2N2NA

Tom1 negatively modulates binding of tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
EQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tom1 Modulates Binding of Tollip to Phosphatidylinositol 3-Phosphate via a Coupled Folding and Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Target of Myb protein 1
total genus 36
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2n2nA00
1NWMX 1YD8G 2N9DA 2N2NA 1WRDA 1WR6A 1O3XA 1OXZA 1X79A 1NAFA
chains in the Genus database with same CATH superfamily
2VVNA 2E5LT 5AQGB 4EYYR 5L3FB 3N9NA 1YD8G 3KV6A 2WS3A 4DV3T 3T1HT 3E22E 4V1Av 4QX7B 5LYJE 1HTJF 2BBJA 3UU5A 3UU3A 2KINB 3PUVF 3K3OA 1G8XA 3P4PA 4ISTA 5AQLB 5FVKA 5JDMA 4JI3T 5JR9B 2E9XC 3S4UA 4L0RA 4LFAT 1ZV4X 3DJBA 4DR1T 4K0KT 4ZI7E 1QSDA 4KX6A 3F2EA 2VQFT 2YEVC 2WDQA 1VCSA 4PNIA 4YSXA 2V1DB 5FXVA 5JRCB 2XAGB 4CXYA 3MXZA 4DUYT 5F5WA 1SUMB 2JMKA 2K3WA 2HN2A 2MTQA 3FXEB 4HWHA 5HEOA 5JTGA 3OPCA 3SS1A 3TLSA 1MMAA 2VKJA 4ILAA 4B3TT 4X62T 2OLTA 2YU1A 2IDOB 3AE8A 2KMFA 2IC6A 3ZCIA 2UXDT 5JR9A 4CZZB 3I9YA 3BQLA 4F6RC 4LF9T 4HFVA 4PK4A 2XASB 4HWIB 4PW8A 4TN7B 1WFDA 4CQIA 5JDLA 3F57A 5TAOA 2E5VA 1Y01A 2BVLA 3PUQA 2D9DA 3QB5A 3AE7A 1U4QA 4ILBA 2X68A 4U2ZA 3NZQA 1MIWA 3H3MA 5AQHB 3ZYKA 5L47A 3RPUA 4EGWA 3V5UA 1IJ6A 4L9IA 1ZEEA 2WAUA 2KLQA 3N9OA 3NWIA 2JMHA 2XQAA 5J2UE 4WNKA 4DR5T 3AVSA 2I6HA 3OYXA 3SWHA 4ASKA 3CX6B 3MZKB 2DWKA 4O4IE 1ZKEA 5FXXA 2H3RA 3AE1A 2KT9A 2UU9T 4UELA 1M62A 4JYAT 4HE8A 4JI4T 2XQ3A 2WWUA 3PUAA 5LGUB 3AAEB 2CXDA 4TWDA 4ZHQE 5LGNB 3PUSA 1HNZT 5JQGE 3ZLIA 3EHZA 3ZMUB 4DVDA 3GN5A 3ZSTA 3KV9A 4P0BA 2CWYA 2X9HA 2IIUA 3ZMZB 1XNRT 2CBJA 2CHNA 1UX4A 2CWOA 4GK0E 4A56A 4HFCA 2YKSA 4TV8E 5AQRB 5JRCA 2I59A 2JIWA 2CXLA 3AEGA 3HKEE 4OFZA 5LB7B 4COFA 4YTNA 5HXEA 1IJ5A 4UV9B 5LP6E 1E7PA 2W61A 4DV4T 2V5DA 1YW0A 2E9XA 3U3IA 2W0GA 2RA1A 4UVAB 4LF6T 2SPCA 4WW0A 5LA6E 2QRXA 5DQWA 2E9XD 3AE6A 4ZEYA 4DV1T 2G0UA 3SRZA 3C98B 1OXZA 3AE2A 1LKXA 1Z8UA 3K8PC 1HF8A 2OA5A 3P8CD 4H63V 1OEDE 4J2CA 5HEUA 4AKIA 4U31A 3C64A 4O2AE 2RPAA 2IMLA 3UQ7A 1WLXA 4I4TE 4EIWA 2X9YA 4U3CA 2BKOA 5LG3A 4PAGA 3P50A 4TWHA 3OBVE 2VB6A 1ZOYA 1G73A 3P4RA 4TWFA 3RHWA 5ABGA 5AQIB 4U2YA 2DNXA 3ZMTB 2WZHA 1IZNB 5JR9C 2PJQA 5JDHA 2LRLA 4PJJA 4QX8B 2KSRA 3E0ZA 5C2TA 2JQHA 3GWHA 3IEEA 2UUBT 2C5JA 2UXNB 4KI0F 4OYKA 5FL0A 4JI0T 5AQUB 4H9SE 3RYIE 4AKHA 3T8OA 1D1BA 1D0XA 4PFPA 4L5GA 3D0TA 2CLYB 2L9QA 5DABA 2CXFA 1VRBA 4IE4A 1J5WA 3LBXB 3QB5K 4GK5E 4DUZT 5H6QB 4B3ST 3UU6A 4LFBT 2FBWA 4UVBB 2A9UA 2BG9C 4B6XA 3RH3A 4LF5T 3RX6A 5CGMA 3ONJA 2FJBA 4PJNA 5H6RB 3KVBA 3CIRA 3NRXA 3QNUA 1KNPA 2BDEA 1T72A 1L0VA 2IHR1 4AQFC 1WR0A 4DR3T 4HWDA 2XAHB 2D5UA 2X0HA 4E7SA 3CQGB 3GMIA 5AQVB 4F8HA 4ZZCA 2NR4A 5J0ZA 3CQXC 4YHHT 1Z0PA 4LF4T 1B7TA 3AEEA 2NTXA 2V26A 4A97A 1MNEA 2XAJB 3P4SA 2DWGA 2V8SV 3I0QA 4N78D 4DNDA 2MOZA 4EYUA 2YDQA 4LMLA 4WZXA 4OK0A 2WZIA 4WYVA 3RI5A 3NVOA 3PV0F 3J9X1 1HNWT 2H7VC 2W00A 1KEYA 5HCMA 1O3XA 1FEWA 2IC9A 2LRKA 3AA0B 3VHLA 3WI3A 4ADZA 2X0YA 2WMNA 1J1JA 2QA7A 2V7KA 4ILUA 1SE7A 4YFSA 1JNRA 5HEGA 1DU2A 5JDQA 5KMGP 2HN1A 2N9DA 3GA8A 1I94T 3A8YC 1S94A 1UGOA 1YQ4A 3HA4A 4KP3C 2KNDA 1WCRA 2W2UA 2ZMAA 3U78A 5LBQB 2XQ6A 2BKNA 2V5CA 2WBLA 3NRYA 4DV7T 5DQVA 5AQFB 4Z8XA 5L3DB 3PJAA 4JEHB 4CI1B 4JI7T 4HWFA 1MIYA 2CCQA 3H37A 4WBNE 2LT3A 5A1LA 2X51A 2C5IT 5HWYA 3RKGA 3FZFB 3TKLB 2XTLA 2PFVA 3FZMB 2HHHT 4DR4T 2H89A 2M6IA 3RYFE 3M3ZB 1Y64B 4YHJA 4I43B 1NWMX 3PJAJ 2EHOB 1T8BA 2HPJA 2LLYA 3CPZA 5FY0A 3WAJA 3K1SA 2CLYC 3AE3A 3FB2A 1N33T 5HCJA 2XAQB 2BG9A 4O4JE 3CVRA 2WSSV 2DI4A 3AEFA 3ZMSB 3L8RA 2BG9B 2EHOC 2LM9A 5EK3A 4PFOA 1KNZA 3TLWA 1NAFA 4UF0B 2IUBA 4YTMA 2A3DA 2JRKA 3EI0A 4U7IA 2DHRA 3Q5XA 1QLBA 2Y8DA 3P7IA 4NUUA 4X20E 3RGLA 2WY2A 3N2GE 2IAKA 3M65A 3Q5WA 2ZM0A 3TLTA 4U72A 4AISA 2FJAA 4O4HE 5HXRA 4CN1A 2YN6A 3PUWF 2CM0A 5AQQB 4EZ4A 4DV5T 2J47A 1KK7A 2V7MA 4EZHA 3F31A 1HG5A 2WB5A 3ABVA 4JI5T 2QVAA 5FVLA 3UUBA 1J5ET 2BS2A 1YQ3A 3MKDA 4CI3B 5AQSB 4A98A 2PBIA 4DIDB 3J7Yq 3QC9A 3UUMA 2VQET 3PE0A 5IUXA 3B13A 1KF6A 3OKQA 2DLRA 5FY7A 4LF8T 2F4VT 3AEDA 5LJNA 1IBMT 1VCTA 1YXRA 3CK6A 2VVSA 3KV5A 4IHJE 4HFDA 3RRWA 1HNXT 1IBLT 4LFCT 1GQEA 5HAXA 1U5PA 3AE4A 2QGSA 4YSYA 3PDYA 2VK9A 4HFBA 5AFUL 5LMNT 4NXNT 5AQMB 2ODUA 5C8YE 2Y6XA 3AA1B 3T1YT 4YTPA 1T7SA 2EHOD 5HEHA 3JAEA 3A5XA 3AE5A 2K9AA 2N1GA 4I0UA 2BZBA 1MMDA 1YKHB 1IBKT 2WMOA 2B76A 3R84B 3EABA 3EDUA 3AEBA 3AEAA 3RIAA 3ZN0B 4DR6T 4BAYB 4MLKA 1R8IA 5HXSA 4OYJA 3OVUA 2DCFA 2V7IA 2GK9A 3DTOA 3HKCE 4O4LE 5J1GA 4IE7A 3HKBE 1HS7A 2LHNA 4ZI2C 4PK5A 3AXJA 3VRBA 3FZKB 3HI2A 4NPPA 1W9RA 1X79A 3ZT5A 2K48A 3LJCA 1IAPA 4HEAA 4ZZBA 4X65T 2ODVA 5LXTE 2CMRA 2WDRA 3CKDA 5ABHA 5FNVE 2YDRA 3RKOA 3AB3B 2JQKA 5FMNA 3IBPA 1W0BA 2CA5A 2VWAA 3L3PA 2XAFB 3RQWA 4IDOA 3TLVA 4AXPA 5LHIB 2NTYA 3RLFF 2ES0A 1UCUA 2XY8B 4IREA 1HG2A 4PJMA 5FY1A 4DBRA 4H9PC 4QKNA 5M4YA 1W0AA 3AVRA 1YKEB 2WU5A 3LFMA 5ABEA 3ZT6A 2D0UA 4TX5A 3B57A 1MMNA 3ONXA 2VKHA 2VASA 3LG7A 1XDOA 2L3LA 2WU2A 3KFWX 3AECA 3N9MA 5FKYA 4ZI3C 5JVDE 5LBMA 1N36T 3MACA 4HGAA 2XQYA 3ZC0A 2MAWA 1HX1B 2X9WA 2J1DG 4KHZF 4TNWA 3JC6D 3BK9A 3VKHA 4IDZA 5EK2A 2J62A 2LE8A 5HEJA 4CXXA 4QXHB 3OJAA 2Q9QA 3CMLA 3L39A 2BVMA 2VKDA 2WDVA 3N2OA 4K0UA 2JJ9A 3UU8A 3MK7C 4TNVA 5JDNA 5L4EA 4TV9E 1WYBA 4GOUA 4IDPA 1D1AA 3RIUA 3C4ZA 3QOFA 3GN5B 4DMWA 4TUYE 4AIUA 3CX8B 1E1HB 2WM9A 4DR2T 2V6XA 3A7MA 3C50A 4IT4A 4X1KE 5LHHB 3UUNA 3N5LA 4MALA 2QYWA 3ZN1B 1QUUA 5BR8T 2L8KA 2D2SA 3L09A 4DV0T 3ZMVB 5BMVE 3Q5DA 4H9NC 3VU7H 3C51A 5L3EB 3O9XA 2UUCT 4AKLA 2J4GA 4QHOA 4EV6A 4IE5A 1JNZA 5FP3A 1BR0A 2M6BA 2IW5B 4ISSA 4JI2T 2KWIB 2VL0A 3EAMA 3FZLB 4YLHA 5LOVE 2NW9A 4NXMT 2HPLA 3AA6B 3UULA 3VKGA 3PURA 4GKKT 1HCIA 4U7YA 3LK2B 3TLUA 2WCAA 3RF1A 3CX7B 3ZYMA 2VURA 1N32T 4YY3T 1FJGT 3JAFA 2CHOA 2V6YA 2E2AA 2W63A 2W66A 3I1AA 4C91A 2V7LA 5ABFA 3MJXA 2LHRA 3ZEFB 2V7JA 2BBHA 2LSGA 4CI2B 5JREA 5LMUT 1UUSA 2XM2A 4BJMA 1ZHCA 2PTFA 4JI8T 4AQGA 3SFDA 4NUVA 2ZM6T 2ZM2A 3ZSSA 2AE9A 1US7B 4YT0A 2K24A 5JH7E 4NIQA 5IWAT 2CRBA 5HXHA 1XDPA 2X0LB 5HXCA 2PG8A 4BJNA 1XWMA 4XBFB 1MNDA 4GYRA 2M67A 5FL1A 3KV4A 3VR8A 3RYCE 3UU4A 3B5MA 5CB4E 4QXBB 2CE7A 2XUEA 4X1IE 4U74A 1S35A 1OEDB 4ZOLE 5EZYE 3V5SA 4QH5A 1HX8A 3N2KE 4YSZA 4EEBA 2ACZA 3QUJA 2A2FX 1CUNA 1UK5A 3BQIA 2LEHA 1BR2A 2I0MA 3DP7A 1WR6A 3LDQB 4G2AA 4MFRA 1ZP0A 1T98A 2YINA 2P9BA 3G06A 3MA9A 3N9QA 2E9XB 1OEDC 2LSIA 3AE9A 1UX5A 3PUZF 4CN4A 1AJ3A 3QK6A 3AAIA 3RIUC 2MBGA 4DMVA 3E08A 5LG4A 4UVCB 3N9PA 1WRDA 3PU8A 4X66T 2HH7A 2UXCT 4KHPT 3SOLA 4DR7T 2CPTA 3EUHA 3ONLC 3ETUA 3ANWB 3Q9DA 4HFHA 3C4XA 4DBQA 1LVFA 3FBLA 4GYSA 1D1CA 4MHCA 3FHNA 4O8SA 1EZ3A 3PUXF 4OX9T 4IDQA 3CWZB 1KNRA 4A5XA 2EHOA 3PUGA 4JI6T 4IL4A 2BG9E 2LOSA 2LSKA 5LJMA 2ZLYA 3AAAB 3OTOT 1FMWA 4HTEA 5J2TE 5F3JA 4EEDA 2XHEB 2JPFA 2H88A 4IL9A 4DO0A 2Q9QD 2WP9A 3SFEA 3KVAA 4HFIA 4ANJA 3I9WA 5KXJA 3CQCB 2K5BB 2XJ7A 3LK42 4MBQA 4UIGA 2R6GF 2CBIA 2ZM8A 3ZPOA 4ZI3D 5F8PA 4X64T 3HR0A 4TZ4C 3O1IA 2W4XA 3JADA 4WBOA 2YDSA 1CHUA 2X9XA 4GIWA 4G63A 1MMGA 3AXJB 3EDVA 4Z90A 2RP4A 5KX5E 3HKDE 3UT5E 1FIOA 1SA0E 2W62A 2XZEA 3FBZA 3AA7B 5L3BB 3H3AA 4XAXB 4AQYT 2KZ7B 2AXDS 2ACXA 4KBMB 3RC3A 4B3MT 2BS3A 2WQYA 1BR4A 2X66A 2XM1A 4JLEA 5IYZE 3W15B 2YOEA 2Z6EA 4HN9A 2YU2A 3K3QC 2FUPA 3O4XE 4IDNA 5EK4A 3ZT7A 4YXDA 4DV6T 3UTKA 3PTRB 2C0SA 2E8IA 5LGTB 5AQKB 2Y48B 4ZXLA 5C3JA 4B3RT 3RYHE 4ILCA 2NP9A 2LKHA 4QH4A 4X1YE 3X1DA 4KMCA 3C4WA 3IA3A 5AQTB 5L3CB 2Q9QC 5DJQC 5IHYA 4O2BE 3R6NA 2LSYA 4UXNB 2NWBA 4CN6A 2UXXB 5GONE 4P0AA 4E7ZA 2VKOA 4H9QC 4YJ3E 1D0ZA 5ABFB 4JEUB 4PK6A 3UQ4A 2Q9QB 5LHGB 3ZYLA 3RC8A 4GKJT 1W09A 1NEKA 3ZJ2A 3PUYF 4IE6A 5AQJB 1FMVA 1X9BA 2C5KT 5ETWA 1MIVA 2FJDA 4M1PA 4QH1A 5FXWA 1UURA 5E0OA 1WYCA 3EVYA 1OWAA 5L4HA 3UUXB 3UFGA 1VOMA 5L2LA 4DV2T 4JV5T 4X5TA 4H9OC 2LKGA 2KWHA 2LOPA 3KDSE 4FI5A 5LCYA 2V6YB 3N9LA 4EXTA 2LSJA 5FXZA 3ZCJA 1KFYA 4HKAA 3JCFA 4AQFA 4FJOA 4UF0A 4ERRA 4OHFA 5L3GB 4HWCA 2XQ5A 3NKZA 2H7OA 2LJLA 3ZJ1A 3VRAA 2XQ9A 2BS4A 3NBXX 2X67A 3BQKA 4P09A 3RIFA 4AKGA 2NW8A 4JBWF 2XSBA 3LK3B 3P4QA 4LMJA 1LRZA 3ESLA 4P1NA 4ZS3A 4EOZB 1XMOT 2UXBT 3UFEA 5LNKA 4AKRB 3P4WA 3RQUA 1NENA 1HFAA 3KINB 1XNQT 3HL6A 3PU3A 2XQ4A 3FZHB 1SHZC 4LMKA 1HR0T 4BA9A 4EAHA 2MPKA 2FJEA 3I0OA 4I50E 1E2AA 5AQNB 1V9DA 3RRCA 2XSAA 5HYAA 3KBTA 2NW7A 3K3NA 1LVKA 1XZYA 2UUAT 2KXPB 5CFBA 1H7CA 4Z91A 3ETVA 4H9RC 5KDMC 2NOXA 2OV9A 5ADXL 4UEMA 4IGUA 4PJLA 2XQ8A 4C90A 4EB6E 3ZKRA 4H63H 2BKPA 3Q5EA 1OEDA 3O1HA 4UR9A 2CEAA 3OYZA 4HFEA 2W67A 1N34T 3ZC1A 2XQ7A 2JQQA 3Q2MA 5CA1E 3JC6C 3LBXA 2YK0A 4U33A 4IIJE 4KUMB 2DL1A 2N2NA 4QXCB 4LF7T 2VL8A 5CA0E 4IE0A 5JDGA 5CJ5A 4XZCA 4ZI2D 4I55E 4JUYA 4JI1T 2MYSA 3WAKA 1XMQT 3O1JA 1BR1A 2WWVA 1I6ZA 2XPKA 3IHRA 4UV8B 3LSVA 4YJ2E 3ANWA 3IF8B 3KBUA 2A72A 2JQ9A 2D0TA 3VR9A 5JDFA 3NZPA 4CXWA 5HWXA 5FYMA 4AI6A 4Q25A 1D0YA 1M7KA 2B1EA 2LM2A 5AQOB 5AQPB 3FXDB 4ZS2A 4QWNB
chains in the Genus database with same CATH topology
4EYYR 5L3FB 3N9NA 1YD8G 3KV6A 3E22E 4V1Av 4QX7B 5LYJE 1HTJF 2KINB 3K3OA 1G8XA 4ISTA 5JDMA 5JR9B 2E9XC 3S4UA 4L0RA 1ZV4X 3DJBA 4ZI7E 1QSDA 3F2EA 2YEVC 4PNIA 5JRCB 2V1DB 5FXVA 2XAGB 4CXYA 3MXZA 2JMKA 3FXEB 2MTQA 3SS1A 1MMAA 2VKJA 2YU1A 3ZCIA 2KMFA 2IC6A 5JR9A 4CZZB 3I9YA 3BQLA 4HFVA 4PK4A 2XASB 4PW8A 4TN7B 4CQIA 5JDLA 3F57A 5TAOA 3UFEA 2BVLA 3UT5E 3PUQA 1U4QA 3ZYKA 2X68A 3NZQA 1MIWA 3RPUA 3V5UA 1IJ6A 4L9IA 1ZEEA 2WAUA 2KLQA 3N9OA 5J2UE 2JMHA 4WNKA 3AVSA 3OYXA 3SWHA 4ASKA 3CX6B 3MZKB 2DWKA 4O4IE 1ZKEA 5FXXA 2H3RA 2KT9A 4UELA 4HE8A 3PUAA 2WWUA 5LGUB 3AAEB 2CXDA 4ZHQE 5LGNB 3PUSA 5JQGE 3ZLIA 3ZMUB 4DVDA 3GN5A 3KV9A 2CWYA 2X9HA 3ZMZB 1UX4A 2CWOA 4GK0E 4A56A 4TV8E 5JRCA 2I59A 4OFZA 2CXLA 3HKEE 5HXEA 1IJ5A 4UV9B 5LP6E 2W61A 1YW0A 2E9XA 3U3IA 2W0GA 2RA1A 4UVAB 2SPCA 4WW0A 5LA6E 5DQWA 2E9XD 2G0UA 3SRZA 3C98B 1OXZA 1LKXA 3K8PC 3P8CD 1HF8A 2OA5A 4H63V 4J2CA 3J7Yq 4AKIA 3C64A 4O2AE 1WLXA 4I4TE 4EIWA 2X9YA 4PAGA 3OBVE 2VB6A 1G73A 2DNXA 3ZMTB 1IZNB 5JR9C 2PJQA 5JDHA 4QX8B 4PJJA 3E0ZA 3GWHA 3IEEA 2C5JA 2UXNB 4OYKA 4AKHA 3RYIE 4H9SE 3T8OA 1D1BA 1D0XA 4PFPA 4L5GA 3D0TA 2CLYB 2L9QA 5DABA 2CXFA 1VRBA 4IE4A 3LBXB 4GK5E 5H6QB 4UVBB 4B6XA 3RH3A 3RX6A 4PJNA 5H6RB 3KVBA 3NRXA 2BDEA 4AQFC 2XAHB 2D5UA 4E7SA 3CQGB 3GMIA 3CQXC 1Z0PA 1B7TA 2NTXA 2V26A 1MNEA 2XAJB 2DWGA 3I0QA 4N78D 4DNDA 2MOZA 4EYUA 4OK0A 3J9X1 2H7VC 2W00A 1O3XA 1FEWA 2IC9A 3AA0B 3WI3A 4ADZA 4ZI2C 3ZC0A 4YFSA 2WMNA 2V7KA 2QA7A 4ILUA 5JDQA 5KMGP 2N9DA 3GA8A 1S94A 3HA4A 4KP3C 2KNDA 2ZMAA 3U78A 5LBQB 2WBLA 3NRYA 5DQVA 5L3DB 4Z8XA 4JEHB 4CI1B 1MIYA 2CCQA 3H37A 4WBNE 2LT3A 5A1LA 2X51A 2C5IT 3TKLB 2XTLA 2PFVA 3RYFE 1Y64B 4YHJA 4I43B 1NWMX 2EHOB 2HPJA 5FY0A 3WAJA 3CPZA 2CLYC 3FB2A 2XAQB 4O4JE 3CVRA 2WSSV 2DI4A 3ZMSB 2EHOC 2LM9A 5EK3A 4PFOA 1KNZA 1NAFA 4UF0B 2A3DA 2JRKA 2DHRA 3Q5XA 2Y8DA 3P7IA 4NUUA 4X20E 3N2GE 2IAKA 3M65A 3Q5WA 2ZM0A 4U72A 5HXRA 4O4HE 2CM0A 4EZ4A 1KK7A 2V7MA 4EZHA 3F31A 1HG5A 3MKDA 4CI3B 2PBIA 3QC9A 3UUMA 3PE0A 3B13A 3OKQA 2DLRA 5LJNA 3KV5A 4IHJE 3RRWA 5HAXA 1U5PA 2QGSA 5AFUL 3PDYA 2VK9A 5C8YE 2ODUA 2Y6XA 3AA1B 2EHOD 3A5XA 2K9AA 2N1GA 1MMDA 2BZBA 1YKHB 2WMOA 3R84B 3EDUA 3ZN0B 4BAYB 4MLKA 5HXSA 4OYJA 2DCFA 2V7IA 2GK9A 3DTOA 3HKCE 4O4LE 5J1GA 4IE7A 3HKBE 1HS7A 2LHNA 4PK5A 3HI2A 1X79A 2K48A 3LJCA 1IAPA 4HEAA 2ODVA 5LXTE 2CMRA 3CKDA 5FNVE 3RKOA 3AB3B 5FMNA 3IBPA 2VWAA 2CA5A 3L3PA 2XAFB 5LHIB 4AXPA 2NTYA 2ES0A 1UCUA 1HG2A 4PJMA 5FY1A 4DBRA 4H9PC 4QKNA 5M4YA 3AVRA 1YKEB 3LFMA 2D0UA 4TX5A 3B57A 1MMNA 3ONXA 2VKHA 2VASA 3LG7A 2L3LA 3KFWX 3N9MA 4ZI3C 5JVDE 5LBMA 3MACA 4HGAA 2XQYA 2X9WA 2J1DG 3JC6D 3BK9A 3VKHA 4IDZA 5EK2A 2LE8A 4CXXA 4QXHB 3OJAA 2Q9QA 3CMLA 2BVMA 2VKDA 3N2OA 4K0UA 2JJ9A 3MK7C 5JDNA 4TV9E 1WYBA 4GOUA 1D1AA 4DMWA 3C4ZA 3GN5B 4TUYE 3CX8B 1E1HB 2WM9A 3C50A 4X1KE 5LHHB 3UUNA 3N5LA 4MALA 3ZN1B 1QUUA 2L8KA 2D2SA 3L09A 3ZMVB 5BMVE 3VU7H 4H9NC 5L3EB 3C51A 3O9XA 4AKLA 1BR0A 4QHOA 4IE5A 5FP3A 2IW5B 4ISSA 2KWIB 5LOVE 4YLHA 2NW9A 2HPLA 3AA6B 3UULA 3VKGA 3PURA 1HCIA 3LK2B 3ZYMA 3CX7B 3I1AA 2W63A 4C91A 2V7LA 3MJXA 2LHRA 3ZEFB 2V7JA 2LSGA 4CI2B 5JREA 4BJMA 1ZHCA 4AQGA 4NUVA 2ZM2A 5JH7E 1US7B 2K24A 5HXHA 2X0LB 5HXCA 2PG8A 4BJNA 4XBFB 1MNDA 4GYRA 2M67A 3KV4A 3RYCE 5CB4E 4QXBB 2CE7A 2XUEA 4X1IE 4U74A 1S35A 4ZOLE 5EZYE 3V5SA 4F6RC 1HX8A 3N2KE 3QUJA 2A2FX 3DP7A 1CUNA 3BQIA 1BR2A 2LEHA 4G2AA 4P0BA 1WR6A 4MFRA 3N9QA 1T98A 2YINA 2P9BA 3MA9A 1AJ3A 2E9XB 2LSIA 1UX5A 3QK6A 3AAIA 2MBGA 4DMVA 3E08A 5LG4A 4UVCB 3N9PA 1WRDA 3PU8A 2HH7A 3SOLA 3EUHA 3Q9DA 3ETUA 3ANWB 3C4XA 4DBQA 1LVFA 3FBLA 4GYSA 1D1CA 4MHCA 3FHNA 4O8SA 1EZ3A 3CWZB 2EHOA 3PUGA 2LOSA 2LSKA 5LJMA 2ZLYA 3AAAB 1FMWA 4HTEA 5J2TE 5F3JA 2XHEB 2JPFA 4DO0A 2Q9QD 3KVAA 4ANJA 3I9WA 3CQCB 2K5BB 3LK42 4MBQA 4UIGA 3ZPOA 4ZI3D 5L3GB 2ZM8A 5F8PA 3HR0A 4TZ4C 3O1IA 4WBOA 4GIWA 2X9XA 4G63A 1MMGA 3EDVA 2RP4A 5KX5E 3HKDE 1FIOA 1SA0E 2W62A 3FBZA 3AA7B 5L3BB 3H3AA 4XAXB 2KZ7B 2ACXA 4KBMB 3RC3A 2X66A 1BR4A 5IYZE 4JLEA 3W15B 4HN9A 2Z6EA 2YU2A 3K3QC 3O4XE 5EK4A 3UTKA 3PTRB 2C0SA 2E8IA 5LGTB 2Y48B 3RYHE 2NP9A 4X1YE 4KMCA 3C4WA 5L3CB 2Q9QC 5DJQC 5IHYA 4O2BE 3R6NA 2LSYA 4UXNB 2NWBA 2UXXB 5GONE 4P0AA 4E7ZA 2VKOA 4H9QC 4YJ3E 1D0ZA 4JEUB 4PK6A 3RC8A 2Q9QB 5LHGB 3ZYLA 3ZJ2A 4IE6A 1FMVA 2C5KT 5ETWA 5FXWA 1MIVA 4M1PA 5HWYA 3VHLA 5E0OA 1WYCA 3EVYA 1OWAA 3UUXB 1VOMA 5L2LA 4H9OC 2LOPA 2KWHA 3KDSE 4FI5A 5LCYA 3N9LA 4EXTA 2LSJA 5FXZA 3ZCJA 4HKAA 4AQFA 4FJOA 4UF0A 4ERRA 4OHFA 2H7OA 2LJLA 3ZJ1A 3NBXX 4AKGA 2X67A 3BQKA 4P09A 2NW8A 3LK3B 1LRZA 3ESLA 4ZS3A 4EOZB 5LNKA 4AKRB 3KINB 1HFAA 3HL6A 3PU3A 1SHZC 4BA9A 4EAHA 3I0OA 4I50E 1V9DA 3RRCA 5HYAA 3KBTA 2NW7A 3K3NA 1LVKA 2KXPB 1H7CA 3ETVA 4H9RC 5KDMC 2NOXA 5ADXL 4UEMA 4IGUA 4PJLA 4C90A 4EB6E 4H63H 3O1HA 2CEAA 3OYZA 3ZC1A 2JQQA 3Q2MA 5CA1E 3JC6C 3LBXA 2YK0A 4IIJE 4KUMB 2N2NA 4QXCB 2VL8A 5CA0E 4IE0A 5JDGA 4XZCA 4ZI2D 4I55E 4JUYA 2MYSA 3WAKA 3O1JA 1BR1A 3IHRA 4UV8B 4YJ2E 3ANWA 3IF8B 3KBUA 2A72A 2D0TA 5JDFA 3NZPA 4CXWA 5HWXA 5FYMA 4AI6A 1D0YA 2B1EA 5FY7A 3FXDB 4ZS2A 4QWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWM X;  1YD8 G;  2N9D A;  2N2N A;  1WRD A;  1WR6 A;  1O3X A;  1OXZ A;  1X79 A;  1NAF A; 
#chains in the Genus database with same CATH topology
 2VVN A;  2E5L T;  5AQG B;  4EYY R;  5L3F B;  3N9N A;  1YD8 G;  3KV6 A;  2WS3 A;  4DV3 T;  3T1H T;  3E22 E;  4V1A v;  4QX7 B;  5LYJ E;  1HTJ F;  2BBJ A;  3UU5 A;  3UU3 A;  2KIN B;  3PUV F;  3K3O A;  1G8X A;  3P4P A;  4IST A;  5AQL B;  5FVK A;  5JDM A;  4JI3 T;  5JR9 B;  2E9X C;  3S4U A;  4L0R A;  4LFA T;  1ZV4 X;  3DJB A;  4DR1 T;  4K0K T;  4ZI7 E;  1QSD A;  4KX6 A;  3F2E A;  2VQF T;  2YEV C;  2WDQ A;  1VCS A;  4PNI A;  4YSX A;  2V1D B;  5FXV A;  5JRC B;  2XAG B;  4CXY A;  3MXZ A;  4DUY T;  5F5W A;  1SUM B;  2JMK A;  2K3W A;  2HN2 A;  2MTQ A;  3FXE B;  4HWH A;  5HEO A;  5JTG A;  3OPC A;  3SS1 A;  3TLS A;  1MMA A;  2VKJ A;  4ILA A;  4B3T T;  4X62 T;  2OLT A;  2YU1 A;  2IDO B;  3AE8 A;  2KMF A;  2IC6 A;  3ZCI A;  2UXD T;  5JR9 A;  4CZZ B;  3I9Y A;  3BQL A;  4F6R C;  4LF9 T;  4HFV A;  4PK4 A;  2XAS B;  4HWI B;  4PW8 A;  4TN7 B;  1WFD A;  4CQI A;  5JDL A;  3F57 A;  5TAO A;  2E5V A;  1Y01 A;  2BVL A;  3PUQ A;  2D9D A;  3QB5 A;  3AE7 A;  1U4Q A;  4ILB A;  2X68 A;  4U2Z A;  3NZQ A;  1MIW A;  3H3M A;  5AQH B;  3ZYK A;  5L47 A;  3RPU A;  4EGW A;  3V5U A;  1IJ6 A;  4L9I A;  1ZEE A;  2WAU A;  2KLQ A;  3N9O A;  3NWI A;  2JMH A;  2XQA A;  5J2U E;  4WNK A;  4DR5 T;  3AVS A;  2I6H A;  3OYX A;  3SWH A;  4ASK A;  3CX6 B;  3MZK B;  2DWK A;  4O4I E;  1ZKE A;  5FXX A;  2H3R A;  3AE1 A;  2KT9 A;  2UU9 T;  4UEL A;  1M62 A;  4JYA T;  4HE8 A;  4JI4 T;  2XQ3 A;  2WWU A;  3PUA A;  5LGU B;  3AAE B;  2CXD A;  4TWD A;  4ZHQ E;  5LGN B;  3PUS A;  1HNZ T;  5JQG E;  3ZLI A;  3EHZ A;  3ZMU B;  4DVD A;  3GN5 A;  3ZST A;  3KV9 A;  4P0B A;  2CWY A;  2X9H A;  2IIU A;  3ZMZ B;  1XNR T;  2CBJ A;  2CHN A;  1UX4 A;  2CWO A;  4GK0 E;  4A56 A;  4HFC A;  2YKS A;  4TV8 E;  5AQR B;  5JRC A;  2I59 A;  2JIW A;  2CXL A;  3AEG A;  3HKE E;  4OFZ A;  5LB7 B;  4COF A;  4YTN A;  5HXE A;  1IJ5 A;  4UV9 B;  5LP6 E;  1E7P A;  2W61 A;  4DV4 T;  2V5D A;  1YW0 A;  2E9X A;  3U3I A;  2W0G A;  2RA1 A;  4UVA B;  4LF6 T;  2SPC A;  4WW0 A;  5LA6 E;  2QRX A;  5DQW A;  2E9X D;  3AE6 A;  4ZEY A;  4DV1 T;  2G0U A;  3SRZ A;  3C98 B;  1OXZ A;  3AE2 A;  1LKX A;  1Z8U A;  3K8P C;  1HF8 A;  2OA5 A;  3P8C D;  4H63 V;  1OED E;  4J2C A;  5HEU A;  4AKI A;  4U31 A;  3C64 A;  4O2A E;  2RPA A;  2IML A;  3UQ7 A;  1WLX A;  4I4T E;  4EIW A;  2X9Y A;  4U3C A;  2BKO A;  5LG3 A;  4PAG A;  3P50 A;  4TWH A;  3OBV E;  2VB6 A;  1ZOY A;  1G73 A;  3P4R A;  4TWF A;  3RHW A;  5ABG A;  5AQI B;  4U2Y A;  2DNX A;  3ZMT B;  2WZH A;  1IZN B;  5JR9 C;  2PJQ A;  5JDH A;  2LRL A;  4PJJ A;  4QX8 B;  2KSR A;  3E0Z A;  5C2T A;  2JQH A;  3GWH A;  3IEE A;  2UUB T;  2C5J A;  2UXN B;  4KI0 F;  4OYK A;  5FL0 A;  4JI0 T;  5AQU B;  4H9S E;  3RYI E;  4AKH A;  3T8O A;  1D1B A;  1D0X A;  4PFP A;  4L5G A;  3D0T A;  2CLY B;  2L9Q A;  5DAB A;  2CXF A;  1VRB A;  4IE4 A;  1J5W A;  3LBX B;  3QB5 K;  4GK5 E;  4DUZ T;  5H6Q B;  4B3S T;  3UU6 A;  4LFB T;  2FBW A;  4UVB B;  2A9U A;  2BG9 C;  4B6X A;  3RH3 A;  4LF5 T;  3RX6 A;  5CGM A;  3ONJ A;  2FJB A;  4PJN A;  5H6R B;  3KVB A;  3CIR A;  3NRX A;  3QNU A;  1KNP A;  2BDE A;  1T72 A;  1L0V A;  2IHR 1;  4AQF C;  1WR0 A;  4DR3 T;  4HWD A;  2XAH B;  2D5U A;  2X0H A;  4E7S A;  3CQG B;  3GMI A;  5AQV B;  4F8H A;  4ZZC A;  2NR4 A;  5J0Z A;  3CQX C;  4YHH T;  1Z0P A;  4LF4 T;  1B7T A;  3AEE A;  2NTX A;  2V26 A;  4A97 A;  1MNE A;  2XAJ B;  3P4S A;  2DWG A;  2V8S V;  3I0Q A;  4N78 D;  4DND A;  2MOZ A;  4EYU A;  2YDQ A;  4LML A;  4WZX A;  4OK0 A;  2WZI A;  4WYV A;  3RI5 A;  3NVO A;  3PV0 F;  3J9X 1;  1HNW T;  2H7V C;  2W00 A;  1KEY A;  5HCM A;  1O3X A;  1FEW A;  2IC9 A;  2LRK A;  3AA0 B;  3VHL A;  3WI3 A;  4ADZ A;  2X0Y A;  2WMN A;  1J1J A;  2QA7 A;  2V7K A;  4ILU A;  1SE7 A;  4YFS A;  1JNR A;  5HEG A;  1DU2 A;  5JDQ A;  5KMG P;  2HN1 A;  2N9D A;  3GA8 A;  1I94 T;  3A8Y C;  1S94 A;  1UGO A;  1YQ4 A;  3HA4 A;  4KP3 C;  2KND A;  1WCR A;  2W2U A;  2ZMA A;  3U78 A;  5LBQ B;  2XQ6 A;  2BKN A;  2V5C A;  2WBL A;  3NRY A;  4DV7 T;  5DQV A;  5AQF B;  4Z8X A;  5L3D B;  3PJA A;  4JEH B;  4CI1 B;  4JI7 T;  4HWF A;  1MIY A;  2CCQ A;  3H37 A;  4WBN E;  2LT3 A;  5A1L A;  2X51 A;  2C5I T;  5HWY A;  3RKG A;  3FZF B;  3TKL B;  2XTL A;  2PFV A;  3FZM B;  2HHH T;  4DR4 T;  2H89 A;  2M6I A;  3RYF E;  3M3Z B;  1Y64 B;  4YHJ A;  4I43 B;  1NWM X;  3PJA J;  2EHO B;  1T8B A;  2HPJ A;  2LLY A;  3CPZ A;  5FY0 A;  3WAJ A;  3K1S A;  2CLY C;  3AE3 A;  3FB2 A;  1N33 T;  5HCJ A;  2XAQ B;  2BG9 A;  4O4J E;  3CVR A;  2WSS V;  2DI4 A;  3AEF A;  3ZMS B;  3L8R A;  2BG9 B;  2EHO C;  2LM9 A;  5EK3 A;  4PFO A;  1KNZ A;  3TLW A;  1NAF A;  4UF0 B;  2IUB A;  4YTM A;  2A3D A;  2JRK A;  3EI0 A;  4U7I A;  2DHR A;  3Q5X A;  1QLB A;  2Y8D A;  3P7I A;  4NUU A;  4X20 E;  3RGL A;  2WY2 A;  3N2G E;  2IAK A;  3M65 A;  3Q5W A;  2ZM0 A;  3TLT A;  4U72 A;  4AIS A;  2FJA A;  4O4H E;  5HXR A;  4CN1 A;  2YN6 A;  3PUW F;  2CM0 A;  5AQQ B;  4EZ4 A;  4DV5 T;  2J47 A;  1KK7 A;  2V7M A;  4EZH A;  3F31 A;  1HG5 A;  2WB5 A;  3ABV A;  4JI5 T;  2QVA A;  5FVL A;  3UUB A;  1J5E T;  2BS2 A;  1YQ3 A;  3MKD A;  4CI3 B;  5AQS B;  4A98 A;  2PBI A;  4DID B;  3J7Y q;  3QC9 A;  3UUM A;  2VQE T;  3PE0 A;  5IUX A;  3B13 A;  1KF6 A;  3OKQ A;  2DLR A;  5FY7 A;  4LF8 T;  2F4V T;  3AED A;  5LJN A;  1IBM T;  1VCT A;  1YXR A;  3CK6 A;  2VVS A;  3KV5 A;  4IHJ E;  4HFD A;  3RRW A;  1HNX T;  1IBL T;  4LFC T;  1GQE A;  5HAX A;  1U5P A;  3AE4 A;  2QGS A;  4YSY A;  3PDY A;  2VK9 A;  4HFB A;  5AFU L;  5LMN T;  4NXN T;  5AQM B;  2ODU A;  5C8Y E;  2Y6X A;  3AA1 B;  3T1Y T;  4YTP A;  1T7S A;  2EHO D;  5HEH A;  3JAE A;  3A5X A;  3AE5 A;  2K9A A;  2N1G A;  4I0U A;  2BZB A;  1MMD A;  1YKH B;  1IBK T;  2WMO A;  2B76 A;  3R84 B;  3EAB A;  3EDU A;  3AEB A;  3AEA A;  3RIA A;  3ZN0 B;  4DR6 T;  4BAY B;  4MLK A;  1R8I A;  5HXS A;  4OYJ A;  3OVU A;  2DCF A;  2V7I A;  2GK9 A;  3DTO A;  3HKC E;  4O4L E;  5J1G A;  4IE7 A;  3HKB E;  1HS7 A;  2LHN A;  4ZI2 C;  4PK5 A;  3AXJ A;  3VRB A;  3FZK B;  3HI2 A;  4NPP A;  1W9R A;  1X79 A;  3ZT5 A;  2K48 A;  3LJC A;  1IAP A;  4HEA A;  4ZZB A;  4X65 T;  2ODV A;  5LXT E;  2CMR A;  2WDR A;  3CKD A;  5ABH A;  5FNV E;  2YDR A;  3RKO A;  3AB3 B;  2JQK A;  5FMN A;  3IBP A;  1W0B A;  2CA5 A;  2VWA A;  3L3P A;  2XAF B;  3RQW A;  4IDO A;  3TLV A;  4AXP A;  5LHI B;  2NTY A;  3RLF F;  2ES0 A;  1UCU A;  2XY8 B;  4IRE A;  1HG2 A;  4PJM A;  5FY1 A;  4DBR A;  4H9P C;  4QKN A;  5M4Y A;  1W0A A;  3AVR A;  1YKE B;  2WU5 A;  3LFM A;  5ABE A;  3ZT6 A;  2D0U A;  4TX5 A;  3B57 A;  1MMN A;  3ONX A;  2VKH A;  2VAS A;  3LG7 A;  1XDO A;  2L3L A;  2WU2 A;  3KFW X;  3AEC A;  3N9M A;  5FKY A;  4ZI3 C;  5JVD E;  5LBM A;  1N36 T;  3MAC A;  4HGA A;  2XQY A;  3ZC0 A;  2MAW A;  1HX1 B;  2X9W A;  2J1D G;  4KHZ F;  4TNW A;  3JC6 D;  3BK9 A;  3VKH A;  4IDZ A;  5EK2 A;  2J62 A;  2LE8 A;  5HEJ A;  4CXX A;  4QXH B;  3OJA A;  2Q9Q A;  3CML A;  3L39 A;  2BVM A;  2VKD A;  2WDV A;  3N2O A;  4K0U A;  2JJ9 A;  3UU8 A;  3MK7 C;  4TNV A;  5JDN A;  5L4E A;  4TV9 E;  1WYB A;  4GOU A;  4IDP A;  1D1A A;  3RIU A;  3C4Z A;  3QOF A;  3GN5 B;  4DMW A;  4TUY E;  4AIU A;  3CX8 B;  1E1H B;  2WM9 A;  4DR2 T;  2V6X A;  3A7M A;  3C50 A;  4IT4 A;  4X1K E;  5LHH B;  3UUN A;  3N5L A;  4MAL A;  2QYW A;  3ZN1 B;  1QUU A;  5BR8 T;  2L8K A;  2D2S A;  3L09 A;  4DV0 T;  3ZMV B;  5BMV E;  3Q5D A;  4H9N C;  3VU7 H;  3C51 A;  5L3E B;  3O9X A;  2UUC T;  4AKL A;  2J4G A;  4QHO A;  4EV6 A;  4IE5 A;  1JNZ A;  5FP3 A;  1BR0 A;  2M6B A;  2IW5 B;  4ISS A;  4JI2 T;  2KWI B;  2VL0 A;  3EAM A;  3FZL B;  4YLH A;  5LOV E;  2NW9 A;  4NXM T;  2HPL A;  3AA6 B;  3UUL A;  3VKG A;  3PUR A;  4GKK T;  1HCI A;  4U7Y A;  3LK2 B;  3TLU A;  2WCA A;  3RF1 A;  3CX7 B;  3ZYM A;  2VUR A;  1N32 T;  4YY3 T;  1FJG T;  3JAF A;  2CHO A;  2V6Y A;  2E2A A;  2W63 A;  2W66 A;  3I1A A;  4C91 A;  2V7L A;  5ABF A;  3MJX A;  2LHR A;  3ZEF B;  2V7J A;  2BBH A;  2LSG A;  4CI2 B;  5JRE A;  5LMU T;  1UUS A;  2XM2 A;  4BJM A;  1ZHC A;  2PTF A;  4JI8 T;  4AQG A;  3SFD A;  4NUV A;  2ZM6 T;  2ZM2 A;  3ZSS A;  2AE9 A;  1US7 B;  4YT0 A;  2K24 A;  5JH7 E;  4NIQ A;  5IWA T;  2CRB A;  5HXH A;  1XDP A;  2X0L B;  5HXC A;  2PG8 A;  4BJN A;  1XWM A;  4XBF B;  1MND A;  4GYR A;  2M67 A;  5FL1 A;  3KV4 A;  3VR8 A;  3RYC E;  3UU4 A;  3B5M A;  5CB4 E;  4QXB B;  2CE7 A;  2XUE A;  4X1I E;  4U74 A;  1S35 A;  1OED B;  4ZOL E;  5EZY E;  3V5S A;  4QH5 A;  1HX8 A;  3N2K E;  4YSZ A;  4EEB A;  2ACZ A;  3QUJ A;  2A2F X;  1CUN A;  1UK5 A;  3BQI A;  2LEH A;  1BR2 A;  2I0M A;  3DP7 A;  1WR6 A;  3LDQ B;  4G2A A;  4MFR A;  1ZP0 A;  1T98 A;  2YIN A;  2P9B A;  3G06 A;  3MA9 A;  3N9Q A;  2E9X B;  1OED C;  2LSI A;  3AE9 A;  1UX5 A;  3PUZ F;  4CN4 A;  1AJ3 A;  3QK6 A;  3AAI A;  3RIU C;  2MBG A;  4DMV A;  3E08 A;  5LG4 A;  4UVC B;  3N9P A;  1WRD A;  3PU8 A;  4X66 T;  2HH7 A;  2UXC T;  4KHP T;  3SOL A;  4DR7 T;  2CPT A;  3EUH A;  3ONL C;  3ETU A;  3ANW B;  3Q9D A;  4HFH A;  3C4X A;  4DBQ A;  1LVF A;  3FBL A;  4GYS A;  1D1C A;  4MHC A;  3FHN A;  4O8S A;  1EZ3 A;  3PUX F;  4OX9 T;  4IDQ A;  3CWZ B;  1KNR A;  4A5X A;  2EHO A;  3PUG A;  4JI6 T;  4IL4 A;  2BG9 E;  2LOS A;  2LSK A;  5LJM A;  2ZLY A;  3AAA B;  3OTO T;  1FMW A;  4HTE A;  5J2T E;  5F3J A;  4EED A;  2XHE B;  2JPF A;  2H88 A;  4IL9 A;  4DO0 A;  2Q9Q D;  2WP9 A;  3SFE A;  3KVA A;  4HFI A;  4ANJ A;  3I9W A;  5KXJ A;  3CQC B;  2K5B B;  2XJ7 A;  3LK4 2;  4MBQ A;  4UIG A;  2R6G F;  2CBI A;  2ZM8 A;  3ZPO A;  4ZI3 D;  5F8P A;  4X64 T;  3HR0 A;  4TZ4 C;  3O1I A;  2W4X A;  3JAD A;  4WBO A;  2YDS A;  1CHU A;  2X9X A;  4GIW A;  4G63 A;  1MMG A;  3AXJ B;  3EDV A;  4Z90 A;  2RP4 A;  5KX5 E;  3HKD E;  3UT5 E;  1FIO A;  1SA0 E;  2W62 A;  2XZE A;  3FBZ A;  3AA7 B;  5L3B B;  3H3A A;  4XAX B;  4AQY T;  2KZ7 B;  2AXD S;  2ACX A;  4KBM B;  3RC3 A;  4B3M T;  2BS3 A;  2WQY A;  1BR4 A;  2X66 A;  2XM1 A;  4JLE A;  5IYZ E;  3W15 B;  2YOE A;  2Z6E A;  4HN9 A;  2YU2 A;  3K3Q C;  2FUP A;  3O4X E;  4IDN A;  5EK4 A;  3ZT7 A;  4YXD A;  4DV6 T;  3UTK A;  3PTR B;  2C0S A;  2E8I A;  5LGT B;  5AQK B;  2Y48 B;  4ZXL A;  5C3J A;  4B3R T;  3RYH E;  4ILC A;  2NP9 A;  2LKH A;  4QH4 A;  4X1Y E;  3X1D A;  4KMC A;  3C4W A;  3IA3 A;  5AQT B;  5L3C B;  2Q9Q C;  5DJQ C;  5IHY A;  4O2B E;  3R6N A;  2LSY A;  4UXN B;  2NWB A;  4CN6 A;  2UXX B;  5GON E;  4P0A A;  4E7Z A;  2VKO A;  4H9Q C;  4YJ3 E;  1D0Z A;  5ABF B;  4JEU B;  4PK6 A;  3UQ4 A;  2Q9Q B;  5LHG B;  3ZYL A;  3RC8 A;  4GKJ T;  1W09 A;  1NEK A;  3ZJ2 A;  3PUY F;  4IE6 A;  5AQJ B;  1FMV A;  1X9B A;  2C5K T;  5ETW A;  1MIV A;  2FJD A;  4M1P A;  4QH1 A;  5FXW A;  1UUR A;  5E0O A;  1WYC A;  3EVY A;  1OWA A;  5L4H A;  3UUX B;  3UFG A;  1VOM A;  5L2L A;  4DV2 T;  4JV5 T;  4X5T A;  4H9O C;  2LKG A;  2KWH A;  2LOP A;  3KDS E;  4FI5 A;  5LCY A;  2V6Y B;  3N9L A;  4EXT A;  2LSJ A;  5FXZ A;  3ZCJ A;  1KFY A;  4HKA A;  3JCF A;  4AQF A;  4FJO A;  4UF0 A;  4ERR A;  4OHF A;  5L3G B;  4HWC A;  2XQ5 A;  3NKZ A;  2H7O A;  2LJL A;  3ZJ1 A;  3VRA A;  2XQ9 A;  2BS4 A;  3NBX X;  2X67 A;  3BQK A;  4P09 A;  3RIF A;  4AKG A;  2NW8 A;  4JBW F;  2XSB A;  3LK3 B;  3P4Q A;  4LMJ A;  1LRZ A;  3ESL A;  4P1N A;  4ZS3 A;  4EOZ B;  1XMO T;  2UXB T;  3UFE A;  5LNK A;  4AKR B;  3P4W A;  3RQU A;  1NEN A;  1HFA A;  3KIN B;  1XNQ T;  3HL6 A;  3PU3 A;  2XQ4 A;  3FZH B;  1SHZ C;  4LMK A;  1HR0 T;  4BA9 A;  4EAH A;  2MPK A;  2FJE A;  3I0O A;  4I50 E;  1E2A A;  5AQN B;  1V9D A;  3RRC A;  2XSA A;  5HYA A;  3KBT A;  2NW7 A;  3K3N A;  1LVK A;  1XZY A;  2UUA T;  2KXP B;  5CFB A;  1H7C A;  4Z91 A;  3ETV A;  4H9R C;  5KDM C;  2NOX A;  2OV9 A;  5ADX L;  4UEM A;  4IGU A;  4PJL A;  2XQ8 A;  4C90 A;  4EB6 E;  3ZKR A;  4H63 H;  2BKP A;  3Q5E A;  1OED A;  3O1H A;  4UR9 A;  2CEA A;  3OYZ A;  4HFE A;  2W67 A;  1N34 T;  3ZC1 A;  2XQ7 A;  2JQQ A;  3Q2M A;  5CA1 E;  3JC6 C;  3LBX A;  2YK0 A;  4U33 A;  4IIJ E;  4KUM B;  2DL1 A;  2N2N A;  4QXC B;  4LF7 T;  2VL8 A;  5CA0 E;  4IE0 A;  5JDG A;  5CJ5 A;  4XZC A;  4ZI2 D;  4I55 E;  4JUY A;  4JI1 T;  2MYS A;  3WAK A;  1XMQ T;  3O1J A;  1BR1 A;  2WWV A;  1I6Z A;  2XPK A;  3IHR A;  4UV8 B;  3LSV A;  4YJ2 E;  3ANW A;  3IF8 B;  3KBU A;  2A72 A;  2JQ9 A;  2D0T A;  3VR9 A;  5JDF A;  3NZP A;  4CXW A;  5HWX A;  5FYM A;  4AI6 A;  4Q25 A;  1D0Y A;  1M7K A;  2B1E A;  2LM2 A;  5AQO B;  5AQP B;  3FXD B;  4ZS2 A;  4QWN B; 
#chains in the Genus database with same CATH homology
 4EYY R;  5L3F B;  3N9N A;  1YD8 G;  3KV6 A;  3E22 E;  4V1A v;  4QX7 B;  5LYJ E;  1HTJ F;  2KIN B;  3K3O A;  1G8X A;  4IST A;  5JDM A;  5JR9 B;  2E9X C;  3S4U A;  4L0R A;  1ZV4 X;  3DJB A;  4ZI7 E;  1QSD A;  3F2E A;  2YEV C;  4PNI A;  5JRC B;  2V1D B;  5FXV A;  2XAG B;  4CXY A;  3MXZ A;  2JMK A;  3FXE B;  2MTQ A;  3SS1 A;  1MMA A;  2VKJ A;  2YU1 A;  3ZCI A;  2KMF A;  2IC6 A;  5JR9 A;  4CZZ B;  3I9Y A;  3BQL A;  4HFV A;  4PK4 A;  2XAS B;  4PW8 A;  4TN7 B;  4CQI A;  5JDL A;  3F57 A;  5TAO A;  3UFE A;  2BVL A;  3UT5 E;  3PUQ A;  1U4Q A;  3ZYK A;  2X68 A;  3NZQ A;  1MIW A;  3RPU A;  3V5U A;  1IJ6 A;  4L9I A;  1ZEE A;  2WAU A;  2KLQ A;  3N9O A;  5J2U E;  2JMH A;  4WNK A;  3AVS A;  3OYX A;  3SWH A;  4ASK A;  3CX6 B;  3MZK B;  2DWK A;  4O4I E;  1ZKE A;  5FXX A;  2H3R A;  2KT9 A;  4UEL A;  4HE8 A;  3PUA A;  2WWU A;  5LGU B;  3AAE B;  2CXD A;  4ZHQ E;  5LGN B;  3PUS A;  5JQG E;  3ZLI A;  3ZMU B;  4DVD A;  3GN5 A;  3KV9 A;  2CWY A;  2X9H A;  3ZMZ B;  1UX4 A;  2CWO A;  4GK0 E;  4A56 A;  4TV8 E;  5JRC A;  2I59 A;  4OFZ A;  2CXL A;  3HKE E;  5HXE A;  1IJ5 A;  4UV9 B;  5LP6 E;  2W61 A;  1YW0 A;  2E9X A;  3U3I A;  2W0G A;  2RA1 A;  4UVA B;  2SPC A;  4WW0 A;  5LA6 E;  5DQW A;  2E9X D;  2G0U A;  3SRZ A;  3C98 B;  1OXZ A;  1LKX A;  3K8P C;  3P8C D;  1HF8 A;  2OA5 A;  4H63 V;  4J2C A;  3J7Y q;  4AKI A;  3C64 A;  4O2A E;  1WLX A;  4I4T E;  4EIW A;  2X9Y A;  4PAG A;  3OBV E;  2VB6 A;  1G73 A;  2DNX A;  3ZMT B;  1IZN B;  5JR9 C;  2PJQ A;  5JDH A;  4QX8 B;  4PJJ A;  3E0Z A;  3GWH A;  3IEE A;  2C5J A;  2UXN B;  4OYK A;  4AKH A;  3RYI E;  4H9S E;  3T8O A;  1D1B A;  1D0X A;  4PFP A;  4L5G A;  3D0T A;  2CLY B;  2L9Q A;  5DAB A;  2CXF A;  1VRB A;  4IE4 A;  3LBX B;  4GK5 E;  5H6Q B;  4UVB B;  4B6X A;  3RH3 A;  3RX6 A;  4PJN A;  5H6R B;  3KVB A;  3NRX A;  2BDE A;  4AQF C;  2XAH B;  2D5U A;  4E7S A;  3CQG B;  3GMI A;  3CQX C;  1Z0P A;  1B7T A;  2NTX A;  2V26 A;  1MNE A;  2XAJ B;  2DWG A;  3I0Q A;  4N78 D;  4DND A;  2MOZ A;  4EYU A;  4OK0 A;  3J9X 1;  2H7V C;  2W00 A;  1O3X A;  1FEW A;  2IC9 A;  3AA0 B;  3WI3 A;  4ADZ A;  4ZI2 C;  3ZC0 A;  4YFS A;  2WMN A;  2V7K A;  2QA7 A;  4ILU A;  5JDQ A;  5KMG P;  2N9D A;  3GA8 A;  1S94 A;  3HA4 A;  4KP3 C;  2KND A;  2ZMA A;  3U78 A;  5LBQ B;  2WBL A;  3NRY A;  5DQV A;  5L3D B;  4Z8X A;  4JEH B;  4CI1 B;  1MIY A;  2CCQ A;  3H37 A;  4WBN E;  2LT3 A;  5A1L A;  2X51 A;  2C5I T;  3TKL B;  2XTL A;  2PFV A;  3RYF E;  1Y64 B;  4YHJ A;  4I43 B;  1NWM X;  2EHO B;  2HPJ A;  5FY0 A;  3WAJ A;  3CPZ A;  2CLY C;  3FB2 A;  2XAQ B;  4O4J E;  3CVR A;  2WSS V;  2DI4 A;  3ZMS B;  2EHO C;  2LM9 A;  5EK3 A;  4PFO A;  1KNZ A;  1NAF A;  4UF0 B;  2A3D A;  2JRK A;  2DHR A;  3Q5X A;  2Y8D A;  3P7I A;  4NUU A;  4X20 E;  3N2G E;  2IAK A;  3M65 A;  3Q5W A;  2ZM0 A;  4U72 A;  5HXR A;  4O4H E;  2CM0 A;  4EZ4 A;  1KK7 A;  2V7M A;  4EZH A;  3F31 A;  1HG5 A;  3MKD A;  4CI3 B;  2PBI A;  3QC9 A;  3UUM A;  3PE0 A;  3B13 A;  3OKQ A;  2DLR A;  5LJN A;  3KV5 A;  4IHJ E;  3RRW A;  5HAX A;  1U5P A;  2QGS A;  5AFU L;  3PDY A;  2VK9 A;  5C8Y E;  2ODU A;  2Y6X A;  3AA1 B;  2EHO D;  3A5X A;  2K9A A;  2N1G A;  1MMD A;  2BZB A;  1YKH B;  2WMO A;  3R84 B;  3EDU A;  3ZN0 B;  4BAY B;  4MLK A;  5HXS A;  4OYJ A;  2DCF A;  2V7I A;  2GK9 A;  3DTO A;  3HKC E;  4O4L E;  5J1G A;  4IE7 A;  3HKB E;  1HS7 A;  2LHN A;  4PK5 A;  3HI2 A;  1X79 A;  2K48 A;  3LJC A;  1IAP A;  4HEA A;  2ODV A;  5LXT E;  2CMR A;  3CKD A;  5FNV E;  3RKO A;  3AB3 B;  5FMN A;  3IBP A;  2VWA A;  2CA5 A;  3L3P A;  2XAF B;  5LHI B;  4AXP A;  2NTY A;  2ES0 A;  1UCU A;  1HG2 A;  4PJM A;  5FY1 A;  4DBR A;  4H9P C;  4QKN A;  5M4Y A;  3AVR A;  1YKE B;  3LFM A;  2D0U A;  4TX5 A;  3B57 A;  1MMN A;  3ONX A;  2VKH A;  2VAS A;  3LG7 A;  2L3L A;  3KFW X;  3N9M A;  4ZI3 C;  5JVD E;  5LBM A;  3MAC A;  4HGA A;  2XQY A;  2X9W A;  2J1D G;  3JC6 D;  3BK9 A;  3VKH A;  4IDZ A;  5EK2 A;  2LE8 A;  4CXX A;  4QXH B;  3OJA A;  2Q9Q A;  3CML A;  2BVM A;  2VKD A;  3N2O A;  4K0U A;  2JJ9 A;  3MK7 C;  5JDN A;  4TV9 E;  1WYB A;  4GOU A;  1D1A A;  4DMW A;  3C4Z A;  3GN5 B;  4TUY E;  3CX8 B;  1E1H B;  2WM9 A;  3C50 A;  4X1K E;  5LHH B;  3UUN A;  3N5L A;  4MAL A;  3ZN1 B;  1QUU A;  2L8K A;  2D2S A;  3L09 A;  3ZMV B;  5BMV E;  3VU7 H;  4H9N C;  5L3E B;  3C51 A;  3O9X A;  4AKL A;  1BR0 A;  4QHO A;  4IE5 A;  5FP3 A;  2IW5 B;  4ISS A;  2KWI B;  5LOV E;  4YLH A;  2NW9 A;  2HPL A;  3AA6 B;  3UUL A;  3VKG A;  3PUR A;  1HCI A;  3LK2 B;  3ZYM A;  3CX7 B;  3I1A A;  2W63 A;  4C91 A;  2V7L A;  3MJX A;  2LHR A;  3ZEF B;  2V7J A;  2LSG A;  4CI2 B;  5JRE A;  4BJM A;  1ZHC A;  4AQG A;  4NUV A;  2ZM2 A;  5JH7 E;  1US7 B;  2K24 A;  5HXH A;  2X0L B;  5HXC A;  2PG8 A;  4BJN A;  4XBF B;  1MND A;  4GYR A;  2M67 A;  3KV4 A;  3RYC E;  5CB4 E;  4QXB B;  2CE7 A;  2XUE A;  4X1I E;  4U74 A;  1S35 A;  4ZOL E;  5EZY E;  3V5S A;  4F6R C;  1HX8 A;  3N2K E;  3QUJ A;  2A2F X;  3DP7 A;  1CUN A;  3BQI A;  1BR2 A;  2LEH A;  4G2A A;  4P0B A;  1WR6 A;  4MFR A;  3N9Q A;  1T98 A;  2YIN A;  2P9B A;  3MA9 A;  1AJ3 A;  2E9X B;  2LSI A;  1UX5 A;  3QK6 A;  3AAI A;  2MBG A;  4DMV A;  3E08 A;  5LG4 A;  4UVC B;  3N9P A;  1WRD A;  3PU8 A;  2HH7 A;  3SOL A;  3EUH A;  3Q9D A;  3ETU A;  3ANW B;  3C4X A;  4DBQ A;  1LVF A;  3FBL A;  4GYS A;  1D1C A;  4MHC A;  3FHN A;  4O8S A;  1EZ3 A;  3CWZ B;  2EHO A;  3PUG A;  2LOS A;  2LSK A;  5LJM A;  2ZLY A;  3AAA B;  1FMW A;  4HTE A;  5J2T E;  5F3J A;  2XHE B;  2JPF A;  4DO0 A;  2Q9Q D;  3KVA A;  4ANJ A;  3I9W A;  3CQC B;  2K5B B;  3LK4 2;  4MBQ A;  4UIG A;  3ZPO A;  4ZI3 D;  5L3G B;  2ZM8 A;  5F8P A;  3HR0 A;  4TZ4 C;  3O1I A;  4WBO A;  4GIW A;  2X9X A;  4G63 A;  1MMG A;  3EDV A;  2RP4 A;  5KX5 E;  3HKD E;  1FIO A;  1SA0 E;  2W62 A;  3FBZ A;  3AA7 B;  5L3B B;  3H3A A;  4XAX B;  2KZ7 B;  2ACX A;  4KBM B;  3RC3 A;  2X66 A;  1BR4 A;  5IYZ E;  4JLE A;  3W15 B;  4HN9 A;  2Z6E A;  2YU2 A;  3K3Q C;  3O4X E;  5EK4 A;  3UTK A;  3PTR B;  2C0S A;  2E8I A;  5LGT B;  2Y48 B;  3RYH E;  2NP9 A;  4X1Y E;  4KMC A;  3C4W A;  5L3C B;  2Q9Q C;  5DJQ C;  5IHY A;  4O2B E;  3R6N A;  2LSY A;  4UXN B;  2NWB A;  2UXX B;  5GON E;  4P0A A;  4E7Z A;  2VKO A;  4H9Q C;  4YJ3 E;  1D0Z A;  4JEU B;  4PK6 A;  3RC8 A;  2Q9Q B;  5LHG B;  3ZYL A;  3ZJ2 A;  4IE6 A;  1FMV A;  2C5K T;  5ETW A;  5FXW A;  1MIV A;  4M1P A;  5HWY A;  3VHL A;  5E0O A;  1WYC A;  3EVY A;  1OWA A;  3UUX B;  1VOM A;  5L2L A;  4H9O C;  2LOP A;  2KWH A;  3KDS E;  4FI5 A;  5LCY A;  3N9L A;  4EXT A;  2LSJ A;  5FXZ A;  3ZCJ A;  4HKA A;  4AQF A;  4FJO A;  4UF0 A;  4ERR A;  4OHF A;  2H7O A;  2LJL A;  3ZJ1 A;  3NBX X;  4AKG A;  2X67 A;  3BQK A;  4P09 A;  2NW8 A;  3LK3 B;  1LRZ A;  3ESL A;  4ZS3 A;  4EOZ B;  5LNK A;  4AKR B;  3KIN B;  1HFA A;  3HL6 A;  3PU3 A;  1SHZ C;  4BA9 A;  4EAH A;  3I0O A;  4I50 E;  1V9D A;  3RRC A;  5HYA A;  3KBT A;  2NW7 A;  3K3N A;  1LVK A;  2KXP B;  1H7C A;  3ETV A;  4H9R C;  5KDM C;  2NOX A;  5ADX L;  4UEM A;  4IGU A;  4PJL A;  4C90 A;  4EB6 E;  4H63 H;  3O1H A;  2CEA A;  3OYZ A;  3ZC1 A;  2JQQ A;  3Q2M A;  5CA1 E;  3JC6 C;  3LBX A;  2YK0 A;  4IIJ E;  4KUM B;  2N2N A;  4QXC B;  2VL8 A;  5CA0 E;  4IE0 A;  5JDG A;  4XZC A;  4ZI2 D;  4I55 E;  4JUY A;  2MYS A;  3WAK A;  3O1J A;  1BR1 A;  3IHR A;  4UV8 B;  4YJ2 E;  3ANW A;  3IF8 B;  3KBU A;  2A72 A;  2D0T A;  5JDF A;  3NZP A;  4CXW A;  5HWX A;  5FYM A;  4AI6 A;  1D0Y A;  2B1E A;  5FY7 A;  3FXD B;  4ZS2 A;  4QWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...