3EUHA

Crystal structure of the muke-mukf complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
315
Chain Sequence
VPELVAWARKNDFSISLPVDRLSFLLAVATLNGEMSEGELVDAFRHVSDAFEQTSETIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome partition protein mukF
publication title Structural studies of a bacterial condensin complex reveal ATP-dependent disruption of intersubunit interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 121
structure length 315
sequence length 320
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3euhA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3euhA02
1KYWA 4KMFA 4LD5A 1ULYA 5IT3A 1HW1A 2GWRA 2HTSA 4Y17A 2XIGA 3REOA 4G7ZF 1I6XA 1ZG3A 1I27A 2Z9OA 1PDNC 3MCZA 3ISPA 1OKRA 4XLPF 4RB1A 2H6CA 1R1VA 1GVJA 2OZ6A 1Z6TA 5L3BA 1OMIA 3HSRA 3LWFA 6PAXA 2XASA 3R0AA 4CYDA 3ZMTA 2BEOA 1ZG5A 2Y0MA 2DQRA 1QZYA 4XSZF 1FYMA 1ZH5A 2EV6A 5E1WA 2TDXA 2RV8A 1ZYRF 1J2XA 4UVBA 4G7OF 1ZN2A 1X3UA 3GO5A 1IN8A 1USSA 4EJTA 2ZO4A 1QPMA 2L01A 3T8TA 3DKWA 5KK1A 2EWNA 1WSUA 4BAYA 4HLXA 1PP8F 2VBZA 2QQBA 1OYYA 2J5PA 5L3GA 3DFGA 2FF4A 1KQ9A 4HDVA 1FP2A 1HXDA 1KU3A 3TO9A 4RAZA 2HKXA 3GFJA 2EA4A 4YFXF 1HKTA 1FT9A 4EJUA 4MTEA 2E7XA 3V8KA 3FXQA 3RTRA 5LHIA 2EJRA 3BJAA 4B09A 1ZRFA 1IN6A 1BJAA 2XUBA 1SD4A 4Y15A 2QBYB 4OMYA 3VOEA 4LGWA 2WV0A 3KP5A 3JSOA 4R8HA 4XLNF 3QPHA 3R4KA 5J8CA 3WTYC 2EFWA 4BHPA 1L3LA 4DQ2A 2LF7A 3RKYA 3G3ZA 4MEYF 1W7PD 3HTUA 2K27A 1D8JA 4ZZLA 1S8NA 1G3SA 5D5XB 2NS0A 1TLHB 1RZ4A 4FX0A 1T0FA 3ZPLA 1YW8A 3H92A 4M73A 3FX3A 3W6JB 5EEGA 2MLKA 1J7KA 2V1DA 3GUDA 1O3SA 1A04A 5DD4A 4Z2YA 2VE8A 5L3CA 1YW9A 1MDMB 5K1YA 1IN7A 3RKXA 1MGTA 1B9NA 5CVVA 1LDDA 5D5WB 1XN7A 3HRUA 2XAHA 5ERIA 1YS6A 2VE9A 3BJOA 2H09A 3N4MA 2M5WA 2QVOA 5L3FA 1G3TA 4P5OA 1P4XA 5ILSA 3DXJF 4MNUA 2DPDA 2W24A 4R1HA 3EYIA 3DV8A 4I7HA 3NQOA 5FB2A 1K78A 5EEHA 5HDGA 3WGGA 1GHCA 3V7RA 4M6YA 4AIJA 2G7UA 1JGSA 2A3SA 3WTUC 3QAHA 1BOAA 2MC3A 1LDJA 5E8GA 3F3XA 4HZFA 3IRQA 3MWMA 4LB6B 4ASNA 1H9GA 4I0BA 2XROA 2Z5UA 4UV8A 5FLXK 1MJAA 3M7GA 2HZTA 4RGUA 2GXGA 2IJLA 3CUQB 4OIRF 2XAQA 3FXRA 2ADUA 4WK8F 4MGRA 3GF2A 2ELHA 1XB4A 4CZZA 3WTZA 4KDPA 1STZA 2P5KA 4HQEA 1R7JA 2BBYA 1IAWA 3DPLC 2EA2A 3PQJA 4KIFA 5D8LB 4MQVA 2J5OA 2G7HA 3I71A 3ZMZA 2LNBA 1FC3A 1TQMA 3C7JA 4LK0F 2GXBA 4XSXF 3HHHA 5HLIA 4IRGA 4U7DA 4L5IA 3B73A 4M6XA 5D8KB 3F8MA 4OMZA 4B8XA 1I1SA 2KKOA 1FPQA 1J75A 5D5UB 2WC2A 3GWZA 3U2RA 2FSWA 2PI0A 5JHUA 2NAZA 4JBAA 1XD7A 2RGVA 1FBQA 4G8XA 2KJCA 3ERED 4HDUA 3ZMDA 3RYPA 4HLYA 4FHTA 2HR3A 2M1BA 1MJ9A 2VT2A 2DK8A 4MEXF 3KZZA 1ON1A 4A2UA 2DPUA 3LAJA 1BC8C 5CLSA 2RKHA 5FO5A 2JRTA 1B6AA 2EV0A 1LQ1A 2F2EA 2KJBA 1PP7U 1O7LA 5J6XA 5ILUA 3MAJA 3LA3A 2IA0A 1BM9A 3IKVA 1FSEA 4L9VA 3WTVC 2D2WA 4EJVA 2VBXA 3FM5A 3WGHA 2PN6A 3F6OA 3TO7A 2HYGD 2L02A 4LG0B 1R23A 5BQTA 2RNJA 3KP2A 1XMAA 5AIPA 3JW4A 1XSXA 4AIHA 2CGPA 4ZYHA 3GLXA 3OV8A 3KP7A 3T0YA 3IWZA 2NNNA 3KEOA 1K7AA 1R00A 4MTDA 4A5NA 1SD5A 2NYXA 4QWQA 2HQNA 1RI7A 2QM3A 4PCQA 4ESJA 4AVPA 3QOPA 2Q8KA 1CF7A 3JTGA 4UVAA 2FMLA 2DK5A 1Z1DA 1S3JA 2MH2A 2E7WA 3O2PE 4HAMA 5ICCA 1FSHA 2DQLA 4A0ZA 1HKSA 1O57A 1Z6RA 3BY6A 4IPAA 3SHFA 2GIVA 5JFRA 1WRJA 3L7WA 1YLFA 3QU3A 2VOPA 4IJAA 2L4MA 1B9MA 2CG4A 3BROA 3TGNA 4KT5C 2PMUA 1XDUA 1YQAA 2GA1A 4EGYA 4RB2C 3GFMA 2R7DA 1ZRCA 1U5TB 4HBLA 2IRFG 2L54A 2X4HA 3KP3A 4IXAA 1FYLA 1O7FA 1ZLKA 4JQFA 1U5TC 1SFXA 2OBPA 3K9TA 1DUXC 4Q4ZF 1E17A 2PLYA 5ICGA 2IP2A 1RNLA 3E5UA 5DCMB 1D5VA 1BIBA 2STTA 4I98B 3CO6C 2V79A 2HEOA 3V4GA 2YX4A 1K79A 3SFZA 2HTJA 3HIFA 1EV7A 1W7PB 2HQRA 2O6GE 4U88A 3I59A 3ZQ7A 1GXPA 1IF1A 4G94A 1QBJA 4L9NA 4N0BA 5JR3A 1FX7A 3KCCA 5FLXZ 2XKPA 2L4AA 4HX4A 3E6BA 2VC1A 3EQLF 3HYIA 1KA8A 2K86A 5AIQA 4ZH4F 4Q48A 2YSRA 2ZXJA 1TNSA 4RAYA 3L09A 1UHMA 2L3DA 1BI0A 5J8FA 2P5VA 1F9NA 3F8CA 3JAMK 3LQQA 4KMUX 2JZYA 3V8LA 1S7OA 4N9IA 2HKOA 5JI6A 5K5RA 2VONA 2ETHA 4ZYGA 1IRGA 2CO5A 5E17F 4WXDA 2RC4A 2PMHA 3FM3A 2XVCA 3BDDA 1TW3A 3KE2A 4A12A 3T8RA 2P7CB 2DLLA 3F6VA 3IRRA 2K7LA 4ENNA 3QU6A 2V1UA 5F6FA 2JPCA 4KNYA 2O61A 4HQMA 5E20A 1V3FA 3P9CA 4ESBA 4I01A 4G6DA 1SD6A 2DU9A 3CLOA 2EV5A 3K1PA 3H3UA 2K4BA 3SZPA 2VXZA 4WXCA 3RI4A 4YFNF 2YR2A 2A5YB 2FU4A 4HF2A 3BP8A 3P9KA 4EJWA 3FXUA 4P9UA 2XGXA 4I2OA 5FD6A 1TNTA 3B02A 5BOXA 4CGZA 3NRVA 4BH9A 3LQRA 3I0TA 5HDKA 2PG4A 5TRDA 2O0YA 2CYYA 4M9XA 3RJPA 1WWXA 5LBQA 2G9WA 4KIGA 3V7CA 2ZCWA 2PFBA 3KFWX 3VFZA 1R1TA 4L5JA 2O3FA 3WTSC 2D45A 1YW7A 2IT0A 2F5FA 1R22A 3EETA 1SAXA 4N9HA 2H27A 4ENJA 1ZGJA 5E1XA 2Y48A 3WODF 2XAJA 5D5VB 3Q9SA 3QP6A 4GYGA 1O3QA 2JT1A 4A0YA 4KIBA 3D0SA 1ZGAA 3ECOA 3M8EA 1BI3A 5L3EA 1U6GA 1R5GA 2COMA 2DAOA 5ICEA 4LLNA 1YG2A 4ZYDA 5CVIA 5F64A 3PQKA 4YIFA 1XDSA 4KN4X 4UNOA 3FWEA 1F5TA 1C0WA 4A0XA 3HOTA 3J80K 2Z33A 4EVIA 2DFIA 4CICA 2P5LC 4AD9A 2Q2EA 2VOOA 5CYVA 3ML6A 3WU0A 3MFKA 1HQCA 2FBIA 2F5CA 2BYVE 2FOKA 1LEAA 3C18A 4ZYEA 4DNCA 2D1HA 3KLOA 1XGMA 3VODA 2E1NA 4U0YA 4EM0B 3E97A 2A6HF 3FZVA 1J5YA 1J0RA 3E6CC 5CJ9A 1T38A 1G3WA 1KU9A 1T39A 4WF2A 1BI2A 1FZPB 2FNAA 1SMYF 4LFUA 1FBSA 5FD5A 4TV7A 3RPQA 2CW0F 4RGSA 1U8RA 4D0PA 1OR7A 3MEXA 2F5DA 3K69A 2FQ3A 5LEJA 3DEUA 4BXUA 2W57A 3WTTC 2V1XA 3GXOA 4L9JA 2HOEA 1LDKB 4MHGA 3ROUA 1LNWA 3V7SA 2UWMA 3TQNA 2GQQA 4ENKA 3TO6A 4HOBA 2Y75A 4XBFA 1Y0UA 3HSFA 2LSOA 2E1CA 3MZYA 4I0AA 2JSCA 4H0EA 3AAFA 3F8FA 4G7HF 3JAMZ 5A2QK 2LDUA 1XGOA 2IA1A 4JK1X 4ESFA 2MD5A 2UXXA 3PFIA 4IHSA 2BV6A 4M72A 1IXSB 3ZP5A 2STWA 4BHCA 3LAPA 4RB0A 3U1DA 5K5OA 3G73A 4HV5A 2IA2A 1UCRA 5BMZA 3R60A 3JSPA 2W85A 2OU2A 3F8BA 3FMRA 1XMKA 2ZMEA 2HS5A 3ABUA 1D8KA 1FY7A 5D4SA 1T6SA 1I5ZA 3KP6A 3FF5A 4HV6A 3IL2A 4EJOA 2WTEA 3GYHX 1K78B 2ESNA 1IN4A 5E18F 1TW2A 2V9VA 1Z91A 3F8NA 4PGHA 4KFCA 1RUOA 4NB5A 2W84A 2HWVA 1TTYA 5H6RA 3WE2A 2XHKA 1HW5A 2FEZA 5HLGA 4R79A 2JPBA 3R61A 1IXRC 1SD7A 3SQNA 3H3ZA 4M71A 2OQGA 1F4KA 4OIPF 2MA3A 3C1DA 4M9SA 2V6CA 4YFKF 5LGNA 1H9TA 2RDPA 2ZFWA 5DYMA 5DUKA 2LKPA 2FMYA 4EMSA 3I58A 2P7VB 5DD8A 3ELKA 3JTHA 1B4AA 1VTNC 1D3YA 3KP4A 4L0YB 2A6EF 1EH6A 1EH8A 1ODDA 3DPTA 5CVUA 5F1RA 1UB9A 4UHTA 1J9IA 4A5MA 3Q9VA 1JE8A 1LEBA 2P4WA 3HRMA 1XCBA 1B59A 4M74A 3WG9A 1BI1A 4M9ZA 4O3MA 4P55A 3P9IA 5LHHA 1KQ8A 2F5EA 1KYZA 2P6SA 2FRHA 3GX4X 5ILVA 2DBBA 2QQAA 2EFNA 3TDUC 1AWCA 1TQIA 1KU2A 3BPVA 1YTYA 3EYYA 5CVRA 2P6TA 2HDCA 2VT3A 3ZN1A 3J80Z 3HRTA 3K1MA 4RB3C 4XRFA 1K6OA 2XKOA 4AIKA 4HA8A 2IVMA 1P6RA 4E70A 4A6DA 3I5UA 3LSTA 1TQPA 4ON0A 1WKMA 4GGGA 1ZAOA 5HS9A 4ZZDA 3RYRA 2VN2A 2Z99A 2ZJ2A 3M1EA 4Q47A 3C3WA 1XGSA 3GW2A 3WTXC 4LK1F 3S2WA 3LA2A 4EGZA 1FYKA 2A07F 1S29A 3O6BB 3QRFF 2PEXA 5L3DA 1QQIA 3BJ6A 2DT5A 1ZHFA 1H0MA 3QPTA 3BZ6A 5H6QA 3BPXA 4PZJA 2VBWA 3I54A 2EFOA 5HDNA 1QGPA 4OINF 3OOPA 2QBYA 4O5VA 3P7NA 4PGGA 1DPUA 3J7AO 2BE5F 2UZKA 2FBKA 1RIOH 1OPCA 4U0WA 2HGCA 5ICFA 3I64A 3CUOA 4YIIA 1CF7B 2XAGA 4LJZF 1PUEE 2ZNZA 4RGXA 5A2QZ 1OYIA 1F1ZA 2M8EA 1G3YA 1MDMA 2QYOA 4HYEA 3TOAA 1LVAA 1QO0D 2B0LA 2OD5A 3MZHA 3E5XA 1E2XA 3F72A 3T1BA 2O03A 3VEPA 1XSVA 2CWEA 3RPUA 4Y13A 5TJJA 3ABTA 2FBHA 1L0OC 3CTAA 3IC7A 5IT9K 2Q0OA 2K4JA 1IRFA 3KETA 2H94A 4HF0A 3HRSA 5K5QA 4EM1A 1CGPA 3E5QA 1ONVA 1ZRDA 2MBFA 5HS8A 2ISYA 3BWGA 1W4MA 1MKMA 2CSOA 4U7BA 1I1GA 1MZBA 3F23A 2C6YA 3WE3A 2X0LA 1Z7UA 3ZN0A 3J81K 4CDGA 1XCVA 1YS7A 1HW2A 5HLHA 4S05A 3CUQA 3I59B 1S7AA 3GEZA 5LHGA 2QZ8A 5E1ZB 1FP1D 2M45A 4ETSA 1B1BA 2DO7A 2ZNYA 4WXHA 1YYVA 2YPRA 4LLLA 3IHUA 2DTRA 1YFHA 3W6KB 1Q1HA 1LJ9A 4P96A 2ACJA 1W5TA 4A6EA 1P4WA 4EQQA 2OAZA 4UVCA 1WI9A 2VODA 4UV9A 4FX4A 4GXOA 3HSEA 5H20A 4CHUA 2M87A 1DPRA 2UXNA 2R7FA 3SZTA 3RIRA 2EFPA 2EK5A 1REPC 3TOBA 2Z3YA 4I09A 1IUYA 2XRNA 3GVAA 1YIOA 2RVCA 3DF8A 1MJBA 4IRHA 1IZ1A 1MD0A 1ZG1A 5HOOA 3IWFA 3R6SA 1HSJA 3K2ZA 5DDGA 4EV0A 2A68F 4HW0A 1UHWA 3LFKA 5HVQC 3I4PA 4OIQF 3U9GA 4IF4A 2NRAC 1BC7C 1G6NA 1DDNA 2KRFA 1HKQA 1SFEA 5LLQA 3Q5FA 4WWCA 1BBYA 1R5HA 2GA2A 3VB2A 3M9AA 2GZWA 3NEUA 3ULQB 1ZARA 1FWZA 1JXSA 2A61A 5DCFA 2CQKA 1R58A 1ON2A 5D6EA 2FA5A 1Z05A 1IW7F 1RUNA 4L9TA 2KIFA 5LGTA 2IPQX 3KLNA 3BOQA 1P4AA 1JHHA 1HBXG 2HFHA 2P8TA 1YO5C 5AONA 1ZLJA 2AS5F 2QLZA 4LG0A 2QUFA 1FOKA 4CXFA 1O3TA 3ZMUA 1HSTA 1SFUA 5LEKA 1BIAA 4G6QA 5BPDA 2H6BA 3GFIA 1FLIA 2EFQA 4LB5A 2FE3A 4WX9A 4YG2F 2MH9A 4IRIA 3CUQC 3F22A 3V8JA 2O8XA 4F7ZA 1BN5A 4S04A 5JVTA 5E8IA 1FNNA 1GXQA 2A69F 3FHZA 1FBUA 2M30A 4BQAA 3L2CA 1Z9CA 3TKYA 4K2EA 3FMSA 2KIUA 3DQVC 4UXNA 4QLCU 1WQ2A 2YX7A 3CJNA 5FGMA 1U3EM 3L9FA 3HTSB 5FFXA 2OA4A 2KIMA 2XAFA 4KICA 1P2FA 1USTA 3DP7A 4BNCA 4U0VA 1U5TA 5IT9Z 4RS8A 3E6MA 3M8FA 5LGUA 1JHFA 3CO7C 5BPIA 3ZMSA 4WCGA 4FT8A 3SXYA 1KGSA 2FNPA 2PBIA 3D5LA 4GCVA 3HOSA 2AXLA 1UFMA 5DCMA 5LRRA 1T2KA 2MLGA 3F21A 1QNTA 3TDZC 4MQ9F 4OIOF 4ENMA 4UUVA 1W7PA 1IN5A 4HF1A 2W25A 2GAUA 3ECHA 5DUIA 3LA7A 1SMTA 1T98A 4BYYA 3J81Z 1V4RA 1KQ0A 2IW5A 3GFLA 2QWWA 5D4RA 3E3VA 4AWXB 5ED4A 2K02A 5KVRA 4RGRA 4CO8A 3L00A 2ISZA 4OU0A 2VBYA 3KZYA 3O3KA 1KU7A 4KYWA 5CVJA 1EH7A 4HX7A 2JTVA 4KN7X 3N97A 1XGNA 2QQ9A 3WU1B 4NQWA 3RDIA 1J59A 3RKWA 4Q5SF 5HS7A 4L0ZB 1DP7P 3EUHA 5DV5A 4BHBA 2PJPA 3GZ6A 1O3RA 1NHAA 4GYIA 2HYFA 3K0LA 1IXCA 2LF8A 4OOIA 2PQ8A 2ZBKA 1R1UA 1U2WA 3T5XA 3KEQA 2D1VA 3IKTA 1LB2A 3COAC 2NNYA 1S6LA 2ZKZA 3HHGA 2ESHA 2RQPA 2ZMEB 3MQ0A 3CDHA 4L18B 2R3SA 3HUGA 4I02A 3WTWC 1P92A 2WWYA 1ZREA 4O6JA 2OZUA 2FXAA 1W5SA 3WGIA 5BS6A 2RN7A 4G9YA 1QZZA 3K1NA 1G4DA 4GO1A 1XSDA 1AOYA 2XV4S 3E6DA 4P9FA 2DW4A 4PDKA 5FFZA 3ZMVA 2CFXA 4HX8A 3R0JA 2DI3A 4IVNA 1OYWA 4NHJA 3GZ5A 1U78A 5D6FA 4KA4A 2OQRA 4EM2A 3FMQA 4IHTA 2BGCA 2VC0A 4KUMA 3EDPA 3I53A 1TBXA 4LMYA 5LRSA 4LLGF 1R36A 2EB7A 3QP5A 2YU3A 5DEQA 2QENA
chains in the Genus database with same CATH superfamily
1KYWA 2K24A 4KMFA 3VRAA 4DV1T 5F1JA 4LD5A 1ULYA 5IT3A 1HW1A 2GWRA 2HTSA 3PO2J 1FEXA 2A2FX 1W0BA 4Y17A 3HOWJ 4DMVA 5IYBJ 1LFBA 2XIGA 4HWFA 1O4XA 2W7NA 3E22E 2XSAA 3QK6A 3WHBA 1UX5A 2I10A 3REOA 4G7ZF 4DV0T 2VWAA 1I6XA 2WWUA 1ZG3A 1I27A 4XKBA 2JA6J 2PFVA 5JH7E 4OYKA 3GZNB 5JRCB 2Z9OA 1PVEA 1PDNC 2J47A 4RLFA 3OYAA 1Y8QB 3MCZA 3Q9DA 3ISPA 1OKRA 3ASOH 5FJ8J 4XLPF 4LG3A 4RB1A 3AE1A 2H89A 1MIYA 4YTPA 2H6CA 1UUSA 2CHNA 3ABLH 4I6ZA 5B3SH 4UR9A 2WZHA 5LHHB 2MABA 1R1VA 4IKFA 3PUXF 5C3EJ 3BG7A 5CJ5A 4PJLA 5M5XJ 3LBXA 2KP6A 4CN6A 3ZQGA 1GVJA 4DR2T 4L0RA 2OZ6A 4X6AJ 1Z6TA 5L3BA 1OMIA 3R6NA 3Q0WA 3HSRA 2W66A 2DCEA 5AQIB 3LWFA 1YJNI 6PAXA 2XASA 5ABGA 3R0AA 4CYDA 4AKRB 3ZMTA 3BQIA 3VSLA 1Z3XA 5HNHA 2BBHA 2BEOA 4V19K 1ZG5A 3UR3C 2BKNA 2XF5A 2Y0MA 4HWDA 2DQRA 3NARA 1HF0A 3H9QA 3QYEA 5C4XJ 1QZYA 4M3FA 2JA8J 4XSZF 3N2GE 3PJAJ 4D1QA 1FYMA 2JA5J 2CQQA 2E1MB 2VQHA 1ZH5A 2EV6A 1MIWA 5ABFA 4BJ5C 2NVUB 4CCMA 3EUHC 2KT0A 2YINA 5E1WA 3IF8B 2TDXA 2RV8A 4BEHA 5FVKA 3ZN1B 2LBFB 4BKXA 3JRBA 3HXLA 4LF6T 1ZYRF 3SOLA 2JQHA 1J2XA 5F27A 4UVBA 5HEGA 4OYJA 1DU2A 1JKOC 2RA1A 2R7QA 4B47A 3I3LA 5JDNA 2L9RA 4G7OF 1ZN2A 5LFAA 1X3UA 2HOSA 4ISSA 3IA3A 3GO5A 5J47A 2UUBT 1IN8A 3HJEA 4BL0B 3ONXA 4NC6A 1USSA 3CCVI 2X6YA 2WU2A 4EJTA 1TT0A 2KRHA 2ZO4A 2KFDA 1MMGA 4EOZB 1QPMA 3H3VK 3AXJB 3D5RC 1QVUA 2GBYA 1E3OC 4PW8A 4QXHB 2L01A 3AEEA 5JTGA 3CCMI 1W0TA 2JQKA 5DQWA 4CCJA 2LY1A 3K4MA 5EF6A 2VJ4A 1X1DA 4KJZA 2DDAA 2BXYA 3DKWA 3T8TA 5LOVE 5KK1A 4LF4T 4J2CA 3ESWB 1BR4A 2DA5A 2EWNA 4F55A 1U4QA 1WSUA 2CRGA 1Y01A 2D5VA 2MC4A 3K10A 4BAYA 2DJIA 4YIRX 2E2HJ 1MMSA 2VKOA 2ZM8A 4YLHA 2M67A 4HLXA 1PP8F 1BJZA 2VBZA 2QQBA 1OYYA 2J5PA 5L3GA 3DFGA 2FF4A 1KQ9A 2JWTA 4HDVA 3MA9A 2LSYA 1FP2A 3ONLC 5L3DB 1D0ZA 1HXDA 1KU3A 3TO9A 4RAZA 4I43B 2HKXA 3NWSA 4JUYA 2CXFA 5L47A 1X2MA 3GFJA 4V2FA 2K3WA 2EA4A 4YFXF 1YRNB 3JREA 2W4SA 1HKTA 2LM9A 3N2KE 4AVZA 1VQPI 1VQ6I 1X79A 2W62A 1IZNB 1FT9A 4EJUA 4MTEA 2IC9A 2E7XA 5H6QB 1CHUA 2LOOA 3X2QH 3V8KA 3FXQA 3HC7A 3FXLA 4HPQA 2VPLA 3N2OA 1P7JA 3RTRA 5LHIA 3CCEI 5F0FA 4M1PA 3QWLA 3I9V2 2EJRA 3BJAA 2V4JC 3HPHA 1IN6A 1BJAA 2XUBA 3TBIA 4B09A 3CCQI 1ZRFA 3AAEB 3KV9A 1SD4A 2K9LA 4Y15A 2QBYB 4OMYA 2V6YB 3VOEA 4LGWA 1A5JA 1ENHA 2WB1A 2WV0A 3KP5A 4Z90A 3JSOA 2VQLA 2XQ4A 1WVRA 4BQOA 3E7LA 3BTCA 4R8HA 3CCRI 3RKGA 4XLNF 3QPHA 3R4KA 1TWGJ 5J8CA 2HPLA 2HPJA 3WTYC 3DLAA 2EFWA 4JI6T 4BHPA 1VFCA 1L3LA 4DQ2A 4LMKA 2LF7A 3RKYA 1DGWY 5IP7J 5AQMB 3G3ZA 1B72B 2O8KA 1SA0E 4ERRA 2L7KA 4MEYF 4BXFA 3OKQA 1W7PD 3HTUA 4DOZA 1T7SA 2K27A 4E4HA 1HOMA 2YU1A 1D8JA 1WLXA 2H8WA 1S8NA 3MVPA 4ZZLA 1G3SA 3O1HA 5D5XB 4TZ4C 3RQUA 2NS0A 4IDNA 5KXJA 1TLHB 1HCIA 3AG2H 1RZ4A 1AA7A 4FX0A 1T0FA 1HG2A 4RM3A 4ZC3A 2FJBA 3MKYB 1N36T 2XAGB 2BZBA 2NXNB 3ZPLA 1YW8A 3H92A 4M73A 3FX3A 3W6JB 5EEGA 4CSWA 3AE6A 4EGWA 2Q9QA 2MLKA 3CVRA 3AL0B 1J7KA 2V1DA 2LKHA 3GUDA 1O3SA 4Y7NJ 1YKEB 1MBJA 1A04A 5DD4A 4Z2YA 4A3LJ 2VE8A 2OTLI 3FXOA 2IS4A 1IV8A 4W1UA 4CCLA 4IGUA 5L3CA 1YW9A 1MDMB 3BG6A 5K1YA 1IN7A 3RKXA 2M6BA 1MGTA 2JRMA 5DQVA 3PU3A 3VR8A 3A01A 4K0UA 4JI3T 1B9NA 5CVVA 2AXDS 5AQQB 1Y56A 4TWDA 1LDDA 1X9BA 2L5QA 2KIQA 5D5WB 1XN7A 2LD5A 3CCLI 1UGOA 1GUUA 3HRUA 2GK9A 1PJRA 2XAHA 2IIUA 3C50A 5GP9A 2JSPA 2DXIA 3D5SC 1FTTA 3ZQQA 5JDMA 3GLLA 2X85A 4YFSA 5ERIA 1DGRM 3NVOA 1YS6A 4YJ2E 5HXSA 3ABKH 2VE9A 3VR9A 3E0ZA 3BJOA 2H09A 3SJMA 3N4MA 4L5GA 5AQLB 2M5WA 2E71A 2QVOA 4P5OA 1G3TA 5L3FA 1P4XA 2DT7B 5ILSA 3DXJF 4MNUA 2DPDA 2W24A 4R1HA 4OK0A 3OYHA 3EYIA 2XTLA 3DV8A 3ZT5A 1TWCJ 3K70C 3L8RA 3PUGA 4I7HA 2V9KA 3NQOA 1XMOT 5J0ZA 5FB2A 1K78A 5EEHA 2R6GF 5HDGA 3WGGA 2WU5A 3TEDA 1GHCA 3UFEA 1SVOA 4ZTFA 3HZJA 2L7MP 3V7RA 1QU3A 3HOVJ 2M7AA 3PE0A 4M6YA 1DU0A 3N9PA 2K9NA 1FMWA 4AIJA 3F9KA 3GMEA 3HBLA 1HC8A 2LREA 1OCOH 3NZQA 2OJED 2G7UA 1JGSA 2A3SA 3WTUC 1GDTA 2KDOA 3QAHA 2R7VA 4ILUA 3CX7B 1CUNA 4IE0A 2ES0A 4JYAT 4D5CA 4DV6T 3T1HT 1JTXA 3KIOA 5B5EC 4XLFA 1BOAA 3PUZF 2MC3A 2CE7A 3VRBA 5FY1A 3UUXB 5EJCA 1LDJA 3A03A 3I56I 3ZYKA 5E8GA 3F3XA 4HZFA 2JA7J 2BY2A 2IS2A 4M6VA 1UX4A 3IRQA 2W82A 3MWMA 1EJ9A 1OCRH 2X0LB 2EH3A 4LMJA 4LB6B 4LF8T 4ASNA 1ETVA 1H9GA 4I0BA 3J7ZI 2XROA 3AG1H 1YW0A 3FZKB 2Z5UA 4UV8A 2HNHA 3ZN0B 3S32A 1LE8B 1MJAA 5FLXK 3M7GA 2HZTA 4RAFA 5HLTA 2ZLYA 3EUKL 4RGUA 3ZR8X 4Z8XA 3PUVF 3OYZA 1KF6A 2GXGA 3O1JA 2IJLA 5FXZA 2MW8A 3CUQB 4OIRF 2XAQA 2NTXA 4PJNA 1RETA 3QODA 5LHGB 3FXRA 3RYCE 2XC7A 3LL7A 2E2JJ 2ADUA 1AKHA 4WK8F 4HNVA 4NUBA 3UULA 2R7OA 2V6EA 2LM2A 4I4TE 4MGRA 3HOZJ 3BC8A 3GF2A 2ELHA 3O8HA 2IS1A 1XB4A 4KI0F 1ZOYA 4HEAA 2F4MB 4IL9A 4CZZA 3K4CA 3GTKJ 3J9X1 2CV0A 3WTZA 4KDPA 5J1UA 1STZA 2P5KA 3LSPA 4HQEA 2QF7A 4D9JA 2E2AA 3AAAB 4UY8I 2AXTC 1R7JA 2V6XA 4YHJA 2E9XA 4WBNE 5ADXL 2JA2A 2BBYA 3W3CA 4KHZF 3CPZA 4PFPA 2QSHX 4P0BA 1IAWA 3DPLC 1BW5A 4V2GA 2EA2A 2JQ7A 3X1DA 5EEAA 3PQJA 4KIFA 5D8LB 4MQVA 3ZQHA 2L9QA 3A1YA 5M4YA 2J5OA 2G7HA 4UVCB 1WH5A 2KZGA 3L39A 2CWOA 2I5UA 3I71A 1WYBA 2ZSHB 2OTJI 2M6IA 1ETQA 4UV9B 2R5ZA 4AKIA 3FXJA 3ZMZA 3HKCE 2LNBA 3LK3B 4I76A 5EDNA 1FC3A 1TQMA 3C7JA 3AG3H 3BT9A 1FEWA 4LK0F 2KINB 2UXNB 3N9NA 4Y33A 2GXBA 1XC5A 2F4VT 4XSXF 1VI0A 3FZHB 4HFEA 4YHHT 3HHHA 5HLIA 4IRGA 4C30A 4EATA 4IO9F 4GIWA 2QRXA 1LPQA 4U7DA 3RHWA 3UU3A 3HKZN 4L5IA 3ZSSA 4DV7T 2M0MA 3B73A 3MD2A 4M6XA 5D8KB 4BDZA 4BE0A 3CD6I 2WB5A 3F8MA 3AECA 3KX2A 4AQGA 4OMZA 5DABA 4B8XA 1GT0C 1I1SA 2KKOA 5E0OA 1FPQA 2FQ4A 1J75A 5D5UB 2RREA 2V5CA 2WC2A 3GWZA 3PJRA 1T0FC 2WADA 5C2TA 1A36A 4BQNA 4DUZT 3UUBA 2NP9A 3LSIA 3U2RA 2FSWA 4LIUA 2PI0A 5JHUA 2Q9QC 4U74A 2NAZA 5AQTB 4BBSJ 4JBAA 3AEBA 1NH3A 1XD7A 4ZJZA 4YRVA 2RGVA 2CQ7A 2PJRB 1DU6A 2CXDA 4EXTA 1PUFA 2NTYA 1FBQA 1MNEA 2IGOA 4CI3B 2QCOA 4G8XA 5KDMC 4X64T 4O8SA 1WRDA 2KJCA 3ERED 2Y9ZA 1X1BA 3HGGA 4ANJA 4ZDOA 3L3PA 2B9SA 1FIAA 1Z77A 1BR2A 4HDUA 1XS9A 5M3MJ 4NUVA 1WJBA 3ZMDA 4ILCA 3RYPA 1MBGA 2XQ8A 4HLYA 4UUSB 4FHTA 1WFXA 2HR3A 2EBIA 4I99C 1FIOA 2LTPA 4UF0B 4ADZA 2E5NA 1T8IA 2M1BA 1MJ9A 2VT2A 3H35A 4CYCB 2DK8A 5AQPB 4MEXF 2K85A 3KZZA 2CM0A 4C3HJ 5HYAA 3DKYA 2LKSA 2JJ9A 1ON1A 2H1KA 3BG3A 4A2UA 3HI2A 4U3CA 1S7EA 2LEHA 2AQEA 1Y1WJ 1YQ4A 4IDZA 1ACIA 2DPUA 5HNFA 3OYXA 3LAJA 1FJLA 1K4SA 2HI3A 1BC8C 5AQOB 4AKGA 5CLSA 1IG7A 2RKHA 5FO5A 2JRTA 1B6AA 1I3AA 2EV0A 1LQ1A 1F36A 3MZKB 5EK4A 2F2EA 2BZTA 2KJBA 1PP7U 5TISC 3PV0F 1WJCA 1O7LA 2BG9B 4IDPA 4QIWN 5J6XA 5ILUA 2WB1N 1MMNA 3MAJA 3LA3A 4CXWA 2IA0A 4A97A 3VDXA 4MIMA 3BR5A 5F0CA 1BM9A 3IKVA 3HA4A 1FSEA 2OV7A 2ID3A 4L9VA 2D2WA 3N05A 3WTVC 1RPWA 1HS7A 1U5PA 4JX6A 5LGTB 4U31A 1X2NA 5BMVE 1K83J 4EJVA 4BY7J 3KINB 3K4LA 4H4KC 4AKHA 3P4RA 3RC8A 4IOAF 2VBXA 1T72A 3M3ZB 5LJMA 3KDSE 4GKJT 1US7B 4WYVA 2GXAA 3FM5A 3BK9A 1U9NA 3WGHA 4BGDA 2PN6A 2LP0A 3F6OA 4PSWA 3TO7A 2J1DG 3ABMH 2HYGD 2L02A 5FKKA 2NR4A 4LG0B 1HNXT 4YELA 4XZCA 1ERDA 3S2DJ 1R23A 3M1CA 5BQTA 4O2BE 3ZMUB 5GTHC 1X58A 5HCMA 3QYBA 2RNJA 5DJQC 3KP2A 3LSHA 5K7FA 1XMAA 2DA6A 4E7SA 3CC2I 2P9BA 2CQXA 3LSVA 2JJ7A 1KZHA 1YJWI 4A3DJ 3FZLB 5AIPA 3JW4A 5CFBA 1XSXA 2CUFA 4AIHA 2CGPA 1BA5A 2N2NA 5FKMA 3GLXA 3OV8A 4ZYHA 2EZHA 3KP7A 3OYKA 2YDQA 3ZYMA 3T0YA 1OJLA 4CCOA 1QLBA 3IWZA 2NNNA 3CC4I 5HXEA 4IQ4A 3KEOA 3CF5F 1K7AA 1BR0A 2X9DA 4X1EA 3O4XE 1R00A 4HFDA 2UXCT 2VB6A 2E19A 4BJTA 3L1PA 4MTDA 5IP9J 4DV2T 4A5NA 2WA0A 3Q5XA 1SD5A 2NYXA 4QWQA 2W63A 2HQNA 1RI7A 2QM3A 4PCQA 1WHUA 1ZK8A 4X0GA 4AISA 2KSRA 4ESJA 4AVPA 3NRYA 3QOPA 2Q8KA 1B8IB 1CF7A 4IE6A 5ABEA 3DKXA 2QA7A 4J00A 1VQLI 2R0QC 3JTGA 4UVAA 2VVSA 2FMLA 2NS8A 4GYRA 2DK5A 1Z1DA 5GPCA 4N4NB 5E3OA 1HX1B 1S3JA 2MH2A 2DNXA 4TNVA 5J40A 4A3FJ 2E7WA 3W6VA 3NZPA 3O2PE 4HAMA 5ICCA 4XRMA 1FSHA 3KV6A 2E8IA 2DQLA 4A0ZA 2CWYA 1HKSA 1O57A 2ZXIA 3JCFA 3CWZB 5F0HA 3OSFA 1Z6RA 3BY6A 4IPAA 3SHFA 3H0DA 2E5VA 3CF2A 5LXTE 2L9VA 4LOCA 4UXNB 2GIVA 5JFRA 3RQWA 3U3IA 4JI4T 1VOMA 3OYIA 1WRJA 3BTLA 3L7WA 1YLFA 5EZYE 5GTIC 3MK7C 4PK5A 3QU3A 2VOPA 5EZHA 4IJAA 3BQYA 3TP0A 3LNQA 2EHOD 2XQ3A 4AIUA 2XZEA 2M7BA 5LBMA 3WAKA 4ZS2A 2L4MA 2BY0A 1B9MA 2CG4A 4G2AA 2HYJA 1ZHCA 2XAFB 1ETYA 3BROA 3TGNA 1MH4A 2UUCT 4KT5C 1S9HA 3G1LA 2IMLA 3GTJJ 3MZ8A 5HXRA 3ZEFB 4AYBA 2X67A 2PMUA 4EEBA 4QHOA 5HEOA 1XDUA 1YQAA 4B3RT 2GA1A 3DTOA 2BY1A 4RB2C 4EGYA 2UU9T 3GFMA 2R7DA 3OR1C 1ZRCA 1JI8A 1U5TB 4HBLA 2IRFG 5LGUB 2XY8B 2R5YB 2WZIA 2L54A 1SE7A 4ILAA 2X4HA 3KP3A 4IXAA 1FYLA 1O7FA 1ZLKA 1FJGT 3ZMSB 1VQ9I 2LKGA 2EIMH 4JQFA 1MBKA 1U5TC 1SFXA 2OBPA 1RESA 3K9TA 1IO2A 1DUXC 5AQSB 4Q4ZF 2X1CA 1E17A 3AB3B 1JJ8C 3G06A 4M3BA 3PUQA 2DHRA 2PLYA 2BS4A 4ZI3D 3H3AA 3Q3SA 3EHZA 5ICGA 2IP2A 1RNLA 3E5UA 5DCMB 1D5VA 1BIBA 2STTA 3A0HC 2CLYB 1QSDA 2WS3A 4B44A 3ANWA 3C4XA 3UU5A 4A5XA 4I98B 4A3KJ 2LHRA 3CO6C 2V79A 2HEOA 5J1GA 1HA8A 3V4GA 3KVBA 2YX4A 1K79A 3BR6A 2HTJA 3SFZA 5JLXA 5JVGF 2CV1A 2JMKA 4XAXB 3HIFA 1EV7A 2W48A 1W7PB 1S94A 5LB7B 3RX6A 1JTYA 2HQRA 1R8IA 2O6GE 2A3DA 3FBIB 4U7YA 1R6RA 3CMLA 3E0JB 2ME0A 4U88A 3I59A 3ZQ7A 1GXPA 1IF1A 4G94A 3S93A 3PUFA 1QBJA 2XQAA 4CI2B 5TAOA 3K4BA 1IRZA 2D0UA 1SAUA 4L9NA 4N0BA 5JHFA 5JR3A 1FX7A 2LRKA 3KCCA 3JC6D 5FLXZ 2LOSA 1LFPA 5AQJB 4YXDA 3SFDA 2M4GA 2L3LA 2R7RA 4YSZA 2H88A 2IW5B 1Y8RB 3OYDA 3CCUI 3UFGA 4LF5T 2XKPA 3B13A 4QH4A 2DODA 2JMHA 2L4AA 4DVDA 4QTRA 1VQKI 4HX4A 3E6BA 4NBQA 2MOZA 2R7WA 3W2AA 4XMYA 3PIPF 2VC1A 5EGOB 3EQLF 4CI1B 3HYIA 1KA8A 3K4KA 2V9PA 4IIJE 1QZEA 3FDYA 3PUAA 4JI5T 1FIPA 4DV5T 5FKNA 4B48A 1A6IA 2K86A 5AIQA 2E2IJ 4E6KG 2R4GA 1HNZT 4JX5A 3DBHB 5E3MA 3IAM2 3S1RJ 3C4WA 1H88C 4ZH4F 3G2BA 1W0UA 3EUAA 3ZYLA 2BW3B 4Q48A 2YSRA 2H7OA 1TWAJ 2ZXJA 1TNSA 4RAYA 2WDVA 4DIQA 3L09A 1X4PA 5KMGP 3BQZA 3F0CA 4A98A 1UHMA 2L3DA 3UUMA 1BI0A 5J8FA 2VJJA 2P5VA 1F9NA 3F8CA 3JAMK 3LQQA 4KMUX 3PM1A 2CHOA 3PUYF 2JZYA 3R84B 4HG2A 4U2ZA 5FY0A 4XORA 1D0YA 1S7OA 3V8LA 3IEEA 4NXMT 4ZZCA 4N9IA 3CMAI 2MPKA 3UTKA 1IBLT 2Y6XA 3VHLA 2FD5A 2BDEA 2OA5A 3RIFA 1JUPA 2HKOA 1Q1VA 5JI6A 4NQWB 2OC6A 5K5RA 5LD2C 1I3QJ 2VONA 1ZEEA 2ETHA 4ZYGA 1IRGA 2X51A 3KYDB 2LSGA 2CXLA 2CO5A 5E17F 3M4OJ 4WXDA 1MNMC 2V7JA 5HWXA 3U21A 3JRHA 4E7LA 4IHXA 1M62A 2RC4A 2PMHA 2L0KA 1WR0A 3U78A 3FM3A 1VQOI 5HXHA 2XVCA 3BDDA 2X48A 2VKHA 1TW3A 3KE2A 4XN0A 4A12A 3T8RA 2E9XD 2P7CB 1GQEA 4A93J 1XNRT 2AHQA 2DLLA 3F6VA 3S8PA 1IUFA 1G59A 2MTQA 3AE2A 3IRRA 2K7LA 3N9QA 1W5CC 5IPAA 1OQYA 4ENNA 3UUNA 3QU6A 2V1UA 5CB4E 2LR8A 5AFUL 2J4GA 2KZVA 4TX5A 5F6FA 1W09A 2E5LT 2JPCA 4KNYA 4ZDPA 3F31A 1OEDA 2O61A 4HQMA 5E20A 4A3EJ 1V3FA 4WNKA 1WCMJ 2YS9A 3P9CA 1VQNI 3IH4A 2I0MA 4ESBA 3UT5E 3ZKRA 5JREA 4I01A 4G6DA 2I6HA 1SD6A 2DU9A 1TP4A 5EG0A 3CLOA 2EV5A 2FJDA 3K1PA 3RKOA 4RM2A 1VZ0A 3HUGB 1D1CA 4PUSA 3H3UA 2K4BA 3SZPA 3L2WA 4BJMA 5FL1A 4XR6A 2NW7A 2VXZA 4WXCA 2ECBA 3RI4A 2DA1A 1RKWA 4YFNF 4IEJA 2WY2A 2YR2A 4KHPT 2A5YB 2FU4A 3Q5WA 2UUZA 2NOGA 4J19A 4HF2A 1WYCA 3BP8A 3P9KA 4Q25A 4EJWA 4G63A 1V5GA 2KZ7B 2V8SV 3BR0A 2VQFT 3FXUA 3MJXA 5AQUB 2RP4A 3HDDA 4P9UA 2XGXA 4I2OA 4MLKA 2DOAA 5LG3A 5FD6A 2BG9E 2ZM2A 1TNTA 3OVUA 4N78D 3B02A 5BOXA 3RYFE 4CGZA 3NRVA 4N4OB 4BH9A 3OY9A 2B7EA 3H3MA 3LQRA 4C3JJ 2HOAA 3DEWA 4CZCA 4IOCF 3AA0B 3ZMVB 3I0TA 5HDKA 2PG4A 5TRDA 4DR5T 2RNGA 4B3ST 2ZM0A 3Q5DA 2O0YA 2JUGA 2CYYA 4OHFA 1UG2A 4M9XA 3RJPA 2NWBA 1WWXA 2O5RA 3TW7A 2LY2A 3JAEA 5LBQA 2G9WA 4KIGA 3LSGA 3FXKA 2LSIA 3V7CA 2CW8A 3J7YJ 4GDFA 4KP3C 2ZCWA 3QYFA 4PJJA 1ZGWA 3PUWF 5AQKB 2ZC2A 2PFBA 3K3OA 3KFWX 1WH7A 4ZTJA 3VFZA 1R1TA 4L5JA 4A3MJ 3S1QJ 5FP3A 2O3FA 3WTSC 3HKBE 2VK9A 4JI2T 3H0GJ 3AKZA 4NUUA 2K9QA 2D45A 1VF9A 1YW7A 4KUMB 4U33A 2MG4A 4IHWA 3GA8A 2IT0A 2F5FA 3C51A 1R22A 2E36A 1R9TJ 2LFBA 1NG6A 3EETA 3H36A 1I50J 3GMIA 1SAXA 1YIJI 1XWMA 4N9HA 3AA1B 2H27A 2XHEB 4ZZBA 3TLWA 4XQFA 2XM2A 4ENJA 1SUMB 1ZGJA 4HNTA 5E1XA 2Y48A 1S35A 2CFOA 3WODF 2QGUA 2EPFA 2XAJA 3BG5A 2EHOA 3GN5A 2LJLA 4GK5E 4HKAA 1QPIA 1NENA 1WJDA 3OYLA 5D5VB 1X4OA 3N9LA 3Q9SA 1OFCX 3HKDE 2FUPA 1A6QA 3OWTA 3M65A 3TKLB 3QP6A 5E3NA 4GYGA 1O3QA 3LFMA 2JT1A 2QKMB 4XKVA 5CPRB 3VYRB 4A0YA 1VRBA 1XZYA 5L2LA 4F3QA 1OWAA 1LFUP 2KWHA 5LP6E 4KIBA 1GVDA 3OYGA 3ZCIA 3JRFA 2R7XA 3OPCA 3D0SA 2Y0SN 5LJNA 1ZGAA 3ECOA 3M8EA 3N5LA 1BI3A 2LG4A 3BG9A 3OIQA 4QH5A 5L3EA 1NWMX 1U6GA 4U87A 1R5GA 2COMA 2MSYA 2K48A 3EAMA 3PDYA 2DAOA 4OAZA 3SS1A 4AYBN 3P7IA 5ICEA 2K9SA 4LLNA 4AC0A 4DUYT 3MACA 1G8XA 4HEA2 3LBXB 5JDLA 4PFOA 5L3BB 1MBEA 4ZXLA 2XDVA 3LFUA 1YG2A 4ZYDA 5M5WJ 3V5SA 3CK6A 5CVIA 5J4VA 2VKEA 2XASB 1J09A 3GTMJ 3CP8A 3ZMTB 5F64A 3KYCB 3PQKA 1XDSA 4KN4X 3V42A 4YIFA 1TL8A 2VKJA 3KVAA 4UNOA 4IT4A 3H9JA 3FWEA 1F5TA 3K2AA 1C0WA 1LKXA 5EK2A 3F2EA 4A0XA 2KMFA 4YTNA 4D7NA 3HOTA 2KT9A 2QVAA 3J80K 3RZDJ 5HODA 2Z33A 4EVIA 2JRKA 2DFIA 4CICA 5GONE 2P5LC 3JRCA 4AD9A 5ABFB 4B3TT 2Q2EA 3LSKA 5FLMJ 2VOOA 4C3IJ 2YDRA 5CYVA 5CQGA 3FXMA 3NRXA 2DWKA 3ML6A 2DFHA 3WU0A 4IZZA 3MFKA 4BEHB 1HQCA 2HH7A 1Y6IA 2F5CA 2FBIA 4ITVA 2BYVE 4PK4A 2KISA 1X1AA 1LEAA 2FOKA 2HVQA 3C18A 4ZYEA 4UVBB 4G12A 4DNCA 1GV2A 2EZLA 1JJ6C 3HL6A 2D1HA 3UNGC 3B6AA 3IP4B 2NS7A 3KLOA 1V54H 4A3JJ 2I59A 1XGMA 5GPAA 1R5ID 2E1NA 3VODA 4IE5A 5FYMA 3C64A 3MMYB 5KHDA 5JR9A 2Y30A 1IV6A 4U0YA 4EM0B 3E97A 1OEDC 1U0JA 2A6HF 3FZVA 3K1SA 3J7Yq 2WY8Q 2V7KA 4EZHA 3BTIA 1J5YA 4XONA 3P50A 4BY1J 1J0RA 3W2WA 3E6CC 5CJ9A 1T38A 3KPHA 5E3LA 1TWFJ 3FISA 2DI4A 4ZEYA 4BU2A 1G3WA 1KU9A 2XPWA 3A7MA 3NAUA 1T39A 2IAIA 4WF2A 2VQGA 3DTEA 5LMNT 1BI2A 2M3AA 2JQQA 1FZPB 1ZP0A 2FNAA 1SMYF 4H9QC 3C2GA 4BAYB 4COFA 4LFUA 4NIQA 2LSKA 1OCCH 2DMNA 4A56A 1FBSA 5L3GB 5JDFA 5FD5A 2H3RA 3ZJ1A 2DMQA 2WAEA 4JOMA 4TV7A 3D0TA 4UELA 4PSXA 1WJ5A 4GOUA 2X68A 4X62T 3LJCA 4XOPA 4Y3OA 1W1WE 5FXVA 3RPQA 2ELJA 1UHSA 2CW0F 4RGSA 1U8RA 3I4MJ 4D0PA 1OR7A 2NW8A 4A69C 2EZKA 1IRXA 3MEXA 2F5DA 3S1MJ 4X5TA 3SYTA 4QPQA 3K69A 4BUPA 2FQ3A 5F5WA 3RRWA 5LEJA 3P8CD 5IY5H 3DEUA 1V5FA 4J01A 3ZQCA 4BXUA 2W57A 3CLQA 3WTTC 3MKZA 4FCYA 3BQKA 4EYUA 4OWRB 4B4CA 3RQ4A 5M3FJ 5LHIB 2V1XA 3GXOA 2CCQA 1SEUA 4L9JA 3HM5A 2HOEA 4II2A 4Y4RA 5FXWA 1LDKB 4MHGA 3S15J 2PMZA 2Z6EA 3ROUA 1LNWA 2CMRA 1UMQA 3S14J 3M07A 3V7SA 4JI8T 3E08A 1T33A 2LRDA 4KMCA 4OX9T 2HHHT 2VLAA 2UWMA 3TQNA 2M2EA 2GQQA 2HVRA 4ENKA 2CQNA 3RSNA 3TO6A 4P09A 3CQXC 4HOBA 2Y75A 4XBFA 1Y0UA 1Z8UA 5FMNA 3HSFA 3AE4A 1T08B 2K5CA 2LSOA 2E1CA 1O3XA 2QGSA 3MZYA 2IXSA 2JSCA 2IEKA 4I0AA 4H0EA 3ZGKA 3AG4H 3ZXSA 4AQFA 3AAFA 3F8FA 2CBJA 3MXZA 4G7HF 2EHOC 3OBVE 3JAMZ 5A2QK 3TLVA 1ORKA 2LDUA 5A1LA 3TLTA 1TT5B 1XGOA 2IA1A 4IL6C 4JK1X 3I55I 2WCAA 4XLHA 1XNQT 4ESFA 2MD5A 3VWBA 5ETWA 2XRLA 4EEFG 2JVHA 2M0CA 2LYCA 2Q9QB 1UJ8A 2XF6A 2WAQA 3CJQB 4QXCB 2UXXA 2V1DB 2LVSA 3PFIA 4IHSA 2BV6A 4DR7T 4M72A 5JDGA 3RGLA 1IXSB 3ZP5A 2STWA 4BHCA 3KV4A 1EA3A 3DTIA 3PSFA 2C5IT 4GRIA 3FZFB 3LAPA 5L3CB 2HPMA 4E7ZA 4RB0A 3U1DA 5K5OA 4HSRA 4HV5A 3K7AJ 3G73A 3CP2A 3A01B 4LF9T 2IA2A 1D0XA 5CQEA 4EYYR 5AQGB 1UCRA 4X66T 2L9SA 4TV8E 2QKLB 2XF7A 5BMZA 3QPSA 2XAHB 4LFCT 2XB5A 3R60A 3JSPA 4NPPA 2W85A 1XTAA 3NWTA 3VYSB 2UV1A 2OU2A 3F8BA 3A0BC 3HEFA 3FMRA 4P1WA 2V7IA 1VQ5I 1XMKA 2ZMEA 3P4QA 2HS5A 4FASD 4IL4A 4ZI3C 3ABUA 1IJ5A 3BR2A 1D8KA 3G71I 1FY7A 5L3FB 1IBMT 5FKLA 1E7PA 2NVQJ 2A05A 2DWGA 5D4SA 1T6SA 1I5ZA 2GLOA 1YHQI 3KP6A 3TLSA 3FF5A 3ETVA 4HV6A 1Z21A 3VSKA 3IL2A 2XQYA 4EJOA 3H37A 5HWYA 4GYSA 3PJAA 4XK4A 3ZT7A 4ZI2D 2WTEA 3GYHX 4JP0A 3FXDB 2WSSV 1K78B 2JQ9A 2ESNA 2V7LA 2LHNA 5LYJE 1IN4A 4MFDA 1HTJF 5E18F 2L7FP 1TW2A 4BE1A 2V9VA 2BHZA 2X1DA 1MSFC 1Z91A 4EEDA 5DS9A 2DFFA 3F8NA 4PGHA 3JC6C 4KFCA 1N78A 4NC7A 3RC3A 3OS1A 1RUOA 3HKEE 3UU4A 4NB5A 3QNUA 3DEEA 2W84A 2HWVA 2XAUA 3EPZA 1H8AC 4IQJA 2WAFA 1TTYA 1ETOA 4FE4A 5H6RA 2VASA 3AE5A 4JI1T 1APLC 3WE2A 4DNDA 3HB9A 2ELKA 2XHKA 1HW5A 4XM3A 2V5DA 4UIGA 1FOWA 4U7IA 3G6EI 2FEZA 4XN3A 2YDSA 3OMYA 3A02A 4AIDA 3CMEI 4MHCA 3W2VA 3PSIA 3LOCA 3OOUA 5HLGA 1J1JA 3AVRA 3RIAA 4R79A 2JPBA 3R61A 1K4TA 4H63V 2XQ6A 5L4HA 1IXRC 1SD7A 4UV8B 3RPUD 2A6TA 3SQNA 1E0EA 3OL4A 3H3ZA 4M71A 2OQGA 1F4KA 4OIPF 2MA3A 3UU6A 3C1DA 1NG7A 4M9SA 4CQIA 4DV4T 5EZGA 1F43A 4QPOA 1BR1A 2XAQB 4O4LE 3CX6B 2V6CA 4YFKF 5LGNA 1H9TA 2Y31A 2RDPA 1YD8G 3SRZA 2ZFWA 3P4PA 1AKHB 3WU2C 2ZSIB 3ZC0A 5DYMA 5FROA 4HFHA 5DUKA 2LKPA 2FMYA 3I58A 4EMSA 2P7VB 2XUEA 4HWCA 5DD8A 3GTLJ 2EIKH 3ELKA 1I39A 3JTHA 2K40A 3L2VA 1RC9A 2GIZA 4UB8C 4I50E 1B4AA 2BS3A 4CZZB 4CN1A 3FHNA 1VTNC 1D3YA 3KP4A 4L0YB 5ABHA 2JK3A 2A6EF 1EH6A 2IGKA 1EH8A 1ODDA 2DA3A 3LSRA 4HWIB 1UG0A 3DPTA 5CVUA 5F1RA 4C90A 4A3IJ 2E9XB 2FX0A 1UB9A 3QOEA 3G1MA 1SC7A 2IGNA 3VU7H 4PK6A 4UHTA 1J9IA 3H5RA 1K6YA 1D1AA 1P9QC 2O7OA 4A5MA 2BOLA 3Q9VA 3RCOA 4RBOA 1JE8A 1IGNA 2NOXA 5JDQA 5JRCA 3A4CA 1LEBA 2CBIA 2P4WA 3HRMA 2DMUA 2Q1ZB 2E9XC 1L0VA 1XCBA 3RIUA 1B59A 4M74A 3WG9A 3OIPA 1TWHJ 5HAXA 1BI1A 1X1PA 5KCMA 4AQYT 1X3WB 2HDWA 1YXRA 3ESLA 3LDQB 2R5ZB 3ZMZB 2Y8DA 4M9ZA 4O3MA 4P55A 2HU9A 3P9IA 4DYQA 5LHHA 3OS0A 2DA2A 2F5EA 1U8BA 1KQ8A 1KYZA 1ZQ3P 3UQ7A 2HXOA 3CCYA 2P6SA 2FBWA 2FRHA 3GX4X 5ILVA 3RRCA 2DBBA 3CIRA 4GKKT 3C2HA 1UZCA 3I9WA 2QQAA 2NW9A 2EFNA 3LSJA 4CCNA 1YKHB 2LK2A 4MBQA 2MD0A 4AQFC 3TDUC 1AWCA 3HOXJ 1NK3P 4IHJE 4F6RC 3UQ4A 1YI2I 5JDHA 1TQIA 1HCRA 4X1YE 4X20E 1KU2A 2IS6A 4BACA 3BPVA 5HEJA 2G0UA 4P1NA 2IBDA 1YTYA 2L8KA 2IGMA 5KAFC 4WBOA 3EYYA 2X6WA 1JNRA 2XQ5A 2HN2A 5EYRA 1W36D 5CVRA 2P6TA 2X66A 3DTKA 2HDCA 2VT3A 3ZN1A 2LBFA 3J80Z 4KX6A 4B43A 3HRTA 5GAHJ 1PUFB 5C3JA 3K1MA 4RB3C 4XRFA 3ZCOA 4H9PC 5J3LA 1K6OA 1OCZH 1IC8A 5FLVA 2IC6A 2XKOA 2R7UA 4AIKA 2HOTA 4HN9A 4JI0T 3LK2B 2WWVA 5BR8T 4HA8A 2IVMA 3AA7B 4FJOA 2ACZA 1P6RA 3Q0VA 3TLUA 4H9OC 4E70A 4A6DA 1HG5A 3I5UA 3QUJA 3HPGA 4XKCA 3B57A 1OXZA 3LSTA 1MW7A 1TQPA 4ON0A 1WKMA 4GGGA 4S0HB 4BDYA 1ZAOA 2TCTA 5HS9A 2VKDA 1LVKA 4ZZDA 2LY9A 1I6ZA 3RYRA 3CJTB 4KITB 3CKDA 2ACXA 2VN2A 2Z99A 2ZJ2A 2XQ9A 3M1EA 2ZMEC 3AXJA 3RYHE 2ZM6T 3FK6A 2AQFA 1NK2P 2ID6A 4DZPA 2YUSA 4Q47A 4LITA 2DL1A 4JYKA 3ZT6A 2H1LA 2WAUA 3C3WA 1XGSA 1RKTA 3GW2A 5DM6F 3VYTB 3DLLF 3WTXC 4ZOLE 3ERMA 4LK1F 3LA2A 3S2WA 1OCTC 4EGZA 2VUMJ 3W15B 2PMZN 1JGGA 1FYKA 1Z7LA 2A07F 3EABA 4BJ6C 1S29A 2E60A 1WZ2A 3AE7A 4XIDA 2KMUA 3RYIE 3BZCA 3GTPJ 2CUEA 4B1RA 4HTEA 4M3EA 2FJAA 5AQHB 3O6BB 3QRFF 2PEXA 1KEYA 5L3DA 2DMPA 3N9OA 1SVMA 1QQIA 1VCSA 3BJ6A 2DT5A 1ZHFA 2SPCA 4ILBA 1IDYA 3JCUC 1H0MA 3ZC1A 3QPTA 2VJIA 1YRNA 2E5ZA 3BZ6A 2QEXI 2YEVC 1NAFA 1G2HA 3IH3A 4JX4A 5J2TE 3CZ6A 3L2QA 2BVMA 5H6QA 4Y52J 3BPXA 4PZJA 4BJNA 2XSJC 4H63H 3L2RA 2VBWA 1Z0PA 2DMTA 4E7KA 2CH0A 3I54A 2R7ZJ 1Y39A 2EFOA 5HDNA 2VJ5A 2WAQN 3WG7H 2K5BB 3A5XA 1QGPA 3K4JA 2BS2A 4OINF 3OOPA 2QBYA 2V6YA 4IDOA 4O5VA 3P7NA 1HDDC 2ODUA 2KNDA 4PGGA 4B3XA 1HF8A 1DPUA 3J7AO 4C9YA 1WR6A 2BE5F 2UXDT 5J1YA 1JUMA 1VQ8I 3OS2A 2JPFA 1UCUA 2VKVA 1QUUA 2UZKA 1VQ4I 3NWIA 3PTRB 2FBKA 2H7VC 2H8RA 4MALA 5J1RA 4AM3A 4ZS3A 3TP3A 4FISA 1RIOH 1ETXA 3BLYA 1B72A 1FTZA 1OPCA 4U0WA 2CJJA 2HGCA 5ICFA 1E3HA 1QHHD 4P0AA 2QSFX 4ZDLA 5JQGE 3I64A 2YN6A 3CUOA 1RRJA 2D9DA 4EV6A 4YIIA 5BNGA 3RF1A 2Y9YA 3JRGA 4TV9E 2XPVA 2XAGA 1CF7B 4FI5A 3C4ZA 2XGCA 3S3OA 4LJZF 5GAEJ 5H2FC 2W0GA 5IWAT 1PUEE 1U9OA 4UVAB 3GTGJ 1WI3A 2W00A 3Q5EA 1EZ3A 2ZNZA 2AE9A 4RGXA 1BW6A 5A2QZ 1OYIA 1IJWC 3S4UA 3M3YJ 3FB2A 4YJ3E 1F1ZA 4YEJA 2M8EA 3G4SI 4DR6T 5FKOA 1G3YA 3RIUC 4DR3T 3K8PC 1MDMA 1HX8A 2QYOA 4HYEA 2ZMAA 3TOAA 2QYWA 3FK7A 1LVAA 3AE3A 3H5AA 4QSHA 1QO0D 4LMLA 3T1YT 2X6OA 2B0LA 2DFEA 1AU7A 2OD5A 4OFZA 2WBMA 3GBGA 5F8PA 2V7MA 2VQCA 1VNDA 2D2SA 1W9RA 1QHGA 4DJAA 3MZHA 1KNZA 3E5XA 2KLOA 2WMNA 1E2XA 4XLEA 4PJ0C 4DGWB 4M3DA 3F72A 1YJ9I 5HEUA 1R4NB 3T1BA 2O03A 3K3QC 3LSMA 4BXXJ 1JKRC 1M7KA 1EKEA 4RMNA 3N9MA 5KAIC 1MNDA 2JN6A 1YQ3A 3CCSI 4KT6A 3VEPA 1XSVA 3TL4X 4E7HA 2RAEA 3OJAA 3AEFA 2CWEA 2E1MC 3RPUA 1DP3A 4Y13A 5TJJA 1QRYA 4QH1A 2DA4A 2FBHA 3ABTA 1L0OC 3CTAA 3IC7A 5IT9K 3C2BA 1H7CA 2Q0OA 2K4JA 1IRFA 2WDQA 2X6XA 4XNFA 4XRSG 1SVLA 3KETA 2H94A 4HF0A 1ZKEA 2I8DA 3HRSA 5K5QA 4EM1A 1CGPA 4GK0E 3E5QA 3FBZA 4O4HE 2WY7Q 4B6XA 1ONVA 2F48A 4MFEA 3HKZA 3GTOJ 3EDVA 3VPRA 4BA9A 2EIJH 4A3GJ 4HE8A 1TC3C 2XQ7A 4XICA 1ZRDA 3Q2MA 3AE9A 4ABZA 2XSBA 2MBFA 4F93B 5HS8A 2R7SA 2X0YA 4EAHA 2ISYA 3BWGA 1W4MA 1MKMA 5JVDE 4DR1T 3BTJA 2CSOA 2ZFUA 3PFYA 4ISTA 4U7BA 1I1GA 3ZSTA 3ZLIA 3WHCA 2O9LA 4O4IE 2DOFA 2PTFA 4FETA 3ABVA 4NXNT 1MZBA 2RPAA 3F23A 2C6YA 3WE3A 1N77A 2PG8A 3F57A 3ANWB 4V1Av 3PNYA 4D5FA 4KBMB 4PNIA 4CCKA 2X0LA 2CUZA 2YU9J 5C44J 1YITI 1Z7UA 5FY7A 3QPLA 5FRMA 3ZN0A 1Y0NA 3J81K 1LE8A 3M8JA 5KNLA 4CDGA 1XCVA 1YS7A 1ZR4A 1HW2A 1E2AA 3FIWA 5HLHA 2P0WA 5LA6E 4S05A 1XPXA 3CUQA 3I59B 3RI5A 5AQFB 4DW6A 1S7AA 4CA0A 2C0SA 1JT0A 3GEZA 5LHGA 2QZ8A 5E1ZB 5HCJA 1FP1D 2M45A 4ETSA 1ZR2A 2D0TA 3DCFA 1B1BA 4NC8A 2DO7A 3BR1A 1HNWT 2ZNYA 2R93J 4WXHA 3MKWB 2WM9A 1V55H 1YYVA 2YPRA 5CA0E 4LLLA 3IHUA 3DU6A 2DTRA 1YFHA 3W6KB 2DTZA 3FBNB 3L2UA 1Q1HA 1LJ9A 5B66C 2FOWA 4P96A 4OAYA 1I94T 2F4IA 4BBRJ 2LT3A 3IV5A 4AU7A 4LFAT 2ACJA 3S3NA 1RR8C 4KISA 3SWHA 1K61A 4JV5T 1W5TA 2MYSA 4A6EA 1P4WA 4EQQA 2OAZA 4UVCA 2BHYA 2L7ZA 3K3NA 1WI9A 1FOYA 1S72I 2WMOA 2G0EA 2CS3A 2VODA 4UV9A 4XLCA 4Z6YA 4FX4A 5HXCA 1MSEC 2ICWG 1Z0XA 3ZJ2A 4GXOA 2EZIA 3HSEA 5H20A 4CHUA 2M87A 1DPRA 2UXNA 2R7FA 3SZTA 3RIRA 4EZ4A 2EFPA 2EK5A 2LMDA 1REPC 4LFBT 2Y2ZA 4WW0A 2CPTA 3TOBA 3PURA 4XRSA 2KXPB 2F6CA 2OPTA 4C2TA 1SFOJ 2E1OA 2Z3YA 1KONA 4I09A 4W97A 1Z3YA 3PUSA 2W1OA 2JUCA 1IUYA 2XRNA 4Z91A 4ASKA 3GVAA 3KEYA 1IJ6A 1WJFA 3AA6B 3C98B 3VKHA 1YIOA 1Y1VJ 3SDGA 3JR9A 2RVCA 1Y64B 2EILH 3DF8A 3S17J 4ZI2C 2UUAT 4IHYA 2ZXHA 1MJBA 2NVYJ 4IRHA 4HFCA 2F4OB 3PUBA 1LRZA 4HFIA 4RLQA 3AL0C 2X1EA 3BR3A 4C2MJ 2PJRA 1JT6A 2XPUA 1IZ1A 4FTHA 3S1NJ 5IOYA 4QKNA 1MD0A 2GOMA 3PL8A 1ZG1A 5HOOA 3IWFA 3R6SA 1HSJA 4D7MA 3ETUA 4DIDB 1JUSA 3K2ZA 3PNVA 5DDGA 2UXBT 4EV0A 3IHRA 2OCCH 2QA4I 2A68F 4HW0A 1OEDB 2VVNA 1UHWA 3LFKA 5HVQC 5LCYA 3IUOA 1YE9A 2AO9A 3S3MA 3KV5A 3ZQLA 1KNRA 3QC9A 4DBQA 5C4JJ 4UUSA 3SFIA 3I4PA 3ZOBA 5EG0B 4UF0A 5CGMA 4OIQF 5C8YE 4H9NC 1V9DA 3CQGB 4CYCA 5L4EA 3U9GA 4IF4A 3O1IA 1J5WA 2NRAC 4NNJA 1BC7C 1G6NA 2ME6A 2KRFA 1DDNA 2BKOA 1ZTRA 3CDIA 1HKQA 1OISA 2X9WA 2ZB9A 2XJ7A 3CQCB 1SFEA 3I0QA 5LLQA 4I0UA 3OYJA 3I9YA 3Q5FA 4WWCA 1BBYA 1ZV4X 1R5HA 4HGAA 2ZXWH 2GA2A 3H1CA 3VB2A 3M9AA 2B76A 2GZWA 3NEUA 3ULQB 1ZARA 1FWZA 1JXSA 2A61A 3LG7A 2KQRA 5DCFA 4MFRA 5B1BH 2CQKA 1R58A 2XGDA 3ZQIA 3BZKA 2BG9A 1ON2A 5D6EA 4TN7B 4LIVA 4UB6C 2FA5A 1MIJA 3RLFF 1Z05A 4FQGA 5GADJ 4TWFA 1IW7F 3OYBA 2W2UA 2FJ1A 3H5NA 1RUNA 2X0HA 3OTOT 2TRTA 3FXEB 1UAAA 1KNPA 3A8YC 4L9TA 1ITYA 2N1GA 1QVTA 1N75A 2KIFA 3VKGA 3TMOA 1ETKA 5LGTA 3OSGA 4EIWA 3DPUA 2IPQX 3SEZA 2YK0A 3KLNA 5KX5E 1AJ3A 2M4KA 1P4AA 3BOQA 1UK5A 1ETWA 5FXXA 1JHHA 2XPKA 5AQNB 5DTDA 3MKDA 1HBXG 2HFHA 2P8TA 1MBFA 5LBQB 3SDBA 1YO5C 1LUJB 2QSGX 5AONA 3NBXX 1ZLJA 2WP9A 3ONJA 4F92B 2AS5F 2QLZA 5B1AH 5FKYA 4RDUA 3FBLA 2K3PA 2X9YA 4LG0A 3MN2A 1A31A 2QUFA 1FOKA 4TUYE 1DQUA 4CXFA 1O3TA 4HRIA 3ZMUA 1HSTA 1SFUA 5LEKA 1BIAA 4G6QA 1POGA 3AFHA 5BPDA 2LC2A 4QWNB 2H6BA 1YOVB 3GFIA 2W67A 1FLIA 2B1EA 4FE7A 2EFQA 4LB5A 1HLVA 4RAGA 2FE3A 3I0OA 2Y69H 4WX9A 2XM1A 2BVLA 3OYCA 4YG2F 2MH9A 4IRIA 4UUTA 2HDDA 3DBRB 4K0KT 3SFEA 3DBLB 3CUQC 2PJQA 4JBWF 5EK3A 3AVSA 3K6GA 3V8JA 3F22A 2VI6A 5IP6A 2Y48B 4HWHA 1OCPA 2O8XA 1XDOA 2XAJB 3GN5B 2EHOB 3AAIA 3WI3A 2CA5A 2V1NA 1VQMI 4DZJA 4E7JA 3DU5A 4C2UA 2V7FA 5GAGJ 3I4NJ 4CH7A 3K4NA 3V5UA 2ECCA 3IAS2 4F7ZA 1BN5A 4A3CJ 4S04A 5JVTA 3O8GA 2KHMA 2CMPA 5E8IA 4TWHA 3SEQA 1B8IA 2CW7A 1FNNA 1CQTA 1W36C 3U1KA 1GXQA 2A69F 5LNKA 4YT0A 3FHZA 2D5UA 5L3EB 1FBUA 1WPKA 1XMXA 3TW6A 2M30A 5IOZA 3H9GA 4BQAA 4QX8B 2B63J 2LLYA 5LG4A 3MKLA 4NDLA 2VXDA 3L2CA 5F08A 3TKYA 1Z9CA 2NVXJ 5IYZE 4K2EA 2CV2A 2VL0A 4UEMA 4TNWA 3FMSA 3A2KA 2KIUA 4ZI7E 2P81A 3DQVC 3VYUB 3AEAA 1P7IA 3CMYA 1H89C 4UXNA 1WJEA 1X19A 2OCEA 4QLCU 3JRAA 2HQAA 2OF7A 3P4WA 2WDRA 1JKPC 1WQ2A 2YX7A 2DYRH 2M9HA 3CJNA 2ZJRF 5IUXA 1G73A 5FGMA 2Q2EB 1U3EM 3L9FA 4C91A 3HTSB 5FFXA 4A3BJ 4H9SE 2OA4A 2LE8A 1WCRA 2KIMA 4AKLA 1IBKT 3AEGA 3BQLA 3QOFA 2F5VA 2C5KT 2XAFA 4KICA 2IDOB 1P2FA 1USTA 3RH3A 5DM7F 2HZDA 4BS9A 2WQYA 4CN4A 2OLTA 1LVFA 3DP7A 4H9RC 1XDPA 2DCFA 2L9NA 2E35A 4BNCA 3JRDA 2HPIA 4U0VA 1U5TA 2KPMA 5JR9B 5IT9Z 1NTCA 4RS8A 3E6MA 3M8FA 5LGUA 2R5YA 3OL3A 2EQRA 2OV9A 2VURA 3KBTA 4IE7A 3RZOJ 2JIWA 1T95A 1JHFA 1B7TA 1MMAA 4O2AE 3CO7C 5BPIA 3ZMSA 4WCGA 4FT8A 4WZXA 3SXYA 1D1BA 4JLEA 3LMMA 2XSDC 1KGSA 3GTQJ 5JR9C 1E3PA 3I1AA 2FNPA 2PBIA 3D5LA 1T8BA 2LOPA 4HSTA 3CC7I 2BBJA 4GCVA 5HEHA 2L2OA 3HOSA 3WAJA 4JI7T 3CCJI 2AXLA 3HOYJ 1UFMA 2M34A 3OIOA 4F91B 2DOEA 2HN1A 5DCMA 5LRRA 1XG1A 2N8GA 3S2HJ 2X9XA 1T2KA 4DYCA 2MLGA 2LH9A 4HNUA 3G1OA 1YX3A 3F21A 5J2UE 4B3AA 1QNTA 2EINH 1SANA 5TGTA 2CU7A 5F3JA 2KLQA 2J62A 4M3GA 3CESA 3TDZC 3K70D 5FRNA 1E1HB 3UU8A 3OYMA 4MQ9F 2JVGA 1SFKA 3EI0A 4OIOF 2K9AA 4ENMA 4UUVA 2IHR1 2W4XA 3FKIJ 1W7PA 1XMQT 1IN5A 3BCAA 2W25A 4HF1A 4YSYA 2KWIB 3T8OA 2BG9C 2GAUA 2BXZA 3ECHA 4F8HA 5DUIA 3LA7A 1IDZA 2YU2A 2VQET 3S16J 1MMDA 1SMTA 4CUGA 1IAPA 1T98A 2KDZA 4IDQA 2IUBA 1RR7A 4BYYA 3J81Z 1QA6A 3NKZA 1HDPA 2A5WA 4YSXA 1T56A 1V4RA 4IHVA 5IHYA 1KQ0A 2IW5A 4HFBA 3GFLA 4JEUB 2QWWA 1WJAA 1FMVA 2KRCA 2HQ5A 2VPRA 3P5JA 2WBLA 4AI6A 4DMWA 5F04A 5D4RA 5EGOA 3E3VA 2BKPA 2DJNA 3HG9A 3ZQFA 3EVYA 4AWXB 1OR7C 5ED4A 2A72A 2K02A 5KVRA 4AUXA 4RGRA 4CO8A 2K3FA 2XGEA 3L00A 2LKXA 2NOJB 3CX8B 4XLAA 2ISZA 3LK42 3RQIA 5AQVB 4OU0A 2YKSA 2Z16A 2VBYA 5AQRB 2C5JA 3KZYA 4IX7A 3O3KA 2BW3A 3P4SA 2R92J 4XKWA 1KU7A 3Q0UA 2YOEA 3ASNH 4KYWA 5CVJA 1N34T 1EH7A 3CJRB 4HX7A 9ANTA 4DO0A 3B6CA 2COBA 2JTVA 1PYVA 4KN7X 4XBFB 4L9IA 3E1SA 2WV1A 3OYFA 3N97A 1EF4A 1X1CA 3ZCJA 1XGNA 1R49A 1VCTA 2QQ9A 3RKQA 3WU1B 5J4YA 1SHZC 1MIVA 1WGXA 3UKGA 4NQWA 5LMUT 2ZJPF 4RA2A 4QXBB 2A9UA 3RDIA 1HFAA 1A35A 2N9DA 1ZELA 3JAFA 1J59A 3KBUA 3RKWA 4Q5SF 4IE4A 4PAGA 4L5EA 2BY3A 2XB0X 1XX5A 3CQZJ 5HS7A 4DYRA 4L0ZB 1GLNA 1BOBA 2M8GX 1DP7P 2ODVA 5CA1E 1MBHA 3EUHA 5DV5A 2FJEA 1UURA 4BHBA 3OR2C 2UXXB 3EDUA 2PJPA 4F52A 1KFYA 1V5EA 3QB5A 3QB5K 4X1IE 3GZ6A 4E7IA 1O3RA 1NHAA 5E79C 3O9XA 4GYIA 2K9MA 2CEAA 2HYFA 2JMWA 4BQQA 3FKJA 4CXYA 3J7AY 3K0LA 5CKTA 2MBGA 2VIXA 1IXCA 3QQAA 2V26A 2MFZA 2LF8A 1WFDA 2LLKA 4OOIA 3OYEA 5IYDJ 2PQ8A 2ZBKA 1R1UA 1U2WA 3T5XA 1R4MB 1AHDP 1KK7A 3PIOF 3ZRGA 3AE8A 3AEDA 3JADA 5IYCJ 3KEQA 2HXIA 2D1VA 3CMMA 1MH3A 3IKTA 1D5YA 1OEDE 2CRBA 1LB2A 3COAC 2NNYA 1S6LA 4ZHQE 2DA7A 2ZKZA 1UELB 3HHGA 4BE2A 1J5ET 2ESHA 1M1EB 2RQPA 3FZMB 2GOXB 1R71A 2ZMEB 3MQ0A 3B5MA 3CDHA 4L18B 4AXPA 3PO3J 1GV5A 1YX5A 2R3SA 3HUGA 2DN0A 4I02A 1NEKA 4B3MT 2IAKA 3WTWC 1P92A 4DV3T 2Y0SA 4HFVA 4LF7T 2WWYA 1ZREA 2KL4A 2LSJA 1W0AA 4YY3T 1N32T 4O4JE 4O6JA 2MAWA 3DWLE 4I55E 2OZUA 1JKQC 2FXAA 1W5SA 2Z1DA 4G6TB 5BS6A 3WGIA 1Z67A 4PJMA 5FNVE 2RN7A 1HR0T 2LRLA 4QX7B 4G9YA 2Q9QD 1N33T 4IREA 1QZZA 3HR0A 4MO7A 3K1NA 1G4DA 4GO1A 1XSDA 4GFBA 4MLOA 5K7ZA 1AOYA 4II3A 2XV4S 3E6DA 2PX9A 4P9FA 2VL8A 2E34A 2DLRA 3HOUJ 2DW4A 4XL9A 4JEHB 4PDKA 1TZLA 2FUG2 3DJBA 3HL2A 2W61A 1S5LC 2RQQA 2NVTJ 5FFZA 2DYSH 3SZGA 3ZMVA 1N25A 2CFXA 4HX8A 2R7TA 5H6RB 3R0JA 4CXXA 4XOTA 4DBRA 2HVSA 4YTMA 2DI3A 3PNTA 4IVNA 3BCBA 1OYWA 3GCMA 4NHJA 2X9HA 3IBPA 3KZIC 2ZJQF 3GZ5A 1U78A 5D6FA 4KA4A 5FL0A 3KYLA 4EB6E 2CUJA 3PU8A 3D1NI 2OQRA 2CLYC 3JRIA 1VQ7I 4X1KE 4EM2A 3ZPOA 2DDBA 5K7HA 4U72A 3FMQA 3CDLA 2DT6A 4IHTA 2BGCA 4X65T 2VC0A 4KUMA 3EDPA 3I53A 1TBXA 4LMYA 5LRSA 1OLTA 2QQ8A 3ONQA 2GM4A 1I6HJ 2MGQA 1R36A 2OUMA 4LLGF 5JLWA 5LGNB 3GWHA 1FOXA 2EB7A 3QP5A 3OYNA 1BL0A 2YU3A 1X3ZB 3IH2A 5FVLA 4U2YA 3HGYA 1ZKGA 2Z2SB 5M5YJ 5DEQA 2QENA 1JNZA 4DR4T 4ZYAA
chains in the Genus database with same CATH topology
1KYWA 2K24A 4KMFA 4LD5A 1ULYA 5IT3A 1HW1A 2GWRA 2HTSA 2A2FX 4DMVA 4Y17A 2XIGA 3E22E 3QK6A 1UX5A 3REOA 4G7ZF 2VWAA 1I6XA 2WWUA 1ZG3A 1I27A 2PFVA 5JH7E 4OYKA 5JRCB 2Z9OA 1PDNC 3Q9DA 3MCZA 3ISPA 1OKRA 4XLPF 4RB1A 1MIYA 2H6CA 5LHHB 1R1VA 4PJLA 3LBXA 1GVJA 4L0RA 2OZ6A 1Z6TA 5L3BA 1OMIA 3R6NA 3HSRA 3LWFA 6PAXA 2XASA 3R0AA 4CYDA 4AKRB 3ZMTA 3BQIA 2BEOA 1ZG5A 2Y0MA 2DQRA 1QZYA 4XSZF 3N2GE 1FYMA 1ZH5A 1MIWA 2EV6A 2YINA 5E1WA 3IF8B 2TDXA 2RV8A 3ZN1B 1ZYRF 3SOLA 1J2XA 4UVBA 4OYJA 2RA1A 5JDNA 4G7OF 1ZN2A 4ISSA 1X3UA 3GO5A 1IN8A 3ONXA 1USSA 4EJTA 2ZO4A 1MMGA 4EOZB 1QPMA 4PW8A 4QXHB 2L01A 5DQWA 3T8TA 3DKWA 5LOVE 5KK1A 4J2CA 2EWNA 1BR4A 1U4QA 1WSUA 4BAYA 2VKOA 2ZM8A 4YLHA 2M67A 4HLXA 1PP8F 2VBZA 2QQBA 1OYYA 2J5PA 5L3GA 3DFGA 2FF4A 1KQ9A 3MA9A 4HDVA 2LSYA 1FP2A 5L3DB 1D0ZA 1HXDA 1KU3A 3TO9A 4RAZA 4I43B 2HKXA 4JUYA 2CXFA 3GFJA 2EA4A 4YFXF 1HKTA 2LM9A 3N2KE 1X79A 2W62A 1IZNB 1FT9A 4EJUA 4MTEA 2IC9A 2E7XA 5H6QB 3V8KA 3FXQA 3N2OA 3RTRA 5LHIA 4M1PA 2EJRA 3BJAA 4B09A 1ZRFA 1IN6A 1BJAA 2XUBA 3AAEB 3KV9A 1SD4A 4Y15A 2QBYB 4OMYA 3VOEA 4LGWA 2WV0A 3KP5A 3JSOA 4R8HA 4XLNF 3QPHA 3R4KA 5J8CA 2HPLA 2HPJA 3WTYC 2EFWA 4BHPA 1L3LA 4DQ2A 2LF7A 3RKYA 3G3ZA 1SA0E 4ERRA 4MEYF 3OKQA 1W7PD 3HTUA 2K27A 2YU1A 1D8JA 1WLXA 4ZZLA 1S8NA 3O1HA 4TZ4C 1G3SA 5D5XB 2NS0A 1TLHB 1HCIA 1RZ4A 4FX0A 1T0FA 1HG2A 2XAGB 2BZBA 3ZPLA 1YW8A 3H92A 4M73A 3FX3A 3W6JB 5EEGA 2Q9QA 2MLKA 3CVRA 1J7KA 2V1DA 3GUDA 1O3SA 1YKEB 1A04A 5DD4A 4Z2YA 2VE8A 4IGUA 5L3CA 1YW9A 1MDMB 5K1YA 1IN7A 3RKXA 1MGTA 5DQVA 3PU3A 4K0UA 1B9NA 5CVVA 1LDDA 5D5WB 1XN7A 3HRUA 2GK9A 2XAHA 3C50A 5JDMA 4YFSA 5ERIA 1YS6A 4YJ2E 5HXSA 2VE9A 3E0ZA 3BJOA 2H09A 3N4MA 4L5GA 2M5WA 2QVOA 5L3FA 1G3TA 4P5OA 1P4XA 5ILSA 3DXJF 4MNUA 2DPDA 2W24A 4R1HA 4OK0A 3EYIA 2XTLA 3DV8A 3PUGA 4I7HA 3NQOA 5FB2A 1K78A 5EEHA 5HDGA 3WGGA 3UFEA 1GHCA 3V7RA 3PE0A 4M6YA 3N9PA 1FMWA 4AIJA 3NZQA 2G7UA 1JGSA 2A3SA 3WTUC 4ILUA 3QAHA 3CX7B 1CUNA 4IE0A 2ES0A 1BOAA 2MC3A 2CE7A 5FY1A 3UUXB 1LDJA 3ZYKA 5E8GA 3F3XA 4HZFA 1UX4A 3IRQA 3MWMA 2X0LB 4LB6B 4ASNA 1H9GA 4I0BA 1YW0A 2XROA 3ZN0B 2Z5UA 4UV8A 2ZLYA 5FLXK 1MJAA 3M7GA 2HZTA 4Z8XA 4RGUA 3OYZA 2GXGA 3O1JA 2IJLA 5FXZA 3CUQB 4OIRF 2XAQA 2NTXA 4PJNA 5LHGB 3FXRA 3RYCE 2ADUA 4WK8F 3UULA 4I4TE 4MGRA 3GF2A 2ELHA 1XB4A 4HEAA 4CZZA 3J9X1 3WTZA 4KDPA 1STZA 2P5KA 4HQEA 3AAAB 1R7JA 4YHJA 5ADXL 2E9XA 4WBNE 2BBYA 3CPZA 4PFPA 4P0BA 1IAWA 3DPLC 2EA2A 3PQJA 4KIFA 5D8LB 4MQVA 2L9QA 5M4YA 2J5OA 2G7HA 4UVCB 2CWOA 3I71A 1WYBA 4UV9B 4AKIA 3ZMZA 3HKCE 2LNBA 3LK3B 1FC3A 1TQMA 3C7JA 1FEWA 2UXNB 4LK0F 2KINB 3N9NA 2GXBA 4XSXF 3HHHA 5HLIA 4IRGA 4GIWA 4U7DA 4L5IA 3B73A 4M6XA 5D8KB 4AQGA 3F8MA 4OMZA 5DABA 4B8XA 1I1SA 2KKOA 5E0OA 1FPQA 1J75A 5D5UB 2WC2A 3GWZA 2NP9A 3U2RA 2FSWA 2Q9QC 2PI0A 5JHUA 4U74A 2NAZA 4JBAA 1XD7A 4EXTA 2RGVA 2CXDA 2NTYA 1FBQA 1MNEA 4CI3B 4G8XA 5KDMC 4O8SA 1WRDA 2KJCA 3ERED 4ANJA 3L3PA 1BR2A 4HDUA 4NUVA 3ZMDA 3RYPA 4HLYA 4FHTA 2HR3A 4UF0B 1FIOA 4ADZA 2M1BA 1MJ9A 2VT2A 2DK8A 4MEXF 5HYAA 3KZZA 2CM0A 2JJ9A 1ON1A 3HI2A 4A2UA 2LEHA 4IDZA 2DPUA 3OYXA 3LAJA 1BC8C 4AKGA 5CLSA 2RKHA 5FO5A 2JRTA 1B6AA 2EV0A 1LQ1A 3MZKB 5EK4A 2F2EA 2KJBA 1PP7U 1O7LA 5J6XA 5ILUA 3MAJA 1MMNA 3LA3A 4CXWA 2IA0A 1BM9A 3IKVA 3HA4A 1FSEA 4L9VA 3WTVC 2D2WA 1HS7A 1U5PA 5LGTB 5BMVE 4EJVA 3KINB 4AKHA 3RC8A 2VBXA 5LJMA 3KDSE 1US7B 3FM5A 3BK9A 3WGHA 2PN6A 3F6OA 3TO7A 2J1DG 2HYGD 2L02A 4LG0B 4XZCA 1R23A 5BQTA 4O2BE 3ZMUB 2RNJA 5DJQC 3KP2A 1XMAA 4E7SA 2P9BA 5AIPA 3JW4A 1XSXA 4AIHA 2CGPA 2N2NA 3ZYMA 4ZYHA 3GLXA 3OV8A 3KP7A 3T0YA 3IWZA 2NNNA 5HXEA 3KEOA 1K7AA 1BR0A 3O4XE 1R00A 2VB6A 4MTDA 4A5NA 3Q5XA 1SD5A 2NYXA 4QWQA 2W63A 2HQNA 1RI7A 2QM3A 4PCQA 4ESJA 4AVPA 3NRYA 3QOPA 2Q8KA 1CF7A 4IE6A 2QA7A 3JTGA 4UVAA 2FMLA 4GYRA 2DK5A 1Z1DA 1S3JA 2MH2A 2DNXA 2E7WA 3NZPA 3O2PE 4HAMA 5ICCA 1FSHA 3KV6A 2E8IA 2DQLA 4A0ZA 2CWYA 1HKSA 1O57A 3CWZB 1Z6RA 3BY6A 4IPAA 3SHFA 5LXTE 4UXNB 2GIVA 5JFRA 3U3IA 1VOMA 1WRJA 3L7WA 1YLFA 5EZYE 3MK7C 4PK5A 3QU3A 2VOPA 4IJAA 2EHOD 5LBMA 3WAKA 4ZS2A 2L4MA 1B9MA 2CG4A 4G2AA 1ZHCA 2XAFB 3BROA 3TGNA 4KT5C 5HXRA 3ZEFB 2X67A 2PMUA 4QHOA 1XDUA 1YQAA 2GA1A