3CWZB

Structure of rab6(gtp)-r6ip1 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
336
structure length
310
Chain Sequence
NLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKLAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSLPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Ras-related protein Rab-6A
total genus 87
structure length 310
sequence length 336
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01477 PLAT PLAT/LH2 domain
B PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cwzB01
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 3cwzB03
1RRHA 1CA1A 3O8YA 3FG3A 1LPAB 3VF1A 3V92A 2WY6A 1KHOA 1JNQA 3BNEA 2P0MA 1FGRA 1BU8A 3FG1A 4NREA 1LNHA 1HPLA 1QMDA 2PPLA 1FGOA 1FGMA 1RRLA 1FGTA 1NO3A 1W52X 2FNQA 3BNDA 1QM6A 3CWZB 1GYGA 2SBLA 2WXTA 3PZWA 4WHAA 4WFOA 1N8SA 2DWGA 2WXUA 3V98A 1ROVA 1GPLA 1ETHA 1YGEA 1LOXA 5EEOA 2PVSA 4QWTA 3BNCA 3FG4A 1F8NA 4GIWA 1N8QA 2IUJA 1OLPA 1IK3A 2IUKA 1FGQA 2OXEA 3BNBA 2DWKA 1LPBB 2CXLA 1HU9A 1Y4KA 2CXFA 3V99A 1RP1A
chains in the Genus database with same CATH superfamily
2Z6EA 2A3DA 1LKXA 4EYYR 1J5ET 2WWVA 3V98A 3HL6A 4LF6T 3QUJA 3VR8A 5LBMA 5LGUB 4DV4T 4NUVA 3KV4A 4AKHA 3JADA 2MYSA 4HFVA 5FKYA 4LF7T 5ABEA 3BNEA 5EK4A 1T7SA 3JCFA 3DJBA 3VHLA 2IAKA 5CGMA 3PDYA 3U6GA 4HFDA 2XAFB 3F57A 3AE9A 3ZT7A 3AA0B 3NZPA 2BKOA 4PJJA 2W63A 2IUBA 4CN1A 3ZPOA 1HNZT 1BR4A 2LRLA 1UCUA 4ILCA 3UU3A 3B13A 3FBZA 5CJ5A 2VVNA 2CM0A 3BNBA 3HKDE 5FVKA 3MK7C 5IYZE 2JQQA 4LF5T 2PTFA 3CQXC 4OFZA 5HYAA 5M4YA 2J62A 2NWBA 2I0MA 3E22E 2WZHA 4GOUA 4WZXA 2UUAT 4JUYA 1N32T 2VB6A 3UU8A 2XQ8A 4IDNA 4AI6A 2BKNA 2HN2A 1WRDA 4DBQA 4X62T 4YY3T 5F8PA 5L3DB 1NENA 1XNQT 3KFWX 4OYKA 5AQFB 2YINA 2X68A 5E0OA 5FL0A 4JI1T 1OEDC 1W52X 3KBUA 2W00A 3TLUA 5FP3A 3H3AA 4IT4A 3ZMTB 5AQOB 3PUWF 3QC9A 4YTMA 2YDSA 2KLQA 4JLEA 4ZI2C 2C0SA 3C51A 4HWHA 2WY6A 3CX7B 2WS3A 1KHOA 5JDLA 4PK6A 4QWNB 1W0BA 2XFEA 3NWIA 2LKGA 2A2FX 2FNQA 2QA7A 4UV8B 4IDZA 2L8KA 2NP9A 5LJMA 3OPCA 3AA6B 3ONLC 3FZLB 2XQ9A 3RQUA 3AEAA 4YSYA 3ZSTA 3DP7A 1W0AA 4U7YA 5AQPB 4X20E 1IJ6A 2Q9QA 2EHOA 2X0LB 4TX5A 3VKGA 4BJMA 4WNKA 4CXXA 2W0GA 2BS4A 5L4HA 3T8OA 3SRZA 5JR9B 2DNXA 3SFEA 3BK9A 2LSJA 3RIAA 3BNCA 2ZM2A 2KSRA 2HHHT 3MXZA 4TV9E 3OJAA 1RP1A 3ZCJA 4AQFA 5AQHB 4IDOA 5AQLB 4O2BE 2PBIA 2E9XC 5AQSB 1HF8A 2IW5B 2IC6A 3JC6D 3AVSA 2NOXA 2QZ7A 4MFRA 1VRBA 5LG3A 1Z8UA 3I9WA 5AQIB 3RIFA 2ZM0A 2L9QA 4A56A 3BQLA 1AJ3A 3ZC1A 4I55E 3L3PA 1IK3A 1HR0T 1KF6A 4L9IA 4YHJA 4QH1A 1M62A 1S94A 3IEEA 2K48A 3KDSE 2H89A 5FNVE 5FY0A 1N36T 4ZI2D 1E2AA 3G06A 2YN6A 4TZ4C 3W15B 4ZI3C 2HN1A 4YFSA 4UF0B 5L3BB 4CI3B 3IHRA 4YJ3E 4IL4A 1YKEB 2B76A 2VL0A 2E5LT 4H9OC 4X1KE 1D0ZA 1WCRA 2AE9A 4XBFB 3UUXB 4UVCB 4MHCA 3RGLA 3RF1A 3KVBA 5JR9C 5KDMC 1BR1A 1IZNB 1EZ3A 3GMIA 5HXHA 3BQKA 1MIYA 2KXVA 4EV6A 1KFYA 3O9XA 2RPAA 2KWHA 1KEYA 1D0YA 4JV5T 3TKLB 3AEDA 4H9SE 3EDUA 2P0MA 3FG1A 5AQKB 3IBPA 3N2GE 4UELA 5JH7E 4LF4T 1HTJF 2LT3A 4LFAT 4GIWA 5JRCB 5IUXA 5AFUL 3CQCB 5LB7B 2ACZA 2F4VT 2LHRA 3OTOT 5BMVE 5HXCA 2YEVC 2D9DA 3K8PC 2VKDA 2XAGB 2I59A 3PU8A 2A72A 3CIRA 2LM2A 1OXZA 3ESLA 3P4PA 3TLSA 2XQ5A 4EYUA 3AA7B 2LRKA 5LJNA 3C64A 2WWUA 3P4WA 4G63A 4MBQA 1RRHA 1CA1A 1NWMX 2ES0A 4KBMB 1YW0A 2LLYA 5HCJA 2X51A 3T1YT 4ZHQE 3H3MA 2BDEA 2NTYA 5L3GB 1Y01A 4QKNA 1UK5A 2YOEA 3GWHA 3ETUA 3F31A 1I6ZA 3V92A 2YU1A 1FGRA 4DR4T 5L47A 1HG2A 2V7LA 2LGEA 3BNDA 4GKJT 4MLKA 3HKEE 4ZI3D 3AECA 1WYCA 4A5XA 4ZZBA 3Q5DA 2H88A 3B57A 2CPTA 4TWDA 3AEGA 1WR0A 3L09A 1WFDA 4P1NA 4HE8A 4QWTA 5IHYA 5FY7A 5F5WA 1LPBB 2KZ7B 1U4QA 1N33T 3RLFF 5JRCA 2CEAA 4CN4A 2IHR1 2HH7A 4FI5A 1XMOT 3N9NA 5J2UE 4LMLA 2CLYB 1OEDB 3MACA 2CXFA 4YXDA 2CHOA 5HAXA 4IE6A 1D1BA 2QNGA 2LHNA 2WP9A 3EVYA 2Y48B 1QM6A 3QB5K 4DV0T 1UX4A 2UUBT 4AKGA 5TAOA 3LFMA 3ZMSB 3VKHA 2X9XA 4X5TA 3CK6A 2JMHA 1MNEA 2CBIA 3UFGA 3PZWA 5DQVA 3Q5WA 3UT5E 4DO0A 2XAJB 2YDRA 3L39A 1KNPA 2OLTA 2QYWA 3PV0F 3J9X1 2VKJA 4H63V 1BR2A 3LK2B 3SFDA 2BVMA 2BG9A 2MOZA 2M6IA 4QEYA 5J1GA 1G8XA 2XQ4A 4ZS2A 2XPKA 3ZJ1A 4GKKT 5LGNB 2K3WA 4UVBB 4DV2T 1B7TA 5FXWA 2XQ3A 3VRBA 3UULA 2BS3A 3LBXB 4AIUA 5CB4E 5EZYE 4U31A 3AE5A 5AQUB 5FXVA 2ACXA 3A8YC 3KV5A 4A97A 4QHOA 2L3LA 3TLTA 4UIGA 3Q5EA 4YSZA 4DIDB 1HPLA 2FJBA 2JQ9A 3N9MA 1X79A 4GYRA 1WR6A 3FG4A 2BBJA 1N8QA 1J1JA 4ZEYA 5FXZA 3QNUA 2DL1A 2JRKA 5HEJA 2WB5A 2W67A 2VK9A 3PUQA 3AEBA 4HFCA 4IIJE 1IBLT 1HNWT 4CI2B 4AXPA 5LHGB 2VKHA 2E2AA 1G73A 1MNDA 3Q5XA 2E5VA 1FJGT 4N78D 4C90A 3E0ZA 3AE8A 4EEDA 3UU5A 1MMGA 5HWYA 1T8BA 3L8RA 4O8SA 4WBNE 1UUSA 2UXXB 4JYAT 2SBLA 3ANWA 3ZMZB 3PE0A 3JAEA 5HXSA 3AB3B 5AQVB 4NIQA 3RYIE 2WM9A 3I0OA 4JI6T 2DLRA 2X9WA 1GYGA 2Q9QB 4H63H 3OVUA 5LHIB 3NZQA 2LSIA 2XQ7A 4HN9A 2JJ9A 3N9LA 4HFEA 3OYZA 3RYCE 3VF1A 2UUCT 2W61A 3MZKB 5HEOA 2CA5A 4DV3T 4LFBT 2IIUA 2OA5A 1QMDA 1VCTA 3LK3B 1T98A 4F8HA 3P8CD 2EHOD 2XQ6A 2UXNB 4KI0F 4EZHA 3ABVA 3O8YA 2C5IT 3ZKRA 1DU2A 3N5LA 2V6YA 5LGTB 2KWIB 2N9DA 2G0UA 3ZT6A 1W9RA 4PJMA 3C4ZA 2CXLA 5LHHB 4JEHB 2XAQB 2WBLA 2VL8A 1MMDA 2V6YB 1NEKA 4DR7T 2QGSA 4AQFC 1FEWA 5LXTE 4CQIA 1M7KA 1HNXT 2E9XA 4AKLA 2NR4A 4PK4A 3P4RA 4BJNA 3F2EA 4WFOA 1UURA 1FMVA 3PURA 4QH5A 2FJEA 4NUUA 5IWAT 5A1LA 2X0HA 2WQYA 3CQGB 2X9HA 4M1PA 2CXDA 3LK42 3PUZF 2W4XA 5J0ZA 1XZYA 3NVOA 5HEUA 1S35A 2Q9QC 3RYHE 1IAPA 3ZMVB 3PUAA 4Q25A 4EB6E 5HCMA 2LE8A 5KX5E 1FMWA 4IE0A 2WU5A 3ZCIA 1Y64B 3RPUA 2DCFA 2D2SA 2P9BA 3N9QA 4ASKA 4DNDA 4PAGA 3EAMA 3SS1A 5FY1A 3CVRA 3PUYF 2DI4A 4OYJA 5JR9A 2B1EA 1YXRA 5JREA 4DV7T 5FXXA 2WXTA 4CN6A 2H7VC 3N2OA 4OK0A 3FB2A 3M3ZB 3RX6A 2CBJA 4LF8T 2WY2A 2XAHB 4HWFA 3QOFA 2LEHA 4U7IA 3GA8A 2IDOB 2XHJA 4P0BA 1SHZC 4V1Av 3UU6A 3RKGA 5AQQB 2NW7A 4COFA 4DV1T 1UGOA 1WLXA 2HPLA 3V99A 5FVLA 3RH3A 4PW8A 4AKIA 2XUEA 4NXMT 2ZM8A 5GONE 4EGWA 1FGMA 3VR9A 3PUVF 1FIOA 5JDMA 1T72A 2E9XD 3C98B 3EI0A 3IBZA 2XHHA 3MA9A 2OXEA 3R6NA 3LG7A 2V7KA 4TN7B 3M65A 4TNWA 5C8YE 4ZS3A 5AQJB 3LSVA 4B3MT 2YKSA 4IL9A 4JI7T 2BBHA 1KNRA 2UXCT 3AEEA 2X66A 2XM1A 3EHZA 3KBTA 1D1AA 4TNVA 2VASA 1UX5A 3PU3A 4PNIA 2V7IA 3O4XE 4ADZA 2K9AA 1HCIA 4IREA 1ROVA 5H6RB 4XAXB 1ZKEA 1I94T 4HKAA 3ZSSA 2MTQA 1ZHCA 5C2TA 1QUUA 3O1HA 1QLBA 4ZI7E 2CHNA 3IA3A 3T1HT 2W66A 2PG8A 4O4IE 3OBVE 1LVKA 4BAYB 1N8SA 4YSXA 3AE2A 2XJ7A 4CZZB 5EK3A 4EOZB 4YTPA 2WSSV 3S4UA 3RKOA 1HU9A 4TV8E 2WDVA 4O4LE 4IE4A 5L3CB 2EHOC 4NXNT 2LSGA 3A7MA 3ZC0A 2WDRA 3Q2MA 4DR5T 5HWXA 1FGQA 2D5UA 3RC3A 2YDQA 4WYVA 4YT0A 3AE6A 3QK6A 1N34T 3EDVA 2XASB 3FXDB 1RRLA 3CWZB 4H9NC 3ZYMA 3UTKA 3HKCE 3RIUC 2Q9QD 2WAUA 3FZFB 4HGAA 4B3RT 2Y8DA 2H3RA 3ZN1B 3NRYA 2UU9T 2QVAA 4GK5E 3VU7H 5AQGB 2LSKA 2WCAA 1ZOYA 4O4JE 5JDQA 3FZMB 1KNZA 4A98A 5H6QB 3RHWA 4UXNB 4HFBA 2UXBT 2BG9B 2W2UA 3MKDA 4FJOA 3KVAA 4IDQA 5JDFA 3EUHA 2VQFT 2XTLA 1U5PA 3RI5A 2WDQA 1HX1B 2FBWA 4JI3T 1CUNA 2FJAA 3AE7A 1YKHB 3SWHA 3GN5A 2XHEB 4PK5A 4OHFA 4ZOLE 2ZMAA 4CXYA 4LFCT 1O3XA 2PVSA 5KXJA 3N9OA 2CRBA 4U2ZA 2GK9A 3ZYLA 3BQIA 3OYXA 5HEGA 2M6BA 4DUZT 3UUMA 2XM2A 1LOXA 1JNRA 2XFDA 2CCQA 4JI4T 4IE7A 2NTXA 4DVDA 3UU4A 1W09A 4ERRA 4F6RC 5FMNA 3C50A 1SUMB 2PJQA 4LMKA 4I0UA 3RIUA 5ABHA 1YQ4A 3PJAA 4P09A 2JQKA 2C5KT 2JPFA 2WMNA 3TLVA 3CMLA 4DV6T 2A9UA 4ZZCA 4K0KT 3FG3A 3ZLIA 1OEDA 4HFIA 4IGUA 4H9PC 3P50A 2MPKA 1D1CA 4ISTA 3A5XA 2SPCA 1YGEA 2LSYA 4QX7B 3ZMUB 3ONXA 2K24A 3Q9DA 4Z91A 3FXEB 3FZHB 5HXEA 1IBKT 4BA9A 3VRAA 5LOVE 3LBXA 4WHAA 1ZEEA 3ZEFB 4DUYT 5LYJE 1L0VA 1E7PA 3JC6C 2OV9A 3O1JA 4JBWF 4H9RC 4L5GA 3PUXF 3HA4A 3I1AA 4JI8T 5F3JA 2ODUA 2KINB 4DR6T 2W62A 3PUGA 5AQMB 2WXUA 1GPLA 4G2AA 5LBQB 2J47A 1H7CA 2NW8A 2LG7A 2DWKA 4U74A 4EIWA 3QB5A 5ETWA 3UQ7A 1XDOA 2LOSA 4QX8B 3LJCA 2V1DB 2KMFA 2BKPA 5L3EB 3NBXX 3NKZA 4UR9A 2D0TA 3AE4A 4JI2T 4LF9T 4ZXLA 2RA1A 4K0UA 2LM9A 2NW9A 4DR1T 2ZM6T 3O1IA 2LKHA 4UV9B 2XY8B 3AAEB 2PFVA 2V6XA 4KP3C 4U33A 2J4GA 3CX8B 2VVSA 4WW0A 4J2CA 4DMWA 3HKBE 4B6XA 3AE1A 3U3IA 1Z0PA 2BS2A 4HEAA 4AQGA 1LNHA 2PPLA 1NO3A 2FJDA 4MALA 2LJLA 3KINB 1R8IA 2DWGA 4ANJA 1MMNA 2X67A 4DBRA 2C5JA 3I9YA 1VCSA 4E7SA 4KHZF 5LCYA 2XQAA 4UEMA 4WBOA 3FZKB 4CXWA 2MBGA 4UVAB 3AXJA 5LNKA 5JDGA 2J1DG 5DQWA 4QXBB 3RQWA 3RRWA 4AQYT 3AAAB 2E8IA 2V5DA 1LPAB 4TWHA 3V5UA 2MAWA 4YTNA 5JQGE 4X1YE 4H9QC 3MJXA 3AAIA 5JVDE 5EK2A 2IC9A 2XZEA 3NRXA 2VURA 4DR3T 3K1SA 4PFOA 4I43B 3U78A 3UQ4A 2V7JA 4TUYE 5HXRA 3AVRA 2BZBA 1OWAA 2VWAA 5JDNA 4I4TE 1BR0A 1SE7A 3D0TA 4YJ2E 3JAFA 1VOMA 4HTEA 2V5CA 2D0UA 1LVFA 2VKOA 1JNQA 2WZIA 3ZT5A 1IJ5A 1US7B 2ODVA 3ZYKA 5LMUT 2KNDA 2JMKA 5AQRB 5L2LA 4HFHA 1OLPA 2YU2A 2YK0A 4EEBA 3PJAJ 4KMCA 5L3FB 3RRCA 2Y6XA 3AEFA 4TWFA 4U3CA 5ADXL 3CPZA 1OEDE 1HG5A 3FBLA 4Z90A 3IF8B 1YQ3A 1X9BA 4EAHA 3P7IA 3C4XA 3K3OA 3WAKA 2UXDT 3EABA 3I0QA 5EEOA 4DV5T 1HX8A 5JTGA 2N2NA 5AQTB 2CLYC 4LMJA 3ZJ2A 1V9DA 2IMLA 2FUPA 3PTRB 4IDPA 2N1GA 4EZ4A 4X64T 1XWMA 3AXJB 4I50E 2JQHA 2JIWA 2IUKA 1ZP0A 5CFBA 2WU2A 4O4HE 5KMGP 5FYMA 1NAFA 3LDQB 2CMRA 4E7ZA 5JDHA 4X1IE 2XSBA 5BR8T 3AE3A 3DTOA 4XZCA 4L0RA 2XQYA 2CWOA 2M67A 3ETVA 3RC8A 1J5WA 5AQNB 3R84B 2VQET 1SA0E 4PJLA 2DHRA 3ZN0B 3B5MA 3RYFE 4AISA 3UUNA 4DR2T 1WYBA 2XSAA 4KUMB 5LG4A 4JI0T 1LRZA 2LOPA 3V5SA 4ISSA 3AA1B 2BG9E 4P0AA 1CHUA 4PFPA 1HS7A 3N2KE 4B3ST 2CWYA 4AKRB 4IHJE 2BVLA 4YLHA 2AXDS 3K3QC 2RP4A 3WI3A 3PUSA 4JEUB 3E08A 3N9PA 4Z8XA 3KV9A 2R6GF 2HPJA 3P4QA 5DABA 1XDPA 2E9XB 4U72A 3SOLA 4X65T 4ILUA 4NREA 3FHNA 4HWIB 2V8SV 4GYSA 2LRGA 1KK7A 2CE7A 1F8NA 5LP6E 1Y4KA 3GN5B 2BG9C 5FL1A 5ABGA 1QSDA 5HEHA 4UF0A 1HFAA 3C4WA 4CI1B 2X9YA 1JNZA 1MIVA 1IBMT 2KXTA 2H7OA 4ILAA 4B3TT 1ETHA 2X0YA 2IUJA 3KV6A 4IE5A 2V7MA 2WMOA 3HI2A 4HWCA 4QH4A 4OX9T 3K3NA 4C91A 3TLWA 2ZLYA 5LA6E 4GK0E 4O2AE 3UFEA 4YHHT 3ONJA 4U2YA 1FGOA 5CA1E 4KHPT 1E1HB 3HR0A 4X66T 5L4EA 2KT9A 1GQEA 2QRXA 3UUBA 4EXTA 3H37A 1MMAA 1BU8A 5C3JA 3OKQA 2K5BB 3WAJA 3X1DA 4NPPA 5ABFB 4QXHB 4ILBA 4PJNA 2V26A 4DMVA 2I6HA 3ANWB 1XNRT 1XMQT 3J7Yq 5J2TE 5ABFA 4HWDA 1D0XA 1FGTA 4JI5T 2KXPB 4KX6A 5LMNT 1MIWA 3CKDA 3CX6B 3P4SA 4QXCB 5CA0E 1YD8G 5DJQC 2EHOB 1ZV4X
chains in the Genus database with same CATH topology
2Z6EA 3RX6A 2NW9A 2A3DA 2XAHB 3O1IA 1LKXA 3B57A 4UV9B 4EYYR 3AAEB 2LEHA 2PFVA 3L09A 4KP3C 3GA8A 3V98A 4P0BA 1SHZC 3HL6A 4V1Av 3CX8B 3QUJA 4HE8A 4QWTA 4WW0A 5IHYA 2NW7A 4J2CA 5LBMA 5FY7A 4DMWA 5LGUB 1LPBB 4NUVA 3KV4A 4AKHA 1WLXA 2KZ7B 1U4QA 2HPLA 3HKBE 4B6XA 3V99A 3U3IA 1Z0PA 2MYSA 3RH3A 4PW8A 4AKIA 4HFVA 2XUEA 4HEAA 5JRCA 3BNEA 4AQGA 2ZM8A 2CEAA 1LNHA 5EK4A 5GONE 3DJBA 2HH7A 3VHLA 4FI5A 1FGMA 2PPLA 2IAKA 1NO3A 3PDYA 1FIOA 4MALA 2LJLA 3KINB 2DWGA 5JDMA 2E9XD 3C98B 3N9NA 5J2UE 4ANJA 3MA9A 2OXEA 2XAFB 3F57A 2CLYB 3MACA 3R6NA 1MMNA 3LG7A 2X67A 2CXFA 2V7KA 3AA0B 4TN7B 4DBRA 2C5JA 3I9YA 3M65A 3NZPA 4IE6A 5HAXA 5C8YE 4E7SA 5LCYA 4PJJA 1D1BA 2W63A 4UEMA 4WBOA 4ZS3A 2LHNA 3ZPOA 4CXWA 1BR4A 2MBGA 3EVYA 1UCUA 4UVAB 2Y48B 5LNKA 1QM6A 3B13A 5JDGA 3FBZA 1UX4A 4AKGA 2J1DG 5DQWA 4QXBB 2CM0A 5TAOA 3RRWA 3LFMA 3AAAB 3BNBA 3ZMSB 3HKDE 2X66A 3MK7C 2E8IA 3VKHA 5IYZE 2JQQA 2X9XA 1LPAB 3V5UA 3CQXC 3KBTA 1D1AA 4OFZA 5HYAA 2JMHA 5M4YA 2VASA 1MNEA 2NWBA 1UX5A 3PU3A 4PNIA 5JQGE 2V7IA 3E22E 4GOUA 4X1YE 3O4XE 4ADZA 3PZWA 4H9QC 3MJXA 3AAIA 5DQVA 2K9AA 1HCIA 3Q5WA 5JVDE 5H6RB 4XAXB 3UT5E 1ZKEA 4DO0A 1ROVA 5EK2A 4HKAA 4JUYA 2XAJB 2VB6A 2IC9A 4AI6A 2MTQA 1ZHCA 1WRDA 4DBQA 3NRXA 1QUUA 3O1HA 5F8PA 3J9X1 5L3DB 4PFOA 4ZI7E 2VKJA 3KFWX 4OYKA 4I43B 3U78A 4H63V 1BR2A 3LK2B 2BVMA 2PG8A 2V7JA 2YINA 4TUYE 5HXRA 4O4IE 3OBVE 2X68A 2MOZA 3AVRA 1LVKA 5E0OA 1W52X 3KBUA 2W00A 5J1GA 4BAYB 1G8XA 2BZBA 1OWAA 1N8SA 5FP3A 3H3AA 4ZS2A 3ZJ1A 3ZMTB 4CZZB 5EK3A 2VWAA 4EOZB 5JDNA 2WSSV 3QC9A 4I4TE 3S4UA 5LGNB 3RKOA 1BR0A 4UVBB 1HU9A 2KLQA 3D0TA 4JLEA 4YJ2E 4ZI2C 4TV8E 1B7TA 2C0SA 1VOMA 4HTEA 3C51A 2D0UA 5FXWA 1LVFA 3CX7B 2WY6A 1KHOA 2VKOA 4O4LE 1JNQA 4IE4A 5JDLA 5L3CB 2EHOC 4PK6A 4QWNB 3UULA 3LBXB 1IJ5A 1US7B 2LSGA 2A2FX 2ODVA 3ZYKA 5CB4E 2FNQA 3ZC0A 2QA7A 3Q2MA 4UV8B 5EZYE 4IDZA 2L8KA 2NP9A 2KNDA 2JMKA 5LJMA 5FXVA 5L2LA 1OLPA 3AA6B 5HWXA 2YU2A 2D5UA 2YK0A 1FGQA 3RC3A 2ACXA 4KMCA 5L3FB 3RRCA 2Y6XA 3KV5A 5ADXL 3CPZA 4QHOA 2L3LA 1HG5A 3FBLA 4UIGA 3DP7A 3IF8B 3QK6A 4EAHA 1HPLA 3EDVA 2XASB 3FXDB 1RRLA 3P7IA 3N9MA 1X79A 3C4XA 3CWZB 4X20E 1IJ6A 3K3OA 3WAKA 4GYRA 2Q9QA 4H9NC 3ZYMA 3UTKA 2EHOA 2X0LB 3I0QA 1WR6A 3HKCE 5EEOA 3FG4A 1N8QA 4TX5A 5FXZA 1HX8A 2Q9QD 2N2NA 3VKGA 4BJMA 2WAUA 4WNKA 4CXXA 2JRKA 4HGAA 2CLYC 2VK9A 2W0GA 3ZJ2A 1V9DA 2Y8DA 2H3RA 3PTRB 3PUQA 3T8OA 3SRZA 3ZN1B 5JR9B 3NRYA 2DNXA 2N1GA 4IIJE 4EZ4A 4GK5E 3VU7H 2LSKA 3BK9A 2LSJA 4O4JE 4I50E 4CI2B 3BNCA 5JDQA 2ZM2A 1KNZA 2IUKA 4AXPA 5LHGB 2VKHA 3MXZA 5H6QB 4TV9E 3OJAA 1G73A 1RP1A 1MNDA 3Q5XA 4UXNB 4O4HE 3ZCJA 4N78D 4AQFA 5KMGP 5FYMA 3MKDA 4FJOA 4C90A 3E0ZA 3KVAA 5JDFA 3EUHA 1NAFA 1MMGA 5HWYA 4O2BE 2PBIA 2CMRA 2XTLA 2E9XC 1U5PA 4O8SA 4E7ZA 1HF8A 2UXXB 2IW5B 4WBNE 5JDHA 4X1IE 2SBLA 3ANWA 2IC6A 3ZMZB 3JC6D 3AVSA 2NOXA 1CUNA 3PE0A 4MFRA 3DTOA 1VRBA 4XZCA 5HXSA 4L0RA 2XQYA 3AB3B 2CWOA 2M67A 1YKHB 3ETVA 3I9WA 3RC8A 3SWHA 3RYIE 3R84B 3GN5A 2XHEB 1SA0E 2WM9A 2ZM0A 3I0OA 2L9QA 4PK5A 4PJLA 2DHRA 3ZN0B 3RYFE 2DLRA 4OHFA 4ZOLE 3BQLA 2X9WA 4A56A 1AJ3A 3UUNA 3ZC1A 4I55E 1GYGA 2Q9QB 1WYBA 4H63H 3L3PA 2ZMAA 4KUMB 5LG4A 5LHIB 4CXYA 1O3XA 3NZQA 2PVSA 2LSIA 3N9OA 4HN9A 2JJ9A 1LRZA 1IK3A 2LOPA 3N9LA 2GK9A 4L9IA 3V5SA 4ISSA 4YHJA 3ZYLA 3BQIA 3AA1B 3OYZA 1S94A 3RYCE 4P0AA 3IEEA 2K48A 3KDSE 3VF1A 3OYXA 2W61A 5FNVE 3MZKB 5FY0A 4PFPA 2CA5A 1HS7A 4ZI2D 3N2KE 2OA5A 2CWYA 4AKRB 1QMDA 4IHJE 3LK3B 4TZ4C 1T98A 2BVLA 3W15B 4ZI3C 3P8CD 4YFSA 4YLHA 4UF0B 2EHOD 5L3BB 4CI3B 3IHRA 3K3QC 3UUMA 2RP4A 4YJ3E 1YKEB 3WI3A 3PUSA 1LOXA 4JEUB 3E08A 3N9PA 2CCQA 4H9OC 4Z8XA 2UXNB 4IE7A 3KV9A 4X1KE 2NTXA 4EZHA 4DVDA 1D0ZA 2HPJA 4XBFB 3UUXB 5DABA 4UVCB 2E9XB 4MHCA 4U72A 3SOLA 4ERRA 2C5IT 5FMNA 4F6RC 3O8YA 4ILUA 3C50A 3KVBA 5JR9C 2PJQA 5KDMC 4NREA 3FHNA 1BR1A 1IZNB 3N5LA 1EZ3A 3GMIA 5HXHA 5LGTB 2KWIB 1MIYA 2N9DA 3BQKA 4GYSA 2G0UA 4P09A 3O9XA 1KK7A 2C5KT 2CE7A 2JPFA 4PJMA 1F8NA 2WMNA 2KWHA 3C4ZA 2CXLA 5LHHB 3CMLA 5LP6E 1Y4KA 1D0YA 4JEHB 2XAQB 3TKLB 2WBLA 3GN5B 2VL8A 1MMDA 1QSDA 4UF0A 3FG3A 1HFAA 3ZLIA 3C4WA 4H9SE 2QGSA 2X9YA 4CI1B 3EDUA 4AQFC 2P0MA 4IGUA 3FG1A 1FEWA 5LXTE 1MIVA 3IBPA 4CQIA 4H9PC 3N2GE 4UELA 5JH7E 2E9XA 4AKLA 1D1CA 2H7OA 4PK4A 4ISTA 4BJNA 1HTJF 3F2EA 2LT3A 4WFOA 3A5XA 1ETHA 2SPCA 1YGEA 2LSYA 4QX7B 4GIWA 1FMVA 3PURA 5JRCB 2IUJA 3KV6A 3ZMUB 3CQCB 4NUUA 5AFUL 4IE5A 5A1LA 2V7MA 3ONXA 2K24A 3Q9DA 2WMOA 3HI2A 3K3NA 2LHRA 3CQGB 3FXEB 4C91A 5BMVE 5HXCA 2YEVC 2ZLYA 5LA6E 4GK0E 5HXEA 3K8PC 4O2AE 2X9HA 3UFEA 2VKDA 2XAGB 4M1PA 2CXDA 4BA9A 3LK42 1FGOA 2I59A 5LOVE 5CA1E 3PU8A 3LBXA 2A72A 4WHAA 1ZEEA 1E1HB 3HR0A 1S35A 1OXZA 2Q9QC 3ZEFB 3ESLA 4EYUA 2KT9A 3RYHE 3AA7B 5LYJE 5LJNA 3JC6C 3C64A 3O1JA 1IAPA 2WWUA 3ZMVB 4H9RC 4G63A 3PUAA 4MBQA 4EB6E 1RRHA 2LE8A 1NWMX 4EXTA 5KX5E 2ES0A 1CA1A 4L5GA 4KBMB 3H37A 1MMAA 1YW0A 1FMWA 4IE0A 1BU8A 3OKQA 2X51A 1Y64B 3HA4A 3ZCIA 3I1AA 2K5BB 3RPUA 4ZHQE 2DCFA 3WAJA 2D2SA 5F3JA 2ODUA 2KINB 2W62A 2P9BA 3N9QA 3PUGA 2WXUA 2BDEA 2NTYA 1GPLA 4G2AA 5LBQB 5L3GB 1H7CA 2NW8A 4QKNA 2DWKA 4ASKA 4U74A 4DNDA 4QXHB 4PAGA 4PJNA 4EIWA 3SS1A 2V26A 4DMVA 3ANWB 5ETWA 5FY1A 3CVRA 3GWHA 3ETUA 3F31A 3J7Yq 3V92A 5J2TE 2YU1A 2DI4A 2LOSA 4OYJA 1FGRA 4QX8B 3LJCA 5JR9A 2B1EA 2V1DB 1HG2A 2KMFA 5L3EB 5JREA 1D0XA 2V7LA 1FGTA 5FXXA 3NBXX 3BNDA 2KXPB 2WXTA 1MIWA 4MLKA 3HKEE 3CKDA 3CX6B 2H7VC 4ZI3D 2D0TA 3N2OA 4OK0A 4QXCB 5CA0E 1YD8G 1WYCA 2RA1A 3FB2A 4K0UA 5DJQC 2EHOB 2LM9A 1ZV4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRH A;  1CA1 A;  3O8Y A;  3FG3 A;  1LPA B;  3VF1 A;  3V92 A;  2WY6 A;  1KHO A;  1JNQ A;  3BNE A;  2P0M A;  1FGR A;  1BU8 A;  3FG1 A;  4NRE A;  1LNH A;  1HPL A;  1QMD A;  2PPL A;  1FGO A;  1FGM A;  1RRL A;  1FGT A;  1NO3 A;  1W52 X;  2FNQ A;  3BND A;  1QM6 A;  3CWZ B;  1GYG A;  2SBL A;  2WXT A;  3PZW A;  4WHA A;  4WFO A;  1N8S A;  2DWG A;  2WXU A;  3V98 A;  1ROV A;  1GPL A;  1ETH A;  1YGE A;  1LOX A;  5EEO A;  2PVS A;  4QWT A;  3BNC A;  3FG4 A;  1F8N A;  4GIW A;  1N8Q A;  2IUJ A;  1OLP A;  1IK3 A;  2IUK A;  1FGQ A;  2OXE A;  3BNB A;  2DWK A;  1LPB B;  2CXL A;  1HU9 A;  1Y4K A;  2CXF A;  3V99 A;  1RP1 A; 
#chains in the Genus database with same CATH topology
 2Z6E A;  2A3D A;  1LKX A;  4EYY R;  1J5E T;  2WWV A;  3V98 A;  3HL6 A;  4LF6 T;  3QUJ A;  3VR8 A;  5LBM A;  5LGU B;  4DV4 T;  4NUV A;  3KV4 A;  4AKH A;  3JAD A;  2MYS A;  4HFV A;  5FKY A;  4LF7 T;  5ABE A;  3BNE A;  5EK4 A;  1T7S A;  3JCF A;  3DJB A;  3VHL A;  2IAK A;  5CGM A;  3PDY A;  3U6G A;  4HFD A;  2XAF B;  3F57 A;  3AE9 A;  3ZT7 A;  3AA0 B;  3NZP A;  2BKO A;  4PJJ A;  2W63 A;  2IUB A;  4CN1 A;  3ZPO A;  1HNZ T;  1BR4 A;  2LRL A;  1UCU A;  4ILC A;  3UU3 A;  3B13 A;  3FBZ A;  5CJ5 A;  2VVN A;  2CM0 A;  3BNB A;  3HKD E;  5FVK A;  3MK7 C;  5IYZ E;  2JQQ A;  4LF5 T;  2PTF A;  3CQX C;  4OFZ A;  5HYA A;  5M4Y A;  2J62 A;  2NWB A;  2I0M A;  3E22 E;  2WZH A;  4GOU A;  4WZX A;  2UUA T;  4JUY A;  1N32 T;  2VB6 A;  3UU8 A;  2XQ8 A;  4IDN A;  4AI6 A;  2BKN A;  2HN2 A;  1WRD A;  4DBQ A;  4X62 T;  4YY3 T;  5F8P A;  5L3D B;  1NEN A;  1XNQ T;  3KFW X;  4OYK A;  5AQF B;  2YIN A;  2X68 A;  5E0O A;  5FL0 A;  4JI1 T;  1OED C;  1W52 X;  3KBU A;  2W00 A;  3TLU A;  5FP3 A;  3H3A A;  4IT4 A;  3ZMT B;  5AQO B;  3PUW F;  3QC9 A;  4YTM A;  2YDS A;  2KLQ A;  4JLE A;  4ZI2 C;  2C0S A;  3C51 A;  4HWH A;  2WY6 A;  3CX7 B;  2WS3 A;  1KHO A;  5JDL A;  4PK6 A;  4QWN B;  1W0B A;  2XFE A;  3NWI A;  2LKG A;  2A2F X;  2FNQ A;  2QA7 A;  4UV8 B;  4IDZ A;  2L8K A;  2NP9 A;  5LJM A;  3OPC A;  3AA6 B;  3ONL C;  3FZL B;  2XQ9 A;  3RQU A;  3AEA A;  4YSY A;  3ZST A;  3DP7 A;  1W0A A;  4U7Y A;  5AQP B;  4X20 E;  1IJ6 A;  2Q9Q A;  2EHO A;  2X0L B;  4TX5 A;  3VKG A;  4BJM A;  4WNK A;  4CXX A;  2W0G A;  2BS4 A;  5L4H A;  3T8O A;  3SRZ A;  5JR9 B;  2DNX A;  3SFE A;  3BK9 A;  2LSJ A;  3RIA A;  3BNC A;  2ZM2 A;  2KSR A;  2HHH T;  3MXZ A;  4TV9 E;  3OJA A;  1RP1 A;  3ZCJ A;  4AQF A;  5AQH B;  4IDO A;  5AQL B;  4O2B E;  2PBI A;  2E9X C;  5AQS B;  1HF8 A;  2IW5 B;  2IC6 A;  3JC6 D;  3AVS A;  2NOX A;  2QZ7 A;  4MFR A;  1VRB A;  5LG3 A;  1Z8U A;  3I9W A;  5AQI B;  3RIF A;  2ZM0 A;  2L9Q A;  4A56 A;  3BQL A;  1AJ3 A;  3ZC1 A;  4I55 E;  3L3P A;  1IK3 A;  1HR0 T;  1KF6 A;  4L9I A;  4YHJ A;  4QH1 A;  1M62 A;  1S94 A;  3IEE A;  2K48 A;  3KDS E;  2H89 A;  5FNV E;  5FY0 A;  1N36 T;  4ZI2 D;  1E2A A;  3G06 A;  2YN6 A;  4TZ4 C;  3W15 B;  4ZI3 C;  2HN1 A;  4YFS A;  4UF0 B;  5L3B B;  4CI3 B;  3IHR A;  4YJ3 E;  4IL4 A;  1YKE B;  2B76 A;  2VL0 A;  2E5L T;  4H9O C;  4X1K E;  1D0Z A;  1WCR A;  2AE9 A;  4XBF B;  3UUX B;  4UVC B;  4MHC A;  3RGL A;  3RF1 A;  3KVB A;  5JR9 C;  5KDM C;  1BR1 A;  1IZN B;  1EZ3 A;  3GMI A;  5HXH A;  3BQK A;  1MIY A;  2KXV A;  4EV6 A;  1KFY A;  3O9X A;  2RPA A;  2KWH A;  1KEY A;  1D0Y A;  4JV5 T;  3TKL B;  3AED A;  4H9S E;  3EDU A;  2P0M A;  3FG1 A;  5AQK B;  3IBP A;  3N2G E;  4UEL A;  5JH7 E;  4LF4 T;  1HTJ F;  2LT3 A;  4LFA T;  4GIW A;  5JRC B;  5IUX A;  5AFU L;  3CQC B;  5LB7 B;  2ACZ A;  2F4V T;  2LHR A;  3OTO T;  5BMV E;  5HXC A;  2YEV C;  2D9D A;  3K8P C;  2VKD A;  2XAG B;  2I59 A;  3PU8 A;  2A72 A;  3CIR A;  2LM2 A;  1OXZ A;  3ESL A;  3P4P A;  3TLS A;  2XQ5 A;  4EYU A;  3AA7 B;  2LRK A;  5LJN A;  3C64 A;  2WWU A;  3P4W A;  4G63 A;  4MBQ A;  1RRH A;  1CA1 A;  1NWM X;  2ES0 A;  4KBM B;  1YW0 A;  2LLY A;  5HCJ A;  2X51 A;  3T1Y T;  4ZHQ E;  3H3M A;  2BDE A;  2NTY A;  5L3G B;  1Y01 A;  4QKN A;  1UK5 A;  2YOE A;  3GWH A;  3ETU A;  3F31 A;  1I6Z A;  3V92 A;  2YU1 A;  1FGR A;  4DR4 T;  5L47 A;  1HG2 A;  2V7L A;  2LGE A;  3BND A;  4GKJ T;  4MLK A;  3HKE E;  4ZI3 D;  3AEC A;  1WYC A;  4A5X A;  4ZZB A;  3Q5D A;  2H88 A;  3B57 A;  2CPT A;  4TWD A;  3AEG A;  1WR0 A;  3L09 A;  1WFD A;  4P1N A;  4HE8 A;  4QWT A;  5IHY A;  5FY7 A;  5F5W A;  1LPB B;  2KZ7 B;  1U4Q A;  1N33 T;  3RLF F;  5JRC A;  2CEA A;  4CN4 A;  2IHR 1;  2HH7 A;  4FI5 A;  1XMO T;  3N9N A;  5J2U E;  4LML A;  2CLY B;  1OED B;  3MAC A;  2CXF A;  4YXD A;  2CHO A;  5HAX A;  4IE6 A;  1D1B A;  2QNG A;  2LHN A;  2WP9 A;  3EVY A;  2Y48 B;  1QM6 A;  3QB5 K;  4DV0 T;  1UX4 A;  2UUB T;  4AKG A;  5TAO A;  3LFM A;  3ZMS B;  3VKH A;  2X9X A;  4X5T A;  3CK6 A;  2JMH A;  1MNE A;  2CBI A;  3UFG A;  3PZW A;  5DQV A;  3Q5W A;  3UT5 E;  4DO0 A;  2XAJ B;  2YDR A;  3L39 A;  1KNP A;  2OLT A;  2QYW A;  3PV0 F;  3J9X 1;  2VKJ A;  4H63 V;  1BR2 A;  3LK2 B;  3SFD A;  2BVM A;  2BG9 A;  2MOZ A;  2M6I A;  4QEY A;  5J1G A;  1G8X A;  2XQ4 A;  4ZS2 A;  2XPK A;  3ZJ1 A;  4GKK T;  5LGN B;  2K3W A;  4UVB B;  4DV2 T;  1B7T A;  5FXW A;  2XQ3 A;  3VRB A;  3UUL A;  2BS3 A;  3LBX B;  4AIU A;  5CB4 E;  5EZY E;  4U31 A;  3AE5 A;  5AQU B;  5FXV A;  2ACX A;  3A8Y C;  3KV5 A;  4A97 A;  4QHO A;  2L3L A;  3TLT A;  4UIG A;  3Q5E A;  4YSZ A;  4DID B;  1HPL A;  2FJB A;  2JQ9 A;  3N9M A;  1X79 A;  4GYR A;  1WR6 A;  3FG4 A;  2BBJ A;  1N8Q A;  1J1J A;  4ZEY A;  5FXZ A;  3QNU A;  2DL1 A;  2JRK A;  5HEJ A;  2WB5 A;  2W67 A;  2VK9 A;  3PUQ A;  3AEB A;  4HFC A;  4IIJ E;  1IBL T;  1HNW T;  4CI2 B;  4AXP A;  5LHG B;  2VKH A;  2E2A A;  1G73 A;  1MND A;  3Q5X A;  2E5V A;  1FJG T;  4N78 D;  4C90 A;  3E0Z A;  3AE8 A;  4EED A;  3UU5 A;  1MMG A;  5HWY A;  1T8B A;  3L8R A;  4O8S A;  4WBN E;  1UUS A;  2UXX B;  4JYA T;  2SBL A;  3ANW A;  3ZMZ B;  3PE0 A;  3JAE A;  5HXS A;  3AB3 B;  5AQV B;  4NIQ A;  3RYI E;  2WM9 A;  3I0O A;  4JI6 T;  2DLR A;  2X9W A;  1GYG A;  2Q9Q B;  4H63 H;  3OVU A;  5LHI B;  3NZQ A;  2LSI A;  2XQ7 A;  4HN9 A;  2JJ9 A;  3N9L A;  4HFE A;  3OYZ A;  3RYC E;  3VF1 A;  2UUC T;  2W61 A;  3MZK B;  5HEO A;  2CA5 A;  4DV3 T;  4LFB T;  2IIU A;  2OA5 A;  1QMD A;  1VCT A;  3LK3 B;  1T98 A;  4F8H A;  3P8C D;  2EHO D;  2XQ6 A;  2UXN B;  4KI0 F;  4EZH A;  3ABV A;  3O8Y A;  2C5I T;  3ZKR A;  1DU2 A;  3N5L A;  2V6Y A;  5LGT B;  2KWI B;  2N9D A;  2G0U A;  3ZT6 A;  1W9R A;  4PJM A;  3C4Z A;  2CXL A;  5LHH B;  4JEH B;  2XAQ B;  2WBL A;  2VL8 A;  1MMD A;  2V6Y B;  1NEK A;  4DR7 T;  2QGS A;  4AQF C;  1FEW A;  5LXT E;  4CQI A;  1M7K A;  1HNX T;  2E9X A;  4AKL A;  2NR4 A;  4PK4 A;  3P4R A;  4BJN A;  3F2E A;  4WFO A;  1UUR A;  1FMV A;  3PUR A;  4QH5 A;  2FJE A;  4NUU A;  5IWA T;  5A1L A;  2X0H A;  2WQY A;  3CQG B;  2X9H A;  4M1P A;  2CXD A;  3LK4 2;  3PUZ F;  2W4X A;  5J0Z A;  1XZY A;  3NVO A;  5HEU A;  1S35 A;  2Q9Q C;  3RYH E;  1IAP A;  3ZMV B;  3PUA A;  4Q25 A;  4EB6 E;  5HCM A;  2LE8 A;  5KX5 E;  1FMW A;  4IE0 A;  2WU5 A;  3ZCI A;  1Y64 B;  3RPU A;  2DCF A;  2D2S A;  2P9B A;  3N9Q A;  4ASK A;  4DND A;  4PAG A;  3EAM A;  3SS1 A;  5FY1 A;  3CVR A;  3PUY F;  2DI4 A;  4OYJ A;  5JR9 A;  2B1E A;  1YXR A;  5JRE A;  4DV7 T;  5FXX A;  2WXT A;  4CN6 A;  2H7V C;  3N2O A;  4OK0 A;  3FB2 A;  3M3Z B;  3RX6 A;  2CBJ A;  4LF8 T;  2WY2 A;  2XAH B;  4HWF A;  3QOF A;  2LEH A;  4U7I A;  3GA8 A;  2IDO B;  2XHJ A;  4P0B A;  1SHZ C;  4V1A v;  3UU6 A;  3RKG A;  5AQQ B;  2NW7 A;  4COF A;  4DV1 T;  1UGO A;  1WLX A;  2HPL A;  3V99 A;  5FVL A;  3RH3 A;  4PW8 A;  4AKI A;  2XUE A;  4NXM T;  2ZM8 A;  5GON E;  4EGW A;  1FGM A;  3VR9 A;  3PUV F;  1FIO A;  5JDM A;  1T72 A;  2E9X D;  3C98 B;  3EI0 A;  3IBZ A;  2XHH A;  3MA9 A;  2OXE A;  3R6N A;  3LG7 A;  2V7K A;  4TN7 B;  3M65 A;  4TNW A;  5C8Y E;  4ZS3 A;  5AQJ B;  3LSV A;  4B3M T;  2YKS A;  4IL9 A;  4JI7 T;  2BBH A;  1KNR A;  2UXC T;  3AEE A;  2X66 A;  2XM1 A;  3EHZ A;  3KBT A;  1D1A A;  4TNV A;  2VAS A;  1UX5 A;  3PU3 A;  4PNI A;  2V7I A;  3O4X E;  4ADZ A;  2K9A A;  1HCI A;  4IRE A;  1ROV A;  5H6R B;  4XAX B;  1ZKE A;  1I94 T;  4HKA A;  3ZSS A;  2MTQ A;  1ZHC A;  5C2T A;  1QUU A;  3O1H A;  1QLB A;  4ZI7 E;  2CHN A;  3IA3 A;  3T1H T;  2W66 A;  2PG8 A;  4O4I E;  3OBV E;  1LVK A;  4BAY B;  1N8S A;  4YSX A;  3AE2 A;  2XJ7 A;  4CZZ B;  5EK3 A;  4EOZ B;  4YTP A;  2WSS V;  3S4U A;  3RKO A;  1HU9 A;  4TV8 E;  2WDV A;  4O4L E;  4IE4 A;  5L3C B;  2EHO C;  4NXN T;  2LSG A;  3A7M A;  3ZC0 A;  2WDR A;  3Q2M A;  4DR5 T;  5HWX A;  1FGQ A;  2D5U A;  3RC3 A;  2YDQ A;  4WYV A;  4YT0 A;  3AE6 A;  3QK6 A;  1N34 T;  3EDV A;  2XAS B;  3FXD B;  1RRL A;  3CWZ B;  4H9N C;  3ZYM A;  3UTK A;  3HKC E;  3RIU C;  2Q9Q D;  2WAU A;  3FZF B;  4HGA A;  4B3R T;  2Y8D A;  2H3R A;  3ZN1 B;  3NRY A;  2UU9 T;  2QVA A;  4GK5 E;  3VU7 H;  5AQG B;  2LSK A;  2WCA A;  1ZOY A;  4O4J E;  5JDQ A;  3FZM B;  1KNZ A;  4A98 A;  5H6Q B;  3RHW A;  4UXN B;  4HFB A;  2UXB T;  2BG9 B;  2W2U A;  3MKD A;  4FJO A;  3KVA A;  4IDQ A;  5JDF A;  3EUH A;  2VQF T;  2XTL A;  1U5P A;  3RI5 A;  2WDQ A;  1HX1 B;  2FBW A;  4JI3 T;  1CUN A;  2FJA A;  3AE7 A;  1YKH B;  3SWH A;  3GN5 A;  2XHE B;  4PK5 A;  4OHF A;  4ZOL E;  2ZMA A;  4CXY A;  4LFC T;  1O3X A;  2PVS A;  5KXJ A;  3N9O A;  2CRB A;  4U2Z A;  2GK9 A;  3ZYL A;  3BQI A;  3OYX A;  5HEG A;  2M6B A;  4DUZ T;  3UUM A;  2XM2 A;  1LOX A;  1JNR A;  2XFD A;  2CCQ A;  4JI4 T;  4IE7 A;  2NTX A;  4DVD A;  3UU4 A;  1W09 A;  4ERR A;  4F6R C;  5FMN A;  3C50 A;  1SUM B;  2PJQ A;  4LMK A;  4I0U A;  3RIU A;  5ABH A;  1YQ4 A;  3PJA A;  4P09 A;  2JQK A;  2C5K T;  2JPF A;  2WMN A;  3TLV A;  3CML A;  4DV6 T;  2A9U A;  4ZZC A;  4K0K T;  3FG3 A;  3ZLI A;  1OED A;  4HFI A;  4IGU A;  4H9P C;  3P50 A;  2MPK A;  1D1C A;  4IST A;  3A5X A;  2SPC A;  1YGE A;  2LSY A;  4QX7 B;  3ZMU B;  3ONX A;  2K24 A;  3Q9D A;  4Z91 A;  3FXE B;  3FZH B;  5HXE A;  1IBK T;  4BA9 A;  3VRA A;  5LOV E;  3LBX A;  4WHA A;  1ZEE A;  3ZEF B;  4DUY T;  5LYJ E;  1L0V A;  1E7P A;  3JC6 C;  2OV9 A;  3O1J A;  4JBW F;  4H9R C;  4L5G A;  3PUX F;  3HA4 A;  3I1A A;  4JI8 T;  5F3J A;  2ODU A;  2KIN B;  4DR6 T;  2W62 A;  3PUG A;  5AQM B;  2WXU A;  1GPL A;  4G2A A;  5LBQ B;  2J47 A;  1H7C A;  2NW8 A;  2LG7 A;  2DWK A;  4U74 A;  4EIW A;  3QB5 A;  5ETW A;  3UQ7 A;  1XDO A;  2LOS A;  4QX8 B;  3LJC A;  2V1D B;  2KMF A;  2BKP A;  5L3E B;  3NBX X;  3NKZ A;  4UR9 A;  2D0T A;  3AE4 A;  4JI2 T;  4LF9 T;  4ZXL A;  2RA1 A;  4K0U A;  2LM9 A;  2NW9 A;  4DR1 T;  2ZM6 T;  3O1I A;  2LKH A;  4UV9 B;  2XY8 B;  3AAE B;  2PFV A;  2V6X A;  4KP3 C;  4U33 A;  2J4G A;  3CX8 B;  2VVS A;  4WW0 A;  4J2C A;  4DMW A;  3HKB E;  4B6X A;  3AE1 A;  3U3I A;  1Z0P A;  2BS2 A;  4HEA A;  4AQG A;  1LNH A;  2PPL A;  1NO3 A;  2FJD A;  4MAL A;  2LJL A;  3KIN B;  1R8I A;  2DWG A;  4ANJ A;  1MMN A;  2X67 A;  4DBR A;  2C5J A;  3I9Y A;  1VCS A;  4E7S A;  4KHZ F;  5LCY A;  2XQA A;  4UEM A;  4WBO A;  3FZK B;  4CXW A;  2MBG A;  4UVA B;  3AXJ A;  5LNK A;  5JDG A;  2J1D G;  5DQW A;  4QXB B;  3RQW A;  3RRW A;  4AQY T;  3AAA B;  2E8I A;  2V5D A;  1LPA B;  4TWH A;  3V5U A;  2MAW A;  4YTN A;  5JQG E;  4X1Y E;  4H9Q C;  3MJX A;  3AAI A;  5JVD E;  5EK2 A;  2IC9 A;  2XZE A;  3NRX A;  2VUR A;  4DR3 T;  3K1S A;  4PFO A;  4I43 B;  3U78 A;  3UQ4 A;  2V7J A;  4TUY E;  5HXR A;  3AVR A;  2BZB A;  1OWA A;  2VWA A;  5JDN A;  4I4T E;  1BR0 A;  1SE7 A;  3D0T A;  4YJ2 E;  3JAF A;  1VOM A;  4HTE A;  2V5C A;  2D0U A;  1LVF A;  2VKO A;  1JNQ A;  2WZI A;  3ZT5 A;  1IJ5 A;  1US7 B;  2ODV A;  3ZYK A;  5LMU T;  2KND A;  2JMK A;  5AQR B;  5L2L A;  4HFH A;  1OLP A;  2YU2 A;  2YK0 A;  4EEB A;  3PJA J;  4KMC A;  5L3F B;  3RRC A;  2Y6X A;  3AEF A;  4TWF A;  4U3C A;  5ADX L;  3CPZ A;  1OED E;  1HG5 A;  3FBL A;  4Z90 A;  3IF8 B;  1YQ3 A;  1X9B A;  4EAH A;  3P7I A;  3C4X A;  3K3O A;  3WAK A;  2UXD T;  3EAB A;  3I0Q A;  5EEO A;  4DV5 T;  1HX8 A;  5JTG A;  2N2N A;  5AQT B;  2CLY C;  4LMJ A;  3ZJ2 A;  1V9D A;  2IML A;  2FUP A;  3PTR B;  4IDP A;  2N1G A;  4EZ4 A;  4X64 T;  1XWM A;  3AXJ B;  4I50 E;  2JQH A;  2JIW A;  2IUK A;  1ZP0 A;  5CFB A;  2WU2 A;  4O4H E;  5KMG P;  5FYM A;  1NAF A;  3LDQ B;  2CMR A;  4E7Z A;  5JDH A;  4X1I E;  2XSB A;  5BR8 T;  3AE3 A;  3DTO A;  4XZC A;  4L0R A;  2XQY A;  2CWO A;  2M67 A;  3ETV A;  3RC8 A;  1J5W A;  5AQN B;  3R84 B;  2VQE T;  1SA0 E;  4PJL A;  2DHR A;  3ZN0 B;  3B5M A;  3RYF E;  4AIS A;  3UUN A;  4DR2 T;  1WYB A;  2XSA A;  4KUM B;  5LG4 A;  4JI0 T;  1LRZ A;  2LOP A;  3V5S A;  4ISS A;  3AA1 B;  2BG9 E;  4P0A A;  1CHU A;  4PFP A;  1HS7 A;  3N2K E;  4B3S T;  2CWY A;  4AKR B;  4IHJ E;  2BVL A;  4YLH A;  2AXD S;  3K3Q C;  2RP4 A;  3WI3 A;  3PUS A;  4JEU B;  3E08 A;  3N9P A;  4Z8X A;  3KV9 A;  2R6G F;  2HPJ A;  3P4Q A;  5DAB A;  1XDP A;  2E9X B;  4U72 A;  3SOL A;  4X65 T;  4ILU A;  4NRE A;  3FHN A;  4HWI B;  2V8S V;  4GYS A;  2LRG A;  1KK7 A;  2CE7 A;  1F8N A;  5LP6 E;  1Y4K A;  3GN5 B;  2BG9 C;  5FL1 A;  5ABG A;  1QSD A;  5HEH A;  4UF0 A;  1HFA A;  3C4W A;  4CI1 B;  2X9Y A;  1JNZ A;  1MIV A;  1IBM T;  2KXT A;  2H7O A;  4ILA A;  4B3T T;  1ETH A;  2X0Y A;  2IUJ A;  3KV6 A;  4IE5 A;  2V7M A;  2WMO A;  3HI2 A;  4HWC A;  4QH4 A;  4OX9 T;  3K3N A;  4C91 A;  3TLW A;  2ZLY A;  5LA6 E;  4GK0 E;  4O2A E;  3UFE A;  4YHH T;  3ONJ A;  4U2Y A;  1FGO A;  5CA1 E;  4KHP T;  1E1H B;  3HR0 A;  4X66 T;  5L4E A;  2KT9 A;  1GQE A;  2QRX A;  3UUB A;  4EXT A;  3H37 A;  1MMA A;  1BU8 A;  5C3J A;  3OKQ A;  2K5B B;  3WAJ A;  3X1D A;  4NPP A;  5ABF B;  4QXH B;  4ILB A;  4PJN A;  2V26 A;  4DMV A;  2I6H A;  3ANW B;  1XNR T;  1XMQ T;  3J7Y q;  5J2T E;  5ABF A;  4HWD A;  1D0X A;  1FGT A;  4JI5 T;  2KXP B;  4KX6 A;  5LMN T;  1MIW A;  3CKD A;  3CX6 B;  3P4S A;  4QXC B;  5CA0 E;  1YD8 G;  5DJQ C;  2EHO B;  1ZV4 X; 
#chains in the Genus database with same CATH homology
 2Z6E A;  3RX6 A;  2NW9 A;  2A3D A;  2XAH B;  3O1I A;  1LKX A;  3B57 A;  4UV9 B;  4EYY R;  3AAE B;  2LEH A;  2PFV A;  3L09 A;  4KP3 C;  3GA8 A;  3V98 A;  4P0B A;  1SHZ C;  3HL6 A;  4V1A v;  3CX8 B;  3QUJ A;  4HE8 A;  4QWT A;  4WW0 A;  5IHY A;  2NW7 A;  4J2C A;  5LBM A;  5FY7 A;  4DMW A;  5LGU B;  1LPB B;  4NUV A;  3KV4 A;  4AKH A;  1WLX A;  2KZ7 B;  1U4Q A;  2HPL A;  3HKB E;  4B6X A;  3V99 A;  3U3I A;  1Z0P A;  2MYS A;  3RH3 A;  4PW8 A;  4AKI A;  4HFV A;  2XUE A;  4HEA A;  5JRC A;  3BNE A;  4AQG A;  2ZM8 A;  2CEA A;  1LNH A;  5EK4 A;  5GON E;  3DJB A;  2HH7 A;  3VHL A;  4FI5 A;  1FGM A;  2PPL A;  2IAK A;  1NO3 A;  3PDY A;  1FIO A;  4MAL A;  2LJL A;  3KIN B;  2DWG A;  5JDM A;  2E9X D;  3C98 B;  3N9N A;  5J2U E;  4ANJ A;  3MA9 A;  2OXE A;  2XAF B;  3F57 A;  2CLY B;  3MAC A;  3R6N A;  1MMN A;  3LG7 A;  2X67 A;  2CXF A;  2V7K A;  3AA0 B;  4TN7 B;  4DBR A;  2C5J A;  3I9Y A;  3M65 A;  3NZP A;  4IE6 A;  5HAX A;  5C8Y E;  4E7S A;  5LCY A;  4PJJ A;  1D1B A;  2W63 A;  4UEM A;  4WBO A;  4ZS3 A;  2LHN A;  3ZPO A;  4CXW A;  1BR4 A;  2MBG A;  3EVY A;  1UCU A;  4UVA B;  2Y48 B;  5LNK A;  1QM6 A;  3B13 A;  5JDG A;  3FBZ A;  1UX4 A;  4AKG A;  2J1D G;  5DQW A;  4QXB B;  2CM0 A;  5TAO A;  3RRW A;  3LFM A;  3AAA B;  3BNB A;  3ZMS B;  3HKD E;  2X66 A;  3MK7 C;  2E8I A;  3VKH A;  5IYZ E;  2JQQ A;  2X9X A;  1LPA B;  3V5U A;  3CQX C;  3KBT A;  1D1A A;  4OFZ A;  5HYA A;  2JMH A;  5M4Y A;  2VAS A;  1MNE A;  2NWB A;  1UX5 A;  3PU3 A;  4PNI A;  5JQG E;  2V7I A;  3E22 E;  4GOU A;  4X1Y E;  3O4X E;  4ADZ A;  3PZW A;  4H9Q C;  3MJX A;  3AAI A;  5DQV A;  2K9A A;  1HCI A;  3Q5W A;  5JVD E;  5H6R B;  4XAX B;  3UT5 E;  1ZKE A;  4DO0 A;  1ROV A;  5EK2 A;  4HKA A;  4JUY A;  2XAJ B;  2VB6 A;  2IC9 A;  4AI6 A;  2MTQ A;  1ZHC A;  1WRD A;  4DBQ A;  3NRX A;  1QUU A;  3O1H A;  5F8P A;  3J9X 1;  5L3D B;  4PFO A;  4ZI7 E;  2VKJ A;  3KFW X;  4OYK A;  4I43 B;  3U78 A;  4H63 V;  1BR2 A;  3LK2 B;  2BVM A;  2PG8 A;  2V7J A;  2YIN A;  4TUY E;  5HXR A;  4O4I E;  3OBV E;  2X68 A;  2MOZ A;  3AVR A;  1LVK A;  5E0O A;  1W52 X;  3KBU A;  2W00 A;  5J1G A;  4BAY B;  1G8X A;  2BZB A;  1OWA A;  1N8S A;  5FP3 A;  3H3A A;  4ZS2 A;  3ZJ1 A;  3ZMT B;  4CZZ B;  5EK3 A;  2VWA A;  4EOZ B;  5JDN A;  2WSS V;  3QC9 A;  4I4T E;  3S4U A;  5LGN B;  3RKO A;  1BR0 A;  4UVB B;  1HU9 A;  2KLQ A;  3D0T A;  4JLE A;  4YJ2 E;  4ZI2 C;  4TV8 E;  1B7T A;  2C0S A;  1VOM A;  4HTE A;  3C51 A;  2D0U A;  5FXW A;  1LVF A;  3CX7 B;  2WY6 A;  1KHO A;  2VKO A;  4O4L E;  1JNQ A;  4IE4 A;  5JDL A;  5L3C B;  2EHO C;  4PK6 A;  4QWN B;  3UUL A;  3LBX B;  1IJ5 A;  1US7 B;  2LSG A;  2A2F X;  2ODV A;  3ZYK A;  5CB4 E;  2FNQ A;  3ZC0 A;  2QA7 A;  3Q2M A;  4UV8 B;  5EZY E;  4IDZ A;  2L8K A;  2NP9 A;  2KND A;  2JMK A;  5LJM A;  5FXV A;  5L2L A;  1OLP A;  3AA6 B;  5HWX A;  2YU2 A;  2D5U A;  2YK0 A;  1FGQ A;  3RC3 A;  2ACX A;  4KMC A;  5L3F B;  3RRC A;  2Y6X A;  3KV5 A;  5ADX L;  3CPZ A;  4QHO A;  2L3L A;  1HG5 A;  3FBL A;  4UIG A;  3DP7 A;  3IF8 B;  3QK6 A;  4EAH A;  1HPL A;  3EDV A;  2XAS B;  3FXD B;  1RRL A;  3P7I A;  3N9M A;  1X79 A;  3C4X A;  3CWZ B;  4X20 E;  1IJ6 A;  3K3O A;  3WAK A;  4GYR A;  2Q9Q A;  4H9N C;  3ZYM A;  3UTK A;  2EHO A;  2X0L B;  3I0Q A;  1WR6 A;  3HKC E;  5EEO A;  3FG4 A;  1N8Q A;  4TX5 A;  5FXZ A;  1HX8 A;  2Q9Q D;  2N2N A;  3VKG A;  4BJM A;  2WAU A;  4WNK A;  4CXX A;  2JRK A;  4HGA A;  2CLY C;  2VK9 A;  2W0G A;  3ZJ2 A;  1V9D A;  2Y8D A;  2H3R A;  3PTR B;  3PUQ A;  3T8O A;  3SRZ A;  3ZN1 B;  5JR9 B;  3NRY A;  2DNX A;  2N1G A;  4IIJ E;  4EZ4 A;  4GK5 E;  3VU7 H;  2LSK A;  3BK9 A;  2LSJ A;  4O4J E;  4I50 E;  4CI2 B;  3BNC A;  5JDQ A;  2ZM2 A;  1KNZ A;  2IUK A;  4AXP A;  5LHG B;  2VKH A;  3MXZ A;  5H6Q B;  4TV9 E;  3OJA A;  1G73 A;  1RP1 A;  1MND A;  3Q5X A;  4UXN B;  4O4H E;  3ZCJ A;  4N78 D;  4AQF A;  5KMG P;  5FYM A;  3MKD A;  4FJO A;  4C90 A;  3E0Z A;  3KVA A;  5JDF A;  3EUH A;  1NAF A;  1MMG A;  5HWY A;  4O2B E;  2PBI A;  2CMR A;  2XTL A;  2E9X C;  1U5P A;  4O8S A;  4E7Z A;  1HF8 A;  2UXX B;  2IW5 B;  4WBN E;  5JDH A;  4X1I E;  2SBL A;  3ANW A;  2IC6 A;  3ZMZ B;  3JC6 D;  3AVS A;  2NOX A;  1CUN A;  3PE0 A;  4MFR A;  3DTO A;  1VRB A;  4XZC A;  5HXS A;  4L0R A;  2XQY A;  3AB3 B;  2CWO A;  2M67 A;  1YKH B;  3ETV A;  3I9W A;  3RC8 A;  3SWH A;  3RYI E;  3R84 B;  3GN5 A;  2XHE B;  1SA0 E;  2WM9 A;  2ZM0 A;  3I0O A;  2L9Q A;  4PK5 A;  4PJL A;  2DHR A;  3ZN0 B;  3RYF E;  2DLR A;  4OHF A;  4ZOL E;  3BQL A;  2X9W A;  4A56 A;  1AJ3 A;  3UUN A;  3ZC1 A;  4I55 E;  1GYG A;  2Q9Q B;  1WYB A;  4H63 H;  3L3P A;  2ZMA A;  4KUM B;  5LG4 A;  5LHI B;  4CXY A;  1O3X A;  3NZQ A;  2PVS A;  2LSI A;  3N9O A;  4HN9 A;  2JJ9 A;  1LRZ A;  1IK3 A;  2LOP A;  3N9L A;  2GK9 A;  4L9I A;  3V5S A;  4ISS A;  4YHJ A;  3ZYL A;  3BQI A;  3AA1 B;  3OYZ A;  1S94 A;  3RYC E;  4P0A A;  3IEE A;  2K48 A;  3KDS E;  3VF1 A;  3OYX A;  2W61 A;  5FNV E;  3MZK B;  5FY0 A;  4PFP A;  2CA5 A;  1HS7 A;  4ZI2 D;  3N2K E;  2OA5 A;  2CWY A;  4AKR B;  1QMD A;  4IHJ E;  3LK3 B;  4TZ4 C;  1T98 A;  2BVL A;  3W15 B;  4ZI3 C;  3P8C D;  4YFS A;  4YLH A;  4UF0 B;  2EHO D;  5L3B B;  4CI3 B;  3IHR A;  3K3Q C;  3UUM A;  2RP4 A;  4YJ3 E;  1YKE B;  3WI3 A;  3PUS A;  1LOX A;  4JEU B;  3E08 A;  3N9P A;  2CCQ A;  4H9O C;  4Z8X A;  2UXN B;  4IE7 A;  3KV9 A;  4X1K E;  2NTX A;  4EZH A;  4DVD A;  1D0Z A;  2HPJ A;  4XBF B;  3UUX B;  5DAB A;  4UVC B;  2E9X B;  4MHC A;  4U72 A;  3SOL A;  4ERR A;  2C5I T;  5FMN A;  4F6R C;  3O8Y A;  4ILU A;  3C50 A;  3KVB A;  5JR9 C;  2PJQ A;  5KDM C;  4NRE A;  3FHN A;  1BR1 A;  1IZN B;  3N5L A;  1EZ3 A;  3GMI A;  5HXH A;  5LGT B;  2KWI B;  1MIY A;  2N9D A;  3BQK A;  4GYS A;  2G0U A;  4P09 A;  3O9X A;  1KK7 A;  2C5K T;  2CE7 A;  2JPF A;  4PJM A;  1F8N A;  2WMN A;  2KWH A;  3C4Z A;  2CXL A;  5LHH B;  3CML A;  5LP6 E;  1Y4K A;  1D0Y A;  4JEH B;  2XAQ B;  3TKL B;  2WBL A;  3GN5 B;  2VL8 A;  1MMD A;  1QSD A;  4UF0 A;  3FG3 A;  1HFA A;  3ZLI A;  3C4W A;  4H9S E;  2QGS A;  2X9Y A;  4CI1 B;  3EDU A;  4AQF C;  2P0M A;  4IGU A;  3FG1 A;  1FEW A;  5LXT E;  1MIV A;  3IBP A;  4CQI A;  4H9P C;  3N2G E;  4UEL A;  5JH7 E;  2E9X A;  4AKL A;  1D1C A;  2H7O A;  4PK4 A;  4IST A;  4BJN A;  1HTJ F;  3F2E A;  2LT3 A;  4WFO A;  3A5X A;  1ETH A;  2SPC A;  1YGE A;  2LSY A;  4QX7 B;  4GIW A;  1FMV A;  3PUR A;  5JRC B;  2IUJ A;  3KV6 A;  3ZMU B;  3CQC B;  4NUU A;  5AFU L;  4IE5 A;  5A1L A;  2V7M A;  3ONX A;  2K24 A;  3Q9D A;  2WMO A;  3HI2 A;  3K3N A;  2LHR A;  3CQG B;  3FXE B;  4C91 A;  5BMV E;  5HXC A;  2YEV C;  2ZLY A;  5LA6 E;  4GK0 E;  5HXE A;  3K8P C;  4O2A E;  2X9H A;  3UFE A;  2VKD A;  2XAG B;  4M1P A;  2CXD A;  4BA9 A;  3LK4 2;  1FGO A;  2I59 A;  5LOV E;  5CA1 E;  3PU8 A;  3LBX A;  2A72 A;  4WHA A;  1ZEE A;  1E1H B;  3HR0 A;  1S35 A;  1OXZ A;  2Q9Q C;  3ZEF B;  3ESL A;  4EYU A;  2KT9 A;  3RYH E;  3AA7 B;  5LYJ E;  5LJN A;  3JC6 C;  3C64 A;  3O1J A;  1IAP A;  2WWU A;  3ZMV B;  4H9R C;  4G63 A;  3PUA A;  4MBQ A;  4EB6 E;  1RRH A;  2LE8 A;  1NWM X;  4EXT A;  5KX5 E;  2ES0 A;  1CA1 A;  4L5G A;  4KBM B;  3H37 A;  1MMA A;  1YW0 A;  1FMW A;  4IE0 A;  1BU8 A;  3OKQ A;  2X51 A;  1Y64 B;  3HA4 A;  3ZCI A;  3I1A A;  2K5B B;  3RPU A;  4ZHQ E;  2DCF A;  3WAJ A;  2D2S A;  5F3J A;  2ODU A;  2KIN B;  2W62 A;  2P9B A;  3N9Q A;  3PUG A;  2WXU A;  2BDE A;  2NTY A;  1GPL A;  4G2A A;  5LBQ B;  5L3G B;  1H7C A;  2NW8 A;  4QKN A;  2DWK A;  4ASK A;  4U74 A;  4DND A;  4QXH B;  4PAG A;  4PJN A;  4EIW A;  3SS1 A;  2V26 A;  4DMV A;  3ANW B;  5ETW A;  5FY1 A;  3CVR A;  3GWH A;  3ETU A;  3F31 A;  3J7Y q;  3V92 A;  5J2T E;  2YU1 A;  2DI4 A;  2LOS A;  4OYJ A;  1FGR A;  4QX8 B;  3LJC A;  5JR9 A;  2B1E A;  2V1D B;  1HG2 A;  2KMF A;  5L3E B;  5JRE A;  1D0X A;  2V7L A;  1FGT A;  5FXX A;  3NBX X;  3BND A;  2KXP B;  2WXT A;  1MIW A;  4MLK A;  3HKE E;  3CKD A;  3CX6 B;  2H7V C;  4ZI3 D;  2D0T A;  3N2O A;  4OK0 A;  4QXC B;  5CA0 E;  1YD8 G;  1WYC A;  2RA1 A;  3FB2 A;  4K0U A;  5DJQ C;  2EHO B;  2LM9 A;  1ZV4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...