3EUHA

Crystal structure of the muke-mukf complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
315
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
publication title Structural studies of a bacterial condensin complex reveal ATP-dependent disruption of intersubunit interactions.
pubmed doi rcsb
source organism Escherichia coli
total genus 121
structure length 315
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3euhA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3euhA02
4LFUA 3WG9A 2ZNYA 3GW2A 2DAOA 1W7PD 3C3WA 1VTNC 3BJAA 4A5MA 3QP6A 3GZ5A 2RGVA 3OOPA 3ZN1A 1J7KA 2D1HA 3RPQA 2P8TA 2PMHA 3DPTA 4I02A 4LK0F 1ZHFA 3LWFA 2HKXA 3ZQ7A 5BQTA 1ZAOA 3BPVA 4RAZA 1TNSA 4M6YA 3KP2A 3LQRA 3I71A 2D2WA 1FNNA 1P4XA 3V7SA 4QLCU 3F8BA 4L0YB 5HLGA 1RI7A 2IJLA 4A0YA 5D6FA 4Y17A 4P55A 4WXDA 1SMYF 1HSTA 4XLPF 2IA0A 3F6VA 3RKYA 5FGMA 4R79A 3K69A 2GXGA 2GAUA 2H27A 1G3TA 1ZYRF 1D5VA 2ZBKA 1RIOH 4DQ2A 3R0AA 1K78B 1U5TB 5ICEA 2Y48A 4RGUA 3R0JA 4I7HA 3RJPA 4UV9A 5CVIA 5AIPA 1IUYA 4NQWA 2V1DA 4YIIA 2A6EF 3F3XA 5CVUA 2VT3A 3KETA 2EK5A 5JI6A 1REPC 2EB7A 2O0YA 2MLGA 2VBYA 3WU1B 3LQQA 5E20A 2P7CB 2FBHA 3JAMK 3I54A 2OD5A 3V8JA 4I01A 2HR3A 4RGSA 4HZFA 4BXUA 3L00A 3RKWA 3M1EA 4A2UA 6PAXA 1C0WA 1QZYA 4IHTA 3ULQB 4HLYA 1I6XA 2JZYA 4WWCA 1SMTA 3TO6A 2L4AA 1IN7A 4R8HA 3IHUA 2K02A 1J0RA 3SHFA 2QBYB 2Z9OA 4ENJA 4KIBA 5E1XA 1HW1A 2M8EA 3HIFA 3ZMVA 2HQRA 2XIGA 5L3FA 2GIVA 3LAJA 4GGGA 4EJUA 3IKVA 1TNTA 2Z3YA 1GXQA 4QWQA 1RUOA 4FHTA 2XAHA 5FFXA 3R6SA 3LFKA 2FF4A 2LDUA 2CO5A 4IVNA 2VBZA 1IXSB 4PCQA 3BOQA 4CGZA 2MC3A 3TQNA 2MLKA 1FYLA 3TOBA 4XSZF 2G7UA 3GLXA 4L5IA 1ON2A 1TBXA 5D5VB 1HXDA 1IZ1A 1X3UA 3LA7A 3WTUC 4XSXF 2ZXJA 4BHCA 1ULYA 2WV0A 4UV8A 3E97A 1D8JA 3OV8A 1FC3A 2P6TA 1BIBA 3GFMA 1FOKA 4EM0B 1SD6A 5HOOA 3BJOA 3FZVA 1Z91A 5IT9K 5F1RA 2FBKA 1T6SA 2STTA 2XASA 4HQMA 2YSRA 3S2WA 1AWCA 5DCFA 1V4RA 4M9XA 3J80Z 4IRGA 5ERIA 4ASNA 1XGOA 2V1UA 1YW7A 3RYPA 1J2XA 1R7JA 5F6FA 1CGPA 2PJPA 5ED4A 2EA4A 3PFIA 2KIMA 4EVIA 3WTYC 1SD5A 1QQIA 2KRFA 3ZMZA 3K0LA 1LNWA 3F8MA 5FO5A 4HV6A 1IN5A 3RPUA 4KFCA 3T5XA 1T2KA 3WTXC 4CYDA 1FBUA 2M87A 3IKTA 2E7XA 5KK1A 2OU2A 3FMQA 4ESBA 5E17F 4NB5A 4KICA 3MWMA 2BGCA 4OIPF 3HHHA 1PUEE 5LHGA 1IN4A 4PZJA 3LA2A 2ZMEB 2VOOA 3EETA 4HLXA 5CVVA 2QWWA 1BI3A 1ZH5A 3V8LA 1QGPA 1HKSA 1LEAA 3GFJA 3EYYA 4LMYA 2FXAA 2ZFWA 1O7LA 1EV7A 4MQVA 3P9KA 4LB5A 2AXLA 4MNUA 1U6GA 2QQBA 1FYKA 1PP8F 1E2XA 1LDJA 2J5OA 1BN5A 3HRMA 2V79A 3E6CC 1UCRA 3KZYA 4KIFA 1MGTA 3T1BA 4IHSA 3ZPLA 2NNYA 4Y13A 3DQVC 1FLIA 4LLGF 3C18A 5CYVA 3KCCA 2MBFA 4AD9A 4LG0B 4EM1A 3KLOA 3QU3A 3W6KB 1T98A 4EMSA 1ZG1A 1IN6A 4MHGA 3F21A 1BBYA 3HRUA 1W5TA 1YS7A 2O8XA 4CXFA 4BQAA 4BNCA 1MJ9A 1OKRA 2A3SA 4YFNF 4M6XA 5AIQA 2IPQX 2IP2A 3HTUA 5HDNA 4DNCA 4JQFA 3HSFA 4PGHA 4A12A 4OU0A 2A5YB 1R5HA 1G3WA 2FMYA 2QZ8A 1G3YA 5H20A 2PQ8A 2DLLA 4B8XA 1KQ9A 2F5CA 1MDMB 5FFZA 5LHIA 2VE8A 3AAFA 1FWZA 2L54A 2K7LA 3TDZC 5CVRA 2L02A 2Y75A 4OIOF 1S6LA 2HFHA 4N9HA 3IWZA 2KIFA 2E1NA 2DT5A 3F6OA 2OQRA 1FZPB 2EA2A 2CGPA 2UXXA 2F5FA 5AONA 1TQPA 1KU7A 5HLIA 5ICCA 1XGMA 2FE3A 2R7FA 2DPUA 4KUMA 4RGXA 2R3SA 4AIJA 4PGGA 2H09A 3BROA 1XGNA 2K86A 2E1CA 4K2EA 1K79A 1LDDA 2HYGD 4ESJA 1TQIA 1I5ZA 3HHGA 1G3SA 1O3SA 2OA4A 2A6HF 4KNYA 3R4KA 5H6QA 3MFKA 2HOEA 2K4JA 3W6JB 2G7HA 5J6XA 3JSOA 1H9TA 2PN6A 1SAXA 1IW7F 1GHCA 1FYMA 1YG2A 1IF1A 5FLXZ 2FQ3A 1HKTA 4XRFA 1SFEA 5LGNA 1QNTA 2ETHA 1USSA 1RNLA 1R1TA 3ZMUA 2YPRA 1SD7A 2HWVA 2V9VA 2DO7A 4HBLA 3HYIA 3VEPA 3ECOA 1SFUA 2ZCWA 4MTDA 3WTWC 4OIQF 2VC0A 4U7DA 3I58A 1Z6TA 4IJAA 2CG4A 2HTJA 5DUKA 5JVTA 5ICFA 2WC2A 5A2QZ 2Z5UA 2RNJA 4O6JA 3ML6A 1XN7A 4RB3C 1XDUA 3U2RA 4XBFA 3GF2A 3MAJA 4U0WA 4Y15A 3ZP5A 2O3FA 4EM2A 5LBQA 2O03A 2Q0OA 4A0XA 5D5XB 4IXAA 3F8CA 2W84A 1R58A 1MJAA 4AIKA 3P9CA 1D8KA 2M1BA 1FP1D 2HDCA 5HDGA 1ZRDA 1TLHB 2DFIA 5E18F 2FSWA 1HKQA 1BI1A 1JHHA 2KJCA 2GA2A 1XCVA 3I59A 2EV5A 4G7OF 1W7PB 2ZO4A 1I27A 4ZYEA 2PLYA 2W85A 2ADUA 4BHBA 3RYRA 3ZMSA 3LAPA 5K1YA 2IVMA 1I1GA 4N9IA 4YFKF 1ZARA 3TOAA 2ZNZA 1BC7C 4ENNA 3VODA 3ZMDA 3HOTA 2UXNA 1FT9A 2BBYA 4TV7A 1NHAA 1QO0D 3GYHX 3MEXA 2MD5A 3CLOA 2LKPA 3WTTC 1KU3A 1S29A 4Z2YA 1O3QA 1YQAA 2A61A 1CF7B 4UXNA 1F1ZA 5LEJA 2RC4A 4EJOA 1HW2A 3T8RA 5HVQC 2DI3A 1ZGAA 2RDPA 2QLZA 1Z6RA 2RVCA 3TDUC 3GFIA 4EV0A 4EJTA 4WCGA 1S7OA 1LVAA 4U7BA 3KP3A 2WWYA 3J80K 3FM3A 2DPDA 1Y0UA 5D4SA 2IA2A 1IXCA 1IRGA 3D5LA 4AWXB 4M9ZA 4A5NA 2M30A 3KP7A 3N4MA 5K5QA 1U78A 4M71A 1J5YA 2HYFA 3I0TA 3DKWA 3CUQB 2Z33A 3WU0A 3SZPA 4LD5A 3J7AO 4L9NA 3CUOA 2HS5A 2XROA 2XAGA 5DV5A 1FBSA 1HW5A 4HX7A 3IC7A 3V7CA 1T39A 2JT1A 3IL2A 2DU9A 3JTHA 5BOXA 3O6BB 3G3ZA 4KN7X 2W57A 5J8FA 3PQJA 4NHJA 2FNPA 3KLNA 3GVAA 1K78A 4H0EA 3NEUA 1U5TA 1ZLKA 4I2OA 3ROUA 2RKHA 5E1ZB 5H6RA 5BMZA 4MQ9F 1WQ2A 1LEBA 3KE2A 4HW0A 2GZWA 2VBWA 1P92A 1WRJA 2BYVE 2CQKA 4GYIA 2TDXA 1BI2A 3ZN0A 3HUGA 2CSOA 3WTSC 2XKOA 3N97A 1OMIA 3HTSB 4OMYA 2LSOA 1USTA 2BE5F 1EH7A 1XD7A 5JHUA 4S05A 4UHTA 3ABUA 1F9NA 3BWGA 4O5VA 1R1VA 1KU9A 1T38A 2BEOA 3H3UA 1UHWA 1R1UA 1UFMA 2QBYA 3FMSA 4HF1A 3Q9VA 3VOEA 1H9GA 1TW2A 1YS6A 3WTVC 4MEYF 4I09A 2ZKZA 3U1DA 4S04A 3J81Z 4EJWA 4L9VA 1QZZA 3WGHA 4KIGA 3FXRA 5ILSA 3FMRA 4UNOA 1LB2A 2BV6A 4G9YA 2P6SA 4OIRF 3EQLF 4JBAA 1Z05A 4F7ZA 2ACJA 3K9TA 3H92A 1L3LA 1YO5C 5DD4A 1FBQA 4P5OA 1KA8A 1ODDA 1YLFA 1PP7U 1JGSA 4UVBA 3U9GA 5TRDA 4G6QA 3WGGA 2G9WA 2P5LC 2QQ9A 2FNAA 3ERED 3GEZA 2P5KA 2B0LA 3E6DA 1I1SA 2JTVA 1QPMA 4Q47A 2UZKA 1D3YA 1B1BA 5LHHA 3K1PA 4N0BA 5DCMB 1O7FA 2ELHA 3B02A 2JPCA 1WKMA 1YYVA 2K4BA 2XHKA 4WXHA 1XMAA 2OAZA 4UVCA 3JTGA 4L0ZB 3EYIA 3F23A 2ESHA 4KMFA 3GO5A 5HS8A 2V6CA 1S3JA 2Y0MA 2EFQA 3L9FA 4EJVA 3ABTA 2E7WA 2OZUA 2L01A 1Z1DA 3I4PA 1BOAA 2M5WA 3MCZA 2HKOA 3KP6A 3F8NA 4ENMA 2NNNA 1R23A 3REOA 1QBJA 2F5DA 3EDPA 5FD5A 1B59A 5D5WB 3QAHA 3BDDA 4AVPA 1IRFA 3HRTA 2IRFG 1KGSA 1U5TC 4A6EA 3FX3A 3M7GA 2X4HA 5FLXK 4ESFA 2DTRA 3TGNA 5L3GA 5DD8A 1TTYA 5D5UB 2A69F 2ZMEA 4YG2F 4IRIA 3CDHA 1EH8A 4HYEA 2QENA 1YW9A 4M73A 5L3DA 3F22A 4FX4A 5LRSA 1W5SA 3WODF 3IRRA 3GX4X 2UWMA 4ON0A 1TQMA 3Q5FA 4M74A 5DDGA 2OBPA 2JPBA 5BPIA 3SQNA 3L7WA 4L9JA 3QRFF 3E6MA 1FSEA 5A2QK 4IF4A 1RZ4A 4CICA 2RV8A 3FM5A 2HEOA 4EQQA 5HS9A 2QYOA 2VBXA 2F5EA 1U2WA 2F2EA 1ZN2A 2VOPA 5FB2A 4LG0A 2PI0A 4A0ZA 2Q2EA 2H6BA 3CTAA 3DEUA 3LSTA 3TKYA 1F4KA 3I53A 4HAMA 2QUFA 4Q5SF 2RQPA 3K1MA 3L09A 2MA3A 1BC8C 1P2FA 4LLLA 2KKOA 4HF0A 4M9SA 2R7DA 4BYYA 4U0VA 1HSJA 5BS6A 1KYZA 2C6YA 1FP2A 1J59A 3L2CA 4B09A 1YFHA 2KJBA 3KZZA 1W4MA 2ISZA 1DP7P 1HQCA 1IAWA 2FBIA 1J75A 2FU4A 2X0LA 2H94A 3V4GA 1PDNC 1MDMA 4Q4ZF 4L5JA 3I64A 3SZTA 1G4DA 2XGXA 3BY6A 2EV0A 3K2ZA 3E5QA 2NRAC 3IRQA 3CO6C 1P4WA 5HS7A 4L18B 1OPCA 1KYWA 1OYIA 1XMKA 2GQQA 1B4AA 4KDPA 5DYMA 1ZLJA 3DV8A 3SXYA 1FX7A 4CDGA 3TO9A 1MD0A 3QP5A 3V8KA 1F5TA 2DBBA 3FWEA 2AS5F 2Z99A 1G6NA 3B73A 4GO1A 3FXUA 5E8IA 3KP5A 4KMUX 3K1NA 1B6AA 1Q1HA 3KP4A 3C7JA 3ELKA 3PQKA 1S8NA 4LK1F 3BP8A 5EEHA 5CJ9A 3O2PE 4RB0A 1HBXG 3R61A 1TW3A 2DQLA 2A07F 2XUBA 5ILUA 3FXQA 2RN7A 1O3TA 3RKXA 5D6EA 5ILVA 4G6DA 4BAYA 2XAQA 2OQGA 4IRHA 4ZZLA 2ZJ2A 1J9IA 5F64A 3GZ6A 5L3CA 1U8RA 5JFRA 4KYWA 2XVCA 1WWXA 3BPXA 4WX9A 1DUXC 5JR3A 1LQ1A 4IPAA 4UVAA 5D8KB 1XCBA 5E8GA 2MH2A 2QVOA 5ICGA 2YR2A 1SD4A 4HF2A 2VC1A 4EGYA 2NS0A 1KQ8A 4WK8F 2M45A 5DEQA 2P7VB 3E5XA 2EJRA 4RGRA 4HOBA 5L3BA 2IA1A 1Z7UA 3F8FA 4G94A 1ON1A 4YIFA 2YX7A 3RTRA 2YU3A 4E70A 3CO7C 5K5OA 2O6GE 2FEZA 3DPLC 2W24A 3RI4A 4LLNA 2W25A 2EFWA 4ZYGA 4CHUA 4PDKA 1JXSA 4G8XA 2VODA 3LA3A 3E3VA 4P9UA 4ENKA 1B9NA 3MZHA 1YTYA 1R36A 5E1WA 3JAMZ 2VONA 1W7PA 4WXCA 1XDSA 2Q8KA 3F72A 4MTEA 1LJ9A 5HLHA 3FHZA 1LDKB 2HQNA 1XGSA 4P9FA 3VB2A 1L0OC 3J81K 1XSVA 1ZG5A 2PEXA 1DDNA 3P7NA 2HGCA 2VT2A 1OYYA 4KA4A 4MEXF 2XAFA 2K27A 3QPTA 3GWZA 4KN4X 1BJAA 3R60A 1OYWA 3C1DA 1JHFA 5EEGA 3BJ6A 4I98B 3WE2A 5IT3A 4JK1X 5D8LB 1BIAA 2LNBA 3H3ZA 3RIRA 1KU2A 4ZYDA 3ZMTA 1IN8A 1CF7A 3DF8A 5LRRA 1S7AA 4AIHA 1U3EM 2MH9A 1FPQA 3M9AA 1ZGJA 3JSPA 1FY7A 4HDUA 1R22A 2EFPA 1ZRFA 4BHPA 1E17A 3KEQA 3HSEA 5J8CA 1YIOA 2CFXA 2V1XA 1O3RA 3QOPA 2NYXA 1K7AA 3T8TA 1YW8A 1K6OA 2PG4A 1MZBA 5KVRA 4XLNF 2H6CA 1UHMA 4HV5A 5IT9Z 3CUQA 2FMLA 4U0YA 3EUHA 3FF5A 3WE3A 3NQOA 3I5UA 1XSXA 1Z9CA 3COAC 4FX0A 3WTZA 4HDVA 2EFNA 3SFZA 3G73A 3JW4A 4GCVA 1SFXA 1UB9A 2DQRA 3MZYA 5L3EA 4RB2C 5BPDA 2NAZA 1KQ0A 4RB1A 4WF2A 2PBIA 1R00A 1WI9A 1P6RA 1XSDA 5FD6A 1MKMA 3QPHA 1BM9A 4M72A 3ECHA 1GXPA 4KT5C 3DP7A 2DW4A 2QM3A 3HSRA 4G7ZF 3M8FA 2ESNA 2J5PA 4U88A 4YFXF 2QQAA 2FRHA 4CO8A 2PFBA 2JSCA 1AOYA 1H0MA 4RAYA 2XAJA 3M8EA 1XB4A 2HTSA 1A04A 4R1HA 4I0AA 2GA1A 2L4MA 3DXJF 5HDKA 3GFLA 4I0BA 2CWEA 2HZTA 4HQEA 2D1VA 2COMA 5CVJA 4BH9A 2IT0A 4P96A 3HOSA 4HA8A 2A68F 3KFWX 1IXRC 4A6DA 4GXOA 4UUVA 1MJBA 2DK5A 5D4RA 4FT8A 3BZ6A 2GWRA 1ZRCA 1V3FA 2OZ6A 1P4AA 2LF7A 4LJZF 2XV4S 3CJNA 5LEKA 5CLSA 2STWA 3QU6A 4OINF 3RDIA 5LGTA 2JRTA 4LGWA 1EH6A 1ZREA 4ETSA 2LF8A 3D0SA 4HX8A 5LLQA 1R5GA 3E6BA 3O3KA 1T0FA 5DUIA 4EGZA 2GXBA 2IW5A 4D0PA 4HX4A 3GXOA 1FSHA 1OR7A 5LGUA 3I59B 2YX4A 4G7HF 4LB6B 5TJJA 1B9MA 2WTEA 2KIUA 3HRSA 3Q9SA 4Q48A 1BI0A 2CW0F 1WSUA 3E5UA 3GUDA 3KEOA 2P5VA 4ZYHA 2VN2A 3P9IA 4ZZDA 1DPRA 5DCMA 2D45A 2L3DA 2XKPA 1STZA 1RUNA 1ZG3A 2VXZA 2CYYA 4MGRA 3TO7A 2EFOA 4CZZA 4OMZA 2DK8A 2ISYA 5K5RA 2VE9A 3VFZA 2XRNA 2FA5A 4O3MA 4ZH4F 3MQ0A 4L9TA 2O61A 4OOIA 4GYGA 1O57A 1ONVA 3V7RA 2EV6A 1GVJA 3NRVA 3CUQC 2EWNA 2FOKA 3DFGA 3ISPA 2P4WA 3IWFA 1JE8A 3WGIA 2PMUA 4RS8A 3T0YA 1DPUA
chains in the Genus database with same CATH superfamily
4LFUA 3WG9A 1JUSA 3A01B 2V7FA 2CMPA 2ZNYA 3IUOA 1LFUP 3GW2A 3KV6A 2DAOA 3ZYKA 5F5WA 3QPLA 1W7PD 4UXNB 1JUPA 3TLSA 2E34A 3C3WA 1VTNC 3BJAA 3HPGA 4A5MA 1ZEEA 2UUZA 1IG7A 5TGTA 1QPIA 3QP6A 3GZ5A 3ABKH 2RGVA 2VJ5A 2PJRB 4UF0B 3OOPA 1R4NB 1AA7A 3ZN1A 1J7KA 1Z3XA 2EPFA 2V6EA 1VNDA 2D1HA 2P8TA 2PMHA 3DPTA 4I02A 3RPQA 2DL1A 4P1NA 5FY7A 5FXZA 5C3EJ 3C51A 4LK0F 1ZHFA 5CFBA 3ESLA 3NBXX 4YSXA 3LWFA 1VF9A 4CXXA 2HKXA 3ZQ7A 5BQTA 1ZAOA 4N4NB 4RMNA 3CP8A 3BPVA 4TUYE 4W97A 1VOMA 5TISC 1GT0C 4XORA 1HCRA 3N05A 4FISA 3K4BA 4RAZA 4AM3A 1HNZT 2BBHA 3AEDA 1TNSA 3JRCA 4M6YA 5M5WJ 3KP2A 3LQRA 2D5UA 3I71A 4PJJA 1E2AA 2K3WA 2D2WA 4CN6A 1IDZA 3L3PA 4ASKA 2R5YB 3S3NA 4KP3C 4DO0A 3HOVJ 3QWLA 1FNNA 1P4XA 3V7SA 4QLCU 1OISA 2VLAA 5JDQA 2FJAA 2WDQA 2WBMA 3F8BA 4L0YB 4HWDA 2JQ7A 4M3DA 4HSRA 1T8IA 3ONXA 1LFBA 5HLGA 3K3NA 3CP2A 3SEQA 3K70C 1RI7A 4CN1A 5KCMA 3OS0A 2IJLA 3ZQHA 3AKZA 2GBYA 4A0YA 4NXNT 1UX5A 2MAWA 5L47A 3I0OA 4PFPA 2E9XC 5D6FA 2BKPA 4QKNA 4Y17A 4P55A 3ONQA 2XAGB 2JRMA 4V1Av 4C91A 4AC0A 3W6VA 1QLBA 4WXDA 1SMYF 1W36C 1HSTA 3OYGA 3FXEB 4XLPF 2IA0A 2WM9A 2M6IA 5AQUB 3F6VA 2LYCA 2VQGA 3RKYA 4HNTA 5FGMA 3CCEI 1XNQT 4R79A 2F4MB 3K69A 2CJJA 2IXSA 2A6TA 2E71A 2GXGA 2GAUA 3ESWB 2PFVA 3H35A 3LK2B 2H27A 4JYAT 1G3TA 1POGA 1ZYRF 1D5VA 1BR0A 5A1LA 2EILH 2LREA 4HN9A 2F6CA 4X64T 4OHFA 2ZBKA 3FXJA 4EZ4A 5F3JA 4PW8A 1RIOH 1HG2A 4DQ2A 3R0AA 5E79C 2FJDA 3GMEA 1H8AC 3DKYA 1K78B 2IHR1 5KAFC 1U5TB 4ILUA 4X1KE 3L1PA 3PE0A 2JVHA 3HOYJ 3OVUA 5ICEA 2Y48A 5H6RB 2CLYB 3AE1A 4XQFA 1ZGWA 2JQ9A 4RGUA 3R0JA 4I7HA 3JRHA 2CM0A 4JEHB 3N9LA 2CV0A 3J7AY 3RJPA 2CBIA 3ZGKA 5FROA 4UV9A 1FIPA 5CVIA 3LK42 3CF5F 2DCFA 4U72A 4V2FA 5AIPA 1JKPC 1IUYA 3BTIA 4IGUA 4JLEA 5LB7B 4NQWA 2V1DA 4YIIA 2A6EF 3F3XA 4GDFA 2R7OA 2NS8A 4DUYT 5CVUA 2VT3A 1MMNA 1GV2A 3KETA 1QVTA 2EK5A 3B5MA 4O8SA 2GLOA 4E7KA 1EA3A 5JI6A 1REPC 2CQNA 2I8DA 2EB7A 2WSSV 2DFFA 2LR8A 4RBOA 2O0YA 4B3XA 5C44J 2ACXA 2MLGA 5HWXA 4TWHA 4YT0A 3ZKRA 2VBYA 1OFCX 3LQQA 3WU1B 3LG7A 4F6RC 5E20A 2P7CB 2JQQA 2FBHA 3JAMK 2L2OA 3I54A 3I3LA 5JRCB 2OD5A 2OPTA 3V8JA 4NBQA 3OYDA 3L2QA 4I01A 2FX0A 1NK2P 2HR3A 3F31A 4RGSA 4HZFA 4BXUA 5AQOB 2ME6A 3L00A 3RKWA 2XM2A 4JI8T 1KONA 3M1EA 4A2UA 2LOOA 5JR9A 6PAXA 2VVNA 1T0FC 5HEJA 1C0WA 1QZYA 1FOYA 3HOUJ 2Z2SB 1UCUA 2KWIB 4UUSB 3UUMA 1LRZA 5F0FA 4IHTA 3K3OA 3ZMTB 3ULQB 3BG6A 1OR7C 4HLYA 3BR6A 5IWAT 1D1CA 3HKZN 1I6XA 2JZYA 4WWCA 4DV2T 4RDUA 4C2UA 2KRHA 3CCLI 4ZI3C 1B7TA 1SMTA 1WCRA 4KJZA 2L4AA 3HBLA 3TO6A 1IV8A 1IN7A 1N25A 3IHUA 4R8HA 5GAGJ 5EG0A 1XS9A 2K02A 3PJRA 1J0RA 4A3LJ 1KF6A 3AXJB 2I0MA 4EEBA 5M4YA 3SHFA 2QBYB 2Z9OA 2CWYA 1LE8B 3I0QA 3UUBA 4B3MT 4ENJA 4U87A 1MMGA 3CCSI 4U74A 2UV1A 5AQQB 4KIBA 5E1XA 1HW1A 2M8EA 1HF0A 1FOXA 3HIFA 1JNZA 2W82A 4WBNE 3ZMVA 2HQRA 2XIGA 4X65T 5L3FA 1NWMX 4IE7A 2GIVA 4NC8A 2CQ7A 3LAJA 1T72A 4GGGA 3MK7C 4EJUA 3IKVA 4Z6YA 1B72B 5C8YE 1TNTA 2Z3YA 1GXQA 1NG7A 3RIAA 3OWTA 4QWQA 5KX5E 1RUOA 4FHTA 2JPFA 2V7JA 2XAHA 5FFXA 3R6SA 3LFKA 4ZI7E 1WYCA 1HNWT 2FF4A 2YKSA 3K70D 2LDUA 3P50A 3T8OA 5F0HA 5GP9A 2CO5A 4IVNA 4JI2T 3PO3J 4YIRX 5JTGA 5KNLA 2VBZA 1OCPA 4XAXB 4YJ3E 4AQFA 1JUMA 2E9XD 5DTDA 3LSGA 1T8BA 2KWHA 2BVMA 2Y9ZA 1IXSB 4PCQA 3HOWJ 3AE5A 1AKHB 2DA1A 3BOQA 1B8IA 5HWYA 2F4VT 2JMHA 4CGZA 1W36D 2ODUA 4HWFA 1U8BA 1YXRA 5AQMB 2MC3A 3TQNA 2MLKA 2QA7A 3E0ZA 2LTPA 3M4OJ 4EV6A 1FYLA 5IYBJ 4YTNA 4DR5T 2W48A 5FLMJ 2J62A 2XZEA 4UR9A 2MD0A 3TOBA 4IE0A 2E36A 2LLKA 3RKOA 4XSZF 2XQAA 5LP6E 2G7UA 2OV7A 3GLXA 1ON2A 4L5IA 1TBXA 5D5VB 2VKOA 4UVBB 1HXDA 4ZTJA 4IL6C 3VRAA 1IZ1A 4Y52J 1HFAA 3VKHA 5BNGA 2OA5A 1X3UA 1ZELA 1O3XA 3AAIA 4XR6A 4DV4T 3LA7A 5IHYA 3WTUC 2IGKA 2XDVA 4XSXF 2ZXJA 4BHCA 4NIQA 2DJIA 1ULYA 4QXBB 2WV0A 3BTCA 4UV8A 2VKJA 3E97A 1D8JA 2VVSA 1X19A 3OV8A 4ZDLA 1FC3A 1WR0A 2P6TA 1E3OC 3BG3A 1BIBA 2LG4A 2OTJI 4XKBA 1ZV4X 4LMKA 2DA7A 3BTLA 4QX8B 3GFMA 4Y7NJ 2JN6A 4J19A 3V5SA 4HSTA 5LHHB 2CV2A 2JQHA 3AAEB 5CGMA 4JV5T 1FOKA 4EM0B 3AA7B 5HEGA 3CMYA 5DJQC 3WAKA 1SD6A 5HOOA 2GOMA 1V55H 3BJOA 4B1RA 1OXZA 3FZVA 1Z91A 5IT9K 3PIOF 5F1RA 3PUSA 4YFSA 2FBKA 5AQPB 1RC9A 1T6SA 2STTA 2XASA 3K4MA 4HQMA 2BZBA 3AE4A 3RQUA 2NS7A 3SZGA 3S1MJ 2YSRA 3S2WA 3A5XA 4HFCA 5CA0E 1AWCA 1YKHB 2NW9A 2VJ4A 1H7CA 5DCFA 5EJCA 4BKXA 4UVCB 2R7VA 5KDMC 1RETA 1V4RA 4M9XA 4XOPA 4QPOA 3J80Z 4IRGA 3BLYA 1BR2A 1S5LC 5ERIA 1ENHA 3LFUA 3A1YA 4ASNA 1ZTRA 3D1NI 1NENA 1XGOA 2V1UA 1YW7A 3RYPA 1J2XA 1R7JA 5F6FA 2JA2A 3JREA 2NVTJ 5LMUT 1CGPA 1Y6IA 3A0BC 2PJPA 5ED4A 2ZLYA 2EA4A 1I3AA 2BY2A 3PFIA 2KIMA 2N1GA 2GIZA 5AQRB 4EVIA 2LE8A 3OYCA 3WTYC 2R0QC 1SD5A 5FKNA 5HODA 1JNRA 4JOMA 1QQIA 2KRFA 2L9VA 3RZDJ 4QXCB 1JKOC 3ZMZA 5DQVA 3QUJA 4ZI3D 1D0ZA 1HR0T 3K0LA 2PX9A 3OL4A 3ASOH 1LNWA 3F8MA 2X9YA 2A5WA 4HWIB 1WGXA 5FY1A 2L0KA 5FO5A 4S0HB 2X48A 3GTQJ 4XLEA 4BQOA 4HV6A 3S32A 1IN5A 2JUCA 3RPUA 3CMMA 3K7AJ 4KFCA 5LJMA 3C2HA 2CV1A 3IAM2 3T5XA 2A2FX 3NAUA 4G2AA 4Z8XA 3OS1A 2ECBA 1T2KA 2Y6XA 2ZJPF 3WTXC 5JHFA 4CYDA 1SEUA 3H0DA 1FBUA 2F48A 1E0EA 2M87A 5CPRB 3IKTA 2E7XA 5KK1A 4BY7J 1UAAA 3HPHA 2CRGA 4X66T 2WMNA 1YQ3A 1VQMI 2OU2A 3IH3A 3FMQA 3K4CA 4ESBA 5E17F 5AQLB 4NB5A 1TT5B 4NNJA 2C5KT 4KICA 3MWMA 1G8XA 4XRSA 2BDEA 2VQET 2D0UA 2HPIA 2QKLB 1QVUA 3GZNB 3GN5A 2K9NA 1A6QA 2BGCA 5L3GB 3CK6A 4OIPF 3HHHA 3ZYLA 4IT4A 1PUEE 3ZSSA 2M6BA 3HZJA 5LHGA 5ABHA 2IAIA 1IN4A 4PZJA 3EDUA 3LA2A 4JUYA 5J1UA 2IEKA 1SE7A 4PAGA 3PNVA 2ZMEB 2VOOA 1HG5A 1X1DA 3EETA 4HLXA 5CVVA 2QWWA 2XQ8A 3LK3B 2CW7A 1BI3A 1ZH5A 3V8LA 2Y2ZA 1A31A 5K7HA 2X0HA 1UUSA 5FMNA 1QGPA 1HF8A 2OCEA 1HKSA 1LEAA 3GFJA 3BQZA 3EYYA 4LMYA 4ILCA 2FXAA 2LP0A 2PG8A 3OYXA 4TX5A 5L3DB 2LKXA 2ZFWA 2V7KA 1O7LA 1EV7A 1WH5A 2K9MA 4MQVA 3K4NA 5M3MJ 3PNTA 1MSFC 3P9KA 1UK5A 3MZKB 3RIFA 3V5UA 4LB5A 2AXLA 3IEEA 4MNUA 3HDDA 4DV1T 3KV5A 1IBMT 4XLCA 2DMNA 1U6GA 2QQBA 3G71I 3ANWA 2XSAA 3IV5A 3RKQA 3JRDA 2ES0A 1XDPA 4IHJE 2V8SV 1FYKA 1T56A 3HXLA 1PP8F 2E35A 2EZLA 2JQKA 1E2XA 5EZGA 4DNDA 1LDJA 2Q9QB 5ETWA 4XNFA 3ZC0A 1ZK8A 2HXOA 5JR9C 1X1PA 2J5OA 3AL0C 1Y8QB 4DR1T 1S35A 2FJBA 2WCAA 1EKEA 1BN5A 3HRMA 3LDQB 2V79A 4GOUA 3E6CC 1UCRA 2YDRA 3KZYA 4KIFA 1MGTA 2BS3A 3T1BA 4IHSA 2D2SA 3ZPLA 2ELKA 2NNYA 2K3FA 4M3GA 3MJXA 4Y13A 2EIKH 3DQVC 5EGOB 5B66C 4MHCA 2DXIA 2WY8Q 1FLIA 5LYJE 4LLGF 4PK6A 4IQ4A 2DTZA 1QA6A 4XKVA 5F04A 3SYTA 3UQ7A 4XM3A 2L7ZA 2BW3A 3C18A 3K10A 5CYVA 3OYBA 4YTMA 3KCCA 2MBFA 4AD9A 4LG0B 4EM1A 5FP3A 4EATA 5LA6E 1ORKA 2Q2EB 2KZ7B 2XQ5A 1S7EA 3KLOA 3QU3A 3ZQIA 3W6KB 1T98A 4EMSA 1ZG1A 1VQ5I 3UUNA 3B6AA 4AQGA 3MKWB 1PJRA 4M6VA 3I56I 1IN6A 2EZHA 5KMGP 4MHGA 2M0CA 3F21A 2NP9A 2WS3A 1BBYA 2UXBT 2YEVC 1KFYA 3HKDE 4O2AE 3HRUA 2X6XA 1W5TA 4AVZA 3A8YC 4HEAA 3AE9A 1YS7A 1OJLA 3DEWA 3ZXSA 4DOZA 3WG7H 2O8XA 2R4GA 4CXFA 4BE2A 4BQAA 1X3ZB 4U2YA 5EK3A 4BNCA 1MJ9A 2LJLA 2WDRA 3PU3A 4F3QA 1OKRA 2EHOB 4AQFC 2A3SA 4YFNF 1QZEA 2BY0A 2YDSA 1W0BA 4AKLA 2CMRA 4M6XA 5AIQA 3HKZA 2IPQX 2LRDA 2IP2A 2PTFA 4QH1A 2XPWA 3HTUA 5HDNA 4H4KC 1FOWA 1DU2A 4DNCA 4JQFA 4E6KG 3HSFA 3IA3A 4II2A 3CQCB 4PGHA 2A9UA 4A12A 2XGCA 4Y33A 4OU0A 2A5YB 1R5HA 2HH7A 3AEGA 3NKZA 1G3WA 3I55I 4X62T 4LF9T 2X0LB 2RP4A 2FMYA 2DYSH 2QZ8A 1G3YA 5H20A 4BEHA 2PQ8A 3ZCJA 3RX6A 4ZDPA 4QSHA 3ETVA 2DLLA 1KEYA 1IO2A 4B8XA 1OEDA 2CRBA 3IHRA 5LFAA 3CC2I 2L3LA 2P81A 3VPRA 3FBLA 1WR6A 3JADA 3L39A 2XY8B 3BG5A 1KQ9A 4DV7T 2F5CA 4PJNA 3BQYA 5FFZA 1MDMB 4HRIA 2DLRA 3RIUA 5LHIA 2VE8A 2IS1A 1XWMA 3AAFA 2K9AA 3F57A 3ZT5A 1FWZA 1U9NA 2L54A 4CI3B 1FTZA 2M34A 3VYRB 4FI5A 1SVOA 2K7LA 2M9HA 3TDZC 2DI4A 4XOTA 4GK0E 3I4NJ 5CVRA 2L02A 2Y75A 2XSDC 3ZT7A 4ILBA 4OIOF 1S6LA 1P7IA 2HFHA 1JTXA 4N9HA 3IWZA 2KIFA 2YU1A 2E1NA 2DT5A 3F6OA 2OQRA 1FZPB 3PU8A 4IL4A 2EA2A 2CGPA 1WLXA 2UXXA 2F5FA 4IE6A 5AONA 3QYFA 5M3FJ 2LVSA 1TQPA 3CCVI 2B7EA 3VSKA 1KU7A 5HLIA 9ANTA 2EINH 3HEFA 3GTKJ 4YHHT 5ICCA 1XGMA 2FE3A 2ZFUA 4IIJE 2R7FA 1VZ0A 2DPUA 1QUUA 3DTKA 4ZZCA 3LSPA 4ITVA 4KUMA 4Q25A 4RGXA 2R3SA 4RAFA 2HHHT 4AIJA 4LFAT 4PGGA 3GTJJ 4ZXLA 2LM2A 1HOMA 2YK0A 4AQYT 2X9XA 4B4CA 3CX6B 2H09A 2JJ9A 3BROA 3VYSB 3QB5A 1XGNA 4F8HA 2VK9A 2K86A 2E1CA 2VQCA 2XQ7A 4EXTA 2NTXA 1WJEA 4HEA2 4K2EA 4XN0A 1K79A 4TN7B 4B6XA 2YUSA 5LD2C 2WY2A 1RR7A 1LDDA 4XL9A 1VCSA 2DWGA 2HYGD 3PUWF 4JI7T 2NVYJ 4KT6A 3EHZA 4ESJA 1TQIA 4WYVA 1I5ZA 3HHGA 1G3SA 1O3SA 3JRGA 4DBRA 2OA4A 2IDOB 2A6HF 3LNQA 4KNYA 3E7LA 4IHXA 3OJAA 2VWAA 3AE6A 1Y8RB 1HCIA 3B13A 3JAFA 3R4KA 4LMJA 2YDQA 5H6QA 1YRNB 3MFKA 5FNVE 2HOEA 1QRYA 4ZHQE 2K4JA 2QA4I 4DR2T 2ZXHA 1TP4A 2Y0SN 3W6JB 2HVSA 4CYCB 2G7HA 4M3FA 5J6XA 5EEAA 5DQWA 4H9PC 3BG9A 5JLWA 2Y48B 2HVRA 1D0YA 3JSOA 4F55A 1H9TA 1ZR2A 2V6YB 1N36T 4U7YA 1S9HA 2PN6A 3OOUA 1SAXA 3C4WA 4BAYB 2XAQB 1IW7F 1GHCA 1FYMA 1YG2A 5E3MA 3IBPA 4IDOA 1IF1A 3NWIA 4K0KT 3S4UA 2L7FP 2XC7A 5FLXZ 4BE0A 1W09A 2FQ3A 1N77A 3CJQB 1HKTA 2LHNA 4F91B 2MPKA 4XRFA 5FVKA 1SFEA 5LGNA 1XDOA 5E0OA 2R7ZJ 4M3EA 1OEDE 1QNTA 2CU7A 2ETHA 3RQIA 3LSRA 1USSA 1FTTA 1RNLA 2X51A 1R1TA 2E2HJ 2HOTA 2YINA 3LBXA 5AQGB 4UUTA 4AKHA 5JLXA 4BQQA 4NUVA 1PUFB 1IJWC 3QC9A 4JP0A 4G63A 3TMOA 3ZMUA 3HKCE 2Z1DA 4FJOA 1L0VA 1SFOJ 2YPRA 5E3OA 3TP0A 3Q5DA 4O4IE 1SD7A 2HWVA 2R5ZB 4H63H 2L9QA 4UVAB 2V9VA 2DO7A 3PTRB 2QKMB 1DGWY 3HYIA 4HBLA 3VEPA 4I4TE 3ECOA 4TWDA 1SFUA 2ZCWA 1HS7A 4MTDA 1MBKA 3WTWC 3HR0A 4IKFA 4OIQF 3PL8A 1NAFA 2RAEA 2VC0A 2R7TA 2I5UA 4XK4A 4U7DA 2CPTA 3S17J 3I58A 1Z6TA 1X79A 4IJAA 4DZJA 2V7IA 2CG4A 3W2VA 2HTJA 1V5GA 5J1GA 2E5ZA 2DCEA 2HQ5A 4U33A 2EZIA 5DUKA 3PUBA 1YJWI 5JVTA 4IZZA 5ICFA 2DN0A 2JJ7A 4LF5T 2KMUA 4GKJT 5HXRA 2WC2A 3AFHA 1MIVA 2V9KA 1Z67A 4O2BE 1JJ6C 2H7VC 3J7Yq 4DR4T 1IC8A 3P4QA 2DA2A 5A2QZ 2Z5UA 3Q5WA 2JVGA 5GTIC 2RNJA 4IHYA 4XLFA 1IGNA 4O6JA 3ML6A 1UGOA 4X1YE 5EZYE 1XN7A 1TL8A 5C4XJ 1BL0A 3OS2A 4RB3C 1XDUA 3G6EI 3U2RA 5L3BB 3AA1B 4LFCT 4AI6A 1WI3A 1YX5A 4ZTFA 4XBFA 1X1CA 2KP6A 3GMIA 4LF7T 1YKEB 4DV0T 3GF2A 3MAJA 2Y69H 4U0WA 4Y15A 2O3FA 2QCOA 4EM2A 2QEXI 3ZP5A 2DA4A 2O8KA 1OCCH 5LBQA 1Z0PA 2CBJA 4P0BA 2K9LA 3PIPF 4J2CA 2O03A 2R93J 2Q0OA 4A0XA 5D5XB 4IXAA 3ZYMA 4GFBA 3LFMA 3F8CA 2BY1A 1MNDA 2QF7A 3BZKA 2E19A 3C2GA 2W84A 1VQ8I 2WZIA 2AQFA 4OYKA 1R58A 1MJAA 4AIKA 3P9CA 4E7SA 1D8KA 2M1BA 4D7MA 1FP1D 2DYRH 2HVQA 1T08B 3ONJA 5KAIC 4G12A 2HDCA 4AU7A 5HDGA 4P09A 1ZRDA 2AXTC 3S14J 4ILAA 4FTHA 2BHZA 4JX5A 2CXFA 1TLHB 2KDZA 1UZCA 2W7NA 2DFIA 5E18F 2HOSA 2FSWA 3V42A 1HKQA 2F5VA 4YHJA 4JI3T 1JHHA 1BI1A 5CA1E 2KJCA 3QODA 2P9BA 2GA2A 1XCVA 2D9DA 3MA9A 5AQJB 4H9NC 2XPUA 3I59A 4PUSA 3FXLA 2EV5A 4DBQA 4G7OF 3R84B 2LSJA 4ZS3A 2JIWA 3RYCE 2WWUA 1W7PB 3PURA 4KI0F 3RPUD 2N2NA 2ZO4A 2V6XA 4C90A 1R4MB 4IDQA 1I27A 4ZYEA 2PLYA 2W85A 3H37A 2WB1N 1R9TJ 3G1LA 5GPCA 2ADUA 3OL3A 2L8KA 4BHBA 3B6CA 3RYRA 3CWZB 2VQLA 3ZMSA 3LAPA 3N9MA 5K1YA 3ZSTA 4MLOA 2IVMA 3FXMA 3AE3A 3VR9A 1OEDC 1J5ET 4C3IJ 1I1GA 4N9IA 4YFKF 1ZARA 3U1KA 5GONE 3E0JB 2LC2A 4V2GA 3TOAA 2ZNZA 2AQEA 4ABZA 1BC7C 2BKNA 4EYUA 2KZGA 2XAFB 1ZP0A 4ENNA 1EJ9A 4HG2A 3VODA 3ZMDA 3HOTA 1Y1WJ 2UXNA 2HDWA 2VURA 1FIAA 1IAPA 1TWAJ 4U2ZA 1W0UA 1FT9A 2BBYA 2CQQA 3H3VK 4TV7A 3Q9DA 1R6RA 1MMDA 4U7IA 5JDMA 2LH9A 3TP3A 5DM7F 3MMYB 1ERDA 1WPKA 4NC7A 1SAUA 1NHAA 1QO0D 2BS4A 3EDVA 4KHPT 3KVBA 3GYHX 4HFVA 1O4XA 3MEXA 3AVSA 1GDTA 2MD5A 4LIVA 3CLOA 1DP3A 3EUKL 5CB4E 3VR8A 3DEEA 3TW7A 2LKPA 2XF6A 4B44A 2W4SA 3WTTC 3P4SA 1KU3A 1S29A 2X66A 1V5FA 4Z2YA 5FLVA 5ABFA 2R7QA 5IYZE 1M62A 1SA0E 3H5NA 3A01A 4DJAA 2IUBA 2KT9A 1O3QA 1YQAA 1SVLA 1YITI 2A61A 2K3PA 3RI5A 4P1WA 1CF7B 4UXNA 3S1RJ 1F1ZA 2M67A 3RLFF 3KZIC 3IP4B 5LEJA 3DTIA 4TV9E 2WZHA 1X9BA 3KV4A 2RC4A 1US7B 1ZKEA 2CXLA 2J47A 3UUXB 1ETKA 4YSYA 4EJOA 2EZKA 3N9OA 5LXTE 5J47A 3C50A 2PJRA 4UF0A 2E1MC 1HW2A 3T8RA 3WI3A 3OYNA 2KQRA 2L7MP 3G1OA 3A0HC 5HVQC 2DI3A 5C3JA 1ZGAA 2JK3A 2RDPA 2ZC2A 4CCOA 4E7LA 3SWHA 2QLZA 1Z6RA 2RVCA 3CDIA 3K6GA 3TDUC 2X0YA 3Q5EA 3GFIA 4EV0A 4EJTA 1HTJF 4A3GJ 2R7RA 4WCGA 1S7OA 4EB6E 2W61A 1LVAA 3BQIA 1MH4A 4U7BA 4GK5E 2TRTA 3KP3A 3EPZA 1Y01A 3QOEA 3G4SI 3PJAJ 1V9DA 2WWYA 3J80K 2MGQA 3FM3A 5AQKB 3X1DA 2DPDA 4X20E 3KBTA 2H1KA 4C30A 3CESA 3WU2C 1Y0UA 2V1NA 2W00A 5D4SA 2IA2A 1IXCA 4K0UA 3ZJ1A 1IRGA 3JCFA 3D5LA 4PSXA 4AWXB 4M9ZA 4A5NA 4O4JE 2R5YA 5B5EC 1Z0XA 2BG9B 1FMVA 5M5XJ 3W3CA 1JKRC 2M30A 3KP7A 4X6AJ 4CXYA 3N4MA 2D5VA 3P5JA 4IREA 5K5QA 1U78A 1WJAA 4M71A 1J5YA 4A3FJ 2WWVA 1YE9A 2HYFA 3I0TA 2MFZA 3DKWA 2V7LA 4ZI2D 2BBJA 3MXZA 3CUQB 3BC8A 3PSFA 3W2WA 3CCRI 2I6HA 2XSBA 2Z33A 3RYIE 3WU0A 3SZPA 4LD5A 2ACZA 2XHEB 3J7AO 3PNYA 3QOFA 5J4VA 3L8RA 4L9NA 1OWAA 3H1CA 3CUOA 4PSWA 2LM9A 3CIRA 2HS5A 2XROA 4ADZA 3DBLB 3CCUI 2XAGA 5DV5A 4H9QC 4IOAF 1FBSA 4DVDA 1TZLA 1HW5A 3RQ4A 2LY2A 3QYBA 1FMWA 4HX7A 5L3CB 2CS3A 3IC7A 3V7CA 3NZPA 1T39A 1UURA 4COFA 1NG6A 2JT1A 3IL2A 2XQ6A 1S72I 4NUUA 2DU9A 3JTHA 3LL7A 3GTOJ 5BOXA 2TCTA 1S94A 2OJED 3O6BB 3ZR8X 4ZS2A 3UTKA 3VU7H 3G3ZA 3ZQLA 3VHLA 4A3IJ 5L3EB 2LBFB 4A3MJ 2KSRA 2W4XA 2ZM2A 4KN7X 2W57A 5J8FA 3O1IA 3PQJA 4NHJA 2FNPA 2Y0SA 1U5PA 3BR0A 3GVAA 3KLNA 1T95A 3OIOA 3W2AA 4A3EJ 4YEJA 3PUXF 4IE4A 2HQAA 1K78A 4H0EA 3NEUA 5HCMA 1U5TA 5M5YJ 5JVDE 1WJ5A 1ZLKA 4I2OA 3ROUA 3KYDB 4JEUB 2RKHA 1LFPA 3FBNB 4A97A 5E1ZB 2W1OA 4BBRJ 5H6RA 4OWRB 5BMZA 2C5JA 4YTPA 3TEDA 5KHDA 4F92B 1KNPA 4MQ9F 2HN1A 4A3DJ 4DZPA 1WQ2A 1LEBA 4Z90A 3KE2A 1MSEC 4HW0A 2UXCT 2GZWA 2VBWA 3F9KA 4ISTA 2QSHX 1P92A 3RIUC 1WRJA 4DIDB 2X85A 2BYVE 2CQKA 3JAEA 3N2KE 3KVAA 4GYIA 2KRCA 1BI2A 2TDXA 3ZN0A 3HUGA 2CSOA 3WTSC 1JT6A 3CZ6A 3G06A 2XKOA 2QGUA 3CCYA 4C3HJ 3N97A 4BJNA 4DR6T 2FUPA 1OMIA 2H89A 3HTSB 3HA4A 5HCJA 3I4MJ 3PO2J 2QYWA 3KV9A 4OMYA 2LSOA 4L5GA 4LMLA 2E9XB 3OIPA 1IZNB 2XAJB 1AJ3A 2LOPA 4B47A 5JRCA 1SUMB 1USTA 2BE5F 3FHNA 1W1WE 2VQFT 4IO9F 1EH7A 2V4JC 2LEHA 1XD7A 3FXKA 3FZHB 1LPQA 5JHUA 2KNDA 3JRAA 2FUG2 3RKGA 3D5RC 3IAS2 4S05A 4UHTA 2HDDA 5HXEA 2E2IJ 3ABUA 2RNGA 1FEWA 4UUSA 4TNWA 3K1SA 2Y30A 4AIUA 1F9NA 3BWGA 3L2RA 2FJEA 3PUQA 4WNKA 3BR5A 4O5VA 1ZR4A 1Y39A 2X9WA 3LOCA 2XF7A 1R1VA 1J1JA 1KU9A 3QB5K 2CEAA 1T38A 2BEOA 3H3UA 2PJQA 1UHWA 1R1UA 4CXWA 2CH0A 4YLHA 4QPQA 1MBHA 1UFMA 1D5YA 2F4OB 3AXJA 3RYFE 3GWHA 2QBYA 3X2QH 3DWLE 3UQ4A 4Y3OA 1LE8A 2R7UA 3FMSA 2GK9A 5EK4A 3HGGA 4LG3A 4EEFG 3Q9VA 5B1AH 3VOEA 1H9GA 1VQ4I 3S3OA 4HF1A 5F27A 3FISA 3ZQFA 4QWNB 2A72A 2DMQA 5GADJ 1TW2A 2ZJRF 4IL9A 3CLQA 5K7FA 1YS6A 3WTVC 4CCMA 5DS9A 5FKYA 2ID3A 4MEYF 4CH7A 5HXCA 4I09A 2ZKZA 3U1DA 4S04A 3J81Z 1WVRA 1B72A 4EJWA 4L9VA 1QZZA 1JI8A 3OBVE 4HFBA 2XQ3A 1TWCJ 3WGHA 4H9OC 4KIGA 5HNFA 4LFBT 4DMWA 3FXRA 2ZM6T 5ILSA 2OTLI 5LCYA 3HJEA 3FMRA 1DU0A 3N5LA 3KDSE 1MIYA 3RYHE 3VYUB 4UNOA 5LGTB 5IY5H 2X67A 4X1EA 1LB2A 1LVKA 2BV6A 4DW6A 2H8RA 2Z6EA 3CKDA 1WRDA 2E5VA 4H9SE 1FIOA 4YJ2E 4LITA 3P4WA 2CHNA 3K4KA 2DJNA 3FIWA 4G9YA 4L9IA 2DOEA 2P6SA 1MH3A 3TLWA 2BY3A 1AKHA 4OIRF 1IJ5A 3EQLF 3OY9A 4JBAA 1Z05A 2YU2A 4F7ZA 4FETA 2LMDA 3S15J 4IDZA 2ACJA 1RKWA 3K9TA 3H92A 5TAOA 2WAQN 1L3LA 4XIDA 2KFDA 3J7ZI 5DD4A 1YO5C 3L2WA 4EYYR 1FBQA 4ISSA 2IW5B 2QQ8A 1J5WA 2WB1A 4QXHB 4P5OA 1KA8A 1ODDA 1YLFA 4RLFA 4D5FA 3JRBA 1D1BA 2DMTA 1PP7U 1JGSA 2WMOA 5LGUB 4UVBA 3U9GA 5TRDA 4G6QA 3WGGA 4AKGA 2G9WA 2P5LC 2QQ9A 5B3SH 2FNAA 4ZEYA 2K5CA 3SJMA 4PK5A 5EYRA 1M7KA 3ERED 3ZLIA 3U78A 3GEZA 3IH4A 3PFYA 3C4XA 4JBWF 3S1QJ 2P5KA 2B0LA 4C2MJ 3E6DA 2LSIA 4MFRA 4AYBN 3E1SA 2UUAT 1I1SA 2JTVA 3BR2A 4XRMA 2LSYA 1QPMA 2RREA 3GLLA 4Q47A 2OV9A 1OQYA 2AO9A 3N9NA 2UZKA 5ABEA 1D3YA 3OYAA 3TLVA 2VKHA 3UU3A 1B1BA 5LHHA 2UU9T 3K1PA 4N0BA 2CFOA 5DCMB 1KNRA 1O7FA 2ELHA 3CJTB 5L4EA 3B02A 3CF2A 5J0ZA 3PM1A 1RKTA 4A98A 2JPCA 3QQAA 2W67A 1WKMA 3FK7A 4B43A 1YYVA 3DCFA 3ZQCA 2V5DA 3FZFB 3Q5XA 4GKKT 1M1EB 2K4BA 2XHKA 2VUMJ 4WXHA 5FXVA 2L7KA 1X1AA 1XMAA 2OAZA 4UVCA 3JTGA 1Y56A 4TNVA 2B9SA 2UXDT 4DV6T 4CZZB 4L0ZB 3EYIA 3F23A 2HPLA 4BA9A 2ESHA 3DBRB 1K61A 4KMFA 4XLAA 3ABLH 3GO5A 1P9QC 2KDOA 5HS8A 4A5XA 3OYJA 4ZC3A 2V6CA 1CQTA 3PJAA 2LFBA 1JGGA 3BCAA 4QH4A 2M8GX 5JDNA 1S3JA 2CWOA 4YY3T 3T1YT 4B3ST 5ABGA 4AISA 2DODA 2Y0MA 5AQTB 2KLQA 3RRWA 3SRZA 2MYSA 2EFQA 2WA0A 4XKCA 3L9FA 1KK7A 2WB5A 1AHDP 5KXJA 4EJVA 2IGOA 1Y64B 5HEUA 5J2TE 3ABTA 2E7WA 3TBIA 1X2MA 1ETVA 2OZUA 2QGSA 2MTQA 1WFDA 3F2EA 3LSIA 2L01A 5HLTA 1LKXA 3BT9A 1BR1A 1Z1DA 3JCUC 3A7MA 3I4PA 1BOAA 2M5WA 3ZCIA 3NARA 3MCZA 2HKOA 5FJ8J 2OC6A 2JA8J 3J7YJ 3KP6A 2L9SA 3F8NA 3OR2C 4BU2A 4ENMA 2VI6A 3ZN1B 2NNNA 3CQGB 1R23A 3REOA 1QBJA 2R7XA 2F5DA 3EDPA 1HA8A 1VFCA 2BVLA 2ID6A 5FD5A 5FVLA 2H3RA 2HOAA 2QRXA 1APLC 1B59A 5D5WB 4E7IA 1IBLT 2V9PA 3BDDA 3QAHA 4AVPA 1IRFA 2FOWA 3HRTA 3EABA 1EF4A 3PUAA 5F08A 1HDPA 3AEFA 2IRFG 1KGSA 1U5TC 2HU9A 4A6EA 3FX3A 3M7GA 2X4HA 5FLXK 2DOAA 4ESFA 2DTRA 1SVMA 3TGNA 5L3GA 3AG1H 3CMAI 1IV6A 4RLQA 5DD8A 1YQ4A 1X1BA 2E2JJ 1TTYA 2KT0A 2X6YA 3FDYA 2XF5A 4EZHA 1XZYA 1XMOT 2CLYC 3AB3B 2NVQJ 3P7IA 5FXWA 2K9SA 3JRFA 2JA5J 3CX7B 1QHGA 5D5UB 1VQ7I 3ZQQA 2YOEA 3N2GE 4MBQA 2A69F 2ZMEA 2DWKA 5IYDJ 1NEKA 4YG2F 4IRIA 1BR4A 2DMPA 1VQPI 2V5CA 4KBMB 4LOCA 4O4HE 2DT6A 3GA8A 1Z3YA 3CDHA 4JI5T 3VDXA 4CCKA 2ECCA 1D1AA 2XQ4A 1EH8A 5HNHA 4HYEA 2MC4A 2QENA 4GRIA 1JKQC 5JQGE 4PJMA 1YW9A 4M73A 5L3DA 3UU6A 2Z16A 2HN2A 3ZPOA 1I6ZA 3F22A 4FX4A 5LRSA 2K40A 1W5SA 2E1OA 3WODF 4X5TA 3IRRA 2GM4A 1WCMJ 3GX4X 2FBWA 2UWMA 1OCRH 2X9DA 3CC7I 3JRIA 2IS6A 2FJ1A 2VJIA 4PJLA 4ON0A 3OYLA 4GIWA 1GUUA 1A5JA 4QX7B 1TQMA 4HKAA 1PVEA 3Q5FA 2UUCT 4M74A 1Z77A 1K6YA 3HL2A 5DDGA 5FRMA 2Q1ZB 1MNMC 2OBPA 2JPBA 1VCTA 1YX3A 5BPIA 4Z91A 3SQNA 2Q9QA 2AHQA 4AUXA 3L7WA 2EIJH 3PDYA 4L9JA 5B1BH 4QH5A 2BXZA 3QRFF 2L9NA 3E6MA 1FSEA 5A2QK 4IF4A 2VPLA 2I10A 1RZ4A 3A4CA 5LNKA 4CICA 2RV8A 3FM5A 1ETOA 2KHMA 1IRXA 3OSFA 2HEOA 4ZDOA 3EVYA 5JREA 3VWBA 2WP9A 2A3DA 4EQQA 3HOZJ 5EGOA 1IBKT 4DIQA 2ME0A 3LSMA 3B57A 3E22E 5L2LA 5HS9A 2QYOA 2VBXA 2F5EA 2H8WA 1U2WA 2QSGX 2CE7A 3HGYA 2F2EA 1ZN2A 4LF6T 2FD5A 3S16J 2VOPA 5FB2A 1Z8UA 5IYCJ 4LG0A 3AG3H 3OIQA 1VQLI 3LMMA 2PI0A 2Q2EA 4A0ZA 1IJ6A 3SFIA 2H6BA 2IAKA 3CTAA 4PJ0C 3PV0F 1HC8A 5FKLA 3O8HA 3CJRB 3SFDA 3HB9A 3DEUA 2Y9YA 4UV9B 3LSTA 4NPPA 5HXSA 3TKYA 1F4KA 3I53A 4NQWB 2OCCH 2QUFA 4HAMA 2V1DB 1XG1A 5DABA 4Q5SF 3BG7A 3KEYA 2RQPA 1K4SA 3RRCA 3K1MA 3L09A 2E2AA 2MA3A 4HGAA 2IC9A 1BC8C 3HOXJ 1JJ8C 1P2FA 3HM5A 4LLLA 5HYAA 2O9LA 2KKOA 4HF0A 4M9SA 2R7DA 3OYKA 1UG0A 1JT0A 4BYYA 4U0VA 4BJ5C 2EHOA 3RCOA 3BK9A 1UX4A 3Q2MA 1HSJA 1OLTA 4QHOA 4WZXA 4D9JA 2DT7B 5BS6A 1KYZA 2X68A 1R5ID 2C6YA 2E5NA 5ADXL 2IS2A 1FP2A 1J59A 4ZYAA 2KINB 3AE8A 3L2CA 3O4XE 1TWGJ 1N33T 1RPWA 1TWFJ 4B09A 4CA0A 5JR9B 1YFHA 2KJBA 3KZZA 4HNUA 3AL0B 1W4MA 4IE5A 2NW7A 2DFEA 5E3NA 1ZQ3P 1XPXA 2ISZA 4OK0A 1DP7P 5FKMA 1HQCA 1IAWA 2H88A 2FBIA 1J75A 2FU4A 1K4TA 2RPAA 1U0JA 2X0LA 4I6ZA 3FBIB 2H94A 4B3RT 2EIMH 4FE4A 4BDYA 1BA5A 3DKXA 3MKZA 1G73A 3BQLA 5IOYA 5HEHA 4IHVA 4II3A 2RA1A 3AEEA 5EF6A 5EG0B 2CA5A 4NDLA 3V4GA 2XQYA 1N78A 5IPAA 4FCYA 3GTMJ 1PDNC 3D0TA 1MDMA 4Q4ZF 1HX1B 4XRSG 4L5JA 1FEXA 3I64A 4JX4A 3SZTA 2AXDS 3UU4A 1G4DA 4BJ6C 4BY1J 3E08A 1RR8C 2XGXA 3ZMVB 5JDHA 5L3FB 2WBLA 5FYMA 3BY6A 4DR3T 4RM3A 1BW5A 2XRLA 3AE2A 2EV0A 2VKVA 3K2ZA 3E5QA 2NRAC 3FK6A 2H7OA 2DHRA 2LD5A 5AQVB 3IRQA 4A3BJ 2N9DA 3CO6C 1P4WA 4I76A 2XAHB 1DU6A 3L2UA 5HS7A 2WAQA 3I9YA 4L18B 1OPCA 1KYWA 3T1HT 2VJJA 2OF7A 4I99C 1H88C 1XX5A 1IDYA 1OYIA 2M3AA 1G2HA 1XMKA 2WQYA 3SEZA 5JH7E 1G59A 2GQQA 2GXAA 4EEDA 1E7PA 1B4AA 5FL0A 4KDPA 5DYMA 1WJDA 1D0XA 1MMSA 5GAHJ 2LSGA 1ZLJA 3DV8A 3SXYA 4KMCA 4ZI2C 1B8IB 1FX7A 4OX9T 4CDGA 2MSYA 1VI0A 1I39A 5J1RA 3BCBA 3TO9A 2XPKA 3NVOA 2ZSIB 1MD0A 3AA0B 3QP5A 3V8KA 3VSLA 2B1EA 4HFEA 1MBEA 3TLTA 1X4PA 3ERMA 1F5TA 4BUPA 4CI2B 3SS1A 3S8PA 2G0EA 2DBBA 3MKLA 3FWEA 4AYBA 4CI1B 2RQQA 1E3PA 4CSWA 4U31A 3CMEI 4B48A 2AS5F 2Z99A 4JI4T 4EIWA 1G6NA 3B73A 3OYHA 4E7JA 3LSVA 2NWBA 5HXHA 3H9JA 4GO1A 2SPCA 3FXUA 5E8IA 2LT3A 3KP5A 1T7SA 4KMUX 2MG4A 3K1NA 1P7JA 2C5IT 2ZXIA 1B6AA 1Q1HA 3KP4A 1VRBA 3C7JA 1GV5A 3ELKA 3PQKA 3L2VA 3MACA 3QK6A 4UB6C 1S8NA 2VASA 2K9QA 4DUZT 4LK1F 3BP8A 5EEHA 4IOCF 2HPJA 4FE7A 4UV8B 5CJ9A 1HDDC 2NR4A 3DJBA 3O2PE 3MZ8A 3P4RA 5IP7J 2W66A 4RB0A 4CN4A 4EGWA 1HBXG 3FXOA 1X58A 3R61A 3DTOA 2EBIA 1TW3A 1YRNA 4A69C 1DQUA 2DQLA 5IOZA 1QHHD 2A07F 1ZHCA 3UT5E 4LF4T 2XUBA 4NXMT 5ILUA 4CYCA 2VKEA 1UHSA 2NOJB 3FXQA 2ZM0A 3NWSA 2RN7A 4MLKA 1O3TA 3RKXA 3HKBE 5D6EA 2KPMA 5ILVA 4G6DA 2CW8A 2V6YA 2XASB 3NWTA 4BAYA 5J4YA 4I43B 2XAQA 1FJGT 4HWCA 2OQGA 4IRHA 3UFEA 2WY7Q 5FKOA 3NZQA 4ZZLA 5EDNA 3ZJ2A 3U3IA 2ZJ2A 1YJNI 1J9IA 2CHOA 2E8IA 3KBUA 4XZCA 5F64A 2WV1A 4CCJA 1YI2I 3ZN0B 1W9RA 3HUGB 4CZCA 2LKHA 2W62A 2NXNB 3I9WA 5BR8T 3GZ6A 2R7WA 2ZMEC 2LHRA 4W1UA 5L3CA 4D5CA 1U8RA 2YN6A 2MBGA 4YXDA 5JFRA 3DLAA 3O8GA 4KYWA 2XVCA 1WWXA 3BPXA 1PUFA 1SFKA 4WX9A 2VB6A 3BQKA 3WAJA 2F4IA 1DUXC 2K24A 5BMVE 5LBMA 2WADA 4LIUA 3N9PA 3CCQI 2DOFA 3CD6I 4JI0T 3SDBA 5JR3A 5J1YA 2R5ZA 1LQ1A 4IPAA 4UVAA 5D8KB 1XCBA 4I0UA 3PSIA 3ZMZB 4J01A 4MALA 5E8GA 1BJZA 2MH2A 3H36A 4DR7T 1MBFA 4OYJA 1OCTC 4DMVA 1XTAA 3FKIJ 4BJTA 2BZTA 3C2BA 2HYJA 2QVOA 3PUZF 5ICGA 1UELB 3FZMB 2YR2A 3PUGA 3M1CA 1SD4A 4HF2A 4B3TT 3UR3C 2Q9QC 2VC1A 4EGYA 3ONLC 3CCJI 2NS0A 4F52A 2JA6J 2DA3A 1KQ8A 4WK8F 2H1LA 1MNEA 4RA2A 2M45A 5DEQA 1VQKI 1N32T 2P7VB 4MFDA 3E5XA 2EJRA 2ODVA 4RGRA 3LSHA 3NRYA 3UU5A 2PMZN 3ASNH 4HOBA 5L3BA 2IA1A 1Z7UA 4B3AA 3F8FA 4HFDA 3MVPA 3C98B 1SC7A 1VQNI 3G2BA 2VL8A 4G94A 3GN5B 2VIXA 1ON1A 4D1QA 4ZOLE 4EOZB 1ITYA 2EQRA 3K4JA 1NTCA 2YX7A 4YIFA 3WHCA 3UKGA 1A35A 4EAHA 3RTRA 2YU3A 4H9RC 3WHBA 5FY0A 5LHGB 3Q0UA 4DYCA 3LSJA 5F1JA 2E60A 3FB2A 4GYSA 2NW8A 4E70A 3CO7C 5K5OA 2O6GE 2FEZA 4C9YA 2IGNA 3DPLC 1MBJA 2W24A 3C4ZA 2XM1A 3MN2A 2DDAA 3RI4A 4LLNA 2B76A 3ZC1A 2W25A 2EFWA 3ABMH 3DU6A 4ZYGA 4CHUA 5GTHC 1OCOH 2ZJQF 2W63A 4PDKA 1JXSA 3CPZA 5C2TA 5LG4A 1WJCA 5J2UE 2LY1A 4G8XA 1Y0NA 3QPSA 2ZSHB 2VODA 3DBHB 3LA3A 3VYTB 1WFXA 4IDPA 3W15B 2XSJC 4IEJA 3E3VA 1LUJB 2MW8A 2LRLA 2EHOC 3M65A 4P9UA 4ENKA 3AA6B 1B9NA 3MZHA 3TW6A 4V19K 2LSKA 3S2HJ 3AEAA 3RQWA 1YTYA 1R36A 5E1WA 3HG9A 5F0CA 3ANWB 2HI3A 1ACIA 1DGRM 3JAMZ 2XUEA 4AIDA 1W7PA 2VONA 4WXCA 1XDSA 2Q8KA 3SOLA 5K7ZA 1ETYA 3F72A 4MTEA 2V7MA 1LJ9A 5HLHA 3MKDA 4UEMA 2QSFX 2IBDA 3FHZA 2X9HA 1WZ2A 3EUAA 3RC8A 3KINB 2IMLA 1LDKB 2HQNA 4HFHA 2JUGA 1XGSA 3QYEA 4YSZA 5EK2A 3NRXA 4P9FA 3VB2A 1BOBA 1L0OC 2BXYA 3DTEA 2AE9A 3J81K 4AKRB 1XSVA 2Y31A 4BJMA 2DA6A 5FKKA 4ERRA 3BZCA 3OR1C 3S2DJ 3RSNA 1ZG5A 2KIQA 2LY9A 2PEXA 1DDNA 4UY8I 4HE8A 3P7NA 3FZLB 2CUEA 4NUBA 2HGCA 2DNXA 1Q1VA 2VT2A 3RZOJ 2BW3B 1OYYA 3H5RA 4KA4A 1XMQT 2XB5A 1V54H 1YW0A 2LLYA 1XNRT 2JSPA 4HNVA 4MEXF 2XGEA 2XAFA 2XQ9A 3H3AA 3OYEA 1Z21A 1MW7A 2K27A 5FL1A 3QPTA 1YD8G 3GWZA 4QIWN 4KN4X 1BJAA 3ZQGA 1VQ9I 4D7NA 2X1EA 3A2KA 3RGLA 1EZ3A 1VQ6I 2M4KA 3R60A 1OYWA 3C1DA 1JHFA 1MIJA 5EEGA 1VQOI 3AE7A 2XGDA 4OAZA 3BJ6A 1LVFA 1I3QJ 4BE1A 4I98B 3WE2A 4CUGA 5IT3A 3P4PA 3OYZA 4JK1X 4J00A 4M1PA 2K5BB 3RF1A 5D8LB 1BIAA 2LNBA 3H3ZA 3RIRA 3UULA 1KU2A 1Y1VJ 3CQZJ 2NOXA 2C0SA 2KZVA 5CQEA 2M0MA 4ZYDA 3M3ZB 3QNUA 3ZMTA 1IN8A 5JVGF 3ZEFB 1CF7A 1IUFA 3DF8A 3ETUA 4PK4A 5LRRA 1S7AA 1PYVA 4Y4RA 2Q9QD 5AQSB 4AIHA 1E3HA 2MH9A 1U3EM 2JWTA 3HKEE 2XPVA 2NVUB 1FPQA 3FBZA 2CXDA 4WBOA 3I9V2 3M9AA 3TLUA 1ZGJA 3JSPA 2X1DA 3S1NJ 1AU7A 1YOVB 1TT0A 4FASD 3FZKB 3OSGA 4TWFA 1WJFA 4BEHB 2N8GA 1W0AA 1ZOYA 3FXDB 1FY7A 4HDUA 3S93A 5JDGA 1R22A 2EFPA 2IC6A 1ZRFA 3MKYB 2NTYA 1OEDB 4BHPA 1E17A 3KEQA 3HSEA 5AQNB 5HEOA 5J8CA 3M8JA 1YIOA 2CFXA 2JMWA 2G0UA 4P0AA 4A3JJ 4IDNA 3H5AA 2V1XA 4UELA 2BHYA 1O3RA 2VKDA 2R92J 4TV8E 3QOPA 2BOLA 2CUZA 5GAEJ 2NYXA 2Y8DA 3OPCA 4X1IE 5LHIB 4A93J 3UU8A 3O9XA 1K7AA 2K85A 4BXFA 2X6WA 3EI0A 5AQHB 5CQGA 1QSDA 3T8TA 3LSKA 1YW8A 1ETQA 3TL4X 1RESA 1YIJI 2J1DG 1K6OA 2PG4A 1I50J 2A05A 4CCLA 2BG9A 4PFOA 1GVDA 1MZBA 5KVRA 4XLNF 4E4HA 1T33A 2H6CA 5HAXA 2LK2A 1UHMA 4BGDA 4E7HA 2UXXB 5IUXA 3AEBA 4HV5A 1IRZA 5IT9Z 3CUQA 4DYQA 2JMKA 2FMLA 4DYRA 2EHOD 2CUFA 5E3LA 2V26A 4U0YA 3O1HA 4PNIA 3EUHA 3PUYF 3FF5A 3H9QA 3CVRA 4KUMB 3DLLF 3WE3A 3NQOA 2ZMAA 3I5UA 3H3MA 2M7AA 3AG2H 1GQEA 5LJNA 1XSXA 3OKQA 2O7OA 4BDZA 3AAAB 1ETWA 4O4LE 1N75A 2WU2A 5J40A 3F0CA 1Z9CA 4BACA 3COAC 2XJ7A 3KYCB 4FX0A 3WTZA 2VL0A 5F8PA 3CC4I 3SFZA 2DA5A 2EFNA 3G73A 4HDVA 1R71A 2LRKA 3JW4A 4GCVA 1SFXA 1UB9A 4X0GA 2E1MB 1K83J 4CCNA 2WU5A 4JI1T 2DQRA 3ZOBA 3OYMA 3MZYA 5L3EA 1UG2A 2LBFA 4RB2C 5BPDA 3K3QC 3VKGA 2J4GA 1H89C 2NAZA 2CQXA 1KQ0A 4RB1A 2HXIA 4WF2A 2PBIA 1R00A 1WI9A 1E1HB 2W2UA 3AG4H 4OAYA 4OFZA 4IQJA 2HNHA 1P6RA 3A02A 1XSDA 3OMYA 5FD6A 2OLTA 4XKWA 1MKMA 2WAEA 2M2EA 3OYIA 4HPQA 2HZDA 1NH3A 3Q0WA 2NVXJ 5AQIB 5H6QB 3C64A 3QPHA 1BM9A 4M72A 2BS2A 3ECHA 1GXPA 3KYLA 2JRKA 4KT5C 3DU5A 1V5EA 4JI6T 5IP9J 3GTLJ 2EH3A 3DP7A 2O5RA 2WAFA 4AXPA 4XN3A 3LJCA 2DW4A 2QM3A 3HSRA 4G7ZF 2UUBT 3M8FA 2ZXWH 4MFEA 2FQ4A 2ESNA 5AFUL 1WHUA 2J5PA 4MO7A 4U88A 1I94T 5AQFB 3JR9A 2L5QA 4YFXF 2QQAA 2FRHA 4CO8A 2PFBA 2JSCA 2XAUA 3K4LA 4RAGA 3SDGA 5IP6A 4A3CJ 1AOYA 1H0MA 2E9XA 3P8CD 4RAYA 1MIWA 5LGNB 1GLNA 2XAJA 4RM2A 3RC3A 3OTOT 3M8EA 1QU3A 2MOZA 1TC3C 1XB4A 4GYRA 2HTSA 1SANA 1YJ9I 3OYFA 4BS9A 3ZT6A 4ZZBA 2DDBA 5H2FC 4N78D 3LBXB 2XB0X 1FJLA 1A04A 4R1HA 5J3LA 4I0AA 2GA1A 4UB8C 2L4MA 2VQHA 3DXJF 5GPAA 1KZHA 5HDKA 5C4JJ 4IX7A 2JA7J 5LMNT 3KPHA 2B63J 3JC6C 2W0GA 2BKOA 4QTRA 3ZMUB 3RH3A 3GFLA 3M3YJ 5FXXA 4I0BA 2CWEA 3A03A 2HZTA 2MABA 4DGWB 4IHWA 4BXXJ 4FQGA 3UNGC 4HQEA 4MIMA 2K48A 2D1VA 2COMA 1HNXT 5CVJA 3FKJA 2BG9E 4BH9A 2IT0A 3AVRA 2PMZA 4P96A 4E7ZA 4HA8A 3HOSA 2A68F 3KFWX 4A56A 1IXRC 4XONA 3CDLA 2R6GF 4KX6A 4A6DA 1U4QA 3PUFA 1CHUA 3GCMA 3CQXC 3D5SC 5DM6F 2D0TA 5JDFA 5EZHA 3Q3SA 2WDVA 3KIOA 1J09A 4GXOA 2YU9J 1MJBA 4UUVA 1I6HJ 3AECA 4DV5T 2DK5A 1XMXA 5D4RA 3G1MA 4FT8A 3BZ6A 4BL0B 4KISA 2GWRA 4HWHA 1ZRCA 1V3FA 2OZ6A 3PUVF 5JDLA 1MMAA 4I55E 1Z7LA 2I59A 1P4AA 2LF7A 4LJZF 2VXDA 2XV4S 3CJNA 3K2AA 3I1AA 5LOVE 4XBFB 4M3BA 5LEKA 1XC5A 5CLSA 1OCZH 4YRVA 2STWA 4WW0A 3QU6A 2KXPB 1WYBA 3CMLA 4OINF 1HX8A 2M7BA 4KITB 5LBQB 3RDIA 5LGTA 2JRTA 4LGWA 1UMQA 1EH6A 4A3KJ 1A6IA 1ZREA 4ETSA 2OUMA 2LF8A 4KHZF 4LF8T 4HTEA 2GOXB 3O1JA 4ANJA 1WH7A 3RHWA 4JYKA 4HFIA 3D0SA 3CX8B 4HX8A 4C3JJ 1X3WB 5LLQA 1R5GA 1TWHJ 1JTYA 3CCMI 1YHQI 1R8IA 3BR1A 2M4GA 3E6BA 3O3KA 1T0FA 5DUIA 4BQNA 4F93B 4UIGA 4EGZA 4TZ4C 2GXBA 1UJ8A 2IW5A 2ELJA 3GTPJ 4D0PA 3GBGA 1ETXA 1W5CC 4HX4A 3GXOA 4XICA 1FSHA 1OR7A 1SHZC 4U3CA 2P0WA 3IF8B 2L9RA 5LGUA 1WJBA 3VRBA 1NK3P 4YELA 3I59B 2YX4A 4G7HF 4LB6B 1U9OA 5TJJA 3KX2A 2X6OA 2KMFA 3N9QA 4C2TA 3S3MA 1B9MA 3ZCOA 5FRNA 2DMUA 3HI2A 4XLHA 2WTEA 3HC7A 4XMYA 1F36A 4JX6A 3J9X1 5CJ5A 4ZJZA 2KIUA 3ZRGA 3HRSA 3U21A 4DV3T 2E5LT 3Q9SA 4Q48A 1BI0A 2CW0F 2XTLA 1WSUA 3E5UA 3GUDA 2DFHA 3KEOA 1BW6A 2P5VA 4ZYHA 1KNZA 2VN2A 2X1CA 3P9IA 3BR3A 4ZZDA 2LOSA 3ZMSB 1DPRA 3ABVA 3UFGA 5DCMA 2D45A 2L3DA 2HPMA 1F43A 4I50E 3R6NA 2XKPA 1STZA 1RUNA 3TKLB 1ZG3A 2VXZA 3H0GJ 2YS9A 1RRJA 4AKIA 4CQIA 3N2OA 2CYYA 5CKTA 1N34T 4NC6A 2R7SA 2ICWG 2CUJA 4N4OB 4MGRA 1CUNA 3TO7A 2UXNB 2EFOA 4CZZA 4OMZA 2DK8A 2IGMA 2ISYA 4L5EA 5K5RA 4G6TB 3VFZA 2VE9A 2XRNA 3EAMA 4H63V 3SFEA 3Q0VA 3K8PC 2FA5A 4BBSJ 4O3MA 5L4HA 2ZM8A 3GTGJ 1MBGA 4ZH4F 1ZKGA 2KL4A 3MQ0A 4L9TA 1HLVA 2O61A 2BG9C 4L0RA 1X4OA 2VPRA 3JC6D 5LG3A 2CCQA 4OOIA 2KLOA 4GYGA 2COBA 3BTJA 1O57A 1W0TA 1ONVA 1X2NA 2LKSA 2NOGA 3M07A 3V7RA 2IIUA 2EV6A 3HL6A 1GVJA 3NRVA 2IS4A 2LKGA 2ZB9A 1R49A 3CUQC 2WAUA 2EWNA 2FOKA 3DFGA 3DPUA 2P4WA 3ISPA 3IWFA 3MD2A 1JE8A 1A36A 3H9GA 3IH2A 3WGIA 2QVAA 2PMUA 4RS8A 3T0YA 1DPUA 5ABFB 3EUHC 2KISA
chains in the Genus database with same CATH topology
4LFUA 3WG9A 2ZNYA 3GW2A 3KV6A 2DAOA 3ZYKA 1W7PD 4UXNB 3C3WA 1VTNC 3BJAA 4A5MA 1ZEEA 3QP6A 3GZ5A 2RGVA 4UF0B 3OOPA 3ZN1A 1J7KA 2D1HA 3RPQA 2P8TA 2PMHA 3DPTA 4I02A 3J9X1 5FY7A 5FXZA 3C51A 4LK0F 1ZHFA 3ESLA 3NBXX 3LWFA 4CXXA 2HKXA 3ZQ7A 5BQTA 1ZAOA 3BPVA 4TUYE 1VOMA 4RAZA 1TNSA 4M6YA 3KP2A 3LQRA 2D5UA 3I71A 4PJJA 2D2WA 3L3PA 4ASKA 4DO0A 4KP3C 1FNNA 1P4XA 3V7SA 4QLCU 5JDQA 3F8BA 4L0YB 3ONXA 5HLGA 3K3NA 1RI7A 2IJLA 4A0YA 1UX5A 3I0OA 4PFPA 2E9XC 5D6FA 4QKNA 4Y17A 4P55A 2XAGB 4V1Av 4C91A 4WXDA 1SMYF 1HSTA 3FXEB 4XLPF 2IA0A 2WM9A 3F6VA 3RKYA 5FGMA 4R79A 3K69A 2GXGA 2GAUA 2PFVA 3LK2B 2H27A 1G3TA 1ZYRF 1D5VA 1BR0A 5A1LA 4HN9A 4OHFA 2ZBKA 4EZ4A 5F3JA 4PW8A 1RIOH 1HG2A 4DQ2A 3R0AA 1K78B 1U5TB 4ILUA 4X1KE 3PE0A 5ICEA 2Y48A 5H6RB 2CLYB 4RGUA 3R0JA 4I7HA 2CM0A 4JEHB 3N9LA 3RJPA 3LK42 4UV9A 5CVIA 4U72A 2DCFA 5AIPA 4JLEA 1IUYA 4IGUA 4NQWA 2V1DA 4YIIA 2A6EF 3F3XA 5CVUA 2VT3A 1MMNA 3KETA 2EK5A 4O8SA 2WSSV 5JI6A 1REPC 2EB7A 2O0YA 2ACXA 2MLGA 5HWXA 2VBYA 3WU1B 3LQQA 3LG7A 4F6RC 5E20A 2P7CB 2JQQA 2FBHA 3JAMK 3I54A 5JRCB 2OD5A 3V8JA 4I01A 2HR3A 3F31A 4RGSA 4HZFA 4BXUA 3L00A 3RKWA 3M1EA 4A2UA 5JR9A 6PAXA 1C0WA 1QZYA 1UCUA 2KWIB 3UUMA 1LRZA 4IHTA 3K3OA 3ZMTB 3ULQB 4HLYA 1D1CA 1I6XA 2JZYA 4WWCA 4ZI3C 1B7TA 1SMTA 3TO6A 2L4AA 1IN7A 4R8HA 3IHUA 2K02A 1J0RA 5M4YA 3SHFA 2QBYB 2Z9OA 2CWYA 3I0QA 4ENJA 1MMGA 4U74A 4KIBA 5E1XA 1HW1A 2M8EA 3HIFA 4WBNE 3ZMVA 2HQRA 2XIGA 5L3FA 1NWMX 4IE7A 2GIVA 3LAJA 3MK7C 4GGGA 4EJUA 3IKVA 5C8YE 1TNTA 2Z3YA 1GXQA 4QWQA 5KX5E 1RUOA 4FHTA 2JPFA 2V7JA 2XAHA 5FFXA 3R6SA 3LFKA 4ZI7E 1WYCA 2FF4A 2LDUA 3T8OA 2CO5A 4IVNA 2VBZA 4XAXB 4YJ3E 4AQFA 2E9XD 2KWHA 2BVMA 1IXSB 4PCQA 3BOQA 5HWYA 2JMHA 4CGZA 2ODUA 2MC3A 3TQNA 2MLKA 2QA7A 3E0ZA 1FYLA 3TOBA 4IE0A 3RKOA 4XSZF 5LP6E 2G7UA 3GLXA 4L5IA 1ON2A 1TBXA 5D5VB 2VKOA 4UVBB 1HXDA 1IZ1A 1HFAA 3VKHA 2OA5A 1X3UA 3AAIA 1O3XA 3LA7A 5IHYA 3WTUC 4XSXF 2ZXJA 4BHCA 1ULYA 4QXBB 2WV0A 4UV8A 2VKJA 3E97A 1D8JA 3OV8A 1FC3A 2P6TA 1BIBA 1ZV4X 4QX8B 3GFMA 3V5SA 5LHHB 1FOKA 4EM0B 3AA7B 5DJQC 3WAKA 1SD6A 5HOOA 3BJOA 1OXZA 3FZVA 1Z91A 5IT9K 4YFSA 5F1RA 3PUSA 2FBKA 1T6SA 2STTA 2XASA 2BZBA 4HQMA 2YSRA 3S2WA 3A5XA 5CA0E 1AWCA 1YKHB 2NW9A 1H7CA 5DCFA 4UVCB 5KDMC 1V4RA 4M9XA 3J80Z 4IRGA 5ERIA 1BR2A 4ASNA 1XGOA 2V1UA 1YW7A 3RYPA 1J2XA 1R7JA 5F6FA 1CGPA 2PJPA 5ED4A 2ZLYA 2EA4A 3PFIA 2N1GA 2KIMA 4EVIA 2LE8A 3WTYC 1SD5A 1QQIA 2KRFA 4QXCB 3ZMZA 5DQVA 3QUJA 4ZI3D 1D0ZA 3K0LA 1LNWA 3F8MA 2X9YA 5FY1A 5FO5A 4HV6A 1IN5A 3RPUA 4KFCA 5LJMA 3T5XA 2A2FX 4G2AA 4Z8XA 1T2KA 2Y6XA 3WTXC 4CYDA 1FBUA 2M87A 3IKTA 2E7XA 5KK1A 2WMNA 2OU2A 3FMQA 4ESBA 5E17F 4NB5A 2C5KT 4KICA 3MWMA 1G8XA 2BDEA 2D0UA 3GN5A 2BGCA 5L3GB 4OIPF 3HHHA 3ZYLA 1PUEE 5LHGA 1IN4A 4PZJA 3EDUA 3LA2A 4JUYA 4PAGA 2ZMEB 2VOOA 1HG5A 3LK3B 3EETA 4HLXA 5CVVA 2QWWA 1BI3A 1ZH5A 3V8LA 5FMNA 1QGPA 1HF8A 1HKSA 1LEAA 3GFJA 3EYYA 4LMYA 4TX5A 2FXAA 2PG8A 3OYXA 5L3DB 2ZFWA 2V7KA 1O7LA 1EV7A 4MQVA 3MZKB 3P9KA 3V5UA 4LB5A 2AXLA 3IEEA 4MNUA 3KV5A 1U6GA 2QQBA 3ANWA 2ES0A 4IHJE 1FYKA 1PP8F 1E2XA 4DNDA 1LDJA 2Q9QB 5ETWA 3ZC0A 5JR9C 2J5OA 1S35A 1BN5A 3HRMA 4GOUA 2V79A 3E6CC 1UCRA 3KZYA 4KIFA 1MGTA 3T1BA 4IHSA 2D2SA 3ZPLA 2NNYA 3MJXA 4Y13A 3DQVC 4MHCA 1FLIA 5LYJE 4LLGF 4PK6A 3C18A 5CYVA 5FP3A 5LA6E 3KCCA 2MBFA 4AD9A 4LG0B 4EM1A 2KZ7B 3KLOA 3QU3A 3W6KB 1T98A 4EMSA 1ZG1A 3UUNA 4AQGA 1IN6A 5KMGP 4MHGA 3F21A 2NP9A 1BBYA 2YEVC 3HKDE 4O2AE 3HRUA 1W5TA 4HEAA 1YS7A 2O8XA 4CXFA 4BQAA 5EK3A 4BNCA 1MJ9A 2LJLA 3PU3A 1OKRA 2EHOB 4AQFC 2A3SA 4YFNF 4AKLA 2CMRA 4M6XA 5AIQA 2IPQX 2IP2A 3HTUA 5HDNA 4DNCA 4JQFA 3HSFA 3CQCB 4PGHA 4A12A 4OU0A 2A5YB 1R5HA 2HH7A 1G3WA 2X0LB 2RP4A 2FMYA 2QZ8A 1G3YA 5H20A 2PQ8A 3ZCJA 3RX6A 3ETVA 2DLLA 4B8XA 3IHRA 2L3LA 3FBLA 1WR6A 1KQ9A 2F5CA 1MDMB 4PJNA 5FFZA 2DLRA 5LHIA 2VE8A 3F57A 3AAFA 2K9AA 1FWZA 2L54A 4CI3B 4FI5A 2K7LA 3TDZC 2DI4A 4GK0E 5CVRA 2L02A 2Y75A 4OIOF 1S6LA 2HFHA 4N9HA 3IWZA 2KIFA 2YU1A 2E1NA 2DT5A 3F6OA 2OQRA 1FZPB 3PU8A 2EA2A 2CGPA 1WLXA 2UXXA 2F5FA 4IE6A 5AONA 1TQPA 1KU7A 5HLIA 5ICCA 1XGMA 2FE3A 4IIJE 2R7FA 2DPUA 1QUUA 4KUMA 4RGXA 2R3SA 4AIJA 4PGGA 2YK0A 2X9XA 3CX6B</