3AXJA

High resolution crystal structure of c3po
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
225
structure length
225
Chain Sequence
SQDPMSNFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALKYDVKKIEEVVYDVSIRGLSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM27569p
publication title High resolution crystal structure of C3PO
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 90
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3axjA01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3axjA02
3PJAJ 1KEYA 4WYVA 3RIUA 3RIUC 3AXJB 1J1JA 3QB5K 3PJAA 3QB5A 2QRXA 3AXJA 2QVAA
chains in the Genus database with same CATH superfamily
3O1IA 3U78A 1NAFA 4YJ3E 5L3EB 3EVYA 4LMJA 3E22E 3HKCE 4YSYA 4NIQA 1SA0E 2YU2A 4AQYT 3A8YC 4KI0F 2W63A 4LF6T 5JDHA 4EGWA 2NP9A 1G8XA 4QX8B 2KXPB 5FXXA 4C90A 3RF1A 1T8BA 4I55E 4ISSA 2W00A 3N9OA 3I1AA 3ZMZB 4AXPA 4IE0A 2Y6XA 4IIJE 3N2OA 5AQIB 3ZYMA 3GN5B 2X67A 5L4HA 3Q5XA 3I0OA 3B13A 2E9XC 2RPAA 4IDQA 3FHNA 4XZCA 3PUVF 2UXCT 2M6BA 3ONJA 3RYFE 2H3RA 5KXJA 4HWDA 2IC6A 1DU2A 4ZXLA 3V5SA 2BKNA 3W15B 3N2KE 4COFA 3TLTA 4IDPA 5L2LA 2VASA 1MNEA 5KMGP 2WU2A 4AIUA 1HX1B 2IMLA 2PBIA 4A56A 1T7SA 3UUNA 1S35A 3N2GE 4ZI3C 4IL4A 1WRDA 2V26A 4B3ST 2KZ7B 5HWXA 2WCAA 2FJBA 2EHOB 4PJNA 4TV9E 4AKLA 3OTOT 5FY7A 1YW0A 4GKJT 2WWVA 3NZPA 5J0ZA 3CK6A 1WCRA 2H7VC 3OYZA 5JQGE 2ZM0A 2YK0A 4YY3T 4UVCB 1Z0PA 2LSYA 4PW8A 5LB7B 4A97A 3GA8A 3UU3A 3KBTA 2K9AA 3CPZA 3EHZA 4P0BA 3ESLA 3K8PC 5CGMA 3SRZA 2UUAT 2LHNA 2VWAA 2NTXA 4JEUB 4ZI7E 4TNWA 2ODUA 1HNZT 3EDVA 2D5UA 5A1LA 5LJMA 5EK2A 4H63V 4UV9B 4YFSA 4ZHQE 5CA0E 2VL0A 2XZEA 5LHGB 3CMLA 3AA1B 2UXXB 3GMIA 4PJMA 4YLHA 3UT5E 2D9DA 3KV6A 5DJQC 2BS2A 1UX5A 5FXVA 2DLRA 2YN6A 2Q9QB 3L8RA 3RKGA 3Q5WA 1YQ4A 3ZPOA 4B6XA 5L3DB 4EYYR 5LJNA 2XQ7A 1YKHB 2XQ5A 1WYBA 3LDQB 2HH7A 2KSRA 2W4XA 2OV9A 4YHHT 4KUMB 2RA1A 4G2AA 2AE9A 2HPLA 2A9UA 4AKIA 5AQRB 4GKKT 3HKEE 3PUGA 1D1CA 5BMVE 3CKDA 2JQ9A 3NKZA 2LEHA 3PJAJ 5AQFB 5AQHB 1VCTA 1W9RA 3QC9A 3QB5K 3JC6C 2QVAA 3AE6A 3UQ4A 1UGOA 3Q9DA 1XZYA 2DCFA 3QK6A 2C5JA 2CCQA 3RKOA 1OEDB 3AB3B 4WW0A 3G06A 2CA5A 3F31A 4YJ2E 5AQTB 4PJLA 4TN7B 3NRYA 5LYJE 4DV2T 3A7MA 2D0TA 4HWFA 1LKXA 4IE5A 4WYVA 3PUAA 4LF9T 4OHFA 2V6XA 3ZEFB 4H9RC 4JV5T 1SUMB 2XJ7A 3VU7H 4MHCA 3MKDA 4F6RC 4GYSA 1XNQT 2IHR1 1I6ZA 4ZI3D 2BDEA 4WZXA 2OA5A 3RIAA 2E9XA 4JI4T 4B3MT 4MALA 4DV4T 2KT9A 2CRBA 3JADA 4QX7B 2N9DA 2FBWA 2R6GF 4EYUA 1IJ6A 4L9IA 4UXNB 2C0SA 3UU4A 4IE6A 4AQGA 3H3AA 3L09A 4U31A 4PK4A 1FMVA 2XY8B 5HAXA 2W61A 2CHOA 3OJAA 5AQGB 1LVKA 3ZMTB 2G0UA 1KNRA 1OXZA 3WI3A 4YTPA 2DWKA 2GK9A 2XAHB 3MZKB 3RC3A 5FVKA 1J5WA 5C8YE 3ZN1B 5JVDE 1QSDA 4UR9A 2YEVC 2Y48B 4I43B 2PFVA 2HHHT 4EV6A 2BVLA 2CWOA 4U72A 4Z8XA 5FYMA 4ADZA 5LMNT 2XAJB 1U4QA 5HEGA 5JH7E 3AE8A 1B7TA 4U33A 2WDRA 3QNUA 4ZEYA 2LT3A 3BK9A 5LOVE 3ZSTA 5HCJA 4QH5A 3CX7B 3SWHA 4JI8T 2BKPA 4JI0T 3T8OA 4CN1A 3LK42 4CXWA 2D2SA 2YDSA 4U7YA 1UCUA 2ZM6T 1KF6A 2BVMA 4QHOA 3TLVA 5FNVE 4YSXA 3UU8A 5HXEA 2LOPA 3FZHB 1XNRT 3L39A 3X1DA 1HNWT 4IL9A 1W0BA 1D0XA 3P4QA 4UIGA 3P4WA 4ERRA 2VVNA 3JC6D 3ZJ1A 2VKJA 5CFBA 1HG5A 4TV8E 2UXDT 2IIUA 4HE8A 2ZLYA 1O3XA 3HKBE 2XQ6A 3FBZA 2XASB 4EEBA 3ZT7A 1KFYA 1MIVA 1N33T 1EZ3A 2X9YA 5HEJA 4TWFA 4QXHB 3ONXA 3MXZA 4X64T 4GIWA 1BR0A 3UUBA 1XMQT 3LFMA 1FIOA 3RRCA 1MMNA 3CX8B 4DR5T 4U74A 4HFIA 2E9XB 3FBLA 5F5WA 4X62T 3R84B 2WMOA 3AEDA 3CVRA 4DMWA 4X66T 5AQKB 2X66A 5JDFA 5DQWA 1Y64B 3AAAB 3F2EA 2LKHA 3I9WA 4L5GA 4AISA 2NW7A 4WNKA 5E0OA 5LGNB 4OYJA 1ZOYA 4ASKA 2I59A 2C5KT 1E2AA 3TLUA 4JI3T 3RIUA 2XM2A 4PFPA 3LK3B 1JNRA 3KBUA 1M7KA 3AE7A 4XAXB 1T72A 1E1HB 4IDNA 4X20E 4AKHA 1HNXT 4PAGA 1SHZC 3AE4A 3LBXA 3NWIA 3VR8A 3SFDA 1UK5A 5JTGA 5LXTE 4DR4T 4GOUA 3KFWX 4HKAA 5AFUL 5JDNA 1W0AA 4EZ4A 4WBOA 1HS7A 4LFBT 3C4ZA 2B1EA 2LKGA 3AE1A 3AE2A 2UUCT 1HFAA 2IDOB 2FUPA 4ILUA 2WS3A 2WB5A 4TWDA 1OWAA 2WMNA 5FL0A 3KVBA 4BJMA 2RP4A 4E7ZA 1HF8A 2V6YA 2IAKA 1VRBA 3RHWA 2WQYA 3RYIE 4DR2T 4KX6A 5AQQB 1GQEA 2K5BB 2IUBA 5HYAA 3EAMA 5HCMA 3WAKA 2WWUA 4OK0A 3RQUA 3ZCJA 3D0TA 4JLEA 4AKRB 3ETUA 1MNDA 4DUYT 1Y01A 1FEWA 4K0UA 3P4PA 3ZSSA 1FMWA 3BQIA 1I94T 1N36T 2WU5A 4QH1A 1HR0T 4DV0T 3ANWB 3NBXX 2BZBA 1VCSA 2BKOA 2DNXA 2UU9T 2LHRA 1T98A 2MTQA 4H63H 2V7LA 2C5IT 4YSZA 4TWHA 1CUNA 2XQ4A 4DO0A 1HG2A 2HPJA 5AQJB 1BR1A 2CWYA 3DTOA 2XQ9A 4UF0A 3PURA 2JMHA 3UFGA 3AVRA 3O9XA 1IBMT 3RQWA 4LFCT 5F3JA 1V9DA 3L3PA 4DV5T 1KNPA 3JAFA 4BA9A 4F8HA 2CHNA 2XQAA 3Q2MA 5HXRA 2BG9C 2J62A 4PFOA 3ABVA 4AQFC 1X79A 2X51A 3RH3A 2XPKA 2PJQA 2W2UA 2CE7A 4I4TE 5L3GB 3VHLA 1HTJF 2NTYA 4QXCB 4H9SE 1WYCA 3ZT6A 2XSAA 3RGLA 4H9OC 2UXNB 5FY1A 4EIWA 3MK7C 2B76A 4LMLA 3O4XE 2W62A 4QXBB 3SOLA 3OYXA 3P4RA 5LP6E 4DUZT 4X1IE 4X65T 2BS3A 3AE9A 4U3CA 4G63A 3KV9A 3AEFA 3ZMSB 1SE7A 1D1BA 2JQKA 3C64A 3H3MA 4DR1T 4IE7A 2P9BA 4O4HE 2XTLA 2WM9A 2Q9QC 3ZYLA 3LBXB 3N9QA 4ILCA 2VVSA 3Q5DA 2X0LB 5LHIB 1W09A 3KV4A 2V7JA 3CIRA 3HL6A 5LCYA 2JMKA 3OBVE 2N1GA 4AKGA 4HEAA 3N9MA 1LRZA 4O4IE 2BBHA 3UU5A 5BR8T 2JQHA 3QOFA 2XM1A 1ZKEA 3IHRA 4O4JE 4E7SA 3AA6B 3UTKA 4CI2B 5F8PA 1WFDA 1M62A 3NVOA 4ZZBA 4TNVA 3RX6A 3RYHE 1IJ5A 1YXRA 2V6YB 2LM2A 3LSVA 2XUEA 2WP9A 3AE5A 2W0GA 2ZM2A 1OEDC 4HTEA 1XMOT 4CI3B 1J5ET 3QB5A 4JBWF 2XAFB 2UUBT 3P4SA 1ZHCA 3B5MA 3S4UA 4U2YA 4UVBB 1H7CA 1IAPA 2LSGA 4O4LE 1ZP0A 2KMFA 5FVLA 4ISTA 3VR9A 3JAEA 5EZYE 2SPCA 2XQ8A 2FJDA 3RIFA 3N5LA 4OYKA 5IYZE 3CQCB 1MIYA 4I0UA 2WAUA 4DR6T 3AEBA 2PTFA 4DBRA 5IHYA 2WSSV 3ZN0B 3N9NA 5C3JA 3PTRB 1XDOA 2ACXA 2VB6A 2VKDA 2EHOD 3T1YT 5JDGA 3VRBA 3AEAA 4O2AE 4FJOA 4UF0B 2HN1A 1QLBA 5JR9C 2DL1A 3M65A 3P7IA 4HWIB 3IBPA 4WBNE 4H9NC 5ETWA 4MLKA 3C4WA 2DI4A 4DV7T 1N34T 4Z91A 1D1AA 2CLYC 2QYWA 4CXYA 4UV8B 3P50A 3CQGB 2XAQB 5L3BB 5LNKA 4LF8T 5AQVB 5JRCA 2N2NA 2YDQA 2WZIA 4BJNA 4OX9T 4NPPA 3ZCIA 1MMGA 2IC9A 4Z90A 3VKHA 2V5DA 3I0QA 2WDVA 2ZMAA 4HGAA 4ZS3A 3QUJA 2VL8A 3HR0A 4TZ4C 4DVDA 3E08A 2CBJA 2X0YA 4MBQA 3N9PA 3PUZF 5FL1A 3BQLA 4QKNA 3FZMB 4HFHA 4LF4T 4B3TT 2BG9A 3Q5EA 4AI6A 2NW9A 2I6HA 2J4GA 1N32T 2OLTA 4NUVA 3J7Yq 4CI1B 2Q9QD 4J2CA 5KX5E 3C50A 5HEHA 4LF7T 1WR0A 4UELA 3T1HT 2CPTA 3ZC1A 3ZJ2A 5JREA 5JDQA 2M6IA 3ZLIA 2KLQA 3EDUA 4CN6A 4PJJA 1J1JA 3ONLC 2V1DB 3HI2A 1UUSA 2CXFA 3V5UA 5DQVA 4LFAT 4IREA 3HA4A 5FMNA 2FJAA 3I9YA 3HKDE 4EZHA 4CN4A 5LHHB 3PE0A 1G73A 2VK9A 5CA1E 2V7MA 3ETVA 3O1JA 3FZLB 1Z8UA 2QRXA 5HXHA 4KBMB 2QA7A 5AQUB 2V8SV 1HCIA 2UXBT 2JRKA 2A3DA 2W66A 4ZI2C 3FXDB 2LRKA 3KINB 3ZMUB 5JDLA 2CEAA 5LMUT 3AAEB 3PUQA 5J1GA 4X1KE 4KMCA 3P8CD 5AQNB 3AECA 5LG4A 3TLSA 4A98A 2WY2A 5L4EA 4L0RA 3LK2B 4TUYE 2XSBA 5ABFA 4QWNB 4H9QC 5AQSB 2AXDS 1WLXA 5CB4E 3WAJA 4HFEA 3U3IA 4IGUA 1OEDA 3TLWA 3PUYF 3C98B 4TX5A 3MJXA 3AEGA 3F57A 1IZNB 3RI5A 4YT0A 2H89A 3AE3A 4IDZA 1US7B 5M4YA 3ZYKA 4DMVA 4ZS2A 3NZQA 2MPKA 5FXWA 1E7PA 5EK3A 2CMRA 3FXEB 4H9PC 4DR7T 4JI7T 1LVFA 5HXSA 3KV5A 2L3LA 5JRCB 2NOXA 2CBIA 1WR6A 3OPCA 3RC8A 2LE8A 4CZZB 2XHEB 4JI5T 2NW8A 5JR9A 3KDSE 4HWHA 4KHPT 2LRLA 2A2FX 4DV6T 3AEEA 4GK0E 4IHJE 3SS1A 4JI6T 4HFCA 5J2TE 2BG9B 5LG3A 3VRAA 2KWHA 1MMDA 3UULA 2BBJA 4U7IA 3SFEA 1L0VA 5AQPB 5FXZA 2EHOC 2LSIA 5FKYA 3C4XA 2JPFA 2L9QA 3EABA 2ACZA 2E8IA 4ZOLE 4P0AA 4V1Av 1KEYA 4QH4A 3PU8A 5IUXA 2IW5B 1X9BA 5LGTB 3DP7A 5ADXL 4NXMT 5H6QB 4OFZA 2WZHA 2YU1A 2K48A 4EOZB 4PK5A 5HEOA 4JI1T 2BS4A 2BG9E 4EXTA 3E0ZA 3PUWF 2FJEA 3TKLB 4LMKA 5LBMA 2V7IA 5L47A 1D0ZA 1U5PA 4HFBA 3PV0F 3JCFA 4JI2T 3K3OA 4O2BE 4YTNA 4LF5T 3LG7A 4BAYB 3MACA 5DABA 5ABEA 1IBLT 4HN9A 3LJCA 2LOSA 4GK5E 4ZI2D 1R8IA 3AXJA 4EAHA 5LBQB 3VKGA 3K3QC 4HFVA 3K3NA 2K24A 4P1NA 2HN2A 3OVUA 2H7OA 5AQMB 4IT4A 2L8KA 5HEUA 2VQFT 3IEEA 2QGSA 5ABFB 2ES0A 2WBLA 3FZKB 4DR3T 3A5XA 3H37A 3N9LA 2MOZA 4K0KT 5ABHA 5HWYA 1BR2A 4DV1T 5L3FB 2E9XD 2NWBA 4XBFB 4DV3T 3AAIA 4A5XA 1YD8G 2J1DG 2V5CA 2CXLA 1S94A 4DNDA 1FJGT 1ZEEA 2K3WA 4UEMA 3UUMA 4I50E 2MBGA 1BR4A 3AA0B 1YQ3A 4UVAB 4YXDA 4MFRA 4O8SA 4HFDA 1MMAA 5AQLB 4NXNT 2WDQA 2YINA 4ILBA 3K1SA 2VURA 3IF8B 5EK4A 2LLYA 5JDMA 3RIUC 2JJ9A 3FB2A 1OEDE 2I0MA 4PNIA 2DHRA 2X9XA 2X9HA 2V7KA 4EEDA 4YTMA 3ZC0A 4KP3C 3UUXB 1UURA 4X5TA 4JEHB 5J2UE 5JR9B 1XWMA 1CHUA 3RLFF 3GWHA 3ZMVB 2X68A 1KK7A 3CX6B 1UX4A 5FP3A 2J47A 4EB6E 2CLYB 4U2ZA 4NUUA 2E5LT 5TAOA 4ILAA 4DIDB 5FY0A 5ABGA 4JUYA 4YHJA 3GN5A 3M3ZB 5LGUB 5HXCA 4B3RT 2VKOA 3RPUA 2YKSA 1YKEB 3R6NA 4FI5A 2M67A 2CXDA 2CM0A 3KVAA 4KHZF 4DBQA 2E5VA 5KDMC 2XQYA 5IWAT 2W67A 3PUXF 2XQ3A 2MAWA 3B57A 1JNZA 2YOEA 3PDYA 2JQQA 1QUUA 3PU3A 4ANJA 4P09A 1D0YA 2LSKA 5GONE 4PK6A 1MIWA 5LA6E 2ODVA 3UQ7A 3EI0A 4C91A 2EHOA 3J9X1 1VOMA 4N78D 1XDPA 1KNZA 2XAGB 4GYRA 3AXJB 2JIWA 1IBKT 3PJAA 2F4VT 3EUHA 4IDOA 2DWGA 3UU6A 2D0UA 3CWZB 2VKHA 5L3CB 3CQXC 5C2TA 3O1HA 3ZT5A 4CXXA 1ZV4X 2YDRA 3MA9A 3UFEA 4HWCA 5H6RB 4M1PA 4AQFA 3OKQA 3IA3A 3AVSA 4Q25A 4IE4A 4X1YE 3FZFB 4ZZCA 1HX8A 2Y8DA 5AQOB 3ANWA 2LJLA 2NR4A 2PG8A 3RRWA 1NENA 1AJ3A 2KWIB 2LSJA 3C51A 3ZKRA 2X9WA 2KINB 2ZM8A 3BQKA 2E2AA 1NEKA 2A72A 5CJ5A 3AA7B 3RYCE 2KNDA 2X0HA 4CQIA 2VQET 3NRXA 3PUSA 3DJBA 2Q9QA 2MYSA 2LM9A 1NWMX 2Z6EA 4JYAT 2H88A
chains in the Genus database with same CATH topology
3PJAJ 1KEYA 4WYVA 3RIUA 3RIUC 3AXJB 1J1JA 3QB5K 3PJAA 3QB5A 2QRXA 3AXJA 2QVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJA J;  1KEY A;  4WYV A;  3RIU A;  3RIU C;  3AXJ B;  1J1J A;  3QB5 K;  3PJA A;  3QB5 A;  2QRX A;  3AXJ A;  2QVA A; 
#chains in the Genus database with same CATH topology
 3O1I A;  3U78 A;  1NAF A;  4YJ3 E;  5L3E B;  3EVY A;  4LMJ A;  3E22 E;  3HKC E;  4YSY A;  4NIQ A;  1SA0 E;  2YU2 A;  4AQY T;  3A8Y C;  4KI0 F;  2W63 A;  4LF6 T;  5JDH A;  4EGW A;  2NP9 A;  1G8X A;  4QX8 B;  2KXP B;  5FXX A;  4C90 A;  3RF1 A;  1T8B A;  4I55 E;  4ISS A;  2W00 A;  3N9O A;  3I1A A;  3ZMZ B;  4AXP A;  4IE0 A;  2Y6X A;  4IIJ E;  3N2O A;  5AQI B;  3ZYM A;  3GN5 B;  2X67 A;  5L4H A;  3Q5X A;  3I0O A;  3B13 A;  2E9X C;  2RPA A;  4IDQ A;  3FHN A;  4XZC A;  3PUV F;  2UXC T;  2M6B A;  3ONJ A;  3RYF E;  2H3R A;  5KXJ A;  4HWD A;  2IC6 A;  1DU2 A;  4ZXL A;  3V5S A;  2BKN A;  3W15 B;  3N2K E;  4COF A;  3TLT A;  4IDP A;  5L2L A;  2VAS A;  1MNE A;  5KMG P;  2WU2 A;  4AIU A;  1HX1 B;  2IML A;  2PBI A;  4A56 A;  1T7S A;  3UUN A;  1S35 A;  3N2G E;  4ZI3 C;  4IL4 A;  1WRD A;  2V26 A;  4B3S T;  2KZ7 B;  5HWX A;  2WCA A;  2FJB A;  2EHO B;  4PJN A;  4TV9 E;  4AKL A;  3OTO T;  5FY7 A;  1YW0 A;  4GKJ T;  2WWV A;  3NZP A;  5J0Z A;  3CK6 A;  1WCR A;  2H7V C;  3OYZ A;  5JQG E;  2ZM0 A;  2YK0 A;  4YY3 T;  4UVC B;  1Z0P A;  2LSY A;  4PW8 A;  5LB7 B;  4A97 A;  3GA8 A;  3UU3 A;  3KBT A;  2K9A A;  3CPZ A;  3EHZ A;  4P0B A;  3ESL A;  3K8P C;  5CGM A;  3SRZ A;  2UUA T;  2LHN A;  2VWA A;  2NTX A;  4JEU B;  4ZI7 E;  4TNW A;  2ODU A;  1HNZ T;  3EDV A;  2D5U A;  5A1L A;  5LJM A;  5EK2 A;  4H63 V;  4UV9 B;  4YFS A;  4ZHQ E;  5CA0 E;  2VL0 A;  2XZE A;  5LHG B;  3CML A;  3AA1 B;  2UXX B;  3GMI A;  4PJM A;  4YLH A;  3UT5 E;  2D9D A;  3KV6 A;  5DJQ C;  2BS2 A;  1UX5 A;  5FXV A;  2DLR A;  2YN6 A;  2Q9Q B;  3L8R A;  3RKG A;  3Q5W A;  1YQ4 A;  3ZPO A;  4B6X A;  5L3D B;  4EYY R;  5LJN A;  2XQ7 A;  1YKH B;  2XQ5 A;  1WYB A;  3LDQ B;  2HH7 A;  2KSR A;  2W4X A;  2OV9 A;  4YHH T;  4KUM B;  2RA1 A;  4G2A A;  2AE9 A;  2HPL A;  2A9U A;  4AKI A;  5AQR B;  4GKK T;  3HKE E;  3PUG A;  1D1C A;  5BMV E;  3CKD A;  2JQ9 A;  3NKZ A;  2LEH A;  3PJA J;  5AQF B;  5AQH B;  1VCT A;  1W9R A;  3QC9 A;  3QB5 K;  3JC6 C;  2QVA A;  3AE6 A;  3UQ4 A;  1UGO A;  3Q9D A;  1XZY A;  2DCF A;  3QK6 A;  2C5J A;  2CCQ A;  3RKO A;  1OED B;  3AB3 B;  4WW0 A;  3G06 A;  2CA5 A;  3F31 A;  4YJ2 E;  5AQT B;  4PJL A;  4TN7 B;  3NRY A;  5LYJ E;  4DV2 T;  3A7M A;  2D0T A;  4HWF A;  1LKX A;  4IE5 A;  4WYV A;  3PUA A;  4LF9 T;  4OHF A;  2V6X A;  3ZEF B;  4H9R C;  4JV5 T;  1SUM B;  2XJ7 A;  3VU7 H;  4MHC A;  3MKD A;  4F6R C;  4GYS A;  1XNQ T;  2IHR 1;  1I6Z A;  4ZI3 D;  2BDE A;  4WZX A;  2OA5 A;  3RIA A;  2E9X A;  4JI4 T;  4B3M T;  4MAL A;  4DV4 T;  2KT9 A;  2CRB A;  3JAD A;  4QX7 B;  2N9D A;  2FBW A;  2R6G F;  4EYU A;  1IJ6 A;  4L9I A;  4UXN B;  2C0S A;  3UU4 A;  4IE6 A;  4AQG A;  3H3A A;  3L09 A;  4U31 A;  4PK4 A;  1FMV A;  2XY8 B;  5HAX A;  2W61 A;  2CHO A;  3OJA A;  5AQG B;  1LVK A;  3ZMT B;  2G0U A;  1KNR A;  1OXZ A;  3WI3 A;  4YTP A;  2DWK A;  2GK9 A;  2XAH B;  3MZK B;  3RC3 A;  5FVK A;  1J5W A;  5C8Y E;  3ZN1 B;  5JVD E;  1QSD A;  4UR9 A;  2YEV C;  2Y48 B;  4I43 B;  2PFV A;  2HHH T;  4EV6 A;  2BVL A;  2CWO A;  4U72 A;  4Z8X A;  5FYM A;  4ADZ A;  5LMN T;  2XAJ B;  1U4Q A;  5HEG A;  5JH7 E;  3AE8 A;  1B7T A;  4U33 A;  2WDR A;  3QNU A;  4ZEY A;  2LT3 A;  3BK9 A;  5LOV E;  3ZST A;  5HCJ A;  4QH5 A;  3CX7 B;  3SWH A;  4JI8 T;  2BKP A;  4JI0 T;  3T8O A;  4CN1 A;  3LK4 2;  4CXW A;  2D2S A;  2YDS A;  4U7Y A;  1UCU A;  2ZM6 T;  1KF6 A;  2BVM A;  4QHO A;  3TLV A;  5FNV E;  4YSX A;  3UU8 A;  5HXE A;  2LOP A;  3FZH B;  1XNR T;  3L39 A;  3X1D A;  1HNW T;  4IL9 A;  1W0B A;  1D0X A;  3P4Q A;  4UIG A;  3P4W A;  4ERR A;  2VVN A;  3JC6 D;  3ZJ1 A;  2VKJ A;  5CFB A;  1HG5 A;  4TV8 E;  2UXD T;  2IIU A;  4HE8 A;  2ZLY A;  1O3X A;  3HKB E;  2XQ6 A;  3FBZ A;  2XAS B;  4EEB A;  3ZT7 A;  1KFY A;  1MIV A;  1N33 T;  1EZ3 A;  2X9Y A;  5HEJ A;  4TWF A;  4QXH B;  3ONX A;  3MXZ A;  4X64 T;  4GIW A;  1BR0 A;  3UUB A;  1XMQ T;  3LFM A;  1FIO A;  3RRC A;  1MMN A;  3CX8 B;  4DR5 T;  4U74 A;  4HFI A;  2E9X B;  3FBL A;  5F5W A;  4X62 T;  3R84 B;  2WMO A;  3AED A;  3CVR A;  4DMW A;  4X66 T;  5AQK B;  2X66 A;  5JDF A;  5DQW A;  1Y64 B;  3AAA B;  3F2E A;  2LKH A;  3I9W A;  4L5G A;  4AIS A;  2NW7 A;  4WNK A;  5E0O A;  5LGN B;  4OYJ A;  1ZOY A;  4ASK A;  2I59 A;  2C5K T;  1E2A A;  3TLU A;  4JI3 T;  3RIU A;  2XM2 A;  4PFP A;  3LK3 B;  1JNR A;  3KBU A;  1M7K A;  3AE7 A;  4XAX B;  1T72 A;  1E1H B;  4IDN A;  4X20 E;  4AKH A;  1HNX T;  4PAG A;  1SHZ C;  3AE4 A;  3LBX A;  3NWI A;  3VR8 A;  3SFD A;  1UK5 A;  5JTG A;  5LXT E;  4DR4 T;  4GOU A;  3KFW X;  4HKA A;  5AFU L;  5JDN A;  1W0A A;  4EZ4 A;  4WBO A;  1HS7 A;  4LFB T;  3C4Z A;  2B1E A;  2LKG A;  3AE1 A;  3AE2 A;  2UUC T;  1HFA A;  2IDO B;  2FUP A;  4ILU A;  2WS3 A;  2WB5 A;  4TWD A;  1OWA A;  2WMN A;  5FL0 A;  3KVB A;  4BJM A;  2RP4 A;  4E7Z A;  1HF8 A;  2V6Y A;  2IAK A;  1VRB A;  3RHW A;  2WQY A;  3RYI E;  4DR2 T;  4KX6 A;  5AQQ B;  1GQE A;  2K5B B;  2IUB A;  5HYA A;  3EAM A;  5HCM A;  3WAK A;  2WWU A;  4OK0 A;  3RQU A;  3ZCJ A;  3D0T A;  4JLE A;  4AKR B;  3ETU A;  1MND A;  4DUY T;  1Y01 A;  1FEW A;  4K0U A;  3P4P A;  3ZSS A;  1FMW A;  3BQI A;  1I94 T;  1N36 T;  2WU5 A;  4QH1 A;  1HR0 T;  4DV0 T;  3ANW B;  3NBX X;  2BZB A;  1VCS A;  2BKO A;  2DNX A;  2UU9 T;  2LHR A;  1T98 A;  2MTQ A;  4H63 H;  2V7L A;  2C5I T;  4YSZ A;  4TWH A;  1CUN A;  2XQ4 A;  4DO0 A;  1HG2 A;  2HPJ A;  5AQJ B;  1BR1 A;  2CWY A;  3DTO A;  2XQ9 A;  4UF0 A;  3PUR A;  2JMH A;  3UFG A;  3AVR A;  3O9X A;  1IBM T;  3RQW A;  4LFC T;  5F3J A;  1V9D A;  3L3P A;  4DV5 T;  1KNP A;  3JAF A;  4BA9 A;  4F8H A;  2CHN A;  2XQA A;  3Q2M A;  5HXR A;  2BG9 C;  2J62 A;  4PFO A;  3ABV A;  4AQF C;  1X79 A;  2X51 A;  3RH3 A;  2XPK A;  2PJQ A;  2W2U A;  2CE7 A;  4I4T E;  5L3G B;  3VHL A;  1HTJ F;  2NTY A;  4QXC B;  4H9S E;  1WYC A;  3ZT6 A;  2XSA A;  3RGL A;  4H9O C;  2UXN B;  5FY1 A;  4EIW A;  3MK7 C;  2B76 A;  4LML A;  3O4X E;  2W62 A;  4QXB B;  3SOL A;  3OYX A;  3P4R A;  5LP6 E;  4DUZ T;  4X1I E;  4X65 T;  2BS3 A;  3AE9 A;  4U3C A;  4G63 A;  3KV9 A;  3AEF A;  3ZMS B;  1SE7 A;  1D1B A;  2JQK A;  3C64 A;  3H3M A;  4DR1 T;  4IE7 A;  2P9B A;  4O4H E;  2XTL A;  2WM9 A;  2Q9Q C;  3ZYL A;  3LBX B;  3N9Q A;  4ILC A;  2VVS A;  3Q5D A;  2X0L B;  5LHI B;  1W09 A;  3KV4 A;  2V7J A;  3CIR A;  3HL6 A;  5LCY A;  2JMK A;  3OBV E;  2N1G A;  4AKG A;  4HEA A;  3N9M A;  1LRZ A;  4O4I E;  2BBH A;  3UU5 A;  5BR8 T;  2JQH A;  3QOF A;  2XM1 A;  1ZKE A;  3IHR A;  4O4J E;  4E7S A;  3AA6 B;  3UTK A;  4CI2 B;  5F8P A;  1WFD A;  1M62 A;  3NVO A;  4ZZB A;  4TNV A;  3RX6 A;  3RYH E;  1IJ5 A;  1YXR A;  2V6Y B;  2LM2 A;  3LSV A;  2XUE A;  2WP9 A;  3AE5 A;  2W0G A;  2ZM2 A;  1OED C;  4HTE A;  1XMO T;  4CI3 B;  1J5E T;  3QB5 A;  4JBW F;  2XAF B;  2UUB T;  3P4S A;  1ZHC A;  3B5M A;  3S4U A;  4U2Y A;  4UVB B;  1H7C A;  1IAP A;  2LSG A;  4O4L E;  1ZP0 A;  2KMF A;  5FVL A;  4IST A;  3VR9 A;  3JAE A;  5EZY E;  2SPC A;  2XQ8 A;  2FJD A;  3RIF A;  3N5L A;  4OYK A;  5IYZ E;  3CQC B;  1MIY A;  4I0U A;  2WAU A;  4DR6 T;  3AEB A;  2PTF A;  4DBR A;  5IHY A;  2WSS V;  3ZN0 B;  3N9N A;  5C3J A;  3PTR B;  1XDO A;  2ACX A;  2VB6 A;  2VKD A;  2EHO D;  3T1Y T;  5JDG A;  3VRB A;  3AEA A;  4O2A E;  4FJO A;  4UF0 B;  2HN1 A;  1QLB A;  5JR9 C;  2DL1 A;  3M65 A;  3P7I A;  4HWI B;  3IBP A;  4WBN E;  4H9N C;  5ETW A;  4MLK A;  3C4W A;  2DI4 A;  4DV7 T;  1N34 T;  4Z91 A;  1D1A A;  2CLY C;  2QYW A;  4CXY A;  4UV8 B;  3P50 A;  3CQG B;  2XAQ B;  5L3B B;  5LNK A;  4LF8 T;  5AQV B;  5JRC A;  2N2N A;  2YDQ A;  2WZI A;  4BJN A;  4OX9 T;  4NPP A;  3ZCI A;  1MMG A;  2IC9 A;  4Z90 A;  3VKH A;  2V5D A;  3I0Q A;  2WDV A;  2ZMA A;  4HGA A;  4ZS3 A;  3QUJ A;  2VL8 A;  3HR0 A;  4TZ4 C;  4DVD A;  3E08 A;  2CBJ A;  2X0Y A;  4MBQ A;  3N9P A;  3PUZ F;  5FL1 A;  3BQL A;  4QKN A;  3FZM B;  4HFH A;  4LF4 T;  4B3T T;  2BG9 A;  3Q5E A;  4AI6 A;  2NW9 A;  2I6H A;  2J4G A;  1N32 T;  2OLT A;  4NUV A;  3J7Y q;  4CI1 B;  2Q9Q D;  4J2C A;  5KX5 E;  3C50 A;  5HEH A;  4LF7 T;  1WR0 A;  4UEL A;  3T1H T;  2CPT A;  3ZC1 A;  3ZJ2 A;  5JRE A;  5JDQ A;  2M6I A;  3ZLI A;  2KLQ A;  3EDU A;  4CN6 A;  4PJJ A;  1J1J A;  3ONL C;  2V1D B;  3HI2 A;  1UUS A;  2CXF A;  3V5U A;  5DQV A;  4LFA T;  4IRE A;  3HA4 A;  5FMN A;  2FJA A;  3I9Y A;  3HKD E;  4EZH A;  4CN4 A;  5LHH B;  3PE0 A;  1G73 A;  2VK9 A;  5CA1 E;  2V7M A;  3ETV A;  3O1J A;  3FZL B;  1Z8U A;  2QRX A;  5HXH A;  4KBM B;  2QA7 A;  5AQU B;  2V8S V;  1HCI A;  2UXB T;  2JRK A;  2A3D A;  2W66 A;  4ZI2 C;  3FXD B;  2LRK A;  3KIN B;  3ZMU B;  5JDL A;  2CEA A;  5LMU T;  3AAE B;  3PUQ A;  5J1G A;  4X1K E;  4KMC A;  3P8C D;  5AQN B;  3AEC A;  5LG4 A;  3TLS A;  4A98 A;  2WY2 A;  5L4E A;  4L0R A;  3LK2 B;  4TUY E;  2XSB A;  5ABF A;  4QWN B;  4H9Q C;  5AQS B;  2AXD S;  1WLX A;  5CB4 E;  3WAJ A;  4HFE A;  3U3I A;  4IGU A;  1OED A;  3TLW A;  3PUY F;  3C98 B;  4TX5 A;  3MJX A;  3AEG A;  3F57 A;  1IZN B;  3RI5 A;  4YT0 A;  2H89 A;  3AE3 A;  4IDZ A;  1US7 B;  5M4Y A;  3ZYK A;  4DMV A;  4ZS2 A;  3NZQ A;  2MPK A;  5FXW A;  1E7P A;  5EK3 A;  2CMR A;  3FXE B;  4H9P C;  4DR7 T;  4JI7 T;  1LVF A;  5HXS A;  3KV5 A;  2L3L A;  5JRC B;  2NOX A;  2CBI A;  1WR6 A;  3OPC A;  3RC8 A;  2LE8 A;  4CZZ B;  2XHE B;  4JI5 T;  2NW8 A;  5JR9 A;  3KDS E;  4HWH A;  4KHP T;  2LRL A;  2A2F X;  4DV6 T;  3AEE A;  4GK0 E;  4IHJ E;  3SS1 A;  4JI6 T;  4HFC A;  5J2T E;  2BG9 B;  5LG3 A;  3VRA A;  2KWH A;  1MMD A;  3UUL A;  2BBJ A;  4U7I A;  3SFE A;  1L0V A;  5AQP B;  5FXZ A;  2EHO C;  2LSI A;  5FKY A;  3C4X A;  2JPF A;  2L9Q A;  3EAB A;  2ACZ A;  2E8I A;  4ZOL E;  4P0A A;  4V1A v;  1KEY A;  4QH4 A;  3PU8 A;  5IUX A;  2IW5 B;  1X9B A;  5LGT B;  3DP7 A;  5ADX L;  4NXM T;  5H6Q B;  4OFZ A;  2WZH A;  2YU1 A;  2K48 A;  4EOZ B;  4PK5 A;  5HEO A;  4JI1 T;  2BS4 A;  2BG9 E;  4EXT A;  3E0Z A;  3PUW F;  2FJE A;  3TKL B;  4LMK A;  5LBM A;  2V7I A;  5L47 A;  1D0Z A;  1U5P A;  4HFB A;  3PV0 F;  3JCF A;  4JI2 T;  3K3O A;  4O2B E;  4YTN A;  4LF5 T;  3LG7 A;  4BAY B;  3MAC A;  5DAB A;  5ABE A;  1IBL T;  4HN9 A;  3LJC A;  2LOS A;  4GK5 E;  4ZI2 D;  1R8I A;  3AXJ A;  4EAH A;  5LBQ B;  3VKG A;  3K3Q C;  4HFV A;  3K3N A;  2K24 A;  4P1N A;  2HN2 A;  3OVU A;  2H7O A;  5AQM B;  4IT4 A;  2L8K A;  5HEU A;  2VQF T;  3IEE A;  2QGS A;  5ABF B;  2ES0 A;  2WBL A;  3FZK B;  4DR3 T;  3A5X A;  3H37 A;  3N9L A;  2MOZ A;  4K0K T;  5ABH A;  5HWY A;  1BR2 A;  4DV1 T;  5L3F B;  2E9X D;  2NWB A;  4XBF B;  4DV3 T;  3AAI A;  4A5X A;  1YD8 G;  2J1D G;  2V5C A;  2CXL A;  1S94 A;  4DND A;  1FJG T;  1ZEE A;  2K3W A;  4UEM A;  3UUM A;  4I50 E;  2MBG A;  1BR4 A;  3AA0 B;  1YQ3 A;  4UVA B;  4YXD A;  4MFR A;  4O8S A;  4HFD A;  1MMA A;  5AQL B;  4NXN T;  2WDQ A;  2YIN A;  4ILB A;  3K1S A;  2VUR A;  3IF8 B;  5EK4 A;  2LLY A;  5JDM A;  3RIU C;  2JJ9 A;  3FB2 A;  1OED E;  2I0M A;  4PNI A;  2DHR A;  2X9X A;  2X9H A;  2V7K A;  4EED A;  4YTM A;  3ZC0 A;  4KP3 C;  3UUX B;  1UUR A;  4X5T A;  4JEH B;  5J2U E;  5JR9 B;  1XWM A;  1CHU A;  3RLF F;  3GWH A;  3ZMV B;  2X68 A;  1KK7 A;  3CX6 B;  1UX4 A;  5FP3 A;  2J47 A;  4EB6 E;  2CLY B;  4U2Z A;  4NUU A;  2E5L T;  5TAO A;  4ILA A;  4DID B;  5FY0 A;  5ABG A;  4JUY A;  4YHJ A;  3GN5 A;  3M3Z B;  5LGU B;  5HXC A;  4B3R T;  2VKO A;  3RPU A;  2YKS A;  1YKE B;  3R6N A;  4FI5 A;  2M67 A;  2CXD A;  2CM0 A;  3KVA A;  4KHZ F;  4DBQ A;  2E5V A;  5KDM C;  2XQY A;  5IWA T;  2W67 A;  3PUX F;  2XQ3 A;  2MAW A;  3B57 A;  1JNZ A;  2YOE A;  3PDY A;  2JQQ A;  1QUU A;  3PU3 A;  4ANJ A;  4P09 A;  1D0Y A;  2LSK A;  5GON E;  4PK6 A;  1MIW A;  5LA6 E;  2ODV A;  3UQ7 A;  3EI0 A;  4C91 A;  2EHO A;  3J9X 1;  1VOM A;  4N78 D;  1XDP A;  1KNZ A;  2XAG B;  4GYR A;  3AXJ B;  2JIW A;  1IBK T;  3PJA A;  2F4V T;  3EUH A;  4IDO A;  2DWG A;  3UU6 A;  2D0U A;  3CWZ B;  2VKH A;  5L3C B;  3CQX C;  5C2T A;  3O1H A;  3ZT5 A;  4CXX A;  1ZV4 X;  2YDR A;  3MA9 A;  3UFE A;  4HWC A;  5H6R B;  4M1P A;  4AQF A;  3OKQ A;  3IA3 A;  3AVS A;  4Q25 A;  4IE4 A;  4X1Y E;  3FZF B;  4ZZC A;  1HX8 A;  2Y8D A;  5AQO B;  3ANW A;  2LJL A;  2NR4 A;  2PG8 A;  3RRW A;  1NEN A;  1AJ3 A;  2KWI B;  2LSJ A;  3C51 A;  3ZKR A;  2X9W A;  2KIN B;  2ZM8 A;  3BQK A;  2E2A A;  1NEK A;  2A72 A;  5CJ5 A;  3AA7 B;  3RYC E;  2KND A;  2X0H A;  4CQI A;  2VQE T;  3NRX A;  3PUS A;  3DJB A;  2Q9Q A;  2MYS A;  2LM9 A;  1NWM X;  2Z6E A;  4JYA T;  2H88 A; 
#chains in the Genus database with same CATH homology
 3PJA J;  1KEY A;  4WYV A;  3RIU A;  3RIU C;  3AXJ B;  1J1J A;  3QB5 K;  3PJA A;  3QB5 A;  2QRX A;  3AXJ A;  2QVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...