3CWZB

Structure of rab6(gtp)-r6ip1 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
336
structure length
310
Chain Sequence
b'NLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKLAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSLPEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-6A
publication title Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 87
structure length 310
sequence length 336
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01477 PLAT PLAT/LH2 domain
B PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cwzB01
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 3cwzB03
1FGQA 1N8QA 1YGEA 1QM6A 3FG3A 1JNQA 2DWGA 1GPLA 2CXFA 1LPAB 1NO3A 2DWKA 2PVSA 1LNHA 2IUKA 3BNBA 1LPBB 3FG4A 1FGMA 1FGRA 3PZWA 2IUJA 4WFOA 3O8YA 2OXEA 1OLPA 1Y4KA 1RRHA 3BNEA 2SBLA 3V99A 4QWTA 1QMDA 1RRLA 3BNDA 1FGOA 1RP1A 4NREA 1ROVA 2WY6A 3BNCA 4WHAA 1N8SA 1GYGA 3VF1A 3V98A 2P0MA 3V92A 1BU8A 1FGTA 2CXLA 2PPLA 5EEOA 3CWZB 1LOXA 2FNQA 1ETHA 2WXTA 3FG1A 1IK3A 1F8NA 1KHOA 1HU9A 1CA1A 1W52X 2WXUA 1HPLA 4GIWA
chains in the Genus database with same CATH superfamily
3MA9A 4Z90A 2V7IA 2ZM6T 2BS4A 2Q9QD 3PUQA 1LNHA 2W67A 2KNDA 3FXEB 2E5LT 2LSIA 3ZLIA 3T8OA 2XFEA 3H3MA 3AB3B 4BJNA 2E9XD 2VQFT 2UXDT 4L0RA 2CMRA 1OEDE 3FHNA 5AQLB 1FGRA 1Y4KA 4U2YA 3AE3A 2BKNA 3C4XA 1MIVA 3EI0A 5AQMB 3AXJA 2XSBA 4UIGA 3PUGA 1WRDA 4O2AE 3CIRA 4DR6T 4ZZBA 2HPJA 4EEDA 2VL8A 4IDQA 2VL0A 3RI5A 4NPPA 4HFVA 2CLYC 3AXJB 4LMJA 3CX6B 5FVKA 3UUXB 2RPAA 3P8CD 4LMLA 3ZN0B 5LGNB 4LMKA 5KXJA 5C3JA 2A2FX 2X9YA 5JREA 3O9XA 4HFHA 1S35A 3EDUA 2CLYB 3NVOA 1OEDC 2BVMA 4YSXA 1NENA 2WU5A 4GIWA 2V7LA 1VCTA 2WMNA 2NR4A 2K48A 2N2NA 5ADXL 2LOSA 2YK0A 1OEDA 5LB7B 5KX5E 5L2LA 2WDVA 3FZMB 4TX5A 2YEVC 3RIFA 4QKNA 2IIUA 4DV3T 4JI2T 4NIQA 4X1YE 3KINB 4UVCB 1W0AA 3DP7A 3Q9DA 3BQLA 2LM2A 3ZC1A 1OEDB 2QA7A 4CXXA 3C64A 3LK2B 2LGEA 2XQYA 4EXTA 4WW0A 4KI0F 3PV0F 2V8SV 3QC9A 2XQ5A 2BDEA 2UUBT 4H63H 3N5LA 1U4QA 4QXCB 4H9NC 5LGUB 1WLXA 4Q25A 3AEBA 3OVUA 2CCQA 3CVRA 4MALA 3AE4A 3QB5K 1YGEA 2BKPA 4WBOA 2P9BA 4AKLA 2QYWA 2XQ8A 2HPLA 2LJLA 3AVRA 4E7ZA 3RYHE 3AE6A 4AIUA 3KV4A 5LMNT 5AQRB 5FXWA 1BR1A 1D1CA 2N9DA 1WFDA 4X5TA 4U3CA 3SFEA 3KDSE 2XPKA 4L5GA 3ZMUB 3ONJA 2KMFA 4YFSA 4HWHA 2BKOA 2SBLA 4H9RC 3ZYLA 4ERRA 4U74A 3ZPOA 3P4RA 3IEEA 4KBMB 3NZPA 2QZ7A 4YSZA 1DU2A 4U7IA 1V9DA 5CJ5A 2XAHB 2MYSA 4TZ4C 1E7PA 4EB6E 2W61A 2MBGA 5FY7A 1ZEEA 4NREA 1ROVA 3I1AA 4AXPA 4NUUA 1HCIA 4EZHA 2FJDA 3RPUA 3F31A 2KZ7B 1HPLA 2FJEA 3KFWX 4IL9A 2ACZA 1YKEB 1N33T 2ODVA 4PK6A 2L9QA 2LT3A 4YHJA 2VASA 4IE6A 3PZWA 1Z0PA 3P4QA 1N32T 1R8IA 2J1DG 4QWTA 3Q5WA 3EUHA 5AQKB 5HEJA 3CQCB 3T1YT 2UUCT 4ZXLA 3DTOA 4CN1A 4B6XA 3FZHB 5FXXA 3L09A 1US7B 3UT5E 3KBUA 1AJ3A 2W00A 2YU1A 3AEFA 2NOXA 2C0SA 2JQ9A 5FP3A 2FNQA 1ZKEA 2C5JA 2CE7A 3PE0A 1J5WA 1UK5A 4O8SA 5ABEA 2D9DA 4IDNA 3PUWF 5J1GA 2LG7A 5HWXA 2H7VC 4WBNE 3RLFF 5JDNA 1YW0A 3C50A 3ZMVB 2JPFA 2IC6A 4ANJA 3FBLA 5LHIB 4I4TE 1GQEA 3BQKA 4FI5A 2WM9A 1IZNB 4DUYT 4TWDA 2J4GA 2XAJB 4EZ4A 4JBWF 4PNIA 1IJ5A 2XJ7A 4O4IE 3L3PA 2YN6A 1HNZT 3CX7B 2VQET 3U3IA 3EVYA 4U7YA 3OYXA 4HKAA 2PTFA 4JI0T 3DJBA 1KNRA 3PU3A 3UUBA 4X65T 2WDRA 1E2AA 2WAUA 1JNZA 2CWOA 2DLRA 3HKEE 4TWFA 2N1GA 3CKDA 4QX7B 3WAJA 5J2TE 1M62A 3B13A 2DNXA 2V1DB 4HTEA 4X1KE 4LF7T 3CMLA 5HEUA 3ZCJA 3BK9A 2X9HA 3P7IA 3ZMTB 4X64T 2K9AA 4LFAT 3I0QA 5FY1A 2ACXA 3Q5DA 3ANWB 3IA3A 2PG8A 1NO3A 3B57A 4ZS3A 5JDHA 3PUVF 1UCUA 3P4WA 3FZKB 2X0LB 2IHR1 4JI6T 3TLVA 4ZI2C 4C91A 5AQIB 3RKGA 4O4JE 2KINB 4IHJE 2VB6A 1I94T 4HFEA 4HGAA 4DMWA 3RYFE 2BBJA 1FGMA 4LF4T 1FIOA 2QRXA 5AQFB 2CRBA 2MOZA 3PURA 4ZI3D 2CBIA 2PPLA 2VKOA 5LG4A 1XDPA 3OPCA 3U78A 2XAFB 3C4WA 3CX8B 3AE5A 4XBFB 5L3BB 4EIWA 2WZIA 3AA7B 3PDYA 5GONE 1HF8A 4KUMB 2C5IT 3CK6A 1T98A 2K24A 5KDMC 2HHHT 1F8NA 3EHZA 1XDOA 4DV6T 3UUNA 1IJ6A 2Q9QA 2BBHA 3TLSA 5FY0A 5ABGA 2EHOC 2V6XA 2V5DA 3HA4A 2VKDA 2XQAA 2M67A 3JC6C 2XQ6A 4CI2B 3AE9A 2EHOA 2WXUA 3M65A 1FGQA 5L4EA 4JLEA 1KK7A 3LK3B 4NUVA 2IC9A 3PTRB 4EEBA 1UX5A 2CXDA 5LXTE 1Z8UA 4HWCA 5ABFA 4WNKA 3I9YA 2H89A 2EHOB 3Q5XA 2KXVA 4KMCA 4AKHA 2IAKA 2X51A 2IUJA 5ABFB 3TLTA 3FBZA 2CEAA 2CM0A 4O4LE 5LBMA 4PJLA 2V7JA 5IUXA 1OXZA 2VKJA 2X9XA 2OXEA 3P4PA 1MNEA 4U31A 4JI1T 2XTLA 2B76A 2LSGA 2V26A 4QH5A 1KNPA 3ETVA 3V5SA 1W0BA 4A5XA 4JEHB 4MLKA 5CFBA 5AFUL 3N9PA 3ZT5A 2JRKA 1KNZA 3SS1A 3WI3A 2E5VA 4HEAA 2KLQA 1SHZC 2XM1A 2DWKA 2ZLYA 3RRCA 5JDMA 4IL4A 4KX6A 1UURA 3QK6A 3PUZF 2ZM8A 5DABA 4G2AA 4IE0A 3NKZA 5FL1A 1X79A 5LGTB 2SPCA 5F5WA 1HTJF 4I0UA 1HS7A 2WB5A 4P0AA 4I50E 2NW7A 2BS2A 1T7SA 2JQKA 3UFGA 3GN5A 5JDLA 5A1LA 5HAXA 5DJQC 1D1BA 4JI5T 4B3ST 3LFMA 4BAYB 2UXNB 1RRLA 1NWMX 4LF8T 4UR9A 3GN5B 4U33A 1SE7A 3EABA 2B1EA 2LHRA 1XNQT 4GYSA 2NW9A 3KVBA 1WYBA 1B7TA 1Y64B 2D5UA 3UTKA 2XAGB 2YU2A 5L3FB 3PUXF 3NBXX 4DIDB 4WHAA 3V5UA 3JAEA 3ONXA 4LF6T 3AA6B 1YXRA 3VKHA 5EK2A 4PFOA 1MMAA 2L3LA 3Q2MA 2CBJA 4HFBA 4UVBB 3MACA 2BS3A 2KSRA 4DBQA 1QMDA 4WZXA 4C90A 5FKYA 2FJBA 2LM9A 3QB5A 3QUJA 1LVFA 4DR3T 1YD8G 3OKQA 4ISSA 3SOLA 2XUEA 2DL1A 4ILUA 2XSAA 5EEOA 2BZBA 5L3CB 2NTYA 5HXCA 3LJCA 5FL0A 4IE4A 2YKSA 2LKGA 4CXWA 4IIJE 4ZEYA 2X0YA 5ETWA 2XASB 1UX4A 4I43B 4DR2T 3AA0B 3FG4A 2NWBA 1HG2A 2CWYA 2LHNA 4CI1B 3UQ7A 5F3JA 3X1DA 4UEMA 1H7CA 4PJMA 2OV9A 1MNDA 3ONLC 4OFZA 4XAXB 5DQVA 4EYUA 4P0BA 4IREA 2WXTA 1WR0A 4PFPA 2LRKA 2E2AA 2XQ4A 3FG3A 3AECA 3RX6A 4ILCA 3T1HT 3VRBA 2HH7A 1OLPA 4YHHT 1RRHA 1XZYA 2JMKA 1BR4A 4PK5A 4X66T 3ZC0A 4H63V 2XFDA 2JQQA 2UU9T 3FZFB 1N36T 5E0OA 2F4VT 1QM6A 1D1AA 1HX8A 2WWUA 2YDQA 4DV2T 2LRLA 5HXSA 3QOFA 1MIWA 1XNRT 4JI3T 2L8KA 4EOZB 3CQGB 3ZSTA 4E7SA 5AQQB 2XHEB 5LNKA 1ZOYA 3KVAA 1CUNA 3PUYF 5JQGE 2V7KA 5FXVA 3GMIA 4PW8A 1XMOT 4ZOLE 2CXLA 2H3RA 3L39A 1FJGT 4YTMA 2K5BB 3LDQB 1KFYA 4DV5T 3UU4A 1MIYA 1BR0A 2WP9A 2YOEA 5JR9A 1HFAA 3CQXC 2ZMAA 1QUUA 3D0TA 5EK3A 5LP6E 4CI3B 4YTNA 2UXCT 4AKIA 2WS3A 4UV9B 4K0KT 4EAHA 5LOVE 1YQ4A 2WDQA 5AQPB 3HL6A 4IGUA 1CHUA 4ISTA 3U6GA 2I0MA 4YT0A 3MK7C 4TNWA 4AQYT 3H37A 5JH7E 3K8PC 3AVSA 3R84B 4ZHQE 4QXHB 3KV5A 5C8YE 3I0OA 4O2BE 3BNEA 5TAOA 2W62A 3E08A 3KV6A 2FJAA 1FMWA 3MJXA 3QNUA 2X67A 2ES0A 3K1SA 3J7Yq 3OJAA 1JNRA 2A3DA 4H9PC 2XAQB 3JCFA 3FXDB 4P09A 4CN4A 3J9X1 3N2GE 3SRZA 2KWHA 2PFVA 2WY6A 2V5CA 4U2ZA 1EZ3A 3UULA 2BVLA 1KHOA 1ZHCA 3RYCE 3L8RA 4ILAA 1FMVA 4GKJT 3SWHA 1IBMT 2V6YA 4OYJA 5L3DB 2PBIA 3UU5A 4DMVA 2W2UA 4EGWA 3FB2A 4PAGA 4WYVA 2VURA 2V6YB 4IE7A 2YDSA 3FZLB 3RKOA 3I9WA 4UXNB 3JADA 4BA9A 4DO0A 3TLWA 5FNVE 2JQHA 1JNQA 2XHHA 1LPBB 2A72A 4QHOA 2YINA 2QGSA 3ZMSB 2VKHA 3HKDE 4IDPA 1NAFA 1QLBA 5HEGA 5HWYA 2WMOA 2VK9A 4P1NA 5L3EB 4MHCA 1LKXA 2WSSV 2J47A 5JDQA 2PJQA 1S94A 4JI4T 2E8IA 5LA6E 4OHFA 1HX1B 2Q9QC 2IDOB 2DHRA 3FG1A 5FMNA 1MMDA 4YJ2E 2H88A 4H9QC 2WCAA 3H3AA 4AISA 4CN6A 4DV1T 4A56A 3RF1A 2JMHA 2E9XC 3UU3A 4DV4T 3NZQA 4V1Av 3PJAA 2XQ7A 1UUSA 3ZYKA 2E9XA 2WWVA 3PUSA 2Q9QB 5CA0E 2X68A 1GPLA 3VR9A 4DBRA 3ABVA 5CGMA 3AEAA 1SA0E 2GK9A 2W66A 4KHZF 4YLHA 3F2EA 3TKLB 3V92A 2E9XB 3VRAA 2NTXA 4H9SE 1MMNA 1HR0T 3N9NA 4ZI2D 1VOMA 3BNBA 4OK0A 1D0ZA 2M6BA 4CXYA 4KHPT 2LOPA 1YQ3A 4AQFC 2LSYA 1J5ET 2Y48B 4QH4A 3ZT6A 5JTGA 5IHYA 4HFCA 3MXZA 5AQOB 3HKCE 3ZYMA 3RGLA 3C98B 2ZM0A 4ZS2A 4AQFA 2C5KT 2RP4A 5FVLA 3RQUA 4TN7B 3VKGA 5LCYA 3RC8A 2XY8B 3C51A 2WU2A 4NXNT 1D0XA 1BU8A 3BQIA 2ODUA 3LG7A 4JUYA 3IF8B 3ZN1B 3G06A 5AQJB 3GA8A 4XZCA 3N9LA 2I59A 3PJAJ 2CHNA 5IWAT 4JI8T 1UGOA 1QSDA 1W09A 2KXTA 3ETUA 2XHJA 4QX8B 3CWZB 2EHOD 3S4UA 1HNXT 3AE2A 1FEWA 3JC6D 3NRXA 2NP9A 4GK5E 3GWHA 4IDOA 3OBVE 4DR5T 4PJNA 3ZEFB 3EDVA 5ABHA 4YSYA 3AAIA 2ZM2A 4L9IA 3O4XE 4FJOA 4H9OC 3C4ZA 3LK42 2CPTA 3K3OA 3RQWA 4AKGA 4LFBT 5BMVE 3ZKRA 3RIUC 3VU7H 4YTPA 4DV0T 4UV8B 1G73A 3E22E 3RIUA 2MAWA 3AAEB 4HN9A 2WZHA 3RHWA 2LLYA 2OA5A 1W52X 4MBQA 1VCSA 4J2CA 4HWIB 3UFEA 3SFDA 3UU8A 2HN2A 4ASKA 3TLUA 4ZZCA 3N9QA 3R6NA 4B3RT 2YDRA 1T72A 3A5XA 3RC3A 3O1HA 2IUKA 3RIAA 4ADZA 2QVAA 2CXFA 4YY3T 4YXDA 1N34T 1G8XA 3RYIE 2K3WA 1X9BA 4AI6A 1OWAA 4YJ3E 4GOUA 3ZMZB 4JYAT 2DWGA 4OX9T 1J1JA 5FXZA 4X1IE 4Z91A 4B3MT 3IBZA 3O8YA 5H6RB 4HWFA 4JI7T 2XQ9A 3K3NA 2AXDS 3O1JA 2FUPA 3Q5EA 3RRWA 1CA1A 4WFOA 3NRYA 4QXBB 3MKDA 1I6ZA 4HE8A 2LE8A 2D0UA 5AQHB 3N9MA 1RP1A 5JDFA 3CPZA 1KF6A 4EV6A 1D0YA 2JIWA 2D2SA 2X9WA 2G0UA 4AKRB 5LYJE 4HFIA 4QH1A 5C2TA 3HR0A 5H6QB 2IUBA 4M1PA 4DNDA 4MFRA 5J2UE 1BR2A 3UUMA 4QEYA 1ZV4X 3NWIA 1SUMB 2LRGA 2LSKA 1M7KA 1WCRA 1VRBA 1MMGA 4BJMA 3ZT7A 5AQSB 4KP3C 1IBLT 4I55E 3AE1A 3UQ4A 3BNCA 4OYKA 2UXXB 2WY2A 4CQIA 3LSVA 4IE5A 2KWIB 3F57A 1YKHB 1IBKT 4GK0E 5BR8T 2KXPB 1L0VA 2I6HA 1ZP0A 4CZZB 5LBQB 4TV8E 1Y01A 5DQWA 3M3ZB 5M4YA 3AA1B 2UXBT 3VF1A 3IHRA 5HXHA 1LVKA 5JR9C 2V7MA 2QNGA 4HFDA 2WBLA 4X62T 5J0ZA 2LSJA 1W9RA 2MTQA 3P50A 5LHHB 3A8YC 3V98A 1FGTA 2DI4A 5F8PA 4DVDA 2J62A 5JR9B 4AQGA 3N9OA 2LEHA 5L4HA 5KMGP 2IMLA 5EZYE 3O1IA 1FGOA 5EK4A 5FYMA 4F6RC 1N8SA 3ESLA 4NXMT 2WQYA 1N8QA 3JAFA 3B5MA 5L3GB 3HI2A 4GYRA 4ZI3C 5CA1E 5HCJA 5JDGA 5HXRA 4DR4T 1XWMA 1GYGA 1T8BA 4B3TT 5LJNA 5HEOA 3HKBE 4G63A 2W63A 3N2OA 3ZSSA 4ILBA 5AQUB 5LJMA 3V99A 1NEKA 4ZI7E 2Y8DA 4UELA 2X66A 1LPAB 2AE9A 3ANWA 3VHLA 1LRZA 4U72A 2VVNA 3P4SA 1KEYA 1ETHA 1U5PA 2CA5A 3LBXA 3PUAA 4LFCT 5JRCA 5CB4E 1HNWT 2H7OA 3AE7A 5AQNB 3KBTA 2BG9E 2A9UA 4X20E 4IDZA 2Y6XA 2XM2A 4TUYE 1XMQT 3AEGA 1LOXA 3LBXB 5JRCB 3OYZA 4TNVA 4DV7T 4K0UA 5AQTB 4PJJA 3BNDA 2XZEA 2VWAA 2HN1A 2CHOA 5LHGB 4JV5T 3AE8A 3K3QC 5LMUT 2Z6EA 4F8HA 4LF9T 4O4HE 5IYZE 4Z8XA 4A97A 5AQVB 3AEEA 3AAAB 2W4XA 3MZKB 4UF0A 1IK3A 2X0HA 4DR1T 3OTOT 4COFA 2XQ3A 2UUAT 5HCMA 3E0ZA 4IT4A 5L47A 3RH3A 3ZCIA 4UF0B 2IW5B 3ZJ1A 3AEDA 3KV9A 4QWNB 2RA1A 3W15B 2BG9C 1HG5A 2D0TA 1WYCA 4UVAB 1IAPA 4N78D 3EAMA 4DR7T 2DCFA 4HWDA 2BG9A 1WR6A 5JVDE 2W0GA 5LG3A 2JJ9A 2NW8A 3UU6A 3PU8A 3N2KE 3VR8A 4PK4A 2PVSA 2M6IA 2BG9B 4DUZT 2FBWA 5HEHA 2P0MA 4TWHA 5HYAA 4TV9E 2R6GF 2LKHA 4GKKT 1O3XA 1E1HB 3WAKA 2KT9A 4A98A 5AQGB 2VVSA 3ZJ2A 5HXEA 4EYYR 2OLTA 2MPKA 4JEUB 3IBPA 1HU9A 4LF5T 3A7MA
chains in the Genus database with same CATH topology
3MA9A 2VB6A 4YJ3E 2V7IA 4GOUA 3ZMZB 2DWGA 2Q9QD 3PUQA 4HGAA 1MIYA 3RYFE 4DMWA 1LNHA 1FGMA 5FXZA 4X1IE 2KNDA 1BR0A 3FXEB 3O8YA 5JR9A 5H6RB 1FIOA 1HFAA 3CQXC 2LSIA 2ZMAA 1QUUA 3T8OA 3D0TA 3ZLIA 5EK3A 5LP6E 4CI3B 2MOZA 3PURA 4ZI3D 2PPLA 3AB3B 3K3NA 2VKOA 3O1JA 4BJNA 2E9XD 5LG4A 3RRWA 1CA1A 4AKIA 4WFOA 4L0RA 2CMRA 3NRYA 4QXBB 4UV9B 3U78A 4EAHA 3FHNA 2XAFB 3C4WA 3CX8B 5LOVE 3MKDA 4XBFB 5L3BB 1FGRA 4EIWA 3HL6A 4HE8A 3AA7B 3PDYA 2LE8A 1Y4KA 2D0UA 4IGUA 5GONE 1HF8A 4ISTA 3C4XA 3N9MA 1RP1A 4KUMB 5JDFA 1MIVA 2C5IT 3CPZA 1T98A 3MK7C 4UIGA 3PUGA 1D0YA 2K24A 5KDMC 1F8NA 1WRDA 4O2AE 2D2SA 2X9WA 3H37A 5JH7E 2G0UA 3K8PC 2HPJA 3AVSA 3R84B 3UUNA 4AKRB 2VL8A 4ZHQE 5LYJE 4QXHB 1IJ6A 2Q9QA 3KV5A 5FY0A 4HFVA 5C8YE 3I0OA 2CLYC 4O2BE 3BNEA 2EHOC 3HR0A 5TAOA 3HA4A 3CX6B 2VKDA 2M67A 3JC6C 5H6QB 3UUXB 2W62A 3E08A 4CI2B 4M1PA 3KV6A 4DNDA 1FMWA 4MFRA 3P8CD 5J2UE 3MJXA 1BR2A 2X67A 2ES0A 3UUMA 3ZN0B 3J7Yq 2EHOA 3OJAA 2WXUA 1ZV4X 2A3DA 3M65A 4H9PC 5LGNB 2XAQB 1FGQA 3FXDB 4JLEA 2LSKA 1KK7A 3LK3B 4P09A 4NUVA 2IC9A 3PTRB 3J9X1 1VRBA 2A2FX 1UX5A 1MMGA 3N2GE 2CXDA 2X9YA 3SRZA 5LXTE 2KWHA 5JREA 3O9XA 4BJMA 2PFVA 4KP3C 4WNKA 1S35A 3I9YA 4I55E 3EDUA 2WY6A 3BNCA 4OYKA 2CLYB 2EHOB 1EZ3A 2UXXB 3UULA 4CQIA 2BVLA 2BVMA 4IE5A 3Q5XA 1KHOA 2KWIB 1ZHCA 3RYCE 4KMCA 3F57A 2V7LA 4GIWA 1FMVA 2WMNA 4AKHA 3SWHA 1YKHB 2K48A 2N2NA 5ADXL 2LOSA 2IAKA 2X51A 4GK0E 2KXPB 2IUJA 4OYJA 5L3DB 2PBIA 2YK0A 4CZZB 5L2LA 5KX5E 5LBQB 4DMVA 4TV8E 4TX5A 3FBZA 2YEVC 3FB2A 2CEAA 4QKNA 5DQWA 4PAGA 2CM0A 4O4LE 5M4YA 3AA1B 5LBMA 3VF1A 4X1YE 3IHRA 2V7JA 3KINB 4PJLA 4UVCB 1OXZA 2VKJA 2X9XA 5HXHA 1LVKA 3DP7A 5JR9C 3Q9DA 4IE7A 2OXEA 3BQLA 3ZC1A 2V7MA 1MNEA 3I9WA 3RKOA 2XTLA 2QA7A 4UXNB 4BA9A 4CXXA 2LSGA 2WBLA 5FNVE 4DO0A 2LSJA 1JNQA 3C64A 2V26A 2A72A 2MTQA 3LK2B 1LPBB 4QHOA 2YINA 5LHHB 2XQYA 2QGSA 3ZMSB 3ETVA 3V5SA 4WW0A 4EXTA 2VKHA 3HKDE 1NAFA 3QC9A 4JEHB 2BDEA 4MLKA 5AFUL 3N9PA 4H63H 2JRKA 5HWYA 3N5LA 1KNZA 1U4QA 4QXCB 4H9NC 2WMOA 2VK9A 5LGUB 1WLXA 3SS1A 3WI3A 3V98A 1FGTA 4HEAA 2DI4A 2CCQA 3CVRA 4MALA 5L3EB 1YGEA 4MHCA 1LKXA 1SHZC 2KLQA 4WBOA 5F8PA 2P9BA 4DVDA 4AKLA 2DWKA 2ZLYA 3RRCA 5JR9B 5JDMA 4AQGA 2WSSV 3N9OA 2LEHA 2PJQA 5JDQA 5KMGP 1S94A 2E8IA 2HPLA 2LJLA 3AVRA 5LA6E 4E7ZA 5EZYE 3O1IA 3RYHE 1FGOA 3QK6A 5EK4A 3KV4A 5FYMA 4F6RC 4OHFA 1N8SA 2ZM8A 5FXWA 1BR1A 2Q9QC 5DABA 4G2AA 1D1CA 4IE0A 2N9DA 2DHRA 3ESLA 3FG1A 1X79A 5FMNA 1MMDA 3KDSE 1N8QA 4YJ2E 4H9QC 5L3GB 4L5GA 3HI2A 3ZMUB 4GYRA 3H3AA 5LGTB 4A56A 2KMFA 4YFSA 2SPCA 4ZI3C 1HTJF 2JMHA 5CA1E 5JDGA 5HXRA 2SBLA 2E9XC 1HS7A 4H9RC 3NZQA 3ZYLA 4ERRA 1GYGA 4V1Av 4P0AA 4I50E 4U74A 3ZPOA 2NW7A 5LJNA 3IEEA 3HKBE 4KBMB 3NZPA 3ZYKA 4G63A 2E9XA 3GN5A 5JDLA 5A1LA 3PUSA 2Q9QB 5HAXA 1V9DA 2W63A 3N2OA 5CA0E 2X68A 5DJQC 1GPLA 1D1BA 2XAHB 2MYSA 4TZ4C 4DBRA 4EB6E 5LJMA 2W61A 2MBGA 5FY7A 3LFMA 3V99A 1SA0E 4BAYB 1ZEEA 2UXNB 2GK9A 1RRLA 1NWMX 4ZI7E 4NREA 1ROVA 4YLHA 3F2EA 3I1AA 3TKLB 2Y8DA 4AXPA 3V92A 2E9XB 4NUUA 1HCIA 3GN5B 4EZHA 2NTXA 4H9SE 4UELA 1MMNA 2B1EA 2LHRA 3RPUA 3F31A 2KZ7B 3N9NA 4GYSA 1HPLA 4ZI2D 2NW9A 3KVBA 3KFWX 1WYBA 1VOMA 1YKEB 2X66A 1B7TA 1Y64B 2D5UA 2ODVA 4PK6A 2L9QA 2LT3A 4YHJA 1LPAB 2VASA 3UTKA 4IE6A 4OK0A 3BNBA 3PZWA 3ANWA 2XAGB 1D0ZA 1Z0PA 3VHLA 2YU2A 5L3FB 2J1DG 4CXYA 2LOPA 4QWTA 3Q5WA 1LRZA 4AQFC 3NBXX 4U72A 2LSYA 4WHAA 2Y48B 3EUHA 3V5UA 5IHYA 3CQCB 3MXZA 3HKCE 3ZYMA 1ETHA 3ONXA 3AA6B 1U5PA 2CA5A 3C98B 3DTOA 3LBXA 3PUAA 3VKHA 2ZM0A 4ZS2A 4AQFA 5CB4E 2C5KT 5JRCA 4B6XA 2RP4A 5FXXA 5EK2A 3L09A 4PFOA 1MMAA 2H7OA 2L3LA 1US7B 3UT5E 3Q2MA 4TN7B 3KBTA 3KBUA 1AJ3A 3VKGA 5LCYA 4UVBB 2W00A 3RC8A 2YU1A 3MACA 2NOXA 4DBQA 1QMDA 4X20E 4C90A 4IDZA 2Y6XA 3C51A 2LM9A 4TUYE 3QUJA 1LVFA 1D0XA 2C0SA 1BU8A 1YD8G 3OKQA 3BQIA 1LOXA 5FP3A 2ODUA 3LBXB 4ISSA 3SOLA 2FNQA 5JRCB 1ZKEA 3OYZA 3LG7A 4JUYA 4K0UA 2C5JA 4PJJA 3IF8B 2CE7A 3BNDA 2VWAA 3PE0A 2XUEA 3ZN1B 4ILUA 4O8SA 5LHGB 5EEOA 3GA8A 2BZBA 4XZCA 3K3QC 5L3CB 3N9LA 5J1GA 2I59A 2NTYA 2Z6EA 5HXCA 5HWXA 3LJCA 2H7VC 4WBNE 5JDNA 4IE4A 1QSDA 1YW0A 3C50A 4O4HE 3ZMVB 5IYZE 3ETUA 2JPFA 4Z8XA 4QX8B 3CWZB 2IC6A 4ANJA 4CXWA 2EHOD 3S4UA 4IIJE 1FEWA 5ETWA 2XASB 3JC6D 3NRXA 2NP9A 3AAAB 1UX4A 3FBLA 4GK5E 4I4TE 3MZKB 5LHIB 4I43B 3GWHA 4UF0A 3AA0B 3BQKA 1IK3A 4FI5A 3FG4A 3OBVE 2NWBA 2WM9A 1HG2A 2CWYA 1IZNB 2LHNA 4CI1B 2XAJB 4EZ4A 5F3JA 4PNIA 1IJ5A 4UEMA 4PJNA 3ZEFB 3E0ZA 3EDVA 3L3PA 4O4IE 1H7CA 4PJMA 3RH3A 3AAIA 3CX7B 1MNDA 3ZCIA 5DQVA 3EVYA 4OFZA 4XAXB 3U3IA 4EYUA 4P0BA 2ZM2A 4L9IA 4UF0B 2WXTA 3O4XE 2IW5B 4PFPA 3OYXA 4HKAA 4FJOA 4H9OC 3DJBA 3C4ZA 3PU3A 3ZJ1A 3LK42 3FG3A 3K3OA 3KV9A 4QWNB 2RA1A 3RX6A 3W15B 4AKGA 1HG5A 2D0TA 5BMVE 3VU7H 1WYCA 4UVAB 1IAPA 4UV8B 2HH7A 1OLPA 2WAUA 1RRHA 1G73A 4N78D 2JMKA 1BR4A 2DCFA 2CWOA 3E22E 4PK5A 2DLRA 3HKEE 1WR6A 2N1GA 3CKDA 3AAEB 5JVDE 3ZC0A 4HN9A 2W0GA 4H63V 2JJ9A 2JQQA 2OA5A 4MBQA 1W52X 2NW8A 4QX7B 5E0OA 3PU8A 3WAJA 3N2KE 5J2TE 4J2CA 1QM6A 3B13A 4PK4A 2PVSA 2DNXA 1D1AA 3UFEA 1HX8A 2WWUA 2V1DB 4HTEA 4ASKA 3N9QA 4X1KE 5HXSA 3CMLA 3R6NA 3ZCJA 1MIWA 3BK9A 2X9HA 3P7IA 2P0MA 3ZMTB 2K9AA 3A5XA 3RC3A 5HYAA 2L8KA 4EOZB 3O1HA 3I0QA 4TV9E 5FY1A 2IUKA 2ACXA 3CQGB 1O3XA 4ADZA 4E7SA 1E1HB 3WAKA 3ANWB 2PG8A 2CXFA 1NO3A 2KT9A 2XHEB 5LNKA 3KVAA 1CUNA 3B57A 4ZS3A 5JDHA 5JQGE 3ZJ2A 1UCUA 2V7KA 5FXVA 3GMIA 2X0LB 4PW8A 5HXEA 4EYYR 1G8XA 4ZI2C 3RYIE 4ZOLE 4C91A 2CXLA 4O4JE 2H3RA 4JEUB 2KINB 4AI6A 3IBPA 1HU9A 4IHJE 1OWAA 2K5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGQ A;  1N8Q A;  1YGE A;  1QM6 A;  3FG3 A;  1JNQ A;  2DWG A;  1GPL A;  2CXF A;  1LPA B;  1NO3 A;  2DWK A;  2PVS A;  1LNH A;  2IUK A;  3BNB A;  1LPB B;  3FG4 A;  1FGM A;  1FGR A;  3PZW A;  2IUJ A;  4WFO A;  3O8Y A;  2OXE A;  1OLP A;  1Y4K A;  1RRH A;  3BNE A;  2SBL A;  3V99 A;  4QWT A;  1QMD A;  1RRL A;  3BND A;  1FGO A;  1RP1 A;  4NRE A;  1ROV A;  2WY6 A;  3BNC A;  4WHA A;  1N8S A;  1GYG A;  3VF1 A;  3V98 A;  2P0M A;  3V92 A;  1BU8 A;  1FGT A;  2CXL A;  2PPL A;  5EEO A;  3CWZ B;  1LOX A;  2FNQ A;  1ETH A;  2WXT A;  3FG1 A;  1IK3 A;  1F8N A;  1KHO A;  1HU9 A;  1CA1 A;  1W52 X;  2WXU A;  1HPL A;  4GIW A; 
#chains in the Genus database with same CATH topology
 3MA9 A;  4Z90 A;  2V7I A;  2ZM6 T;  2BS4 A;  2Q9Q D;  3PUQ A;  1LNH A;  2W67 A;  2KND A;  3FXE B;  2E5L T;  2LSI A;  3ZLI A;  3T8O A;  2XFE A;  3H3M A;  3AB3 B;  4BJN A;  2E9X D;  2VQF T;  2UXD T;  4L0R A;  2CMR A;  1OED E;  3FHN A;  5AQL B;  1FGR A;  1Y4K A;  4U2Y A;  3AE3 A;  2BKN A;  3C4X A;  1MIV A;  3EI0 A;  5AQM B;  3AXJ A;  2XSB A;  4UIG A;  3PUG A;  1WRD A;  4O2A E;  3CIR A;  4DR6 T;  4ZZB A;  2HPJ A;  4EED A;  2VL8 A;  4IDQ A;  2VL0 A;  3RI5 A;  4NPP A;  4HFV A;  2CLY C;  3AXJ B;  4LMJ A;  3CX6 B;  5FVK A;  3UUX B;  2RPA A;  3P8C D;  4LML A;  3ZN0 B;  5LGN B;  4LMK A;  5KXJ A;  5C3J A;  2A2F X;  2X9Y A;  5JRE A;  3O9X A;  4HFH A;  1S35 A;  3EDU A;  2CLY B;  3NVO A;  1OED C;  2BVM A;  4YSX A;  1NEN A;  2WU5 A;  4GIW A;  2V7L A;  1VCT A;  2WMN A;  2NR4 A;  2K48 A;  2N2N A;  5ADX L;  2LOS A;  2YK0 A;  1OED A;  5LB7 B;  5KX5 E;  5L2L A;  2WDV A;  3FZM B;  4TX5 A;  2YEV C;  3RIF A;  4QKN A;  2IIU A;  4DV3 T;  4JI2 T;  4NIQ A;  4X1Y E;  3KIN B;  4UVC B;  1W0A A;  3DP7 A;  3Q9D A;  3BQL A;  2LM2 A;  3ZC1 A;  1OED B;  2QA7 A;  4CXX A;  3C64 A;  3LK2 B;  2LGE A;  2XQY A;  4EXT A;  4WW0 A;  4KI0 F;  3PV0 F;  2V8S V;  3QC9 A;  2XQ5 A;  2BDE A;  2UUB T;  4H63 H;  3N5L A;  1U4Q A;  4QXC B;  4H9N C;  5LGU B;  1WLX A;  4Q25 A;  3AEB A;  3OVU A;  2CCQ A;  3CVR A;  4MAL A;  3AE4 A;  3QB5 K;  1YGE A;  2BKP A;  4WBO A;  2P9B A;  4AKL A;  2QYW A;  2XQ8 A;  2HPL A;  2LJL A;  3AVR A;  4E7Z A;  3RYH E;  3AE6 A;  4AIU A;  3KV4 A;  5LMN T;  5AQR B;  5FXW A;  1BR1 A;  1D1C A;  2N9D A;  1WFD A;  4X5T A;  4U3C A;  3SFE A;  3KDS E;  2XPK A;  4L5G A;  3ZMU B;  3ONJ A;  2KMF A;  4YFS A;  4HWH A;  2BKO A;  2SBL A;  4H9R C;  3ZYL A;  4ERR A;  4U74 A;  3ZPO A;  3P4R A;  3IEE A;  4KBM B;  3NZP A;  2QZ7 A;  4YSZ A;  1DU2 A;  4U7I A;  1V9D A;  5CJ5 A;  2XAH B;  2MYS A;  4TZ4 C;  1E7P A;  4EB6 E;  2W61 A;  2MBG A;  5FY7 A;  1ZEE A;  4NRE A;  1ROV A;  3I1A A;  4AXP A;  4NUU A;  1HCI A;  4EZH A;  2FJD A;  3RPU A;  3F31 A;  2KZ7 B;  1HPL A;  2FJE A;  3KFW X;  4IL9 A;  2ACZ A;  1YKE B;  1N33 T;  2ODV A;  4PK6 A;  2L9Q A;  2LT3 A;  4YHJ A;  2VAS A;  4IE6 A;  3PZW A;  1Z0P A;  3P4Q A;  1N32 T;  1R8I A;  2J1D G;  4QWT A;  3Q5W A;  3EUH A;  5AQK B;  5HEJ A;  3CQC B;  3T1Y T;  2UUC T;  4ZXL A;  3DTO A;  4CN1 A;  4B6X A;  3FZH B;  5FXX A;  3L09 A;  1US7 B;  3UT5 E;  3KBU A;  1AJ3 A;  2W00 A;  2YU1 A;  3AEF A;  2NOX A;  2C0S A;  2JQ9 A;  5FP3 A;  2FNQ A;  1ZKE A;  2C5J A;  2CE7 A;  3PE0 A;  1J5W A;  1UK5 A;  4O8S A;  5ABE A;  2D9D A;  4IDN A;  3PUW F;  5J1G A;  2LG7 A;  5HWX A;  2H7V C;  4WBN E;  3RLF F;  5JDN A;  1YW0 A;  3C50 A;  3ZMV B;  2JPF A;  2IC6 A;  4ANJ A;  3FBL A;  5LHI B;  4I4T E;  1GQE A;  3BQK A;  4FI5 A;  2WM9 A;  1IZN B;  4DUY T;  4TWD A;  2J4G A;  2XAJ B;  4EZ4 A;  4JBW F;  4PNI A;  1IJ5 A;  2XJ7 A;  4O4I E;  3L3P A;  2YN6 A;  1HNZ T;  3CX7 B;  2VQE T;  3U3I A;  3EVY A;  4U7Y A;  3OYX A;  4HKA A;  2PTF A;  4JI0 T;  3DJB A;  1KNR A;  3PU3 A;  3UUB A;  4X65 T;  2WDR A;  1E2A A;  2WAU A;  1JNZ A;  2CWO A;  2DLR A;  3HKE E;  4TWF A;  2N1G A;  3CKD A;  4QX7 B;  3WAJ A;  5J2T E;  1M62 A;  3B13 A;  2DNX A;  2V1D B;  4HTE A;  4X1K E;  4LF7 T;  3CML A;  5HEU A;  3ZCJ A;  3BK9 A;  2X9H A;  3P7I A;  3ZMT B;  4X64 T;  2K9A A;  4LFA T;  3I0Q A;  5FY1 A;  2ACX A;  3Q5D A;  3ANW B;  3IA3 A;  2PG8 A;  1NO3 A;  3B57 A;  4ZS3 A;  5JDH A;  3PUV F;  1UCU A;  3P4W A;  3FZK B;  2X0L B;  2IHR 1;  4JI6 T;  3TLV A;  4ZI2 C;  4C91 A;  5AQI B;  3RKG A;  4O4J E;  2KIN B;  4IHJ E;  2VB6 A;  1I94 T;  4HFE A;  4HGA A;  4DMW A;  3RYF E;  2BBJ A;  1FGM A;  4LF4 T;  1FIO A;  2QRX A;  5AQF B;  2CRB A;  2MOZ A;  3PUR A;  4ZI3 D;  2CBI A;  2PPL A;  2VKO A;  5LG4 A;  1XDP A;  3OPC A;  3U78 A;  2XAF B;  3C4W A;  3CX8 B;  3AE5 A;  4XBF B;  5L3B B;  4EIW A;  2WZI A;  3AA7 B;  3PDY A;  5GON E;  1HF8 A;  4KUM B;  2C5I T;  3CK6 A;  1T98 A;  2K24 A;  5KDM C;  2HHH T;  1F8N A;  3EHZ A;  1XDO A;  4DV6 T;  3UUN A;  1IJ6 A;  2Q9Q A;  2BBH A;  3TLS A;  5FY0 A;  5ABG A;  2EHO C;  2V6X A;  2V5D A;  3HA4 A;  2VKD A;  2XQA A;  2M67 A;  3JC6 C;  2XQ6 A;  4CI2 B;  3AE9 A;  2EHO A;  2WXU A;  3M65 A;  1FGQ A;  5L4E A;  4JLE A;  1KK7 A;  3LK3 B;  4NUV A;  2IC9 A;  3PTR B;  4EEB A;  1UX5 A;  2CXD A;  5LXT E;  1Z8U A;  4HWC A;  5ABF A;  4WNK A;  3I9Y A;  2H89 A;  2EHO B;  3Q5X A;  2KXV A;  4KMC A;  4AKH A;  2IAK A;  2X51 A;  2IUJ A;  5ABF B;  3TLT A;  3FBZ A;  2CEA A;  2CM0 A;  4O4L E;  5LBM A;  4PJL A;  2V7J A;  5IUX A;  1OXZ A;  2VKJ A;  2X9X A;  2OXE A;  3P4P A;  1MNE A;  4U31 A;  4JI1 T;  2XTL A;  2B76 A;  2LSG A;  2V26 A;  4QH5 A;  1KNP A;  3ETV A;  3V5S A;  1W0B A;  4A5X A;  4JEH B;  4MLK A;  5CFB A;  5AFU L;  3N9P A;  3ZT5 A;  2JRK A;  1KNZ A;  3SS1 A;  3WI3 A;  2E5V A;  4HEA A;  2KLQ A;  1SHZ C;  2XM1 A;  2DWK A;  2ZLY A;  3RRC A;  5JDM A;  4IL4 A;  4KX6 A;  1UUR A;  3QK6 A;  3PUZ F;  2ZM8 A;  5DAB A;  4G2A A;  4IE0 A;  3NKZ A;  5FL1 A;  1X79 A;  5LGT B;  2SPC A;  5F5W A;  1HTJ F;  4I0U A;  1HS7 A;  2WB5 A;  4P0A A;  4I50 E;  2NW7 A;  2BS2 A;  1T7S A;  2JQK A;  3UFG A;  3GN5 A;  5JDL A;  5A1L A;  5HAX A;  5DJQ C;  1D1B A;  4JI5 T;  4B3S T;  3LFM A;  4BAY B;  2UXN B;  1RRL A;  1NWM X;  4LF8 T;  4UR9 A;  3GN5 B;  4U33 A;  1SE7 A;  3EAB A;  2B1E A;  2LHR A;  1XNQ T;  4GYS A;  2NW9 A;  3KVB A;  1WYB A;  1B7T A;  1Y64 B;  2D5U A;  3UTK A;  2XAG B;  2YU2 A;  5L3F B;  3PUX F;  3NBX X;  4DID B;  4WHA A;  3V5U A;  3JAE A;  3ONX A;  4LF6 T;  3AA6 B;  1YXR A;  3VKH A;  5EK2 A;  4PFO A;  1MMA A;  2L3L A;  3Q2M A;  2CBJ A;  4HFB A;  4UVB B;  3MAC A;  2BS3 A;  2KSR A;  4DBQ A;  1QMD A;  4WZX A;  4C90 A;  5FKY A;  2FJB A;  2LM9 A;  3QB5 A;  3QUJ A;  1LVF A;  4DR3 T;  1YD8 G;  3OKQ A;  4ISS A;  3SOL A;  2XUE A;  2DL1 A;  4ILU A;  2XSA A;  5EEO A;  2BZB A;  5L3C B;  2NTY A;  5HXC A;  3LJC A;  5FL0 A;  4IE4 A;  2YKS A;  2LKG A;  4CXW A;  4IIJ E;  4ZEY A;  2X0Y A;  5ETW A;  2XAS B;  1UX4 A;  4I43 B;  4DR2 T;  3AA0 B;  3FG4 A;  2NWB A;  1HG2 A;  2CWY A;  2LHN A;  4CI1 B;  3UQ7 A;  5F3J A;  3X1D A;  4UEM A;  1H7C A;  4PJM A;  2OV9 A;  1MND A;  3ONL C;  4OFZ A;  4XAX B;  5DQV A;  4EYU A;  4P0B A;  4IRE A;  2WXT A;  1WR0 A;  4PFP A;  2LRK A;  2E2A A;  2XQ4 A;  3FG3 A;  3AEC A;  3RX6 A;  4ILC A;  3T1H T;  3VRB A;  2HH7 A;  1OLP A;  4YHH T;  1RRH A;  1XZY A;  2JMK A;  1BR4 A;  4PK5 A;  4X66 T;  3ZC0 A;  4H63 V;  2XFD A;  2JQQ A;  2UU9 T;  3FZF B;  1N36 T;  5E0O A;  2F4V T;  1QM6 A;  1D1A A;  1HX8 A;  2WWU A;  2YDQ A;  4DV2 T;  2LRL A;  5HXS A;  3QOF A;  1MIW A;  1XNR T;  4JI3 T;  2L8K A;  4EOZ B;  3CQG B;  3ZST A;  4E7S A;  5AQQ B;  2XHE B;  5LNK A;  1ZOY A;  3KVA A;  1CUN A;  3PUY F;  5JQG E;  2V7K A;  5FXV A;  3GMI A;  4PW8 A;  1XMO T;  4ZOL E;  2CXL A;  2H3R A;  3L39 A;  1FJG T;  4YTM A;  2K5B B;  3LDQ B;  1KFY A;  4DV5 T;  3UU4 A;  1MIY A;  1BR0 A;  2WP9 A;  2YOE A;  5JR9 A;  1HFA A;  3CQX C;  2ZMA A;  1QUU A;  3D0T A;  5EK3 A;  5LP6 E;  4CI3 B;  4YTN A;  2UXC T;  4AKI A;  2WS3 A;  4UV9 B;  4K0K T;  4EAH A;  5LOV E;  1YQ4 A;  2WDQ A;  5AQP B;  3HL6 A;  4IGU A;  1CHU A;  4IST A;  3U6G A;  2I0M A;  4YT0 A;  3MK7 C;  4TNW A;  4AQY T;  3H37 A;  5JH7 E;  3K8P C;  3AVS A;  3R84 B;  4ZHQ E;  4QXH B;  3KV5 A;  5C8Y E;  3I0O A;  4O2B E;  3BNE A;  5TAO A;  2W62 A;  3E08 A;  3KV6 A;  2FJA A;  1FMW A;  3MJX A;  3QNU A;  2X67 A;  2ES0 A;  3K1S A;  3J7Y q;  3OJA A;  1JNR A;  2A3D A;  4H9P C;  2XAQ B;  3JCF A;  3FXD B;  4P09 A;  4CN4 A;  3J9X 1;  3N2G E;  3SRZ A;  2KWH A;  2PFV A;  2WY6 A;  2V5C A;  4U2Z A;  1EZ3 A;  3UUL A;  2BVL A;  1KHO A;  1ZHC A;  3RYC E;  3L8R A;  4ILA A;  1FMV A;  4GKJ T;  3SWH A;  1IBM T;  2V6Y A;  4OYJ A;  5L3D B;  2PBI A;  3UU5 A;  4DMV A;  2W2U A;  4EGW A;  3FB2 A;  4PAG A;  4WYV A;  2VUR A;  2V6Y B;  4IE7 A;  2YDS A;  3FZL B;  3RKO A;  3I9W A;  4UXN B;  3JAD A;  4BA9 A;  4DO0 A;  3TLW A;  5FNV E;  2JQH A;  1JNQ A;  2XHH A;  1LPB B;  2A72 A;  4QHO A;  2YIN A;  2QGS A;  3ZMS B;  2VKH A;  3HKD E;  4IDP A;  1NAF A;  1QLB A;  5HEG A;  5HWY A;  2WMO A;  2VK9 A;  4P1N A;  5L3E B;  4MHC A;  1LKX A;  2WSS V;  2J47 A;  5JDQ A;  2PJQ A;  1S94 A;  4JI4 T;  2E8I A;  5LA6 E;  4OHF A;  1HX1 B;  2Q9Q C;  2IDO B;  2DHR A;  3FG1 A;  5FMN A;  1MMD A;  4YJ2 E;  2H88 A;  4H9Q C;  2WCA A;  3H3A A;  4AIS A;  4CN6 A;  4DV1 T;  4A56 A;  3RF1 A;  2JMH A;  2E9X C;  3UU3 A;  4DV4 T;  3NZQ A;  4V1A v;  3PJA A;  2XQ7 A;  1UUS A;  3ZYK A;  2E9X A;  2WWV A;  3PUS A;  2Q9Q B;  5CA0 E;  2X68 A;  1GPL A;  3VR9 A;  4DBR A;  3ABV A;  5CGM A;  3AEA A;  1SA0 E;  2GK9 A;  2W66 A;  4KHZ F;  4YLH A;  3F2E A;  3TKL B;  3V92 A;  2E9X B;  3VRA A;  2NTX A;  4H9S E;  1MMN A;  1HR0 T;  3N9N A;  4ZI2 D;  1VOM A;  3BNB A;  4OK0 A;  1D0Z A;  2M6B A;  4CXY A;  4KHP T;  2LOP A;  1YQ3 A;  4AQF C;  2LSY A;  1J5E T;  2Y48 B;  4QH4 A;  3ZT6 A;  5JTG A;  5IHY A;  4HFC A;  3MXZ A;  5AQO B;  3HKC E;  3ZYM A;  3RGL A;  3C98 B;  2ZM0 A;  4ZS2 A;  4AQF A;  2C5K T;  2RP4 A;  5FVL A;  3RQU A;  4TN7 B;  3VKG A;  5LCY A;  3RC8 A;  2XY8 B;  3C51 A;  2WU2 A;  4NXN T;  1D0X A;  1BU8 A;  3BQI A;  2ODU A;  3LG7 A;  4JUY A;  3IF8 B;  3ZN1 B;  3G06 A;  5AQJ B;  3GA8 A;  4XZC A;  3N9L A;  2I59 A;  3PJA J;  2CHN A;  5IWA T;  4JI8 T;  1UGO A;  1QSD A;  1W09 A;  2KXT A;  3ETU A;  2XHJ A;  4QX8 B;  3CWZ B;  2EHO D;  3S4U A;  1HNX T;  3AE2 A;  1FEW A;  3JC6 D;  3NRX A;  2NP9 A;  4GK5 E;  3GWH A;  4IDO A;  3OBV E;  4DR5 T;  4PJN A;  3ZEF B;  3EDV A;  5ABH A;  4YSY A;  3AAI A;  2ZM2 A;  4L9I A;  3O4X E;  4FJO A;  4H9O C;  3C4Z A;  3LK4 2;  2CPT A;  3K3O A;  3RQW A;  4AKG A;  4LFB T;  5BMV E;  3ZKR A;  3RIU C;  3VU7 H;  4YTP A;  4DV0 T;  4UV8 B;  1G73 A;  3E22 E;  3RIU A;  2MAW A;  3AAE B;  4HN9 A;  2WZH A;  3RHW A;  2LLY A;  2OA5 A;  1W52 X;  4MBQ A;  1VCS A;  4J2C A;  4HWI B;  3UFE A;  3SFD A;  3UU8 A;  2HN2 A;  4ASK A;  3TLU A;  4ZZC A;  3N9Q A;  3R6N A;  4B3R T;  2YDR A;  1T72 A;  3A5X A;  3RC3 A;  3O1H A;  2IUK A;  3RIA A;  4ADZ A;  2QVA A;  2CXF A;  4YY3 T;  4YXD A;  1N34 T;  1G8X A;  3RYI E;  2K3W A;  1X9B A;  4AI6 A;  1OWA A;  4YJ3 E;  4GOU A;  3ZMZ B;  4JYA T;  2DWG A;  4OX9 T;  1J1J A;  5FXZ A;  4X1I E;  4Z91 A;  4B3M T;  3IBZ A;  3O8Y A;  5H6R B;  4HWF A;  4JI7 T;  2XQ9 A;  3K3N A;  2AXD S;  3O1J A;  2FUP A;  3Q5E A;  3RRW A;  1CA1 A;  4WFO A;  3NRY A;  4QXB B;  3MKD A;  1I6Z A;  4HE8 A;  2LE8 A;  2D0U A;  5AQH B;  3N9M A;  1RP1 A;  5JDF A;  3CPZ A;  1KF6 A;  4EV6 A;  1D0Y A;  2JIW A;  2D2S A;  2X9W A;  2G0U A;  4AKR B;  5LYJ E;  4HFI A;  4QH1 A;  5C2T A;  3HR0 A;  5H6Q B;  2IUB A;  4M1P A;  4DND A;  4MFR A;  5J2U E;  1BR2 A;  3UUM A;  4QEY A;  1ZV4 X;  3NWI A;  1SUM B;  2LRG A;  2LSK A;  1M7K A;  1WCR A;  1VRB A;  1MMG A;  4BJM A;  3ZT7 A;  5AQS B;  4KP3 C;  1IBL T;  4I55 E;  3AE1 A;  3UQ4 A;  3BNC A;  4OYK A;  2UXX B;  2WY2 A;  4CQI A;  3LSV A;  4IE5 A;  2KWI B;  3F57 A;  1YKH B;  1IBK T;  4GK0 E;  5BR8 T;  2KXP B;  1L0V A;  2I6H A;  1ZP0 A;  4CZZ B;  5LBQ B;  4TV8 E;  1Y01 A;  5DQW A;  3M3Z B;  5M4Y A;  3AA1 B;  2UXB T;  3VF1 A;  3IHR A;  5HXH A;  1LVK A;  5JR9 C;  2V7M A;  2QNG A;  4HFD A;  2WBL A;  4X62 T;  5J0Z A;  2LSJ A;  1W9R A;  2MTQ A;  3P50 A;  5LHH B;  3A8Y C;  3V98 A;  1FGT A;  2DI4 A;  5F8P A;  4DVD A;  2J62 A;  5JR9 B;  4AQG A;  3N9O A;  2LEH A;  5L4H A;  5KMG P;  2IML A;  5EZY E;  3O1I A;  1FGO A;  5EK4 A;  5FYM A;  4F6R C;  1N8S A;  3ESL A;  4NXM T;  2WQY A;  1N8Q A;  3JAF A;  3B5M A;  5L3G B;  3HI2 A;  4GYR A;  4ZI3 C;  5CA1 E;  5HCJ A;  5JDG A;  5HXR A;  4DR4 T;  1XWM A;  1GYG A;  1T8B A;  4B3T T;  5LJN A;  5HEO A;  3HKB E;  4G63 A;  2W63 A;  3N2O A;  3ZSS A;  4ILB A;  5AQU B;  5LJM A;  3V99 A;  1NEK A;  4ZI7 E;  2Y8D A;  4UEL A;  2X66 A;  1LPA B;  2AE9 A;  3ANW A;  3VHL A;  1LRZ A;  4U72 A;  2VVN A;  3P4S A;  1KEY A;  1ETH A;  1U5P A;  2CA5 A;  3LBX A;  3PUA A;  4LFC T;  5JRC A;  5CB4 E;  1HNW T;  2H7O A;  3AE7 A;  5AQN B;  3KBT A;  2BG9 E;  2A9U A;  4X20 E;  4IDZ A;  2Y6X A;  2XM2 A;  4TUY E;  1XMQ T;  3AEG A;  1LOX A;  3LBX B;  5JRC B;  3OYZ A;  4TNV A;  4DV7 T;  4K0U A;  5AQT B;  4PJJ A;  3BND A;  2XZE A;  2VWA A;  2HN1 A;  2CHO A;  5LHG B;  4JV5 T;  3AE8 A;  3K3Q C;  5LMU T;  2Z6E A;  4F8H A;  4LF9 T;  4O4H E;  5IYZ E;  4Z8X A;  4A97 A;  5AQV B;  3AEE A;  3AAA B;  2W4X A;  3MZK B;  4UF0 A;  1IK3 A;  2X0H A;  4DR1 T;  3OTO T;  4COF A;  2XQ3 A;  2UUA T;  5HCM A;  3E0Z A;  4IT4 A;  5L47 A;  3RH3 A;  3ZCI A;  4UF0 B;  2IW5 B;  3ZJ1 A;  3AED A;  3KV9 A;  4QWN B;  2RA1 A;  3W15 B;  2BG9 C;  1HG5 A;  2D0T A;  1WYC A;  4UVA B;  1IAP A;  4N78 D;  3EAM A;  4DR7 T;  2DCF A;  4HWD A;  2BG9 A;  1WR6 A;  5JVD E;  2W0G A;  5LG3 A;  2JJ9 A;  2NW8 A;  3UU6 A;  3PU8 A;  3N2K E;  3VR8 A;  4PK4 A;  2PVS A;  2M6I A;  2BG9 B;  4DUZ T;  2FBW A;  5HEH A;  2P0M A;  4TWH A;  5HYA A;  4TV9 E;  2R6G F;  2LKH A;  4GKK T;  1O3X A;  1E1H B;  3WAK A;  2KT9 A;  4A98 A;  5AQG B;  2VVS A;  3ZJ2 A;  5HXE A;  4EYY R;  2OLT A;  2MPK A;  4JEU B;  3IBP A;  1HU9 A;  4LF5 T;  3A7M A; 
#chains in the Genus database with same CATH homology
 3MA9 A;  2VB6 A;  4YJ3 E;  2V7I A;  4GOU A;  3ZMZ B;  2DWG A;  2Q9Q D;  3PUQ A;  4HGA A;  1MIY A;  3RYF E;  4DMW A;  1LNH A;  1FGM A;  5FXZ A;  4X1I E;  2KND A;  1BR0 A;  3FXE B;  3O8Y A;  5JR9 A;  5H6R B;  1FIO A;  1HFA A;  3CQX C;  2LSI A;  2ZMA A;  1QUU A;  3T8O A;  3D0T A;  3ZLI A;  5EK3 A;  5LP6 E;  4CI3 B;  2MOZ A;  3PUR A;  4ZI3 D;  2PPL A;  3AB3 B;  3K3N A;  2VKO A;  3O1J A;  4BJN A;  2E9X D;  5LG4 A;  3RRW A;  1CA1 A;  4AKI A;  4WFO A;  4L0R A;  2CMR A;  3NRY A;  4QXB B;  4UV9 B;  3U78 A;  4EAH A;  3FHN A;  2XAF B;  3C4W A;  3CX8 B;  5LOV E;  3MKD A;  4XBF B;  5L3B B;  1FGR A;  4EIW A;  3HL6 A;  4HE8 A;  3AA7 B;  3PDY A;  2LE8 A;  1Y4K A;  2D0U A;  4IGU A;  5GON E;  1HF8 A;  4IST A;  3C4X A;  3N9M A;  1RP1 A;  4KUM B;  5JDF A;  1MIV A;  2C5I T;  3CPZ A;  1T98 A;  3MK7 C;  4UIG A;  3PUG A;  1D0Y A;  2K24 A;  5KDM C;  1F8N A;  1WRD A;  4O2A E;  2D2S A;  2X9W A;  3H37 A;  5JH7 E;  2G0U A;  3K8P C;  2HPJ A;  3AVS A;  3R84 B;  3UUN A;  4AKR B;  2VL8 A;  4ZHQ E;  5LYJ E;  4QXH B;  1IJ6 A;  2Q9Q A;  3KV5 A;  5FY0 A;  4HFV A;  5C8Y E;  3I0O A;  2CLY C;  4O2B E;  3BNE A;  2EHO C;  3HR0 A;  5TAO A;  3HA4 A;  3CX6 B;  2VKD A;  2M67 A;  3JC6 C;  5H6Q B;  3UUX B;  2W62 A;  3E08 A;  4CI2 B;  4M1P A;  3KV6 A;  4DND A;  1FMW A;  4MFR A;  3P8C D;  5J2U E;  3MJX A;  1BR2 A;  2X67 A;  2ES0 A;  3UUM A;  3ZN0 B;  3J7Y q;  2EHO A;  3OJA A;  2WXU A;  1ZV4 X;  2A3D A;  3M65 A;  4H9P C;  5LGN B;  2XAQ B;  1FGQ A;  3FXD B;  4JLE A;  2LSK A;  1KK7 A;  3LK3 B;  4P09 A;  4NUV A;  2IC9 A;  3PTR B;  3J9X 1;  1VRB A;  2A2F X;  1UX5 A;  1MMG A;  3N2G E;  2CXD A;  2X9Y A;  3SRZ A;  5LXT E;  2KWH A;  5JRE A;  3O9X A;  4BJM A;  2PFV A;  4KP3 C;  4WNK A;  1S35 A;  3I9Y A;  4I55 E;  3EDU A;  2WY6 A;  3BNC A;  4OYK A;  2CLY B;  2EHO B;  1EZ3 A;  2UXX B;  3UUL A;  4CQI A;  2BVL A;  2BVM A;  4IE5 A;  3Q5X A;  1KHO A;  2KWI B;  1ZHC A;  3RYC E;  4KMC A;  3F57 A;  2V7L A;  4GIW A;  1FMV A;  2WMN A;  4AKH A;  3SWH A;  1YKH B;  2K48 A;  2N2N A;  5ADX L;  2LOS A;  2IAK A;  2X51 A;  4GK0 E;  2KXP B;  2IUJ A;  4OYJ A;  5L3D B;  2PBI A;  2YK0 A;  4CZZ B;  5L2L A;  5KX5 E;  5LBQ B;  4DMV A;  4TV8 E;  4TX5 A;  3FBZ A;  2YEV C;  3FB2 A;  2CEA A;  4QKN A;  5DQW A;  4PAG A;  2CM0 A;  4O4L E;  5M4Y A;  3AA1 B;  5LBM A;  3VF1 A;  4X1Y E;  3IHR A;  2V7J A;  3KIN B;  4PJL A;  4UVC B;  1OXZ A;  2VKJ A;  2X9X A;  5HXH A;  1LVK A;  3DP7 A;  5JR9 C;  3Q9D A;  4IE7 A;  2OXE A;  3BQL A;  3ZC1 A;  2V7M A;  1MNE A;  3I9W A;  3RKO A;  2XTL A;  2QA7 A;  4UXN B;  4BA9 A;  4CXX A;  2LSG A;  2WBL A;  5FNV E;  4DO0 A;  2LSJ A;  1JNQ A;  3C64 A;  2V26 A;  2A72 A;  2MTQ A;  3LK2 B;  1LPB B;  4QHO A;  2YIN A;  5LHH B;  2XQY A;  2QGS A;  3ZMS B;  3ETV A;  3V5S A;  4WW0 A;  4EXT A;  2VKH A;  3HKD E;  1NAF A;  3QC9 A;  4JEH B;  2BDE A;  4MLK A;  5AFU L;  3N9P A;  4H63 H;  2JRK A;  5HWY A;  3N5L A;  1KNZ A;  1U4Q A;  4QXC B;  4H9N C;  2WMO A;  2VK9 A;  5LGU B;  1WLX A;  3SS1 A;  3WI3 A;  3V98 A;  1FGT A;  4HEA A;  2DI4 A;  2CCQ A;  3CVR A;  4MAL A;  5L3E B;  1YGE A;  4MHC A;  1LKX A;  1SHZ C;  2KLQ A;  4WBO A;  5F8P A;  2P9B A;  4DVD A;  4AKL A;  2DWK A;  2ZLY A;  3RRC A;  5JR9 B;  5JDM A;  4AQG A;  2WSS V;  3N9O A;  2LEH A;  2PJQ A;  5JDQ A;  5KMG P;  1S94 A;  2E8I A;  2HPL A;  2LJL A;  3AVR A;  5LA6 E;  4E7Z A;  5EZY E;  3O1I A;  3RYH E;  1FGO A;  3QK6 A;  5EK4 A;  3KV4 A;  5FYM A;  4F6R C;  4OHF A;  1N8S A;  2ZM8 A;  5FXW A;  1BR1 A;  2Q9Q C;  5DAB A;  4G2A A;  1D1C A;  4IE0 A;  2N9D A;  2DHR A;  3ESL A;  3FG1 A;  1X79 A;  5FMN A;  1MMD A;  3KDS E;  1N8Q A;  4YJ2 E;  4H9Q C;  5L3G B;  4L5G A;  3HI2 A;  3ZMU B;  4GYR A;  3H3A A;  5LGT B;  4A56 A;  2KMF A;  4YFS A;  2SPC A;  4ZI3 C;  1HTJ F;  2JMH A;  5CA1 E;  5JDG A;  5HXR A;  2SBL A;  2E9X C;  1HS7 A;  4H9R C;  3NZQ A;  3ZYL A;  4ERR A;  1GYG A;  4V1A v;  4P0A A;  4I50 E;  4U74 A;  3ZPO A;  2NW7 A;  5LJN A;  3IEE A;  3HKB E;  4KBM B;  3NZP A;  3ZYK A;  4G63 A;  2E9X A;  3GN5 A;  5JDL A;  5A1L A;  3PUS A;  2Q9Q B;  5HAX A;  1V9D A;  2W63 A;  3N2O A;  5CA0 E;  2X68 A;  5DJQ C;  1GPL A;  1D1B A;  2XAH B;  2MYS A;  4TZ4 C;  4DBR A;  4EB6 E;  5LJM A;  2W61 A;  2MBG A;  5FY7 A;  3LFM A;  3V99 A;  1SA0 E;  4BAY B;  1ZEE A;  2UXN B;  2GK9 A;  1RRL A;  1NWM X;  4ZI7 E;  4NRE A;  1ROV A;  4YLH A;  3F2E A;  3I1A A;  3TKL B;  2Y8D A;  4AXP A;  3V92 A;  2E9X B;  4NUU A;  1HCI A;  3GN5 B;  4EZH A;  2NTX A;  4H9S E;  4UEL A;  1MMN A;  2B1E A;  2LHR A;  3RPU A;  3F31 A;  2KZ7 B;  3N9N A;  4GYS A;  1HPL A;  4ZI2 D;  2NW9 A;  3KVB A;  3KFW X;  1WYB A;  1VOM A;  1YKE B;  2X66 A;  1B7T A;  1Y64 B;  2D5U A;  2ODV A;  4PK6 A;  2L9Q A;  2LT3 A;  4YHJ A;  1LPA B;  2VAS A;  3UTK A;  4IE6 A;  4OK0 A;  3BNB A;  3PZW A;  3ANW A;  2XAG B;  1D0Z A;  1Z0P A;  3VHL A;  2YU2 A;  5L3F B;  2J1D G;  4CXY A;  2LOP A;  4QWT A;  3Q5W A;  1LRZ A;  4AQF C;  3NBX X;  4U72 A;  2LSY A;  4WHA A;  2Y48 B;  3EUH A;  3V5U A;  5IHY A;  3CQC B;  3MXZ A;  3HKC E;  3ZYM A;  1ETH A;  3ONX A;  3AA6 B;  1U5P A;  2CA5 A;  3C98 B;  3DTO A;  3LBX A;  3PUA A;  3VKH A;  2ZM0 A;  4ZS2 A;  4AQF A;  5CB4 E;  2C5K T;  5JRC A;  4B6X A;  2RP4 A;  5FXX A;  5EK2 A;  3L09 A;  4PFO A;  1MMA A;  2H7O A;  2L3L A;  1US7 B;  3UT5 E;  3Q2M A;  4TN7 B;  3KBT A;  3KBU A;  1AJ3 A;  3VKG A;  5LCY A;  4UVB B;  2W00 A;  3RC8 A;  2YU1 A;  3MAC A;  2NOX A;  4DBQ A;  1QMD A;  4X20 E;  4C90 A;  4IDZ A;  2Y6X A;  3C51 A;  2LM9 A;  4TUY E;  3QUJ A;  1LVF A;  1D0X A;  2C0S A;  1BU8 A;  1YD8 G;  3OKQ A;  3BQI A;  1LOX A;  5FP3 A;  2ODU A;  3LBX B;  4ISS A;  3SOL A;  2FNQ A;  5JRC B;  1ZKE A;  3OYZ A;  3LG7 A;  4JUY A;  4K0U A;  2C5J A;  4PJJ A;  3IF8 B;  2CE7 A;  3BND A;  2VWA A;  3PE0 A;  2XUE A;  3ZN1 B;  4ILU A;  4O8S A;  5LHG B;  5EEO A;  3GA8 A;  2BZB A;  4XZC A;  3K3Q C;  5L3C B;  3N9L A;  5J1G A;  2I59 A;  2NTY A;  2Z6E A;  5HXC A;  5HWX A;  3LJC A;  2H7V C;  4WBN E;  5JDN A;  4IE4 A;  1QSD A;  1YW0 A;  3C50 A;  4O4H E;  3ZMV B;  5IYZ E;  3ETU A;  2JPF A;  4Z8X A;  4QX8 B;  3CWZ B;  2IC6 A;  4ANJ A;  4CXW A;  2EHO D;  3S4U A;  4IIJ E;  1FEW A;  5ETW A;  2XAS B;  3JC6 D;  3NRX A;  2NP9 A;  3AAA B;  1UX4 A;  3FBL A;  4GK5 E;  4I4T E;  3MZK B;  5LHI B;  4I43 B;  3GWH A;  4UF0 A;  3AA0 B;  3BQK A;  1IK3 A;  4FI5 A;  3FG4 A;  3OBV E;  2NWB A;  2WM9 A;  1HG2 A;  2CWY A;  1IZN B;  2LHN A;  4CI1 B;  2XAJ B;  4EZ4 A;  5F3J A;  4PNI A;  1IJ5 A;  4UEM A;  4PJN A;  3ZEF B;  3E0Z A;  3EDV A;  3L3P A;  4O4I E;  1H7C A;  4PJM A;  3RH3 A;  3AAI A;  3CX7 B;  1MND A;  3ZCI A;  5DQV A;  3EVY A;  4OFZ A;  4XAX B;  3U3I A;  4EYU A;  4P0B A;  2ZM2 A;  4L9I A;  4UF0 B;  2WXT A;  3O4X E;  2IW5 B;  4PFP A;  3OYX A;  4HKA A;  4FJO A;  4H9O C;  3DJB A;  3C4Z A;  3PU3 A;  3ZJ1 A;  3LK4 2;  3FG3 A;  3K3O A;  3KV9 A;  4QWN B;  2RA1 A;  3RX6 A;  3W15 B;  4AKG A;  1HG5 A;  2D0T A;  5BMV E;  3VU7 H;  1WYC A;  4UVA B;  1IAP A;  4UV8 B;  2HH7 A;  1OLP A;  2WAU A;  1RRH A;  1G73 A;  4N78 D;  2JMK A;  1BR4 A;  2DCF A;  2CWO A;  3E22 E;  4PK5 A;  2DLR A;  3HKE E;  1WR6 A;  2N1G A;  3CKD A;  3AAE B;  5JVD E;  3ZC0 A;  4HN9 A;  2W0G A;  4H63 V;  2JJ9 A;  2JQQ A;  2OA5 A;  4MBQ A;  1W52 X;  2NW8 A;  4QX7 B;  5E0O A;  3PU8 A;  3WAJ A;  3N2K E;  5J2T E;  4J2C A;  1QM6 A;  3B13 A;  4PK4 A;  2PVS A;  2DNX A;  1D1A A;  3UFE A;  1HX8 A;  2WWU A;  2V1D B;  4HTE A;  4ASK A;  3N9Q A;  4X1K E;  5HXS A;  3CML A;  3R6N A;  3ZCJ A;  1MIW A;  3BK9 A;  2X9H A;  3P7I A;  2P0M A;  3ZMT B;  2K9A A;  3A5X A;  3RC3 A;  5HYA A;  2L8K A;  4EOZ B;  3O1H A;  3I0Q A;  4TV9 E;  5FY1 A;  2IUK A;  2ACX A;  3CQG B;  1O3X A;  4ADZ A;  4E7S A;  1E1H B;  3WAK A;  3ANW B;  2PG8 A;  2CXF A;  1NO3 A;  2KT9 A;  2XHE B;  5LNK A;  3KVA A;  1CUN A;  3B57 A;  4ZS3 A;  5JDH A;  5JQG E;  3ZJ2 A;  1UCU A;  2V7K A;  5FXV A;  3GMI A;  2X0L B;  4PW8 A;  5HXE A;  4EYY R;  1G8X A;  4ZI2 C;  3RYI E;  4ZOL E;  4C91 A;  2CXL A;  4O4J E;  2H3R A;  4JEU B;  2KIN B;  4AI6 A;  3IBP A;  1HU9 A;  4IHJ E;  1OWA A;  2K5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...