3AXJA

High resolution crystal structure of c3po
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
225
structure length
225
Chain Sequence
SQDPMSNFVNLDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSDLSQISAACGLARKQVELCAQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFHLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALKYDVKKIEEVVYDVSIRGLSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of C3PO
rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords GM27569p
total genus 90
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3axjA01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3axjA02
1KEYA 3RIUA 4WYVA 3PJAA 3AXJA 3PJAJ 3QB5K 3RIUC 2QRXA 1J1JA 3AXJB 3QB5A 2QVAA
chains in the Genus database with same CATH superfamily
3RKOA 2D5UA 3BK9A 1DU2A 3O1HA 3QK6A 4PW8A 5FL1A 1SA0E 1YXRA 3QB5K 3EABA 3ZT7A 1IBKT 3RC8A 2JRKA 3PDYA 1FJGT 3R84B 2WP9A 3ZMZB 2IC6A 2P9BA 4LFAT 5LA6E 4CZZB 2ACXA 2EHOA 4NXNT 4IIJE 1NAFA 3PJAJ 5AQIB 2VKOA 3I1AA 2XQ9A 5CJ5A 4PJLA 3ZC0A 4JI4T 1Y64B 4IDNA 4ZI7E 2PBIA 4UELA 4MLKA 4E7ZA 3AVRA 4H9QC 4KP3C 5IYZE 5JDFA 3RQUA 2Y6XA 2WB5A 2ZLYA 2HN2A 3WAKA 1KNRA 3EDVA 2JMHA 4JI5T 3RYIE 3V5UA 5JDGA 4CN1A 2V7KA 5H6QB 1HNXT 2CWYA 1HF8A 1VRBA 3LBXB 2YN6A 4JI0T 3UU3A 3NBXX 4BJNA 2ODUA 1CUNA 2BVLA 3MKDA 4X66T 2X66A 3PUVF 2ZM8A 1MMGA 4XAXB 3RX6A 2ZM2A 1E2AA 4EXTA 3UQ4A 4YTNA 5L2LA 4AQYT 4UF0A 1UX5A 1UURA 4QWNB 1J1JA 2H7VC 5DQWA 5LOVE 2KWHA 2K9AA 2QA7A 2XASB 3K3QC 3KVBA 3KINB 3MA9A 4H9RC 4IE6A 2CXFA 4PFOA 3AVSA 3RC3A 4LF9T 3EUHA 3I0QA 2MPKA 5IWAT 5LHIB 2PG8A 3PE0A 5LMNT 3CKDA 3KVAA 4HN9A 3K3OA 4LF8T 1N33T 1OWAA 2CM0A 4LMLA 4DUYT 2KMFA 4YSYA 3CX7B 4DR1T 2K5BB 4G2AA 3AE2A 2UUAT 2H7OA 4X1IE 1KNZA 4U31A 4HFEA 4DR7T 3O1IA 3I9WA 4NUUA 3ZJ2A 2CHNA 2E9XA 3MZKB 2BS2A 3LK42 4EV6A 2X9YA 4BA9A 3JAFA 4O2BE 1J5ET 3NRXA 2FUPA 2NW9A 2E8IA 3C4ZA 3H37A 5DABA 4HWFA 2LHNA 3KBUA 2OLTA 3ONLC 4IREA 4ZEYA 4CI1B 3R6NA 3ZEFB 3OJAA 5EK3A 5ABEA 4DV3T 2LM9A 4DR3T 4I50E 3PUGA 3VKGA 2NR4A 3P4QA 1MNEA 2KWIB 1XZYA 3LK3B 3M3ZB 3SWHA 1S35A 2KLQA 1ZKEA 4CQIA 1ZV4X 2N9DA 2E9XD 1XDOA 4O2AE 4PJJA 4TNWA 2V7JA 3KV5A 5IHYA 2VK9A 2W61A 4DBQA 5C2TA 5HYAA 5LJNA 3B13A 4UF0B 3U3IA 3O9XA 4QXHB 4DR5T 2BBJA 1BR0A 2QYWA 5AQNB 1OXZA 3U78A 4AKHA 3SFDA 1SE7A 5FNVE 3K8PC 2F4VT 3W15B 2KZ7B 2K3WA 5AQFB 2DL1A 5JDNA 3UUNA 4HWHA 4CI2B 5L3CB 2KNDA 4ILBA 5ABGA 3IHRA 5FVLA 5FXXA 4QXCB 3TLTA 2I59A 3NWIA 4NIQA 2XM2A 3GMIA 2CEAA 4EZHA 3O4XE 5F3JA 4H63V 2Y48B 4N78D 3LSVA 3RIAA 2ZM0A 4YXDA 4LMKA 5L47A 5J2TE 3ETVA 5AQRB 4TUYE 4M1PA 4TV9E 3ZMVB 2Q9QC 3RKGA 3E0ZA 5AQMB 5JRCB 2Q9QD 4EEBA 5L3GB 5LHHB 5CFBA 4O4IE 5LJMA 2AE9A 3HKBE 4ERRA 3ZN0B 1VCTA 4I43B 4JBWF 2V7LA 2VKHA 4MHCA 5HXEA 2VURA 2NW7A 4ZHQE 3CMLA 2CXDA 4AQFA 1JNRA 4UIGA 3HKDE 5HEOA 4AKGA 2JQKA 3PUSA 4WBOA 4ZOLE 1R8IA 5H6RB 5HEJA 4DR4T 4L0RA 3PUWF 4EYYR 3ZYLA 1Z8UA 4TWFA 2B1EA 2DCFA 2J4GA 4MFRA 2Q9QA 2WS3A 5J1GA 1HNZT 1T7SA 3MK7C 1WYCA 1LRZA 4I0UA 2I0MA 4KBMB 5HEGA 3RLFF 3LFMA 4YSZA 4GOUA 3EAMA 3I0OA 3OVUA 4HTEA 4ZXLA 2V6XA 3P50A 4PK5A 4U33A 1UK5A 4WZXA 4CI3B 4UR9A 4ZI2C 4B3MT 3UU4A 4EB6E 4EOZB 2YOEA 3PTRB 1WR6A 4G63A 3UUBA 4KUMB 4DR2T 2W00A 4KHZF 1FEWA 5E0OA 5FY0A 3ZC1A 1LKXA 4QKNA 3ZMUB 3ESLA 4H9PC 4QHOA 2FBWA 3DP7A 3SOLA 3ZCIA 3IA3A 3ZJ1A 2UXCT 5JDQA 2LSYA 3OPCA 3Q5EA 2V6YA 3SFEA 2YDSA 5EK2A 2WMOA 3JC6D 4ILAA 5HEUA 4HFHA 1KK7A 5BMVE 3I9YA 4JUYA 5LCYA 4TWHA 2LSJA 5LBMA 2V1DB 2LT3A 3AEBA 4FI5A 4ILCA 3FXEB 4BAYB 2N1GA 5C8YE 3RIUA 4JEHB 4K0KT 1OEDE 1XWMA 3OKQA 2A9UA 4O4JE 1IJ6A 4IT4A 3CPZA 2WM9A 1U5PA 1OEDB 2PJQA 3Q2MA 4K0UA 3CQXC 3HKCE 2X68A 5FXZA 3UT5E 2JPFA 3P4RA 4TN7B 2EHOC 3SS1A 4JYAT 2YINA 1SHZC 3UQ7A 1ZP0A 2XJ7A 2GK9A 2JQ9A 2W66A 3TLVA 2XQ7A 4DR6T 4DV7T 3FHNA 2CPTA 2LLYA 4GKKT 4ZI3D 2XAHB 3ZLIA 3A8YC 3VR9A 5CGMA 3L09A 1GQEA 2DWGA 2VVNA 3DJBA 3AA6B 4U74A 1HS7A 5HXCA 3ABVA 1UGOA 2LRKA 4I55E 2CLYC 2I6HA 3ONXA 4DVDA 2W67A 2BKNA 5BR8T 2X51A 4DV2T 2NP9A 1MIYA 2J47A 2V5CA 2XQYA 2X9HA 3AEGA 3FBZA 3GN5B 3IF8B 4IE4A 4TWDA 5KMGP 1KNPA 2UXNB 3P4SA 2LRLA 4DO0A 3WAJA 4PNIA 3J7Yq 4PAGA 1NWMX 5FY1A 1T98A 5ABHA 4KX6A 2VQFT 4UEMA 3UTKA 2ZMAA 3PV0F 1HFAA 4YY3T 1LVFA 4O8SA 1Y01A 2HHHT 5EK4A 4AQFC 4HFBA 3G06A 2JQHA 3ZN1B 4X64T 2V7IA 4H9NC 1MMNA 1AJ3A 1W9RA 5JDMA 2UXXB 4DUZT 2L8KA 2E5VA 2WY2A 2UU9T 5L4HA 1HG5A 1MIVA 2IDOB 3F2EA 3Q5XA 3VRAA 3BQIA 3ETUA 4KMCA 1NEKA 3ANWA 2HPLA 4A56A 4AIUA 5L3BB 1I94T 4OYJA 1M62A 5JREA 3ZYKA 2FJEA 3M65A 2DI4A 5JDHA 5LG4A 3X1DA 4X1YE 3EI0A 2M6IA 1G73A 4IDQA 4ANJA 3H3AA 4COFA 3PUQA 2XQ8A 4B3ST 2XQAA 2XQ4A 2MAWA 2BVMA 4QH4A 2HN1A 3AEEA 4IDOA 1MMDA 4L9IA 5JRCA 3J9X1 3ZT6A 2CXLA 4Q25A 3CX6B 3UUXB 2XZEA 3N2KE 2K48A 3ANWB 1U4QA 3CIRA 4HGAA 4ISSA 1QLBA 4QH5A 4F6RC 3HA4A 4Z8XA 3B57A 3P4WA 3PUXF 4AISA 4FJOA 5LGNB 5HXHA 4B3RT 3AEFA 5LP6E 2DHRA 4UXNB 3ZSTA 2H89A 3UU6A 4EAHA 5LHGB 4OX9T 1FMVA 3N2GE 2CBJA 2OV9A 3JCFA 5AQJB 3AXJA 3PU3A 4QXBB 4E7SA 3FBLA 4HFIA 2BKPA 1HTJF 3C50A 4DV1T 4LFBT 3VRBA 4AQGA 1IAPA 1UX4A 2D9DA 5HAXA 1WCRA 4Z90A 5LGTB 2LSKA 2H88A 1D1CA 5DJQC 3S4UA 1W0AA 4H9OC 1V9DA 4IL9A 4F8HA 3V5SA 4X65T 2BS4A 2NTYA 2MBGA 2RA1A 3K3NA 4OFZA 4C91A 2WCAA 1B7TA 3NZQA 1MIWA 5FP3A 1N34T 3VU7H 5J0ZA 2VL0A 5FKYA 4YJ2E 4MBQA 4Z91A 1HR0T 2C5IT 4TV8E 2NTXA 2L9QA 3QOFA 3A5XA 4CXXA 5IUXA 2X0LB 5KDMC 3OTOT 2FJDA 4PK6A 2Y8DA 4YHHT 3F57A 2CHOA 3QC9A 3IBPA 2WZIA 3UFGA 4C90A 4IDPA 3RRWA 3LJCA 1E1HB 4EEDA 4X62T 5M4YA 2CE7A 1BR2A 1YW0A 3FXDB 2AXDS 5CA0E 1WLXA 3EDUA 1WR0A 2C5JA 4AKRB 4IGUA 3CK6A 3KDSE 2JJ9A 2CA5A 2DNXA 1JNZA 4EZ4A 4U7YA 3SRZA 2V7MA 2KT9A 2W62A 2CWOA 2XAJB 4P0AA 2C0SA 4GYRA 3NZPA 3ONJA 4HKAA 4WW0A 5AQHB 2XSBA 5JR9A 4CXWA 1O3XA 4YTMA 5LGUB 2RPAA 3AXJB 4YT0A 1W0BA 4HFDA 2M6BA 1X9BA 4HFVA 5KXJA 3AE7A 3C51A 2VL8A 4PFPA 1D1BA 4OHFA 4NXMT 2XHEB 3FZHB 3RYHE 1W09A 2R6GF 4JLEA 1H7CA 2XQ5A 3N9PA 5FXWA 3RHWA 4XBFB 3AA0B 3UULA 3WI3A 1EZ3A 3AEDA 2XPKA 4X20E 1XMOT 4DBRA 3ZKRA 2WAUA 3K1SA 3TKLB 2WDQA 4EGWA 2ZM6T 1IJ5A 2IAKA 2WDVA 5CA1E 1N32T 5LNKA 1QUUA 2C5KT 2YKSA 3AAEB 1M7KA 2IHR1 4IL4A 4P0BA 3RQWA 4B6XA 5TAOA 3TLSA 4YLHA 5C3JA 4DV4T 3RPUA 2WQYA 2W0GA 2LKGA 2LOSA 2NOXA 2QRXA 3OBVE 4TX5A 3AECA 5HCMA 3LG7A 5HCJA 3N9NA 3C4XA 2UXDT 4PJNA 2XY8B 2IW5B 3AE4A 2SPCA 3P4PA 5CB4E 4JI7T 1HNWT 2PTFA 3PUZF 4P09A 2D0UA 5L4EA 2CCQA 3CVRA 3UU8A 5JQGE 3FZKB 2A72A 2ODVA 4UV8B 3RYCE 3KFWX 2XSAA 4WYVA 3PJAA 4IE0A 2WWUA 4QX7B 1YKHB 1WYBA 1UUSA 1YQ4A 3AAIA 3AE3A 3N9LA 3VR8A 5AQLB 2WU2A 3RF1A 4CN4A 4JI3T 4GYSA 1UCUA 1YKEB 2OA5A 2KXPB 2LHRA 3LBXA 4X5TA 3UFEA 3UUMA 5AQSB 2FJAA 4NUVA 4YTPA 1S94A 3JAEA 4ZZCA 3JADA 3A7MA 3FZFB 2Z6EA 3N9MA 2WZHA 1ZHCA 3E08A 2MYSA 2E9XC 2WBLA 5HWXA 2WU5A 4ILUA 4U72A 4JI6T 2W4XA 2EHOB 1XDPA 1XNQT 4KI0F 3T8OA 5HXSA 3ZMTB 4MALA 5AQOB 3H3MA 4EYUA 2KSRA 2J1DG 2ACZA 2QVAA 3FZMB 4UVAB 1HCIA 1YD8G 4ZI3C 2LM2A 3HR0A 4A97A 4DMWA 3CQCB 4AKIA 3T1HT 5JTGA 3F31A 4YSXA 4JI1T 3QNUA 3HL6A 2YEVC 5JDLA 2ES0A 3AE9A 3P8CD 3Q9DA 1HX1B 2V26A 2X9XA 3MACA 4O4HE 3RIFA 1X79A 4HWIB 4B3TT 4IHJE 5LG3A 2FJBA 2HPJA 2XAQB 2CLYB 1E7PA 2B76A 3JC6C 5F8PA 1FIOA 3Q5DA 4V1Av 5J2UE 4ASKA 5ETWA 4HWDA 3MXZA 5JH7E 4DNDA 4LF5T 5FMNA 4UVCB 3AA1B 2BBHA 3DTOA 4WBNE 3AAAB 3C64A 5DQVA 5AQKB 5LMUT 4LF4T 1IBMT 2BS3A 5L3FB 1D0ZA 4GIWA 3RGLA 4X1KE 4A5XA 3N2OA 4ADZA 1IBLT 3N9OA 4NPPA 2MOZA 3AEAA 4IE5A 5AQPB 3ZYMA 2A3DA 1NENA 1J5WA 2IIUA 2V5DA 3OYXA 4TNVA 1KFYA 3ZMSB 3OYZA 4GK0E 1CHUA 2BG9A 3NVOA 2LE8A 4LF6T 4TZ4C 2WMNA 4EIWA 4KHPT 1LVKA 4HFCA 2LKHA 1D0XA 3AB3B 4YFSA 3PURA 5GONE 1L0VA 4DMVA 4O4LE 2G0UA 2XQ3A 2BG9B 4GKJT 2E9XB 5F5WA 2L3LA 5AFUL 5ABFB 5JR9B 5LYJE 3ZSSA 3RYFE 5FY7A 1WFDA 1MNDA 2YDRA 1YQ3A 5JR9C 5LB7B 1BR4A 4UV9B 1Z0PA 3L39A 3ZPOA 3GWHA 4I4TE 3Q5WA 4U3CA 2WWVA 2CBIA 2KINB 2RP4A 2W63A 2XUEA 4YHJA 3UU5A 5ADXL 1XMQT 1I6ZA 2WDRA 4IE7A 4ZI2D 2Q9QB 2YU1A 3C98B 4YJ3E 5AQQB 2LJLA 4JI2T 4LMJA 2LSIA 5LXTE 2PFVA 5JVDE 5FL0A 3KV6A 1G8XA 4H9SE 2BG9E 4IDZA 1OEDC 1IZNB 3AE5A 4JEUB 3BQLA 2JIWA 3NKZA 4J2CA 2VKJA 2VB6A 3LK2B 2XQ6A 4QH1A 2VASA 2HH7A 3T1YT 3HI2A 2UUBT 3AE1A 3HKEE 1QSDA 2X67A 4AKLA 2IUBA 2X0HA 3N5LA 2V8SV 4HE8A 4AI6A 4U7IA 3PUYF 5LBQB 3BQKA 4BJMA 3AA7B 2MTQA 4XZCA 2YK0A 3RIUC 2QGSA 2CMRA 3KBTA 4PJMA 3KV9A 3AE8A 1D1AA 2IC9A 2IMLA 2LOPA 2BKOA 2DWKA 5L3EB 4DV0T 2NW8A 4OYKA 2JMKA 2M67A 4U2YA 5EZYE 4ZS3A 3IEEA 3MJXA 2D0TA 3D0TA 3GA8A 3LDQB 4DV6T 4JI8T 1XNRT 2A2FX 2BZBA 2E2AA 3NRYA 5FVKA 3L3PA 1WRDA 2WSSV 3E22E 1ZEEA 3GN5A 4PK4A 2XTLA 3FB2A 1HG2A 4OK0A 2YU2A 2K24A 2BDEA 2E5LT 2XAGB 2V6YB 2LSGA 2J62A 5AQVB 5ABFA 1D0YA 1BR1A 3P7IA 3CX8B 1MMAA 5AQGB 3ZCJA 3AE6A 3B5MA 3TLUA 3VHLA 5KX5E 2UUCT 3PU8A 3QUJA 3PUAA 3QB5A 4ZS2A 4LF7T 2CRBA 4GK5E 2JQQA 3VKHA 3KV4A 4HWCA 2DLRA 4U2ZA 4L5GA 1N36T 2YDQA 3CWZB 4UVBB 1ZOYA 2X0YA 2H3RA 4LFCT 4QX8B 2VVSA 3N9QA 5AQUB 4AXPA 5HEHA 1SUMB 3EVYA 4HEAA 3FZLB 4A98A 5A1LA 4DV5T 4ZZBA 1OEDA 1VCSA 2UXBT 5HWYA 1VOMA 2VKDA 3RH3A 1KEYA 2BG9C 2XAFB 3TLWA 2X9WA 3O1JA 5FXVA 4H63H 2EHOD 4CXYA 1FMWA 2NWBA 4CN6A 2LEHA 2VQET 1US7B 3L8RA 3RRCA 4WNKA 1T72A 5FYMA 3ZT5A 2W2UA 5L3DB 2VWAA 1HX8A 3EHZA 3RI5A 4JV5T 4P1NA 2XM1A 1T8BA 3C4WA 5AQTB 2N2NA 4DIDB 2D2SA 3CQGB 1KF6A 4ISTA 5HXRA
chains in the Genus database with same CATH topology
1KEYA 3RIUA 4WYVA 3PJAA 3AXJA 3PJAJ 3QB5K 3RIUC 2QRXA 1J1JA 3AXJB 3QB5A 2QVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KEY A;  3RIU A;  4WYV A;  3PJA A;  3AXJ A;  3PJA J;  3QB5 K;  3RIU C;  2QRX A;  1J1J A;  3AXJ B;  3QB5 A;  2QVA A; 
#chains in the Genus database with same CATH topology
 3RKO A;  2D5U A;  3BK9 A;  1DU2 A;  3O1H A;  3QK6 A;  4PW8 A;  5FL1 A;  1SA0 E;  1YXR A;  3QB5 K;  3EAB A;  3ZT7 A;  1IBK T;  3RC8 A;  2JRK A;  3PDY A;  1FJG T;  3R84 B;  2WP9 A;  3ZMZ B;  2IC6 A;  2P9B A;  4LFA T;  5LA6 E;  4CZZ B;  2ACX A;  2EHO A;  4NXN T;  4IIJ E;  1NAF A;  3PJA J;  5AQI B;  2VKO A;  3I1A A;  2XQ9 A;  5CJ5 A;  4PJL A;  3ZC0 A;  4JI4 T;  1Y64 B;  4IDN A;  4ZI7 E;  2PBI A;  4UEL A;  4MLK A;  4E7Z A;  3AVR A;  4H9Q C;  4KP3 C;  5IYZ E;  5JDF A;  3RQU A;  2Y6X A;  2WB5 A;  2ZLY A;  2HN2 A;  3WAK A;  1KNR A;  3EDV A;  2JMH A;  4JI5 T;  3RYI E;  3V5U A;  5JDG A;  4CN1 A;  2V7K A;  5H6Q B;  1HNX T;  2CWY A;  1HF8 A;  1VRB A;  3LBX B;  2YN6 A;  4JI0 T;  3UU3 A;  3NBX X;  4BJN A;  2ODU A;  1CUN A;  2BVL A;  3MKD A;  4X66 T;  2X66 A;  3PUV F;  2ZM8 A;  1MMG A;  4XAX B;  3RX6 A;  2ZM2 A;  1E2A A;  4EXT A;  3UQ4 A;  4YTN A;  5L2L A;  4AQY T;  4UF0 A;  1UX5 A;  1UUR A;  4QWN B;  1J1J A;  2H7V C;  5DQW A;  5LOV E;  2KWH A;  2K9A A;  2QA7 A;  2XAS B;  3K3Q C;  3KVB A;  3KIN B;  3MA9 A;  4H9R C;  4IE6 A;  2CXF A;  4PFO A;  3AVS A;  3RC3 A;  4LF9 T;  3EUH A;  3I0Q A;  2MPK A;  5IWA T;  5LHI B;  2PG8 A;  3PE0 A;  5LMN T;  3CKD A;  3KVA A;  4HN9 A;  3K3O A;  4LF8 T;  1N33 T;  1OWA A;  2CM0 A;  4LML A;  4DUY T;  2KMF A;  4YSY A;  3CX7 B;  4DR1 T;  2K5B B;  4G2A A;  3AE2 A;  2UUA T;  2H7O A;  4X1I E;  1KNZ A;  4U31 A;  4HFE A;  4DR7 T;  3O1I A;  3I9W A;  4NUU A;  3ZJ2 A;  2CHN A;  2E9X A;  3MZK B;  2BS2 A;  3LK4 2;  4EV6 A;  2X9Y A;  4BA9 A;  3JAF A;  4O2B E;  1J5E T;  3NRX A;  2FUP A;  2NW9 A;  2E8I A;  3C4Z A;  3H37 A;  5DAB A;  4HWF A;  2LHN A;  3KBU A;  2OLT A;  3ONL C;  4IRE A;  4ZEY A;  4CI1 B;  3R6N A;  3ZEF B;  3OJA A;  5EK3 A;  5ABE A;  4DV3 T;  2LM9 A;  4DR3 T;  4I50 E;  3PUG A;  3VKG A;  2NR4 A;  3P4Q A;  1MNE A;  2KWI B;  1XZY A;  3LK3 B;  3M3Z B;  3SWH A;  1S35 A;  2KLQ A;  1ZKE A;  4CQI A;  1ZV4 X;  2N9D A;  2E9X D;  1XDO A;  4O2A E;  4PJJ A;  4TNW A;  2V7J A;  3KV5 A;  5IHY A;  2VK9 A;  2W61 A;  4DBQ A;  5C2T A;  5HYA A;  5LJN A;  3B13 A;  4UF0 B;  3U3I A;  3O9X A;  4QXH B;  4DR5 T;  2BBJ A;  1BR0 A;  2QYW A;  5AQN B;  1OXZ A;  3U78 A;  4AKH A;  3SFD A;  1SE7 A;  5FNV E;  3K8P C;  2F4V T;  3W15 B;  2KZ7 B;  2K3W A;  5AQF B;  2DL1 A;  5JDN A;  3UUN A;  4HWH A;  4CI2 B;  5L3C B;  2KND A;  4ILB A;  5ABG A;  3IHR A;  5FVL A;  5FXX A;  4QXC B;  3TLT A;  2I59 A;  3NWI A;  4NIQ A;  2XM2 A;  3GMI A;  2CEA A;  4EZH A;  3O4X E;  5F3J A;  4H63 V;  2Y48 B;  4N78 D;  3LSV A;  3RIA A;  2ZM0 A;  4YXD A;  4LMK A;  5L47 A;  5J2T E;  3ETV A;  5AQR B;  4TUY E;  4M1P A;  4TV9 E;  3ZMV B;  2Q9Q C;  3RKG A;  3E0Z A;  5AQM B;  5JRC B;  2Q9Q D;  4EEB A;  5L3G B;  5LHH B;  5CFB A;  4O4I E;  5LJM A;  2AE9 A;  3HKB E;  4ERR A;  3ZN0 B;  1VCT A;  4I43 B;  4JBW F;  2V7L A;  2VKH A;  4MHC A;  5HXE A;  2VUR A;  2NW7 A;  4ZHQ E;  3CML A;  2CXD A;  4AQF A;  1JNR A;  4UIG A;  3HKD E;  5HEO A;  4AKG A;  2JQK A;  3PUS A;  4WBO A;  4ZOL E;  1R8I A;  5H6R B;  5HEJ A;  4DR4 T;  4L0R A;  3PUW F;  4EYY R;  3ZYL A;  1Z8U A;  4TWF A;  2B1E A;  2DCF A;  2J4G A;  4MFR A;  2Q9Q A;  2WS3 A;  5J1G A;  1HNZ T;  1T7S A;  3MK7 C;  1WYC A;  1LRZ A;  4I0U A;  2I0M A;  4KBM B;  5HEG A;  3RLF F;  3LFM A;  4YSZ A;  4GOU A;  3EAM A;  3I0O A;  3OVU A;  4HTE A;  4ZXL A;  2V6X A;  3P50 A;  4PK5 A;  4U33 A;  1UK5 A;  4WZX A;  4CI3 B;  4UR9 A;  4ZI2 C;  4B3M T;  3UU4 A;  4EB6 E;  4EOZ B;  2YOE A;  3PTR B;  1WR6 A;  4G63 A;  3UUB A;  4KUM B;  4DR2 T;  2W00 A;  4KHZ F;  1FEW A;  5E0O A;  5FY0 A;  3ZC1 A;  1LKX A;  4QKN A;  3ZMU B;  3ESL A;  4H9P C;  4QHO A;  2FBW A;  3DP7 A;  3SOL A;  3ZCI A;  3IA3 A;  3ZJ1 A;  2UXC T;  5JDQ A;  2LSY A;  3OPC A;  3Q5E A;  2V6Y A;  3SFE A;  2YDS A;  5EK2 A;  2WMO A;  3JC6 D;  4ILA A;  5HEU A;  4HFH A;  1KK7 A;  5BMV E;  3I9Y A;  4JUY A;  5LCY A;  4TWH A;  2LSJ A;  5LBM A;  2V1D B;  2LT3 A;  3AEB A;  4FI5 A;  4ILC A;  3FXE B;  4BAY B;  2N1G A;  5C8Y E;  3RIU A;  4JEH B;  4K0K T;  1OED E;  1XWM A;  3OKQ A;  2A9U A;  4O4J E;  1IJ6 A;  4IT4 A;  3CPZ A;  2WM9 A;  1U5P A;  1OED B;  2PJQ A;  3Q2M A;  4K0U A;  3CQX C;  3HKC E;  2X68 A;  5FXZ A;  3UT5 E;  2JPF A;  3P4R A;  4TN7 B;  2EHO C;  3SS1 A;  4JYA T;  2YIN A;  1SHZ C;  3UQ7 A;  1ZP0 A;  2XJ7 A;  2GK9 A;  2JQ9 A;  2W66 A;  3TLV A;  2XQ7 A;  4DR6 T;  4DV7 T;  3FHN A;  2CPT A;  2LLY A;  4GKK T;  4ZI3 D;  2XAH B;  3ZLI A;  3A8Y C;  3VR9 A;  5CGM A;  3L09 A;  1GQE A;  2DWG A;  2VVN A;  3DJB A;  3AA6 B;  4U74 A;  1HS7 A;  5HXC A;  3ABV A;  1UGO A;  2LRK A;  4I55 E;  2CLY C;  2I6H A;  3ONX A;  4DVD A;  2W67 A;  2BKN A;  5BR8 T;  2X51 A;  4DV2 T;  2NP9 A;  1MIY A;  2J47 A;  2V5C A;  2XQY A;  2X9H A;  3AEG A;  3FBZ A;  3GN5 B;  3IF8 B;  4IE4 A;  4TWD A;  5KMG P;  1KNP A;  2UXN B;  3P4S A;  2LRL A;  4DO0 A;  3WAJ A;  4PNI A;  3J7Y q;  4PAG A;  1NWM X;  5FY1 A;  1T98 A;  5ABH A;  4KX6 A;  2VQF T;  4UEM A;  3UTK A;  2ZMA A;  3PV0 F;  1HFA A;  4YY3 T;  1LVF A;  4O8S A;  1Y01 A;  2HHH T;  5EK4 A;  4AQF C;  4HFB A;  3G06 A;  2JQH A;  3ZN1 B;  4X64 T;  2V7I A;  4H9N C;  1MMN A;  1AJ3 A;  1W9R A;  5JDM A;  2UXX B;  4DUZ T;  2L8K A;  2E5V A;  2WY2 A;  2UU9 T;  5L4H A;  1HG5 A;  1MIV A;  2IDO B;  3F2E A;  3Q5X A;  3VRA A;  3BQI A;  3ETU A;  4KMC A;  1NEK A;  3ANW A;  2HPL A;  4A56 A;  4AIU A;  5L3B B;  1I94 T;  4OYJ A;  1M62 A;  5JRE A;  3ZYK A;  2FJE A;  3M65 A;  2DI4 A;  5JDH A;  5LG4 A;  3X1D A;  4X1Y E;  3EI0 A;  2M6I A;  1G73 A;  4IDQ A;  4ANJ A;  3H3A A;  4COF A;  3PUQ A;  2XQ8 A;  4B3S T;  2XQA A;  2XQ4 A;  2MAW A;  2BVM A;  4QH4 A;  2HN1 A;  3AEE A;  4IDO A;  1MMD A;  4L9I A;  5JRC A;  3J9X 1;  3ZT6 A;  2CXL A;  4Q25 A;  3CX6 B;  3UUX B;  2XZE A;  3N2K E;  2K48 A;  3ANW B;  1U4Q A;  3CIR A;  4HGA A;  4ISS A;  1QLB A;  4QH5 A;  4F6R C;  3HA4 A;  4Z8X A;  3B57 A;  3P4W A;  3PUX F;  4AIS A;  4FJO A;  5LGN B;  5HXH A;  4B3R T;  3AEF A;  5LP6 E;  2DHR A;  4UXN B;  3ZST A;  2H89 A;  3UU6 A;  4EAH A;  5LHG B;  4OX9 T;  1FMV A;  3N2G E;  2CBJ A;  2OV9 A;  3JCF A;  5AQJ B;  3AXJ A;  3PU3 A;  4QXB B;  4E7S A;  3FBL A;  4HFI A;  2BKP A;  1HTJ F;  3C50 A;  4DV1 T;  4LFB T;  3VRB A;  4AQG A;  1IAP A;  1UX4 A;  2D9D A;  5HAX A;  1WCR A;  4Z90 A;  5LGT B;  2LSK A;  2H88 A;  1D1C A;  5DJQ C;  3S4U A;  1W0A A;  4H9O C;  1V9D A;  4IL9 A;  4F8H A;  3V5S A;  4X65 T;  2BS4 A;  2NTY A;  2MBG A;  2RA1 A;  3K3N A;  4OFZ A;  4C91 A;  2WCA A;  1B7T A;  3NZQ A;  1MIW A;  5FP3 A;  1N34 T;  3VU7 H;  5J0Z A;  2VL0 A;  5FKY A;  4YJ2 E;  4MBQ A;  4Z91 A;  1HR0 T;  2C5I T;  4TV8 E;  2NTX A;  2L9Q A;  3QOF A;  3A5X A;  4CXX A;  5IUX A;  2X0L B;  5KDM C;  3OTO T;  2FJD A;  4PK6 A;  2Y8D A;  4YHH T;  3F57 A;  2CHO A;  3QC9 A;  3IBP A;  2WZI A;  3UFG A;  4C90 A;  4IDP A;  3RRW A;  3LJC A;  1E1H B;  4EED A;  4X62 T;  5M4Y A;  2CE7 A;  1BR2 A;  1YW0 A;  3FXD B;  2AXD S;  5CA0 E;  1WLX A;  3EDU A;  1WR0 A;  2C5J A;  4AKR B;  4IGU A;  3CK6 A;  3KDS E;  2JJ9 A;  2CA5 A;  2DNX A;  1JNZ A;  4EZ4 A;  4U7Y A;  3SRZ A;  2V7M A;  2KT9 A;  2W62 A;  2CWO A;  2XAJ B;  4P0A A;  2C0S A;  4GYR A;  3NZP A;  3ONJ A;  4HKA A;  4WW0 A;  5AQH B;  2XSB A;  5JR9 A;  4CXW A;  1O3X A;  4YTM A;  5LGU B;  2RPA A;  3AXJ B;  4YT0 A;  1W0B A;  4HFD A;  2M6B A;  1X9B A;  4HFV A;  5KXJ A;  3AE7 A;  3C51 A;  2VL8 A;  4PFP A;  1D1B A;  4OHF A;  4NXM T;  2XHE B;  3FZH B;  3RYH E;  1W09 A;  2R6G F;  4JLE A;  1H7C A;  2XQ5 A;  3N9P A;  5FXW A;  3RHW A;  4XBF B;  3AA0 B;  3UUL A;  3WI3 A;  1EZ3 A;  3AED A;  2XPK A;  4X20 E;  1XMO T;  4DBR A;  3ZKR A;  2WAU A;  3K1S A;  3TKL B;  2WDQ A;  4EGW A;  2ZM6 T;  1IJ5 A;  2IAK A;  2WDV A;  5CA1 E;  1N32 T;  5LNK A;  1QUU A;  2C5K T;  2YKS A;  3AAE B;  1M7K A;  2IHR 1;  4IL4 A;  4P0B A;  3RQW A;  4B6X A;  5TAO A;  3TLS A;  4YLH A;  5C3J A;  4DV4 T;  3RPU A;  2WQY A;  2W0G A;  2LKG A;  2LOS A;  2NOX A;  2QRX A;  3OBV E;  4TX5 A;  3AEC A;  5HCM A;  3LG7 A;  5HCJ A;  3N9N A;  3C4X A;  2UXD T;  4PJN A;  2XY8 B;  2IW5 B;  3AE4 A;  2SPC A;  3P4P A;  5CB4 E;  4JI7 T;  1HNW T;  2PTF A;  3PUZ F;  4P09 A;  2D0U A;  5L4E A;  2CCQ A;  3CVR A;  3UU8 A;  5JQG E;  3FZK B;  2A72 A;  2ODV A;  4UV8 B;  3RYC E;  3KFW X;  2XSA A;  4WYV A;  3PJA A;  4IE0 A;  2WWU A;  4QX7 B;  1YKH B;  1WYB A;  1UUS A;  1YQ4 A;  3AAI A;  3AE3 A;  3N9L A;  3VR8 A;  5AQL B;  2WU2 A;  3RF1 A;  4CN4 A;  4JI3 T;  4GYS A;  1UCU A;  1YKE B;  2OA5 A;  2KXP B;  2LHR A;  3LBX A;  4X5T A;  3UFE A;  3UUM A;  5AQS B;  2FJA A;  4NUV A;  4YTP A;  1S94 A;  3JAE A;  4ZZC A;  3JAD A;  3A7M A;  3FZF B;  2Z6E A;  3N9M A;  2WZH A;  1ZHC A;  3E08 A;  2MYS A;  2E9X C;  2WBL A;  5HWX A;  2WU5 A;  4ILU A;  4U72 A;  4JI6 T;  2W4X A;  2EHO B;  1XDP A;  1XNQ T;  4KI0 F;  3T8O A;  5HXS A;  3ZMT B;  4MAL A;  5AQO B;  3H3M A;  4EYU A;  2KSR A;  2J1D G;  2ACZ A;  2QVA A;  3FZM B;  4UVA B;  1HCI A;  1YD8 G;  4ZI3 C;  2LM2 A;  3HR0 A;  4A97 A;  4DMW A;  3CQC B;  4AKI A;  3T1H T;  5JTG A;  3F31 A;  4YSX A;  4JI1 T;  3QNU A;  3HL6 A;  2YEV C;  5JDL A;  2ES0 A;  3AE9 A;  3P8C D;  3Q9D A;  1HX1 B;  2V26 A;  2X9X A;  3MAC A;  4O4H E;  3RIF A;  1X79 A;  4HWI B;  4B3T T;  4IHJ E;  5LG3 A;  2FJB A;  2HPJ A;  2XAQ B;  2CLY B;  1E7P A;  2B76 A;  3JC6 C;  5F8P A;  1FIO A;  3Q5D A;  4V1A v;  5J2U E;  4ASK A;  5ETW A;  4HWD A;  3MXZ A;  5JH7 E;  4DND A;  4LF5 T;  5FMN A;  4UVC B;  3AA1 B;  2BBH A;  3DTO A;  4WBN E;  3AAA B;  3C64 A;  5DQV A;  5AQK B;  5LMU T;  4LF4 T;  1IBM T;  2BS3 A;  5L3F B;  1D0Z A;  4GIW A;  3RGL A;  4X1K E;  4A5X A;  3N2O A;  4ADZ A;  1IBL T;  3N9O A;  4NPP A;  2MOZ A;  3AEA A;  4IE5 A;  5AQP B;  3ZYM A;  2A3D A;  1NEN A;  1J5W A;  2IIU A;  2V5D A;  3OYX A;  4TNV A;  1KFY A;  3ZMS B;  3OYZ A;  4GK0 E;  1CHU A;  2BG9 A;  3NVO A;  2LE8 A;  4LF6 T;  4TZ4 C;  2WMN A;  4EIW A;  4KHP T;  1LVK A;  4HFC A;  2LKH A;  1D0X A;  3AB3 B;  4YFS A;  3PUR A;  5GON E;  1L0V A;  4DMV A;  4O4L E;  2G0U A;  2XQ3 A;  2BG9 B;  4GKJ T;  2E9X B;  5F5W A;  2L3L A;  5AFU L;  5ABF B;  5JR9 B;  5LYJ E;  3ZSS A;  3RYF E;  5FY7 A;  1WFD A;  1MND A;  2YDR A;  1YQ3 A;  5JR9 C;  5LB7 B;  1BR4 A;  4UV9 B;  1Z0P A;  3L39 A;  3ZPO A;  3GWH A;  4I4T E;  3Q5W A;  4U3C A;  2WWV A;  2CBI A;  2KIN B;  2RP4 A;  2W63 A;  2XUE A;  4YHJ A;  3UU5 A;  5ADX L;  1XMQ T;  1I6Z A;  2WDR A;  4IE7 A;  4ZI2 D;  2Q9Q B;  2YU1 A;  3C98 B;  4YJ3 E;  5AQQ B;  2LJL A;  4JI2 T;  4LMJ A;  2LSI A;  5LXT E;  2PFV A;  5JVD E;  5FL0 A;  3KV6 A;  1G8X A;  4H9S E;  2BG9 E;  4IDZ A;  1OED C;  1IZN B;  3AE5 A;  4JEU B;  3BQL A;  2JIW A;  3NKZ A;  4J2C A;  2VKJ A;  2VB6 A;  3LK2 B;  2XQ6 A;  4QH1 A;  2VAS A;  2HH7 A;  3T1Y T;  3HI2 A;  2UUB T;  3AE1 A;  3HKE E;  1QSD A;  2X67 A;  4AKL A;  2IUB A;  2X0H A;  3N5L A;  2V8S V;  4HE8 A;  4AI6 A;  4U7I A;  3PUY F;  5LBQ B;  3BQK A;  4BJM A;  3AA7 B;  2MTQ A;  4XZC A;  2YK0 A;  3RIU C;  2QGS A;  2CMR A;  3KBT A;  4PJM A;  3KV9 A;  3AE8 A;  1D1A A;  2IC9 A;  2IML A;  2LOP A;  2BKO A;  2DWK A;  5L3E B;  4DV0 T;  2NW8 A;  4OYK A;  2JMK A;  2M67 A;  4U2Y A;  5EZY E;  4ZS3 A;  3IEE A;  3MJX A;  2D0T A;  3D0T A;  3GA8 A;  3LDQ B;  4DV6 T;  4JI8 T;  1XNR T;  2A2F X;  2BZB A;  2E2A A;  3NRY A;  5FVK A;  3L3P A;  1WRD A;  2WSS V;  3E22 E;  1ZEE A;  3GN5 A;  4PK4 A;  2XTL A;  3FB2 A;  1HG2 A;  4OK0 A;  2YU2 A;  2K24 A;  2BDE A;  2E5L T;  2XAG B;  2V6Y B;  2LSG A;  2J62 A;  5AQV B;  5ABF A;  1D0Y A;  1BR1 A;  3P7I A;  3CX8 B;  1MMA A;  5AQG B;  3ZCJ A;  3AE6 A;  3B5M A;  3TLU A;  3VHL A;  5KX5 E;  2UUC T;  3PU8 A;  3QUJ A;  3PUA A;  3QB5 A;  4ZS2 A;  4LF7 T;  2CRB A;  4GK5 E;  2JQQ A;  3VKH A;  3KV4 A;  4HWC A;  2DLR A;  4U2Z A;  4L5G A;  1N36 T;  2YDQ A;  3CWZ B;  4UVB B;  1ZOY A;  2X0Y A;  2H3R A;  4LFC T;  4QX8 B;  2VVS A;  3N9Q A;  5AQU B;  4AXP A;  5HEH A;  1SUM B;  3EVY A;  4HEA A;  3FZL B;  4A98 A;  5A1L A;  4DV5 T;  4ZZB A;  1OED A;  1VCS A;  2UXB T;  5HWY A;  1VOM A;  2VKD A;  3RH3 A;  1KEY A;  2BG9 C;  2XAF B;  3TLW A;  2X9W A;  3O1J A;  5FXV A;  4H63 H;  2EHO D;  4CXY A;  1FMW A;  2NWB A;  4CN6 A;  2LEH A;  2VQE T;  1US7 B;  3L8R A;  3RRC A;  4WNK A;  1T72 A;  5FYM A;  3ZT5 A;  2W2U A;  5L3D B;  2VWA A;  1HX8 A;  3EHZ A;  3RI5 A;  4JV5 T;  4P1N A;  2XM1 A;  1T8B A;  3C4W A;  5AQT B;  2N2N A;  4DID B;  2D2S A;  3CQG B;  1KF6 A;  4IST A;  5HXR A; 
#chains in the Genus database with same CATH homology
 1KEY A;  3RIU A;  4WYV A;  3PJA A;  3AXJ A;  3PJA J;  3QB5 K;  3RIU C;  2QRX A;  1J1J A;  3AXJ B;  3QB5 A;  2QVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...