3AXJA

High resolution crystal structure of c3po
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
225
structure length
225
Chain Sequence
SQDPMSNFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALKYDVKKIEEVVYDVSIRGLSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GM27569p
publication title High resolution crystal structure of C3PO
rcsb
source organism Drosophila melanogaster
total genus 90
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3axjA01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3axjA02
3QB5A 2QRXA 3RIUA 1J1JA 3RIUC 3AXJB 3PJAJ 2QVAA 4WYVA 3QB5K 3AXJA 1KEYA 3PJAA
chains in the Genus database with same CATH superfamily
4K0UA 4JI5T 1XDPA 3RIUA 3O1IA 2LOPA 2C5IT 3HA4A 1X79A 2WP9A 3AE1A 4AKGA 4H9PC 2LKHA 4H63H 3QNUA 5F3JA 3RKGA 2QVAA 3AVRA 3JC6D 3ZN0B 3UTKA 4OYKA 5JH7E 2BS4A 3Q2MA 1MIYA 4HN9A 5FY0A 2BZBA 4EZHA 2C0SA 1W09A 1WLXA 3AEBA 5HEHA 1VOMA 4DR2T 2WBLA 2LHNA 4EYUA 2JPFA 3RYHE 5L47A 4TN7B 3A7MA 3MXZA 1JNRA 5LMNT 3PE0A 2DI4A 2LKGA 2EHOC 2XQ6A 1HR0T 3TLTA 3HKEE 2L8KA 4L9IA 2XASB 2LT3A 4DV7T 2D0TA 4J2CA 2VKHA 1W0BA 5AQJB 4ZS3A 2E8IA 2LSJA 5FVLA 3PTRB 1OXZA 4NPPA 4COFA 1UCUA 5AFUL 4CN4A 1KNRA 5LJMA 3RI5A 3WAKA 2WAUA 4HWFA 2BKPA 5LMUT 2V7JA 3RQWA 3AAAB 3PUYF 4U7YA 2QA7A 3U78A 1IBMT 3NWIA 5C2TA 3ZMVB 5KMGP 1H7CA 3MZKB 2ES0A 2NWBA 5F8PA 2CRBA 2YINA 3VR8A 3MA9A 4H9RC 4DMWA 4IL4A 4QH4A 4GKKT 5TAOA 2ZMAA 1Z8UA 3MKDA 1IAPA 4DUYT 1CHUA 5HEOA 5AQVB 4ZXLA 4HKAA 4HFBA 3OBVE 2UUAT 5JVDE 1S35A 5ABEA 2BVLA 1I94T 5HXRA 1LVKA 4DV5T 3I0OA 1US7B 1D1BA 4F8HA 4PNIA 4N78D 4X62T 2EHOB 2I59A 2CCQA 1T8BA 3MACA 2JIWA 3IF8B 2CBIA 5LGTB 3SOLA 2JQ9A 3X1DA 3R6NA 1HTJF 4GKJT 2VL8A 3PUWF 2CM0A 2UUCT 3GWHA 2KWHA 4ERRA 3P50A 3C64A 4JEUB 1KK7A 2SPCA 3RIUC 2H3RA 4AQFA 2ZM0A 3N2GE 1MIVA 4QH5A 5L3GB 3RYCE 2VQET 3K3NA 2QRXA 4YJ2E 5HXCA 2CWOA 2QYWA 3V5UA 2DL1A 3AEGA 3N9LA 3RPUA 3AE5A 3UU8A 5LHIB 2V8SV 4DVDA 3NBXX 3UUNA 5JDNA 1EZ3A 2Z6EA 2AE9A 4OX9T 4IT4A 2Q9QC 3IHRA 2BS3A 2W63A 4OYJA 4V1Av 5CGMA 2WMOA 4IE0A 3FZFB 3O1JA 2HPJA 3IEEA 4Q25A 2XQYA 2KNDA 4ZI2C 4HFIA 3N9PA 4LF6T 4LFBT 2XTLA 2K5BB 3FHNA 2IIUA 2X67A 2JRKA 2NOXA 3P4RA 1T7SA 2WDVA 2E5VA 1R8IA 2WZHA 2BKOA 2V5CA 1JNZA 3S4UA 5LA6E 4ZS2A 2OV9A 5LGUB 2VKDA 4B3MT 5GONE 1FEWA 3LDQB 4KP3C 2FUPA 4U31A 5A1LA 5L3FB 5L3CB 5JQGE 5AQNB 3CX8B 1OWAA 3Q9DA 3TLWA 2ZM8A 5EK3A 2V7MA 2X51A 2YOEA 2VB6A 2K3WA 4AIUA 2I0MA 2LRLA 2N2NA 3AA1B 2LM9A 1MMAA 3L3PA 1SA0E 4IGUA 4PK6A 4ISTA 2NTXA 5JRCA 3AEAA 2IMLA 1D1AA 2BBHA 5HCJA 1KNPA 1HFAA 2RP4A 4QXHB 4TNWA 3UT5E 4MFRA 3ZYLA 1BR0A 1SE7A 1HG2A 1WFDA 3N9NA 3SRZA 3AE4A 2BS2A 2HN1A 5KXJA 2XAHB 2MTQA 2WCAA 3T8OA 2Q9QB 4O4JE 5LBQB 2H7VC 2EHOA 3OYZA 3O1HA 1XZYA 2E9XB 2I6HA 4YTNA 3KVBA 3UUXB 3QUJA 4NUVA 3ETVA 2WMNA 3L8RA 3ZMSB 3IBPA 4TNVA 4TWHA 2NTYA 4AKRB 2YU2A 4LF4T 2YN6A 4DR1T 4CN1A 5ABFB 2G0UA 2LEHA 2RPAA 4U3CA 5AQGB 3RRCA 4TV9E 3RH3A 2VVNA 4QXCB 2IHR1 5F5WA 2PBIA 2WWVA 1YW0A 2XSAA 2BKNA 2CA5A 4AQFC 1QUUA 1NAFA 4DV0T 5C3JA 2X66A 4HFHA 1W0AA 3ZJ2A 4DV6T 3T1YT 2XZEA 2WU2A 2VVSA 3KBTA 5H6QB 3RX6A 2X9WA 3N9MA 5HYAA 2WY2A 4AI6A 3VKGA 4X64T 3AEFA 1L0VA 3RGLA 3EDVA 2VURA 2XAGB 2LSIA 2J47A 4MALA 5LOVE 1FJGT 3PUSA 2KLQA 4CI1B 2L9QA 3UQ4A 1X9BA 3C50A 2XY8B 3TLVA 3ZT6A 2CHOA 4TV8E 5AQIB 4ZI2D 3I0QA 4YHJA 3RRWA 4WNKA 5CFBA 2BG9B 5HEGA 4CXWA 3E08A 3CX6B 2OA5A 2X0YA 2XQ4A 5HAXA 4HGAA 2XUEA 3K3QC 3PJAA 4JI3T 4OHFA 3P4QA 5JDQA 3UULA 4YSYA 3JAFA 5FL1A 5J0ZA 1NEKA 3SFDA 5LHHB 4PFPA 1HX8A 1ZHCA 5AQRB 4QKNA 3M65A 3P8CD 4IDQA 2XAJB 2K24A 4X66T 3KVAA 4CN6A 4HFVA 1BR4A 1YQ3A 4X1YE 4XAXB 5CA1E 2A2FX 4GK5E 4QHOA 3N2OA 4UIGA 3ZYMA 3I9YA 2H7OA 4IREA 3N9QA 4LMJA 1YKHB 3HI2A 4LFAT 3ONLC 2D5UA 3PJAJ 2OLTA 1U4QA 2PFVA 4O2BE 2V7IA 5LB7B 4I4TE 3LK3B 4GOUA 5L4EA 1LVFA 1MNEA 4PK5A 3KBUA 2D0UA 2HH7A 3AA7B 3AE3A 4Z90A 1XMOT 2Q9QA 1HNXT 1G73A 3PUAA 2E9XA 4WBNE 4O4HE 2LSYA 2PJQA 3WAJA 1N33T 3CK6A 2A72A 5IUXA 3A5XA 2DCFA 3B5MA 1XMQT 3RHWA 4ZOLE 5CB4E 4EAHA 2W4XA 1YQ4A 1UURA 3E22E 3UU4A 4IDNA 5CA0E 5ABGA 2FBWA 3ZC1A 5JDHA 4DV4T 5ABFA 4LF9T 4IE5A 5ETWA 4A5XA 3UUMA 2WB5A 3OTOT 5FXWA 5FYMA 2M67A 3UFEA 4H9QC 5DABA 3AE9A 3H3MA 3RC8A 3LK42 3KV4A 5AQMB 5FKYA 3F31A 3M3ZB 3UQ7A 3LFMA 4PJMA 1QSDA 2A9UA 5JDFA 5FNVE 1KNZA 3PV0F 4WW0A 4C90A 3CX7B 4CI2B 5DQVA 3AE8A 2FJEA 4C91A 1UUSA 2IDOB 1NENA 3O4XE 1I6ZA 2WU5A 4AISA 2BBJA 2HHHT 3ZKRA 3ZN1B 5JRCB 5DJQC 4EZ4A 5FVKA 3DTOA 4KHZF 4YTMA 4JI6T 4JI4T 4HFCA 4DR5T 3UUBA 1J5WA 2XQ8A 5HWYA 1BR2A 3AAIA 3EUHA 4JV5T 4A97A 4HWHA 4UV8B 5AQFB 1YD8G 2BG9A 4OFZA 3G06A 3JADA 3FZLB 1IBKT 2X9XA 4CQIA 3ZSSA 2B76A 1FMWA 3TKLB 1D0ZA 5AQHB 2V1DB 2LSGA 3VRAA 1N36T 4P1NA 4UR9A 2J62A 3PU3A 2F4VT 4BA9A 5AQQB 2D2SA 4P09A 4MLKA 2YKSA 4O2AE 2UXBT 2RA1A 4YXDA 4DR4T 1U5PA 4AQGA 4ISSA 5AQUB 3EDUA 2NW7A 3MK7C 3NRYA 1MIWA 3VHLA 1UGOA 3AEDA 1J1JA 1O3XA 3CQXC 2V26A 3ZCIA 4YFSA 1IJ6A 3ZT5A 2NW8A 5LCYA 2P9BA 2ACZA 1HNWT 1QLBA 1WR0A 2E9XC 1N32T 4U2YA 3K1SA 4EIWA 4DV1T 1OEDB 2EHOD 3QB5K 2HPLA 5AQKB 4UF0B 1ZEEA 2FJAA 2UXCT 3GN5B 4HFDA 2MAWA 3ONJA 3VU7H 1YXRA 4HWCA 2J4GA 2YDQA 4TX5A 5FL0A 4GK0E 1WRDA 3U3IA 1HNZT 1VCSA 3HL6A 1MMGA 5KDMC 4H9NC 5CJ5A 3IA3A 4DNDA 5EZYE 4G63A 3CKDA 5ADXL 4HTEA 2DWGA 4EYYR 4O4LE 2IUBA 4QH1A 3B13A 3SS1A 2V7KA 3ZPOA 2VL0A 2YDRA 2IC6A 2NR4A 4Z91A 3ZMTB 4GYRA 1Y64B 3C4ZA 4MBQA 3OJAA 2X9YA 2VKJA 2ZLYA 3VRBA 2LOSA 2UXNB 4B3RT 1WYCA 1E2AA 1LKXA 1B7TA 2MOZA 3EVYA 4O8SA 4YT0A 2W0GA 2DLRA 3P7IA 4TZ4C 4IDOA 3EABA 1HS7A 3K3OA 1XWMA 2BG9C 2N1GA 2D9DA 5FXZA 3PUZF 2JQKA 3ZMUB 5IYZE 1T72A 5JR9C 2ODVA 1AJ3A 5FP3A 3MJXA 4JI0T 2CPTA 4QX7B 2VQFT 5H6RB 1UX4A 4NUUA 3VR9A 1Z0PA 4X20E 4IL9A 3L39A 2J1DG 4PJJA 4ZI7E 3AE2A 4FI5A 4ILAA 3SFEA 5JDGA 3LK2B 5J2TE 3J9X1 4EB6E 5J2UE 1MMDA 5L3BB 1ZKEA 3ZLIA 2K9AA 3Q5DA 3V5SA 2ZM2A 2C5KT 2WSSV 3CQGB 2WS3A 2C5JA 5LGNB 3N2KE 1HG5A 1XNRT 3N9OA 3AVSA 1SHZC 5ABHA 4YTPA 1W9RA 3ANWB 1YKEB 4I0UA 3H37A 3SWHA 3DP7A 1FIOA 5JREA 3D0TA 4UVAB 3FB2A 3ZSTA 2XSBA 2V7LA 3LSVA 1IBLT 4I43B 4QX8B 1ZOYA 2LE8A 4F6RC 3P4SA 3ZMZB 2CMRA 1E1HB 3KFWX 3ZT7A 3UU6A 2WDRA 4U74A 5C8YE 2Q9QD 1OEDA 4EEBA 3F57A 3ONXA 5FXXA 2JMKA 2E9XD 4UF0A 3NZQA 4CXXA 4AKHA 2DWKA 2XQAA 3GN5A 5KX5E 3OYXA 4WBOA 2XQ5A 4TWFA 3EHZA 3HR0A 3GA8A 2N9DA 2KZ7B 5HXSA 1ZP0A 2W2UA 2WDQA 3RC3A 5JR9B 5LG4A 3FZKB 5L4HA 3NRXA 3LBXB 4KUMB 4AKIA 1KEYA 3RIAA 4YSXA 4DV3T 3AECA 2HN2A 5JTGA 1DU2A 3I1AA 3CVRA 3HKCE 2E2AA 3AEEA 2PTFA 4KHPT 4I55E 3AE7A 4JI7T 3C4WA 4PFOA 5JDMA 1SUMB 2XM1A 4HEAA 2V6YB 4NIQA 5BMVE 2V5DA 2JJ9A 5L2LA 4YHHT 3T1HT 4B6XA 1E7PA 4EV6A 3UU5A 2YDSA 4PW8A 4B3TT 4BJNA 2X9HA 2UUBT 3PURA 2XJ7A 1D0YA 1UX5A 2E5LT 3E0ZA 3AA6B 3RLFF 3WI3A 3BK9A 4IHJE 2JQQA 4H9OC 2ACXA 4ILUA 2GK9A 3RF1A 3UU3A 4EEDA 4CXYA 5LXTE 3RIFA 5AQPB 4I50E 4ANJA 3Q5XA 3C4XA 2XQ9A 3TLUA 1NWMX 4AKLA 2L3LA 2K48A 3P4PA 1S94A 5LJNA 3KV5A 3C98B 4BAYB 4UXNB 3FBZA 1G8XA 4E7ZA 5AQTB 2BDEA 4ZI3C 5LNKA 2BVMA 1KF6A 1WYBA 2LJLA 4LFCT 2MPKA 2Y48B 2CXLA 1FMVA 4ZEYA 3AAEB 4HWDA 5LHGB 4IIJE 4ILCA 4U7IA 3PUXF 3H3AA 3DJBA 1D1CA 2KT9A 3FXEB 2IW5B 4KMCA 3RYFE 3ANWA 3O9XA 4PK4A 2WZIA 4JEHB 4TWDA 1N34T 4X65T 2KWIB 3LJCA 3PUQA 4DIDB 2XAQB 2UXXB 4DR3T 2XQ3A 4ZZCA 1XDOA 1VCTA 3F2EA 4LF5T 4EGWA 3GMIA 2YK0A 4H63V 2IAKA 3B57A 5LBMA 3JAEA 3FZMB 4KI0F 1WCRA 3AE6A 2CHNA 4PJNA 3C51A 3RQUA 4ILBA 4Z8XA 1OEDC 4JYAT 1GQEA 4P0AA 2M6BA 3CWZB 2UU9T 4L5GA 4KX6A 5HEUA 5JR9A 2LLYA 2YU1A 3LBXA 4DO0A 2MBGA 3BQIA 2R6GF 4X1KE 2BG9E 3KV6A 3EAMA 4O4IE 5FY7A 4EXTA 2KSRA 4BJMA 3Q5WA 4ASKA 3KINB 4LMKA 2JQHA 3NZPA 4UV9B 2JMHA 4HE8A 2DNXA 3KDSE 2CXFA 2X0LB 2V6YA 4ZHQE 1J5ET 2M6IA 4YY3T 3FXDB 1V9DA 2KXPB 1LRZA 1CUNA 2XAFB 4GIWA 1M7KA 4YJ3E 5IHYA 3OVUA 1IZNB 2WM9A 3PDYA 2VKOA 2W67A 4JI1T 2W62A 1T98A 3HKBE 2CXDA 3QB5A 4DV2T 5BR8T 2FJDA 4JI2T 3ESLA 5E0OA 4ZZBA 4HWIB 2PG8A 3PU8A 3ZEFB 2LHRA 4HFEA 5HWXA 4FJOA 1MMNA 4LMLA 3I9WA 1VRBA 2XM2A 3JCFA 4LF8T 3RKOA 4IE6A 2LM2A 1KFYA 2KINB 3FBLA 4DUZT 3AB3B 4K0KT 4CZZB 4XZCA 4ZI3D 3AXJB 3ZC0A 2VASA 3CQCB 4E7SA 2XQ7A 4MHCA 3R84B 3W15B 3NVOA 4PAGA 3QOFA 2CLYC 4JUYA 5EK2A 4QXBB 2WWUA 5EK4A 5HEJA 3ZYKA 5M4YA 4AQYT 4G2AA 2KMFA 2ZM6T 2DHRA 5LYJE 2CE7A 3FZHB 4UELA 3BQLA 2CEAA 3HKDE 2X0HA 1HCIA 5AQLB 1MNDA 1HF8A 1IJ5A 4IDZA 4EOZB 5L3DB 2WQYA 1M62A 3JC6C 2W61A 4TUYE 2VWAA 4A56A 4AXPA 2XPKA 3QC9A 5L3EB 3A8YC 2FJBA 4WYVA 5AQSB 5LG3A 3OKQA 4L0RA 3ETUA 4M1PA 3VKHA 2V6XA 3ZCJA 3BQKA 4YSZA 2QGSA 3LG7A 2LRKA 4WZXA 4P0BA 4DR7T 2LSKA 2A3DA 3AA0B 2NP9A 2B1EA 1WR6A 4GYSA 4DR6T 4U72A 2X68A 3ABVA 4XBFB 2YEVC 3P4WA 3PUVF 2XHEB 2H89A 4YLHA 1XNQT 3ZJ1A 3CMLA 4UEMA 2CLYB 5FMNA 3OPCA 4OK0A 5IWAT 4NXMT 4DMVA 5FY1A 2UXDT 4KBMB 3K8PC 4A98A 4B3ST 3N5LA 4ADZA 3NKZA 2H88A 4UVCB 5HXEA 4DBRA 3QK6A 3KV9A 3L09A 2CWYA 5DQWA 2Y8DA 4IE4A 3TLSA 2W00A 2IC9A 3EI0A 3UFGA 2Y6XA 4DBQA 5FXVA 1HX1B 3J7Yq 2W66A 3RYIE 4IE7A 4U2ZA 3AXJA 5AQOB 4H9SE 1OEDE 4LF7T 3Q5EA 2ODUA 4IDPA 2AXDS 4X1IE 2MYSA 1Y01A 2NW9A 3CPZA 4NXNT 5LP6E 4JBWF 5JDLA 3CIRA 4JLEA 4JI8T 1UK5A 4UVBB 4CI3B 4X5TA 5HCMA 3PUGA 2VK9A 4U33A 4QWNB 4PJLA 1ZV4X 1BR1A 1D0XA 2CBJA 5J1GA 5HXHA
chains in the Genus database with same CATH topology
3QB5A 2QRXA 3RIUA 1J1JA 3RIUC 3AXJB 3PJAJ 2QVAA 4WYVA 3QB5K 3AXJA 1KEYA 3PJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB5 A;  2QRX A;  3RIU A;  1J1J A;  3RIU C;  3AXJ B;  3PJA J;  2QVA A;  4WYV A;  3QB5 K;  3AXJ A;  1KEY A;  3PJA A; 
#chains in the Genus database with same CATH topology
 4K0U A;  4JI5 T;  1XDP A;  3RIU A;  3O1I A;  2LOP A;  2C5I T;  3HA4 A;  1X79 A;  2WP9 A;  3AE1 A;  4AKG A;  4H9P C;  2LKH A;  4H63 H;  3QNU A;  5F3J A;  3RKG A;  2QVA A;  3AVR A;  3JC6 D;  3ZN0 B;  3UTK A;  4OYK A;  5JH7 E;  2BS4 A;  3Q2M A;  1MIY A;  4HN9 A;  5FY0 A;  2BZB A;  4EZH A;  2C0S A;  1W09 A;  1WLX A;  3AEB A;  5HEH A;  1VOM A;  4DR2 T;  2WBL A;  2LHN A;  4EYU A;  2JPF A;  3RYH E;  5L47 A;  4TN7 B;  3A7M A;  3MXZ A;  1JNR A;  5LMN T;  3PE0 A;  2DI4 A;  2LKG A;  2EHO C;  2XQ6 A;  1HR0 T;  3TLT A;  3HKE E;  2L8K A;  4L9I A;  2XAS B;  2LT3 A;  4DV7 T;  2D0T A;  4J2C A;  2VKH A;  1W0B A;  5AQJ B;  4ZS3 A;  2E8I A;  2LSJ A;  5FVL A;  3PTR B;  1OXZ A;  4NPP A;  4COF A;  1UCU A;  5AFU L;  4CN4 A;  1KNR A;  5LJM A;  3RI5 A;  3WAK A;  2WAU A;  4HWF A;  2BKP A;  5LMU T;  2V7J A;  3RQW A;  3AAA B;  3PUY F;  4U7Y A;  2QA7 A;  3U78 A;  1IBM T;  3NWI A;  5C2T A;  3ZMV B;  5KMG P;  1H7C A;  3MZK B;  2ES0 A;  2NWB A;  5F8P A;  2CRB A;  2YIN A;  3VR8 A;  3MA9 A;  4H9R C;  4DMW A;  4IL4 A;  4QH4 A;  4GKK T;  5TAO A;  2ZMA A;  1Z8U A;  3MKD A;  1IAP A;  4DUY T;  1CHU A;  5HEO A;  5AQV B;  4ZXL A;  4HKA A;  4HFB A;  3OBV E;  2UUA T;  5JVD E;  1S35 A;  5ABE A;  2BVL A;  1I94 T;  5HXR A;  1LVK A;  4DV5 T;  3I0O A;  1US7 B;  1D1B A;  4F8H A;  4PNI A;  4N78 D;  4X62 T;  2EHO B;  2I59 A;  2CCQ A;  1T8B A;  3MAC A;  2JIW A;  3IF8 B;  2CBI A;  5LGT B;  3SOL A;  2JQ9 A;  3X1D A;  3R6N A;  1HTJ F;  4GKJ T;  2VL8 A;  3PUW F;  2CM0 A;  2UUC T;  3GWH A;  2KWH A;  4ERR A;  3P50 A;  3C64 A;  4JEU B;  1KK7 A;  2SPC A;  3RIU C;  2H3R A;  4AQF A;  2ZM0 A;  3N2G E;  1MIV A;  4QH5 A;  5L3G B;  3RYC E;  2VQE T;  3K3N A;  2QRX A;  4YJ2 E;  5HXC A;  2CWO A;  2QYW A;  3V5U A;  2DL1 A;  3AEG A;  3N9L A;  3RPU A;  3AE5 A;  3UU8 A;  5LHI B;  2V8S V;  4DVD A;  3NBX X;  3UUN A;  5JDN A;  1EZ3 A;  2Z6E A;  2AE9 A;  4OX9 T;  4IT4 A;  2Q9Q C;  3IHR A;  2BS3 A;  2W63 A;  4OYJ A;  4V1A v;  5CGM A;  2WMO A;  4IE0 A;  3FZF B;  3O1J A;  2HPJ A;  3IEE A;  4Q25 A;  2XQY A;  2KND A;  4ZI2 C;  4HFI A;  3N9P A;  4LF6 T;  4LFB T;  2XTL A;  2K5B B;  3FHN A;  2IIU A;  2X67 A;  2JRK A;  2NOX A;  3P4R A;  1T7S A;  2WDV A;  2E5V A;  1R8I A;  2WZH A;  2BKO A;  2V5C A;  1JNZ A;  3S4U A;  5LA6 E;  4ZS2 A;  2OV9 A;  5LGU B;  2VKD A;  4B3M T;  5GON E;  1FEW A;  3LDQ B;  4KP3 C;  2FUP A;  4U31 A;  5A1L A;  5L3F B;  5L3C B;  5JQG E;  5AQN B;  3CX8 B;  1OWA A;  3Q9D A;  3TLW A;  2ZM8 A;  5EK3 A;  2V7M A;  2X51 A;  2YOE A;  2VB6 A;  2K3W A;  4AIU A;  2I0M A;  2LRL A;  2N2N A;  3AA1 B;  2LM9 A;  1MMA A;  3L3P A;  1SA0 E;  4IGU A;  4PK6 A;  4IST A;  2NTX A;  5JRC A;  3AEA A;  2IML A;  1D1A A;  2BBH A;  5HCJ A;  1KNP A;  1HFA A;  2RP4 A;  4QXH B;  4TNW A;  3UT5 E;  4MFR A;  3ZYL A;  1BR0 A;  1SE7 A;  1HG2 A;  1WFD A;  3N9N A;  3SRZ A;  3AE4 A;  2BS2 A;  2HN1 A;  5KXJ A;  2XAH B;  2MTQ A;  2WCA A;  3T8O A;  2Q9Q B;  4O4J E;  5LBQ B;  2H7V C;  2EHO A;  3OYZ A;  3O1H A;  1XZY A;  2E9X B;  2I6H A;  4YTN A;  3KVB A;  3UUX B;  3QUJ A;  4NUV A;  3ETV A;  2WMN A;  3L8R A;  3ZMS B;  3IBP A;  4TNV A;  4TWH A;  2NTY A;  4AKR B;  2YU2 A;  4LF4 T;  2YN6 A;  4DR1 T;  4CN1 A;  5ABF B;  2G0U A;  2LEH A;  2RPA A;  4U3C A;  5AQG B;  3RRC A;  4TV9 E;  3RH3 A;  2VVN A;  4QXC B;  2IHR 1;  5F5W A;  2PBI A;  2WWV A;  1YW0 A;  2XSA A;  2BKN A;  2CA5 A;  4AQF C;  1QUU A;  1NAF A;  4DV0 T;  5C3J A;  2X66 A;  4HFH A;  1W0A A;  3ZJ2 A;  4DV6 T;  3T1Y T;  2XZE A;  2WU2 A;  2VVS A;  3KBT A;  5H6Q B;  3RX6 A;  2X9W A;  3N9M A;  5HYA A;  2WY2 A;  4AI6 A;  3VKG A;  4X64 T;  3AEF A;  1L0V A;  3RGL A;  3EDV A;  2VUR A;  2XAG B;  2LSI A;  2J47 A;  4MAL A;  5LOV E;  1FJG T;  3PUS A;  2KLQ A;  4CI1 B;  2L9Q A;  3UQ4 A;  1X9B A;  3C50 A;  2XY8 B;  3TLV A;  3ZT6 A;  2CHO A;  4TV8 E;  5AQI B;  4ZI2 D;  3I0Q A;  4YHJ A;  3RRW A;  4WNK A;  5CFB A;  2BG9 B;  5HEG A;  4CXW A;  3E08 A;  3CX6 B;  2OA5 A;  2X0Y A;  2XQ4 A;  5HAX A;  4HGA A;  2XUE A;  3K3Q C;  3PJA A;  4JI3 T;  4OHF A;  3P4Q A;  5JDQ A;  3UUL A;  4YSY A;  3JAF A;  5FL1 A;  5J0Z A;  1NEK A;  3SFD A;  5LHH B;  4PFP A;  1HX8 A;  1ZHC A;  5AQR B;  4QKN A;  3M65 A;  3P8C D;  4IDQ A;  2XAJ B;  2K24 A;  4X66 T;  3KVA A;  4CN6 A;  4HFV A;  1BR4 A;  1YQ3 A;  4X1Y E;  4XAX B;  5CA1 E;  2A2F X;  4GK5 E;  4QHO A;  3N2O A;  4UIG A;  3ZYM A;  3I9Y A;  2H7O A;  4IRE A;  3N9Q A;  4LMJ A;  1YKH B;  3HI2 A;  4LFA T;  3ONL C;  2D5U A;  3PJA J;  2OLT A;  1U4Q A;  2PFV A;  4O2B E;  2V7I A;  5LB7 B;  4I4T E;  3LK3 B;  4GOU A;  5L4E A;  1LVF A;  1MNE A;  4PK5 A;  3KBU A;  2D0U A;  2HH7 A;  3AA7 B;  3AE3 A;  4Z90 A;  1XMO T;  2Q9Q A;  1HNX T;  1G73 A;  3PUA A;  2E9X A;  4WBN E;  4O4H E;  2LSY A;  2PJQ A;  3WAJ A;  1N33 T;  3CK6 A;  2A72 A;  5IUX A;  3A5X A;  2DCF A;  3B5M A;  1XMQ T;  3RHW A;  4ZOL E;  5CB4 E;  4EAH A;  2W4X A;  1YQ4 A;  1UUR A;  3E22 E;  3UU4 A;  4IDN A;  5CA0 E;  5ABG A;  2FBW A;  3ZC1 A;  5JDH A;  4DV4 T;  5ABF A;  4LF9 T;  4IE5 A;  5ETW A;  4A5X A;  3UUM A;  2WB5 A;  3OTO T;  5FXW A;  5FYM A;  2M67 A;  3UFE A;  4H9Q C;  5DAB A;  3AE9 A;  3H3M A;  3RC8 A;  3LK4 2;  3KV4 A;  5AQM B;  5FKY A;  3F31 A;  3M3Z B;  3UQ7 A;  3LFM A;  4PJM A;  1QSD A;  2A9U A;  5JDF A;  5FNV E;  1KNZ A;  3PV0 F;  4WW0 A;  4C90 A;  3CX7 B;  4CI2 B;  5DQV A;  3AE8 A;  2FJE A;  4C91 A;  1UUS A;  2IDO B;  1NEN A;  3O4X E;  1I6Z A;  2WU5 A;  4AIS A;  2BBJ A;  2HHH T;  3ZKR A;  3ZN1 B;  5JRC B;  5DJQ C;  4EZ4 A;  5FVK A;  3DTO A;  4KHZ F;  4YTM A;  4JI6 T;  4JI4 T;  4HFC A;  4DR5 T;  3UUB A;  1J5W A;  2XQ8 A;  5HWY A;  1BR2 A;  3AAI A;  3EUH A;  4JV5 T;  4A97 A;  4HWH A;  4UV8 B;  5AQF B;  1YD8 G;  2BG9 A;  4OFZ A;  3G06 A;  3JAD A;  3FZL B;  1IBK T;  2X9X A;  4CQI A;  3ZSS A;  2B76 A;  1FMW A;  3TKL B;  1D0Z A;  5AQH B;  2V1D B;  2LSG A;  3VRA A;  1N36 T;  4P1N A;  4UR9 A;  2J62 A;  3PU3 A;  2F4V T;  4BA9 A;  5AQQ B;  2D2S A;  4P09 A;  4MLK A;  2YKS A;  4O2A E;  2UXB T;  2RA1 A;  4YXD A;  4DR4 T;  1U5P A;  4AQG A;  4ISS A;  5AQU B;  3EDU A;  2NW7 A;  3MK7 C;  3NRY A;  1MIW A;  3VHL A;  1UGO A;  3AED A;  1J1J A;  1O3X A;  3CQX C;  2V26 A;  3ZCI A;  4YFS A;  1IJ6 A;  3ZT5 A;  2NW8 A;  5LCY A;  2P9B A;  2ACZ A;  1HNW T;  1QLB A;  1WR0 A;  2E9X C;  1N32 T;  4U2Y A;  3K1S A;  4EIW A;  4DV1 T;  1OED B;  2EHO D;  3QB5 K;  2HPL A;  5AQK B;  4UF0 B;  1ZEE A;  2FJA A;  2UXC T;  3GN5 B;  4HFD A;  2MAW A;  3ONJ A;  3VU7 H;  1YXR A;  4HWC A;  2J4G A;  2YDQ A;  4TX5 A;  5FL0 A;  4GK0 E;  1WRD A;  3U3I A;  1HNZ T;  1VCS A;  3HL6 A;  1MMG A;  5KDM C;  4H9N C;  5CJ5 A;  3IA3 A;  4DND A;  5EZY E;  4G63 A;  3CKD A;  5ADX L;  4HTE A;  2DWG A;  4EYY R;  4O4L E;  2IUB A;  4QH1 A;  3B13 A;  3SS1 A;  2V7K A;  3ZPO A;  2VL0 A;  2YDR A;  2IC6 A;  2NR4 A;  4Z91 A;  3ZMT B;  4GYR A;  1Y64 B;  3C4Z A;  4MBQ A;  3OJA A;  2X9Y A;  2VKJ A;  2ZLY A;  3VRB A;  2LOS A;  2UXN B;  4B3R T;  1WYC A;  1E2A A;  1LKX A;  1B7T A;  2MOZ A;  3EVY A;  4O8S A;  4YT0 A;  2W0G A;  2DLR A;  3P7I A;  4TZ4 C;  4IDO A;  3EAB A;  1HS7 A;  3K3O A;  1XWM A;  2BG9 C;  2N1G A;  2D9D A;  5FXZ A;  3PUZ F;  2JQK A;  3ZMU B;  5IYZ E;  1T72 A;  5JR9 C;  2ODV A;  1AJ3 A;  5FP3 A;  3MJX A;  4JI0 T;  2CPT A;  4QX7 B;  2VQF T;  5H6R B;  1UX4 A;  4NUU A;  3VR9 A;  1Z0P A;  4X20 E;  4IL9 A;  3L39 A;  2J1D G;  4PJJ A;  4ZI7 E;  3AE2 A;  4FI5 A;  4ILA A;  3SFE A;  5JDG A;  3LK2 B;  5J2T E;  3J9X 1;  4EB6 E;  5J2U E;  1MMD A;  5L3B B;  1ZKE A;  3ZLI A;  2K9A A;  3Q5D A;  3V5S A;  2ZM2 A;  2C5K T;  2WSS V;  3CQG B;  2WS3 A;  2C5J A;  5LGN B;  3N2K E;  1HG5 A;  1XNR T;  3N9O A;  3AVS A;  1SHZ C;  5ABH A;  4YTP A;  1W9R A;  3ANW B;  1YKE B;  4I0U A;  3H37 A;  3SWH A;  3DP7 A;  1FIO A;  5JRE A;  3D0T A;  4UVA B;  3FB2 A;  3ZST A;  2XSB A;  2V7L A;  3LSV A;  1IBL T;  4I43 B;  4QX8 B;  1ZOY A;  2LE8 A;  4F6R C;  3P4S A;  3ZMZ B;  2CMR A;  1E1H B;  3KFW X;  3ZT7 A;  3UU6 A;  2WDR A;  4U74 A;  5C8Y E;  2Q9Q D;  1OED A;  4EEB A;  3F57 A;  3ONX A;  5FXX A;  2JMK A;  2E9X D;  4UF0 A;  3NZQ A;  4CXX A;  4AKH A;  2DWK A;  2XQA A;  3GN5 A;  5KX5 E;  3OYX A;  4WBO A;  2XQ5 A;  4TWF A;  3EHZ A;  3HR0 A;  3GA8 A;  2N9D A;  2KZ7 B;  5HXS A;  1ZP0 A;  2W2U A;  2WDQ A;  3RC3 A;  5JR9 B;  5LG4 A;  3FZK B;  5L4H A;  3NRX A;  3LBX B;  4KUM B;  4AKI A;  1KEY A;  3RIA A;  4YSX A;  4DV3 T;  3AEC A;  2HN2 A;  5JTG A;  1DU2 A;  3I1A A;  3CVR A;  3HKC E;  2E2A A;  3AEE A;  2PTF A;  4KHP T;  4I55 E;  3AE7 A;  4JI7 T;  3C4W A;  4PFO A;  5JDM A;  1SUM B;  2XM1 A;  4HEA A;  2V6Y B;  4NIQ A;  5BMV E;  2V5D A;  2JJ9 A;  5L2L A;  4YHH T;  3T1H T;  4B6X A;  1E7P A;  4EV6 A;  3UU5 A;  2YDS A;  4PW8 A;  4B3T T;  4BJN A;  2X9H A;  2UUB T;  3PUR A;  2XJ7 A;  1D0Y A;  1UX5 A;  2E5L T;  3E0Z A;  3AA6 B;  3RLF F;  3WI3 A;  3BK9 A;  4IHJ E;  2JQQ A;  4H9O C;  2ACX A;  4ILU A;  2GK9 A;  3RF1 A;  3UU3 A;  4EED A;  4CXY A;  5LXT E;  3RIF A;  5AQP B;  4I50 E;  4ANJ A;  3Q5X A;  3C4X A;  2XQ9 A;  3TLU A;  1NWM X;  4AKL A;  2L3L A;  2K48 A;  3P4P A;  1S94 A;  5LJN A;  3KV5 A;  3C98 B;  4BAY B;  4UXN B;  3FBZ A;  1G8X A;  4E7Z A;  5AQT B;  2BDE A;  4ZI3 C;  5LNK A;  2BVM A;  1KF6 A;  1WYB A;  2LJL A;  4LFC T;  2MPK A;  2Y48 B;  2CXL A;  1FMV A;  4ZEY A;  3AAE B;  4HWD A;  5LHG B;  4IIJ E;  4ILC A;  4U7I A;  3PUX F;  3H3A A;  3DJB A;  1D1C A;  2KT9 A;  3FXE B;  2IW5 B;  4KMC A;  3RYF E;  3ANW A;  3O9X A;  4PK4 A;  2WZI A;  4JEH B;  4TWD A;  1N34 T;  4X65 T;  2KWI B;  3LJC A;  3PUQ A;  4DID B;  2XAQ B;  2UXX B;  4DR3 T;  2XQ3 A;  4ZZC A;  1XDO A;  1VCT A;  3F2E A;  4LF5 T;  4EGW A;  3GMI A;  2YK0 A;  4H63 V;  2IAK A;  3B57 A;  5LBM A;  3JAE A;  3FZM B;  4KI0 F;  1WCR A;  3AE6 A;  2CHN A;  4PJN A;  3C51 A;  3RQU A;  4ILB A;  4Z8X A;  1OED C;  4JYA T;  1GQE A;  4P0A A;  2M6B A;  3CWZ B;  2UU9 T;  4L5G A;  4KX6 A;  5HEU A;  5JR9 A;  2LLY A;  2YU1 A;  3LBX A;  4DO0 A;  2MBG A;  3BQI A;  2R6G F;  4X1K E;  2BG9 E;  3KV6 A;  3EAM A;  4O4I E;  5FY7 A;  4EXT A;  2KSR A;  4BJM A;  3Q5W A;  4ASK A;  3KIN B;  4LMK A;  2JQH A;  3NZP A;  4UV9 B;  2JMH A;  4HE8 A;  2DNX A;  3KDS E;  2CXF A;  2X0L B;  2V6Y A;  4ZHQ E;  1J5E T;  2M6I A;  4YY3 T;  3FXD B;  1V9D A;  2KXP B;  1LRZ A;  1CUN A;  2XAF B;  4GIW A;  1M7K A;  4YJ3 E;  5IHY A;  3OVU A;  1IZN B;  2WM9 A;  3PDY A;  2VKO A;  2W67 A;  4JI1 T;  2W62 A;  1T98 A;  3HKB E;  2CXD A;  3QB5 A;  4DV2 T;  5BR8 T;  2FJD A;  4JI2 T;  3ESL A;  5E0O A;  4ZZB A;  4HWI B;  2PG8 A;  3PU8 A;  3ZEF B;  2LHR A;  4HFE A;  5HWX A;  4FJO A;  1MMN A;  4LML A;  3I9W A;  1VRB A;  2XM2 A;  3JCF A;  4LF8 T;  3RKO A;  4IE6 A;  2LM2 A;  1KFY A;  2KIN B;  3FBL A;  4DUZ T;  3AB3 B;  4K0K T;  4CZZ B;  4XZC A;  4ZI3 D;  3AXJ B;  3ZC0 A;  2VAS A;  3CQC B;  4E7S A;  2XQ7 A;  4MHC A;  3R84 B;  3W15 B;  3NVO A;  4PAG A;  3QOF A;  2CLY C;  4JUY A;  5EK2 A;  4QXB B;  2WWU A;  5EK4 A;  5HEJ A;  3ZYK A;  5M4Y A;  4AQY T;  4G2A A;  2KMF A;  2ZM6 T;  2DHR A;  5LYJ E;  2CE7 A;  3FZH B;  4UEL A;  3BQL A;  2CEA A;  3HKD E;  2X0H A;  1HCI A;  5AQL B;  1MND A;  1HF8 A;  1IJ5 A;  4IDZ A;  4EOZ B;  5L3D B;  2WQY A;  1M62 A;  3JC6 C;  2W61 A;  4TUY E;  2VWA A;  4A56 A;  4AXP A;  2XPK A;  3QC9 A;  5L3E B;  3A8Y C;  2FJB A;  4WYV A;  5AQS B;  5LG3 A;  3OKQ A;  4L0R A;  3ETU A;  4M1P A;  3VKH A;  2V6X A;  3ZCJ A;  3BQK A;  4YSZ A;  2QGS A;  3LG7 A;  2LRK A;  4WZX A;  4P0B A;  4DR7 T;  2LSK A;  2A3D A;  3AA0 B;  2NP9 A;  2B1E A;  1WR6 A;  4GYS A;  4DR6 T;  4U72 A;  2X68 A;  3ABV A;  4XBF B;  2YEV C;  3P4W A;  3PUV F;  2XHE B;  2H89 A;  4YLH A;  1XNQ T;  3ZJ1 A;  3CML A;  4UEM A;  2CLY B;  5FMN A;  3OPC A;  4OK0 A;  5IWA T;  4NXM T;  4DMV A;  5FY1 A;  2UXD T;  4KBM B;  3K8P C;  4A98 A;  4B3S T;  3N5L A;  4ADZ A;  3NKZ A;  2H88 A;  4UVC B;  5HXE A;  4DBR A;  3QK6 A;  3KV9 A;  3L09 A;  2CWY A;  5DQW A;  2Y8D A;  4IE4 A;  3TLS A;  2W00 A;  2IC9 A;  3EI0 A;  3UFG A;  2Y6X A;  4DBQ A;  5FXV A;  1HX1 B;  3J7Y q;  2W66 A;  3RYI E;  4IE7 A;  4U2Z A;  3AXJ A;  5AQO B;  4H9S E;  1OED E;  4LF7 T;  3Q5E A;  2ODU A;  4IDP A;  2AXD S;  4X1I E;  2MYS A;  1Y01 A;  2NW9 A;  3CPZ A;  4NXN T;  5LP6 E;  4JBW F;  5JDL A;  3CIR A;  4JLE A;  4JI8 T;  1UK5 A;  4UVB B;  4CI3 B;  4X5T A;  5HCM A;  3PUG A;  2VK9 A;  4U33 A;  4QWN B;  4PJL A;  1ZV4 X;  1BR1 A;  1D0X A;  2CBJ A;  5J1G A;  5HXH A; 
#chains in the Genus database with same CATH homology
 3QB5 A;  2QRX A;  3RIU A;  1J1J A;  3RIU C;  3AXJ B;  3PJA J;  2QVA A;  4WYV A;  3QB5 K;  3AXJ A;  1KEY A;  3PJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...