2N2NA

Tom1 negatively modulates binding of tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of Myb protein 1
publication title Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n2nA00
1WR6A 1O3XA 1WRDA 1YD8G 2N2NA 1OXZA 2N9DA 1NWMX 1X79A 1NAFA
chains in the Genus database with same CATH superfamily
3FZKB 2FJEA 4TWDA 3H37A 5M4YA 3AVSA 5ABGA 4UXNB 4AKIA 2GK9A 1YKHB 3NZPA 4CI3B 4IT4A 2WAUA 2IMLA 4AQFA 2W62A 4PK6A 1FMWA 3RIUC 2CHNA 3RYFE 3C4XA 2L8KA 4ZZBA 2BDEA 2LM9A 2X9HA 4ZEYA 1ZOYA 2X0HA 3AXJB 5FXZA 2NW9A 1OXZA 4TX5A 2CEAA 4M1PA 2XAGB 5JDQA 4JI7T 4OFZA 4Z90A 1HF8A 5AQPB 2EHOA 5EK3A 3RKGA 4O4HE 1XMOT 5HWXA 3N2KE 3A7MA 3B13A 3WI3A 3GA8A 1H7CA 4HWDA 3KBUA 3HKEE 2C5KT 4JI0T 1W0AA 4QHOA 4OX9T 3ZKRA 4BJNA 2VKHA 5A1LA 1Z0PA 2HPJA 2J47A 1E1HB 4QX8B 2YU2A 3PUQA 2XTLA 2NW8A 3EABA 2WZHA 4WBOA 4IDNA 5AQTB 2KXPB 2OV9A 3O4XE 4X1IE 2E5VA 3FZMB 2OA5A 1W9RA 2VVNA 4QH4A 1HG2A 5HXCA 3JAFA 3K1SA 1IJ5A 5CA0E 3ZYKA 5LBMA 4P0BA 5J1GA 3U3IA 4QXBB 3SFDA 1KNPA 3AB3B 5EZYE 2N1GA 3JAEA 2H7VC 5L3BB 4KBMB 2VVSA 3F31A 4I0UA 3AA7B 4WZXA 2XHEB 3P4QA 3W15B 5LHIB 4JBWF 3I0OA 1SHZC 4U31A 2FJAA 4U2ZA 1UX4A 2XM2A 3RH3A 3EI0A 4UIGA 5JTGA 5FKYA 3IBPA 4DV6T 4EEBA 2BBHA 3N9NA 3AE8A 3RIAA 1ZHCA 4EEDA 4TZ4C 3HKBE 2CM0A 2YN6A 4X5TA 3PJAJ 4GKKT 3CIRA 2XQ8A 3VKHA 2BBJA 3AE1A 3LK3B 4IL4A 3ZMSB 4UV9B 2WMNA 2ODVA 2IAKA 2AXDS 2V7JA 3JCFA 3CMLA 4C90A 3T1YT 2XSBA 1IBLT 3P7IA 5H6QB 2WWVA 2DL1A 1ZV4X 1VRBA 3EUHA 1FJGT 4O2BE 2WWUA 1LKXA 2HN2A 3SOLA 1BR0A 3FXDB 2JQQA 2E5LT 3L39A 1WCRA 4EGWA 4DVDA 5KMGP 5LB7B 4EV6A 5LA6E 3UUMA 4IDPA 5E0OA 2BKPA 2BG9E 4IE0A 4KHPT 4DUZT 3AECA 3P8CD 4NUVA 3ZT6A 3LK2B 4QKNA 4LF7T 5L3FB 2VURA 3UT5E 3SS1A 2RPAA 3ONLC 4JI3T 2I6HA 5AQFB 4U2YA 2VWAA 2K5BB 3AE6A 1W0BA 5C3JA 5IYZE 3VKGA 5LP6E 2A9UA 5AQVB 4X62T 2YDRA 4N78D 5LBQB 5J2TE 4H9PC 4XZCA 4ZI3D 2WM9A 2EHOD 1HNXT 4H9RC 2E9XA 2DLRA 2D9DA 5LJMA 4L0RA 4PJJA 1YQ4A 3EDUA 2VK9A 1DU2A 3RLFF 3AE4A 4QX7B 4LFBT 2J62A 4YHJA 4IDZA 2UXXB 4Z8XA 5HEUA 3FZHB 3F2EA 2C0SA 5LHGB 3JADA 2IUBA 5LNKA 5JREA 3P4RA 3UU8A 5ABHA 3LFMA 3ZPOA 4LMJA 4X66T 3DJBA 4CN1A 4JI6T 1B7TA 5IWAT 3ZSTA 2DWKA 1NWMX 4GK5E 4I55E 5DQWA 3R84B 3ZCJA 4DV0T 5GONE 3SFEA 2NW7A 2W2UA 1UCUA 2HPLA 4TWFA 2CWOA 5JRCB 4O8SA 3LK42 3PJAA 2DWGA 4EZHA 2Y8DA 4JI4T 3P4SA 4IDQA 2KNDA 3EVYA 2L9QA 5FMNA 4CXXA 1MIWA 3VRBA 4KMCA 1ZKEA 3NWIA 1GQEA 3FZFB 1U4QA 3RIUA 2XSAA 4GOUA 2V26A 4A98A 3GMIA 2BG9C 1NENA 3BK9A 2VASA 3PV0F 4Q25A 4QH1A 3VR8A 4B3TT 2LEHA 2JQHA 4AKLA 1WLXA 4K0KT 4AKHA 4UF0B 4YTMA 1KF6A 3E22E 4LMLA 3RRWA 5FL0A 4KI0F 2QVAA 5AQGB 4IIJE 5JR9C 4YY3T 5AQJB 2W67A 1BR2A 2UXNB 5BMVE 5FVLA 3QB5A 3NKZA 3K8PC 4U33A 2JQ9A 4A56A 4DO0A 2UXBT 1T7SA 5CJ5A 4QXCB 5FVKA 5FYMA 2D2SA 3C4ZA 3U78A 4DR5T 4HWFA 1D0ZA 1Y01A 4X65T 3C64A 1XMQT 3RF1A 3ZMTB 4EB6E 2B1EA 4IL9A 4DR6T 1T98A 1V9DA 2BVMA 2RP4A 5JH7E 4QH5A 3Q9DA 1QLBA 2NOXA 4DR3T 3LBXA 3O1HA 2WDVA 1M62A 5LXTE 1LVKA 3ANWA 3H3AA 3ZLIA 2WBLA 2V6YA 3GN5A 1LRZA 3ONJA 2LLYA 3NRYA 3DTOA 4JYAT 2LE8A 3HKDE 5IHYA 3I9YA 3P4WA 4ZI2C 3HA4A 3ZT5A 1WR0A 2BS2A 1BR1A 3KBTA 5C2TA 2E9XD 2VKOA 4E7SA 3JC6D 3K3OA 2MOZA 5FXWA 4AQYT 4ZS3A 3ZCIA 4LFAT 2M67A 5FY0A 3AA1B 3CKDA 3FHNA 5HEJA 1KEYA 5HXHA 3NRXA 3AEDA 3RI5A 5CGMA 3N9MA 5JDLA 2LHRA 4BAYB 2XM1A 3V5UA 3AA6B 4X1YE 2ZM0A 2CA5A 2UUCT 2DHRA 3O9XA 4YSYA 3OBVE 2KINB 2V1DB 4UELA 3ZSSA 2P9BA 1OWAA 2VQFT 4A5XA 3IHRA 2Q9QA 4UV8B 4UVAB 3C4WA 4JEHB 2H89A 3EDVA 4DIDB 2B76A 4AQGA 4XAXB 1E2AA 2K9AA 5AQUB 4YT0A 2LT3A 1HNZT 1T8BA 2LOPA 2UXCT 2CWYA 3R6NA 2DNXA 2CXDA 4LF9T 4EIWA 4ZOLE 2XPKA 4BA9A 2XAJB 4ZS2A 1KFYA 3J7Yq 2W61A 4BJMA 5CFBA 3TLWA 2VB6A 3CWZB 5ABEA 1N32T 4DNDA 4EXTA 3KFWX 1HNWT 3AE7A 2KMFA 1HFAA 2QGSA 5L3CB 4ISTA 2UUAT 1YQ3A 4TV8E 1IZNB 2ES0A 2MAWA 4EOZB 2F4VT 1OEDA 2W63A 4B6XA 2DCFA 3CQCB 3A8YC 1O3XA 4HTEA 5AQLB 4K0UA 4LF5T 2D0UA 3VHLA 3ESLA 2KZ7B 2UXDT 3IA3A 4EYYR 2FJBA 3AAAB 3GWHA 1IBMT 2WZIA 4IE6A 3RPUA 3UQ4A 3F57A 2KWIB 1JNZA 2W00A 4U72A 5EK2A 2CXFA 1US7B 4CI1B 5IUXA 2WY2A 3AA0B 2XQYA 2YEVC 4YSXA 4HWIB 5LGTB 3QNUA 2WSSV 4COFA 3AEAA 2ACXA 1MNDA 4AQFC 2X9YA 1BR4A 4WBNE 4HFIA 4HN9A 2X9XA 2BG9A 3BQLA 2QRXA 4H9QC 4ASKA 2UU9T 3EHZA 4PJMA 2KLQA 3P50A 1HX1B 3BQIA 4NUUA 4IE5A 3ZYLA 3PDYA 5ADXL 5LGUB 5H6RB 1T72A 4HE8A 2JQKA 2Y6XA 4MHCA 4ZI3C 2HH7A 4CI2B 3TLTA 2EHOC 3EAMA 3LBXB 2YDQA 5KX5E 3ZC0A 3Q5EA 3ANWB 1G8XA 4UVCB 2WDQA 4PK4A 2NTYA 3GN5B 2VKDA 2XJ7A 5AQOB 5LYJE 3X1DA 2PBIA 1SA0E 1D0YA 2JMKA 4AXPA 3KV4A 3CX6B 2A3DA 3QOFA 3RX6A 5JDMA 4JUYA 4CN6A 1HCIA 4JLEA 3HR0A 2V6XA 2X0LB 1UURA 4P1NA 3VRAA 2N2NA 2MBGA 4DMWA 2WU2A 2W4XA 3LDQB 4G2AA 4ANJA 5DABA 5ABFA 3AE2A 1NEKA 2WS3A 4B3RT 2VL0A 2IW5B 4G63A 4WYVA 5FNVE 3L3PA 4GYRA 3E0ZA 4PK5A 2QYWA 4ADZA 4YFSA 2EHOB 2WDRA 1X9BA 4U7YA 2Q9QD 4DV5T 2XAHB 3WAJA 4O4JE 4YXDA 2VL8A 4PFPA 4AIUA 3PU8A 1VCTA 4EAHA 5BR8T 3QUJA 3PUWF 3C51A 3RC8A 2H3RA 4HWHA 1WYBA 2OLTA 4A97A 3ETUA 3FZLB 2CBIA 1MIVA 2X68A 1ZP0A 4PJNA 3SWHA 1U5PA 2CCQA 3AAIA 5FXXA 3T8OA 2ODUA 2QA7A 2D0TA 2IDOB 3KVAA 4HGAA 3MACA 5HYAA 2HN1A 2L3LA 3D0TA 2HHHT 5JDFA 2J4GA 4HFEA 2LM2A 5F8PA 3UTKA 5L3GB 5LHHB 2I59A 2PFVA 3OYZA 4L9IA 3T1HT 1YD8G 4MBQA 4HFDA 4OHFA 3ZMVB 3Q5DA 4AI6A 2XAQB 3ZN1B 1EZ3A 1QSDA 2DI4A 1FMVA 3PTRB 1E7PA 2Y48B 3FXEB 1KNZA 4B3MT 3FB2A 3ZC1A 3MKDA 1SUMB 2BKOA 4MALA 4DR1T 1OEDB 3ABVA 4GIWA 3KV6A 4YLHA 5AQSB 2FBWA 3TKLB 3CX8B 4HFCA 3ZN0B 3PUAA 1D1BA 3C50A 3Q5XA 3RKOA 1HX8A 2LKHA 3PU3A 3RQUA 1I94T 1XDPA 2RA1A 2MYSA 3HL6A 5HCMA 3N9QA 4CQIA 4E7ZA 3MK7C 4IREA 2CBJA 4JI8T 4HFHA 1MMGA 3S4UA 1UK5A 5AQHB 1ZEEA 2LRKA 2E8IA 2CLYB 3G06A 4HFVA 2E9XC 1WYCA 2XQ9A 2ZMAA 3O1JA 2BZBA 5ETWA 4KUMB 5L4EA 2WB5A 3N9LA 4UEMA 3RRCA 4GYSA 3P4PA 2LSYA 3FBZA 1WFDA 2NTXA 4CXWA 2IHR1 3CQXC 3MJXA 2LSJA 1MMDA 5LMNT 3AE3A 2LSIA 2D5UA 2YINA 2K48A 4U7IA 5KXJA 4PW8A 4H63V 4DV7T 2YOEA 3ZJ1A 4ZHQE 3RIFA 4O2AE 2V8SV 2IIUA 1VOMA 4AKRB 5LGNB 2XQAA 4EYUA 5AQMB 2ZM2A 2ACZA 3V5SA 3KINB 5FY7A 4DBRA 1XNRT 1KNRA 4ILAA 2E9XB 5ABFB 4KP3C 3ETVA 5F5WA 4YHHT 4LFCT 3Q5WA 4IGUA 4NPPA 2MTQA 3TLSA 2CMRA 3CPZA 2XQ6A 3CK6A 1XZYA 4V1Av 2X66A 3KDSE 4QWNB 5HAXA 2PTFA 1QUUA 3HI2A 2XZEA 5HCJA 3Q2MA 1MMNA 2G0UA 1UX5A 3PUYF 3UU4A 3RHWA 4ZI2D 2BS3A 3M3ZB 2XQ3A 5HXEA 2C5IT 2IC6A 4H9NC 4H63H 5FY1A 4IHJE 5KDMC 2V5DA 2XQ7A 5CA1E 4DR2T 1VCSA 2LSKA 3AEEA 4X20E 4HWCA 4PAGA 3J9X1 3RGLA 4TN7B 3AEBA 4JI1T 3KV5A 1Y64B 4JV5T 4O4IE 2UUBT 4J2CA 5DJQC 4NIQA 1HG5A 2XAFB 3BQKA 5LOVE 4AISA 5JRCA 5CB4E 2H88A 2VKJA 4LF4T 5LG4A 1N36T 3O1IA 4ZZCA 4MFRA 2XUEA 1WRDA 2WP9A 4IE4A 4KHZF 4IE7A 2V7LA 4DV2T 2CE7A 1UUSA 3OKQA 4NXMT 5AFUL 2A2FX 2KWHA 1YXRA 2YU1A 3ZT7A 3UFGA 3UUXB 4I43B 3IEEA 2X67A 5HXSA 4P0AA 3LSVA 4CN4A 4OK0A 1MNEA 1KK7A 3QB5K 1M7KA 4DMVA 4UF0A 3HKCE 2WU5A 2K3WA 2Z6EA 2WQYA 4DR7T 4JEUB 2XQ4A 2V7KA 5JVDE 2X51A 2ZM8A 3VR9A 1OEDE 5L47A 4LF6T 5L2LA 2NR4A 3NBXX 3MXZA 3SRZA 5AQQB 3VU7H 4TNVA 3AVRA 4O4LE 1JNRA 5J2UE 4AKGA 3PURA 4DUYT 1S35A 2BKNA 2JPFA 3UULA 3AEGA 1XWMA 4TV9E 3NVOA 4PNIA 5L3EB 1IAPA 4L5GA 3B5MA 3OVUA 2E2AA 4GKJT 2N9DA 5L3DB 2CHOA 2V7IA 2WMOA 4HEAA 5FXVA 3K3NA 2BS4A 5HEHA 2ZM6T 2LSGA 5FP3A 5DQVA 2CRBA 2X9WA 3L09A 2V6YB 1D0XA 2XASB 2VQET 3CVRA 3UU5A 5JR9A 4ZXLA 1D1AA 1J1JA 2Q9QC 3UQ7A 2JJ9A 2KT9A 3WAKA 4ERRA 3FBLA 1XNQT 1CUNA 2WCAA 4UVBB 4Z91A 1W09A 2LKGA 1HS7A 2YKSA 2M6BA 3KV9A 1UGOA 4DV3T 4XBFB 1MIYA 1Z8UA 3UUNA 4DBQA 2C5JA 2H7OA 3ZJ2A 2ZLYA 1X79A 2W66A 4ISSA 5LMUT 4CZZB 5AQIB 4TNWA 5J0ZA 5JDHA 4GK0E 3TLUA 2V7MA 4YJ2E 4F8HA 4JI2T 4LMKA 3OPCA 1D1CA 3AXJA 2NWBA 2JIWA 3N2OA 3CX7B 3AEFA 3RQWA 2FUPA 2BVLA 2PJQA 4PFOA 1NAFA 2NP9A 3C98B 4PJLA 4QXHB 3LJCA 3KVBA 3DP7A 3AE9A 2IC9A 2PG8A 2Q9QB 3H3MA 3PUZF 2KSRA 4TUYE 4I50E 1OEDC 1S94A 3UU6A 3OJAA 2X0YA 4NXNT 5HEGA 2SPCA 2V5CA 3PUGA 4F6RC 4ILBA 3PE0A 1FEWA 3UU3A 3N2GE 3M65A 4DV4T 3ONXA 3L8RA 2CXLA 5HEOA 5LCYA 3RYCE 3E08A 4UR9A 4JI5T 3PUSA 2J1DG 4U74A 3A5XA 3RYHE 3UUBA 1R8IA 1HR0T 4C91A 2LOSA 3K3QC 2FJDA 4I4TE 5EK4A 2AE9A 4ILCA 3I0QA 4P09A 3I9WA 3RC3A 3PUXF 4ZI7E 5JDGA 1WR6A 4H9OC 1YW0A 4HKAA 3ZEFB 3AE5A 3I1AA 4WNKA 1HTJF 2CLYC 4KX6A 4TWHA 3NZQA 2K24A 4OYJA 2CPTA 2M6IA 3PUVF 1MMAA 2XY8B 4FJOA 3TLVA 3UFEA 4DV1T 5JQGE 1L0VA 2YDSA 4YSZA 4FI5A 3N9OA 5AQRB 2LRLA 1FIOA 1SE7A 3ZMUB 5F3JA 1G73A 1N34T 1AJ3A 2LHNA 3MA9A 3RYIE 4EZ4A 5C8YE 2R6GF 4YJ3E 3ZMZB 3MZKB 4X1KE 5LJNA 5FL1A 1J5ET 5LG3A 4U3CA 1N33T 3LG7A 5HXRA 4B3ST 4OYKA 2MPKA 2W0GA 4ILUA 2BG9B 5AQNB 5JDNA 4YTNA 2YK0A 3N5LA 4MLKA 5HWYA 1I6ZA 3JC6C 1LVFA 4CXYA 3OYXA 3QK6A 2I0MA 2A72A 2JRKA 4HFBA 3QC9A 4X64T 1YKEB 1J5WA 4LF8T 3OTOT 4YTPA 3AAEB 4H9SE 5TAOA 2JMHA 1IJ6A 5JR9B 3IF8B 5AQKB 2XQ5A 4DR4T 2LJLA 1IBKT 4IDOA 3CQGB 4WW0A 5L4HA 3N9PA 3ZYMA 3B57A 1CHUA 1XDOA
chains in the Genus database with same CATH topology
2X0LB 2VASA 3H37A 3UUXB 5M4YA 2N2NA 4I43B 3AVSA 4UXNB 2MBGA 4AKIA 3IEEA 2GK9A 1YKHB 3NZPA 4DMWA 4CI3B 2X67A 2LEHA 5HXSA 4P0AA 2WAUA 4AKLA 1WLXA 4OK0A 4AKHA 4UF0B 4AQFA 1MNEA 1KK7A 4G2AA 4ANJA 2W62A 4PK6A 3E22E 5DABA 3RRWA 1FMWA 2IW5B 3RYFE 3C4XA 2L8KA 4DMVA 4UF0A 2BDEA 2LM9A 2X9HA 4G63A 5FNVE 3HKCE 3L3PA 4GYRA 3E0ZA 2Z6EA 4IIJE 5JR9C 5FXZA 4PK5A 2NW9A 1OXZA 4TX5A 2CEAA 4JEUB 4ADZA 4YFSA 4M1PA 2XAGB 2EHOB 2V7KA 5JDQA 5JVDE 2X51A 2ZM8A 2Q9QD 2XAHB 1BR2A 4OFZA 3WAJA 4O4JE 2UXNB 1HF8A 5L2LA 2VL8A 3NBXX 4PFPA 3MXZA 3PU8A 5BMVE 2EHOA 5EK3A 3SRZA 3VU7H 4O4HE 4EAHA 3AVRA 3K8PC 5HWXA 3QUJA 3N2KE 4A56A 4DO0A 4O4LE 3B13A 5J2UE 3WI3A 3C51A 3RC8A 2H3RA 3GA8A 1H7CA 4AKGA 1WYBA 3PURA 4QXCB 3KBUA 3ETUA 1S35A 5FYMA 1MIVA 3HKEE 2JPFA 2X68A 3UULA 2C5KT 2D2SA 3C4ZA 4PJNA 3SWHA 1U5PA 4QHOA 2CCQA 3U78A 4TV9E 3AAIA 4PNIA 1D0ZA 4BJNA 5FXXA 3T8OA 5L3EB 2VKHA 1IAPA 2ODUA 2QA7A 2D0TA 5A1LA 4L5GA 1Z0PA 3C64A 3KVAA 4HGAA 2HPJA 3MACA 5HYAA 2N9DA 5L3DB 1E1HB 2L3LA 3ZMTB 3D0TA 4QX8B 2YU2A 5JDFA 4EB6E 2B1EA 3PUQA 2V7IA 1T98A 2WMOA 2XTLA 4HEAA 5FXVA 2NW8A 1V9DA 3K3NA 2BVMA 2RP4A 5JH7E 4WBOA 5F8PA 2KXPB 3UTKA 5L3GB 3O4XE 5LHHB 4X1IE 2I59A 2LSGA 5FP3A 3Q9DA 5DQVA 2PFVA 2OA5A 2NOXA 2X9WA 3OYZA 3L09A 3LBXA 4L9IA 1D0XA 3O1HA 1YD8G 4MBQA 2XASB 1HG2A 3CVRA 5HXCA 1LVKA 5LXTE 3ANWA 5JR9A 3H3AA 3ZLIA 2WBLA 4OHFA 1IJ5A 1D1AA 3ZMVB 3GN5A 5CA0E 2Q9QC 3ZYKA 5LBMA 1LRZA 4AI6A 4P0BA 2JJ9A 2XAQB 2KT9A 3ZN1B 3NRYA 3WAKA 4ERRA 1EZ3A 3DTOA 5J1GA 1QSDA 2LE8A 3FBLA 3HKDE 3U3IA 5IHYA 3I9YA 1CUNA 4UVBB 4QXBB 1HS7A 2DI4A 1FMVA 4ZI2C 3PTRB 3KV9A 3HA4A 2Y48B 3AB3B 3FXEB 4XBFB 5EZYE 2N1GA 1MIYA 1KNZA 3FB2A 3ZC1A 1BR1A 2H7VC 3KBTA 2C5JA 3UUNA 3MKDA 4DBQA 2H7OA 4MALA 4KBMB 3ZJ2A 5L3BB 2E9XD 2VKOA 2ZLYA 4E7SA 3JC6D 1X79A 3K3OA 3F31A 2MOZA 4ISSA 3AA7B 4GIWA 2XHEB 5FXWA 4CZZB 4ZS3A 3KV6A 4YLHA 3ZCIA 3W15B 5LHIB 3TKLB 3I0OA 1SHZC 3CX8B 3ZN0B 4GK0E 1UX4A 2M67A 3PUAA 5JDHA 5FY0A 1D1BA 3C50A 3RH3A 3Q5XA 3AA1B 3RKOA 1HX8A 3PU3A 3CKDA 2V7MA 3FHNA 4UIGA 4YJ2E 3IBPA 3N9NA 5HXHA 3NRXA 1D1CA 2NWBA 3N2OA 3N9MA 3CX7B 1ZHCA 5JDLA 2RA1A 2MYSA 2LHRA 4TZ4C 3HKBE 4BAYB 3V5UA 2BVLA 2CM0A 2PJQA 3AA6B 4PFOA 3HL6A 4X1YE 1NAFA 2NP9A 2ZM0A 3C98B 2CA5A 4PJLA 3VKHA 2DHRA 4QXHB 3O9XA 3LJCA 3LK3B 3KVBA 3N9QA 4CQIA 3ZMSB 4E7ZA 3DP7A 4UV9B 3MK7C 3OBVE 2KINB 2V1DB 2IC9A 2PG8A 2Q9QB 2WMNA 2ODVA 4UELA 2IAKA 2P9BA 1OWAA 2V7JA 4TUYE 3CMLA 4C90A 1MMGA 3IHRA 4I50E 1S94A 2Q9QA 4UV8B 3S4UA 3P7IA 5H6QB 4UVAB 3OJAA 3C4WA 4JEHB 1ZV4X 1VRBA 3EUHA 1ZEEA 2SPCA 3EDVA 3PUGA 4O2BE 4F6RC 2WWUA 1LKXA 3PE0A 2E8IA 1FEWA 3SOLA 2CLYB 4AQGA 1BR0A 4XAXB 3FXDB 3N2GE 4HFVA 2ZMAA 1WYCA 2E9XC 2JQQA 2K9AA 2BZBA 2LT3A 2CXLA 3M65A 3O1JA 3ONXA 4DVDA 5LCYA 5KMGP 2LOPA 3RYCE 5ETWA 3E08A 2CWYA 4KUMB 3R6NA 2DNXA 2CXDA 3PUSA 2J1DG 4U74A 3A5XA 3N9LA 4EIWA 4UEMA 4ZOLE 3RRCA 3RYHE 4GYSA 5LA6E 3UUMA 2LSYA 3FBZA 4BA9A 2LOSA 3K3QC 4C91A 2XAJB 4ZS2A 5E0OA 2NTXA 4I4TE 5EK4A 4CXWA 4IE0A 3CQXC 4P09A 3I0QA 3MJXA 3I9WA 2LSJA 1MMDA 3P8CD 4NUVA 3J7Yq 3RC3A 2LSIA 2D5UA 3LK2B 2W61A 2YINA 4BJMA 4ZI7E 4QKNA 2K48A 5JDGA 1WR6A 2VB6A 3CWZB 4H9OC 4PW8A 5L3FB 4H63V 1YW0A 3UT5E 4DNDA 4HKAA 3SS1A 4EXTA 3ZEFB 3KFWX 3I1AA 4WNKA 2KMFA 1HFAA 3ZJ1A 1HTJF 2QGSA 4ZHQE 2CLYC 2VWAA 4O2AE 2K5BB 1VOMA 5L3CB 4AKRB 5LGNB 4ISTA 4TV8E 1IZNB 2ES0A 3NZQA 4EOZB 5IYZE 3VKGA 4EYUA 2K24A 5LP6E 2W63A 4B6XA 2DCFA 4OYJA 3CQCB 1O3XA 4HTEA 2ZM2A 4K0UA 3V5SA 4N78D 3KINB 5LBQB 1MMAA 5FY7A 4DBRA 4FJOA 2D0UA 3UFEA 3VHLA 5JQGE 3ESLA 2KZ7B 5J2TE 2E9XB 4H9PC 4XZCA 4KP3C 4FI5A 4ZI3D 3ETVA 3N9OA 2WM9A 2EHOD 4EYYR 3AAAB 3Q5WA 4IGUA 1FIOA 3GWHA 4H9RC 2E9XA 2MTQA 2DLRA 2CMRA 4IE6A 3CPZA 3RPUA 3ZMUB 3F57A 5F3JA 5LJMA 4L0RA 4PJJA 2KWIB 1G73A 3EDUA 1AJ3A 2VK9A 2LHNA 4QX7B 3MA9A 4V1Av 2W00A 2X66A 4U72A 3RYIE 4EZ4A 5C8YE 4YHJA 3KDSE 4IDZA 2UXXB 4QWNB 4YJ3E 5HAXA 5EK2A 2CXFA 1QUUA 4Z8XA 3HI2A 1US7B 3F2EA 2C0SA 5LHGB 3ZMZB 3MZKB 4CI1B 4X1KE 3Q2MA 1MMNA 5LNKA 5LJNA 5JREA 3AA0B 2G0UA 1UX5A 2XQYA 3LG7A 2YEVC 3LFMA 3ZPOA 4ZI2D 5HXEA 5HXRA 3DJBA 2C5IT 2IC6A 4H9NC 4OYKA 5LGTB 4H63H 5FY1A 1B7TA 2W0GA 4IHJE 2WSSV 4ILUA 5KDMC 5CA1E 2LSKA 2DWKA 2ACXA 5JDNA 4X20E 1MNDA 2YK0A 4AQFC 2X9YA 1BR4A 3N5LA 4PAGA 4MLKA 1NWMX 5HWYA 4HN9A 3J9X1 4WBNE 3JC6C 2X9XA 4TN7B 1LVFA 4GK5E 4I55E 5DQWA 3BQLA 4CXYA 3KV5A 4H9QC 4ASKA 1Y64B 3R84B 3ZCJA 3OYXA 4PJMA 2KLQA 3BQIA 5GONE 4NUUA 4IE5A 3QK6A 3ZYLA 3PDYA 4O4IE 2NW7A 1UCUA 2HPLA 5ADXL 5LGUB 2CWOA 5JRCB 4J2CA 4O8SA 2A72A 2JRKA 3QC9A 3LK42 5H6RB 5DJQC 4HE8A 4EZHA 2DWGA 1YKEB 2Y8DA 1HG5A 2KNDA 3EVYA 2L9QA 2XAFB 3BQKA 5FMNA 2Y6XA 4MHCA 4ZI3C 5LOVE 5JRCA 2HH7A 5CB4E 4CI2B 2EHOC 2VKJA 4CXXA 3AAEB 1MIWA 4H9SE 4KMCA 5LG4A 1ZKEA 3LBXB 5TAOA 3O1IA 1U4QA 2JMHA 5KX5E 3ZC0A 4MFRA 1IJ6A 2XUEA 1WRDA 3ANWB 5JR9B 1G8XA 4UVCB 3IF8B 4IE4A 4PK4A 2NTYA 3GN5B 4GOUA 2V26A 2VKDA 4IE7A 5LYJE 2LJLA 2V7LA 2PBIA 1SA0E 1D0YA 2JMKA 2CE7A 3CQGB 4AXPA 3KV4A 4WW0A 3CX6B 3GMIA 3OKQA 3N9PA 2A3DA 3RX6A 5AFUL 5JDMA 4JUYA 3ZYMA 2A2FX 3B57A 1HCIA 2KWHA 4JLEA 3HR0A 3BK9A 2YU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR6 A;  1O3X A;  1WRD A;  1YD8 G;  2N2N A;  1OXZ A;  2N9D A;  1NWM X;  1X79 A;  1NAF A; 
#chains in the Genus database with same CATH topology
 3FZK B;  2FJE A;  4TWD A;  3H37 A;  5M4Y A;  3AVS A;  5ABG A;  4UXN B;  4AKI A;  2GK9 A;  1YKH B;  3NZP A;  4CI3 B;  4IT4 A;  2WAU A;  2IML A;  4AQF A;  2W62 A;  4PK6 A;  1FMW A;  3RIU C;  2CHN A;  3RYF E;  3C4X A;  2L8K A;  4ZZB A;  2BDE A;  2LM9 A;  2X9H A;  4ZEY A;  1ZOY A;  2X0H A;  3AXJ B;  5FXZ A;  2NW9 A;  1OXZ A;  4TX5 A;  2CEA A;  4M1P A;  2XAG B;  5JDQ A;  4JI7 T;  4OFZ A;  4Z90 A;  1HF8 A;  5AQP B;  2EHO A;  5EK3 A;  3RKG A;  4O4H E;  1XMO T;  5HWX A;  3N2K E;  3A7M A;  3B13 A;  3WI3 A;  3GA8 A;  1H7C A;  4HWD A;  3KBU A;  3HKE E;  2C5K T;  4JI0 T;  1W0A A;  4QHO A;  4OX9 T;  3ZKR A;  4BJN A;  2VKH A;  5A1L A;  1Z0P A;  2HPJ A;  2J47 A;  1E1H B;  4QX8 B;  2YU2 A;  3PUQ A;  2XTL A;  2NW8 A;  3EAB A;  2WZH A;  4WBO A;  4IDN A;  5AQT B;  2KXP B;  2OV9 A;  3O4X E;  4X1I E;  2E5V A;  3FZM B;  2OA5 A;  1W9R A;  2VVN A;  4QH4 A;  1HG2 A;  5HXC A;  3JAF A;  3K1S A;  1IJ5 A;  5CA0 E;  3ZYK A;  5LBM A;  4P0B A;  5J1G A;  3U3I A;  4QXB B;  3SFD A;  1KNP A;  3AB3 B;  5EZY E;  2N1G A;  3JAE A;  2H7V C;  5L3B B;  4KBM B;  2VVS A;  3F31 A;  4I0U A;  3AA7 B;  4WZX A;  2XHE B;  3P4Q A;  3W15 B;  5LHI B;  4JBW F;  3I0O A;  1SHZ C;  4U31 A;  2FJA A;  4U2Z A;  1UX4 A;  2XM2 A;  3RH3 A;  3EI0 A;  4UIG A;  5JTG A;  5FKY A;  3IBP A;  4DV6 T;  4EEB A;  2BBH A;  3N9N A;  3AE8 A;  3RIA A;  1ZHC A;  4EED A;  4TZ4 C;  3HKB E;  2CM0 A;  2YN6 A;  4X5T A;  3PJA J;  4GKK T;  3CIR A;  2XQ8 A;  3VKH A;  2BBJ A;  3AE1 A;  3LK3 B;  4IL4 A;  3ZMS B;  4UV9 B;  2WMN A;  2ODV A;  2IAK A;  2AXD S;  2V7J A;  3JCF A;  3CML A;  4C90 A;  3T1Y T;  2XSB A;  1IBL T;  3P7I A;  5H6Q B;  2WWV A;  2DL1 A;  1ZV4 X;  1VRB A;  3EUH A;  1FJG T;  4O2B E;  2WWU A;  1LKX A;  2HN2 A;  3SOL A;  1BR0 A;  3FXD B;  2JQQ A;  2E5L T;  3L39 A;  1WCR A;  4EGW A;  4DVD A;  5KMG P;  5LB7 B;  4EV6 A;  5LA6 E;  3UUM A;  4IDP A;  5E0O A;  2BKP A;  2BG9 E;  4IE0 A;  4KHP T;  4DUZ T;  3AEC A;  3P8C D;  4NUV A;  3ZT6 A;  3LK2 B;  4QKN A;  4LF7 T;  5L3F B;  2VUR A;  3UT5 E;  3SS1 A;  2RPA A;  3ONL C;  4JI3 T;  2I6H A;  5AQF B;  4U2Y A;  2VWA A;  2K5B B;  3AE6 A;  1W0B A;  5C3J A;  5IYZ E;  3VKG A;  5LP6 E;  2A9U A;  5AQV B;  4X62 T;  2YDR A;  4N78 D;  5LBQ B;  5J2T E;  4H9P C;  4XZC A;  4ZI3 D;  2WM9 A;  2EHO D;  1HNX T;  4H9R C;  2E9X A;  2DLR A;  2D9D A;  5LJM A;  4L0R A;  4PJJ A;  1YQ4 A;  3EDU A;  2VK9 A;  1DU2 A;  3RLF F;  3AE4 A;  4QX7 B;  4LFB T;  2J62 A;  4YHJ A;  4IDZ A;  2UXX B;  4Z8X A;  5HEU A;  3FZH B;  3F2E A;  2C0S A;  5LHG B;  3JAD A;  2IUB A;  5LNK A;  5JRE A;  3P4R A;  3UU8 A;  5ABH A;  3LFM A;  3ZPO A;  4LMJ A;  4X66 T;  3DJB A;  4CN1 A;  4JI6 T;  1B7T A;  5IWA T;  3ZST A;  2DWK A;  1NWM X;  4GK5 E;  4I55 E;  5DQW A;  3R84 B;  3ZCJ A;  4DV0 T;  5GON E;  3SFE A;  2NW7 A;  2W2U A;  1UCU A;  2HPL A;  4TWF A;  2CWO A;  5JRC B;  4O8S A;  3LK4 2;  3PJA A;  2DWG A;  4EZH A;  2Y8D A;  4JI4 T;  3P4S A;  4IDQ A;  2KND A;  3EVY A;  2L9Q A;  5FMN A;  4CXX A;  1MIW A;  3VRB A;  4KMC A;  1ZKE A;  3NWI A;  1GQE A;  3FZF B;  1U4Q A;  3RIU A;  2XSA A;  4GOU A;  2V26 A;  4A98 A;  3GMI A;  2BG9 C;  1NEN A;  3BK9 A;  2VAS A;  3PV0 F;  4Q25 A;  4QH1 A;  3VR8 A;  4B3T T;  2LEH A;  2JQH A;  4AKL A;  1WLX A;  4K0K T;  4AKH A;  4UF0 B;  4YTM A;  1KF6 A;  3E22 E;  4LML A;  3RRW A;  5FL0 A;  4KI0 F;  2QVA A;  5AQG B;  4IIJ E;  5JR9 C;  4YY3 T;  5AQJ B;  2W67 A;  1BR2 A;  2UXN B;  5BMV E;  5FVL A;  3QB5 A;  3NKZ A;  3K8P C;  4U33 A;  2JQ9 A;  4A56 A;  4DO0 A;  2UXB T;  1T7S A;  5CJ5 A;  4QXC B;  5FVK A;  5FYM A;  2D2S A;  3C4Z A;  3U78 A;  4DR5 T;  4HWF A;  1D0Z A;  1Y01 A;  4X65 T;  3C64 A;  1XMQ T;  3RF1 A;  3ZMT B;  4EB6 E;  2B1E A;  4IL9 A;  4DR6 T;  1T98 A;  1V9D A;  2BVM A;  2RP4 A;  5JH7 E;  4QH5 A;  3Q9D A;  1QLB A;  2NOX A;  4DR3 T;  3LBX A;  3O1H A;  2WDV A;  1M62 A;  5LXT E;  1LVK A;  3ANW A;  3H3A A;  3ZLI A;  2WBL A;  2V6Y A;  3GN5 A;  1LRZ A;  3ONJ A;  2LLY A;  3NRY A;  3DTO A;  4JYA T;  2LE8 A;  3HKD E;  5IHY A;  3I9Y A;  3P4W A;  4ZI2 C;  3HA4 A;  3ZT5 A;  1WR0 A;  2BS2 A;  1BR1 A;  3KBT A;  5C2T A;  2E9X D;  2VKO A;  4E7S A;  3JC6 D;  3K3O A;  2MOZ A;  5FXW A;  4AQY T;  4ZS3 A;  3ZCI A;  4LFA T;  2M67 A;  5FY0 A;  3AA1 B;  3CKD A;  3FHN A;  5HEJ A;  1KEY A;  5HXH A;  3NRX A;  3AED A;  3RI5 A;  5CGM A;  3N9M A;  5JDL A;  2LHR A;  4BAY B;  2XM1 A;  3V5U A;  3AA6 B;  4X1Y E;  2ZM0 A;  2CA5 A;  2UUC T;  2DHR A;  3O9X A;  4YSY A;  3OBV E;  2KIN B;  2V1D B;  4UEL A;  3ZSS A;  2P9B A;  1OWA A;  2VQF T;  4A5X A;  3IHR A;  2Q9Q A;  4UV8 B;  4UVA B;  3C4W A;  4JEH B;  2H89 A;  3EDV A;  4DID B;  2B76 A;  4AQG A;  4XAX B;  1E2A A;  2K9A A;  5AQU B;  4YT0 A;  2LT3 A;  1HNZ T;  1T8B A;  2LOP A;  2UXC T;  2CWY A;  3R6N A;  2DNX A;  2CXD A;  4LF9 T;  4EIW A;  4ZOL E;  2XPK A;  4BA9 A;  2XAJ B;  4ZS2 A;  1KFY A;  3J7Y q;  2W61 A;  4BJM A;  5CFB A;  3TLW A;  2VB6 A;  3CWZ B;  5ABE A;  1N32 T;  4DND A;  4EXT A;  3KFW X;  1HNW T;  3AE7 A;  2KMF A;  1HFA A;  2QGS A;  5L3C B;  4IST A;  2UUA T;  1YQ3 A;  4TV8 E;  1IZN B;  2ES0 A;  2MAW A;  4EOZ B;  2F4V T;  1OED A;  2W63 A;  4B6X A;  2DCF A;  3CQC B;  3A8Y C;  1O3X A;  4HTE A;  5AQL B;  4K0U A;  4LF5 T;  2D0U A;  3VHL A;  3ESL A;  2KZ7 B;  2UXD T;  3IA3 A;  4EYY R;  2FJB A;  3AAA B;  3GWH A;  1IBM T;  2WZI A;  4IE6 A;  3RPU A;  3UQ4 A;  3F57 A;  2KWI B;  1JNZ A;  2W00 A;  4U72 A;  5EK2 A;  2CXF A;  1US7 B;  4CI1 B;  5IUX A;  2WY2 A;  3AA0 B;  2XQY A;  2YEV C;  4YSX A;  4HWI B;  5LGT B;  3QNU A;  2WSS V;  4COF A;  3AEA A;  2ACX A;  1MND A;  4AQF C;  2X9Y A;  1BR4 A;  4WBN E;  4HFI A;  4HN9 A;  2X9X A;  2BG9 A;  3BQL A;  2QRX A;  4H9Q C;  4ASK A;  2UU9 T;  3EHZ A;  4PJM A;  2KLQ A;  3P50 A;  1HX1 B;  3BQI A;  4NUU A;  4IE5 A;  3ZYL A;  3PDY A;  5ADX L;  5LGU B;  5H6R B;  1T72 A;  4HE8 A;  2JQK A;  2Y6X A;  4MHC A;  4ZI3 C;  2HH7 A;  4CI2 B;  3TLT A;  2EHO C;  3EAM A;  3LBX B;  2YDQ A;  5KX5 E;  3ZC0 A;  3Q5E A;  3ANW B;  1G8X A;  4UVC B;  2WDQ A;  4PK4 A;  2NTY A;  3GN5 B;  2VKD A;  2XJ7 A;  5AQO B;  5LYJ E;  3X1D A;  2PBI A;  1SA0 E;  1D0Y A;  2JMK A;  4AXP A;  3KV4 A;  3CX6 B;  2A3D A;  3QOF A;  3RX6 A;  5JDM A;  4JUY A;  4CN6 A;  1HCI A;  4JLE A;  3HR0 A;  2V6X A;  2X0L B;  1UUR A;  4P1N A;  3VRA A;  2N2N A;  2MBG A;  4DMW A;  2WU2 A;  2W4X A;  3LDQ B;  4G2A A;  4ANJ A;  5DAB A;  5ABF A;  3AE2 A;  1NEK A;  2WS3 A;  4B3R T;  2VL0 A;  2IW5 B;  4G63 A;  4WYV A;  5FNV E;  3L3P A;  4GYR A;  3E0Z A;  4PK5 A;  2QYW A;  4ADZ A;  4YFS A;  2EHO B;  2WDR A;  1X9B A;  4U7Y A;  2Q9Q D;  4DV5 T;  2XAH B;  3WAJ A;  4O4J E;  4YXD A;  2VL8 A;  4PFP A;  4AIU A;  3PU8 A;  1VCT A;  4EAH A;  5BR8 T;  3QUJ A;  3PUW F;  3C51 A;  3RC8 A;  2H3R A;  4HWH A;  1WYB A;  2OLT A;  4A97 A;  3ETU A;  3FZL B;  2CBI A;  1MIV A;  2X68 A;  1ZP0 A;  4PJN A;  3SWH A;  1U5P A;  2CCQ A;  3AAI A;  5FXX A;  3T8O A;  2ODU A;  2QA7 A;  2D0T A;  2IDO B;  3KVA A;  4HGA A;  3MAC A;  5HYA A;  2HN1 A;  2L3L A;  3D0T A;  2HHH T;  5JDF A;  2J4G A;  4HFE A;  2LM2 A;  5F8P A;  3UTK A;  5L3G B;  5LHH B;  2I59 A;  2PFV A;  3OYZ A;  4L9I A;  3T1H T;  1YD8 G;  4MBQ A;  4HFD A;  4OHF A;  3ZMV B;  3Q5D A;  4AI6 A;  2XAQ B;  3ZN1 B;  1EZ3 A;  1QSD A;  2DI4 A;  1FMV A;  3PTR B;  1E7P A;  2Y48 B;  3FXE B;  1KNZ A;  4B3M T;  3FB2 A;  3ZC1 A;  3MKD A;  1SUM B;  2BKO A;  4MAL A;  4DR1 T;  1OED B;  3ABV A;  4GIW A;  3KV6 A;  4YLH A;  5AQS B;  2FBW A;  3TKL B;  3CX8 B;  4HFC A;  3ZN0 B;  3PUA A;  1D1B A;  3C50 A;  3Q5X A;  3RKO A;  1HX8 A;  2LKH A;  3PU3 A;  3RQU A;  1I94 T;  1XDP A;  2RA1 A;  2MYS A;  3HL6 A;  5HCM A;  3N9Q A;  4CQI A;  4E7Z A;  3MK7 C;  4IRE A;  2CBJ A;  4JI8 T;  4HFH A;  1MMG A;  3S4U A;  1UK5 A;  5AQH B;  1ZEE A;  2LRK A;  2E8I A;  2CLY B;  3G06 A;  4HFV A;  2E9X C;  1WYC A;  2XQ9 A;  2ZMA A;  3O1J A;  2BZB A;  5ETW A;  4KUM B;  5L4E A;  2WB5 A;  3N9L A;  4UEM A;  3RRC A;  4GYS A;  3P4P A;  2LSY A;  3FBZ A;  1WFD A;  2NTX A;  4CXW A;  2IHR 1;  3CQX C;  3MJX A;  2LSJ A;  1MMD A;  5LMN T;  3AE3 A;  2LSI A;  2D5U A;  2YIN A;  2K48 A;  4U7I A;  5KXJ A;  4PW8 A;  4H63 V;  4DV7 T;  2YOE A;  3ZJ1 A;  4ZHQ E;  3RIF A;  4O2A E;  2V8S V;  2IIU A;  1VOM A;  4AKR B;  5LGN B;  2XQA A;  4EYU A;  5AQM B;  2ZM2 A;  2ACZ A;  3V5S A;  3KIN B;  5FY7 A;  4DBR A;  1XNR T;  1KNR A;  4ILA A;  2E9X B;  5ABF B;  4KP3 C;  3ETV A;  5F5W A;  4YHH T;  4LFC T;  3Q5W A;  4IGU A;  4NPP A;  2MTQ A;  3TLS A;  2CMR A;  3CPZ A;  2XQ6 A;  3CK6 A;  1XZY A;  4V1A v;  2X66 A;  3KDS E;  4QWN B;  5HAX A;  2PTF A;  1QUU A;  3HI2 A;  2XZE A;  5HCJ A;  3Q2M A;  1MMN A;  2G0U A;  1UX5 A;  3PUY F;  3UU4 A;  3RHW A;  4ZI2 D;  2BS3 A;  3M3Z B;  2XQ3 A;  5HXE A;  2C5I T;  2IC6 A;  4H9N C;  4H63 H;  5FY1 A;  4IHJ E;  5KDM C;  2V5D A;  2XQ7 A;  5CA1 E;  4DR2 T;  1VCS A;  2LSK A;  3AEE A;  4X20 E;  4HWC A;  4PAG A;  3J9X 1;  3RGL A;  4TN7 B;  3AEB A;  4JI1 T;  3KV5 A;  1Y64 B;  4JV5 T;  4O4I E;  2UUB T;  4J2C A;  5DJQ C;  4NIQ A;  1HG5 A;  2XAF B;  3BQK A;  5LOV E;  4AIS A;  5JRC A;  5CB4 E;  2H88 A;  2VKJ A;  4LF4 T;  5LG4 A;  1N36 T;  3O1I A;  4ZZC A;  4MFR A;  2XUE A;  1WRD A;  2WP9 A;  4IE4 A;  4KHZ F;  4IE7 A;  2V7L A;  4DV2 T;  2CE7 A;  1UUS A;  3OKQ A;  4NXM T;  5AFU L;  2A2F X;  2KWH A;  1YXR A;  2YU1 A;  3ZT7 A;  3UFG A;  3UUX B;  4I43 B;  3IEE A;  2X67 A;  5HXS A;  4P0A A;  3LSV A;  4CN4 A;  4OK0 A;  1MNE A;  1KK7 A;  3QB5 K;  1M7K A;  4DMV A;  4UF0 A;  3HKC E;  2WU5 A;  2K3W A;  2Z6E A;  2WQY A;  4DR7 T;  4JEU B;  2XQ4 A;  2V7K A;  5JVD E;  2X51 A;  2ZM8 A;  3VR9 A;  1OED E;  5L47 A;  4LF6 T;  5L2L A;  2NR4 A;  3NBX X;  3MXZ A;  3SRZ A;  5AQQ B;  3VU7 H;  4TNV A;  3AVR A;  4O4L E;  1JNR A;  5J2U E;  4AKG A;  3PUR A;  4DUY T;  1S35 A;  2BKN A;  2JPF A;  3UUL A;  3AEG A;  1XWM A;  4TV9 E;  3NVO A;  4PNI A;  5L3E B;  1IAP A;  4L5G A;  3B5M A;  3OVU A;  2E2A A;  4GKJ T;  2N9D A;  5L3D B;  2CHO A;  2V7I A;  2WMO A;  4HEA A;  5FXV A;  3K3N A;  2BS4 A;  5HEH A;  2ZM6 T;  2LSG A;  5FP3 A;  5DQV A;  2CRB A;  2X9W A;  3L09 A;  2V6Y B;  1D0X A;  2XAS B;  2VQE T;  3CVR A;  3UU5 A;  5JR9 A;  4ZXL A;  1D1A A;  1J1J A;  2Q9Q C;  3UQ7 A;  2JJ9 A;  2KT9 A;  3WAK A;  4ERR A;  3FBL A;  1XNQ T;  1CUN A;  2WCA A;  4UVB B;  4Z91 A;  1W09 A;  2LKG A;  1HS7 A;  2YKS A;  2M6B A;  3KV9 A;  1UGO A;  4DV3 T;  4XBF B;  1MIY A;  1Z8U A;  3UUN A;  4DBQ A;  2C5J A;  2H7O A;  3ZJ2 A;  2ZLY A;  1X79 A;  2W66 A;  4ISS A;  5LMU T;  4CZZ B;  5AQI B;  4TNW A;  5J0Z A;  5JDH A;  4GK0 E;  3TLU A;  2V7M A;  4YJ2 E;  4F8H A;  4JI2 T;  4LMK A;  3OPC A;  1D1C A;  3AXJ A;  2NWB A;  2JIW A;  3N2O A;  3CX7 B;  3AEF A;  3RQW A;  2FUP A;  2BVL A;  2PJQ A;  4PFO A;  1NAF A;  2NP9 A;  3C98 B;  4PJL A;  4QXH B;  3LJC A;  3KVB A;  3DP7 A;  3AE9 A;  2IC9 A;  2PG8 A;  2Q9Q B;  3H3M A;  3PUZ F;  2KSR A;  4TUY E;  4I50 E;  1OED C;  1S94 A;  3UU6 A;  3OJA A;  2X0Y A;  4NXN T;  5HEG A;  2SPC A;  2V5C A;  3PUG A;  4F6R C;  4ILB A;  3PE0 A;  1FEW A;  3UU3 A;  3N2G E;  3M65 A;  4DV4 T;  3ONX A;  3L8R A;  2CXL A;  5HEO A;  5LCY A;  3RYC E;  3E08 A;  4UR9 A;  4JI5 T;  3PUS A;  2J1D G;  4U74 A;  3A5X A;  3RYH E;  3UUB A;  1R8I A;  1HR0 T;  4C91 A;  2LOS A;  3K3Q C;  2FJD A;  4I4T E;  5EK4 A;  2AE9 A;  4ILC A;  3I0Q A;  4P09 A;  3I9W A;  3RC3 A;  3PUX F;  4ZI7 E;  5JDG A;  1WR6 A;  4H9O C;  1YW0 A;  4HKA A;  3ZEF B;  3AE5 A;  3I1A A;  4WNK A;  1HTJ F;  2CLY C;  4KX6 A;  4TWH A;  3NZQ A;  2K24 A;  4OYJ A;  2CPT A;  2M6I A;  3PUV F;  1MMA A;  2XY8 B;  4FJO A;  3TLV A;  3UFE A;  4DV1 T;  5JQG E;  1L0V A;  2YDS A;  4YSZ A;  4FI5 A;  3N9O A;  5AQR B;  2LRL A;  1FIO A;  1SE7 A;  3ZMU B;  5F3J A;  1G73 A;  1N34 T;  1AJ3 A;  2LHN A;  3MA9 A;  3RYI E;  4EZ4 A;  5C8Y E;  2R6G F;  4YJ3 E;  3ZMZ B;  3MZK B;  4X1K E;  5LJN A;  5FL1 A;  1J5E T;  5LG3 A;  4U3C A;  1N33 T;  3LG7 A;  5HXR A;  4B3S T;  4OYK A;  2MPK A;  2W0G A;  4ILU A;  2BG9 B;  5AQN B;  5JDN A;  4YTN A;  2YK0 A;  3N5L A;  4MLK A;  5HWY A;  1I6Z A;  3JC6 C;  1LVF A;  4CXY A;  3OYX A;  3QK6 A;  2I0M A;  2A72 A;  2JRK A;  4HFB A;  3QC9 A;  4X64 T;  1YKE B;  1J5W A;  4LF8 T;  3OTO T;  4YTP A;  3AAE B;  4H9S E;  5TAO A;  2JMH A;  1IJ6 A;  5JR9 B;  3IF8 B;  5AQK B;  2XQ5 A;  4DR4 T;  2LJL A;  1IBK T;  4IDO A;  3CQG B;  4WW0 A;  5L4H A;  3N9P A;  3ZYM A;  3B57 A;  1CHU A;  1XDO A; 
#chains in the Genus database with same CATH homology
 2X0L B;  2VAS A;  3H37 A;  3UUX B;  5M4Y A;  2N2N A;  4I43 B;  3AVS A;  4UXN B;  2MBG A;  4AKI A;  3IEE A;  2GK9 A;  1YKH B;  3NZP A;  4DMW A;  4CI3 B;  2X67 A;  2LEH A;  5HXS A;  4P0A A;  2WAU A;  4AKL A;  1WLX A;  4OK0 A;  4AKH A;  4UF0 B;  4AQF A;  1MNE A;  1KK7 A;  4G2A A;  4ANJ A;  2W62 A;  4PK6 A;  3E22 E;  5DAB A;  3RRW A;  1FMW A;  2IW5 B;  3RYF E;  3C4X A;  2L8K A;  4DMV A;  4UF0 A;  2BDE A;  2LM9 A;  2X9H A;  4G63 A;  5FNV E;  3HKC E;  3L3P A;  4GYR A;  3E0Z A;  2Z6E A;  4IIJ E;  5JR9 C;  5FXZ A;  4PK5 A;  2NW9 A;  1OXZ A;  4TX5 A;  2CEA A;  4JEU B;  4ADZ A;  4YFS A;  4M1P A;  2XAG B;  2EHO B;  2V7K A;  5JDQ A;  5JVD E;  2X51 A;  2ZM8 A;  2Q9Q D;  2XAH B;  1BR2 A;  4OFZ A;  3WAJ A;  4O4J E;  2UXN B;  1HF8 A;  5L2L A;  2VL8 A;  3NBX X;  4PFP A;  3MXZ A;  3PU8 A;  5BMV E;  2EHO A;  5EK3 A;  3SRZ A;  3VU7 H;  4O4H E;  4EAH A;  3AVR A;  3K8P C;  5HWX A;  3QUJ A;  3N2K E;  4A56 A;  4DO0 A;  4O4L E;  3B13 A;  5J2U E;  3WI3 A;  3C51 A;  3RC8 A;  2H3R A;  3GA8 A;  1H7C A;  4AKG A;  1WYB A;  3PUR A;  4QXC B;  3KBU A;  3ETU A;  1S35 A;  5FYM A;  1MIV A;  3HKE E;  2JPF A;  2X68 A;  3UUL A;  2C5K T;  2D2S A;  3C4Z A;  4PJN A;  3SWH A;  1U5P A;  4QHO A;  2CCQ A;  3U78 A;  4TV9 E;  3AAI A;  4PNI A;  1D0Z A;  4BJN A;  5FXX A;  3T8O A;  5L3E B;  2VKH A;  1IAP A;  2ODU A;  2QA7 A;  2D0T A;  5A1L A;  4L5G A;  1Z0P A;  3C64 A;  3KVA A;  4HGA A;  2HPJ A;  3MAC A;  5HYA A;  2N9D A;  5L3D B;  1E1H B;  2L3L A;  3ZMT B;  3D0T A;  4QX8 B;  2YU2 A;  5JDF A;  4EB6 E;  2B1E A;  3PUQ A;  2V7I A;  1T98 A;  2WMO A;  2XTL A;  4HEA A;  5FXV A;  2NW8 A;  1V9D A;  3K3N A;  2BVM A;  2RP4 A;  5JH7 E;  4WBO A;  5F8P A;  2KXP B;  3UTK A;  5L3G B;  3O4X E;  5LHH B;  4X1I E;  2I59 A;  2LSG A;  5FP3 A;  3Q9D A;  5DQV A;  2PFV A;  2OA5 A;  2NOX A;  2X9W A;  3OYZ A;  3L09 A;  3LBX A;  4L9I A;  1D0X A;  3O1H A;  1YD8 G;  4MBQ A;  2XAS B;  1HG2 A;  3CVR A;  5HXC A;  1LVK A;  5LXT E;  3ANW A;  5JR9 A;  3H3A A;  3ZLI A;  2WBL A;  4OHF A;  1IJ5 A;  1D1A A;  3ZMV B;  3GN5 A;  5CA0 E;  2Q9Q C;  3ZYK A;  5LBM A;  1LRZ A;  4AI6 A;  4P0B A;  2JJ9 A;  2XAQ B;  2KT9 A;  3ZN1 B;  3NRY A;  3WAK A;  4ERR A;  1EZ3 A;  3DTO A;  5J1G A;  1QSD A;  2LE8 A;  3FBL A;  3HKD E;  3U3I A;  5IHY A;  3I9Y A;  1CUN A;  4UVB B;  4QXB B;  1HS7 A;  2DI4 A;  1FMV A;  4ZI2 C;  3PTR B;  3KV9 A;  3HA4 A;  2Y48 B;  3AB3 B;  3FXE B;  4XBF B;  5EZY E;  2N1G A;  1MIY A;  1KNZ A;  3FB2 A;  3ZC1 A;  1BR1 A;  2H7V C;  3KBT A;  2C5J A;  3UUN A;  3MKD A;  4DBQ A;  2H7O A;  4MAL A;  4KBM B;  3ZJ2 A;  5L3B B;  2E9X D;  2VKO A;  2ZLY A;  4E7S A;  3JC6 D;  1X79 A;  3K3O A;  3F31 A;  2MOZ A;  4ISS A;  3AA7 B;  4GIW A;  2XHE B;  5FXW A;  4CZZ B;  4ZS3 A;  3KV6 A;  4YLH A;  3ZCI A;  3W15 B;  5LHI B;  3TKL B;  3I0O A;  1SHZ C;  3CX8 B;  3ZN0 B;  4GK0 E;  1UX4 A;  2M67 A;  3PUA A;  5JDH A;  5FY0 A;  1D1B A;  3C50 A;  3RH3 A;  3Q5X A;  3AA1 B;  3RKO A;  1HX8 A;  3PU3 A;  3CKD A;  2V7M A;  3FHN A;  4UIG A;  4YJ2 E;  3IBP A;  3N9N A;  5HXH A;  3NRX A;  1D1C A;  2NWB A;  3N2O A;  3N9M A;  3CX7 B;  1ZHC A;  5JDL A;  2RA1 A;  2MYS A;  2LHR A;  4TZ4 C;  3HKB E;  4BAY B;  3V5U A;  2BVL A;  2CM0 A;  2PJQ A;  3AA6 B;  4PFO A;  3HL6 A;  4X1Y E;  1NAF A;  2NP9 A;  2ZM0 A;  3C98 B;  2CA5 A;  4PJL A;  3VKH A;  2DHR A;  4QXH B;  3O9X A;  3LJC A;  3LK3 B;  3KVB A;  3N9Q A;  4CQI A;  3ZMS B;  4E7Z A;  3DP7 A;  4UV9 B;  3MK7 C;  3OBV E;  2KIN B;  2V1D B;  2IC9 A;  2PG8 A;  2Q9Q B;  2WMN A;  2ODV A;  4UEL A;  2IAK A;  2P9B A;  1OWA A;  2V7J A;  4TUY E;  3CML A;  4C90 A;  1MMG A;  3IHR A;  4I50 E;  1S94 A;  2Q9Q A;  4UV8 B;  3S4U A;  3P7I A;  5H6Q B;  4UVA B;  3OJA A;  3C4W A;  4JEH B;  1ZV4 X;  1VRB A;  3EUH A;  1ZEE A;  2SPC A;  3EDV A;  3PUG A;  4O2B E;  4F6R C;  2WWU A;  1LKX A;  3PE0 A;  2E8I A;  1FEW A;  3SOL A;  2CLY B;  4AQG A;  1BR0 A;  4XAX B;  3FXD B;  3N2G E;  4HFV A;  2ZMA A;  1WYC A;  2E9X C;  2JQQ A;  2K9A A;  2BZB A;  2LT3 A;  2CXL A;  3M65 A;  3O1J A;  3ONX A;  4DVD A;  5LCY A;  5KMG P;  2LOP A;  3RYC E;  5ETW A;  3E08 A;  2CWY A;  4KUM B;  3R6N A;  2DNX A;  2CXD A;  3PUS A;  2J1D G;  4U74 A;  3A5X A;  3N9L A;  4EIW A;  4UEM A;  4ZOL E;  3RRC A;  3RYH E;  4GYS A;  5LA6 E;  3UUM A;  2LSY A;  3FBZ A;  4BA9 A;  2LOS A;  3K3Q C;  4C91 A;  2XAJ B;  4ZS2 A;  5E0O A;  2NTX A;  4I4T E;  5EK4 A;  4CXW A;  4IE0 A;  3CQX C;  4P09 A;  3I0Q A;  3MJX A;  3I9W A;  2LSJ A;  1MMD A;  3P8C D;  4NUV A;  3J7Y q;  3RC3 A;  2LSI A;  2D5U A;  3LK2 B;  2W61 A;  2YIN A;  4BJM A;  4ZI7 E;  4QKN A;  2K48 A;  5JDG A;  1WR6 A;  2VB6 A;  3CWZ B;  4H9O C;  4PW8 A;  5L3F B;  4H63 V;  1YW0 A;  3UT5 E;  4DND A;  4HKA A;  3SS1 A;  4EXT A;  3ZEF B;  3KFW X;  3I1A A;  4WNK A;  2KMF A;  1HFA A;  3ZJ1 A;  1HTJ F;  2QGS A;  4ZHQ E;  2CLY C;  2VWA A;  4O2A E;  2K5B B;  1VOM A;  5L3C B;  4AKR B;  5LGN B;  4IST A;  4TV8 E;  1IZN B;  2ES0 A;  3NZQ A;  4EOZ B;  5IYZ E;  3VKG A;  4EYU A;  2K24 A;  5LP6 E;  2W63 A;  4B6X A;  2DCF A;  4OYJ A;  3CQC B;  1O3X A;  4HTE A;  2ZM2 A;  4K0U A;  3V5S A;  4N78 D;  3KIN B;  5LBQ B;  1MMA A;  5FY7 A;  4DBR A;  4FJO A;  2D0U A;  3UFE A;  3VHL A;  5JQG E;  3ESL A;  2KZ7 B;  5J2T E;  2E9X B;  4H9P C;  4XZC A;  4KP3 C;  4FI5 A;  4ZI3 D;  3ETV A;  3N9O A;  2WM9 A;  2EHO D;  4EYY R;  3AAA B;  3Q5W A;  4IGU A;  1FIO A;  3GWH A;  4H9R C;  2E9X A;  2MTQ A;  2DLR A;  2CMR A;  4IE6 A;  3CPZ A;  3RPU A;  3ZMU B;  3F57 A;  5F3J A;  5LJM A;  4L0R A;  4PJJ A;  2KWI B;  1G73 A;  3EDU A;  1AJ3 A;  2VK9 A;  2LHN A;  4QX7 B;  3MA9 A;  4V1A v;  2W00 A;  2X66 A;  4U72 A;  3RYI E;  4EZ4 A;  5C8Y E;  4YHJ A;  3KDS E;  4IDZ A;  2UXX B;  4QWN B;  4YJ3 E;  5HAX A;  5EK2 A;  2CXF A;  1QUU A;  4Z8X A;  3HI2 A;  1US7 B;  3F2E A;  2C0S A;  5LHG B;  3ZMZ B;  3MZK B;  4CI1 B;  4X1K E;  3Q2M A;  1MMN A;  5LNK A;  5LJN A;  5JRE A;  3AA0 B;  2G0U A;  1UX5 A;  2XQY A;  3LG7 A;  2YEV C;  3LFM A;  3ZPO A;  4ZI2 D;  5HXE A;  5HXR A;  3DJB A;  2C5I T;  2IC6 A;  4H9N C;  4OYK A;  5LGT B;  4H63 H;  5FY1 A;  1B7T A;  2W0G A;  4IHJ E;  2WSS V;  4ILU A;  5KDM C;  5CA1 E;  2LSK A;  2DWK A;  2ACX A;  5JDN A;  4X20 E;  1MND A;  2YK0 A;  4AQF C;  2X9Y A;  1BR4 A;  3N5L A;  4PAG A;  4MLK A;  1NWM X;  5HWY A;  4HN9 A;  3J9X 1;  4WBN E;  3JC6 C;  2X9X A;  4TN7 B;  1LVF A;  4GK5 E;  4I55 E;  5DQW A;  3BQL A;  4CXY A;  3KV5 A;  4H9Q C;  4ASK A;  1Y64 B;  3R84 B;  3ZCJ A;  3OYX A;  4PJM A;  2KLQ A;  3BQI A;  5GON E;  4NUU A;  4IE5 A;  3QK6 A;  3ZYL A;  3PDY A;  4O4I E;  2NW7 A;  1UCU A;  2HPL A;  5ADX L;  5LGU B;  2CWO A;  5JRC B;  4J2C A;  4O8S A;  2A72 A;  2JRK A;  3QC9 A;  3LK4 2;  5H6R B;  5DJQ C;  4HE8 A;  4EZH A;  2DWG A;  1YKE B;  2Y8D A;  1HG5 A;  2KND A;  3EVY A;  2L9Q A;  2XAF B;  3BQK A;  5FMN A;  2Y6X A;  4MHC A;  4ZI3 C;  5LOV E;  5JRC A;  2HH7 A;  5CB4 E;  4CI2 B;  2EHO C;  2VKJ A;  4CXX A;  3AAE B;  1MIW A;  4H9S E;  4KMC A;  5LG4 A;  1ZKE A;  3LBX B;  5TAO A;  3O1I A;  1U4Q A;  2JMH A;  5KX5 E;  3ZC0 A;  4MFR A;  1IJ6 A;  2XUE A;  1WRD A;  3ANW B;  5JR9 B;  1G8X A;  4UVC B;  3IF8 B;  4IE4 A;  4PK4 A;  2NTY A;  3GN5 B;  4GOU A;  2V26 A;  2VKD A;  4IE7 A;  5LYJ E;  2LJL A;  2V7L A;  2PBI A;  1SA0 E;  1D0Y A;  2JMK A;  2CE7 A;  3CQG B;  4AXP A;  3KV4 A;  4WW0 A;  3CX6 B;  3GMI A;  3OKQ A;  3N9P A;  2A3D A;  3RX6 A;  5AFU L;  5JDM A;  4JUY A;  3ZYM A;  2A2F X;  3B57 A;  1HCI A;  2KWH A;  4JLE A;  3HR0 A;  3BK9 A;  2YU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...