3CWZB

Structure of rab6(gtp)-r6ip1 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
336
structure length
310
Chain Sequence
NLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKLAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSLPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ras-related protein Rab-6A
publication title Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 310
sequence length 336
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01477 PLAT PLAT/LH2 domain
B PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cwzB01
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 3cwzB03
4WHAA 2CXFA 2IUKA 1N8QA 2SBLA 1FGTA 1QM6A 1RRLA 2CXLA 3FG4A 1CA1A 1LOXA 1QMDA 1ROVA 3BNEA 1HPLA 1GYGA 1FGRA 2PVSA 3V98A 2WXTA 1OLPA 1F8NA 2PPLA 3BNDA 1FGOA 3PZWA 1N8SA 3VF1A 1HU9A 3FG3A 2FNQA 2DWKA 1FGQA 1W52X 1NO3A 1LPAB 1YGEA 3BNBA 2WXUA 2WY6A 4QWTA 1ETHA 1RRHA 1RP1A 1GPLA 1BU8A 2P0MA 4GIWA 4WFOA 1Y4KA 3FG1A 3BNCA 3V92A 1IK3A 3O8YA 5EEOA 1LNHA 1KHOA 3V99A 1LPBB 1JNQA 4NREA 3CWZB 1FGMA 2DWGA 2OXEA 2IUJA
chains in the Genus database with same CATH superfamily
2NWBA 2WDVA 4IE0A 1QM6A 4WBNE 2UU9T 4LFBT 2IIUA 5JDMA 2BG9E 3ZKRA 2ZM8A 4WBOA 3PJAJ 3OTOT 5HEHA 5DQVA 1XNRT 1LNHA 1EZ3A 1FGMA 3AEAA 4QKNA 1YKHB 3TLSA 3NRXA 3N5LA 3WAKA 2YKSA 1QSDA 2LKGA 2XQ3A 3SS1A 3Q2MA 5LJNA 4A56A 5LBQB 3UFEA 5AQPB 5GONE 2CEAA 3U78A 3X1DA 4HE8A 3QK6A 3T1HT 2XQ5A 3FXEB 4YT0A 4HFIA 2YOEA 1IZNB 1FGQA 3UU8A 4IDZA 1NWMX 3SRZA 3AAAB 1FJGT 2ZM2A 4I0UA 5HEGA 4DR3T 2WQYA 2ES0A 3GN5A 4TWHA 2EHOD 2ZM0A 3ANWB 3AE6A 4JYAT 2D0UA 2J47A 4AISA 3AXJA 3NBXX 4AKGA 4DV3T 2M6IA 3AE7A 2LGEA 4WFOA 2V7LA 3PJAA 2CPTA 2LRKA 2CHOA 4NREA 3MA9A 2N2NA 3RX6A 4P1NA 3Q5EA 2QGSA 3AECA 4JUYA 2CWOA 3OJAA 4FI5A 4YY3T 3NVOA 2LOPA 4DR2T 4JI0T 2XZEA 2W62A 1NENA 3B5MA 5BMVE 1Y64B 2JMHA 2LSKA 4U2YA 3JAEA 5L2LA 2MTQA 2C5KT 4PNIA 4ILAA 4B3RT 3P4SA 2E9XD 3ONLC 4IREA 2WM9A 2K9AA 1HNWT 5AQLB 4C90A 4YSZA 4X65T 3PTRB 1YQ3A 4NUVA 1W09A 3UFGA 2L9QA 4G2AA 3LBXB 1W52X 1FEWA 2DNXA 1V9DA 1MMDA 5LG3A 5AQSB 5L4EA 1I6ZA 2XY8B 3B13A 2CLYC 3GN5B 3UQ7A 4U3CA 3GA8A 4OX9T 3AXJB 4HWDA 2BBJA 5LOVE 5HXCA 1N32T 2WAUA 1J1JA 4DR6T 2A72A 5DJQC 2V5CA 1HX1B 3N2KE 4WW0A 2CLYB 3FZLB 4YXDA 3PV0F 2VK9A 4LF6T 1H7CA 3FBZA 5AQTB 4EYYR 3LG7A 4NXMT 1UURA 3KBUA 3N9OA 5FL0A 5JDQA 5AQUB 3ZEFB 4JEUB 2LRGA 3UU6A 5C3JA 3PUVF 3V5SA 1SA0E 2CBIA 4LF5T 3FZKB 3IA3A 3HL6A 1YXRA 4TUYE 4ZHQE 5CA1E 5JDFA 2X0LB 4ZOLE 3CQGB 2FJAA 4NUUA 5LMUT 1QLBA 4DV4T 5L3GB 2FBWA 4XAXB 2XAQB 2R6GF 1UX4A 4DMWA 1FGRA 4MFRA 3TKLB 1YGEA 4ADZA 2KMFA 5HEOA 3C50A 4O2AE 5J0ZA 5HCJA 2XAJB 3KINB 4GIWA 4UVCB 2XQ4A 3L8RA 4K0KT 2V7IA 4PJMA 3DJBA 2NTXA 4LFCT 5JTGA 1XDPA 5FP3A 4M1PA 3BQLA 3K8PC 2KXTA 1W0AA 1XMOT 4ZS2A 1D0XA 2WY6A 2WMNA 2W00A 3FHNA 3B57A 3ZMSB 3VKHA 5AQFB 2UXDT 1KNRA 5ABEA 2OLTA 4EOZB 2X68A 1KK7A 3ESLA 1HNZT 2WCAA 3LK2B 5FKYA 1T98A 3AE3A 5LG4A 2D5UA 5DQWA 2BG9A 4OYKA 4CXYA 2XJ7A 2XTLA 1SHZC 3FG4A 2KWIB 3ZN1B 4AQYT 2C5JA 2VKHA 3UU5A 2CBJA 2LSYA 3PURA 3NZQA 5IYZE 2LKHA 1BU8A 3UUMA 4DNDA 2PFVA 1S94A 3TLTA 2KLQA 1QMDA 4PJLA 4DR5T 5JDNA 2KXVA 2V7JA 3OYZA 3P4QA 1Y01A 4JI4T 2RA1A 3KFWX 5FMNA 3F2EA 4FJOA 3AE1A 4UF0A 4GKKT 1WYCA 4UV8B 4ISSA 4DV5T 2QZ7A 3JC6C 2BKPA 3Q5DA 1MMNA 5M4YA 5JRCA 4H9RC 3ABVA 2Z6EA 3BK9A 2EHOA 3L3PA 4IDQA 3VHLA 3OKQA 5LGNB 5HXHA 3ONJA 3UULA 1LPBB 3N2GE 3OPCA 4KUMB 4EV6A 1XNQT 4HTEA 2WU5A 3NWIA 3VU7H 4JEHB 3ZYLA 1KEYA 2RP4A 4X1KE 4TNVA 2QRXA 2H88A 3OYXA 5LMNT 2WSSV 2DWGA 4ANJA 4TX5A 2FJDA 2PBIA 3WI3A 2CE7A 4GYRA 5L3DB 2VL0A 4ZEYA 4KMCA 1VRBA 2BZBA 1OLPA 1N33T 2C0SA 5L3BB 3FG3A 2DHRA 2IW5B 3BNBA 4JI3T 2WY2A 4AKHA 4DO0A 4EGWA 4UEMA 4LF9T 2JPFA 3AAEB 4I43B 2E9XA 4CQIA 5KMGP 3I0QA 1WFDA 2E5VA 3T8OA 3AE8A 3FZMB 4LF4T 4HWFA 3PUAA 2JQKA 2BKOA 3J9X1 4E7ZA 4B3MT 3VF1A 3ZSSA 3MACA 2DWKA 1G8XA 3CMLA 5JR9A 2WB5A 3ZJ1A 2VB6A 3V5UA 1MMAA 1IK3A 4L0RA 2B76A 2V6XA 3EUHA 3ZC1A 4PK4A 2XQAA 4O4LE 1KF6A 4CN6A 3VR8A 5JRCB 3P4RA 2CWYA 2B1EA 4OHFA 1UUSA 2EHOB 4JV5T 3PUXF 4IHJE 5KXJA 1W0BA 3ETUA 5HWYA 2XASB 2KXPB 3RPUA 4GOUA 4LMKA 3ZT6A 3P8CD 2A2FX 4F8HA 3ANWA 4KX6A 4LMLA 5ADXL 2J1DG 3WAJA 4TN7B 2UUCT 5LGTB 2XAGB 1VCSA 2E9XC 3K1SA 3ZMVB 3EVYA 3VKGA 2HN1A 3JC6D 3L39A 5AQOB 3O1HA 5JR9C 2UXNB 2D2SA 3EI0A 3K3OA 4COFA 2E8IA 3CX7B 4ILBA 3RH3A 2IAKA 4AKRB 3L09A 3KV6A 2E9XB 5L47A 3AEGA 1E2AA 3UTKA 4NXNT 5C8YE 3RIAA 5AQHB 3IBZA 5CJ5A 3SFDA 1UGOA 4KP3C 5JR9B 2ACXA 5AQNB 2XPKA 4IIJE 1T72A 3V99A 3KDSE 2JMKA 3HKDE 5H6QB 5ABFA 2WZIA 5DABA 3AE4A 4PK6A 2LE8A 4ILUA 4DR1T 4ZXLA 2LOSA 4YSXA 2N1GA 3LBXA 4TNWA 2WMOA 4QWTA 2KZ7B 5AQJB 1E7PA 4HWCA 2QVAA 4IGUA 4ZI3C 5FVKA 2XFDA 2E5LT 1KHOA 2W4XA 2G0UA 1ZOYA 1MMGA 4CN1A 4YHHT 3AVSA 4JI7T 2ZM6T 3KVAA 3MJXA 2CRBA 3CX6B 5LHIB 5FXXA 3K3QC 2XUEA 4HFVA 2IUJA 4PW8A 1SE7A 3ETVA 3JADA 1HPLA 2H3RA 3ZMUB 4Z90A 3PDYA 1WYBA 1HR0T 4ZI2D 1HX8A 2LM2A 3UUNA 5AQVB 3IEEA 5JDLA 4DIDB 3EABA 4HWIB 2FUPA 2XFEA 2SBLA 1G73A 2CM0A 1MIVA 5JDGA 4YJ2E 4JI2T 4WZXA 1NEKA 1XDOA 1D1CA 2UXBT 1RP1A 1WR6A 2D9DA 3O1JA 4B3ST 3ZT7A 2OXEA 3C64A 4B6XA 5ABFB 2UXXB 2V5DA 3ZLIA 5JQGE 4TWDA 2XQ9A 2YDRA 2YU2A 1GQEA 2BVMA 1KNPA 4HGAA 4MHCA 3CQXC 4QX7B 2XSAA 4EEBA 4V1Av 4DBRA 2VKJA 4AKIA 2QA7A 2E2AA 4ZI7E 5FXWA 4ZZCA 4NIQA 4GK0E 4JI1T 3P4PA 5ETWA 5HAXA 2VASA 5HEJA 2IHR1 4DBQA 2ODVA 1LRZA 1IJ6A 4X1IE 1N36T 4AKLA 2VWAA 5ABGA 4ZI3D 3PUYF 4A97A 2XQYA 2Y6XA 4HEAA 4YHJA 3E22E 3H37A 1FGOA 3PZWA 4OK0A 2WDQA 3EDVA 3DTOA 3P7IA 1MIYA 2I59A 4U2ZA 3RYCE 3M3ZB 3I9YA 2MAWA 5JVDE 2ZLYA 2W63A 4QHOA 2BKNA 4I4TE 4AQFC 3RI5A 2XSBA 3ONXA 3J7Yq 3N9QA 3F57A 4XZCA 3HR0A 3S4UA 2WWVA 2CXLA 2NW7A 3A7MA 3HKCE 2D0TA 4K0UA 4EYUA 2X0HA 4Z91A 3A5XA 2IDOB 2F4VT 1ZV4X 2NP9A 3AA6B 5AQMB 1N34T 1T7SA 1FIOA 3ZYMA 2PVSA 1T8BA 1J5WA 3NRYA 4AQGA 3VRAA 5TAOA 1UK5A 4UXNB 4O2BE 5LCYA 3BQIA 2W67A 4B3TT 1YKEB 4H63H 5FY1A 3CVRA 3I1AA 3P50A 3AA0B 4DV2T 3FXDB 1OEDA 3QB5K 2OA5A 2X9WA 4U31A 3RRCA 3FZHB 4PJJA 1N8QA 3P4WA 4CN4A 5J2UE 2WS3A 4H63V 5CB4E 3HI2A 3PUGA 3RQWA 4ERRA 4TV9E 3ZN0B 3O9XA 2WU2A 1WRDA 2IUBA 3IBPA 4ZS3A 1VCTA 1WLXA 1AJ3A 4JLEA 4PK5A 3UUXB 4ASKA 2IMLA 2CXDA 1HG2A 2VVSA 3ZMTB 4DUZT 3E0ZA 2KT9A 2VURA 3GWHA 3OVUA 2PG8A 2V1DB 4X20E 2XAFB 4A5XA 1IBLT 3V98A 2WXTA 3TLVA 1JNRA 1MNDA 4YTNA 4DMVA 1OEDC 1OXZA 4HFEA 4IT4A 4H9QC 3QC9A 2LEHA 1OWAA 2PJQA 2BS2A 3KV5A 5JREA 2LT3A 4YTMA 3KBTA 1FMWA 5FYMA 1HU9A 4I55E 5LB7B 1OEDB 1HNXT 2DLRA 3PU8A 2LSIA 2SPCA 3K3NA 2XHHA 3DP7A 5IWAT 2NOXA 2J62A 2L3LA 2IUKA 1MNEA 3QNUA 3O4XE 3AE9A 4F6RC 1MIWA 4L9IA 3RIFA 3RIUC 5FVLA 2JQ9A 2Y48B 2V6YB 3SOLA 2ZMAA 1ZP0A 1D0ZA 2BS3A 5AQQB 4Q25A 5BR8T 3RKOA 1BR4A 5FXZA 5EK3A 1RRLA 3PUWF 4GK5E 4X1YE 4KI0F 3SFEA 4QH5A 1HS7A 2M67A 1US7B 4ZI2C 4QXCB 2K5BB 4LF8T 2HPJA 3O8YA 1HFAA 1YD8G 2X9XA 4J2CA 1BR0A 2Q9QD 2MYSA 2VKDA 3ZSTA 5A1LA 1ZEEA 3PE0A 1U5PA 1FMVA 4DV7T 4YFSA 1SUMB 2IC9A 3ZCIA 4X64T 3RGLA 5C2TA 4U7YA 2VKOA 5EK2A 4EAHA 1HCIA 2KSRA 4A98A 4GYSA 2FNQA 4HFHA 1O3XA 5LP6E 3A8YC 1W9RA 5HXRA 4HN9A 3UQ4A 2W0GA 4TWFA 2AE9A 2K24A 4IE6A 1KNZA 4DR7T 4WYVA 3QUJA 4HWHA 4X66T 4U72A 4U74A 1OEDE 2KNDA 3KV9A 2YEVC 1UCUA 1U4QA 2XM1A 4P09A 3AA1B 1ZKEA 1IJ5A 4H9NC 3IF8B 1BR1A 1X79A 5CGMA 3M65A 2K3WA 2V8SV 5HCMA 2LHNA 1CUNA 3RYIE 3CQCB 2I0MA 3Q5XA 3Q5WA 5JH7E 4PJNA 2JQHA 4QH4A 1DU2A 2LHRA 4MLKA 1XMQT 2LSGA 4UR9A 3Q9DA 5HEUA 2K48A 3F31A 1Y4KA 3N2OA 2A3DA 4DV1T 3N9LA 4XBFB 3C51A 2RPAA 2H89A 3LK3B 3NKZA 4O4JE 4EZ4A 2FJEA 2VVNA 1Z0PA 2UUAT 2QYWA 2LG7A 2VQFT 3MKDA 2I6HA 4H9PC 5AQRB 4CI1B 4U7IA 4DVDA 4WNKA 1BR2A 3QOFA 4QH1A 5LHGB 4LMJA 5HXSA 4MALA 1LOXA 3MXZA 2DL1A 3CIRA 1M62A 3RHWA 3LFMA 1LPAB 3FB2A 1RRHA 3UUBA 3GMIA 3PU3A 5L3CB 4DV6T 5LBMA 2XQ7A 2ODUA 2P9BA 2V7KA 2X9YA 3FZFB 1LKXA 1X9BA 1IAPA 4UV9B 5LNKA 2BBHA 1Z8UA 4DV0T 5EK4A 2CMRA 3G06A 2YDSA 4MBQA 1JNQA 2X0YA 1CHUA 5IUXA 4G63A 2CA5A 3N9MA 4IL9A 3T1YT 2C5IT 1L0VA 2MBGA 4PFPA 5EZYE 1D1AA 2VL8A 2FJBA 1E1HB 4BA9A 5FL1A 4IE4A 3C4WA 2LJLA 4AQFA 4HFBA 3VRBA 4BJNA 3V92A 5LYJE 2BVLA 2HPLA 3RQUA 1NAFA 3IHRA 2BS4A 2M6BA 3HKBE 4E7SA 2LSJA 1ROVA 4DUYT 2PPLA 2H7VC 3AEDA 4PFOA 1NO3A 1LVKA 1J5ET 4P0BA 3UU3A 4H9SE 3EAMA 5CFBA 4HFDA 3AE2A 4C91A 3AAIA 4CXXA 5LJMA 2JIWA 4DR4T 4ILCA 4YSYA 4NPPA 3KV4A 3LDQB 2WP9A 2AXDS 2LLYA 4YLHA 1XWMA 4QXBB 3LK42 2ACZA 5JDHA 5CA0E 1I94T 2V7MA 2XHJA 3PUSA 5HWXA 4JBWF 4QWNB 2PTFA 3H3AA 4AXPA 2X9HA 1CA1A 1JNZA 3HKEE 4UVAB 4CXWA 1D0YA 2JJ9A 3EDUA 2BDEA 2XQ8A 5ABHA 5F3JA 2W2UA 3ZT5A 5F8PA 2CXFA 4OYJA 2HHHT 2HN2A 3C98B 2QNGA 3UU4A 5AQGB 4EEDA 3R84B 2Q9QA 4CI3B 4JI5T 2VQET 2YU1A 3AE5A 4LFAT 3AB3B 3BQKA 4WHAA 5AQKB 3N9NA 3ZMZB 3U6GA 2XAHB 4UIGA 4TZ4C 2JQQA 3E08A 2KWHA 1WR0A 2H7OA 4EZHA 4QX8B 2WBLA 2OV9A 5AQIB 1YQ4A 4CZZB 4AI6A 3JCFA 2NR4A 5KX5E 2JRKA 2MPKA 1VOMA 5FY0A 3W15B 1XZYA 4N78D 1R8IA 4H9OC 3MK7C 4GKJT 3TLUA 2X66A 4TV8E 4YTPA 1D1BA 2N9DA 3CWZB 5HXEA 3LSVA 3RRWA 3I0OA 5FNVE 3RKGA 3ZPOA 2V26A 3CK6A 4IDOA 3CPZA 2Q9QC 4UVBB 2V6YA 2WXUA 2YK0A 4YJ3E 3RC8A 4ISTA 5F5WA 4O8SA 3CKDA 4UELA 4QEYA 3I9WA 3LJCA 2LRLA 4AIUA 4JI8T 1M7KA 3FBLA 2GK9A 4BAYB 2UXCT 3PUQA 4EXTA 5KDMC 3RIUA 2WWUA 2Q9QB 5E0OA 3BNCA 5AFUL 2MOZA 4KHPT 5LA6E 3JAFA 1FGTA 3EHZA 4KBMB 1ZHCA 3QB5A 3AEBA 3AVRA 3RYFE 2CHNA 1GPLA 2A9UA 2NW8A 2DCFA 2BG9C 3NZPA 1YW0A 4LF7T 3TLWA 2NTYA 4U33A 3ZCJA 4IDPA 4IDNA 3AEFA 2NW9A 1F8NA 3AEEA 3BNDA 4P0AA 3AA7B 5FXVA 3C4ZA 1HG5A 1QUUA 4I50E 3ZC0A 4CI2B 4OFZA 4X5TA 2BG9B 3CX8B 5EEOA 3C4XA 4PAGA 4JI6T 5LHHB 3N9PA 2WDRA 2XHEB 3HA4A 2W61A 3U3IA 3RF1A 5L3FB 3ZJ2A 2L8KA 4KHZF 5J2TE 5L4HA 2XQ6A 4IE5A 2X51A 2YN6A 2HH7A 2YINA 2X67A 3RC3A 3BNEA 4HFCA 2CCQA 4HKAA 1HF8A 4Z8XA 2EHOC 5L3EB 3H3MA 3VR9A 5LXTE 4QXHB 2LM9A 3MZKB 4UF0B 1B7TA 5HYAA 3OBVE 2KINB 3KVBA 3O1IA 3D0TA 4ZZBA 2WZHA 5LGUB 3RYHE 4X62T 2DI4A 4L5GA 1GYGA 1LVFA 2IC6A 5J1GA 1N8SA 3RLFF 1IBKT 2Y8DA 4EIWA 5IHYA 3SWHA 3FG1A 3UT5E 4BJMA 1HTJF 2J4GA 5FY7A 4IE7A 2W66A 1IBMT 4O4IE 1S35A 1KFYA 3R6NA 2YDQA 5H6RB 4EB6E 2UUBT 4IL4A 2XM2A 1ETHA 1WCRA 1UX5A 2P0MA 4O4HE 3PUZF 3ZYKA
chains in the Genus database with same CATH topology
2NWBA 2ODUA 4IE0A 2P9BA 1QM6A 2CXLA 2NW7A 2V7KA 2X9YA 4KUMB 1LKXA 4WBNE 5JDMA 3HKCE 1IAPA 4UV9B 4HTEA 2D0TA 3VU7H 2ZM8A 4K0UA 4EYUA 5LNKA 4WBOA 4JEHB 3ZYLA 2RP4A 4X1KE 5EK4A 2CMRA 3A5XA 3OYXA 5DQVA 1LNHA 4MBQA 1EZ3A 2WSSV 1JNQA 1FGMA 2DWGA 4QKNA 1YKHB 4G63A 2CA5A 4ANJA 1ZV4X 2NP9A 3N9MA 4TX5A 2PBIA 3AA6B 2CE7A 4GYRA 3WI3A 5L3DB 2C5IT 2MBGA 4PFPA 1FIOA 5EZYE 3ZYMA 4KMCA 1D1AA 1VRBA 2PVSA 2BZBA 1OLPA 3NRXA 2VL8A 1E1HB 3N5LA 3NRYA 2C0SA 4AQGA 5L3BB 3FG3A 4BA9A 3WAKA 2DHRA 4IE4A 2IW5B 5TAOA 1QSDA 3BNBA 3C4WA 2LJLA 4AQFA 4AKHA 4DO0A 3SS1A 3Q2MA 4UEMA 5LJNA 4UXNB 4BJNA 3V92A 5LYJE 2JPFA 3AAEB 2BVLA 4O2BE 4I43B 5LBQB 5LCYA 3UFEA 4A56A 2E9XA 4CQIA 5KMGP 3I0QA 5GONE 3BQIA 2CEAA 2HPLA 1NAFA 3T8OA 3U78A 3IHRA 3HKBE 4HE8A 1YKEB 3QK6A 4H63H 5FY1A 4E7SA 2LSJA 3FXEB 1ROVA 3PUAA 2PPLA 3J9X1 4E7ZA 3CVRA 2H7VC 3VF1A 3MACA 2DWKA 4PFOA 1G8XA 1IZNB 3I1AA 1FGQA 1NO3A 1LVKA 3CMLA 5JR9A 3AA0B 4IDZA 1NWMX 3FXDB 3ZJ1A 4P0BA 2VB6A 3V5UA 1MMAA 3SRZA 1IK3A 2OA5A 4H9SE 3AAAB 4L0RA 3EUHA 2X9WA 4PK4A 3ZC1A 4C91A 3AAIA 3RRCA 2ZM2A 4PJJA 1N8QA 4CXXA 4O4LE 5LJMA 5J2UE 5JRCB 2CWYA 2ES0A 3GN5A 2EHOD 2ZM0A 3ANWB 4H63V 5CB4E 3HI2A 3PUGA 2B1EA 4OHFA 4ERRA 2D0UA 2EHOB 4TV9E 3ZN0B 3NBXX 3KV4A 3O9XA 4AKGA 4IHJE 4WFOA 2V7LA 1WRDA 4YLHA 4QXBB 3ETUA 3LK42 5HWYA 5JDHA 4NREA 3MA9A 5CA0E 2N2NA 3RX6A 2XASB 2V7MA 2KXPB 3IBPA 4GOUA 3RPUA 3PUSA 4ZS3A 5HWXA 4QWNB 1WLXA 2QGSA 1AJ3A 3H3AA 4JLEA 4PK5A 2X9HA 4JUYA 3UUXB 4AXPA 1CA1A 4ASKA 3P8CD 2CXDA 2A2FX 3ANWA 3HKEE 1HG2A 2CWOA 4UVAB 3OJAA 3ZMTB 4FI5A 5ADXL 2J1DG 4CXWA 3WAJA 1D0YA 2KT9A 2JJ9A 3E0ZA 4TN7B 3GWHA 5LGTB 3EDUA 2BDEA 2XAGB 5F3JA 2E9XC 3ZMVB 5F8PA 2LOPA 2PG8A 3EVYA 3VKGA 3JC6D 2CXFA 4OYJA 2W62A 2V1DB 4X20E 2XAFB 5BMVE 3V98A 3C98B 2WXTA 1Y64B 2JMHA 2LSKA 1MNDA 3O1HA 5JR9C 5L2LA 2UXNB 2MTQA 2C5KT 2D2SA 4DMVA 3R84B 2Q9QA 3K3OA 1OXZA 4PNIA 2E8IA 3CX7B 2E9XD 4CI3B 2WM9A 4H9QC 3RH3A 3QC9A 2K9AA 2IAKA 2YU1A 4AKRB 3L09A 3KV6A 2LEHA 2E9XB 4C90A 1OWAA 3AB3B 3BQKA 2PJQA 3PTRB 4WHAA 3KV5A 4NUVA 3UTKA 3N9NA 5JREA 3ZMZB 2LT3A 2L9QA 5C8YE 2XAHB 4G2AA 3KBTA 3LBXB 1FMWA 5FYMA 4UIGA 4TZ4C 1HU9A 4KP3C 5JR9B 1W52X 2JQQA 1FEWA 2DNXA 1V9DA 3E08A 1MMDA 4I55E 2KWHA 2ACXA 2DLRA 3PU8A 2LSIA 2SPCA 3K3NA 4IIJE 3DP7A 2H7OA 3V99A 2NOXA 4EZHA 3KDSE 2JMKA 3HKDE 4QX8B 2L3LA 5H6QB 2WBLA 2IUKA 3B13A 1MNEA 2CLYC 5DABA 4CZZB 3O4XE 4F6RC 3GN5B 1MIWA 4AI6A 4L9IA 3GA8A 4PK6A 2LE8A 2Y48B 5KX5E 4ILUA 2JRKA 2LOSA 3SOLA 1VOMA 2N1GA 3LBXA 5FY0A 3W15B 2WMOA 4N78D 4QWTA 2ZMAA 2KZ7B 1D0ZA 5LOVE 4H9OC 3MK7C 5HXCA 2WAUA 4IGUA 4ZI3C 2X66A 4TV8E 2A72A 5DJQC 1KHOA 1D1BA 2N9DA 3CWZB 5HXEA 3RKOA 2G0UA 1BR4A 5FXZA 5EK3A 1MMGA 3N2KE 1RRLA 4WW0A 3RRWA 2CLYB 3I0OA 4GK5E 3AVSA 4X1YE 5FNVE 3ZPOA 2V26A 2VK9A 1H7CA 3FBZA 3KVAA 3MJXA 3CX6B 5LHIB 3CPZA 2Q9QC 4UVBB 2WXUA 5FXXA 1HS7A 2YK0A 4YJ3E 4EYYR 2M67A 1US7B 4ZI2C 4QXCB 3RC8A 3LG7A 2K5BB 3KBUA 4ISTA 2HPJA 3O8YA 3N9OA 4O8SA 3CKDA 1HFAA 2XUEA 3K3QC 4HFVA 4UELA 5JDQA 3ZEFB 4JEUB 2IUJA 4PW8A 1YD8G 3I9WA 3V5SA 3LJCA 2X9XA 1SA0E 3ETVA 4J2CA 1BR0A 2H3RA 1HPLA 3FBLA 2GK9A 4BAYB 3ZMUB 2Q9QD 3PUQA 4EXTA 3PDYA 2MYSA 2VKDA 1WYBA 5KDMC 2WWUA 3HL6A 4ZI2D 2Q9QB 4TUYE 1HX8A 1ZEEA 5A1LA 3PE0A 4ZHQE 3UUNA 1U5PA 5CA1E 5JDFA 2X0LB 4ZOLE 3CQGB 5E0OA 3BNCA 5AFUL 4NUUA 1FMVA 3IEEA 2MOZA 5L3GB 5JDLA 4YFSA 2IC9A 4XAXB 5LA6E 2XAQB 3ZCIA 1FGTA 2SBLA 1G73A 1UX4A 4DMWA 2VKOA 5EK2A 1FGRA 4EAHA 2CM0A 3N2GE 1HCIA 1MIVA 4KBMB 5JDGA 1ZHCA 4MFRA 4YJ2E 4GYSA 3TKLB 2FNQA 1O3XA 1YGEA 4ADZA 2KMFA 5LP6E 1D1CA 3C50A 4O2AE 3AVRA 3RYFE 5HXRA 1RP1A 1GPLA 2XAJB 3KINB 4GIWA 2NW8A 2DCFA 4UVCB 1WR6A 3NZPA 3S4UA 1YW0A 2V7IA 3O1JA 4PJMA 4HN9A 3DJBA 2NTXA 2NTYA 2OXEA 2W0GA 3C64A 4B6XA 3ZCJA 2UXXB 2K24A 3ZLIA 4IE6A 5JQGE 1KNZA 5FP3A 3QUJA 4M1PA 3BQLA 3K8PC 4U72A 2NW9A 4U74A 1F8NA 2YU2A 4ZS2A 3BNDA 2KNDA 3KV9A 4P0AA 3AA7B 2BVMA 2YEVC 5FXVA 1D0XA 3C4ZA 4HGAA 2WY6A 1HG5A 1QUUA 1UCUA 2WMNA 2W00A 1U4QA 3FHNA 4I50E 3ZC0A 4CI2B 4MHCA 3CQXC 4OFZA 4QX7B 3B57A 3ZMSB 3VKHA 3CX8B 5EEOA 3C4XA 4P09A 3AA1B 4PAGA 4V1Av 4DBRA 1ZKEA 1IJ5A 5LHHB 4H9NC 2VKJA 4AKIA 2QA7A 3IF8B 1BR1A 3N9PA 4EOZB 2X68A 4ZI7E 5FXWA 1X79A 1KK7A 3ESLA 4GK0E 2XHEB 3M65A 3LK2B 3HA4A 5ETWA 5HAXA 2W61A 3U3IA 2VASA 1T98A 5L3FB 3ZJ2A 2L8KA 2LHNA 5J2TE 1CUNA 5LG4A 3RYIE 2D5UA 4IE5A 3CQCB 5DQWA 4OYKA 3Q5XA 4CXYA 3Q5WA 2X51A 2XTLA 5JH7E 4DBQA 4PJNA 1SHZC 2HH7A 2ODVA 2YINA 2X67A 3FG4A 2KWIB 3RC3A 3ZN1B 3BNEA 1LRZA 2C5JA 1IJ6A 2CCQA 1HF8A 2VKHA 4HKAA 4X1IE 4Z8XA 2LHRA 2EHOC 5L3EB 4MLKA 5LXTE 2LSGA 4QXHB 3Q9DA 4AKLA 2K48A 2VWAA 3F31A 2LSYA 2LM9A 3PURA 3NZQA 5IYZE 3MZKB 4ZI3D 3UUMA 1BU8A 4UF0B 1B7TA 1Y4KA 3N2OA 2A3DA 5HYAA 3N9LA 3OBVE 4XBFB 2KINB 3KVBA 3O1IA 3C51A 3D0TA 4DNDA 5LGUB 2XQYA 2Y6XA 2PFVA 3RYHE 1S94A 3LK3B 4HEAA 2DI4A 4O4JE 4YHJA 2KLQA 1QMDA 3E22E 4L5GA 4EZ4A 1GYGA 3H37A 4PJLA 1LVFA 2IC6A 5J1GA 5JDNA 1FGOA 1N8SA 3PZWA 2V7JA 1Z0PA 3OYZA 4OK0A 2Y8DA 3MKDA 4EIWA 2RA1A 5IHYA 3EDVA 3DTOA 4H9PC 3SWHA 4CI1B 3P7IA 1MIYA 3KFWX 3FG1A 4DVDA 5FMNA 3UT5E 2I59A 4BJMA 3F2EA 4FJOA 4UF0A 4WNKA 1BR2A 1HTJF 1WYCA 4UV8B 3RYCE 4ISSA 5LHGB 3I9YA 5FY7A 4IE7A 5JVDE 2ZLYA 2W63A 3JC6C 4QHOA 1MMNA 5HXSA 5M4YA 4MALA 1LOXA 5JRCA 3MXZA 4O4IE 1S35A 4H9RC 3R6NA 4I4TE 5H6RB 4AQFC 3LFMA 4EB6E 2Z6EA 3BK9A 2EHOA 1LPAB 3L3PA 3FB2A 3VHLA 1ETHA 1RRHA 3ONXA 3OKQA 1UX5A 5LGNB 3GMIA 3J7Yq 2P0MA 3N9QA 5HXHA 4O4HE 3PU3A 3ZYKA 3UULA 3F57A 5L3CB 1LPBB 4XZCA 3HR0A 5LBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHA A;  2CXF A;  2IUK A;  1N8Q A;  2SBL A;  1FGT A;  1QM6 A;  1RRL A;  2CXL A;  3FG4 A;  1CA1 A;  1LOX A;  1QMD A;  1ROV A;  3BNE A;  1HPL A;  1GYG A;  1FGR A;  2PVS A;  3V98 A;  2WXT A;  1OLP A;  1F8N A;  2PPL A;  3BND A;  1FGO A;  3PZW A;  1N8S A;  3VF1 A;  1HU9 A;  3FG3 A;  2FNQ A;  2DWK A;  1FGQ A;  1W52 X;  1NO3 A;  1LPA B;  1YGE A;  3BNB A;  2WXU A;  2WY6 A;  4QWT A;  1ETH A;  1RRH A;  1RP1 A;  1GPL A;  1BU8 A;  2P0M A;  4GIW A;  4WFO A;  1Y4K A;  3FG1 A;  3BNC A;  3V92 A;  1IK3 A;  3O8Y A;  5EEO A;  1LNH A;  1KHO A;  3V99 A;  1LPB B;  1JNQ A;  4NRE A;  3CWZ B;  1FGM A;  2DWG A;  2OXE A;  2IUJ A; 
#chains in the Genus database with same CATH topology
 2NWB A;  2WDV A;  4IE0 A;  1QM6 A;  4WBN E;  2UU9 T;  4LFB T;  2IIU A;  5JDM A;  2BG9 E;  3ZKR A;  2ZM8 A;  4WBO A;  3PJA J;  3OTO T;  5HEH A;  5DQV A;  1XNR T;  1LNH A;  1EZ3 A;  1FGM A;  3AEA A;  4QKN A;  1YKH B;  3TLS A;  3NRX A;  3N5L A;  3WAK A;  2YKS A;  1QSD A;  2LKG A;  2XQ3 A;  3SS1 A;  3Q2M A;  5LJN A;  4A56 A;  5LBQ B;  3UFE A;  5AQP B;  5GON E;  2CEA A;  3U78 A;  3X1D A;  4HE8 A;  3QK6 A;  3T1H T;  2XQ5 A;  3FXE B;  4YT0 A;  4HFI A;  2YOE A;  1IZN B;  1FGQ A;  3UU8 A;  4IDZ A;  1NWM X;  3SRZ A;  3AAA B;  1FJG T;  2ZM2 A;  4I0U A;  5HEG A;  4DR3 T;  2WQY A;  2ES0 A;  3GN5 A;  4TWH A;  2EHO D;  2ZM0 A;  3ANW B;  3AE6 A;  4JYA T;  2D0U A;  2J47 A;  4AIS A;  3AXJ A;  3NBX X;  4AKG A;  4DV3 T;  2M6I A;  3AE7 A;  2LGE A;  4WFO A;  2V7L A;  3PJA A;  2CPT A;  2LRK A;  2CHO A;  4NRE A;  3MA9 A;  2N2N A;  3RX6 A;  4P1N A;  3Q5E A;  2QGS A;  3AEC A;  4JUY A;  2CWO A;  3OJA A;  4FI5 A;  4YY3 T;  3NVO A;  2LOP A;  4DR2 T;  4JI0 T;  2XZE A;  2W62 A;  1NEN A;  3B5M A;  5BMV E;  1Y64 B;  2JMH A;  2LSK A;  4U2Y A;  3JAE A;  5L2L A;  2MTQ A;  2C5K T;  4PNI A;  4ILA A;  4B3R T;  3P4S A;  2E9X D;  3ONL C;  4IRE A;  2WM9 A;  2K9A A;  1HNW T;  5AQL B;  4C90 A;  4YSZ A;  4X65 T;  3PTR B;  1YQ3 A;  4NUV A;  1W09 A;  3UFG A;  2L9Q A;  4G2A A;  3LBX B;  1W52 X;  1FEW A;  2DNX A;  1V9D A;  1MMD A;  5LG3 A;  5AQS B;  5L4E A;  1I6Z A;  2XY8 B;  3B13 A;  2CLY C;  3GN5 B;  3UQ7 A;  4U3C A;  3GA8 A;  4OX9 T;  3AXJ B;  4HWD A;  2BBJ A;  5LOV E;  5HXC A;  1N32 T;  2WAU A;  1J1J A;  4DR6 T;  2A72 A;  5DJQ C;  2V5C A;  1HX1 B;  3N2K E;  4WW0 A;  2CLY B;  3FZL B;  4YXD A;  3PV0 F;  2VK9 A;  4LF6 T;  1H7C A;  3FBZ A;  5AQT B;  4EYY R;  3LG7 A;  4NXM T;  1UUR A;  3KBU A;  3N9O A;  5FL0 A;  5JDQ A;  5AQU B;  3ZEF B;  4JEU B;  2LRG A;  3UU6 A;  5C3J A;  3PUV F;  3V5S A;  1SA0 E;  2CBI A;  4LF5 T;  3FZK B;  3IA3 A;  3HL6 A;  1YXR A;  4TUY E;  4ZHQ E;  5CA1 E;  5JDF A;  2X0L B;  4ZOL E;  3CQG B;  2FJA A;  4NUU A;  5LMU T;  1QLB A;  4DV4 T;  5L3G B;  2FBW A;  4XAX B;  2XAQ B;  2R6G F;  1UX4 A;  4DMW A;  1FGR A;  4MFR A;  3TKL B;  1YGE A;  4ADZ A;  2KMF A;  5HEO A;  3C50 A;  4O2A E;  5J0Z A;  5HCJ A;  2XAJ B;  3KIN B;  4GIW A;  4UVC B;  2XQ4 A;  3L8R A;  4K0K T;  2V7I A;  4PJM A;  3DJB A;  2NTX A;  4LFC T;  5JTG A;  1XDP A;  5FP3 A;  4M1P A;  3BQL A;  3K8P C;  2KXT A;  1W0A A;  1XMO T;  4ZS2 A;  1D0X A;  2WY6 A;  2WMN A;  2W00 A;  3FHN A;  3B57 A;  3ZMS B;  3VKH A;  5AQF B;  2UXD T;  1KNR A;  5ABE A;  2OLT A;  4EOZ B;  2X68 A;  1KK7 A;  3ESL A;  1HNZ T;  2WCA A;  3LK2 B;  5FKY A;  1T98 A;  3AE3 A;  5LG4 A;  2D5U A;  5DQW A;  2BG9 A;  4OYK A;  4CXY A;  2XJ7 A;  2XTL A;  1SHZ C;  3FG4 A;  2KWI B;  3ZN1 B;  4AQY T;  2C5J A;  2VKH A;  3UU5 A;  2CBJ A;  2LSY A;  3PUR A;  3NZQ A;  5IYZ E;  2LKH A;  1BU8 A;  3UUM A;  4DND A;  2PFV A;  1S94 A;  3TLT A;  2KLQ A;  1QMD A;  4PJL A;  4DR5 T;  5JDN A;  2KXV A;  2V7J A;  3OYZ A;  3P4Q A;  1Y01 A;  4JI4 T;  2RA1 A;  3KFW X;  5FMN A;  3F2E A;  4FJO A;  3AE1 A;  4UF0 A;  4GKK T;  1WYC A;  4UV8 B;  4ISS A;  4DV5 T;  2QZ7 A;  3JC6 C;  2BKP A;  3Q5D A;  1MMN A;  5M4Y A;  5JRC A;  4H9R C;  3ABV A;  2Z6E A;  3BK9 A;  2EHO A;  3L3P A;  4IDQ A;  3VHL A;  3OKQ A;  5LGN B;  5HXH A;  3ONJ A;  3UUL A;  1LPB B;  3N2G E;  3OPC A;  4KUM B;  4EV6 A;  1XNQ T;  4HTE A;  2WU5 A;  3NWI A;  3VU7 H;  4JEH B;  3ZYL A;  1KEY A;  2RP4 A;  4X1K E;  4TNV A;  2QRX A;  2H88 A;  3OYX A;  5LMN T;  2WSS V;  2DWG A;  4ANJ A;  4TX5 A;  2FJD A;  2PBI A;  3WI3 A;  2CE7 A;  4GYR A;  5L3D B;  2VL0 A;  4ZEY A;  4KMC A;  1VRB A;  2BZB A;  1OLP A;  1N33 T;  2C0S A;  5L3B B;  3FG3 A;  2DHR A;  2IW5 B;  3BNB A;  4JI3 T;  2WY2 A;  4AKH A;  4DO0 A;  4EGW A;  4UEM A;  4LF9 T;  2JPF A;  3AAE B;  4I43 B;  2E9X A;  4CQI A;  5KMG P;  3I0Q A;  1WFD A;  2E5V A;  3T8O A;  3AE8 A;  3FZM B;  4LF4 T;  4HWF A;  3PUA A;  2JQK A;  2BKO A;  3J9X 1;  4E7Z A;  4B3M T;  3VF1 A;  3ZSS A;  3MAC A;  2DWK A;  1G8X A;  3CML A;  5JR9 A;  2WB5 A;  3ZJ1 A;  2VB6 A;  3V5U A;  1MMA A;  1IK3 A;  4L0R A;  2B76 A;  2V6X A;  3EUH A;  3ZC1 A;  4PK4 A;  2XQA A;  4O4L E;  1KF6 A;  4CN6 A;  3VR8 A;  5JRC B;  3P4R A;  2CWY A;  2B1E A;  4OHF A;  1UUS A;  2EHO B;  4JV5 T;  3PUX F;  4IHJ E;  5KXJ A;  1W0B A;  3ETU A;  5HWY A;  2XAS B;  2KXP B;  3RPU A;  4GOU A;  4LMK A;  3ZT6 A;  3P8C D;  2A2F X;  4F8H A;  3ANW A;  4KX6 A;  4LML A;  5ADX L;  2J1D G;  3WAJ A;  4TN7 B;  2UUC T;  5LGT B;  2XAG B;  1VCS A;  2E9X C;  3K1S A;  3ZMV B;  3EVY A;  3VKG A;  2HN1 A;  3JC6 D;  3L39 A;  5AQO B;  3O1H A;  5JR9 C;  2UXN B;  2D2S A;  3EI0 A;  3K3O A;  4COF A;  2E8I A;  3CX7 B;  4ILB A;  3RH3 A;  2IAK A;  4AKR B;  3L09 A;  3KV6 A;  2E9X B;  5L47 A;  3AEG A;  1E2A A;  3UTK A;  4NXN T;  5C8Y E;  3RIA A;  5AQH B;  3IBZ A;  5CJ5 A;  3SFD A;  1UGO A;  4KP3 C;  5JR9 B;  2ACX A;  5AQN B;  2XPK A;  4IIJ E;  1T72 A;  3V99 A;  3KDS E;  2JMK A;  3HKD E;  5H6Q B;  5ABF A;  2WZI A;  5DAB A;  3AE4 A;  4PK6 A;  2LE8 A;  4ILU A;  4DR1 T;  4ZXL A;  2LOS A;  4YSX A;  2N1G A;  3LBX A;  4TNW A;  2WMO A;  4QWT A;  2KZ7 B;  5AQJ B;  1E7P A;  4HWC A;  2QVA A;  4IGU A;  4ZI3 C;  5FVK A;  2XFD A;  2E5L T;  1KHO A;  2W4X A;  2G0U A;  1ZOY A;  1MMG A;  4CN1 A;  4YHH T;  3AVS A;  4JI7 T;  2ZM6 T;  3KVA A;  3MJX A;  2CRB A;  3CX6 B;  5LHI B;  5FXX A;  3K3Q C;  2XUE A;  4HFV A;  2IUJ A;  4PW8 A;  1SE7 A;  3ETV A;  3JAD A;  1HPL A;  2H3R A;  3ZMU B;  4Z90 A;  3PDY A;  1WYB A;  1HR0 T;  4ZI2 D;  1HX8 A;  2LM2 A;  3UUN A;  5AQV B;  3IEE A;  5JDL A;  4DID B;  3EAB A;  4HWI B;  2FUP A;  2XFE A;  2SBL A;  1G73 A;  2CM0 A;  1MIV A;  5JDG A;  4YJ2 E;  4JI2 T;  4WZX A;  1NEK A;  1XDO A;  1D1C A;  2UXB T;  1RP1 A;  1WR6 A;  2D9D A;  3O1J A;  4B3S T;  3ZT7 A;  2OXE A;  3C64 A;  4B6X A;  5ABF B;  2UXX B;  2V5D A;  3ZLI A;  5JQG E;  4TWD A;  2XQ9 A;  2YDR A;  2YU2 A;  1GQE A;  2BVM A;  1KNP A;  4HGA A;  4MHC A;  3CQX C;  4QX7 B;  2XSA A;  4EEB A;  4V1A v;  4DBR A;  2VKJ A;  4AKI A;  2QA7 A;  2E2A A;  4ZI7 E;  5FXW A;  4ZZC A;  4NIQ A;  4GK0 E;  4JI1 T;  3P4P A;  5ETW A;  5HAX A;  2VAS A;  5HEJ A;  2IHR 1;  4DBQ A;  2ODV A;  1LRZ A;  1IJ6 A;  4X1I E;  1N36 T;  4AKL A;  2VWA A;  5ABG A;  4ZI3 D;  3PUY F;  4A97 A;  2XQY A;  2Y6X A;  4HEA A;  4YHJ A;  3E22 E;  3H37 A;  1FGO A;  3PZW A;  4OK0 A;  2WDQ A;  3EDV A;  3DTO A;  3P7I A;  1MIY A;  2I59 A;  4U2Z A;  3RYC E;  3M3Z B;  3I9Y A;  2MAW A;  5JVD E;  2ZLY A;  2W63 A;  4QHO A;  2BKN A;  4I4T E;  4AQF C;  3RI5 A;  2XSB A;  3ONX A;  3J7Y q;  3N9Q A;  3F57 A;  4XZC A;  3HR0 A;  3S4U A;  2WWV A;  2CXL A;  2NW7 A;  3A7M A;  3HKC E;  2D0T A;  4K0U A;  4EYU A;  2X0H A;  4Z91 A;  3A5X A;  2IDO B;  2F4V T;  1ZV4 X;  2NP9 A;  3AA6 B;  5AQM B;  1N34 T;  1T7S A;  1FIO A;  3ZYM A;  2PVS A;  1T8B A;  1J5W A;  3NRY A;  4AQG A;  3VRA A;  5TAO A;  1UK5 A;  4UXN B;  4O2B E;  5LCY A;  3BQI A;  2W67 A;  4B3T T;  1YKE B;  4H63 H;  5FY1 A;  3CVR A;  3I1A A;  3P50 A;  3AA0 B;  4DV2 T;  3FXD B;  1OED A;  3QB5 K;  2OA5 A;  2X9W A;  4U31 A;  3RRC A;  3FZH B;  4PJJ A;  1N8Q A;  3P4W A;  4CN4 A;  5J2U E;  2WS3 A;  4H63 V;  5CB4 E;  3HI2 A;  3PUG A;  3RQW A;  4ERR A;  4TV9 E;  3ZN0 B;  3O9X A;  2WU2 A;  1WRD A;  2IUB A;  3IBP A;  4ZS3 A;  1VCT A;  1WLX A;  1AJ3 A;  4JLE A;  4PK5 A;  3UUX B;  4ASK A;  2IML A;  2CXD A;  1HG2 A;  2VVS A;  3ZMT B;  4DUZ T;  3E0Z A;  2KT9 A;  2VUR A;  3GWH A;  3OVU A;  2PG8 A;  2V1D B;  4X20 E;  2XAF B;  4A5X A;  1IBL T;  3V98 A;  2WXT A;  3TLV A;  1JNR A;  1MND A;  4YTN A;  4DMV A;  1OED C;  1OXZ A;  4HFE A;  4IT4 A;  4H9Q C;  3QC9 A;  2LEH A;  1OWA A;  2PJQ A;  2BS2 A;  3KV5 A;  5JRE A;  2LT3 A;  4YTM A;  3KBT A;  1FMW A;  5FYM A;  1HU9 A;  4I55 E;  5LB7 B;  1OED B;  1HNX T;  2DLR A;  3PU8 A;  2LSI A;  2SPC A;  3K3N A;  2XHH A;  3DP7 A;  5IWA T;  2NOX A;  2J62 A;  2L3L A;  2IUK A;  1MNE A;  3QNU A;  3O4X E;  3AE9 A;  4F6R C;  1MIW A;  4L9I A;  3RIF A;  3RIU C;  5FVL A;  2JQ9 A;  2Y48 B;  2V6Y B;  3SOL A;  2ZMA A;  1ZP0 A;  1D0Z A;  2BS3 A;  5AQQ B;  4Q25 A;  5BR8 T;  3RKO A;  1BR4 A;  5FXZ A;  5EK3 A;  1RRL A;  3PUW F;  4GK5 E;  4X1Y E;  4KI0 F;  3SFE A;  4QH5 A;  1HS7 A;  2M67 A;  1US7 B;  4ZI2 C;  4QXC B;  2K5B B;  4LF8 T;  2HPJ A;  3O8Y A;  1HFA A;  1YD8 G;  2X9X A;  4J2C A;  1BR0 A;  2Q9Q D;  2MYS A;  2VKD A;  3ZST A;  5A1L A;  1ZEE A;  3PE0 A;  1U5P A;  1FMV A;  4DV7 T;  4YFS A;  1SUM B;  2IC9 A;  3ZCI A;  4X64 T;  3RGL A;  5C2T A;  4U7Y A;  2VKO A;  5EK2 A;  4EAH A;  1HCI A;  2KSR A;  4A98 A;  4GYS A;  2FNQ A;  4HFH A;  1O3X A;  5LP6 E;  3A8Y C;  1W9R A;  5HXR A;  4HN9 A;  3UQ4 A;  2W0G A;  4TWF A;  2AE9 A;  2K24 A;  4IE6 A;  1KNZ A;  4DR7 T;  4WYV A;  3QUJ A;  4HWH A;  4X66 T;  4U72 A;  4U74 A;  1OED E;  2KND A;  3KV9 A;  2YEV C;  1UCU A;  1U4Q A;  2XM1 A;  4P09 A;  3AA1 B;  1ZKE A;  1IJ5 A;  4H9N C;  3IF8 B;  1BR1 A;  1X79 A;  5CGM A;  3M65 A;  2K3W A;  2V8S V;  5HCM A;  2LHN A;  1CUN A;  3RYI E;  3CQC B;  2I0M A;  3Q5X A;  3Q5W A;  5JH7 E;  4PJN A;  2JQH A;  4QH4 A;  1DU2 A;  2LHR A;  4MLK A;  1XMQ T;  2LSG A;  4UR9 A;  3Q9D A;  5HEU A;  2K48 A;  3F31 A;  1Y4K A;  3N2O A;  2A3D A;  4DV1 T;  3N9L A;  4XBF B;  3C51 A;  2RPA A;  2H89 A;  3LK3 B;  3NKZ A;  4O4J E;  4EZ4 A;  2FJE A;  2VVN A;  1Z0P A;  2UUA T;  2QYW A;  2LG7 A;  2VQF T;  3MKD A;  2I6H A;  4H9P C;  5AQR B;  4CI1 B;  4U7I A;  4DVD A;  4WNK A;  1BR2 A;  3QOF A;  4QH1 A;  5LHG B;  4LMJ A;  5HXS A;  4MAL A;  1LOX A;  3MXZ A;  2DL1 A;  3CIR A;  1M62 A;  3RHW A;  3LFM A;  1LPA B;  3FB2 A;  1RRH A;  3UUB A;  3GMI A;  3PU3 A;  5L3C B;  4DV6 T;  5LBM A;  2XQ7 A;  2ODU A;  2P9B A;  2V7K A;  2X9Y A;  3FZF B;  1LKX A;  1X9B A;  1IAP A;  4UV9 B;  5LNK A;  2BBH A;  1Z8U A;  4DV0 T;  5EK4 A;  2CMR A;  3G06 A;  2YDS A;  4MBQ A;  1JNQ A;  2X0Y A;  1CHU A;  5IUX A;  4G63 A;  2CA5 A;  3N9M A;  4IL9 A;  3T1Y T;  2C5I T;  1L0V A;  2MBG A;  4PFP A;  5EZY E;  1D1A A;  2VL8 A;  2FJB A;  1E1H B;  4BA9 A;  5FL1 A;  4IE4 A;  3C4W A;  2LJL A;  4AQF A;  4HFB A;  3VRB A;  4BJN A;  3V92 A;  5LYJ E;  2BVL A;  2HPL A;  3RQU A;  1NAF A;  3IHR A;  2BS4 A;  2M6B A;  3HKB E;  4E7S A;  2LSJ A;  1ROV A;  4DUY T;  2PPL A;  2H7V C;  3AED A;  4PFO A;  1NO3 A;  1LVK A;  1J5E T;  4P0B A;  3UU3 A;  4H9S E;  3EAM A;  5CFB A;  4HFD A;  3AE2 A;  4C91 A;  3AAI A;  4CXX A;  5LJM A;  2JIW A;  4DR4 T;  4ILC A;  4YSY A;  4NPP A;  3KV4 A;  3LDQ B;  2WP9 A;  2AXD S;  2LLY A;  4YLH A;  1XWM A;  4QXB B;  3LK4 2;  2ACZ A;  5JDH A;  5CA0 E;  1I94 T;  2V7M A;  2XHJ A;  3PUS A;  5HWX A;  4JBW F;  4QWN B;  2PTF A;  3H3A A;  4AXP A;  2X9H A;  1CA1 A;  1JNZ A;  3HKE E;  4UVA B;  4CXW A;  1D0Y A;  2JJ9 A;  3EDU A;  2BDE A;  2XQ8 A;  5ABH A;  5F3J A;  2W2U A;  3ZT5 A;  5F8P A;  2CXF A;  4OYJ A;  2HHH T;  2HN2 A;  3C98 B;  2QNG A;  3UU4 A;  5AQG B;  4EED A;  3R84 B;  2Q9Q A;  4CI3 B;  4JI5 T;  2VQE T;  2YU1 A;  3AE5 A;  4LFA T;  3AB3 B;  3BQK A;  4WHA A;  5AQK B;  3N9N A;  3ZMZ B;  3U6G A;  2XAH B;  4UIG A;  4TZ4 C;  2JQQ A;  3E08 A;  2KWH A;  1WR0 A;  2H7O A;  4EZH A;  4QX8 B;  2WBL A;  2OV9 A;  5AQI B;  1YQ4 A;  4CZZ B;  4AI6 A;  3JCF A;  2NR4 A;  5KX5 E;  2JRK A;  2MPK A;  1VOM A;  5FY0 A;  3W15 B;  1XZY A;  4N78 D;  1R8I A;  4H9O C;  3MK7 C;  4GKJ T;  3TLU A;  2X66 A;  4TV8 E;  4YTP A;  1D1B A;  2N9D A;  3CWZ B;  5HXE A;  3LSV A;  3RRW A;  3I0O A;  5FNV E;  3RKG A;  3ZPO A;  2V26 A;  3CK6 A;  4IDO A;  3CPZ A;  2Q9Q C;  4UVB B;  2V6Y A;  2WXU A;  2YK0 A;  4YJ3 E;  3RC8 A;  4IST A;  5F5W A;  4O8S A;  3CKD A;  4UEL A;  4QEY A;  3I9W A;  3LJC A;  2LRL A;  4AIU A;  4JI8 T;  1M7K A;  3FBL A;  2GK9 A;  4BAY B;  2UXC T;  3PUQ A;  4EXT A;  5KDM C;  3RIU A;  2WWU A;  2Q9Q B;  5E0O A;  3BNC A;  5AFU L;  2MOZ A;  4KHP T;  5LA6 E;  3JAF A;  1FGT A;  3EHZ A;  4KBM B;  1ZHC A;  3QB5 A;  3AEB A;  3AVR A;  3RYF E;  2CHN A;  1GPL A;  2A9U A;  2NW8 A;  2DCF A;  2BG9 C;  3NZP A;  1YW0 A;  4LF7 T;  3TLW A;  2NTY A;  4U33 A;  3ZCJ A;  4IDP A;  4IDN A;  3AEF A;  2NW9 A;  1F8N A;  3AEE A;  3BND A;  4P0A A;  3AA7 B;  5FXV A;  3C4Z A;  1HG5 A;  1QUU A;  4I50 E;  3ZC0 A;  4CI2 B;  4OFZ A;  4X5T A;  2BG9 B;  3CX8 B;  5EEO A;  3C4X A;  4PAG A;  4JI6 T;  5LHH B;  3N9P A;  2WDR A;  2XHE B;  3HA4 A;  2W61 A;  3U3I A;  3RF1 A;  5L3F B;  3ZJ2 A;  2L8K A;  4KHZ F;  5J2T E;  5L4H A;  2XQ6 A;  4IE5 A;  2X51 A;  2YN6 A;  2HH7 A;  2YIN A;  2X67 A;  3RC3 A;  3BNE A;  4HFC A;  2CCQ A;  4HKA A;  1HF8 A;  4Z8X A;  2EHO C;  5L3E B;  3H3M A;  3VR9 A;  5LXT E;  4QXH B;  2LM9 A;  3MZK B;  4UF0 B;  1B7T A;  5HYA A;  3OBV E;  2KIN B;  3KVB A;  3O1I A;  3D0T A;  4ZZB A;  2WZH A;  5LGU B;  3RYH E;  4X62 T;  2DI4 A;  4L5G A;  1GYG A;  1LVF A;  2IC6 A;  5J1G A;  1N8S A;  3RLF F;  1IBK T;  2Y8D A;  4EIW A;  5IHY A;  3SWH A;  3FG1 A;  3UT5 E;  4BJM A;  1HTJ F;  2J4G A;  5FY7 A;  4IE7 A;  2W66 A;  1IBM T;  4O4I E;  1S35 A;  1KFY A;  3R6N A;  2YDQ A;  5H6R B;  4EB6 E;  2UUB T;  4IL4 A;  2XM2 A;  1ETH A;  1WCR A;  1UX5 A;  2P0M A;  4O4H E;  3PUZ F;  3ZYK A; 
#chains in the Genus database with same CATH homology
 2NWB A;  2ODU A;  4IE0 A;  2P9B A;  1QM6 A;  2CXL A;  2NW7 A;  2V7K A;  2X9Y A;  4KUM B;  1LKX A;  4WBN E;  5JDM A;  3HKC E;  1IAP A;  4UV9 B;  4HTE A;  2D0T A;  3VU7 H;  2ZM8 A;  4K0U A;  4EYU A;  5LNK A;  4WBO A;  4JEH B;  3ZYL A;  2RP4 A;  4X1K E;  5EK4 A;  2CMR A;  3A5X A;  3OYX A;  5DQV A;  1LNH A;  4MBQ A;  1EZ3 A;  2WSS V;  1JNQ A;  1FGM A;  2DWG A;  4QKN A;  1YKH B;  4G63 A;  2CA5 A;  4ANJ A;  1ZV4 X;  2NP9 A;  3N9M A;  4TX5 A;  2PBI A;  3AA6 B;  2CE7 A;  4GYR A;  3WI3 A;  5L3D B;  2C5I T;  2MBG A;  4PFP A;  1FIO A;  5EZY E;  3ZYM A;  4KMC A;  1D1A A;  1VRB A;  2PVS A;  2BZB A;  1OLP A;  3NRX A;  2VL8 A;  1E1H B;  3N5L A;  3NRY A;  2C0S A;  4AQG A;  5L3B B;  3FG3 A;  4BA9 A;  3WAK A;  2DHR A;  4IE4 A;  2IW5 B;  5TAO A;  1QSD A;  3BNB A;  3C4W A;  2LJL A;  4AQF A;  4AKH A;  4DO0 A;  3SS1 A;  3Q2M A;  4UEM A;  5LJN A;  4UXN B;  4BJN A;  3V92 A;  5LYJ E;  2JPF A;  3AAE B;  2BVL A;  4O2B E;  4I43 B;  5LBQ B;  5LCY A;  3UFE A;  4A56 A;  2E9X A;  4CQI A;  5KMG P;  3I0Q A;  5GON E;  3BQI A;  2CEA A;  2HPL A;  1NAF A;  3T8O A;  3U78 A;  3IHR A;  3HKB E;  4HE8 A;  1YKE B;  3QK6 A;  4H63 H;  5FY1 A;  4E7S A;  2LSJ A;  3FXE B;  1ROV A;  3PUA A;  2PPL A;  3J9X 1;  4E7Z A;  3CVR A;  2H7V C;  3VF1 A;  3MAC A;  2DWK A;  4PFO A;  1G8X A;  1IZN B;  3I1A A;  1FGQ A;  1NO3 A;  1LVK A;  3CML A;  5JR9 A;  3AA0 B;  4IDZ A;  1NWM X;  3FXD B;  3ZJ1 A;  4P0B A;  2VB6 A;  3V5U A;  1MMA A;  3SRZ A;  1IK3 A;  2OA5 A;  4H9S E;  3AAA B;  4L0R A;  3EUH A;  2X9W A;  4PK4 A;  3ZC1 A;  4C91 A;  3AAI A;  3RRC A;  2ZM2 A;  4PJJ A;  1N8Q A;  4CXX A;  4O4L E;  5LJM A;  5J2U E;  5JRC B;  2CWY A;  2ES0 A;  3GN5 A;  2EHO D;  2ZM0 A;  3ANW B;  4H63 V;  5CB4 E;  3HI2 A;  3PUG A;  2B1E A;  4OHF A;  4ERR A;  2D0U A;  2EHO B;  4TV9 E;  3ZN0 B;  3NBX X;  3KV4 A;  3O9X A;  4AKG A;  4IHJ E;  4WFO A;  2V7L A;  1WRD A;  4YLH A;  4QXB B;  3ETU A;  3LK4 2;  5HWY A;  5JDH A;  4NRE A;  3MA9 A;  5CA0 E;  2N2N A;  3RX6 A;  2XAS B;  2V7M A;  2KXP B;  3IBP A;  4GOU A;  3RPU A;  3PUS A;  4ZS3 A;  5HWX A;  4QWN B;  1WLX A;  2QGS A;  1AJ3 A;  3H3A A;  4JLE A;  4PK5 A;  2X9H A;  4JUY A;  3UUX B;  4AXP A;  1CA1 A;  4ASK A;  3P8C D;  2CXD A;  2A2F X;  3ANW A;  3HKE E;  1HG2 A;  2CWO A;  4UVA B;  3OJA A;  3ZMT B;  4FI5 A;  5ADX L;  2J1D G;  4CXW A;  3WAJ A;  1D0Y A;  2KT9 A;  2JJ9 A;  3E0Z A;  4TN7 B;  3GWH A;  5LGT B;  3EDU A;  2BDE A;  2XAG B;  5F3J A;  2E9X C;  3ZMV B;  5F8P A;  2LOP A;  2PG8 A;  3EVY A;  3VKG A;  3JC6 D;  2CXF A;  4OYJ A;  2W62 A;  2V1D B;  4X20 E;  2XAF B;  5BMV E;  3V98 A;  3C98 B;  2WXT A;  1Y64 B;  2JMH A;  2LSK A;  1MND A;  3O1H A;  5JR9 C;  5L2L A;  2UXN B;  2MTQ A;  2C5K T;  2D2S A;  4DMV A;  3R84 B;  2Q9Q A;  3K3O A;  1OXZ A;  4PNI A;  2E8I A;  3CX7 B;  2E9X D;  4CI3 B;  2WM9 A;  4H9Q C;  3RH3 A;  3QC9 A;  2K9A A;  2IAK A;  2YU1 A;  4AKR B;  3L09 A;  3KV6 A;  2LEH A;  2E9X B;  4C90 A;  1OWA A;  3AB3 B;  3BQK A;  2PJQ A;  3PTR B;  4WHA A;  3KV5 A;  4NUV A;  3UTK A;  3N9N A;  5JRE A;  3ZMZ B;  2LT3 A;  2L9Q A;  5C8Y E;  2XAH B;  4G2A A;  3KBT A;  3LBX B;  1FMW A;  5FYM A;  4UIG A;  4TZ4 C;  1HU9 A;  4KP3 C;  5JR9 B;  1W52 X;  2JQQ A;  1FEW A;  2DNX A;  1V9D A;  3E08 A;  1MMD A;  4I55 E;  2KWH A;  2ACX A;  2DLR A;  3PU8 A;  2LSI A;  2SPC A;  3K3N A;  4IIJ E;  3DP7 A;  2H7O A;  3V99 A;  2NOX A;  4EZH A;  3KDS E;  2JMK A;  3HKD E;  4QX8 B;  2L3L A;  5H6Q B;  2WBL A;  2IUK A;  3B13 A;  1MNE A;  2CLY C;  5DAB A;  4CZZ B;  3O4X E;  4F6R C;  3GN5 B;  1MIW A;  4AI6 A;  4L9I A;  3GA8 A;  4PK6 A;  2LE8 A;  2Y48 B;  5KX5 E;  4ILU A;  2JRK A;  2LOS A;  3SOL A;  1VOM A;  2N1G A;  3LBX A;  5FY0 A;  3W15 B;  2WMO A;  4N78 D;  4QWT A;  2ZMA A;  2KZ7 B;  1D0Z A;  5LOV E;  4H9O C;  3MK7 C;  5HXC A;  2WAU A;  4IGU A;  4ZI3 C;  2X66 A;  4TV8 E;  2A72 A;  5DJQ C;  1KHO A;  1D1B A;  2N9D A;  3CWZ B;  5HXE A;  3RKO A;  2G0U A;  1BR4 A;  5FXZ A;  5EK3 A;  1MMG A;  3N2K E;  1RRL A;  4WW0 A;  3RRW A;  2CLY B;  3I0O A;  4GK5 E;  3AVS A;  4X1Y E;  5FNV E;  3ZPO A;  2V26 A;  2VK9 A;  1H7C A;  3FBZ A;  3KVA A;  3MJX A;  3CX6 B;  5LHI B;  3CPZ A;  2Q9Q C;  4UVB B;  2WXU A;  5FXX A;  1HS7 A;  2YK0 A;  4YJ3 E;  4EYY R;  2M67 A;  1US7 B;  4ZI2 C;  4QXC B;  3RC8 A;  3LG7 A;  2K5B B;  3KBU A;  4IST A;  2HPJ A;  3O8Y A;  3N9O A;  4O8S A;  3CKD A;  1HFA A;  2XUE A;  3K3Q C;  4HFV A;  4UEL A;  5JDQ A;  3ZEF B;  4JEU B;  2IUJ A;  4PW8 A;  1YD8 G;  3I9W A;  3V5S A;  3LJC A;  2X9X A;  1SA0 E;  3ETV A;  4J2C A;  1BR0 A;  2H3R A;  1HPL A;  3FBL A;  2GK9 A;  4BAY B;  3ZMU B;  2Q9Q D;  3PUQ A;  4EXT A;  3PDY A;  2MYS A;  2VKD A;  1WYB A;  5KDM C;  2WWU A;  3HL6 A;  4ZI2 D;  2Q9Q B;  4TUY E;  1HX8 A;  1ZEE A;  5A1L A;  3PE0 A;  4ZHQ E;  3UUN A;  1U5P A;  5CA1 E;  5JDF A;  2X0L B;  4ZOL E;  3CQG B;  5E0O A;  3BNC A;  5AFU L;  4NUU A;  1FMV A;  3IEE A;  2MOZ A;  5L3G B;  5JDL A;  4YFS A;  2IC9 A;  4XAX B;  5LA6 E;  2XAQ B;  3ZCI A;  1FGT A;  2SBL A;  1G73 A;  1UX4 A;  4DMW A;  2VKO A;  5EK2 A;  1FGR A;  4EAH A;  2CM0 A;  3N2G E;  1HCI A;  1MIV A;  4KBM B;  5JDG A;  1ZHC A;  4MFR A;  4YJ2 E;  4GYS A;  3TKL B;  2FNQ A;  1O3X A;  1YGE A;  4ADZ A;  2KMF A;  5LP6 E;  1D1C A;  3C50 A;  4O2A E;  3AVR A;  3RYF E;  5HXR A;  1RP1 A;  1GPL A;  2XAJ B;  3KIN B;  4GIW A;  2NW8 A;  2DCF A;  4UVC B;  1WR6 A;  3NZP A;  3S4U A;  1YW0 A;  2V7I A;  3O1J A;  4PJM A;  4HN9 A;  3DJB A;  2NTX A;  2NTY A;  2OXE A;  2W0G A;  3C64 A;  4B6X A;  3ZCJ A;  2UXX B;  2K24 A;  3ZLI A;  4IE6 A;  5JQG E;  1KNZ A;  5FP3 A;  3QUJ A;  4M1P A;  3BQL A;  3K8P C;  4U72 A;  2NW9 A;  4U74 A;  1F8N A;  2YU2 A;  4ZS2 A;  3BND A;  2KND A;  3KV9 A;  4P0A A;  3AA7 B;  2BVM A;  2YEV C;  5FXV A;  1D0X A;  3C4Z A;  4HGA A;  2WY6 A;  1HG5 A;  1QUU A;  1UCU A;  2WMN A;  2W00 A;  1U4Q A;  3FHN A;  4I50 E;  3ZC0 A;  4CI2 B;  4MHC A;  3CQX C;  4OFZ A;  4QX7 B;  3B57 A;  3ZMS B;  3VKH A;  3CX8 B;  5EEO A;  3C4X A;  4P09 A;  3AA1 B;  4PAG A;  4V1A v;  4DBR A;  1ZKE A;  1IJ5 A;  5LHH B;  4H9N C;  2VKJ A;  4AKI A;  2QA7 A;  3IF8 B;  1BR1 A;  3N9P A;  4EOZ B;  2X68 A;  4ZI7 E;  5FXW A;  1X79 A;  1KK7 A;  3ESL A;  4GK0 E;  2XHE B;  3M65 A;  3LK2 B;  3HA4 A;  5ETW A;  5HAX A;  2W61 A;  3U3I A;  2VAS A;  1T98 A;  5L3F B;  3ZJ2 A;  2L8K A;  2LHN A;  5J2T E;  1CUN A;  5LG4 A;  3RYI E;  2D5U A;  4IE5 A;  3CQC B;  5DQW A;  4OYK A;  3Q5X A;  4CXY A;  3Q5W A;  2X51 A;  2XTL A;  5JH7 E;  4DBQ A;  4PJN A;  1SHZ C;  2HH7 A;  2ODV A;  2YIN A;  2X67 A;  3FG4 A;  2KWI B;  3RC3 A;  3ZN1 B;  3BNE A;  1LRZ A;  2C5J A;  1IJ6 A;  2CCQ A;  1HF8 A;  2VKH A;  4HKA A;  4X1I E;  4Z8X A;  2LHR A;  2EHO C;  5L3E B;  4MLK A;  5LXT E;  2LSG A;  4QXH B;  3Q9D A;  4AKL A;  2K48 A;  2VWA A;  3F31 A;  2LSY A;  2LM9 A;  3PUR A;  3NZQ A;  5IYZ E;  3MZK B;  4ZI3 D;  3UUM A;  1BU8 A;  4UF0 B;  1B7T A;  1Y4K A;  3N2O A;  2A3D A;  5HYA A;  3N9L A;  3OBV E;  4XBF B;  2KIN B;  3KVB A;  3O1I A;  3C51 A;  3D0T A;  4DND A;  5LGU B;  2XQY A;  2Y6X A;  2PFV A;  3RYH E;  1S94 A;  3LK3 B;  4HEA A;  2DI4 A;  4O4J E;  4YHJ A;  2KLQ A;  1QMD A;  3E22 E;  4L5G A;  4EZ4 A;  1GYG A;  3H37 A;  4PJL A;  1LVF A;  2IC6 A;  5J1G A;  5JDN A;  1FGO A;  1N8S A;  3PZW A;  2V7J A;  1Z0P A;  3OYZ A;  4OK0 A;  2Y8D A;  3MKD A;  4EIW A;  2RA1 A;  5IHY A;  3EDV A;  3DTO A;  4H9P C;  3SWH A;  4CI1 B;  3P7I A;  1MIY A;  3KFW X;  3FG1 A;  4DVD A;  5FMN A;  3UT5 E;  2I59 A;  4BJM A;  3F2E A;  4FJO A;  4UF0 A;  4WNK A;  1BR2 A;  1HTJ F;  1WYC A;  4UV8 B;  3RYC E;  4ISS A;  5LHG B;  3I9Y A;  5FY7 A;  4IE7 A;  5JVD E;  2ZLY A;  2W63 A;  3JC6 C;  4QHO A;  1MMN A;  5HXS A;  5M4Y A;  4MAL A;  1LOX A;  5JRC A;  3MXZ A;  4O4I E;  1S35 A;  4H9R C;  3R6N A;  4I4T E;  5H6R B;  4AQF C;  3LFM A;  4EB6 E;  2Z6E A;  3BK9 A;  2EHO A;  1LPA B;  3L3P A;  3FB2 A;  3VHL A;  1ETH A;  1RRH A;  3ONX A;  3OKQ A;  1UX5 A;  5LGN B;  3GMI A;  3J7Y q;  2P0M A;  3N9Q A;  5HXH A;  4O4H E;  3PU3 A;  3ZYK A;  3UUL A;  3F57 A;  5L3C B;  1LPB B;  4XZC A;  3HR0 A;  5LBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...