3EUHA

Crystal structure of the muke-mukf complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
315
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of a bacterial condensin complex reveal ATP-dependent disruption of intersubunit interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
total genus 121
structure length 315
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3euhA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3euhA02
1R00A 1LQ1A 3HOSA 1LDJA 1DP7P 3LQQA 1SD7A 4D0PA 5ERIA 3FHZA 3H92A 1KU7A 5D5UB 2YU3A 1U5TB 3R61A 4CO8A 5DD4A 1I5ZA 1Z6TA 3BWGA 3O6BB 3WE2A 4HLXA 4U0YA 3DPTA 5K5OA 4CXFA 1IZ1A 1Q1HA 4CDGA 3EUHA 2DU9A 3E5UA 4I0AA 1U5TC 4DNCA 1J7KA 5K5QA 4WF2A 3HRUA 4HDUA 3JSPA 2HR3A 2DPUA 4KYWA 3FX3A 1I1SA 5BMZA 3RTRA 1XSVA 2HQNA 3F6OA 2PG4A 5FLXZ 2GAUA 3WGIA 3GYHX 1R5HA 4MGRA 2DQLA 2YX4A 5HOOA 2XAGA 2Q0OA 3CTAA 5LGTA 1S3JA 1CF7A 4RAYA 3QOPA 4Y13A 2HFHA 3V8KA 1HKTA 5E17F 4RGSA 4LK0F 1RI7A 1GXQA 3N4MA 1KU2A 5J8CA 4CZZA 4MEXF 5BPIA 1IAWA 2M87A 3IRRA 1TNSA 1XGNA 5A2QK 2MC3A 2CW0F 1FOKA 2HYGD 3E5QA 2F5EA 1H9GA 3JSOA 4LLNA 3R60A 5FD6A 3IL2A 2M5WA 3E6CC 5CYVA 3DXJF 2LSOA 4HF0A 3WU0A 4EV0A 3EETA 4TV7A 1IRFA 3U9GA 5CVIA 2K4JA 2A5YB 5LHIA 4L0YB 5D4SA 3KZYA 2L02A 3G3ZA 1R23A 2HTSA 3T0YA 4L9JA 5LHGA 3FXQA 2XAQA 2COMA 1IW7F 4B09A 2F5DA 1TQIA 2JSCA 4G94A 1YTYA 3WODF 2A61A 2HS5A 2LF7A 1G3WA 5JI6A 5HS7A 2E7XA 2A68F 1BBYA 1WQ2A 4I7HA 2OQRA 5CJ9A 3WTTC 4YFXF 2BEOA 4ENNA 4ENJA 1QBJA 4IPAA 1P92A 2ISYA 1YFHA 1KU3A 2HOEA 5HDGA 1BJAA 1FBUA 4EJWA 1C0WA 4A0ZA 2BE5F 3I53A 4BHBA 3BDDA 3GEZA 1P4XA 3VB2A 4PZJA 1X3UA 4LJZF 4AWXB 1XSXA 4AIKA 3PFIA 2VBYA 4RGXA 2E7WA 3K1MA 3TQNA 4KIBA 3GZ5A 1TW2A 3ECHA 2QM3A 3SXYA 1J0RA 4LFUA 1OMIA 3HTUA 2MD5A 5TJJA 5HVQC 4EGYA 2XAJA 4A12A 4BXUA 2O03A 2ISZA 1IN6A 2ELHA 4EMSA 3I54A 3RKYA 2DPDA 4LD5A 3KLNA 3WTUC 3T8RA 3RYPA 2O6GE 2DO7A 3E97A 4KNYA 3LFKA 2DBBA 5CVVA 3HRTA 3PQJA 1D3YA 2ZNYA 2IA0A 1FP1D 2M45A 3GVAA 2YX7A 4HX4A 1FYKA 2NYXA 3RKXA 3FM5A 3CUQB 2GXBA 5FB2A 3E3VA 4LLLA 3FM3A 4P96A 1XDSA 3OOPA 2HZTA 3F6VA 3C3WA 3FZVA 1FYLA 2OD5A 1IN5A 3ABTA 1J9IA 4L5IA 3KETA 3KP6A 2VC1A 2FEZA 4JBAA 4UV8A 1E2XA 4KN4X 3QP5A 3ELKA 1DPRA 1QO0D 3R4KA 2ZJ2A 1V4RA 4MHGA 1TTYA 1FY7A 1XGMA 3ZN1A 3J7AO 1OYIA 1KQ0A 2FNPA 4EJUA 2K27A 3MEXA 3F72A 1GVJA 4KICA 3RPQA 2Y48A 1USTA 1BI1A 3JAMZ 3ISPA 1STZA 4G6DA 3KZZA 3CUQA 1UFMA 1FZPB 1T38A 1Z6RA 2QZ8A 4KIFA 3LA7A 3TDUC 1J2XA 1QNTA 5CVJA 5DEQA 3VOEA 2O0YA 2XUBA 1NHAA 2V1XA 1HW1A 5E1ZB 2PN6A 4HDVA 3RPUA 1MJBA 4HQMA 4N0BA 4EJVA 3DEUA 1W5TA 5CVRA 3TO7A 2XAHA 3R6SA 5BQTA 4ETSA 3GLXA 2F5CA 2JPBA 2AS5F 4P5OA 2FQ3A 2Q2EA 2ACJA 2PJPA 3TDZC 5LRRA 1JE8A 3WE3A 1W5SA 5F64A 5DDGA 2QYOA 2VE9A 2P5KA 3K1PA 1ZGAA 1O3RA 5D5WB 5L3FA 3QPTA 2P8TA 3WTYC 3KCCA 3C7JA 3DQVC 2GWRA 2FMYA 5DCMB 4ZYEA 2ZFWA 1XGOA 3WTSC 3V8JA 4RGUA 1W7PD 3I5UA 4FHTA 4JK1X 3HYIA 1RZ4A 5L3DA 2VBXA 3ECOA 4LG0A 1GHCA 5H6QA 1LDKB 5BOXA 4Z2YA 4M72A 1SD6A 4CYDA 3GXOA 3CO7C 3ZN0A 3JTGA 1QZYA 4I0BA 1L0OC 5ILUA 2UXNA 5J8FA 2OBPA 3HOTA 4OMZA 1V3FA 4ENKA 4GCVA 1B9NA 1BN5A 3TO9A 1FNNA 3I58A 2IP2A 3DFGA 5FGMA 1K79A 2ZBKA 1JHHA 2CFXA 2XVCA 3RYRA 2VBZA 4WX9A 5IT9Z 4EM2A 5IT3A 3KP4A 1A04A 1G6NA 1MKMA 3RIRA 1HBXG 4LGWA 2CG4A 2MLKA 3BP8A 4BHPA 1K78A 1LJ9A 3HUGA 5TRDA 4I2OA 2VBWA 4IRIA 1G3YA 3GFMA 1PUEE 5E8GA 4Q47A 1D8KA 3WGHA 3FWEA 4IF4A 1XMAA 2KIUA 5ED4A 3L00A 1SMTA 4OU0A 4BNCA 2J5OA 2Z33A 4MQ9F 2P7CB 2QLZA 2A3SA 2EFWA 4WWCA 4H0EA 1XB4A 4A2UA 4YFNF 1AWCA 4HBLA 4LG0B 4LK1F 2FBKA 4O5VA 2Z3YA 3FMQA 4Y15A 2ETHA 2ZMEB 4M6YA 3IHUA 3HIFA 3F3XA 2YPRA 3ZQ7A 4CGZA 4RB3C 4ENMA 3HSRA 1ULYA 4I01A 1F1ZA 4RB1A 2ZKZA 3K2ZA 5J6XA 2GZWA 1MGTA 1YQAA 1HKSA 3FMSA 5HDNA 1SFUA 2ADUA 1IN4A 3L7WA 3P9CA 1EH7A 2Y75A 4OOIA 1Z91A 1S8NA 3V7SA 1ZREA 4WXDA 1H0MA 4ZZLA 4L9NA 3I59A 5FFXA 3P7NA 5D8LB 2IPQX 1U6GA 5E1WA 3ROUA 1U2WA 2BYVE 1IXSB 4BAYA 4U0WA 1ZN2A 4Q5SF 2G7HA 4WXCA 5K5RA 2HEOA 4K2EA 1CGPA 5E1XA 2KRFA 2DFIA 4M74A 2M1BA 3DF8A 3IWZA 4OINF 2Z9OA 1PP7U 2IA1A 2JPCA 2V1DA 4RB2C 4MNUA 2H09A 1IRGA 4HF1A 4ESFA 2XKOA 4EM0B 2LNBA 3ML6A 2RKHA 3LSTA 3FMRA 4P9FA 5K1YA 4U7DA 4A5MA 1F4KA 4LB5A 2RC4A 2R7DA 3ZMVA 4IXAA 3WTWC 2GIVA 4ZYGA 4LMYA 2CQKA 1YLFA 2V6CA 2X4HA 5FD5A 4E70A 1YW8A 3VEPA 4O6JA 3K9TA 1IXRC 2UWMA 2BBYA 3G73A 4Q4ZF 2IT0A 4F7ZA 4OIQF 2XKPA 1UHMA 2QVOA 1FSEA 2XROA 3CLOA 2X0LA 1G4DA 1MZBA 5ICEA 2HKOA 3T8TA 1K6OA 2HYFA 3LAPA 3J81K 1MDMB 2G9WA 3M9AA 1P4WA 2WWYA 1U8RA 1Z9CA 1JHFA 1Z05A 2ZMEA 3HSFA 3EQLF 2Z5UA 1RIOH 4XLNF 3TOAA 3KP7A 3TO6A 3F8MA 3AAFA 3E6BA 3ZPLA 2B0LA 4AVPA 5ICFA 5HDKA 5JHUA 3M1EA 1ZG5A 5AIQA 1FPQA 4PGHA 4R1HA 1J59A 3O2PE 3J80Z 2A6EF 1I1GA 1FLIA 1E17A 5E8IA 1I27A 2FU4A 2MH2A 2A07F 2VN2A 1LEBA 2D1VA 1TNTA 4ZYHA 5D6EA 1J75A 3QRFF 4OMYA 3M7GA 3QPHA 3GFLA 1TBXA 3QP6A 1ZRDA 3E6DA 3ZMTA 2L4MA 1VTNC 4PGGA 2RQPA 2M8EA 4Q48A 1CF7B 2NNYA 5D4RA 2K86A 4IHSA 4G7OF 2M30A 3CJNA 3ABUA 2ZO4A 4HA8A 1ZLJA 4R8HA 1G3SA 1B1BA 1S6LA 3M8EA 3ZMUA 4BQAA 2PFBA 1HSJA 3I64A 1WKMA 3BJAA 2P5VA 3GUDA 2FNAA 2PI0A 4BHCA 2PMHA 4HX8A 2VOOA 3EYIA 3FXRA 2HWVA 3GZ6A 2H6CA 4XBFA 2A69F 4IJAA 5HLIA 5LGNA 2RDPA 4EJOA 1B6AA 4WK8F 2D1HA 2EFNA 2JZYA 2FSWA 1XCBA 1U5TA 1ZG1A 1JGSA 1F5TA 4CHUA 1HQCA 3I59B 4KN7X 2FA5A 4ASNA 1O7LA 4A6EA 1G3TA 2PEXA 1RNLA 1DDNA 3F8NA 3BY6A 2BGCA 3B73A 3J81Z 1LB2A 2H94A 1EH8A 2Y0MA 3JTHA 1XD7A 5JFRA 1PDNC 3JW4A 3R0JA 5LBQA 1R22A 2YR2A 1HXDA 1ZRFA 3SHFA 4A5NA 2XAFA 2AXLA 4EQQA 5DUIA 2IRFG 3MZHA 3KE2A 3D5LA 2ZNZA 3S2WA 4EGZA 3I0TA 1B4AA 5JVTA 3OV8A 2W57A 2FRHA 1FBSA 3QU6A 2NNNA 5KVRA 4YFKF 3DP7A 1FSHA 3FF5A 5D5XB 1UCRA 1O3QA 5E18F 2Q8KA 2VODA 3B02A 1Z7UA 4CICA 5CLSA 6PAXA 2FF4A 1ON2A 1WRJA 2EA4A 2OZ6A 4HYEA 5ILVA 5JR3A 4HQEA 2XGXA 3F8FA 2EV5A 1T2KA 3RKWA 1XGSA 1R58A 2E1NA 3NQOA 3U1DA 2QUFA 1H9TA 5DV5A 3H3ZA 3RDIA 1MJ9A 4IRHA 3WTVC 3FXUA 3ZMDA 3RJPA 2W24A 4EVIA 4IHTA 2D2WA 4MTEA 2IJLA 3GO5A 4M9SA 5F6FA 2PBIA 3N97A 1BC7C 1XDUA 4EM1A 4XLPF 1RUNA 2GQQA 2EFPA 1ZAOA 1BC8C 1LVAA 2QQ9A 4KT5C 5D6FA 2KIMA 2FMLA 3LA3A 1T98A 3LQRA 5H20A 5A2QZ 3REOA 4P9UA 5DD8A 5CVUA 5HLHA 2EV0A 1SFEA 4KUMA 1Z1DA 2K7LA 1SD5A 2KIFA 2NS0A 4UVBA 1MD0A 5FLXK 2VXZA 1WI9A 1BI0A 2VONA 5DUKA 5LLQA 1S29A 2K02A 2OA4A 2JT1A 3V4GA 3MWMA 4QWQA 2IW5A 3ZP5A 2WV0A 5EEGA 3KFWX 3BJOA 1KQ9A 2MA3A 1DPUA 3Q9SA 3SZTA 1KYZA 2FOKA 3HRSA 3K0LA 3TKYA 4BYYA 5L3CA 3F8BA 3VODA 4U7BA 4HV6A 5ILSA 1O7FA 3BJ6A 4HLYA 2G7UA 3KLOA 2STWA 3GFIA 3WTZA 2XRNA 4RGRA 3WGGA 1XMKA 3P9IA 5HS9A 1HW2A 5F1RA 2HQRA 4WXHA 1O57A 2HTJA 4KMFA 3KP2A 1SMYF 1HW5A 2F2EA 4UUVA 3HRMA 1KA8A 1D5VA 1TQMA 5HLGA 1R36A 4GXOA 3NRVA 4I02A 4P55A 2DK8A 1YO5C 2EFOA 2ESHA 5ICCA 3BPXA 4UVCA 4ZH4F 3SFZA 3F23A 2J5PA 5FFZA 1FT9A 2IVMA 1ZGJA 3HTSB 2PLYA 5DYMA 1JXSA 3I4PA 1T0FA 4A0XA 1RUOA 3MQ0A 2E1CA 1SFXA 1IXCA 3F8CA 2P4WA 4EJTA 1D8JA 3I71A 1S7AA 1KU9A 1REPC 1ZARA 4I09A 2EJRA 1ZHFA 1GXPA 2UXXA 1YIOA 2FBIA 2RN7A 4HAMA 1XSDA 4HX7A 1UB9A 2O3FA 2FBHA 3RI4A 5H6RA 3QAHA 1LDDA 3GX4X 3IC7A 4ESJA 4M9XA 1YW7A 1I6XA 3MAJA 2CO5A 2OAZA 2H6BA 2QENA 2HDCA 4G8XA 4PDKA 1U78A 2QBYB 4OIPF 2R3SA 3C18A 4IVNA 2QQBA 1EV7A 4UV9A 1XN7A 3WU1B 1LNWA 3M8FA 3HHGA 2MH9A 4KMUX 1B9MA 4I98B 2DW4A 4ON0A 3Q9VA 4GYGA 4NQWA 3K69A 5FO5A 3MCZA 1IUYA 3SZPA 3BPVA 3MZYA 1ZH5A 2DLLA 2V79A 3IWFA 4RAZA 3CUQC 2LDUA 4UNOA 3EDPA 1R1VA 3GW2A 4RB0A 4MEYF 1EH6A 3GWZA 2EK5A 1L3LA 1YYVA 4UHTA 3KP5A 3GF2A 5KK1A 2DAOA 4FX4A 2MBFA 4G7ZF 1FBQA 1OPCA 1J5YA 5DCMA 1QGPA 3K1NA 2OU2A 1IN8A 5LHHA 2FE3A 2XHKA 3V8LA 2JTVA 2DK5A 1ZRCA 4L9TA 3DPLC 1BM9A 2P7VB 1SD4A 2L3DA 3LWFA 2W25A 2P5LC 1BIAA 1WWXA 1KYWA 3ZMZA 2DT5A 4NB5A 1MDMA 5AIPA 2WC2A 1HSTA 4HV5A 5IT9K 5LEJA 4HW0A 1HKQA 4KDPA 1Y0UA 2CGPA 1R5GA 4MTDA 2QBYA 2NRAC 4FT8A 2O8XA 3Q5FA 2RNJA 4AIJA 1F9NA 2HGCA 3MFKA 4B8XA 1IN7A 1ON1A 3ZMSA 2D45A 4MQVA 2V1UA 2C6YA 1UHWA 2ZCWA 4AIHA 1OKRA 3CUOA 3HHHA 2CSOA 1B59A 2UZKA 1P6RA 3L09A 1ZYRF 2KJCA 1YS7A 1WSUA 2L4AA 1TQPA 2F5FA 1ZG3A 3LA2A 1K78B 1BI2A 4A0YA 3HSEA 1P4AA 1K7AA 4RS8A 4HF2A 4HOBA 4S04A 3WTXC 3F22A 1BIBA 1QZZA 3GFJA 1YG2A 3TGNA 3V7RA 2VE8A 5AONA 2CYYA 3D0SA 3COAC 4PCQA 2GA2A 2K4BA 3E5XA 3IKTA 2V9VA 2W84A 2P6TA 2H27A 4XSZF 2EB7A 3WG9A 4HZFA 2RV8A 4ZYDA 3R0AA 3NEUA 1AOYA 3CO6C 4G7HF 3QU3A 2EFQA 2Z99A 1T6SA 2O61A 1S7OA 1FWZA 2OQGA 2P6SA 4G9YA 3P9KA 1R1UA 3PQKA 2RGVA 2FXAA 3H3UA 3ULQB 2XASA 1MJAA 3L2CA 4ZZDA 3T1BA 2VOPA 2VT2A 3CDHA 2GA1A 4KIGA 3DV8A 3KEOA 4N9IA 2HKXA 2VT3A 4NHJA 1KGSA 2KJBA 1DUXC 4KFCA 5ICGA 5LEKA 4O3MA 4FX0A 2EWNA 1OYYA 3T5XA 2YSRA 3F21A 2MLGA 4ESBA 1USSA 1W7PB 3BROA 2RVCA 4QLCU 3W6JB 4OIOF 2JRTA 3J80K 2LKPA 4N9HA 2IA2A 2NAZA 4S05A 3IKVA 1W4MA 5D5VB 4L9VA 2DI3A 5L3EA 1ODDA 4L5JA 1SAXA 1BOAA 4R79A 3KP3A 2EA2A 3VFZA 3LAJA 1FYMA 4LLGF 4YIFA 1R7JA 5L3GA 2DQRA 4GO1A 2XV4S 4IRGA 2VC0A 1PP8F 3KEQA 4KA4A 4U0VA 2OZUA 2TDXA 4UXNA 5D8KB 5EEHA 1YS6A 2PQ8A 2L01A 4UVAA 1FP2A 1TW3A 3IRQA 1ONVA 4M73A 1ZLKA 5HS8A 4Y17A 5DCFA 3V7CA 4G6QA 2KKOA 3C1DA 2L54A 2A6HF 4JQFA 4WCGA 2CWEA 1FX7A 2W85A 3E6MA 4A6DA 4OIRF 1OYWA 4YG2F 4GYIA 1O3SA 1XCVA 4XRFA 1YW9A 2DTRA 1IF1A 5L3BA 3EYYA 1R1TA 4GGGA 1U3EM 4M6XA 4AD9A 3O3KA 1FC3A 3DKWA 1QPMA 2R7FA 3SQNA 5LGUA 4DQ2A 1BI3A 4L18B 5LRSA 2LF8A 5E20A 2EV6A 4LB6B 2QWWA 4YIIA 1P2FA 2ZXJA 4U88A 3BOQA 3JAMK 3W6KB 4XSXF 1LEAA 2ESNA 1KQ8A 1O3TA 2BV6A 1TLHB 5BPDA 4M9ZA 1T39A 3U2RA 2PMUA 1W7PA 5BS6A 1QQIA 4M71A 2QQAA 3BZ6A 2STTA 1OR7A 3ERED 4L0ZB 3L9FA 2WTEA 2XIGA 4BH9A 2GXGA 3TOBA
chains in the Genus database with same CATH superfamily
2NW8A 1R00A 1LQ1A 2Q9QA 3HOSA 3I0OA 2UXNB 1LDJA 2NXNB 2I5UA 2ELJA 1DP7P 3LQQA 4PAGA 4K0KT 1MBKA 1SD7A 2E1MC 4BJ5C 4XLAA 4EOZB 4JI0T 4D0PA 5ERIA 4HFVA 2W4XA 1ETXA 2H7VC 4TV8E 3FHZA 3H92A 3HKCE 2JUCA 2N8GA 3H3VK 1KU7A 4OAYA 5FY7A 5D5UB 2AQFA 2YU3A 2VASA 3DEWA 2JQ9A 1U5TB 2XSBA 2HPMA 3R61A 1MSEC 5JTGA 1DQUA 3GTQJ 2RQQA 5L4HA 4BQOA 4CO8A 2HNHA 3O1JA 4XIDA 2YINA 2KL4A 5DD4A 1I5ZA 2GM4A 1Z6TA 3BWGA 4NC6A 3O6BB 3WE2A 1FIPA 4HLXA 4PJJA 4U87A 4U0YA 3DPTA 5K5OA 3HEFA 4CXFA 1IZ1A 2VVSA 5IYZE 1Q1HA 1WH7A 4RLFA 4CDGA 3EUHA 4IEJA 2DU9A 5FJ8J 1M1EB 1WLXA 2I0MA 3E5UA 3K6GA 2CWYA 4I0AA 2BS4A 4XKVA 1NH3A 3K4NA 3AL0C 5KXJA 3L2RA 3PJAA 1U5TC 4DNCA 1X4OA 4Z6YA 5B1AH 1JUSA 1J7KA 1Y6IA 3ZQGA 5K5QA 4O8SA 5BMVE 1A6IA 2IIUA 3CMYA 2L0KA 4WF2A 1IBMT 1IBLT 3ONJA 3EUAA 2ZM2A 2FOWA 3HRUA 4HDUA 3JSPA 2HR3A 2DPUA 4KYWA 1Y01A 2XGEA 5J4YA 3LK2B 2VI6A 5DQVA 3FX3A 3E0JB 3EDVA 2M34A 1X4PA 4BDYA 1I1SA 3RLFF 5KAIC 4YSYA 4M3EA 5BMZA 3QYFA 2HPIA 3RTRA 3O9XA 2HDWA 2M4GA 2JQKA 2B76A 1WYCA 3HI2A 1XSVA 3BR5A 4IE6A 2HQNA 2V6YA 1YD8G 3F6OA 2PG4A 4B3AA 4BJTA 3VWBA 5IP9J 2LH9A 5FLXZ 3DBHB 2GAUA 3N2OA 3LOCA 3WGIA 3GYHX 4Y3OA 3ZR8X 5JR9A 1R5HA 3BR1A 1UG0A 4NC8A 3KVAA 3BK9A 3HXLA 2DQLA 2YX4A 4MGRA 5HOOA 4CI3B 2DWGA 1IAPA 5FKOA 2XAGA 4M1PA 4QKNA 4YTMA 2Q0OA 4D5CA 3CTAA 2LJLA 5LGTA 5LYJE 1S3JA 3RIAA 4Z8XA 4LF4T 2WB1A 4IE0A 3SFIA 2L9NA 3TP3A 3RYHE 4Y52J 1CF7A 4A97A 4RAYA 2F48A 3QOPA 4Y13A 1MIWA 2MGQA 2HFHA 3H9GA 3V8KA 4F93B 1H89C 3ASOH 1HKTA 5IY5H 2YUSA 4Q25A 4X65T 4PSWA 5J4VA 3G71I 3WHBA 4ISSA 5E17F 3D1NI 4RGSA 3HB9A 4LK0F 3MN2A 5C44J 1I50J 4ILBA 4X20E 1MIJA 3VKHA 4FASD 1RI7A 1GXQA 3N4MA 4KP3C 1KU2A 2CH0A 5J8CA 4CZZA 1U4QA 3RH3A 2KT9A 2V7KA 1E3OC 4MEXF 1LPQA 3ZMTB 5BPIA 2HXOA 4H9SE 2A6TA 1IAWA 2EHOC 3LJCA 4C2MJ 1XDOA 3FXOA 4U2YA 1ETVA 2M87A 2QA4I 1E1HB 2I59A 3H3MA 3W2WA 3SJMA 3IRRA 1TNSA 4ANJA 1I39A 1T08B 4AKLA 1XGNA 1X19A 5A2QK 2DOAA 1FIOA 2MC3A 5H6RB 1WR6A 3EPZA 3OYKA 2XJ7A 5E0OA 1EZ3A 4FQGA 2CW0F 1FOKA 2HYGD 3E5QA 3JRFA 2CHOA 1W0TA 1MW7A 2F5EA 1H9GA 3JSOA 2BG9A 4F6RC 4LLNA 3VR9A 3R60A 4HEAA 5FD6A 3I9WA 4YRVA 1HF0A 4XKWA 3IL2A 4BY1J 2M5WA 3ERMA 2Q9QB 2XPKA 3W2AA 3CP8A 3MKLA 3V42A 3E6CC 5CYVA 5E3OA 3DXJF 5FKLA 2DXIA 5J3LA 3UKGA 2LSOA 3OOUA 4DV1T 4YT0A 4HF0A 2EZIA 3WU0A 1VQ7I 4HFBA 4EV0A 3EETA 4IL6C 4ZZCA 2CUZA 4TV7A 4A69C 3J9X1 1IRFA 2Y30A 3U9GA 3MK7C 4AKHA 3RSNA 2L7ZA 4XRSA 3TBIA 3HDDA 3K7AJ 5CVIA 3O4XE 3ZMUB 2K4JA 2A5YB 2FJ1A 3PSIA 2C5KT 2WY8Q 4DV6T 4ZC3A 3OYLA 5LHIA 5JDGA 5D4SA 4L0YB 2K5BB 2KMFA 3KZYA 2IS2A 3N2KE 2L02A 1N75A 2WDQA 3G3ZA 1I6ZA 1N25A 1R23A 4BE2A 2HTSA 2KQRA 3T0YA 2DCEA 2MAWA 2PJRB 4L9JA 5JVGF 4B3ST 2R7RA 5JDQA 5LHGA 3FXQA 2XAQA 3GBGA 1J09A 1LVFA 2COMA 1IW7F 3ZYKA 3A0HC 2CQQA 2V1NA 2Y0SA 3KEYA 4IQJA 4B09A 2YDSA 2F5DA 5FXWA 4CYCA 5AQFB 1WR0A 1TQIA 5EJCA 2JSCA 4AIUA 4HWIB 4G94A 1YTYA 2XQ4A 2M6IA 3WODF 2A61A 2HS5A 2LF7A 5CJ5A 1MBEA 1D0XA 1G3WA 4Y7NJ 4EAHA 3RPUD 5JI6A 1CHUA 2XAJB 3UUBA 3UQ7A 4CI2B 4HNTA 5HS7A 2E7XA 2JMWA 2IW5B 3N05A 1QU3A 3LSKA 3IEEA 2A68F 3PV0F 4IREA 3UFGA 1BBYA 4M3DA 3P4QA 1WQ2A 2W00A 2DODA 2KZGA 4I7HA 4V2GA 3UUXB 3GWHA 4ADZA 4B3RT 2OQRA 5CJ9A 3WTTC 5FRMA 5F0CA 3ZGKA 4YFXF 3FKJA 2BEOA 4ENNA 2JN6A 4ENJA 1QBJA 2LSYA 2V6YB 4IPAA 5GONE 1SVMA 1P92A 4P1NA 2ISYA 1YFHA 1KU3A 2COBA 2HOEA 5HDGA 2FQ4A 3HOUJ 4J00A 1BJAA 1FBUA 4EJWA 4A3MJ 1Z3YA 3J7Yq 1C0WA 1SFKA 4A0ZA 4UY8I 3GTKJ 4CN1A 4DV3T 2BE5F 3I53A 4EXTA 5ETWA 3KDSE 4PJLA 4BHBA 1LVKA 3BDDA 4IT4A 3A02A 1J1JA 1T95A 3GEZA 1MMGA 4A56A 4CQIA 4XONA 5M4YA 2CFOA 2LSKA 1Y0NA 1P4XA 3VB2A 4PZJA 1DP3A 2W66A 1HC8A 1X3UA 5C4JJ 1VNDA 3ZQLA 4LJZF 4AWXB 2ZLYA 1XSXA 4BQQA 4AIKA 2CRGA 1BOBA 3A5XA 1HDDC 3F9KA 3OTOT 2UXBT 5LGUB 5JQGE 3AE6A 1WJCA 1OCRH 2HZDA 2VBYA 3PFIA 2ZB9A 2DOFA 2Y9ZA 2CV2A 3S1RJ 2DDAA 4RGXA 3D0TA 3KBTA 2VQFT 1PYVA 2E7WA 3K1MA 3TQNA 2LHNA 3K4LA 4KIBA 2LSJA 3GZ5A 1TW2A 4QXHB 3HOVJ 2HOSA 3S1MJ 1RETA 3ECHA 1UAAA 2QM3A 3SXYA 1J0RA 2CRBA 4LFUA 1N78A 1OMIA 2EINH 3HTUA 5A1LA 1UK5A 2M67A 2MD5A 3LSMA 5TJJA 3QB5K 3G2BA 5HVQC 4EGYA 1TC3C 5LCYA 2XAJA 4A12A 2R7TA 4XLEA 4QH4A 4M6VA 4BXUA 2O03A 3I55I 3HL2A 4JYKA 4LOCA 2ISZA 4LMJA 1IN6A 4OK0A 2R4GA 4DMWA 4YLHA 5KMGP 4YEJA 2JUGA 4QX8B 2ELHA 3BTIA 2ZM8A 3A1YA 4EMSA 3I54A 4LF9T 3I3LA 3RKYA 3L2VA 4LD5A 3U21A 2DPDA 3KLNA 2UV1A 5L3BB 3WTUC 2QGSA 3T8RA 5HCJA 4C3HJ 3RYPA 3DU5A 2O6GE 3DKXA 3I1AA 2DO7A 1OCTC 3E97A 4P09A 4KNYA 3FZKB 1HR0T 1WVRA 3FZLB 2CV0A 3NRXA 3QB5A 4Z90A 4DV0T 3LFKA 2DBBA 3ANWB 2VK9A 5CVVA 3HRTA 3PQJA 1D3YA 3QWLA 1ORKA 1FTTA 5M5XJ 2V1DB 5J47A 2ZNYA 3AKZA 2IA0A 4ZTJA 5LJNA 2CS3A 3ZSTA 1FP1D 2Q1ZB 5L4EA 3CCEI 2M45A 3GVAA 4F91B 3S3OA 4OYKA 3B57A 2JVHA 2YX7A 2K85A 4N78D 2BZBA 4HX4A 1FYKA 2WMOA 4O2AE 3ONXA 5EZHA 1GV5A 5GPCA 2J62A 2NYXA 4NQWB 5F8PA 3RKXA 3FM5A 1QVUA 5JLXA 1LKXA 3OYAA 2VKVA 3CUQB 2KDOA 2GXBA 2E19A 5FB2A 3L2UA 3FDYA 2EIJH 3E3VA 5EGOB 3TLTA 3FB2A 4LLLA 3FM3A 4P96A 5J1YA 2CW7A 5J1UA 1UELB 2DA6A 3BQYA 1XDSA 3PUAA 3OOPA 4TNVA 2HZTA 3D5SC 3F6VA 1G2HA 4ILUA 3A01B 5F1JA 3C3WA 4YJ3E 2X0LB 4BE0A 4HWFA 3S17J 4LG3A 5E3MA 2LRKA 4A3GJ 3CCVI 2EZKA 4UR9A 2LSIA 4QHOA 3FZVA 1FYLA 2OD5A 1JI8A 1NG6A 1IN5A 4XK4A 1NG7A 3ABTA 4LMKA 1J9IA 3HOWJ 3UT5E 4L5IA 3ZCOA 1NK3P 2XTLA 3RGLA 5CGMA 1U9OA 2H7OA 3KETA 2HDDA 3LFMA 3KP6A 1TWHJ 2VC1A 5L3CB 4LFAT 2FEZA 4BS9A 3OL4A 4JBAA 3BCAA 1B72A 3S16J 4AQFA 3LG7A 3O1HA 2KMUA 3LDQB 3L39A 1BJZA 4UV8A 1VQKI 1E2XA 2K3WA 4TNWA 1WPKA 2HI3A 3OJAA 3P5JA 4KN4X 3QP5A 2XPVA 3C2HA 5HXRA 3Q9DA 3CC2I 2H1LA 1UUSA 3ELKA 1YJ9I 1DPRA 1VQ6I 3HKBE 1QO0D 3R4KA 2ZJ2A 1HX1B 1V4RA 4MHGA 1ETQA 1TTYA 3ZJ1A 4K0UA 1FY7A 2QKLB 1XGMA 2DT6A 4FCYA 3S1QJ 3ZN1A 3AB3B 3J7AO 1OYIA 1V9DA 1KQ0A 4TUYE 4YY3T 4ZI7E 2VJ5A 2FNPA 4EJUA 4YJ2E 2F4IA 3CMEI 3Q5WA 2BBHA 2K27A 2XF7A 3MEXA 3F72A 3PIOF 1GVJA 4KICA 4DGWB 2Q9QD 2XF5A 3RPQA 2Y48A 1I3QJ 1USTA 4DR7T 1BI1A 3JAMZ 2I10A 3ISPA 4TWFA 1STZA 3GTMJ 4HKAA 3CC7I 1FTZA 2QSFX 2R7UA 1WCMJ 1JKPC 4G6DA 2Y48B 3GN5A 3HA4A 2WAFA 3MKDA 2VLAA 1U9NA 1VCTA 2ZSHB 2KIQA 3KZZA 3O1IA 3CUQA 2X9DA 1UFMA 2D9DA 3KV4A 4RM3A 5HXCA 3OPCA 1IUFA 3FIWA 1FZPB 2G0UA 3F57A 3N5LA 4AKIA 1QHGA 4BUPA 3SZGA 4BEHB 2JRKA 1T38A 2X67A 3FZFB 3CZ6A 2ZSIB 3M07A 2N9DA 1Z6RA 2MTQA 3DWLE 4ZJZA 1A5JA 5H2FC 4JEHB 2QZ8A 4KIFA 3QYBA 3JC6D 3RX6A 3LA7A 4KJZA 2WZIA 3TDUC 3K3OA 4KX6A 3FHNA 4D7NA 2DWKA 1J2XA 1ITYA 1QNTA 5CVJA 4PNIA 4X1IE 3SDBA 5DEQA 5LP6E 4OYJA 2LMDA 2LBFB 2ME6A 5LBQB 1EKEA 2WADA 2X48A 1ETKA 3VOEA 4EEFG 2O0YA 4HG2A 1T0FC 2BS2A 3GMEA 3ESLA 5JRCA 1HNWT 1MBHA 2H1KA 1JJ8C 2XUBA 5FYMA 3ZMVB 4AXPA 1AJ3A 1NHAA 3PL8A 4HFHA 2V1XA 3RCOA 1HW1A 5E1ZB 2PN6A 4HDVA 3S2DJ 4IL9A 3NZPA 4IHJE 3RPUA 5JRCB 5EDNA 4D5FA 3A01A 2B7EA 4XORA 1VRBA 2BKOA 1MJBA 4HQMA 4N0BA 2E1OA 3QQAA 4EJVA 2R7SA 3DEUA 5FP3A 2Z2SB 1W5TA 4FE7A 5CVRA 3TO7A 3JRHA 1W9RA 3ETUA 3PTRB 1KNRA 2XAHA 3R6SA 5LXTE 4JEUB 1KONA 5BQTA 1WFDA 4ETSA 3FZMB 5JLWA 5HEUA 4PFOA 3K8PC 3GLXA 2F5CA 2JPBA 4WBNE 5F08A 2AS5F 4P5OA 2FQ3A 2Q2EA 2ACJA 3A2KA 2PJPA 3KV9A 3ZT5A 4X66T 2MFZA 3TDZC 2VKHA 1R5ID 4J01A 4LF8T 5LRRA 1JE8A 2C5IT 4U2ZA 1UG2A 5TGTA 1W5SA 3WE3A 3AE8A 3N9OA 5HEOA 3CCMI 1YXRA 5F64A 5DDGA 2BG9E 2QYOA 1OEDB 3PNVA 2VE9A 4HWCA 2P5KA 4HNUA 3I9V2 3K1PA 1ZGAA 1SVLA 4B44A 1X2MA 5D5WB 1O3RA 5L3FA 4RMNA 4DZJA 3IBPA 3QPTA 3Q3SA 2L7FP 2P8TA 4CSWA 1YIJI 3WTYC 4LF7T 3KCCA 3C7JA 3DQVC 5M5WJ 2JA7J 2FUPA 2GWRA 4IX7A 2KWHA 2DN0A 2FMYA 3IH4A 5DCMB 3PNYA 2EZLA 4ZYEA 2ZFWA 3HPHA 2QA7A 4NPPA 3VRBA 1XGOA 2LC2A 2XQ6A 2R5YB 4EB6E 3WTSC 2Y6XA 4XBFB 3CK6A 3V8JA 3KIOA 3FXDB 2BOLA 4X1EA 4OHFA 4UELA 2NOJB 4RGUA 4DR6T 5JDFA 1W7PD 2QCOA 3BR3A 3I5UA 4V1Av 1R4MB 2NW7A 4GKJT 4FHTA 4JK1X 9ANTA 3HYIA 2DA3A 2QQ8A 1RZ4A 2IGMA 2R93J 5L3DA 3ZQIA 4CXWA 2VBXA 3ECOA 4LG0A 4YFSA 1JUMA 1GHCA 3P4PA 5H6QA 3ABLH 1LDKB 4IHVA 5EG0B 5BOXA 2E5NA 2F4MB 3CCLI 4G63A 1MNMC 4Z2YA 4L5EA 3H5RA 2NVXJ 4M72A 1SD6A 1NWMX 2R7VA 4FE4A 2ZC2A 5IP6A 1ZHCA 2KISA 4MIMA 3U1KA 4CYDA 3BC8A 1KZHA 1ZEEA 1UURA 3GXOA 4B3MT 4I43B 3HUGB 3CO7C 1CQTA 1JKQC 5HNHA 3ZN0A 3BT9A 3JTGA 1QZYA 4ILAA 2WB1N 4I0BA 3BG6A 1L0OC 5ILUA 2HQAA 3N2GE 2UXNA 2NVQJ 3MKZA 3UU5A 2WM9A 3S15J 2JK3A 1MSFC 4HNVA 1POGA 1X1BA 4DR5T 4AYBA 5J8FA 2OBPA 3HOTA 4OMZA 1V3FA 2WWUA 3UUNA 3DJBA 3FKIJ 4HGAA 4ENKA 4GCVA 4PK6A 4BEHA 1IO2A 1B9NA 2Y8DA 4I4TE 4DR1T 5JR9B 1BN5A 3TO9A 1FNNA 1MNEA 2IP2A 3I58A 2D0TA 1MH4A 4AKGA 3DFGA 2AQEA 5FGMA 1K79A 2WU2A 1XWMA 2ZBKA 3JREA 1JHHA 2CFXA 2XVCA 3RYRA 5FLVA 2KPMA 2B63J 3C2BA 1XDPA 3IF8B 2UUBT 2VBZA 4WX9A 5IT9Z 4EM2A 5IT3A 3L3PA 3MA9A 3KP4A 4LIUA 1A04A 2CQNA 1G6NA 1UGOA 3NARA 4XQFA 1XPXA 2QSGX 5HAXA 1MKMA 5IP7J 2JQHA 5JR9C 1GVDA 1W0BA 3BQKA 3IV5A 1IZNB 3KBUA 2Z16A 2VKDA 4EEBA 4OWRB 3LSIA 5GPAA 4I50E 4WBOA 3RIRA 1HBXG 3HZJA 4LGWA 1VQOI 2HOTA 3P4SA 4ERRA 5TAOA 5F3JA 4OX9T 3RYIE 2VQCA 2CG4A 2BW3A 2MLKA 4HSRA 2QRXA 3BP8A 1ZQ3P 4EZHA 5CPRB 4A3LJ 2ODUA 3OYJA 5IWAT 2Y2ZA 4BHPA 1NEKA 3P7IA 4I6ZA 1K78A 1LJ9A 4IOCF 5M3MJ 2XHEB 3HUGA 3BG3A 2LBFA 4W1UA 5TRDA 3V5SA 3PO2J 1MIYA 2VJIA 3OYBA 5IHYA 4BA9A 4DNDA 4XZCA 4JV5T 1Z3XA 4I2OA 2VBWA 3K4CA 2EPFA 4IRIA 5JHFA 4IDOA 1SEUA 2JA5J 2A5WA 1GT0C 1G3YA 3GFMA 3AA7B 2QYWA 1PUEE 5E8GA 3EUHC 1T56A 4Q47A 2OCEA 1D8KA 3OR2C 4AIDA 1N36T 3WGHA 4I0UA 3FWEA 4IF4A 1XNRT 3VSKA 1XMAA 2KIUA 4UB6C 5GP9A 2WAUA 5ED4A 4U7YA 3C98B 5HXHA 3L00A 5FKMA 3CDLA 5HXSA 1SMTA 1G8XA 4OU0A 4BNCA 2L7MP 4KMCA 5CB4E 2J5OA 3PJRA 4BBSJ 2Z33A 4MQ9F 2WWVA 3ZN0B 2P7CB 2IC6A 2LHRA 2QLZA 3BG9A 2CCQA 2BY3A 3C4WA 3ETVA 2A3SA 2NS8A 2N2NA 5AQMB 3K4JA 3GLLA 3NAUA 1WJDA 2EFWA 2V7FA 4WWCA 1ZKEA 4H0EA 2YN6A 2FJDA 5K7ZA 2D5UA 1XB4A 2AO9A 2DA5A 2WU5A 3NBXX 3ESWB 3LFUA 1XC5A 2CMPA 4A2UA 2GLOA 4TZ4C 5AQGB 3DTOA 2Q9QC 4YFNF 2H88A 2V6XA 1AWCA 1Y39A 4IGUA 3RKGA 4HBLA 4B3XA 4LG0B 1GV2A 4A3CJ 5AQIB 4LK1F 2MSYA 4GIWA 3JRCA 2VPLA 2FBKA 4E4HA 2GIZA 5HNFA 1LFUP 1JKRC 2XUEA 4O5VA 4JLEA 5LG3A 4DR2T 2BW3B 1OR7C 3I4MJ 3LL7A 3TW6A 4E7SA 2Z3YA 3FMQA 4Y15A 2DA7A 2WZHA 4QXBB 4DJAA 4P0BA 2ETHA 1B8IB 3VR8A 3KV5A 2KDZA 2ZMEB 4M6YA 2IBDA 3ABVA 4YSZA 3IHUA 3HIFA 3F3XA 2YPRA 3ZQ7A 3K3NA 4HN9A 3M3YJ 2LREA 2EQRA 4CGZA 4RB3C 3E0ZA 3F2EA 3RRCA 4LIVA 5HXEA 3AFHA 4ENMA 3HSRA 1F43A 1ULYA 1QLBA 2DHRA 4I01A 5AQPB 4PJMA 2CBIA 1F1ZA 2JMHA 2YDRA 1V5EA 2E5ZA 1D1AA 3LNQA 2X1CA 2ZKZA 2WV1A 3K2ZA 4RB1A 3JR9A 4E7LA 1US7B 4YSXA 5J6XA 2BY2A 2K24A 3MZKB 4UF0B 2GZWA 4A3DJ 2I6HA 1MGTA 1YQAA 1HKSA 3DTEA 1XMOT 3MJXA 3FMSA 5HDNA 2E34A 2C0SA 1BR1A 1SFUA 3MKYB 2ADUA 5EZGA 1R49A 5EG0A 1IN4A 3L7WA 3H5AA 3P9CA 1EH7A 5DTDA 2Y75A 2WAQN 2L9RA 1Z91A 4OOIA 1S8NA 3CD6I 4IOAF 3V7SA 4X64T 1ZREA 2LY2A 1R9TJ 1IJ5A 4WXDA 1H0MA 1VQ5I 4ZZLA 2QGUA 4L9NA 4C9YA 3CCUI 3I59A 3OIQA 4GYSA 2IS6A 3VHLA 5FFXA 2LR8A 4AKRB 4YTPA 3P7NA 2Y0SN 5D8LB 3L2WA 1YQ3A 3AVSA 2A2FX 3RC3A 2IPQX 1U6GA 5E1WA 4PJNA 3AEFA 3ROUA 1H8AC 1U2WA 3AA6B 3LSHA 4XMYA 1NENA 1J5ET 4RAGA 2BYVE 5B66C 3TMOA 1IXSB 4BAYA 1WYBA 5LGNB 2BZTA 5L3EB 4UIGA 4GFBA 1V5GA 3C50A 4MHCA 2ZJRF 2HOAA 4U0WA 1HLVA 3FXEB 5CKTA 3OYDA 1ZN2A 4Q5SF 3HGYA 3KYDB 4ITVA 1A31A 4QH1A 1T33A 2G7HA 4WXCA 2CA5A 5K5RA 1YITI 1PUFB 2HEOA 2IS4A 1HDPA 4K2EA 2YOEA 4MBQA 1QA6A 1L0VA 3RZDJ 1CGPA 3MXZA 2DA1A 3VYSB 1EJ9A 5E1XA 3SOLA 1JUPA 1ACIA 2KRFA 2DFIA 2L9QA 3RC8A 4JX6A 2JIWA 4M74A 5C3EJ 3ONLC 1Y64B 3ZKRA 3AEBA 3IH2A 4A93J 2M1BA 3DF8A 2DTZA 4F52A 1YKEB 1FOXA 5BR8T 4IDQA 2CUEA 1RESA 4BY7J 3IWZA 3UNGC 5JH7E 2OA5A 3OBVE 3TLWA 2J4GA 2E9XA 4OINF 5IOYA 2E2JJ 2Z9OA 2UUZA 1VQPI 4O4LE 3R84B 4NDLA 1PP7U 3CQXC 3RHWA 2IA1A 2JPCA 3CKDA 2EILH 2V1DA 4RB2C 1MBGA 3Q2MA 2LKGA 4MNUA 2H09A 1IRGA 2XAUA 4ESFA 4HF1A 2XKOA 4QX7B 5HEJA 4EM0B 4H63H 2LNBA 4F3QA 1B72B 3ML6A 2RKHA 3LSTA 4CXYA 3AEEA 3FMRA 3DEEA 4P9FA 2M2EA 1HOMA 4X5TA 5K1YA 3DLLF 4U7DA 2DDBA 1RR8C 3I9YA 3H9JA 2M3AA 4A5MA 4YXDA 3DTIA 1F4KA 2RREA 2RC4A 4LB5A 2R7DA 2QF7A 3VSLA 3ZMVA 4IXAA 3WTWC 2GIVA 3JCFA 3QPLA 1OCZH 4U31A 2ZFUA 4ZYGA 4LMYA 2CQKA 4JI2T 1WJAA 1PJRA 3OYCA 1YLFA 2V6CA 2X4HA 5FD5A 4E70A 1S72I 3DCFA 1TL8A 1YW8A 3VEPA 3CJQB 4O6JA 2OPTA 3K9TA 2J1DG 1IXRC 4BACA 2W2UA 2UWMA 5J1RA 3PUZF 2BBYA 3RQIA 3OKQA 4HPQA 3OYNA 3G73A 3S2HJ 2YDQA 4Q4ZF 3VKGA 4XLCA 2TRTA 4UUSB 2IT0A 4U7IA 5FY1A 4CN4A 4O4JE 1WJ5A 4F7ZA 2ECCA 2XKPA 4OIQF 1UHMA 2QVOA 1FSEA 1O3XA 4TV9E 1FOYA 2K40A 4XOTA 4F55A 1BW5A 2ZXWH 5LHGB 2V4JC 2XROA 3CLOA 3PU3A 4M3BA 2CM0A 4A3KJ 2K3FA 2X0LA 3IH3A 1G4DA 1LRZA 3R6NA 3T1HT 1MZBA 5ICEA 4CCJA 4L5GA 2HKOA 3NKZA 3T8TA 4QPQA 3P50A 3AAAB 5LHIB 4GK0E 4JI3T 4OFZA 2HPLA 1K6OA 3PUVF 2HYFA 3LAPA 4HFEA 3J81K 1MDMB 1AKHA 2G9WA 3M9AA 4ZDLA 1P4WA 3OY9A 2M0CA 5HODA 2M8GX 2XQYA 4C2TA 2WWYA 1U8RA 4BGDA 1Z9CA 1JHFA 1HTJF 1Z05A 3VRAA 1IRZA 2LKSA 2ZMEA 3EQLF 3HSFA 2Z5UA 4A5XA 5C8YE 3BTLA 4DUYT 1RIOH 2LOSA 2EIMH 4XLNF 4X1YE 3TOAA 3KP7A 3TO6A 3K2AA 3F8MA 4DYRA 3AAFA 4GOUA 2XF6A 3E6BA 3ZPLA 2KXPB 3AAEB 3ZC0A 1LE8B 5AQQB 2B0LA 4AVPA 2HQ5A 4EATA 1WRDA 4JUYA 5H6QB 3AAIA 5ICFA 2I8DA 5HDKA 5JHUA 3SEZA 5CQGA 3ZC1A 4NXNT 3M1EA 2D5VA 3CP2A 1ZG5A 5AIQA 1LUJB 3HR0A 1FPQA 4PGHA 4R1HA 4CZCA 1J59A 2V8SV 4DZPA 3TKLB 3O2PE 1WFXA 1V54H 2HYJA 4QXCB 1SANA 1QSDA 3J80Z 2A6EF 1I1GA 1FLIA 1E17A 2LKXA 4KISA 2K9MA 3E22E 4YHJA 3L2QA 5E8IA 3K1SA 2V6EA 3CQGB 1I27A 2FU4A 2NW9A 2DL1A 1W0AA 2IHR1 3ZRGA 2MH2A 2A07F 2VN2A 1LEBA 2G0EA 2CW8A 5GAGJ 5JVDE 4GYRA 2D1VA 1TWCJ 1TNTA 4Y4RA 4ZYHA 2ME0A 5D6EA 1J75A 3QRFF 5LD2C 2DYSH 1KEYA 3PUWF 3U3IA 1RR7A 4OMYA 4IDZA 3PNTA 3M7GA 3QPHA 5FVLA 3GFLA 1TBXA 4IHXA 3QP6A 1ZRDA 3E6DA 4C90A 2DFEA 3HG9A 3ZMTA 2EH3A 2L4MA 3PUFA 1VTNC 2EHOA 4PGGA 1X1CA 3A0BC 2XQAA 2RQPA 1Z67A 3LMMA 2M8EA 3FBNB 4Q48A 5E3LA 1CF7B 1SHZC 1VQ9I 2NNYA 5D4RA 4AISA 2X9YA 2KT0A 2K5CA 2DMQA 2JQ7A 4DV4T 4D1QA 4ZI2D 1MBFA 2K86A 2E2AA 3MKWB 2CE7A 2XB0X 4ZYAA 4S0HB 4IHSA 1VQMI 3P4WA 4G7OF 2R7OA 1ETWA 2M30A 3CJNA 3HBLA 3ABUA 1Y8RB 2ZO4A 2FX0A 4HA8A 2CXFA 4EGWA 2SPCA 3AE3A 2M6BA 1ZLJA 2WA0A 2XPWA 3OR1C 4R8HA 1G3SA 2RA1A 3HOYJ 1UHSA 2JA2A 4H9OC 3CMMA 1V55H 5FRNA 1B1BA 1S6LA 3S1NJ 3M8EA 4A3BJ 2X6OA 1HA8A 1DU6A 3ZMUA 2R7XA 4BQAA 2PFBA 1HSJA 3I64A 4ZHQE 1WKMA 5L47A 1D0ZA 3BJAA 3BTJA 2P5VA 2F5VA 3TLVA 3ZLIA 2OTLI 3GUDA 4U33A 2FNAA 4ZI3C 2PI0A 1PVEA 1YHQI 4AQYT 2ODVA 1GQEA 4CXXA 3H37A 4BHCA 3JRDA 4O4HE 3CJTB 2PMHA 3FXJA 4HX8A 3LSPA 2LG4A 3EYIA 3FXRA 2VOOA 1HG5A 2HWVA 2R92J 2LRLA 1UCUA 4JI8T 2VB6A 3GZ6A 2H6CA 4IZZA 4XBFA 5FNVE 3BG5A 3LBXB 2A69F 2W4SA 4IJAA 5HLIA 5LGNA 3JAFA 4I55E 3ZN1B 2RDPA 1A6QA 4BAYB 2CEAA 4DV2T 1RKWA 2N1GA 2QSHX 1TT0A 3G6EI 2LFBA 3QPSA 5AQNB 3N9LA 4H9PC 4EJOA 1H88C 1B6AA 3LBXA 1IRXA 4WK8F 1DGWY 2D1HA 2EFNA 2A05A 1Q1VA 2FSWA 2JZYA 3N9QA 1XCBA 1U5TA 3AG1H 1ZG1A 5HYAA 2KRCA 1JGSA 2FJBA 1F5TA 4CHUA 1HQCA 1E3HA 3I59B 3I56I 3HKDE 2HH7A 5HWYA 2M4KA 4KN7X 2HVRA 5KX5E 1N33T 3E1SA 4I99C 1MMNA 2FA5A 1W09A 4ASNA 3CF5F 1O7LA 3N9PA 2XRLA 3J7YJ 2OTJI 4A6EA 3J7AY 3EHZA 3BQZA 5DJQC 1G3TA 2PEXA 2BBJA 3C4XA 1XNQT 1RNLA 5DM7F 1N32T 2WY7Q 3UU8A 1XZYA 4ZI3D 4XOPA 2EIKH 2MABA 4IHWA 1DDNA 2HN2A 3CWZB 3F8NA 3HL6A 5EK4A 1HNZT 3QODA 1Z0PA 4HFDA 2DMPA 3BY6A 4QIWN 4XAXB 2BGCA 3B73A 1P7JA 3J81Z 3K3QC 1LB2A 2H3RA 2YU1A 3UU4A 2H94A 3EVYA 1EH8A 2DYRH 1ZP0A 2Y0MA 3JTHA 1XD7A 4Y33A 4B48A 5JFRA 1PDNC 2WDRA 3FBIB 3AE4A 2IGNA 2CHNA 3JW4A 4A3FJ 2OC6A 3OIOA 5GAHJ 3CIRA 3L1PA 4CN6A 3RI5A 3R0JA 5LBQA 1R22A 1SVOA 4AVZA 1OEDC 3W15B 1B8IA 2YR2A 1HXDA 2ID3A 1Z7LA 3AG4H 1ZRFA 3SHFA 2ID6A 1XTAA 2H8WA 2WBMA 1WJEA 4A5NA 2XAFA 1HX8A 2AXLA 2CU7A 4EQQA 5DUIA 2HN1A 4H63V 4GRIA 2IRFG 2DCFA 3MZHA 4O4IE 4O2BE 3CX7B 3KE2A 3D5LA 1X1AA 3DU6A 1P7IA 1MMSA 3OYFA 4I76A 2MG4A 4AI6A 2ZNZA 3C64A 3S2WA 2LRDA 2LY9A 4XN0A 4EGZA 4IE5A 1B7TA 1JNZA 3S3NA 5FKYA 3I0TA 2WS3A 1B4AA 1VI0A 1XMQT 1TT5B 5JVTA 2CXDA 5AFUL 3OV8A 4NUVA 2W57A 2FRHA 3PJAJ 5CFBA 1FBSA 1MNDA 3QU6A 3CX6B 2NNNA 5KVRA 3B6CA 4YFKF 2JA6J 2UUCT 3DP7A 5JDMA 2IEKA 1RC9A 2X6XA 5E79C 1FSHA 1YW0A 4WW0A 3FF5A 5D5XB 3H1CA 1UCRA 5IPAA 1O3QA 1HCRA 3KVBA 5E18F 2X85A 4ZEYA 2YU9J 2Q8KA 2VODA 3B02A 1A35A 1Z7UA 3DBLB 4CICA 3K70D 5CLSA 4E7ZA 3S3MA 2L3LA 1BR4A 6PAXA 3GTGJ 2FF4A 4JBWF 1ON2A 4Z91A 5ABEA 2XSDC 1WRJA 2EA4A 1QHHD 2CQ7A 2K9LA 2OZ6A 4HYEA 3HKZN 2CV1A 2ACXA 3IA3A 4J2CA 5ILVA 4F8HA 5JR3A 1YX5A 1OCPA 4HQEA 1IV6A 2XGXA 3F8FA 1BR2A 2M7BA 1D0YA 2XASB 3HKEE 2EV5A 1WJBA 2W62A 1T72A 3NRYA 5K7HA 2CXLA 2PMZA 1T2KA 3RKWA 4D9JA 1XGSA 4DYQA 3UTKA 3QNUA 4RBOA 4H9QC 4C3JJ 1R58A 2XQ9A 5ABHA 4MFDA 4XRMA 2R5ZA 1U0JA 3CC4I 4ZZBA 4D7MA 4XKBA 3JRBA 3RIFA 3AA1B 2E1NA 2FJEA 2XAFB 4LFCT 3NQOA 4FI5A 4YIRX 3M3ZB 4IKFA 4JYAT 4KITB 3ZT6A 2FJAA 3U1DA 2QUFA 1IC8A 3B5MA 3NWTA 4HFIA 1H9TA 5DV5A 3RIUC 3GTLJ 2V5CA 3Q5DA 1T7SA 3C2GA 3HOXJ 3H3ZA 3RDIA 5J0ZA 1MJ9A 4AC0A 3C51A 4IRHA 3WTVC 3FXUA 2HVSA 3ZMDA 3K4KA 2O9LA 2YK0A 3RJPA 2W24A 2FBWA 3AL0B 1TP4A 4EVIA 2XM2A 5EZYE 4IHTA 2LK2A 2D2WA 4MTEA 1E3PA 2IJLA 3GO5A 4M9SA 3FBZA 5F6FA 4QTRA 2PBIA 5LFAA 1GDTA 2X68A 5CA0E 3Q5XA 3NVOA 3ZEFB 1JT0A 3N97A 2AE9A 2LM9A 1BC7C 3BQIA 1XDUA 4EM1A 4XLPF 1RUNA 4EYUA 1IJ6A 2GQQA 2EFPA 1ZAOA 1BA5A 2EHOD 1BC8C 3KX2A 5KCMA 3TL4X 1IDYA 4KHZF 1LVAA 2QQ9A 4KT5C 4KBMB 5D6FA 2X9WA 4DUZT 2KIMA 4FISA 2FMLA 3LA3A 1BW6A 2DLRA 2L5QA 1MMDA 1AU7A 1T98A 3LQRA 2LT3A 5H20A 5A2QZ 1UX5A 3A4CA 2B9SA 2JJ9A 5HEGA 2L9SA 3REOA 4P9UA 1OJLA 1FMVA 2XZEA 2LY1A 4RLQA 5GTHC 5DD8A 5CVUA 5HLHA 3VYRB 1ZR4A 2EV0A 1DU0A 5KDMC 3KYLA 1SFEA 3GN5B 3QUJA 4TX5A 4KUMA 2BS3A 2FUG2 3W6VA 5EF6A 2E5LT 4ZDPA 1Z1DA 5M5YJ 3LK3B 4KI0F 5LHHB 3IAM2 2K7LA 4ZS3A 1SD5A 2KIFA 4F92B 4CYCB 5AQJB 2NS0A 4UVBA 3OYMA 1MD0A 4LF5T 5FLXK 2VXZA 3S4UA 1WI9A 1BI0A 2VONA 1G59A 3N9MA 2ICWG 5FKKA 5AQOB 5DUKA 2LP0A 3DPUA 5LLQA 1S29A 4E7JA 4YHHT 2K02A 3OYHA 2DFHA 2OA4A 2IUBA 4BL0B 1IDZA 2JT1A 3V4GA 4N4OB 2KINB 4YTNA 3MWMA 2RNGA 3K10A 4QWQA 3VYUB 2IW5A 5E3NA 2A9UA 1QVTA 4DIDB 1FEXA 4QSHA 2AXDS 3ZP5A 4BJNA 3QOFA 2WV0A 3N9NA 4JP0A 5EEGA 2WAEA 5TISC 3KFWX 4BU2A 3BJOA 3I0QA 5LG4A 2HVQA 1V5FA 3AECA 1KQ9A 2NS7A 5F27A 2BG9B 2MA3A 3E7LA 3IAS2 2R5YA 1OISA 4IL4A 1DPUA 3Q9SA 3SZTA 2E71A 3RF1A 1KYZA 2FOKA 3HRSA 3K0LA 4QWNB 3TKYA 4BYYA 5L3CA 2JQQA 4COFA 3F8BA 1JGGA 2GOMA 2P0WA 2X9XA 1VQNI 3VODA 3P4RA 4MFRA 1Y56A 3EDUA 4HWHA 2IGKA 4U7BA 2VXDA 1QPIA 1I94T 5FXXA 1P9QC 3CCSI 4HV6A 4TWHA 5ILSA 3OMYA 1W36C 2R7WA 2DMUA 1O7FA 5FY0A 2YU2A 2KSRA 3SFDA 3BJ6A 4XR6A 4GDFA 2Z6EA 2XM1A 4JI6T 2R7QA 2ZXHA 1K61A 2E8IA 4HLYA 3QYEA 2G7UA 1TZLA 5FLMJ 4E7IA 1WI3A 3KLOA 3CDIA 2STWA 4CCNA 3GFIA 4H9NC 4E7KA 2NOGA 3WTZA 2NTYA 2P9BA 2XRNA 4RGRA 3WGGA 1XMKA 1I6HJ 3P9IA 5B1BH 1JT6A 1Z8UA 2P81A 2XQ3A 5HS9A 3ONQA 1WCRA 1HW2A 2L2OA 5F1RA 3RYCE 4CCOA 2YEVC 2HQRA 3ZYLA 2LTPA 2K9QA 1O57A 3PM1A 4WXHA 2VKJA 3CX8B 2HTJA 3CQCB 1IG7A 5FVKA 3T8OA 2JSPA 4KMFA 3KP2A 4JX5A 2DFFA 2M9HA 2LSGA 2F6CA 5IYCJ 3ANWA 4DV5T 1SMYF 1HW5A 5J2UE 4A98A 1RKTA 5AQUB 2F2EA 4BKXA 2IDOB 3M1CA 2K9AA 5B5EC 2ZXIA 4UUVA 3HRMA 1KA8A 1D5VA 1TQMA 2RP4A 5HLGA 4ZI2C 2NTXA 1OQYA 3S8PA 4HRIA 4WYVA 1R36A 3AG2H 4GXOA 2MOZA 2LOOA 4II2A 2V7LA 3NRVA 3OS1A 3VPRA 2HU9A 4JOMA 3BR6A 4I02A 2V9PA 4P55A 2DK8A 2O5RA 2EFOA 1YO5C 1NAFA 2ESHA 5ICCA 2MPKA 3BPXA 4UVCA 3F31A 5AQKB 4QPOA 3CMLA 3OS0A 3AVRA 1GLNA 5EGOA 4ZH4F 2W61A 2LLKA 3SFZA 3F23A 3K70C 5C4XJ 1JTYA 2J5PA 4XLFA 4AUXA 2R5ZB 5FFZA 1FT9A 2IVMA 1ZGWA 1ZGJA 3HTSB 2KNDA 2PLYA 2CBJA 5DYMA 4NUUA 4QH5A 4P1WA 1JXSA 2AXTC 2VQLA 1X1DA 3I4PA 1T0FA 3HOZJ 2TCTA 4A0XA 2XSJC 1RUOA 3MQ0A 1H7CA 2E1CA 4ABZA 1ZK8A 1SFXA 1QUUA 2JVGA 3ZQQA 1IXCA 2VVNA 2V26A 4LFBT 2XQ5A 3F8CA 2P4WA 1VOMA 2VL0A 2IXSA 3Q0WA 4EJTA 1D8JA 2W48A 3I71A 2GXAA 4OAZA 1S7AA 3CCQI 1IV8A 1KU9A 1REPC 3JRIA 3UULA 1ZARA 4I09A 2EJRA 2VQHA 1T8IA 1EA3A 2VJ4A 3M65A 1ZHFA 3OYXA 4LITA 2OV7A 2BY1A 3EUKL 4PUSA 1GXPA 2UXXA 3L8RA 3HM5A 3IP4B 3UU3A 4LF6T 3AG3H 3GTOJ 3V5UA 1HFAA 3HJEA 3CF2A 3MZ8A 1UZCA 2NR4A 4TWDA 1YIOA 2JRMA 4BBRJ 2FBIA 2RN7A 2BHYA 3SFEA 4HAMA 1DU2A 2QEXI 1XSDA 2C5JA 3CCRI 4HX7A 1UB9A 2O3FA 2FBHA 3RI4A 3OS2A 2Y31A 2Y69H 2WQYA 4IE4A 4CUGA 4DR3T 2VPRA 2KZ7B 5H6RA 5FXZA 3QAHA 4CCKA 1LDDA 3WI3A 3GX4X 2XAHB 3IC7A 1UMQA 4ESJA 2WBLA 5LB7B 2PTFA 5CA1E 4M9XA 2KLQA 1YW7A 1X1PA 1I6XA 2XB5A 3O8HA 2V7MA 3HC7A 3X2QH 3MAJA 2CO5A 2MC4A 1QZEA 1W5CC 2OAZA 4HSTA 2H6BA 3M8JA 4UXNB 2QENA 2HDCA 4G8XA 3F0CA 1LFBA 4PDKA 1U78A 2QBYB 2R3SA 4OIPF 1ETYA 4PW8A 5EK3A 2MBGA 3C18A 3H36A 4IVNA 5L2LA 2QQBA 1OCCH 4UB8C 4G12A 1FIAA 1EV7A 4UV9A 1XN7A 2DA2A 4II3A 1LFPA 1LNWA 3WU1B 1S94A 4CZZB 2QVAA 3M8FA 4C2UA 3HHGA 2MH9A 1O4XA 2VQGA 2M7AA 4AQFC 3RKQA 4KMUX 1B9MA 3PIPF 2NWBA 4I98B 1MIVA 2DW4A 4E6KG 5FL0A 4HE8A 1J5WA 3QOEA 3ZCIA 4ON0A 1KF6A 3Q9VA 4GYGA 3PUSA 2V5DA 3AE9A 2EHOB 5GAEJ 2X51A 4NQWA 3OSFA 3K69A 1TWAJ 5FMNA 4NUBA 5FO5A 5DS9A 2PG8A 2KLOA 3FZHB 4BXXJ 3S32A 2F4VT 3H0DA 1HS7A 3S93A 1KNZA 3MCZA 2IAIA 3HKZA 1IUYA 3FXLA 2UXXB 3SZPA 3BPVA 3MZYA 1ZH5A 2DLLA 2V79A 3IWFA 2E9XC 4RAZA 3OYGA 1UX4A 3NZQA 3CUQC 2LDUA 4UNOA 2BXZA 3E08A 1M62A 3EDPA 3O8GA 4UUTA 4H9RC 3G1OA 4DYCA 5KHDA 4UF0A 1R4NB 1JJ6C 2VUMJ 1APLC 2R0QC 5AQRB 1R1VA 2PMZN 1X58A 3GW2A 1YI2I 1PUFA 4FTHA 1BL0A 4B3TT 5L3DB 4RB0A 4GKKT 1VCSA 2UXDT 1SA0E 2X0HA 4MEYF 2WSSV 1MMAA 1EH6A 1W1WE 1VQLI 2BXYA 2Q2EB 3QC9A 5AQLB 3RIUA 5IOZA 3AE5A 4KHPT 2V9KA 2IC9A 3GWZA 2BKNA 1AA7A 2EK5A 4CCLA 1L3LA 1YYVA 2UUAT 1WJFA 3OSGA 4UHTA 2A3DA 3KP5A 3FBLA 4AQGA 1U8BA 4XRSG 3PUYF 3GF2A 5LMNT 5KK1A 2DAOA 2YS9A 4FX4A 2XAQB 1OLTA 1R8IA 4PK4A 3UUMA 2VQET 4UV9B 2CLYC 4EV6A 2MBFA 5L3FB 2DJNA 3WG7H 4IO9F 4E7HA 2XC7A 3KINB 3CESA 4G7ZF 1S35A 5DQWA 1FBQA 4U3CA 4EEDA 1OPCA 1J5YA 1YX3A 3B6AA 5DCMA 1QGPA 4A3EJ 3H5NA 1GUUA 5EYRA 2J47A 4A3JJ 4ZS2A 5HCMA 3CLQA 3ZCJA 3ZMSB 3K1NA 3PDYA 1F36A 4JI4T 2VJJA 2OU2A 2WY2A 1IN8A 5LHHA 2OV9A 3CPZA 1T8BA 3KV6A 5AQTB 1D1BA 2FE3A 2XHKA 3ZQHA 2DMNA 3V8LA 3BCBA 1E7PA 2HPJA 1I3AA 2JTVA 3RQUA 1ZELA 3CVRA 2X6WA 2DJIA 2DK5A 3KZIC 4JI7T 1ZRCA 4L9TA 1ERDA 3DPLC 2CJJA 1BM9A 2P7VB 1SD4A 5K7FA 5LGTB 2L3DA 3LWFA 1Z21A 2W25A 4FETA 2P5LC 2D0UA 2XY8B 5LNKA 3GZNB 4JI1T 1BIAA 1BR0A 3AE7A 3BR0A 5ABFA 1MBJA 3W2VA 1FMWA 1WWXA 2E2HJ 2KP6A 4UUSA 4ISTA 2HHHT 1KYWA 2L9VA 1X79A 3ZMZA 2DT5A 2Y9YA 4NB5A 1MDMA 1AKHB 5AQHB 5AIPA 3OYZA 4DIQA 2LOPA 2X9HA 2WC2A 1HSTA 2IGOA 3G06A 4EZ4A 2PX9A 5JDLA 2DOEA 2OJED 4HV5A 1N77A 5IT9K 5LMUT 3T1YT 2E9XD 4NIQA 3ZT7A 4A3IJ 5LEJA 1U5PA 5J1GA 4IE7A 2W1OA 1HKQA 2X1EA 4HW0A 3VDXA 1Y0UA 4KDPA 2CGPA 2E36A 1HCIA 3PUXF 2X0YA 2E60A 1R5GA 4MTDA 2W82A 3D5RC 4AM3A 3ABKH 5M3FJ 5JREA 2QBYA 2NRAC 2XQ8A 4FT8A 4MLKA 2O8XA 3WHCA 5LBMA 3Q5FA 4NC7A 2RNJA 4AIJA 1F9NA 4V19K 3JAEA 2CUJA 3SRZA 2HGCA 2WAQA 1WHUA 2LVSA 4JX4A 3MFKA 2VL8A 4B8XA 1IN7A 3SWHA 1ON1A 3ZMSA 4PK5A 3ZYMA 4NNJA 2ZM0A 4GK5E 2QKMB 2D45A 4MQVA 2V1UA 1X9BA 3AEDA 5GTIC 2CMRA 2C6YA 1UHWA 2ZCWA 4AIHA 4EIWA 1OKRA 3CUOA 2WMNA 4X62T 3HHHA 2ZJQF 1LE8A 3VYTB 3HPGA 2CSOA 1B59A 2UZKA 2X1DA 4CCMA 4DMVA 1P6RA 3L09A 1ZYRF 4UVBB 2KJCA 3A7MA 1YS7A 4G6TB 3J7ZI 3ZSSA 1WSUA 1N34T 4XL9A 1S5LC 3PE0A 1YQ4A 2L4AA 1TQPA 4P0AA 3CJRB 2E9XB 2F5FA 3FK7A 3JCUC 2NVTJ 3TP0A 2NOXA 1ZOYA 1NK2P 3RQWA 5ABFB 5FL1A 1ZG3A 3LA2A 4DW6A 3JC6C 1K78B 1BI2A 4A0YA 2JJ7A 3HSEA 3H9QA 3NWSA 4BJ6C 1P4AA 3CMAI 3BTCA 1K7AA 4RS8A 4C91A 5JDNA 3BZKA 3PUBA 4U72A 4HF2A 2CWOA 2UU9T 1JTXA 2DNXA 4HOBA 5F04A 4S04A 3WTXC 1VZ0A 3F22A 2RPAA 1BIBA 1QZZA 3GFJA 3OWTA 1YG2A 3TGNA 2V7JA 2E35A 4UVCB 3V7RA 4N4NB 2VE8A 5AONA 2LYCA 4W97A 1CUNA 2ES0A 2CYYA 2IAKA 4UV8B 3D0SA 3COAC 1K83J 4PCQA 2GA2A 1IJWC 2K4BA 3PUQA 3JADA 1YRNB 3GA8A 3G1MA 3E5XA 4RAFA 3IKTA 1RRJA 2IS1A 5CQEA 2CUFA 2V9VA 4X1KE 1SAUA 1E2AA 2W84A 2P6TA 2H27A 3SYTA 3BG7A 1HF8A 3TLSA 4XSZF 1OFCX 4B6XA 1Y1WJ 1DGRM 2EB7A 4CA0A 3WG9A 2L8KA 2XDVA 4HZFA 2RV8A 3SEQA 4ZYDA 2KFDA 3I4NJ 3R0AA 2OLTA 3NEUA 4H4KC 1AOYA 3CO6C 4G7HF 3UU6A 3QU3A 2EFQA 2Z99A 1T6SA 2O61A 4B4CA 1S7OA 4IHYA 1FWZA 3ZJ2A 5ADXL 5DABA 3BLYA 4G2AA 2OQGA 1SUMB 3UR3C 2P6SA 2VURA 2NP9A 4UEMA 3AEAA 5AQSB 3FXMA 4G9YA 1Y8QB 3P9KA 4CH7A 3GTJJ 3PURA 3PFYA 3QK6A 4LMLA 4ZXLA 4DVDA 3LSGA 2CPTA 1R1UA 4NBQA 4YELA 2O8KA 3PQKA 1YOVB 2X6YA 4RA2A 1XS9A 5KNLA 1S7EA 1W0UA 3WAJA 2RGVA 3X1DA 5HWXA 1D5YA 1X3WB 2FXAA 3H3UA 3NWIA 1WZ2A 1HG2A 3MMYB 3ULQB 4MO7A 5HLTA 1VQ8I 2XSAA 4MALA 4MFEA 3PU8A 3IUOA 2XASA 1MJAA 3ZMZB 5L3GB 1YE9A 4MLOA 3AA0B 5J2TE 3L2CA 3OVUA 2MYSA 4ZZDA 3T1BA 2VOPA 2ZMAA 3JRGA 2EBIA 2VT2A 3CDHA 3Q0VA 2ZJPF 2GA1A 4KIGA 3DV8A 4KT6A 4AYBN 4RDUA 3G1LA 3KEOA 1ZKGA 3G4SI 2KWIB 4JI5T 4N9IA 2HKXA 2JPFA 2VT3A 4BE1A 3ABMH 3C4ZA 2W7NA 4IQ4A 2LKHA 4NHJA 3JRAA 1KGSA 2MW8A 3M4OJ 3K4BA 4PFPA 3SDGA 1JNRA 2KJBA 1DUXC 4XM3A 4EYYR 5JDHA 1QRYA 1X3ZB 4KFCA 2DI4A 3K4MA 4XKCA 5ICGA 1NTCA 3GCMA 5LEKA 4O3MA 5HEHA 4FX0A 1K4TA 3KPHA 2EWNA 3KYCB 4BXFA 5DM6F 3MVPA 4HEA2 3ZOBA 1OYYA 3OIPA 1JKOC 4V2FA 3T5XA 1KNPA 2BVLA 2YSRA 3F21A 1VFCA 1EF4A 2MLGA 1OWAA 3LK42 4ESBA 1K4SA 1USSA 2BVMA 1W7PB 3BROA 5J40A 2KHMA 2RVCA 2D2SA 3LSVA 4WZXA 2ZMEC 2AHQA 4QLCU 3W6JB 2K9SA 3ZQCA 5B3SH 4M3FA 4OIOF 2VIXA 2JRTA 5IYBJ 3DKYA 3J80K 4DO0A 2LKPA 3DLAA 3AE1A 4N9HA 2IA2A 1R71A 2NAZA 3CQZJ 1FEWA 1ZTRA 3DBRB 2LEHA 4S05A 3LSRA 2BG9C 2K3PA 2V7IA 4IDNA 3RKOA 5IUXA 2L7KA 2XGCA 1XMXA 4ZDOA 3IKVA 2OUMA 1HNXT 1W4MA 4BQNA 3EABA 3RYFE 5D5VB 4L9VA 2DI3A 5L3EA 1ODDA 2H8RA 2LM2A 4C3IJ 2W63A 2YKSA 4FJOA 4U74A 3WAKA 3OL3A 4RM2A 3PSFA 3BR2A 4L5JA 1SAXA 2OF7A 4DOZA 1YJNI 1BOAA 4R79A 3KP3A 2EA2A 1SFOJ 3VFZA 2XPUA 3LAJA 1FYMA 1YJWI 4LLGF 4YIFA 5LA6E 1R7JA 2GOXB 4XLHA 3ZQFA 5L3GA 5C2TA 3BZCA 2DQRA 4GO1A 1ETOA 5GADJ 3S14J 1IGNA 4L0RA 5IYDJ 3GMIA 2XGDA 2XV4S 4IRGA 2VC0A 4DBRA 1SE7A 3GTPJ 2R6GF 3AEGA 1YKHB 1MH3A 1PP8F 2NVUB 3Q0UA 3KEQA 4KA4A 4HTEA 4ASKA 3Q5EA 3B13A 2O7OA 4U0VA 4B1RA 2E5VA 2OZUA 4PSXA 5FKNA 1A36A 2TDXA 2KZVA 2FD5A 4UXNA 5D8KB 5EEHA 1YS6A 2PQ8A 5FROA 2UXCT 2L01A 4UVAA 3BQLA 2ELKA 3AXJB 1FP2A 1TW3A 4ZTFA 2GK9A 3LSJA 3FXKA 3IRQA 2NVYJ 2LE8A 1ONVA 2WCAA 2WB5A 4J19A 4M73A 1M7KA 1FJLA 4AU7A 4DV7T 3AXJA 2VWAA 4HFCA 1ZLKA 4BDZA 5HS8A 1SC7A 2A72A 1WH5A 5BNGA 4ILCA 4Y17A 2XQ7A 1RPWA 4IDPA 3RRWA 3FISA 3CCJI 3H0GJ 1IBKT 2EZHA 5DCFA 3V7CA 3UFEA 3PUGA 2VKOA 4G6QA 2F4OB 2KKOA 1XG1A 3C1DA 2L54A 1YRNA 2A6HF 4JQFA 4WCGA 2PJRA 1Z0XA 2CWEA 5LJMA 3W3CA 2XAGB 1FX7A 2W85A 2DA4A 3HGGA 2IMLA 1KFYA 3E6MA 2WP9A 4A6DA 4OIRF 1TWGJ 2LD5A 1OYWA 2W0GA 2PFVA 4YG2F 1OEDE 3EAMA 4GYIA 5EEAA 1O3SA 3ZPOA 2PJQA 1XCVA 4XRFA 4XNFA 2ECBA 4DBQA 1YW9A 2DTRA 1Y1VJ 1IF1A 2JA8J 3P8CD 3VU7H 2ZM6T 5L3BA 4CI1B 3EYYA 4KUMB 2WDVA 1R1TA 4GGGA 1U3EM 4M6XA 4AD9A 3O3KA 1FC3A 4M3GA 3UQ4A 3TEDA 3ZXSA 1Z77A 3DKWA 3OYEA 1QPMA 4WNKA 4ZOLE 2R7FA 4XN3A 3MD2A 3SQNA 2E2IJ 1X2NA 1ZV4X 2ACZA 5LGUA 1KK7A 3TLUA 1WGXA 2BY0A 3A03A 1BI3A 4DQ2A 5F5WA 2DT7B 4X0GA 4L18B 2JWTA 4PJ0C 3MACA 4NXMT 2OCCH 3WU2C 1FOWA 3TW7A 5F0HA 5LRSA 4TN7B 5LOVE 1AHDP 1E0EA 1TWFJ 2LF8A 5E20A 5AQVB 2EV6A 4LB6B 2B1EA 2E1MB 2X66A 3H3AA 2QWWA 2K9NA 4YIIA 1P2FA 2ZXJA 3DTKA 4IIJE 5ABGA 1UJ8A 3PO3J 2RAEA 2CLYB 2DMTA 2R7ZJ 3SS1A 4U88A 3BOQA 5FXVA 3JAMK 2GBYA 3U78A 1K6YA 2H89A 3W6KB 3A8YC 2HXIA 1VF9A 4XSXF 2BDEA 1LEAA 2ESNA 2M0MA 1OXZA 2W67A 1XX5A 1KQ8A 1ENHA 3FK6A 4B47A 2LLYA 1O3TA 3OYIA 4X6AJ 2BV6A 5KAFC 5EK2A 4C30A 1OCOH 4L9IA 4UVAB 4BJMA 1TLHB 5BPDA 4M9ZA 2VKEA 3CCYA 2MD0A 1ZR2A 1T39A 4HWDA 4XICA 3IHRA 2CQXA 3U2RA 2PMUA 3ASNH 3RQ4A 1W36D 2KRHA 1G73A 2BHZA 2BKPA 4B43A 1W7PA 3AE2A 5BS6A 1QQIA 4M71A 2K48A 1FJGT 4DR4T 2QQAA 1VQ4I 3H35A 3BZ6A 2STTA 1OR7A 3ERED 4L0ZB 1S9HA 2WTEA 3L9FA 3RZOJ 2XIGA 2JMKA 1D1CA 4BH9A 3EI0A 5F0FA 2GXGA 3TOBA 5C3JA 1OEDA 1R6RA 2Z1DA
chains in the Genus database with same CATH topology
2NW8A 1R00A 1LQ1A 2Q9QA 3HOSA 3I0OA 2UXNB 1LDJA 1DP7P 4PAGA 3LQQA 1SD7A 4EOZB 4D0PA 5ERIA 4HFVA 4TV8E 2H7VC 3FHZA 3H92A 3HKCE 5FY7A 1KU7A 5D5UB 2YU3A 2VASA 1U5TB 3R61A 4CO8A 3O1JA 2YINA 5DD4A 1I5ZA 1Z6TA 3BWGA 3O6BB 3WE2A 4HLXA 4PJJA 5IYZE 4U0YA 3DPTA 5K5OA 4CXFA 1IZ1A 1Q1HA 4CDGA 3EUHA 2DU9A 1WLXA 3E5UA 2CWYA 4I0AA 1U5TC 4DNCA 1J7KA 5K5QA 4O8SA 5BMVE 4WF2A 2ZM2A 3HRUA 4HDUA 3JSPA 2HR3A 2DPUA 4KYWA 3LK2B 5DQVA 3FX3A 3EDVA 1I1SA 5BMZA 3RTRA 3O9XA 1WYCA 3HI2A 1XSVA 4IE6A 2HQNA 1YD8G 3F6OA 2PG4A 5FLXZ 2GAUA 3N2OA 3WGIA 3GYHX 5JR9A 1R5HA 3KVAA 3BK9A 4MGRA 2DQLA 2YX4A 5HOOA 4CI3B 2DWGA 1IAPA 4M1PA 2XAGA 4QKNA 2Q0OA 3CTAA 2LJLA 5LGTA 5LYJE 1S3JA 4Z8XA 4IE0A 3RYHE 1CF7A 4RAYA 3QOPA 4Y13A 1MIWA 2HFHA 3V8KA 1HKTA 4ISSA 5E17F 4RGSA 4LK0F 4X20E 3VKHA 1RI7A 1GXQA 3N4MA 4KP3C 1KU2A 5J8CA 4CZZA 1U4QA 3RH3A 2KT9A 2V7KA 4MEXF 3ZMTB 5BPIA 4H9SE 1IAWA 2EHOC 3LJCA 2M87A 1E1HB 2I59A 3IRRA 1TNSA 4ANJA 4AKLA 1XGNA 5A2QK 1FIOA 2MC3A 5H6RB 1WR6A 5E0OA 1EZ3A 2CW0F 1FOKA 2HYGD 3E5QA 2F5EA 1H9GA 3JSOA 4F6RC 4LLNA 3R60A 4HEAA 5FD6A 3I9WA 3IL2A 2M5WA 2Q9QB 3E6CC 5CYVA 3DXJF 2LSOA 4HF0A 3WU0A 4EV0A 3EETA 4TV7A 3J9X1 1IRFA 3U9GA 3MK7C 4AKHA 3O4XE 5CVIA 3ZMUB 2K4JA 2A5YB 2C5KT 5LHIA 5JDGA 4L0YB 5D4SA 2KMFA 3KZYA 3N2KE 2L02A 3G3ZA 1R23A 2HTSA 3T0YA 4L9JA 5LHGA 3FXQA 2XAQA 1LVFA 2COMA 1IW7F 3ZYKA 5FXWA 4B09A 2F5DA 1TQIA 2JSCA 4G94A 1YTYA 3WODF 2A61A 2HS5A 2LF7A 1D0XA 1G3WA 4EAHA 5JI6A 2XAJB 4CI2B 5HS7A 2E7XA 2IW5B 3IEEA 2A68F 1BBYA 1WQ2A 2W00A 4I7HA 3UUXB 4ADZA 3GWHA 2OQRA 5CJ9A 3WTTC 4YFXF 2BEOA 4ENNA 4ENJA 1QBJA 2LSYA 4IPAA 5GONE 1P92A 2ISYA 1YFHA 1KU3A 2HOEA 5HDGA 1BJAA 1FBUA 4EJWA 3J7Yq 1C0WA 4A0ZA 2BE5F 3I53A 4EXTA 5ETWA 3KDSE 4BHBA 4PJLA 1LVKA 3BDDA 3GEZA 4A56A 1MMGA 4CQIA 5M4YA 2LSKA 1P4XA 3VB2A 4PZJA 1X3UA 4LJZF 4AWXB 2ZLYA 1XSXA 4AIKA 3A5XA 5LGUB 5JQGE 3PFIA 2VBYA 4RGXA 3D0TA 3KBTA 2E7WA 3K1MA 3TQNA 2LHNA 4KIBA 2LSJA 3GZ5A 1TW2A 4QXHB 3ECHA 2QM3A 3SXYA 1J0RA 4LFUA 1OMIA 3HTUA 5A1LA 2M67A 2MD5A 5TJJA 5HVQC 4EGYA 5LCYA 2XAJA 4A12A 4BXUA 2O03A 2ISZA 4DMWA 1IN6A 4OK0A 4YLHA 5KMGP 4QX8B 2ELHA 2ZM8A 4EMSA 3I54A 5L3BB 3RKYA 2DPDA 4LD5A 3KLNA 3WTUC 2QGSA 3T8RA 3RYPA 2O6GE 3I1AA 2DO7A 3E97A 4P09A 4KNYA 3NRXA 3LFKA 2DBBA 3ANWB 2VK9A 5CVVA 3HRTA 3PQJA 1D3YA 2V1DB 2ZNYA 5LJNA 2IA0A 1FP1D 4OYKA 2M45A 3GVAA 3B57A 2YX7A 4N78D 2BZBA 4HX4A 1FYKA 2WMOA 4O2AE 3ONXA 2NYXA 5F8PA 3RKXA 3FM5A 1LKXA 3CUQB 2GXBA 5FB2A 3E3VA 3FB2A 4LLLA 3FM3A 4P96A 1XDSA 3PUAA 3OOPA 2HZTA 3F6VA 4ILUA 3C3WA 4YJ3E 2X0LB 2LSIA 4QHOA 3FZVA 1FYLA 2OD5A 1IN5A 3ABTA 1J9IA 3UT5E 4L5IA 2XTLA 2H7OA 3KETA 5L3CB 3LFMA 3KP6A 2VC1A 2FEZA 4JBAA 4AQFA 3LG7A 3O1HA 4UV8A 3W15B 1E2XA 5HXRA 3OJAA 4KN4X 3QP5A 3Q9DA 3ELKA 1DPRA 3HKBE 1QO0D 3R4KA 2ZJ2A 1V4RA 4MHGA 1TTYA 3ZJ1A 4K0UA 1FY7A 1XGMA 3ZN1A 3AB3B 3J7AO 1OYIA 1V9DA 1KQ0A 4TUYE 4ZI7E 2FNPA 4EJUA 4YJ2E 3Q5WA 2K27A 3MEXA 3F72A 1GVJA 4KICA 2Q9QD 3RPQA 2Y48A 1USTA 1BI1A 3JAMZ 3ISPA 1STZA 4HKAA 4G6DA 2Y48B 3GN5A 3HA4A 3MKDA 3KZZA 3O1IA 3CUQA 1UFMA 3KV4A 5HXCA 4AKIA 3F57A 1FZPB 2G0UA 3N5LA 2JRKA 1T38A 2X67A 2N9DA 1Z6RA 2MTQA 4JEHB 2QZ8A 4KIFA 3JC6D 3RX6A 3LA7A 3TDUC 3K3OA 3FHNA 2DWKA 1J2XA 1QNTA 5CVJA 4PNIA 4X1IE 5DEQA 5LP6E 4OYJA 5LBQB 3VOEA 2O0YA 3ESLA 5JRCA 2XUBA 5FYMA 3ZMVB 4AXPA 1AJ3A 1NHAA 2V1XA 1HW1A 5E1ZB 2PN6A 4HDVA 3NZPA 4IHJE 3RPUA 5JRCB 1VRBA 1MJBA 4HQMA 4N0BA 4EJVA 3DEUA 5FP3A 1W5TA 5CVRA 3TO7A 3PTRB 3ETUA 2XAHA 3R6SA 5LXTE 4JEUB 5BQTA 4ETSA 4PFOA 3K8PC 3GLXA 2F5CA 2JPBA 4WBNE 2AS5F 4P5OA 2FQ3A 2Q2EA 2ACJA 3KV9A 2PJPA 3TDZC 2VKHA 5LRRA 1JE8A 2C5IT 3WE3A 3N9OA 1W5SA 5F64A 5DDGA 2QYOA 2VE9A 2P5KA 3K1PA 1ZGAA 1O3RA 5D5WB 5L3FA 3IBPA 3QPTA 2P8TA 3WTYC 3KCCA 3C7JA 3DQVC 2GWRA 2KWHA 2FMYA 5DCMB 4ZYEA 2ZFWA 2QA7A 1XGOA 4EB6E 3WTSC 2Y6XA 4XBFB 3FXDB 3V8JA 4UELA 4OHFA 4RGUA 5JDFA 1W7PD 4V1Av 3I5UA 2NW7A 4FHTA 4JK1X 3HYIA 1RZ4A 5L3DA 4CXWA 2VBXA 3ECOA 4LG0A 4YFSA 1GHCA 5H6QA 1LDKB 5BOXA 4G63A 4Z2YA 4M72A 1SD6A 1NWMX 1ZHCA 4CYDA 1ZEEA 3GXOA 4I43B 3CO7C 3ZN0A 3JTGA 1QZYA 4I0BA 1L0OC 5ILUA 3N2GE 2UXNA 2WM9A 5J8FA 2OBPA 3HOTA 4OMZA 1V3FA 2WWUA 3UUNA 3DJBA 4HGAA