3AXJA

High resolution crystal structure of c3po
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
225
structure length
225
Chain Sequence
SQDPMSNFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALKYDVKKIEEVVYDVSIRGLSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of C3PO
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords GM27569p
total genus 90
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3axjA01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3axjA02
1J1JA 2QRXA 3QB5K 3AXJB 3PJAA 3AXJA 3QB5A 3RIUC 2QVAA 1KEYA 4WYVA 3PJAJ 3RIUA
chains in the Genus database with same CATH superfamily
2R6GF 3F31A 4TV8E 5FMNA 3CPZA 4X1KE 1YKHB 2EHOB 4YXDA 3HKEE 2CXLA 4I55E 3ESLA 3C64A 3NRXA 4DR1T 1D0XA 2YEVC 4ZZCA 3KDSE 1ZEEA 2WCAA 1Z0PA 3K1SA 2FJAA 3C51A 4HFEA 4P09A 3CX8B 4IL4A 2DWGA 3ZT7A 2XSBA 2V5CA 2W67A 4QH1A 4X1IE 2KSRA 1MMDA 2W2UA 2LSJA 3I0OA 3N9LA 4F6RC 4DV7T 4LF7T 4ZOLE 4DUZT 3J9X1 3ZN1B 3EI0A 3K3NA 3G06A 2WMOA 2ODVA 3CQGB 3LBXA 3DP7A 4H63V 3RH3A 3IBPA 1ZHCA 3Q9DA 4U7IA 2VASA 1E2AA 3D0TA 3ONJA 2OLTA 4WZXA 4TN7B 3UUXB 1UUSA 5LHGB 4AISA 3R6NA 3ZCIA 4JI4T 2BG9C 1M7KA 3GN5A 4YLHA 4EV6A 2X0LB 4BA9A 2JJ9A 4AKGA 4TNVA 2X66A 4JI3T 4DR7T 3OVUA 4O4HE 3UFGA 1J5WA 1YW0A 3CWZB 3SFDA 5IUXA 3RGLA 1CHUA 2IIUA 4KBMB 3EHZA 2PTFA 3OBVE 2WBLA 4BAYB 3AA1B 2NWBA 2H7OA 2ZLYA 3N2KE 4IL9A 5LMUT 1IBMT 1ZV4X 2FJDA 3RF1A 3RIUA 2UUAT 2ZM0A 4JI7T 3L39A 2EHOD 2V7MA 5LBMA 4P0AA 1DU2A 4DBRA 2C5JA 3LK42 5JDFA 2WQYA 3WAJA 2HPLA 1VRBA 3ETVA 2CBJA 4L9IA 3P4RA 1FIOA 3LFMA 3U3IA 4NPPA 2XQ9A 2LRKA 2VWAA 3I1AA 1VCTA 2I6HA 4QHOA 5CB4E 4K0UA 1Z8UA 2BVLA 3LSVA 4YHHT 2DNXA 4UF0A 3CVRA 4J2CA 1YKEB 3ZSTA 4ADZA 4XAXB 4PK6A 2BKNA 3FBZA 3LK3B 3M65A 2LSYA 2X9YA 3P8CD 3F57A 3GA8A 4QX8B 3ZSSA 5LG3A 1X9BA 3PUWF 3ONXA 3NWIA 3DTOA 5HXRA 2CBIA 3TLTA 2V7IA 3QC9A 4KI0F 5AQPB 2AXDS 4QX7B 5FY0A 5JDGA 3K8PC 3E0ZA 3T1YT 1SA0E 4H63H 1EZ3A 3UQ4A 5ABEA 4DV5T 1HS7A 4PFOA 3B57A 3HL6A 2IMLA 2C5KT 4H9QC 4ZEYA 4AIUA 1FEWA 2XQAA 3C50A 3ETUA 4PFPA 4TWDA 2LSGA 1T7SA 1W0BA 4LMJA 3F2EA 4ILCA 4IDZA 4EEBA 4HWFA 4ISSA 4JYAT 3ONLC 2KMFA 2C0SA 5HXSA 2WM9A 4GKJT 3IF8B 1N33T 4GOUA 5FP3A 2D5UA 2CLYB 1D1BA 2W62A 2JQ9A 2QRXA 2YU2A 1QLBA 4KUMB 5LYJE 3M3ZB 1HX8A 3J7Yq 4IE7A 4YT0A 5CA0E 3IHRA 1KFYA 4NUVA 2X68A 3VRBA 4O8SA 2BS3A 1IBKT 1WCRA 4OYJA 2H89A 4I50E 5L3FB 5L3CB 1HX1B 2V5DA 2W63A 2ZM2A 2WB5A 3AAEB 5L3GB 1HR0T 4X66T 4KHZF 5FY7A 2LHRA 2LRLA 4ANJA 5LJNA 4DVDA 3FB2A 5HCMA 2VKDA 3I9YA 4I4TE 2KWIB 4JI5T 3ZLIA 1MNDA 2BVMA 5HCJA 2NR4A 3UQ7A 1S94A 1HG2A 3AE2A 5C8YE 4ZS2A 2L9QA 5HEJA 1UGOA 2XHEB 2IDOB 4B6XA 4G63A 5E0OA 4DR5T 2YDSA 1U4QA 4E7SA 5KX5E 2D0UA 4DR3T 4DR2T 1IZNB 4N78D 4MFRA 5AQLB 3ZJ1A 2QA7A 1OXZA 2XASB 2Q9QC 2QYWA 5ABGA 3UULA 5ABHA 5L3EB 3I0QA 5KMGP 2E5LT 1UX5A 4HWDA 2UXDT 2V6YB 2KINB 2KNDA 2NTYA 4CN4A 4Z8XA 1ZKEA 2J4GA 3N9NA 5HWYA 3SOLA 3QOFA 5FL0A 4O2BE 4EIWA 1WR6A 4ZHQE 5AQNB 4EEDA 2Y8DA 2BBHA 4QKNA 3ZT5A 2JQHA 2CMRA 3EAMA 1D1CA 2E9XD 5AQIB 4NUUA 2M6BA 4ILBA 2XTLA 1MMGA 3KV5A 5JH7E 2CA5A 2ZMAA 4ZI7E 4JUYA 2J47A 1UK5A 2JMKA 2VKOA 2IC6A 3TLUA 4TUYE 2E9XC 1G8XA 4AKHA 5JDQA 4B3RT 3KV9A 5HEHA 1J5ET 4IGUA 3PUXF 2WU5A 1T98A 4UVAB 3AXJA 4HFIA 2X51A 3QB5A 2BKPA 4UF0B 1OEDA 2B76A 1KNRA 2NTXA 2ZM8A 3C4ZA 3PV0F 1OEDE 4JEUB 4UEMA 3N9MA 4QXCB 2WY2A 3ZYLA 2KLQA 2NP9A 3AXJB 4DNDA 2VKHA 3KV4A 2XAGB 1S35A 5ETWA 3RPUA 2L8KA 1OWAA 1ZP0A 3SRZA 5JDHA 2H7VC 4HE8A 4B3ST 3FZLB 4B3TT 3KBTA 3RQWA 4E7ZA 5JRCB 3AAIA 5AQSB 1G73A 2Q9QD 1JNZA 2MYSA 3UUMA 5AFUL 3ZC1A 3Q2MA 5FKYA 4PJNA 1I6ZA 4C90A 1KNPA 2W00A 3AAAB 2V8SV 4HTEA 4DV2T 2UXNB 3ANWA 5FY1A 3S4UA 5LMNT 2YDRA 3ZMUB 1WFDA 5L4EA 3RKGA 2CCQA 4LF5T 4JV5T 4UXNB 5ABFB 4U2ZA 3H37A 5AQHB 5LP6E 5BMVE 3O9XA 1HNWT 3RI5A 4IE6A 4TWFA 4HWHA 1IJ5A 2MTQA 3P50A 3BQIA 3QUJA 3OTOT 3AEFA 4HFCA 2CHOA 3RHWA 3ZT6A 3T1HT 4LFCT 2LEHA 4JI2T 3RKOA 4A56A 4ZZBA 2A72A 1GQEA 3LDQB 2KXPB 3RC3A 3NRYA 5J1GA 2VK9A 2XQ6A 4PNIA 3CQCB 2G0UA 2YU1A 2CE7A 3KINB 5J0ZA 4UV9B 3TLWA 2RPAA 3N9QA 3ABVA 4ZI3C 3B5MA 2CLYC 2CWOA 5L47A 3BQKA 2WWUA 4JBWF 2LM9A 1UCUA 5ADXL 3KV6A 4QXBB 5L3DB 2D9DA 2E5VA 3T8OA 4OX9T 4DMWA 2CEAA 3DJBA 3I9WA 3KFWX 4ISTA 4YTMA 2MAWA 1LVFA 2V7KA 4MBQA 1L0VA 1U5PA 4TV9E 4YJ2E 1KEYA 2M67A 4DV0T 2L3LA 3N2GE 4AKLA 3VR9A 4HFBA 3VR8A 2EHOA 5AQFB 2A9UA 1HF8A 2WS3A 3EUHA 5F5WA 5JRCA 3L3PA 4UVBB 5H6QB 4PK5A 2XY8B 5FXWA 3ZMSB 2WWVA 4LF4T 3NZPA 2Y6XA 3JCFA 3LG7A 3UU4A 3JC6C 4HGAA 3V5SA 1BR0A 4DV6T 2WDVA 2N2NA 3PU8A 4H9OC 3UT5E 5EK3A 4TNWA 2IUBA 1XWMA 4QXHB 4CI1B 1BR4A 2D0TA 3X1DA 2CWYA 4IE0A 1JNRA 2VQET 3SFEA 2BBJA 3HI2A 4AKRB 3RIFA 5FNVE 1N32T 3H3MA 5CJ5A 3CK6A 4IHJE 4WYVA 2XQ7A 3ZPOA 2BS2A 1VOMA 2VVNA 5DQWA 4FI5A 4V1Av 5AQTB 4WBOA 4WW0A 2X67A 2BG9B 4MLKA 3OYXA 1YXRA 4X20E 4LFAT 2WAUA 2C5IT 2XQ5A 5HAXA 3VRAA 5FXVA 4HFVA 2XAJB 2M6IA 3ZN0B 2UXBT 1FMVA 1XZYA 2LE8A 1D0ZA 4YSZA 4ZI3D 1CUNA 2UUBT 4PK4A 2XAQB 3BK9A 4YJ3E 3RRWA 3FZHB 1KNZA 3LK2B 2K5BB 2YKSA 3AE3A 3FZMB 3OYZA 4OFZA 5JVDE 4CXXA 5LXTE 5J2TE 1XMOT 4C91A 2FBWA 2IC9A 2DCFA 1MMNA 1VCSA 4WNKA 3O4XE 1R8IA 3U78A 4CI3B 4ERRA 2UXCT 3EABA 1NWMX 3ZMVB 3NBXX 3KVBA 2NW9A 5LHHB 3AEAA 2DWKA 5L4HA 2XZEA 4CZZB 1UURA 4X1YE 2Q9QB 2EHOC 4O4JE 3RC8A 2I0MA 3N5LA 4QWNB 3RIAA 3A8YC 2XPKA 3ZYKA 1XDOA 5EK2A 5JR9B 5LGNB 1XNQT 2K9AA 2SPCA 4AQYT 4U2YA 1NAFA 4GYSA 3PU3A 4L5GA 3ZMTB 3K3OA 4X64T 3PUZF 5DQVA 2LT3A 3L09A 2LOSA 4O2AE 1QSDA 4UVCB 3RYCE 1J1JA 4HFDA 3KVAA 3MZKB 1YQ4A 4IIJE 2V26A 5GONE 5FL1A 4M1PA 4ZI2C 3OKQA 5JDLA 3AB3B 4YFSA 2X9XA 3PJAJ 3VKHA 4YTNA 1US7B 2JIWA 4MALA 2BDEA 2V6XA 2DL1A 4HKAA 5FXXA 5LBQB 2KZ7B 5CGMA 5F3JA 3ZEFB 4CXYA 1V9DA 4EGWA 4EZHA 5L2LA 4CN1A 3PUVF 1HCIA 2YK0A 5FYMA 5LGUB 4XZCA 5HEGA 5F8PA 1AJ3A 5EK4A 2PFVA 5ABFA 5LGTB 4JI8T 1SE7A 1BR2A 4OYKA 5AQMB 4BJMA 2MBGA 3Q5DA 3LBXB 2A2FX 1E7PA 4OHFA 1X79A 4ILUA 3AEDA 3GMIA 4X65T 5L3BB 1OEDB 3P4WA 3TKLB 4DR6T 2JQQA 2XM2A 1HG5A 4KP3C 3AE6A 4TZ4C 2UU9T 3AA0B 2QVAA 4CXWA 2IW5B 3ANWB 1N36T 2XSAA 3E22E 4JI1T 3AE7A 1NENA 4DR4T 3RYIE 3PJAA 2YOEA 3UU5A 4F8HA 3WI3A 4YY3T 2P9BA 2X9HA 4ASKA 5LHIB 2E9XB 5CA1E 1LKXA 4EYYR 4AKIA 5IWAT 2XQ3A 3CMLA 2CXFA 3PUAA 3Q5WA 1W09A 2N1GA 3PUQA 3RIUC 2HH7A 1O3XA 2YDQA 3A7MA 1WR0A 2IAKA 3AVRA 3MACA 4UELA 4CQIA 3FZFB 3GN5B 4PJJA 3PUSA 1YD8G 3MJXA 4IT4A 5JTGA 3ZC0A 2HN1A 4X62T 4ZXLA 3UFEA 1WYCA 4I0UA 2DLRA 4A97A 2V7JA 4IDQA 2BZBA 2HPJA 4FJOA 2E8IA 3JAEA 3GWHA 1FJGT 5LNKA 5FVLA 2QGSA 2B1EA 2LM2A 3HKDE 4NIQA 3HA4A 2K24A 2MPKA 4AQGA 1W9RA 3ZCJA 4CN6A 5CFBA 2WMNA 4QH4A 4YHJA 3JAFA 2XQ8A 4UV8B 2LKHA 5KXJA 3L8RA 4GIWA 2X0HA 5TAOA 3NVOA 3PUGA 3JADA 3UU3A 3O1IA 2Z6EA 4IE4A 1W0AA 2XM1A 3NKZA 3PTRB 5JR9A 2AE9A 1Y64B 4H9RC 1N34T 2CPTA 3AEGA 2CXDA 4U3CA 4IDOA 2BG9A 3AA6B 5M4YA 4ZS3A 4AQFC 1XMQT 3RQUA 3SS1A 3UTKA 2W4XA 2J1DG 3HR0A 2X9WA 4L0RA 5C3JA 4NXMT 4P0BA 2V6YA 4UR9A 5AQGB 1T72A 2PJQA 4EXTA 5HEUA 2FUPA 2A3DA 2KWHA 3EDUA 4KX6A 2NW8A 2VL0A 3O1JA 4O4IE 4Z90A 4ZI2D 3K3QC 2K3WA 2E9XA 2XJ7A 1SUMB 4PJLA 3AEBA 1MIYA 2XQ4A 2W61A 4UIGA 5LCYA 5HYAA 2UUCT 2ACZA 2VKJA 4PJMA 5AQUB 4ILAA 5DABA 1HFAA 2IHR1 3VHLA 3VKGA 1OEDC 1M62A 3Q5XA 4EB6E 3AE4A 4H9NC 2KT9A 3AE9A 3RYHE 2ACXA 2X0YA 4PAGA 4DIDB 4IE5A 4GK0E 3UU6A 3QK6A 2WP9A 3V5UA 4COFA 2LKGA 1UX4A 5C2TA 4JLEA 4MHCA 4O4LE 2XAFB 4LFBT 2JPFA 2V7LA 3OJAA 3PE0A 5AQKB 2N9DA 2PBIA 3ZMZB 3MA9A 5LJMA 4JI6T 2LHNA 3MK7C 2XAHB 5LA6E 3RLFF 2CHNA 5KDMC 3RYFE 4JEHB 3FXEB 2CRBA 4IREA 3UUBA 5HXCA 3W15B 2LSIA 2Y48B 4Q25A 3AE5A 2FJEA 4TWHA 4I43B 4LMLA 4YSYA 4U33A 4B3MT 3CQXC 5JDNA 4G2AA 3QNUA 5IHYA 2WZIA 3EVYA 3PURA 3P4QA 5JQGE 2JQKA 2J62A 3E08A 2DI4A 2LLYA 4DO0A 2W0GA 2BS4A 2WSSV 4H9PC 1E1HB 3BQLA 2LOPA 4QH5A 3LJCA 2F4VT 3C4XA 3C98B 4GKKT 4EYUA 2LJLA 4LMKA 4U74A 4IDNA 5JR9C 3MXZA 2HN2A 5FXZA 4BJNA 4HWCA 2BKOA 2CM0A 2V1DB 3PDYA 1LVKA 4IDPA 4TX5A 4DMVA 5BR8T 2ES0A 3QB5K 2ODUA 4KHPT 5AQVB 2DHRA 5HXHA 3B13A 4K0KT 5LG4A 2XQYA 3ZJ2A 2OV9A 3CX7B 3HKCE 1XNRT 1ZOYA 4DV4T 4CI2B 2VURA 2WU2A 1HTJF 2FJBA 4LF6T 3AA7B 3UU8A 4AQFA 4YSXA 3R84B 1H7CA 4EAHA 4EZ4A 2NOXA 1IAPA 2YINA 2LSKA 2YN6A 1T8BA 1KF6A 2H3RA 4NXNT 1D0YA 2BG9E 2UXXB 5HWXA 5JREA 2RA1A 2W66A 3FXDB 2WDRA 3HKBE 4LF8T 3FHNA 5DJQC 5FVKA 4EOZB 2XUEA 4HEAA 1WRDA 5LB7B 3RX6A 2I59A 2JRKA 3Q5EA 1HNZT 4GK5E 2GK9A 1WLXA 3AEEA 3FZKB 3IEEA 4U31A 5AQJB 3TLSA 4DBQA 3N2OA 1BR1A 5AQQB 2VL8A 1QUUA 3AECA 2WDQA 4LF9T 3EDVA 3H3AA 3C4WA 5H6RB 2VB6A 1MIWA 3ZYMA 3ZKRA 2MOZA 2VVSA 5LOVE 4KMCA 3CX6B 4XBFB 3VU7H 4U72A 3AE1A 2K48A 1FMWA 4YTPA 4OK0A 4Z91A 2VQFT 4PW8A 3FBLA 3N9PA 5IYZE 2HHHT 1MMAA 4H9SE 3A5XA 1XDPA 4DV1T 2Q9QA 1IJ6A 4DUYT 1NEKA 2WZHA 5JDMA 4HFHA 3TLVA 1IBLT 1LRZA 3CKDA 1B7TA 2OA5A 2H88A 2JMHA 1MNEA 2D2SA 2E2AA 3IA3A 4U7YA 3JC6D 4HWIB 3UUNA 4AXPA 5EZYE 3WAKA 3P4PA 1WYBA 1HNXT 1KK7A 1SHZC 4A98A 4DV3T 3RRCA 4P1NA 3SWHA 5J2UE 4HN9A 5HEOA 5HXEA 3N9OA 4JI0T 3KBUA 3AE8A 4AI6A 3AVSA 3CIRA 2PG8A 3P7IA 2ZM6T 1I94T 2NW7A 4X5TA 3PUYF 3P4SA 3NZQA 1MIVA 1YQ3A 3OPCA 2RP4A 4WBNE 5A1LA 4GYRA 5AQRB 1D1AA 3MKDA 1Y01A 5AQOB 3O1HA 4A5XA
chains in the Genus database with same CATH topology
1J1JA 2QRXA 3QB5K 3AXJB 3PJAA 3AXJA 3QB5A 3RIUC 2QVAA 1KEYA 4WYVA 3PJAJ 3RIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1J A;  2QRX A;  3QB5 K;  3AXJ B;  3PJA A;  3AXJ A;  3QB5 A;  3RIU C;  2QVA A;  1KEY A;  4WYV A;  3PJA J;  3RIU A; 
#chains in the Genus database with same CATH topology
 2R6G F;  3F31 A;  4TV8 E;  5FMN A;  3CPZ A;  4X1K E;  1YKH B;  2EHO B;  4YXD A;  3HKE E;  2CXL A;  4I55 E;  3ESL A;  3C64 A;  3NRX A;  4DR1 T;  1D0X A;  2YEV C;  4ZZC A;  3KDS E;  1ZEE A;  2WCA A;  1Z0P A;  3K1S A;  2FJA A;  3C51 A;  4HFE A;  4P09 A;  3CX8 B;  4IL4 A;  2DWG A;  3ZT7 A;  2XSB A;  2V5C A;  2W67 A;  4QH1 A;  4X1I E;  2KSR A;  1MMD A;  2W2U A;  2LSJ A;  3I0O A;  3N9L A;  4F6R C;  4DV7 T;  4LF7 T;  4ZOL E;  4DUZ T;  3J9X 1;  3ZN1 B;  3EI0 A;  3K3N A;  3G06 A;  2WMO A;  2ODV A;  3CQG B;  3LBX A;  3DP7 A;  4H63 V;  3RH3 A;  3IBP A;  1ZHC A;  3Q9D A;  4U7I A;  2VAS A;  1E2A A;  3D0T A;  3ONJ A;  2OLT A;  4WZX A;  4TN7 B;  3UUX B;  1UUS A;  5LHG B;  4AIS A;  3R6N A;  3ZCI A;  4JI4 T;  2BG9 C;  1M7K A;  3GN5 A;  4YLH A;  4EV6 A;  2X0L B;  4BA9 A;  2JJ9 A;  4AKG A;  4TNV A;  2X66 A;  4JI3 T;  4DR7 T;  3OVU A;  4O4H E;  3UFG A;  1J5W A;  1YW0 A;  3CWZ B;  3SFD A;  5IUX A;  3RGL A;  1CHU A;  2IIU A;  4KBM B;  3EHZ A;  2PTF A;  3OBV E;  2WBL A;  4BAY B;  3AA1 B;  2NWB A;  2H7O A;  2ZLY A;  3N2K E;  4IL9 A;  5LMU T;  1IBM T;  1ZV4 X;  2FJD A;  3RF1 A;  3RIU A;  2UUA T;  2ZM0 A;  4JI7 T;  3L39 A;  2EHO D;  2V7M A;  5LBM A;  4P0A A;  1DU2 A;  4DBR A;  2C5J A;  3LK4 2;  5JDF A;  2WQY A;  3WAJ A;  2HPL A;  1VRB A;  3ETV A;  2CBJ A;  4L9I A;  3P4R A;  1FIO A;  3LFM A;  3U3I A;  4NPP A;  2XQ9 A;  2LRK A;  2VWA A;  3I1A A;  1VCT A;  2I6H A;  4QHO A;  5CB4 E;  4K0U A;  1Z8U A;  2BVL A;  3LSV A;  4YHH T;  2DNX A;  4UF0 A;  3CVR A;  4J2C A;  1YKE B;  3ZST A;  4ADZ A;  4XAX B;  4PK6 A;  2BKN A;  3FBZ A;  3LK3 B;  3M65 A;  2LSY A;  2X9Y A;  3P8C D;  3F57 A;  3GA8 A;  4QX8 B;  3ZSS A;  5LG3 A;  1X9B A;  3PUW F;  3ONX A;  3NWI A;  3DTO A;  5HXR A;  2CBI A;  3TLT A;  2V7I A;  3QC9 A;  4KI0 F;  5AQP B;  2AXD S;  4QX7 B;  5FY0 A;  5JDG A;  3K8P C;  3E0Z A;  3T1Y T;  1SA0 E;  4H63 H;  1EZ3 A;  3UQ4 A;  5ABE A;  4DV5 T;  1HS7 A;  4PFO A;  3B57 A;  3HL6 A;  2IML A;  2C5K T;  4H9Q C;  4ZEY A;  4AIU A;  1FEW A;  2XQA A;  3C50 A;  3ETU A;  4PFP A;  4TWD A;  2LSG A;  1T7S A;  1W0B A;  4LMJ A;  3F2E A;  4ILC A;  4IDZ A;  4EEB A;  4HWF A;  4ISS A;  4JYA T;  3ONL C;  2KMF A;  2C0S A;  5HXS A;  2WM9 A;  4GKJ T;  3IF8 B;  1N33 T;  4GOU A;  5FP3 A;  2D5U A;  2CLY B;  1D1B A;  2W62 A;  2JQ9 A;  2QRX A;  2YU2 A;  1QLB A;  4KUM B;  5LYJ E;  3M3Z B;  1HX8 A;  3J7Y q;  4IE7 A;  4YT0 A;  5CA0 E;  3IHR A;  1KFY A;  4NUV A;  2X68 A;  3VRB A;  4O8S A;  2BS3 A;  1IBK T;  1WCR A;  4OYJ A;  2H89 A;  4I50 E;  5L3F B;  5L3C B;  1HX1 B;  2V5D A;  2W63 A;  2ZM2 A;  2WB5 A;  3AAE B;  5L3G B;  1HR0 T;  4X66 T;  4KHZ F;  5FY7 A;  2LHR A;  2LRL A;  4ANJ A;  5LJN A;  4DVD A;  3FB2 A;  5HCM A;  2VKD A;  3I9Y A;  4I4T E;  2KWI B;  4JI5 T;  3ZLI A;  1MND A;  2BVM A;  5HCJ A;  2NR4 A;  3UQ7 A;  1S94 A;  1HG2 A;  3AE2 A;  5C8Y E;  4ZS2 A;  2L9Q A;  5HEJ A;  1UGO A;  2XHE B;  2IDO B;  4B6X A;  4G63 A;  5E0O A;  4DR5 T;  2YDS A;  1U4Q A;  4E7S A;  5KX5 E;  2D0U A;  4DR3 T;  4DR2 T;  1IZN B;  4N78 D;  4MFR A;  5AQL B;  3ZJ1 A;  2QA7 A;  1OXZ A;  2XAS B;  2Q9Q C;  2QYW A;  5ABG A;  3UUL A;  5ABH A;  5L3E B;  3I0Q A;  5KMG P;  2E5L T;  1UX5 A;  4HWD A;  2UXD T;  2V6Y B;  2KIN B;  2KND A;  2NTY A;  4CN4 A;  4Z8X A;  1ZKE A;  2J4G A;  3N9N A;  5HWY A;  3SOL A;  3QOF A;  5FL0 A;  4O2B E;  4EIW A;  1WR6 A;  4ZHQ E;  5AQN B;  4EED A;  2Y8D A;  2BBH A;  4QKN A;  3ZT5 A;  2JQH A;  2CMR A;  3EAM A;  1D1C A;  2E9X D;  5AQI B;  4NUU A;  2M6B A;  4ILB A;  2XTL A;  1MMG A;  3KV5 A;  5JH7 E;  2CA5 A;  2ZMA A;  4ZI7 E;  4JUY A;  2J47 A;  1UK5 A;  2JMK A;  2VKO A;  2IC6 A;  3TLU A;  4TUY E;  2E9X C;  1G8X A;  4AKH A;  5JDQ A;  4B3R T;  3KV9 A;  5HEH A;  1J5E T;  4IGU A;  3PUX F;  2WU5 A;  1T98 A;  4UVA B;  3AXJ A;  4HFI A;  2X51 A;  3QB5 A;  2BKP A;  4UF0 B;  1OED A;  2B76 A;  1KNR A;  2NTX A;  2ZM8 A;  3C4Z A;  3PV0 F;  1OED E;  4JEU B;  4UEM A;  3N9M A;  4QXC B;  2WY2 A;  3ZYL A;  2KLQ A;  2NP9 A;  3AXJ B;  4DND A;  2VKH A;  3KV4 A;  2XAG B;  1S35 A;  5ETW A;  3RPU A;  2L8K A;  1OWA A;  1ZP0 A;  3SRZ A;  5JDH A;  2H7V C;  4HE8 A;  4B3S T;  3FZL B;  4B3T T;  3KBT A;  3RQW A;  4E7Z A;  5JRC B;  3AAI A;  5AQS B;  1G73 A;  2Q9Q D;  1JNZ A;  2MYS A;  3UUM A;  5AFU L;  3ZC1 A;  3Q2M A;  5FKY A;  4PJN A;  1I6Z A;  4C90 A;  1KNP A;  2W00 A;  3AAA B;  2V8S V;  4HTE A;  4DV2 T;  2UXN B;  3ANW A;  5FY1 A;  3S4U A;  5LMN T;  2YDR A;  3ZMU B;  1WFD A;  5L4E A;  3RKG A;  2CCQ A;  4LF5 T;  4JV5 T;  4UXN B;  5ABF B;  4U2Z A;  3H37 A;  5AQH B;  5LP6 E;  5BMV E;  3O9X A;  1HNW T;  3RI5 A;  4IE6 A;  4TWF A;  4HWH A;  1IJ5 A;  2MTQ A;  3P50 A;  3BQI A;  3QUJ A;  3OTO T;  3AEF A;  4HFC A;  2CHO A;  3RHW A;  3ZT6 A;  3T1H T;  4LFC T;  2LEH A;  4JI2 T;  3RKO A;  4A56 A;  4ZZB A;  2A72 A;  1GQE A;  3LDQ B;  2KXP B;  3RC3 A;  3NRY A;  5J1G A;  2VK9 A;  2XQ6 A;  4PNI A;  3CQC B;  2G0U A;  2YU1 A;  2CE7 A;  3KIN B;  5J0Z A;  4UV9 B;  3TLW A;  2RPA A;  3N9Q A;  3ABV A;  4ZI3 C;  3B5M A;  2CLY C;  2CWO A;  5L47 A;  3BQK A;  2WWU A;  4JBW F;  2LM9 A;  1UCU A;  5ADX L;  3KV6 A;  4QXB B;  5L3D B;  2D9D A;  2E5V A;  3T8O A;  4OX9 T;  4DMW A;  2CEA A;  3DJB A;  3I9W A;  3KFW X;  4IST A;  4YTM A;  2MAW A;  1LVF A;  2V7K A;  4MBQ A;  1L0V A;  1U5P A;  4TV9 E;  4YJ2 E;  1KEY A;  2M67 A;  4DV0 T;  2L3L A;  3N2G E;  4AKL A;  3VR9 A;  4HFB A;  3VR8 A;  2EHO A;  5AQF B;  2A9U A;  1HF8 A;  2WS3 A;  3EUH A;  5F5W A;  5JRC A;  3L3P A;  4UVB B;  5H6Q B;  4PK5 A;  2XY8 B;  5FXW A;  3ZMS B;  2WWV A;  4LF4 T;  3NZP A;  2Y6X A;  3JCF A;  3LG7 A;  3UU4 A;  3JC6 C;  4HGA A;  3V5S A;  1BR0 A;  4DV6 T;  2WDV A;  2N2N A;  3PU8 A;  4H9O C;  3UT5 E;  5EK3 A;  4TNW A;  2IUB A;  1XWM A;  4QXH B;  4CI1 B;  1BR4 A;  2D0T A;  3X1D A;  2CWY A;  4IE0 A;  1JNR A;  2VQE T;  3SFE A;  2BBJ A;  3HI2 A;  4AKR B;  3RIF A;  5FNV E;  1N32 T;  3H3M A;  5CJ5 A;  3CK6 A;  4IHJ E;  4WYV A;  2XQ7 A;  3ZPO A;  2BS2 A;  1VOM A;  2VVN A;  5DQW A;  4FI5 A;  4V1A v;  5AQT B;  4WBO A;  4WW0 A;  2X67 A;  2BG9 B;  4MLK A;  3OYX A;  1YXR A;  4X20 E;  4LFA T;  2WAU A;  2C5I T;  2XQ5 A;  5HAX A;  3VRA A;  5FXV A;  4HFV A;  2XAJ B;  2M6I A;  3ZN0 B;  2UXB T;  1FMV A;  1XZY A;  2LE8 A;  1D0Z A;  4YSZ A;  4ZI3 D;  1CUN A;  2UUB T;  4PK4 A;  2XAQ B;  3BK9 A;  4YJ3 E;  3RRW A;  3FZH B;  1KNZ A;  3LK2 B;  2K5B B;  2YKS A;  3AE3 A;  3FZM B;  3OYZ A;  4OFZ A;  5JVD E;  4CXX A;  5LXT E;  5J2T E;  1XMO T;  4C91 A;  2FBW A;  2IC9 A;  2DCF A;  1MMN A;  1VCS A;  4WNK A;  3O4X E;  1R8I A;  3U78 A;  4CI3 B;  4ERR A;  2UXC T;  3EAB A;  1NWM X;  3ZMV B;  3NBX X;  3KVB A;  2NW9 A;  5LHH B;  3AEA A;  2DWK A;  5L4H A;  2XZE A;  4CZZ B;  1UUR A;  4X1Y E;  2Q9Q B;  2EHO C;  4O4J E;  3RC8 A;  2I0M A;  3N5L A;  4QWN B;  3RIA A;  3A8Y C;  2XPK A;  3ZYK A;  1XDO A;  5EK2 A;  5JR9 B;  5LGN B;  1XNQ T;  2K9A A;  2SPC A;  4AQY T;  4U2Y A;  1NAF A;  4GYS A;  3PU3 A;  4L5G A;  3ZMT B;  3K3O A;  4X64 T;  3PUZ F;  5DQV A;  2LT3 A;  3L09 A;  2LOS A;  4O2A E;  1QSD A;  4UVC B;  3RYC E;  1J1J A;  4HFD A;  3KVA A;  3MZK B;  1YQ4 A;  4IIJ E;  2V26 A;  5GON E;  5FL1 A;  4M1P A;  4ZI2 C;  3OKQ A;  5JDL A;  3AB3 B;  4YFS A;  2X9X A;  3PJA J;  3VKH A;  4YTN A;  1US7 B;  2JIW A;  4MAL A;  2BDE A;  2V6X A;  2DL1 A;  4HKA A;  5FXX A;  5LBQ B;  2KZ7 B;  5CGM A;  5F3J A;  3ZEF B;  4CXY A;  1V9D A;  4EGW A;  4EZH A;  5L2L A;  4CN1 A;  3PUV F;  1HCI A;  2YK0 A;  5FYM A;  5LGU B;  4XZC A;  5HEG A;  5F8P A;  1AJ3 A;  5EK4 A;  2PFV A;  5ABF A;  5LGT B;  4JI8 T;  1SE7 A;  1BR2 A;  4OYK A;  5AQM B;  4BJM A;  2MBG A;  3Q5D A;  3LBX B;  2A2F X;  1E7P A;  4OHF A;  1X79 A;  4ILU A;  3AED A;  3GMI A;  4X65 T;  5L3B B;  1OED B;  3P4W A;  3TKL B;  4DR6 T;  2JQQ A;  2XM2 A;  1HG5 A;  4KP3 C;  3AE6 A;  4TZ4 C;  2UU9 T;  3AA0 B;  2QVA A;  4CXW A;  2IW5 B;  3ANW B;  1N36 T;  2XSA A;  3E22 E;  4JI1 T;  3AE7 A;  1NEN A;  4DR4 T;  3RYI E;  3PJA A;  2YOE A;  3UU5 A;  4F8H A;  3WI3 A;  4YY3 T;  2P9B A;  2X9H A;  4ASK A;  5LHI B;  2E9X B;  5CA1 E;  1LKX A;  4EYY R;  4AKI A;  5IWA T;  2XQ3 A;  3CML A;  2CXF A;  3PUA A;  3Q5W A;  1W09 A;  2N1G A;  3PUQ A;  3RIU C;  2HH7 A;  1O3X A;  2YDQ A;  3A7M A;  1WR0 A;  2IAK A;  3AVR A;  3MAC A;  4UEL A;  4CQI A;  3FZF B;  3GN5 B;  4PJJ A;  3PUS A;  1YD8 G;  3MJX A;  4IT4 A;  5JTG A;  3ZC0 A;  2HN1 A;  4X62 T;  4ZXL A;  3UFE A;  1WYC A;  4I0U A;  2DLR A;  4A97 A;  2V7J A;  4IDQ A;  2BZB A;  2HPJ A;  4FJO A;  2E8I A;  3JAE A;  3GWH A;  1FJG T;  5LNK A;  5FVL A;  2QGS A;  2B1E A;  2LM2 A;  3HKD E;  4NIQ A;  3HA4 A;  2K24 A;  2MPK A;  4AQG A;  1W9R A;  3ZCJ A;  4CN6 A;  5CFB A;  2WMN A;  4QH4 A;  4YHJ A;  3JAF A;  2XQ8 A;  4UV8 B;  2LKH A;  5KXJ A;  3L8R A;  4GIW A;  2X0H A;  5TAO A;  3NVO A;  3PUG A;  3JAD A;  3UU3 A;  3O1I A;  2Z6E A;  4IE4 A;  1W0A A;  2XM1 A;  3NKZ A;  3PTR B;  5JR9 A;  2AE9 A;  1Y64 B;  4H9R C;  1N34 T;  2CPT A;  3AEG A;  2CXD A;  4U3C A;  4IDO A;  2BG9 A;  3AA6 B;  5M4Y A;  4ZS3 A;  4AQF C;  1XMQ T;  3RQU A;  3SS1 A;  3UTK A;  2W4X A;  2J1D G;  3HR0 A;  2X9W A;  4L0R A;  5C3J A;  4NXM T;  4P0B A;  2V6Y A;  4UR9 A;  5AQG B;  1T72 A;  2PJQ A;  4EXT A;  5HEU A;  2FUP A;  2A3D A;  2KWH A;  3EDU A;  4KX6 A;  2NW8 A;  2VL0 A;  3O1J A;  4O4I E;  4Z90 A;  4ZI2 D;  3K3Q C;  2K3W A;  2E9X A;  2XJ7 A;  1SUM B;  4PJL A;  3AEB A;  1MIY A;  2XQ4 A;  2W61 A;  4UIG A;  5LCY A;  5HYA A;  2UUC T;  2ACZ A;  2VKJ A;  4PJM A;  5AQU B;  4ILA A;  5DAB A;  1HFA A;  2IHR 1;  3VHL A;  3VKG A;  1OED C;  1M62 A;  3Q5X A;  4EB6 E;  3AE4 A;  4H9N C;  2KT9 A;  3AE9 A;  3RYH E;  2ACX A;  2X0Y A;  4PAG A;  4DID B;  4IE5 A;  4GK0 E;  3UU6 A;  3QK6 A;  2WP9 A;  3V5U A;  4COF A;  2LKG A;  1UX4 A;  5C2T A;  4JLE A;  4MHC A;  4O4L E;  2XAF B;  4LFB T;  2JPF A;  2V7L A;  3OJA A;  3PE0 A;  5AQK B;  2N9D A;  2PBI A;  3ZMZ B;  3MA9 A;  5LJM A;  4JI6 T;  2LHN A;  3MK7 C;  2XAH B;  5LA6 E;  3RLF F;  2CHN A;  5KDM C;  3RYF E;  4JEH B;  3FXE B;  2CRB A;  4IRE A;  3UUB A;  5HXC A;  3W15 B;  2LSI A;  2Y48 B;  4Q25 A;  3AE5 A;  2FJE A;  4TWH A;  4I43 B;  4LML A;  4YSY A;  4U33 A;  4B3M T;  3CQX C;  5JDN A;  4G2A A;  3QNU A;  5IHY A;  2WZI A;  3EVY A;  3PUR A;  3P4Q A;  5JQG E;  2JQK A;  2J62 A;  3E08 A;  2DI4 A;  2LLY A;  4DO0 A;  2W0G A;  2BS4 A;  2WSS V;  4H9P C;  1E1H B;  3BQL A;  2LOP A;  4QH5 A;  3LJC A;  2F4V T;  3C4X A;  3C98 B;  4GKK T;  4EYU A;  2LJL A;  4LMK A;  4U74 A;  4IDN A;  5JR9 C;  3MXZ A;  2HN2 A;  5FXZ A;  4BJN A;  4HWC A;  2BKO A;  2CM0 A;  2V1D B;  3PDY A;  1LVK A;  4IDP A;  4TX5 A;  4DMV A;  5BR8 T;  2ES0 A;  3QB5 K;  2ODU A;  4KHP T;  5AQV B;  2DHR A;  5HXH A;  3B13 A;  4K0K T;  5LG4 A;  2XQY A;  3ZJ2 A;  2OV9 A;  3CX7 B;  3HKC E;  1XNR T;  1ZOY A;  4DV4 T;  4CI2 B;  2VUR A;  2WU2 A;  1HTJ F;  2FJB A;  4LF6 T;  3AA7 B;  3UU8 A;  4AQF A;  4YSX A;  3R84 B;  1H7C A;  4EAH A;  4EZ4 A;  2NOX A;  1IAP A;  2YIN A;  2LSK A;  2YN6 A;  1T8B A;  1KF6 A;  2H3R A;  4NXN T;  1D0Y A;  2BG9 E;  2UXX B;  5HWX A;  5JRE A;  2RA1 A;  2W66 A;  3FXD B;  2WDR A;  3HKB E;  4LF8 T;  3FHN A;  5DJQ C;  5FVK A;  4EOZ B;  2XUE A;  4HEA A;  1WRD A;  5LB7 B;  3RX6 A;  2I59 A;  2JRK A;  3Q5E A;  1HNZ T;  4GK5 E;  2GK9 A;  1WLX A;  3AEE A;  3FZK B;  3IEE A;  4U31 A;  5AQJ B;  3TLS A;  4DBQ A;  3N2O A;  1BR1 A;  5AQQ B;  2VL8 A;  1QUU A;  3AEC A;  2WDQ A;  4LF9 T;  3EDV A;  3H3A A;  3C4W A;  5H6R B;  2VB6 A;  1MIW A;  3ZYM A;  3ZKR A;  2MOZ A;  2VVS A;  5LOV E;  4KMC A;  3CX6 B;  4XBF B;  3VU7 H;  4U72 A;  3AE1 A;  2K48 A;  1FMW A;  4YTP A;  4OK0 A;  4Z91 A;  2VQF T;  4PW8 A;  3FBL A;  3N9P A;  5IYZ E;  2HHH T;  1MMA A;  4H9S E;  3A5X A;  1XDP A;  4DV1 T;  2Q9Q A;  1IJ6 A;  4DUY T;  1NEK A;  2WZH A;  5JDM A;  4HFH A;  3TLV A;  1IBL T;  1LRZ A;  3CKD A;  1B7T A;  2OA5 A;  2H88 A;  2JMH A;  1MNE A;  2D2S A;  2E2A A;  3IA3 A;  4U7Y A;  3JC6 D;  4HWI B;  3UUN A;  4AXP A;  5EZY E;  3WAK A;  3P4P A;  1WYB A;  1HNX T;  1KK7 A;  1SHZ C;  4A98 A;  4DV3 T;  3RRC A;  4P1N A;  3SWH A;  5J2U E;  4HN9 A;  5HEO A;  5HXE A;  3N9O A;  4JI0 T;  3KBU A;  3AE8 A;  4AI6 A;  3AVS A;  3CIR A;  2PG8 A;  3P7I A;  2ZM6 T;  1I94 T;  2NW7 A;  4X5T A;  3PUY F;  3P4S A;  3NZQ A;  1MIV A;  1YQ3 A;  3OPC A;  2RP4 A;  4WBN E;  5A1L A;  4GYR A;  5AQR B;  1D1A A;  3MKD A;  1Y01 A;  5AQO B;  3O1H A;  4A5X A; 
#chains in the Genus database with same CATH homology
 1J1J A;  2QRX A;  3QB5 K;  3AXJ B;  3PJA A;  3AXJ A;  3QB5 A;  3RIU C;  2QVA A;  1KEY A;  4WYV A;  3PJA J;  3RIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...