3EUHA

Crystal structure of the muke-mukf complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
315
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of a bacterial condensin complex reveal ATP-dependent disruption of intersubunit interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
total genus 121
structure length 315
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3euhA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3euhA02
3KP5A 1IRGA 4DQ2A 2RQPA 3MZYA 2VODA 4YFKF 3ZMZA 1UB9A 2AS5F 3V8LA 1HW1A 5CVJA 3CO7C 3DPTA 2HOEA 3ZQ7A 2GA1A 4CICA 4B09A 2Z3YA 2STTA 1G3SA 4OIQF 4AD9A 5J8FA 1I1SA 4N0BA 2OBPA 5D8LB 5DD4A 2H27A 4LLLA 3GLXA 1LQ1A 4EJTA 5CVIA 1QGPA 1MDMB 4L18B 1S3JA 4QWQA 2QYOA 2OD5A 2Z5UA 5L3GA 3R0JA 3ELKA 2FEZA 3IC7A 1XSVA 5HDNA 3JW4A 3RDIA 4WF2A 1Z9CA 4KICA 2DQRA 1U8RA 4KNYA 3EDPA 2DK8A 4A0XA 3ABUA 2ZJ2A 2VE9A 3D0SA 5K1YA 4QLCU 3BWGA 3FMRA 4HA8A 2UZKA 3C18A 4OIOF 1PUEE 4OIRF 2HKXA 1F9NA 3T5XA 4G7ZF 3I59B 3W6KB 1LDKB 4L9TA 1MZBA 1IN8A 2K4BA 1TTYA 1K78A 1O3QA 4RAZA 1G4DA 1IN4A 3TGNA 5L3DA 2W25A 5HLIA 2PQ8A 2VC0A 2HKOA 4GYIA 2KIFA 1YG2A 1HKTA 4RGUA 1R58A 1QPMA 3L00A 4U88A 1LEAA 1S7AA 4RB0A 1OYIA 3P9CA 3F3XA 2A68F 3ECHA 2P5KA 1HKQA 3GUDA 3HRUA 4ON0A 4WX9A 1BIAA 3H3ZA 2MLKA 1SMTA 4ETSA 1XDUA 4OINF 5LHHA 2L02A 1P4WA 2YX7A 1UHWA 4HBLA 2M1BA 4CGZA 2RNJA 3M7GA 3ISPA 1FNNA 4HYEA 1S29A 4GGGA 4M6XA 4LGWA 3BJ6A 1LNWA 3Q5FA 2CYYA 1Z7UA 2HQNA 2TDXA 3TKYA 2MLGA 1BI2A 5HS9A 2ZXJA 3KZZA 3R0AA 2FBKA 1W4MA 5DCMA 3KP4A 2YU3A 1LEBA 3LA2A 4U0VA 3BDDA 1U78A 5HOOA 2NRAC 2ETHA 2KIMA 5D8KB 4I98B 4I0AA 1XGOA 4KIBA 4DNCA 1OKRA 3F8FA 5HS7A 3NEUA 3QOPA 5CJ9A 1DP7P 2J5PA 1B4AA 2W85A 2ACJA 1MDMA 4M9ZA 2IVMA 1QQIA 2XAQA 3HYIA 2DK5A 3EUHA 2L3DA 2O61A 5FFZA 4L0YB 2ZNYA 4G6QA 1WKMA 4LB5A 1FBQA 4WXDA 5E1WA 3KLOA 4KIFA 1TNTA 1X3UA 4N9HA 2P5LC 3J80Z 3REOA 3V7RA 1B9NA 4LFUA 4ZYEA 3JTHA 1RI7A 2W84A 2EFNA 5AIPA 4MQ9F 2XROA 4LK1F 2VBXA 2G9WA 4MTDA 4EVIA 1EV7A 4WK8F 3P9KA 3JTGA 3IL2A 3TO6A 1EH6A 1KQ9A 1J7KA 3DXJF 2NNYA 3C7JA 1SAXA 1HSJA 1RUNA 5K5OA 4IPAA 2UXNA 3WODF 1R22A 3ZN1A 3I58A 2QWWA 1U5TC 3DP7A 1HW2A 3KE2A 3LWFA 3RKXA 4UUVA 1ZAOA 4LK0F 1MD0A 2QM3A 3RYPA 5BQTA 4RGSA 4LLGF 1U5TB 5D5VB 5D5WB 2QZ8A 1ONVA 3SZPA 2A61A 2V9VA 3K1PA 4AVPA 1KYWA 4I02A 3ULQB 2CG4A 2IA2A 3JSPA 1EH8A 3L9FA 1RZ4A 2ZCWA 4LG0A 2LNBA 1VTNC 1UCRA 3NQOA 2STWA 1J2XA 1A04A 4YIIA 3W6JB 4N9IA 1B9MA 3FM3A 1IF1A 5LEKA 4OIPF 1ZREA 3AAFA 1G3YA 2CWEA 5HS8A 1K79A 3GO5A 4YFXF 2VN2A 4P9FA 1IN5A 1LVAA 3BJAA 5JI6A 3QRFF 1RIOH 5HLHA 1ZRFA 1J5YA 1T2KA 4I01A 5DYMA 1ZG3A 1XD7A 2OZ6A 1KU7A 3BJOA 1K6OA 4ZZLA 4EGZA 2VE8A 2LKPA 2YSRA 2IW5A 4L0ZB 5A2QZ 2FBIA 5F6FA 5JVTA 1TNSA 4CO8A 1YFHA 2P5VA 1XB4A 2M8EA 5BPDA 2MD5A 3HHGA 3E3VA 3QPHA 2M30A 1L0OC 2OQGA 3P7NA 4P55A 1FY7A 2ADUA 3VB2A 3RI4A 3QU6A 3MFKA 3COAC 3VODA 3GYHX 1FOKA 1O7LA 4D0PA 3E5UA 2CQKA 4A0YA 3ZMDA 4M74A 4MNUA 4HF2A 2IA1A 4CZZA 4TV7A 2EB7A 3GFMA 2HFHA 4ENKA 2GAUA 3K1MA 4HV6A 2ZMEA 5FO5A 3ECOA 2HQRA 3T8RA 3L09A 5FD5A 2FBHA 1QNTA 1W7PD 1G3TA 4ZYHA 1R23A 4AIKA 5E20A 3LA3A 2FNAA 2FXAA 5BOXA 2O6GE 2XGXA 2PBIA 3I4PA 3ABTA 4ZYDA 1KQ8A 3V8JA 4R79A 3RYRA 4HDUA 5K5RA 1T6SA 4IRHA 3GVAA 2EV0A 5ICGA 4JQFA 3GFJA 3VFZA 3P9IA 4G8XA 2E7WA 2XASA 5LHIA 2WTEA 2YPRA 3T8TA 4Y13A 1TBXA 3WE3A 4Y17A 1T0FA 3BOQA 1BC7C 1OMIA 5A2QK 4OOIA 3HRSA 2Q2EA 1U5TA 3DKWA 4E70A 1R36A 1YS6A 4YG2F 3LAJA 3RKYA 1ZGAA 2FE3A 3K9TA 3MAJA 3E6BA 5D5XB 2H6BA 2VONA 2OU2A 4HV5A 5IT9Z 4HLXA 1SD7A 4Z2YA 4P5OA 4MQVA 4KA4A 1YTYA 1RUOA 3EQLF 3ZP5A 2OQRA 2PFBA 1JHHA 3K2ZA 2EFOA 3BP8A 3BPXA 2R7DA 2L01A 3QPTA 4YFNF 3JAMZ 3FHZA 1NHAA 1FSEA 3FMQA 1IRFA 1WI9A 2JTVA 3N4MA 4ZYGA 2O3FA 2K4JA 2L54A 4RS8A 2DFIA 2EJRA 1MJ9A 4CXFA 2HZTA 3SQNA 2QVOA 3OOPA 2YR2A 5L3CA 3I0TA 5CVVA 1KU2A 5EEHA 4CYDA 2DQLA 5D4SA 4R1HA 3F21A 3WTTC 3V7SA 2W24A 4BHBA 3MEXA 3WU0A 3E6DA 1DPUA 4WXCA 3I54A 3KETA 1K78B 2BBYA 1F5TA 5E8GA 2GZWA 4PGGA 2K86A 5IT9K 1KU9A 2F5CA 2FA5A 2D1HA 4OMYA 3NRVA 3GXOA 1XGSA 1GVJA 3MQ0A 2EFWA 1FBSA 3HSFA 1IZ1A 1H9GA 2VBYA 3IWFA 2B0LA 1GHCA 4M72A 5AONA 5BPIA 4RGRA 2M87A 5ED4A 4BAYA 1O3TA 1SD4A 1PDNC 3L7WA 3MZHA 3DV8A 4HX7A 4IHSA 3KEOA 1MJBA 2QQAA 4IRIA 5IT3A 3WU1B 2M5WA 1XGNA 1W5SA 4HX8A 1EH7A 2RV8A 3J80K 1MJAA 5FFXA 1V4RA 3CDHA 2L4MA 3O2PE 4IHTA 1BJAA 4G9YA 1G6NA 1WRJA 4A6DA 5DCMB 3SFZA 3LFKA 1B1BA 1XMKA 1H0MA 3SXYA 1SFEA 3J81K 4HOBA 2XAFA 1OR7A 1REPC 2NYXA 3WTUC 2KKOA 3K1NA 2LF7A 2PN6A 3E6MA 3PQJA 3PQKA 4UVBA 4G6DA 1KU3A 1FLIA 4RB1A 1O7FA 4ZZDA 3HRTA 1SFUA 1U6GA 1XMAA 2R7FA 4OMZA 4ENNA 1QBJA 4LMYA 4KN7X 1CF7A 3Q9SA 1QO0D 6PAXA 1P6RA 1WWXA 5HVQC 2MA3A 3HTUA 5LGNA 2D45A 4M9SA 4XBFA 1JE8A 2ESNA 3QP6A 3M8FA 1ON1A 3SZTA 2C6YA 2A3SA 2VT3A 2MC3A 2EFPA 3GEZA 2COMA 2WC2A 4BYYA 3JAMK 1J75A 4G7HF 3E5QA 4NB5A 5LGTA 1XSDA 3TQNA 5KK1A 4K2EA 4L5JA 3LQQA 1ZHFA 4KUMA 3E6CC 2HR3A 3CUOA 1TQPA 3BPVA 3M8EA 2CGPA 3CUQB 5CVRA 5ILSA 4EGYA 1ZRCA 2W57A 4PGHA 4HX4A 4NQWA 5TJJA 3HRMA 2GWRA 4EM0B 5K5QA 4HQEA 4U7DA 3LQRA 4ZH4F 5HDKA 1FYMA 1I6XA 2AXLA 4U0YA 3DF8A 1WQ2A 3RTRA 3TDUC 4BNCA 5H6RA 5HLGA 5DEQA 3I71A 1V3FA 3E5XA 2JZYA 1OPCA 3KFWX 3WTSC 2H09A 3DPLC 3KZYA 4O3MA 2PLYA 2A5YB 2JSCA 5DV5A 3WE2A 1UFMA 5DUKA 2MH2A 3WTXC 4ESFA 1JGSA 1DUXC 1R00A 2EK5A 3GZ6A 3HHHA 2QENA 4Y15A 1TLHB 1BOAA 3ZMTA 4L9JA 2CFXA 5E8IA 3J81Z 4MTEA 4KIGA 3T1BA 4JK1X 1R1TA 1F4KA 5E18F 1E17A 2QQBA 3GWZA 2HTSA 1J0RA 2JT1A 3ZN0A 1YO5C 2FMYA 1FPQA 3JSOA 1XN7A 3LSTA 1ZLKA 3HUGA 3N97A 2P6SA 4L9VA 1XGMA 4BHCA 2A6HF 3F8CA 2A6EF 5ERIA 5JHUA 2JPBA 2H6CA 2ESHA 1DPRA 5FB2A 3F6VA 5LLQA 1T98A 3Q9VA 1FBUA 1IN7A 5CYVA 2F5DA 4ESBA 2EV5A 3FM5A 5TRDA 4O6JA 2FSWA 1ODDA 2PG4A 3BZ6A 3D5LA 1KYZA 1J9IA 1D8KA 4KN4X 1R1VA 1KGSA 4B8XA 1ZG1A 2Y48A 1XCVA 4KDPA 3FMSA 2O0YA 2FU4A 3CLOA 2UWMA 5H6QA 3EYYA 3HOSA 3FX3A 5BMZA 2QUFA 2X0LA 5JFRA 4EQQA 3WGIA 2GXBA 2K27A 2ELHA 3ROUA 5ICEA 3CJNA 3ZMVA 4UNOA 5L3EA 2DBBA 4HLYA 3U2RA 4S04A 4RB3C 3KP2A 3ZMSA 2J5OA 2GIVA 5FD6A 1ZG5A 1YQAA 4EJWA 1YW7A 4WCGA 1I27A 3TDZC 3CO6C 5D4RA 3RPQA 2XAJA 3O3KA 1O3RA 5EEGA 1QZZA 2P6TA 4A5NA 3ERED 1FSHA 3F22A 1S7OA 1BM9A 2XAHA 2FRHA 3WTWC 3HOTA 4BXUA 2QLZA 4UV9A 4FX0A 3WGGA 4CDGA 1FWZA 3U9GA 2HTJA 3C1DA 1S6LA 1USTA 3R60A 5E1ZB 1FC3A 2X4HA 2E7XA 3FXQA 4I2OA 3IRQA 3RJPA 3QAHA 2XIGA 1AOYA 1ZN2A 3QU3A 2FQ3A 4XSXF 2DPDA 5LBQA 2D1VA 1IW7F 3G3ZA 2IPQX 2QBYA 2VOOA 5BS6A 2KRFA 5E1XA 2VOPA 2BEOA 2DPUA 3DEUA 4IRGA 2ZKZA 1RNLA 4M6YA 1O3SA 5E17F 1PP7U 4O5VA 2DU9A 1OYWA 2VXZA 2K7LA 4GO1A 4P96A 1L3LA 3L2CA 3F8BA 1H9TA 1SFXA 3HIFA 2P4WA 2HDCA 4HW0A 3V4GA 1ZGJA 4G7OF 1HKSA 1D8JA 3ZPLA 3TOAA 4EJUA 5DCFA 3CUQA 4WWCA 1AWCA 1XCBA 4EJOA 4ESJA 2LDUA 2DW4A 3G73A 4R8HA 2OA4A 1Z05A 2H94A 4GXOA 1FYLA 2EA2A 4HDVA 1YLFA 4FX4A 2HWVA 4LD5A 3VOEA 1GXQA 2RC4A 3F8NA 1YYVA 3FXUA 3TOBA 3I64A 2BGCA 3KP7A 1IXCA 4UHTA 2HS5A 3F72A 2EWNA 4HQMA 1JXSA 4XLPF 1TW2A 3K69A 2DO7A 1I1GA 2V1UA 2VC1A 5ICFA 4HF0A 2JRTA 3V8KA 5L3FA 4PDKA 1BIBA 4BQAA 3FWEA 3F23A 5FLXK 4A5MA 2RN7A 3GW2A 5ILVA 2ISYA 1OYYA 2LSOA 1WSUA 4YIFA 2DLLA 5DUIA 1T39A 2Z9OA 2E1CA 1STZA 4KMUX 1R7JA 2BE5F 4H0EA 2V1XA 2XV4S 3GF2A 5ICCA 5CLSA 1W7PB 1R5GA 2V79A 3S2WA 1MGTA 1SD6A 4BH9A 3CTAA 3CUQC 2CW0F 3GX4X 3HSRA 1XSXA 1FYKA 4L5IA 3H3UA 4AIHA 1BI0A 5D5UB 4FHTA 4GCVA 1JHFA 4XSZF 3VEPA 4LLNA 5FLXZ 2G7UA 4NHJA 4WXHA 1HXDA 1KQ0A 1FP1D 1F1ZA 2M45A 1TQMA 4EM1A 3EYIA 4OU0A 2RDPA 4BHPA 2XUBA 3B02A 5DDGA 2DI3A 1IAWA 5DD8A 1IXSB 2IJLA 4UV8A 1Z1DA 4L9NA 4CHUA 4AIJA 5J6XA 2ZBKA 2Y0MA 1ZLJA 3O6BB 4UXNA 3WTZA 4EM2A 3C3WA 1YW8A 1DDNA 3V7CA 4JBAA 1ON2A 2O8XA 4UVCA 4Q4ZF 3K0LA 2ZNZA 2V1DA 4M73A 3LA7A 3RKWA 2Z99A 1FT9A 4ASNA 1SD5A 2QBYB 3WG9A 4XRFA 3MWMA 4HAMA 4FT8A 2A69F 4I0BA 2R3SA 2LF8A 2XKPA 4F7ZA 2QQ9A 5CVUA 2XHKA 1TQIA 1IN6A 2RKHA 4G94A 2XAGA 1USSA 2F2EA 1U3EM 3EETA 2NNNA 1YIOA 3H92A 2MH9A 4KT5C 2WWYA 4KFCA 5F1RA 3DFGA 3HTSB 3HSEA 2RVCA 1Z6RA 4I09A 3U1DA 3E97A 2DT5A 5KVRA 4LJZF 5H20A 2ZFWA 3M9AA 2Y75A 2DAOA 4EMSA 4MEYF 4A12A 2FMLA 2FNPA 2Q8KA 3FZVA 5LRSA 1P4XA 2CSOA 2HYFA 3GZ5A 4A0ZA 1K7AA 4M71A 3R4KA 2HEOA 3IHUA 5LEJA 4S05A 1I5ZA 4PZJA 2XRNA 5LHGA 3IKTA 2PMUA 1B59A 5ILUA 3B73A 2O03A 4IJAA 2JPCA 3R6SA 3ML6A 4AWXB 1U2WA 3FXRA 1D3YA 2GXGA 4EV0A 1W5TA 2P7CB 2IT0A 1W7PA 4EJVA 4IXAA 2YX4A 3MCZA 4U7BA 2XVCA 3M1EA 4P9UA 1B6AA 1XDSA 2V6CA 2ISZA 3R61A 2P7VB 3IWZA 4U0WA 2CO5A 3I53A 3KP6A 1HBXG 5HDGA 2ZMEB 5D6EA 4ENJA 2PEXA 1HQCA 4MEXF 2Q0OA 3BROA 1Z6TA 5L3BA 3J7AO 1R1UA 4Q47A 1ZYRF 1P4AA 3SHFA 3GFLA 4HF1A 1P92A 4ENMA 3T0YA 1LJ9A 1TW3A 2FOKA 2P8TA 4Q48A 2L4AA 1BC8C 3KEQA 3WTVC 3TO9A 3KP3A 2VT2A 4Q5SF 2WV0A 1LDDA 2ZO4A 3RPUA 3QP5A 3IRRA 1YS7A 1FZPB 1ZARA 1ZH5A 1E2XA 3PFIA 3LAPA 1GXPA 2F5EA 3KLNA 1Q1HA 2K02A 1SMYF 2EFQA 3F8MA 5J8CA 1LDJA 1MKMA 1C0WA 5LGUA 3FF5A 2Z33A 2KJBA 2PI0A 4M9XA 2PJPA 3WTYC 4A2UA 5F64A 4I7HA 3OV8A 3F6OA 2HYGD 5D6FA 1D5VA 2PMHA 2IA0A 4RGXA 2BV6A 2HGCA 5JR3A 3WGHA 1YW9A 2NAZA 1CGPA 2OAZA 1PP8F 2IP2A 1ZRDA 4IVNA 4UVAA 4MHGA 4LB6B 3IKVA 3RIRA 1R5HA 1P2FA 3TO7A 2KJCA 1S8NA 2OZUA 1BBYA 4XLNF 2F5FA 4GYGA 3GFIA 3KCCA 1BN5A 3DQVC 1J59A 2VBWA 2GA2A 4KMFA 1FX7A 1FP2A 5AIQA 1BI3A 2VBZA 3BY6A 4A6EA 1IXRC 1LB2A 2E1NA 1ULYA 1Z91A 2XKOA 1T38A 1QZYA 4PCQA 4KYWA 3ZMUA 3I5UA 4MGRA 1HSTA 4RB2C 2UXXA 2FF4A 2EV6A 1IUYA 5LRRA 5FGMA 2G7HA 2EA4A 4HZFA 1HW5A 4IF4A 2MBFA 2KIUA 3I59A 1UHMA 2A07F 1CF7B 1G3WA 4LG0B 1KA8A 2IRFG 4RAYA 1BI1A 2BYVE 2RGVA 1Y0UA 1O57A 2DTRA 2GQQA 2D2WA 2NS0A
chains in the Genus database with same CATH superfamily
3KP5A 1M7KA 3EVYA 1IRGA 3P7IA 4RAGA 5EGOA 3PUXF 3PUGA 2BXYA 4DQ2A 3I4NJ 1D0XA 4HFEA 3BTJA 2RQPA 3BQIA 4AC0A 3MZYA 5HNFA 4YFKF 2VODA 4AI6A 3ZMZA 1UB9A 3FZKB 4ZDPA 4FI5A 2AS5F 3V8LA 1HW1A 1UURA 5CVJA 3NVOA 4EGWA 3J9X1 3RQUA 1LFPA 3CO7C 3DPTA 1Y39A 3HKBE 3LG7A 1OJLA 2HOEA 3ZQ7A 2GA1A 4CICA 4B09A 3TMOA 4TWFA 2Z3YA 4XK4A 1G3SA 4KITB 4AD9A 5J8FA 2STTA 4N0BA 4OIQF 1I1SA 3ZMUB 2HVQA 2OBPA 3BCAA 4NUVA 5D8LB 2WA0A 5DD4A 3Q5XA 2H27A 5LP6E 2NOGA 4LLLA 4XIDA 1PUFA 3GLXA 5CQEA 5IWAT 3IF8B 2JPFA 3AECA 2BG9B 3SFEA 1LQ1A 2MC4A 3DCFA 4EJTA 4YTPA 3LSJA 5CVIA 4XM3A 1VNDA 3DEWA 1LVKA 1QGPA 3C2GA 1SEUA 2DODA 2XC7A 1MDMB 4L18B 2H88A 3CQZJ 2QVAA 2HYJA 3AE4A 4JLEA 4O2BE 1YHQI 3C2HA 1S3JA 2K9QA 4QWQA 2QYOA 2OD5A 3ONXA 2Z5UA 2CXFA 4KHPT 5L3GA 1ERDA 2LREA 3R0JA 3ELKA 1V5EA 4E7SA 5E0OA 3RIUC 2NVYJ 1GV5A 5JDLA 2FEZA 3IC7A 1MBEA 2XM2A 1XSVA 3F31A 3MJXA 2K9SA 5HDNA 2R5ZB 2ACZA 2TCTA 3JW4A 2XQ3A 2M2EA 3RDIA 2ACXA 4WF2A 2CEAA 5B1BH 1Z9CA 2BKNA 2O7OA 2X0YA 4KICA 2DQRA 1U8RA 2PJRA 4KNYA 4CQIA 4TNVA 3EDPA 1JT0A 2DK8A 4A0XA 2M3AA 1KNZA 5FKOA 4YSZA 1FOYA 3ABUA 4GDFA 2ZJ2A 2VE9A 3D0SA 1IC8A 5K1YA 2V8SV 4QLCU 2IEKA 2CV1A 2K24A 3BWGA 5CA0E 1XNQT 3FMRA 2LKGA 3PSFA 4HA8A 4Y3OA 2UZKA 3WAKA 1MMNA 2HQ5A 3N05A 3VR9A 1Z67A 5EDNA 2X9XA 4H4KC 1IAPA 1VQNI 3RHWA 3S2HJ 5EGOB 2Q9QC 1JI8A 4HWCA 3C18A 4ISTA 4OIOF 3GTOJ 3JAFA 5B66C 1PUEE 3KEYA 4C2TA 3UU8A 2ZJQF 4OIRF 5J1RA 4A3CJ 2HKXA 4ISSA 2SPCA 2XY8B 5F1JA 1F9NA 2ZSIB 3T5XA 1X4PA 5FKMA 4G7ZF 4DV3T 1HNXT 3I59B 1ETQA 3Q0UA 1HX1B 4HWHA 4HNTA 4IZZA 4PJMA 1VQOI 1YI2I 4U31A 4HSTA 3CK6A 5ABEA 4XR6A 3W6KB 3ABMH 3GTMJ 4KT6A 5LGNB 1K83J 3QUJA 2LOSA 1LDKB 4L9TA 1MZBA 1VQPI 2OCCH 1IN8A 1QUUA 3LL7A 2Q9QD 4IHXA 3QPSA 4JI3T 2K4BA 1TTYA 2W67A 1MIYA 3OKQA 2XF7A 1WCRA 3SFDA 2CUJA 1K78A 1O3QA 4RAZA 4C3IJ 4B3XA 2PG8A 1G4DA 5KAFC 5DQVA 1IN4A 1SVOA 4LOCA 5FXVA 2QGSA 3TGNA 4EB6E 5L3DA 2W25A 5HLIA 2CJJA 2PQ8A 2VC0A 1YJNI 1N25A 2HKOA 4GYIA 4OX9T 2KIFA 1WVRA 3V5SA 3K4MA 4LF6T 1YG2A 1HKTA 4RGUA 1R58A 2E36A 1QPMA 1NTCA 4FJOA 1MBJA 3OR2C 2K5BB 3L00A 4U88A 4OAYA 1LEAA 2DT7B 2BBHA 1S7AA 4RB0A 4IO9F 3RC3A 1OYIA 1IDZA 4AKGA 2H8WA 2Y48B 1IV8A 3P9CA 3F3XA 3P8CD 2A68F 2EIKH 2P5KA 1HKQA 3ECHA 3GUDA 2GIZA 3HRUA 5AQVB 4DBRA 3LJCA 5J0ZA 4ON0A 4BXXJ 4WX9A 1BIAA 3H3ZA 3HG9A 3ZQIA 4H63V 1VQ5I 4L5GA 5FMNA 2MLKA 2VQET 1SMTA 4ETSA 1XDUA 4OINF 2XASB 5LHHA 4BDYA 4CH7A 3ONLC 2L02A 2DHRA 1P4WA 3AE7A 2CWYA 2WWVA 2YX7A 1UHWA 4HBLA 2M1BA 4CGZA 2DWKA 3OYAA 2RNJA 2CE7A 2XQ5A 3M7GA 2L7ZA 1FNNA 3ISPA 4HYEA 5B3SH 1MIJA 5FL0A 1S29A 3H1CA 4GGGA 3HKEE 4RBOA 4HFCA 2L7MP 4LGWA 3BJ6A 1LNWA 4M6XA 1X1PA 3G71I 2CYYA 3Q5FA 3DBRB 1Z7UA 4TUYE 4E7ZA 4FTHA 2HQNA 2E8IA 3VKGA 2TDXA 1UX5A 4CYCB 4OWRB 5F5WA 5L3BB 2XGDA 3MMYB 3TKYA 2MLGA 1BI2A 1GQEA 5HS9A 3L8RA 2ZXJA 3PJAJ 2LKSA 1HF8A 1T72A 3BQLA 3KZZA 5L3GB 3R0AA 4U3CA 2IGKA 3FISA 4I76A 3L2RA 2LFBA 2FBKA 1W9RA 1W4MA 2L7FP 5DCMA 3BG5A 3S8PA 3KP4A 2QA4I 4IE4A 2YU3A 2HQAA 1LEBA 5L4HA 3LA2A 3VYRB 4U0VA 3BDDA 1U78A 3JRDA 3IH4A 1NEKA 3GZNB 1DGWY 3SEZA 2V7FA 5HOOA 4JX6A 2NRAC 3O1IA 2ETHA 2KIMA 5D8KB 4I98B 1SFKA 3AFHA 1XGOA 4I0AA 4KIBA 4DNCA 2LSGA 2DN0A 5IOZA 1OKRA 3F8FA 2CV2A 1I6ZA 1WH7A 5HS7A 5LA6E 3BTLA 3D0TA 4LF5T 3NEUA 3RF1A 3Q9DA 3KBTA 5FKNA 2DYSH 3QOPA 5CJ9A 2MYSA 3HOXJ 1DP7P 3FBZA 3PU3A 1AJ3A 4N4OB 2ELKA 1A6QA 1B4AA 2BXZA 2J5PA 2W85A 1JUSA 3I9V2 4UB8C 2ACJA 2GBYA 2XB0X 1MDMA 5HWYA 1EKEA 4BS9A 1VCSA 3T1YT 3GMIA 3UU4A 1DU2A 4QIWN 1VQLI 3ZCJA 2E9XC 2Y0SN 1KK7A 4M9ZA 4M6VA 1PUFB 2IVMA 3OYXA 4IDOA 4QWNB 4EYUA 2IIUA 1O3XA 1QQIA 2XAQA 4LITA 3HYIA 3U1KA 1KNRA 2DK5A 3EUHA 3CLQA 2L3DA 2O61A 2KL4A 5FFZA 4L0YB 1D1BA 2ZNYA 5LHGB 2AE9A 3C4ZA 4G6QA 1OEDC 2WSSV 2CRBA 1R9TJ 1SAUA 3O9XA 5AQHB 3L1PA 2QKMB 1WKMA 2VKDA 3AEDA 4LB5A 4DOZA 1FBQA 2WDQA 3LOCA 2LHNA 2XAUA 4WXDA 5E1WA 2R7UA 4XBFB 2DOFA 4B43A 2V7IA 3KLOA 4KIFA 3BK9A 1TNTA 1X3UA 3JCUC 3QQAA 2EHOB 3AEAA 4YFSA 3ZMTB 3PIPF 3KYLA 4N9HA 2CU7A 3DBHB 2PMZA 2P5LC 3CX8B 3J80Z 2CV0A 4HFIA 3REOA 2ZJRF 4P09A 4UXNB 3V7RA 3AA6B 5EYRA 1B9NA 2EZIA 4LFUA 4ZYEA 4IQJA 4JI8T 3KIOA 3JTHA 2X6WA 1HTJF 1RI7A 2DT6A 2W84A 1B8IB 3O1HA 3DBLB 1IRXA 3I55I 2HN2A 2EFNA 5AIPA 3BT9A 3RQ4A 2WP9A 5HLTA 4ITVA 1G59A 3BCBA 1HOMA 2C5JA 3AA7B 1R4NB 4KI0F 2BS4A 1AKHB 2XQ6A 4F3QA 4MQ9F 2XROA 4ZI7E 4LK1F 5AFUL 2VBXA 2ZC2A 2G9WA 2V7LA 2VI6A 2CHOA 2A72A 4MTDA 1K6YA 4H9NC 2FBWA 5HCJA 2BW3A 4EVIA 3CWZB 4M3GA 5FKYA 4U87A 5FRMA 1EV7A 1XTAA 1X3ZB 4C30A 4WK8F 3P9KA 4IE7A 2WBLA 2V6YB 3AAAB 3DU5A 4E7IA 3OYZA 2R7RA 3JTGA 2LSKA 3KBUA 4A5XA 2CQQA 3IL2A 1OCTC 5JVDE 3ZYKA 5FJ8J 3TO6A 2V5DA 4AIDA 1EH6A 3A2KA 1J7KA 1KQ9A 3BR1A 3DXJF 3C7JA 2NNYA 2P9BA 1W0TA 3FZFB 1SAXA 2R7VA 4NBQA 1HSJA 4DV5T 3AVSA 1ETVA 1RUNA 4A3BJ 3ZYMA 4II2A 3QOEA 4EZ4A 5K5OA 4IPAA 2UXNA 3WODF 5A1LA 4G6TB 1HX8A 3F9KA 2J62A 2Z6EA 4J2CA 5ABFA 1R22A 3ZN1A 2HPMA 1M1EB 1FEWA 4HNVA 3DKYA 2KZVA 3I58A 3RSNA 3R84B 5K7ZA 2E5LT 2IXSA 5C2TA 4YRVA 2WU2A 2QWWA 1U5TC 3DP7A 1HW2A 2N2NA 2DDAA 3UUBA 3F0CA 3KE2A 2VURA 2K5CA 2LSJA 2LMDA 2R5ZA 2K9NA 3LWFA 3RKXA 4UUVA 3LFMA 3U78A 2GM4A 3VHLA 4MALA 1ZAOA 3RKGA 4EOZB 2AHQA 4LK0F 2DNXA 2EPFA 1MD0A 4ABZA 3KINB 2QM3A 2AQEA 2FJDA 3RYPA 5BQTA 5GONE 2FJEA 4RGSA 4JI0T 4LLGF 3T1HT 5HEHA 1U5TB 5AQRB 4NQWB 5HODA 5D5VB 2QZ8A 5D5WB 1UK5A 5CJ5A 1ONVA 2LY9A 3SZPA 3CCSI 3L39A 5KX5E 5FXXA 2A61A 4CXWA 4YELA 2V9VA 3TW6A 3K1PA 2QSHX 4HE8A 4QXHB 1QPIA 4DIQA 1HC8A 4AVPA 1KYWA 3AG3H 4ADZA 4I02A 3ULQB 1WJCA 2CG4A 3FXDB 2L9NA 3CKDA 4B3ST 1V55H 5CB4E 2IA2A 4HFBA 3JSPA 1EH8A 3HGYA 3BZKA 4TV8E 2XDVA 1VF9A 2DFHA 4P0AA 3L9FA 4A3IJ 2EHOD 4HPQA 1K4SA 4LF4T 1RZ4A 2ZCWA 2W82A 4LG0A 1OQYA 3AAIA 4K0KT 1Q1VA 2LNBA 1VTNC 2ES0A 1UCRA 3NQOA 2W00A 2D9DA 1T08B 2STWA 1HCRA 5L2LA 1J2XA 1VQKI 1A04A 2ZM6T 3TLSA 2XGEA 2WY2A 4YIIA 3RYIE 3W6JB 4N9IA 4A69C 1ETWA 2GOXB 3ZCIA 1B9MA 1NG7A 5F08A 4HNUA 3FM3A 1IF1A 5LEKA 3CX6B 4OIPF 1ZREA 4UVCB 3AAFA 1K61A 4U74A 4CI2B 1FIOA 1G3YA 3ZMSB 2CWEA 4OFZA 3Q5EA 5HS8A 5JR9C 1K79A 1S35A 3GO5A 4RDUA 1J1JA 4YFXF 2P81A 4WYVA 4A3GJ 2VN2A 2Z1DA 4P9FA 1IN5A 4G2AA 5EG0A 4I50E 1LVAA 3BJAA 5JI6A 4A93J 3QYBA 3RKQA 3QRFF 3IBPA 4BQOA 4DZPA 1RIOH 4GYSA 5HLHA 1H8AC 3DKXA 4HRIA 4X6AJ 1HNWT 1ZRFA 5EK4A 4PNIA 3W2WA 1S94A 4H9QC 1IJ6A 5LGTB 1J5YA 1T2KA 4I01A 1MMSA 1CHUA 3ESWB 3FK7A 5IYZE 5DYMA 2NW9A 3SOLA 3DPUA 4XRMA 4E4HA 1ZG3A 5H2FC 1XD7A 4EXTA 4QPQA 2R7QA 3QB5K 4Y4RA 2JA2A 2L9QA 5FKLA 2OZ6A 1KU7A 3BJOA 2W1OA 1L0VA 4ZZLA 1K6OA 3DLLF 4EGZA 2VE8A 3CP8A 1DU6A 2LKPA 2YSRA 5F04A 2IUBA 3OTOT 2IW5A 1MH4A 1S5LC 3HB9A 2DFEA 2QGUA 5A2QZ 2FBIA 5F6FA 5JVTA 5C44J 1TNSA 4CO8A 1YFHA 2WBMA 2HOSA 2P5VA 5LMUT 1JKQC 1HLVA 1XB4A 3AEBA 2M8EA 3Q5DA 4X65T 5BPDA 2BZBA 3K1SA 2R93J 3U3IA 2MD5A 3HHGA 3E3VA 3QPHA 3IH2A 2LH9A 3OS2A 2E1MC 3AL0B 3OOUA 1T8IA 2M30A 1L0OC 2OQGA 3P7NA 4P55A 5ETWA 1FY7A 2ADUA 1LUJB 1AU7A 2VLAA 3VB2A 3CCRI 3RI4A 4BJMA 5E3OA 3BG7A 2CM0A 1H89C 3QU6A 4CCKA 3I3LA 4BBSJ 4YSXA 4QTRA 3MFKA 3COAC 3VODA 1DGRM 3GYHX 1W09A 2FJAA 1W1WE 1FOKA 3JADA 1O7LA 4D0PA 2IS6A 4AYBA 2JK3A 4E7KA 1HDDC 3HOVJ 3K3NA 3E5UA 2BY1A 2NTXA 2JQQA 2CQKA 4A0YA 5FLMJ 3PUVF 5JDFA 3ZKRA 3KYDB 2KQRA 4UY8I 3NKZA 3OYMA 2MD0A 2UV1A 3G6EI 5LD2C 3ZMDA 2K48A 3BG9A 3HUGB 4M74A 2DMQA 5GAGJ 2W66A 3OSGA 4MNUA 4HF2A 2IA1A 4CZZA 4TV7A 4Z90A 2EB7A 2QCOA 2L7KA 4HSRA 3C4XA 1X2NA 3GFMA 3CMYA 2HFHA 4CCOA 5JDQA 2XM1A 4ENKA 1XX5A 5KCMA 2HVRA 5JTGA 5FKKA 2GAUA 1BJZA 3K1MA 2EZLA 2ZMEA 2ZSHB 3LSGA 4HV6A 5FO5A 3UQ7A 1CUNA 3ECOA 4B4CA 3VYUB 2HQRA 1GDTA 3K7AJ 3T8RA 2E9XA 1LKXA 3L09A 1W36D 2Q1ZB 4X0GA 2ZM0A 5FD5A 2IW5B 2FBHA 3AE1A 4UELA 5AQSB 3OSFA 1QNTA 1Z8UA 3EUHC 2JA5J 1W7PD 1MMGA 1S7EA 2KMUA 1G3TA 2EZHA 4ZYHA 1R23A 4AIKA 1MSEC 2RP4A 2AXTC 2XSAA 1Z7LA 5E20A 2R7WA 1BR1A 3LA3A 3NAUA 2FNAA 4NNJA 4JI7T 1MMDA 1X19A 2FXAA 2LG4A 3K10A 5BOXA 2KRCA 4ZZCA 1ZV4X 4XORA 4ANJA 1HA8A 5JH7E 2VB6A 2YEVC 2NP9A 5EG0B 2Y9ZA 2IHR1 2O6GE 4BL0B 1ENHA 2X6YA 3ZCOA 2XGXA 3ZPOA 2PBIA 4PAGA 3I4PA 4HFVA 2X9HA 1UELB 2JRMA 3LMMA 1H88C 3K3OA 3ABTA 4ZYDA 4XQFA 1X9BA 3P4QA 5JRCB 4B3RT 1KQ8A 3K4CA 3L2VA 2LM2A 1TP4A 3GMEA 3V8JA 4R79A 3AKZA 2LSIA 3RYRA 2BHYA 1WZ2A 4HDUA 5K5RA 1T6SA 1WRDA 4IRHA 2R4GA 2WB1A 3GVAA 2PTFA 4PJNA 3KYCB 2EV0A 5ICGA 4JQFA 3GFJA 3VFZA 3P9IA 2QEXI 3PL8A 2JUGA 4G8XA 2UXDT 2E7WA 2XASA 5LHIA 2VJ5A 2WTEA 2YPRA 1FJLA 3T8TA 4Y13A 1TBXA 1XWMA 3WE3A 3FZHB 1BW6A 4Y17A 1TWGJ 4RM3A 5GTHC 2E34A 2CPTA 2AO9A 3PUZF 2CCQA 1T0FA 3BOQA 1BC7C 2UUCT 1OMIA 1MIWA 2X68A 5A2QK 2CW8A 4OOIA 2E1OA 3HRSA 1NG6A 5IYDJ 2Q2EA 1U5TA 1KEYA 2RA1A 3HJEA 3HA4A 4MFRA 3KVBA 3FZMB 3DKWA 4E70A 2QQ8A 2V4JC 2DLRA 4YJ3E 1R36A 1QZEA 4XZCA 4PFPA 3LSVA 1HG2A 4D1QA 3DU6A 3BR2A 1YS6A 2A5WA 5LBQB 4YG2F 3M1CA 3LAJA 2X48A 2OF7A 4NDLA 1T7SA 3LK2B 3RKYA 1ZGAA 2YKSA 2LC2A 3HKDE 2FE3A 4DZJA 3K9TA 4HG2A 2JRKA 3MAJA 4IEJA 4C90A 4DV6T 3E6BA 5D5XB 3EUKL 4DV1T 2H6BA 2LJLA 5JLXA 3VWBA 2VONA 2WM9A 2LKXA 2OU2A 2Z2SB 3HEFA 4HV5A 1NENA 1J09A 5IT9Z 4HLXA 3ZQGA 1SD7A 1UMQA 4NUBA 4Z2YA 4BXFA 3C2BA 5EZHA 5M5WJ 3NBXX 2NVUB 3H9JA 4P5OA 3JRCA 3L3PA 4TX5A 2W4SA 3CQXC 3UQ4A 3VRAA 4MQVA 4BU2A 4EIWA 4KA4A 2VKHA 1YTYA 3EQLF 3ZP5A 2OQRA 1RUOA 3HOUJ 2PFBA 5HEUA 4ZHQE 4DGWB 1JHHA 3K2ZA 2EFOA 4DR5T 2DA6A 1IBKT 3BP8A 3S15J 2D5UA 3RZDJ 3BPXA 2R7DA 2HXOA 2L01A 5C4JJ 1HG5A 3CCEI 3QPTA 4F91B 2B1EA 4WBOA 2CMRA 4Z91A 4PUSA 4B3MT 4YFNF 3JAMZ 3FHZA 2R7TA 3ABVA 3OYNA 2VVSA 1NHAA 3FMQA 1FSEA 1P7IA 3KV9A 1HS7A 1GV2A 1IRFA 1T56A 1QVTA 4LIUA 5IYBJ 1WI9A 3RGLA 2JTVA 4HWDA 2DFFA 3N4MA 1OLTA 3S3OA 3OYCA 4U33A 4COFA 2EHOA 2VQHA 1T95A 4ZYGA 2O3FA 1DQUA 5M3FJ 2K4JA 2UXNB 2L54A 4RS8A 2DFIA 2EJRA 1MJ9A 4JV5T 3HPGA 4CXFA 2HZTA 3OYDA 2VQCA 3G1MA 3SQNA 3AL0C 2QVOA 1X79A 3OOPA 4IL4A 2BY2A 2YR2A 1EF4A 3AE2A 4TV9E 5L3CA 2Y0SA 1EA3A 3I0TA 5LHIB 5F27A 2VJIA 3G06A 3H37A 3TEDA 5CVVA 3KV5A 3BTIA 1KU2A 4QSHA 5EEHA 1MNDA 4XRSG 4CYDA 2XSJC 2R92J 1RKWA 4L9IA 3TLTA 2DQLA 2X85A 5D4SA 2ZLYA 3QYEA 4R1HA 4TWHA 5FY1A 3CX7B 5J4YA 3PTRB 4IDQA 2ZFUA 3F21A 3IV5A 4P1NA 4I43B 3WTTC 1YRNB 3ZSSA 3CZ6A 2ZM8A 3V7SA 3HR0A 5FYMA 3N5LA 5AQUB 2JJ7A 1QHHD 2W24A 4BHBA 3AA0B 4JEUB 3MEXA 3WU0A 4QXBB 4LFAT 3OJAA 3E6DA 5KMGP 5GTIC 2C5IT 3RPUD 3ERMA 1DPUA 2OTLI 1I50J 3OIQA 4I4TE 4WXCA 3I54A 3KETA 1XDPA 2E5VA 4KUMB 2EBIA 5KDMC 1K78B 4O4JE 5AQIB 2BBYA 1RR7A 1YE9A 2K9LA 5E8GA 1F5TA 4BUPA 1TZLA 2GZWA 4PGGA 5J47A 3CCJI 1FOXA 3WI3A 2K86A 4JI4T 1ETKA 4PJLA 3QPLA 2V1NA 2I59A 2QKLB 4CUGA 4GK0E 3CQGB 4D9JA 5IT9K 1U0JA 3H5RA 1VQ6I 4YT0A 1Y6IA 3RQWA 1KU9A 2F5CA 2FA5A 3ABKH 3LFUA 2D1HA 4NC7A 4OMYA 1KNPA 4A97A 3ZMZB 1WFXA 3NRVA 2CUZA 3GXOA 1XGSA 2B76A 1GVJA 3MQ0A 2EFWA 2JN6A 3E7LA 2OCEA 1FBSA 1V54H 3HSFA 1IZ1A 4QH4A 1H9GA 2VBYA 4M3DA 3G4SI 1D1AA 3IWFA 2B0LA 3I4MJ 2YDQA 4AM3A 3S14J 4UB6C 1GHCA 3MN2A 3MD2A 4M72A 5AONA 5BPIA 4RGRA 2M87A 4YEJA 5ED4A 4BAYA 1BR2A 3N9LA 1U5PA 1E7PA 1FMWA 1SC7A 1O3TA 1SD4A 4RA2A 1SE7A 4IX7A 2NXNB 1PDNC 4U7IA 3VRBA 5CPRB 3GTJJ 2DCEA 4A3MJ 2KMFA 3BQZA 3L7WA 3E0JB 3MZHA 3DV8A 3EDUA 1TWFJ 4HX7A 1TWCJ 1ZTRA 4IT4A 2ZB9A 1ACIA 2XB5A 4IHSA 3KEOA 1MJBA 2QQAA 4IRIA 5IT3A 3WU1B 4OYJA 3DLAA 3P4RA 4X1EA 2M5WA 1XGNA 4LG3A 3N2KE 1W5SA 4HX8A 1EH7A 1QRYA 4Q25A 2RV8A 2EHOC 2CXLA 3J80K 4ZJZA 2GLOA 5FY7A 1MJAA 2F48A 2HNHA 5FFXA 3ASNH 2BY0A 2IGNA 2G0UA 3ZC1A 1V4RA 1UGOA 4XLCA 5HEGA 2B9SA 2DTZA 2OPTA 5J2UE 4F93B 3CDHA 2L4MA 3H0GJ 3O2PE 5HNHA 3PUWF 2N8GA 2IBDA 4IHTA 4I0UA 4LMJA 1BJAA 2OUMA 3TL4X 4G9YA 2WZIA 3GLLA 4AIUA 2F5VA 1G6NA 2CUEA 1WRJA 1T33A 4ZI3C 4A6DA 3VYSB 4H9SE 5DCMB 3UKGA 3SFZA 3LFKA 2MW8A 1I6HJ 1BA5A 2BS2A 1B1BA 1XMKA 3UR3C 1H0MA 2IMLA 1V5GA 4YIRX 3SXYA 1QU3A 5CGMA 5F3JA 1A36A 3OYBA 1GLNA 1SFEA 3J81K 1IZNB 3H3VK 2W4XA 4HOBA 3AVRA 3FDYA 2XAFA 1OR7A 1REPC 2NYXA 3WTUC 1VQMI 1ITYA 1A31A 2KKOA 2RQQA 3K1NA 4BJNA 2LF7A 2PN6A 4JUYA 5FNVE 3E6MA 5HXEA 3PQJA 3PQKA 4UVBA 3S2DJ 2E5NA 2FJ1A 4G6DA 3ANWA 1KU3A 2JJ9A 3FHNA 1FLIA 3HGGA 4RB1A 4IHWA 2EIMH 2HHHT 1ZGWA 2X6XA 3NWIA 1O7FA 4ZZDA 2UUAT 4YTNA 1UG0A 3HRTA 2JQ9A 3PUAA 1SFUA 1U6GA 4YXDA 1XMAA 1I3QJ 2R7FA 2AQFA 4OMZA 4ENNA 4BJ6C 3ZQCA 4P0BA 1ZKGA 1QBJA 2E60A 1OCPA 1X4OA 4LMYA 4IDNA 4KN7X 4IE5A 5JR9A 5LGUB 2DOEA 3HBLA 1HFAA 1B8IA 5E3LA 4DBQA 3AEFA 3G1LA 5EJCA 2V5CA 1VOMA 1CF7A 1WJAA 3Q9SA 1E0EA 5AQOB 2ZXHA 3LSIA 2M0MA 1QO0D 6PAXA 4JI2T 4DR7T 1P6RA 1WWXA 5HVQC 4CCNA 1R6RA 4A3LJ 2V6XA 3DTOA 3X1DA 5K7HA 3QC9A 2VJJA 2ODVA 2MA3A 3HTUA 4DMVA 5GAHJ 4OAZA 5LGNA 5KAIC 4B1RA 3WU2C 2D45A 3SS1A 1Y1WJ 4M9SA 4XBFA 4Z6YA 1JE8A 3QYFA 3GTKJ 2ESNA 3QP6A 5HYAA 3M8FA 1ON1A 3ZYLA 3EUAA 3CCVI 5L4EA 4DV7T 3U21A 2WDVA 2JUCA 4QHOA 3ONJA 2LK2A 3IH3A 4FISA 2KISA 2XPWA 5EEAA 5LBMA 4DNDA 4N78D 2FX0A 4XKCA 3SZTA 2C6YA 2VKVA 2VKJA 1OISA 3RYFE 2CWOA 2A3SA 2VT3A 2J4GA 2MC3A 4WNKA 1WYBA 2IAKA 2EFPA 3GEZA 4WZXA 2CS3A 3ZOBA 2COMA 4ZI2C 3KVAA 1RKTA 2WC2A 4BYYA 4CCJA 3GTQJ 3JAMK 1J75A 5AQKB 4BQQA 2Y69H 1M62A 2L2OA 4G7HF 3E5QA 4AKIA 2ZXWH 4DUZT 2MOZA 4NB5A 5LGTA 1XSDA 4IOCF 2IC9A 3TQNA 1Z0PA 5KK1A 2WAEA 3ZGKA 2H7VC 2ZMEC 2M6IA 3PIOF 2K40A 4K2EA 4L5EA 3NRXA 3O1JA 5C3EJ 2I0MA 4HEAA 5HEOA 4LFCT 1D0YA 3HZJA 1G2HA 4L5JA 3LQQA 4GYRA 1ZHFA 1QSDA 4KUMA 3E6CC 2HR3A 2NS8A 2I8DA 3CUOA 1TQPA 5LOVE 3ZJ2A 3BPVA 2E19A 3FKJA 3M8EA 2CGPA 3GN5B 5L3CB 4IHYA 3CUQB 5J1UA 3UNGC 1SFOJ 3UU5A 5CVRA 2JWTA 5ILSA 1G8XA 4EGYA 1ZRCA 3DWLE 2W57A 5GPAA 4PGHA 4M1PA 3IAS2 2F4OB 4JI1T 4HX4A 3L2UA 5HWXA 4X62T 2CBJA 2K9AA 4NQWA 2KSRA 2VQFT 5TJJA 3P50A 3JR9A 1IJWC 3PUSA 5DQWA 3HRMA 2GWRA 4MLOA 4EM0B 5K5QA 4HQEA 5M5XJ 3C98B 2A2FX 4U7DA 2L3LA 3LQRA 1KFYA 4NC8A 3S1RJ 2XPKA 1R8IA 4IE6A 4JI6T 4AKRB 3AEEA 4ZH4F 5HDKA 1FYMA 2V9PA 1I6XA 1PYVA 1MBHA 2AXLA 4U0YA 3OYHA 3DF8A 3V42A 3CMAI 2IS4A 3AXJA 5M5YJ 1WQ2A 3V5UA 3RTRA 4ZDLA 3TDUC 2COBA 3OS0A 4A3EJ 4BNCA 1QLBA 3BR5A 2XAGB 3P4WA 3BLYA 4CN4A 2NVQJ 5H6RA 4TZ4C 5HLGA 3KV4A 1IRZA 3BQKA 5IYCJ 4JYAT 4ZI3D 1WPKA 5DEQA 4TN7B 4MIMA 3PO2J 2BG9A 4QX7B 4IOAF 3KPHA 3I71A 1V3FA 3E5XA 2GXAA 1YD8G 2JZYA 3Q0WA 4Y33A 4GRIA 1OPCA 3KFWX 3A0BC 4CI1B 3DTEA 4PJJA 3WTSC 1APLC 2AXDS 2M67A 2H09A 5F0FA 3DPLC 3OVUA 2XAHB 1MBFA 1U9OA 3KZYA 4DIDB 4GKKT 3K70D 1G73A 1FJGT 4O3MA 5AQGB 2R0QC 2PLYA 2A5YB 2V6YA 2JSCA 1WJ5A 3J7YJ 2IDOB 4MLKA 2HVSA 3I0QA 4L0RA 2H3RA 2OJED 5DV5A 3WE2A 3QNUA 2X9WA 3BC8A 3K8PC 1UFMA 5DUKA 5L3DB 1ZQ3P 2MH2A 1U4QA 3WTXC 3RLFF 2VKOA 3AE9A 3CF5F 4GKJT 4ESFA 1JGSA 4KMCA 1ZR2A 4IDPA 2NVTJ 2V9KA 1DUXC 2VIXA 3ONQA 1UG2A 4BJTA 2W48A 5JHFA 1A35A 1R00A 1MNEA 2EK5A 2VL8A 2BOLA 2X51A 5AQJB 2LP0A 3GZ6A 3KX2A 3HHHA 3SDGA 2QENA 5CKTA 1WHUA 3SFIA 2IS2A 2I5UA 4Y15A 3HKZN 1TLHB 2NW8A 3N2OA 1BOAA 3JRFA 4Y52J 1SHZC 3PV0F 3ZMTA 2ID3A 1Z21A 2LY2A 2KLOA 4HEA2 1B7TA 1XPXA 5ABGA 3JAEA 4L9JA 4RMNA 2CFXA 5E8IA 3T8OA 2KWHA 2Q2EB 3J81Z 1OFCX 3PNYA 4Y7NJ 4MTEA 4XRSA 1YKEB 4UVBB 3TLVA 3ZMVB 4XLAA 4KIGA 3T1BA 4XMYA 1IGNA 4JK1X 4H9RC 2H7OA 4GOUA 3CCLI 5IP6A 1LE8A 1H7CA 1R1TA 4PK6A 4HWFA 1K4TA 1F4KA 3H3MA 4AKHA 5E18F 3ZEFB 3JRHA 3FXLA 1IBMT 2L9SA 3OY9A 1UCUA 3BTCA 1E17A 2E5ZA 2QQBA 3GWZA 4A3JJ 2HTSA 1J0RA 1LRZA 2JT1A 3ZN0A 1YO5C 2FMYA 1FPQA 3BR0A 3JSOA 4UF0B 1XN7A 3CCMI 3LSTA 2I6HA 4D7MA 1ZLKA 2WAQN 5ABHA 3GTPJ 3HUGA 3EABA 3PUQA 3HPHA 2VKEA 3N97A 1IV6A 4II3A 2M7BA 4F92B 3N2GE 2P6SA 2PJRB 1IUFA 3WG7H 5EF6A 4L9VA 4KX6A 3O4XE 3S17J 1XGMA 3AXJB 2KT0A 3QWLA 4BHCA 4UUSA 2A6HF 3F8CA 2DXIA 2A6EF 3N9PA 2XQAA 5ERIA 5JHUA 4HFHA 2JPBA 5FVKA 2H6CA 1JNRA 2ESHA 3WHCA 1FTZA 1DPRA 5FB2A 3F6VA 3MZ8A 5LLQA 1T98A 3Q9VA 1FBUA 3GTLJ 2NOXA 3RI5A 1IN7A 5CYVA 5BNGA 3A7MA 4HWIB 2F5DA 4ESBA 2EV5A 3FK6A 2RREA 4V19K 3CJTB 1P9QC 3FM5A 5TRDA 5GADJ 2YU1A 4O6JA 2WCAA 2DI4A 1RR8C 2WS3A 2YS9A 3OWTA 3B13A 4ZXLA 2FSWA 1ODDA 1X1BA 4PSXA 1IBLT 2PG4A 2R6GF 2CQNA 3BZ6A 1OEDB 4X64T 1Y8RB 3D5LA 3HL6A 1Z3YA 4ZS3A 2WADA 1KYZA 1XNRT 1J9IA 2KNDA 1R4MB 1D8KA 2BHZA 4KN4X 1OCZH 3CCUI 1R1VA 1KGSA 4B8XA 3M07A 4BKXA 2C5KT 4BQNA 2LYCA 3S1NJ 1ZG1A 3CCQI 5LJNA 4IREA 4BY1J 2Y48A 1XCVA 4KDPA 3A8YC 3FMSA 2O0YA 5M4YA 3OL3A 2WAUA 2FU4A 3CLOA 3HXLA 4C2UA 4KJZA 4AUXA 2UWMA 1RPWA 5EK3A 5C8YE 2X1CA 4MO7A 5H6QA 3H0DA 3C50A 3EYYA 4IGUA 4CSWA 1JGGA 4V2FA 4G63A 2D0UA 2MGQA 1VZ0A 3FX3A 3HOSA 5BMZA 2LRKA 2ZJPF 2WU5A 1W0UA 2QUFA 2H1KA 1V9DA 3S3NA 2X0LA 3GBGA 3PURA 1X3WB 3JREA 5JFRA 2P0WA 2KFDA 4EQQA 3WGIA 1XDOA 2HU9A 1MMAA 2GXBA 2CXDA 1KONA 4UUSB 1YQ3A 2F6CA 2K27A 2W2UA 5L3FB 3JRGA 1SVLA 3M65A 5L47A 2ELHA 3TBIA 3ROUA 3GN5A 3K6GA 3HKCE 5E3MA 4CYCA 5ICEA 2HN1A 3LSMA 2R5YB 2OLTA 3CJNA 3PJAA 3ZMVA 4UNOA 2BZTA 3A02A 5L3EA 5HXHA 1KF6A 4U2YA 3FBIB 2MSYA 2KWIB 4X1YE 1J5ET 2DBBA 4HLYA 2LM9A 3U2RA 2LRDA 5JDHA 1MW7A 4S04A 4RB3C 3KP2A 5IHYA 1OR7C 3S3MA 1WFDA 3W2AA 4NXNT 2Y30A 4PSWA 4XKVA 1TT5B 1W0BA 5LYJE 2LBFB 4ZDOA 2LLKA 4E6KG 2V1DB 3F2EA 2L0KA 2PFVA 2FQ4A 2FUPA 2LBFA 3H35A 2K3FA 2J5OA 3ZMSA 2WMNA 3QB5A 4HFDA 2GIVA 4U2ZA 3TP3A 3I1AA 4YLHA 4XL9A 2DWGA 3BZCA 3IUOA 5FD6A 1ZG5A 2JA7J 4ZTFA 3LBXA 5IY5H 2V7KA 4CCLA 1YQAA 5B1AH 4EJWA 1YW7A 4WCGA 1I27A 3TDZC 3CO6C 3PO3J 1NAFA 1OXZA 1NH3A 1A6IA 1WYCA 2WWUA 3B5MA 4PJ0C 5D4RA 4W1UA 2K85A 1MNMC 4ILAA 4DMWA 3RPQA 2XAJA 2DA3A 2BKOA 3O3KA 2LVSA 4C9YA 2XPUA 1UJ8A 2IAIA 1O3RA 5LMNT 5EEGA 5H6QB 1QZZA 2LD5A 2P6TA 4IKFA 4A5NA 5CFBA 2X1EA 3ERED 1FSHA 1WJDA 2NWBA 3F22A 4PW8A 4DR3T 1S7OA 3BR6A 4ZOLE 5FL1A 1BM9A 1BL0A 2LT3A 1KZHA 2XAHA 1AA7A 2FRHA 3WTWC 3HOTA 2XUEA 4PK5A 4BXUA 2QLZA 3CMMA 4UV9A 4FX0A 3MKLA 4BDZA 2LSYA 4CN6A 5LXTE 3A03A 3WGGA 3AB3B 4CDGA 3A1YA 4JOMA 2K9MA 1FWZA 3U9GA 2HTJA 2V7JA 2R7SA 5JR9B 3C1DA 3MXZA 1S6LA 4DV0T 1USTA 3R60A 3GTGJ 3CQCB 2PJQA 5E1ZB 3A4CA 5ABFB 3CMEI 1FC3A 2X4HA 2Y8DA 1Y8QB 2E7XA 2X9YA 3N9OA 2N1GA 3FXJA 3FXQA 4I2OA 1N34T 3IRQA 2KIQA 3RJPA 3AE3A 1N75A 3QAHA 3F57A 2XIGA 1GVDA 2CQ7A 1RC9A 2W0GA 1AOYA 2VQLA 3HL2A 4BA9A 4UVAB 2ZM2A 5JREA 1ZN2A 3QU3A 2VXDA 3RZOJ 2FQ3A 4XSXF 4XOTA 2DPDA 1E1HB 4ZEYA 5LBQA 4A3FJ 2D1VA 1IW7F 2VVNA 3GWHA 3G3ZA 2L8KA 2LEHA 3EHZA 2WV1A 2IPQX 2QBYA 2L9RA 2VOOA 2J47A 2ECBA 2MAWA 1Y01A 5FXZA 5BS6A 4X1IE 4DR2T 2KRFA 2M9HA 3CVRA 3KV6A 5E1XA 3SRZA 2KHMA 1QA6A 4XOPA 2VOPA 2EZKA 5LB7B 2BEOA 4XONA 3DEUA 2DPUA 4AXPA 4IRGA 4ERRA 2ZKZA 1PVEA 2M4GA 2O8KA 1RNLA 4M6YA 3PUYF 3UULA 1HNZT 1O3SA 5E17F 1PP7U 4O5VA 2DU9A 4ILCA 1OCRH 1POGA 1OYWA 2VXZA 2CW7A 2K7LA 4GO1A 4P96A 3H3AA 4ZYAA 5FVLA 1L3LA 3LSKA 2LHRA 3L2CA 3F8BA 2M8GX 2BDEA 4YY3T 3E08A 3FKIJ 1WCMJ 4AISA 1H9TA 1SFXA 1W36C 3NARA 3GA8A 3HIFA 1T0FC 2P4WA 2HDCA 2ME0A 4HW0A 2WY7Q 4UF0A 3V4GA 1ZGJA 4G7OF 5J4VA 1N33T 1HKSA 1D8JA 2IGMA 3HC7A 1S72I 3TOAA 3ZPLA 3N9NA 4EJUA 5DCFA 3CUQA 4WWCA 2PX9A 3VSKA 1YJWI 1AWCA 1AKHA 3PDYA 2VUMJ 1E3HA 1XCBA 4EJOA 4ESJA 3N9QA 1LE8B 2UXXB 3ZT6A 3PUFA 2DMTA 2LDUA 1ZOYA 4NIQA 3O8HA 2O9LA 2CBIA 2KDOA 4MBQA 3P4SA 2DW4A 3G73A 4R8HA 1LPQA 3KDSE 2OA4A 3CP2A 1UZCA 1Z05A 2H94A 4GXOA 3ZT7A 4AQFC 1Y1VJ 1FYLA 4B3AA 5J1GA 2EIJH 2EA2A 1S9HA 2M34A 3OR1C 4WW0A 4HDVA 2XQ4A 4UIGA 1YLFA 1BW5A 4FX4A 5JDMA 4RLFA 2HWVA 3LNQA 4QXCB 4LD5A 4C3HJ 3VOEA 2G0EA 4DV2T 2YUSA 2DMNA 1JTYA 1GXQA 1ETYA 5J3LA 4NXMT 1MBGA 1YRNA 2MABA 4BJ5C 2RC4A 3F8NA 3S16J 1YYVA 1DP3A 1Y0NA 3FXUA 3TOBA 3A01B 3I64A 2BGCA 2NTYA 4YTMA 1XMOT 1HDPA 3KP7A 1IXCA 4UHTA 4BACA 3S1MJ 2E9XB 3UUXB 5DS9A 2HS5A 2QA7A 4GFBA 4LFBT 3F72A 2EWNA 4HQMA 3H9QA 1BOBA 2XRLA 1JXSA 3KZIC 4XLPF 3K4KA 3SDBA 1ZR4A 1TW2A 3K69A 2DO7A 3OIPA 1I1GA 2BG9C 3ZRGA 2V1UA 2VC1A 3LSPA 2DMUA 1VQ4I 3AA1B 3AG2H 1XZYA 2MTQA 1UX4A 3UUMA 5ICFA 1TWAJ 4HF0A 2JRTA 2DA2A 3ZT5A 2K3WA 3V8KA 5L3FA 3RIUA 4PDKA 2LOOA 1BIBA 4BQAA 3MZKB 1OEDE 3JRBA 2L9VA 3FWEA 3F23A 2VJ4A 5AQMB 5FLXK 4A5MA 1VI0A 4IIJE 5DABA 2RN7A 2CA5A 3GW2A 4A3DJ 3CDLA 5ILVA 2ISYA 3VYTB 1OYYA 3ZR8X 5LCYA 4KBMB 1BR0A 2LSOA 5F0HA 1WSUA 2NVXJ 4L0ZB 1ZK8A 1N32T 4HTEA 1U9NA 4YIFA 2DLLA 3N9MA 5DUIA 2XQ7A 3UU6A 1T39A 3PNTA 4DR1T 3K2AA 2Z9OA 2D0TA 3LDQB 2I10A 4K0UA 3R6NA 4XN3A 2JVHA 1STZA 2E1CA 4IHVA 3I9YA 4EAHA 4DV4T 4KMUX 2XQYA 1R7JA 2BE5F 3MK7C 4H0EA 2V1XA 2N9DA 2XV4S 4XKBA 3RYHE 1YX5A 3GF2A 5ICCA 2A3DA 3P4PA 5CLSA 3WAJA 4O8SA 1W7PB 4CCMA 4V2GA 1R5GA 1RESA 2V79A 1Z3XA 1UHSA 3S2WA 1MGTA 2BVLA 2EILH 2J1DG 4O4IE 1SD6A 4B3TT 3X2QH 4BH9A 5IP9J 5LFAA 3CTAA 2YDSA 2EINH 2RAEA 5JQGE 2BBJA 3CUQC 2CW0F 2WB5A 2Q9QA 3GX4X 3UFGA 3HSRA 4ZC3A 3M3ZB 3D5RC 1XSXA 3ZN0B 1FYKA 4L5IA 2XAJB 5TGTA 2OV9A 3H3UA 4AIHA 1BI0A 3PFYA 4FE7A 4FHTA 5D5UB 9ANTA 4H9PC 3L2WA 4CN1A 2UU9T 2QF7A 4GCVA 4EEBA 1TC3C 1JHFA 2JQ7A 4UV9B 2HPIA 4AVZA 2HZDA 3E0ZA 2A9UA 2W63A 4XSZF 3EPZA 4G12A 1MSFC 3VEPA 1YW0A 2ME6A 2WAFA 4RLQA 4LLNA 5FLXZ 2DMPA 3OL4A 5GAEJ 4JX5A 1GT0C 4ZS2A 3QODA 5CA1E 3LBXB 4CI3B 1FOWA 1MBKA 2G7UA 3TP0A 4WXHA 4NHJA 1JKRC 1HXDA 5GP9A 1KQ0A 1FP1D 5IP7J 5EZYE 1R49A 2CUFA 3RIAA 1F1ZA 2HXIA 2CLYC 2M45A 1CQTA 1TQMA 4EM1A 3L2QA 3TLWA 4E7JA 2KRHA 3EYIA 5GPCA 1XG1A 5HXSA 3CJRB 4OU0A 4LIVA 5J40A 1WJFA 1Z77A 2RDPA 4BHPA 4DJAA 2UUZA 1XMQT 2MFZA 3S93A 2XUBA 3B02A 2VWAA 5DDGA 4HN9A 2H8RA 2DI3A 5KHDA 1IAWA 5DD8A 3PM1A 1IXSB 2IJLA 4UV8A 5HXCA 4BE1A 2Y9YA 4X20E 1Z1DA 1WR6A 2V26A 4D5FA 4L9NA 4CHUA 3QOFA 4AIJA 5J6XA 2ZBKA 1US7B 2Y0MA 1ZLJA 3VU7H 4V1Av 4EEFG 3O6BB 3S1QJ 4UXNA 3MKZA 2M7AA 2C0SA 3WTZA 4EM2A 2X66A 1I39A 2BVMA 3C3WA 1YW8A 5DM7F 1DDNA 2DA4A 4FETA 5BR8T 3V7CA 3CCYA 4F55A 3MA9A 2WMOA 4JBAA 4PFOA 3TLUA 1I3AA 3ZSTA 1ON2A 2O8XA 3AG4H 2XSDC 4JBWF 4UVCA 3HOYJ 4NPPA 4EEDA 4Q4ZF 4KISA 2H1LA 2Z16A 4O4LE 3BG6A 4D5CA 3K0LA 4N4NB 2ZNZA 3UU3A 2UXBT 2ZXIA 2V1DA 3I56I 4UUTA 2XQ8A 4B48A 3CDIA 1XMXA 3H36A 4M73A 5IOYA 3S4UA 3OYIA 2HOAA 2RPAA 3LA7A 2QRXA 3RKWA 4XN0A 2KXPB 2Z99A 5J2TE 2BG9E 4LF7T 1FT9A 2F4MB 4B6XA 2ICWG 4FQGA 4BEHA 3JCFA 4ASNA 1SD5A 2QBYB 3FXEB 3WG9A 2KDZA 4XRFA 2Q9QB 2RNGA 2VK9A 4EV6A 5HAXA 4QX8B 3MWMA 1JJ8C 2YOEA 3C4WA 4HAMA 2CMPA 1RRJA 5AQFB 4AYBN 3FXKA 1I94T 3K4LA 2JQHA 3LSRA 2HH7A 1QVUA 2E2AA 2YDRA 4QKNA 2EH3A 4FT8A 2A69F 4I0BA 1D5YA 1NK2P 3JRIA 2F4IA 2R3SA 2LF8A 1YJ9I 2XKPA 4F7ZA 4XLHA 1WJBA 3K4JA 4ZTJA 2HOTA 4AQYT 2QQ9A 4YSYA 5CVUA 4E7HA 2FJBA 2XHKA 1TQIA 1ZP0A 2B63J 3PNVA 5AQTB 1IN6A 3RRWA 1QHGA 2RKHA 4G94A 1ZKEA 2LLYA 2XAGA 3HKZA 1YOVB 1E2AA 4JI5T 4QH1A 3AE5A 1OWAA 1USSA 4M3BA 2F2EA 4DYCA 3ZN1B 1VQ7I 3CMLA 1U3EM 4ILBA 3EETA 3E1SA 2LOPA 1N78A 2E9XD 2NNNA 1YIOA 1FMVA 3H92A 2O5RA 2XF5A 2MH9A 4HKAA 2E1MB 3FIWA 2MPKA 3E22E 3MACA 2IGOA 5EK2A 2NOJB 4KT5C 1SVMA 1VRBA 3BR3A 2JQKA 2WWYA 4BE0A 4KFCA 2KINB 3MKDA 4JEHB 4AQGA 5F1RA 5TAOA 1YKHB 3DFGA 3HTSB 3HSEA 1OEDA 4CXXA 2RVCA 5DJQC 4E7LA 1Z6RA 3RX6A 5FLVA 1VQ8I 4I09A 3U1DA 2NW7A 3E97A 2X67A 2DT5A 2FOWA 5KVRA 4LJZF 2E35A 4UR9A 3ZQFA 5H20A 3ETUA 3RYCE 3W15B 2DJNA 1JT6A 2WAQA 2B7EA 4DYRA 1X2MA 1W5CC 2ZFWA 3M9AA 5KXJA 5E79C 3JRAA 2OA5A 3CJQB 4GK5E 2Y75A 2DAOA 4EMSA 2M0CA 5B5EC 3K70C 4MEYF 2KP6A 4A12A 4BE2A 3FXMA 2FMLA 2W7NA 3A01A 3FXOA 2FNPA 2Q8KA 3FZVA 3ZJ1A 5LRSA 3CESA 3PE0A 3Q5WA 3VR8A 3OMYA 3C51A 3PJRA 1P4XA 3J7ZI 2CSOA 2HYFA 2D2SA 2M4KA 1OCCH 2GOMA 5FRNA 2FUG2 3GZ5A 2KLQA 2MG4A 4A0ZA 4I55E 3IEEA 4JYKA 2JVGA 5FY0A 3CIRA 1TL8A 3TKLB 4PK4A 1K7AA 4M71A 5EZGA 3R4KA 2HEOA 1ORKA 3A5XA 2HPLA 5JDGA 2UUBT 1ZELA 3IHUA 1FIAA 5LEJA 5C3JA 4S05A 1I5ZA 3NZQA 4QPOA 2GK9A 3IAM2 5CQGA 4PZJA 2YK0A 2Y6XA 3AE8A 3IA3A 1OCOH 1YITI 3AE6A 3EDVA 4F8HA 3ESLA 3ABLH 3LK3B 3P5JA 2QSGX 2XRNA 4X5TA 1E3OC 3NRYA 4I6ZA 1HF0A 3PU8A 5LHGA 2NS7A 1LFUP 3OIOA 3IKTA 2WZHA 4EZHA 2PMUA 2JIWA 1B59A 5ILUA 2DYRH 4DVDA 3MVPA 3B73A 2O03A 2IS1A 1NWMX 4IJAA 2R7XA 4CXYA 2JPCA 3HM5A 1HCIA 3R6SA 5K7FA 1JJ6C 4B44A 3ML6A 4AWXB 2HDDA 2R7ZJ 2WDRA 3OBVE 4EYYR 1U2WA 1B72B 2OTJI 2XSBA 4A56A 4MFDA 1AHDP 5JDNA 4MHCA 3FXRA 4EATA 1D3YA 5H6RB 3HOWJ 3LSHA 2GXGA 4EV0A 2E2IJ 5IPAA 4U7YA 2W61A 1W5TA 2P7CB 1WGXA 2E71A 2E2HJ 2IT0A 1W7PA 2XAFB 4EJVA 4IXAA 3ZQLA 2YX4A 1N36T 2JSPA 2XAQB 5FXWA 3MCZA 4U7BA 3H5NA 2XVCA 3PUBA 3M1EA 5DTDA 2X1DA 4XLFA 2KT9A 2L5QA 4P9UA 2WB1N 4J19A 1B6AA 4TWDA 2JMWA 2QSFX 2R7OA 3G2BA 4X1KE 3UT5E 3MKWB 3JC6C 1UAAA 3ZLIA 4OK0A 5F0CA 3ZQHA 1XDSA 2V6CA 2Y2ZA 3OYFA 4P1WA 2ISZA 3RRCA 3R61A 3JC6D 2P7VB 3M3YJ 4UEMA 3IWZA 3W3CA 4C3JJ 4U0WA 2CO5A 3I53A 1YX3A 3KP6A 3CC7I 1F43A 4OHFA 3CC4I 1HBXG 3OPCA 4IDZA 4KHZF 4ZI2D 5HDGA 2ZMEB 2JA6J 5D6EA 4ENJA 2H89A 2PEXA 2X9DA 3RKOA 1HQCA 2VPRA 2Q0OA 4MEXF 3BROA 1EZ3A 3A0HC 4ZZBA 1Z6TA 1JUPA 5L3BA 1WH5A 4FE4A 3J7AO 1D0ZA 1ETXA 3RQIA 3HOZJ 1R1UA 4Q47A 1FTTA 1ZYRF 2HDWA 1P4AA 2V7MA 3I0OA 3SHFA 4BEHB 5ADXL 3GFLA 2DDBA 1P92A 4HF1A 4ENMA 3T0YA 1LJ9A 4YHHT 1Y64B 5FP3A 2EQRA 3S32A 1TW3A 3O8GA 1R5ID 2FOKA 5KNLA 3CPZA 3FBNB 4FASD 2P8TA 5M3MJ 1XS9A 1J5WA 1IG7A 4UV8B 4M3EA 5LHHB 4Q48A 5IUXA 4X66T 2L4AA 3BQYA 5AQLB 1BC8C 4A3KJ 3KEQA 3WTVC 3TO9A 1XC5A 3KP3A 3TW7A 2ID6A 5JLWA 2HPJA 2VT2A 2BKPA 4Q5SF 3LK42 3UUNA 1JKPC 4O2AE 1X1DA 3G1OA 2WV0A 3ETVA 1PJRA 3UFEA 3Q3SA 3RC8A 1LDDA 5LJMA 2ZO4A 3M8JA 3RPUA 3M4OJ 4IL9A 5L3EB 1WJEA 4AU7A 1YIJI 3QP5A 4DR4T 4RAFA 1YS7A 3IRRA 1FZPB 1ZARA 1ZH5A 2OC6A 3DEEA 1E2XA 2BW3B 3PFIA 2X0HA 3LAPA 1GXPA 2ZMAA 3K3QC 2F5EA 4DW6A 3KLNA 4KP3C 1Q1HA 3WHBA 2K02A 2LR8A 4B47A 3RH3A 3DJBA 2UXCT 4AKLA 4JP0A 1SMYF 2YINA 2XF6A 5AQPB 4IQ4A 1EJ9A 3SWHA 2EFQA 3F8MA 5J8CA 5FROA 1LDJA 2CLYB 3J7AY 1YXRA 3FBLA 3AG1H 4BGDA 5HXRA 1WI3A 1MKMA 1VFCA 1C0WA 5LGUA 5DM6F 2XTLA 3B6AA 1LFBA 4HGAA 3FF5A 2Z33A 2KJBA 1JUMA 4XNFA 2PI0A 4M9XA 2PJPA 4DUYT 1Y56A 2FD5A 3WTYC 4Z8XA 4A2UA 2LY1A 5F64A 4I7HA 2XHEB 4H9OC 2R5YA 1D1CA 2YU2A 4LMKA 2XGCA 3ASOH 4OYKA 3OV8A 2CRGA 3F6OA 3SZGA 3QK6A 5F8PA 4A98A 1IO2A 2KPMA 3AEGA 4XKWA 5JRCA 2HYGD 3K4NA 5D6FA 1D5VA 1X58A 2PMHA 3DTIA 1DU0A 2OV7A 2PMZN 1UUSA 1HR0T 2JMKA 1WLXA 2M6BA 2VPLA 1FEXA 2IA0A 4RGXA 1V5FA 5HEJA 2BV6A 1SUMB 2E2JJ 2CHNA 1IDYA 1JNZA 2HGCA 3RIFA 2VASA 4DYQA 4IE0A 5LNKA 2XQ9A 1BR4A 2VQGA 5JR3A 1ZEEA 3I9WA 4BBRJ 1JKOC 5HCMA 3WGHA 2KZ7B 1YW9A 3K4BA 2ELJA 4BY7J 2CFOA 2NAZA 2OAZA 3B6CA 1CGPA 3IHRA 4O4HE 2XPVA 1TWHJ 4S0HB 4J01A 3OYLA 3OS1A 1PP8F 2IP2A 2YN6A 3SJMA 4NUUA 3B57A 3W6VA 1ZRDA 4IVNA 1GUUA 4UVAA 2DOAA 2A6TA 2DJIA 4MHGA 2CH0A 3CD6I 4LB6B 1SANA 3MKYB 5E3NA 1YQ4A 3IKVA 4DR6T 3BG3A 3RIRA 1R5HA 1P2FA 1TT0A 4I99C 4F52A 4J00A 2LTPA 4IL6C 3NWSA 4F6RC 3TO7A 2KJCA 3J7Yq 1N77A 4U72A 1S8NA 4RM2A 4CZZB 3H9GA 2W62A 2X0LB 2OZUA 5TISC 1BBYA 4XICA 2QYWA 2XJ7A 4XLNF 3OYEA 2NR4A 5LG3A 3GCMA 2KZGA 4LF8T 4ILUA 2F5FA 3H5AA 4GYGA 3OYJA 5J1YA 2A05A 4W97A 1A5JA 3GFIA 3ANWB 5BMVE 3AAEB 3OYGA 3W2VA 4NC6A 2F4VT 2JMHA 3SEQA 3KCCA 1BN5A 4H63H 3VKHA 2XZEA 3SYTA 1VQ9I 3DQVC 1J59A 2K3PA 2ECCA 1MH3A 2VBWA 3NWTA 3VDXA 1E3PA 3NZPA 4XAXB 1MIVA 2GA2A 1X1AA 4IHJE 4KMFA 3PSIA 3C64A 4QH5A 2JA8J 1FX7A 1FP2A 4ASKA 5AIQA 1WR0A 1IJ5A 1BI3A 2VBZA 2MBGA 4M3FA 4YJ2E 3BY6A 3CF2A 4A6EA 1IXRC 1B72A 1LB2A 2E1NA 1NK3P 2D5VA 1ULYA 4LF9T 4JX4A 3DTKA 4DO0A 2WY8Q 3Q2MA 3UTKA 1Z91A 2WQYA 2XKOA 4AQFA 1T38A 3RCOA 5C4XJ 1QZYA 4C91A 1F36A 3HI2A 4PCQA 3ZXSA 4KYWA 4LMLA 3ZMUA 4WBNE 3I5UA 4FCYA 3D1NI 2VL0A 4MGRA 1HSTA 1FIPA 2X6OA 3ZQQA 4RB2C 1R71A 1JTXA 2LKHA 2BY3A 2LRLA 3EI0A 2UXXA 2YU9J 2FF4A 2EV6A 1RETA 2Y31A 1IUYA 1SA0E 1Z0XA 5LRRA 5FGMA 5AQQB 3EAMA 2G7HA 2EA4A 3HDDA 4GIWA 5JVGF 3D5SC 2ODUA 4HZFA 5AQNB 1ETOA 1HW5A 2DCFA 1O4XA 2DA7A 2V6EA 4IF4A 4D7NA 3CC2I 4CZCA 2DA5A 2IC6A 2HI3A 4C2MJ 3Q0VA 1VCTA 3IP4B 4XLEA 3FZLB 2MBFA 2KIUA 1W0AA 2BS3A 3I59A 1T8BA 1UHMA 2A07F 1LVFA 1CF7B 1G3WA 4LG0B 4MFEA 3FB2A 5LG4A 1KA8A 4YHJA 2IRFG 4TNWA 3ZC0A 2LE8A 1P7JA 3OYKA 4RAYA 1BI1A 2BYVE 3VSLA 2DL1A 2DA1A 4BAYB 2RGVA 1X1CA 1ZHCA 4CA0A 1Y0UA 2TRTA 2CQXA 3VPRA 1O57A 2DTRA 2GQQA 1U8BA 2D2WA 2NS0A
chains in the Genus database with same CATH topology
3KP5A 3EVYA 1IRGA 3P7IA 3PUGA 4DQ2A 1D0XA 2RQPA 3BQIA 3MZYA 2VODA 4YFKF 4AI6A 3ZMZA 1UB9A 4FI5A 2AS5F 3V8LA 1HW1A 5CVJA 3J9X1 3CO7C 3DPTA 3LG7A 3HKBE 2HOEA 3ZQ7A 2GA1A 4CICA 4B09A 2Z3YA 2STTA 1G3SA 4OIQF 4AD9A 5J8FA 1I1SA 4N0BA 3ZMUB 2OBPA 4NUVA 5D8LB 5DD4A 3Q5XA 2H27A 5LP6E 4LLLA 3GLXA 3IF8B 2JPFA 1LQ1A 4EJTA 5CVIA 1LVKA 1QGPA 1MDMB 4L18B 4O2BE 4JLEA 1S3JA 4QWQA 2QYOA 2OD5A 3ONXA 2Z5UA 2CXFA 5L3GA 4E7SA 3R0JA 3ELKA 5E0OA 5JDLA 2FEZA 3IC7A 1XSVA 3F31A 3MJXA 5HDNA 3JW4A 3RDIA 2ACXA 4WF2A 2CEAA 1Z9CA 4KICA 2DQRA 1U8RA 4KNYA 4CQIA 3EDPA 2DK8A 4A0XA 1KNZA 3ABUA 2ZJ2A 2VE9A 3D0SA 5K1YA 4QLCU 5CA0E 2K24A 3BWGA 3FMRA 4HA8A 2UZKA 3WAKA 1MMNA 2X9XA 1IAPA 2Q9QC 3C18A 4ISTA 4OIOF 1PUEE 4OIRF 2HKXA 4ISSA 2SPCA 1F9NA 3T5XA 4G7ZF 3I59B 4PJMA 5LGNB 3W6KB 3QUJA 2LOSA 1LDKB 4L9TA 1MZBA 1IN8A 1QUUA 2Q9QD 2K4BA 1TTYA 1MIYA 3OKQA 1K78A 1O3QA 4RAZA 2PG8A 1G4DA 5DQVA 5FXVA 1IN4A 2QGSA 3TGNA 4EB6E 5L3DA 2W25A 5HLIA 2PQ8A 2VC0A 2HKOA 4GYIA 2KIFA 3V5SA 1YG2A 1HKTA 4RGUA 1R58A 1QPMA 4FJOA 2K5BB 3L00A 4U88A 1LEAA 4AKGA 1S7AA 4RB0A 3RC3A 1OYIA 2Y48B 3P9CA 3F3XA 3P8CD 2A68F 3ECHA 2P5KA 1HKQA 3GUDA 3HRUA 3LJCA 4DBRA 4ON0A 4WX9A 1BIAA 3H3ZA 4H63V 4L5GA 5FMNA 2MLKA 1SMTA 4ETSA 1XDUA 4OINF 2XASB 5LHHA 2L02A 2DHRA 1P4WA 2CWYA 2YX7A 1UHWA 4HBLA 2M1BA 4CGZA 2DWKA 2RNJA 2CE7A 3M7GA 3ISPA 1FNNA 4HYEA 1S29A 4GGGA 3HKEE 4M6XA 4LGWA 3BJ6A 1LNWA 3Q5FA 2CYYA 4TUYE 1Z7UA 4E7ZA 2HQNA 2E8IA 3VKGA 2TDXA 1UX5A 5L3BB 3TKYA 2MLGA 1BI2A 5HS9A 2ZXJA 1HF8A 3BQLA 5L3GB 3KZZA 3R0AA 2FBKA 1W4MA 5DCMA 4IE4A 3KP4A 2YU3A 1LEBA 3LA2A 4U0VA 3BDDA 1U78A 5HOOA 2NRAC 3O1IA 2ETHA 2KIMA 5D8KB 4I98B 4I0AA 1XGOA 4KIBA 4DNCA 2LSGA 1OKRA 3F8FA 5HS7A 5LA6E 3D0TA 3NEUA 3Q9DA 3KBTA 3QOPA 3FBZA 5CJ9A 2MYSA 1DP7P 3PU3A 1AJ3A 2J5PA 1B4AA 2W85A 2ACJA 1MDMA 5HWYA 3GMIA 3ZCJA 2E9XC 1KK7A 4M9ZA 2IVMA 3OYXA 4QWNB 4EYUA 1O3XA 1QQIA 2XAQA 3HYIA 2DK5A 3EUHA 2L3DA 2O61A 5FFZA 4L0YB 2ZNYA 1D1BA 5LHGB 3C4ZA 4G6QA 2WSSV 3O9XA 1WKMA 2VKDA 4LB5A 1FBQA 2LHNA 4WXDA 5E1WA 4XBFB 2V7IA 3KLOA 4KIFA 3BK9A 1TNTA 1X3UA 3ZMTB 2EHOB 4YFSA 4N9HA 2P5LC 3CX8B 3J80Z 3REOA 4P09A 4UXNB 3V7RA 3AA6B 1B9NA 4LFUA 4ZYEA 3JTHA 1HTJF 1RI7A 2W84A 3O1HA 2EFNA 5AIPA 2C5JA 4MQ9F 2XROA 4ZI7E 4LK1F 5AFUL 2VBXA 2G9WA 2V7LA 2A72A 4MTDA 4H9NC 4EVIA 3CWZB 1EV7A 4WK8F 3P9KA 4IE7A 2WBLA 3AAAB 3OYZA 3JTGA 2LSKA 3KBUA 3IL2A 3ZYKA 5JVDE 3TO6A 1EH6A 1KQ9A 1J7KA 3DXJF 2NNYA 3C7JA 2P9BA 1SAXA 1HSJA 3AVSA 1RUNA 3ZYMA 4EZ4A 5K5OA 4IPAA 2UXNA 3WODF 5A1LA 4J2CA 2Z6EA 1R22A 3ZN1A 1FEWA 3I58A 3R84B 2QWWA 1U5TC 3DP7A 1HW2A 2N2NA 3KE2A 2LSJA 3LFMA 3LWFA 3RKXA 4UUVA 3U78A 3VHLA 4MALA 1ZAOA 4EOZB 4LK0F 2DNXA 1MD0A 3KINB 2QM3A 3RYPA 5BQTA 5GONE 4RGSA 4LLGF 1U5TB 5D5VB 5D5WB 2QZ8A 1ONVA 3SZPA 5KX5E 5FXXA 2A61A 4CXWA 2V9VA 3K1PA 4HE8A 4QXHB 4AVPA 1KYWA 4ADZA 4I02A 3ULQB 3FXDB 2CG4A 3CKDA 5CB4E 2IA2A 3JSPA 1EH8A 4TV8E 4P0AA 3L9FA 2EHOD 1RZ4A 2ZCWA 3AAIA 4LG0A 2LNBA 1VTNC 2ES0A 1UCRA 3NQOA 2W00A 2STWA 5L2LA 1J2XA 1A04A 4YIIA 3RYIE 3W6JB 4N9IA 3ZCIA 1B9MA 3FM3A 1IF1A 5LEKA 3CX6B 4OIPF 1ZREA 4UVCB 3AAFA 4U74A 4CI2B 1FIOA 1G3YA 3ZMSB 2CWEA 4OFZA 5HS8A 5JR9C 1K79A 1S35A 3GO5A 4YFXF 2VN2A 4P9FA 1IN5A 4G2AA 4I50E 1LVAA 3BJAA 5JI6A 3QRFF 3IBPA 1RIOH 4GYSA 5HLHA 1ZRFA 5EK4A 4PNIA 1S94A 4H9QC 1IJ6A 5LGTB 1J5YA 1T2KA 4I01A 5IYZE 2NW9A 5DYMA 3SOLA 1ZG3A 1XD7A 4EXTA 2L9QA 2OZ6A 1KU7A 3BJOA 1K6OA 4ZZLA 4EGZA 2VE8A 2LKPA 2YSRA 2IW5A 4L0ZB 5A2QZ 3AA7B 2FBIA 5F6FA 5JVTA 1TNSA 4CO8A 1YFHA 2P5VA 1XB4A 2M8EA 5BPDA 2BZBA 3U3IA 2MD5A 3HHGA 3E3VA 3QPHA 2M30A 1L0OC 2OQGA 3P7NA 4P55A 5ETWA 1FY7A 2ADUA 3VB2A 3RI4A 4BJMA 2CM0A 3QU6A 3MFKA 3COAC 3VODA 3GYHX 1FOKA 1O7LA 4D0PA 3K3NA 3E5UA 2NTXA 2JQQA 2CQKA 4A0YA 5JDFA 3ZMDA 2K48A 4M74A 4MNUA 4HF2A 2IA1A 4CZZA 4TV7A 2EB7A 3C4XA 3GFMA 2HFHA 5JDQA 4ENKA 2GAUA 3K1MA 4HV6A 2ZMEA 5FO5A 1CUNA 3ECOA 2HQRA 3T8RA 2E9XA 1LKXA 3L09A 2ZM0A 5FD5A 2IW5B 2FBHA 4UELA 1QNTA 1W7PD 1MMGA 1G3TA 4ZYHA 1R23A 4AIKA 2RP4A 5E20A 1BR1A 3LA3A 2FNAA 1MMDA 2FXAA 5BOXA 1ZV4X 4ANJA 5JH7E 2VB6A 2YEVC 2NP9A 2O6GE 2XGXA 3ZPOA 2PBIA 4PAGA 3I4PA 4HFVA 2X9HA 3K3OA 3ABTA 4ZYDA 5JRCB