2N2NA

Tom1 negatively modulates binding of tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Target of Myb protein 1
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n2nA00
1YD8G 1WR6A 1O3XA 2N2NA 1OXZA 1WRDA 1X79A 2N9DA 1NAFA 1NWMX
chains in the Genus database with same CATH superfamily
2IMLA 3FB2A 2WP9A 3KVBA 5ABFA 4IE7A 5LA6E 4J2CA 3AA6B 2WDVA 3LJCA 3KBUA 3PURA 2IW5B 3UQ4A 3ZMSB 4A56A 1ZHCA 4DUZT 1D0YA 4OYKA 3AEBA 4IDPA 5LBMA 5JR9B 3CWZB 2FJDA 3I0QA 3N9PA 2ACZA 5HEOA 3AA7B 4H9QC 4DV7T 2LOSA 2K5BB 3PTRB 1MIVA 4TN7B 4U2ZA 2BKPA 3SRZA 3N9QA 4IHJE 5AQGB 4IE5A 3VU7H 4TNVA 3C4XA 4P09A 2XQ5A 3K3NA 1MMDA 2NW8A 3BK9A 4PJNA 2OLTA 3G06A 4U74A 4DIDB 4Z91A 2UXDT 4ILAA 5CJ5A 4LFBT 2VK9A 4ASKA 3FZLB 4XBFB 2CCQA 3T1HT 4TNWA 2XJ7A 3AE8A 2V5DA 4HFDA 4GKKT 3U3IA 4B3TT 4IDZA 4ZI3D 1D1BA 4P0BA 1FMVA 2X0HA 2X9XA 4ZEYA 5JDHA 2BS3A 2LSKA 3AE1A 2E5VA 3PUYF 1D1AA 1U4QA 4ISSA 4EGWA 4WBNE 1DU2A 3A8YC 3P4PA 2WDRA 4H63H 4IL4A 5LHIB 2D0UA 3BQIA 3F2EA 3GWHA 3ZMVB 2JJ9A 2CHNA 3JAEA 2NW9A 2Z6EA 4X20E 5ABGA 3RYFE 3UFEA 3LDQB 2H89A 3QOFA 4QX8B 3SOLA 3N9OA 4H9PC 1LKXA 4HFCA 2X51A 3ZYLA 1ZKEA 5L3GB 4BJNA 5AQRB 5LMUT 4AKHA 2MAWA 3GN5B 4JI4T 4DR5T 2W66A 4HFBA 4DUYT 3AVSA 1KNZA 3KV9A 1SA0E 3PUXF 1OEDB 3AE3A 2FBWA 4YTNA 4TWHA 2CRBA 4XAXB 2X0YA 2KT9A 5AQPB 2LHNA 2EHOB 2VVSA 3AE2A 3BQKA 4ISTA 3ZT5A 5LGNB 2E9XA 2Y48B 4YTPA 3AE7A 3R6NA 4TV9E 3U78A 2JQQA 3AEAA 3PUQA 5AQMB 5LHHB 3ZMTB 1FIOA 2E9XC 3H37A 2DLRA 2XSBA 3ESLA 2NW7A 4UXNB 2CWOA 3K1SA 5H6QB 4KX6A 4MALA 4P1NA 4U7IA 4UR9A 4DMVA 2LRKA 5BMVE 3I0OA 3OBVE 2DWKA 3ABVA 1KNRA 5AQIB 3MXZA 4WNKA 5JTGA 1HTJF 1YD8G 3HKDE 4JEUB 5FMNA 4O4LE 2VL8A 3NBXX 1BR2A 2WSSV 3EABA 3LBXA 2PJQA 2LE8A 5FXXA 3OJAA 4JI2T 5CGMA 5HXSA 2UXNB 3K3QC 5FNVE 1M7KA 2MPKA 1WLXA 2YDRA 4LF8T 4U3CA 2V7IA 3RKGA 3VRAA 4IDNA 4CN1A 2XQ6A 4CN4A 5EK4A 4LF6T 3VKGA 3T8OA 1J5WA 5C8YE 3VKHA 2BVLA 2G0UA 3AB3B 3CPZA 4QHOA 2VKHA 1I94T 3ANWA 3FZHB 2LEHA 3JAFA 3ONLC 3B5MA 5LNKA 4K0UA 4GIWA 4KUMB 4NIQA 4HE8A 4C91A 1KEYA 4AI6A 3FXDB 3AEEA 3LFMA 3CQXC 1JNZA 4YHHT 2AE9A 1J5ET 1HX1B 1FEWA 1UX5A 2C5KT 5CFBA 3AEFA 2HHHT 2V5CA 4AISA 4AQGA 4WBOA 5LJMA 1IJ6A 1CHUA 1VCTA 2IDOB 3E22E 4GK5E 4Q25A 4L0RA 4TWDA 3SS1A 2YDQA 4JI8T 2PFVA 3TLWA 2XM2A 4QKNA 4EYYR 4JI0T 3OTOT 1EZ3A 3PUGA 2VQFT 2XQ3A 4DR7T 3I9YA 4G63A 5EZYE 2X67A 2C5JA 4DR6T 5JVDE 3HL6A 2H88A 1OXZA 4I55E 1YKHB 2J47A 4QXHB 2KNDA 5AQLB 1NAFA 2CE7A 2H3RA 4EEBA 1GQEA 2A9UA 4JI7T 4I50E 3KBTA 5JDGA 3PV0F 2H7VC 3NZQA 2V6XA 4AQYT 3J9X1 4NUVA 3ZN0B 5HXRA 5HXHA 4DR4T 2C5IT 2XAJB 2B1EA 3AA0B 2LSGA 3K3OA 3N9NA 3PUZF 3MJXA 3H3MA 4IIJE 3HKCE 3P4RA 4UV9B 3EUHA 1E7PA 1CUNA 4DVDA 5FL1A 3ZYKA 3N2KE 4ILUA 4AQFA 4H9NC 3ZEFB 2LT3A 4H9RC 5ADXL 4TV8E 2CXDA 4FJOA 2VKOA 1QUUA 2XTLA 4YJ3E 2D9DA 2X9WA 4U2YA 4ZXLA 3VRBA 5L3EB 1X79A 5LYJE 4X64T 4DV6T 5H6RB 4MFRA 1KNPA 5LGTB 3ETUA 4HFIA 1X9BA 4HGAA 5J1GA 5LG4A 2WWVA 3N2OA 4HFHA 5F8PA 3UU4A 1HNXT 2HPLA 2E2AA 3C98B 3LG7A 3UUNA 2OV9A 3HA4A 2V6YB 3M65A 5HXEA 3FZKB 4ZZBA 3P7IA 3HI2A 1MNEA 3ZLIA 4COFA 4O4IE 2QA7A 3PDYA 4EV6A 2WS3A 4ANJA 2NR4A 2V26A 5J2TE 3AAEB 5FY1A 4KHZF 2BKNA 2M6IA 3CX8B 2VB6A 1WR6A 4U72A 4WZXA 3ZCIA 2W62A 2YOEA 3Q5EA 4B3MT 2K3WA 5JRCB 4E7SA 4X66T 2K24A 4ADZA 1MMNA 4IGUA 4GYSA 4UELA 4PJLA 1D0ZA 4JEHB 3AAIA 1E1HB 2A72A 1T72A 1IZNB 1WRDA 2QYWA 2VASA 3K8PC 4HWDA 4QXCB 2ODUA 2BG9A 2Q9QA 3V5SA 1YW0A 2Q9QD 3N9LA 3N9MA 5JR9C 1D1CA 2YN6A 4QX7B 4YSXA 1V9DA 3CX6B 4EYUA 5KMGP 2IHR1 4DV3T 2MTQA 2X9HA 5JR9A 3EVYA 3C64A 1HG2A 3O4XE 5CB4E 4DO0A 5FXZA 1Y01A 3RF1A 3AE5A 2M67A 2XUEA 1UUSA 2X9YA 2JPFA 3UU6A 4LF9T 4AKIA 1H7CA 4PJMA 4AXPA 1XDOA 4HFEA 1LVKA 2WCAA 3PJAA 2ZM6T 2KWHA 1FMWA 3QUJA 3EDVA 5FP3A 4A97A 3UQ7A 4U33A 2JMKA 4LMKA 5LG3A 1Y64B 5FY7A 3KFWX 1BR1A 2ZM2A 1OEDE 3KV4A 3UU3A 4PAGA 2LJLA 5AQKB 5IHYA 2DL1A 4DV5T 2F4VT 5AQHB 3IHRA 3FHNA 4TZ4C 4PK4A 2ACXA 3MZKB 5C2TA 4UF0B 4ZS2A 4CQIA 4LMLA 5HCMA 5L3FB 3LK42 3ZC1A 4IREA 4O2AE 2Y6XA 3A5XA 3LK2B 4OYJA 3H3AA 3RC3A 3ZT7A 5LB7B 2LHRA 2W4XA 3ONJA 5E0OA 2GK9A 1UURA 4HWFA 1HS7A 2N2NA 3QK6A 2DNXA 3OYXA 1MIYA 4EB6E 4OHFA 2D0TA 3KV6A 3S4UA 4DV1T 5JRCA 1B7TA 4UVAB 4H9OC 4X62T 5BR8T 2UUCT 2IC6A 4UIGA 4UV8B 4MLKA 3RI5A 4ILBA 4ZS3A 2CBJA 4V1Av 4X1YE 5DJQC 3SFEA 2H7OA 4ZOLE 2X68A 3AEGA 2B76A 5L3BB 4YXDA 2LKHA 4ZZCA 4MHCA 1IBMT 3GN5A 4YY3T 4HWIB 3UTKA 4ZI2C 4Z8XA 4DR3T 4I43B 3TKLB 2KXPB 3F31A 5TAOA 3P8CD 3PE0A 1KK7A 1W0AA 2FUPA 4TWFA 2XPKA 4XZCA 1IJ5A 4AKRB 2E5LT 3TLUA 4AQFC 5J2UE 2LSIA 1SE7A 4TX5A 1ZV4X 1XDPA 2EHOD 1VCSA 5EK3A 3NKZA 2EHOA 3RYHE 4EXTA 3WAJA 3OKQA 2E9XB 5JDFA 2VKJA 4OX9T 5FL0A 3V5UA 1XWMA 2XM1A 3NZPA 5AQFB 2R6GF 1WFDA 4DNDA 3N2GE 1BR0A 2JQ9A 3SFDA 5LP6E 2CPTA 1IBLT 4K0KT 1W09A 2K48A 4U7YA 2IIUA 4WYVA 5AQJB 5JH7E 4AKLA 4ZI7E 4E7ZA 5LJNA 3M3ZB 3CVRA 1HFAA 2L8KA 4CZZB 4ZI2D 3L3PA 3FZFB 4CXYA 4AKGA 1MMAA 3RIFA 2WZIA 1MIWA 3ZSSA 4EZ4A 2HN2A 3ZT6A 2OA5A 3LBXB 3UUXB 4LFCT 4P0AA 2LSJA 1HNZT 3VHLA 3RIUC 1E2AA 2CEAA 1UX4A 2V7KA 2CM0A 4H9SE 5AQQB 2WQYA 2IC9A 4ZI3C 2NP9A 2JQKA 2WZHA 3UU8A 2KSRA 2WDQA 3ANWB 4JLEA 2PTFA 5HYAA 3C50A 1O3XA 2HN1A 2XQYA 2XAHB 3AXJA 1N34T 1HNWT 4YTMA 3PJAJ 5JDMA 2W0GA 3KVAA 2V1DB 2WBLA 2W63A 3GMIA 4I0UA 3QC9A 4OK0A 5ETWA 1LVFA 4CI1B 4LF7T 3VR9A 2WM9A 5FXVA 5LBQB 3DJBA 5JDLA 1SUMB 2YINA 3DP7A 3PU3A 3MACA 2CXFA 4IE4A 3L09A 4LFAT 4CXXA 4HWHA 2V7LA 5HEUA 5DABA 3AE9A 2KWIB 4A98A 2FJAA 3P4WA 2XHEB 2BBJA 4IDOA 4AIUA 4UVBB 2PBIA 3RGLA 5IUXA 3FZMB 5LHGB 2CLYB 3C4ZA 2I59A 2J1DG 3RQWA 2MBGA 4BA9A 2RPAA 2XY8B 3A7MA 3UU5A 1MMGA 2ZM0A 4ERRA 4HN9A 4EAHA 1YKEB 3ZC0A 4KHPT 2YK0A 5AQOB 5ABFB 1XMOT 2JIWA 4UVCB 3RPUA 4ZHQE 4O4JE 2W61A 3FXEB 5A1LA 2LKGA 1NWMX 2W67A 1US7B 2DI4A 2QGSA 3P50A 5L3DB 2UU9T 4JI1T 1N32T 2WMNA 2X0LB 1G73A 2RP4A 2YEVC 3AAAB 3EDUA 3EHZA 4O8SA 4PFOA 5DQWA 2XZEA 5F5WA 5LXTE 5J0ZA 4QH5A 2KMFA 4B6XA 4PW8A 3L8RA 5ABHA 4MBQA 3RRWA 4X1KE 1Z8UA 2VVNA 3NVOA 4NPPA 4X1IE 4JI6T 1XNRT 4GK0E 4IDQA 3CKDA 3ETVA 4HWCA 4JUYA 1NENA 4PJJA 2E8IA 3RH3A 2JRKA 2YKSA 2MYSA 3RX6A 3MKDA 3ZSTA 2BS2A 4GKJT 4HEAA 1L0VA 4NUUA 2V7MA 1HR0T 5IWAT 1YQ4A 3IF8B 1U5PA 3PUVF 5L4HA 4KMCA 2V6YA 3UUMA 4FI5A 4EOZB 4NXNT 1XZYA 4QH1A 5HWXA 4DV0T 1FJGT 3O9XA 4JYAT 3IEEA 4O4HE 4F8HA 4KBMB 3NRYA 2LSYA 2W2UA 2WMOA 4L9IA 4A5XA 2VQET 3UUBA 2I6HA 1T7SA 2CXLA 2NWBA 3P4SA 2VL0A 4O2BE 1I6ZA 1LRZA 4C90A 5F3JA 1UCUA 2AXDS 1XMQT 3ZMUB 5HEHA 3PU8A 1MNDA 4ILCA 3C51A 3ZCJA 5L4EA 1OEDC 4DV4T 2J62A 3TLSA 4CI3B 3D0TA 2M6BA 4JI3T 2XQ9A 1XNQT 3LK3B 2BG9B 2Q9QB 3QNUA 3ZMZB 3ZKRA 3O1HA 4QH4A 3CQGB 2LM9A 3PUSA 2XAGB 1OEDA 5HCJA 2EHOC 4JV5T 4LF5T 5DQVA 3AECA 2E9XD 4QWNB 3UT5E 1HCIA 2LLYA 2CA5A 3I1AA 1ZP0A 1IBKT 3KDSE 2W00A 3ZN1B 2CLYC 3AE4A 2YU2A 1WYCA 3RIAA 5HEJA 3WI3A 1SHZC 2BG9E 2BBHA 2BG9C 1W9RA 2Q9QC 4OFZA 5HXCA 5CA1E 3HKBE 2VKDA 2VURA 2DHRA 4JBWF 3BQLA 3WAKA 2PG8A 3C4WA 5L3CB 3EAMA 3UFGA 2D5UA 3PUWF 1HF8A 5FVKA 5AQNB 2BS4A 2LM2A 3NRXA 2YDSA 4IT4A 3CX7B 3FBZA 3HKEE 2JMHA 5KDMC 3AVRA 4CN6A 4F6RC 4DBRA 3RIUA 5KXJA 1KF6A 1VOMA 4IE6A 4IL9A 2CMRA 4WW0A 2UUAT 5JDQA 4NXMT 1ZEEA 1WYBA 1T8BA 5JREA 3W15B 4UF0A 1N33T 2JQHA 2XQ8A 2BVMA 1AJ3A 2LOPA 3O1IA 2ES0A 4PNIA 4YSZA 3NWIA 5L2LA 4HKAA 1UK5A 1WR0A 2J4GA 2UXXB 3I9WA 2ZMAA 3RLFF 3TLTA 3ZJ1A 2NOXA 2IAKA 2XAFB 2WWUA 4KI0F 3FBLA 4GYRA 5FYMA 4TUYE 4EZHA 2P9BA 3OVUA 4BJMA 2L9QA 1WCRA 5LOVE 5AQTB 2I0MA 3CK6A 4N78D 2BKOA 4H63V 3JC6D 3IA3A 2X66A 2XAQB 1YXRA 3GA8A 3AA1B 5GONE 1NEKA 2L3LA 4M1PA 4HFVA 4YSYA 5LGUB 5AQUB 1G8XA 5HWYA 4EEDA 3AEDA 5LCYA 4EIWA 2NTYA 1J1JA 5EK2A 1T98A 4X5TA 3KV5A 2DWGA 3RC8A 1QLBA 5JDNA 2XQ4A 2BDEA 4HTEA 1W0BA 2C0SA 2XASB 2DCFA 5HAXA 2V7JA 3CQCB 2XQAA 4CI2B 3Q5XA 3HR0A 5IYZE 1BR4A 3J7Yq 5C3JA 4YJ2E 5LMNT 3N5LA 2KINB 1M62A 5AQVB 5FKYA 5CA0E 3Q2MA 2A2FX 3PUAA 3T1YT 2CHOA 2XSAA 3Q5WA 4GOUA 2FJEA 1JNRA 2A3DA 2HPJA 3AE6A 4L5GA 4U31A 5FY0A 3RHWA 2D2SA 1Z0PA 1R8IA 2ZLYA 3LSVA 3QB5K 1HG5A 3Q9DA 4G2AA 4Z90A 2RA1A 3OPCA 3DTOA 3MA9A 5M4YA 3O1JA 4JI5T 1YQ3A 4YLHA 1VRBA 5AQSB 3E08A 3B13A 1UGOA 2UUBT 2LRLA 1IAPA 3CMLA 4X65T 1OWAA 3TLVA 2UXCT 1QSDA 2N1GA 4I4TE 5JQGE 4LF4T 3MK7C 3RYIE 4B3RT 4UEMA 4QXBB 5KX5E 3IBPA 5HEGA 4DMWA 4YFSA 4KP3C 3SWHA 4PK5A 2Y8DA 1N36T 3E0ZA 3RKOA 4CXWA 5FVLA 2FJBA 3P4QA 2WU2A 5ABEA 3JCFA 3ONXA 3AXJB 2HH7A 3ZYMA 3ZPOA 5AFUL 1ZOYA 3RYCE 3JADA 3ZJ2A 3Q5DA 2NTXA 2BZBA 3L39A 1HX8A 2YU1A 4PFPA 2WY2A 3QB5A 4BAYB 2SPCA 3R84B 2IUBA 2ZM8A 2MOZA 1D0XA 3F57A 3B57A 3OYZA 2KLQA 4B3ST 2WAUA 2CBIA 3CIRA 3VR8A 3X1DA 2UXBT 1S94A 2QRXA 2V8SV 2WU5A 3EI0A 2N9DA 2CWYA 3JC6C 1KFYA 4LMJA 4YHJA 3RQUA 4DBQA 4DV2T 2WB5A 4IE0A 4PK6A 3RRCA 1S35A 3KINB 2KZ7B 5FXWA 3UULA 2ODVA 2XQ7A 4YT0A 4DR1T 2VWAA 2QVAA 2K9AA 4DR2T 5L47A
chains in the Genus database with same CATH topology
3FB2A 3KVBA 4IE7A 5LA6E 4J2CA 3AA6B 3LJCA 3KBUA 3PURA 2IW5B 3ZMSB 1ZHCA 1D0YA 4OYKA 5LBMA 3CWZB 3I0QA 3N9PA 3AA7B 4H9QC 2LOSA 2K5BB 3PTRB 1MIVA 4TN7B 3SRZA 3N9QA 4IHJE 3VU7H 4IE5A 3C4XA 4P09A 3K3NA 1MMDA 2NW8A 3BK9A 4PJNA 4U74A 2VK9A 4ASKA 4XBFB 2CCQA 3U3IA 4IDZA 4ZI3D 1D1BA 4P0BA 1FMVA 2X9XA 5JDHA 2LSKA 4ISSA 1D1AA 1U4QA 4WBNE 4H63H 5LHIB 5JRCB 2D0UA 3BQIA 3F2EA 3GWHA 3ZMVB 2JJ9A 3UFEA 3RYFE 2NW9A 2Z6EA 4X20E 5LGTB 3SOLA 4QX8B 3N9OA 4H9PC 1LKXA 3ZYLA 2X51A 1ZKEA 5L3GB 4BJNA 4AKHA 3GN5B 3AVSA 3KV9A 1SA0E 4XAXB 2KT9A 2LHNA 2EHOB 4ISTA 3BQKA 5LGNB 2E9XA 2Y48B 3R6NA 4TV9E 3U78A 2JQQA 3PUQA 5LHHB 3ZMTB 1FIOA 2E9XC 3H37A 2DLRA 3ESLA 2NW7A 4UXNB 2CWOA 5H6QB 4MALA 5BMVE 4DMVA 3I0OA 3OBVE 2DWKA 3MXZA 4WNKA 1HTJF 1YD8G 3HKDE 4JEUB 5FMNA 4O4LE 2VL8A 3NBXX 1BR2A 2WSSV 3LBXA 2PJQA 2LE8A 5FXXA 3OJAA 5HXSA 2UXNB 3K3QC 5FNVE 1WLXA 2V7IA 3VKGA 5EK4A 3T8OA 5C8YE 2BVLA 2G0UA 3AB3B 3CPZA 4QHOA 2VKHA 3ANWA 5LNKA 2LEHA 4K0UA 4GIWA 4KUMB 4C91A 4HE8A 4AI6A 3FXDB 3LFMA 3CQXC 1FEWA 1UX5A 2C5KT 5LJMA 4AQGA 4WBOA 1IJ6A 3E22E 4GK5E 4L0RA 3SS1A 2PFVA 4EYYR 4QKNA 1EZ3A 3PUGA 3I9YA 4G63A 5EZYE 2X67A 2C5JA 5JVDE 3HL6A 1OXZA 4I55E 1YKHB 4QXHB 2KNDA 1NAFA 2CE7A 2H3RA 4I50E 3KBTA 5JDGA 2H7VC 3NZQA 3J9X1 4NUVA 3ZN0B 5HXRA 5HXHA 2C5IT 2XAJB 2B1EA 3AA0B 2LSGA 3K3OA 3N9NA 4IIJE 3MJXA 4UV9B 3HKCE 3EUHA 4DVDA 1CUNA 3ZYKA 3N2KE 4ILUA 4AQFA 4H9NC 3ZEFB 2LT3A 4H9RC 5ADXL 4TV8E 2CXDA 4FJOA 2VKOA 1QUUA 2XTLA 4YJ3E 2X9WA 5L3EB 5LYJE 1KNZA 1X79A 5H6RB 4MFRA 3ETUA 4HGAA 5J1GA 5LG4A 3N2OA 5F8PA 2HPLA 3C98B 3LG7A 3UUNA 3HA4A 3M65A 5HXEA 3P7IA 3HI2A 1MNEA 3ZLIA 4O4IE 2QA7A 3PDYA 4ANJA 2V26A 5J2TE 3AAEB 5FY1A 3CX8B 2VB6A 1WR6A 4U72A 3ZCIA 2W62A 4E7SA 2K24A 4ADZA 1MMNA 4IGUA 4GYSA 4UELA 4PJLA 1D0ZA 4JEHB 3AAIA 1E1HB 2A72A 4QXCB 1IZNB 1WRDA 2VASA 3K8PC 2ODUA 2Q9QA 3V5SA 1YW0A 2Q9QD 3N9LA 3N9MA 5JR9C 1D1CA 4QX7B 1V9DA 3CX6B 4EYUA 2MTQA 2X9HA 5JR9A 3EVYA 3C64A 1HG2A 3O4XE 5CB4E 4DO0A 5FXZA 2M67A 2XUEA 2X9YA 2JPFA 4AKIA 1H7CA 4PJMA 4AXPA 1LVKA 2KWHA 1FMWA 3QUJA 3EDVA 5FP3A 2JMKA 1Y64B 5FY7A 3KFWX 1BR1A 2ZM2A 3KV4A 4PAGA 2LJLA 5IHYA 3IHRA 3FHNA 4TZ4C 4PK4A 2ACXA 3MZKB 4UF0B 4ZS2A 4CQIA 5L3FB 3LK42 3ZC1A 4O2AE 2Y6XA 3A5XA 3LK2B 4OYJA 3H3AA 3RC3A 5HYAA 3VKHA 2LHRA 1HS7A 5E0OA 2GK9A 2N2NA 3QK6A 2DNXA 3OYXA 1MIYA 4EB6E 4OHFA 2D0TA 3KV6A 3S4UA 5JRCA 1B7TA 4UVAB 4H9OC 2IC6A 4UIGA 4UV8B 4MLKA 4ZS3A 4V1Av 4X1YE 5DJQC 2H7OA 4ZOLE 2X68A 5L3BB 4MHCA 3GN5A 3UTKA 4ZI2C 4Z8XA 4I43B 3TKLB 2KXPB 3F31A 5TAOA 3P8CD 3PE0A 1KK7A 4XZCA 1IJ5A 4AKRB 4AQFC 5J2UE 2LSIA 4TX5A 4EXTA 1ZV4X 5EK3A 2EHOD 3RYHE 3WAJA 2EHOA 3OKQA 2E9XB 5JDFA 2VKJA 3V5UA 5KMGP 3NZPA 1BR0A 4DNDA 3N2GE 5LP6E 2K48A 4AKLA 4ZI7E 4E7ZA 5LJNA 3CVRA 1HFAA 2L8KA 4CZZB 4ZI2D 3L3PA 4CXYA 1MMAA 1MIWA 4EZ4A 2OA5A 3LBXB 3UUXB 4P0AA 2LSJA 3VHLA 2CEAA 1UX4A 2V7KA 2CM0A 4H9SE 2IC9A 4ZI3C 2NP9A 3ANWB 4JLEA 3C50A 1O3XA 2XQYA 2XAHB 5JDMA 2W0GA 3KVAA 2V1DB 2WBLA 2W63A 3GMIA 4OK0A 3QC9A 5ETWA 4CI1B 1LVFA 2WM9A 5FXVA 5LBQB 3DJBA 5JDLA 2YINA 3DP7A 3PU3A 3MACA 2CXFA 4IE4A 3L09A 4CXXA 2V7LA 5DABA 2KWIB 2XHEB 4UVBB 2PBIA 5LHGB 2CLYB 3C4ZA 2I59A 2J1DG 4EZHA 2MBGA 4BA9A 4ERRA 1MMGA 2ZM0A 4HN9A 4EAHA 1YKEB 3ZC0A 2YK0A 4UVCB 3RPUA 4ZHQE 4O4JE 2W61A 3FXEB 5A1LA 1NWMX 4AKGA 1US7B 2DI4A 2QGSA 5L3DB 2WMNA 2X0LB 1G73A 2RP4A 2YEVC 3AAAB 3EDUA 4O8SA 4PFOA 5DQWA 5LXTE 2KMFA 4B6XA 4PW8A 4MBQA 3RRWA 4X1KE 4X1IE 4GK0E 3CKDA 3ETVA 3RH3A 4JUYA 4A56A 4PJJA 2E8IA 4BJMA 2JRKA 5JH7E 2MYSA 3RX6A 3MKDA 4HEAA 4NUUA 2V7MA 3IF8B 1U5PA 3UUMA 4EOZB 4KMCA 4FI5A 5HWXA 3O9XA 3IEEA 4O4HE 4KBMB 3NRYA 2LSYA 4L9IA 2WMOA 2CXLA 2NWBA 4O2BE 1LRZA 4C90A 5F3JA 1UCUA 3ZMUB 3PU8A 1MNDA 3ZCJA 3C51A 4CI3B 3D0TA 3LK3B 2Q9QB 3ZMZB 3O1HA 3CQGB 2LM9A 3PUSA 2XAGB 2EHOC 5DQVA 3UT5E 2E9XD 4QWNB 1HCIA 2CA5A 3I1AA 3KDSE 2W00A 3ZN1B 2CLYC 2YU2A 1WYCA 3WI3A 1SHZC 2Q9QC 5HXCA 4OFZA 5CA1E 3HKBE 2VKDA 2DHRA 3BQLA 3WAKA 2PG8A 3C4WA 5L3CB 2D5UA 1HF8A 3NRXA 3CX7B 3FBZA 3HKEE 2JMHA 5KDMC 3AVRA 4F6RC 4DBRA 1VOMA 4IE6A 2CMRA 4WW0A 5JDQA 1ZEEA 1WYBA 5JREA 3W15B 4UF0A 2BVMA 1AJ3A 2LOPA 3O1IA 2ES0A 4PNIA 5L2LA 4HKAA 2UXXB 3I9WA 2ZMAA 3ZJ1A 2NOXA 2IAKA 2XAFB 2WWUA 3FBLA 4GYRA 5FYMA 4TUYE 2P9BA 2L9QA 5LOVE 4N78D 4H63V 3JC6D 2X66A 2XAQB 3GA8A 3AA1B 5GONE 2L3LA 4M1PA 4HFVA 5LGUB 1G8XA 5HWYA 4EIWA 5LCYA 5EK2A 2NTYA 1T98A 3KV5A 2DWGA 3RC8A 5JDNA 2BDEA 4HTEA 2C0SA 2XASB 2DCFA 5HAXA 2V7JA 3CQCB 4CI2B 3Q5XA 3HR0A 5IYZE 1BR4A 3J7Yq 4YJ2E 3N5LA 2KINB 5CA0E 3Q2MA 2A2FX 3PUAA 3Q5WA 4GOUA 5FY0A 2A3DA 2HPJA 4L5GA 2D2SA 1Z0PA 2ZLYA 4G2AA 1HG5A 3Q9DA 2RA1A 3DTOA 3MA9A 5M4YA 3O1JA 4YLHA 1VRBA 3E08A 3B13A 3CMLA 1IAPA 1OWAA 1QSDA 2N1GA 4I4TE 5JQGE 3MK7C 3RYIE 4UEMA 4QXBB 5KX5E 3IBPA 4DMWA 4YFSA 4KP3C 3SWHA 4PK5A 2Y8DA 3E0ZA 3RKOA 4CXWA 3ONXA 5AFUL 2HH7A 3ZYMA 3ZPOA 3RYCE 3ZJ2A 2NTXA 2BZBA 4PFPA 1HX8A 2YU1A 4BAYB 2SPCA 3R84B 2ZM8A 2MOZA 1D0XA 3F57A 3B57A 3OYZA 2KLQA 2WAUA 1S94A 2N9DA 2CWYA 3JC6C 4YHJA 4DBQA 4IE0A 4PK6A 3RRCA 1S35A 3KINB 2KZ7B 5FXWA 3UULA 2ODVA 2VWAA 5JR9B 2K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YD8 G;  1WR6 A;  1O3X A;  2N2N A;  1OXZ A;  1WRD A;  1X79 A;  2N9D A;  1NAF A;  1NWM X; 
#chains in the Genus database with same CATH topology
 2IML A;  3FB2 A;  2WP9 A;  3KVB A;  5ABF A;  4IE7 A;  5LA6 E;  4J2C A;  3AA6 B;  2WDV A;  3LJC A;  3KBU A;  3PUR A;  2IW5 B;  3UQ4 A;  3ZMS B;  4A56 A;  1ZHC A;  4DUZ T;  1D0Y A;  4OYK A;  3AEB A;  4IDP A;  5LBM A;  5JR9 B;  3CWZ B;  2FJD A;  3I0Q A;  3N9P A;  2ACZ A;  5HEO A;  3AA7 B;  4H9Q C;  4DV7 T;  2LOS A;  2K5B B;  3PTR B;  1MIV A;  4TN7 B;  4U2Z A;  2BKP A;  3SRZ A;  3N9Q A;  4IHJ E;  5AQG B;  4IE5 A;  3VU7 H;  4TNV A;  3C4X A;  4P09 A;  2XQ5 A;  3K3N A;  1MMD A;  2NW8 A;  3BK9 A;  4PJN A;  2OLT A;  3G06 A;  4U74 A;  4DID B;  4Z91 A;  2UXD T;  4ILA A;  5CJ5 A;  4LFB T;  2VK9 A;  4ASK A;  3FZL B;  4XBF B;  2CCQ A;  3T1H T;  4TNW A;  2XJ7 A;  3AE8 A;  2V5D A;  4HFD A;  4GKK T;  3U3I A;  4B3T T;  4IDZ A;  4ZI3 D;  1D1B A;  4P0B A;  1FMV A;  2X0H A;  2X9X A;  4ZEY A;  5JDH A;  2BS3 A;  2LSK A;  3AE1 A;  2E5V A;  3PUY F;  1D1A A;  1U4Q A;  4ISS A;  4EGW A;  4WBN E;  1DU2 A;  3A8Y C;  3P4P A;  2WDR A;  4H63 H;  4IL4 A;  5LHI B;  2D0U A;  3BQI A;  3F2E A;  3GWH A;  3ZMV B;  2JJ9 A;  2CHN A;  3JAE A;  2NW9 A;  2Z6E A;  4X20 E;  5ABG A;  3RYF E;  3UFE A;  3LDQ B;  2H89 A;  3QOF A;  4QX8 B;  3SOL A;  3N9O A;  4H9P C;  1LKX A;  4HFC A;  2X51 A;  3ZYL A;  1ZKE A;  5L3G B;  4BJN A;  5AQR B;  5LMU T;  4AKH A;  2MAW A;  3GN5 B;  4JI4 T;  4DR5 T;  2W66 A;  4HFB A;  4DUY T;  3AVS A;  1KNZ A;  3KV9 A;  1SA0 E;  3PUX F;  1OED B;  3AE3 A;  2FBW A;  4YTN A;  4TWH A;  2CRB A;  4XAX B;  2X0Y A;  2KT9 A;  5AQP B;  2LHN A;  2EHO B;  2VVS A;  3AE2 A;  3BQK A;  4IST A;  3ZT5 A;  5LGN B;  2E9X A;  2Y48 B;  4YTP A;  3AE7 A;  3R6N A;  4TV9 E;  3U78 A;  2JQQ A;  3AEA A;  3PUQ A;  5AQM B;  5LHH B;  3ZMT B;  1FIO A;  2E9X C;  3H37 A;  2DLR A;  2XSB A;  3ESL A;  2NW7 A;  4UXN B;  2CWO A;  3K1S A;  5H6Q B;  4KX6 A;  4MAL A;  4P1N A;  4U7I A;  4UR9 A;  4DMV A;  2LRK A;  5BMV E;  3I0O A;  3OBV E;  2DWK A;  3ABV A;  1KNR A;  5AQI B;  3MXZ A;  4WNK A;  5JTG A;  1HTJ F;  1YD8 G;  3HKD E;  4JEU B;  5FMN A;  4O4L E;  2VL8 A;  3NBX X;  1BR2 A;  2WSS V;  3EAB A;  3LBX A;  2PJQ A;  2LE8 A;  5FXX A;  3OJA A;  4JI2 T;  5CGM A;  5HXS A;  2UXN B;  3K3Q C;  5FNV E;  1M7K A;  2MPK A;  1WLX A;  2YDR A;  4LF8 T;  4U3C A;  2V7I A;  3RKG A;  3VRA A;  4IDN A;  4CN1 A;  2XQ6 A;  4CN4 A;  5EK4 A;  4LF6 T;  3VKG A;  3T8O A;  1J5W A;  5C8Y E;  3VKH A;  2BVL A;  2G0U A;  3AB3 B;  3CPZ A;  4QHO A;  2VKH A;  1I94 T;  3ANW A;  3FZH B;  2LEH A;  3JAF A;  3ONL C;  3B5M A;  5LNK A;  4K0U A;  4GIW A;  4KUM B;  4NIQ A;  4HE8 A;  4C91 A;  1KEY A;  4AI6 A;  3FXD B;  3AEE A;  3LFM A;  3CQX C;  1JNZ A;  4YHH T;  2AE9 A;  1J5E T;  1HX1 B;  1FEW A;  1UX5 A;  2C5K T;  5CFB A;  3AEF A;  2HHH T;  2V5C A;  4AIS A;  4AQG A;  4WBO A;  5LJM A;  1IJ6 A;  1CHU A;  1VCT A;  2IDO B;  3E22 E;  4GK5 E;  4Q25 A;  4L0R A;  4TWD A;  3SS1 A;  2YDQ A;  4JI8 T;  2PFV A;  3TLW A;  2XM2 A;  4QKN A;  4EYY R;  4JI0 T;  3OTO T;  1EZ3 A;  3PUG A;  2VQF T;  2XQ3 A;  4DR7 T;  3I9Y A;  4G63 A;  5EZY E;  2X67 A;  2C5J A;  4DR6 T;  5JVD E;  3HL6 A;  2H88 A;  1OXZ A;  4I55 E;  1YKH B;  2J47 A;  4QXH B;  2KND A;  5AQL B;  1NAF A;  2CE7 A;  2H3R A;  4EEB A;  1GQE A;  2A9U A;  4JI7 T;  4I50 E;  3KBT A;  5JDG A;  3PV0 F;  2H7V C;  3NZQ A;  2V6X A;  4AQY T;  3J9X 1;  4NUV A;  3ZN0 B;  5HXR A;  5HXH A;  4DR4 T;  2C5I T;  2XAJ B;  2B1E A;  3AA0 B;  2LSG A;  3K3O A;  3N9N A;  3PUZ F;  3MJX A;  3H3M A;  4IIJ E;  3HKC E;  3P4R A;  4UV9 B;  3EUH A;  1E7P A;  1CUN A;  4DVD A;  5FL1 A;  3ZYK A;  3N2K E;  4ILU A;  4AQF A;  4H9N C;  3ZEF B;  2LT3 A;  4H9R C;  5ADX L;  4TV8 E;  2CXD A;  4FJO A;  2VKO A;  1QUU A;  2XTL A;  4YJ3 E;  2D9D A;  2X9W A;  4U2Y A;  4ZXL A;  3VRB A;  5L3E B;  1X79 A;  5LYJ E;  4X64 T;  4DV6 T;  5H6R B;  4MFR A;  1KNP A;  5LGT B;  3ETU A;  4HFI A;  1X9B A;  4HGA A;  5J1G A;  5LG4 A;  2WWV A;  3N2O A;  4HFH A;  5F8P A;  3UU4 A;  1HNX T;  2HPL A;  2E2A A;  3C98 B;  3LG7 A;  3UUN A;  2OV9 A;  3HA4 A;  2V6Y B;  3M65 A;  5HXE A;  3FZK B;  4ZZB A;  3P7I A;  3HI2 A;  1MNE A;  3ZLI A;  4COF A;  4O4I E;  2QA7 A;  3PDY A;  4EV6 A;  2WS3 A;  4ANJ A;  2NR4 A;  2V26 A;  5J2T E;  3AAE B;  5FY1 A;  4KHZ F;  2BKN A;  2M6I A;  3CX8 B;  2VB6 A;  1WR6 A;  4U72 A;  4WZX A;  3ZCI A;  2W62 A;  2YOE A;  3Q5E A;  4B3M T;  2K3W A;  5JRC B;  4E7S A;  4X66 T;  2K24 A;  4ADZ A;  1MMN A;  4IGU A;  4GYS A;  4UEL A;  4PJL A;  1D0Z A;  4JEH B;  3AAI A;  1E1H B;  2A72 A;  1T72 A;  1IZN B;  1WRD A;  2QYW A;  2VAS A;  3K8P C;  4HWD A;  4QXC B;  2ODU A;  2BG9 A;  2Q9Q A;  3V5S A;  1YW0 A;  2Q9Q D;  3N9L A;  3N9M A;  5JR9 C;  1D1C A;  2YN6 A;  4QX7 B;  4YSX A;  1V9D A;  3CX6 B;  4EYU A;  5KMG P;  2IHR 1;  4DV3 T;  2MTQ A;  2X9H A;  5JR9 A;  3EVY A;  3C64 A;  1HG2 A;  3O4X E;  5CB4 E;  4DO0 A;  5FXZ A;  1Y01 A;  3RF1 A;  3AE5 A;  2M67 A;  2XUE A;  1UUS A;  2X9Y A;  2JPF A;  3UU6 A;  4LF9 T;  4AKI A;  1H7C A;  4PJM A;  4AXP A;  1XDO A;  4HFE A;  1LVK A;  2WCA A;  3PJA A;  2ZM6 T;  2KWH A;  1FMW A;  3QUJ A;  3EDV A;  5FP3 A;  4A97 A;  3UQ7 A;  4U33 A;  2JMK A;  4LMK A;  5LG3 A;  1Y64 B;  5FY7 A;  3KFW X;  1BR1 A;  2ZM2 A;  1OED E;  3KV4 A;  3UU3 A;  4PAG A;  2LJL A;  5AQK B;  5IHY A;  2DL1 A;  4DV5 T;  2F4V T;  5AQH B;  3IHR A;  3FHN A;  4TZ4 C;  4PK4 A;  2ACX A;  3MZK B;  5C2T A;  4UF0 B;  4ZS2 A;  4CQI A;  4LML A;  5HCM A;  5L3F B;  3LK4 2;  3ZC1 A;  4IRE A;  4O2A E;  2Y6X A;  3A5X A;  3LK2 B;  4OYJ A;  3H3A A;  3RC3 A;  3ZT7 A;  5LB7 B;  2LHR A;  2W4X A;  3ONJ A;  5E0O A;  2GK9 A;  1UUR A;  4HWF A;  1HS7 A;  2N2N A;  3QK6 A;  2DNX A;  3OYX A;  1MIY A;  4EB6 E;  4OHF A;  2D0T A;  3KV6 A;  3S4U A;  4DV1 T;  5JRC A;  1B7T A;  4UVA B;  4H9O C;  4X62 T;  5BR8 T;  2UUC T;  2IC6 A;  4UIG A;  4UV8 B;  4MLK A;  3RI5 A;  4ILB A;  4ZS3 A;  2CBJ A;  4V1A v;  4X1Y E;  5DJQ C;  3SFE A;  2H7O A;  4ZOL E;  2X68 A;  3AEG A;  2B76 A;  5L3B B;  4YXD A;  2LKH A;  4ZZC A;  4MHC A;  1IBM T;  3GN5 A;  4YY3 T;  4HWI B;  3UTK A;  4ZI2 C;  4Z8X A;  4DR3 T;  4I43 B;  3TKL B;  2KXP B;  3F31 A;  5TAO A;  3P8C D;  3PE0 A;  1KK7 A;  1W0A A;  2FUP A;  4TWF A;  2XPK A;  4XZC A;  1IJ5 A;  4AKR B;  2E5L T;  3TLU A;  4AQF C;  5J2U E;  2LSI A;  1SE7 A;  4TX5 A;  1ZV4 X;  1XDP A;  2EHO D;  1VCS A;  5EK3 A;  3NKZ A;  2EHO A;  3RYH E;  4EXT A;  3WAJ A;  3OKQ A;  2E9X B;  5JDF A;  2VKJ A;  4OX9 T;  5FL0 A;  3V5U A;  1XWM A;  2XM1 A;  3NZP A;  5AQF B;  2R6G F;  1WFD A;  4DND A;  3N2G E;  1BR0 A;  2JQ9 A;  3SFD A;  5LP6 E;  2CPT A;  1IBL T;  4K0K T;  1W09 A;  2K48 A;  4U7Y A;  2IIU A;  4WYV A;  5AQJ B;  5JH7 E;  4AKL A;  4ZI7 E;  4E7Z A;  5LJN A;  3M3Z B;  3CVR A;  1HFA A;  2L8K A;  4CZZ B;  4ZI2 D;  3L3P A;  3FZF B;  4CXY A;  4AKG A;  1MMA A;  3RIF A;  2WZI A;  1MIW A;  3ZSS A;  4EZ4 A;  2HN2 A;  3ZT6 A;  2OA5 A;  3LBX B;  3UUX B;  4LFC T;  4P0A A;  2LSJ A;  1HNZ T;  3VHL A;  3RIU C;  1E2A A;  2CEA A;  1UX4 A;  2V7K A;  2CM0 A;  4H9S E;  5AQQ B;  2WQY A;  2IC9 A;  4ZI3 C;  2NP9 A;  2JQK A;  2WZH A;  3UU8 A;  2KSR A;  2WDQ A;  3ANW B;  4JLE A;  2PTF A;  5HYA A;  3C50 A;  1O3X A;  2HN1 A;  2XQY A;  2XAH B;  3AXJ A;  1N34 T;  1HNW T;  4YTM A;  3PJA J;  5JDM A;  2W0G A;  3KVA A;  2V1D B;  2WBL A;  2W63 A;  3GMI A;  4I0U A;  3QC9 A;  4OK0 A;  5ETW A;  1LVF A;  4CI1 B;  4LF7 T;  3VR9 A;  2WM9 A;  5FXV A;  5LBQ B;  3DJB A;  5JDL A;  1SUM B;  2YIN A;  3DP7 A;  3PU3 A;  3MAC A;  2CXF A;  4IE4 A;  3L09 A;  4LFA T;  4CXX A;  4HWH A;  2V7L A;  5HEU A;  5DAB A;  3AE9 A;  2KWI B;  4A98 A;  2FJA A;  3P4W A;  2XHE B;  2BBJ A;  4IDO A;  4AIU A;  4UVB B;  2PBI A;  3RGL A;  5IUX A;  3FZM B;  5LHG B;  2CLY B;  3C4Z A;  2I59 A;  2J1D G;  3RQW A;  2MBG A;  4BA9 A;  2RPA A;  2XY8 B;  3A7M A;  3UU5 A;  1MMG A;  2ZM0 A;  4ERR A;  4HN9 A;  4EAH A;  1YKE B;  3ZC0 A;  4KHP T;  2YK0 A;  5AQO B;  5ABF B;  1XMO T;  2JIW A;  4UVC B;  3RPU A;  4ZHQ E;  4O4J E;  2W61 A;  3FXE B;  5A1L A;  2LKG A;  1NWM X;  2W67 A;  1US7 B;  2DI4 A;  2QGS A;  3P50 A;  5L3D B;  2UU9 T;  4JI1 T;  1N32 T;  2WMN A;  2X0L B;  1G73 A;  2RP4 A;  2YEV C;  3AAA B;  3EDU A;  3EHZ A;  4O8S A;  4PFO A;  5DQW A;  2XZE A;  5F5W A;  5LXT E;  5J0Z A;  4QH5 A;  2KMF A;  4B6X A;  4PW8 A;  3L8R A;  5ABH A;  4MBQ A;  3RRW A;  4X1K E;  1Z8U A;  2VVN A;  3NVO A;  4NPP A;  4X1I E;  4JI6 T;  1XNR T;  4GK0 E;  4IDQ A;  3CKD A;  3ETV A;  4HWC A;  4JUY A;  1NEN A;  4PJJ A;  2E8I A;  3RH3 A;  2JRK A;  2YKS A;  2MYS A;  3RX6 A;  3MKD A;  3ZST A;  2BS2 A;  4GKJ T;  4HEA A;  1L0V A;  4NUU A;  2V7M A;  1HR0 T;  5IWA T;  1YQ4 A;  3IF8 B;  1U5P A;  3PUV F;  5L4H A;  4KMC A;  2V6Y A;  3UUM A;  4FI5 A;  4EOZ B;  4NXN T;  1XZY A;  4QH1 A;  5HWX A;  4DV0 T;  1FJG T;  3O9X A;  4JYA T;  3IEE A;  4O4H E;  4F8H A;  4KBM B;  3NRY A;  2LSY A;  2W2U A;  2WMO A;  4L9I A;  4A5X A;  2VQE T;  3UUB A;  2I6H A;  1T7S A;  2CXL A;  2NWB A;  3P4S A;  2VL0 A;  4O2B E;  1I6Z A;  1LRZ A;  4C90 A;  5F3J A;  1UCU A;  2AXD S;  1XMQ T;  3ZMU B;  5HEH A;  3PU8 A;  1MND A;  4ILC A;  3C51 A;  3ZCJ A;  5L4E A;  1OED C;  4DV4 T;  2J62 A;  3TLS A;  4CI3 B;  3D0T A;  2M6B A;  4JI3 T;  2XQ9 A;  1XNQ T;  3LK3 B;  2BG9 B;  2Q9Q B;  3QNU A;  3ZMZ B;  3ZKR A;  3O1H A;  4QH4 A;  3CQG B;  2LM9 A;  3PUS A;  2XAG B;  1OED A;  5HCJ A;  2EHO C;  4JV5 T;  4LF5 T;  5DQV A;  3AEC A;  2E9X D;  4QWN B;  3UT5 E;  1HCI A;  2LLY A;  2CA5 A;  3I1A A;  1ZP0 A;  1IBK T;  3KDS E;  2W00 A;  3ZN1 B;  2CLY C;  3AE4 A;  2YU2 A;  1WYC A;  3RIA A;  5HEJ A;  3WI3 A;  1SHZ C;  2BG9 E;  2BBH A;  2BG9 C;  1W9R A;  2Q9Q C;  4OFZ A;  5HXC A;  5CA1 E;  3HKB E;  2VKD A;  2VUR A;  2DHR A;  4JBW F;  3BQL A;  3WAK A;  2PG8 A;  3C4W A;  5L3C B;  3EAM A;  3UFG A;  2D5U A;  3PUW F;  1HF8 A;  5FVK A;  5AQN B;  2BS4 A;  2LM2 A;  3NRX A;  2YDS A;  4IT4 A;  3CX7 B;  3FBZ A;  3HKE E;  2JMH A;  5KDM C;  3AVR A;  4CN6 A;  4F6R C;  4DBR A;  3RIU A;  5KXJ A;  1KF6 A;  1VOM A;  4IE6 A;  4IL9 A;  2CMR A;  4WW0 A;  2UUA T;  5JDQ A;  4NXM T;  1ZEE A;  1WYB A;  1T8B A;  5JRE A;  3W15 B;  4UF0 A;  1N33 T;  2JQH A;  2XQ8 A;  2BVM A;  1AJ3 A;  2LOP A;  3O1I A;  2ES0 A;  4PNI A;  4YSZ A;  3NWI A;  5L2L A;  4HKA A;  1UK5 A;  1WR0 A;  2J4G A;  2UXX B;  3I9W A;  2ZMA A;  3RLF F;  3TLT A;  3ZJ1 A;  2NOX A;  2IAK A;  2XAF B;  2WWU A;  4KI0 F;  3FBL A;  4GYR A;  5FYM A;  4TUY E;  4EZH A;  2P9B A;  3OVU A;  4BJM A;  2L9Q A;  1WCR A;  5LOV E;  5AQT B;  2I0M A;  3CK6 A;  4N78 D;  2BKO A;  4H63 V;  3JC6 D;  3IA3 A;  2X66 A;  2XAQ B;  1YXR A;  3GA8 A;  3AA1 B;  5GON E;  1NEK A;  2L3L A;  4M1P A;  4HFV A;  4YSY A;  5LGU B;  5AQU B;  1G8X A;  5HWY A;  4EED A;  3AED A;  5LCY A;  4EIW A;  2NTY A;  1J1J A;  5EK2 A;  1T98 A;  4X5T A;  3KV5 A;  2DWG A;  3RC8 A;  1QLB A;  5JDN A;  2XQ4 A;  2BDE A;  4HTE A;  1W0B A;  2C0S A;  2XAS B;  2DCF A;  5HAX A;  2V7J A;  3CQC B;  2XQA A;  4CI2 B;  3Q5X A;  3HR0 A;  5IYZ E;  1BR4 A;  3J7Y q;  5C3J A;  4YJ2 E;  5LMN T;  3N5L A;  2KIN B;  1M62 A;  5AQV B;  5FKY A;  5CA0 E;  3Q2M A;  2A2F X;  3PUA A;  3T1Y T;  2CHO A;  2XSA A;  3Q5W A;  4GOU A;  2FJE A;  1JNR A;  2A3D A;  2HPJ A;  3AE6 A;  4L5G A;  4U31 A;  5FY0 A;  3RHW A;  2D2S A;  1Z0P A;  1R8I A;  2ZLY A;  3LSV A;  3QB5 K;  1HG5 A;  3Q9D A;  4G2A A;  4Z90 A;  2RA1 A;  3OPC A;  3DTO A;  3MA9 A;  5M4Y A;  3O1J A;  4JI5 T;  1YQ3 A;  4YLH A;  1VRB A;  5AQS B;  3E08 A;  3B13 A;  1UGO A;  2UUB T;  2LRL A;  1IAP A;  3CML A;  4X65 T;  1OWA A;  3TLV A;  2UXC T;  1QSD A;  2N1G A;  4I4T E;  5JQG E;  4LF4 T;  3MK7 C;  3RYI E;  4B3R T;  4UEM A;  4QXB B;  5KX5 E;  3IBP A;  5HEG A;  4DMW A;  4YFS A;  4KP3 C;  3SWH A;  4PK5 A;  2Y8D A;  1N36 T;  3E0Z A;  3RKO A;  4CXW A;  5FVL A;  2FJB A;  3P4Q A;  2WU2 A;  5ABE A;  3JCF A;  3ONX A;  3AXJ B;  2HH7 A;  3ZYM A;  3ZPO A;  5AFU L;  1ZOY A;  3RYC E;  3JAD A;  3ZJ2 A;  3Q5D A;  2NTX A;  2BZB A;  3L39 A;  1HX8 A;  2YU1 A;  4PFP A;  2WY2 A;  3QB5 A;  4BAY B;  2SPC A;  3R84 B;  2IUB A;  2ZM8 A;  2MOZ A;  1D0X A;  3F57 A;  3B57 A;  3OYZ A;  2KLQ A;  4B3S T;  2WAU A;  2CBI A;  3CIR A;  3VR8 A;  3X1D A;  2UXB T;  1S94 A;  2QRX A;  2V8S V;  2WU5 A;  3EI0 A;  2N9D A;  2CWY A;  3JC6 C;  1KFY A;  4LMJ A;  4YHJ A;  3RQU A;  4DBQ A;  4DV2 T;  2WB5 A;  4IE0 A;  4PK6 A;  3RRC A;  1S35 A;  3KIN B;  2KZ7 B;  5FXW A;  3UUL A;  2ODV A;  2XQ7 A;  4YT0 A;  4DR1 T;  2VWA A;  2QVA A;  2K9A A;  4DR2 T;  5L47 A; 
#chains in the Genus database with same CATH homology
 3FB2 A;  3KVB A;  4IE7 A;  5LA6 E;  4J2C A;  3AA6 B;  3LJC A;  3KBU A;  3PUR A;  2IW5 B;  3ZMS B;  1ZHC A;  1D0Y A;  4OYK A;  5LBM A;  3CWZ B;  3I0Q A;  3N9P A;  3AA7 B;  4H9Q C;  2LOS A;  2K5B B;  3PTR B;  1MIV A;  4TN7 B;  3SRZ A;  3N9Q A;  4IHJ E;  3VU7 H;  4IE5 A;  3C4X A;  4P09 A;  3K3N A;  1MMD A;  2NW8 A;  3BK9 A;  4PJN A;  4U74 A;  2VK9 A;  4ASK A;  4XBF B;  2CCQ A;  3U3I A;  4IDZ A;  4ZI3 D;  1D1B A;  4P0B A;  1FMV A;  2X9X A;  5JDH A;  2LSK A;  4ISS A;  1D1A A;  1U4Q A;  4WBN E;  4H63 H;  5LHI B;  5JRC B;  2D0U A;  3BQI A;  3F2E A;  3GWH A;  3ZMV B;  2JJ9 A;  3UFE A;  3RYF E;  2NW9 A;  2Z6E A;  4X20 E;  5LGT B;  3SOL A;  4QX8 B;  3N9O A;  4H9P C;  1LKX A;  3ZYL A;  2X51 A;  1ZKE A;  5L3G B;  4BJN A;  4AKH A;  3GN5 B;  3AVS A;  3KV9 A;  1SA0 E;  4XAX B;  2KT9 A;  2LHN A;  2EHO B;  4IST A;  3BQK A;  5LGN B;  2E9X A;  2Y48 B;  3R6N A;  4TV9 E;  3U78 A;  2JQQ A;  3PUQ A;  5LHH B;  3ZMT B;  1FIO A;  2E9X C;  3H37 A;  2DLR A;  3ESL A;  2NW7 A;  4UXN B;  2CWO A;  5H6Q B;  4MAL A;  5BMV E;  4DMV A;  3I0O A;  3OBV E;  2DWK A;  3MXZ A;  4WNK A;  1HTJ F;  1YD8 G;  3HKD E;  4JEU B;  5FMN A;  4O4L E;  2VL8 A;  3NBX X;  1BR2 A;  2WSS V;  3LBX A;  2PJQ A;  2LE8 A;  5FXX A;  3OJA A;  5HXS A;  2UXN B;  3K3Q C;  5FNV E;  1WLX A;  2V7I A;  3VKG A;  5EK4 A;  3T8O A;  5C8Y E;  2BVL A;  2G0U A;  3AB3 B;  3CPZ A;  4QHO A;  2VKH A;  3ANW A;  5LNK A;  2LEH A;  4K0U A;  4GIW A;  4KUM B;  4C91 A;  4HE8 A;  4AI6 A;  3FXD B;  3LFM A;  3CQX C;  1FEW A;  1UX5 A;  2C5K T;  5LJM A;  4AQG A;  4WBO A;  1IJ6 A;  3E22 E;  4GK5 E;  4L0R A;  3SS1 A;  2PFV A;  4EYY R;  4QKN A;  1EZ3 A;  3PUG A;  3I9Y A;  4G63 A;  5EZY E;  2X67 A;  2C5J A;  5JVD E;  3HL6 A;  1OXZ A;  4I55 E;  1YKH B;  4QXH B;  2KND A;  1NAF A;  2CE7 A;  2H3R A;  4I50 E;  3KBT A;  5JDG A;  2H7V C;  3NZQ A;  3J9X 1;  4NUV A;  3ZN0 B;  5HXR A;  5HXH A;  2C5I T;  2XAJ B;  2B1E A;  3AA0 B;  2LSG A;  3K3O A;  3N9N A;  4IIJ E;  3MJX A;  4UV9 B;  3HKC E;  3EUH A;  4DVD A;  1CUN A;  3ZYK A;  3N2K E;  4ILU A;  4AQF A;  4H9N C;  3ZEF B;  2LT3 A;  4H9R C;  5ADX L;  4TV8 E;  2CXD A;  4FJO A;  2VKO A;  1QUU A;  2XTL A;  4YJ3 E;  2X9W A;  5L3E B;  5LYJ E;  1KNZ A;  1X79 A;  5H6R B;  4MFR A;  3ETU A;  4HGA A;  5J1G A;  5LG4 A;  3N2O A;  5F8P A;  2HPL A;  3C98 B;  3LG7 A;  3UUN A;  3HA4 A;  3M65 A;  5HXE A;  3P7I A;  3HI2 A;  1MNE A;  3ZLI A;  4O4I E;  2QA7 A;  3PDY A;  4ANJ A;  2V26 A;  5J2T E;  3AAE B;  5FY1 A;  3CX8 B;  2VB6 A;  1WR6 A;  4U72 A;  3ZCI A;  2W62 A;  4E7S A;  2K24 A;  4ADZ A;  1MMN A;  4IGU A;  4GYS A;  4UEL A;  4PJL A;  1D0Z A;  4JEH B;  3AAI A;  1E1H B;  2A72 A;  4QXC B;  1IZN B;  1WRD A;  2VAS A;  3K8P C;  2ODU A;  2Q9Q A;  3V5S A;  1YW0 A;  2Q9Q D;  3N9L A;  3N9M A;  5JR9 C;  1D1C A;  4QX7 B;  1V9D A;  3CX6 B;  4EYU A;  2MTQ A;  2X9H A;  5JR9 A;  3EVY A;  3C64 A;  1HG2 A;  3O4X E;  5CB4 E;  4DO0 A;  5FXZ A;  2M67 A;  2XUE A;  2X9Y A;  2JPF A;  4AKI A;  1H7C A;  4PJM A;  4AXP A;  1LVK A;  2KWH A;  1FMW A;  3QUJ A;  3EDV A;  5FP3 A;  2JMK A;  1Y64 B;  5FY7 A;  3KFW X;  1BR1 A;  2ZM2 A;  3KV4 A;  4PAG A;  2LJL A;  5IHY A;  3IHR A;  3FHN A;  4TZ4 C;  4PK4 A;  2ACX A;  3MZK B;  4UF0 B;  4ZS2 A;  4CQI A;  5L3F B;  3LK4 2;  3ZC1 A;  4O2A E;  2Y6X A;  3A5X A;  3LK2 B;  4OYJ A;  3H3A A;  3RC3 A;  5HYA A;  3VKH A;  2LHR A;  1HS7 A;  5E0O A;  2GK9 A;  2N2N A;  3QK6 A;  2DNX A;  3OYX A;  1MIY A;  4EB6 E;  4OHF A;  2D0T A;  3KV6 A;  3S4U A;  5JRC A;  1B7T A;  4UVA B;  4H9O C;  2IC6 A;  4UIG A;  4UV8 B;  4MLK A;  4ZS3 A;  4V1A v;  4X1Y E;  5DJQ C;  2H7O A;  4ZOL E;  2X68 A;  5L3B B;  4MHC A;  3GN5 A;  3UTK A;  4ZI2 C;  4Z8X A;  4I43 B;  3TKL B;  2KXP B;  3F31 A;  5TAO A;  3P8C D;  3PE0 A;  1KK7 A;  4XZC A;  1IJ5 A;  4AKR B;  4AQF C;  5J2U E;  2LSI A;  4TX5 A;  4EXT A;  1ZV4 X;  5EK3 A;  2EHO D;  3RYH E;  3WAJ A;  2EHO A;  3OKQ A;  2E9X B;  5JDF A;  2VKJ A;  3V5U A;  5KMG P;  3NZP A;  1BR0 A;  4DND A;  3N2G E;  5LP6 E;  2K48 A;  4AKL A;  4ZI7 E;  4E7Z A;  5LJN A;  3CVR A;  1HFA A;  2L8K A;  4CZZ B;  4ZI2 D;  3L3P A;  4CXY A;  1MMA A;  1MIW A;  4EZ4 A;  2OA5 A;  3LBX B;  3UUX B;  4P0A A;  2LSJ A;  3VHL A;  2CEA A;  1UX4 A;  2V7K A;  2CM0 A;  4H9S E;  2IC9 A;  4ZI3 C;  2NP9 A;  3ANW B;  4JLE A;  3C50 A;  1O3X A;  2XQY A;  2XAH B;  5JDM A;  2W0G A;  3KVA A;  2V1D B;  2WBL A;  2W63 A;  3GMI A;  4OK0 A;  3QC9 A;  5ETW A;  4CI1 B;  1LVF A;  2WM9 A;  5FXV A;  5LBQ B;  3DJB A;  5JDL A;  2YIN A;  3DP7 A;  3PU3 A;  3MAC A;  2CXF A;  4IE4 A;  3L09 A;  4CXX A;  2V7L A;  5DAB A;  2KWI B;  2XHE B;  4UVB B;  2PBI A;  5LHG B;  2CLY B;  3C4Z A;  2I59 A;  2J1D G;  4EZH A;  2MBG A;  4BA9 A;  4ERR A;  1MMG A;  2ZM0 A;  4HN9 A;  4EAH A;  1YKE B;  3ZC0 A;  2YK0 A;  4UVC B;  3RPU A;  4ZHQ E;  4O4J E;  2W61 A;  3FXE B;  5A1L A;  1NWM X;  4AKG A;  1US7 B;  2DI4 A;  2QGS A;  5L3D B;  2WMN A;  2X0L B;  1G73 A;  2RP4 A;  2YEV C;  3AAA B;  3EDU A;  4O8S A;  4PFO A;  5DQW A;  5LXT E;  2KMF A;  4B6X A;  4PW8 A;  4MBQ A;  3RRW A;  4X1K E;  4X1I E;  4GK0 E;  3CKD A;  3ETV A;  3RH3 A;  4JUY A;  4A56 A;  4PJJ A;  2E8I A;  4BJM A;  2JRK A;  5JH7 E;  2MYS A;  3RX6 A;  3MKD A;  4HEA A;  4NUU A;  2V7M A;  3IF8 B;  1U5P A;  3UUM A;  4EOZ B;  4KMC A;  4FI5 A;  5HWX A;  3O9X A;  3IEE A;  4O4H E;  4KBM B;  3NRY A;  2LSY A;  4L9I A;  2WMO A;  2CXL A;  2NWB A;  4O2B E;  1LRZ A;  4C90 A;  5F3J A;  1UCU A;  3ZMU B;  3PU8 A;  1MND A;  3ZCJ A;  3C51 A;  4CI3 B;  3D0T A;  3LK3 B;  2Q9Q B;  3ZMZ B;  3O1H A;  3CQG B;  2LM9 A;  3PUS A;  2XAG B;  2EHO C;  5DQV A;  3UT5 E;  2E9X D;  4QWN B;  1HCI A;  2CA5 A;  3I1A A;  3KDS E;  2W00 A;  3ZN1 B;  2CLY C;  2YU2 A;  1WYC A;  3WI3 A;  1SHZ C;  2Q9Q C;  5HXC A;  4OFZ A;  5CA1 E;  3HKB E;  2VKD A;  2DHR A;  3BQL A;  3WAK A;  2PG8 A;  3C4W A;  5L3C B;  2D5U A;  1HF8 A;  3NRX A;  3CX7 B;  3FBZ A;  3HKE E;  2JMH A;  5KDM C;  3AVR A;  4F6R C;  4DBR A;  1VOM A;  4IE6 A;  2CMR A;  4WW0 A;  5JDQ A;  1ZEE A;  1WYB A;  5JRE A;  3W15 B;  4UF0 A;  2BVM A;  1AJ3 A;  2LOP A;  3O1I A;  2ES0 A;  4PNI A;  5L2L A;  4HKA A;  2UXX B;  3I9W A;  2ZMA A;  3ZJ1 A;  2NOX A;  2IAK A;  2XAF B;  2WWU A;  3FBL A;  4GYR A;  5FYM A;  4TUY E;  2P9B A;  2L9Q A;  5LOV E;  4N78 D;  4H63 V;  3JC6 D;  2X66 A;  2XAQ B;  3GA8 A;  3AA1 B;  5GON E;  2L3L A;  4M1P A;  4HFV A;  5LGU B;  1G8X A;  5HWY A;  4EIW A;  5LCY A;  5EK2 A;  2NTY A;  1T98 A;  3KV5 A;  2DWG A;  3RC8 A;  5JDN A;  2BDE A;  4HTE A;  2C0S A;  2XAS B;  2DCF A;  5HAX A;  2V7J A;  3CQC B;  4CI2 B;  3Q5X A;  3HR0 A;  5IYZ E;  1BR4 A;  3J7Y q;  4YJ2 E;  3N5L A;  2KIN B;  5CA0 E;  3Q2M A;  2A2F X;  3PUA A;  3Q5W A;  4GOU A;  5FY0 A;  2A3D A;  2HPJ A;  4L5G A;  2D2S A;  1Z0P A;  2ZLY A;  4G2A A;  1HG5 A;  3Q9D A;  2RA1 A;  3DTO A;  3MA9 A;  5M4Y A;  3O1J A;  4YLH A;  1VRB A;  3E08 A;  3B13 A;  3CML A;  1IAP A;  1OWA A;  1QSD A;  2N1G A;  4I4T E;  5JQG E;  3MK7 C;  3RYI E;  4UEM A;  4QXB B;  5KX5 E;  3IBP A;  4DMW A;  4YFS A;  4KP3 C;  3SWH A;  4PK5 A;  2Y8D A;  3E0Z A;  3RKO A;  4CXW A;  3ONX A;  5AFU L;  2HH7 A;  3ZYM A;  3ZPO A;  3RYC E;  3ZJ2 A;  2NTX A;  2BZB A;  4PFP A;  1HX8 A;  2YU1 A;  4BAY B;  2SPC A;  3R84 B;  2ZM8 A;  2MOZ A;  1D0X A;  3F57 A;  3B57 A;  3OYZ A;  2KLQ A;  2WAU A;  1S94 A;  2N9D A;  2CWY A;  3JC6 C;  4YHJ A;  4DBQ A;  4IE0 A;  4PK6 A;  3RRC A;  1S35 A;  3KIN B;  2KZ7 B;  5FXW A;  3UUL A;  2ODV A;  2VWA A;  5JR9 B;  2K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...