2N2NA

Tom1 negatively modulates binding of tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Target of Myb protein 1
publication title Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n2nA00
2N2NA 2N9DA 1NWMX 1O3XA 1WRDA 1X79A 1YD8G 1OXZA 1NAFA 1WR6A
chains in the Genus database with same CATH superfamily
3W15B 5LYJE 2YU1A 3C4WA 4DR1T 2W63A 2WAUA 5J0ZA 4IE7A 4JI5T 2YDQA 2IIUA 2C5JA 2W4XA 3WI3A 3KV5A 3AE1A 4EAHA 4TNVA 1XDPA 4X64T 3AVSA 3PUXF 3L09A 2CWYA 4KI0F 5H6RB 4HGAA 3OBVE 2UXNB 2EHOA 4XAXB 4YLHA 2DCFA 2XQAA 2V6YA 4HTEA 3ONLC 2IUBA 3SFEA 3RIAA 4DBQA 5ABEA 4MHCA 5AQJB 4O4IE 3QOFA 5JDLA 4X1IE 3PDYA 5HEUA 2IW5B 2BKOA 1MIVA 3PUVF 4LF8T 4PK5A 2VQFT 2BG9A 3AEAA 5FXVA 5HXSA 3PUZF 3N2OA 1HG2A 1MMNA 2BZBA 5L3DB 4CI3B 1YQ3A 2R6GF 5AQIB 3UU6A 3ZYKA 3AVRA 2UXXB 4P09A 4DUZT 2UXBT 4YFSA 1SE7A 4C90A 1HNXT 4A98A 4JYAT 5CA0E 2VK9A 2L3LA 3JC6C 4DV7T 2EHOB 3K3NA 3O1JA 2HPLA 4YTMA 4Q25A 2NOXA 3HKCE 2PJQA 2ZM2A 4PFOA 2HHHT 4I50E 3IHRA 4MALA 3ANWA 1HFAA 2BS3A 4CN1A 3F31A 2ES0A 2GK9A 2EHOD 5EK4A 1T8BA 3MK7C 2K9AA 3ZC0A 3HI2A 2WS3A 4CXXA 1FMVA 3CQCB 3ZN0B 5HEGA 1YD8G 2LRKA 4HKAA 3CQXC 2I6HA 3K3OA 5C2TA 2C5KT 1U4QA 2DNXA 3J9X1 1ZOYA 1OXZA 2JRKA 2WMNA 3PJAJ 4I55E 3PUWF 3JC6D 2Y6XA 3R6NA 1KF6A 2CHNA 2J47A 2LT3A 3KDSE 3UT5E 4MFRA 3ZMSB 4V1Av 3ANWB 2VASA 1OWAA 3FZHB 3JCFA 1FJGT 3K1SA 1LKXA 2CMRA 3FB2A 4O4HE 1W09A 2W2UA 3PUAA 2V7MA 2XAQB 5LP6E 3OJAA 3CQGB 2N1GA 1MMGA 1MNDA 3NRXA 3PU8A 2W00A 5FYMA 3ABVA 5JDNA 5FKYA 2XAJB 5KMGP 4BJNA 3EUHA 3NZQA 4B3MT 5L4HA 1WYCA 4DO0A 4EB6E 2X67A 2VQET 5HCMA 5J1GA 4GK5E 2WU2A 5IYZE 3Q5EA 4PJMA 3AE2A 4ZEYA 2BKPA 4ASKA 3RX6A 1CUNA 4AKLA 3A7MA 2CXLA 1US7B 1QUUA 2LOSA 1N33T 2RP4A 3Q5WA 2YK0A 4PW8A 4U3CA 3P4QA 2FJBA 4U74A 3MZKB 2ODVA 3TLTA 2LLYA 4XBFB 3RYHE 1YXRA 5HEOA 2D5UA 4PFPA 5BR8T 4JEUB 4O4LE 1XNQT 5EK3A 5HYAA 2QYWA 4ANJA 1G73A 2ODUA 3QC9A 5HXCA 1OEDA 3HKEE 1V9DA 3V5UA 3AECA 3EDUA 3GN5A 1XMOT 3PUYF 2E2AA 2UUBT 2HN2A 4WYVA 2M6IA 5L47A 3A5XA 3FXDB 2VKOA 2PBIA 5JDFA 2A9UA 1IZNB 3OVUA 2Q9QA 1UK5A 4A97A 4K0KT 4QX8B 2UUCT 1XDOA 3KBTA 2X9WA 2K48A 1HG5A 2VKJA 3PJAA 4P0BA 4IDNA 4WNKA 4EIWA 2JMKA 3UUBA 1VCSA 3N2GE 5LA6E 3K8PC 1YW0A 4WW0A 5LMNT 3LFMA 4H9QC 1VOMA 3Q5DA 5AQTB 2LSJA 2V6XA 1ZV4X 5CB4E 3AE5A 4NUUA 4DUYT 4KBMB 3RKGA 4DR5T 3LK3B 4H63H 5AQUB 4CXYA 2VWAA 1OEDB 4UVCB 1MNEA 3LBXA 3GN5B 1UCUA 1D0XA 1IBMT 2CXFA 5FXWA 4DR6T 5LG3A 2C0SA 1R8IA 2Q9QB 4AQFA 3QB5A 3B57A 4KX6A 3O1IA 4CN6A 2UUAT 5FY0A 4EEDA 4IT4A 2MPKA 2CXDA 1WR6A 3L3PA 2M67A 5JH7E 2KXPB 2ZLYA 2Q9QD 2FJEA 3Q5XA 1IBKT 3ZJ2A 1YKHB 5FXZA 3B5MA 3N9OA 4HN9A 2XQYA 4HWDA 4L0RA 2WSSV 3QNUA 2W66A 2JIWA 4PJNA 3ONXA 2X51A 2XSBA 3AAEB 2WQYA 4LF9T 3DTOA 3LDQB 2CRBA 5FL1A 3NVOA 2XAHB 3TLUA 4P1NA 3AE6A 2NTXA 5HXHA 3KV4A 3LBXB 4ILUA 2IHR1 4HWCA 2BS2A 5JR9C 5AQKB 1X9BA 1IBLT 3ZT7A 5HWXA 1UURA 4HFIA 4IDOA 5L3FB 2YINA 3VHLA 4IREA 2E5LT 2I0MA 2JPFA 4IE0A 5LHHB 3P4WA 4UVBB 3F2EA 3G06A 1U5PA 4KHPT 2JQ9A 2DLRA 4O8SA 3T8OA 2ZMAA 4IE4A 1YQ4A 5DABA 4O4JE 2CE7A 3FZKB 1WFDA 5FY7A 3FBLA 2SPCA 5JR9B 3JADA 5AFUL 2Z6EA 1LVKA 4JBWF 3RC8A 3I9WA 5JTGA 4NXNT 5JREA 3E0ZA 1M7KA 3L39A 5H6QB 4YSYA 2X68A 5FL0A 3SWHA 4ILBA 2LOPA 3FBZA 4JI8T 2D0UA 4LF4T 3L8RA 3AE3A 2LSIA 4ZZCA 3N9QA 3P4SA 1NWMX 1UX5A 2F4VT 4IL9A 3E22E 3JAFA 3PUGA 3GWHA 2X9YA 3CIRA 4YY3T 2V7LA 2XJ7A 2QGSA 1BR2A 4IE5A 2FUPA 1CHUA 2V7IA 4U33A 1MIWA 2V5DA 4ZXLA 4TWFA 4IHJE 2EHOC 1Y64B 3RRWA 2Y48B 2PFVA 4YJ2E 5J2UE 2A3DA 4HFBA 3MXZA 1D1AA 5L2LA 2H7VC 4AKRB 4X5TA 4HFHA 3LG7A 2WDVA 4U2ZA 4CQIA 2MBGA 3HKDE 2V1DB 5AQGB 2NP9A 4DV4T 4EZHA 2D9DA 2BG9C 4XZCA 3UU8A 4B3ST 3O4XE 5LB7B 3KVBA 2XAFB 3E08A 5DQWA 4AKIA 4UELA 1N36T 2IDOB 4HWIB 2FJDA 4HFEA 2J62A 3UU4A 2V6YB 3M3ZB 4TX5A 5HCJA 3ETUA 2XQ7A 3RYCE 4UV8B 1HX1B 4QH5A 3Q9DA 4JI7T 4NPPA 2LEHA 2KINB 3N9LA 2B76A 4QHOA 3EDVA 4TV9E 4LFCT 2YDRA 3BQKA 5TAOA 2DWGA 5AQQB 4AI6A 2BG9B 3N9PA 2DL1A 1T98A 4H9PC 3KFWX 4YSZA 5F5WA 5F3JA 2J1DG 2LKGA 3ZJ1A 1IJ5A 3ZMVB 1OEDE 1GQEA 3RYIE 4MBQA 4DV2T 4ISTA 3CK6A 4B3TT 2IC9A 4EZ4A 1JNZA 2KWHA 2VB6A 2XPKA 2BKNA 4TUYE 4OYKA 4LMLA 3AB3B 4DIDB 3N5LA 4M1PA 3CMLA 3ESLA 5HEHA 2YN6A 4EEBA 1HF8A 3K3QC 2V5CA 1W0AA 2UU9T 4HWFA 5AQOB 4JI4T 4PK6A 3PE0A 1NENA 3AE8A 1ZP0A 3VRBA 5LBQB 4QKNA 4Z90A 2WM9A 5AQNB 1VCTA 2KWIB 3CWZB 4HE8A 4YHJA 2LM9A 3UFGA 2VKHA 2WY2A 5LJMA 4IGUA 3ETVA 1MMAA 4ZHQE 3KINB 2JQHA 2NW9A 4DV6T 2OV9A 3GA8A 4JI2T 5JDMA 3IEEA 2M6BA 2C5IT 2OLTA 2E9XA 3BQLA 3AAIA 1XWMA 3J7Yq 4JV5T 2XAGB 3WAKA 4LF5T 4OHFA 4KP3C 4ERRA 5AQLB 4JI0T 4H9RC 3AE4A 1ZEEA 4LFAT 5EZYE 4MLKA 2XY8B 1XMQT 2ZM8A 1T7SA 1E7PA 5LGTB 4IIJE 4J2CA 4DVDA 2V26A 5LHGB 1HS7A 3SFDA 2D0TA 1J1JA 3LSVA 2YEVC 3VKHA 2YOEA 3TLWA 3R84B 3MKDA 5AQRB 3AEBA 5LBMA 3F57A 1OEDC 3EAMA 2E9XB 2ZM0A 3RIUA 1Z0PA 4TV8E 3I1AA 3EHZA 5LXTE 1L0VA 2BBJA 2BBHA 4COFA 3H37A 4ILCA 3LK2B 3AE9A 3V5SA 2Q9QC 3UU3A 2BVMA 2CLYB 5E0OA 2LE8A 2KMFA 4AQGA 3VR9A 3S4UA 2E9XD 4DMVA 1KK7A 3TKLB 3AA1B 3UUNA 1MIYA 2X9HA 3RYFE 3RPUA 3QUJA 3RQUA 4GKJT 5LCYA 2H88A 4QH4A 2JMHA 1UX4A 3IBPA 3CPZA 4DNDA 2WWVA 4B3RT 5DJQC 3PU3A 3MJXA 5LOVE 2XM1A 3P7IA 5L3GB 3T1YT 2AE9A 2WBLA 3NBXX 2D2SA 2L8KA 4YXDA 3WAJA 2CA5A 5EK2A 3C51A 4AQFC 3UUXB 5FNVE 4DR2T 1LRZA 3AA0B 4DBRA 2YDSA 1KFYA 3I0QA 5HAXA 5AQHB 2H89A 5L4EA 3MACA 2JJ9A 2CCQA 4N78D 1E1HB 2BDEA 3UTKA 2V7KA 3ZKRA 1BR0A 3UQ7A 5HXRA 4QXHB 4ZOLE 3OYXA 5AQFB 2BG9E 4UEMA 4ADZA 5M4YA 3RC3A 4JI1T 4B6XA 4WZXA 4ZI2D 2V8SV 1JNRA 2CPTA 3NKZA 4X66T 3AAAB 4H63V 2LHRA 3RLFF 2WDQA 3FZMB 2QVAA 2MYSA 4GIWA 4QX7B 1EZ3A 2K5BB 2FJAA 2Y8DA 1VRBA 3VU7H 4O2BE 5KXJA 1WLXA 4H9NC 4UVAB 5JDQA 2WMOA 2NR4A 1D0YA 4YSXA 3C50A 2XQ8A 3I0OA 2WU5A 2BS4A 2E8IA 2AXDS 5FMNA 1D1CA 4QH1A 2XQ3A 2UXDT 3RI5A 3IF8B 1UUSA 3GMIA 2VL0A 4ZZBA 1HTJF 4EYYR 2XQ6A 1J5ET 2X0HA 2NTYA 1HX8A 3X1DA 3AEEA 2FBWA 2LSGA 1O3XA 3H3AA 5IHYA 1D1BA 1IJ6A 5IWAT 4AIUA 4AQYT 1M62A 2VKDA 4PK4A 4JUYA 1WR0A 5AQVB 3ZCJA 4ZI7E 4EOZB 2B1EA 3HR0A 3D0TA 3JAEA 2LJLA 2NWBA 3ZSSA 5JRCA 4GK0E 4I4TE 5GONE 3U3IA 4QXBB 3ZT5A 3FZLB 2WB5A 3QK6A 3ZSTA 1WRDA 3M65A 4IE6A 2H7OA 4NXMT 2LKHA 3ZPOA 1LVFA 2RPAA 4E7SA 3VKGA 4DR4T 2A2FX 3CX8B 1KEYA 2NW8A 5HXEA 4X1KE 4ZI3C 2IAKA 4GOUA 4Z91A 4CXWA 3RIFA 3OYZA 2WWUA 3C4XA 3UUMA 5KDMC 2XHEB 3MA9A 4U7YA 1SUMB 4F6RC 1KNRA 4CZZB 5CJ5A 5ABGA 2WCAA 4HFVA 2WZIA 5JRCB 4OYJA 4U72A 4BJMA 2XZEA 1W9RA 2ACZA 4LF6T 4KHZF 3BK9A 2IMLA 5C8YE 2HN1A 5LGUB 4AISA 2DWKA 1HCIA 3UQ4A 5AQMB 1QLBA 4ILAA 4YT0A 3CX6B 2XM2A 3H3MA 3P4RA 2PTFA 2VVSA 2ACXA 2W61A 3T1HT 4NUVA 5F8PA 2LM2A 4CI2B 1HNWT 2X9XA 5JVDE 1S94A 1WCRA 2G0UA 4JLEA 4ZI3D 2KSRA 4BA9A 3OPCA 2VVNA 5KX5E 2J4GA 3RQWA 1DU2A 3SOLA 3CKDA 1BR4A 2X66A 3N9NA 4LMKA 5J2TE 4NIQA 4EXTA 2WP9A 4CI1B 4U31A 1Z8UA 1FIOA 2LRLA 3RRCA 3P4PA 4DR3T 5ADXL 4ZS2A 4U7IA 3TLSA 2XQ9A 3ZMUB 2WDRA 2CWOA 5CGMA 4I0UA 4PNIA 4EV6A 5HWYA 5FP3A 4AXPA 3N9MA 4TWDA 2KZ7B 3UFEA 5LHIB 3AXJA 3ZN1B 1HNZT 4LMJA 4DV0T 3FHNA 2L9QA 2XTLA 1N34T 2XQ5A 2DHRA 3PUQA 2W62A 2VURA 3C98B 3VRAA 4DV5T 4L5GA 2H3RA 1T72A 5LMUT 4IDZA 4AKHA 1S35A 2WZHA 2XUEA 2QA7A 3ONJA 2XASB 4FJOA 2DI4A 3TLVA 4UV9B 3LJCA 3O9XA 3LK42 2N2NA 3KV9A 4TNWA 2XSAA 3P8CD 3O1HA 4C91A 2A72A 5CFBA 5CA1E 2HPJA 4K0UA 4LF7T 4DR7T 1SA0E 2E9XC 3DJBA 4HFCA 1ZKEA 5LGNB 2KT9A 3AXJB 2RA1A 4X62T 4PJJA 4KMCA 2PG8A 4A56A 1E2AA 4H9OC 3PV0F 4L9IA 4G2AA 4EGWA 5FY1A 5ABFA 3AEDA 3NRYA 5IUXA 2HH7A 3EI0A 3ZMTB 2CLYC 4Z8XA 4PJLA 2XQ4A 1BR1A 3C64A 5JDHA 1XNRT 1NEKA 2JQQA 4I43B 3ZEFB 4A5XA 2YKSA 1NAFA 3ZLIA 3IA3A 5L3CB 4FI5A 4DMWA 3ZYLA 5HEJA 3PURA 1SHZC 2CBIA 1Y01A 3OTOT 4UR9A 3SS1A 5BMVE 2W0GA 3AEGA 3KV6A 2LSYA 4F8HA 3UULA 1IAPA 3PUSA 4UIGA 4U2YA 2K24A 4KUMB 3RIUC 1H7CA 4WBOA 3RF1A 2E5VA 4WBNE 4IDPA 1FEWA 5ABFB 2KNDA 1ZHCA 3I9YA 4CN4A 5LG4A 2JQKA 3RHWA 4JI6T 2I59A 2MAWA 4YTNA 4ZI2C 1X79A 3HL6A 3HA4A 2IC6A 4GYSA 4TN7B 3AEFA 4UF0A 3RKOA 2V7JA 2NW7A 3C4ZA 4YTPA 3UU5A 4QWNB 3B13A 1G8XA 4O2AE 5FVKA 2BVLA 3PTRB 2YU2A 4OK0A 1WYBA 1XZYA 3AA7B 3QB5K 2W67A 2VL8A 2X0LB 4IDQA 1J5WA 3AA6B 2K3WA 4TZ4C 4P0AA 3FZFB 5AQSB 1I94T 3KBUA 4YHHT 5FXXA 5L3BB 4X20E 4LFBT 4DV1T 1N32T 1KNZA 2ZM6T 4ISSA 3P50A 2LHNA 4UXNB 1B7TA 5ETWA 3AE7A 4ZS3A 1MMDA 2UXCT 3RGLA 1D0ZA 4HEAA 4UF0B 5JR9A 5LNKA 2CM0A 3OKQA 4GYRA 3ZMZB 3EABA 2MOZA 3CVRA 2X0YA 4E7ZA 4IL4A 3NZPA 4G63A 3A8YC 3FXEB 5JDGA 4OX9T 1W0BA 3CX7B 4DV3T 5A1LA 1AJ3A 4JI3T 2MTQA 3ZC1A 1I6ZA 4YJ3E 5DQVA 3ZT6A 5ABHA 3KVAA 3BQIA 3NWIA 3RH3A 4BAYB 1KNPA 2P9BA 4GKKT 5JQGE 3DP7A 5LJNA 2OA5A 1FMWA 3U78A 2KLQA 1HR0T 4JEHB 5FVLA 4HFDA 4X65T 4H9SE 3SRZA 4X1YE 5C3JA 2CHOA 3HKBE 4QXCB 3Q2MA 3VR8A 2CEAA 3ZCIA 5L3EB 2QRXA 1YKEB 4AKGA 3ZYMA 4PAGA 4EYUA 4HWHA 1UGOA 2CBJA 2N9DA 2LSKA 3EVYA 3N2KE 4OFZA 1QSDA 4TWHA 5AQPB
chains in the Genus database with same CATH topology
2G0UA 2XAGB 3O1IA 4JLEA 3W15B 3WAKA 4ZI3D 5LYJE 2YU1A 5FY0A 4OHFA 3C4WA 4KP3C 4BA9A 4ERRA 2W63A 2WAUA 2CXDA 4IE7A 5KX5E 1WR6A 3L3PA 2M67A 2C5JA 5JH7E 2KXPB 3WI3A 2ZLYA 3KV5A 4H9RC 3SOLA 1ZEEA 3CKDA 1BR4A 4EAHA 2Q9QD 5EZYE 3Q5XA 2X66A 4MLKA 3N9NA 3ZJ2A 3AVSA 2ZM8A 1YKHB 3L09A 5FXZA 3N9OA 4HN9A 2CWYA 2XQYA 5LGTB 4L0RA 5J2TE 2WSSV 4IIJE 4J2CA 4EXTA 4PJNA 5H6RB 4HGAA 4CI1B 4DVDA 3OBVE 1FIOA 2UXNB 2V26A 3ONXA 2EHOA 2X51A 4XAXB 5LHGB 1HS7A 3RRCA 3AAEB 3DTOA 4YLHA 2D0TA 2DCFA 5ADXL 2YEVC 4ZS2A 2XAHB 3VKHA 2NTXA 4HTEA 5HXHA 3KV4A 3ZMUB 3R84B 3MKDA 3LBXB 4ILUA 4DBQA 2CWOA 5LBMA 3F57A 4MHCA 5JR9C 4O4IE 2E9XB 2ZM0A 4PNIA 5JDLA 1Z0PA 4X1IE 3PDYA 5HWXA 4TV8E 5HWYA 5FP3A 4AXPA 3N9MA 3I1AA 2KZ7B 5LXTE 3UFEA 5L3FB 2YINA 2IW5B 1MIVA 3VHLA 4PK5A 5LHIB 3H37A 5FXVA 5HXSA 3N2OA 2JPFA 4IE0A 1HG2A 3LK2B 3ZN1B 1MMNA 3V5SA 2Q9QC 5LHHB 2BVMA 2BZBA 2CLYB 5L3DB 5E0OA 4CI3B 2LE8A 2KMFA 3FHNA 4AQGA 4UVBB 3F2EA 2L9QA 3S4UA 2XTLA 3ZYKA 1U5PA 2DHRA 2DLRA 2E9XD 3AVRA 3PUQA 2UXXB 2W62A 4O8SA 3T8OA 4P09A 2ZMAA 3C98B 4IE4A 4DMVA 4YFSA 1KK7A 4L5GA 2H3RA 4C90A 3TKLB 3AA1B 3UUNA 5DABA 4O4JE 5CA0E 1MIYA 2X9HA 3RYFE 3RPUA 2VK9A 2CE7A 3QUJA 2L3LA 4IDZA 4AKHA 5LCYA 5FY7A 3FBLA 1S35A 3JC6C 2SPCA 5JR9B 2JMHA 2EHOB 3K3NA 3O1JA 1UX4A 2XUEA 2HPLA 2QA7A 3IBPA 5AFUL 2Z6EA 1LVKA 3CPZA 2NOXA 2XASB 4FJOA 2DI4A 3HKCE 4DNDA 2PJQA 4UV9B 2ZM2A 3RC8A 4PFOA 3LJCA 5DJQC 3PU3A 4I50E 3I9WA 3MJXA 3IHRA 3O9XA 4MALA 5LOVE 3P7IA 3LK42 5JREA 5L3GB 2N2NA 3KV9A 3E0ZA 3P8CD 3ANWA 3O1HA 1HFAA 5H6QB 3F31A 4C91A 2A72A 2ES0A 2GK9A 5CA1E 2HPJA 2EHOD 2X68A 5EK4A 3SWHA 2WBLA 4K0UA 3NBXX 3MK7C 1SA0E 2K9AA 2D2SA 2E9XC 3ZC0A 2L8KA 2LOPA 3DJBA 3FBZA 3WAJA 3HI2A 1ZKEA 5LGNB 2CA5A 2KT9A 2RA1A 5EK2A 4PJJA 3C51A 2D0UA 4KMCA 4CXXA 1FMVA 4AQFC 3CQCB 2PG8A 4A56A 4H9OC 4L9IA 3UUXB 3ZN0B 5FNVE 2LSIA 1YD8G 3N9QA 4G2AA 5FY1A 1LRZA 3AA0B 1NWMX 3NRYA 1UX5A 2HH7A 4HKAA 3CQXC 4DBRA 3K3OA 3ZMTB 2CLYC 3E22E 4PJLA 2C5KT 4Z8XA 3I0QA 1U4QA 5HAXA 2DNXA 1BR1A 3J9X1 3C64A 5JDHA 3MACA 1OXZA 2JRKA 2JJ9A 2WMNA 2CCQA 3PUGA 3GWHA 4N78D 2X9YA 1E1HB 2BDEA 3UTKA 2V7KA 2V7LA 1BR0A 4I55E 2JQQA 4I43B 2QGSA 5HXRA 3ZEFB 1BR2A 4QXHB 4ZOLE 4IE5A 3OYXA 3JC6D 1NAFA 3ZLIA 2Y6XA 4UEMA 2V7IA 3R6NA 4ADZA 5M4YA 1MIWA 3RC3A 4B6XA 5L3CB 4FI5A 2LT3A 3KDSE 4DMWA 4ZI2D 3ZYLA 3PURA 3UT5E 4IHJE 2EHOC 4MFRA 3ZMSB 1SHZC 4V1Av 3AAAB 4H63V 1Y64B 3RRWA 2Y48B 2LHRA 3SS1A 5BMVE 2W0GA 2PFVA 4YJ2E 3KV6A 3ANWB 2MYSA 2LSYA 4GIWA 5J2UE 2A3DA 2VASA 3UULA 1OWAA 3MXZA 4QX7B 1EZ3A 1IAPA 3PUSA 4UIGA 1D1AA 2K5BB 5L2LA 2H7VC 4AKRB 1LKXA 2Y8DA 3LG7A 1VRBA 2CMRA 3FB2A 4O4HE 3VU7H 2K24A 4O2BE 4CQIA 4KUMB 1WLXA 2MBGA 4H9NC 3HKDE 2V1DB 2NP9A 1H7CA 3PUAA 4UVAB 5JDQA 2WMOA 2V7MA 4WBOA 4EZHA 1D0YA 2XAQB 5LP6E 3C50A 4WBNE 3I0OA 1FEWA 4XZCA 2KNDA 1ZHCA 3I9YA 3O4XE 3KVBA 2E8IA 3OJAA 3CQGB 2N1GA 5LG4A 1MMGA 1MNDA 3NRXA 5FMNA 2XAFB 1D1CA 3E08A 3PU8A 5DQWA 4AKIA 4UELA 2W00A 5FYMA 5JDNA 2XAJB 2I59A 5KMGP 4ZI2C 3IF8B 1X79A 3HL6A 3HA4A 2IC6A 4BJNA 4GYSA 4TN7B 3EUHA 4UF0A 2V7JA 2NW7A 3RKOA 3NZQA 4TX5A 3GMIA 3C4ZA 4QWNB 1WYCA 4DO0A 3ETUA 3B13A 1G8XA 4O2AE 4EB6E 2X67A 2BVLA 4UV8B 3RYCE 1HTJF 5J1GA 3PTRB 2YU2A 3Q9DA 2LEHA 2KINB 3N9LA 4OK0A 1WYBA 4QHOA 3EDVA 4GK5E 4TV9E 5IYZE 4EYYR 3AA7B 2NTYA 1HX8A 4PJMA 2LSGA 3BQKA 1O3XA 2VL8A 2X0LB 4ASKA 5TAOA 3H3AA 5IHYA 2DWGA 4AI6A 3RX6A 1CUNA 4AKLA 1D1BA 1IJ6A 3N9PA 2CXLA 1US7B 1QUUA 2LOSA 2RP4A 3Q5WA 3AA6B 2VKDA 4PK4A 4P0AA 4TZ4C 1T98A 2YK0A 4H9PC 4JUYA 4PW8A 3KFWX 3ZCJA 4ZI7E 5F3JA 4EOZB 2B1EA 2J1DG 3HR0A 3D0TA 2LJLA 3KBUA 3ZJ1A 2NWBA 5FXXA 5JRCA 5L3BB 1IJ5A 4X20E 4GK0E 4U74A 3ZMVB 4I4TE 5GONE 3MZKB 2ODVA 3U3IA 4QXBB 4XBFB 3RYIE 4MBQA 4ISTA 3RYHE 1KNZA 4ISSA 4UXNB 2D5UA 2LHNA 1B7TA 2IC9A 4EZ4A 5ETWA 4PFPA 4ZS3A 1MMDA 4JEUB 2KWHA 2VB6A 3QK6A 4O4LE 5EK3A 5HYAA 1D0ZA 4TUYE 1WRDA 4OYKA 3M65A 4ANJA 1G73A 2ODUA 4HEAA 4UF0B 3QC9A 5HXCA 4IE6A 5JR9A 3AB3B 3HKEE 1V9DA 2H7OA 3V5UA 5LNKA 2CM0A 3OKQA 4GYRA 3ZMZB 3EDUA 2MOZA 3GN5A 3ZPOA 1LVFA 4E7SA 3CVRA 3N5LA 4E7ZA 4M1PA 3VKGA 3CMLA 2A2FX 3ESLA 3NZPA 3CX8B 4G63A 3A5XA 3FXDB 2NW8A 2VKOA 3FXEB 5JDGA 1HF8A 3K3QC 2PBIA 5JDFA 3CX7B 1IZNB 2Q9QA 5HXEA 4X1KE 4ZI3C 4QX8B 5A1LA 2IAKA 1AJ3A 2MTQA 3ZC1A 4GOUA 3KBTA 2X9WA 4PK6A 2K48A 1HG5A 4CXWA 2VKJA 3OYZA 4YJ3E 3PE0A 4P0BA 5DQVA 4WNKA 4EIWA 3KVAA 2WWUA 3C4XA 3BQIA 3RH3A 4BAYB 2JMKA 3UUMA 5LBQB 2P9BA 4QKNA 3N2GE 5LA6E 5JQGE 5KDMC 2XHEB 2WM9A 3K8PC 1YW0A 2KWIB 4WW0A 3DP7A 3LFMA 4H9QC 3MA9A 3CWZB 1VOMA 4HE8A 4YHJA 2LM9A 2LSJA 4F6RC 2OA5A 5LJNA 1FMWA 1ZV4X 4CZZB 5JRCB 4HFVA 4OYJA 4U72A 4BJMA 3U78A 5CB4E 2VKHA 2KLQA 4NUUA 4JEHB 4KBMB 4H9SE 3SRZA 4X1YE 3BK9A 3LK3B 5LJMA 3HKBE 4H63H 4QXCB 5C8YE 4IGUA 3ETVA 3Q2MA 1MMAA 5LGUB 2CEAA 2DWKA 1HCIA 4CXYA 4ZHQE 2VWAA 3KINB 4UVCB 1MNEA 3ZCIA 5L3EB 1YKEB 4AKGA 3ZYMA 3CX6B 4PAGA 4EYUA 2NW9A 3LBXA 3GN5B 3GA8A 1UCUA 2ACXA 2W61A 5JDMA 4NUVA 3IEEA 5F8PA 1D0XA 2C5IT 4CI2B 2E9XA 2N9DA 2CXFA 5FXWA 2LSKA 3BQLA 3EVYA 3N2KE 4OFZA 2X9XA 2C0SA 5JVDE 2Q9QB 1QSDA 4AQFA 1S94A 3B57A 3AAIA 3J7Yq
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  2N9D A;  1NWM X;  1O3X A;  1WRD A;  1X79 A;  1YD8 G;  1OXZ A;  1NAF A;  1WR6 A; 
#chains in the Genus database with same CATH topology
 3W15 B;  5LYJ E;  2YU1 A;  3C4W A;  4DR1 T;  2W63 A;  2WAU A;  5J0Z A;  4IE7 A;  4JI5 T;  2YDQ A;  2IIU A;  2C5J A;  2W4X A;  3WI3 A;  3KV5 A;  3AE1 A;  4EAH A;  4TNV A;  1XDP A;  4X64 T;  3AVS A;  3PUX F;  3L09 A;  2CWY A;  4KI0 F;  5H6R B;  4HGA A;  3OBV E;  2UXN B;  2EHO A;  4XAX B;  4YLH A;  2DCF A;  2XQA A;  2V6Y A;  4HTE A;  3ONL C;  2IUB A;  3SFE A;  3RIA A;  4DBQ A;  5ABE A;  4MHC A;  5AQJ B;  4O4I E;  3QOF A;  5JDL A;  4X1I E;  3PDY A;  5HEU A;  2IW5 B;  2BKO A;  1MIV A;  3PUV F;  4LF8 T;  4PK5 A;  2VQF T;  2BG9 A;  3AEA A;  5FXV A;  5HXS A;  3PUZ F;  3N2O A;  1HG2 A;  1MMN A;  2BZB A;  5L3D B;  4CI3 B;  1YQ3 A;  2R6G F;  5AQI B;  3UU6 A;  3ZYK A;  3AVR A;  2UXX B;  4P09 A;  4DUZ T;  2UXB T;  4YFS A;  1SE7 A;  4C90 A;  1HNX T;  4A98 A;  4JYA T;  5CA0 E;  2VK9 A;  2L3L A;  3JC6 C;  4DV7 T;  2EHO B;  3K3N A;  3O1J A;  2HPL A;  4YTM A;  4Q25 A;  2NOX A;  3HKC E;  2PJQ A;  2ZM2 A;  4PFO A;  2HHH T;  4I50 E;  3IHR A;  4MAL A;  3ANW A;  1HFA A;  2BS3 A;  4CN1 A;  3F31 A;  2ES0 A;  2GK9 A;  2EHO D;  5EK4 A;  1T8B A;  3MK7 C;  2K9A A;  3ZC0 A;  3HI2 A;  2WS3 A;  4CXX A;  1FMV A;  3CQC B;  3ZN0 B;  5HEG A;  1YD8 G;  2LRK A;  4HKA A;  3CQX C;  2I6H A;  3K3O A;  5C2T A;  2C5K T;  1U4Q A;  2DNX A;  3J9X 1;  1ZOY A;  1OXZ A;  2JRK A;  2WMN A;  3PJA J;  4I55 E;  3PUW F;  3JC6 D;  2Y6X A;  3R6N A;  1KF6 A;  2CHN A;  2J47 A;  2LT3 A;  3KDS E;  3UT5 E;  4MFR A;  3ZMS B;  4V1A v;  3ANW B;  2VAS A;  1OWA A;  3FZH B;  3JCF A;  1FJG T;  3K1S A;  1LKX A;  2CMR A;  3FB2 A;  4O4H E;  1W09 A;  2W2U A;  3PUA A;  2V7M A;  2XAQ B;  5LP6 E;  3OJA A;  3CQG B;  2N1G A;  1MMG A;  1MND A;  3NRX A;  3PU8 A;  2W00 A;  5FYM A;  3ABV A;  5JDN A;  5FKY A;  2XAJ B;  5KMG P;  4BJN A;  3EUH A;  3NZQ A;  4B3M T;  5L4H A;  1WYC A;  4DO0 A;  4EB6 E;  2X67 A;  2VQE T;  5HCM A;  5J1G A;  4GK5 E;  2WU2 A;  5IYZ E;  3Q5E A;  4PJM A;  3AE2 A;  4ZEY A;  2BKP A;  4ASK A;  3RX6 A;  1CUN A;  4AKL A;  3A7M A;  2CXL A;  1US7 B;  1QUU A;  2LOS A;  1N33 T;  2RP4 A;  3Q5W A;  2YK0 A;  4PW8 A;  4U3C A;  3P4Q A;  2FJB A;  4U74 A;  3MZK B;  2ODV A;  3TLT A;  2LLY A;  4XBF B;  3RYH E;  1YXR A;  5HEO A;  2D5U A;  4PFP A;  5BR8 T;  4JEU B;  4O4L E;  1XNQ T;  5EK3 A;  5HYA A;  2QYW A;  4ANJ A;  1G73 A;  2ODU A;  3QC9 A;  5HXC A;  1OED A;  3HKE E;  1V9D A;  3V5U A;  3AEC A;  3EDU A;  3GN5 A;  1XMO T;  3PUY F;  2E2A A;  2UUB T;  2HN2 A;  4WYV A;  2M6I A;  5L47 A;  3A5X A;  3FXD B;  2VKO A;  2PBI A;  5JDF A;  2A9U A;  1IZN B;  3OVU A;  2Q9Q A;  1UK5 A;  4A97 A;  4K0K T;  4QX8 B;  2UUC T;  1XDO A;  3KBT A;  2X9W A;  2K48 A;  1HG5 A;  2VKJ A;  3PJA A;  4P0B A;  4IDN A;  4WNK A;  4EIW A;  2JMK A;  3UUB A;  1VCS A;  3N2G E;  5LA6 E;  3K8P C;  1YW0 A;  4WW0 A;  5LMN T;  3LFM A;  4H9Q C;  1VOM A;  3Q5D A;  5AQT B;  2LSJ A;  2V6X A;  1ZV4 X;  5CB4 E;  3AE5 A;  4NUU A;  4DUY T;  4KBM B;  3RKG A;  4DR5 T;  3LK3 B;  4H63 H;  5AQU B;  4CXY A;  2VWA A;  1OED B;  4UVC B;  1MNE A;  3LBX A;  3GN5 B;  1UCU A;  1D0X A;  1IBM T;  2CXF A;  5FXW A;  4DR6 T;  5LG3 A;  2C0S A;  1R8I A;  2Q9Q B;  4AQF A;  3QB5 A;  3B57 A;  4KX6 A;  3O1I A;  4CN6 A;  2UUA T;  5FY0 A;  4EED A;  4IT4 A;  2MPK A;  2CXD A;  1WR6 A;  3L3P A;  2M67 A;  5JH7 E;  2KXP B;  2ZLY A;  2Q9Q D;  2FJE A;  3Q5X A;  1IBK T;  3ZJ2 A;  1YKH B;  5FXZ A;  3B5M A;  3N9O A;  4HN9 A;  2XQY A;  4HWD A;  4L0R A;  2WSS V;  3QNU A;  2W66 A;  2JIW A;  4PJN A;  3ONX A;  2X51 A;  2XSB A;  3AAE B;  2WQY A;  4LF9 T;  3DTO A;  3LDQ B;  2CRB A;  5FL1 A;  3NVO A;  2XAH B;  3TLU A;  4P1N A;  3AE6 A;  2NTX A;  5HXH A;  3KV4 A;  3LBX B;  4ILU A;  2IHR 1;  4HWC A;  2BS2 A;  5JR9 C;  5AQK B;  1X9B A;  1IBL T;  3ZT7 A;  5HWX A;  1UUR A;  4HFI A;  4IDO A;  5L3F B;  2YIN A;  3VHL A;  4IRE A;  2E5L T;  2I0M A;  2JPF A;  4IE0 A;  5LHH B;  3P4W A;  4UVB B;  3F2E A;  3G06 A;  1U5P A;  4KHP T;  2JQ9 A;  2DLR A;  4O8S A;  3T8O A;  2ZMA A;  4IE4 A;  1YQ4 A;  5DAB A;  4O4J E;  2CE7 A;  3FZK B;  1WFD A;  5FY7 A;  3FBL A;  2SPC A;  5JR9 B;  3JAD A;  5AFU L;  2Z6E A;  1LVK A;  4JBW F;  3RC8 A;  3I9W A;  5JTG A;  4NXN T;  5JRE A;  3E0Z A;  1M7K A;  3L39 A;  5H6Q B;  4YSY A;  2X68 A;  5FL0 A;  3SWH A;  4ILB A;  2LOP A;  3FBZ A;  4JI8 T;  2D0U A;  4LF4 T;  3L8R A;  3AE3 A;  2LSI A;  4ZZC A;  3N9Q A;  3P4S A;  1NWM X;  1UX5 A;  2F4V T;  4IL9 A;  3E22 E;  3JAF A;  3PUG A;  3GWH A;  2X9Y A;  3CIR A;  4YY3 T;  2V7L A;  2XJ7 A;  2QGS A;  1BR2 A;  4IE5 A;  2FUP A;  1CHU A;  2V7I A;  4U33 A;  1MIW A;  2V5D A;  4ZXL A;  4TWF A;  4IHJ E;  2EHO C;  1Y64 B;  3RRW A;  2Y48 B;  2PFV A;  4YJ2 E;  5J2U E;  2A3D A;  4HFB A;  3MXZ A;  1D1A A;  5L2L A;  2H7V C;  4AKR B;  4X5T A;  4HFH A;  3LG7 A;  2WDV A;  4U2Z A;  4CQI A;  2MBG A;  3HKD E;  2V1D B;  5AQG B;  2NP9 A;  4DV4 T;  4EZH A;  2D9D A;  2BG9 C;  4XZC A;  3UU8 A;  4B3S T;  3O4X E;  5LB7 B;  3KVB A;  2XAF B;  3E08 A;  5DQW A;  4AKI A;  4UEL A;  1N36 T;  2IDO B;  4HWI B;  2FJD A;  4HFE A;  2J62 A;  3UU4 A;  2V6Y B;  3M3Z B;  4TX5 A;  5HCJ A;  3ETU A;  2XQ7 A;  3RYC E;  4UV8 B;  1HX1 B;  4QH5 A;  3Q9D A;  4JI7 T;  4NPP A;  2LEH A;  2KIN B;  3N9L A;  2B76 A;  4QHO A;  3EDV A;  4TV9 E;  4LFC T;  2YDR A;  3BQK A;  5TAO A;  2DWG A;  5AQQ B;  4AI6 A;  2BG9 B;  3N9P A;  2DL1 A;  1T98 A;  4H9P C;  3KFW X;  4YSZ A;  5F5W A;  5F3J A;  2J1D G;  2LKG A;  3ZJ1 A;  1IJ5 A;  3ZMV B;  1OED E;  1GQE A;  3RYI E;  4MBQ A;  4DV2 T;  4IST A;  3CK6 A;  4B3T T;  2IC9 A;  4EZ4 A;  1JNZ A;  2KWH A;  2VB6 A;  2XPK A;  2BKN A;  4TUY E;  4OYK A;  4LML A;  3AB3 B;  4DID B;  3N5L A;  4M1P A;  3CML A;  3ESL A;  5HEH A;  2YN6 A;  4EEB A;  1HF8 A;  3K3Q C;  2V5C A;  1W0A A;  2UU9 T;  4HWF A;  5AQO B;  4JI4 T;  4PK6 A;  3PE0 A;  1NEN A;  3AE8 A;  1ZP0 A;  3VRB A;  5LBQ B;  4QKN A;  4Z90 A;  2WM9 A;  5AQN B;  1VCT A;  2KWI B;  3CWZ B;  4HE8 A;  4YHJ A;  2LM9 A;  3UFG A;  2VKH A;  2WY2 A;  5LJM A;  4IGU A;  3ETV A;  1MMA A;  4ZHQ E;  3KIN B;  2JQH A;  2NW9 A;  4DV6 T;  2OV9 A;  3GA8 A;  4JI2 T;  5JDM A;  3IEE A;  2M6B A;  2C5I T;  2OLT A;  2E9X A;  3BQL A;  3AAI A;  1XWM A;  3J7Y q;  4JV5 T;  2XAG B;  3WAK A;  4LF5 T;  4OHF A;  4KP3 C;  4ERR A;  5AQL B;  4JI0 T;  4H9R C;  3AE4 A;  1ZEE A;  4LFA T;  5EZY E;  4MLK A;  2XY8 B;  1XMQ T;  2ZM8 A;  1T7S A;  1E7P A;  5LGT B;  4IIJ E;  4J2C A;  4DVD A;  2V26 A;  5LHG B;  1HS7 A;  3SFD A;  2D0T A;  1J1J A;  3LSV A;  2YEV C;  3VKH A;  2YOE A;  3TLW A;  3R84 B;  3MKD A;  5AQR B;  3AEB A;  5LBM A;  3F57 A;  1OED C;  3EAM A;  2E9X B;  2ZM0 A;  3RIU A;  1Z0P A;  4TV8 E;  3I1A A;  3EHZ A;  5LXT E;  1L0V A;  2BBJ A;  2BBH A;  4COF A;  3H37 A;  4ILC A;  3LK2 B;  3AE9 A;  3V5S A;  2Q9Q C;  3UU3 A;  2BVM A;  2CLY B;  5E0O A;  2LE8 A;  2KMF A;  4AQG A;  3VR9 A;  3S4U A;  2E9X D;  4DMV A;  1KK7 A;  3TKL B;  3AA1 B;  3UUN A;  1MIY A;  2X9H A;  3RYF E;  3RPU A;  3QUJ A;  3RQU A;  4GKJ T;  5LCY A;  2H88 A;  4QH4 A;  2JMH A;  1UX4 A;  3IBP A;  3CPZ A;  4DND A;  2WWV A;  4B3R T;  5DJQ C;  3PU3 A;  3MJX A;  5LOV E;  2XM1 A;  3P7I A;  5L3G B;  3T1Y T;  2AE9 A;  2WBL A;  3NBX X;  2D2S A;  2L8K A;  4YXD A;  3WAJ A;  2CA5 A;  5EK2 A;  3C51 A;  4AQF C;  3UUX B;  5FNV E;  4DR2 T;  1LRZ A;  3AA0 B;  4DBR A;  2YDS A;  1KFY A;  3I0Q A;  5HAX A;  5AQH B;  2H89 A;  5L4E A;  3MAC A;  2JJ9 A;  2CCQ A;  4N78 D;  1E1H B;  2BDE A;  3UTK A;  2V7K A;  3ZKR A;  1BR0 A;  3UQ7 A;  5HXR A;  4QXH B;  4ZOL E;  3OYX A;  5AQF B;  2BG9 E;  4UEM A;  4ADZ A;  5M4Y A;  3RC3 A;  4JI1 T;  4B6X A;  4WZX A;  4ZI2 D;  2V8S V;  1JNR A;  2CPT A;  3NKZ A;  4X66 T;  3AAA B;  4H63 V;  2LHR A;  3RLF F;  2WDQ A;  3FZM B;  2QVA A;  2MYS A;  4GIW A;  4QX7 B;  1EZ3 A;  2K5B B;  2FJA A;  2Y8D A;  1VRB A;  3VU7 H;  4O2B E;  5KXJ A;  1WLX A;  4H9N C;  4UVA B;  5JDQ A;  2WMO A;  2NR4 A;  1D0Y A;  4YSX A;  3C50 A;  2XQ8 A;  3I0O A;  2WU5 A;  2BS4 A;  2E8I A;  2AXD S;  5FMN A;  1D1C A;  4QH1 A;  2XQ3 A;  2UXD T;  3RI5 A;  3IF8 B;  1UUS A;  3GMI A;  2VL0 A;  4ZZB A;  1HTJ F;  4EYY R;  2XQ6 A;  1J5E T;  2X0H A;  2NTY A;  1HX8 A;  3X1D A;  3AEE A;  2FBW A;  2LSG A;  1O3X A;  3H3A A;  5IHY A;  1D1B A;  1IJ6 A;  5IWA T;  4AIU A;  4AQY T;  1M62 A;  2VKD A;  4PK4 A;  4JUY A;  1WR0 A;  5AQV B;  3ZCJ A;  4ZI7 E;  4EOZ B;  2B1E A;  3HR0 A;  3D0T A;  3JAE A;  2LJL A;  2NWB A;  3ZSS A;  5JRC A;  4GK0 E;  4I4T E;  5GON E;  3U3I A;  4QXB B;  3ZT5 A;  3FZL B;  2WB5 A;  3QK6 A;  3ZST A;  1WRD A;  3M65 A;  4IE6 A;  2H7O A;  4NXM T;  2LKH A;  3ZPO A;  1LVF A;  2RPA A;  4E7S A;  3VKG A;  4DR4 T;  2A2F X;  3CX8 B;  1KEY A;  2NW8 A;  5HXE A;  4X1K E;  4ZI3 C;  2IAK A;  4GOU A;  4Z91 A;  4CXW A;  3RIF A;  3OYZ A;  2WWU A;  3C4X A;  3UUM A;  5KDM C;  2XHE B;  3MA9 A;  4U7Y A;  1SUM B;  4F6R C;  1KNR A;  4CZZ B;  5CJ5 A;  5ABG A;  2WCA A;  4HFV A;  2WZI A;  5JRC B;  4OYJ A;  4U72 A;  4BJM A;  2XZE A;  1W9R A;  2ACZ A;  4LF6 T;  4KHZ F;  3BK9 A;  2IML A;  5C8Y E;  2HN1 A;  5LGU B;  4AIS A;  2DWK A;  1HCI A;  3UQ4 A;  5AQM B;  1QLB A;  4ILA A;  4YT0 A;  3CX6 B;  2XM2 A;  3H3M A;  3P4R A;  2PTF A;  2VVS A;  2ACX A;  2W61 A;  3T1H T;  4NUV A;  5F8P A;  2LM2 A;  4CI2 B;  1HNW T;  2X9X A;  5JVD E;  1S94 A;  1WCR A;  2G0U A;  4JLE A;  4ZI3 D;  2KSR A;  4BA9 A;  3OPC A;  2VVN A;  5KX5 E;  2J4G A;  3RQW A;  1DU2 A;  3SOL A;  3CKD A;  1BR4 A;  2X66 A;  3N9N A;  4LMK A;  5J2T E;  4NIQ A;  4EXT A;  2WP9 A;  4CI1 B;  4U31 A;  1Z8U A;  1FIO A;  2LRL A;  3RRC A;  3P4P A;  4DR3 T;  5ADX L;  4ZS2 A;  4U7I A;  3TLS A;  2XQ9 A;  3ZMU B;  2WDR A;  2CWO A;  5CGM A;  4I0U A;  4PNI A;  4EV6 A;  5HWY A;  5FP3 A;  4AXP A;  3N9M A;  4TWD A;  2KZ7 B;  3UFE A;  5LHI B;  3AXJ A;  3ZN1 B;  1HNZ T;  4LMJ A;  4DV0 T;  3FHN A;  2L9Q A;  2XTL A;  1N34 T;  2XQ5 A;  2DHR A;  3PUQ A;  2W62 A;  2VUR A;  3C98 B;  3VRA A;  4DV5 T;  4L5G A;  2H3R A;  1T72 A;  5LMU T;  4IDZ A;  4AKH A;  1S35 A;  2WZH A;  2XUE A;  2QA7 A;  3ONJ A;  2XAS B;  4FJO A;  2DI4 A;  3TLV A;  4UV9 B;  3LJC A;  3O9X A;  3LK4 2;  2N2N A;  3KV9 A;  4TNW A;  2XSA A;  3P8C D;  3O1H A;  4C91 A;  2A72 A;  5CFB A;  5CA1 E;  2HPJ A;  4K0U A;  4LF7 T;  4DR7 T;  1SA0 E;  2E9X C;  3DJB A;  4HFC A;  1ZKE A;  5LGN B;  2KT9 A;  3AXJ B;  2RA1 A;  4X62 T;  4PJJ A;  4KMC A;  2PG8 A;  4A56 A;  1E2A A;  4H9O C;  3PV0 F;  4L9I A;  4G2A A;  4EGW A;  5FY1 A;  5ABF A;  3AED A;  3NRY A;  5IUX A;  2HH7 A;  3EI0 A;  3ZMT B;  2CLY C;  4Z8X A;  4PJL A;  2XQ4 A;  1BR1 A;  3C64 A;  5JDH A;  1XNR T;  1NEK A;  2JQQ A;  4I43 B;  3ZEF B;  4A5X A;  2YKS A;  1NAF A;  3ZLI A;  3IA3 A;  5L3C B;  4FI5 A;  4DMW A;  3ZYL A;  5HEJ A;  3PUR A;  1SHZ C;  2CBI A;  1Y01 A;  3OTO T;  4UR9 A;  3SS1 A;  5BMV E;  2W0G A;  3AEG A;  3KV6 A;  2LSY A;  4F8H A;  3UUL A;  1IAP A;  3PUS A;  4UIG A;  4U2Y A;  2K24 A;  4KUM B;  3RIU C;  1H7C A;  4WBO A;  3RF1 A;  2E5V A;  4WBN E;  4IDP A;  1FEW A;  5ABF B;  2KND A;  1ZHC A;  3I9Y A;  4CN4 A;  5LG4 A;  2JQK A;  3RHW A;  4JI6 T;  2I59 A;  2MAW A;  4YTN A;  4ZI2 C;  1X79 A;  3HL6 A;  3HA4 A;  2IC6 A;  4GYS A;  4TN7 B;  3AEF A;  4UF0 A;  3RKO A;  2V7J A;  2NW7 A;  3C4Z A;  4YTP A;  3UU5 A;  4QWN B;  3B13 A;  1G8X A;  4O2A E;  5FVK A;  2BVL A;  3PTR B;  2YU2 A;  4OK0 A;  1WYB A;  1XZY A;  3AA7 B;  3QB5 K;  2W67 A;  2VL8 A;  2X0L B;  4IDQ A;  1J5W A;  3AA6 B;  2K3W A;  4TZ4 C;  4P0A A;  3FZF B;  5AQS B;  1I94 T;  3KBU A;  4YHH T;  5FXX A;  5L3B B;  4X20 E;  4LFB T;  4DV1 T;  1N32 T;  1KNZ A;  2ZM6 T;  4ISS A;  3P50 A;  2LHN A;  4UXN B;  1B7T A;  5ETW A;  3AE7 A;  4ZS3 A;  1MMD A;  2UXC T;  3RGL A;  1D0Z A;  4HEA A;  4UF0 B;  5JR9 A;  5LNK A;  2CM0 A;  3OKQ A;  4GYR A;  3ZMZ B;  3EAB A;  2MOZ A;  3CVR A;  2X0Y A;  4E7Z A;  4IL4 A;  3NZP A;  4G63 A;  3A8Y C;  3FXE B;  5JDG A;  4OX9 T;  1W0B A;  3CX7 B;  4DV3 T;  5A1L A;  1AJ3 A;  4JI3 T;  2MTQ A;  3ZC1 A;  1I6Z A;  4YJ3 E;  5DQV A;  3ZT6 A;  5ABH A;  3KVA A;  3BQI A;  3NWI A;  3RH3 A;  4BAY B;  1KNP A;  2P9B A;  4GKK T;  5JQG E;  3DP7 A;  5LJN A;  2OA5 A;  1FMW A;  3U78 A;  2KLQ A;  1HR0 T;  4JEH B;  5FVL A;  4HFD A;  4X65 T;  4H9S E;  3SRZ A;  4X1Y E;  5C3J A;  2CHO A;  3HKB E;  4QXC B;  3Q2M A;  3VR8 A;  2CEA A;  3ZCI A;  5L3E B;  2QRX A;  1YKE B;  4AKG A;  3ZYM A;  4PAG A;  4EYU A;  4HWH A;  1UGO A;  2CBJ A;  2N9D A;  2LSK A;  3EVY A;  3N2K E;  4OFZ A;  1QSD A;  4TWH A;  5AQP B; 
#chains in the Genus database with same CATH homology
 2G0U A;  2XAG B;  3O1I A;  4JLE A;  3W15 B;  3WAK A;  4ZI3 D;  5LYJ E;  2YU1 A;  5FY0 A;  4OHF A;  3C4W A;  4KP3 C;  4BA9 A;  4ERR A;  2W63 A;  2WAU A;  2CXD A;  4IE7 A;  5KX5 E;  1WR6 A;  3L3P A;  2M67 A;  2C5J A;  5JH7 E;  2KXP B;  3WI3 A;  2ZLY A;  3KV5 A;  4H9R C;  3SOL A;  1ZEE A;  3CKD A;  1BR4 A;  4EAH A;  2Q9Q D;  5EZY E;  3Q5X A;  2X66 A;  4MLK A;  3N9N A;  3ZJ2 A;  3AVS A;  2ZM8 A;  1YKH B;  3L09 A;  5FXZ A;  3N9O A;  4HN9 A;  2CWY A;  2XQY A;  5LGT B;  4L0R A;  5J2T E;  2WSS V;  4IIJ E;  4J2C A;  4EXT A;  4PJN A;  5H6R B;  4HGA A;  4CI1 B;  4DVD A;  3OBV E;  1FIO A;  2UXN B;  2V26 A;  3ONX A;  2EHO A;  2X51 A;  4XAX B;  5LHG B;  1HS7 A;  3RRC A;  3AAE B;  3DTO A;  4YLH A;  2D0T A;  2DCF A;  5ADX L;  2YEV C;  4ZS2 A;  2XAH B;  3VKH A;  2NTX A;  4HTE A;  5HXH A;  3KV4 A;  3ZMU B;  3R84 B;  3MKD A;  3LBX B;  4ILU A;  4DBQ A;  2CWO A;  5LBM A;  3F57 A;  4MHC A;  5JR9 C;  4O4I E;  2E9X B;  2ZM0 A;  4PNI A;  5JDL A;  1Z0P A;  4X1I E;  3PDY A;  5HWX A;  4TV8 E;  5HWY A;  5FP3 A;  4AXP A;  3N9M A;  3I1A A;  2KZ7 B;  5LXT E;  3UFE A;  5L3F B;  2YIN A;  2IW5 B;  1MIV A;  3VHL A;  4PK5 A;  5LHI B;  3H37 A;  5FXV A;  5HXS A;  3N2O A;  2JPF A;  4IE0 A;  1HG2 A;  3LK2 B;  3ZN1 B;  1MMN A;  3V5S A;  2Q9Q C;  5LHH B;  2BVM A;  2BZB A;  2CLY B;  5L3D B;  5E0O A;  4CI3 B;  2LE8 A;  2KMF A;  3FHN A;  4AQG A;  4UVB B;  3F2E A;  2L9Q A;  3S4U A;  2XTL A;  3ZYK A;  1U5P A;  2DHR A;  2DLR A;  2E9X D;  3AVR A;  3PUQ A;  2UXX B;  2W62 A;  4O8S A;  3T8O A;  4P09 A;  2ZMA A;  3C98 B;  4IE4 A;  4DMV A;  4YFS A;  1KK7 A;  4L5G A;  2H3R A;  4C90 A;  3TKL B;  3AA1 B;  3UUN A;  5DAB A;  4O4J E;  5CA0 E;  1MIY A;  2X9H A;  3RYF E;  3RPU A;  2VK9 A;  2CE7 A;  3QUJ A;  2L3L A;  4IDZ A;  4AKH A;  5LCY A;  5FY7 A;  3FBL A;  1S35 A;  3JC6 C;  2SPC A;  5JR9 B;  2JMH A;  2EHO B;  3K3N A;  3O1J A;  1UX4 A;  2XUE A;  2HPL A;  2QA7 A;  3IBP A;  5AFU L;  2Z6E A;  1LVK A;  3CPZ A;  2NOX A;  2XAS B;  4FJO A;  2DI4 A;  3HKC E;  4DND A;  2PJQ A;  4UV9 B;  2ZM2 A;  3RC8 A;  4PFO A;  3LJC A;  5DJQ C;  3PU3 A;  4I50 E;  3I9W A;  3MJX A;  3IHR A;  3O9X A;  4MAL A;  5LOV E;  3P7I A;  3LK4 2;  5JRE A;  5L3G B;  2N2N A;  3KV9 A;  3E0Z A;  3P8C D;  3ANW A;  3O1H A;  1HFA A;  5H6Q B;  3F31 A;  4C91 A;  2A72 A;  2ES0 A;  2GK9 A;  5CA1 E;  2HPJ A;  2EHO D;  2X68 A;  5EK4 A;  3SWH A;  2WBL A;  4K0U A;  3NBX X;  3MK7 C;  1SA0 E;  2K9A A;  2D2S A;  2E9X C;  3ZC0 A;  2L8K A;  2LOP A;  3DJB A;  3FBZ A;  3WAJ A;  3HI2 A;  1ZKE A;  5LGN B;  2CA5 A;  2KT9 A;  2RA1 A;  5EK2 A;  4PJJ A;  3C51 A;  2D0U A;  4KMC A;  4CXX A;  1FMV A;  4AQF C;  3CQC B;  2PG8 A;  4A56 A;  4H9O C;  4L9I A;  3UUX B;  3ZN0 B;  5FNV E;  2LSI A;  1YD8 G;  3N9Q A;  4G2A A;  5FY1 A;  1LRZ A;  3AA0 B;  1NWM X;  3NRY A;  1UX5 A;  2HH7 A;  4HKA A;  3CQX C;  4DBR A;  3K3O A;  3ZMT B;  2CLY C;  3E22 E;  4PJL A;  2C5K T;  4Z8X A;  3I0Q A;  1U4Q A;  5HAX A;  2DNX A;  1BR1 A;  3J9X 1;  3C64 A;  5JDH A;  3MAC A;  1OXZ A;  2JRK A;  2JJ9 A;  2WMN A;  2CCQ A;  3PUG A;  3GWH A;  4N78 D;  2X9Y A;  1E1H B;  2BDE A;  3UTK A;  2V7K A;  2V7L A;  1BR0 A;  4I55 E;  2JQQ A;  4I43 B;  2QGS A;  5HXR A;  3ZEF B;  1BR2 A;  4QXH B;  4ZOL E;  4IE5 A;  3OYX A;  3JC6 D;  1NAF A;  3ZLI A;  2Y6X A;  4UEM A;  2V7I A;  3R6N A;  4ADZ A;  5M4Y A;  1MIW A;  3RC3 A;  4B6X A;  5L3C B;  4FI5 A;  2LT3 A;  3KDS E;  4DMW A;  4ZI2 D;  3ZYL A;  3PUR A;  3UT5 E;  4IHJ E;  2EHO C;  4MFR A;  3ZMS B;  1SHZ C;  4V1A v;  3AAA B;  4H63 V;  1Y64 B;  3RRW A;  2Y48 B;  2LHR A;  3SS1 A;  5BMV E;  2W0G A;  2PFV A;  4YJ2 E;  3KV6 A;  3ANW B;  2MYS A;  2LSY A;  4GIW A;  5J2U E;  2A3D A;  2VAS A;  3UUL A;  1OWA A;  3MXZ A;  4QX7 B;  1EZ3 A;  1IAP A;  3PUS A;  4UIG A;  1D1A A;  2K5B B;  5L2L A;  2H7V C;  4AKR B;  1LKX A;  2Y8D A;  3LG7 A;  1VRB A;  2CMR A;  3FB2 A;  4O4H E;  3VU7 H;  2K24 A;  4O2B E;  4CQI A;  4KUM B;  1WLX A;  2MBG A;  4H9N C;  3HKD E;  2V1D B;  2NP9 A;  1H7C A;  3PUA A;  4UVA B;  5JDQ A;  2WMO A;  2V7M A;  4WBO A;  4EZH A;  1D0Y A;  2XAQ B;  5LP6 E;  3C50 A;  4WBN E;  3I0O A;  1FEW A;  4XZC A;  2KND A;  1ZHC A;  3I9Y A;  3O4X E;  3KVB A;  2E8I A;  3OJA A;  3CQG B;  2N1G A;  5LG4 A;  1MMG A;  1MND A;  3NRX A;  5FMN A;  2XAF B;  1D1C A;  3E08 A;  3PU8 A;  5DQW A;  4AKI A;  4UEL A;  2W00 A;  5FYM A;  5JDN A;  2XAJ B;  2I59 A;  5KMG P;  4ZI2 C;  3IF8 B;  1X79 A;  3HL6 A;  3HA4 A;  2IC6 A;  4BJN A;  4GYS A;  4TN7 B;  3EUH A;  4UF0 A;  2V7J A;  2NW7 A;  3RKO A;  3NZQ A;  4TX5 A;  3GMI A;  3C4Z A;  4QWN B;  1WYC A;  4DO0 A;  3ETU A;  3B13 A;  1G8X A;  4O2A E;  4EB6 E;  2X67 A;  2BVL A;  4UV8 B;  3RYC E;  1HTJ F;  5J1G A;  3PTR B;  2YU2 A;  3Q9D A;  2LEH A;  2KIN B;  3N9L A;  4OK0 A;  1WYB A;  4QHO A;  3EDV A;  4GK5 E;  4TV9 E;  5IYZ E;  4EYY R;  3AA7 B;  2NTY A;  1HX8 A;  4PJM A;  2LSG A;  3BQK A;  1O3X A;  2VL8 A;  2X0L B;  4ASK A;  5TAO A;  3H3A A;  5IHY A;  2DWG A;  4AI6 A;  3RX6 A;  1CUN A;  4AKL A;  1D1B A;  1IJ6 A;  3N9P A;  2CXL A;  1US7 B;  1QUU A;  2LOS A;  2RP4 A;  3Q5W A;  3AA6 B;  2VKD A;  4PK4 A;  4P0A A;  4TZ4 C;  1T98 A;  2YK0 A;  4H9P C;  4JUY A;  4PW8 A;  3KFW X;  3ZCJ A;  4ZI7 E;  5F3J A;  4EOZ B;  2B1E A;  2J1D G;  3HR0 A;  3D0T A;  2LJL A;  3KBU A;  3ZJ1 A;  2NWB A;  5FXX A;  5JRC A;  5L3B B;  1IJ5 A;  4X20 E;  4GK0 E;  4U74 A;  3ZMV B;  4I4T E;  5GON E;  3MZK B;  2ODV A;  3U3I A;  4QXB B;  4XBF B;  3RYI E;  4MBQ A;  4IST A;  3RYH E;  1KNZ A;  4ISS A;  4UXN B;  2D5U A;  2LHN A;  1B7T A;  2IC9 A;  4EZ4 A;  5ETW A;  4PFP A;  4ZS3 A;  1MMD A;  4JEU B;  2KWH A;  2VB6 A;  3QK6 A;  4O4L E;  5EK3 A;  5HYA A;  1D0Z A;  4TUY E;  1WRD A;  4OYK A;  3M65 A;  4ANJ A;  1G73 A;  2ODU A;  4HEA A;  4UF0 B;  3QC9 A;  5HXC A;  4IE6 A;  5JR9 A;  3AB3 B;  3HKE E;  1V9D A;  2H7O A;  3V5U A;  5LNK A;  2CM0 A;  3OKQ A;  4GYR A;  3ZMZ B;  3EDU A;  2MOZ A;  3GN5 A;  3ZPO A;  1LVF A;  4E7S A;  3CVR A;  3N5L A;  4E7Z A;  4M1P A;  3VKG A;  3CML A;  2A2F X;  3ESL A;  3NZP A;  3CX8 B;  4G63 A;  3A5X A;  3FXD B;  2NW8 A;  2VKO A;  3FXE B;  5JDG A;  1HF8 A;  3K3Q C;  2PBI A;  5JDF A;  3CX7 B;  1IZN B;  2Q9Q A;  5HXE A;  4X1K E;  4ZI3 C;  4QX8 B;  5A1L A;  2IAK A;  1AJ3 A;  2MTQ A;  3ZC1 A;  4GOU A;  3KBT A;  2X9W A;  4PK6 A;  2K48 A;  1HG5 A;  4CXW A;  2VKJ A;  3OYZ A;  4YJ3 E;  3PE0 A;  4P0B A;  5DQV A;  4WNK A;  4EIW A;  3KVA A;  2WWU A;  3C4X A;  3BQI A;  3RH3 A;  4BAY B;  2JMK A;  3UUM A;  5LBQ B;  2P9B A;  4QKN A;  3N2G E;  5LA6 E;  5JQG E;  5KDM C;  2XHE B;  2WM9 A;  3K8P C;  1YW0 A;  2KWI B;  4WW0 A;  3DP7 A;  3LFM A;  4H9Q C;  3MA9 A;  3CWZ B;  1VOM A;  4HE8 A;  4YHJ A;  2LM9 A;  2LSJ A;  4F6R C;  2OA5 A;  5LJN A;  1FMW A;  1ZV4 X;  4CZZ B;  5JRC B;  4HFV A;  4OYJ A;  4U72 A;  4BJM A;  3U78 A;  5CB4 E;  2VKH A;  2KLQ A;  4NUU A;  4JEH B;  4KBM B;  4H9S E;  3SRZ A;  4X1Y E;  3BK9 A;  3LK3 B;  5LJM A;  3HKB E;  4H63 H;  4QXC B;  5C8Y E;  4IGU A;  3ETV A;  3Q2M A;  1MMA A;  5LGU B;  2CEA A;  2DWK A;  1HCI A;  4CXY A;  4ZHQ E;  2VWA A;  3KIN B;  4UVC B;  1MNE A;  3ZCI A;  5L3E B;  1YKE B;  4AKG A;  3ZYM A;  3CX6 B;  4PAG A;  4EYU A;  2NW9 A;  3LBX A;  3GN5 B;  3GA8 A;  1UCU A;  2ACX A;  2W61 A;  5JDM A;  4NUV A;  3IEE A;  5F8P A;  1D0X A;  2C5I T;  4CI2 B;  2E9X A;  2N9D A;  2CXF A;  5FXW A;  2LSK A;  3BQL A;  3EVY A;  3N2K E;  4OFZ A;  2X9X A;  2C0S A;  5JVD E;  2Q9Q B;  1QSD A;  4AQF A;  1S94 A;  3B57 A;  3AAI A;  3J7Y q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...