3CWZB

Structure of rab6(gtp)-r6ip1 complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
336
structure length
310
Chain Sequence
NLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKLAVMSPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGLYAKWLVECVMVRNEVTGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSLPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Ras-related protein Rab-6A
total genus 87
structure length 310
sequence length 336
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01477 PLAT PLAT/LH2 domain
B PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cwzB01
2.60.60.20 Mainly Beta Sandwich Lipoxygenase-1 PLAT/LH2 domain 3cwzB03
2WY6A 3O8YA 1Y4KA 1LPBB 1QM6A 2DWKA 1LPAB 1LOXA 1GYGA 1RRLA 2PVSA 1ETHA 1FGTA 1ROVA 1OLPA 3V92A 1FGRA 1CA1A 2OXEA 1N8QA 3VF1A 2DWGA 4WFOA 1JNQA 2FNQA 1LNHA 2WXUA 2SBLA 4QWTA 2IUJA 1YGEA 4GIWA 1FGOA 1FGMA 1W52X 3BNBA 3BNEA 3FG1A 1GPLA 1RP1A 1N8SA 3FG3A 2CXLA 1HPLA 1HU9A 4NREA 2WXTA 1FGQA 1KHOA 2CXFA 1QMDA 3FG4A 3BNDA 3V98A 4WHAA 1NO3A 3V99A 1IK3A 2P0MA 1RRHA 2PPLA 3CWZB 3BNCA 2IUKA 5EEOA 1BU8A 1F8NA 3PZWA
chains in the Genus database with same CATH superfamily
3N2OA 4HFHA 1E1HB 4P1NA 2E5LT 1Z0PA 4DUZT 1VOMA 4NUUA 3P4PA 5TAOA 3RIUC 4UR9A 2D5UA 3O8YA 4C91A 4UEMA 2FJAA 5LBMA 4J2CA 4QHOA 4IDNA 4X1YE 2JQKA 1W0AA 2JIWA 5LJNA 2YU1A 1OEDA 5DQVA 2BKPA 1T8BA 1MMDA 3AE3A 2YU2A 1BR2A 3OVUA 3OKQA 3ZT7A 3AE6A 2WS3A 4ZI2D 3SRZA 5AQGB 3EDVA 1QSDA 4LF7T 1HX8A 4CI2B 2BVMA 1LKXA 2B76A 4EB6E 1XMQT 4TWHA 3EHZA 4JI3T 2ZLYA 1T72A 2WU2A 5FYMA 1FIOA 3MJXA 1IBKT 3RIFA 2XAHB 5LCYA 3P8CD 1IBMT 4TUYE 2IIUA 5FKYA 2LKGA 2BVLA 2Q9QC 1LPBB 3CK6A 4ASKA 3E08A 1JNZA 4GKKT 1RRHA 1M62A 2BS2A 1VCTA 4JEHB 4L9IA 4V1Av 5M4YA 2WSSV 3GN5B 2J62A 2NTXA 1UX4A 1XNQT 2A2FX 2LHNA 1N34T 2Z6EA 4ZI3D 3RKGA 2V6YA 1D0XA 3C4XA 3BNCA 2IMLA 3M3ZB 4YT0A 1MNEA 4DV6T 3AA7B 3O1HA 1KF6A 3UU5A 3B57A 4CI3B 5L4EA 3OJAA 4TX5A 3RYIE 4PJLA 2LE8A 1Y4KA 4CXXA 1RRLA 1ZV4X 1ETHA 3VKGA 4H9SE 4B3RT 5LNKA 3ANWB 2K48A 3VR8A 1W09A 2VL0A 5JH7E 3BQKA 1U5PA 1CUNA 4UXNB 2EHOC 4JI2T 2XUEA 1QM6A 2XM2A 1UURA 2DCFA 2FUPA 1YGEA 4EYUA 2LHRA 3LSVA 4LFCT 3JC6D 4E7ZA 5HAXA 3ZEFB 2XQ8A 4AXPA 3CVRA 2YN6A 3C4WA 4OYJA 3NZQA 2VQET 2C5JA 2ODUA 5FXZA 4YJ2E 5AQRB 2A3DA 2V6YB 1L0VA 4FI5A 3N9LA 3PUYF 2QA7A 3LK42 2BG9C 4IIJE 1HNWT 4UVCB 1I6ZA 2JQQA 4BAYB 5C8YE 2KT9A 1Z8UA 2UXBT 5H6RB 2PPLA 4KHZF 2V5DA 4QH5A 3MK7C 4KI0F 2IUKA 4YHHT 2BKOA 4X62T 3DJBA 3J9X1 2XAFB 4P0AA 1FGRA 3RIAA 2WWVA 2JQ9A 4H63V 5FXWA 2WB5A 3ZSSA 3WI3A 3TLWA 3KBTA 1VRBA 3HL6A 2X68A 2HHHT 2V7KA 3QUJA 3VRBA 1XDPA 4JYAT 5KDMC 4P0BA 3FXEB 2RP4A 4DO0A 4ISSA 4EAHA 3ZMTB 2N1GA 4I4TE 2W2UA 4LMJA 1FMVA 2ZM0A 5LYJE 4EYYR 1XMOT 2OLTA 4JEUB 5E0OA 4TN7B 5ABHA 4AI6A 4ZI3C 3O9XA 5EEOA 2UU9T 1J5ET 1M7KA 2VKDA 3H37A 4X5TA 3I9YA 5JDNA 2WY2A 2KWIB 1OEDE 3P4QA 1T98A 4DR6T 2BS4A 1J5WA 1QLBA 1SUMB 2BG9E 1MMGA 2KWHA 2KXVA 4YTPA 1U4QA 3AE8A 3HA4A 1D0YA 4WFOA 4K0UA 1HF8A 2Y6XA 2XFDA 3TLVA 2CPTA 5FVKA 3AA1B 1BR0A 3FZLB 4NPPA 5FNVE 2CBJA 1DU2A 4QH1A 2MPKA 3RRWA 4U2ZA 2QZ7A 2DL1A 3ZN0B 4U3CA 3EI0A 2LRGA 5AQKB 3GA8A 3FG3A 3RLFF 1BR1A 1YXRA 4O4JE 3ETUA 3OTOT 1IK3A 5HYAA 2M6BA 3KFWX 2E9XD 3IEEA 1S94A 3GMIA 4DR3T 3PUZF 5CB4E 3LJCA 1FGOA 1W52X 1WCRA 5FL1A 2E9XB 1NEKA 4LMLA 2I0MA 4I55E 2JQHA 2AXDS 3W15B 1FEWA 2ZM2A 4B6XA 4LF9T 2KZ7B 4X1KE 1OEDC 3N9OA 4IE0A 1LVKA 5JDGA 2YOEA 1YD8G 2Q9QD 1E2AA 3NZPA 2E8IA 2YK0A 4JI8T 2XQ6A 3ZMSB 4IDPA 4GK0E 3A5XA 1KNZA 3DP7A 2PTFA 3OYZA 1FMWA 2WY6A 4EIWA 4LMKA 3O1JA 4QX7B 2YKSA 3PUXF 3ABVA 4KP3C 2Y48B 3C64A 4BA9A 2NW8A 4EEDA 5L3GB 3O4XE 5HEHA 1KEYA 5L3EB 2QRXA 2BKNA 4LF6T 3RX6A 1QUUA 5ETWA 3JC6C 2XAGB 4AQYT 5H6QB 3AECA 2VL8A 4WNKA 4GK5E 5LHHB 3SFDA 4JBWF 2LSKA 4IL4A 3IA3A 4F6RC 5ABEA 5FXVA 3ZMVB 2NP9A 4YHJA 3K3NA 4AQFA 3PZWA 1NAFA 4MLKA 4P09A 1D1AA 5IHYA 1YQ3A 2B1EA 3ESLA 4WYVA 1HR0T 3CKDA 3KV6A 4HWFA 3BQLA 4OX9T 1XWMA 5LOVE 4O2BE 3ONXA 3ZSTA 1Y64B 1HTJF 3GN5A 2H3RA 3I0OA 2BG9B 4QXBB 2W66A 2X0LB 3FZHB 2LM2A 5HEOA 5L2LA 3U78A 2I6HA 2V26A 4N78D 3N9PA 3AEDA 2KINB 3FBZA 1D0ZA 3CMLA 3AEFA 3MKDA 3JADA 4EZHA 2WXUA 3LG7A 4KUMB 3PJAJ 3HKCE 1MMNA 3MACA 3RHWA 1N33T 4O4IE 2YEVC 4Z90A 3VR9A 3PUAA 2WZHA 1KNRA 4H63H 2HPLA 3QC9A 4E7SA 3B5MA 3NRYA 5ADXL 2IHR1 2J47A 4XZCA 4BJMA 2NWBA 3AA0B 2RA1A 2KSRA 4UVAB 1HU9A 5JRCA 2CXFA 4IE6A 2A72A 5JR9A 4AKHA 3CX7B 3U3IA 3PU3A 2JMHA 4M1PA 2XFEA 2V7LA 3NVOA 3UQ7A 3AEBA 3CQXC 4YFSA 4HFDA 2V7JA 3M65A 2WXTA 1YQ4A 3JAFA 2YINA 3AE9A 3PJAA 5HEGA 2XQ3A 4HFIA 4PFPA 3PV0F 2BZBA 2DLRA 1OLPA 2PFVA 2HN1A 2H89A 3Q5EA 4JUYA 1UK5A 1IAPA 5AQOB 2UXNB 4WZXA 3ZT5A 3CQGB 1LVFA 3K3QC 2VKJA 3VF1A 3CX6B 4QXHB 1N8SA 3RGLA 5J1GA 3FHNA 2OV9A 5EK3A 3TKLB 4ERRA 2J4GA 2CWYA 3AXJA 1GYGA 3JCFA 3KV4A 3V5SA 4PJNA 4BJNA 3HI2A 3P4SA 4IE7A 4ZHQE 2BDEA 4NUVA 5HCJA 4OHFA 2CXLA 1D1BA 3UFEA 3FZKB 5JTGA 1IJ6A 4COFA 3V99A 3T8OA 4MFRA 5AQUB 4DBQA 3KV9A 3I9WA 2CXDA 2YDRA 5ABGA 5LMUT 3ETVA 3ZC0A 4CQIA 1OWAA 3UU6A 1N32T 2EHOA 4ZEYA 1W9RA 4DV2T 2IUJA 4DMVA 2XPKA 4Z91A 1XDOA 4JI5T 1RP1A 4AKGA 5EZYE 4YSZA 2CM0A 3PDYA 4ILBA 5JRCB 4U2YA 2L8KA 3QB5K 3C4ZA 3ZLIA 2C0SA 4U72A 2CLYC 4DBRA 2LLYA 1BU8A 2XQYA 1LOXA 2IUBA 4AKLA 2W63A 2X67A 3T1YT 4TWFA 3H3AA 4ANJA 4AQFC 2LSGA 2UXDT 4EZ4A 4U7YA 2CHOA 5LMNT 5KXJA 4HFCA 2W4XA 3A7MA 2LSIA 2E2AA 5L3FB 5JDFA 3IF8B 3LBXB 1S35A 2L3LA 4PFOA 3ZC1A 2XHEB 4IDOA 4YXDA 1MIVA 4QX8B 2G0UA 5LGTB 1KK7A 1X79A 5HWYA 4A98A 4DR7T 5JREA 2CMRA 3EABA 4OYKA 2X66A 3UUNA 4DV5T 1QMDA 3HKBE 2KXTA 2LRLA 2X0HA 3N5LA 3UUBA 5F5WA 2BBJA 2FJDA 5CGMA 2FJBA 3E0ZA 3P4RA 2XQ4A 4KBMB 3EAMA 2CWOA 3AAEB 2WM9A 3QK6A 3OPCA 2W0GA 5CA1E 4EOZB 3AE5A 5L3CB 3L3PA 5KX5E 2UUCT 4UV8B 4DIDB 5LG4A 1NENA 4JI7T 3N2GE 3RKOA 4DR1T 4TZ4C 2C5KT 4X1IE 4MALA 2Q9QB 2LKHA 4EXTA 1IZNB 3JAEA 2HN2A 4HWHA 2GK9A 3NBXX 2XM1A 3BNEA 4PK5A 3C98B 1WLXA 3TLTA 3P50A 4O4LE 3PTRB 4EEBA 2XSBA 3I1AA 5JR9C 1SE7A 2M6IA 1UUSA 3BQIA 4L0RA 3ZMUB 4GOUA 2X9YA 3K1SA 5DQWA 3UTKA 3FXDB 4YY3T 5L47A 5LG3A 4G63A 4CN6A 5JDQA 2QGSA 2WDRA 4DV1T 4GKJT 4QWTA 3AVRA 2PBIA 4HTEA 3PU8A 4NREA 4H9QC 1X9BA 3G06A 1D1CA 2VVSA 3SOLA 5C3JA 4PK6A 3AEAA 3N2KE 3RF1A 3IBZA 1I94T 3ONLC 4HFBA 4IDZA 2ACXA 2V5CA 2CHNA 2LM9A 3VKHA 4FJOA 1UCUA 5F3JA 1YKEB 2AE9A 5AQPB 1XNRT 1H7CA 2HPJA 4PJMA 2FNQA 1FGMA 3RC8A 4JI0T 5EK2A 3TLSA 4ZS3A 3TLUA 1T7SA 2VB6A 3BNDA 4OK0A 3OYXA 4ILAA 4NIQA 2CEAA 3CWZB 4MHCA 4QKNA 3A8YC 3AXJB 5AQTB 1ROVA 2X9WA 4UELA 3HKDE 2ZM6T 2WU5A 2KXPB 2LEHA 1FGQA 5LXTE 1HNXT 5J0ZA 4CXWA 4AQGA 5GONE 4GYSA 3S4UA 4UV9B 3ZN1B 3WAKA 5HCMA 1BR4A 2MAWA 3FZFB 3K3OA 2WZIA 4DMWA 4AIUA 1IJ5A 2WMNA 3V98A 4IE4A 2WBLA 5BR8T 5LHIB 2VK9A 5HXCA 2MOZA 2K5BB 4B3MT 3ZPOA 3R84B 2UXCT 4Q25A 1V9DA 5HWXA 2HH7A 2DWGA 1R8IA 5L4HA 5BMVE 1WYBA 2XHJA 3PURA 2VQFT 2VWAA 4PK4A 4X65T 4HWDA 2EHOD 3KVBA 4AKRB 5HXHA 2PG8A 5FP3A 3Q5XA 2V8SV 3KVAA 5FXXA 2DWKA 2MYSA 4YJ3E 1ZKEA 1IBLT 3VRAA 2XAJB 1ZOYA 4PAGA 5A1LA 5LJMA 5HEUA 5FY1A 3ZKRA 1F8NA 2XJ7A 4O4HE 5LP6E 2SPCA 2MBGA 4IDQA 4HWCA 1NWMX 4QXCB 2LJLA 2IW5B 4XAXB 3RPUA 1YKHB 2DHRA 3EDUA 1O3XA 3GWHA 3MA9A 4ZXLA 3RYCE 5LHGB 1E7PA 4UIGA 3NRXA 2XQAA 4CXYA 3LDQB 3UU3A 2CLYB 2XQ5A 5CA0E 3QNUA 3X1DA 4IE5A 3AVSA 3DTOA 3CPZA 4ISTA 3UFGA 4C90A 4JI1T 4CN1A 4JLEA 2JPFA 2VKOA 2LOPA 4HFEA 3KINB 4YTNA 4UVBB 1VCSA 2Q9QA 4LF5T 3Q5DA 3EUHA 4X66T 4ILCA 5F8PA 2BG9A 3AB3B 5HEJA 2M67A 3AEGA 4HKAA 2W00A 3BK9A 1B7TA 2LT3A 2R6GF 4QWNB 4HGAA 4I50E 3RH3A 2XTLA 4K0KT 3ANWA 3RQUA 4QEYA 3Q9DA 4TNWA 2W67A 3RYFE 3PUQA 2X9XA 3F57A 2FJEA 1ZEEA 1KHOA 3UU4A 3KBUA 5AQVB 4DUYT 5LB7B 4KX6A 2WWUA 4H9NC 4I43B 3IBPA 5IWAT 2D9DA 1G8XA 2V6XA 4PNIA 2ES0A 3ONJA 4Z8XA 4TV9E 5JQGE 2XQ9A 3AE2A 4QH4A 1YW0A 2OA5A 1HG2A 4EGWA 3VU7H 4DV4T 2UUBT 3P4WA 2H7VC 4PJJA 3LFMA 2LSJA 2P9BA 4LFBT 3BNBA 3HKEE 3AE4A 4H9PC 3B13A 3FG4A 3O1IA 3UT5E 1OXZA 2FBWA 2XQ7A 3CIRA 2BS3A 5AQQB 2YDSA 1G73A 5JVDE 3P7IA 5L3BB 2SBLA 3HR0A 4X64T 3F31A 4KMCA 5JDLA 3AEEA 3RC3A 3ZCIA 2JMKA 5IUXA 5C2TA 3MXZA 3SFEA 2K9AA 2DI4A 1HX1B 2IDOB 2NW7A 4UF0B 4ZOLE 4ZI2C 3EVYA 3PUVF 5LBQB 5AQJB 2NW9A 3Q5WA 4YTMA 2D0UA 1SHZC 4U33A 4A56A 5LA6E 4H9OC 3L09A 5HXRA 2D2SA 4DR4T 5KMGP 4IL9A 4WHAA 2VURA 4CN4A 4ADZA 3VHLA 2ZMAA 4HE8A 4IGUA 3AAIA 3J7Yq 3UQ4A 2N2NA 3C50A 4JI4T 5JDHA 4AISA 4WBNE 3T1HT 2I59A 2JRKA 3SS1A 5ABFA 4IREA 5AQMB 2WDQA 5AQLB 5DABA 4KHPT 3MZKB 2IC9A 2DNXA 2UUAT 3CX8B 1CHUA 1AJ3A 3C51A 4IHJE 2MTQA 5HXSA 4HEAA 3I0QA 3ZJ1A 1MIYA 4JI6T 1HPLA 1WYCA 3UULA 2A9UA 3L8RA 1FJGT 4I0UA 3PE0A 1UX5A 2QYWA 2X0YA 4LF4T 1HCIA 1UGOA 3N9MA 2OXEA 5EK4A 1ZHCA 3K8PC 3H3MA 5JR9B 4LFAT 4O2AE 2E9XA 4JV5T 3U6GA 4CZZB 4DNDA 2H7OA 4LF8T 3E22E 1MIWA 2NOXA 2N9DA 3R6NA 3NWIA 4ZI7E 2K3WA 2H88A 2V7IA 2XSAA 4A97A 4DV7T 4G2AA 2D0TA 2XASB 1W0BA 4HN9A 3LBXA 5AQSB 4UF0A 3UU8A 1ZP0A 5HXEA 1MMAA 4L5GA 2LOSA 2J1DG 1N8QA 4DR5T 3AA6B 5FVLA 5FL0A 4DR2T 2V7MA 2W61A 5FY0A 2KMFA 2P0MA 4DVDA 1HFAA 1JNRA 1OEDB 3ZYLA 3PUWF 3ZMZB 3V92A 2XAQB 4MBQA 2KNDA 4A5XA 5AQNB 3RQWA 2KLQA 5AQIB 5FY7A 2CBIA 3AE1A 3F2EA 3L39A 1NO3A 4AKIA 4TWDA 3N9QA 3RRCA 1FGTA 1MNDA 2LG7A 3KDSE 4H9RC 3RYHE 2CCQA 5ABFB 4TV8E 1JNQA 2XZEA 4GIWA 2BBHA 4DV3T 4U74A 2WCAA 4X20E 4XBFB 2VKHA 2VASA 2WAUA 4YLHA 3CQCB 2WMOA 2VVNA 4ILUA 4ZZCA 2QVAA 4B3ST 4F8HA 3UUMA 4WBOA 3KV5A 1SA0E 4U31A 1HNZT 2XHHA 2IC6A 3ZCJA 4IT4A 1CA1A 3WAJA 5L3DB 1J1JA 1N36T 3ZT6A 3N9NA 2WP9A 4DV0T 3FG1A 4YSYA 3QOFA 4HWIB 5DJQC 4OFZA 2E5VA 2E9XC 1LRZA 3FBLA 4TNVA 4ZS2A 2V1DB 4PW8A 2JJ9A 5J2UE 3AE7A 2CE7A 2WDVA 2XY8B 1EZ3A 1US7B 4U7IA 1GPLA 5AQHB 3ZYKA 1KFYA 3AAAB 3V5UA 1KNPA 2RPAA 4GYRA 5LGUB 2CRBA 3IHRA 2WQYA 2IAKA 1Y01A 5FMNA 1GQEA 1WFDA 1LNHA 5AQFB 3FZMB 2W62A 2EHOB 3PUGA 5JDMA 2L9QA 4B3TT 4WW0A 2PJQA 3Q2MA 2ODVA 2ZM8A 3NKZA 2LSYA 4YSXA 1LPAB 3ZJ2A 1WR6A 1WR0A 2C5IT 3OBVE 1WRDA 2K24A 2X51A 2NR4A 4EV6A 1HG5A 2X9HA 3FB2A 2LGEA 3LK2B 3QB5A 4HFVA 3D0TA 3SWHA 1HS7A 4NXNT 3PUSA 2LRKA 5J2TE 5CJ5A 4O8SA 1XZYA 5LGNB 2QNGA 4CI1B 2PVSA 4ZZBA 4NXMT 5IYZE 2CA5A 5AFUL 2Y8DA 5CFBA 3LK3B 2UXXB 3RIUA 3UUXB 2YDQA 2ACZA 2F4VT 3RI5A 2NTYA 3ZYMA
chains in the Genus database with same CATH topology
4EOZB 2E9XD 3IEEA 3N2OA 1S94A 1E1HB 3GMIA 5L3CB 3L3PA 5KX5E 1G73A 5JVDE 5CB4E 4UV8B 3P7IA 3LJCA 5L3BB 5LG4A 1Z0PA 2SBLA 3HR0A 1FGOA 1W52X 2E9XB 1VOMA 3N2GE 4NUUA 3F31A 3RKOA 4KMCA 4I55E 5JDLA 3W15B 1FEWA 2ZM2A 4B6XA 5TAOA 3RC3A 2KZ7B 3ZCIA 4TZ4C 2JMKA 2C5KT 4X1IE 4X1KE 4MALA 2D5UA 2Q9QB 4EXTA 3O8YA 3N9OA 4C91A 4IE0A 1LVKA 1IZNB 4UEMA 5JDGA 1YD8G 5LBMA 4J2CA 4QHOA 2GK9A 3NBXX 2Q9QD 3MXZA 4X1YE 2K9AA 3NZPA 3BNEA 4PK5A 2E8IA 2YK0A 3C98B 2DI4A 1WLXA 2NW7A 4UF0B 4ZOLE 4ZI2C 5LJNA 4O4LE 3ZMSB 2YU1A 3PTRB 4GK0E 5DQVA 3EVYA 3A5XA 5LBQB 2NW9A 1MMDA 3DP7A 1KNZA 3OYZA 1FMWA 2YU2A 2WY6A 1BR2A 4EIWA 3OKQA 3Q5WA 3I1AA 5JR9C 3O1JA 3BQIA 2D0UA 4QX7B 4ZI2D 1SHZC 4L0RA 3SRZA 3ZMUB 4A56A 5LA6E 4GOUA 4H9OC 2X9YA 3L09A 3EDVA 2D2SA 1QSDA 5HXRA 5KMGP 5DQWA 3UTKA 3FXDB 4KP3C 1HX8A 4WHAA 2Y48B 3C64A 4BA9A 2NW8A 5L3GB 3O4XE 4ADZA 4CI2B 5L3EB 2BVMA 1LKXA 4G63A 3VHLA 4EB6E 5JDQA 2ZLYA 3RX6A 1QUUA 2ZMAA 5ETWA 2QGSA 2XAGB 3JC6C 5H6QB 4HE8A 4IGUA 3AAIA 3J7Yq 2VL8A 4WNKA 5FYMA 2N2NA 3C50A 4QWTA 1FIOA 3MJXA 3AVRA 4GK5E 5JDHA 5LHHB 2PBIA 4HTEA 3PU8A 4WBNE 4NREA 2I59A 2JRKA 2XAHB 4H9QC 3SS1A 5LCYA 1D1CA 2LSKA 3P8CD 4TUYE 3SOLA 4F6RC 4PK6A 5FXVA 5DABA 3ZMVB 3MZKB 2NP9A 4YHJA 3K3NA 2IC9A 4AQFA 2DNXA 3PZWA 1NAFA 2BVLA 2Q9QC 1LPBB 4MLKA 3N2KE 4P09A 3CX8B 1D1AA 1AJ3A 5IHYA 3C51A 2B1EA 3ESLA 4IHJE 3CKDA 3KV6A 4IDZA 2MTQA 3BQLA 4ASKA 4HEAA 5HXSA 5LOVE 2ACXA 3I0QA 3ZJ1A 4O2BE 2LM9A 3ONXA 3VKHA 1MIYA 4FJOA 1HPLA 1Y64B 1HTJF 1UCUA 3GN5A 5F3JA 1WYCA 2H3RA 3E08A 3I0OA 3UULA 4QXBB 1RRHA 1YKEB 2X0LB 5L2LA 4JEHB 3PE0A 3U78A 1UX5A 1H7CA 1HCIA 4L9IA 2HPJA 3N9MA 4V1Av 5EK4A 5M4YA 2OXEA 2WSSV 1ZHCA 3GN5B 2V26A 3K8PC 4PJMA 5JR9B 4N78D 4O2AE 2NTXA 2FNQA 1UX4A 2E9XA 2A2FX 3N9PA 2LHNA 1FGMA 3RC8A 2Z6EA 4ZI3D 2KINB 5EK2A 4ZS3A 3FBZA 4CZZB 4DNDA 2VB6A 3BNDA 4OK0A 2H7OA 1D0XA 1D0ZA 3OYXA 2CEAA 3C4XA 3E22E 3CMLA 1MIWA 3CWZB 3BNCA 2NOXA 4MHCA 4QKNA 2N9DA 3MKDA 3R6NA 4ZI7E 1ROVA 4EZHA 2X9WA 4UELA 2V7IA 3HKDE 2WXUA 2KXPB 4G2AA 2D0TA 2XASB 2LEHA 3LG7A 4KUMB 3HKCE 1MNEA 4HN9A 1MMNA 3LBXA 3MACA 4O4IE 1FGQA 3AA7B 2YEVC 4UF0A 3O1HA 5LXTE 3B57A 4CXWA 4AQGA 5GONE 3PUAA 4CI3B 4GYSA 3OJAA 3S4UA 4TX5A 3RYIE 4UV9B 4PJLA 1MMAA 5HXEA 2LE8A 1Y4KA 4L5GA 3ZN1B 4CXXA 2LOSA 1ZV4X 4H63H 1RRLA 2HPLA 1ETHA 3QC9A 3VKGA 3WAKA 4H9SE 2J1DG 1N8QA 4E7SA 3AA6B 3NRYA 5ADXL 4XZCA 4BJMA 1BR4A 2NWBA 3ANWB 5LNKA 3AA0B 3K3OA 2RA1A 4UVAB 4DMWA 2K48A 1IJ5A 1HU9A 2V7MA 2WMNA 5JRCA 2CXFA 2W61A 3V98A 4IE4A 4IE6A 3BQKA 5FY0A 1U5PA 1CUNA 5JH7E 2WBLA 2A72A 4UXNB 5JR9A 5LHIB 2KMFA 3CX7B 2EHOC 4AKHA 4DVDA 2P0MA 3U3IA 3PU3A 1HFAA 2JMHA 2VK9A 2XUEA 4M1PA 5HXCA 2MOZA 2K5BB 3ZYLA 1QM6A 3ZMZB 3V92A 3ZPOA 3R84B 2V7LA 2XAQB 1V9DA 4MBQA 2HH7A 5HWXA 2DWGA 2DCFA 2KNDA 1YGEA 4EYUA 3CQXC 5BMVE 1WYBA 4YFSA 3PURA 2LHRA 2V7JA 2VWAA 2KLQA 3M65A 5FY7A 4PK4A 2WXTA 3F2EA 2YINA 3JC6D 1NO3A 4AKIA 2EHOD 3KVBA 4AKRB 5HXHA 2PG8A 3N9QA 5FP3A 3Q5XA 4E7ZA 3RRCA 4PFPA 3KVAA 5HAXA 5FXXA 2DWKA 3ZEFB 2BZBA 1FGTA 2DLRA 1MNDA 2MYSA 4AXPA 3KDSE 4YJ3E 1OLPA 3CVRA 4H9RC 2PFVA 3C4WA 3RYHE 4OYJA 2CCQA 3NZQA 4TV8E 1JNQA 1ZKEA 4GIWA 4JUYA 2C5JA 2ODUA 5FXZA 4YJ2E 4U74A 1IAPA 4X20E 2XAJB 2A3DA 4XBFB 4PAGA 5A1LA 5LJMA 5FY1A 2UXNB 2VKHA 1F8NA 2VASA 4FI5A 2WAUA 4YLHA 3N9LA 3CQGB 1LVFA 2QA7A 3CQCB 4O4HE 3K3QC 5LP6E 2SPCA 2VKJA 2WMOA 3LK42 4IIJE 4UVCB 3VF1A 3CX6B 4QXHB 2JQQA 2MBGA 4ILUA 4BAYB 1NWMX 5C8YE 4QXCB 1N8SA 2LJLA 2KT9A 2IW5B 5J1GA 3FHNA 4XAXB 3RPUA 3EDUA 1YKHB 2DHRA 1O3XA 3GWHA 4WBOA 3UUMA 3MA9A 5EK3A 3RYCE 3TKLB 5H6RB 3KV5A 5LHGB 2PPLA 1SA0E 4ERRA 3MK7C 2IUKA 4UIGA 3NRXA 3DJBA 3J9X1 2CWYA 4CXYA 2XAFB 2IC6A 4P0AA 1GYGA 3ZCJA 2CLYB 1FGRA 1CA1A 3KV4A 3V5SA 3WAJA 5CA0E 5L3DB 4PJNA 4BJNA 3HI2A 4IE7A 3N9NA 4ZHQE 4IE5A 3AVSA 3FG1A 2BDEA 3DTOA 3CPZA 4H63V 4ISTA 4NUVA 4OHFA 5FXWA 3WI3A 4C90A 2CXLA 1D1BA 3UFEA 3KBTA 4JLEA 2JPFA 1VRBA 2LOPA 2VKOA 5DJQC 1IJ6A 3V99A 3HL6A 2X68A 4OFZA 3T8OA 4MFRA 2V7KA 3QUJA 2E9XC 3ZYMA 3FBLA 1LRZA 3KINB 4DBQA 5KDMC 4ZS2A 4P0BA 2V1DB 3FXEB 3KV9A 4PW8A 2JJ9A 2RP4A 3I9WA 2CXDA 2Q9QA 4UVBB 5J2UE 4DO0A 2CE7A 3ETVA 3EUHA 3ZC0A 4CQIA 1OWAA 4ISSA 1EZ3A 1US7B 2EHOA 2N1GA 4I4TE 5F8PA 3ZMTB 4EAHA 3AB3B 2IUJA 4DMVA 1GPLA 1RP1A 4AKGA 2M67A 5EZYE 1FMVA 2ZM0A 5LYJE 4HKAA 4EYYR 2CM0A 3ZYKA 2W00A 3PDYA 4JEUB 3BK9A 5JRCB 1B7TA 4TN7B 2LT3A 5E0OA 4QWNB 3AAAB 2L8KA 4HGAA 3V5UA 4AI6A 4I50E 4ZI3C 3RH3A 3C4ZA 2XTLA 2C0SA 4U72A 3ZLIA 2CLYC 3ANWA 4GYRA 3O9XA 5LGUB 4DBRA 5EEOA 1BU8A 2XQYA 3IHRA 1LOXA 2IAKA 2VKDA 3H37A 3Q9DA 5FMNA 4AKLA 2W63A 2X67A 3I9YA 5JDNA 3H3AA 4ANJA 4AQFC 2LSGA 2KWIB 1LNHA 4EZ4A 3RYFE 3PUQA 1T98A 2X9XA 3F57A 2W62A 1ZEEA 2EHOB 3PUGA 2LSIA 2L9QA 5JDMA 1KHOA 4WW0A 5L3FB 2PJQA 3KBUA 5JDFA 3Q2MA 3IF8B 3LBXB 2ODVA 1S35A 2L3LA 2ZM8A 4PFOA 1MMGA 2KWHA 3ZC1A 2LSYA 2XHEB 2WWUA 4H9NC 1LPAB 1U4QA 1WR6A 4I43B 3ZJ2A 2C5IT 1D0YA 3HA4A 3IBPA 1MIVA 3OBVE 1G8XA 4QX8B 4WFOA 4PNIA 1WRDA 2K24A 2G0UA 2ES0A 2X51A 5LGTB 4K0UA 1KK7A 1HG5A 4Z8XA 2X9HA 1HF8A 1X79A 2Y6XA 3FB2A 4TV9E 5HWYA 3LK2B 5JREA 2CMRA 3AA1B 4HFVA 4OYKA 2X66A 3UUNA 5JQGE 1BR0A 3HKBE 1QMDA 3D0TA 5FNVE 3SWHA 1HS7A 3PUSA 5J2TE 1YW0A 4O8SA 3N5LA 5LGNB 2OA5A 3RRWA 1HG2A 3ZN0B 3VU7H 4CI1B 2PVSA 5IYZE 2CA5A 2H7VC 4PJJA 3LFMA 2LSJA 5AFUL 2Y8DA 2P9BA 3E0ZA 3BNBA 3HKEE 3GA8A 3LK3B 2UXXB 3FG3A 4KBMB 3UUXB 1BR1A 2CWOA 3AAEB 4O4JE 4H9PC 3ETUA 3B13A 3FG4A 2WM9A 3O1IA 3UT5E 5HYAA 3QK6A 1IK3A 1OXZA 2W0GA 5CA1E 2NTYA 3KFWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WY6 A;  3O8Y A;  1Y4K A;  1LPB B;  1QM6 A;  2DWK A;  1LPA B;  1LOX A;  1GYG A;  1RRL A;  2PVS A;  1ETH A;  1FGT A;  1ROV A;  1OLP A;  3V92 A;  1FGR A;  1CA1 A;  2OXE A;  1N8Q A;  3VF1 A;  2DWG A;  4WFO A;  1JNQ A;  2FNQ A;  1LNH A;  2WXU A;  2SBL A;  4QWT A;  2IUJ A;  1YGE A;  4GIW A;  1FGO A;  1FGM A;  1W52 X;  3BNB A;  3BNE A;  3FG1 A;  1GPL A;  1RP1 A;  1N8S A;  3FG3 A;  2CXL A;  1HPL A;  1HU9 A;  4NRE A;  2WXT A;  1FGQ A;  1KHO A;  2CXF A;  1QMD A;  3FG4 A;  3BND A;  3V98 A;  4WHA A;  1NO3 A;  3V99 A;  1IK3 A;  2P0M A;  1RRH A;  2PPL A;  3CWZ B;  3BNC A;  2IUK A;  5EEO A;  1BU8 A;  1F8N A;  3PZW A; 
#chains in the Genus database with same CATH topology
 3N2O A;  4HFH A;  1E1H B;  4P1N A;  2E5L T;  1Z0P A;  4DUZ T;  1VOM A;  4NUU A;  3P4P A;  5TAO A;  3RIU C;  4UR9 A;  2D5U A;  3O8Y A;  4C91 A;  4UEM A;  2FJA A;  5LBM A;  4J2C A;  4QHO A;  4IDN A;  4X1Y E;  2JQK A;  1W0A A;  2JIW A;  5LJN A;  2YU1 A;  1OED A;  5DQV A;  2BKP A;  1T8B A;  1MMD A;  3AE3 A;  2YU2 A;  1BR2 A;  3OVU A;  3OKQ A;  3ZT7 A;  3AE6 A;  2WS3 A;  4ZI2 D;  3SRZ A;  5AQG B;  3EDV A;  1QSD A;  4LF7 T;  1HX8 A;  4CI2 B;  2BVM A;  1LKX A;  2B76 A;  4EB6 E;  1XMQ T;  4TWH A;  3EHZ A;  4JI3 T;  2ZLY A;  1T72 A;  2WU2 A;  5FYM A;  1FIO A;  3MJX A;  1IBK T;  3RIF A;  2XAH B;  5LCY A;  3P8C D;  1IBM T;  4TUY E;  2IIU A;  5FKY A;  2LKG A;  2BVL A;  2Q9Q C;  1LPB B;  3CK6 A;  4ASK A;  3E08 A;  1JNZ A;  4GKK T;  1RRH A;  1M62 A;  2BS2 A;  1VCT A;  4JEH B;  4L9I A;  4V1A v;  5M4Y A;  2WSS V;  3GN5 B;  2J62 A;  2NTX A;  1UX4 A;  1XNQ T;  2A2F X;  2LHN A;  1N34 T;  2Z6E A;  4ZI3 D;  3RKG A;  2V6Y A;  1D0X A;  3C4X A;  3BNC A;  2IML A;  3M3Z B;  4YT0 A;  1MNE A;  4DV6 T;  3AA7 B;  3O1H A;  1KF6 A;  3UU5 A;  3B57 A;  4CI3 B;  5L4E A;  3OJA A;  4TX5 A;  3RYI E;  4PJL A;  2LE8 A;  1Y4K A;  4CXX A;  1RRL A;  1ZV4 X;  1ETH A;  3VKG A;  4H9S E;  4B3R T;  5LNK A;  3ANW B;  2K48 A;  3VR8 A;  1W09 A;  2VL0 A;  5JH7 E;  3BQK A;  1U5P A;  1CUN A;  4UXN B;  2EHO C;  4JI2 T;  2XUE A;  1QM6 A;  2XM2 A;  1UUR A;  2DCF A;  2FUP A;  1YGE A;  4EYU A;  2LHR A;  3LSV A;  4LFC T;  3JC6 D;  4E7Z A;  5HAX A;  3ZEF B;  2XQ8 A;  4AXP A;  3CVR A;  2YN6 A;  3C4W A;  4OYJ A;  3NZQ A;  2VQE T;  2C5J A;  2ODU A;  5FXZ A;  4YJ2 E;  5AQR B;  2A3D A;  2V6Y B;  1L0V A;  4FI5 A;  3N9L A;  3PUY F;  2QA7 A;  3LK4 2;  2BG9 C;  4IIJ E;  1HNW T;  4UVC B;  1I6Z A;  2JQQ A;  4BAY B;  5C8Y E;  2KT9 A;  1Z8U A;  2UXB T;  5H6R B;  2PPL A;  4KHZ F;  2V5D A;  4QH5 A;  3MK7 C;  4KI0 F;  2IUK A;  4YHH T;  2BKO A;  4X62 T;  3DJB A;  3J9X 1;  2XAF B;  4P0A A;  1FGR A;  3RIA A;  2WWV A;  2JQ9 A;  4H63 V;  5FXW A;  2WB5 A;  3ZSS A;  3WI3 A;  3TLW A;  3KBT A;  1VRB A;  3HL6 A;  2X68 A;  2HHH T;  2V7K A;  3QUJ A;  3VRB A;  1XDP A;  4JYA T;  5KDM C;  4P0B A;  3FXE B;  2RP4 A;  4DO0 A;  4ISS A;  4EAH A;  3ZMT B;  2N1G A;  4I4T E;  2W2U A;  4LMJ A;  1FMV A;  2ZM0 A;  5LYJ E;  4EYY R;  1XMO T;  2OLT A;  4JEU B;  5E0O A;  4TN7 B;  5ABH A;  4AI6 A;  4ZI3 C;  3O9X A;  5EEO A;  2UU9 T;  1J5E T;  1M7K A;  2VKD A;  3H37 A;  4X5T A;  3I9Y A;  5JDN A;  2WY2 A;  2KWI B;  1OED E;  3P4Q A;  1T98 A;  4DR6 T;  2BS4 A;  1J5W A;  1QLB A;  1SUM B;  2BG9 E;  1MMG A;  2KWH A;  2KXV A;  4YTP A;  1U4Q A;  3AE8 A;  3HA4 A;  1D0Y A;  4WFO A;  4K0U A;  1HF8 A;  2Y6X A;  2XFD A;  3TLV A;  2CPT A;  5FVK A;  3AA1 B;  1BR0 A;  3FZL B;  4NPP A;  5FNV E;  2CBJ A;  1DU2 A;  4QH1 A;  2MPK A;  3RRW A;  4U2Z A;  2QZ7 A;  2DL1 A;  3ZN0 B;  4U3C A;  3EI0 A;  2LRG A;  5AQK B;  3GA8 A;  3FG3 A;  3RLF F;  1BR1 A;  1YXR A;  4O4J E;  3ETU A;  3OTO T;  1IK3 A;  5HYA A;  2M6B A;  3KFW X;  2E9X D;  3IEE A;  1S94 A;  3GMI A;  4DR3 T;  3PUZ F;  5CB4 E;  3LJC A;  1FGO A;  1W52 X;  1WCR A;  5FL1 A;  2E9X B;  1NEK A;  4LML A;  2I0M A;  4I55 E;  2JQH A;  2AXD S;  3W15 B;  1FEW A;  2ZM2 A;  4B6X A;  4LF9 T;  2KZ7 B;  4X1K E;  1OED C;  3N9O A;  4IE0 A;  1LVK A;  5JDG A;  2YOE A;  1YD8 G;  2Q9Q D;  1E2A A;  3NZP A;  2E8I A;  2YK0 A;  4JI8 T;  2XQ6 A;  3ZMS B;  4IDP A;  4GK0 E;  3A5X A;  1KNZ A;  3DP7 A;  2PTF A;  3OYZ A;  1FMW A;  2WY6 A;  4EIW A;  4LMK A;  3O1J A;  4QX7 B;  2YKS A;  3PUX F;  3ABV A;  4KP3 C;  2Y48 B;  3C64 A;  4BA9 A;  2NW8 A;  4EED A;  5L3G B;  3O4X E;  5HEH A;  1KEY A;  5L3E B;  2QRX A;  2BKN A;  4LF6 T;  3RX6 A;  1QUU A;  5ETW A;  3JC6 C;  2XAG B;  4AQY T;  5H6Q B;  3AEC A;  2VL8 A;  4WNK A;  4GK5 E;  5LHH B;  3SFD A;  4JBW F;  2LSK A;  4IL4 A;  3IA3 A;  4F6R C;  5ABE A;  5FXV A;  3ZMV B;  2NP9 A;  4YHJ A;  3K3N A;  4AQF A;  3PZW A;  1NAF A;  4MLK A;  4P09 A;  1D1A A;  5IHY A;  1YQ3 A;  2B1E A;  3ESL A;  4WYV A;  1HR0 T;  3CKD A;  3KV6 A;  4HWF A;  3BQL A;  4OX9 T;  1XWM A;  5LOV E;  4O2B E;  3ONX A;  3ZST A;  1Y64 B;  1HTJ F;  3GN5 A;  2H3R A;  3I0O A;  2BG9 B;  4QXB B;  2W66 A;  2X0L B;  3FZH B;  2LM2 A;  5HEO A;  5L2L A;  3U78 A;  2I6H A;  2V26 A;  4N78 D;  3N9P A;  3AED A;  2KIN B;  3FBZ A;  1D0Z A;  3CML A;  3AEF A;  3MKD A;  3JAD A;  4EZH A;  2WXU A;  3LG7 A;  4KUM B;  3PJA J;  3HKC E;  1MMN A;  3MAC A;  3RHW A;  1N33 T;  4O4I E;  2YEV C;  4Z90 A;  3VR9 A;  3PUA A;  2WZH A;  1KNR A;  4H63 H;  2HPL A;  3QC9 A;  4E7S A;  3B5M A;  3NRY A;  5ADX L;  2IHR 1;  2J47 A;  4XZC A;  4BJM A;  2NWB A;  3AA0 B;  2RA1 A;  2KSR A;  4UVA B;  1HU9 A;  5JRC A;  2CXF A;  4IE6 A;  2A72 A;  5JR9 A;  4AKH A;  3CX7 B;  3U3I A;  3PU3 A;  2JMH A;  4M1P A;  2XFE A;  2V7L A;  3NVO A;  3UQ7 A;  3AEB A;  3CQX C;  4YFS A;  4HFD A;  2V7J A;  3M65 A;  2WXT A;  1YQ4 A;  3JAF A;  2YIN A;  3AE9 A;  3PJA A;  5HEG A;  2XQ3 A;  4HFI A;  4PFP A;  3PV0 F;  2BZB A;  2DLR A;  1OLP A;  2PFV A;  2HN1 A;  2H89 A;  3Q5E A;  4JUY A;  1UK5 A;  1IAP A;  5AQO B;  2UXN B;  4WZX A;  3ZT5 A;  3CQG B;  1LVF A;  3K3Q C;  2VKJ A;  3VF1 A;  3CX6 B;  4QXH B;  1N8S A;  3RGL A;  5J1G A;  3FHN A;  2OV9 A;  5EK3 A;  3TKL B;  4ERR A;  2J4G A;  2CWY A;  3AXJ A;  1GYG A;  3JCF A;  3KV4 A;  3V5S A;  4PJN A;  4BJN A;  3HI2 A;  3P4S A;  4IE7 A;  4ZHQ E;  2BDE A;  4NUV A;  5HCJ A;  4OHF A;  2CXL A;  1D1B A;  3UFE A;  3FZK B;  5JTG A;  1IJ6 A;  4COF A;  3V99 A;  3T8O A;  4MFR A;  5AQU B;  4DBQ A;  3KV9 A;  3I9W A;  2CXD A;  2YDR A;  5ABG A;  5LMU T;  3ETV A;  3ZC0 A;  4CQI A;  1OWA A;  3UU6 A;  1N32 T;  2EHO A;  4ZEY A;  1W9R A;  4DV2 T;  2IUJ A;  4DMV A;  2XPK A;  4Z91 A;  1XDO A;  4JI5 T;  1RP1 A;  4AKG A;  5EZY E;  4YSZ A;  2CM0 A;  3PDY A;  4ILB A;  5JRC B;  4U2Y A;  2L8K A;  3QB5 K;  3C4Z A;  3ZLI A;  2C0S A;  4U72 A;  2CLY C;  4DBR A;  2LLY A;  1BU8 A;  2XQY A;  1LOX A;  2IUB A;  4AKL A;  2W63 A;  2X67 A;  3T1Y T;  4TWF A;  3H3A A;  4ANJ A;  4AQF C;  2LSG A;  2UXD T;  4EZ4 A;  4U7Y A;  2CHO A;  5LMN T;  5KXJ A;  4HFC A;  2W4X A;  3A7M A;  2LSI A;  2E2A A;  5L3F B;  5JDF A;  3IF8 B;  3LBX B;  1S35 A;  2L3L A;  4PFO A;  3ZC1 A;  2XHE B;  4IDO A;  4YXD A;  1MIV A;  4QX8 B;  2G0U A;  5LGT B;  1KK7 A;  1X79 A;  5HWY A;  4A98 A;  4DR7 T;  5JRE A;  2CMR A;  3EAB A;  4OYK A;  2X66 A;  3UUN A;  4DV5 T;  1QMD A;  3HKB E;  2KXT A;  2LRL A;  2X0H A;  3N5L A;  3UUB A;  5F5W A;  2BBJ A;  2FJD A;  5CGM A;  2FJB A;  3E0Z A;  3P4R A;  2XQ4 A;  4KBM B;  3EAM A;  2CWO A;  3AAE B;  2WM9 A;  3QK6 A;  3OPC A;  2W0G A;  5CA1 E;  4EOZ B;  3AE5 A;  5L3C B;  3L3P A;  5KX5 E;  2UUC T;  4UV8 B;  4DID B;  5LG4 A;  1NEN A;  4JI7 T;  3N2G E;  3RKO A;  4DR1 T;  4TZ4 C;  2C5K T;  4X1I E;  4MAL A;  2Q9Q B;  2LKH A;  4EXT A;  1IZN B;  3JAE A;  2HN2 A;  4HWH A;  2GK9 A;  3NBX X;  2XM1 A;  3BNE A;  4PK5 A;  3C98 B;  1WLX A;  3TLT A;  3P50 A;  4O4L E;  3PTR B;  4EEB A;  2XSB A;  3I1A A;  5JR9 C;  1SE7 A;  2M6I A;  1UUS A;  3BQI A;  4L0R A;  3ZMU B;  4GOU A;  2X9Y A;  3K1S A;  5DQW A;  3UTK A;  3FXD B;  4YY3 T;  5L47 A;  5LG3 A;  4G63 A;  4CN6 A;  5JDQ A;  2QGS A;  2WDR A;  4DV1 T;  4GKJ T;  4QWT A;  3AVR A;  2PBI A;  4HTE A;  3PU8 A;  4NRE A;  4H9Q C;  1X9B A;  3G06 A;  1D1C A;  2VVS A;  3SOL A;  5C3J A;  4PK6 A;  3AEA A;  3N2K E;  3RF1 A;  3IBZ A;  1I94 T;  3ONL C;  4HFB A;  4IDZ A;  2ACX A;  2V5C A;  2CHN A;  2LM9 A;  3VKH A;  4FJO A;  1UCU A;  5F3J A;  1YKE B;  2AE9 A;  5AQP B;  1XNR T;  1H7C A;  2HPJ A;  4PJM A;  2FNQ A;  1FGM A;  3RC8 A;  4JI0 T;  5EK2 A;  3TLS A;  4ZS3 A;  3TLU A;  1T7S A;  2VB6 A;  3BND A;  4OK0 A;  3OYX A;  4ILA A;  4NIQ A;  2CEA A;  3CWZ B;  4MHC A;  4QKN A;  3A8Y C;  3AXJ B;  5AQT B;  1ROV A;  2X9W A;  4UEL A;  3HKD E;  2ZM6 T;  2WU5 A;  2KXP B;  2LEH A;  1FGQ A;  5LXT E;  1HNX T;  5J0Z A;  4CXW A;  4AQG A;  5GON E;  4GYS A;  3S4U A;  4UV9 B;  3ZN1 B;  3WAK A;  5HCM A;  1BR4 A;  2MAW A;  3FZF B;  3K3O A;  2WZI A;  4DMW A;  4AIU A;  1IJ5 A;  2WMN A;  3V98 A;  4IE4 A;  2WBL A;  5BR8 T;  5LHI B;  2VK9 A;  5HXC A;  2MOZ A;  2K5B B;  4B3M T;  3ZPO A;  3R84 B;  2UXC T;  4Q25 A;  1V9D A;  5HWX A;  2HH7 A;  2DWG A;  1R8I A;  5L4H A;  5BMV E;  1WYB A;  2XHJ A;  3PUR A;  2VQF T;  2VWA A;  4PK4 A;  4X65 T;  4HWD A;  2EHO D;  3KVB A;  4AKR B;  5HXH A;  2PG8 A;  5FP3 A;  3Q5X A;  2V8S V;  3KVA A;  5FXX A;  2DWK A;  2MYS A;  4YJ3 E;  1ZKE A;  1IBL T;  3VRA A;  2XAJ B;  1ZOY A;  4PAG A;  5A1L A;  5LJM A;  5HEU A;  5FY1 A;  3ZKR A;  1F8N A;  2XJ7 A;  4O4H E;  5LP6 E;  2SPC A;  2MBG A;  4IDQ A;  4HWC A;  1NWM X;  4QXC B;  2LJL A;  2IW5 B;  4XAX B;  3RPU A;  1YKH B;  2DHR A;  3EDU A;  1O3X A;  3GWH A;  3MA9 A;  4ZXL A;  3RYC E;  5LHG B;  1E7P A;  4UIG A;  3NRX A;  2XQA A;  4CXY A;  3LDQ B;  3UU3 A;  2CLY B;  2XQ5 A;  5CA0 E;  3QNU A;  3X1D A;  4IE5 A;  3AVS A;  3DTO A;  3CPZ A;  4IST A;  3UFG A;  4C90 A;  4JI1 T;  4CN1 A;  4JLE A;  2JPF A;  2VKO A;  2LOP A;  4HFE A;  3KIN B;  4YTN A;  4UVB B;  1VCS A;  2Q9Q A;  4LF5 T;  3Q5D A;  3EUH A;  4X66 T;  4ILC A;  5F8P A;  2BG9 A;  3AB3 B;  5HEJ A;  2M67 A;  3AEG A;  4HKA A;  2W00 A;  3BK9 A;  1B7T A;  2LT3 A;  2R6G F;  4QWN B;  4HGA A;  4I50 E;  3RH3 A;  2XTL A;  4K0K T;  3ANW A;  3RQU A;  4QEY A;  3Q9D A;  4TNW A;  2W67 A;  3RYF E;  3PUQ A;  2X9X A;  3F57 A;  2FJE A;  1ZEE A;  1KHO A;  3UU4 A;  3KBU A;  5AQV B;  4DUY T;  5LB7 B;  4KX6 A;  2WWU A;  4H9N C;  4I43 B;  3IBP A;  5IWA T;  2D9D A;  1G8X A;  2V6X A;  4PNI A;  2ES0 A;  3ONJ A;  4Z8X A;  4TV9 E;  5JQG E;  2XQ9 A;  3AE2 A;  4QH4 A;  1YW0 A;  2OA5 A;  1HG2 A;  4EGW A;  3VU7 H;  4DV4 T;  2UUB T;  3P4W A;  2H7V C;  4PJJ A;  3LFM A;  2LSJ A;  2P9B A;  4LFB T;  3BNB A;  3HKE E;  3AE4 A;  4H9P C;  3B13 A;  3FG4 A;  3O1I A;  3UT5 E;  1OXZ A;  2FBW A;  2XQ7 A;  3CIR A;  2BS3 A;  5AQQ B;  2YDS A;  1G73 A;  5JVD E;  3P7I A;  5L3B B;  2SBL A;  3HR0 A;  4X64 T;  3F31 A;  4KMC A;  5JDL A;  3AEE A;  3RC3 A;  3ZCI A;  2JMK A;  5IUX A;  5C2T A;  3MXZ A;  3SFE A;  2K9A A;  2DI4 A;  1HX1 B;  2IDO B;  2NW7 A;  4UF0 B;  4ZOL E;  4ZI2 C;  3EVY A;  3PUV F;  5LBQ B;  5AQJ B;  2NW9 A;  3Q5W A;  4YTM A;  2D0U A;  1SHZ C;  4U33 A;  4A56 A;  5LA6 E;  4H9O C;  3L09 A;  5HXR A;  2D2S A;  4DR4 T;  5KMG P;  4IL9 A;  4WHA A;  2VUR A;  4CN4 A;  4ADZ A;  3VHL A;  2ZMA A;  4HE8 A;  4IGU A;  3AAI A;  3J7Y q;  3UQ4 A;  2N2N A;  3C50 A;  4JI4 T;  5JDH A;  4AIS A;  4WBN E;  3T1H T;  2I59 A;  2JRK A;  3SS1 A;  5ABF A;  4IRE A;  5AQM B;  2WDQ A;  5AQL B;  5DAB A;  4KHP T;  3MZK B;  2IC9 A;  2DNX A;  2UUA T;  3CX8 B;  1CHU A;  1AJ3 A;  3C51 A;  4IHJ E;  2MTQ A;  5HXS A;  4HEA A;  3I0Q A;  3ZJ1 A;  1MIY A;  4JI6 T;  1HPL A;  1WYC A;  3UUL A;  2A9U A;  3L8R A;  1FJG T;  4I0U A;  3PE0 A;  1UX5 A;  2QYW A;  2X0Y A;  4LF4 T;  1HCI A;  1UGO A;  3N9M A;  2OXE A;  5EK4 A;  1ZHC A;  3K8P C;  3H3M A;  5JR9 B;  4LFA T;  4O2A E;  2E9X A;  4JV5 T;  3U6G A;  4CZZ B;  4DND A;  2H7O A;  4LF8 T;  3E22 E;  1MIW A;  2NOX A;  2N9D A;  3R6N A;  3NWI A;  4ZI7 E;  2K3W A;  2H88 A;  2V7I A;  2XSA A;  4A97 A;  4DV7 T;  4G2A A;  2D0T A;  2XAS B;  1W0B A;  4HN9 A;  3LBX A;  5AQS B;  4UF0 A;  3UU8 A;  1ZP0 A;  5HXE A;  1MMA A;  4L5G A;  2LOS A;  2J1D G;  1N8Q A;  4DR5 T;  3AA6 B;  5FVL A;  5FL0 A;  4DR2 T;  2V7M A;  2W61 A;  5FY0 A;  2KMF A;  2P0M A;  4DVD A;  1HFA A;  1JNR A;  1OED B;  3ZYL A;  3PUW F;  3ZMZ B;  3V92 A;  2XAQ B;  4MBQ A;  2KND A;  4A5X A;  5AQN B;  3RQW A;  2KLQ A;  5AQI B;  5FY7 A;  2CBI A;  3AE1 A;  3F2E A;  3L39 A;  1NO3 A;  4AKI A;  4TWD A;  3N9Q A;  3RRC A;  1FGT A;  1MND A;  2LG7 A;  3KDS E;  4H9R C;  3RYH E;  2CCQ A;  5ABF B;  4TV8 E;  1JNQ A;  2XZE A;  4GIW A;  2BBH A;  4DV3 T;  4U74 A;  2WCA A;  4X20 E;  4XBF B;  2VKH A;  2VAS A;  2WAU A;  4YLH A;  3CQC B;  2WMO A;  2VVN A;  4ILU A;  4ZZC A;  2QVA A;  4B3S T;  4F8H A;  3UUM A;  4WBO A;  3KV5 A;  1SA0 E;  4U31 A;  1HNZ T;  2XHH A;  2IC6 A;  3ZCJ A;  4IT4 A;  1CA1 A;  3WAJ A;  5L3D B;  1J1J A;  1N36 T;  3ZT6 A;  3N9N A;  2WP9 A;  4DV0 T;  3FG1 A;  4YSY A;  3QOF A;  4HWI B;  5DJQ C;  4OFZ A;  2E5V A;  2E9X C;  1LRZ A;  3FBL A;  4TNV A;  4ZS2 A;  2V1D B;  4PW8 A;  2JJ9 A;  5J2U E;  3AE7 A;  2CE7 A;  2WDV A;  2XY8 B;  1EZ3 A;  1US7 B;  4U7I A;  1GPL A;  5AQH B;  3ZYK A;  1KFY A;  3AAA B;  3V5U A;  1KNP A;  2RPA A;  4GYR A;  5LGU B;  2CRB A;  3IHR A;  2WQY A;  2IAK A;  1Y01 A;  5FMN A;  1GQE A;  1WFD A;  1LNH A;  5AQF B;  3FZM B;  2W62 A;  2EHO B;  3PUG A;  5JDM A;  2L9Q A;  4B3T T;  4WW0 A;  2PJQ A;  3Q2M A;  2ODV A;  2ZM8 A;  3NKZ A;  2LSY A;  4YSX A;  1LPA B;  3ZJ2 A;  1WR6 A;  1WR0 A;  2C5I T;  3OBV E;  1WRD A;  2K24 A;  2X51 A;  2NR4 A;  4EV6 A;  1HG5 A;  2X9H A;  3FB2 A;  2LGE A;  3LK2 B;  3QB5 A;  4HFV A;  3D0T A;  3SWH A;  1HS7 A;  4NXN T;  3PUS A;  2LRK A;  5J2T E;  5CJ5 A;  4O8S A;  1XZY A;  5LGN B;  2QNG A;  4CI1 B;  2PVS A;  4ZZB A;  4NXM T;  5IYZ E;  2CA5 A;  5AFU L;  2Y8D A;  5CFB A;  3LK3 B;  2UXX B;  3RIU A;  3UUX B;  2YDQ A;  2ACZ A;  2F4V T;  3RI5 A;  2NTY A;  3ZYM A; 
#chains in the Genus database with same CATH homology
 4EOZ B;  2E9X D;  3IEE A;  3N2O A;  1S94 A;  1E1H B;  3GMI A;  5L3C B;  3L3P A;  5KX5 E;  1G73 A;  5JVD E;  5CB4 E;  4UV8 B;  3P7I A;  3LJC A;  5L3B B;  5LG4 A;  1Z0P A;  2SBL A;  3HR0 A;  1FGO A;  1W52 X;  2E9X B;  1VOM A;  3N2G E;  4NUU A;  3F31 A;  3RKO A;  4KMC A;  4I55 E;  5JDL A;  3W15 B;  1FEW A;  2ZM2 A;  4B6X A;  5TAO A;  3RC3 A;  2KZ7 B;  3ZCI A;  4TZ4 C;  2JMK A;  2C5K T;  4X1I E;  4X1K E;  4MAL A;  2D5U A;  2Q9Q B;  4EXT A;  3O8Y A;  3N9O A;  4C91 A;  4IE0 A;  1LVK A;  1IZN B;  4UEM A;  5JDG A;  1YD8 G;  5LBM A;  4J2C A;  4QHO A;  2GK9 A;  3NBX X;  2Q9Q D;  3MXZ A;  4X1Y E;  2K9A A;  3NZP A;  3BNE A;  4PK5 A;  2E8I A;  2YK0 A;  3C98 B;  2DI4 A;  1WLX A;  2NW7 A;  4UF0 B;  4ZOL E;  4ZI2 C;  5LJN A;  4O4L E;  3ZMS B;  2YU1 A;  3PTR B;  4GK0 E;  5DQV A;  3EVY A;  3A5X A;  5LBQ B;  2NW9 A;  1MMD A;  3DP7 A;  1KNZ A;  3OYZ A;  1FMW A;  2YU2 A;  2WY6 A;  1BR2 A;  4EIW A;  3OKQ A;  3Q5W A;  3I1A A;  5JR9 C;  3O1J A;  3BQI A;  2D0U A;  4QX7 B;  4ZI2 D;  1SHZ C;  4L0R A;  3SRZ A;  3ZMU B;  4A56 A;  5LA6 E;  4GOU A;  4H9O C;  2X9Y A;  3L09 A;  3EDV A;  2D2S A;  1QSD A;  5HXR A;  5KMG P;  5DQW A;  3UTK A;  3FXD B;  4KP3 C;  1HX8 A;  4WHA A;  2Y48 B;  3C64 A;  4BA9 A;  2NW8 A;  5L3G B;  3O4X E;  4ADZ A;  4CI2 B;  5L3E B;  2BVM A;  1LKX A;  4G63 A;  3VHL A;  4EB6 E;  5JDQ A;  2ZLY A;  3RX6 A;  1QUU A;  2ZMA A;  5ETW A;  2QGS A;  2XAG B;  3JC6 C;  5H6Q B;  4HE8 A;  4IGU A;  3AAI A;  3J7Y q;  2VL8 A;  4WNK A;  5FYM A;  2N2N A;  3C50 A;  4QWT A;  1FIO A;  3MJX A;  3AVR A;  4GK5 E;  5JDH A;  5LHH B;  2PBI A;  4HTE A;  3PU8 A;  4WBN E;  4NRE A;  2I59 A;  2JRK A;  2XAH B;  4H9Q C;  3SS1 A;  5LCY A;  1D1C A;  2LSK A;  3P8C D;  4TUY E;  3SOL A;  4F6R C;  4PK6 A;  5FXV A;  5DAB A;  3ZMV B;  3MZK B;  2NP9 A;  4YHJ A;  3K3N A;  2IC9 A;  4AQF A;  2DNX A;  3PZW A;  1NAF A;  2BVL A;  2Q9Q C;  1LPB B;  4MLK A;  3N2K E;  4P09 A;  3CX8 B;  1D1A A;  1AJ3 A;  5IHY A;  3C51 A;  2B1E A;  3ESL A;  4IHJ E;  3CKD A;  3KV6 A;  4IDZ A;  2MTQ A;  3BQL A;  4ASK A;  4HEA A;  5HXS A;  5LOV E;  2ACX A;  3I0Q A;  3ZJ1 A;  4O2B E;  2LM9 A;  3ONX A;  3VKH A;  1MIY A;  4FJO A;  1HPL A;  1Y64 B;  1HTJ F;  1UCU A;  3GN5 A;  5F3J A;  1WYC A;  2H3R A;  3E08 A;  3I0O A;  3UUL A;  4QXB B;  1RRH A;  1YKE B;  2X0L B;  5L2L A;  4JEH B;  3PE0 A;  3U78 A;  1UX5 A;  1H7C A;  1HCI A;  4L9I A;  2HPJ A;  3N9M A;  4V1A v;  5EK4 A;  5M4Y A;  2OXE A;  2WSS V;  1ZHC A;  3GN5 B;  2V26 A;  3K8P C;  4PJM A;  5JR9 B;  4N78 D;  4O2A E;  2NTX A;  2FNQ A;  1UX4 A;  2E9X A;  2A2F X;  3N9P A;  2LHN A;  1FGM A;  3RC8 A;  2Z6E A;  4ZI3 D;  2KIN B;  5EK2 A;  4ZS3 A;  3FBZ A;  4CZZ B;  4DND A;  2VB6 A;  3BND A;  4OK0 A;  2H7O A;  1D0X A;  1D0Z A;  3OYX A;  2CEA A;  3C4X A;  3E22 E;  3CML A;  1MIW A;  3CWZ B;  3BNC A;  2NOX A;  4MHC A;  4QKN A;  2N9D A;  3MKD A;  3R6N A;  4ZI7 E;  1ROV A;  4EZH A;  2X9W A;  4UEL A;  2V7I A;  3HKD E;  2WXU A;  2KXP B;  4G2A A;  2D0T A;  2XAS B;  2LEH A;  3LG7 A;  4KUM B;  3HKC E;  1MNE A;  4HN9 A;  1MMN A;  3LBX A;  3MAC A;  4O4I E;  1FGQ A;  3AA7 B;  2YEV C;  4UF0 A;  3O1H A;  5LXT E;  3B57 A;  4CXW A;  4AQG A;  5GON E;  3PUA A;  4CI3 B;  4GYS A;  3OJA A;  3S4U A;  4TX5 A;  3RYI E;  4UV9 B;  4PJL A;  1MMA A;  5HXE A;  2LE8 A;  1Y4K A;  4L5G A;  3ZN1 B;  4CXX A;  2LOS A;  1ZV4 X;  4H63 H;  1RRL A;  2HPL A;  1ETH A;  3QC9 A;  3VKG A;  3WAK A;  4H9S E;  2J1D G;  1N8Q A;  4E7S A;  3AA6 B;  3NRY A;  5ADX L;  4XZC A;  4BJM A;  1BR4 A;  2NWB A;  3ANW B;  5LNK A;  3AA0 B;  3K3O A;  2RA1 A;  4UVA B;  4DMW A;  2K48 A;  1IJ5 A;  1HU9 A;  2V7M A;  2WMN A;  5JRC A;  2CXF A;  2W61 A;  3V98 A;  4IE4 A;  4IE6 A;  3BQK A;  5FY0 A;  1U5P A;  1CUN A;  5JH7 E;  2WBL A;  2A72 A;  4UXN B;  5JR9 A;  5LHI B;  2KMF A;  3CX7 B;  2EHO C;  4AKH A;  4DVD A;  2P0M A;  3U3I A;  3PU3 A;  1HFA A;  2JMH A;  2VK9 A;  2XUE A;  4M1P A;  5HXC A;  2MOZ A;  2K5B B;  3ZYL A;  1QM6 A;  3ZMZ B;  3V92 A;  3ZPO A;  3R84 B;  2V7L A;  2XAQ B;  1V9D A;  4MBQ A;  2HH7 A;  5HWX A;  2DWG A;  2DCF A;  2KND A;  1YGE A;  4EYU A;  3CQX C;  5BMV E;  1WYB A;  4YFS A;  3PUR A;  2LHR A;  2V7J A;  2VWA A;  2KLQ A;  3M65 A;  5FY7 A;  4PK4 A;  2WXT A;  3F2E A;  2YIN A;  3JC6 D;  1NO3 A;  4AKI A;  2EHO D;  3KVB A;  4AKR B;  5HXH A;  2PG8 A;  3N9Q A;  5FP3 A;  3Q5X A;  4E7Z A;  3RRC A;  4PFP A;  3KVA A;  5HAX A;  5FXX A;  2DWK A;  3ZEF B;  2BZB A;  1FGT A;  2DLR A;  1MND A;  2MYS A;  4AXP A;  3KDS E;  4YJ3 E;  1OLP A;  3CVR A;  4H9R C;  2PFV A;  3C4W A;  3RYH E;  4OYJ A;  2CCQ A;  3NZQ A;  4TV8 E;  1JNQ A;  1ZKE A;  4GIW A;  4JUY A;  2C5J A;  2ODU A;  5FXZ A;  4YJ2 E;  4U74 A;  1IAP A;  4X20 E;  2XAJ B;  2A3D A;  4XBF B;  4PAG A;  5A1L A;  5LJM A;  5FY1 A;  2UXN B;  2VKH A;  1F8N A;  2VAS A;  4FI5 A;  2WAU A;  4YLH A;  3N9L A;  3CQG B;  1LVF A;  2QA7 A;  3CQC B;  4O4H E;  3K3Q C;  5LP6 E;  2SPC A;  2VKJ A;  2WMO A;  3LK4 2;  4IIJ E;  4UVC B;  3VF1 A;  3CX6 B;  4QXH B;  2JQQ A;  2MBG A;  4ILU A;  4BAY B;  1NWM X;  5C8Y E;  4QXC B;  1N8S A;  2LJL A;  2KT9 A;  2IW5 B;  5J1G A;  3FHN A;  4XAX B;  3RPU A;  3EDU A;  1YKH B;  2DHR A;  1O3X A;  3GWH A;  4WBO A;  3UUM A;  3MA9 A;  5EK3 A;  3RYC E;  3TKL B;  5H6R B;  3KV5 A;  5LHG B;  2PPL A;  1SA0 E;  4ERR A;  3MK7 C;  2IUK A;  4UIG A;  3NRX A;  3DJB A;  3J9X 1;  2CWY A;  4CXY A;  2XAF B;  2IC6 A;  4P0A A;  1GYG A;  3ZCJ A;  2CLY B;  1FGR A;  1CA1 A;  3KV4 A;  3V5S A;  3WAJ A;  5CA0 E;  5L3D B;  4PJN A;  4BJN A;  3HI2 A;  4IE7 A;  3N9N A;  4ZHQ E;  4IE5 A;  3AVS A;  3FG1 A;  2BDE A;  3DTO A;  3CPZ A;  4H63 V;  4IST A;  4NUV A;  4OHF A;  5FXW A;  3WI3 A;  4C90 A;  2CXL A;  1D1B A;  3UFE A;  3KBT A;  4JLE A;  2JPF A;  1VRB A;  2LOP A;  2VKO A;  5DJQ C;  1IJ6 A;  3V99 A;  3HL6 A;  2X68 A;  4OFZ A;  3T8O A;  4MFR A;  2V7K A;  3QUJ A;  2E9X C;  3ZYM A;  3FBL A;  1LRZ A;  3KIN B;  4DBQ A;  5KDM C;  4ZS2 A;  4P0B A;  2V1D B;  3FXE B;  3KV9 A;  4PW8 A;  2JJ9 A;  2RP4 A;  3I9W A;  2CXD A;  2Q9Q A;  4UVB B;  5J2U E;  4DO0 A;  2CE7 A;  3ETV A;  3EUH A;  3ZC0 A;  4CQI A;  1OWA A;  4ISS A;  1EZ3 A;  1US7 B;  2EHO A;  2N1G A;  4I4T E;  5F8P A;  3ZMT B;  4EAH A;  3AB3 B;  2IUJ A;  4DMV A;  1GPL A;  1RP1 A;  4AKG A;  2M67 A;  5EZY E;  1FMV A;  2ZM0 A;  5LYJ E;  4HKA A;  4EYY R;  2CM0 A;  3ZYK A;  2W00 A;  3PDY A;  4JEU B;  3BK9 A;  5JRC B;  1B7T A;  4TN7 B;  2LT3 A;  5E0O A;  4QWN B;  3AAA B;  2L8K A;  4HGA A;  3V5U A;  4AI6 A;  4I50 E;  4ZI3 C;  3RH3 A;  3C4Z A;  2XTL A;  2C0S A;  4U72 A;  3ZLI A;  2CLY C;  3ANW A;  4GYR A;  3O9X A;  5LGU B;  4DBR A;  5EEO A;  1BU8 A;  2XQY A;  3IHR A;  1LOX A;  2IAK A;  2VKD A;  3H37 A;  3Q9D A;  5FMN A;  4AKL A;  2W63 A;  2X67 A;  3I9Y A;  5JDN A;  3H3A A;  4ANJ A;  4AQF C;  2LSG A;  2KWI B;  1LNH A;  4EZ4 A;  3RYF E;  3PUQ A;  1T98 A;  2X9X A;  3F57 A;  2W62 A;  1ZEE A;  2EHO B;  3PUG A;  2LSI A;  2L9Q A;  5JDM A;  1KHO A;  4WW0 A;  5L3F B;  2PJQ A;  3KBU A;  5JDF A;  3Q2M A;  3IF8 B;  3LBX B;  2ODV A;  1S35 A;  2L3L A;  2ZM8 A;  4PFO A;  1MMG A;  2KWH A;  3ZC1 A;  2LSY A;  2XHE B;  2WWU A;  4H9N C;  1LPA B;  1U4Q A;  1WR6 A;  4I43 B;  3ZJ2 A;  2C5I T;  1D0Y A;  3HA4 A;  3IBP A;  1MIV A;  3OBV E;  1G8X A;  4QX8 B;  4WFO A;  4PNI A;  1WRD A;  2K24 A;  2G0U A;  2ES0 A;  2X51 A;  5LGT B;  4K0U A;  1KK7 A;  1HG5 A;  4Z8X A;  2X9H A;  1HF8 A;  1X79 A;  2Y6X A;  3FB2 A;  4TV9 E;  5HWY A;  3LK2 B;  5JRE A;  2CMR A;  3AA1 B;  4HFV A;  4OYK A;  2X66 A;  3UUN A;  5JQG E;  1BR0 A;  3HKB E;  1QMD A;  3D0T A;  5FNV E;  3SWH A;  1HS7 A;  3PUS A;  5J2T E;  1YW0 A;  4O8S A;  3N5L A;  5LGN B;  2OA5 A;  3RRW A;  1HG2 A;  3ZN0 B;  3VU7 H;  4CI1 B;  2PVS A;  5IYZ E;  2CA5 A;  2H7V C;  4PJJ A;  3LFM A;  2LSJ A;  5AFU L;  2Y8D A;  2P9B A;  3E0Z A;  3BNB A;  3HKE E;  3GA8 A;  3LK3 B;  2UXX B;  3FG3 A;  4KBM B;  3UUX B;  1BR1 A;  2CWO A;  3AAE B;  4O4J E;  4H9P C;  3ETU A;  3B13 A;  3FG4 A;  2WM9 A;  3O1I A;  3UT5 E;  5HYA A;  3QK6 A;  1IK3 A;  1OXZ A;  2W0G A;  5CA1 E;  2NTY A;  3KFW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...