3EUHA

Crystal structure of the muke-mukf complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
315
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome partition protein mukF
publication title Structural studies of a bacterial condensin complex reveal ATP-dependent disruption of intersubunit interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 121
structure length 315
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3euhA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3euhA02
1ZLKA 2FOKA 3KP6A 1FPQA 2YSRA 2VOOA 5EEHA 2D2WA 2L02A 3U9GA 4WXDA 4ESBA 4FT8A 3DXJF 5AIPA 4UVAA 2VXZA 4N9IA 3N4MA 1O7FA 1B6AA 5HOOA 4Y13A 4F7ZA 2CO5A 2DBBA 4EGZA 1B9MA 2QVOA 1ONVA 3HHHA 4R8HA 1XSDA 3ML6A 2V79A 2DPUA 5IT9K 4GGGA 3CO7C 1OR7A 4EM2A 3WG9A 3R0JA 2YPRA 2OU2A 1T98A 2R7FA 3EUHA 2XROA 2P6SA 2ZKZA 3GYHX 2VE9A 3E6MA 1MKMA 2FMLA 1DPUA 3QP5A 4KDPA 4MQVA 2E7WA 1Q1HA 2BGCA 3PQJA 5HLGA 1QZYA 4M73A 5FGMA 1R00A 3ZMDA 1P6RA 4GO1A 1B4AA 4P96A 4TV7A 1KQ0A 4QLCU 5ICFA 2ZBKA 4N0BA 5DCMB 2XKOA 3LA3A 4A12A 2EJRA 1HBXG 4PGGA 3E6BA 4M9ZA 2XRNA 2A6HF 1K6OA 2IVMA 1FYMA 3GZ5A 4RB1A 4DQ2A 3CUQB 5CYVA 3M8FA 3V8KA 3LQQA 2F5FA 3WGGA 3QAHA 2HZTA 3WTYC 2HTSA 2NNNA 2KRFA 1D3YA 4EGYA 4G6DA 3LAJA 2DAOA 4ON0A 1ZGJA 3HOSA 1XGNA 3I5UA 1BN5A 4N9HA 1YYVA 3L2CA 3ECHA 3ZN1A 2KJBA 2E7XA 1WRJA 3KEQA 4Q47A 3IHUA 2IA0A 3ZMZA 3M1EA 2V9VA 4EM0B 1SD4A 3M8EA 1S3JA 1CF7A 5DEQA 3LA7A 1FC3A 2JSCA 1T39A 5ICGA 2HDCA 4M6YA 4MQ9F 4ZZLA 5DV5A 1G3TA 1ZARA 3CTAA 4NB5A 1HKSA 1W7PB 3BJOA 3FXQA 2BBYA 4HF1A 3KZZA 1RUNA 5FFXA 3ABUA 5DCFA 1T2KA 1FSHA 5E8GA 1XGSA 5L3EA 5L3FA 3O3KA 3F21A 1USTA 2FQ3A 1MDMB 4HX4A 4I09A 4UVBA 3GVAA 2LKPA 4Z2YA 4Q4ZF 2CGPA 5IT9Z 2MH2A 4I01A 3TO9A 4L9JA 2QUFA 5BOXA 4P9FA 2Q0OA 2NAZA 1YS6A 2RDPA 2G9WA 3RYPA 1KYZA 2NNYA 3HRSA 4O6JA 3O2PE 3S2WA 4LLLA 1E2XA 3DQVC 1RNLA 3G3ZA 4YG2F 5ILSA 1CGPA 2V1UA 3RI4A 4Y17A 1WQ2A 2P5KA 5A2QK 3DP7A 4ESFA 3WTSC 3E5XA 1IW7F 2V6CA 1U5TC 3HSRA 3VEPA 1YLFA 2PN6A 4EJVA 4PGHA 3WTWC 1ZH5A 1GXQA 4WF2A 2PMUA 3ZMVA 5BQTA 2RKHA 3J7AO 3RKXA 3EYYA 3GFLA 1S7OA 1L3LA 2XAGA 4M6XA 1F1ZA 4CICA 2ESHA 2FMYA 4R79A 2JPBA 1H9GA 2XHKA 1DPRA 2LF8A 2V1DA 5K5OA 1YTYA 2W84A 5LEKA 4A2UA 4L5IA 1T0FA 3BJAA 3L00A 1XGOA 3HRTA 2FBKA 3P9KA 3H3ZA 1P4AA 2L4MA 1K79A 2FXAA 4M71A 4XSZF 1BI1A 5E18F 1BIAA 4XSXF 2F5EA 2K27A 1XDUA 2FNAA 2F2EA 2A3SA 3DV8A 4IHSA 2PEXA 4MEYF 1S6LA 2ZFWA 4HZFA 4RB3C 1H9TA 2E1CA 5CJ9A 1H0MA 1EH7A 2XAHA 5DYMA 5E17F 2CW0F 3C3WA 3FMQA 2GQQA 3MAJA 5LEJA 2OQGA 3QU6A 2O61A 2Q8KA 2YX7A 5FB2A 3VFZA 3WGIA 1S29A 1FX7A 2H09A 2ISYA 1IN5A 5E1ZB 4LMYA 3QU3A 5L3CA 2IA2A 2KKOA 4G94A 1BIBA 1B59A 3GEZA 3GFIA 1OKRA 2XAFA 3PFIA 2PQ8A 1DUXC 2IRFG 1AOYA 2RQPA 2CG4A 5TRDA 2GXBA 1Z05A 2GXGA 1P4XA 4KA4A 4KICA 1LJ9A 4HDVA 3B73A 1LEBA 1I5ZA 3RPUA 4CO8A 3DPLC 4LFUA 1W7PA 2P6TA 4OIOF 5LHGA 1XMAA 3LA2A 4RGRA 5A2QZ 4AVPA 2PLYA 1TQPA 3OV8A 1OMIA 1V4RA 3P9IA 1JHHA 3TO6A 2OA4A 1I1SA 1KGSA 4BXUA 5LGTA 2EV0A 3BP8A 1HKQA 2VOPA 1MDMA 4M9XA 2ZNYA 3FM5A 5K5RA 5J8FA 1GXPA 1SMYF 3NRVA 3SZTA 1KQ9A 3ZMSA 4HOBA 4KMUX 2MH9A 2IJLA 3HUGA 3K1MA 4IVNA 2R3SA 2DW4A 3WE3A 3WU0A 2KIFA 4FX4A 2XKPA 3BZ6A 3B02A 2V1XA 4HF2A 1U3EM 1XGMA 4PDKA 3WTZA 4GYIA 1XD7A 4M9SA 3MWMA 4L9NA 2ZO4A 4WX9A 2STTA 3I54A 3T8RA 3CJNA 1QNTA 2F5CA 4BHPA 3U1DA 5L3GA 4AD9A 4ASNA 1W7PD 2DK8A 2W24A 4HQMA 2A5YB 1ZLJA 2LSOA 3O6BB 5L3DA 1RI7A 1W4MA 3KE2A 3HSFA 2D1HA 2A61A 1EV7A 5K1YA 3BWGA 4XLNF 3BDDA 3NEUA 1EH6A 4RS8A 4UUVA 3RDIA 3MEXA 3FXUA 1B1BA 4OIPF 3KETA 5FD6A 1IF1A 2O0YA 2CWEA 3GWZA 4KMFA 5JFRA 3RKWA 1BOAA 2OD5A 1ON2A 3GZ6A 1MJ9A 2FF4A 2QQAA 1HW1A 3NQOA 1FY7A 4E70A 1XSVA 3SZPA 1XSXA 3EYIA 5ILUA 4AIKA 1UFMA 1O3QA 2AXLA 2ETHA 4PZJA 5HLIA 4A5NA 5DD4A 3DFGA 3W6KB 2CQKA 2GA1A 4LK0F 5FFZA 2COMA 2XUBA 1R1UA 2GWRA 2QZ8A 3L09A 2BEOA 4RGUA 3F22A 1BI2A 1U5TB 3IC7A 5HS9A 2VN2A 5TJJA 2JT1A 2FA5A 4UNOA 6PAXA 1TLHB 1OYWA 1D5VA 1Z6TA 4OU0A 5F6FA 5F1RA 1IZ1A 3SXYA 2XAJA 4L5JA 3GF2A 3SFZA 4DNCA 2ZCWA 3TGNA 2X4HA 3ZN0A 3ECOA 5E20A 1STZA 3LWFA 4KN4X 3M7GA 4KIFA 5KK1A 1R5HA 3FMSA 2H6BA 4KNYA 2L3DA 2DU9A 1DDNA 3CUOA 3HSEA 1ZYRF 1ON1A 4A6DA 4LG0A 3MFKA 3G73A 3TDZC 5HDKA 3I4PA 1ZG5A 1RZ4A 4BAYA 2A6EF 1J2XA 3REOA 3HTSB 2IA1A 4HQEA 2YR2A 3C1DA 3HHGA 1EH8A 3WTXC 3FF5A 5LRRA 3BJ6A 1UHWA 4A0ZA 5D4RA 1NHAA 1FWZA 1DP7P 4NHJA 2GIVA 2O03A 5IT3A 1IRFA 3WE2A 2DTRA 3V8LA 4LGWA 3W6JB 3WTTC 1RUOA 2VT3A 4MTEA 2K86A 2M30A 4RGSA 3CO6C 1Y0UA 3ERED 5CVJA 1WWXA 2O6GE 2QQBA 2G7UA 5D6EA 3F8MA 1F4KA 3WODF 5AONA 1I1GA 1XB4A 3F6VA 1UCRA 2VT2A 3ABTA 1BBYA 1S8NA 3R4KA 4BQAA 2H27A 2HS5A 4EJOA 2H94A 2M45A 5HS8A 3HIFA 5D4SA 4BHCA 1LDJA 3HYIA 2OZUA 3GLXA 3D5LA 1VTNC 1J5YA 4EQQA 2D45A 5E8IA 1HW2A 1QPMA 1FLIA 2P5LC 5DUKA 3H3UA 3Q5FA 1U8RA 3V4GA 2QLZA 3JAMK 3K2ZA 4G7OF 5K5QA 2CSOA 1XCBA 4IHTA 4P55A 4JQFA 1ODDA 5LHHA 2ZMEA 3QPHA 3P7NA 1IN7A 4YIFA 1TW2A 3QP6A 1MZBA 3T0YA 3JSOA 2H6CA 2RV8A 4BHBA 1OPCA 2VC1A 3K1PA 4I0BA 3I58A 3GXOA 2K7LA 1P4WA 3ROUA 4GCVA 1YW7A 4RAYA 1BJAA 3ZMUA 1YO5C 2FE3A 4Q48A 1FBUA 4BYYA 2IT0A 3R61A 4U7DA 4HW0A 2M87A 3TO7A 1K7AA 3KFWX 4QWQA 2KIMA 5E1WA 3ZMTA 2XVCA 3PQKA 1KU9A 1FOKA 1ZRDA 2EB7A 3BY6A 1G4DA 3LFKA 1U5TA 5CVRA 2M8EA 5FLXK 2STWA 3EQLF 4HAMA 4YFNF 3BOQA 3FZVA 1J0RA 1HXDA 2K02A 3GW2A 3CDHA 1IXCA 1OYYA 2RGVA 1R1TA 1IN4A 1YS7A 2K4BA 3KP5A 4MGRA 3WTVC 2ZXJA 4RAZA 1ZRCA 5DCMA 4HV5A 3L7WA 4UHTA 3R60A 2Z5UA 3DPTA 2QBYB 2Y75A 3V7CA 1Z6RA 2HGCA 2AS5F 3CUQA 1BI3A 4B09A 2MC3A 2DQLA 4IRHA 4JK1X 2L4AA 1ZAOA 4G9YA 3V7SA 4GXOA 1IXSB 4KIBA 4LJZF 2C6YA 2FBHA 4FHTA 4UV9A 1TQIA 1LDKB 4U0VA 1JE8A 3TDUC 2EFNA 4IF4A 4XRFA 3GX4X 3K0LA 4EMSA 4AIJA 1O3SA 2J5OA 2MBFA 3JAMZ 4HYEA 1O3TA 2P4WA 4HBLA 2VC0A 3RKYA 4XLPF 3K1NA 2P8TA 4U0YA 2GZWA 4HLYA 1UHMA 2PBIA 4CYDA 2Y48A 4MEXF 1W5SA 3Q9VA 2QWWA 1LEAA 2VODA 4PCQA 4Q5SF 1KU3A 3HRMA 4JBAA 4ZYHA 1P2FA 2HTJA 4ESJA 1TTYA 2L01A 2ELHA 1FP2A 1FBQA 3F3XA 3ZQ7A 1YW9A 1UB9A 1A04A 4ETSA 5LLQA 4OOIA 3I59B 3F8NA 2A69F 2WC2A 1F5TA 2W57A 4A0XA 2W25A 2HYGD 2LF7A 2CFXA 3MCZA 2VONA 1J7KA 1LQ1A 2VBYA 3ZPLA 4LLGF 4K2EA 4A5MA 2CYYA 1HSTA 5KVRA 2P7VB 2A68F 5LHIA 4FX0A 5H20A 4ENKA 3T5XA 1IXRC 3K69A 3FWEA 3ULQB 1GHCA 4BNCA 3IL2A 3IWZA 4L0YB 3COAC 4CXFA 5ICCA 3KP3A 1R23A 4ZYEA 5D8KB 2W85A 4WWCA 1WKMA 2HKOA 3IWFA 1SMTA 2DLLA 2HWVA 1BI0A 2EA4A 5DD8A 5ED4A 3SQNA 4GYGA 1FSEA 1R58A 3TOAA 1ULYA 4OMZA 1BM9A 3F72A 2PJPA 5HDGA 3F23A 5AIQA 1BC7C 4HF0A 1LVAA 4EJUA 4U7BA 4D0PA 4YFKF 1U2WA 2GA2A 4IRGA 5ILVA 2O3FA 3KZYA 1G3YA 2X0LA 5H6QA 3VB2A 5HVQC 1REPC 2KJCA 2NS0A 5JVTA 5BS6A 2EFWA 5FO5A 2VBXA 2EV6A 3F8FA 1Z1DA 4WK8F 3H92A 2DI3A 3LAPA 2IP2A 3F8BA 2HQNA 4HLXA 5LGNA 4HV6A 4IRIA 2QBYA 4G8XA 2L54A 3FMRA 5JI6A 3F8CA 2EFQA 2GAUA 2XASA 3VODA 2WWYA 1LB2A 2EA2A 3TOBA 4KFCA 2K4JA 2HEOA 2HKXA 1SFEA 4RGXA 4U0WA 3T1BA 1FBSA 4LK1F 1ZG3A 3RJPA 1R7JA 4ENMA 5D5VB 2XAQA 1FT9A 4AIHA 4P9UA 1Z9CA 2P7CB 1SAXA 2JZYA 2YX4A 1TNTA 1ZHFA 2IPQX 2ACJA 2EK5A 1T6SA 3J80K 1MJAA 1XMKA 2LDUA 4M74A 4OIRF 1R5GA 4NQWA 1YQAA 4KUMA 3RPQA 3IKTA 5J6XA 3DEUA 4UVCA 1TNSA 2LNBA 4UXNA 4ENJA 4EVIA 3RYRA 4CGZA 4G7HF 1ZG1A 4BH9A 4ZYGA 2PG4A 2EV5A 3JW4A 1FYLA 3I59A 3IKVA 2MLKA 5JHUA 3KP7A 1PDNC 3M9AA 1WI9A 3E5QA 2BV6A 1QO0D 1QZZA 3KEOA 2OZ6A 1OYIA 5LGUA 4I98B 4MTDA 3N97A 1IN8A 4WXCA 2VE8A 2KIUA 4S04A 3WTUC 2ZJ2A 1Z91A 4RB0A 2FSWA 1HKTA 2MLGA 4UV8A 5LRSA 3I0TA 3GO5A 2FBIA 3ELKA 4EV0A 1J59A 2ADUA 3C18A 1X3UA 2G7HA 3MZHA 4LLNA 2EWNA 3FM3A 1YG2A 5LBQA 2DO7A 1SFUA 2PMHA 1F9NA 2Z33A 3KP4A 1IUYA 4O3MA 3TKYA 1GVJA 4KN7X 1LNWA 3BPVA 2PI0A 4EJTA 2DK5A 2RVCA 1WSUA 1SD5A 1JHFA 2BYVE 4L18B 2NRAC 3HTUA 1MGTA 2HFHA 2TDXA 5D5WB 4S05A 3I53A 4I02A 1W5TA 5H6RA 2WTEA 2NYXA 2M1BA 3EDPA 1I27A 2R7DA 4EJWA 2XIGA 1IN6A 5D5UB 1KU7A 1YIOA 4U88A 1KQ8A 3I64A 1XCVA 2Z3YA 2Y0MA 2UXNA 2EFPA 4AWXB 2OBPA 2HYFA 4G6QA 1I6XA 2EFOA 2MD5A 1G3WA 5CVVA 4HX7A 2JPCA 3GFJA 3E5UA 3L9FA 4L9TA 3J80Z 5EEGA 3R0AA 3DF8A 1O57A 4MNUA 4I2OA 1YFHA 1O7LA 1P92A 1ZRFA 1ZGAA 3KP2A 3OOPA 4LD5A 1ZN2A 1K78B 1D8JA 2QYOA 2XGXA 2E1NA 2Q2EA 3K9TA 2ESNA 4LB5A 2DT5A 5HS7A 3JTGA 3QPTA 1TQMA 5HLHA 1QGPA 2UXXA 2HQRA 2RNJA 5DUIA 1TBXA 3J81K 2VBZA 1SFXA 3RTRA 1IAWA 2PFBA 3QOPA 2IW5A 5CVUA 2XV4S 2FRHA 2Z99A 5JR3A 1JXSA 4WCGA 3E6CC 1J75A 3R6SA 4WXHA 1QQIA 4LB6B 1D8KA 3CUQC 2HR3A 1LDDA 1SD7A 1O3RA 1FNNA 2O8XA 4I7HA 2DPDA 4P5OA 1XDSA 3KCCA 4CZZA 1AWCA 3D0SA 3GFMA 1BC8C 4KT5C 1S7AA 4A0YA 4R1HA 3JTHA 3C7JA 2F5DA 1KA8A 3VOEA 4IJAA 4XBFA 5ERIA 3V8JA 4OIQF 3TQNA 3I71A 3RIRA 2ISZA 4OINF 4RB2C 2P5VA 1R1VA 1PUEE 4MHGA 5F64A 3HRUA 3BROA 1HQCA 3ZP5A 3WU1B 4HDUA 3MQ0A 1E17A 3LQRA 4LG0B 4HX8A 1HW5A 1R22A 5D5XB 2UZKA 4CDGA 5FD5A 2Z9OA 3DKWA 1FZPB 4ZZDA 3FHZA 1MJBA 5BMZA 1FYKA 3ISPA 4OMYA 1PP8F 1RIOH 2QENA 3GUDA 1JGSA 1U78A 5CVIA 3CLOA 1T38A 1G6NA 5DDGA 3KLNA 5HDNA 2HOEA 4KYWA 1MD0A 2QM3A 3V7RA 2BE5F 5D8LB 4L0ZB 4I0AA 2FEZA 1SD6A 2JTVA 1QBJA 2DFIA 2QQ9A 1CF7B 4ZH4F 4L9VA 3F6OA 4CHUA 5BPIA 4Y15A 1B9NA 3E97A 3LSTA 2OQRA 3P9CA 1TW3A 4B8XA 1C0WA 5FLXZ 3E6DA 4G7ZF 4ZYDA 3Q9SA 1KU2A 1L0OC 1KYWA 3HOTA 3JSPA 3BPXA 2ZNZA 3IRRA 2RC4A 4IXAA 3J81Z 1V3FA 4ENNA 3MZYA 5L3BA 4A6EA 2MA3A 1IRGA 1J9IA 5D6FA 4YFXF 1YW8A 2RN7A 1U6GA 5CLSA 3FXRA 4O5VA 1XN7A 1HSJA 4M72A 3T8TA 2YU3A 5E1XA 1USSA 3EETA 3AAFA 2JRTA 3WGHA 1R36A 4EM1A 3SHFA 4KIGA 5ICEA 4YIIA 2B0LA 2A07F 3QRFF 2M5WA 2D1VA 1G3SA 5J8CA 1ZREA 1PP7U 4HA8A 2UWMA 1FP1D 1Z7UA 2VBWA 3FX3A 3KLOA 2DQRA 3E3VA 4H0EA 2WV0A 2FNPA 4IPAA 2OAZA 2ZMEB 2J5PA 1K78A 5BPDA 2FU4A 3IRQA 3U2RA
chains in the Genus database with same CATH superfamily
2KISA 1K6YA 2K9MA 3HG9A 3K4CA 1QSDA 1E3OC 1X19A 2FOKA 1BJZA 3KP6A 1ZLKA 5FRNA 2BVLA 3D1NI 2ECBA 4CXYA 3BR3A 1FPQA 2YSRA 2VOOA 2LM2A 2VXDA 5JR9C 2ZJPF 5EEHA 4A56A 2D2WA 2VL8A 2L02A 4ERRA 3U9GA 4U87A 4IO9F 4WXDA 1BL0A 4ESBA 4G2AA 3BG7A 4FT8A 3DXJF 4PK4A 5AIPA 5K7ZA 2WAQA 3IAS2 2KWIB 4UVAA 2WQYA 2VXZA 3CMAI 4F55A 3GZNB 4U2YA 4N9IA 4B3RT 3LSRA 3N4MA 2CV0A 1O7FA 1B6AA 4RBOA 5HOOA 1AJ3A 2FOWA 4Y13A 2XSJC 4F7ZA 3P8CD 2CO5A 3RF1A 2OPTA 2DBBA 3K7AJ 1UUSA 4EGZA 3PUVF 2E1OA 2V26A 1B9MA 4G6TB 2Y69H 3ZMVB 2FJEA 5BMVE 2QVOA 1ONVA 3BQIA 3HHHA 4R8HA 1XSDA 4ABZA 4EEDA 3ML6A 3AE7A 2V79A 2VQGA 4EATA 4KX6A 5JDHA 1R6RA 2DPUA 2XAGB 5IT9K 2D0TA 5JDFA 3H9JA 4GGGA 4A3CJ 1ZP0A 1N34T 3CO7C 1BR4A 3PV0F 5HWYA 3AE3A 4F93B 1OR7A 2HQAA 3WG9A 3R0JA 4EM2A 4BY1J 3PURA 4YXDA 2YPRA 4MALA 4MLOA 2BY3A 1WFDA 1UX4A 2OU2A 2Q9QC 1T98A 2R7FA 3EUHA 2XROA 3JRDA 2BKPA 5F1JA 2P6SA 3AG1H 2R5YB 2ZKZA 3GYHX 2VE9A 3BCAA 3E6MA 2ELJA 3HR0A 3ESWB 1HLVA 4HFEA 5M4YA 2WBMA 4LITA 3ZT5A 3KV5A 1MKMA 5CKTA 3DEEA 4KISA 1VQLI 4KJZA 3O1IA 3X2QH 1A5JA 3H0GJ 4XN0A 3S3OA 1WJAA 2FMLA 2HN2A 2LTPA 4FASD 1DPUA 4C3HJ 4D1QA 3QP5A 4KDPA 5J40A 4MQVA 1YJ9I 5HXSA 1YJNI 1SAUA 2L7FP 2E7WA 2XC7A 1KEYA 1Q1HA 2BGCA 3CJTB 3OYGA 3PQJA 5HLGA 3Q3SA 2MABA 4BACA 3PUYF 2H1KA 3RYFE 3CMYA 2VPRA 3OR1C 5CA0E 3AXJA 1QZYA 4M73A 3AE9A 5FGMA 3AA7B 1R00A 3CMMA 3VWBA 4DV1T 3ZMDA 2NVYJ 1P6RA 1T7SA 3HI2A 4HFBA 4GO1A 2M2EA 1B4AA 5IP7J 2LYCA 4DUZT 3N05A 4TZ4C 2P0WA 3H5AA 4P96A 5C44J 3HC7A 4PNIA 3CQCB 5DQWA 3CCEI 1UZCA 1UCUA 2AE9A 2VQLA 4TV7A 1KQ0A 1Y64B 2KSRA 3UU6A 4QLCU 5FL0A 4RM2A 3G1OA 2G0EA 4ZZBA 5ICFA 2W82A 2ZBKA 3HGYA 4N0BA 2MYSA 2UUZA 5DCMB 2CW7A 2XKOA 3VRBA 3ZPOA 3LA3A 4A12A 3AVRA 2EJRA 4DOZA 1UGOA 1HBXG 4CN1A 4PGGA 3PUAA 3E6BA 4CN6A 4M9ZA 2E35A 2QKMB 1X58A 2XRNA 3SZGA 4TNVA 2A6HF 1K6OA 5AQMB 2IVMA 5J47A 4E7KA 2H89A 3GTOJ 1BR2A 2NOGA 1FYMA 2KP6A 1PYVA 3LK2B 3QOEA 3JAFA 3GZ5A 4RB1A 4DQ2A 1WYBA 2C5JA 3CUQB 5CYVA 3PUWF 3M8FA 3V8KA 2NR4A 2R7XA 1EA3A 3LJCA 3SOLA 3LQQA 2I8DA 2F5FA 2WY7Q 3WGGA 4CCNA 3MVPA 4JEUB 3K70D 3AE1A 3QAHA 3SEQA 4HKAA 3LFMA 2V7JA 3QPLA 2HZTA 2BG9C 3MACA 1ZGWA 3WTYC 2GLOA 1EF4A 5FY1A 2HTSA 4HEA2 4BJTA 5LB7B 2NNNA 4A3LJ 2KRFA 1T8IA 1D3YA 4EGYA 3D5RC 4JEHB 2QA7A 3BTLA 5AQHB 3PO3J 4DO0A 4G6DA 3LAJA 3C50A 2DAOA 2CA5A 4ON0A 4B3ST 1ZGJA 5L3CB 2VQET 2VKEA 2CUEA 3QYFA 1XGNA 3HOSA 3T1HT 4CXWA 3I5UA 4BJ6C 1BN5A 4N9HA 1QA6A 1YYVA 3L2CA 4OHFA 1Y56A 4XR6A 3EUKL 3ECHA 3LSIA 2CW8A 4UV9B 2W67A 1W5CC 2J1DG 1T08B 1XX5A 3ZN1A 2KJBA 2E7XA 3N2GE 2OA5A 1WRJA 5EK4A 3KEQA 2HOTA 5FY0A 5LA6E 2CQNA 4Q47A 3IHUA 2IA0A 3ZMZA 3M1EA 2V9VA 4EM0B 4L5GA 4B6XA 1X1BA 2VJIA 1SD4A 2KT0A 3M8EA 1S3JA 2LT3A 3HKDE 1B8IA 1CF7A 2CXFA 5DEQA 1FOXA 1Z8UA 3LA7A 1I6HJ 1FC3A 3ZSSA 3NBXX 2JSCA 1T39A 5ICGA 1VQPI 1PVEA 2HDCA 4M6YA 2IDOB 4MQ9F 3OYZA 5AQTB 2XSDC 2HN1A 4ZZLA 5B1AH 3AA1B 1IJWC 4BUPA 5DV5A 1Q1VA 1JT0A 1G3TA 1ZARA 4QH4A 3CTAA 3VRAA 5LG3A 4CN4A 4NB5A 1SFOJ 1HKSA 5B1BH 1W7PB 1IRXA 4H4KC 3BJOA 1HG2A 3FXQA 2BBYA 4MO7A 4HF1A 1L0VA 3KZZA 1MMSA 2LP0A 1IAPA 4COFA 1RUNA 5LHGB 4A3EJ 5FFXA 1MSEC 3JR9A 3QB5A 1HFAA 4H63V 4ZTFA 4IHVA 3ABUA 1OJLA 4ZC3A 3GTPJ 3PSFA 5DCFA 3RSNA 5GAGJ 2D5VA 4F8HA 3VR8A 3AL0B 4BBRJ 1T2KA 2JVGA 1FSHA 5L4EA 4H9PC 4Y4RA 5E8GA 1XGSA 1IJ5A 5HWXA 5L3EA 5L3FA 3O3KA 3UR3C 3LK3B 3NZQA 2RA1A 3K4BA 1M62A 5LGTB 3JRCA 3F21A 5J0ZA 1E3PA 3R6NA 1USTA 4HNTA 1QZEA 2XQYA 2ZSHB 2FQ3A 1MDMB 3BC8A 4HX4A 1W09A 4I09A 4C3IJ 2BBJA 5EK3A 1FTTA 4UVBA 4XRSA 2M9HA 3KZIC 4LMLA 3B6AA 2R92J 2XY8B 3N5LA 2YN6A 1TL8A 2PJRB 5JVDE 3ZMSB 1RR7A 2EZIA 4U72A 4YTMA 2ZC2A 3GVAA 1NG6A 2L7ZA 5FXWA 2LKPA 4Z2YA 3CP2A 4Q4ZF 2CGPA 3M3YJ 5IT9Z 3ESLA 3JAEA 4JI5T 5LOVE 2MH2A 1W36C 3PUQA 3HUGB 5LD2C 1HC8A 4DUYT 2QGUA 3M07A 2X67A 4I01A 4UUSA 4E4HA 3BQZA 1TWFJ 1Y6IA 3H9GA 3TO9A 3HA4A 4O8SA 2XSBA 4L9JA 4AKIA 3H36A 2BKOA 2QUFA 5BOXA 1OEDB 3H3MA 3CDIA 5HAXA 3DLLF 4P9FA 1Z7LA 4EXTA 2JA2A 2Q0OA 2NAZA 3HBLA 2QSGX 1YS6A 1VQ4I 1Y8RB 2RDPA 2OLTA 1U9OA 2E5ZA 2G9WA 3Q0UA 3RYPA 5E0OA 4NUVA 3UUNA 3X1DA 4YY3T 5JREA 4XRSG 5LFAA 3HOWJ 1E2AA 4AKLA 4W97A 4GKJT 4PFPA 4Y7NJ 3CCJI 2V6EA 1KYZA 2NNYA 3S4UA 4FETA 1LVKA 1WJCA 2CLYC 2F5VA 3HRSA 4O6JA 4RAFA 3O2PE 3BTJA 3S2WA 2ZM2A 4LLLA 1E2XA 1EKEA 3DQVC 1RETA 1RNLA 1AU7A 3KDSE 1MBFA 2M4GA 5HCMA 3G3ZA 4YG2F 5ILSA 1CGPA 3ETUA 4U31A 1MIVA 3A1YA 1X4OA 4J19A 3RI4A 1A35A 2V1UA 3WI3A 1FEWA 4Y17A 5HXHA 2VURA 1ZHCA 1MBJA 1WQ2A 3JC6D 3TP3A 2YU2A 2P5KA 2KZGA 5L3GB 1XNQT 5A2QK 1XMQT 3DP7A 4ESFA 1T95A 1OEDE 1QHHD 3WTSC 3E5XA 4TWHA 3OY9A 3LL7A 1IW7F 1BW6A 2NTYA 2DA4A 1TT5B 2V6CA 1U5TC 5L3DB 3HSRA 3CCRI 4IDZA 5ABHA 1E3HA 2N1GA 3VEPA 1YLFA 3PM1A 3FISA 2HXIA 3S3MA 2PN6A 4EJVA 4PGHA 3WTWC 1ZH5A 4BJNA 2KNDA 2X1EA 1GXQA 2L9RA 3I3LA 4WF2A 2PMUA 2FUG2 3ZMVA 2HVSA 4QSHA 3AEEA 2UXDT 2N9DA 3ZYLA 5BQTA 1T33A 2RKHA 3J7AO 2YUSA 4DR5T 4EB6E 2KRHA 2CMPA 3MJXA 3M65A 3HXLA 4ZS2A 3RKXA 3EYYA 3GFLA 3K3NA 1X1CA 2WY8Q 1S7OA 1L3LA 1BR0A 4DR6T 2XAGA 3HEFA 4M6XA 1F1ZA 4CICA 2ESHA 3B13A 2QCOA 1W0BA 1U4QA 5HEUA 2FMYA 3OIOA 4R79A 2V7FA 3AE5A 2JPBA 1H9GA 2XHKA 1DPRA 2LF8A 1FOYA 3N9PA 2V1DA 1Z77A 5K5OA 2R5YA 3RRWA 1YTYA 3P4SA 3BG6A 2BHZA 2HQ5A 2W84A 3J7Yq 1FEXA 2IEKA 5LEKA 3N2KE 1K4SA 4A2UA 3ZT6A 4LIVA 3OOUA 4L5IA 1T0FA 1PJRA 3BJAA 3L00A 1XGOA 3HRTA 3OR2C 2HPLA 4IREA 3M1CA 2FBKA 3P9KA 4V19K 3H3ZA 1CHUA 1HA8A 1P4AA 2L4MA 4ZDLA 2JUCA 3MA9A 2R5ZB 5JVGF 1K79A 1HF0A 3PO2J 2MD0A 2BS2A 3H5RA 2FXAA 4Y52J 4M71A 3VR9A 4XSZF 1R71A 2ES0A 1HDDC 2X0LB 1BI1A 2V6YB 5E18F 1BIAA 3LMMA 4XSXF 1N33T 2DMNA 2F5EA 3UNGC 5EG0B 4S0HB 4XM3A 4GIWA 4DR2T 3WU2C 2K27A 2VKVA 2DYRH 1XDUA 4AI6A 1KNPA 2DHRA 4XOPA 2FNAA 2F2EA 2GXAA 3CKDA 5JR9B 3NVOA 3K4KA 3RYCE 4EEFG 2XQ4A 4O4LE 5JRCB 5JDQA 3C4ZA 2ZXWH 3DWLE 4LG3A 4TWDA 1KFYA 2A3SA 3FBNB 1H89C 4PK5A 3DV8A 4C2TA 4IHSA 1SE7A 5EDNA 2LJLA 4BE1A 2PEXA 4MEYF 2Y31A 4EZ4A 1S6LA 2ZFWA 3HJEA 4HZFA 5LMUT 2DFEA 3OYEA 4RB3C 4ANJA 2NOXA 2QF7A 3ETVA 1U5PA 1H9TA 4LOCA 2E1CA 3H0DA 4Y33A 5CJ9A 1H0MA 2NVUB 3HOYJ 1EH7A 5B3SH 2W7NA 2C5IT 2JRMA 2NOJB 2XAHA 4AKGA 1HX8A 1X9BA 3C2HA 3GLLA 4IQ4A 4XKCA 5DYMA 4IX7A 5E17F 2XASB 2CW0F 3C3WA 3FMQA 2YK0A 3CVRA 4IEJA 4WYVA 2GQQA 4D5FA 5H2FC 3MAJA 3EABA 3ZN0B 2ZMAA 4IOAF 2Z1DA 5LEJA 1WRDA 2OQGA 3QU6A 3K2AA 2O61A 1QRYA 1VQ6I 2CQQA 2Q8KA 5E3MA 2V7MA 4HEAA 5F5WA 1V5GA 5AQKB 3A4CA 1IRZA 5FKMA 2YX7A 5FB2A 3E0JB 5C4XJ 2CWYA 3ZQIA 3PIOF 2VQCA 3VFZA 1WR6A 3WGIA 3ASOH 1S29A 1ZR4A 1FX7A 3FHNA 2H09A 2ISYA 1IN5A 5E1ZB 2Q9QB 3KBUA 4LMYA 1G2HA 1YKEB 3QU3A 5L3CA 3CX8B 2IA2A 1LFPA 2KKOA 1BIBA 1B59A 3GEZA 4G94A 3GFIA 4HFIA 1OKRA 1IBKT 2DT7B 2R4GA 3MKZA 2XAFA 2DLRA 2KQRA 3DTEA 5ETWA 1IV8A 1RESA 3CCYA 2DN0A 4MLKA 3PFIA 2PQ8A 1DUXC 5LMNT 4EZHA 2IRFG 4ZJZA 4AIUA 3A2KA 1AOYA 4CUGA 2RQPA 4O2BE 4ZXLA 2CG4A 4ASKA 5TRDA 4N4NB 4KHPT 2M7AA 3ZXSA 3GMIA 2GXBA 4BAYB 1Z05A 2GXGA 1P4XA 2NW9A 4EYUA 2IMLA 4KA4A 4KICA 1LJ9A 2DMPA 4HDVA 1QU3A 2E8IA 3TLTA 3FZHB 3B73A 1LEBA 4BBSJ 1I5ZA 2XGEA 3RPUA 4CO8A 3DPLC 3HKZA 4LFUA 2ZM6T 3LSVA 2Q1ZB 3PTRB 3AKZA 4OYJA 3FXKA 4NC7A 2H8WA 3CC7I 1DU0A 1X3WB 1W7PA 3TBIA 2VKJA 2FQ4A 4DZJA 3B5MA 4X20E 4YSYA 2P6TA 2DTZA 4OIOF 2X66A 5IYDJ 1MNDA 5LHGA 2XUEA 3RC8A 3JRAA 3B57A 3F31A 4AQFC 4P0AA 1XMAA 3LA2A 4JX6A 3TLSA 4RGRA 4XMYA 1MIJA 1VNDA 2LRKA 4FQGA 5A2QZ 4AVPA 3L2RA 2PLYA 3AEBA 1B7TA 3ONJA 5C3JA 1TQPA 2PX9A 3OV8A 4BS9A 1OMIA 1V4RA 2KLOA 3VSLA 4DYRA 3P9IA 1JHHA 3TO6A 2OA4A 3L3PA 2P81A 1ZOYA 2WU2A 5FROA 2N2NA 3VKGA 1I1SA 3Q2MA 3BCBA 1KGSA 4IE7A 4BXUA 5LGTA 2EV0A 3BP8A 5J1UA 3ZKRA 1HKQA 2VOPA 1ZEEA 3OS0A 2FUPA 1MDMA 4M9XA 4DNDA 2ZNYA 1X79A 3FM5A 4XLEA 2OV7A 3ZQQA 4Z6YA 5K5RA 3RH3A 5J8FA 3KIOA 1GXPA 3RKGA 1SMYF 3QB5K 2IGOA 2M0MA 3NRVA 3SZTA 2DA6A 2V5CA 1KQ9A 1E0EA 3LSGA 1LKXA 3ZMSA 2BG9B 1MBEA 4HOBA 2W63A 2E5VA 4DV2T 2L9VA 3ABKH 4KMUX 3A5XA 3RI5A 4GK5E 3NAUA 2IS4A 5AQOB 2MH9A 3ANWA 2DL1A 4A97A 4C91A 2BY0A 5IWAT 3MKLA 2IJLA 2F6CA 2NW8A 2CXDA 3HUGA 3K1MA 3UFEA 4IVNA 2R3SA 2DW4A 3WE3A 4QXHB 4IHWA 3WU0A 3HL2A 3HKZN 5E3LA 2KIFA 4FX4A 2XKPA 3S1MJ 3BZ6A 5CFBA 2MAWA 4RLFA 3B02A 2V1XA 4GFBA 4EIWA 4HF2A 4IHXA 3FZLB 1U3EM 1OEDA 1XGMA 4OAZA 4PDKA 3WTZA 4GYIA 1XD7A 1JKRC 3RQIA 3PL8A 3J7ZI 2X9XA 2XQ5A 4M9SA 3MWMA 1S9HA 4L9NA 2ZO4A 2BG9E 1EZ3A 3L2UA 1YE9A 2PJQA 4WX9A 4NIQA 4LFCT 4WZXA 3WG7H 4FE4A 5KAFC 2STTA 2MPKA 3I54A 2YS9A 2Y8DA 4DYQA 1ZELA 2XPWA 3TEDA 5GTIC 4A3KJ 3FZFB 3T8RA 3CJNA 1R4NB 1QNTA 2XPUA 3ASNH 2F5CA 3GA8A 4L9IA 2E1MC 3BR1A 4BHPA 5FMNA 4B44A 3M4OJ 2RP4A 3U1DA 5L3GA 2E2IJ 3AEAA 4AYBN 4AD9A 1ETOA 1I50J 4ASNA 5DJQC 5GPCA 4D9JA 4EOZB 4ZS3A 2X85A 1W7PD 2DK8A 2W24A 4HQMA 2A5YB 1ZLJA 2LSOA 3O6BB 5L3DA 1RI7A 5TAOA 3UU3A 1X1DA 1WJ5A 4C30A 1W4MA 3KE2A 3V42A 4QX7B 5M5WJ 3SFEA 3CCLI 3HSFA 2D1HA 1NK2P 5JTGA 2A61A 4GDFA 4IE4A 4Q25A 1EV7A 4YHHT 1X1AA 4RAGA 5K1YA 5JQGE 1VRBA 3BWGA 3Q9DA 5FVKA 4XLNF 4B47A 2WAUA 5LHHB 5F08A 2K48A 3BDDA 2NTXA 3NEUA 1EH6A 4RS8A 4WBOA 4PJNA 2OTLI 3VDXA 4UUVA 5EEAA 4MFEA 3PUBA 3MEXA 3FXUA 3RDIA 3O9XA 2LH9A 2X68A 1B1BA 2BKNA 4EAHA 2MG4A 3IH3A 4OIPF 4U7IA 5H6RB 2DWKA 2HH7A 3KETA 3D0TA 5FD6A 2VIXA 1IF1A 3GTLJ 1UK5A 4BQOA 1JUMA 4H9NC 2O0YA 1V55H 4IKFA 2CWEA 3GWZA 4KMFA 2CV1A 4JI7T 3CCMI 4B3AA 3LSMA 3S8PA 5JFRA 3RKWA 3AEFA 1BOAA 3T1YT 2OD5A 4B3MT 1ON2A 3GZ6A 1S94A 4GYSA 1MJ9A 2FF4A 1ETYA 1J1JA 3P4WA 2QQAA 1W9RA 2UUAT 1I94T 2JJ9A 3S2HJ 2K3WA 3BG5A 4DJAA 2O9LA 3ZMUB 4AQYT 2A9UA 2VJ5A 1HW1A 4M3GA 1QPIA 3N9NA 3NQOA 4DW6A 1FY7A 1V5EA 2L7MP 4E70A 4LMJA 1SVLA 3TW6A 1XSVA 2R5ZA 1YD8G 2KZVA 3SZPA 1XSXA 1OR7C 3EYIA 5ILUA 4AIKA 4ZI3C 1UFMA 3AG4H 4QX8B 4ZI2C 1O3QA 3ZMTB 2AXLA 3KYDB 2ETHA 4PZJA 5HLIA 4A5NA 4MFDA 2CLYB 4YRVA 4IIJE 4CXXA 5DD4A 4PK6A 5EG0A 2XF7A 2HXOA 3GCMA 3DFGA 3W6KB 5JH7E 2V7KA 2CQKA 2GA1A 2QVAA 4LK0F 1WYCA 4DV3T 4IQJA 2HVQA 3KX2A 5FFZA 3UKGA 2W4XA 2UV1A 2COMA 4PW8A 5JR9A 1I3AA 3NKZA 2AO9A 2XUBA 2LHNA 2Y6XA 4DIDB 2NVQJ 1R1UA 2HI3A 2GWRA 2QZ8A 3ONLC 3L09A 2BEOA 4TX5A 4LFBT 2BY2A 2FD5A 3BT9A 4RGUA 3BR0A 3RLFF 3F22A 2K3PA 1BI2A 1U5TB 3IC7A 3SDBA 2EZKA 5HS9A 3CX7B 4X5TA 1I6ZA 1VOMA 2VN2A 3O8GA 5TJJA 2JT1A 4DV6T 2FA5A 3K6GA 2IUBA 4UNOA 4JI2T 6PAXA 1TLHB 2YINA 2IBDA 1OYWA 1D5VA 1Z6TA 4OU0A 5F6FA 5F1RA 1IZ1A 4IZZA 1XWMA 4YJ3E 1R49A 1WR0A 4CI2B 2WBLA 3SXYA 1WCMJ 4AC0A 3ABLH 5FXZA 1YOVB 2XAJA 3GF2A 4L5JA 3SFZA 2ZCWA 4DNCA 2QSHX 2ZLYA 3TGNA 3OL3A 1D5YA 2X4HA 1MBKA 3ZN0A 2JN6A 3HZJA 1YI2I 2E2HJ 4E7LA 3ECOA 4LIUA 2FJAA 3HM5A 5E20A 3VPRA 1STZA 3LWFA 4KN4X 5F8PA 5IOZA 4MIMA 3I4MJ 2LOSA 3M7GA 2IS2A 4KIFA 3I0OA 4I50E 1TWCJ 3FZKB 2LY1A 5KK1A 4PAGA 1M7KA 5EZYE 1R5HA 3FMSA 2H6BA 4KNYA 1ETKA 2L3DA 2DDAA 2B1EA 4XLHA 4WW0A 3U3IA 4JX4A 3PNTA 4P09A 2DU9A 3IP4B 1DDNA 1HR0T 2WP9A 3CDLA 1QLBA 4BJMA 2H1LA 2HZDA 3UUBA 2WY2A 1SVMA 5L4HA 4ZYAA 3ZJ2A 3CUOA 3HSEA 4V2GA 2IHR1 1MMDA 1D0YA 2LFBA 1ZYRF 3CCSI 1WI3A 1ON1A 4A6DA 1ZKEA 4G63A 3OWTA 3RZOJ 4LG0A 2VVSA 3MFKA 2XGDA 2XQ7A 3G73A 3TDZC 5HDKA 3O4XE 3I4PA 4P1WA 1D1BA 1JUSA 1ZG5A 1OQYA 1RZ4A 3NZPA 4GK0E 1I39A 4BAYA 2QKLB 2E5NA 2A6EF 1F43A 5KX5E 1PUFA 2JA5J 1FOWA 4DBQA 2MTQA 3GMEA 1J2XA 2XZEA 1WJEA 3REOA 3HTSB 2SPCA 2IA1A 4HQEA 1O3XA 2ME6A 2QYWA 1IDZA 4IE5A 1HNWT 2YR2A 3BQYA 3C1DA 2HU9A 2CBIA 1YRNB 1T56A 3HHGA 5CQGA 2KDZA 2X6WA 2YDQA 5B66C 1EH8A 2HYJA 1DP3A 3WTXC 3FF5A 4BE2A 5LRRA 1FIPA 3BJ6A 2V4JC 1SEUA 2L9NA 1UHWA 2RAEA 2BY1A 3HKEE 4A0ZA 5D4RA 1NHAA 1FWZA 1DP7P 2XF5A 4NHJA 2CQ7A 2GIVA 2O03A 4HNVA 5IT3A 3CD6I 1P7JA 3N9MA 1IRFA 3HPHA 4XONA 1WVRA 3WE2A 1GUUA 2XPVA 1QVTA 4CCMA 3I4NJ 1Z0PA 5IHYA 3ERMA 2JQKA 2DTRA 4NUBA 5FKNA 3V8LA 2IIUA 1XS9A 3IEEA 3ZCOA 5HYAA 4LGWA 1VQNI 1IC8A 2JMKA 3W6JB 3PUZF 1X4PA 3PE0A 3WTTC 3W3CA 1RUOA 3RQWA 4IDPA 4KMCA 1TWGJ 2VT3A 4MTEA 1YJWI 3N2OA 2K86A 1Z67A 3K3QC 4H9QC 3OKQA 2W62A 4TUYE 2M30A 4RGSA 2XB5A 1JI8A 3RQUA 4ZI3D 4ZI2D 1LUJB 1JNZA 3ONQA 4ZHQE 2CU7A 3IA3A 3GTMJ 1VCSA 2NXNB 1DGWY 2XRLA 2BG9A 3CO6C 1Y0UA 3ERED 2BW3B 5CVJA 2X0HA 2Y48B 5TISC 5AQFB 4X66T 1UX5A 4M6VA 3N9LA 1WWXA 2O6GE 5J2UE 2DI4A 4J01A 2QQBA 2IGKA 4DR4T 3PNYA 2G7UA 2BZTA 3CK6A 5D6EA 2R7ZJ 3Q5XA 3F8MA 1F4KA 3W15B 3WODF 4AM3A 3HOVJ 5AONA 4LF8T 2YU1A 5FY7A 1I1GA 3RYHE 1XB4A 2BHYA 3F6VA 2H7VC 1ETWA 2Q9QD 1MW7A 3S1RJ 1UCRA 3O8HA 4BXFA 2VT2A 3CQZJ 3ZOBA 3ABTA 4XNFA 1BBYA 2XTLA 5AQSB 1S8NA 4ADZA 2XJ7A 2E71A 1TWAJ 1QUUA 2BS4A 3AAAB 3R4KA 3ZLIA 4BQAA 1U9NA 2H27A 2HS5A 5GADJ 4EJOA 4H9OC 2H94A 2M45A 5HEJA 3DJBA 5HS8A 5F3JA 3ZC1A 4PUSA 3DPUA 5E3NA 3HIFA 3Q0VA 2FJ1A 4TV8E 5FVLA 5D4SA 3HL6A 3PU3A 4BHCA 2RQQA 1VQMI 5AQJB 1LDJA 4JP0A 2KPMA 3HYIA 2OZUA 2I10A 5M3FJ 3GLXA 5FP3A 3D5LA 1VTNC 4QKNA 4DZPA 3OBVE 5AQNB 3HOXJ 1W0AA 1G8XA 1J5YA 3C2GA 3PFYA 4EQQA 2E9XC 3BQLA 4U7YA 4E6KG 2R0QC 3CC2I 1T72A 3OYCA 2D45A 3H3AA 2PG8A 2IS1A 4MBQA 5E8IA 1OCOH 1U0JA 1HW2A 3RIFA 2GIZA 1D1AA 1Y0NA 1QPMA 1FLIA 2P5LC 5DUKA 3H3UA 3EPZA 5FJ8J 3Q5FA 2XAUA 1U8RA 5LHIB 3V4GA 4BEHB 2KMFA 2QLZA 3O1JA 3BG9A 4BDYA 5EGOB 3JAMK 4UIGA 4LFAT 3K2ZA 4G7OF 5K5QA 2CSOA 1XCBA 4IHTA 4P55A 4JQFA 1ODDA 1LE8B 2DJNA 3S2DJ 3GN5A 4I55E 1VQ5I 4JI8T 2W61A 3UUMA 5LHHA 3MKDA 2ZMEA 3QPHA 3P7NA 1IN7A 3OYNA 3CESA 1IV6A 2XQ8A 4YIFA 4E7ZA 1TW2A 3W2WA 2CHOA 3KPHA 4QPQA 3QP6A 1ZQ3P 1MZBA 2HPJA 3QYEA 3T0YA 3JSOA 2YU9J 2GK9A 3FK7A 2H3RA 3SWHA 2M6IA 5J4YA 1XTAA 2H6CA 1E7PA 2RV8A 4BHBA 2IGNA 3LFUA 1NENA 5HEOA 1OPCA 2VC1A 3K1PA 4I0BA 1FMVA 3K1SA 2CRGA 3I58A 2G0UA 1JUPA 2CV2A 2IAIA 1TT0A 2CBJA 3GXOA 2ACXA 2K7LA 1H7CA 2HDWA 1P4WA 3UQ7A 4JI4T 3TMOA 3ROUA 4X0GA 4GCVA 1YW7A 4RAYA 2XGCA 1AHDP 1BJAA 4ILUA 4TV9E 2ZXIA 4A3MJ 3VYUB 2JQ9A 3MZKB 3ZYMA 2DODA 2EHOC 2VL0A 2NVXJ 3ZMUA 1YO5C 3EVYA 2FE3A 1LFBA 1FBUA 2X6YA 4Q48A 4BYYA 2ZJQF 1YX3A 2BDEA 3O1HA 4MFRA 2IT0A 3MK7C 3R61A 5CA1E 1RKTA 1JNRA 5ABEA 1APLC 4U7DA 2J62A 3UU4A 4HW0A 1VQ7I 4YT0A 2MFZA 2M87A 3TO7A 4DIQA 1K7AA 2QQ8A 3IUOA 3KFWX 4QWQA 2DA5A 2BXZA 3PJAA 4YFSA 1ZKGA 1XMOT 2F4MB 2KIMA 5E1WA 4A3BJ 3AE6A 4II3A 1MMAA 3ZMTA 2XVCA 3PQKA 1WCRA 4X1KE 4YHJA 2LEHA 1U8BA 2CCQA 5JDMA 1CQTA 1KU9A 1YITI 2JK3A 3BK9A 3K4NA 3ZSTA 1N36T 2H8RA 2JA7J 3NRYA 1FOKA 4A93J 1YX5A 1HOMA 3OYAA 3KVAA 4RA2A 1ZRDA 2XF6A 3ZJ1A 3LSHA 1ORKA 4JX5A 4LF6T 2E1MB 2EZHA 3H35A 3PUGA 3KVBA 2X9DA 2EB7A 1HCIA 3BY6A 3UQ4A 2L2OA 1G4DA 3LFKA 3QPSA 5F04A 5DQVA 1DU6A 4OYKA 5IYBJ 3CCUI 2L0KA 1U5TA 5CVRA 1HX1B 5B5EC 2PFVA 1VZ0A 1Z3XA 2M8EA 4PSXA 2AQFA 1IDYA 2JWTA 3D5SC 5FLXK 5IPAA 2YDSA 5KXJA 4F3QA 2STWA 3EQLF 4HAMA 3G4SI 3RIUC 2MSYA 5C3EJ 4YFNF 2K9LA 4A98A 3L39A 3BOQA 4BKXA 3DTOA 2VVNA 4IL9A 2CRBA 3FZVA 1J0RA 3CF5F 2OF7A 4X1YE 1HXDA 1XZYA 4AKRB 5KDMC 2K9QA 3DU6A 5F0FA 2K02A 3GW2A 3CDHA 3CIRA 3ZCJA 1B72B 1IXCA 1OYYA 2LRDA 3OTOT 4HWFA 4V2FA 2GOXB 5H6QB 2LY2A 2RGVA 4XIDA 2JUGA 3V5SA 1R1TA 1V9DA 2RPAA 3P4QA 1IN4A 3J7AY 1YS7A 2K4BA 3L2QA 2H7OA 5LNKA 4XOTA 3CWZB 3BR5A 3KP5A 3LG7A 3FDYA 1D1CA 4MGRA 3WTVC 2ZXJA 3G1MA 5AQRB 4RAZA 3A03A 5F27A 2XB0X 2O8KA 2VPLA 1E1HB 4A5XA 1ZRCA 4ILBA 5DCMA 4HV5A 1W36D 2EPFA 2ZFUA 3L7WA 4UHTA 3FXDB 2M3AA 1UG2A 4HE8A 4D5CA 3GTGJ 4F52A 5LGNB 1UG0A 3R60A 2Z5UA 3DPTA 4HFVA 1ZTRA 4JI3T 2QBYB 2Y75A 5FKOA 4AXPA 2F4IA 5DS9A 3V7CA 1LVFA 3OYXA 2RREA 3HGGA 3CQGB 1N32T 1Z6RA 3HOUJ 2HGCA 2VWAA 9ANTA 2AS5F 3CUQA 1BI3A 4HNUA 4B09A 1IJ6A 1FIOA 2MC3A 3CQXC 2DQLA 1JJ6C 4IRHA 2LVSA 4L5EA 5BNGA 2L7KA 4JK1X 4M1PA 3LOCA 2L4AA 2ECCA 1NG7A 1XDPA 3LSJA 1YRNA 2VB6A 1ZAOA 4G9YA 3V7SA 1BA5A 3AEGA 4P1NA 2NS7A 2F4VT 4PJ0C 4GXOA 1IXSB 5CQEA 1VQKI 4KIBA 4LJZF 3N9QA 2V7IA 4GYRA 4ILCA 5HXCA 2WCAA 2XAQB 2KL4A 2VI6A 4L0RA 5TGTA 2C6YA 3QYBA 2ZM0A 2DNXA 2FBHA 3CP8A 3AXJB 1JJ8C 4FISA 4FHTA 4UV9A 2LSGA 3ZQGA 1TQIA 5LJNA 1LDKB 1POGA 5GPAA 2FX0A 4U0VA 2XQ3A 5J1RA 1JE8A 1HTJF 3TDUC 2EFNA 3A02A 4IF4A 4XRFA 3GX4X 3K0LA 4EMSA 1UURA 4AIJA 2KHMA 1O3SA 3RRCA 2J5OA 2MBFA 3Q5EA 5LXTE 2LSIA 3JAMZ 4TWFA 4HYEA 1O3TA 2P4WA 4HBLA 1KZHA 3A7MA 3GWHA 4XORA 2VC0A 4A3GJ 4ZTJA 4RDUA 2E19A 3RKYA 4XLPF 4TNWA 2JMHA 3LK42 1S5LC 3K1NA 2P8TA 4QH5A 2R7QA 2GZWA 2RNGA 4U0YA 4HLYA 1UHMA 2PBIA 3DCFA 4CYDA 2KINB 4J00A 4DV4T 2Y48A 2BW3A 4MEXF 1AKHB 2ZM8A 2DA7A 4XZCA 4NQWB 5JLWA 1W5SA 3Q9VA 2QA4I 2EIKH 2QWWA 1LEAA 4OAYA 4KUMB 4DV0T 3TLVA 2Y30A 1DQUA 2DFHA 4PCQA 1VF9A 3SFIA 2MW8A 2VODA 1KU3A 3HRMA 4JBAA 3GTKJ 5FRMA 4Q5SF 2UXCT 1ACIA 4UVCB 4ZYHA 1P2FA 3BG3A 2HTJA 3LNQA 1R9TJ 4M3BA 2L8KA 4ESJA 4UXNB 1TTYA 2ME0A 2QEXI 1YW0A 3RCOA 2L01A 2WDQA 4DVDA 2EIJH 2ELHA 3KV9A 2L9SA 2WMNA 3ABMH 1FP2A 2E5LT 1FBQA 1Y39A 2NVTJ 2GOMA 3F3XA 1F36A 4B48A 1OXZA 3ZQ7A 1YW9A 5HODA 1UB9A 4IE0A 4EYYR 1A04A 4ETSA 3M3ZB 5LLQA 4IDQA 1M1EB 2HNHA 2M0CA 4BQNA 4OOIA 5IP9J 1MSFC 3I59B 3F8NA 2A5WA 2A69F 2WC2A 1F5TA 2LR8A 2W57A 1MNMC 4J2CA 4JI1T 4A0XA 2W25A 4AYBA 2LY9A 3UTKA 2HYGD 2LF7A 2DOAA 2CFXA 3MCZA 4AVZA 3OL4A 2VONA 3ZT7A 5LGUB 1J7KA 1ZR2A 2PJRA 1MNEA 2VBYA 3U21A 1LQ1A 3ZPLA 4CCLA 4LLGF 2JQQA 3ZN1B 4UEMA 5EZGA 2E60A 4K2EA 4NUUA 4A5MA 2TRTA 4X64T 2CYYA 5FXVA 2LOOA 2DA3A 4DYCA 3VKHA 5L2LA 1HSTA 2OUMA 3G1LA 4UUTA 5KVRA 2KZ7B 5IOYA 3IAM2 4AQFA 4I76A 4ISTA 3S15J 1MMNA 2P7VB 3U1KA 3I56I 2PTFA 4IHYA 4YTNA 2A68F 5LHIA 4BEHA 3FKJA 2JSPA 1FTZA 3JRHA 2CFOA 1MH4A 3K8PC 4HWCA 5EGOA 4FX0A 4UV8B 4NPPA 5HNFA 2LKHA 5H20A 3AA6B 1TWHJ 2XQ6A 4ENKA 1LE8A 2CJJA 3FXOA 2WV1A 1ITYA 3T5XA 1IXRC 3LSKA 3K69A 3OMYA 3KYLA 4OWRB 3FWEA 3ULQB 2WSSV 4YTPA 2R7VA 4K0UA 1Y8QB 2F48A 4YIRX 3OIPA 1GHCA 4DR7T 3DU5A 5EYRA 2WDRA 4GRIA 3EHZA 3H37A 4BNCA 1DGRM 3IL2A 3IWZA 2L5QA 2X9YA 4L0YB 4UB8C 1MBGA 3C4XA 5LBQB 3COAC 4CXFA 2JQHA 3E1SA 5ICCA 2XQ9A 1GLNA 4HSRA 2ACZA 2LLYA 2QRXA 5M5YJ 4UR9A 1WFXA 2DMUA 3TKLB 4EGWA 5LYJE 2IGMA 1HNZT 2X1CA 3BR6A 3AE4A 3CCQI 2M4KA 4JLEA 2IS6A 4CSWA 3KP3A 2C0SA 1XDOA 4JI6T 5AFUL 3ZQCA 4KBMB 3DTKA 3QC9A 1YKHB 2BBHA 1R23A 1NEKA 1OISA 4ZYEA 3ZQFA 1Z0XA 4XK4A 3CX6B 3Q5DA 5D8KB 2W85A 3C64A 4WWCA 1WKMA 2HKOA 2W2UA 3IWFA 1SMTA 5KCMA 2DLLA 1SA0E 4NNJA 2A2FX 1X1PA 2CEAA 2HWVA 1BI0A 2EA4A 3B6CA 5DD8A 5ED4A 2LD5A 3SQNA 2FJDA 1JKQC 2DA2A 1X2NA 4GYGA 4A3IJ 1FSEA 4NBQA 1R58A 4CH7A 1A36A 4UELA 5FXXA 4ZI7E 3TOAA 5ADXL 1R8IA 2LSJA 3PIPF 4UUSB 3A01B 3SJMA 3G71I 1KF6A 1IO2A 1ULYA 3RGLA 2CXLA 4OMZA 4B43A 1A31A 1WJBA 1BM9A 1W1WE 3EUAA 3E08A 3F72A 4PJJA 2PJPA 4X62T 2W1OA 2E9XB 5HDGA 3F23A 5AIQA 4XKBA 1GQEA 4LF9T 2M7BA 2LM9A 3FBLA 5ABFB 5AQVB 2WZHA 1X2MA 3ZQHA 4PFOA 4CA0A 2X51A 2EH3A 2LLKA 1BC7C 2KT9A 2DYSH 2V1NA 3OPCA 4HF0A 1LVAA 3RKOA 4EJUA 4U7BA 1IGNA 3M8JA 4HWIB 4XLFA 4O2AE 4F91B 4M3FA 4D0PA 4YFKF 1U2WA 3F9KA 3ZGKA 2GA2A 2LRLA 2UXNB 3J7YJ 4EEBA 1FMWA 4IRGA 4NXMT 5ILVA 3AVSA 2K9AA 1G73A 2W48A 2OC6A 2O3FA 3I55I 2R7UA 1YXRA 4LF7T 3UU8A 3KZYA 2I0MA 5KNLA 4PJLA 3VHLA 1G3YA 4A3JJ 1B72A 1KK7A 4YSZA 2X0LA 3EUHC 2V6YA 1YQ3A 3ZYKA 3WHCA 1XG1A 5H6QA 3JADA 2M6BA 3VB2A 5HVQC 3BR2A 2IXSA 4DMVA 1REPC 2KJCA 2EIMH 4XAXB 4OK0A 2NS0A 5JVTA 3OYBA 3BZKA 2EZLA 5BS6A 2EFWA 4ZDOA 4AU7A 4HSTA 4XKVA 5FO5A 3IBPA 2Y9ZA 2ICWG 2VBXA 2LBFB 2DJIA 2EV6A 3F8FA 1Z1DA 2X9HA 5JDGA 3OYJA 4LMKA 4QH1A 5KHDA 3AG2H 4AIDA 4WK8F 1R5ID 3H92A 3LSPA 5JRCA 3FXJA 1OLTA 2DI3A 4YLHA 3LAPA 2IP2A 3F8BA 2VQFT 2WMOA 3NWIA 5JDLA 2HQNA 4XN3A 2EHOB 2WU5A 1HDPA 5F0HA 2JA6J 2PMZA 4HLXA 5LGNA 4NDLA 3BLYA 4KP3C 5AQGB 2YDRA 2Q2EB 4HV6A 5L47A 4IRIA 2QBYA 3L1PA 4G8XA 2L54A 3GBGA 2HPIA 2A3DA 3PNVA 3FMRA 5JI6A 3W2AA 5F0CA 3F8CA 3VYRB 1QHGA 1OCZH 2EFQA 1V54H 2LC2A 3CMEI 4IHJE 2GAUA 2UXXB 2XASA 3PUSA 3VODA 2W4SA 2WWYA 2JVHA 2EA2A 3IH2A 3MZ8A 1LB2A 2LHRA 3TOBA 2V1DB 3G06A 5HLTA 4KFCA 2K4JA 2VJJA 2V8SV 3ONXA 4BY7J 2WA0A 5BR8T 2HEOA 2HKXA 1AA7A 2GM4A 1SFEA 3RHWA 4RGXA 4OX9T 2IW5B 3AEDA 4U0WA 3T1BA 2L9QA 2W66A 1ENHA 1FBSA 1LFUP 4X65T 1VCTA 5FYMA 3JRGA 2DOEA 4QHOA 2WAQN 2X9WA 4LK1F 1ZG3A 3A0HC 3RJPA 1R7JA 4ENMA 5D5VB 2DXIA 2KLQA 2Q9QA 2XAQA 3PSIA 3UT5E 1FT9A 4AIHA 4P9UA 1Z9CA 1IBMT 3ZEFB 4AUXA 4X1EA 4BL0B 2LKGA 2DMTA 4AQGA 4U74A 2P7CB 1SAXA 1MMGA 2JZYA 3IV5A 1J5WA 3VYSB 3KYCB 4U33A 4ITVA 4UF0B 2AXTC 1JKPC 2YX4A 1TNTA 2K3FA 4CQIA 2F4OB 1ZHFA 3EAMA 4CZZB 3KV4A 5J4VA 2IPQX 1GT0C 1VQ8I 3Q5WA 3S16J 3IF8B 2K40A 4HFCA 2ACJA 4KITB 2K9NA 2EK5A 2BS3A 5IUXA 4XLAA 2PMZN 3DTIA 1YHQI 3E0ZA 4C2MJ 1S72I 1T6SA 5J1YA 3J80K 3CZ6A 3LDQB 2K5CA 1MJAA 1XMKA 1V5FA 2OJED 3RZDJ 2LDUA 2CS3A 4M74A 1HG5A 3SDGA 3P5JA 2OCEA 1R5GA 4OIRF 4C2UA 3I0QA 1AKHA 2UXBT 4NQWA 5GP9A 4CCJA 1YQAA 1NH3A 4AKHA 4FJOA 1WH7A 2VKHA 4KUMA 3RPQA 3IKTA 3G6EI 5J6XA 4AISA 4PSWA 4A3DJ 4HPQA 3RQ4A 3DEUA 2O5RA 4ZDPA 4WBNE 4UVCA 3L2WA 1XNRT 3TLUA 2JRKA 3PUFA 1TNSA 1XC5A 3H9QA 4XBFB 3P4PA 2LNBA 4UXNA 4CYCB 2JQ7A 2XAHB 3N9OA 4ENJA 3C2BA 4EVIA 3RYRA 4CGZA 3IHRA 2ID3A 3PJAJ 3GTJJ 4G7HF 2AQEA 1ZG1A 1GV5A 2N8GA 2I59A 3JRFA 4BH9A 4ZYGA 4IGUA 2W0GA 1IUFA 2LREA 2A72A 4X1IE 1T8BA 5A1LA 2JIWA 2PG4A 2L3LA 1UELB 2VASA 3JC6C 2EV5A 3JW4A 1FYLA 5HEGA 5FNVE 2VQHA 3I59A 1OCCH 3IKVA 1XPXA 4DGWB 4B4CA 2MLKA 5JHUA 1JTYA 3KP7A 2HOAA 1PDNC 3M9AA 1WI9A 4C9YA 3E5QA 3TP0A 2BV6A 2BZBA 4E7SA 1QO0D 1QZZA 1OCPA 3KEOA 2KXPB 1LPQA 3FBZA 3W2VA 2WAFA 3OS1A 2AHQA 2J4GA 2OZ6A 2LSYA 1OYIA 5LGUA 1US7B 2XAFB 4I98B 3OSFA 2Y2ZA 4MTDA 3N97A 4YJ2E 1JGGA 3ZQLA 1KNZA 3K10A 5GTHC 3AECA 1IN8A 4WXCA 1GDTA 2VE8A 2B76A 4I0UA 4KI0F 1FJGT 2KIUA 3I9V2 4S04A 3OSGA 3WTUC 1N75A 1YIJI 1EJ9A 2BVMA 3KBTA 3L2VA 4CI1B 2ZJ2A 3A0BC 2Z16A 2X6OA 5HXRA 1Z91A 1GV2A 3UFGA 4I99C 5HNHA 4EV6A 1MBHA 4RB0A 4LF4T 2FSWA 1HKTA 2MLGA 5IP6A 1H8AC 1D0XA 2M67A 5DM6F 4UV8A 5FKKA 2CMRA 5LRSA 2E34A 3I0TA 3GO5A 5FKYA 2FBIA 3C4WA 2VK9A 3ELKA 3VYTB 1WGXA 3DBLB 1S35A 2HPMA 4QWNB 4O4HE 4EV0A 1J59A 1VQ9I 4JYAT 2ADUA 3C18A 2V9PA 3RYIE 5M5XJ 1X3UA 2V7LA 3R84B 3QNUA 1UJ8A 3TLWA 2G7HA 3MZHA 4E7HA 2WM9A 4LLNA 1RKWA 2Z2SB 1JKOC 2EWNA 3FM3A 2J47A 1YG2A 5LBQA 2DO7A 1SFUA 3KINB 5K7HA 2PMHA 5LG4A 1F9NA 3HPGA 2Z33A 2YOEA 3KP4A 4YEJA 1IUYA 2VKDA 4O3MA 3CJRB 1JTXA 4BGDA 3EDVA 3TKYA 2I5UA 1WZ2A 1GVJA 5JHFA 4II2A 4KN7X 4UB6C 3OS2A 3CC4I 2XM1A 4JBWF 1LNWA 3NRXA 3BPVA 2ZMEC 2ID6A 2PI0A 3SEZA 2LMDA 5DABA 4EJTA 2DK5A 2V6XA 2RVCA 1WSUA 3JCUC 1WJFA 1W0TA 4A69C 4Z90A 3RC3A 1SD5A 2P9BA 1JHFA 2BYVE 1S7EA 4L18B 1DU2A 2C5KT 2NRAC 3FIWA 3HTUA 5LBMA 2XDVA 2ZB9A 1MGTA 4FE7A 4RMNA 1CUNA 2HFHA 2TDXA 2CE7A 3QK6A 2DMQA 5D5WB 3ANWB 2DWGA 2CWOA 2IC9A 2D2SA 4S05A 3I53A 3AE8A 2DCEA 4QTRA 2BXYA 3A01A 4I02A 3S1NJ 3CMLA 1W5TA 5H6RA 4TN7B 2WTEA 2NYXA 2M1BA 2YKSA 3EDPA 3UUXB 1I27A 2R7DA 3F2EA 4EJWA 2XIGA 2D0UA 2E9XA 1IN6A 5D5UB 1KU7A 4DR1T 1YIOA 1A6QA 4U88A 3S14J 4BU2A 1NAFA 5L3BB 4XRMA 2FJBA 5ABFA 2UUCT 4IDOA 4YELA 1OWAA 1KQ8A 3I64A 1IG7A 1FIAA 2EINH 2LK2A 4N78D 2R7SA 3VSKA 1XCVA 4GOUA 2Z3YA 5FLMJ 3FB2A 4H9SE 3V5UA 2Y0MA 5AQIB 2UXNA 3BQKA 3LBXB 1TC3C 2B9SA 2EFPA 4AWXB 2OBPA 2HYFA 4G6QA 2FBWA 4K0KT 3WHBA 5GAEJ 5KMGP 2JMWA 1SHZC 1I6XA 3MD2A 2EFOA 3P7IA 5J2TE 3TL4X 4V1Av 2MD5A 3RIAA 5M3MJ 1N25A 1G3WA 5CVVA 4FCYA 2NP9A 4OFZA 2LE8A 1D0ZA 1WHUA 3AFHA 2JPCA 4HX7A 4Z8XA 4NC6A 2ELKA 3GFJA 3E5UA 2LKSA 4C90A 3UULA 4LF5T 2K5BB 2KWHA 4M3EA 2JPFA 3L9FA 1SC7A 4L9TA 2CPTA 3J80Z 2R6GF 2LBFA 1T0FC 5EEGA 3R0AA 3DF8A 1O57A 4MNUA 4I2OA 4F6RC 2OCCH 3QODA 2ODUA 2M8GX 5E79C 1ETXA 4KT6A 3OYFA 1O4XA 2X1DA 1WLXA 3NWTA 1YFHA 1O7LA 1P92A 1ZRFA 5LJMA 1ZGAA 2MC4A 3KP2A 3OOPA 4LD5A 3OYKA 1ZN2A 1K78B 1D8JA 2HHHT 2EHOA 4QXBB 4Z91A 2QYOA 4FTHA 4NC8A 1P9QC 2XGXA 4B3XA 2WB5A 2E1NA 2Q2EA 3K9TA 4W1UA 5CJ5A 2ESNA 4G12A 4LB5A 2KRCA 2JA8J 2DT5A 3DBRB 5HS7A 3S17J 1HS7A 4RLQA 3JTGA 3QPTA 4XLCA 1TQMA 1R4MB 5LCYA 5HLHA 5KAIC 1QGPA 5AQQB 3VU7H 2UXXA 4NXNT 4IOCF 3PUXF 2HQRA 4DBRA 3QWLA 2RNJA 5DUIA 1HF8A 4UVAB 1TBXA 3J81K 2VBZA 1SFXA 1OFCX 1RC9A 4BQQA 3RTRA 5JLXA 1IAWA 3FKIJ 2PFBA 3E7LA 1TP4A 3QOPA 2MOZA 3OJAA 3AAEB 5HCJA 2IW5A 4WNKA 4C3JJ 1Z21A 5CVUA 1SANA 4B3TT 2XV4S 2FRHA 3OYLA 2Z99A 5JR3A 4O4JE 1JXSA 4IL6C 3OYDA 2E9XD 4WCGA 3G2BA 3E6CC 5GAHJ 1J75A 3R6SA 2WDVA 3JRBA 4WXHA 3U78A 1QQIA 2XQAA 4LB6B 3FZMB 3MXZA 1D8KA 5IYZE 4ZEYA 3CUQC 2HR3A 1LDDA 1SD7A 4QIWN 1Z3YA 1O3RA 1FNNA 1ERDA 4U3CA 2O8XA 4I7HA 3SS1A 4DV5T 4HGAA 1KNRA 2DPDA 2NS8A 3RIUA 4XQFA 4UF0A 4P5OA 1XDSA 3KCCA 4F92B 4JUYA 4GKKT 3CJQB 1OCTC 1VI0A 2DFFA 4CZZA 2V5DA 4UVBB 4E7JA 1G59A 5AQUB 3I9YA 2WAEA 4JV5T 1IZNB 4HRIA 4BE0A 3D0SA 5EJCA 1AWCA 3GFMA 3I9WA 4MHCA 1SUMB 1SFKA 1BC8C 4KT5C 3PJRA 1S7AA 2ODVA 2WZIA 4HFHA 4IE6A 4A0YA 3KV6A 3P4RA 2O7OA 3WAKA 4R1HA 4N4OB 2KDOA 3JTHA 3C7JA 3K4MA 2R7WA 2IC6A 2R7TA 3HOZJ 4DR3T 4ZZCA 2F5DA 2DCFA 1RRJA 1KA8A 2YEVC 1OCRH 5CB4E 3VOEA 3QOFA 5AQPB 2DOFA 3IH4A 3NWSA 2ZXHA 3DKYA 4IJAA 1A6IA 2A6TA 1WJDA 3A8YC 3KEYA 1JT6A 4XBFA 5ERIA 3HKCE 2K85A 3V8JA 4CYCA 4OIQF 3TQNA 1BW5A 4I4TE 3DBHB 2CUZA 1VQOI 2LSKA 2XAJB 3I71A 2OTJI 3JREA 2XM2A 3RIRA 4KHZF 3ZR8X 2ISZA 3FXLA 3OVUA 5EZHA 3FK6A 4OINF 2UU9T 4PJMA 2X6XA 1RR8C 5DTDA 3Q0WA 2P5VA 4RB2C 2EHOD 5J1GA 1Y1WJ 1R1VA 1X3ZB 2HOSA 1I3QJ 1PUEE 3HDDA 5LP6E 2CUJA 4MHGA 2EBIA 5F64A 4ZOLE 3SRZA 3HRUA 3EI0A 1GVDA 3TW7A 4BJ5C 3JRIA 2D9DA 4XICA 4HWHA 1TZLA 2V9KA 3BROA 4M3DA 1HQCA 2BOLA 4D7NA 5IY5H 1WPKA 3WU1B 2VJ4A 3ZP5A 4HDUA 4X6AJ 1ZK8A 2CQXA 3ZRGA 4UY8I 3S1QJ 3S93A 2CUFA 3S3NA 2A05A 3K4JA 2HDDA 3MQ0A 4H9RC 2WB1A 1H88C 2LKXA 4FI5A 2WWVA 3CLQA 2VKOA 1E17A 3F57A 4JYKA 1MIYA 3AL0C 2E36A 2W00A 3OYMA 1VFCA 3LQRA 4LG0B 4HX8A 3DLAA 3F0CA 3NARA 1HW5A 1R22A 5D5XB 3AB3B 3JCFA 3AG3H 4CI3B 2UZKA 4CDGA 3CF2A 4IDNA 4DMWA 2R7RA 5J3LA 5FD5A 2Z9OA 3DKWA 5CGMA 2UUBT 1NWMX 2I6HA 1PUFB 1FZPB 1BOBA 4ZZDA 3FHZA 3K3OA 1N78A 1MJBA 5BMZA 1FYKA 3ISPA 4OMYA 1PP8F 4HWDA 1RIOH 3ABVA 3BTIA 1YQ4A 4IL4A 3FBIB 2H88A 2KIQA 2R93J 2QENA 2LOPA 1LRZA 5HEHA 4ILAA 3GUDA 1Y01A 1JGSA 1K4TA 1HCRA 2NWBA 3DKXA 5FL1A 2WS3A 5C2TA 3EDUA 1U78A 2X0YA 5CVIA 2M34A 3CLOA 2K9SA 1T38A 1G6NA 5DDGA 3KLNA 5HDNA 2HOEA 4CZCA 4KYWA 3HKBE 1MD0A 2DDBA 3BZCA 1UHSA 2QM3A 4QPOA 5K7FA 5C4JJ 2XSAA 1SVOA 4BDZA 3V7RA 2IAKA 4RM3A 1OEDC 3AAIA 5C8YE 2BE5F 5D8LB 4L0ZB 3C51A 4I0AA 4YSXA 2FEZA 4O4IE 2EILH 3ZMZB 4CCKA 3ZC0A 4DV7T 1SD6A 4ISSA 2JTVA 3OIQA 1QBJA 3W6VA 2DFIA 2QQ9A 5IYCJ 1B8IB 1CF7B 2E2AA 4ZH4F 1FJLA 2WB1N 4D7MA 2K24A 4L9VA 1NK3P 3F6OA 3SYTA 4I6ZA 4CHUA 2QGSA 3E22E 5BPIA 3C98B 2AXDS 4Y15A 2WWUA 4HFDA 4QXCB 4JI0T 1B9NA 3E97A 3MMYB 3LSTA 2OQRA 3P9CA 2XHEB 1P7IA 1TW3A 4B8XA 1UMQA 1MH3A 1WH5A 3MN2A 1UAAA 4Y3OA 3RX6A 2QSFX 1C0WA 3MKYB 5FLXZ 4BXXJ 4U2ZA 3E6DA 4G7ZF 3UU5A 1HNXT 1K83J 2VLAA 2JJ7A 4ZYDA 4H63H 5GONE 3P50A 3AE2A 3Q9SA 1QVUA 3S32A 1KONA 2Y9YA 1KU2A 1L0OC 2X48A 1J5ET 1KYWA 3HOTA 3JSPA 3BPXA 2Y0SA 2KMUA 2ZNZA 3IRRA 2ZSIB 2RC4A 4HG2A 4IXAA 3J81Z 3WAJA 2LG4A 1V3FA 3MKWB 4ENNA 2D5UA 3MZYA 2XPKA 5L3BA 4A6EA 2MA3A 1IRGA 1J9IA 1J09A 5L3EB 5L3FB 5D6FA 4YFXF 2NW7A 5EF6A 3QUJA 4IT4A 1YW8A 2CH0A 2RN7A 1Y1VJ 1U6GA 2B7EA 5CLSA 5E3OA 3FXRA 3K4LA 4O5VA 3OYHA 4A3FJ 2HVRA 1XN7A 1HSJA 5FLVA 3J9X1 4M72A 3ZCIA 3T8TA 1K61A 2YU3A 5E1XA 1RPWA 2DT6A 4XL9A 3H5NA 1USSA 4CCOA 1ZV4X 3LBXA 3H1CA 2MGQA 3EETA 3HB9A 3AAFA 3FXEB 2R7OA 2JRTA 3FXMA 3WGHA 4JOMA 3CPZA 1R36A 4EM1A 3DEWA 5CPRB 4B1RA 3SHFA 2TCTA 4KIGA 5ICEA 4YIIA 4P0BA 2B0LA 2EQRA 2A07F 1BR1A 3RPUD 2E2JJ 5JDNA 3QRFF 3T8OA 2M5WA 5EK2A 2D1VA 1G3SA 5ABGA 5J8CA 3CCVI 1NTCA 1ZREA 2COBA 1W0UA 2OV9A 1PP7U 4HA8A 2UWMA 1FP1D 1Z7UA 2VBWA 3FX3A 3KLOA 1MIWA 2CHNA 2ZJRF 3SFDA 5DM7F 1XMXA 1ETQA 2DQRA 5FKLA 1N77A 3H3VK 3AA0B 5HXEA 3E3VA 3BTCA 3I1AA 1ETVA 2GBYA 2WADA 4H0EA 2WV0A 2VUMJ 1IBLT 4XKWA 2FNPA 3GN5B 4HN9A 5AQLB 3L8RA 2KFDA 4IPAA 2MBGA 2OAZA 2ZMEB 2J5PA 3RKQA 2Y0SN 1K78A 3PU8A 3QQAA 5BPDA 2FU4A 3IRQA 2Z6EA 3PDYA 2B63J 2DA1A 4E7IA 4BA9A 3GTQJ 4I43B 2CM0A 3OYIA 3U2RA 3K70C 4HTEA
chains in the Genus database with same CATH topology
1QSDA 1ZLKA 2FOKA 3KP6A 2BVLA 4CXYA 1FPQA 2YSRA 2VOOA 5JR9C 5EEHA 4A56A 2D2WA 2VL8A 2L02A 4ERRA 3U9GA 4WXDA 4ESBA 4G2AA 4FT8A 4PK4A 3DXJF 5AIPA 2KWIB 4UVAA 2VXZA 4N9IA 3N4MA 1O7FA 1B6AA 5HOOA 1AJ3A 4Y13A 4F7ZA 3P8CD 2CO5A 2DBBA 4EGZA 2V26A 1B9MA 3ZMVB 5BMVE 2QVOA 1ONVA 3BQIA 3HHHA 4R8HA 1XSDA 3ML6A 2V79A 5JDHA 2DPUA 2XAGB 5IT9K 2D0TA 5JDFA 4GGGA 3CO7C 1BR4A 5HWYA 1OR7A 4EM2A 3WG9A 3R0JA 3PURA 2YPRA 4MALA 1UX4A 2OU2A 2Q9QC 1T98A 2R7FA 3EUHA 2XROA 2P6SA 2ZKZA 3GYHX 2VE9A 3E6MA 3HR0A 5M4YA 3KV5A 1MKMA 3O1IA 2FMLA 1DPUA 3QP5A 4KDPA 4MQVA 5HXSA 2E7WA 1Q1HA 2BGCA 3PQJA 5HLGA 3RYFE 5CA0E 1QZYA 4M73A 5FGMA 3AA7B 1R00A 3ZMDA 1P6RA 3HI2A 4GO1A 1B4AA 4TZ4C 4P96A 4PNIA 3CQCB 5DQWA 1UCUA 4TV7A 1KQ0A 1Y64B 4QLCU 5ICFA 2ZBKA 4N0BA 5DCMB 2MYSA 3ZPOA 2XKOA 3LA3A 4A12A 3AVRA 2EJRA 1HBXG 4PGGA 3PUAA 3E6BA 4M9ZA 2XRNA 2A6HF 1K6OA 2IVMA 1BR2A 1FYMA 3LK2B 3GZ5A 4RB1A 4DQ2A 1WYBA 2C5JA 3CUQB 5CYVA 3M8FA 3V8KA 3LJCA 3SOLA 3LQQA 2F5FA 3WGGA 4JEUB 3QAHA 4HKAA 3LFMA 2V7JA 2HZTA 3MACA 3WTYC 5FY1A 2HTSA 2NNNA 2KRFA 1D3YA 4EGYA 4JEHB 2QA7A 4DO0A 4G6DA 3LAJA 3C50A 2DAOA 2CA5A 4ON0A 1ZGJA 5L3CB 3HOSA 1XGNA 4CXWA 3I5UA 1BN5A 4N9HA 4OHFA 1YYVA 3L2CA 3ECHA 4UV9B 2J1DG 3N2GE 3ZN1A 5EK4A 2KJBA 2E7XA 5FY0A 2OA5A 1WRJA 5LA6E 3KEQA 4Q47A 3IHUA 2IA0A 3ZMZA 3M1EA 2V9VA 4EM0B 4L5GA 4B6XA 2LT3A 1SD4A 3M8EA 1S3JA 3HKDE 1CF7A 2CXFA 5DEQA 3LA7A 1FC3A 3NBXX 2JSCA 1T39A 5ICGA 2HDCA 4M6YA 4MQ9F 3OYZA 4ZZLA 3AA1B 5DV5A 1G3TA 1ZARA 3CTAA 4NB5A 1HKSA 1W7PB 3BJOA 1HG2A 3FXQA 2BBYA 4HF1A 3KZZA 5LHGB 1RUNA 5FFXA 1HFAA 4H63V 3ABUA 5DCFA 1T2KA 1FSHA 4H9PC 5E8GA 1XGSA 1IJ5A 5HWXA 5L3EA 5L3FA 3O3KA 3LK3B 3NZQA 2RA1A 5LGTB 3F21A 3R6NA 1USTA 2XQYA 2FQ3A 1MDMB 4HX4A 4I09A 5EK3A 4UVBA 3N5LA 5JVDE 3ZMSB 4U72A 5FXWA 3GVAA 2LKPA 4Z2YA 4Q4ZF 2CGPA 5IT9Z 3ESLA 5LOVE 2MH2A 3PUQA 2X67A 4I01A 3TO9A 3HA4A 4O8SA 4L9JA 4AKIA 2QUFA 5BOXA 5HAXA 4P9FA 4EXTA 2Q0OA 2NAZA 1YS6A 2RDPA 2G9WA 3RYPA 5E0OA 4NUVA 3UUNA 5JREA 4AKLA 4PFPA 1KYZA 2NNYA 3S4UA 1LVKA 2CLYC 3HRSA 4O6JA 3O2PE 3S2WA 2ZM2A 4LLLA 1E2XA 4H9NC 3DQVC 1RNLA 3KDSE 3G3ZA 4YG2F 5ILSA 1CGPA 3ETUA 1MIVA 2V1UA 3RI4A 3WI3A 1FEWA 4Y17A 5HXHA 1ZHCA 1WQ2A 3JC6D 2YU2A 2P5KA 5L3GB 5A2QK 3DP7A 4ESFA 3WTSC 3E5XA 1IW7F 2NTYA 2V6CA 1U5TC 5L3DB 3HSRA 4IDZA 2N1GA 3VEPA 1YLFA 2PN6A 4EJVA 4PGHA 3WTWC 1ZH5A 4BJNA 2KNDA 1GXQA 4WF2A 2PMUA 3ZMVA 2N9DA 3ZYLA 5BQTA 2RKHA 3J7AO 4EB6E 3MJXA 3M65A 4ZS2A 3RKXA 3EYYA 3GFLA 3K3NA 1BR0A 1S7OA 1L3LA 2XAGA 4M6XA 1F1ZA 4CICA 2ESHA 3B13A 1U4QA 2FMYA 4R79A 2JPBA 1H9GA 2XHKA 1DPRA 2LF8A 3N9PA 2V1DA 5K5OA 3RRWA 1YTYA 2W84A 3J7Yq 5LEKA 3N2KE 4A2UA 4L5IA 1T0FA 3BJAA 3L00A 1XGOA 3HRTA 2HPLA 2FBKA 3P9KA 3H3ZA 1P4AA 2L4MA 3MA9A 1K79A 2FXAA 4M71A 4XSZF 2ES0A 2X0LB 1BI1A 5E18F 1BIAA 4XSXF 2F5EA 4GIWA 2K27A 1XDUA 4AI6A 2DHRA 3CKDA 2FNAA 2F2EA 5JR9B 3RYCE 4O4LE 5JRCB 5JDQA 3C4ZA 2A3SA 4PK5A 3DV8A 4IHSA 2LJLA 2PEXA 4MEYF 4EZ4A 1S6LA 2ZFWA 4HZFA 4RB3C 4ANJA 2NOXA 3ETVA 1U5PA 1H9TA 2E1CA 5CJ9A 1H0MA 1EH7A 2C5IT 2XAHA 4AKGA 1HX8A 5DYMA 2XASB 5E17F 3CVRA 2CW0F 3C3WA 3FMQA 2YK0A 2GQQA 3MAJA 3ZN0B 2ZMAA 5LEJA 1WRDA 2OQGA 3QU6A 2O61A 2Q8KA 2V7MA 4HEAA 2YX7A 5FB2A 2CWYA 3VFZA 1WR6A 3WGIA 1S29A 3KBUA 1FX7A 2Q9QB 2H09A 2ISYA 1IN5A 5E1ZB 3FHNA 4LMYA 1YKEB 3QU3A 5L3CA 3CX8B 2IA2A 2KKOA 4G94A 1BIBA 1B59A 3GEZA 3GFIA 1OKRA 2XAFA 2DLRA 5ETWA 4MLKA 3PFIA 2PQ8A 1DUXC 4EZHA 2IRFG 1AOYA 2RQPA 4O2BE 2CG4A 4ASKA 5TRDA 4BAYB 3GMIA 2GXBA 1Z05A 2GXGA 1P4XA 2NW9A 4EYUA 4KA4A 4KICA 1LJ9A 4HDVA 2E8IA 3B73A 1LEBA 1I5ZA 3RPUA 4CO8A 3DPLC 4LFUA 3PTRB 4OYJA 1W7PA 2VKJA 4X20E 2P6TA 4OIOF 2X66A 1MNDA 5LHGA 2XUEA 3RC8A 3B57A 3F31A 4AQFC 4P0AA 1XMAA 3LA2A 4RGRA 5A2QZ 4AVPA 2PLYA 1B7TA 1TQPA 3OV8A 1OMIA 1V4RA 3P9IA 1JHHA 3TO6A 2OA4A 3L3PA 2N2NA 3VKGA 1I1SA 3Q2MA 1KGSA 4IE7A 4BXUA 5LGTA 2EV0A 3BP8A 1HKQA 2VOPA 1ZEEA 1MDMA 4M9XA 4DNDA 2ZNYA 1X79A 3FM5A 5K5RA 3RH3A 5J8FA 1GXPA 1SMYF 3NRVA 3SZTA 1KQ9A 1LKXA 3ZMSA 4HOBA 2W63A 4KMUX 3A5XA 4GK5E 4C91A 2MH9A 3ANWA 2IJLA 2NW8A 2CXDA 3HUGA 3K1MA 3UFEA 4IVNA 2R3SA 2DW4A 3WE3A 4QXHB 3WU0A 2KIFA 4FX4A 2XKPA 3BZ6A 3B02A 2V1XA 4EIWA 4HF2A