3CWZB

Structure of rab6(gtp)-r6ip1 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
336
structure length
310
Chain Sequence
NLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKLAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSLPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-6A
publication title Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 87
structure length 310
sequence length 336
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01477 PLAT PLAT/LH2 domain
B PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cwzB01
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 3cwzB03
3BNDA 3FG3A 3O8YA 2IUJA 4WHAA 2WXUA 1N8QA 1LPAB 3FG1A 2DWGA 1QM6A 2IUKA 3V92A 1ROVA 1IK3A 3CWZB 2PVSA 1NO3A 3V99A 3V98A 1LNHA 3BNEA 1OLPA 1YGEA 1RRLA 2CXLA 2OXEA 1FGOA 4NREA 1LPBB 2WXTA 1F8NA 4QWTA 1RRHA 2CXFA 2PPLA 1FGQA 1FGMA 1Y4KA 1HPLA 2WY6A 3BNCA 1QMDA 2SBLA 1GYGA 1KHOA 5EEOA 3BNBA 1N8SA 3PZWA 1ETHA 1FGRA 1GPLA 4GIWA 4WFOA 3VF1A 2FNQA 2P0MA 1LOXA 3FG4A 1JNQA 2DWKA 1HU9A 1W52X 1RP1A 1BU8A 1CA1A 1FGTA
chains in the Genus database with same CATH superfamily
2YOEA 4CXYA 1I6ZA 2W00A 1BR4A 1JNZA 3RRWA 3AB3B 4KMCA 4Q25A 2X67A 3CPZA 2L8KA 3L39A 5EK4A 5L3CB 4UEMA 4DUYT 2V6XA 1WFDA 5FXVA 4DV0T 3PUAA 3CX8B 5DABA 2MPKA 2N2NA 2NOXA 3BNEA 2W61A 4GYSA 5AFUL 5F3JA 3KV4A 4YFSA 2D0TA 4O4JE 3G06A 3ZMZB 2QYWA 3PU3A 4K0KT 1FGTA 4OYJA 4U72A 4QKNA 2IUJA 3RIUA 2CPTA 3VU7H 5FY7A 4JI7T 1H7CA 1YKEB 4IE7A 4QWTA 1UGOA 2WXTA 4U7YA 4O8SA 3JC6D 2D5UA 2KSRA 4Z8XA 1D0YA 4HTEA 3LG7A 5FXXA 4PJMA 3UU6A 4AQFA 4F6RC 2XQYA 1HR0T 5JH7E 2Y8DA 1D0XA 1UUSA 1W0AA 2WS3A 4HEAA 3RF1A 3AAAB 3FZFB 3V98A 1Y01A 5JDNA 3AE8A 2XAJB 4AQYT 2WZIA 4AQGA 5JR9C 2LOSA 3UFEA 4CXWA 5CGMA 2PG8A 3LK3B 5C2TA 2CWYA 2IC6A 2WAUA 3BK9A 3O1HA 5LHIB 4GK0E 2KXTA 4DV5T 4LFAT 2HN1A 5HAXA 5L3FB 2YDQA 4UV9B 5AQJB 3HKEE 2CXDA 5FP3A 1U5PA 4ILCA 2UUAT 2V8SV 4H63H 2BVLA 4PW8A 4IT4A 4X65T 3RC8A 2D9DA 4U74A 3KBUA 3PUWF 3OYZA 1IBMT 3P8CD 2D0UA 4PK5A 4V1Av 4EOZB 1VCSA 3Q5EA 3C4XA 3P4SA 3LSVA 2ACZA 3FZMB 3RI5A 2BKOA 3QB5A 3X1DA 2B1EA 4YXDA 2HPLA 2WM9A 1IZNB 2E5VA 2XQAA 2ZM6T 1Y64B 3RYCE 2CHOA 4YSYA 4ISTA 5IUXA 2OXEA 2VURA 4DV6T 4B3RT 2DI4A 3EABA 4P1NA 5LNKA 4UVAB 2ZM2A 2KWIB 2VQFT 2XQ6A 3FBZA 4HWIB 3RC3A 1HNWT 4HFBA 4LMJA 3K1SA 3M3ZB 1V9DA 1N33T 4PJNA 3BNCA 5J2UE 2N1GA 3CX6B 2DWKA 1FJGT 4U2ZA 4EXTA 1VOMA 5HXEA 1YQ3A 3O4XE 5L3EB 2MOZA 1MNEA 1S94A 4X1YE 4JEHB 2C5IT 1FGMA 4ISSA 5LYJE 4XBFB 2UXDT 2VK9A 5JDFA 2BKPA 4ZI2D 2C5JA 3K3NA 4YY3T 2NWBA 2XZEA 4WNKA 4ZEYA 1NO3A 4QWNB 4AISA 4KP3C 3I9WA 2CBIA 4BAYB 3U78A 4WYVA 4I55E 4LF6T 5HCMA 2X9WA 3AEFA 4COFA 1UK5A 3AECA 3FG3A 2E9XC 3ZMUB 3ZCIA 2UUBT 2M6BA 3CKDA 4O4LE 2VB6A 3AE3A 5LMUT 1FMVA 4HGAA 5C8YE 1N34T 5FL0A 3FZHB 5AQFB 3HA4A 1OEDC 2VASA 4M1PA 4U3CA 2Q9QD 5AQHB 1L0VA 1RP1A 5BMVE 5AQVB 3IEEA 4ZZCA 3IF8B 2GK9A 1YW0A 3LFMA 4NPPA 4CXXA 1YXRA 3UUMA 2CEAA 3RIAA 1W09A 4AKRB 2BG9B 5FNVE 1KNRA 4HE8A 1KHOA 3B13A 4JBWF 1XMOT 2IUBA 1HU9A 4JUYA 1WLXA 2A72A 1CUNA 1WCRA 4YTNA 3RKGA 4AXPA 5HCJA 2YU1A 2V5DA 3C4WA 5HXHA 5E0OA 3UUBA 4LFCT 1IAPA 4TN7B 2KZ7B 1J5WA 2JIWA 2WMOA 4PK4A 2XHJA 5C3JA 4IE6A 1IJ6A 4QXHB 1ZOYA 3BQKA 2XQ3A 5EK3A 2M6IA 1GYGA 5JRCA 2WU5A 1SUMB 1HX8A 2V7JA 3P4WA 4CN4A 2EHOA 4CI3B 2YK0A 3UT5E 4I4TE 4LF4T 2PVSA 3UQ4A 2YEVC 4DR4T 5LB7B 3AE5A 4A56A 2JQHA 3LK2B 2V5CA 2JMKA 2H89A 3PUVF 4DUZT 1Z8UA 3T8OA 2V7MA 4QXBB 4BA9A 1IK3A 3P4RA 4JLEA 3N5LA 4HN9A 1LKXA 1D1CA 1OWAA 2CLYB 1J1JA 4QH4A 5AQKB 4AKGA 2HHHT 3MA9A 5KX5E 5L4EA 2WCAA 1OXZA 4TV8E 1N8QA 2HN2A 4L0RA 4CI1B 3ZN0B 2IDOB 5IWAT 1FGOA 3N9LA 3VR9A 4J2CA 4H9PC 5AQGB 3Q5XA 3VKGA 3CX7B 2E2AA 1YD8G 4JEUB 3H3MA 4QX7B 1LPAB 3FG1A 2WDQA 2WWVA 3TLUA 4WZXA 1WYBA 2IMLA 4F8HA 2BDEA 2YN6A 2RP4A 3HKCE 2DLRA 2LHRA 5AQRB 4IDOA 4XAXB 5HWXA 2CBJA 2LSKA 3SWHA 2YKSA 2ZM8A 3A5XA 4MHCA 1CA1A 3LBXA 2M67A 3C64A 5ADXL 4B3ST 3VHLA 3ETUA 3N9QA 4WBOA 2LE8A 1LVKA 5CFBA 3ANWA 5FY0A 3J9X1 1RRHA 2K3WA 3U3IA 2Q9QB 4U2YA 3QC9A 3O1JA 1M62A 3P4QA 5FYMA 4DV1T 3PJAJ 4LF9T 3CWZB 3CQGB 1R8IA 1LNHA 4PJLA 4EEDA 2XAHB 4CZZB 4YSXA 5TAOA 3SFDA 3WAKA 2VKJA 2EHOC 3SRZA 2MTQA 3LDQB 5DJQC 4X1IE 3KINB 3HR0A 2LHNA 2FUPA 2KXPB 2XQ7A 3KVBA 1QLBA 4HWHA 2AE9A 2VL0A 5F8PA 1LRZA 2FNQA 3ZYMA 3C51A 4N78D 4PAGA 4I50E 5IYZE 3ZPOA 3RH3A 1KNZA 3N9OA 1VRBA 2XSAA 3SFEA 2BS2A 3A7MA 3ABVA 5AQLB 3WI3A 1CHUA 3BNDA 2KWHA 2ACXA 5L4HA 2KINB 4IE0A 4DVDA 4IL4A 3ETVA 3OJAA 2YINA 5JVDE 2NW8A 4A98A 2H3RA 1NWMX 2UXCT 4LFBT 5ABGA 5F5WA 4DBQA 5LGUB 4X62T 4KHZF 2PJQA 3AEDA 4NREA 1IBLT 4E7ZA 2XPKA 2W67A 3RRCA 2CWOA 2F4VT 3V5SA 2CCQA 5JDQA 5CJ5A 4TNWA 5M4YA 2JMHA 3CQCB 3F57A 1MIVA 4IDQA 3HKBE 4YJ2E 2LJLA 4YTMA 2KNDA 5KDMC 1HPLA 2PFVA 3RYHE 4MALA 3T1YT 4X64T 2K5BB 2E9XA 4PNIA 3O8YA 2YDRA 2A2FX 2ODVA 5ABFA 1XDPA 3R6NA 5H6QB 5BR8T 3L8RA 3T1HT 5LBQB 3DTOA 1FGQA 1LVFA 1OEDA 4KHPT 3NVOA 1FEWA 4NUVA 4TWFA 3UUNA 4YT0A 2WQYA 1UX4A 4X5TA 4NXMT 3QOFA 2J1DG 4H9SE 5FVLA 1WR6A 2X51A 3FHNA 3ZJ1A 3P7IA 1YQ4A 1HFAA 2XASB 1NAFA 2WDVA 3UTKA 3F31A 3ZEFB 2KT9A 2VKOA 5J2TE 3FBLA 2CXFA 5LOVE 4EZHA 3B5MA 3ZYLA 1T72A 3RPUA 4UF0B 3O9XA 2E9XD 1E7PA 2FJEA 5J1GA 3V92A 1QSDA 3RKOA 4FJOA 4IIJE 4YLHA 5LG4A 4EEBA 4GOUA 3ZLIA 2X66A 1J5ET 4WFOA 1IBKT 2BG9C 4NXNT 5AQIB 2Z6EA 3GN5A 3AEEA 2K24A 4KX6A 1UX5A 4LMLA 2UXXB 4ZI3C 5KMGP 1JNRA 2W62A 3JCFA 3GA8A 2IHR1 4LF7T 5JR9B 2YDSA 1X9BA 3JAEA 3N2OA 1MMAA 3MJXA 1LPBB 2P9BA 1D1AA 2JQKA 2XQ5A 5EEOA 4ZS2A 3KBTA 3ZJ2A 2LSJA 2CE7A 3QUJA 1MNDA 2WU2A 4JI1T 2KLQA 1KF6A 4UXNB 3AXJB 2CXLA 2L3LA 3LJCA 1O3XA 3NBXX 3AAIA 4EGWA 5JDHA 1SHZC 4ILAA 3ZYKA 1HNZT 2P0MA 1XWMA 2V6YA 2E8IA 5HEJA 4B3TT 3L3PA 4CQIA 1XNQT 5HEOA 2UU9T 5JREA 2X9HA 2PPLA 3B57A 4C90A 4B6XA 1MMGA 2NR4A 3UU5A 2QA7A 3KV5A 2D2SA 4AKLA 5AQSB 2Y6XA 2XTLA 1IJ5A 1OEDE 4KUMB 3FZLB 4U31A 2DCFA 2X0YA 3N9PA 2J62A 4JI3T 3FXEB 4DNDA 5HYAA 2SPCA 1ZKEA 4DIDB 5J0ZA 5LGTB 1N8SA 3PUQA 3OVUA 2FJDA 4HFEA 4PFOA 3QB5K 2X68A 3JAFA 3TLSA 2VKDA 3RGLA 1UURA 2FBWA 4EB6E 3E0ZA 1OLPA 3UU8A 3O1IA 2A9UA 3Q9DA 1GPLA 2VKHA 3AA6B 2BZBA 3VKHA 4Z91A 4DR1T 4H9RC 4YSZA 3AE9A 1HNXT 2W63A 4H9NC 3MK7C 2W4XA 3U6GA 5JQGE 2UUCT 5DQVA 4MFRA 5LP6E 3AE1A 5ABFB 4ERRA 3K8PC 3N2GE 4DMVA 5GONE 1HTJF 2Q9QC 1B7TA 1XDOA 4DR3T 1ROVA 1OEDB 2LSYA 5AQTB 2H7VC 2IC9A 3R84B 2WY6A 5FXZA 4GIWA 4IE5A 3OBVE 5AQQB 3GWHA 3ZC1A 4LF5T 4E7SA 1D1BA 3PU8A 4QXCB 2ES0A 3QK6A 4G2AA 1YGEA 1ZEEA 3CIRA 4GKKT 1Z0PA 3EDUA 3ONJA 4MBQA 4JI8T 1I94T 4YHJA 4DR7T 2CRBA 3MXZA 2WP9A 3AA1B 3QNUA 2EHOD 3AVSA 2OV9A 3AEBA 4FI5A 4UELA 3OKQA 1T8BA 3ZT5A 3PZWA 5HXRA 3SS1A 5H6RB 3BQIA 4ZS3A 1KFYA 3W15B 1BU8A 4WHAA 2WXUA 2LOPA 2XQ4A 5L2LA 3PDYA 3UU4A 3PE0A 4DV3T 1ZV4X 4DV7T 2UXBT 5FKYA 3OTOT 2WZHA 1MMDA 3BQLA 1QMDA 2I0MA 3UUXB 3J7Yq 3UULA 4P0AA 5FL1A 1MMNA 2RPAA 3SOLA 2G0UA 2BS3A 2K48A 3PURA 4H9OC 2LLYA 2ZLYA 2QGSA 4ZHQE 3ZT7A 5LA6E 4L9IA 1Y4KA 2XUEA 2A3DA 5KXJA 4HWCA 3MACA 4TX5A 4OK0A 4ZOLE 3PTRB 4IDZA 4TZ4C 1AJ3A 4X20E 4HFIA 2XHEB 2QVAA 1HF8A 2LEHA 5AQOB 1XZYA 5AQPB 4DR6T 4WBNE 3ZSSA 3RQWA 4HFDA 4P0BA 3NKZA 4X66T 2BS4A 4AIUA 2WMNA 4DR2T 4OFZA 2LSIA 2LRKA 2MAWA 1HG2A 1FMWA 2DNXA 3ZN1B 4DV4T 5LHGB 4NUUA 2WY2A 3AE2A 1BR0A 4GK5E 3VRBA 4NIQA 2VVNA 3FB2A 4YHHT 3EUHA 2SBLA 2CA5A 2UXNB 3NRXA 4HWDA 5L47A 4EIWA 2BG9A 2X0LB 4PFPA 3RYIE 2WDRA 4X1KE 2WB5A 1YKHB 1WYCA 4PK6A 4PJJA 4ZZBA 1GQEA 5HEGA 3CQXC 2E5LT 1M7KA 4HKAA 5FMNA 3C4ZA 2I6HA 5HEHA 3PUYF 1ETHA 2XM1A 5LHHB 4XZCA 4ILBA 4EZ4A 1BR1A 3EDVA 3PUGA 4BJNA 2QRXA 3ONXA 2DHRA 2AXDS 3AE6A 3ZMVB 5JRCB 5LBMA 2CM0A 1D0ZA 2OA5A 5LXTE 2EHOB 2BKNA 2WSSV 1HS7A 1HG5A 1NEKA 1WR0A 1MIWA 4TWDA 5FVKA 2LKGA 2JPFA 3PUZF 2XQ9A 4QEYA 2K9AA 3E22E 2V7IA 4CI2B 1RRLA 3AA0B 3LK42 3PUXF 2V1DB 5LJNA 2YU2A 4IDNA 4GKJT 3H3AA 2NW9A 2XAQB 4ZI3D 1W52X 2QNGA 4O2BE 2I59A 2LM9A 2WBLA 2LRGA 5ABEA 3AE7A 3TLVA 4EV6A 1KEYA 3VR8A 2W0GA 3VRAA 4QHOA 5EK2A 2ODUA 4KBMB 1EZ3A 4TUYE 1QM6A 4TWHA 2LG7A 2XAFB 2OLTA 3OYXA 4G63A 4ZXLA 3F2EA 3KV6A 3BNBA 4EYYR 2LKHA 5EZYE 3JC6C 5LCYA 1WRDA 3S4UA 5A1LA 1DU2A 3AEGA 3K3QC 2ZMAA 4OYKA 3I1AA 2V7KA 2XSBA 2XHHA 3LBXB 4QH5A 2FJAA 3HL6A 3UQ7A 3OPCA 3N2KE 2JQQA 3NZPA 4HWFA 3ANWB 3P50A 2XAGB 3V5UA 1T98A 3NWIA 4AKIA 4Z90A 5JDMA 1XNRT 2BG9E 3I9YA 1LOXA 5FXWA 3NZQA 2X9YA 2Q9QA 1SE7A 3P4PA 4P09A 2LSGA 3HI2A 3RIUC 1BR2A 2IAKA 5CA0E 5L3GB 3CVRA 2Y48B 2R6GF 3WAJA 2NTYA 3EAMA 4JI6T 5JDLA 2MBGA 5L3DB 2HH7A 1N32T 4AQFC 4YTPA 3KV9A 2C5KT 5HWYA 3C50A 3ZSTA 3K3OA 3FXDB 3HKDE 4IDPA 2LRLA 4H9QC 1UCUA 4CN1A 5FY1A 3Q2MA 5LJMA 4GYRA 4EYUA 4O4HE 2NW7A 2KMFA 2C0SA 2IIUA 4ZI7E 3H37A 3PV0F 4JI2T 4JI5T 2BBHA 5AQMB 4HFHA 4TV9E 3ZT6A 1ZHCA 4ADZA 1F8NA 4ASKA 4OX9T 3AA7B 5DQWA 3JADA 2J4GA 2XJ7A 3PUSA 3RQUA 3ESLA 2CLYC 4IHJE 4YJ3E 4JI4T 1KK7A 3N9NA 2JRKA 4DMWA 3RLFF 4EAHA 3PJAA 2XFEA 3IBPA 3D0TA 4ILUA 3Q5WA 4JV5T 4UVCB 4ZI2C 2W2UA 3RYFE 3M65A 3DJBA 2X9XA 3AVRA 4H63V 1US7B 2N9DA 2PTFA 2CHNA 4WW0A 5ETWA 5JTGA 4QH1A 3NRYA 2LT3A 3RX6A 2XM2A 3KFWX 4DR5T 5LMNT 3UFGA 2HPJA 2DWGA 3IA3A 1G8XA 5HXCA 4KI0F 2W66A 4UVBB 3TKLB 1HCIA 2VVSA 5CB4E 2E9XB 1ZP0A 2H7OA 2H88A 2CMRA 2J47A 4O4IE 3EI0A 3UU3A 2NTXA 5LG3A 3AE4A 2V7LA 2VWAA 2MYSA 3MKDA 2PBIA 3ZC0A 4IREA 3ZKRA 4OHFA 5ABHA 1FGRA 4I0UA 4HFCA 3L09A 2NP9A 1SA0E 4UV8B 4TNVA 4A5XA 4K0UA 4U33A 2RA1A 1T7SA 5HEUA 5LGNB 3AAEB 1W0BA 3TLTA 1HX1B 4B3MT 5L3BB 3EVYA 2QZ7A 3DP7A 3ZMTB 1W9RA 3I0QA 3Q5DA 1NENA 4LMKA 2BBJA 4A97A 2DL1A 3EHZA 3RIFA 2LGEA 4MLKA 5CA1E 3E08A 2L9QA 4UF0A 4AKHA 2IUKA 1X79A 3RHWA 4DBRA 4QX8B 3TLWA 3GN5B 3CK6A 4IE4A 1G73A 3FZKB 2B76A 4DV2T 4UR9A 3N9MA 4DO0A 4JI0T 4HFVA 3CMLA 3ZCJA 2BVMA 1U4QA 5IHYA 4ANJA 4LF8T 4BJMA 2XQ8A 5JDGA 3C98B 3ONLC 2WWUA 5JR9A 1S35A 4I43B 4CN6A 1FIOA 2JJ9A 1N36T 2VL8A 2KXVA 3IBZA 4UIGA 3ZMSB 2FJBA 5AQNB 1QUUA 2ZM0A 3MZKB 1E2AA 1KNPA 2LM2A 1E1HB 2JQ9A 5AQUB 5HXSA 2IW5B 2V6YB 2V26A 3KDSE 4AI6A 1MIYA 1VCTA 3AXJA 3VF1A 4JYAT 3FG4A 1JNQA 2VQET 3IHRA 2X0HA 4U7IA 4O2AE 2XFDA 3KVAA 4L5GA 3V99A 3I0OA 3GMIA 3A8YC 4C91A 4IL9A 3AEAA 2XY8B 1XMQT 4IGUA
chains in the Genus database with same CATH topology
4CXYA 1EZ3A 4TUYE 1N8QA 2QA7A 2W00A 1BR4A 3KV5A 1QM6A 4L0RA 4CI1B 3RRWA 3ZN0B 2XAFB 3OYXA 4G63A 2D2SA 3AB3B 3F2EA 4AKLA 3KV6A 4KMCA 1FGOA 3N9LA 4J2CA 2X67A 4H9PC 3BNBA 2Y6XA 3CPZA 2L8KA 2XTLA 5EK4A 1IJ5A 4EYYR 5L3CB 4UEMA 5EZYE 3Q5XA 3VKGA 4KUMB 3JC6C 3CX7B 1YD8G 5LCYA 2DCFA 1WRDA 3S4UA 3N9PA 4JEUB 5FXVA 3PUAA 3CX8B 4QX7B 5A1LA 5DABA 1LPAB 3FG1A 3K3QC 2ZMAA 4OYKA 2N2NA 2NOXA 3FXEB 4DNDA 5HYAA 3BNEA 3I1AA 1WYBA 2V7KA 2BDEA 2SPCA 2RP4A 2W61A 3HKCE 2DLRA 1ZKEA 4GYSA 2LHRA 5AFUL 5F3JA 3KV4A 3LBXB 4YFSA 5LGTB 4XAXB 1N8SA 2D0TA 4O4JE 5HWXA 2LSKA 3PUQA 3ZMZB 3HL6A 3PU3A 3SWHA 2ZM8A 3A5XA 4MHCA 1CA1A 3LBXA 2M67A 3N2KE 4PFOA 2JQQA 2X68A 3C64A 3NZPA 4OYJA 4U72A 1FGTA 4QKNA 5ADXL 2IUJA 3ANWB 2XAGB 3VHLA 3ETUA 2VKDA 3V5UA 1T98A 3VU7H 3N9QA 4AKIA 5JDMA 4WBOA 5FY7A 2LE8A 4EB6E 1LVKA 3E0ZA 1H7CA 1OLPA 1YKEB 4IE7A 3ANWA 3O1IA 5FY0A 3J9X1 4QWTA 2WXTA 1RRHA 4O8SA 3JC6D 3U3IA 3Q9DA 2Q9QB 1GPLA 2D5UA 3QC9A 3O1JA 4Z8XA 3I9YA 2VKHA 1D0YA 3AA6B 1LOXA 5FXWA 4HTEA 3NZQA 3LG7A 5FXXA 2BZBA 2X9YA 4PJMA 4AQFA 3VKHA 5FYMA 2Q9QA 2XQYA 4F6RC 5JH7E 2Y8DA 2LSGA 4H9RC 3HI2A 1D0XA 4P09A 4HEAA 3CWZB 1BR2A 2IAKA 3AAAB 2W63A 3CQGB 4H9NC 5CA0E 3MK7C 3V98A 1LNHA 5L3GB 3CVRA 2Y48B 4PJLA 5JDNA 3WAJA 2XAHB 2NTYA 2XAJB 4CZZB 5TAOA 4AQGA 5JQGE 5JDLA 5JR9C 5DQVA 4MFRA 5LP6E 2MBGA 2LOSA 3UFEA 5L3DB 4CXWA 2HH7A 4ERRA 3WAKA 2VKJA 2PG8A 4AQFC 3K8PC 3LK3B 3KV9A 3N2GE 5GONE 4DMVA 2C5KT 5HWYA 1HTJF 2CWYA 2EHOC 2IC6A 3C50A 1B7TA 2Q9QC 2WAUA 3BK9A 2MTQA 3K3OA 3O1HA 3SRZA 5LHIB 1ROVA 5DJQC 4GK0E 4X1IE 3FXDB 2LSYA 3KINB 3HKDE 3HR0A 2H7VC 2LHNA 2IC9A 3R84B 5HAXA 2KXPB 4H9QC 5L3FB 3KVBA 4UV9B 2WY6A 3HKEE 2CXDA 1UCUA 5FP3A 1U5PA 5FY1A 5FXZA 3Q2MA 5LJMA 4GIWA 4IE5A 4GYRA 4EYUA 4O4HE 2NW7A 3OBVE 5F8PA 1LRZA 2KMFA 2FNQA 3GWHA 4H63H 2BVLA 3ZYMA 3ZC1A 2C0SA 3C51A 4PW8A 4ZI7E 4N78D 4PAGA 4E7SA 3H37A 3RC8A 1D1BA 3PU8A 4U74A 3KBUA 4I50E 4QXCB 3OYZA 5IYZE 2ES0A 3P8CD 3QK6A 4G2AA 2D0UA 3ZPOA 4PK5A 3RH3A 1KNZA 4V1Av 4TV9E 1ZEEA 1ZHCA 4ADZA 4EOZB 1YGEA 3N9OA 1F8NA 4ASKA 1VRBA 1Z0PA 3AA7B 3EDUA 5DQWA 3C4XA 4MBQA 4YHJA 3MXZA 3AA1B 3PUSA 2EHOD 2B1EA 3ESLA 2CLYC 3WI3A 2HPLA 2WM9A 3BNDA 4IHJE 4YJ3E 3AVSA 1IZNB 1Y64B 3RYCE 2KWHA 2ACXA 4FI5A 1KK7A 3N9NA 2KINB 4UELA 4IE0A 4DVDA 2JRKA 4DMWA 3ETVA 4ISTA 3OJAA 2YINA 2OXEA 3OKQA 4EAHA 5JVDE 3IBPA 2NW8A 3PZWA 5HXRA 2H3RA 2DI4A 3SS1A 5H6RB 3BQIA 4ZS3A 1NWMX 3D0TA 4ILUA 3Q5WA 3W15B 5LNKA 4UVAB 1BU8A 4UVCB 2ZM2A 2KWIB 4ZI2C 4WHAA 3RYFE 2WXUA 5LGUB 2LOPA 4DBQA 3FBZA 5L2LA 3PDYA 3M65A 3RC3A 3DJBA 2X9XA 3AVRA 3PE0A 4H63V 1US7B 2N9DA 1ZV4X 2PJQA 4WW0A 4NREA 5ETWA 1MMDA 1V9DA 3BQLA 4PJNA 1QMDA 3BNCA 4E7ZA 3NRYA 5J2UE 2LT3A 3UUXB 3RX6A 3J7Yq 3UULA 4P0AA 3RRCA 2N1GA 2CWOA 1MMNA 3SOLA 3CX6B 2DWKA 3V5SA 2CCQA 3KFWX 4EXTA 5JDQA 1VOMA 2G0UA 5M4YA 2JMHA 3CQCB 3F57A 5HXEA 2HPJA 1MIVA 2DWGA 2K48A 3O4XE 3PURA 5L3EB 1G8XA 2MOZA 3HKBE 1MNEA 5HXCA 1S94A 4YJ2E 4H9OC 4X1YE 2LJLA 4JEHB 2ZLYA 2C5IT 2QGSA 4ZHQE 4UVBB 3TKLB 5LA6E 4L9IA 1HCIA 2KNDA 5KDMC 1FGMA 1Y4KA 1HPLA 2XUEA 5CB4E 4ISSA 2A3DA 2PFVA 5LYJE 2E9XB 4MALA 3RYHE 4XBFB 2H7OA 2VK9A 5JDFA 3MACA 4ZI2D 4TX5A 2C5JA 2CMRA 4OK0A 4ZOLE 4O4IE 3K3NA 3PTRB 2NTXA 2K5BB 2E9XA 2NWBA 4PNIA 4IDZA 3O8YA 4TZ4C 2A2FX 4WNKA 1AJ3A 4X20E 2ODVA 2V7LA 2VWAA 1NO3A 4QWNB 3R6NA 4KP3C 2MYSA 3I9WA 3MKDA 2XHEB 5H6QB 4BAYB 3U78A 2PBIA 5LBQB 3ZC0A 3DTOA 1FGQA 4OHFA 1HF8A 4I55E 2LEHA 1LVFA 1FGRA 3L09A 2NP9A 1FEWA 4NUVA 2X9WA 3FG3A 4WBNE 2E9XC 3ZMUB 1SA0E 3UUNA 3ZCIA 4P0BA 3CKDA 1UX4A 4O4LE 4UV8B 2VB6A 1FMVA 4HGAA 5C8YE 4K0UA 2WMNA 2J1DG 4OFZA 2LSIA 2RA1A 3HA4A 4H9SE 2VASA 5LGNB 3AAEB 1HG2A 1WR6A 1FMWA 2X51A 2DNXA 4M1PA 3ZN1B 2Q9QD 3FHNA 5LHGB 3ZJ1A 3P7IA 1RP1A 4NUUA 5BMVE 1HFAA 2XASB 5L3BB 3IEEA 3IF8B 1NAFA 2GK9A 3EVYA 1YW0A 3LFMA 4CXXA 3UTKA 3F31A 3UUMA 1BR0A 2CEAA 4GK5E 3ZEFB 3DP7A 2KT9A 2VKOA 4AKRB 3ZMTB 5J2TE 3FBLA 5FNVE 2CXFA 4HE8A 3FB2A 5LOVE 4EZHA 3EUHA 3I0QA 2SBLA 2CA5A 1KHOA 3B13A 2UXNB 3ZYLA 3NRXA 4EIWA 3RPUA 2X0LB 4PFPA 4UF0B 2E9XD 3RYIE 3O9XA 4MLKA 5CA1E 3E08A 1HU9A 2L9QA 4X1KE 4JUYA 1WLXA 1YKHB 1WYCA 4PK6A 2A72A 4PJJA 5J1GA 1CUNA 4UF0A 4AKHA 2IUKA 3V92A 1QSDA 3RKOA 1X79A 4FJOA 4IIJE 4YLHA 5LG4A 3CQXC 4AXPA 4DBRA 4HKAA 2YU1A 4QX8B 5FMNA 3C4ZA 3GN5B 4GOUA 4IE4A 1ETHA 1G73A 3C4WA 5HXHA 3ZLIA 5E0OA 2X66A 5LHHB 4WFOA 4XZCA 1IAPA 2Z6EA 3GN5A 4TN7B 2K24A 4EZ4A 1BR1A 3EDVA 1UX5A 3N9MA 2UXXB 4ZI3C 2KZ7B 5KMGP 4DO0A 3PUGA 4HFVA 2W62A 3CMLA 4BJNA 3ZCJA 3GA8A 3ONXA 2BVMA 1U4QA 5JR9B 2DHRA 5IHYA 2WMOA 4PK4A 4ANJA 4IE6A 1IJ6A 4QXHB 2CM0A 5LBMA 3ZMVB 4BJMA 5JRCB 3N2OA 5JDGA 1D0ZA 3BQKA 1MMAA 3MJXA 1LPBB 3C98B 2OA5A 5EK3A 2P9BA 1D1AA 2WWUA 5LXTE 5EEOA 1GYGA 4ZS2A 5JR9A 1S35A 4I43B 2EHOB 2WSSV 1FIOA 1HS7A 5JRCA 1HG5A 3KBTA 1HX8A 3ZJ2A 2V7JA 1MIWA 2JJ9A 2VL8A 2LSJA 2CE7A 4UIGA 3ZMSB 2EHOA 4CI3B 2JPFA 2YK0A 3QUJA 1MNDA 3UT5E 1QUUA 2K9AA 2ZM0A 3E22E 2KLQA 3MZKB 4I4TE 2PVSA 2V7IA 2YEVC 1E1HB 4UXNB 4CI2B 1RRLA 2CXLA 3AA0B 3LK42 5HXSA 2L3LA 3LJCA 2V1DB 1O3XA 3NBXX 2IW5B 4A56A 4AI6A 2V26A 3KDSE 1MIYA 3AAIA 3LK2B 5LJNA 2YU2A 2JMKA 5JDHA 3H3AA 2NW9A 1SHZC 3ZYKA 3VF1A 2XAQB 4ZI3D 2P0MA 3FG4A 1JNQA 1W52X 3IHRA 2E8IA 4O2BE 2I59A 3T8OA 2V7MA 3L3PA 2LM9A 4O2AE 4QXBB 4BA9A 4CQIA 1IK3A 3KVAA 4JLEA 4L5GA 2WBLA 3N5LA 3V99A 4HN9A 1LKXA 1D1CA 1OWAA 3I0OA 3GMIA 5JREA 2CLYB 2X9HA 2PPLA 3B57A 4C91A 4AKGA 3MA9A 2W0GA 4QHOA 5KX5E 4C90A 5EK2A 4IGUA 2ODUA 4B6XA 1MMGA 1OXZA 4KBMB 4TV8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BND A;  3FG3 A;  3O8Y A;  2IUJ A;  4WHA A;  2WXU A;  1N8Q A;  1LPA B;  3FG1 A;  2DWG A;  1QM6 A;  2IUK A;  3V92 A;  1ROV A;  1IK3 A;  3CWZ B;  2PVS A;  1NO3 A;  3V99 A;  3V98 A;  1LNH A;  3BNE A;  1OLP A;  1YGE A;  1RRL A;  2CXL A;  2OXE A;  1FGO A;  4NRE A;  1LPB B;  2WXT A;  1F8N A;  4QWT A;  1RRH A;  2CXF A;  2PPL A;  1FGQ A;  1FGM A;  1Y4K A;  1HPL A;  2WY6 A;  3BNC A;  1QMD A;  2SBL A;  1GYG A;  1KHO A;  5EEO A;  3BNB A;  1N8S A;  3PZW A;  1ETH A;  1FGR A;  1GPL A;  4GIW A;  4WFO A;  3VF1 A;  2FNQ A;  2P0M A;  1LOX A;  3FG4 A;  1JNQ A;  2DWK A;  1HU9 A;  1W52 X;  1RP1 A;  1BU8 A;  1CA1 A;  1FGT A; 
#chains in the Genus database with same CATH topology
 2YOE A;  4CXY A;  1I6Z A;  2W00 A;  1BR4 A;  1JNZ A;  3RRW A;  3AB3 B;  4KMC A;  4Q25 A;  2X67 A;  3CPZ A;  2L8K A;  3L39 A;  5EK4 A;  5L3C B;  4UEM A;  4DUY T;  2V6X A;  1WFD A;  5FXV A;  4DV0 T;  3PUA A;  3CX8 B;  5DAB A;  2MPK A;  2N2N A;  2NOX A;  3BNE A;  2W61 A;  4GYS A;  5AFU L;  5F3J A;  3KV4 A;  4YFS A;  2D0T A;  4O4J E;  3G06 A;  3ZMZ B;  2QYW A;  3PU3 A;  4K0K T;  1FGT A;  4OYJ A;  4U72 A;  4QKN A;  2IUJ A;  3RIU A;  2CPT A;  3VU7 H;  5FY7 A;  4JI7 T;  1H7C A;  1YKE B;  4IE7 A;  4QWT A;  1UGO A;  2WXT A;  4U7Y A;  4O8S A;  3JC6 D;  2D5U A;  2KSR A;  4Z8X A;  1D0Y A;  4HTE A;  3LG7 A;  5FXX A;  4PJM A;  3UU6 A;  4AQF A;  4F6R C;  2XQY A;  1HR0 T;  5JH7 E;  2Y8D A;  1D0X A;  1UUS A;  1W0A A;  2WS3 A;  4HEA A;  3RF1 A;  3AAA B;  3FZF B;  3V98 A;  1Y01 A;  5JDN A;  3AE8 A;  2XAJ B;  4AQY T;  2WZI A;  4AQG A;  5JR9 C;  2LOS A;  3UFE A;  4CXW A;  5CGM A;  2PG8 A;  3LK3 B;  5C2T A;  2CWY A;  2IC6 A;  2WAU A;  3BK9 A;  3O1H A;  5LHI B;  4GK0 E;  2KXT A;  4DV5 T;  4LFA T;  2HN1 A;  5HAX A;  5L3F B;  2YDQ A;  4UV9 B;  5AQJ B;  3HKE E;  2CXD A;  5FP3 A;  1U5P A;  4ILC A;  2UUA T;  2V8S V;  4H63 H;  2BVL A;  4PW8 A;  4IT4 A;  4X65 T;  3RC8 A;  2D9D A;  4U74 A;  3KBU A;  3PUW F;  3OYZ A;  1IBM T;  3P8C D;  2D0U A;  4PK5 A;  4V1A v;  4EOZ B;  1VCS A;  3Q5E A;  3C4X A;  3P4S A;  3LSV A;  2ACZ A;  3FZM B;  3RI5 A;  2BKO A;  3QB5 A;  3X1D A;  2B1E A;  4YXD A;  2HPL A;  2WM9 A;  1IZN B;  2E5V A;  2XQA A;  2ZM6 T;  1Y64 B;  3RYC E;  2CHO A;  4YSY A;  4IST A;  5IUX A;  2OXE A;  2VUR A;  4DV6 T;  4B3R T;  2DI4 A;  3EAB A;  4P1N A;  5LNK A;  4UVA B;  2ZM2 A;  2KWI B;  2VQF T;  2XQ6 A;  3FBZ A;  4HWI B;  3RC3 A;  1HNW T;  4HFB A;  4LMJ A;  3K1S A;  3M3Z B;  1V9D A;  1N33 T;  4PJN A;  3BNC A;  5J2U E;  2N1G A;  3CX6 B;  2DWK A;  1FJG T;  4U2Z A;  4EXT A;  1VOM A;  5HXE A;  1YQ3 A;  3O4X E;  5L3E B;  2MOZ A;  1MNE A;  1S94 A;  4X1Y E;  4JEH B;  2C5I T;  1FGM A;  4ISS A;  5LYJ E;  4XBF B;  2UXD T;  2VK9 A;  5JDF A;  2BKP A;  4ZI2 D;  2C5J A;  3K3N A;  4YY3 T;  2NWB A;  2XZE A;  4WNK A;  4ZEY A;  1NO3 A;  4QWN B;  4AIS A;  4KP3 C;  3I9W A;  2CBI A;  4BAY B;  3U78 A;  4WYV A;  4I55 E;  4LF6 T;  5HCM A;  2X9W A;  3AEF A;  4COF A;  1UK5 A;  3AEC A;  3FG3 A;  2E9X C;  3ZMU B;  3ZCI A;  2UUB T;  2M6B A;  3CKD A;  4O4L E;  2VB6 A;  3AE3 A;  5LMU T;  1FMV A;  4HGA A;  5C8Y E;  1N34 T;  5FL0 A;  3FZH B;  5AQF B;  3HA4 A;  1OED C;  2VAS A;  4M1P A;  4U3C A;  2Q9Q D;  5AQH B;  1L0V A;  1RP1 A;  5BMV E;  5AQV B;  3IEE A;  4ZZC A;  3IF8 B;  2GK9 A;  1YW0 A;  3LFM A;  4NPP A;  4CXX A;  1YXR A;  3UUM A;  2CEA A;  3RIA A;  1W09 A;  4AKR B;  2BG9 B;  5FNV E;  1KNR A;  4HE8 A;  1KHO A;  3B13 A;  4JBW F;  1XMO T;  2IUB A;  1HU9 A;  4JUY A;  1WLX A;  2A72 A;  1CUN A;  1WCR A;  4YTN A;  3RKG A;  4AXP A;  5HCJ A;  2YU1 A;  2V5D A;  3C4W A;  5HXH A;  5E0O A;  3UUB A;  4LFC T;  1IAP A;  4TN7 B;  2KZ7 B;  1J5W A;  2JIW A;  2WMO A;  4PK4 A;  2XHJ A;  5C3J A;  4IE6 A;  1IJ6 A;  4QXH B;  1ZOY A;  3BQK A;  2XQ3 A;  5EK3 A;  2M6I A;  1GYG A;  5JRC A;  2WU5 A;  1SUM B;  1HX8 A;  2V7J A;  3P4W A;  4CN4 A;  2EHO A;  4CI3 B;  2YK0 A;  3UT5 E;  4I4T E;  4LF4 T;  2PVS A;  3UQ4 A;  2YEV C;  4DR4 T;  5LB7 B;  3AE5 A;  4A56 A;  2JQH A;  3LK2 B;  2V5C A;  2JMK A;  2H89 A;  3PUV F;  4DUZ T;  1Z8U A;  3T8O A;  2V7M A;  4QXB B;  4BA9 A;  1IK3 A;  3P4R A;  4JLE A;  3N5L A;  4HN9 A;  1LKX A;  1D1C A;  1OWA A;  2CLY B;  1J1J A;  4QH4 A;  5AQK B;  4AKG A;  2HHH T;  3MA9 A;  5KX5 E;  5L4E A;  2WCA A;  1OXZ A;  4TV8 E;  1N8Q A;  2HN2 A;  4L0R A;  4CI1 B;  3ZN0 B;  2IDO B;  5IWA T;  1FGO A;  3N9L A;  3VR9 A;  4J2C A;  4H9P C;  5AQG B;  3Q5X A;  3VKG A;  3CX7 B;  2E2A A;  1YD8 G;  4JEU B;  3H3M A;  4QX7 B;  1LPA B;  3FG1 A;  2WDQ A;  2WWV A;  3TLU A;  4WZX A;  1WYB A;  2IML A;  4F8H A;  2BDE A;  2YN6 A;  2RP4 A;  3HKC E;  2DLR A;  2LHR A;  5AQR B;  4IDO A;  4XAX B;  5HWX A;  2CBJ A;  2LSK A;  3SWH A;  2YKS A;  2ZM8 A;  3A5X A;  4MHC A;  1CA1 A;  3LBX A;  2M67 A;  3C64 A;  5ADX L;  4B3S T;  3VHL A;  3ETU A;  3N9Q A;  4WBO A;  2LE8 A;  1LVK A;  5CFB A;  3ANW A;  5FY0 A;  3J9X 1;  1RRH A;  2K3W A;  3U3I A;  2Q9Q B;  4U2Y A;  3QC9 A;  3O1J A;  1M62 A;  3P4Q A;  5FYM A;  4DV1 T;  3PJA J;  4LF9 T;  3CWZ B;  3CQG B;  1R8I A;  1LNH A;  4PJL A;  4EED A;  2XAH B;  4CZZ B;  4YSX A;  5TAO A;  3SFD A;  3WAK A;  2VKJ A;  2EHO C;  3SRZ A;  2MTQ A;  3LDQ B;  5DJQ C;  4X1I E;  3KIN B;  3HR0 A;  2LHN A;  2FUP A;  2KXP B;  2XQ7 A;  3KVB A;  1QLB A;  4HWH A;  2AE9 A;  2VL0 A;  5F8P A;  1LRZ A;  2FNQ A;  3ZYM A;  3C51 A;  4N78 D;  4PAG A;  4I50 E;  5IYZ E;  3ZPO A;  3RH3 A;  1KNZ A;  3N9O A;  1VRB A;  2XSA A;  3SFE A;  2BS2 A;  3A7M A;  3ABV A;  5AQL B;  3WI3 A;  1CHU A;  3BND A;  2KWH A;  2ACX A;  5L4H A;  2KIN B;  4IE0 A;  4DVD A;  4IL4 A;  3ETV A;  3OJA A;  2YIN A;  5JVD E;  2NW8 A;  4A98 A;  2H3R A;  1NWM X;  2UXC T;  4LFB T;  5ABG A;  5F5W A;  4DBQ A;  5LGU B;  4X62 T;  4KHZ F;  2PJQ A;  3AED A;  4NRE A;  1IBL T;  4E7Z A;  2XPK A;  2W67 A;  3RRC A;  2CWO A;  2F4V T;  3V5S A;  2CCQ A;  5JDQ A;  5CJ5 A;  4TNW A;  5M4Y A;  2JMH A;  3CQC B;  3F57 A;  1MIV A;  4IDQ A;  3HKB E;  4YJ2 E;  2LJL A;  4YTM A;  2KND A;  5KDM C;  1HPL A;  2PFV A;  3RYH E;  4MAL A;  3T1Y T;  4X64 T;  2K5B B;  2E9X A;  4PNI A;  3O8Y A;  2YDR A;  2A2F X;  2ODV A;  5ABF A;  1XDP A;  3R6N A;  5H6Q B;  5BR8 T;  3L8R A;  3T1H T;  5LBQ B;  3DTO A;  1FGQ A;  1LVF A;  1OED A;  4KHP T;  3NVO A;  1FEW A;  4NUV A;  4TWF A;  3UUN A;  4YT0 A;  2WQY A;  1UX4 A;  4X5T A;  4NXM T;  3QOF A;  2J1D G;  4H9S E;  5FVL A;  1WR6 A;  2X51 A;  3FHN A;  3ZJ1 A;  3P7I A;  1YQ4 A;  1HFA A;  2XAS B;  1NAF A;  2WDV A;  3UTK A;  3F31 A;  3ZEF B;  2KT9 A;  2VKO A;  5J2T E;  3FBL A;  2CXF A;  5LOV E;  4EZH A;  3B5M A;  3ZYL A;  1T72 A;  3RPU A;  4UF0 B;  3O9X A;  2E9X D;  1E7P A;  2FJE A;  5J1G A;  3V92 A;  1QSD A;  3RKO A;  4FJO A;  4IIJ E;  4YLH A;  5LG4 A;  4EEB A;  4GOU A;  3ZLI A;  2X66 A;  1J5E T;  4WFO A;  1IBK T;  2BG9 C;  4NXN T;  5AQI B;  2Z6E A;  3GN5 A;  3AEE A;  2K24 A;  4KX6 A;  1UX5 A;  4LML A;  2UXX B;  4ZI3 C;  5KMG P;  1JNR A;  2W62 A;  3JCF A;  3GA8 A;  2IHR 1;  4LF7 T;  5JR9 B;  2YDS A;  1X9B A;  3JAE A;  3N2O A;  1MMA A;  3MJX A;  1LPB B;  2P9B A;  1D1A A;  2JQK A;  2XQ5 A;  5EEO A;  4ZS2 A;  3KBT A;  3ZJ2 A;  2LSJ A;  2CE7 A;  3QUJ A;  1MND A;  2WU2 A;  4JI1 T;  2KLQ A;  1KF6 A;  4UXN B;  3AXJ B;  2CXL A;  2L3L A;  3LJC A;  1O3X A;  3NBX X;  3AAI A;  4EGW A;  5JDH A;  1SHZ C;  4ILA A;  3ZYK A;  1HNZ T;  2P0M A;  1XWM A;  2V6Y A;  2E8I A;  5HEJ A;  4B3T T;  3L3P A;  4CQI A;  1XNQ T;  5HEO A;  2UU9 T;  5JRE A;  2X9H A;  2PPL A;  3B57 A;  4C90 A;  4B6X A;  1MMG A;  2NR4 A;  3UU5 A;  2QA7 A;  3KV5 A;  2D2S A;  4AKL A;  5AQS B;  2Y6X A;  2XTL A;  1IJ5 A;  1OED E;  4KUM B;  3FZL B;  4U31 A;  2DCF A;  2X0Y A;  3N9P A;  2J62 A;  4JI3 T;  3FXE B;  4DND A;  5HYA A;  2SPC A;  1ZKE A;  4DID B;  5J0Z A;  5LGT B;  1N8S A;  3PUQ A;  3OVU A;  2FJD A;  4HFE A;  4PFO A;  3QB5 K;  2X68 A;  3JAF A;  3TLS A;  2VKD A;  3RGL A;  1UUR A;  2FBW A;  4EB6 E;  3E0Z A;  1OLP A;  3UU8 A;  3O1I A;  2A9U A;  3Q9D A;  1GPL A;  2VKH A;  3AA6 B;  2BZB A;  3VKH A;  4Z91 A;  4DR1 T;  4H9R C;  4YSZ A;  3AE9 A;  1HNX T;  2W63 A;  4H9N C;  3MK7 C;  2W4X A;  3U6G A;  5JQG E;  2UUC T;  5DQV A;  4MFR A;  5LP6 E;  3AE1 A;  5ABF B;  4ERR A;  3K8P C;  3N2G E;  4DMV A;  5GON E;  1HTJ F;  2Q9Q C;  1B7T A;  1XDO A;  4DR3 T;  1ROV A;  1OED B;  2LSY A;  5AQT B;  2H7V C;  2IC9 A;  3R84 B;  2WY6 A;  5FXZ A;  4GIW A;  4IE5 A;  3OBV E;  5AQQ B;  3GWH A;  3ZC1 A;  4LF5 T;  4E7S A;  1D1B A;  3PU8 A;  4QXC B;  2ES0 A;  3QK6 A;  4G2A A;  1YGE A;  1ZEE A;  3CIR A;  4GKK T;  1Z0P A;  3EDU A;  3ONJ A;  4MBQ A;  4JI8 T;  1I94 T;  4YHJ A;  4DR7 T;  2CRB A;  3MXZ A;  2WP9 A;  3AA1 B;  3QNU A;  2EHO D;  3AVS A;  2OV9 A;  3AEB A;  4FI5 A;  4UEL A;  3OKQ A;  1T8B A;  3ZT5 A;  3PZW A;  5HXR A;  3SS1 A;  5H6R B;  3BQI A;  4ZS3 A;  1KFY A;  3W15 B;  1BU8 A;  4WHA A;  2WXU A;  2LOP A;  2XQ4 A;  5L2L A;  3PDY A;  3UU4 A;  3PE0 A;  4DV3 T;  1ZV4 X;  4DV7 T;  2UXB T;  5FKY A;  3OTO T;  2WZH A;  1MMD A;  3BQL A;  1QMD A;  2I0M A;  3UUX B;  3J7Y q;  3UUL A;  4P0A A;  5FL1 A;  1MMN A;  2RPA A;  3SOL A;  2G0U A;  2BS3 A;  2K48 A;  3PUR A;  4H9O C;  2LLY A;  2ZLY A;  2QGS A;  4ZHQ E;  3ZT7 A;  5LA6 E;  4L9I A;  1Y4K A;  2XUE A;  2A3D A;  5KXJ A;  4HWC A;  3MAC A;  4TX5 A;  4OK0 A;  4ZOL E;  3PTR B;  4IDZ A;  4TZ4 C;  1AJ3 A;  4X20 E;  4HFI A;  2XHE B;  2QVA A;  1HF8 A;  2LEH A;  5AQO B;  1XZY A;  5AQP B;  4DR6 T;  4WBN E;  3ZSS A;  3RQW A;  4HFD A;  4P0B A;  3NKZ A;  4X66 T;  2BS4 A;  4AIU A;  2WMN A;  4DR2 T;  4OFZ A;  2LSI A;  2LRK A;  2MAW A;  1HG2 A;  1FMW A;  2DNX A;  3ZN1 B;  4DV4 T;  5LHG B;  4NUU A;  2WY2 A;  3AE2 A;  1BR0 A;  4GK5 E;  3VRB A;  4NIQ A;  2VVN A;  3FB2 A;  4YHH T;  3EUH A;  2SBL A;  2CA5 A;  2UXN B;  3NRX A;  4HWD A;  5L47 A;  4EIW A;  2BG9 A;  2X0L B;  4PFP A;  3RYI E;  2WDR A;  4X1K E;  2WB5 A;  1YKH B;  1WYC A;  4PK6 A;  4PJJ A;  4ZZB A;  1GQE A;  5HEG A;  3CQX C;  2E5L T;  1M7K A;  4HKA A;  5FMN A;  3C4Z A;  2I6H A;  5HEH A;  3PUY F;  1ETH A;  2XM1 A;  5LHH B;  4XZC A;  4ILB A;  4EZ4 A;  1BR1 A;  3EDV A;  3PUG A;  4BJN A;  2QRX A;  3ONX A;  2DHR A;  2AXD S;  3AE6 A;  3ZMV B;  5JRC B;  5LBM A;  2CM0 A;  1D0Z A;  2OA5 A;  5LXT E;  2EHO B;  2BKN A;  2WSS V;  1HS7 A;  1HG5 A;  1NEK A;  1WR0 A;  1MIW A;  4TWD A;  5FVK A;  2LKG A;  2JPF A;  3PUZ F;  2XQ9 A;  4QEY A;  2K9A A;  3E22 E;  2V7I A;  4CI2 B;  1RRL A;  3AA0 B;  3LK4 2;  3PUX F;  2V1D B;  5LJN A;  2YU2 A;  4IDN A;  4GKJ T;  3H3A A;  2NW9 A;  2XAQ B;  4ZI3 D;  1W52 X;  2QNG A;  4O2B E;  2I59 A;  2LM9 A;  2WBL A;  2LRG A;  5ABE A;  3AE7 A;  3TLV A;  4EV6 A;  1KEY A;  3VR8 A;  2W0G A;  3VRA A;  4QHO A;  5EK2 A;  2ODU A;  4KBM B;  1EZ3 A;  4TUY E;  1QM6 A;  4TWH A;  2LG7 A;  2XAF B;  2OLT A;  3OYX A;  4G63 A;  4ZXL A;  3F2E A;  3KV6 A;  3BNB A;  4EYY R;  2LKH A;  5EZY E;  3JC6 C;  5LCY A;  1WRD A;  3S4U A;  5A1L A;  1DU2 A;  3AEG A;  3K3Q C;  2ZMA A;  4OYK A;  3I1A A;  2V7K A;  2XSB A;  2XHH A;  3LBX B;  4QH5 A;  2FJA A;  3HL6 A;  3UQ7 A;  3OPC A;  3N2K E;  2JQQ A;  3NZP A;  4HWF A;  3ANW B;  3P50 A;  2XAG B;  3V5U A;  1T98 A;  3NWI A;  4AKI A;  4Z90 A;  5JDM A;  1XNR T;  2BG9 E;  3I9Y A;  1LOX A;  5FXW A;  3NZQ A;  2X9Y A;  2Q9Q A;  1SE7 A;  3P4P A;  4P09 A;  2LSG A;  3HI2 A;  3RIU C;  1BR2 A;  2IAK A;  5CA0 E;  5L3G B;  3CVR A;  2Y48 B;  2R6G F;  3WAJ A;  2NTY A;  3EAM A;  4JI6 T;  5JDL A;  2MBG A;  5L3D B;  2HH7 A;  1N32 T;  4AQF C;  4YTP A;  3KV9 A;  2C5K T;  5HWY A;  3C50 A;  3ZST A;  3K3O A;  3FXD B;  3HKD E;  4IDP A;  2LRL A;  4H9Q C;  1UCU A;  4CN1 A;  5FY1 A;  3Q2M A;  5LJM A;  4GYR A;  4EYU A;  4O4H E;  2NW7 A;  2KMF A;  2C0S A;  2IIU A;  4ZI7 E;  3H37 A;  3PV0 F;  4JI2 T;  4JI5 T;  2BBH A;  5AQM B;  4HFH A;  4TV9 E;  3ZT6 A;  1ZHC A;  4ADZ A;  1F8N A;  4ASK A;  4OX9 T;  3AA7 B;  5DQW A;  3JAD A;  2J4G A;  2XJ7 A;  3PUS A;  3RQU A;  3ESL A;  2CLY C;  4IHJ E;  4YJ3 E;  4JI4 T;  1KK7 A;  3N9N A;  2JRK A;  4DMW A;  3RLF F;  4EAH A;  3PJA A;  2XFE A;  3IBP A;  3D0T A;  4ILU A;  3Q5W A;  4JV5 T;  4UVC B;  4ZI2 C;  2W2U A;  3RYF E;  3M65 A;  3DJB A;  2X9X A;  3AVR A;  4H63 V;  1US7 B;  2N9D A;  2PTF A;  2CHN A;  4WW0 A;  5ETW A;  5JTG A;  4QH1 A;  3NRY A;  2LT3 A;  3RX6 A;  2XM2 A;  3KFW X;  4DR5 T;  5LMN T;  3UFG A;  2HPJ A;  2DWG A;  3IA3 A;  1G8X A;  5HXC A;  4KI0 F;  2W66 A;  4UVB B;  3TKL B;  1HCI A;  2VVS A;  5CB4 E;  2E9X B;  1ZP0 A;  2H7O A;  2H88 A;  2CMR A;  2J47 A;  4O4I E;  3EI0 A;  3UU3 A;  2NTX A;  5LG3 A;  3AE4 A;  2V7L A;  2VWA A;  2MYS A;  3MKD A;  2PBI A;  3ZC0 A;  4IRE A;  3ZKR A;  4OHF A;  5ABH A;  1FGR A;  4I0U A;  4HFC A;  3L09 A;  2NP9 A;  1SA0 E;  4UV8 B;  4TNV A;  4A5X A;  4K0U A;  4U33 A;  2RA1 A;  1T7S A;  5HEU A;  5LGN B;  3AAE B;  1W0B A;  3TLT A;  1HX1 B;  4B3M T;  5L3B B;  3EVY A;  2QZ7 A;  3DP7 A;  3ZMT B;  1W9R A;  3I0Q A;  3Q5D A;  1NEN A;  4LMK A;  2BBJ A;  4A97 A;  2DL1 A;  3EHZ A;  3RIF A;  2LGE A;  4MLK A;  5CA1 E;  3E08 A;  2L9Q A;  4UF0 A;  4AKH A;  2IUK A;  1X79 A;  3RHW A;  4DBR A;  4QX8 B;  3TLW A;  3GN5 B;  3CK6 A;  4IE4 A;  1G73 A;  3FZK B;  2B76 A;  4DV2 T;  4UR9 A;  3N9M A;  4DO0 A;  4JI0 T;  4HFV A;  3CML A;  3ZCJ A;  2BVM A;  1U4Q A;  5IHY A;  4ANJ A;  4LF8 T;  4BJM A;  2XQ8 A;  5JDG A;  3C98 B;  3ONL C;  2WWU A;  5JR9 A;  1S35 A;  4I43 B;  4CN6 A;  1FIO A;  2JJ9 A;  1N36 T;  2VL8 A;  2KXV A;  3IBZ A;  4UIG A;  3ZMS B;  2FJB A;  5AQN B;  1QUU A;  2ZM0 A;  3MZK B;  1E2A A;  1KNP A;  2LM2 A;  1E1H B;  2JQ9 A;  5AQU B;  5HXS A;  2IW5 B;  2V6Y B;  2V26 A;  3KDS E;  4AI6 A;  1MIY A;  1VCT A;  3AXJ A;  3VF1 A;  4JYA T;  3FG4 A;  1JNQ A;  2VQE T;  3IHR A;  2X0H A;  4U7I A;  4O2A E;  2XFD A;  3KVA A;  4L5G A;  3V99 A;  3I0O A;  3GMI A;  3A8Y C;  4C91 A;  4IL9 A;  3AEA A;  2XY8 B;  1XMQ T;  4IGU A; 
#chains in the Genus database with same CATH homology
 4CXY A;  1EZ3 A;  4TUY E;  1N8Q A;  2QA7 A;  2W00 A;  1BR4 A;  3KV5 A;  1QM6 A;  4L0R A;  4CI1 B;  3RRW A;  3ZN0 B;  2XAF B;  3OYX A;  4G63 A;  2D2S A;  3AB3 B;  3F2E A;  4AKL A;  3KV6 A;  4KMC A;  1FGO A;  3N9L A;  4J2C A;  2X67 A;  4H9P C;  3BNB A;  2Y6X A;  3CPZ A;  2L8K A;  2XTL A;  5EK4 A;  1IJ5 A;  4EYY R;  5L3C B;  4UEM A;  5EZY E;  3Q5X A;  3VKG A;  4KUM B;  3JC6 C;  3CX7 B;  1YD8 G;  5LCY A;  2DCF A;  1WRD A;  3S4U A;  3N9P A;  4JEU B;  5FXV A;  3PUA A;  3CX8 B;  4QX7 B;  5A1L A;  5DAB A;  1LPA B;  3FG1 A;  3K3Q C;  2ZMA A;  4OYK A;  2N2N A;  2NOX A;  3FXE B;  4DND A;  5HYA A;  3BNE A;  3I1A A;  1WYB A;  2V7K A;  2BDE A;  2SPC A;  2RP4 A;  2W61 A;  3HKC E;  2DLR A;  1ZKE A;  4GYS A;  2LHR A;  5AFU L;  5F3J A;  3KV4 A;  3LBX B;  4YFS A;  5LGT B;  4XAX B;  1N8S A;  2D0T A;  4O4J E;  5HWX A;  2LSK A;  3PUQ A;  3ZMZ B;  3HL6 A;  3PU3 A;  3SWH A;  2ZM8 A;  3A5X A;  4MHC A;  1CA1 A;  3LBX A;  2M67 A;  3N2K E;  4PFO A;  2JQQ A;  2X68 A;  3C64 A;  3NZP A;  4OYJ A;  4U72 A;  1FGT A;  4QKN A;  5ADX L;  2IUJ A;  3ANW B;  2XAG B;  3VHL A;  3ETU A;  2VKD A;  3V5U A;  1T98 A;  3VU7 H;  3N9Q A;  4AKI A;  5JDM A;  4WBO A;  5FY7 A;  2LE8 A;  4EB6 E;  1LVK A;  3E0Z A;  1H7C A;  1OLP A;  1YKE B;  4IE7 A;  3ANW A;  3O1I A;  5FY0 A;  3J9X 1;  4QWT A;  2WXT A;  1RRH A;  4O8S A;  3JC6 D;  3U3I A;  3Q9D A;  2Q9Q B;  1GPL A;  2D5U A;  3QC9 A;  3O1J A;  4Z8X A;  3I9Y A;  2VKH A;  1D0Y A;  3AA6 B;  1LOX A;  5FXW A;  4HTE A;  3NZQ A;  3LG7 A;  5FXX A;  2BZB A;  2X9Y A;  4PJM A;  4AQF A;  3VKH A;  5FYM A;  2Q9Q A;  2XQY A;  4F6R C;  5JH7 E;  2Y8D A;  2LSG A;  4H9R C;  3HI2 A;  1D0X A;  4P09 A;  4HEA A;  3CWZ B;  1BR2 A;  2IAK A;  3AAA B;  2W63 A;  3CQG B;  4H9N C;  5CA0 E;  3MK7 C;  3V98 A;  1LNH A;  5L3G B;  3CVR A;  2Y48 B;  4PJL A;  5JDN A;  3WAJ A;  2XAH B;  2NTY A;  2XAJ B;  4CZZ B;  5TAO A;  4AQG A;  5JQG E;  5JDL A;  5JR9 C;  5DQV A;  4MFR A;  5LP6 E;  2MBG A;  2LOS A;  3UFE A;  5L3D B;  4CXW A;  2HH7 A;  4ERR A;  3WAK A;  2VKJ A;  2PG8 A;  4AQF C;  3K8P C;  3LK3 B;  3KV9 A;  3N2G E;  5GON E;  4DMV A;  2C5K T;  5HWY A;  1HTJ F;  2CWY A;  2EHO C;  2IC6 A;  3C50 A;  1B7T A;  2Q9Q C;  2WAU A;  3BK9 A;  2MTQ A;  3K3O A;  3O1H A;  3SRZ A;  5LHI B;  1ROV A;  5DJQ C;  4GK0 E;  4X1I E;  3FXD B;  2LSY A;  3KIN B;  3HKD E;  3HR0 A;  2H7V C;  2LHN A;  2IC9 A;  3R84 B;  5HAX A;  2KXP B;  4H9Q C;  5L3F B;  3KVB A;  4UV9 B;  2WY6 A;  3HKE E;  2CXD A;  1UCU A;  5FP3 A;  1U5P A;  5FY1 A;  5FXZ A;  3Q2M A;  5LJM A;  4GIW A;  4IE5 A;  4GYR A;  4EYU A;  4O4H E;  2NW7 A;  3OBV E;  5F8P A;  1LRZ A;  2KMF A;  2FNQ A;  3GWH A;  4H63 H;  2BVL A;  3ZYM A;  3ZC1 A;  2C0S A;  3C51 A;  4PW8 A;  4ZI7 E;  4N78 D;  4PAG A;  4E7S A;  3H37 A;  3RC8 A;  1D1B A;  3PU8 A;  4U74 A;  3KBU A;  4I50 E;  4QXC B;  3OYZ A;  5IYZ E;  2ES0 A;  3P8C D;  3QK6 A;  4G2A A;  2D0U A;  3ZPO A;  4PK5 A;  3RH3 A;  1KNZ A;  4V1A v;  4TV9 E;  1ZEE A;  1ZHC A;  4ADZ A;  4EOZ B;  1YGE A;  3N9O A;  1F8N A;  4ASK A;  1VRB A;  1Z0P A;  3AA7 B;  3EDU A;  5DQW A;  3C4X A;  4MBQ A;  4YHJ A;  3MXZ A;  3AA1 B;  3PUS A;  2EHO D;  2B1E A;  3ESL A;  2CLY C;  3WI3 A;  2HPL A;  2WM9 A;  3BND A;  4IHJ E;  4YJ3 E;  3AVS A;  1IZN B;  1Y64 B;  3RYC E;  2KWH A;  2ACX A;  4FI5 A;  1KK7 A;  3N9N A;  2KIN B;  4UEL A;  4IE0 A;  4DVD A;  2JRK A;  4DMW A;  3ETV A;  4IST A;  3OJA A;  2YIN A;  2OXE A;  3OKQ A;  4EAH A;  5JVD E;  3IBP A;  2NW8 A;  3PZW A;  5HXR A;  2H3R A;  2DI4 A;  3SS1 A;  5H6R B;  3BQI A;  4ZS3 A;  1NWM X;  3D0T A;  4ILU A;  3Q5W A;  3W15 B;  5LNK A;  4UVA B;  1BU8 A;  4UVC B;  2ZM2 A;  2KWI B;  4ZI2 C;  4WHA A;  3RYF E;  2WXU A;  5LGU B;  2LOP A;  4DBQ A;  3FBZ A;  5L2L A;  3PDY A;  3M65 A;  3RC3 A;  3DJB A;  2X9X A;  3AVR A;  3PE0 A;  4H63 V;  1US7 B;  2N9D A;  1ZV4 X;  2PJQ A;  4WW0 A;  4NRE A;  5ETW A;  1MMD A;  1V9D A;  3BQL A;  4PJN A;  1QMD A;  3BNC A;  4E7Z A;  3NRY A;  5J2U E;  2LT3 A;  3UUX B;  3RX6 A;  3J7Y q;  3UUL A;  4P0A A;  3RRC A;  2N1G A;  2CWO A;  1MMN A;  3SOL A;  3CX6 B;  2DWK A;  3V5S A;  2CCQ A;  3KFW X;  4EXT A;  5JDQ A;  1VOM A;  2G0U A;  5M4Y A;  2JMH A;  3CQC B;  3F57 A;  5HXE A;  2HPJ A;  1MIV A;  2DWG A;  2K48 A;  3O4X E;  3PUR A;  5L3E B;  1G8X A;  2MOZ A;  3HKB E;  1MNE A;  5HXC A;  1S94 A;  4YJ2 E;  4H9O C;  4X1Y E;  2LJL A;  4JEH B;  2ZLY A;  2C5I T;  2QGS A;  4ZHQ E;  4UVB B;  3TKL B;  5LA6 E;  4L9I A;  1HCI A;  2KND A;  5KDM C;  1FGM A;  1Y4K A;  1HPL A;  2XUE A;  5CB4 E;  4ISS A;  2A3D A;  2PFV A;  5LYJ E;  2E9X B;  4MAL A;  3RYH E;  4XBF B;  2H7O A;  2VK9 A;  5JDF A;  3MAC A;  4ZI2 D;  4TX5 A;  2C5J A;  2CMR A;  4OK0 A;  4ZOL E;  4O4I E;  3K3N A;  3PTR B;  2NTX A;  2K5B B;  2E9X A;  2NWB A;  4PNI A;  4IDZ A;  3O8Y A;  4TZ4 C;  2A2F X;  4WNK A;  1AJ3 A;  4X20 E;  2ODV A;  2V7L A;  2VWA A;  1NO3 A;  4QWN B;  3R6N A;  4KP3 C;  2MYS A;  3I9W A;  3MKD A;  2XHE B;  5H6Q B;  4BAY B;  3U78 A;  2PBI A;  5LBQ B;  3ZC0 A;  3DTO A;  1FGQ A;  4OHF A;  1HF8 A;  4I55 E;  2LEH A;  1LVF A;  1FGR A;  3L09 A;  2NP9 A;  1FEW A;  4NUV A;  2X9W A;  3FG3 A;  4WBN E;  2E9X C;  3ZMU B;  1SA0 E;  3UUN A;  3ZCI A;  4P0B A;  3CKD A;  1UX4 A;  4O4L E;  4UV8 B;  2VB6 A;  1FMV A;  4HGA A;  5C8Y E;  4K0U A;  2WMN A;  2J1D G;  4OFZ A;  2LSI A;  2RA1 A;  3HA4 A;  4H9S E;  2VAS A;  5LGN B;  3AAE B;  1HG2 A;  1WR6 A;  1FMW A;  2X51 A;  2DNX A;  4M1P A;  3ZN1 B;  2Q9Q D;  3FHN A;  5LHG B;  3ZJ1 A;  3P7I A;  1RP1 A;  4NUU A;  5BMV E;  1HFA A;  2XAS B;  5L3B B;  3IEE A;  3IF8 B;  1NAF A;  2GK9 A;  3EVY A;  1YW0 A;  3LFM A;  4CXX A;  3UTK A;  3F31 A;  3UUM A;  1BR0 A;  2CEA A;  4GK5 E;  3ZEF B;  3DP7 A;  2KT9 A;  2VKO A;  4AKR B;  3ZMT B;  5J2T E;  3FBL A;  5FNV E;  2CXF A;  4HE8 A;  3FB2 A;  5LOV E;  4EZH A;  3EUH A;  3I0Q A;  2SBL A;  2CA5 A;  1KHO A;  3B13 A;  2UXN B;  3ZYL A;  3NRX A;  4EIW A;  3RPU A;  2X0L B;  4PFP A;  4UF0 B;  2E9X D;  3RYI E;  3O9X A;  4MLK A;  5CA1 E;  3E08 A;  1HU9 A;  2L9Q A;  4X1K E;  4JUY A;  1WLX A;  1YKH B;  1WYC A;  4PK6 A;  2A72 A;  4PJJ A;  5J1G A;  1CUN A;  4UF0 A;  4AKH A;  2IUK A;  3V92 A;  1QSD A;  3RKO A;  1X79 A;  4FJO A;  4IIJ E;  4YLH A;  5LG4 A;  3CQX C;  4AXP A;  4DBR A;  4HKA A;  2YU1 A;  4QX8 B;  5FMN A;  3C4Z A;  3GN5 B;  4GOU A;  4IE4 A;  1ETH A;  1G73 A;  3C4W A;  5HXH A;  3ZLI A;  5E0O A;  2X66 A;  5LHH B;  4WFO A;  4XZC A;  1IAP A;  2Z6E A;  3GN5 A;  4TN7 B;  2K24 A;  4EZ4 A;  1BR1 A;  3EDV A;  1UX5 A;  3N9M A;  2UXX B;  4ZI3 C;  2KZ7 B;  5KMG P;  4DO0 A;  3PUG A;  4HFV A;  2W62 A;  3CML A;  4BJN A;  3ZCJ A;  3GA8 A;  3ONX A;  2BVM A;  1U4Q A;  5JR9 B;  2DHR A;  5IHY A;  2WMO A;  4PK4 A;  4ANJ A;  4IE6 A;  1IJ6 A;  4QXH B;  2CM0 A;  5LBM A;  3ZMV B;  4BJM A;  5JRC B;  3N2O A;  5JDG A;  1D0Z A;  3BQK A;  1MMA A;  3MJX A;  1LPB B;  3C98 B;  2OA5 A;  5EK3 A;  2P9B A;  1D1A A;  2WWU A;  5LXT E;  5EEO A;  1GYG A;  4ZS2 A;  5JR9 A;  1S35 A;  4I43 B;  2EHO B;  2WSS V;  1FIO A;  1HS7 A;  5JRC A;  1HG5 A;  3KBT A;  1HX8 A;  3ZJ2 A;  2V7J A;  1MIW A;  2JJ9 A;  2VL8 A;  2LSJ A;  2CE7 A;  4UIG A;  3ZMS B;  2EHO A;  4CI3 B;  2JPF A;  2YK0 A;  3QUJ A;  1MND A;  3UT5 E;  1QUU A;  2K9A A;  2ZM0 A;  3E22 E;  2KLQ A;  3MZK B;  4I4T E;  2PVS A;  2V7I A;  2YEV C;  1E1H B;  4UXN B;  4CI2 B;  1RRL A;  2CXL A;  3AA0 B;  3LK4 2;  5HXS A;  2L3L A;  3LJC A;  2V1D B;  1O3X A;  3NBX X;  2IW5 B;  4A56 A;  4AI6 A;  2V26 A;  3KDS E;  1MIY A;  3AAI A;  3LK2 B;  5LJN A;  2YU2 A;  2JMK A;  5JDH A;  3H3A A;  2NW9 A;  1SHZ C;  3ZYK A;  3VF1 A;  2XAQ B;  4ZI3 D;  2P0M A;  3FG4 A;  1JNQ A;  1W52 X;  3IHR A;  2E8I A;  4O2B E;  2I59 A;  3T8O A;  2V7M A;  3L3P A;  2LM9 A;  4O2A E;  4QXB B;  4BA9 A;  4CQI A;  1IK3 A;  3KVA A;  4JLE A;  4L5G A;  2WBL A;  3N5L A;  3V99 A;  4HN9 A;  1LKX A;  1D1C A;  1OWA A;  3I0O A;  3GMI A;  5JRE A;  2CLY B;  2X9H A;  2PPL A;  3B57 A;  4C91 A;  4AKG A;  3MA9 A;  2W0G A;  4QHO A;  5KX5 E;  4C90 A;  5EK2 A;  4IGU A;  2ODU A;  4B6X A;  1MMG A;  1OXZ A;  4KBM B;  4TV8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...