3EUHA

Crystal structure of the muke-mukf complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
315
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of a bacterial condensin complex reveal ATP-dependent disruption of intersubunit interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
total genus 121
structure length 315
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3euhA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3euhA02
1BC8C 4G7HF 1BN5A 1Z6RA 3M1EA 2LKPA 3GW2A 1S8NA 4AIJA 1KU9A 1LEAA 4MQVA 1SD4A 3EYIA 2EA2A 1D5VA 1H9GA 1FBSA 4MTEA 3LA3A 4LG0B 2P5VA 1LJ9A 4CGZA 1MDMB 2ADUA 3R60A 3RKXA 3GVAA 1U3EM 4LGWA 4M6XA 2IP2A 1HW2A 3QRFF 3BDDA 1V3FA 1MGTA 1YW9A 1XGNA 3QP5A 2IA0A 1ON1A 2L01A 3IRQA 5E17F 3KLNA 5K5RA 4ZH4F 1IXSB 3I53A 4MEXF 5DV5A 5E8IA 2VC1A 3O2PE 2DI3A 3FMQA 3QU6A 3W6JB 5HLIA 3HTUA 2F5CA 4EMSA 3T0YA 1GXQA 4L0YB 3ERED 3J7AO 3HOSA 1K6OA 5FD5A 3M8FA 1IXCA 1FX7A 2VXZA 3O3KA 1P6RA 1ZYRF 1CF7A 2QQ9A 3MCZA 3PQKA 1RZ4A 1A04A 2F2EA 2XHKA 1U78A 2CQKA 2RN7A 3JSOA 2XRNA 4I0AA 3BJOA 2ISZA 4PZJA 1UHWA 4JQFA 2EV0A 2P8TA 2XAGA 1S6LA 2KIMA 1MJAA 4Y13A 3KZZA 4XLNF 1QQIA 4ENMA 5HDNA 4WK8F 5LLQA 2RKHA 3ISPA 3IRRA 2OBPA 2F5FA 4IVNA 3WGGA 2QQAA 1J0RA 1OYYA 2IT0A 5ILVA 2J5PA 3VODA 3TO6A 2C6YA 5BPIA 4L9VA 2MH9A 4BHCA 4HV6A 3FM5A 4S04A 3GUDA 1RUOA 2QBYA 1JXSA 3ZP5A 5DYMA 2EFNA 2ESHA 5HS9A 2QQBA 4HLXA 3FXRA 3L09A 1FZPB 4M71A 1W5TA 1Z6TA 2XAQA 1O3RA 3FM3A 3HSEA 2V9VA 6PAXA 1KGSA 1U6GA 1ZG5A 4CZZA 3P9IA 1B59A 5DDGA 2B0LA 2VOOA 3E5QA 1BIAA 1U5TA 2H6CA 3WTTC 3ECOA 1W7PD 4XSXF 2DT5A 3RDIA 3BROA 1O3TA 3V7SA 2O0YA 1LEBA 1D3YA 4M6YA 3PFIA 1OMIA 4WXDA 2O8XA 4R79A 4U0WA 3ZN1A 4UV9A 5D8KB 2DK5A 4RB2C 4YFNF 4LFUA 3T8RA 3F8FA 4HBLA 5DD4A 2EB7A 4AWXB 2LNBA 2OU2A 1AOYA 4IRGA 3I5UA 4U0VA 1D8JA 2UXXA 4KICA 5JHUA 2QUFA 1XD7A 3DV8A 2P4WA 2E7WA 4YIIA 3H92A 4LK0F 4WF2A 4OU0A 4LB5A 2DTRA 5FFZA 5K1YA 1TQMA 3E3VA 1PP8F 3QAHA 4EM0B 4PGGA 4RAZA 2PLYA 2V6CA 2CO5A 3VB2A 2ZCWA 4LG0A 1QZYA 4A5NA 2NYXA 3ZMTA 1ZHFA 2Z33A 2J5OA 4A6EA 5ICGA 4EM2A 2H94A 3WTZA 5AIQA 3B73A 2Z5UA 2CWEA 5LHHA 3GLXA 4MGRA 1T2KA 4F7ZA 2E1CA 5FB2A 4PCQA 1R36A 2QLZA 4BHPA 1OPCA 4M72A 3EDPA 1FT9A 1KU3A 1O7LA 2QENA 3V7CA 1YLFA 4KDPA 2IVMA 3F3XA 2Y75A 2XAHA 4RGRA 4EV0A 2JRTA 2XGXA 3K1PA 4HQMA 1XDSA 3MZYA 5H20A 3JTHA 3WGHA 2VC0A 3OOPA 3IKTA 3Q9VA 2CSOA 3F8CA 2DLLA 1R1UA 1IRFA 1W7PB 4A5MA 1IAWA 2MA3A 5F6FA 2M1BA 3FMRA 5EEGA 5FGMA 4HZFA 4AVPA 4M9SA 1P92A 2EFQA 4KUMA 2YX7A 2L3DA 1FBUA 2FA5A 1FNNA 1XGMA 4H0EA 1IN5A 4IRHA 4EGZA 4HV5A 1BM9A 2FSWA 2QYOA 2IPQX 3HSRA 1J5YA 1XSVA 2RVCA 4HF0A 5DCMA 4AD9A 2DAOA 5ED4A 3CUQC 4L9JA 4BNCA 2DO7A 4K2EA 2WTEA 4NQWA 1J2XA 5TJJA 2VODA 3LA7A 1EH6A 1JHHA 1I27A 1BOAA 4GYIA 4BH9A 2RQPA 2V79A 1T0FA 2FMYA 4P9FA 2W25A 2ZFWA 1IN8A 2VOPA 3M7GA 3HSFA 2GA2A 4WX9A 4ETSA 1CGPA 5FO5A 1SMTA 1OYIA 2Z9OA 2QM3A 3P9KA 3F6OA 5CVVA 3QU3A 1B4AA 5LHGA 2FF4A 2ZBKA 4HAMA 1WI9A 3I71A 3I0TA 4HOBA 1U2WA 4ZZDA 4FX4A 2PJPA 2H6BA 1O57A 3R4KA 2ETHA 2M87A 1ZRFA 1FOKA 1IN4A 2AXLA 4WCGA 1HBXG 2PFBA 5K5QA 1R1VA 2ZNYA 4RS8A 5CVUA 5KVRA 1TTYA 3MZHA 3E6DA 3L7WA 4ZYGA 3I59A 1G3WA 1JE8A 1ON2A 1R5GA 2FRHA 5LGTA 1F1ZA 3SXYA 4Q48A 3VEPA 1S3JA 3RIRA 3WE2A 2X4HA 3W6KB 2P5LC 1BJAA 3H3ZA 4G7ZF 2M30A 3WODF 5F64A 1J59A 2A07F 1T38A 3HOTA 5HOOA 5L3BA 2FBIA 5DUIA 1SMYF 5L3FA 1ZLKA 1U5TC 2WV0A 2G7UA 5FFXA 1KA8A 2VBWA 4GXOA 4G6QA 1TNSA 1XB4A 2VBYA 3O6BB 1SFXA 2GIVA 2BGCA 4Q4ZF 5DUKA 5LGUA 1YQAA 1YW8A 1R1TA 4IXAA 1KQ9A 2MBFA 3WGIA 3KE2A 3DKWA 2IW5A 2HTJA 1K79A 3F8BA 4Q5SF 3E6MA 5JFRA 4ENNA 3M9AA 1WWXA 1S7OA 2Q0OA 4ESBA 2VBZA 2H27A 1YG2A 1TQIA 1SFUA 3C1DA 4G6DA 3K69A 3KP2A 1Z05A 3SFZA 3ZMSA 5FLXZ 4GCVA 4HX4A 5FD6A 1J7KA 1DPUA 5E18F 1FY7A 3R61A 1MDMA 1B9NA 2XAJA 1U8RA 1T6SA 2RC4A 1XSDA 2VE9A 2YX4A 2K02A 4ASNA 4BYYA 2PG4A 2QWWA 1L3LA 3TDZC 1FLIA 5H6QA 2EFPA 1TBXA 4HX8A 3GYHX 2HOEA 2NNNA 3R0JA 2K27A 2A6EF 2ISYA 4MTDA 1OYWA 3HRTA 4JBAA 2P6TA 1Z91A 4EVIA 4HQEA 1RIOH 3SHFA 5FLXK 2PI0A 2K4JA 1SFEA 1FP1D 4UV8A 1HQCA 2DFIA 1BI3A 1USTA 2KRFA 3I58A 2JT1A 4GYGA 4IJAA 3EETA 2GXGA 2HDCA 1O3SA 2W57A 3LQRA 2L54A 4A6DA 3RYPA 4B09A 1I6XA 4A0XA 1I1SA 2MH2A 3HRSA 4CXFA 1FSEA 4EJWA 1W5SA 5ICCA 5D6FA 1QBJA 2ZO4A 2R7DA 3KETA 3FXUA 4O5VA 2O6GE 3D0SA 3HHGA 5ERIA 1NHAA 1OKRA 4O6JA 2ELHA 1KQ0A 3N4MA 2G9WA 5LEKA 4GGGA 2QBYB 1KQ8A 2V1XA 1T98A 3I59B 1UCRA 4DQ2A 2P6SA 4S05A 1QO0D 3CLOA 1EH7A 3F23A 3IKVA 4IRIA 1GHCA 3BY6A 1QZZA 4OMZA 1LDJA 4QWQA 4LJZF 1GXPA 2W84A 3ZMVA 2A68F 5LBQA 1ZGJA 1PUEE 4EJUA 4LK1F 3DQVC 3F8MA 3E6CC 3AAFA 2OD5A 1TQPA 1HSTA 4IF4A 1T39A 3DPTA 3C18A 4AIKA 2DPDA 1YFHA 4KA4A 1BBYA 4CYDA 3CJNA 2EV6A 3CO6C 4HYEA 1ODDA 5BPDA 3QOPA 2MD5A 3KP5A 5DD8A 3D5LA 3PQJA 5DCFA 1SD5A 2RGVA 5CVRA 3I54A 1S7AA 3JW4A 5F1RA 4LB6B 2HR3A 2EWNA 5HVQC 3KEQA 1ZN2A 1VTNC 3IWFA 5LRSA 3EUHA 5TRDA 2DBBA 2HS5A 4I02A 1WRJA 3B02A 1F5TA 2UWMA 3MAJA 3J81K 2ACJA 3REOA 3GFIA 3IHUA 1IZ1A 5K5OA 2XVCA 4ON0A 3F6VA 3TGNA 4HF1A 3QP6A 2RDPA 1ONVA 4BXUA 4MEYF 4A12A 5JI6A 2MC3A 4R1HA 4JK1X 5L3CA 1PP7U 4M74A 1MD0A 1UHMA 1K78B 5LRRA 2XAFA 3K2ZA 1KU2A 3EQLF 5HS8A 1MJ9A 2QZ8A 3I64A 4RB1A 4BAYA 2HWVA 1IN6A 3HIFA 1FP2A 4U7BA 3BOQA 5D4RA 1DPRA 2YPRA 1P4WA 1L0OC 2DK8A 3G3ZA 5HS7A 1G6NA 4XLPF 4ENKA 2IA2A 2QVOA 4I09A 1R5HA 4RB3C 4CDGA 3WTYC 1E2XA 1YYVA 3Q5FA 4N0BA 2XIGA 3BPVA 2YSRA 3P7NA 4CO8A 4KNYA 2O3FA 2HYFA 5LEJA 1DUXC 2PQ8A 5J6XA 3CUQB 5AIPA 5E20A 2A3SA 2BV6A 4ZZLA 1Z7UA 3GFLA 1HXDA 2O03A 3TOAA 1D8KA 3GZ5A 3LQQA 4L9NA 1XN7A 3DPLC 2CG4A 4FX0A 3ZMZA 4I0BA 4OIOF 2FNPA 3OV8A 1LVAA 3NRVA 1SAXA 3RJPA 4UUVA 1YS6A 2LF8A 2WWYA 2Y0MA 1XCBA 3U9GA 4LLGF 1MJBA 2Z99A 3RKWA 3RYRA 4L9TA 2GWRA 2ZMEB 4KIBA 2KIFA 4IHTA 1V4RA 4HLYA 4KYWA 1ZAOA 1BI1A 4LMYA 3DEUA 1G3TA 3J80K 1F9NA 4P5OA 1B6AA 1IW7F 1USSA 5DCMB 2K86A 2HEOA 2D45A 3QPTA 3R6SA 2G7HA 2FU4A 2HFHA 2HZTA 3MWMA 3E5XA 3WTUC 2BBYA 1HKQA 2XKPA 4A0ZA 4PGHA 3WTWC 4LD5A 3GEZA 4YFKF 5IT9Z 2FXAA 1HKTA 2VBXA 2FEZA 1TW3A 2RV8A 5L3DA 3V8KA 1ZRDA 4I2OA 1XMKA 2FOKA 4WWCA 3IL2A 3K1NA 2HQRA 3ROUA 3GFJA 3BZ6A 5D8LB 1HSJA 5H6RA 2E7XA 1FC3A 3HYIA 2R7FA 4HW0A 2DPUA 1P2FA 1BI2A 1RNLA 2L4AA 3IC7A 3V8LA 4A0YA 1MZBA 4ESJA 1LDKB 1R22A 4EJOA 1XGOA 4HX7A 3V8JA 4BHBA 1KYWA 2D2WA 1ZGAA 4UXNA 3P9CA 3GFMA 4U88A 2MLKA 2CYYA 5IT3A 1G3SA 3RPQA 4HDUA 2Z3YA 4U7DA 5D5VB 2EV5A 1P4XA 1XCVA 3DFGA 3F22A 2LF7A 2JPCA 2NRAC 2K4BA 2P7VB 1STZA 1EV7A 1U5TB 5LGNA 1KYZA 4Y15A 3WTSC 1Y0UA 2BEOA 2P5KA 3VOEA 1E17A 1ZG1A 4N9HA 4IHSA 1H0MA 2CW0F 3G73A 2NAZA 3ZMDA 3BJAA 1FBQA 4KIGA 3BP8A 3HHHA 3N97A 5E1XA 5HDGA 2ESNA 3L2CA 1I5ZA 1FWZA 1YS7A 1REPC 2BE5F 2FBKA 4Z2YA 2EFOA 4M9ZA 2MLGA 2XKOA 4CHUA 4YFXF 1J9IA 3KP3A 4TV7A 3T8TA 3GX4X 1G3YA 2IA1A 3T1BA 1HW1A 4L5IA 3JAMK 4UVCA 3V7RA 4YG2F 4OMYA 3GZ6A 1IXRC 5ICEA 3K0LA 2A6HF 2A61A 1BC7C 4WXCA 1W4MA 2Q8KA 4KMFA 2YU3A 3FWEA 4RGSA 3GO5A 2M45A 3KLOA 2HQNA 1DP7P 1K7AA 2JPBA 4RGUA 4DNCA 4ENJA 1LB2A 2M8EA 2HTSA 2ZNZA 3HUGA 1WKMA 3F72A 1X3UA 1XDUA 2ZXJA 2AS5F 4O3MA 3U1DA 4HA8A 5E1ZB 2H09A 2VT3A 1F4KA 3L00A 2JTVA 1JHFA 4D0PA 3SZTA 2JZYA 2OA4A 5IT9K 2FE3A 4RB0A 4G94A 3CTAA 4RAYA 1FSHA 1YIOA 4XSZF 3JSPA 4XBFA 1FYMA 3U2RA 1R7JA 1AWCA 2GZWA 3MQ0A 3TO7A 5ICFA 4I7HA 5ILSA 1S29A 3BPXA 5AONA 1YTYA 1YO5C 4MNUA 2TDXA 2M5WA 2GXBA 3E6BA 3R0AA 4BQAA 3K1MA 2W85A 3KCCA 1ZH5A 1W7PA 1QGPA 3JAMZ 3Q9SA 4OINF 4RGXA 3J81Z 3LA2A 4FT8A 1FYKA 4OIQF 4P96A 4LLNA 3LAJA 1P4AA 3KP6A 1B1BA 3F21A 3IWZA 3TDUC 1JGSA 4KFCA 3E97A 2DW4A 4ZYDA 1XSXA 2PBIA 5D6EA 2VE8A 4HF2A 4M73A 4I01A 2NS0A 3F8NA 4HDVA 5ILUA 3GWZA 2LSOA 3HTSB 1OR7A 4KT5C 5A2QK 2EK5A 4P9UA 1CF7B 4NHJA 2K7LA 2WC2A 5D5WB 4YIFA 2FQ3A 3ULQB 1IRGA 3COAC 1XMAA 1IUYA 3I4PA 1QPMA 1FYLA 2E1NA 2KKOA 5JR3A 3HRMA 2EFWA 2HKXA 2GAUA 4Q47A 3JTGA 3WE3A 4A2UA 4U0YA 3CO7C 1BI0A 3WTXC 2P7CB 3NQOA 3RI4A 2GQQA 1IF1A 2D1VA 1ZRCA 2VN2A 4QLCU 1ULYA 2ZMEA 5KK1A 2DQLA 3ZN0A 2STTA 4ESFA 2ZJ2A 5EEHA 4N9IA 5E1WA 1UB9A 4G8XA 1Z9CA 4LLLA 3DF8A 3KZYA 3ZPLA 3HRUA 2ZKZA 3KP7A 5CJ9A 3KFWX 1R00A 2V1DA 1WSUA 3KEOA 3KP4A 4FHTA 2VT2A 4ZYHA 2CFXA 1LDDA 3H3UA 2DU9A 1I1GA 1K78A 1B9MA 4GO1A 2XV4S 1O7FA 4KN7X 5LHIA 3FZVA 4Y17A 3ABUA 2OZ6A 5HDKA 2IJLA 2IRFG 3WU0A 1LQ1A 2PEXA 5CVIA 1ZLJA 4MQ9F 2YR2A 2EA4A 3ECHA 3TO9A 2XASA 5CVJA 4PDKA 2PMHA 3TQNA 5J8FA 1EH8A 2BYVE 1UFMA 5J8CA 3RPUA 4L18B 2RNJA 5BOXA 2PMUA 5D5XB 3EYYA 1ZG3A 1GVJA 3WTVC 2OQGA 1R23A 4G9YA 4P55A 4E70A 4EGYA 3QPHA 3DXJF 2OAZA 3J80Z 4M9XA 3T5XA 2W24A 3L9FA 3DP7A 1TW2A 3LFKA 1YW7A 2A69F 2Q2EA 3V4GA 2EJRA 3NEUA 3ML6A 2KJBA 5L3EA 1ZARA 3FX3A 3LWFA 2D1HA 3BWGA 1J75A 2HKOA 4OOIA 2VONA 2HGCA 3ABTA 2STWA 4B8XA 5JVTA 3BJ6A 4XRFA 5DEQA 3FHZA 4WXHA 3ZQ7A 1O3QA 3C3WA 3MFKA 2KIUA 4KIFA 4G7OF 4IPAA 2L02A 3M8EA 2NNYA 2KJCA 3CUQA 1MKMA 2FNAA 4L5JA 2XUBA 2HYGD 1KU7A 2UXNA 4UVBA 3FMSA 5CYVA 4EQQA 1PDNC 1TNTA 2COMA 1HKSA 1Q1HA 5HLGA 5BMZA 3K9TA 4CICA 5BQTA 2GA1A 4EJVA 1C0WA 4MHGA 1FPQA 3TOBA 4I98B 4EM1A 4R8HA 2XROA 3SZPA 2DQRA 3RKYA 3E5UA 3LSTA 1HW5A 2FBHA 5L3GA 1SD7A 3CUOA 2F5EA 3WU1B 3FF5A 3TKYA 1RUNA 1BIBA 4EJTA 5BS6A 2Y48A 1ZREA 1LNWA 2A5YB 2CGPA 5E8GA 1RI7A 4UHTA 4OIRF 3CDHA 1XGSA 2X0LA 1QNTA 2R3SA 2JSCA 3FXQA 5HLHA 5A2QZ 2F5DA 3S2WA 1H9TA 2OQRA 4ZYEA 3ELKA 1R58A 3VFZA 2FMLA 2L4MA 2O61A 5D5UB 4AIHA 3RTRA 4L0ZB 4UVAA 2LDUA 3GXOA 4KMUX 5D4SA 3ZMUA 4NB5A 4OIPF 5CLSA 2PN6A 3GF2A 2V1UA 1WQ2A 1DDNA 1G4DA 1SD6A 4KN4X 1IN7A 2UZKA 4UNOA 1TLHB 3SQNA 2OZUA 3MEXA 1Z1DA 3WG9A 3C7JA 3LAPA
chains in the Genus database with same CATH superfamily
1BC8C 4G7HF 3AAEB 1ORKA 5AQJB 2ME0A 4HWCA 1BN5A 1BR0A 1A36A 1KNRA 2IS4A 1Z6RA 3M1EA 1XG1A 2LKPA 3GW2A 1S8NA 4E7ZA 4AIJA 1W36C 3KV6A 1KU9A 5AQPB 3GLLA 3VWBA 3P4PA 3QB5A 3IH2A 1LEAA 4MQVA 1SD4A 3EYIA 3P7IA 1DP3A 2EA2A 1D5VA 1H9GA 1FBSA 5ABHA 4X1YE 2X6XA 4MTEA 3PO3J 3LA3A 1RKWA 5HODA 5FRMA 3AE9A 4LG0B 5KAFC 2P5VA 3FXJA 1LJ9A 1JKOC 4CGZA 1MDMB 2ADUA 3R60A 3RKXA 1YQ4A 4HWFA 4LF4T 3GVAA 1WJ5A 1U3EM 1OFCX 4LGWA 5J1UA 4M6XA 2IP2A 1HW2A 4XQFA 2GLOA 1FOXA 2XQ5A 1AKHB 3KYCB 3QRFF 4CYCB 3BDDA 2MGQA 3UTKA 1V3FA 1MGTA 2BBHA 5FLMJ 2A3DA 1YW9A 3ABKH 2LSGA 1XGNA 3QP5A 4J19A 3CCEI 1UZCA 5FROA 2IA0A 1Z3XA 1ON1A 2L01A 3S8PA 5CA1E 1WH7A 1TWGJ 3IRQA 4FETA 3RKQA 3KLNA 5E17F 3PUYF 2W48A 4JI8T 2KMFA 4QSHA 1D0YA 2BKNA 5K5RA 3ZT6A 2R4GA 4ZH4F 4YLHA 5IP7J 3J7ZI 1IXSB 3I53A 2K40A 3O8GA 4MEXF 4EGWA 1T08B 2P0WA 2RPAA 5DV5A 4GYSA 4IX7A 5E8IA 4DNDA 2QGUA 4BUPA 2VC1A 1V5FA 3O2PE 2DI3A 2NXNB 3FMQA 3DWLE 1B72B 2OCEA 3QU6A 3W6JB 5HLIA 3HTUA 2N8GA 2F5CA 1IC8A 3PE0A 4EB6E 3NAUA 4EMSA 3T0YA 1GXQA 4L0YB 3P8CD 3ERED 3J7AO 2NW9A 4B47A 4YIRX 3HOSA 1K6OA 2E9XA 3AECA 2BVMA 1YRNA 1WGXA 5FD5A 4U33A 3IP4B 3M8FA 4V1Av 3RC8A 2FQ4A 3N2GE 2DT7B 3GZNB 5EF6A 1IXCA 3AAIA 1VF9A 3PSFA 3L3PA 1FX7A 2CM0A 3CX8B 2VXZA 3AG4H 3O3KA 2EZHA 5FP3A 2E5LT 3AVRA 2A5WA 1P6RA 1ZYRF 2KZGA 3BTCA 1CF7A 2XSBA 2QQ9A 4EOZB 3MCZA 3PQKA 3OSGA 2H88A 1RZ4A 1A04A 3I9YA 5FL0A 1HCIA 3GWHA 3PSIA 2F2EA 2XHKA 1U78A 2IMLA 4U3CA 2CQKA 2RN7A 3JSOA 2X51A 4YSZA 1TWHJ 2LC2A 4H9QC 2XRNA 5JDHA 2HVQA 4I0AA 3BJOA 5KNLA 2OC6A 2HXIA 5AQLB 2ISZA 4EAHA 5KXJA 3HR0A 4PZJA 3LL7A 3UKGA 3OYCA 1J5ET 3UU8A 4XMYA 3EHZA 4CI3B 1IDZA 3CK6A 1UHWA 3BZCA 4JQFA 2EV0A 4RLQA 2D5VA 4ZZBA 5A1LA 2P8TA 2E36A 1LE8A 2XAGA 1S6LA 2KIMA 1MJAA 2VKVA 4Y13A 3K3OA 3CDLA 5FNVE 3KZZA 4DR7T 4XLNF 3EDUA 4LFAT 4F92B 1QQIA 4ENMA 5HDNA 3JRBA 4JP0A 1I3AA 2GK9A 3IA3A 4WK8F 5LLQA 3ANWA 2RKHA 1TC3C 5LBQB 2YUSA 2K5BB 3ISPA 3IRRA 1OEDC 2E2IJ 2OBPA 2F5FA 4IVNA 3WGGA 3S3NA 2JUGA 2ZC2A 2QQAA 2ZXWH 1J0RA 3LNQA 3S15J 1OYYA 3GTKJ 3OYDA 1FTTA 2IT0A 4FCYA 3HUGB 5F8PA 2XPVA 4RM2A 5ILVA 5C4JJ 2J5PA 4U31A 3VODA 3GA8A 4ILAA 5F27A 5F0CA 5JVGF 3J7AY 3I9WA 3TO6A 4IHXA 3PM1A 3ASOH 2C6YA 5BPIA 5JVDE 4NNJA 1H7CA 4L9VA 1QHHD 4PSWA 4TUYE 2W67A 4ZDLA 4ZZCA 2MH9A 2BY3A 1GUUA 4BHCA 4GFBA 3PUWF 4E7KA 4HV6A 3FM5A 2Y31A 4S04A 2M8GX 3M1CA 3CC2I 2BBJA 3GUDA 3RYCE 1RUOA 2BG9E 1XMOT 4GKKT 4XN0A 4U72A 2QBYA 1JXSA 2LE8A 3ZP5A 5F08A 3CF5F 3ETVA 4BQNA 3LSKA 4QHOA 5DYMA 4ZS2A 3NBXX 2IW5B 1HOMA 3KVBA 4BAYB 2IS6A 2CRBA 2R93J 3Q0VA 1US7B 1PYVA 2EFNA 2ESHA 1TP4A 2JQHA 5HS9A 2QQBA 2ECBA 2VVSA 4HLXA 2UXXB 2NR4A 3FXRA 3L09A 4PJLA 4BBSJ 1FZPB 2XQ7A 2QQ8A 4M71A 2NOXA 1W5TA 4EIWA 1Z6TA 3FXEB 2LKGA 2HZDA 1V5GA 5JR9B 2XAQA 2L3LA 5LG3A 1O3RA 3FM3A 3HSEA 4A3GJ 3KVAA 2V9VA 6PAXA 4HEA2 2QGSA 1KGSA 1U6GA 4JI4T 3RRCA 1ZG5A 4CZZA 3P9IA 1SE7A 3CESA 4QXCB 1B59A 5DDGA 3J7YJ 2B0LA 2VOOA 3RIAA 1DQUA 1X9BA 3FKJA 3RHWA 4QPOA 3I1AA 2AQFA 3ZGKA 3E5QA 2DDBA 2BOLA 4BE2A 3G06A 2L9VA 4NC6A 3BLYA 1IZNB 2YOEA 1BIAA 1U5TA 2X48A 2H6CA 2IC6A 4AIDA 3HOVJ 3OIQA 3WTTC 3ECOA 1W7PD 4BQQA 4XSXF 2K9LA 5GAGJ 2DT5A 2MTQA 2E9XC 4M3EA 3RDIA 3CMEI 3ZLIA 3FZLB 4HWHA 2ICWG 3BROA 3RQWA 3W15B 1T33A 3V7SA 2O0YA 1O3TA 1LEBA 3MN2A 1UX4A 4XKVA 4GK5E 1XDOA 4Z6YA 1D3YA 2Z1DA 4M6YA 4ISSA 3PFIA 4HNVA 1OMIA 1Y64B 4DMWA 2MFZA 3K7AJ 4WXDA 2P81A 2O8XA 4R79A 3PUGA 4U0WA 3ZN1A 1HFAA 5AFUL 4UV9A 5D8KB 2DK5A 3C4ZA 2MYSA 4YFNF 4RB2C 4LFUA 3D0TA 4HNTA 3T8RA 4XKBA 2IEKA 2K3FA 4B44A 3BG6A 1UG2A 4PFOA 1WYCA 1X3WB 2R5YA 2JMWA 3F8FA 4HBLA 2MW8A 1T0FC 5TISC 1UGOA 2JVHA 5DD4A 1AU7A 2EB7A 4AWXB 2LNBA 1TT0A 4RDUA 4X0GA 1OLTA 2BXYA 2E5VA 4QH1A 2OU2A 1VI0A 4LIUA 3BCAA 5GADJ 2IS1A 1AOYA 4IRGA 3I5UA 4OAZA 1ETVA 5LD2C 3KDSE 4U0VA 2UV1A 1WI3A 1D8JA 3LDQB 2UXXA 3TLSA 4KICA 1YJWI 3QPSA 5JHUA 2QUFA 2IC9A 1XD7A 3G4SI 3OPCA 3DV8A 2P4WA 4L5GA 3WAKA 2E7WA 4LK0F 3H92A 3FDYA 4WF2A 4YIIA 3ZQCA 1WJCA 5IOZA 2VL0A 4QIWN 3S17J 4OU0A 1W0TA 4LB5A 2R7SA 3UU3A 2DTRA 5F0HA 5FFZA 5K1YA 3B57A 2MSYA 3N9PA 2X0LB 2XQAA 3ZJ1A 1TQMA 3E3VA 2Y6XA 1PP8F 5LB7B 2IGKA 3QAHA 4EM0B 1TWFJ 1JUPA 3S1MJ 3HKDE 5DABA 4PGGA 4RAZA 4AVZA 1W0UA 2PLYA 2E2AA 2V6CA 4BJTA 2CO5A 3VB2A 2ZCWA 2NW7A 4LG0A 1QZYA 5B66C 1HF8A 2QSFX 2GIZA 4A5NA 2NYXA 2LSJA 2KRHA 3H3MA 3ZMTA 4QKNA 3TLVA 4ERRA 4XNFA 3NRYA 1ZHFA 2Z33A 1D1CA 2V6YA 5EZYE 4C2TA 3MKWB 2BZTA 2J5OA 3OL3A 5KMGP 2AQEA 1JKRC 2V7LA 4A6EA 2UU9T 1POGA 5ICGA 4EM2A 2H94A 3CZ6A 3WTZA 5AIQA 4DBRA 3K4BA 5F3JA 3MZKB 4WZXA 3B73A 2Z5UA 5F1JA 2CWEA 2Y69H 1YI2I 5LHHA 3S3OA 1E3HA 3OMYA 3GLXA 1RC9A 3OVUA 3P4QA 4TWDA 3GTJJ 2OA5A 4IDOA 3CMMA 4MGRA 3ONLC 1T2KA 2KWIB 2C5IT 3UUMA 4F7ZA 1WZ2A 2E1CA 3RH3A 2XGEA 1IBMT 5FB2A 4PCQA 5J47A 1OCOH 5E79C 1KONA 1R36A 2M3AA 2QLZA 3W6VA 5JRCA 4BHPA 1JT6A 1OPCA 4M72A 5JDMA 3EDPA 3SDBA 2DTZA 2I59A 3HG9A 3O9XA 4U74A 2J62A 2Q9QC 3BQKA 2FUPA 3MKZA 1FT9A 1KU3A 3TLUA 1O7LA 4A3KJ 5LGUB 1I3QJ 2QENA 4AISA 3ASNH 4PUSA 3QNUA 2VUMJ 3V7CA 4CA0A 1YLFA 5IPAA 5LXTE 4KDPA 2IVMA 2K9MA 4BEHA 2LG4A 1Z0PA 3F3XA 2Y75A 2XAHA 3CCRI 3N9OA 3RYIE 2HDDA 1EJ9A 4RGRA 3CCUI 3CP8A 3KYDB 4EV0A 3RPUD 4DUYT 5JH7E 2JRTA 2XGXA 2LTPA 4BKXA 1KEYA 3K1PA 1SFOJ 3OYKA 1N78A 4UUTA 2YN6A 4HQMA 4HFIA 1XDSA 3MZYA 5H20A 3JTHA 3WGHA 5IY5H 1XPXA 3T8OA 5L4EA 3ZRGA 5CB4E 2VC0A 4F93B 3OOPA 2E8IA 3B6AA 3IKTA 2JQQA 3Q9VA 2CSOA 2ME6A 3PV0F 3F8CA 4O4LE 4UF0A 1U0JA 4X5TA 2LK2A 1VNDA 2DLLA 3TKLB 1R1UA 1IRFA 5AQKB 1W7PB 5EZHA 1BR2A 1LE8B 4HPQA 2BS2A 5CGMA 4A5MA 4P0AA 5DQWA 1IAWA 3JRAA 3GMEA 5EGOB 3ZEFB 2MA3A 5F6FA 2M1BA 2XSDC 4P1NA 3FMRA 1Z0XA 5EEGA 5FGMA 2W2UA 4HZFA 3VSKA 4HKAA 4AVPA 1IRZA 4M9SA 1P92A 4Z8XA 4H9NC 2EFQA 4KUMA 5CQGA 2L9RA 5GTHC 2YX7A 3AXJB 2AHQA 2YS9A 2IBDA 3PL8A 3KYLA 1VQ5I 3CX6B 4JI7T 2L3DA 5F04A 3EVYA 1E1HB 1VCTA 1EA3A 1FBUA 2A9UA 2BHZA 2FA5A 4D1QA 1FNNA 5HNFA 4ZXLA 1XGMA 5K7FA 1T56A 3LSGA 4H0EA 1IN5A 4IRHA 1YQ3A 2BKOA 4EGZA 4HV5A 2H8RA 1BM9A 2FSWA 2QYOA 2IPQX 3JRDA 3HSRA 1S35A 4LMKA 1NAFA 1WFXA 5FKNA 3SEZA 1T8BA 3MKLA 2LHRA 1J5YA 5IHYA 4FE7A 2R7WA 4AKLA 2V8SV 4EEDA 2H1KA 1XSVA 2RVCA 4DV1T 4HF0A 3RIUA 5DCMA 4AD9A 2DAOA 5ED4A 3CUQC 2X1CA 4L9JA 4A3LJ 2QF7A 1MMSA 2GOMA 3IH3A 4BNCA 3R6NA 2DO7A 4K2EA 2XQ6A 2ZM6T 1MMDA 1Y8QB 3H5RA 3S93A 3Q5DA 2WTEA 4NQWA 1J2XA 5TJJA 5J0ZA 2QEXI 5JDFA 2LM2A 1Z21A 2J47A 4XKCA 1MH4A 4ZS3A 3PUSA 3K6GA 2OPTA 2B76A 2HH7A 2R7VA 4KHPT 2VODA 3K4JA 2CXFA 3LA7A 1EH6A 3I0OA 4B3AA 2CV0A 2KDOA 4RA2A 5AQNB 4TNVA 2CXDA 1G8XA 5HXRA 2EIKH 2K9NA 2AXTC 3C50A 1JHHA 3ABMH 1VQ4I 1I27A 1BOAA 4CI1B 3TBIA 1HG5A 1VQMI 1F43A 3E0ZA 4GYIA 4BH9A 2UUCT 4YTNA 2EZIA 1I50J 2RQPA 2V79A 1T0FA 5HWXA 3O8HA 2FMYA 4P9FA 4E7LA 3OYMA 2R7RA 3PUXF 2XRLA 4CCJA 2E60A 3BG9A 2W25A 3I55I 3TEDA 5AQSB 2ZFWA 1IN8A 2VOPA 3I4NJ 1S94A 3M7GA 2W4XA 1HNZT 4DR2T 2O7OA 3HSFA 2GA2A 4WX9A 3K70C 4ETSA 1FEXA 1CGPA 5BMVE 4F6RC 1W1WE 1NH3A 2ID6A 5FO5A 1N34T 4XZCA 1SMTA 3EUAA 4HN9A 3MKDA 1OYIA 2Z9OA 4YJ2E 5L3FB 3EI0A 1N32T 1D0XA 2CUEA 2QM3A 3P9KA 5HAXA 4HRIA 3BG7A 3F6OA 2DJIA 5CVVA 3QU3A 1B4AA 5LHGA 5HNHA 5L3EB 2ZM0A 4YY3T 4UVBB 2FF4A 2ZBKA 3RYFE 4DR1T 1JTYA 1P9QC 1OEDB 4HAMA 1WI9A 3I71A 3LSVA 2ZFUA 4AKGA 3I0TA 3L8RA 1CHUA 4HOBA 5H6RB 1U2WA 1RR7A 2VKHA 3RZDJ 4EEFG 5LG4A 1IBKT 2LBFB 4ZZDA 4YHHT 2JQKA 3RIFA 3CMYA 1CQTA 2M4KA 3OYHA 4FX4A 2PJPA 3AB3B 4HFEA 3N9QA 2H6BA 1D1AA 4KHZF 3PFYA 2NS8A 1O57A 2E1MB 3F2EA 4XK4A 3R4KA 2ETHA 1ETKA 2M87A 1ZRFA 1FOKA 1IN4A 2AXLA 4WCGA 2LD5A 4I0UA 1HBXG 2WMOA 2PFBA 4M3BA 4UVCB 4BU2A 5K5QA 4X20E 1R1VA 3N9NA 2ZNYA 4RS8A 5CVUA 5KVRA 1TTYA 3MZHA 2NVXJ 1JGGA 3E6DA 2E9XD 2KSRA 2X66A 1B8IB 3L7WA 4ZYGA 2GOXB 3I59A 2KISA 1G3WA 3KEYA 4RAGA 1ON2A 1R5GA 1JE8A 4V19K 2H3RA 2YKSA 4IHVA 2W00A 2FRHA 5LGTA 4TN7B 2H1LA 1F1ZA 2EZKA 4YHJA 3HKCE 1KNZA 3SXYA 1X2NA 4D5FA 4Q48A 3VEPA 4QX8B 4DZPA 1S3JA 3ZCIA 3RIRA 4C2MJ 3WE2A 4BS9A 2X4HA 2UXNB 3IAM2 4CCLA 4UUSA 3C2BA 3O1JA 5L3GB 3FIWA 1YITI 4DV0T 3F0CA 2X0HA 4PAGA 3BR2A 3HXLA 1VQ7I 1L0VA 3W6KB 2JA6J 2WDVA 1U4QA 2P5LC 5LA6E 1I39A 2VQGA 3HBLA 3Q0UA 2XSAA 4MFRA 1BJAA 3H3ZA 4G7ZF 2M30A 2TCTA 3AEGA 4FQGA 3WODF 5F64A 1H88C 2XASB 4YXDA 2CH0A 1J59A 1CUNA 5FVLA 2A07F 3PTRB 1T38A 3IEEA 3U21A 4DR4T 3S32A 3X2QH 2W4SA 1GV5A 3L2RA 3TL4X 5HOOA 4AYBN 3HOTA 3A2KA 1Z77A 2W82A 2KIQA 5L3BA 3H9GA 2FBIA 1AHDP 2R7QA 2Y0SA 5DUIA 1BW6A 2VQFT 1SMYF 3DPUA 5L3FA 4YEJA 2VJ5A 1ZLKA 4W97A 1U5TC 3LG7A 4HFVA 2WV0A 2G7UA 5FFXA 4N78D 3OL4A 1KA8A 2VBWA 1MIJA 4GXOA 4X66T 5JDQA 3N5LA 1M7KA 4G6QA 4XOPA 4IE0A 1ZEEA 3VR8A 4BGDA 3G2BA 2B9SA 4ZTJA 5B1BH 1APLC 1ITYA 1TNSA 3CDIA 2LBFA 5E3NA 4A3DJ 2CHOA 1X3ZB 2I5UA 2WV1A 3A0HC 1XB4A 2VBYA 2OJED 3O6BB 2HQAA 1VQ9I 4B3TT 4B43A 1NG6A 3K2AA 2ID3A 2DMPA 3A02A 1SFXA 2GIVA 2VJIA 3H9JA 1OCZH 2BGCA 4WYVA 1GVDA 3UU4A 2X68A 3H35A 3HJEA 4Q4ZF 2RQQA 5DUKA 3FXOA 5LGUA 2CCQA 3TP0A 1YQAA 1YW8A 1R1TA 2DWKA 2HOSA 4IXAA 1KQ9A 2MBFA 3WGIA 3KE2A 1QUUA 3DKWA 2WAFA 2RP4A 1BJZA 2IW5A 2V7JA 4JI5T 2LY2A 2HTJA 2VWAA 1K79A 3F8BA 2HQ5A 4Q5SF 2EILH 3E6MA 1FEWA 5JFRA 2BXZA 1X58A 3HOXJ 2W0GA 1MNEA 4CN1A 1FIPA 1XMQT 1S9HA 3V5UA 4ENNA 2W61A 2FOWA 3M9AA 1WWXA 1S7OA 3DKXA 5EJCA 2Q0OA 2DNXA 2JIWA 2CBIA 4ESBA 1XS9A 2VBZA 4LMJA 2H8WA 3OTOT 3HKZA 2JPFA 1JJ8C 1OCTC 2QKLB 1JUSA 4FASD 5LMUT 5HCMA 1NENA 2BY2A 1YG2A 2H27A 5JR9A 1FOYA 1TQIA 3FZHB 1SFUA 1QU3A 3C1DA 3SFEA 2WDQA 3JAFA 4OYKA 4G6DA 5FYMA 1WRDA 3K69A 3ZSSA 3KP2A 3SWHA 3UUBA 3HKBE 1Z05A 3AEEA 2L7MP 2IGNA 2V26A 4JOMA 3SFZA 3ZMSA 5FLXZ 2GM4A 4GCVA 1B7TA 2HN1A 2ZSIB 4HX4A 3IF8B 2QA7A 1IV8A 5AQVB 5FD6A 3SOLA 1VFCA 4DV3T 5B3SH 1J7KA 1O4XA 1DPUA 2YEVC 3S4UA 3E7LA 1IRXA 2ZSHB 5KCMA 2BVLA 5E18F 1BOBA 1FY7A 3R61A 1MDMA 4IGUA 4BJNA 3JRGA 1B9NA 2XAJA 1U8RA 4CXYA 3AVSA 4QTRA 1T6SA 2RC4A 4UEMA 1XSDA 4ILBA 2LRKA 2VE9A 3K4NA 3HL2A 1XZYA 3L2WA 2YX4A 2K02A 4ASNA 4BYYA 2PG4A 1JI8A 2QWWA 1L3LA 3TDZC 3NZQA 1FLIA 4RM3A 2DA7A 2EFPA 5H6QA 1TBXA 1U9OA 2QCOA 4XOTA 1U9NA 4UV9B 4HX8A 4GKJT 2WAQA 3GYHX 1JUMA 4K0KT 2HOEA 2NNNA 2XAFB 1IBLT 2PJRA 3R0JA 3EUHC 3AFHA 2K27A 2EINH 2A6EF 2WY2A 3IAS2 2UXBT 1LRZA 1UURA 2COBA 3QQAA 2L0KA 2ISYA 4MTDA 3PUVF 2A05A 1OYWA 3VKGA 4PK4A 3CQZJ 3HRTA 4JBAA 4LMLA 2P6TA 5J1RA 1Z91A 4AQFA 3BR5A 4A3IJ 3RKOA 5B1AH 3PU3A 2KFDA 5CFBA 3HDDA 4EVIA 3UULA 4D5CA 3AAAB 4AKRB 4HQEA 1X4PA 1ACIA 3J7Yq 1V5EA 1YIJI 3WHBA 4D7MA 1RIOH 3SHFA 5FLXK 2PI0A 5L3DB 3DBHB 1ETXA 2K4JA 4DV2T 1SFEA 4B3ST 2LRDA 1FP1D 1V54H 2YU1A 4UV8A 1HQCA 4LG3A 3PUZF 1WYBA 2HN2A 4B3RT 2DFIA 3I4MJ 1BI3A 1USTA 1TZLA 2KRFA 2LOPA 2JJ9A 4IREA 2Y48B 3I58A 2JT1A 3OBVE 3RC3A 4GYGA 5GP9A 4IJAA 3ZR8X 3EETA 1Y6IA 2GXGA 3H3AA 5AQRB 5M3FJ 4PK5A 2HDCA 2Y8DA 2DA4A 5K7HA 3L2UA 1O3SA 2W57A 3LQRA 1OISA 3KPHA 1Y01A 5HEGA 3AKZA 5JQGE 2X1DA 2LFBA 2L54A 3OS0A 4A6DA 2ODVA 5GAHJ 3RYPA 4B09A 2J1DG 4TNWA 2QKMB 1I6XA 4A0XA 4ABZA 4KITB 1I1SA 3ZN0B 2MH2A 3ZT7A 3V5SA 3HC7A 3HRSA 4ZI2C 2DMNA 4CXFA 3FXDB 4XAXB 1FSEA 5TAOA 4EJWA 3I0QA 2JSPA 1W5SA 4WBOA 3ZCOA 4JV5T 4FISA 1R4NB 3RQUA 4OYJA 2NP9A 3A4CA 5ICCA 1ERDA 4XIDA 4Z90A 1RR8C 5D6FA 5EYRA 2PX9A 2XC7A 1QBJA 2X67A 2DJNA 3A5XA 2EH3A 1PUFB 5GPAA 2ZO4A 4UVAB 3DLLF 2R7DA 3KETA 3LSRA 3ANWB 3K10A 4AC0A 4XORA 4UXNB 4MALA 2V6EA 3FXUA 4XRSA 4CCNA 5BNGA 4O5VA 2HPJA 3PU8A 2O6GE 3D0SA 4M6VA 3HHGA 5LP6E 1H89C 4JX4A 3CQCB 5ERIA 1NHAA 1OKRA 4X62T 4O6JA 2ELHA 2ZXHA 1VQLI 1KQ0A 1ZR4A 3N4MA 2G9WA 2WB1A 5LEKA 5DJQC 2BW3B 4GGGA 2OTLI 5AQMB 4FI5A 2CQQA 3RSNA 4F55A 2QBYB 4AU7A 3Q0WA 1MBJA 2E2HJ 4QH5A 1KQ8A 2V1XA 1T98A 3I59B 3GN5A 1UCRA 2VL8A 4DQ2A 2RA1A 2WDRA 2P6SA 4DO0A 1ZGWA 4S05A 1QO0D 4NXNT 2NS7A 2XAUA 4IOAF 2A72A 5FKOA 4Q25A 3CLOA 1EH7A 1K83J 3F23A 4XRMA 3VU7H 1DGRM 3IKVA 4IRIA 3UUNA 3BQZA 2F4OB 1GHCA 3BY6A 4IDZA 1QZZA 3OYNA 4OMZA 2H89A 5LGNB 1P7IA 4PJNA 3K1SA 1LDJA 2RAEA 4QWQA 3MMYB 4LJZF 1GXPA 2W84A 3ZMVA 2A68F 5LBQA 1JNRA 1ZGJA 4EZHA 2HPIA 5KX5E 4TV9E 2X9DA 4TX5A 1MMNA 2DA2A 2V9KA 1PUEE 5IYBJ 4EJUA 2VQLA 2HNHA 4LK1F 4C91A 3H3VK 1PJRA 3JC6D 3DQVC 3F8MA 3MKYB 3E6CC 2Y9ZA 1MBKA 2BY1A 2RREA 1MNDA 3AAFA 4X1EA 5FY0A 2VB6A 5F5WA 2OD5A 3LK42 1TQPA 3KZIC 5GONE 4EYYR 1HSTA 4IF4A 1T39A 3CPZA 4UIGA 1X1DA 4G12A 5M3MJ 3DPTA 1MH3A 4HFCA 3C18A 2R92J 2F4VT 4AIKA 3K4CA 5EGOA 2DPDA 3JCFA 4BXFA 1WJEA 3CCJI 1YFHA 4KA4A 4HSRA 2LKXA 2JQ9A 4WW0A 2JQ7A 3QB5K 5AQHB 2ODUA 4JI0T 2EBIA 1BBYA 2DOFA 4CYDA 4V2GA 2AO9A 2BG9A 1X2MA 4KUMB 2LRLA 3BCBA 5EK2A 4G2AA 4KT6A 1ZP0A 2CRGA 3CJNA 1XTAA 5EG0B 3A01A 1ZHCA 2HOTA 2EV6A 1X19A 2WQYA 4ITVA 3CO6C 3CCVI 4HYEA 1ODDA 5BPDA 4CN6A 2JA2A 3QOPA 2MD5A 4C3HJ 2D0UA 3KP5A 3M07A 5DD8A 5FKYA 3D5LA 2CE7A 1JT0A 2WY8Q 2M7AA 3PQJA 5DCFA 1SD5A 2RGVA 5IYDJ 3CF2A 4E7SA 2M6BA 4BJ5C 5J1GA 1SAUA 1V9DA 4H9SE 2WY7Q 5CVRA 3F57A 3K4KA 3I54A 4HEAA 3QOFA 3WHCA 1FJGT 1S7AA 2CU7A 2E5NA 3JW4A 4DBQA 5F1RA 5DM6F 3RZOJ 3AE7A 3LJCA 2JJ7A 1DU2A 4P1WA 4LB6B 3AG2H 2HR3A 2EWNA 1NK2P 4XM3A 4NUVA 2VIXA 4MHCA 5HVQC 3KEQA 1ZN2A 1VTNC 3CQGB 3BTLA 5M5YJ 2DA5A 2ZMAA 1FMVA 2WWUA 3C2GA 3IWFA 5J4YA 5LRSA 3EUHA 2X85A 4I76A 5TRDA 1F36A 2Y0SN 1UX5A 2WADA 2DBBA 2V7IA 2HS5A 5C8YE 2PG8A 2E35A 2FD5A 5TGTA 4I02A 1WRJA 1M62A 5L3BB 2XF6A 3B02A 1F5TA 5CA0E 2DMQA 1P7JA 3BQYA 2UWMA 1QHGA 3OJAA 3MAJA 4CYCA 2DFEA 3J81K 4OK0A 1HR0T 1HDDC 2HPLA 2ACJA 2YDRA 3C2HA 2OTJI 4QWNB 2LR8A 1HNWT 3REOA 3GFIA 3IHUA 1IZ1A 5K5OA 4QXHB 2XVCA 1Y1VJ 4ON0A 4H63H 3M65A 3F6VA 1QZEA 3TGNA 4HF1A 1GQEA 2XQ9A 1UCUA 4IDNA 2RDPA 3QP6A 2WU2A 3O4XE 3ZMTB 4ILCA 5AQGB 4RAFA 4EXTA 3G1OA 4A5XA 5JDGA 4PJ0C 3RI5A 2IGOA 3U78A 4XLEA 3ZYLA 2ACZA 1WR6A 1ONVA 4BXUA 4MEYF 2R0QC 4A12A 3BR0A 2BG9B 4U7IA 2WBLA 4OHFA 5JI6A 2CW8A 2MC3A 2VQET 2LKHA 3B13A 4EZ4A 3HA4A 4R1HA 4I4TE 4Y33A 4JK1X 4A98A 5CQEA 4MO7A 5L3CA 1PP7U 3JADA 1QA6A 3E08A 1Z7LA 2IDOB 4M74A 1X1CA 5ABEA 2WAUA 5C3JA 1MD0A 1UHMA 1K78B 5LRRA 3VRAA 4I43B 2NVQJ 2XAFA 3K2ZA 1KU2A 1UAAA 2C0SA 5DQVA 3EQLF 5HS8A 3PURA 1DGWY 2B63J 1MJ9A 1XC5A 3NKZA 2QZ8A 3I64A 5KAIC 2E5ZA 3RQIA 4RB1A 4CQIA 3BTJA 4BAYA 2HWVA 1W0AA 1IN6A 3JC6C 3GTQJ 2E34A 5IP6A 3LK2B 1ENHA 3OR1C 3HIFA 2OV9A 4J2CA 4CSWA 1FP2A 4MBQA 2YDQA 4IDPA 4E7HA 4U7BA 5FKMA 3BOQA 5D4RA 5HLTA 1X1AA 4NC7A 1DPRA 3K3QC 2YPRA 4D9JA 4ILUA 1P4WA 3CCLI 4NPPA 4PK6A 4XL9A 2V6YB 3N05A 4IL6C 1L0OC 2DA6A 2QYWA 4GRIA 1QVUA 2DK8A 2FJAA 5AQQB 4MFDA 3G3ZA 4YELA 2NVUB 2DHRA 1Y39A 1QVTA 3K4MA 2CA5A 2WSSV 5HS7A 1X1BA 5JR9C 1G6NA 2XDVA 4XLPF 5LGTB 1OJLA 4ENKA 2IA2A 1FJLA 4LF9T 2LYCA 2QVOA 1E7PA 4QH4A 4XKWA 1VCSA 3FK6A 4I09A 2Q1ZB 3H37A 3RX6A 2WMNA 1R5HA 2K48A 3VPRA 2DT6A 2NOGA 4RB3C 5M5XJ 4CDGA 4CN4A 2FX0A 3WTYC 3LOCA 1E2XA 3I56I 4BDZA 4WBNE 2XAJB 3CIRA 3FISA 1YYVA 3Q5FA 4N0BA 2KMUA 2XIGA 3BPVA 5AQTB 4BQOA 1MBHA 1ZK8A 2YSRA 3P7NA 4CO8A 5J2TE 4FE4A 3DEWA 2IUBA 3CJQB 3M3YJ 4XONA 1FTZA 4QXBB 3HKEE 1LPQA 4KNYA 1T7SA 3LBXB 2F5VA 2CQXA 2O3FA 4BE0A 1J5WA 2HYFA 1AKHA 2CBJA 1A6IA 5LEJA 4NUBA 1WFDA 2WBMA 1DUXC 3AE5A 2DCFA 3N2OA 4DR5T 2L9NA 2PQ8A 5J6XA 1K4SA 3CUQB 2P9BA 2W63A 5AIPA 5E20A 2X0YA 2A3SA 2CV1A 1A5JA 4UELA 1K6YA 2BV6A 4MIMA 3H0GJ 3AEFA 4ZZLA 3N9LA 1Z7UA 3GFLA 3AE4A 3FBNB 2LSYA 4AQYT 3FHNA 1HXDA 4W1UA 3VKHA 3NZPA 2E19A 4ZHQE 5FXZA 2LKSA 4L9IA 1TL8A 2O03A 2KLOA 1R8IA 3TOAA 2L8KA 1A35A 2Q9QA 4P09A 3ZQIA 2CHNA 5HCJA 4ZI7E 2XJ7A 2VXDA 4E6KG 1D8KA 2MBGA 3GZ5A 3LQQA 4L9NA 3OYIA 2M6IA 1XN7A 4DVDA 3Q5EA 3KV4A 2Y2ZA 3DPLC 4ASKA 2CG4A 2HI3A 1B72A 5GTIC 2BW3A 2IAIA 4FX0A 3SDGA 3ZMZA 3H1CA 1UK5A 3EPZA 4J01A 3FB2A 3BZKA 1Z3YA 4BE1A 1YD8G 4HTEA 3SYTA 4C3IJ 5HXEA 4BY1J 1S7EA 1J09A 2KZ7B 4I0BA 1JNZA 3KBTA 4OIOF 2FNPA 4A3BJ 5L47A 3OV8A 1LVAA 3NRVA 1SAXA 1ZOYA 3RJPA 2BS4A 4AXPA 2QA4I 1R4MB 3DTKA 4UUVA 4N4OB 1YS6A 4B48A 4JBWF 4XBFB 2YU9J 1IJ5A 2LF8A 2WWYA 4HWDA 3AEDA 3SZGA 2DLRA 2E1OA 2Y0MA 2BG9C 1XMXA 3F9KA 1XCBA 1MIYA 2UUAT 3U9GA 2M7BA 4LLGF 3ZMVB 5HEUA 3SFDA 1MJBA 2W1OA 2Z99A 2X6WA 3RKWA 3RYRA 4L9TA 2X1EA 3OYFA 1GT0C 2GWRA 1YJNI 2ZMEB 4Y4RA 2CEAA 2WU5A 3CCMI 3SJMA 2V6XA 2JA8J 4O2BE 4I99C 4NC8A 3KBUA 2BKPA 2KDZA 3AE6A 4KIBA 4LITA 2A2FX 2I0MA 3RYHE 3ZYKA 2KIFA 2XM1A 3ESWB 3MVPA 1HS7A 4IHTA 2M34A 5LMNT 1V4RA 4HLYA 4KYWA 1MMGA 4UB6C 5H2FC 1ZAOA 3AE2A 2F48A 4LIVA 1MSFC 2KWHA 4ISTA 3RGLA 1BI1A 4LMYA 1QSDA 3DEUA 3CQXC 1YHQI 2H7VC 2NTXA 5LJNA 1G3TA 2HVRA 3PIOF 1JKQC 3J80K 3VHLA 1F9NA 2VLAA 4P5OA 1SEUA 1B6AA 1OWAA 1IW7F 4DV6T 4BJMA 1USSA 5DCMB 3S2DJ 2XY8B 3FKIJ 5IYZE 4UR9A 1R49A 4V2FA 3WU2C 3A01B 1VQKI 2K86A 4IE6A 2Q9QB 5FVKA 4CUGA 1R5ID 5L2LA 2WAQN 2HEOA 3DU6A 3KV5A 1WJDA 1IDYA 3OOUA 2D45A 4LF8T 1OXZA 2A6TA 2K3PA 3QPTA 4NQWB 3R6SA 2EQRA 2G7HA 1OQYA 2FU4A 4C2UA 5HEJA 2HFHA 2HZTA 4PSXA 3MWMA 2F6CA 3GN5B 4TWHA 1YRNB 3E5XA 5GAEJ 2LM9A 3WTUC 2BBYA 2M0CA 3MD2A 3CMLA 1HKQA 2XKPA 4A0ZA 4E4HA 4PGHA 1S72I 1OR7C 1EKEA 4A3JJ 3WTWC 3OYJA 2R7TA 1MBGA 4LD5A 5LNKA 3GEZA 4DMVA 5EDNA 3RF1A 3ZPOA 4YFKF 1VQNI 3HI2A 2QSGX 2W7NA 5IT9Z 3DBRB 4JYAT 2N1GA 2FXAA 2V4JC 5EZGA 3O1IA 2XPWA 1UUSA 3ZQLA 1WCMJ 2LOOA 2VBXA 4F3QA 5E3OA 2ZJQF 1HKTA 4P0BA 3FXKA 1E2AA 3C64A 2FEZA 5JHFA 1TW3A 1HF0A 2RV8A 5L3DA 2KHMA 4I6ZA 3V8KA 1ZRDA 4ZI2D 2FUG2 2VPRA 5LYJE 2WB1N 3HGGA 4I2OA 1XMKA 2R5ZB 4LFCT 2FOKA 5ETWA 4WWCA 4OWRB 1WJFA 2TRTA 3IL2A 3K1NA 2XM2A 1SANA 2HQRA 1ETYA 1G59A 2PTFA 3ROUA 2ELKA 2DFFA 3FZFB 4AIUA 5JREA 4M3DA 3GFJA 5HXCA 4HWIB 1IO2A 3NWIA 2LREA 3LK3B 3BZ6A 3HGYA 3VR9A 4JX6A 3IBPA 3VYUB 5D8LB 4HFHA 1HSJA 2EZLA 5H6RA 2E7XA 3LSMA 1YKHB 4AKIA 3CVRA 2UXDT 3SFIA 4LOCA 1FC3A 3RRWA 2NVTJ 5FKLA 1R6RA 1AA7A 2R7FA 3HYIA 2L7KA 4HW0A 1P2FA 3HEFA 2DPUA 1BI2A 4DIQA 1RNLA 2L2OA 2L4AA 3IC7A 3JCUC 3V8LA 4YFSA 5ABFA 1D1BA 3MJXA 3PIPF 2ES0A 3G1MA 5BR8T 4A0YA 4YTMA 2J4GA 3AXJA 1MZBA 5CJ5A 4DV4T 2KINB 4ESJA 4OAYA 3OS2A 4A93J 2QSHX 1LDKB 2LHNA 2KRCA 5FXVA 1R22A 2F4MB 2D2SA 1LFBA 4ANJA 4IKFA 2CMPA 3QYBA 1XGOA 4HX7A 4EJOA 3ESLA 2KZVA 3O1HA 5L3CB 1XNRT 1XX5A 3V8JA 4AI6A 4BHBA 1KYWA 2D2WA 3LSJA 3TP3A 4Y3OA 3ONXA 1ZGAA 4UXNA 4DOZA 2R5YB 4BEHB 3OY9A 1IJWC 3P9CA 3S3MA 5C44J 4K0UA 3OWTA 3GFMA 2CMRA 2V7MA 3CP2A 4U88A 1Y56A 3L2QA 2MLKA 1JJ6C 2RNGA 2CYYA 2V1DB 1NK3P 3DTEA 5IT3A 4IIJE 3KV9A 1G3SA 3RPQA 3P4RA 4U2YA 5AQFB 3ABLH 1OCRH 1EZ3A 4HDUA 4CI2B 3BR1A 2Z3YA 4COFA 4U7DA 2JMKA 4KX6A 5D5VB 2EV5A 1W09A 1P4XA 2V7FA 3BTIA 4JUYA 2VASA 4IOCF 5AQUB 3ZT5A 1XCVA 2HOAA 3DFGA 4XN3A 2CLYB 4GIWA 4YSXA 1QLBA 4ZYAA 1A6QA 3H0DA 2E9XB 3F22A 5CPRB 4OX9T 3Q2MA 2LF7A 3DJBA 5JDLA 2IXSA 2JPCA 4DYCA 2NRAC 4EV6A 3DEEA 3ZOBA 2K4BA 2P7VB 4H9RC 2UUBT 2W66A 4U2ZA 4KBMB 4AM3A 3QUJA 4ZI3D 4BL0B 2WS3A 3AL0B 1STZA 1EV7A 1HTJF 5C3EJ 1U5TB 4IO9F 5LGNA 4BA9A 1KYZA 1MW7A 2K9QA 1KZHA 3G6EI 2O8KA 5J2UE 4Y15A 3AEBA 3WTSC 3BK9A 3UFEA 2M67A 1Y0UA 1MIVA 2BEOA 2ZM2A 3QWLA 3H9QA 4HFDA 2IGMA 2P5KA 3P5JA 3VOEA 1E17A 2UUZA 1ZG1A 4N9HA 4IHSA 1H0MA 5IUXA 2G0EA 2CW0F 4O2AE 1HA8A 2YU2A 3G73A 2NAZA 4ADZA 4BY7J 2V9PA 3MK7C 2LOSA 5ABFB 5L4HA 5M4YA 3ZMDA 1WJBA 2CW7A 3BJAA 4M3FA 2VURA 1FBQA 2PJQA 4KIGA 3E1SA 1HX8A 1NWMX 4YRVA 3BP8A 3HHHA 2CPTA 3U1KA 3C98B 3N97A 4XLFA 5E1XA 4KMCA 3H5NA 5HDGA 2ESNA 3GBGA 4RBOA 3L2CA 1I5ZA 1FWZA 1YS7A 1REPC 3GTMJ 5LHHB 4N4NB 2BE5F 2ELJA 3QPLA 3UU6A 2FBKA 4Z2YA 2IAKA 4ZDPA 2EFOA 2VKDA 4M9ZA 2MLGA 2XGDA 2Y9YA 1E0EA 4F91B 3AA6B 3N9MA 1R71A 1AJ3A 2WAEA 2XKOA 3LSIA 4X1KE 1LVFA 5EG0A 4CHUA 4YFXF 3CC4I 1J9IA 3FK7A 3KP3A 4TV7A 4QX7B 3T8TA 3GX4X 4X65T 3QYFA 5M5WJ 2K3WA 1G3YA 1SVLA 2IA1A 3N2KE 4XRSG 3I9V2 4TV8E 3T1BA 3K8PC 2ACXA 2E1MC 1HW1A 4L5IA 3PJRA 2Q2EB 3JAMK 3ONJA 1WLXA 4UVCA 2CQ7A 3V7RA 3K70D 4YG2F 3G1LA 4OMYA 3J9X1 3GZ6A 3DCFA 3HB9A 1YXRA 2MOZA 3K4LA 3PUAA 1GV2A 4HFBA 1IXRC 5ICEA 4JI3T 3K0LA 2NVYJ 3OIPA 2A6HF 3QYEA 4G6TB 4NBQA 4ZJZA 1ZQ3P 1VOMA 2LSKA 2A61A 2BZBA 1UHSA 5J3LA 2E2JJ 3QC9A 1BC7C 4PNIA 5F0FA 4WXCA 3M4OJ 2C5KT 1W4MA 2BDEA 2EHOD 3OIOA 3ZMSB 2Q8KA 4KMFA 1BR4A 2WP9A 4O8SA 1NTCA 2YU3A 3JRCA 3FWEA 4RGSA 3GO5A 2M45A 4PFPA 1N36T 4O4IE 2XF7A 1KFYA 4CZCA 3KLOA 2HQNA 1KF6A 2DWGA 3C51A 1QRYA 2PMZN 1DP7P 3MXZA 1IGNA 3PJAJ 3WAJA 4AKHA 3E0JB 1K7AA 2KPMA 2AXDS 2JPBA 3OYZA 5JTGA 4RGUA 1MIWA 2X9XA 2M4GA 3NVOA 1KK7A 3D5SC 2KXPB 4DR3T 5FMNA 3CKDA 4DNCA 2LLYA 4U87A 3V42A 4ENJA 1RRJA 3TW7A 1LB2A 2H7OA 4O4JE 3ABVA 2M8EA 5AQOB 2DYSH 1ZTRA 2HTSA 2LMDA 3WG7H 2ZNZA 2BHYA 3HUGA 1WKMA 5LFAA 4IHWA 2VJ4A 4XLCA 3E22E 2PFVA 3F72A 1G2HA 2FBWA 3FZMB 4JI1T 5JDNA 1OEDE 1X3UA 3ZYMA 1XDUA 2ZXJA 2DDAA 2AS5F 4H9PC 4X1IE 2O5RA 4O3MA 1WCRA 1I94T 3U1DA 5IP9J 5E3MA 2ZB9A 3VYSB 3ZMUB 4HA8A 5E1ZB 2H09A 2VT3A 1UMQA 1F4KA 1HG2A 1VRBA 4FJOA 3L00A 5AQIB 3H5AA 2JTVA 4S0HB 2CUFA 1IAPA 1YJ9I 1JHFA 4D0PA 1Y1WJ 1EF4A 3SZTA 2B1EA 2JZYA 2ZXIA 3HOYJ 2OA4A 5HEOA 5FKKA 5IT9K 1IUFA 1S5LC 1KNPA 1UELB 2FE3A 1I6ZA 3UFGA 3S2HJ 4ZDOA 5J4VA 2VKJA 2XZEA 2VKOA 2HHHT 4RB0A 4X6AJ 4G94A 3CTAA 3GMIA 3A0BC 5FY7A 1ETWA 2N9DA 4NDLA 3X1DA 4RAYA 2LJLA 2X9WA 2F4IA 2XHEB 3ZQHA 4KP3C 1NEKA 2GBYA 2N2NA 1FSHA 1YIOA 1HCRA 2XAQB 3A8YC 2DN0A 4XSZF 3JSPA 3CC7I 3NWSA 4DGWB 4XBFA 2DXIA 3PNVA 1XDPA 3MA9A 3DLAA 1FYMA 4F8HA 3U2RA 2XB5A 4II2A 2MC4A 3G71I 1FIOA 3UUXB 2Z2SB 1R7JA 1ZV4X 1AWCA 2GZWA 3MQ0A 3TO7A 5ICFA 4I7HA 5ILSA 3Q9DA 4JI2T 1U5PA 1S29A 3BPXA 3TLWA 3I3LA 3GCMA 2K9AA 2OLTA 4YTPA 1VZ0A 4LF6T 5AONA 1YKEB 1YTYA 1NG7A 4MNUA 1YO5C 4IE4A 1XWMA 2TDXA 2WZHA 2M5WA 2GXBA 3E6BA 4DV7T 4DR6T 3D5RC 3R0AA 4BQAA 2LT3A 3K1MA 3AA1B 1YW0A 2LLKA 3UNGC 1RKTA 1JTXA 1LFPA 1SHZC 2R5ZA 2KT0A 2W85A 3BR6A 4IHJE 3KCCA 5HXSA 1ZH5A 1W7PA 4QPQA 4JEUB 3JRFA 1ETQA 3SEQA 2ZJRF 1GDTA 1QGPA 3JAMZ 3Q9SA 3ZCJA 4OINF 4RGXA 3J81Z 3LA2A 4FT8A 1FYKA 1LVKA 2DODA 2M2EA 4OIQF 2EIJH 2IS2A 4P96A 4LLNA 3LAJA 1P4AA 4ZEYA 2MD0A 3KP6A 1B1BA 3BQIA 3JAEA 2WWVA 4MLOA 4DYQA 3F21A 4PJJA 3IWZA 3TDUC 1JGSA 4KFCA 5HEHA 1BW5A 3PUQA 3E97A 5J40A 4CXXA 1N77A 4IQJA 2DW4A 1W9RA 4NXMT 2CUJA 1JKPC 4ZYDA 3UQ7A 1WR0A 5ADXL 4NIQA 1XSXA 3PUBA 2PBIA 4DW6A 5DS9A 2R7ZJ 2QVAA 1YOVB 3IH4A 5D6EA 2EHOC 2MG4A 2VE8A 2DCEA 4HF2A 1W5CC 2XQ4A 2XGCA 3VYRB 4ZTFA 3RLFF 1Z67A 1FMWA 3CWZB 4LFBT 3HKZN 4M73A 2K5CA 1UG0A 1T72A 3ONQA 1W0BA 2IHR1 4I01A 4E7IA 1Z8UA 2FJEA 4IDQA 2K24A 2NS0A 3F8NA 4HDVA 3HL6A 3R84B 4PJMA 5ILUA 4A97A 4JX5A 3GWZA 2LSOA 1GLNA 3HTSB 1MBEA 2KP6A 1OR7A 3ZC1A 2HU9A 2HXOA 3MACA 5C2TA 4KT5C 5A2QK 1XNQT 3CCSI 2EK5A 4P9UA 3OYEA 1CF7B 4NHJA 3AA7B 5LJMA 2K7LA 2E71A 2WC2A 3B6CA 3JR9A 2KL4A 1LFUP 5D5WB 5LCYA 3AG1H 1WJAA 4RMNA 1VQPI 2XQ8A 4YIFA 2FJ1A 2XTLA 3OKQA 2FQ3A 3HZJA 5K7ZA 3ULQB 1IRGA 3COAC 1XMAA 3RKGA 4A56A 3CLQA 2X6OA 5FRNA 3F31A 4G63A 1IUYA 5E3LA 3I4PA 4IQ4A 1MNMC 3PDYA 5HWYA 1QPMA 1FYLA 1RESA 4UB8C 1O3XA 2E1NA 1SVOA 2JVGA 1VQ6I 3S14J 1BA5A 2KKOA 2YK0A 2ZM8A 5JR3A 3HRMA 4H63V 3FXLA 5EEAA 2CWYA 2EFWA 1LKXA 2GAUA 2HKXA 2G0UA 2WA0A 2XAGB 2XAHB 4Q47A 3JTGA 3WE3A 4A2UA 4U0YA 3CO7C 1BI0A 3WTXC 2P7CB 4LF7T 4Z91A 3UT5E 3ZSTA 5IWAT 3NQOA 3ETUA 3RI4A 1MBFA 2GQQA 1IF1A 3AE8A 4LF5T 2D1VA 1ZRCA 4HG2A 1J1JA 1T95A 3AEAA 3DTOA 2X6YA 2VN2A 2Y30A 4QLCU 1E3PA 1ULYA 2ZMEA 1ZELA 3EAMA 3SRZA 5KK1A 3GTOJ 2DQLA 3ZN0A 2STTA 2XQYA 4ESFA 3A03A 2CS3A 3C4WA 2ZJ2A 5EEHA 4N9IA 5E1WA 1UB9A 4G8XA 1ZKGA 1WH5A 1Z9CA 2QRXA 2X9YA 5FXWA 1HNXT 4LLLA 3QOEA 2MAWA 1OEDA 3DF8A 2NWBA 2EHOB 3SS1A 2JN6A 2XSJC 3KZYA 3ZQGA 2L9SA 4B4CA 3ZPLA 3HOWJ 3A7MA 2I6HA 4C90A 3NRXA 3HRUA 3P4WA 3OYGA 2ZKZA 3KP7A 5CJ9A 2PJRB 3ZQQA 2NTYA 2NW8A 5FXXA 4KISA 2Z16A 3KFWX 5FJ8J 9ANTA 2DL1A 2LY1A 4JLEA 3S1QJ 5E0OA 3BG3A 1IJ6A 3VDXA 4EEBA 3BQLA 1R00A 2V1DA 1WSUA 3KEOA 4UY8I 2MABA 2R7XA 4BACA 2DFHA 4J00A 3KP4A 2MPKA 4ZI3C 4FHTA 3VRBA 4HNUA 2K9SA 2M0MA 2VT2A 4ZYHA 1SA0E 3AE1A 2D0TA 2CFXA 3FBZA 3AG3H 3L2VA 4KI0F 1I6HJ 2R7UA 1LDDA 3H3UA 2BY0A 3PNTA 1B8IA 4WNKA 2DU9A 1I1GA 3RQ4A 4C9YA 4M3GA 1K78A 1B9MA 4GO1A 1LUJB 2BS3A 2XPKA 4NUUA 1DU6A 2XV4S 4UV8B 1O7FA 3OSFA 4KN7X 5LHIA 3FZVA 4DYRA 1YX3A 4Y17A 3AL0C 3S1RJ 1X4OA 3ABUA 2OZ6A 5HDKA 2IJLA 2IRFG 3WU0A 4DV5T 2ZLYA 1LQ1A 2LSIA 3CJTB 1PVEA 2PEXA 4UF0B 2KNDA 4A3EJ 5CVIA 1ZLJA 3TW6A 4MQ9F 4GOUA 3NWTA 5ABGA 2JUCA 2YR2A 2EA4A 3DU5A 3ECHA 2AE9A 4IEJA 3TO9A 2XASA 5CVJA 4AUXA 4JEHB 4L5EA 2CWOA 4C3JJ 4PDKA 1TT5B 2HVSA 4DZJA 2PMHA 2DYRH 3TQNA 3PO2J 2VJJA 4EATA 5J8FA 1EH8A 3W3CA 2BYVE 1UFMA 4YJ3E 2CUZA 5FL1A 5J8CA 3RPUA 4L18B 2RNJA 4KJZA 1Q1VA 5BOXA 2KT9A 1OCPA 2B7EA 4IZZA 3P4SA 1Y0NA 5IYCJ 5GPCA 2PMUA 5EK3A 5D5XB 3EYYA 2JK3A 3H36A 1ZG3A 1GVJA 4C30A 4Y7NJ 2ECCA 3WTVC 3FZKB 3BT9A 2XB0X 3OYAA 2OQGA 1R23A 3HPGA 4MFEA 3AE3A 1IV6A 4G9YA 4P55A 2X9HA 4IHYA 4XLAA 4E70A 4EGYA 3HOZJ 3OR2C 4BXXJ 4M1PA 2DI4A 3CX7B 3T1HT 3QPHA 3DXJF 4H4KC 4XR6A 5DTDA 2OAZA 4CCOA 3J80Z 4M9XA 1D0ZA 4U7YA 3T5XA 1Y8RB 2W24A 3EUKL 3D1NI 3L9FA 2JMHA 3DP7A 5KHDA 1X1PA 1TW2A 3LFKA 4HGAA 4Y52J 1YW7A 2JA5J 1HC8A 2WB5A 2A69F 2Q2EA 4TWFA 3LSPA 2EJRA 3NEUA 3V4GA 1MSEC 2UXCT 3ML6A 2KJBA 5KDMC 1R9TJ 5LHGB 1HLVA 5L3EA 4B3MT 4IE5A 3QK6A 2R7OA 1ZARA 3AA0B 3FX3A 3LWFA 2D1HA 5FLVA 1V55H 2LH9A 3JREA 3BWGA 1HDPA 2CQNA 2VVNA 2XUEA 5LHIB 4B3XA 1SC7A 1J75A 5C4XJ 2VQHA 4XICA 1K4TA 2HKOA 4OOIA 4I50E 2VONA 2HGCA 3ABTA 3IUOA 2STWA 4AQGA 3QODA 1ETOA 4B8XA 2OUMA 5JVTA 3BJ6A 4HE8A 3TMOA 2XPUA 4XRFA 3LMMA 4ZC3A 3BC8A 4L0RA 5DEQA 2O9LA 2LY9A 5CKTA 3ZMZB 2V1NA 2DOEA 3FHZA 3M8JA 3NARA 2M9HA 4WXHA 3ZQ7A 3UU5A 4II3A 2L5QA 1O3QA 2FJDA 3C3WA 3MFKA 2KIUA 4IL9A 4F52A 4KIFA 4G7OF 2DA3A 3LBXA 4IPAA 2L02A 1HX1B 3JRHA 4BJ6C 3M8EA 5J1YA 3FBIB 3FBLA 3BG5A 2NNYA 1SVMA 2KLQA 3Q5XA 4TZ4C 4DIDB 4A69C 5IOYA 3CCQI 2KJCA 3IV5A 3CUQA 1MKMA 2FNAA 4L5JA 2XUBA 1YX5A 3OYBA 3FXMA 3ZXSA 2HYGD 2XQ3A 1KU7A 4JI6T 3RIUC 2UXNA 3PUFA 4H9OC 2JWTA 4CZZB 2L7FP 1U8BA 5JLXA 4E7JA 2CFOA 4UVBA 4XLHA 2XF5A 3FMSA 4ZOLE 3U3IA 3OYXA 1DU0A 5CYVA 4IT4A 2DMUA 1W36D 4FTHA 2OV7A 4EQQA 2YDSA 3B5MA 1H8AC 3UQ4A 3OYLA 1A31A 1PDNC 1WPKA 3ZJ2A 1BR1A 3C4XA 3W2WA 2CLYC 3T1YT 1TNTA 2COMA 1ZKEA 1HKSA 1Q1HA 4B6XA 3A1YA 2HDWA 1FOWA 1N75A 4A3CJ 1RETA 1SFKA 1MMAA 5HLGA 4X64T 3GTGJ 2DA1A 3RCOA 4I55E 2VI6A 5BMZA 2R6GF 4GDFA 3VSLA 4HSTA 4MLKA 4YSYA 2SPCA 3K9TA 4CICA 5BQTA 1IG7A 2ZJPF 2GA1A 4EJVA 3ZC0A 1FIAA 4MHGA 3JRIA 1C0WA 1FPQA 2EPFA 2NOJB 4I98B 4R8HA 3HPHA 3TOBA 4EM1A 3SZPA 2XROA 1T8IA 3BR3A 3WI3A 2DQRA 3RKYA 5B5EC 3CMAI 4PW8A 2JRKA 3E5UA 3LSTA 2JRMA 2JA7J 3KINB 2HYJA 1HW5A 5LBMA 2LP0A 5LOVE 5DM7F 4DUZT 3DKYA 2VKEA 3S1NJ 2V7KA 2ZMEC 2FBHA 5L3GA 4UUSB 2W62A 3TLTA 4AQFC 2LEHA 1SD7A 3Q5WA 1QPIA 2Q9QD 3CUOA 2F5EA 2L9QA 3WU1B 1M1EB 2CJJA 2VK9A 3FF5A 3TKYA 3HOUJ 1RUNA 2Z6EA 4RLFA 2DMTA 1BIBA 4YT0A 2K85A 4CH7A 4A3FJ 2CV2A 5BS6A 2Y48A 4EJTA 2D9DA 1ZREA 2WCAA 3L39A 1K61A 1LNWA 3VYTB 2D5UA 4CCMA 2LVSA 3W2AA 2A5YB 3ZQFA 2CGPA 3EDVA 2PMZA 5E8GA 1N33T 3K3NA 1RI7A 2WZIA 4UHTA 4OIRF 3CDHA 1XGSA 3LFUA 2X0LA 2VQCA 1QNTA 4GK0E 1N25A 4O4HE 1TWCJ 2JSCA 2R3SA 3FXQA 3PNYA 4D7NA 2FJBA 3P50A 3PJAA 2DOAA 5HLHA 5A2QZ 5HYAA 1RPWA 3UR3C 3DBLB 4DJAA 2F5DA 3S2WA 1E3OC 2KQRA 1H9TA 2OQRA 4ZYEA 1SUMB 3ELKA 1R58A 3LSHA 3Q3SA 3VFZA 2VPLA 2FMLA 2L4MA 1G73A 2O61A 5FY1A 5D5UB 3S16J 2V5DA 3GTLJ 4AIHA 3RTRA 4B1RA 3CJRB 4L0ZB 3GTPJ 1X79A 4A3MJ 2C5JA 4UVAA 1PUFA 2LDUA 3IHRA 4BBRJ 4AYBA 4EYUA 3GXOA 2I8DA 2OF7A 2GXAA 4KMUX 4CCKA 2I10A 3KIOA 2EHOA 2CXLA 4IL4A 5JLWA 3ZN1B 2V5CA 5D4SA 3MZ8A 1VQ8I 3ZMUA 3OS1A 1TWAJ 3EABA 4NB5A 4OIPF 5CLSA 2PN6A 2HPMA 3L1PA 1ZR2A 3GF2A 1BL0A 2V1UA 1WQ2A 2EIMH 3CD6I 3KX2A 1DDNA 4IE7A 4CXWA 3CCYA 1G4DA 2YINA 3M3ZB 5HXHA 3ZKRA 1SD6A 4KN4X 3HM5A 2WM9A 5EK4A 3LFMA 3W2VA 1VQOI 1IN7A 4OFZA 1WHUA 2UZKA 3DTIA 4UNOA 4JYKA 1UJ8A 1WVRA 2IIUA 1D5YA 2L7ZA 1TLHB 1YE9A 3SQNA 2OCCH 2OZUA 3ERMA 4GYRA 5JRCB 1OCCH 3MEXA 5H6QB 1Z1DA 3WG9A 3C7JA 3LAPA 4BDYA
chains in the Genus database with same CATH topology
1BC8C 4G7HF 3AAEB 1BN5A 1BR0A 1Z6RA 3M1EA 2LKPA 3GW2A 1S8NA 4AIJA 3KV6A 4E7ZA 1KU9A 1LEAA 4MQVA 1SD4A 3EYIA 3P7IA 2EA2A 1D5VA 1H9GA 1FBSA 4X1YE 4MTEA 3LA3A 4LG0B 2P5VA 1LJ9A 4CGZA 1MDMB 2ADUA 3R60A 3RKXA 3GVAA 1U3EM 4LGWA 4M6XA 2IP2A 1HW2A 3QRFF 3BDDA 3UTKA 1V3FA 1MGTA 2A3DA 1YW9A 2LSGA 1XGNA 3QP5A 2IA0A 1ON1A 2L01A 5CA1E 3IRQA 5E17F 3KLNA 2KMFA 1D0YA 5K5RA 4ZH4F 4YLHA 1IXSB 3I53A 4MEXF 5DV5A 4GYSA 4DNDA 5E8IA 2VC1A 3O2PE 2DI3A 3FMQA 3QU6A 3W6JB 5HLIA 3HTUA 2F5CA 3PE0A 4EB6E 4EMSA 3T0YA 1GXQA 4L0YB 3P8CD 3ERED 3J7AO 2NW9A 3HOSA 1K6OA 2E9XA 2BVMA 5FD5A 3M8FA 4V1Av 3RC8A 3N2GE 1IXCA 3AAIA 3L3PA 1FX7A 2CM0A 3CX8B 2VXZA 3O3KA 5FP3A 3AVRA 1P6RA 1ZYRF 1CF7A 4EOZB 2QQ9A 3MCZA 3PQKA 1RZ4A 1A04A 3I9YA 1HCIA 3GWHA 2F2EA 2XHKA 1U78A 2CQKA 2RN7A 3JSOA 2X51A 4H9QC 5JDHA 2XRNA 4I0AA 3BJOA 4EAHA 2ISZA 3HR0A 4PZJA 4CI3B 1UHWA 4JQFA 2EV0A 5A1LA 2P8TA 2XAGA 1S6LA 2KIMA 1MJAA 4Y13A 3K3OA 5FNVE 3KZZA 4XLNF 3EDUA 1QQIA 4ENMA 5HDNA 2GK9A 4WK8F 5LLQA 3ANWA 2RKHA 5LBQB 2K5BB 3ISPA 3IRRA 2OBPA 2F5FA 4IVNA 3WGGA 2QQAA 1J0RA 1OYYA 2IT0A 5ILVA 2J5PA 3VODA 3GA8A 3I9WA 3TO6A 5JVDE 2C6YA 5BPIA 1H7CA 4L9VA 4TUYE 2MH9A 4BHCA 4HV6A 3FM5A 4S04A 3RYCE 3GUDA 1RUOA 4U72A 2QBYA 1JXSA 2LE8A 3ZP5A 3ETVA 4QHOA 4ZS2A 5FXXA 5DYMA 2IW5B 3NBXX 3KVBA 4BAYB 1US7B 2EFNA 2ESHA 5HS9A 2QQBA 4HLXA 2UXXB 3FXRA 3L09A 4PJLA 1FZPB 4M71A 2NOXA 1W5TA 4EIWA 1Z6TA 3FXEB 5JR9B 2XAQA 2L3LA 1O3RA 3FM3A 3HSEA 3KVAA 2V9VA 6PAXA 2QGSA 1KGSA 1U6GA 3RRCA 1ZG5A 4CZZA 3P9IA 1B59A 5DDGA 2B0LA 2VOOA 3I1AA 3E5QA 1IZNB 1BIAA 1U5TA 2IC6A 2H6CA 3WTTC 3ECOA 1W7PD 4XSXF 2MTQA 2DT5A 2E9XC 3ZLIA 3RDIA 3BROA 3W15B 1O3TA 3V7SA 2O0YA 1LEBA 1UX4A 4GK5E 1D3YA 4M6YA 4ISSA 3PFIA 1OMIA 1Y64B 4DMWA 4WXDA 2O8XA 4R79A 3PUGA 4U0WA 3ZN1A 1HFAA 5AFUL 4UV9A 5D8KB 2DK5A 3C4ZA 4RB2C 4YFNF 2MYSA 4LFUA 3D0TA 3T8RA 4PFOA 1WYCA 3F8FA 4HBLA 5DD4A 2EB7A 4AWXB 2LNBA 2OU2A 1AOYA 4IRGA 3I5UA 3KDSE 4U0VA 1D8JA 2UXXA 4KICA 5JHUA 2QUFA 2IC9A 1XD7A 4L5GA 3WAKA 3DV8A 2P4WA 2E7WA 4YIIA 3H92A 4LK0F 4WF2A 4OU0A 4LB5A 2DTRA 5FFZA 5K1YA 3B57A 3N9PA 2X0LB 3ZJ1A 1TQMA 3E3VA 2Y6XA 1PP8F 3QAHA 4EM0B 3HKDE 5DABA 4PGGA 4RAZA 2PLYA 2V6CA 2CO5A 3VB2A 2ZCWA 2NW7A 4LG0A 1QZYA 1HF8A 4A5NA 2NYXA 2LSJA 3ZMTA 4QKNA 4ERRA 3NRYA 1ZHFA 2Z33A 1D1CA 5EZYE 2J5OA 5KMGP 2V7LA 4A6EA 5ICGA 4EM2A 2H94A 3WTZA 4DBRA 5AIQA 5F3JA 3MZKB 3B73A 2Z5UA 2CWEA 5LHHA 3GLXA 2OA5A 4MGRA 1T2KA 2KWIB 2C5IT 3UUMA 4F7ZA 3RH3A 2E1CA 5FB2A 4PCQA 1R36A 2QLZA 5JRCA 4BHPA 1OPCA 4M72A 5JDMA 3EDPA 2I59A 3O9XA 4U74A 3BQKA 2Q9QC 1FT9A 1KU3A 1O7LA 5LGUB 2QENA 3V7CA 1YLFA 5LXTE 4KDPA 2IVMA 1Z0PA 3F3XA 2Y75A 2XAHA 3N9OA 3RYIE 4RGRA 4EV0A 5JH7E 2JRTA 2XGXA 3K1PA 4HQMA 1XDSA 3MZYA 5H20A 3JTHA 3WGHA 3T8OA 5CB4E 2VC0A 3OOPA 2E8IA 3IKTA 2JQQA 3Q9VA 2CSOA 3F8CA 4O4LE 4UF0A 2DLLA 3TKLB 1R1UA 1IRFA 1W7PB 1BR2A 4A5MA 4P0AA 5DQWA 1IAWA 3ZEFB 2MA3A 5F6FA 2M1BA 3FMRA 5EEGA 5FGMA 4HZFA 4HKAA 4AVPA 4M9SA 1P92A 4Z8XA 4H9NC 2EFQA 4KUMA 2YX7A 3CX6B 2L3DA 3EVYA 1E1HB 1FBUA 2FA5A 1FNNA 1XGMA 4H0EA 1IN5A 4IRHA 4EGZA 4HV5A 1BM9A 2FSWA 2QYOA 2IPQX 1S35A 3HSRA 1NAFA 2LHRA 1J5YA 5IHYA 4AKLA 1XSVA 2RVCA 4HF0A 5DCMA 4AD9A 2DAOA 5ED4A 3CUQC 4L9JA 4BNCA 3R6NA 2DO7A 4K2EA 1MMDA 2WTEA 4NQWA 1J2XA 5TJJA 5JDFA 4ZS3A 3PUSA 2HH7A 2VODA 2CXFA 3LA7A 1EH6A 3I0OA 2CXDA 1G8XA 5HXRA 3C50A 1JHHA 1I27A 1BOAA 4CI1B 1HG5A 3E0ZA 4GYIA 4BH9A 2RQPA 2V79A 1T0FA 5HWXA 2FMYA 4P9FA 2W25A 2ZFWA 1IN8A 2VOPA 1S94A 3M7GA 3HSFA 2GA2A 4WX9A 4ETSA 1CGPA 5BMVE 4F6RC 5FO5A 4XZCA 1SMTA 4HN9A 5L3FB 3MKDA 1OYIA 2Z9OA 4YJ2E 2QM3A 1D0XA 3P9KA 5HAXA 3F6OA 5CVVA 3QU3A 1B4AA 5LHGA 5L3EB 2ZM0A 4UVBB 2FF4A 2ZBKA 3RYFE 4HAMA 1WI9A 3I71A 4AKGA 3I0TA 4HOBA 5H6RB 1U2WA 2VKHA 5LG4A 4ZZDA 4FX4A 2PJPA 3AB3B 3N9QA 2H6BA 1D1AA 1O57A 3F2EA 3R4KA 2ETHA 2M87A 1ZRFA 1FOKA 1IN4A 2AXLA 4WCGA 1HBXG 2WMOA 2PFBA 4UVCB 5K5QA 4X20E 1R1VA 3N9NA 2ZNYA 4RS8A 5CVUA 5KVRA 1TTYA 3MZHA 3E6DA 2E9XD 2X66A 3L7WA 4ZYGA 3I59A 1G3WA 1JE8A 1ON2A 1R5GA 2H3RA 2W00A 2FRHA 5LGTA 4TN7B 4YHJA 1F1ZA 1KNZA 3HKCE 3SXYA 4Q48A 3VEPA 4QX8B 1S3JA 3ZCIA 3RIRA 3WE2A 2X4HA 2UXNB 5L3GB 3O1JA 4PAGA 3W6KB 1U4QA