1MIYA 3D0TA 4E7SA 1W0BA 4ISSA 1D0XA 3JAFA 4LFCT 4BAYB 3V5SA 2JJ9A 1HG5A 3GN5B 1KNRA 4YJ2E 1KF6A 2EHOA 3ZYLA 2KWIB 3C4WA 3IF8B 2GK9A 3PV0F 4DR7T 5FY0A 2XQYA 1D1AA 2HH7A 3L3PA 4ZI3C 2KNDA 4UVAB 4CN1A 1VRBA 1T98A 1ZOYA 1BR4A 2BDEA 2K3WA 2I6HA 2ZLYA 3NRYA 2BG9C 2V5CA 1V9DA 2OV9A 1J5ET 3M65A 5AQJB 3BQIA 2IUBA 3OPCA 5CJ5A 3ZN1B 4AIUA 3AE4A 4QX8B 3RYFE 3AE8A 3J9X1 2KLQA 1XNRT 4IE7A 4YSYA 3P7IA 3PUXF 5FXVA 3RIUC 1OEDC 3Q9DA 5JDGA 5M4YA 4GKKT 4EYUA 4LF9T 3FZKB 2BG9A 2Q9QA 3ZCJA 2VB6A 3IBPA 3ZMSB 4UXNB 4M1PA 2B76A 1KFYA 2YN6A 3PUVF 4LFAT 1YW0A 1W0AA 2WBLA 4OK0A 4IHJE 3BK9A 4PJMA 3AE5A 5LGUB 3C4ZA 4JI5T 3X1DA 2UUCT 1MMAA 2HPLA 2WY2A 2WDVA 5LCYA 2W61A 3QC9A 3FZMB 3ANWA 1US7B 3LJCA 1YXRA 2LOSA 3WAJA 1IAPA 2R6GF 3P4RA 2V7LA 2C5KT 2UUBT 4AQYT 5LMUT 1NAFA 2CM0A 4DMWA 3AB3B 2D9DA 3LBXA 5DQWA 1H7CA 3KV6A 2DWKA 2M67A 5J2UE 1KK7A 2XSBA 4DV7T 3ONJA 5FVKA 4TWDA 4HFBA 3UU5A 3AECA 2NTYA 3RQWA 4JI2T 4DBRA 2QGSA 2CBJA 4AKGA 4B3ST 2H7OA 4DBQA 1VCSA 3EDUA 4DR2T 3RF1A 3E22E 4ZS3A 4A5XA 4K0KT 2YEVC 4EB6E 2UXCT 1LKXA 3UU3A 2N9DA 4IE4A 2BZBA 2X67A 5LA6E 2D2SA 4PAGA 3EI0A 1T8BA 3P4SA 1OXZA 4Z91A 3N2GE 1W9RA 2Y6XA 2J1DG 4E7ZA 5HEOA 2JPFA 3OYXA 5LNKA 4UELA 3N2OA 1UK5A 1T7SA 5KMGP 5AQSB 4QH4A 5C8YE 3UU4A 3GWHA 2OLTA 1XDOA 2LM2A 4HE8A 2MBGA 4PK4A 5L47A 3RYCE 1BR0A 3DP7A 3RPUA 1QUUA 2K5BB 3ZMTB 3UULA 4JI7T 3LFMA 2J47A 1YQ3A 2V6YA 4AI6A 2NP9A 4EOZB 2M6IA 4J2CA 1NENA 1I94T 5H6QB 2LHNA 3F2EA 4NUVA 3HI2A 2B1EA 2NW7A 2DCFA 5AQGB 3P4QA 4DO0A 2LJLA 2VQET 2VVSA 5A1LA 2DL1A 2EHOB 3CVRA 4TZ4C 2YU1A 4HFHA 2W67A 4KP3C 4G2AA 2JQHA 4AQGA 2UUAT 5AQUB 3M3ZB 1D1BA 4YJ3E 4DR4T 2IIUA 2HHHT 2E5VA 3P8CD 4O8SA 2XZEA 3N9OA 3T1YT 5IUXA 3EHZA 1NEKA 4U2YA 3K3NA 2E5LT 5CGMA 3AAEB 3N9QA 3FXEB 4DR6T 2XHEB 4DV3T 5FY1A 2KT9A 1UX4A 2VL0A 2WZHA 4NPPA 5HXRA 1LVKA 3UQ7A 2WB5A 4A97A 4IDNA 4XZCA 5ADXL 1D0YA 3CIRA 3N9MA 4QWNB 2YDSA 2BG9B 4UEMA 2XAFB 5L3EB 3RI5A 1N32T 3MJXA 3HR0A 1HTJF 4H9NC 4OYJA 4UV9B 2W2UA 1YQ4A 2PJQA 4PK6A 4U33A 4BJMA 2A2FX 2XJ7A 1HNWT 4MBQA 3O1IA 3ZYMA 4P0AA 3OYZA 3ANWB 5ABGA 2HN2A 3C51A 3CK6A 2ZM8A 5AQIB 4L9IA 1CHUA 5HEJA 5LG4A 1UX5A 4H9SE 3LBXB 4YHHT 2E2AA 2LRLA 5LJMA 2C0SA 2Y8DA 2N2NA 3Q2MA 1HX8A 4DV4T 4HWDA 2DNXA 3DTOA 2DLRA 3NVOA 3C4XA 3PU8A 1Z8UA 3FBLA 1ZEEA 2BBJA 1IBLT 5L3BB 2K48A 5L3GB 4TUYE 4TN7B 4PJLA 2KINB 4YT0A 3RGLA 2CLYB 3SOLA 3HL6A 4Z8XA 3LSVA 2EHOD 3B13A 1FMWA 3EUHA 4DV2T 3L8RA 4U74A 1FIOA 5AQLB 3UFEA 2V8SV 1T72A 5DJQC
chains in the Genus database with same CATH topology
3WAKA 5LGTB 4WBOA 2XAHB 2D0UA 2VKHA 1CUNA 3VU7H 4ANJA 5L3DB 2JQQA 3SWHA 4TV9E 3Q9DA 4HGAA 5JDGA 5M4YA 3CX7B 2C5JA 2IAKA 1E1HB 4JEUB 4ASKA 4EXTA 2LOPA 4EYUA 2CWOA 2LE8A 3HKBE 4FJOA 2Q9QA 3ZCJA 5AFUL 2VB6A 4I50E 2K9AA 3C64A 1D1CA 4EIWA 5HWYA 3AA0B 4OFZA 3IBPA 3AA1B 3ZMSB 4UXNB 2EHOC 4O4LE 2JRKA 2PG8A 4M1PA 3LG7A 4KMCA 4QHOA 2VKDA 5FXWA 1YW0A 5JRCA 2WBLA 5L3CB 4OK0A 4IHJE 3ZJ2A 3BK9A 5LXTE 5E0OA 5HXSA 1SA0E 2BVMA 1QSDA 4PJMA 3W15B 3ETUA 2RA1A 5LYJE 5LGUB 3V5UA 3C4ZA 4ZI3D 2A3DA 3KINB 2L9QA 1MMAA 2HPLA 4YFSA 2E9XB 4HTEA 2Y48B 4B6XA 3K8PC 5LCYA 2YK0A 1WLXA 2W61A 3QC9A 4F6RC 3ANWA 4AKIA 2Q9QD 1US7B 3LJCA 4L0RA 3VKGA 2LOSA 2SPCA 3QK6A 5LP6E 3WAJA 2V26A 1G8XA 1IAPA 3E08A 1HG2A 2K24A 2C5KT 2V7LA 2X68A 3ETVA 2X66A 1WYBA 3I9WA 2LSYA 4PW8A 1X79A 2PBIA 4X1YE 1NAFA 4X20E 3EVYA 2CM0A 4PFOA 3MACA 4DMWA 5ETWA 3AB3B 3HKCE 3VHLA 4C91A 1YD8G 2WMOA 2WAUA 5FXXA 2IC9A 3LBXA 5DQWA 1S94A 5L2LA 1H7CA 3KV6A 4QXBB 1IZNB 2DWKA 2M67A 3NZQA 3AAAB 5J2UE 2G0UA 1KK7A 3I0OA 3UUMA 1HF8A 4CXXA 5JVDE 3IHRA 4L5GA 2LSKA 4CXWA 4QXCB 3RYHE 2OA5A 2NTYA 3GN5A 4GK0E 3GA8A 4DBRA 5F3JA 4HFVA 2QGSA 2VK9A 3O9XA 1MNDA 4AKGA 3ESLA 3RKOA 3R84B 2P9BA 2E8IA 2WMNA 4H9RC 4MLKA 4JUYA 5CA1E 4GOUA 2Q9QC 5FY7A 3ZMUB 1ZV4X 3HKEE 2H7OA 3U3IA 4DBQA 3EDUA 3KV9A 3N9NA 4CI3B 5LHHB 1G73A 3E22E 3ZJ1A 3N5LA 4ZS3A 3AVSA 2YEVC 3PE0A 4EB6E 1LKXA 3RC8A 5FMNA 4GYRA 3LK42 2NOXA 2N9DA 3ZEFB 4IE4A 3MA9A 2CXFA 2ES0A 5JDFA 2CE7A 3KBUA 2BZBA 2X67A 5LA6E 2D2SA 4PAGA 5JQGE 1U4QA 4O4JE 1BR2A 1OXZA 4WNKA 4ADZA 5DABA 5HYAA 2HPJA 5JH7E 4UF0B 3PUQA 4O2BE 3I9YA 2MOZA 3N2GE 3IEEA 3OKQA 2Y6XA 3O1JA 2J1DG 1OWAA 4E7ZA 3FXDB 1WRDA 2JPFA 2CA5A 3OYXA 4ERRA 4O4IE 3N9LA 5LNKA 4UELA 3N2OA 4BJNA 5KMGP 1WR6A 4TV8E 3CQXC 5J1GA 2W63A 1FEWA 3PU3A 4O4HE 4IIJE 5C8YE 2RP4A 2NW9A 3ZN0B 1WYCA 3GWHA 5DQVA 4KBMB 4TX5A 1Z0PA 5JDHA 2CXDA 4HE8A 3I1AA 2MBGA 2UXXB 1Y64B 4PK4A 3S4UA 4JEHB 2W00A 3ZMVB 5FP3A 1HFAA 3RH3A 2LHRA 4YLHA 4AKHA 2V1DB 3RYCE 3KFWX 2JMHA 3ZYKA 2WM9A 1BR0A 3BQKA 3J7Yq 2LM9A 5LGNB 3ZPOA 3SRZA 3DP7A 5HWXA 3ZMZB 1ZHCA 3RPUA 1QUUA 2WSSV 3Q5XA 2K5BB 5EK2A 2ZM0A 3ZMTB 3UULA 4O2AE 4V1Av 3MKDA 1IJ5A 4NUUA 4OYKA 3LFMA 3U78A 3ZC0A 3NZPA 4GYSA 2ZMAA 3MXZA 2YINA 4AI6A 2NP9A 2IC6A 4EOZB 2D5UA 5BMVE 2ODUA 3K3QC 3R6NA 4J2CA 4IE5A 1IJ6A 2V7KA 2ZM2A 4A56A 5H6QB 5H6RB 2LHNA 2VWAA 3F2EA 3HI2A 1S35A 2B1EA 4NUVA 4IE6A 2E9XA 2NW7A 3PDYA 4CQIA 1AJ3A 2QA7A 3AA6B 4BA9A 2DCFA 5HXHA 5EK3A 3UUNA 4DO0A 4UV8B 2LJLA 4IGUA 2CLYC 5A1LA 4KUMB 3UUXB 3JC6C 2NW8A 3LK3B 2EHOB 2LEHA 3CVRA 3ONXA 5JDMA 4TZ4C 3O4XE 2YU1A 3RRCA 4DNDA 1ZKEA 2D0TA 2YU2A 3F57A 2X9HA 3O1HA 4AQFA 3AAIA 2XASB 3K3OA 4KP3C 5KX5E 3PUGA 4MHCA 3CQCB 4G2AA 2DI4A 3CWZB 4H9OC 5LBMA 3HA4A 4HEAA 4QX7B 5LHGB 3RX6A 4AQGA 3OBVE 3CQGB 4AKRB 2W0GA 1D1BA 4MALA 4YJ3E 5LJNA 2A72A 3H37A 4CZZB 3A5XA 2JMKA 2Z6EA 4DVDA 3P8CD 4O8SA 2E9XD 3N9OA 4H9QC 1VOMA 5J2TE 4QKNA 4QXHB 3KBTA 3RYIE 2LT3A 2VKOA 1BR1A 3BQLA 5TAOA 2VASA 4JLEA 4N78D 5FXZA 3K3NA 4G63A 4U72A 3AAEB 3N9QA 1YKHB 3FXEB 5LOVE 2XHEB 1D0ZA 3CPZA 4IE0A 4I55E 5FY1A 3N2KE 5JDLA 4PFPA 3ZLIA 5FYMA 2UXNB 1EZ3A 2W62A 3NRXA 3OJAA 4CXYA 3T8OA 3PTRB 4DMVA 3CKDA 2CCQA 5HXEA 3CX6B 3WI3A 3LK2B 2KT9A 1UX4A 3E0ZA 5JR9B 5HXRA 1LRZA 3ZC1A 1LVKA 5LHIB 3PUSA 4H9PC 4HN9A 4WBNE 5HXCA 2CWYA 1SHZC 5ADXL 4XZCA 1D0YA 2DWGA 4PK5A 3N9MA 4EZ4A 4EAHA 2E9XC 4PNIA 2CEAA 4YHJA 4FI5A 4QWNB 4UF0A 4HKAA 4UIGA 1HCIA 1FMVA 3CX8B 2N1GA 2X9XA 3AA7B 4GIWA 4GK5E 1U5PA 3B57A 4ISTA 4ZI2D 2XUEA 3CMLA 3DJBA 5KDMC 1O3XA 4UEMA 1KNZA 3TKLB 4PJNA 2XAFB 2CMRA 5L3EB 4IDZA 4P09A 3MJXA 1MMGA 3JC6D 3HR0A 3KVAA 3EDVA 1HTJF 5EZYE 4H9NC 2X9YA 4OYJA 4UV9B 1MMNA 4AQFC 5JRCB 2C5IT 2CXLA 4ILUA 2PJQA 4PK6A 1NWMX 4BJMA 3N9PA 2A2FX 3RRWA 4ZI7E 4CI1B 3FHNA 3KDSE 3KVBA 3GMIA 4MBQA 3O1IA 5HAXA 5JDNA 4EZHA 3ZYMA 2IW5B 5L3FB 2X0LB 4P0AA 4X1KE 2BVLA 3OYZA 1MMDA 3RC3A 1YKEB 3AVRA 3UTKA 2NWBA 2XAQB 3ANWB 2PFVA 2H7VC 3C51A 2XTLA 2KXPB 2ZM8A 3NBXX 2ACXA 2L3LA 4L9IA 4MFRA 3PURA 4K0UA 4EYYR 4WW0A 5GONE 5JDQA 4ZI2C 1MIVA 2V7JA 3UT5E 4ZS2A 4I4TE 5LG4A 2KZ7B 3PUAA 3SS1A 1UX5A 4H9SE 1MIYA 4OHFA 3LBXB 2I59A 5JREA 3D0TA 4E7SA 4I43B 4AXPA 2LSGA 5LJMA 1B7TA 2C0SA 2Y8DA 1MNEA 4ISSA 1D0XA 2V7MA 2N2NA 3I0QA 4C90A 2DHRA 3Q2MA 4BAYB 1HX8A 4X1IE 3VKHA 3V5SA 2MTQA 2JJ9A 4H63H 1HG5A 2DNXA 3GN5B 5CA0E 3DTOA 2DLRA 4XAXB 5F8PA 4YJ2E 3QUJA 2EHOA 3ZYLA 2KWIB 3C4XA 1UCUA 3C4WA 3PU8A 5LBQB 3IF8B 2LSIA 1HS7A 2GK9A 5DJQC 2L8KA 3FBLA 4ZOLE 4AKLA 1ZEEA 2X9WA 2H3RA 2V7IA 5JR9C 5FY0A 2XQYA 5CB4E 1D1AA 2XAGB 1MIWA 4ZHQE 2HH7A 3L3PA 3ZCIA 5L3BB 4ZI3C 2KNDA 3MZKB 2K48A 5L3GB 4UVAB 4P0BA 1VRBA 1T98A 4TUYE 1BR4A 2BDEA 4TN7B 3Q5WA 2ZLYA 3NRYA 3H3AA 4PJLA 3HKDE 4UVCB 2KINB 2WWUA 1V9DA 2NTXA 2VL8A 2X51A 5FNVE 2VKJA 4XBFB 3M65A 3FB2A 2CLYB 3FBZA 3SOLA 3HL6A 1LVFA 4Z8XA 4PJJA 3BQIA 2EHOD 5EK4A 3B13A 5IYZE 3ZN1B 3C50A 4QX8B 3RYFE 1FMWA 4H63V 3L09A 3EUHA 3F31A 4U74A 3J9X1 2KLQA 1FIOA 2LSJA 4IE7A 2KWHA 2ODVA 2KMFA 3C98B 3KV4A 3MK7C 2XAJB 4CI2B 3P7IA 4UVBB 3UFEA 5FXVA 2MYSA 2Q9QB 5JR9A 3KV5A 5IHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X79 A;  1WRD A;  2N2N A;  1WR6 A;  2N9D A;  1YD8 G;  1OXZ A;  1NWM X;  1O3X A;  1NAF A; 
#chains in the Genus database with same CATH topology
 3G06 A;  4Q25 A;  3RHW A;  5L3D B;  3SWH A;  4TV9 E;  4LF5 T;  2CBI A;  3CX7 B;  4TNV A;  2C5J A;  1E1H B;  2UU9 T;  4FJO A;  5AQT B;  2K9A A;  3AED A;  1OED E;  5HWY A;  3AA0 B;  2EHO C;  3QNU A;  3AE7 A;  2PG8 A;  2VKD A;  1IBM T;  5JRC A;  1I6Z A;  1QSD A;  3W15 B;  2RA1 A;  4EEB A;  3TLV A;  3V5U A;  4ZI3 D;  2A3D A;  2L9Q A;  4DUY T;  2YK0 A;  4F6R C;  2Q9Q D;  3VKG A;  2SPC A;  5LP6 E;  4IRE A;  1HX1 B;  2V26 A;  2FUP A;  1HG2 A;  5L4H A;  3ETV A;  1WYB A;  4PW8 A;  4X1Y E;  4PFO A;  3HKC E;  2WMO A;  2WAU A;  5L2L A;  3AAA B;  3PUZ F;  2G0U A;  3I0O A;  3UUM A;  4CXX A;  5FL0 A;  5F3J A;  4HFV A;  2VK9 A;  3O9X A;  2FJE A;  2P9B A;  2WMN A;  5CFB A;  3QB5 A;  2Q9Q C;  5FY7 A;  3ZMU B;  2LLY A;  3EAB A;  1ZV4 X;  4HWF A;  3U3I A;  4EV6 A;  5HEG A;  3KV9 A;  1G73 A;  1HNZ T;  1E2A A;  3VR8 A;  2BS4 A;  4LFB T;  3AVS A;  3PE0 A;  2XQA A;  2XQ7 A;  3JAE A;  4GYR A;  3ZEF B;  5JDF A;  2CE7 A;  3KBU A;  3ONL C;  2WDR A;  2XQ6 A;  1BR2 A;  3TLS A;  4WNK A;  5DAB A;  3PUQ A;  3I9Y A;  4LF4 T;  4KI0 F;  4LML A;  5ABF A;  4YY3 T;  3FXD B;  4ERR A;  3N9L A;  5AQK B;  5AQP B;  1WR6 A;  3CQX C;  2W63 A;  4O4H E;  4IIJ E;  2NW9 A;  3ZN0 B;  1WYC A;  1Z0P A;  4YTN A;  3UQ4 A;  2UXX B;  5AQM B;  1Y64 B;  4JEH B;  3UFG A;  2W00 A;  2WZI A;  2MAW A;  2LHR A;  2V1D B;  3ZYK A;  3BQK A;  3SRZ A;  4V1A v;  2LRK A;  4DR3 T;  1XMO T;  2F4V T;  3NZP A;  4GYS A;  4OX9 T;  4ILB A;  4LF8 T;  2IC6 A;  3R6N A;  1IJ6 A;  2ZM2 A;  2BBH A;  2WU5 A;  2XPK A;  1S35 A;  2E9X A;  3PDY A;  2QA7 A;  3AA6 B;  5HEU A;  1SE7 A;  2FJB A;  5EK3 A;  4UV8 B;  2CLY C;  3KV5 A;  3JC6 C;  2NW8 A;  4LMJ A;  2LEH A;  5JDM A;  5FKY A;  4DND A;  3F57 A;  4IDQ A;  2X9H A;  3O1H A;  1FJG T;  5HCM A;  1GQE A;  2DI4 A;  3CWZ B;  4JI1 T;  4HEA A;  3RX6 A;  2AXD S;  5C3J A;  3NWI A;  2WWV A;  2JMK A;  4DVD A;  4X5T A;  5AQV B;  4H9Q C;  4KHZ F;  5ABH A;  1E7P A;  5J2T E;  3RYI E;  4QH5 A;  1BR1 A;  5TAO A;  2VAS A;  4N78 D;  5LB7 B;  3OVU A;  4U72 A;  5LOV E;  1D0Z A;  3CPZ A;  3SFD A;  2CHO A;  4HWC A;  4I55 E;  3AEE A;  4PFP A;  2UXN B;  3OJA A;  4DV6 T;  3CX6 B;  3WI3 A;  3ZC1 A;  2HN1 A;  5LHI B;  4WBN E;  3AEA A;  2CWY A;  4PNI A;  4NXN T;  2CEA A;  4FI5 A;  2MPK A;  3VRB A;  3AA7 B;  4ZI2 D;  4IST A;  3B57 A;  5KDM C;  3DJB A;  3TKL B;  3AE3 A;  3JAD A;  4IDZ A;  4P09 A;  1MMG A;  3EDV A;  3TLW A;  5JRC B;  2CXL A;  4ILU A;  2UXB T;  3P50 A;  2JIW A;  3KVB A;  3GMI A;  1HNX T;  2IW5 B;  2BVL A;  3AVR A;  2NWB A;  2XAQ B;  2PFV A;  2ACX A;  3PUR A;  4HFC A;  4ZI2 C;  4U3C A;  3UT5 E;  4UR9 A;  3SS1 A;  2I59 A;  1L0V A;  4TWF A;  5JRE A;  4I43 B;  2LSG A;  3I0Q A;  4C90 A;  2DHR A;  3VKH A;  4X1I E;  2XM1 A;  2MTQ A;  4H63 H;  2H88 A;  5CA0 E;  2X0H A;  5F8P A;  3QUJ A;  2YDR A;  2J62 A;  4DID B;  4AKL A;  2H3R A;  2FJA A;  2AE9 A;  1MIW A;  4DV1 T;  3ZCI A;  5LMN T;  4YSZ A;  5AQR B;  3AEF A;  2CRB A;  3ZSS A;  3ZT7 A;  3AE1 A;  2BKO A;  3HKD E;  2NTX A;  2WWU A;  2VL8 A;  2VKJ A;  4XBF B;  3FB2 A;  2I0M A;  4NIQ A;  1LVF A;  4PJJ A;  3C50 A;  2VQF T;  3QOF A;  5ABF B;  3F31 A;  2LSJ A;  2KWH A;  3KV4 A;  2KMF A;  3TLT A;  4CI2 B;  2XAJ B;  2MYS A;  2Q9Q B;  5LGT B;  4WBO A;  2XAH B;  1XZY A;  2JQQ A;  3NKZ A;  5KXJ A;  4JEU B;  3ABV A;  1J1J A;  4ASK A;  2LOP A;  2LE8 A;  4I50 E;  3C64 A;  4OFZ A;  4O4L E;  2JRK A;  3LG7 A;  4KMC A;  1SA0 E;  2BVM A;  4DR5 T;  3Q5D A;  1UUR A;  3UU8 A;  3KIN B;  4YXD A;  2E9X B;  1N34 T;  3K8P C;  4L0R A;  3QK6 A;  2IDO B;  1Y01 A;  2K24 A;  2X66 A;  3EVY A;  3MAC A;  5ETW A;  2XQ5 A;  3RQU A;  3VHL A;  4Z90 A;  2IC9 A;  1S94 A;  1QLB A;  2M6B A;  5JVD E;  4L5G A;  2LSK A;  4CXW A;  3RYH E;  1W09 A;  2OA5 A;  3GA8 A;  2XSA A;  4X64 T;  3ESL A;  3RKO A;  3R84 B;  2E8I A;  4MLK A;  2V6X A;  4JUY A;  5CA1 E;  4GOU A;  3HKE E;  4YTP A;  2WS3 A;  4CI3 B;  3N5L A;  4JV5 T;  2BG9 E;  3FZH B;  1N36 T;  5FMN A;  2NOX A;  4JI4 T;  1J5W A;  4HFE A;  3AXJ A;  4ADZ A;  5HYA A;  5AQH B;  5JTG A;  2HPJ A;  2MOZ A;  3OKQ A;  1KNP A;  3O1J A;  1WRD A;  4F8H A;  4O4I E;  4BJN A;  1FEW A;  2RP4 A;  2ZM6 T;  5DQV A;  2CXD A;  3ZT5 A;  3P4P A;  5AQF B;  3S4U A;  2JQK A;  3ZMV B;  5FP3 A;  3RH3 A;  2V6Y B;  3KFW X;  3ZST A;  2WM9 A;  5LGN B;  3ZMZ B;  1ZHC A;  3Q5X A;  5EK2 A;  4O2A E;  5IWA T;  4OYK A;  3U78 A;  3ZC0 A;  4IDP A;  2WCA A;  2D5U A;  4IL4 A;  5BMV E;  2ODU A;  3K3Q C;  3OTO T;  2V7K A;  4IL9 A;  5JDL A;  5H6R B;  4QH1 A;  2WU2 A;  2ACZ A;  5HXH A;  2XQ3 A;  2XQ9 A;  2QVA A;  4KUM B;  3UUX B;  3LK3 B;  3RRC A;  2VUR A;  1ZKE A;  2D0T A;  4AQF A;  3AAI A;  2XAS B;  3PUG A;  4H9O C;  3OBV E;  2KSR A;  3CQG B;  4AKR B;  4X62 T;  4HFI A;  5LJN A;  4CZZ B;  3A5X A;  2Z6E A;  2E9X D;  1VOM A;  3PUW F;  3KBT A;  2WQY A;  2VKO A;  4JLE A;  5FXZ A;  1XMQ T;  1XDP A;  3PJA A;  1YKH B;  5C2T A;  3N2K E;  3ZLI A;  3NRX A;  3QB5 K;  2V5D A;  4LF6 T;  4DMV A;  3IA3 A;  2CCQ A;  3LK2 B;  1DU2 A;  3E0Z A;  4H9P C;  5HEH A;  4EED A;  5HXC A;  1SHZ C;  2DWG A;  2NR4 A;  1R8I A;  4EZ4 A;  2E9X C;  1SUM B;  4UF0 A;  1M62 A;  4HKA A;  4UIG A;  2J4G A;  1HCI A;  3CX8 B;  4GIW A;  4GK5 E;  1KNZ A;  1JNZ A;  4KHP T;  3RIA A;  3JC6 D;  3KVA A;  5EZY E;  2X9Y A;  3LDQ B;  2C5I T;  3P4W A;  4CN4 A;  4CI1 B;  3Q5E A;  3FHN A;  3KDS E;  5HAX A;  4B3T T;  4X1K E;  2H7V C;  3TLU A;  3NBX X;  4MFR A;  4WW0 A;  5GON E;  4IDO A;  2WP9 A;  2CPT A;  3AEB A;  4OHF A;  4JI6 T;  3RIU A;  4X65 T;  1OED A;  2W66 A;  4U31 A;  4AXP A;  1B7T A;  1MNE A;  2V7M A;  3VR9 A;  1IBK T;  2BKN A;  3AEG A;  4XAX B;  4EGW A;  4GKJ T;  3JCF A;  5LBQ B;  1UCU A;  1HS7 A;  2LSI A;  2FJD A;  2L8K A;  4ZOL E;  3RKG A;  2X9W A;  2V7I A;  5JR9 C;  5CB4 E;  2XAG B;  4ZHQ E;  5BR8 T;  3MZK B;  1HR0 T;  4P0B A;  2IHR 1;  2XQ4 A;  2QRX A;  1WCR A;  3Q5W A;  3RLF F;  4NXM T;  3H3A A;  4UVC B;  2X51 A;  4HWH A;  5FNV E;  1M7K A;  1UUS A;  3A8Y C;  4JYA T;  3FBZ A;  3AXJ B;  2H89 A;  5EK4 A;  5IYZ E;  1KEY A;  3B5M A;  4H63 V;  3EAM A;  3L09 A;  4HFD A;  2ODV A;  3MK7 C;  3C98 B;  3K1S A;  4UVB B;  5JR9 A;  2IML A;  5IHY A;  2CHN A;  3WAK A;  2D0U A;  2VKH A;  1CUN A;  3VU7 H;  4ANJ A;  2LKH A;  1ZP0 A;  4HGA A;  4WZX A;  2IAK A;  4EXT A;  2CWO A;  3HKB E;  2RPA A;  5AFU L;  1D1C A;  4EIW A;  3AA1 B;  4ZEY A;  5ABE A;  1VCT A;  3RIF A;  4COF A;  4QHO A;  2W4X A;  5FXW A;  5L3C B;  3ZJ2 A;  5LXT E;  5E0O A;  5HXS A;  4ZZC A;  3ETU A;  5LYJ E;  4TWH A;  4YFS A;  2XQ8 A;  4HTE A;  4WYV A;  2Y48 B;  4B6X A;  3A7M A;  1WLX A;  1UGO A;  4AKI A;  1G8X A;  3E08 A;  2LKG A;  2X68 A;  3I9W A;  2QYW A;  2LSY A;  3ZKR A;  1X79 A;  2PBI A;  4X20 E;  4DV5 T;  4C91 A;  1YD8 G;  5FXX A;  4QXB B;  1IZN B;  3NZQ A;  4JI0 T;  1HF8 A;  3IHR A;  5L4E A;  2A9U A;  4QXC B;  3UUB A;  3ZT6 A;  3GN5 A;  4GK0 E;  1MND A;  4H9R C;  3AE6 A;  3N9N A;  2X0Y A;  3FZL B;  4DR1 T;  1XNQ T;  5LHH B;  3ZJ1 A;  5AQQ B;  3RC8 A;  3LK4 2;  3MA9 A;  2CXF A;  2ES0 A;  5JQG E;  1U4Q A;  4O4J E;  2YOE A;  5JH7 E;  4UF0 B;  4O2B E;  3IEE A;  1OWA A;  2CA5 A;  5AQN B;  4U7Y A;  4TV8 E;  5J1G A;  3PU3 A;  4KBM B;  4U2Z A;  3PJA J;  4TX5 A;  5JDH A;  5AQO B;  5FL1 A;  4DUZ T;  3PUY F;  3I1A A;  2JQ9 A;  2UXD T;  1HFA A;  4ZZB A;  4YLH A;  2YDQ A;  4P1N A;  4AKH A;  2JMH A;  3J7Y q;  2LM9 A;  3ZPO A;  4B3R T;  5HWX A;  4IT4 A;  2WSS V;  2ZM0 A;  3MKD A;  1IJ5 A;  4NUU A;  4X66 T;  3L39 A;  2ZMA A;  3MXZ A;  2YIN A;  4A98 A;  4IE5 A;  1OED B;  4A56 A;  2VWA A;  4IE6 A;  4CQI A;  1AJ3 A;  4BA9 A;  2FBW A;  3UUN A;  4IGU A;  4YSX A;  2VVN A;  3ONX A;  3O4X E;  4AIS A;  2YU2 A;  3K3O A;  5KX5 E;  4DV0 T;  5HCJ A;  4MHC A;  3CQC B;  5FVL A;  5LBM A;  3HA4 A;  4QX7 B;  5LHG B;  1X9B A;  2W0G A;  4MAL A;  2A72 A;  2XM2 A;  3SFE A;  4CN6 A;  3H37 A;  4YTM A;  4ILA A;  4QKN A;  1N33 T;  4QXH B;  4I0U A;  2LT3 A;  3BQL A;  4G63 A;  2BS2 A;  4JI8 T;  4IE0 A;  5FYM A;  1EZ3 A;  2W62 A;  4CXY A;  3T8O A;  3PTR B;  3CKD A;  5HXE A;  5JR9 B;  1LRZ A;  4TNW A;  3PUS A;  4HN9 A;  3UU6 A;  3AE9 A;  1JNR A;  4PK5 A;  2YKS A;  4EAH A;  3T1H T;  4YHJ A;  5LG3 A;  4HWI B;  1FMV A;  2N1G A;  2X9X A;  1U5P A;  2XUE A;  3CML A;  1O3X A;  3VRA A;  4PJN A;  4JBW F;  2CMR A;  1WFD A;  1WR0 A;  5F5W A;  1MMN A;  4AQF C;  2WDQ A;  1NWM X;  2BKP A;  3N9P A;  3RRW A;  4ZI7 E;  3FZF B;  4ILC A;  5JDN A;  4EZH A;  5L3F B;  2X0L B;  1MMD A;  3RC3 A;  1YKE B;  3UTK A;  4U7I A;  2BS3 A;  2XY8 B;  2XTL A;  2KXP B;  2L3L A;  4LMK A;  4K0U A;  4EYY R;  4B3M T;  5JDQ A;  1MIV A;  4KX6 A;  4LF7 T;  4ZXL A;  2V7J A;  5J0Z A;  3H3M A;  4ZS2 A;  4I4T E;  4JI3 T;  3AE2 A;  1XWM A;  2PTF A;  2KZ7 B;  3PUA A;  1MIY A;  3D0T A;  4E7S A;  1W0B A;  4ISS A;  1D0X A;  3JAF A;  4LFC T;  4BAY B;  3V5S A;  2JJ9 A;  1HG5 A;  3GN5 B;  1KNR A;  4YJ2 E;  1KF6 A;  2EHO A;  3ZYL A;  2KWI B;  3C4W A;  3IF8 B;  2GK9 A;  3PV0 F;  4DR7 T;  5FY0 A;  2XQY A;  1D1A A;  2HH7 A;  3L3P A;  4ZI3 C;  2KND A;  4UVA B;  4CN1 A;  1VRB A;  1T98 A;  1ZOY A;  1BR4 A;  2BDE A;  2K3W A;  2I6H A;  2ZLY A;  3NRY A;  2BG9 C;  2V5C A;  1V9D A;  2OV9 A;  1J5E T;  3M65 A;  5AQJ B;  3BQI A;  2IUB A;  3OPC A;  5CJ5 A;  3ZN1 B;  4AIU A;  3AE4 A;  4QX8 B;  3RYF E;  3AE8 A;  3J9X 1;  2KLQ A;  1XNR T;  4IE7 A;  4YSY A;  3P7I A;  3PUX F;  5FXV A;  3RIU C;  1OED C;  3Q9D A;  5JDG A;  5M4Y A;  4GKK T;  4EYU A;  4LF9 T;  3FZK B;  2BG9 A;  2Q9Q A;  3ZCJ A;  2VB6 A;  3IBP A;  3ZMS B;  4UXN B;  4M1P A;  2B76 A;  1KFY A;  2YN6 A;  3PUV F;  4LFA T;  1YW0 A;  1W0A A;  2WBL A;  4OK0 A;  4IHJ E;  3BK9 A;  4PJM A;  3AE5 A;  5LGU B;  3C4Z A;  4JI5 T;  3X1D A;  2UUC T;  1MMA A;  2HPL A;  2WY2 A;  2WDV A;  5LCY A;  2W61 A;  3QC9 A;  3FZM B;  3ANW A;  1US7 B;  3LJC A;  1YXR A;  2LOS A;  3WAJ A;  1IAP A;  2R6G F;  3P4R A;  2V7L A;  2C5K T;  2UUB T;  4AQY T;  5LMU T;  1NAF A;  2CM0 A;  4DMW A;  3AB3 B;  2D9D A;  3LBX A;  5DQW A;  1H7C A;  3KV6 A;  2DWK A;  2M67 A;  5J2U E;  1KK7 A;  2XSB A;  4DV7 T;  3ONJ A;  5FVK A;  4TWD A;  4HFB A;  3UU5 A;  3AEC A;  2NTY A;  3RQW A;  4JI2 T;  4DBR A;  2QGS A;  2CBJ A;  4AKG A;  4B3S T;  2H7O A;  4DBQ A;  1VCS A;  3EDU A;  4DR2 T;  3RF1 A;  3E22 E;  4ZS3 A;  4A5X A;  4K0K T;  2YEV C;  4EB6 E;  2UXC T;  1LKX A;  3UU3 A;  2N9D A;  4IE4 A;  2BZB A;  2X67 A;  5LA6 E;  2D2S A;  4PAG A;  3EI0 A;  1T8B A;  3P4S A;  1OXZ A;  4Z91 A;  3N2G E;  1W9R A;  2Y6X A;  2J1D G;  4E7Z A;  5HEO A;  2JPF A;  3OYX A;  5LNK A;  4UEL A;  3N2O A;  1UK5 A;  1T7S A;  5KMG P;  5AQS B;  4QH4 A;  5C8Y E;  3UU4 A;  3GWH A;  2OLT A;  1XDO A;  2LM2 A;  4HE8 A;  2MBG A;  4PK4 A;  5L47 A;  3RYC E;  1BR0 A;  3DP7 A;  3RPU A;  1QUU A;  2K5B B;  3ZMT B;  3UUL A;  4JI7 T;  3LFM A;  2J47 A;  1YQ3 A;  2V6Y A;  4AI6 A;  2NP9 A;  4EOZ B;  2M6I A;  4J2C A;  1NEN A;  1I94 T;  5H6Q B;  2LHN A;  3F2E A;  4NUV A;  3HI2 A;  2B1E A;  2NW7 A;  2DCF A;  5AQG B;  3P4Q A;  4DO0 A;  2LJL A;  2VQE T;  2VVS A;  5A1L A;  2DL1 A;  2EHO B;  3CVR A;  4TZ4 C;  2YU1 A;  4HFH A;  2W67 A;  4KP3 C;  4G2A A;  2JQH A;  4AQG A;  2UUA T;  5AQU B;  3M3Z B;  1D1B A;  4YJ3 E;  4DR4 T;  2IIU A;  2HHH T;  2E5V A;  3P8C D;  4O8S A;  2XZE A;  3N9O A;  3T1Y T;  5IUX A;  3EHZ A;  1NEK A;  4U2Y A;  3K3N A;  2E5L T;  5CGM A;  3AAE B;  3N9Q A;  3FXE B;  4DR6 T;  2XHE B;  4DV3 T;  5FY1 A;  2KT9 A;  1UX4 A;  2VL0 A;  2WZH A;  4NPP A;  5HXR A;  1LVK A;  3UQ7 A;  2WB5 A;  4A97 A;  4IDN A;  4XZC A;  5ADX L;  1D0Y A;  3CIR A;  3N9M A;  4QWN B;  2YDS A;  2BG9 B;  4UEM A;  2XAF B;  5L3E B;  3RI5 A;  1N32 T;  3MJX A;  3HR0 A;  1HTJ F;  4H9N C;  4OYJ A;  4UV9 B;  2W2U A;  1YQ4 A;  2PJQ A;  4PK6 A;  4U33 A;  4BJM A;  2A2F X;  2XJ7 A;  1HNW T;  4MBQ A;  3O1I A;  3ZYM A;  4P0A A;  3OYZ A;  3ANW B;  5ABG A;  2HN2 A;  3C51 A;  3CK6 A;  2ZM8 A;  5AQI B;  4L9I A;  1CHU A;  5HEJ A;  5LG4 A;  1UX5 A;  4H9S E;  3LBX B;  4YHH T;  2E2A A;  2LRL A;  5LJM A;  2C0S A;  2Y8D A;  2N2N A;  3Q2M A;  1HX8 A;  4DV4 T;  4HWD A;  2DNX A;  3DTO A;  2DLR A;  3NVO A;  3C4X A;  3PU8 A;  1Z8U A;  3FBL A;  1ZEE A;  2BBJ A;  1IBL T;  5L3B B;  2K48 A;  5L3G B;  4TUY E;  4TN7 B;  4PJL A;  2KIN B;  4YT0 A;  3RGL A;  2CLY B;  3SOL A;  3HL6 A;  4Z8X A;  3LSV A;  2EHO D;  3B13 A;  1FMW A;  3EUH A;  4DV2 T;  3L8R A;  4U74 A;  1FIO A;  5AQL B;  3UFE A;  2V8S V;  1T72 A;  5DJQ C; 
#chains in the Genus database with same CATH homology
 3WAK A;  5LGT B;  4WBO A;  2XAH B;  2D0U A;  2VKH A;  1CUN A;  3VU7 H;  4ANJ A;  5L3D B;  2JQQ A;  3SWH A;  4TV9 E;  3Q9D A;  4HGA A;  5JDG A;  5M4Y A;  3CX7 B;  2C5J A;  2IAK A;  1E1H B;  4JEU B;  4ASK A;  4EXT A;  2LOP A;  4EYU A;  2CWO A;  2LE8 A;  3HKB E;  4FJO A;  2Q9Q A;  3ZCJ A;  5AFU L;  2VB6 A;  4I50 E;  2K9A A;  3C64 A;  1D1C A;  4EIW A;  5HWY A;  3AA0 B;  4OFZ A;  3IBP A;  3AA1 B;  3ZMS B;  4UXN B;  2EHO C;  4O4L E;  2JRK A;  2PG8 A;  4M1P A;  3LG7 A;  4KMC A;  4QHO A;  2VKD A;  5FXW A;  1YW0 A;  5JRC A;  2WBL A;  5L3C B;  4OK0 A;  4IHJ E;  3ZJ2 A;  3BK9 A;  5LXT E;  5E0O A;  5HXS A;  1SA0 E;  2BVM A;  1QSD A;  4PJM A;  3W15 B;  3ETU A;  2RA1 A;  5LYJ E;  5LGU B;  3V5U A;  3C4Z A;  4ZI3 D;  2A3D A;  3KIN B;  2L9Q A;  1MMA A;  2HPL A;  4YFS A;  2E9X B;  4HTE A;  2Y48 B;  4B6X A;  3K8P C;  5LCY A;  2YK0 A;  1WLX A;  2W61 A;  3QC9 A;  4F6R C;  3ANW A;  4AKI A;  2Q9Q D;  1US7 B;  3LJC A;  4L0R A;  3VKG A;  2LOS A;  2SPC A;  3QK6 A;  5LP6 E;  3WAJ A;  2V26 A;  1G8X A;  1IAP A;  3E08 A;  1HG2 A;  2K24 A;  2C5K T;  2V7L A;  2X68 A;  3ETV A;  2X66 A;  1WYB A;  3I9W A;  2LSY A;  4PW8 A;  1X79 A;  2PBI A;  4X1Y E;  1NAF A;  4X20 E;  3EVY A;  2CM0 A;  4PFO A;  3MAC A;  4DMW A;  5ETW A;  3AB3 B;  3HKC E;  3VHL A;  4C91 A;  1YD8 G;  2WMO A;  2WAU A;  5FXX A;  2IC9 A;  3LBX A;  5DQW A;  1S94 A;  5L2L A;  1H7C A;  3KV6 A;  4QXB B;  1IZN B;  2DWK A;  2M67 A;  3NZQ A;  3AAA B;  5J2U E;  2G0U A;  1KK7 A;  3I0O A;  3UUM A;  1HF8 A;  4CXX A;  5JVD E;  3IHR A;  4L5G A;  2LSK A;  4CXW A;  4QXC B;  3RYH E;  2OA5 A;  2NTY A;  3GN5 A;  4GK0 E;  3GA8 A;  4DBR A;  5F3J A;  4HFV A;  2QGS A;  2VK9 A;  3O9X A;  1MND A;  4AKG A;  3ESL A;  3RKO A;  3R84 B;  2P9B A;  2E8I A;  2WMN A;  4H9R C;  4MLK A;  4JUY A;  5CA1 E;  4GOU A;  2Q9Q C;  5FY7 A;  3ZMU B;  1ZV4 X;  3HKE E;  2H7O A;  3U3I A;  4DBQ A;  3EDU A;  3KV9 A;  3N9N A;  4CI3 B;  5LHH B;  1G73 A;  3E22 E;  3ZJ1 A;  3N5L A;  4ZS3 A;  3AVS A;  2YEV C;  3PE0 A;  4EB6 E;  1LKX A;  3RC8 A;  5FMN A;  4GYR A;  3LK4 2;  2NOX A;  2N9D A;  3ZEF B;  4IE4 A;  3MA9 A;  2CXF A;  2ES0 A;  5JDF A;  2CE7 A;  3KBU A;  2BZB A;  2X67 A;  5LA6 E;  2D2S A;  4PAG A;  5JQG E;  1U4Q A;  4O4J E;  1BR2 A;  1OXZ A;  4WNK A;  4ADZ A;  5DAB A;  5HYA A;  2HPJ A;  5JH7 E;  4UF0 B;  3PUQ A;  4O2B E;  3I9Y A;  2MOZ A;  3N2G E;  3IEE A;  3OKQ A;  2Y6X A;  3O1J A;  2J1D G;  1OWA A;  4E7Z A;  3FXD B;  1WRD A;  2JPF A;  2CA5 A;  3OYX A;  4ERR A;  4O4I E;  3N9L A;  5LNK A;  4UEL A;  3N2O A;  4BJN A;  5KMG P;  1WR6 A;  4TV8 E;  3CQX C;  5J1G A;  2W63 A;  1FEW A;  3PU3 A;  4O4H E;  4IIJ E;  5C8Y E;  2RP4 A;  2NW9 A;  3ZN0 B;  1WYC A;  3GWH A;  5DQV A;  4KBM B;  4TX5 A;  1Z0P A;  5JDH A;  2CXD A;  4HE8 A;  3I1A A;  2MBG A;  2UXX B;  1Y64 B;  4PK4 A;  3S4U A;  4JEH B;  2W00 A;  3ZMV B;  5FP3 A;  1HFA A;  3RH3 A;  2LHR A;  4YLH A;  4AKH A;  2V1D B;  3RYC E;  3KFW X;  2JMH A;  3ZYK A;  2WM9 A;  1BR0 A;  3BQK A;  3J7Y q;  2LM9 A;  5LGN B;  3ZPO A;  3SRZ A;  3DP7 A;  5HWX A;  3ZMZ B;  1ZHC A;  3RPU A;  1QUU A;  2WSS V;  3Q5X A;  2K5B B;  5EK2 A;  2ZM0 A;  3ZMT B;  3UUL A;  4O2A E;  4V1A v;  3MKD A;  1IJ5 A;  4NUU A;  4OYK A;  3LFM A;  3U78 A;  3ZC0 A;  3NZP A;  4GYS A;  2ZMA A;  3MXZ A;  2YIN A;  4AI6 A;  2NP9 A;  2IC6 A;  4EOZ B;  2D5U A;  5BMV E;  2ODU A;  3K3Q C;  3R6N A;  4J2C A;  4IE5 A;  1IJ6 A;  2V7K A;  2ZM2 A;  4A56 A;  5H6Q B;  5H6R B;  2LHN A;  2VWA A;  3F2E A;  3HI2 A;  1S35 A;  2B1E A;  4NUV A;  4IE6 A;  2E9X A;  2NW7 A;  3PDY A;  4CQI A;  1AJ3 A;  2QA7 A;  3AA6 B;  4BA9 A;  2DCF A;  5HXH A;  5EK3 A;  3UUN A;  4DO0 A;  4UV8 B;  2LJL A;  4IGU A;  2CLY C;  5A1L A;  4KUM B;  3UUX B;  3JC6 C;  2NW8 A;  3LK3 B;  2EHO B;  2LEH A;  3CVR A;  3ONX A;  5JDM A;  4TZ4 C;  3O4X E;  2YU1 A;  3RRC A;  4DND A;  1ZKE A;  2D0T A;  2YU2 A;  3F57 A;  2X9H A;  3O1H A;  4AQF A;  3AAI A;  2XAS B;  3K3O A;  4KP3 C;  5KX5 E;  3PUG A;  4MHC A;  3CQC B;  4G2A A;  2DI4 A;  3CWZ B;  4H9O C;  5LBM A;  3HA4 A;  4HEA A;  4QX7 B;  5LHG B;  3RX6 A;  4AQG A;  3OBV E;  3CQG B;  4AKR B;  2W0G A;  1D1B A;  4MAL A;  4YJ3 E;  5LJN A;  2A72 A;  3H37 A;  4CZZ B;  3A5X A;  2JMK A;  2Z6E A;  4DVD A;  3P8C D;  4O8S A;  2E9X D;  3N9O A;  4H9Q C;  1VOM A;  5J2T E;  4QKN A;  4QXH B;  3KBT A;  3RYI E;  2LT3 A;  2VKO A;  1BR1 A;  3BQL A;  5TAO A;  2VAS A;  4JLE A;  4N78 D;  5FXZ A;  3K3N A;  4G63 A;  4U72 A;  3AAE B;  3N9Q A;  1YKH B;  3FXE B;  5LOV E;  2XHE B;  1D0Z A;  3CPZ A;  4IE0 A;  4I55 E;  5FY1 A;  3N2K E;  5JDL A;  4PFP A;  3ZLI A;  5FYM A;  2UXN B;  1EZ3 A;  2W62 A;  3NRX A;  3OJA A;  4CXY A;  3T8O A;  3PTR B;  4DMV A;  3CKD A;  2CCQ A;  5HXE A;  3CX6 B;  3WI3 A;  3LK2 B;  2KT9 A;  1UX4 A;  3E0Z A;  5JR9 B;  5HXR A;  1LRZ A;  3ZC1 A;  1LVK A;  5LHI B;  3PUS A;  4H9P C;  4HN9 A;  4WBN E;  5HXC A;  2CWY A;  1SHZ C;  5ADX L;  4XZC A;  1D0Y A;  2DWG A;  4PK5 A;  3N9M A;  4EZ4 A;  4EAH A;  2E9X C;  4PNI A;  2CEA A;  4YHJ A;  4FI5 A;  4QWN B;  4UF0 A;  4HKA A;  4UIG A;  1HCI A;  1FMV A;  3CX8 B;  2N1G A;  2X9X A;  3AA7 B;  4GIW A;  4GK5 E;  1U5P A;  3B57 A;  4IST A;  4ZI2 D;  2XUE A;  3CML A;  3DJB A;  5KDM C;  1O3X A;  4UEM A;  1KNZ A;  3TKL B;  4PJN A;  2XAF B;  2CMR A;  5L3E B;  4IDZ A;  4P09 A;  3MJX A;  1MMG A;  3JC6 D;  3HR0 A;  3KVA A;  3EDV A;  1HTJ F;  5EZY E;  4H9N C;  2X9Y A;  4OYJ A;  4UV9 B;  1MMN A;  4AQF C;  5JRC B;  2C5I T;  2CXL A;  4ILU A;  2PJQ A;  4PK6 A;  1NWM X;  4BJM A;  3N9P A;  2A2F X;  3RRW A;  4ZI7 E;  4CI1 B;  3FHN A;  3KDS E;  3KVB A;  3GMI A;  4MBQ A;  3O1I A;  5HAX A;  5JDN A;  4EZH A;  3ZYM A;  2IW5 B;  5L3F B;  2X0L B;  4P0A A;  4X1K E;  2BVL A;  3OYZ A;  1MMD A;  3RC3 A;  1YKE B;  3AVR A;  3UTK A;  2NWB A;  2XAQ B;  3ANW B;  2PFV A;  2H7V C;  3C51 A;  2XTL A;  2KXP B;  2ZM8 A;  3NBX X;  2ACX A;  2L3L A;  4L9I A;  4MFR A;  3PUR A;  4K0U A;  4EYY R;  4WW0 A;  5GON E;  5JDQ A;  4ZI2 C;  1MIV A;  2V7J A;  3UT5 E;  4ZS2 A;  4I4T E;  5LG4 A;  2KZ7 B;  3PUA A;  3SS1 A;  1UX5 A;  4H9S E;  1MIY A;  4OHF A;  3LBX B;  2I59 A;  5JRE A;  3D0T A;  4E7S A;  4I43 B;  4AXP A;  2LSG A;  5LJM A;  1B7T A;  2C0S A;  2Y8D A;  1MNE A;  4ISS A;  1D0X A;  2V7M A;  2N2N A;  3I0Q A;  4C90 A;  2DHR A;  3Q2M A;  4BAY B;  1HX8 A;  4X1I E;  3VKH A;  3V5S A;  2MTQ A;  2JJ9 A;  4H63 H;  1HG5 A;  2DNX A;  3GN5 B;  5CA0 E;  3DTO A;  2DLR A;  4XAX B;  5F8P A;  4YJ2 E;  3QUJ A;  2EHO A;  3ZYL A;  2KWI B;  3C4X A;  1UCU A;  3C4W A;  3PU8 A;  5LBQ B;  3IF8 B;  2LSI A;  1HS7 A;  2GK9 A;  5DJQ C;  2L8K A;  3FBL A;  4ZOL E;  4AKL A;  1ZEE A;  2X9W A;  2H3R A;  2V7I A;  5JR9 C;  5FY0 A;  2XQY A;  5CB4 E;  1D1A A;  2XAG B;  1MIW A;  4ZHQ E;  2HH7 A;  3L3P A;  3ZCI A;  5L3B B;  4ZI3 C;  2KND A;  3MZK B;  2K48 A;  5L3G B;  4UVA B;  4P0B A;  1VRB A;  1T98 A;  4TUY E;  1BR4 A;  2BDE A;  4TN7 B;  3Q5W A;  2ZLY A;  3NRY A;  3H3A A;  4PJL A;  3HKD E;  4UVC B;  2KIN B;  2WWU A;  1V9D A;  2NTX A;  2VL8 A;  2X51 A;  5FNV E;  2VKJ A;  4XBF B;  3M65 A;  3FB2 A;  2CLY B;  3FBZ A;  3SOL A;  3HL6 A;  1LVF A;  4Z8X A;  4PJJ A;  3BQI A;  2EHO D;  5EK4 A;  3B13 A;  5IYZ E;  3ZN1 B;  3C50 A;  4QX8 B;  3RYF E;  1FMW A;  4H63 V;  3L09 A;  3EUH A;  3F31 A;  4U74 A;  3J9X 1;  2KLQ A;  1FIO A;  2LSJ A;  4IE7 A;  2KWH A;  2ODV A;  2KMF A;  3C98 B;  3KV4 A;  3MK7 C;  2XAJ B;  4CI2 B;  3P7I A;  4UVB B;  3UFE A;  5FXV A;  2MYS A;  2Q9Q B;  5JR9 A;  3KV5 A;  5IHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...