2N2NA

Tom1 negatively modulates binding of tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
b'EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Target of Myb protein 1
publication title Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n2nA00
2N2NA 1NWMX 1NAFA 1WR6A 1O3XA 1X79A 1OXZA 1YD8G 2N9DA 1WRDA
chains in the Genus database with same CATH superfamily
3LJCA 1T98A 3CX6B 3JAFA 4NXMT 2XAHB 5HAXA 3UU5A 2XASB 3AE4A 2LSJA 4ZXLA 2XY8B 1Y01A 4WW0A 4U33A 5JR9B 1IJ6A 5LP6E 1HNXT 3AE8A 2N1GA 3PUZF 2QYWA 2B1EA 2XPKA 2XAFB 4PK5A 3N2KE 2VURA 2ODUA 2YEVC 3LK2B 1W09A 4YFSA 2PJQA 5FP3A 2ZMAA 3BQKA 3CWZB 2DI4A 2WDRA 4EYUA 3A7MA 4CN4A 4PJJA 4HFVA 4BJNA 3Q5WA 1VRBA 3EDVA 4DV3T 4TZ4C 5ABHA 2WBLA 1LVFA 1FJGT 1ZV4X 2KZ7B 4IDOA 5AQRB 4U2YA 3ZMZB 4XBFB 4PJNA 5HEOA 1KNZA 5LYJE 5FL0A 4WNKA 5ABEA 3DJBA 3V5SA 2IC6A 1HFAA 1HX1B 4H9NC 4ZEYA 1CUNA 4OFZA 4WZXA 1WCRA 3CK6A 4TV9E 1WRDA 3ZN0B 2JIWA 5JRCB 3K3QC 3KVAA 5J2TE 3ONLC 3BK9A 2XAJB 2LSGA 3UULA 3V5UA 5LBMA 3B13A 2WAUA 3DTOA 4QXBB 1MIVA 3GN5B 5J1GA 4YLHA 1M62A 5JDNA 3C4XA 4HWIB 1D0YA 4YT0A 3T8OA 4IE0A 4X1YE 5JVDE 3LFMA 4ZOLE 4KUMB 4AQGA 4ILAA 2VKHA 5H6RB 3C4WA 2V5DA 4TWFA 4JEUB 5J2UE 5LGNB 4IDPA 2WDVA 4CXYA 2LEHA 3B57A 4U3CA 4ADZA 4IIJE 3ZJ2A 3C51A 1Z0PA 2DNXA 5L3GB 5FXZA 3VKHA 3EI0A 4A98A 2PTFA 3MACA 4HWDA 5L4EA 2XQ4A 2WQYA 5LJMA 2C0SA 4TN7B 4PK4A 3AEFA 3OYZA 2N9DA 1VCSA 4DNDA 2YK0A 1D1BA 3PV0F 4JI6T 4U2ZA 2VQET 2WDQA 2IMLA 1UCUA 1HX8A 5C3JA 1R8IA 3PDYA 4U7YA 4C91A 2N2NA 4JEHB 3AA7B 4CZZB 2H7OA 3WAJA 3TKLB 4DBQA 4WYVA 3KV9A 3H37A 3E08A 4YY3T 3RGLA 4B3RT 3PUWF 3FXEB 5AQNB 4Z90A 3RC8A 4HWHA 2VASA 2VB6A 3CKDA 4H63V 2E5VA 2HPJA 2V26A 3HKDE 3KV6A 3R6NA 1ZHCA 4AKIA 3SS1A 2KINB 2E9XA 2LJLA 3PUSA 4TWHA 3VHLA 2GK9A 4QX7B 2A3DA 4AKRB 5LMNT 1HTJF 4QXHB 4Q25A 3EVYA 2K24A 2MPKA 2CXLA 2BVLA 1ZOYA 2I0MA 2WB5A 4UVCB 1XWMA 1AJ3A 2BG9B 2E9XD 1N33T 4TNVA 2JMKA 4EV6A 5FL1A 3ETUA 3CQCB 1W0AA 2W63A 2QVAA 3ZMSB 1YD8G 4JV5T 1OEDB 4OYJA 2LHRA 2LOPA 4JI4T 3Q2MA 2IAKA 3ANWA 3WI3A 3P7IA 4IHJE 2LHNA 5AQLB 4DR1T 4UV8B 5LCYA 4EXTA 4CN6A 4YSXA 4TWDA 2V7JA 1J5ET 3NRYA 2UU9T 1XZYA 2BS2A 3N9MA 1IJ5A 2E9XC 3CIRA 4IDQA 3AECA 3MK7C 5FVKA 3FHNA 2L3LA 4PFOA 4XZCA 4IE5A 3CX8B 5FXXA 1UGOA 4NUUA 5H6QB 2VKDA 4X5TA 5AQIB 2XQ6A 4MALA 4QX8B 2YN6A 5JH7E 1WLXA 4HGAA 2IUBA 3KVBA 3UFGA 3ZJ1A 1GQEA 4I43B 3X1DA 1FMWA 2XHEB 3RLFF 3AXJA 2E8IA 1MIYA 4MLKA 4LF7T 2X67A 2X66A 3QB5A 3MA9A 4G2AA 2UXNB 5JQGE 2CWYA 2NW7A 1J1JA 2JPFA 3C98B 5HEHA 3BQLA 5L2LA 4ZZCA 3RI5A 4ZZBA 2V6YA 2ACZA 4IGUA 4XAXB 5AQMB 5FXVA 2BG9E 5JDGA 5AQFB 4O4JE 2ES0A 2CCQA 3FXDB 2K48A 4IDNA 4GK0E 4O4IE 5C8YE 3PUXF 2WCAA 4GKJT 3RYHE 3HI2A 2VK9A 3UQ4A 4PAGA 4H63H 3AA0B 4UVBB 2ZM8A 3ZEFB 3BQIA 2W67A 2ODVA 2YDRA 3RYCE 2B76A 4JUYA 5FY0A 2J47A 2UXXB 2XQ5A 4U7IA 1T7SA 3RQUA 4G63A 3O1JA 2W2UA 3HKCE 3LK3B 3AA1B 3OKQA 1ZEEA 3RIAA 1HNWT 3GWHA 2X9YA 3D0TA 4H9SE 1FEWA 5JR9A 4P0BA 5FYMA 2DWKA 3S4UA 4UV9B 2VQFT 4F6RC 3UQ7A 1QLBA 5IHYA 1D0ZA 4JI8T 4YTNA 3FZKB 1ZKEA 4JI7T 2M6IA 1EZ3A 4EZHA 4LMJA 2W66A 2CHOA 3Q9DA 4OYKA 4U74A 3N9NA 1YKHB 3JADA 3QK6A 3K3OA 2CRBA 1E1HB 2D5UA 2Q9QB 4E7ZA 3RPUA 3K3NA 1D1AA 3LBXB 4H9RC 3CQGB 3PTRB 3QOFA 4HWFA 5DQWA 3ONJA 2CWOA 5HWXA 5LG4A 4EYYR 5L47A 4LF5T 2VVNA 2UXCT 3EABA 2H3RA 2M6BA 3IHRA 4I50E 5JR9C 5JRCA 2CBJA 4X20E 4P0AA 3N9QA 1BR0A 1JNZA 3RIUA 4AI6A 3N9PA 1HF8A 2D0UA 5LOVE 1D1CA 3GN5A 3H3MA 1WR0A 3A5XA 2CEAA 2WMNA 3AVRA 5BMVE 2X0HA 3ZCIA 4MHCA 5HEUA 3AEEA 4QKNA 2LLYA 3UUXB 5AQQB 5L3EB 1I6ZA 4KP3C 1IZNB 4YHJA 1QSDA 4ANJA 4QH5A 3ZMVB 2CLYB 1Z8UA 2A9UA 1BR2A 2L8KA 4DV7T 1UX4A 4YSZA 4EB6E 4DR3T 3P4PA 2MTQA 4IT4A 4O4LE 2KWIB 5AQSB 2WWVA 2WU2A 2G0UA 4GK5E 2YKSA 4UELA 4HWCA 2QGSA 2NR4A 3OTOT 2DLRA 3RIUC 4PW8A 3C50A 1XNRT 1SA0E 2NTXA 4ZI3D 3F31A 4N78D 2XQAA 1J5WA 3AB3B 4DV1T 4V1Av 3RRWA 2D9DA 3RHWA 2LE8A 1MNEA 2R6GF 3AEGA 3UTKA 4LF8T 5HXCA 2BVMA 5CA0E 3P4WA 2ACXA 2XSBA 3KBUA 2EHOA 1E2AA 1LRZA 3AEBA 4I4TE 4BJMA 3N5LA 2RPAA 2XUEA 3PE0A 1WFDA 4UF0B 4B6XA 4KHPT 4ISSA 5FY1A 2LM9A 2MOZA 4COFA 5CB4E 2X0YA 3AE2A 3SRZA 4DUYT 5FKYA 4JLEA 4IE7A 3K1SA 4ZI3C 2J62A 2HN2A 4ILUA 2V5CA 4ERRA 3MZKB 4X66T 4B3TT 4Z8XA 3JAEA 3RYFE 3P4QA 5LGTB 2K3WA 4B3MT 1YKEB 4LMKA 2C5JA 4K0KT 2FJDA 1YQ4A 2BG9A 3NKZA 3O1IA 2IDOB 2OLTA 4NIQA 3RQWA 3B5MA 2I59A 5LHIB 1OEDA 2EHOB 3RKGA 4KMCA 5HCJA 4DVDA 2BDEA 1OXZA 4PFPA 2JMHA 4UIGA 2XQ3A 2IHR1 2XM1A 3LDQB 3OBVE 2CPTA 4DR4T 5EZYE 5LHGB 2DCFA 3I9WA 4TNWA 2UXBT 2YDSA 5L3CB 1MMGA 3P4SA 4H9OC 4X62T 3ZYLA 2BKOA 1I94T 4ISTA 4HTEA 3AEAA 3PUYF 1UX5A 1DU2A 4CI3B 3P4RA 3GMIA 2W0GA 4HFCA 3L09A 2V7KA 5LG3A 2KNDA 4PNIA 3I1AA 1QUUA 2LT3A 4L5GA 3UU3A 3AEDA 2XQ9A 3ZC1A 3EUHA 2WSSV 2QRXA 2BG9C 3AVSA 2AE9A 4OX9T 2YDQA 5LBQB 2CBIA 3UUBA 3OYXA 4QH1A 5AQGB 1OEDC 3AE3A 1W9RA 5HXHA 2NTYA 4HFBA 2LSKA 4GOUA 3Q5XA 4YTPA 2VWAA 1IBLT 1N32T 3SWHA 1YXRA 2AXDS 5HEJA 3NZQA 5HWYA 5CFBA 3K8PC 2JQHA 3PJAJ 3RYIE 5DJQC 1SHZC 2J4GA 3NVOA 3AE5A 4JBWF 3R84B 5HEGA 4KX6A 3CVRA 5JDQA 4TX5A 2FJEA 3FZHB 1CHUA 2UXDT 1LVKA 2LSIA 2Y8DA 2PG8A 2H89A 1HNZT 3NWIA 2BZBA 2QA7A 3UFEA 4X1IE 1KEYA 4AXPA 1WYBA 4E7SA 4ZI7E 2LOSA 2LRKA 4FI5A 2A72A 4LFBT 4ILCA 5LGUB 4DV4T 3E0ZA 2V7LA 5HXEA 4Z91A 2YINA 2BBJA 2YU2A 4U31A 2CMRA 4QXCB 3IEEA 4JI1T 2X9WA 3PU3A 3MXZA 3UU8A 3IBPA 5LA6E 4IE4A 2UUBT 3J7Yq 1KF6A 4HN9A 1U4QA 4YTMA 2X51A 1YW0A 4LFCT 2WMOA 3ETVA 1MMAA 4WBOA 2Z6EA 1L0VA 2V8SV 2X0LB 1U5PA 4F8HA 3O1HA 1W0BA 3SOLA 2XQ7A 3RRCA 3LG7A 1OEDE 3U78A 2ZM0A 3AE1A 2NOXA 3AAAB 4CN1A 2P9BA 5C2TA 5JREA 4DR5T 3PURA 4X64T 5ADXL 2DHRA 3FBZA 3F57A 3KV5A 5AQHB 1BR4A 4NXNT 5ABFB 5FVLA 4P1NA 3ZMTB 3VR8A 4M1PA 4PK6A 1N34T 4UXNB 2Y6XA 4AKGA 5EK3A 1NENA 5FNVE 3HKEE 2J1DG 3RKOA 2UUCT 3AAEB 4HFEA 5L3DB 2Q9QA 3CPZA 3U3IA 2XQYA 2ZLYA 2W61A 4WBNE 3KV4A 3LBXA 4X65T 5AFUL 2V7MA 4BA9A 3TLWA 2RA1A 2BBHA 2Q9QD 1NAFA 2WP9A 2SPCA 3QNUA 4GKKT 3ZCJA 3AAIA 3RH3A 2RP4A 3MJXA 3FB2A 4DUZT 5IYZE 3QC9A 3PUAA 4KHZF 4PJLA 3LSVA 2PBIA 5HXSA 5AQKB 3HL6A 3VRBA 4FJOA 4O2AE 4NUVA 3J9X1 5DQVA 1S94A 4YJ3E 3Q5EA 3JC6D 3VRAA 1BR1A 3FZLB 5EK4A 2Q9QC 4NPPA 5ABGA 1HG2A 1UK5A 3E22E 4ZI2D 1NEKA 5CGMA 1WYCA 1G73A 3PUQA 1S35A 4AIUA 2LRLA 3T1YT 5HCMA 1M7KA 3ABVA 1US7B 3I9YA 1MNDA 3WAKA 2WZIA 3QB5K 3AE6A 4GYSA 3ESLA 5L3BB 1MIWA 1FIOA 1T72A 4LF9T 2X9HA 3ZT5A 5HYAA 5BR8T 4CI2B 3FBLA 3CMLA 4DV5T 3JC6C 3CX7B 3TLTA 2Y48B 4BAYB 2XM2A 4EIWA 4JYAT 2VL0A 4CI1B 3PU8A 3I0QA 4ZI2C 2MBGA 4DR2T 2WS3A 2WWUA 1HCIA 5E0OA 4QWNB 4QHOA 3SFEA 3EDUA 5LJNA 4CXXA 4O2BE 3N2GE 4UF0A 3M3ZB 4MBQA 4TV8E 5AQPB 2HPLA 2CLYC 5J0ZA 2C5KT 1HG5A 2ZM2A 3DP7A 4O4HE 3UT5E 5IUXA 2W62A 4HE8A 4DIDB 1KNPA 5FMNA 4JI5T 5LB7B 2H7VC 5JDHA 4PJMA 2BKNA 2YU1A 2DL1A 1NWMX 2FJBA 3UU6A 3TLVA 2XSAA 4H9PC 4QH4A 3RF1A 2YOEA 4DV6T 2BS4A 4HFDA 5EK2A 4IE6A 3C64A 5L4HA 2XAQB 3UU4A 1G8XA 1T8BA 3TLSA 2PFVA 2BS3A 3AE7A 3KBTA 1H7CA 2ZM6T 3ZYMA 2EHOD 3NRXA 4L0RA 3HR0A 1XDPA 3UUNA 1WR6A 2V1DB 3IF8B 2WY2A 2WU5A 2K5BB 3ONXA 3ZYKA 3PUVF 4LF4T 5L3FB 5LNKA 4DV0T 1JNRA 1KK7A 4IREA 2W00A 3RX6A 1V9DA 4GIWA 4OHFA 3HKBE 2IW5B 2HN1A 4GYRA 5M4YA 2UUAT 3RC3A 3PUGA 3ZT7A 3JCFA 5LXTE 2BKPA 3P8CD 2EHOC 4JI2T 4DBRA 5AQUB 1HS7A 2WM9A 2V7IA 4J2CA 4LFAT 3VR9A 2M67A 3AA6B 4CXWA 2VKOA 2KLQA 2KT9A 3TLUA 2XQ8A 2X9XA 4DR7T 3H3AA 5DABA 5KDMC 4A97A 2NP9A 3I0OA 4K0UA 4KI0F 2LKHA 1XNQT 1VOMA 2D0TA 4KBMB 3A8YC 3RIFA 2F4VT 2CA5A 2W4XA 1E7PA 2NWBA 3IA3A 5F8PA 3N9LA 1IBMT 3OVUA 3GA8A 5KXJA 2LM2A 2JQQA 3ZSSA 3QUJA 4TUYE 4HFHA 3ZLIA 4YXDA 2E5LT 1XDOA 4O8SA 4UEMA 2IIUA 3L3PA 2L9QA 2I6HA 4ZS3A 4I0UA 1IBKT 2JRKA 1D0XA 5AQJB 4EZ4A 5JTGA 4LF6T 1UURA 3ZC0A 2JJ9A 3CQXC 3O4XE 4DO0A 4YHHT 5FXWA 2E9XB 1KFYA 1FMVA 2NW8A 2IC9A 4IL4A 4JI3T 4DMVA 2XJ7A 2DWGA 5JDLA 1X79A 4AISA 4EGWA 5FY7A 2LKGA 2JQ9A 5CA1E 4AKHA 1SUMB 4UVAB 5CJ5A 3N9OA 3ZMUB 2VKJA 3EAMA 4ASKA 5F5WA 3PJAA 1N36T 2OV9A 4AQYT 2FUPA 3ANWB 3ZSTA 5AQVB 5JDFA 4EOZB 1MMDA 4DMWA 2XAGB 2KXPB 3L39A 4OK0A 2HH7A 4MFRA 3F2EA 1Y64B 5JDMA 5ABFA 2FJAA 2WZHA 1X9BA 2V6XA 3FZMB 4ZHQE 4ZS2A 3M65A 1OWAA 3MKDA 2CXFA 3FZFB 3N2OA 1B7TA 4EEDA 3AE9A 2HHHT 4UR9A 4EAHA 5KX5E 3OPCA 3ZT6A 3ZN1B 5TAOA 2LSYA 4X1KE 2JQKA 4C90A 3KINB 3UUMA 5A1LA 2CXDA 2A2FX 2H88A 4HKAA 3NZPA 3VU7H 2KWHA 2FBWA 5AQOB 4HFIA 4AQFA 5GONE 4IL9A 2E2AA 1LKXA 1UUSA 4A56A 3L8RA 4YJ2E 3AXJB 1HR0T 2D2SA 5F3JA 4LMLA 5HXRA 3OJAA 4H9QC 3LK42 1O3XA 4A5XA 5ETWA 4ILBA 2K9AA 2XZEA 2CM0A 4U72A 2KMFA 4HEAA 4IDZA 3HA4A 1XMOT 1ZP0A 2NW9A 2CHNA 1MMNA 3EHZA 2MYSA 1IAPA 3ZPOA 2VVSA 3P50A 2MAWA 2KSRA 5LMUT 2V6YB 5IWAT 3O9XA 4B3ST 2XTLA 4L9IA 2X68A 5KMGP 4I55E 1KNRA 3KDSE 1XMQT 4YSYA 4CQIA 1SE7A 3SFDA 3C4ZA 4P09A 4EEBA 2VL8A 5LHHB 3W15B 2OA5A 2CE7A 4JI0T 4AQFC 3NBXX 3Q5DA 4DV2T 1VCTA 3G06A 4AKLA 1YQ3A 3ZKRA 3VKGA 4DR6T 2C5IT 5AQTB 3KFWX 3T1HT
chains in the Genus database with same CATH topology
3LJCA 1T98A 2JPFA 4PJMA 3CX6B 3GMIA 2W0GA 3L09A 2YU1A 2V7KA 1NWMX 3C98B 2KNDA 3BQLA 5L2LA 2XAHB 5HAXA 4PNIA 3I1AA 2XASB 1QUUA 2LSJA 2LT3A 4H9PC 4L5GA 3ZC1A 3EUHA 4IGUA 4XAXB 2WSSV 5FXVA 3AVSA 5JDGA 4O4JE 5EK2A 4WW0A 2ES0A 2CCQA 3FXDB 4IE6A 2K48A 5JR9B 1IJ6A 5LBQB 4GK0E 5LP6E 3C64A 4O4IE 5C8YE 2N1GA 2XAQB 2B1EA 1G8XA 3OYXA 2XAFB 4PK5A 2PFVA 3N2KE 3KBTA 1H7CA 5HXHA 3RYHE 2ODUA 3HI2A 2YEVC 2VK9A 2NTYA 3LK2B 4YFSA 2LSKA 2PJQA 4GOUA 3ZYMA 4PAGA 3Q5XA 4H63H 5FP3A 2ZMAA 2EHOD 3BQKA 2VWAA 3CWZB 3AA0B 3NRXA 2DI4A 4L0RA 4UVBB 3HR0A 3UUNA 2ZM8A 3ZEFB 4EYUA 3BQIA 1WR6A 3SWHA 2V1DB 2ODVA 3IF8B 3NZQA 4PJJA 5HWYA 3K8PC 4HFVA 4BJNA 3Q5WA 1VRBA 3EDVA 3RYIE 5DJQC 2K5BB 3RYCE 4TZ4C 3ONXA 2WBLA 4JUYA 3ZYKA 5FY0A 1LVFA 1SHZC 5L3FB 3R84B 5LNKA 2UXXB 3CVRA 1KK7A 5JDQA 4G63A 4TX5A 3O1JA 2W00A 3RX6A 1V9DA 1ZV4X 2KZ7B 3HKCE 1LVKA 2LSIA 3LK3B 3AA1B 3ZMZB 3OKQA 1ZEEA 4GIWA 2Y8DA 4OHFA 4XBFB 2PG8A 3HKBE 2IW5B 4PJNA 3GWHA 4GYRA 1KNZA 2BZBA 5LYJE 2X9YA 5M4YA 2QA7A 3UFEA 4X1IE 3RC3A 3D0TA 3PUGA 4H9SE 1FEWA 5JR9A 4WNKA 4AXPA 3DJBA 1WYBA 3V5SA 2IC6A 4P0BA 1HFAA 5LXTE 4H9NC 5FYMA 4E7SA 4ZI7E 1CUNA 2DWKA 2LOSA 4OFZA 3P8CD 4FI5A 2A72A 3S4UA 4TV9E 2EHOC 1WRDA 5LGUB 3ZN0B 4UV9B 4DBRA 4F6RC 3E0ZA 5JRCB 1HS7A 2V7LA 5HXEA 3K3QC 2WM9A 3KVAA 5IHYA 2V7IA 1D0ZA 2YINA 2YU2A 4J2CA 5J2TE 2CMRA 2M67A 3AA6B 3BK9A 4CXWA 2XAJB 2LSGA 3UULA 2VKOA 4QXCB 3V5UA 1ZKEA 2KLQA 3IEEA 2KT9A 1EZ3A 2X9WA 3PU3A 2X9XA 4EZHA 5LBMA 3MXZA 3B13A 3IBPA 2WAUA 3DTOA 4QXBB 3H3AA 1MIVA 3Q9DA 5DABA 5LA6E 4OYKA 3GN5B 4IE4A 5J1GA 3J7Yq 5KDMC 4YLHA 4HN9A 5JDNA 3C4XA 4U74A 2NP9A 3I0OA 3N9NA 1U4QA 1YKHB 4K0UA 1D0YA 3T8OA 2X51A 3QK6A 4IE0A 3K3OA 4X1YE 1YW0A 5JVDE 3LFMA 1E1HB 1VOMA 2D5UA 4KUMB 2Q9QB 4ZOLE 2WMOA 4AQGA 3ETVA 4E7ZA 2VKHA 2D0TA 1MMAA 4KBMB 4WBOA 2Z6EA 5H6RB 3RPUA 3C4WA 1D1AA 3K3NA 2CA5A 3LBXB 4JEUB 2NWBA 3CQGB 3PTRB 2X0LB 4H9RC 5F8PA 1U5PA 3N9LA 3GA8A 3O1HA 3SOLA 5J2UE 5DQWA 5LGNB 2CWOA 5HWXA 5LG4A 2JQQA 3RRCA 3LG7A 3QUJA 4CXYA 4EYYR 4TUYE 3U78A 2LEHA 3ZLIA 3B57A 4ADZA 4IIJE 3ZJ2A 3C51A 2ZM0A 2NOXA 2H3RA 4O8SA 3AAAB 4UEMA 1Z0PA 2DNXA 3IHRA 4I50E 2P9BA 5FXZA 5JR9C 5L3GB 5JRCA 3VKHA 3L3PA 5JREA 2L9QA 3MACA 4X20E 4ZS3A 3PURA 5ADXL 4P0AA 2JRKA 1D0XA 4EZ4A 2DHRA 3FBZA 3N9QA 5LJMA 3ZC0A 2JJ9A 2C0SA 1BR0A 3F57A 3KV5A 3CQXC 3O4XE 4TN7B 4AI6A 4DO0A 1BR4A 5FXWA 4PK4A 2E9XB 1FMVA 3N9PA 1HF8A 2D0UA 5LOVE 3ZMTB 1D1CA 2NW8A 3GN5A 4M1PA 4PK6A 3OYZA 2N9DA 4UXNB 2IC9A 2Y6XA 4AKGA 5EK3A 5FNVE 4DNDA 3HKEE 2YK0A 1D1BA 3A5XA 2CEAA 2J1DG 3RKOA 2WMNA 3AVRA 5BMVE 1UCUA 3AAEB 3ZCIA 1HX8A 4MHCA 4DMVA 5L3DB 2DWGA 2Q9QA 5JDLA 3PDYA 1X79A 4QKNA 3CPZA 3U3IA 2XQYA 4C91A 2ZLYA 3UUXB 2W61A 4WBNE 2N2NA 3KV4A 4JEHB 3AA7B 5FY7A 4CZZB 3LBXA 2H7OA 3WAJA 5L3EB 3TKLB 5CA1E 4DBQA 4AKHA 4KP3C 1IZNB 4UVAB 3KV9A 4YHJA 1QSDA 4ANJA 5AFUL 3N9OA 2V7MA 4BA9A 3ZMUB 3H37A 2RA1A 2VKJA 3E08A 4ASKA 3ZMVB 2Q9QD 3FXEB 1NAFA 3RC8A 2SPCA 3ANWB 5JDFA 2VASA 2CLYB 3ZCJA 2VB6A 3AAIA 1MMDA 4EOZB 3RH3A 4DMWA 1BR2A 2L8KA 2RP4A 3CKDA 3MJXA 2XAGB 3FB2A 2KXPB 4H63V 1UX4A 2HPJA 2V26A 3HKDE 4OK0A 2HH7A 5IYZE 4MFRA 3KV6A 4EB6E 3F2EA 3QC9A 3R6NA 3PUAA 1ZHCA 4PJLA 2MTQA 1Y64B 4AKIA 4O4LE 3SS1A 5JDMA 2KINB 2KWIB 2E9XA 2PBIA 2LJLA 3PUSA 2G0UA 3VHLA 4GK5E 2GK9A 5HXSA 4QX7B 4UELA 2A3DA 2QGSA 4ZHQE 2DLRA 4PW8A 4AKRB 3C50A 3HL6A 1HTJF 1SA0E 2NTXA 4FJOA 4QXHB 4ZS2A 4ZI3D 3F31A 3EVYA 4N78D 2K24A 3AB3B 3M65A 1OWAA 2BVLA 2CXLA 4V1Av 3MKDA 4O2AE 3RRWA 2CXFA 2LE8A 1MNEA 4NUVA 4UVCB 1AJ3A 3N2OA 1B7TA 3UTKA 2E9XD 3J9X1 5HXCA 5DQVA 4EAHA 1S94A 4YJ3E 5KX5E 2BVMA 3JC6D 3ZN1B 2JMKA 1BR1A 5TAOA 5CA0E 2LSYA 4X1KE 3ETUA 5EK4A 3CQCB 2Q9QC 2W63A 2ACXA 1YD8G 3ZMSB 4C90A 3KINB 1HG2A 4OYJA 3UUMA 3E22E 5A1LA 2LHRA 4ZI2D 2LOPA 3KBUA 3Q2MA 2CXDA 2EHOA 1WYCA 1LRZA 2A2FX 1G73A 3PUQA 2IAKA 4HKAA 4I4TE 4BJMA 1S35A 3N5LA 3ANWA 3WI3A 3NZPA 3VU7H 2KWHA 3P7IA 4IHJE 2XUEA 2LHNA 3PE0A 4UV8B 5LCYA 4AQFA 4EXTA 4UF0B 5GONE 4B6XA 4ISSA 5FY1A 1LKXA 4A56A 1US7B 2LM9A 2MOZA 4YJ2E 2V7JA 3I9YA 5CB4E 1MNDA 3WAKA 2D2SA 5F3JA 3SRZA 3NRYA 4GYSA 4JLEA 3OJAA 5HXRA 4IE7A 3ESLA 4H9QC 3LK42 1MIWA 5L3BB 1O3XA 4ZI3C 1FIOA 5ETWA 3N9MA 1IJ5A 4ILUA 2K9AA 2X9HA 2CM0A 4ERRA 3MZKB 5HYAA 4Z8XA 3RYFE 4U72A 4CI2B 3FBLA 2E9XC 5LGTB 3CMLA 2KMFA 4HEAA 3MK7C 3JC6C 3FHNA 1YKEB 3CX7B 3HA4A 4IDZA 2NW9A 2L3LA 2C5JA 4PFOA 2Y48B 4XZCA 4IE5A 4BAYB 1MMNA 3CX8B 5FXXA 4EIWA 2MYSA 4NUUA 5H6QB 3O1IA 4CI1B 3PU8A 1IAPA 3I0QA 3ZPOA 4ZI2C 2MBGA 2VKDA 3O9XA 2XTLA 2I59A 5LHIB 4L9IA 2EHOB 2X68A 5KMGP 4MALA 4KMCA 4QX8B 2WWUA 1HCIA 4I55E 3KDSE 4DVDA 5JH7E 2BDEA 4QWNB 1WLXA 4HGAA 5E0OA 4QHOA 3EDUA 3KVBA 5LJNA 1OXZA 4PFPA 2JMHA 4UIGA 4CXXA 3ZJ1A 4I43B 4CQIA 4O2BE 3N2GE 4UF0A 1FMWA 3C4ZA 4P09A 2VL8A 3OBVE 4MBQA 3W15B 2XHEB 5LHHB 4TV8E 5EZYE 2E8IA 5LHGB 1MIYA 2DCFA 2OA5A 2CE7A 2HPLA 2CLYC 3I9WA 4MLKA 5L3CB 2C5KT 4AQFC 1HG5A 2ZM2A 3DP7A 1MMGA 3NBXX 2X67A 4H9OC 2X66A 4O4HE 3MA9A 3UT5E 3ZYLA 2W62A 4HE8A 5FMNA 4G2AA 4ISTA 4HTEA 4AKLA 2H7VC 2UXNB 3VKGA 2C5IT 1UX5A 3KFWX 5JQGE 2CWYA 4CI3B 2NW7A 5JDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  1NWM X;  1NAF A;  1WR6 A;  1O3X A;  1X79 A;  1OXZ A;  1YD8 G;  2N9D A;  1WRD A; 
#chains in the Genus database with same CATH topology
 3LJC A;  1T98 A;  3CX6 B;  3JAF A;  4NXM T;  2XAH B;  5HAX A;  3UU5 A;  2XAS B;  3AE4 A;  2LSJ A;  4ZXL A;  2XY8 B;  1Y01 A;  4WW0 A;  4U33 A;  5JR9 B;  1IJ6 A;  5LP6 E;  1HNX T;  3AE8 A;  2N1G A;  3PUZ F;  2QYW A;  2B1E A;  2XPK A;  2XAF B;  4PK5 A;  3N2K E;  2VUR A;  2ODU A;  2YEV C;  3LK2 B;  1W09 A;  4YFS A;  2PJQ A;  5FP3 A;  2ZMA A;  3BQK A;  3CWZ B;  2DI4 A;  2WDR A;  4EYU A;  3A7M A;  4CN4 A;  4PJJ A;  4HFV A;  4BJN A;  3Q5W A;  1VRB A;  3EDV A;  4DV3 T;  4TZ4 C;  5ABH A;  2WBL A;  1LVF A;  1FJG T;  1ZV4 X;  2KZ7 B;  4IDO A;  5AQR B;  4U2Y A;  3ZMZ B;  4XBF B;  4PJN A;  5HEO A;  1KNZ A;  5LYJ E;  5FL0 A;  4WNK A;  5ABE A;  3DJB A;  3V5S A;  2IC6 A;  1HFA A;  1HX1 B;  4H9N C;  4ZEY A;  1CUN A;  4OFZ A;  4WZX A;  1WCR A;  3CK6 A;  4TV9 E;  1WRD A;  3ZN0 B;  2JIW A;  5JRC B;  3K3Q C;  3KVA A;  5J2T E;  3ONL C;  3BK9 A;  2XAJ B;  2LSG A;  3UUL A;  3V5U A;  5LBM A;  3B13 A;  2WAU A;  3DTO A;  4QXB B;  1MIV A;  3GN5 B;  5J1G A;  4YLH A;  1M62 A;  5JDN A;  3C4X A;  4HWI B;  1D0Y A;  4YT0 A;  3T8O A;  4IE0 A;  4X1Y E;  5JVD E;  3LFM A;  4ZOL E;  4KUM B;  4AQG A;  4ILA A;  2VKH A;  5H6R B;  3C4W A;  2V5D A;  4TWF A;  4JEU B;  5J2U E;  5LGN B;  4IDP A;  2WDV A;  4CXY A;  2LEH A;  3B57 A;  4U3C A;  4ADZ A;  4IIJ E;  3ZJ2 A;  3C51 A;  1Z0P A;  2DNX A;  5L3G B;  5FXZ A;  3VKH A;  3EI0 A;  4A98 A;  2PTF A;  3MAC A;  4HWD A;  5L4E A;  2XQ4 A;  2WQY A;  5LJM A;  2C0S A;  4TN7 B;  4PK4 A;  3AEF A;  3OYZ A;  2N9D A;  1VCS A;  4DND A;  2YK0 A;  1D1B A;  3PV0 F;  4JI6 T;  4U2Z A;  2VQE T;  2WDQ A;  2IML A;  1UCU A;  1HX8 A;  5C3J A;  1R8I A;  3PDY A;  4U7Y A;  4C91 A;  2N2N A;  4JEH B;  3AA7 B;  4CZZ B;  2H7O A;  3WAJ A;  3TKL B;  4DBQ A;  4WYV A;  3KV9 A;  3H37 A;  3E08 A;  4YY3 T;  3RGL A;  4B3R T;  3PUW F;  3FXE B;  5AQN B;  4Z90 A;  3RC8 A;  4HWH A;  2VAS A;  2VB6 A;  3CKD A;  4H63 V;  2E5V A;  2HPJ A;  2V26 A;  3HKD E;  3KV6 A;  3R6N A;  1ZHC A;  4AKI A;  3SS1 A;  2KIN B;  2E9X A;  2LJL A;  3PUS A;  4TWH A;  3VHL A;  2GK9 A;  4QX7 B;  2A3D A;  4AKR B;  5LMN T;  1HTJ F;  4QXH B;  4Q25 A;  3EVY A;  2K24 A;  2MPK A;  2CXL A;  2BVL A;  1ZOY A;  2I0M A;  2WB5 A;  4UVC B;  1XWM A;  1AJ3 A;  2BG9 B;  2E9X D;  1N33 T;  4TNV A;  2JMK A;  4EV6 A;  5FL1 A;  3ETU A;  3CQC B;  1W0A A;  2W63 A;  2QVA A;  3ZMS B;  1YD8 G;  4JV5 T;  1OED B;  4OYJ A;  2LHR A;  2LOP A;  4JI4 T;  3Q2M A;  2IAK A;  3ANW A;  3WI3 A;  3P7I A;  4IHJ E;  2LHN A;  5AQL B;  4DR1 T;  4UV8 B;  5LCY A;  4EXT A;  4CN6 A;  4YSX A;  4TWD A;  2V7J A;  1J5E T;  3NRY A;  2UU9 T;  1XZY A;  2BS2 A;  3N9M A;  1IJ5 A;  2E9X C;  3CIR A;  4IDQ A;  3AEC A;  3MK7 C;  5FVK A;  3FHN A;  2L3L A;  4PFO A;  4XZC A;  4IE5 A;  3CX8 B;  5FXX A;  1UGO A;  4NUU A;  5H6Q B;  2VKD A;  4X5T A;  5AQI B;  2XQ6 A;  4MAL A;  4QX8 B;  2YN6 A;  5JH7 E;  1WLX A;  4HGA A;  2IUB A;  3KVB A;  3UFG A;  3ZJ1 A;  1GQE A;  4I43 B;  3X1D A;  1FMW A;  2XHE B;  3RLF F;  3AXJ A;  2E8I A;  1MIY A;  4MLK A;  4LF7 T;  2X67 A;  2X66 A;  3QB5 A;  3MA9 A;  4G2A A;  2UXN B;  5JQG E;  2CWY A;  2NW7 A;  1J1J A;  2JPF A;  3C98 B;  5HEH A;  3BQL A;  5L2L A;  4ZZC A;  3RI5 A;  4ZZB A;  2V6Y A;  2ACZ A;  4IGU A;  4XAX B;  5AQM B;  5FXV A;  2BG9 E;  5JDG A;  5AQF B;  4O4J E;  2ES0 A;  2CCQ A;  3FXD B;  2K48 A;  4IDN A;  4GK0 E;  4O4I E;  5C8Y E;  3PUX F;  2WCA A;  4GKJ T;  3RYH E;  3HI2 A;  2VK9 A;  3UQ4 A;  4PAG A;  4H63 H;  3AA0 B;  4UVB B;  2ZM8 A;  3ZEF B;  3BQI A;  2W67 A;  2ODV A;  2YDR A;  3RYC E;  2B76 A;  4JUY A;  5FY0 A;  2J47 A;  2UXX B;  2XQ5 A;  4U7I A;  1T7S A;  3RQU A;  4G63 A;  3O1J A;  2W2U A;  3HKC E;  3LK3 B;  3AA1 B;  3OKQ A;  1ZEE A;  3RIA A;  1HNW T;  3GWH A;  2X9Y A;  3D0T A;  4H9S E;  1FEW A;  5JR9 A;  4P0B A;  5FYM A;  2DWK A;  3S4U A;  4UV9 B;  2VQF T;  4F6R C;  3UQ7 A;  1QLB A;  5IHY A;  1D0Z A;  4JI8 T;  4YTN A;  3FZK B;  1ZKE A;  4JI7 T;  2M6I A;  1EZ3 A;  4EZH A;  4LMJ A;  2W66 A;  2CHO A;  3Q9D A;  4OYK A;  4U74 A;  3N9N A;  1YKH B;  3JAD A;  3QK6 A;  3K3O A;  2CRB A;  1E1H B;  2D5U A;  2Q9Q B;  4E7Z A;  3RPU A;  3K3N A;  1D1A A;  3LBX B;  4H9R C;  3CQG B;  3PTR B;  3QOF A;  4HWF A;  5DQW A;  3ONJ A;  2CWO A;  5HWX A;  5LG4 A;  4EYY R;  5L47 A;  4LF5 T;  2VVN A;  2UXC T;  3EAB A;  2H3R A;  2M6B A;  3IHR A;  4I50 E;  5JR9 C;  5JRC A;  2CBJ A;  4X20 E;  4P0A A;  3N9Q A;  1BR0 A;  1JNZ A;  3RIU A;  4AI6 A;  3N9P A;  1HF8 A;  2D0U A;  5LOV E;  1D1C A;  3GN5 A;  3H3M A;  1WR0 A;  3A5X A;  2CEA A;  2WMN A;  3AVR A;  5BMV E;  2X0H A;  3ZCI A;  4MHC A;  5HEU A;  3AEE A;  4QKN A;  2LLY A;  3UUX B;  5AQQ B;  5L3E B;  1I6Z A;  4KP3 C;  1IZN B;  4YHJ A;  1QSD A;  4ANJ A;  4QH5 A;  3ZMV B;  2CLY B;  1Z8U A;  2A9U A;  1BR2 A;  2L8K A;  4DV7 T;  1UX4 A;  4YSZ A;  4EB6 E;  4DR3 T;  3P4P A;  2MTQ A;  4IT4 A;  4O4L E;  2KWI B;  5AQS B;  2WWV A;  2WU2 A;  2G0U A;  4GK5 E;  2YKS A;  4UEL A;  4HWC A;  2QGS A;  2NR4 A;  3OTO T;  2DLR A;  3RIU C;  4PW8 A;  3C50 A;  1XNR T;  1SA0 E;  2NTX A;  4ZI3 D;  3F31 A;  4N78 D;  2XQA A;  1J5W A;  3AB3 B;  4DV1 T;  4V1A v;  3RRW A;  2D9D A;  3RHW A;  2LE8 A;  1MNE A;  2R6G F;  3AEG A;  3UTK A;  4LF8 T;  5HXC A;  2BVM A;  5CA0 E;  3P4W A;  2ACX A;  2XSB A;  3KBU A;  2EHO A;  1E2A A;  1LRZ A;  3AEB A;  4I4T E;  4BJM A;  3N5L A;  2RPA A;  2XUE A;  3PE0 A;  1WFD A;  4UF0 B;  4B6X A;  4KHP T;  4ISS A;  5FY1 A;  2LM9 A;  2MOZ A;  4COF A;  5CB4 E;  2X0Y A;  3AE2 A;  3SRZ A;  4DUY T;  5FKY A;  4JLE A;  4IE7 A;  3K1S A;  4ZI3 C;  2J62 A;  2HN2 A;  4ILU A;  2V5C A;  4ERR A;  3MZK B;  4X66 T;  4B3T T;  4Z8X A;  3JAE A;  3RYF E;  3P4Q A;  5LGT B;  2K3W A;  4B3M T;  1YKE B;  4LMK A;  2C5J A;  4K0K T;  2FJD A;  1YQ4 A;  2BG9 A;  3NKZ A;  3O1I A;  2IDO B;  2OLT A;  4NIQ A;  3RQW A;  3B5M A;  2I59 A;  5LHI B;  1OED A;  2EHO B;  3RKG A;  4KMC A;  5HCJ A;  4DVD A;  2BDE A;  1OXZ A;  4PFP A;  2JMH A;  4UIG A;  2XQ3 A;  2IHR 1;  2XM1 A;  3LDQ B;  3OBV E;  2CPT A;  4DR4 T;  5EZY E;  5LHG B;  2DCF A;  3I9W A;  4TNW A;  2UXB T;  2YDS A;  5L3C B;  1MMG A;  3P4S A;  4H9O C;  4X62 T;  3ZYL A;  2BKO A;  1I94 T;  4IST A;  4HTE A;  3AEA A;  3PUY F;  1UX5 A;  1DU2 A;  4CI3 B;  3P4R A;  3GMI A;  2W0G A;  4HFC A;  3L09 A;  2V7K A;  5LG3 A;  2KND A;  4PNI A;  3I1A A;  1QUU A;  2LT3 A;  4L5G A;  3UU3 A;  3AED A;  2XQ9 A;  3ZC1 A;  3EUH A;  2WSS V;  2QRX A;  2BG9 C;  3AVS A;  2AE9 A;  4OX9 T;  2YDQ A;  5LBQ B;  2CBI A;  3UUB A;  3OYX A;  4QH1 A;  5AQG B;  1OED C;  3AE3 A;  1W9R A;  5HXH A;  2NTY A;  4HFB A;  2LSK A;  4GOU A;  3Q5X A;  4YTP A;  2VWA A;  1IBL T;  1N32 T;  3SWH A;  1YXR A;  2AXD S;  5HEJ A;  3NZQ A;  5HWY A;  5CFB A;  3K8P C;  2JQH A;  3PJA J;  3RYI E;  5DJQ C;  1SHZ C;  2J4G A;  3NVO A;  3AE5 A;  4JBW F;  3R84 B;  5HEG A;  4KX6 A;  3CVR A;  5JDQ A;  4TX5 A;  2FJE A;  3FZH B;  1CHU A;  2UXD T;  1LVK A;  2LSI A;  2Y8D A;  2PG8 A;  2H89 A;  1HNZ T;  3NWI A;  2BZB A;  2QA7 A;  3UFE A;  4X1I E;  1KEY A;  4AXP A;  1WYB A;  4E7S A;  4ZI7 E;  2LOS A;  2LRK A;  4FI5 A;  2A72 A;  4LFB T;  4ILC A;  5LGU B;  4DV4 T;  3E0Z A;  2V7L A;  5HXE A;  4Z91 A;  2YIN A;  2BBJ A;  2YU2 A;  4U31 A;  2CMR A;  4QXC B;  3IEE A;  4JI1 T;  2X9W A;  3PU3 A;  3MXZ A;  3UU8 A;  3IBP A;  5LA6 E;  4IE4 A;  2UUB T;  3J7Y q;  1KF6 A;  4HN9 A;  1U4Q A;  4YTM A;  2X51 A;  1YW0 A;  4LFC T;  2WMO A;  3ETV A;  1MMA A;  4WBO A;  2Z6E A;  1L0V A;  2V8S V;  2X0L B;  1U5P A;  4F8H A;  3O1H A;  1W0B A;  3SOL A;  2XQ7 A;  3RRC A;  3LG7 A;  1OED E;  3U78 A;  2ZM0 A;  3AE1 A;  2NOX A;  3AAA B;  4CN1 A;  2P9B A;  5C2T A;  5JRE A;  4DR5 T;  3PUR A;  4X64 T;  5ADX L;  2DHR A;  3FBZ A;  3F57 A;  3KV5 A;  5AQH B;  1BR4 A;  4NXN T;  5ABF B;  5FVL A;  4P1N A;  3ZMT B;  3VR8 A;  4M1P A;  4PK6 A;  1N34 T;  4UXN B;  2Y6X A;  4AKG A;  5EK3 A;  1NEN A;  5FNV E;  3HKE E;  2J1D G;  3RKO A;  2UUC T;  3AAE B;  4HFE A;  5L3D B;  2Q9Q A;  3CPZ A;  3U3I A;  2XQY A;  2ZLY A;  2W61 A;  4WBN E;  3KV4 A;  3LBX A;  4X65 T;  5AFU L;  2V7M A;  4BA9 A;  3TLW A;  2RA1 A;  2BBH A;  2Q9Q D;  1NAF A;  2WP9 A;  2SPC A;  3QNU A;  4GKK T;  3ZCJ A;  3AAI A;  3RH3 A;  2RP4 A;  3MJX A;  3FB2 A;  4DUZ T;  5IYZ E;  3QC9 A;  3PUA A;  4KHZ F;  4PJL A;  3LSV A;  2PBI A;  5HXS A;  5AQK B;  3HL6 A;  3VRB A;  4FJO A;  4O2A E;  4NUV A;  3J9X 1;  5DQV A;  1S94 A;  4YJ3 E;  3Q5E A;  3JC6 D;  3VRA A;  1BR1 A;  3FZL B;  5EK4 A;  2Q9Q C;  4NPP A;  5ABG A;  1HG2 A;  1UK5 A;  3E22 E;  4ZI2 D;  1NEK A;  5CGM A;  1WYC A;  1G73 A;  3PUQ A;  1S35 A;  4AIU A;  2LRL A;  3T1Y T;  5HCM A;  1M7K A;  3ABV A;  1US7 B;  3I9Y A;  1MND A;  3WAK A;  2WZI A;  3QB5 K;  3AE6 A;  4GYS A;  3ESL A;  5L3B B;  1MIW A;  1FIO A;  1T72 A;  4LF9 T;  2X9H A;  3ZT5 A;  5HYA A;  5BR8 T;  4CI2 B;  3FBL A;  3CML A;  4DV5 T;  3JC6 C;  3CX7 B;  3TLT A;  2Y48 B;  4BAY B;  2XM2 A;  4EIW A;  4JYA T;  2VL0 A;  4CI1 B;  3PU8 A;  3I0Q A;  4ZI2 C;  2MBG A;  4DR2 T;  2WS3 A;  2WWU A;  1HCI A;  5E0O A;  4QWN B;  4QHO A;  3SFE A;  3EDU A;  5LJN A;  4CXX A;  4O2B E;  3N2G E;  4UF0 A;  3M3Z B;  4MBQ A;  4TV8 E;  5AQP B;  2HPL A;  2CLY C;  5J0Z A;  2C5K T;  1HG5 A;  2ZM2 A;  3DP7 A;  4O4H E;  3UT5 E;  5IUX A;  2W62 A;  4HE8 A;  4DID B;  1KNP A;  5FMN A;  4JI5 T;  5LB7 B;  2H7V C;  5JDH A;  4PJM A;  2BKN A;  2YU1 A;  2DL1 A;  1NWM X;  2FJB A;  3UU6 A;  3TLV A;  2XSA A;  4H9P C;  4QH4 A;  3RF1 A;  2YOE A;  4DV6 T;  2BS4 A;  4HFD A;  5EK2 A;  4IE6 A;  3C64 A;  5L4H A;  2XAQ B;  3UU4 A;  1G8X A;  1T8B A;  3TLS A;  2PFV A;  2BS3 A;  3AE7 A;  3KBT A;  1H7C A;  2ZM6 T;  3ZYM A;  2EHO D;  3NRX A;  4L0R A;  3HR0 A;  1XDP A;  3UUN A;  1WR6 A;  2V1D B;  3IF8 B;  2WY2 A;  2WU5 A;  2K5B B;  3ONX A;  3ZYK A;  3PUV F;  4LF4 T;  5L3F B;  5LNK A;  4DV0 T;  1JNR A;  1KK7 A;  4IRE A;  2W00 A;  3RX6 A;  1V9D A;  4GIW A;  4OHF A;  3HKB E;  2IW5 B;  2HN1 A;  4GYR A;  5M4Y A;  2UUA T;  3RC3 A;  3PUG A;  3ZT7 A;  3JCF A;  5LXT E;  2BKP A;  3P8C D;  2EHO C;  4JI2 T;  4DBR A;  5AQU B;  1HS7 A;  2WM9 A;  2V7I A;  4J2C A;  4LFA T;  3VR9 A;  2M67 A;  3AA6 B;  4CXW A;  2VKO A;  2KLQ A;  2KT9 A;  3TLU A;  2XQ8 A;  2X9X A;  4DR7 T;  3H3A A;  5DAB A;  5KDM C;  4A97 A;  2NP9 A;  3I0O A;  4K0U A;  4KI0 F;  2LKH A;  1XNQ T;  1VOM A;  2D0T A;  4KBM B;  3A8Y C;  3RIF A;  2F4V T;  2CA5 A;  2W4X A;  1E7P A;  2NWB A;  3IA3 A;  5F8P A;  3N9L A;  1IBM T;  3OVU A;  3GA8 A;  5KXJ A;  2LM2 A;  2JQQ A;  3ZSS A;  3QUJ A;  4TUY E;  4HFH A;  3ZLI A;  4YXD A;  2E5L T;  1XDO A;  4O8S A;  4UEM A;  2IIU A;  3L3P A;  2L9Q A;  2I6H A;  4ZS3 A;  4I0U A;  1IBK T;  2JRK A;  1D0X A;  5AQJ B;  4EZ4 A;  5JTG A;  4LF6 T;  1UUR A;  3ZC0 A;  2JJ9 A;  3CQX C;  3O4X E;  4DO0 A;  4YHH T;  5FXW A;  2E9X B;  1KFY A;  1FMV A;  2NW8 A;  2IC9 A;  4IL4 A;  4JI3 T;  4DMV A;  2XJ7 A;  2DWG A;  5JDL A;  1X79 A;  4AIS A;  4EGW A;  5FY7 A;  2LKG A;  2JQ9 A;  5CA1 E;  4AKH A;  1SUM B;  4UVA B;  5CJ5 A;  3N9O A;  3ZMU B;  2VKJ A;  3EAM A;  4ASK A;  5F5W A;  3PJA A;  1N36 T;  2OV9 A;  4AQY T;  2FUP A;  3ANW B;  3ZST A;  5AQV B;  5JDF A;  4EOZ B;  1MMD A;  4DMW A;  2XAG B;  2KXP B;  3L39 A;  4OK0 A;  2HH7 A;  4MFR A;  3F2E A;  1Y64 B;  5JDM A;  5ABF A;  2FJA A;  2WZH A;  1X9B A;  2V6X A;  3FZM B;  4ZHQ E;  4ZS2 A;  3M65 A;  1OWA A;  3MKD A;  2CXF A;  3FZF B;  3N2O A;  1B7T A;  4EED A;  3AE9 A;  2HHH T;  4UR9 A;  4EAH A;  5KX5 E;  3OPC A;  3ZT6 A;  3ZN1 B;  5TAO A;  2LSY A;  4X1K E;  2JQK A;  4C90 A;  3KIN B;  3UUM A;  5A1L A;  2CXD A;  2A2F X;  2H88 A;  4HKA A;  3NZP A;  3VU7 H;  2KWH A;  2FBW A;  5AQO B;  4HFI A;  4AQF A;  5GON E;  4IL9 A;  2E2A A;  1LKX A;  1UUS A;  4A56 A;  3L8R A;  4YJ2 E;  3AXJ B;  1HR0 T;  2D2S A;  5F3J A;  4LML A;  5HXR A;  3OJA A;  4H9Q C;  3LK4 2;  1O3X A;  4A5X A;  5ETW A;  4ILB A;  2K9A A;  2XZE A;  2CM0 A;  4U72 A;  2KMF A;  4HEA A;  4IDZ A;  3HA4 A;  1XMO T;  1ZP0 A;  2NW9 A;  2CHN A;  1MMN A;  3EHZ A;  2MYS A;  1IAP A;  3ZPO A;  2VVS A;  3P50 A;  2MAW A;  2KSR A;  5LMU T;  2V6Y B;  5IWA T;  3O9X A;  4B3S T;  2XTL A;  4L9I A;  2X68 A;  5KMG P;  4I55 E;  1KNR A;  3KDS E;  1XMQ T;  4YSY A;  4CQI A;  1SE7 A;  3SFD A;  3C4Z A;  4P09 A;  4EEB A;  2VL8 A;  5LHH B;  3W15 B;  2OA5 A;  2CE7 A;  4JI0 T;  4AQF C;  3NBX X;  3Q5D A;  4DV2 T;  1VCT A;  3G06 A;  4AKL A;  1YQ3 A;  3ZKR A;  3VKG A;  4DR6 T;  2C5I T;  5AQT B;  3KFW X;  3T1H T; 
#chains in the Genus database with same CATH homology
 3LJC A;  1T98 A;  2JPF A;  4PJM A;  3CX6 B;  3GMI A;  2W0G A;  3L09 A;  2YU1 A;  2V7K A;  1NWM X;  3C98 B;  2KND A;  3BQL A;  5L2L A;  2XAH B;  5HAX A;  4PNI A;  3I1A A;  2XAS B;  1QUU A;  2LSJ A;  2LT3 A;  4H9P C;  4L5G A;  3ZC1 A;  3EUH A;  4IGU A;  4XAX B;  2WSS V;  5FXV A;  3AVS A;  5JDG A;  4O4J E;  5EK2 A;  4WW0 A;  2ES0 A;  2CCQ A;  3FXD B;  4IE6 A;  2K48 A;  5JR9 B;  1IJ6 A;  5LBQ B;  4GK0 E;  5LP6 E;  3C64 A;  4O4I E;  5C8Y E;  2N1G A;  2XAQ B;  2B1E A;  1G8X A;  3OYX A;  2XAF B;  4PK5 A;  2PFV A;  3N2K E;  3KBT A;  1H7C A;  5HXH A;  3RYH E;  2ODU A;  3HI2 A;  2YEV C;  2VK9 A;  2NTY A;  3LK2 B;  4YFS A;  2LSK A;  2PJQ A;  4GOU A;  3ZYM A;  4PAG A;  3Q5X A;  4H63 H;  5FP3 A;  2ZMA A;  2EHO D;  3BQK A;  2VWA A;  3CWZ B;  3AA0 B;  3NRX A;  2DI4 A;  4L0R A;  4UVB B;  3HR0 A;  3UUN A;  2ZM8 A;  3ZEF B;  4EYU A;  3BQI A;  1WR6 A;  3SWH A;  2V1D B;  2ODV A;  3IF8 B;  3NZQ A;  4PJJ A;  5HWY A;  3K8P C;  4HFV A;  4BJN A;  3Q5W A;  1VRB A;  3EDV A;  3RYI E;  5DJQ C;  2K5B B;  3RYC E;  4TZ4 C;  3ONX A;  2WBL A;  4JUY A;  3ZYK A;  5FY0 A;  1LVF A;  1SHZ C;  5L3F B;  3R84 B;  5LNK A;  2UXX B;  3CVR A;  1KK7 A;  5JDQ A;  4G63 A;  4TX5 A;  3O1J A;  2W00 A;  3RX6 A;  1V9D A;  1ZV4 X;  2KZ7 B;  3HKC E;  1LVK A;  2LSI A;  3LK3 B;  3AA1 B;  3ZMZ B;  3OKQ A;  1ZEE A;  4GIW A;  2Y8D A;  4OHF A;  4XBF B;  2PG8 A;  3HKB E;  2IW5 B;  4PJN A;  3GWH A;  4GYR A;  1KNZ A;  2BZB A;  5LYJ E;  2X9Y A;  5M4Y A;  2QA7 A;  3UFE A;  4X1I E;  3RC3 A;  3D0T A;  3PUG A;  4H9S E;  1FEW A;  5JR9 A;  4WNK A;  4AXP A;  3DJB A;  1WYB A;  3V5S A;  2IC6 A;  4P0B A;  1HFA A;  5LXT E;  4H9N C;  5FYM A;  4E7S A;  4ZI7 E;  1CUN A;  2DWK A;  2LOS A;  4OFZ A;  3P8C D;  4FI5 A;  2A72 A;  3S4U A;  4TV9 E;  2EHO C;  1WRD A;  5LGU B;  3ZN0 B;  4UV9 B;  4DBR A;  4F6R C;  3E0Z A;  5JRC B;  1HS7 A;  2V7L A;  5HXE A;  3K3Q C;  2WM9 A;  3KVA A;  5IHY A;  2V7I A;  1D0Z A;  2YIN A;  2YU2 A;  4J2C A;  5J2T E;  2CMR A;  2M67 A;  3AA6 B;  3BK9 A;  4CXW A;  2XAJ B;  2LSG A;  3UUL A;  2VKO A;  4QXC B;  3V5U A;  1ZKE A;  2KLQ A;  3IEE A;  2KT9 A;  1EZ3 A;  2X9W A;  3PU3 A;  2X9X A;  4EZH A;  5LBM A;  3MXZ A;  3B13 A;  3IBP A;  2WAU A;  3DTO A;  4QXB B;  3H3A A;  1MIV A;  3Q9D A;  5DAB A;  5LA6 E;  4OYK A;  3GN5 B;  4IE4 A;  5J1G A;  3J7Y q;  5KDM C;  4YLH A;  4HN9 A;  5JDN A;  3C4X A;  4U74 A;  2NP9 A;  3I0O A;  3N9N A;  1U4Q A;  1YKH B;  4K0U A;  1D0Y A;  3T8O A;  2X51 A;  3QK6 A;  4IE0 A;  3K3O A;  4X1Y E;  1YW0 A;  5JVD E;  3LFM A;  1E1H B;  1VOM A;  2D5U A;  4KUM B;  2Q9Q B;  4ZOL E;  2WMO A;  4AQG A;  3ETV A;  4E7Z A;  2VKH A;  2D0T A;  1MMA A;  4KBM B;  4WBO A;  2Z6E A;  5H6R B;  3RPU A;  3C4W A;  1D1A A;  3K3N A;  2CA5 A;  3LBX B;  4JEU B;  2NWB A;  3CQG B;  3PTR B;  2X0L B;  4H9R C;  5F8P A;  1U5P A;  3N9L A;  3GA8 A;  3O1H A;  3SOL A;  5J2U E;  5DQW A;  5LGN B;  2CWO A;  5HWX A;  5LG4 A;  2JQQ A;  3RRC A;  3LG7 A;  3QUJ A;  4CXY A;  4EYY R;  4TUY E;  3U78 A;  2LEH A;  3ZLI A;  3B57 A;  4ADZ A;  4IIJ E;  3ZJ2 A;  3C51 A;  2ZM0 A;  2NOX A;  2H3R A;  4O8S A;  3AAA B;  4UEM A;  1Z0P A;  2DNX A;  3IHR A;  4I50 E;  2P9B A;  5FXZ A;  5JR9 C;  5L3G B;  5JRC A;  3VKH A;  3L3P A;  5JRE A;  2L9Q A;  3MAC A;  4X20 E;  4ZS3 A;  3PUR A;  5ADX L;  4P0A A;  2JRK A;  1D0X A;  4EZ4 A;  2DHR A;  3FBZ A;  3N9Q A;  5LJM A;  3ZC0 A;  2JJ9 A;  2C0S A;  1BR0 A;  3F57 A;  3KV5 A;  3CQX C;  3O4X E;  4TN7 B;  4AI6 A;  4DO0 A;  1BR4 A;  5FXW A;  4PK4 A;  2E9X B;  1FMV A;  3N9P A;  1HF8 A;  2D0U A;  5LOV E;  3ZMT B;  1D1C A;  2NW8 A;  3GN5 A;  4M1P A;  4PK6 A;  3OYZ A;  2N9D A;  4UXN B;  2IC9 A;  2Y6X A;  4AKG A;  5EK3 A;  5FNV E;  4DND A;  3HKE E;  2YK0 A;  1D1B A;  3A5X A;  2CEA A;  2J1D G;  3RKO A;  2WMN A;  3AVR A;  5BMV E;  1UCU A;  3AAE B;  3ZCI A;  1HX8 A;  4MHC A;  4DMV A;  5L3D B;  2DWG A;  2Q9Q A;  5JDL A;  3PDY A;  1X79 A;  4QKN A;  3CPZ A;  3U3I A;  2XQY A;  4C91 A;  2ZLY A;  3UUX B;  2W61 A;  4WBN E;  2N2N A;  3KV4 A;  4JEH B;  3AA7 B;  5FY7 A;  4CZZ B;  3LBX A;  2H7O A;  3WAJ A;  5L3E B;  3TKL B;  5CA1 E;  4DBQ A;  4AKH A;  4KP3 C;  1IZN B;  4UVA B;  3KV9 A;  4YHJ A;  1QSD A;  4ANJ A;  5AFU L;  3N9O A;  2V7M A;  4BA9 A;  3ZMU B;  3H37 A;  2RA1 A;  2VKJ A;  3E08 A;  4ASK A;  3ZMV B;  2Q9Q D;  3FXE B;  1NAF A;  3RC8 A;  2SPC A;  3ANW B;  5JDF A;  2VAS A;  2CLY B;  3ZCJ A;  2VB6 A;  3AAI A;  1MMD A;  4EOZ B;  3RH3 A;  4DMW A;  1BR2 A;  2L8K A;  2RP4 A;  3CKD A;  3MJX A;  2XAG B;  3FB2 A;  2KXP B;  4H63 V;  1UX4 A;  2HPJ A;  2V26 A;  3HKD E;  4OK0 A;  2HH7 A;  5IYZ E;  4MFR A;  3KV6 A;  4EB6 E;  3F2E A;  3QC9 A;  3R6N A;  3PUA A;  1ZHC A;  4PJL A;  2MTQ A;  1Y64 B;  4AKI A;  4O4L E;  3SS1 A;  5JDM A;  2KIN B;  2KWI B;  2E9X A;  2PBI A;  2LJL A;  3PUS A;  2G0U A;  3VHL A;  4GK5 E;  2GK9 A;  5HXS A;  4QX7 B;  4UEL A;  2A3D A;  2QGS A;  4ZHQ E;  2DLR A;  4PW8 A;  4AKR B;  3C50 A;  3HL6 A;  1HTJ F;  1SA0 E;  2NTX A;  4FJO A;  4QXH B;  4ZS2 A;  4ZI3 D;  3F31 A;  3EVY A;  4N78 D;  2K24 A;  3AB3 B;  3M65 A;  1OWA A;  2BVL A;  2CXL A;  4V1A v;  3MKD A;  4O2A E;  3RRW A;  2CXF A;  2LE8 A;  1MNE A;  4NUV A;  4UVC B;  1AJ3 A;  3N2O A;  1B7T A;  3UTK A;  2E9X D;  3J9X 1;  5HXC A;  5DQV A;  4EAH A;  1S94 A;  4YJ3 E;  5KX5 E;  2BVM A;  3JC6 D;  3ZN1 B;  2JMK A;  1BR1 A;  5TAO A;  5CA0 E;  2LSY A;  4X1K E;  3ETU A;  5EK4 A;  3CQC B;  2Q9Q C;  2W63 A;  2ACX A;  1YD8 G;  3ZMS B;  4C90 A;  3KIN B;  1HG2 A;  4OYJ A;  3UUM A;  3E22 E;  5A1L A;  2LHR A;  4ZI2 D;  2LOP A;  3KBU A;  3Q2M A;  2CXD A;  2EHO A;  1WYC A;  1LRZ A;  2A2F X;  1G73 A;  3PUQ A;  2IAK A;  4HKA A;  4I4T E;  4BJM A;  1S35 A;  3N5L A;  3ANW A;  3WI3 A;  3NZP A;  3VU7 H;  2KWH A;  3P7I A;  4IHJ E;  2XUE A;  2LHN A;  3PE0 A;  4UV8 B;  5LCY A;  4AQF A;  4EXT A;  4UF0 B;  5GON E;  4B6X A;  4ISS A;  5FY1 A;  1LKX A;  4A56 A;  1US7 B;  2LM9 A;  2MOZ A;  4YJ2 E;  2V7J A;  3I9Y A;  5CB4 E;  1MND A;  3WAK A;  2D2S A;  5F3J A;  3SRZ A;  3NRY A;  4GYS A;  4JLE A;  3OJA A;  5HXR A;  4IE7 A;  3ESL A;  4H9Q C;  3LK4 2;  1MIW A;  5L3B B;  1O3X A;  4ZI3 C;  1FIO A;  5ETW A;  3N9M A;  1IJ5 A;  4ILU A;  2K9A A;  2X9H A;  2CM0 A;  4ERR A;  3MZK B;  5HYA A;  4Z8X A;  3RYF E;  4U72 A;  4CI2 B;  3FBL A;  2E9X C;  5LGT B;  3CML A;  2KMF A;  4HEA A;  3MK7 C;  3JC6 C;  3FHN A;  1YKE B;  3CX7 B;  3HA4 A;  4IDZ A;  2NW9 A;  2L3L A;  2C5J A;  4PFO A;  2Y48 B;  4XZC A;  4IE5 A;  4BAY B;  1MMN A;  3CX8 B;  5FXX A;  4EIW A;  2MYS A;  4NUU A;  5H6Q B;  3O1I A;  4CI1 B;  3PU8 A;  1IAP A;  3I0Q A;  3ZPO A;  4ZI2 C;  2MBG A;  2VKD A;  3O9X A;  2XTL A;  2I59 A;  5LHI B;  4L9I A;  2EHO B;  2X68 A;  5KMG P;  4MAL A;  4KMC A;  4QX8 B;  2WWU A;  1HCI A;  4I55 E;  3KDS E;  4DVD A;  5JH7 E;  2BDE A;  4QWN B;  1WLX A;  4HGA A;  5E0O A;  4QHO A;  3EDU A;  3KVB A;  5LJN A;  1OXZ A;  4PFP A;  2JMH A;  4UIG A;  4CXX A;  3ZJ1 A;  4I43 B;  4CQI A;  4O2B E;  3N2G E;  4UF0 A;  1FMW A;  3C4Z A;  4P09 A;  2VL8 A;  3OBV E;  4MBQ A;  3W15 B;  2XHE B;  5LHH B;  4TV8 E;  5EZY E;  2E8I A;  5LHG B;  1MIY A;  2DCF A;  2OA5 A;  2CE7 A;  2HPL A;  2CLY C;  3I9W A;  4MLK A;  5L3C B;  2C5K T;  4AQF C;  1HG5 A;  2ZM2 A;  3DP7 A;  1MMG A;  3NBX X;  2X67 A;  4H9O C;  2X66 A;  4O4H E;  3MA9 A;  3UT5 E;  3ZYL A;  2W62 A;  4HE8 A;  5FMN A;  4G2A A;  4IST A;  4HTE A;  4AKL A;  2H7V C;  2UXN B;  3VKG A;  2C5I T;  1UX5 A;  3KFW X;  5JQG E;  2CWY A;  4CI3 B;  2NW7 A;  5JDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...